data_2JOA
# 
_entry.id   2JOA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2JOA         
RCSB  RCSB100082   
WWPDB D_1000100082 
BMRB  15154        
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
BMRB 15154 .                                                                                   unspecified 
PDB  2P3W  'Crystal Structure of the HtrA3 PDZ Domain Bound to a Phage-Derived Ligand (FGRWV)' unspecified 
# 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.entry_id                        2JOA 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2007-03-01 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Runyon, S.T.'   1 
'Zhang, Y.'      2 
'Appleton, B.A.' 3 
'Sazinksy, S.L.' 4 
'Wu, P.'         5 
'Pan, B.'        6 
'Wiesmann, C.'   7 
'Skelton, N.J.'  8 
'Sidhu, S.S.'    9 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structural and functional analysis of the PDZ domains of human HtrA1 and HtrA3'          'Protein Sci.'    16 2454 2471 
2007 PRCIEI US 0961-8368 0795 ? 17962403 10.1110/ps.073049407 
1       'HtrA1 bound to an optimized peptide: NMR assignment of PDZ domain and ligand resonances' 'To be Published' ?  ?    ?    ? 
?      ?  ?         0353 ? ?        ?                    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Runyon, S.T.'   1  ? 
primary 'Zhang, Y.'      2  ? 
primary 'Appleton, B.A.' 3  ? 
primary 'Sazinsky, S.L.' 4  ? 
primary 'Wu, P.'         5  ? 
primary 'Pan, B.'        6  ? 
primary 'Wiesmann, C.'   7  ? 
primary 'Skelton, N.J.'  8  ? 
primary 'Sidhu, S.S.'    9  ? 
1       'Runyon, S.T.'   10 ? 
1       'Pan, B.'        11 ? 
1       'Skelton, N.J.'  12 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Serine protease HTRA1' 11582.238 1 3.4.21.- ? 'PDZ domain, residues 379-480' ? 
2 polymer syn 'Peptide H1-C1'         962.083   1 ?        ? ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'L56, Serine protease 11' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSHMKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRE
STLNMVVRRGNEDIMITVIPEEIDP
;
;GSHMKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRE
STLNMVVRRGNEDIMITVIPEEIDP
;
A ? 
2 'polypeptide(L)' no no DSRIWWV DSRIWWV B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   HIS n 
1 4   MET n 
1 5   LYS n 
1 6   LYS n 
1 7   TYR n 
1 8   ILE n 
1 9   GLY n 
1 10  ILE n 
1 11  ARG n 
1 12  MET n 
1 13  MET n 
1 14  SER n 
1 15  LEU n 
1 16  THR n 
1 17  SER n 
1 18  SER n 
1 19  LYS n 
1 20  ALA n 
1 21  LYS n 
1 22  GLU n 
1 23  LEU n 
1 24  LYS n 
1 25  ASP n 
1 26  ARG n 
1 27  HIS n 
1 28  ARG n 
1 29  ASP n 
1 30  PHE n 
1 31  PRO n 
1 32  ASP n 
1 33  VAL n 
1 34  ILE n 
1 35  SER n 
1 36  GLY n 
1 37  ALA n 
1 38  TYR n 
1 39  ILE n 
1 40  ILE n 
1 41  GLU n 
1 42  VAL n 
1 43  ILE n 
1 44  PRO n 
1 45  ASP n 
1 46  THR n 
1 47  PRO n 
1 48  ALA n 
1 49  GLU n 
1 50  ALA n 
1 51  GLY n 
1 52  GLY n 
1 53  LEU n 
1 54  LYS n 
1 55  GLU n 
1 56  ASN n 
1 57  ASP n 
1 58  VAL n 
1 59  ILE n 
1 60  ILE n 
1 61  SER n 
1 62  ILE n 
1 63  ASN n 
1 64  GLY n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  VAL n 
1 69  SER n 
1 70  ALA n 
1 71  ASN n 
1 72  ASP n 
1 73  VAL n 
1 74  SER n 
1 75  ASP n 
1 76  VAL n 
1 77  ILE n 
1 78  LYS n 
1 79  ARG n 
1 80  GLU n 
1 81  SER n 
1 82  THR n 
1 83  LEU n 
1 84  ASN n 
1 85  MET n 
1 86  VAL n 
1 87  VAL n 
1 88  ARG n 
1 89  ARG n 
1 90  GLY n 
1 91  ASN n 
1 92  GLU n 
1 93  ASP n 
1 94  ILE n 
1 95  MET n 
1 96  ILE n 
1 97  THR n 
1 98  VAL n 
1 99  ILE n 
1 100 PRO n 
1 101 GLU n 
1 102 GLU n 
1 103 ILE n 
1 104 ASP n 
1 105 PRO n 
2 1   ASP n 
2 2   SER n 
2 3   ARG n 
2 4   ILE n 
2 5   TRP n 
2 6   TRP n 
2 7   VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'HTRA1, HTRA, PRSS11' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET15b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                
;The peptide was chemically synthesized. The peptide was derived from a phage-displayed library as an optimal ligand for binding to the PDZ domain of human HtrA1.
;
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP HTRA1_HUMAN Q92743 1 
;KKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPDTPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLN
MVVRRGNEDIMITVIPEEIDP
;
380 ? 
2 PDB 2JOA        2JOA   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2JOA A 5 ? 105 ? Q92743 380 ? 480 ? 380 480 
2 2 2JOA B 1 ? 7   ? 2JOA   1   ? 7   ? 1   7   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2JOA GLY A 1 ? UNP Q92743 ? ? 'expression tag' 376 1 
1 2JOA SER A 2 ? UNP Q92743 ? ? 'expression tag' 377 2 
1 2JOA HIS A 3 ? UNP Q92743 ? ? 'expression tag' 378 3 
1 2JOA MET A 4 ? UNP Q92743 ? ? 'expression tag' 379 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'                        
1 2  2 '3D HNCA'                               
1 3  2 '3D HNCO'                               
1 4  2 '3D HNCACB'                             
1 5  2 '3D CBCA(CO)NH'                         
1 6  2 '3D HN(CO)CA'                           
1 7  4 '2D 1H-13C HSQC'                        
1 8  1 '3D 1H-15N NOESY'                       
1 9  3 '3D 1H-13C NOESY'                       
1 10 3 '3D HCCH-TOCSY'                         
1 11 5 '2D 1H-1H NOESY 13C,15N-filtered in F1' 
1 12 5 '2D 1H-1H TOCSY,13C,15N-filtered in F1' 
1 13 6 '3D 1H-13C NOESY, 13C-filtered in F1'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0.025 
_pdbx_nmr_exptl_sample_conditions.pH                     6.0 
_pdbx_nmr_exptl_sample_conditions.pressure               ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units         ? 
_pdbx_nmr_exptl_sample_conditions.temperature            298 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
'2 mM [U-15N] HtrA1-PDZ, 4 mM synthetic peptide H1-C1, 90% H2O/10% D2O'          1 '90% H2O/10% D2O' ? ? ? 
'2 mM [U-13C; U-15N] HtrA1-PDZ, 4 mM synthetic peptide H1-C1, 90% H2O/10% D2O'   2 '90% H2O/10% D2O' ? ? ? 
'2 mM [U-13C; U-15N] HtrA1-PDZ, 4 mM synthetic peptide H1-C1, 100% D2O'          3 '100% D2O'        ? ? ? 
'2 mM [U-10% 13C; U-99% 15N] HtrA1-PDZ, 4 mM synthetic peptide H1-C1, 100% D2O'  4 '100% D2O'        ? ? ? 
'2 mM [U-13C; U-15N] HtrA1-PDZ, 1.8 mM synthetic peptide H1-C1, 90% H2O/10% D2O' 5 '90% H2O/10% D2O' ? ? ? 
'2 mM [U-13C; U-15N] HtrA1-PDZ, 1.8 mM synthetic peptide H1-C1, 100% D2O'        6 '100% D2O'        ? ? ? 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker DRX 1 'Bruker DRX' 
800 Bruker DRX 2 'Bruker DRX' 
# 
_pdbx_nmr_refine.details            'followed by cartesian dynamics and minimization' 
_pdbx_nmr_refine.entry_id           2JOA 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2JOA 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    0.9 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   .08 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     CNX 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2JOA 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'    processing                  NMRPipe '2005 for LINUX' 1 
Goddard                                                'data analysis'             Sparky  3.11             2 
'Hitchens, T.K., Lukin, J.A., Zhan, Y. and Rule, G.S.' 'chemical shift assignment' Monte   2.02             3 
'Guntert, Mumenthaler and Wuthrich'                    'automated noe assignment'  CYANA   2.0              4 
'Bruker Biospin'                                       collection                  TopSpin 1.3              5 
'Cornilescu, Delaglio and Bax'                         'dihedral angle restraints' TALOS   ?                6 
'Accelrys Software Inc.'                               'structure solution'        CNX     2002             7 
'Accelrys Software Inc.'                               refinement                  CNX     2002             8 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2JOA 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2JOA 
_struct.title                     'HtrA1 bound to an optimized peptide: NMR assignment of PDZ domain and ligand resonances' 
_struct.pdbx_descriptor           'Serine protease HTRA1 (E.C.3.4.21.-), Peptide H1-C1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2JOA 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            'PDZ, beta-sandwich, cyclically-permuted, PROTEIN BINDING' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 16 ? HIS A 27 ? THR A 391 HIS A 402 1 ? 12 
HELX_P HELX_P2 2 THR A 46 ? GLY A 52 ? THR A 421 GLY A 427 1 ? 7  
HELX_P HELX_P3 3 SER A 69 ? GLU A 80 ? SER A 444 GLU A 455 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 58 ? ILE A 59 ? VAL A 433 ILE A 434 
A 2 ALA A 37 ? VAL A 42 ? ALA A 412 VAL A 417 
A 3 ILE A 10 ? SER A 14 ? ILE A 385 SER A 389 
A 4 ILE B 4  ? TRP B 6  ? ILE B 4   TRP B 6   
B 1 LEU A 83 ? ARG A 89 ? LEU A 458 ARG A 464 
B 2 GLU A 92 ? VAL A 98 ? GLU A 467 VAL A 473 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 59 ? O ILE A 434 N ALA A 37 ? N ALA A 412 
A 2 3 O ILE A 40 ? O ILE A 415 N ARG A 11 ? N ARG A 386 
A 3 4 N MET A 12 ? N MET A 387 O TRP B 5  ? O TRP B 5   
B 1 2 N MET A 85 ? N MET A 460 O ILE A 96 ? O ILE A 471 
# 
_atom_sites.entry_id                    2JOA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1   ? 6.673   24.087  -15.443 1.00 0.00 ? 376 GLY A N    1  
ATOM 2     C CA   . GLY A 1 1   ? 5.336   23.434  -15.516 1.00 0.00 ? 376 GLY A CA   1  
ATOM 3     C C    . GLY A 1 1   ? 4.364   24.200  -16.393 1.00 0.00 ? 376 GLY A C    1  
ATOM 4     O O    . GLY A 1 1   ? 4.119   25.385  -16.170 1.00 0.00 ? 376 GLY A O    1  
ATOM 5     H H1   . GLY A 1 1   ? 6.686   24.789  -14.676 1.00 0.00 ? 376 GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1   ? 6.885   24.568  -16.341 1.00 0.00 ? 376 GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1   ? 7.409   23.376  -15.260 1.00 0.00 ? 376 GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1   ? 5.455   22.438  -15.913 1.00 0.00 ? 376 GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1   ? 4.926   23.366  -14.519 1.00 0.00 ? 376 GLY A HA3  1  
ATOM 10    N N    . SER A 1 2   ? 3.808   23.520  -17.390 1.00 0.00 ? 377 SER A N    1  
ATOM 11    C CA   . SER A 1 2   ? 2.857   24.143  -18.303 1.00 0.00 ? 377 SER A CA   1  
ATOM 12    C C    . SER A 1 2   ? 1.888   23.109  -18.867 1.00 0.00 ? 377 SER A C    1  
ATOM 13    O O    . SER A 1 2   ? 0.690   23.147  -18.585 1.00 0.00 ? 377 SER A O    1  
ATOM 14    C CB   . SER A 1 2   ? 3.596   24.842  -19.445 1.00 0.00 ? 377 SER A CB   1  
ATOM 15    O OG   . SER A 1 2   ? 4.740   25.529  -18.967 1.00 0.00 ? 377 SER A OG   1  
ATOM 16    H H    . SER A 1 2   ? 4.043   22.577  -17.516 1.00 0.00 ? 377 SER A H    1  
ATOM 17    H HA   . SER A 1 2   ? 2.295   24.878  -17.745 1.00 0.00 ? 377 SER A HA   1  
ATOM 18    H HB2  . SER A 1 2   ? 3.910   24.108  -20.170 1.00 0.00 ? 377 SER A HB2  1  
ATOM 19    H HB3  . SER A 1 2   ? 2.935   25.554  -19.916 1.00 0.00 ? 377 SER A HB3  1  
ATOM 20    H HG   . SER A 1 2   ? 5.489   24.929  -18.948 1.00 0.00 ? 377 SER A HG   1  
ATOM 21    N N    . HIS A 1 3   ? 2.414   22.186  -19.665 1.00 0.00 ? 378 HIS A N    1  
ATOM 22    C CA   . HIS A 1 3   ? 1.595   21.141  -20.268 1.00 0.00 ? 378 HIS A CA   1  
ATOM 23    C C    . HIS A 1 3   ? 2.210   19.764  -20.034 1.00 0.00 ? 378 HIS A C    1  
ATOM 24    O O    . HIS A 1 3   ? 3.154   19.371  -20.719 1.00 0.00 ? 378 HIS A O    1  
ATOM 25    C CB   . HIS A 1 3   ? 1.435   21.393  -21.768 1.00 0.00 ? 378 HIS A CB   1  
ATOM 26    C CG   . HIS A 1 3   ? 0.979   22.780  -22.097 1.00 0.00 ? 378 HIS A CG   1  
ATOM 27    N ND1  . HIS A 1 3   ? 1.673   23.620  -22.942 1.00 0.00 ? 378 HIS A ND1  1  
ATOM 28    C CD2  . HIS A 1 3   ? -0.110  23.475  -21.690 1.00 0.00 ? 378 HIS A CD2  1  
ATOM 29    C CE1  . HIS A 1 3   ? 1.032   24.771  -23.040 1.00 0.00 ? 378 HIS A CE1  1  
ATOM 30    N NE2  . HIS A 1 3   ? -0.053  24.708  -22.290 1.00 0.00 ? 378 HIS A NE2  1  
ATOM 31    H H    . HIS A 1 3   ? 3.376   22.207  -19.852 1.00 0.00 ? 378 HIS A H    1  
ATOM 32    H HA   . HIS A 1 3   ? 0.622   21.172  -19.802 1.00 0.00 ? 378 HIS A HA   1  
ATOM 33    H HB2  . HIS A 1 3   ? 2.384   21.231  -22.256 1.00 0.00 ? 378 HIS A HB2  1  
ATOM 34    H HB3  . HIS A 1 3   ? 0.708   20.699  -22.167 1.00 0.00 ? 378 HIS A HB3  1  
ATOM 35    H HD1  . HIS A 1 3   ? 2.511   23.405  -23.402 1.00 0.00 ? 378 HIS A HD1  1  
ATOM 36    H HD2  . HIS A 1 3   ? -0.881  23.123  -21.018 1.00 0.00 ? 378 HIS A HD2  1  
ATOM 37    H HE1  . HIS A 1 3   ? 1.341   25.619  -23.633 1.00 0.00 ? 378 HIS A HE1  1  
ATOM 38    H HE2  . HIS A 1 3   ? -0.676  25.448  -22.134 1.00 0.00 ? 378 HIS A HE2  1  
ATOM 39    N N    . MET A 1 4   ? 1.668   19.038  -19.063 1.00 0.00 ? 379 MET A N    1  
ATOM 40    C CA   . MET A 1 4   ? 2.164   17.705  -18.738 1.00 0.00 ? 379 MET A CA   1  
ATOM 41    C C    . MET A 1 4   ? 1.082   16.874  -18.056 1.00 0.00 ? 379 MET A C    1  
ATOM 42    O O    . MET A 1 4   ? 0.075   17.408  -17.590 1.00 0.00 ? 379 MET A O    1  
ATOM 43    C CB   . MET A 1 4   ? 3.395   17.803  -17.835 1.00 0.00 ? 379 MET A CB   1  
ATOM 44    C CG   . MET A 1 4   ? 4.710   17.775  -18.597 1.00 0.00 ? 379 MET A CG   1  
ATOM 45    S SD   . MET A 1 4   ? 5.878   19.022  -18.020 1.00 0.00 ? 379 MET A SD   1  
ATOM 46    C CE   . MET A 1 4   ? 6.089   18.526  -16.313 1.00 0.00 ? 379 MET A CE   1  
ATOM 47    H H    . MET A 1 4   ? 0.917   19.406  -18.551 1.00 0.00 ? 379 MET A H    1  
ATOM 48    H HA   . MET A 1 4   ? 2.444   17.222  -19.662 1.00 0.00 ? 379 MET A HA   1  
ATOM 49    H HB2  . MET A 1 4   ? 3.346   18.727  -17.277 1.00 0.00 ? 379 MET A HB2  1  
ATOM 50    H HB3  . MET A 1 4   ? 3.387   16.974  -17.143 1.00 0.00 ? 379 MET A HB3  1  
ATOM 51    H HG2  . MET A 1 4   ? 5.160   16.800  -18.476 1.00 0.00 ? 379 MET A HG2  1  
ATOM 52    H HG3  . MET A 1 4   ? 4.508   17.948  -19.644 1.00 0.00 ? 379 MET A HG3  1  
ATOM 53    H HE1  . MET A 1 4   ? 6.110   19.402  -15.683 1.00 0.00 ? 379 MET A HE1  1  
ATOM 54    H HE2  . MET A 1 4   ? 5.266   17.890  -16.018 1.00 0.00 ? 379 MET A HE2  1  
ATOM 55    H HE3  . MET A 1 4   ? 7.017   17.984  -16.207 1.00 0.00 ? 379 MET A HE3  1  
ATOM 56    N N    . LYS A 1 5   ? 1.297   15.564  -18.001 1.00 0.00 ? 380 LYS A N    1  
ATOM 57    C CA   . LYS A 1 5   ? 0.341   14.658  -17.374 1.00 0.00 ? 380 LYS A CA   1  
ATOM 58    C C    . LYS A 1 5   ? -1.006  14.707  -18.088 1.00 0.00 ? 380 LYS A C    1  
ATOM 59    O O    . LYS A 1 5   ? -1.855  15.542  -17.773 1.00 0.00 ? 380 LYS A O    1  
ATOM 60    C CB   . LYS A 1 5   ? 0.161   15.014  -15.897 1.00 0.00 ? 380 LYS A CB   1  
ATOM 61    C CG   . LYS A 1 5   ? -0.200  13.822  -15.025 1.00 0.00 ? 380 LYS A CG   1  
ATOM 62    C CD   . LYS A 1 5   ? 1.024   13.257  -14.320 1.00 0.00 ? 380 LYS A CD   1  
ATOM 63    C CE   . LYS A 1 5   ? 0.638   12.210  -13.288 1.00 0.00 ? 380 LYS A CE   1  
ATOM 64    N NZ   . LYS A 1 5   ? 0.431   12.808  -11.940 1.00 0.00 ? 380 LYS A NZ   1  
ATOM 65    H H    . LYS A 1 5   ? 2.118   15.197  -18.390 1.00 0.00 ? 380 LYS A H    1  
ATOM 66    H HA   . LYS A 1 5   ? 0.736   13.656  -17.449 1.00 0.00 ? 380 LYS A HA   1  
ATOM 67    H HB2  . LYS A 1 5   ? 1.081   15.440  -15.527 1.00 0.00 ? 380 LYS A HB2  1  
ATOM 68    H HB3  . LYS A 1 5   ? -0.626  15.748  -15.810 1.00 0.00 ? 380 LYS A HB3  1  
ATOM 69    H HG2  . LYS A 1 5   ? -0.916  14.136  -14.282 1.00 0.00 ? 380 LYS A HG2  1  
ATOM 70    H HG3  . LYS A 1 5   ? -0.635  13.053  -15.645 1.00 0.00 ? 380 LYS A HG3  1  
ATOM 71    H HD2  . LYS A 1 5   ? 1.673   12.803  -15.054 1.00 0.00 ? 380 LYS A HD2  1  
ATOM 72    H HD3  . LYS A 1 5   ? 1.545   14.063  -13.825 1.00 0.00 ? 380 LYS A HD3  1  
ATOM 73    H HE2  . LYS A 1 5   ? -0.276  11.731  -13.604 1.00 0.00 ? 380 LYS A HE2  1  
ATOM 74    H HE3  . LYS A 1 5   ? 1.427   11.474  -13.229 1.00 0.00 ? 380 LYS A HE3  1  
ATOM 75    H HZ1  . LYS A 1 5   ? 1.273   12.659  -11.349 1.00 0.00 ? 380 LYS A HZ1  1  
ATOM 76    H HZ2  . LYS A 1 5   ? 0.257   13.831  -12.025 1.00 0.00 ? 380 LYS A HZ2  1  
ATOM 77    H HZ3  . LYS A 1 5   ? -0.388  12.367  -11.475 1.00 0.00 ? 380 LYS A HZ3  1  
ATOM 78    N N    . LYS A 1 6   ? -1.196  13.807  -19.047 1.00 0.00 ? 381 LYS A N    1  
ATOM 79    C CA   . LYS A 1 6   ? -2.443  13.748  -19.802 1.00 0.00 ? 381 LYS A CA   1  
ATOM 80    C C    . LYS A 1 6   ? -3.575  13.210  -18.934 1.00 0.00 ? 381 LYS A C    1  
ATOM 81    O O    . LYS A 1 6   ? -3.388  12.954  -17.745 1.00 0.00 ? 381 LYS A O    1  
ATOM 82    C CB   . LYS A 1 6   ? -2.268  12.870  -21.044 1.00 0.00 ? 381 LYS A CB   1  
ATOM 83    C CG   . LYS A 1 6   ? -1.444  13.527  -22.140 1.00 0.00 ? 381 LYS A CG   1  
ATOM 84    C CD   . LYS A 1 6   ? -2.316  13.986  -23.297 1.00 0.00 ? 381 LYS A CD   1  
ATOM 85    C CE   . LYS A 1 6   ? -1.568  13.921  -24.619 1.00 0.00 ? 381 LYS A CE   1  
ATOM 86    N NZ   . LYS A 1 6   ? -1.924  15.055  -25.516 1.00 0.00 ? 381 LYS A NZ   1  
ATOM 87    H H    . LYS A 1 6   ? -0.484  13.167  -19.250 1.00 0.00 ? 381 LYS A H    1  
ATOM 88    H HA   . LYS A 1 6   ? -2.690  14.752  -20.114 1.00 0.00 ? 381 LYS A HA   1  
ATOM 89    H HB2  . LYS A 1 6   ? -1.779  11.952  -20.756 1.00 0.00 ? 381 LYS A HB2  1  
ATOM 90    H HB3  . LYS A 1 6   ? -3.243  12.638  -21.446 1.00 0.00 ? 381 LYS A HB3  1  
ATOM 91    H HG2  . LYS A 1 6   ? -0.933  14.384  -21.727 1.00 0.00 ? 381 LYS A HG2  1  
ATOM 92    H HG3  . LYS A 1 6   ? -0.718  12.816  -22.506 1.00 0.00 ? 381 LYS A HG3  1  
ATOM 93    H HD2  . LYS A 1 6   ? -3.185  13.349  -23.355 1.00 0.00 ? 381 LYS A HD2  1  
ATOM 94    H HD3  . LYS A 1 6   ? -2.626  15.005  -23.119 1.00 0.00 ? 381 LYS A HD3  1  
ATOM 95    H HE2  . LYS A 1 6   ? -0.507  13.952  -24.419 1.00 0.00 ? 381 LYS A HE2  1  
ATOM 96    H HE3  . LYS A 1 6   ? -1.814  12.991  -25.111 1.00 0.00 ? 381 LYS A HE3  1  
ATOM 97    H HZ1  . LYS A 1 6   ? -2.846  14.880  -25.963 1.00 0.00 ? 381 LYS A HZ1  1  
ATOM 98    H HZ2  . LYS A 1 6   ? -1.976  15.938  -24.971 1.00 0.00 ? 381 LYS A HZ2  1  
ATOM 99    H HZ3  . LYS A 1 6   ? -1.205  15.161  -26.259 1.00 0.00 ? 381 LYS A HZ3  1  
ATOM 100   N N    . TYR A 1 7   ? -4.752  13.043  -19.531 1.00 0.00 ? 382 TYR A N    1  
ATOM 101   C CA   . TYR A 1 7   ? -5.909  12.539  -18.801 1.00 0.00 ? 382 TYR A CA   1  
ATOM 102   C C    . TYR A 1 7   ? -6.740  11.595  -19.665 1.00 0.00 ? 382 TYR A C    1  
ATOM 103   O O    . TYR A 1 7   ? -7.200  11.968  -20.744 1.00 0.00 ? 382 TYR A O    1  
ATOM 104   C CB   . TYR A 1 7   ? -6.778  13.702  -18.319 1.00 0.00 ? 382 TYR A CB   1  
ATOM 105   C CG   . TYR A 1 7   ? -7.714  13.332  -17.191 1.00 0.00 ? 382 TYR A CG   1  
ATOM 106   C CD1  . TYR A 1 7   ? -8.879  12.615  -17.435 1.00 0.00 ? 382 TYR A CD1  1  
ATOM 107   C CD2  . TYR A 1 7   ? -7.434  13.702  -15.881 1.00 0.00 ? 382 TYR A CD2  1  
ATOM 108   C CE1  . TYR A 1 7   ? -9.737  12.276  -16.406 1.00 0.00 ? 382 TYR A CE1  1  
ATOM 109   C CE2  . TYR A 1 7   ? -8.286  13.366  -14.847 1.00 0.00 ? 382 TYR A CE2  1  
ATOM 110   C CZ   . TYR A 1 7   ? -9.436  12.653  -15.115 1.00 0.00 ? 382 TYR A CZ   1  
ATOM 111   O OH   . TYR A 1 7   ? -10.289 12.318  -14.088 1.00 0.00 ? 382 TYR A OH   1  
ATOM 112   H H    . TYR A 1 7   ? -4.844  13.266  -20.480 1.00 0.00 ? 382 TYR A H    1  
ATOM 113   H HA   . TYR A 1 7   ? -5.548  11.994  -17.942 1.00 0.00 ? 382 TYR A HA   1  
ATOM 114   H HB2  . TYR A 1 7   ? -6.140  14.499  -17.972 1.00 0.00 ? 382 TYR A HB2  1  
ATOM 115   H HB3  . TYR A 1 7   ? -7.377  14.059  -19.144 1.00 0.00 ? 382 TYR A HB3  1  
ATOM 116   H HD1  . TYR A 1 7   ? -9.111  12.320  -18.447 1.00 0.00 ? 382 TYR A HD1  1  
ATOM 117   H HD2  . TYR A 1 7   ? -6.533  14.260  -15.675 1.00 0.00 ? 382 TYR A HD2  1  
ATOM 118   H HE1  . TYR A 1 7   ? -10.637 11.717  -16.617 1.00 0.00 ? 382 TYR A HE1  1  
ATOM 119   H HE2  . TYR A 1 7   ? -8.051  13.663  -13.836 1.00 0.00 ? 382 TYR A HE2  1  
ATOM 120   H HH   . TYR A 1 7   ? -9.777  12.094  -13.307 1.00 0.00 ? 382 TYR A HH   1  
ATOM 121   N N    . ILE A 1 8   ? -6.934  10.373  -19.177 1.00 0.00 ? 383 ILE A N    1  
ATOM 122   C CA   . ILE A 1 8   ? -7.716  9.375   -19.898 1.00 0.00 ? 383 ILE A CA   1  
ATOM 123   C C    . ILE A 1 8   ? -9.006  9.038   -19.156 1.00 0.00 ? 383 ILE A C    1  
ATOM 124   O O    . ILE A 1 8   ? -9.908  8.417   -19.716 1.00 0.00 ? 383 ILE A O    1  
ATOM 125   C CB   . ILE A 1 8   ? -6.915  8.076   -20.123 1.00 0.00 ? 383 ILE A CB   1  
ATOM 126   C CG1  . ILE A 1 8   ? -6.099  7.725   -18.877 1.00 0.00 ? 383 ILE A CG1  1  
ATOM 127   C CG2  . ILE A 1 8   ? -6.010  8.214   -21.338 1.00 0.00 ? 383 ILE A CG2  1  
ATOM 128   C CD1  . ILE A 1 8   ? -5.472  6.349   -18.938 1.00 0.00 ? 383 ILE A CD1  1  
ATOM 129   H H    . ILE A 1 8   ? -6.545  10.139  -18.309 1.00 0.00 ? 383 ILE A H    1  
ATOM 130   H HA   . ILE A 1 8   ? -7.968  9.786   -20.865 1.00 0.00 ? 383 ILE A HA   1  
ATOM 131   H HB   . ILE A 1 8   ? -7.618  7.280   -20.320 1.00 0.00 ? 383 ILE A HB   1  
ATOM 132   H HG12 . ILE A 1 8   ? -5.304  8.446   -18.759 1.00 0.00 ? 383 ILE A HG12 1  
ATOM 133   H HG13 . ILE A 1 8   ? -6.742  7.759   -18.011 1.00 0.00 ? 383 ILE A HG13 1  
ATOM 134   H HG21 . ILE A 1 8   ? -5.988  9.246   -21.654 1.00 0.00 ? 383 ILE A HG21 1  
ATOM 135   H HG22 . ILE A 1 8   ? -5.011  7.895   -21.083 1.00 0.00 ? 383 ILE A HG22 1  
ATOM 136   H HG23 . ILE A 1 8   ? -6.391  7.600   -22.142 1.00 0.00 ? 383 ILE A HG23 1  
ATOM 137   H HD11 . ILE A 1 8   ? -5.350  5.965   -17.936 1.00 0.00 ? 383 ILE A HD11 1  
ATOM 138   H HD12 . ILE A 1 8   ? -6.112  5.687   -19.502 1.00 0.00 ? 383 ILE A HD12 1  
ATOM 139   H HD13 . ILE A 1 8   ? -4.507  6.414   -19.418 1.00 0.00 ? 383 ILE A HD13 1  
ATOM 140   N N    . GLY A 1 9   ? -9.091  9.451   -17.893 1.00 0.00 ? 384 GLY A N    1  
ATOM 141   C CA   . GLY A 1 9   ? -10.277 9.182   -17.104 1.00 0.00 ? 384 GLY A CA   1  
ATOM 142   C C    . GLY A 1 9   ? -10.400 7.724   -16.708 1.00 0.00 ? 384 GLY A C    1  
ATOM 143   O O    . GLY A 1 9   ? -11.397 7.072   -17.017 1.00 0.00 ? 384 GLY A O    1  
ATOM 144   H H    . GLY A 1 9   ? -8.343  9.942   -17.495 1.00 0.00 ? 384 GLY A H    1  
ATOM 145   H HA2  . GLY A 1 9   ? -10.243 9.784   -16.208 1.00 0.00 ? 384 GLY A HA2  1  
ATOM 146   H HA3  . GLY A 1 9   ? -11.148 9.462   -17.677 1.00 0.00 ? 384 GLY A HA3  1  
ATOM 147   N N    . ILE A 1 10  ? -9.385  7.211   -16.020 1.00 0.00 ? 385 ILE A N    1  
ATOM 148   C CA   . ILE A 1 10  ? -9.386  5.822   -15.579 1.00 0.00 ? 385 ILE A CA   1  
ATOM 149   C C    . ILE A 1 10  ? -8.399  5.607   -14.436 1.00 0.00 ? 385 ILE A C    1  
ATOM 150   O O    . ILE A 1 10  ? -7.395  6.313   -14.327 1.00 0.00 ? 385 ILE A O    1  
ATOM 151   C CB   . ILE A 1 10  ? -9.040  4.861   -16.735 1.00 0.00 ? 385 ILE A CB   1  
ATOM 152   C CG1  . ILE A 1 10  ? -9.144  3.407   -16.268 1.00 0.00 ? 385 ILE A CG1  1  
ATOM 153   C CG2  . ILE A 1 10  ? -7.646  5.151   -17.270 1.00 0.00 ? 385 ILE A CG2  1  
ATOM 154   C CD1  . ILE A 1 10  ? -8.846  2.397   -17.355 1.00 0.00 ? 385 ILE A CD1  1  
ATOM 155   H H    . ILE A 1 10  ? -8.619  7.781   -15.802 1.00 0.00 ? 385 ILE A H    1  
ATOM 156   H HA   . ILE A 1 10  ? -10.381 5.586   -15.229 1.00 0.00 ? 385 ILE A HA   1  
ATOM 157   H HB   . ILE A 1 10  ? -9.746  5.025   -17.534 1.00 0.00 ? 385 ILE A HB   1  
ATOM 158   H HG12 . ILE A 1 10  ? -8.443  3.242   -15.464 1.00 0.00 ? 385 ILE A HG12 1  
ATOM 159   H HG13 . ILE A 1 10  ? -10.146 3.222   -15.908 1.00 0.00 ? 385 ILE A HG13 1  
ATOM 160   H HG21 . ILE A 1 10  ? -7.362  6.160   -17.007 1.00 0.00 ? 385 ILE A HG21 1  
ATOM 161   H HG22 . ILE A 1 10  ? -6.942  4.456   -16.839 1.00 0.00 ? 385 ILE A HG22 1  
ATOM 162   H HG23 . ILE A 1 10  ? -7.644  5.045   -18.344 1.00 0.00 ? 385 ILE A HG23 1  
ATOM 163   H HD11 . ILE A 1 10  ? -9.531  1.567   -17.273 1.00 0.00 ? 385 ILE A HD11 1  
ATOM 164   H HD12 . ILE A 1 10  ? -8.963  2.866   -18.321 1.00 0.00 ? 385 ILE A HD12 1  
ATOM 165   H HD13 . ILE A 1 10  ? -7.832  2.041   -17.247 1.00 0.00 ? 385 ILE A HD13 1  
ATOM 166   N N    . ARG A 1 11  ? -8.691  4.627   -13.588 1.00 0.00 ? 386 ARG A N    1  
ATOM 167   C CA   . ARG A 1 11  ? -7.830  4.315   -12.455 1.00 0.00 ? 386 ARG A CA   1  
ATOM 168   C C    . ARG A 1 11  ? -7.050  3.028   -12.702 1.00 0.00 ? 386 ARG A C    1  
ATOM 169   O O    . ARG A 1 11  ? -7.630  1.993   -13.030 1.00 0.00 ? 386 ARG A O    1  
ATOM 170   C CB   . ARG A 1 11  ? -8.663  4.183   -11.178 1.00 0.00 ? 386 ARG A CB   1  
ATOM 171   C CG   . ARG A 1 11  ? -9.061  5.518   -10.570 1.00 0.00 ? 386 ARG A CG   1  
ATOM 172   C CD   . ARG A 1 11  ? -10.145 5.348   -9.520  1.00 0.00 ? 386 ARG A CD   1  
ATOM 173   N NE   . ARG A 1 11  ? -9.974  6.272   -8.400  1.00 0.00 ? 386 ARG A NE   1  
ATOM 174   C CZ   . ARG A 1 11  ? -10.537 6.102   -7.207  1.00 0.00 ? 386 ARG A CZ   1  
ATOM 175   N NH1  . ARG A 1 11  ? -11.310 5.048   -6.974  1.00 0.00 ? 386 ARG A NH1  1  
ATOM 176   N NH2  . ARG A 1 11  ? -10.326 6.988   -6.243  1.00 0.00 ? 386 ARG A NH2  1  
ATOM 177   H H    . ARG A 1 11  ? -9.504  4.100   -13.730 1.00 0.00 ? 386 ARG A H    1  
ATOM 178   H HA   . ARG A 1 11  ? -7.130  5.128   -12.334 1.00 0.00 ? 386 ARG A HA   1  
ATOM 179   H HB2  . ARG A 1 11  ? -9.563  3.632   -11.404 1.00 0.00 ? 386 ARG A HB2  1  
ATOM 180   H HB3  . ARG A 1 11  ? -8.089  3.635   -10.444 1.00 0.00 ? 386 ARG A HB3  1  
ATOM 181   H HG2  . ARG A 1 11  ? -8.193  5.967   -10.108 1.00 0.00 ? 386 ARG A HG2  1  
ATOM 182   H HG3  . ARG A 1 11  ? -9.428  6.164   -11.355 1.00 0.00 ? 386 ARG A HG3  1  
ATOM 183   H HD2  . ARG A 1 11  ? -11.105 5.529   -9.980  1.00 0.00 ? 386 ARG A HD2  1  
ATOM 184   H HD3  . ARG A 1 11  ? -10.111 4.335   -9.146  1.00 0.00 ? 386 ARG A HD3  1  
ATOM 185   H HE   . ARG A 1 11  ? -9.409  7.060   -8.547  1.00 0.00 ? 386 ARG A HE   1  
ATOM 186   H HH11 . ARG A 1 11  ? -11.473 4.377   -7.696  1.00 0.00 ? 386 ARG A HH11 1  
ATOM 187   H HH12 . ARG A 1 11  ? -11.729 4.926   -6.073  1.00 0.00 ? 386 ARG A HH12 1  
ATOM 188   H HH21 . ARG A 1 11  ? -9.745  7.783   -6.412  1.00 0.00 ? 386 ARG A HH21 1  
ATOM 189   H HH22 . ARG A 1 11  ? -10.748 6.859   -5.346  1.00 0.00 ? 386 ARG A HH22 1  
ATOM 190   N N    . MET A 1 12  ? -5.734  3.100   -12.540 1.00 0.00 ? 387 MET A N    1  
ATOM 191   C CA   . MET A 1 12  ? -4.874  1.940   -12.743 1.00 0.00 ? 387 MET A CA   1  
ATOM 192   C C    . MET A 1 12  ? -3.859  1.817   -11.611 1.00 0.00 ? 387 MET A C    1  
ATOM 193   O O    . MET A 1 12  ? -3.385  2.819   -11.078 1.00 0.00 ? 387 MET A O    1  
ATOM 194   C CB   . MET A 1 12  ? -4.150  2.042   -14.088 1.00 0.00 ? 387 MET A CB   1  
ATOM 195   C CG   . MET A 1 12  ? -3.534  3.408   -14.349 1.00 0.00 ? 387 MET A CG   1  
ATOM 196   S SD   . MET A 1 12  ? -1.731  3.378   -14.324 1.00 0.00 ? 387 MET A SD   1  
ATOM 197   C CE   . MET A 1 12  ? -1.365  5.124   -14.162 1.00 0.00 ? 387 MET A CE   1  
ATOM 198   H H    . MET A 1 12  ? -5.332  3.953   -12.275 1.00 0.00 ? 387 MET A H    1  
ATOM 199   H HA   . MET A 1 12  ? -5.500  1.061   -12.746 1.00 0.00 ? 387 MET A HA   1  
ATOM 200   H HB2  . MET A 1 12  ? -3.363  1.303   -14.116 1.00 0.00 ? 387 MET A HB2  1  
ATOM 201   H HB3  . MET A 1 12  ? -4.855  1.832   -14.878 1.00 0.00 ? 387 MET A HB3  1  
ATOM 202   H HG2  . MET A 1 12  ? -3.859  3.754   -15.319 1.00 0.00 ? 387 MET A HG2  1  
ATOM 203   H HG3  . MET A 1 12  ? -3.879  4.093   -13.590 1.00 0.00 ? 387 MET A HG3  1  
ATOM 204   H HE1  . MET A 1 12  ? -1.059  5.518   -15.120 1.00 0.00 ? 387 MET A HE1  1  
ATOM 205   H HE2  . MET A 1 12  ? -2.248  5.647   -13.824 1.00 0.00 ? 387 MET A HE2  1  
ATOM 206   H HE3  . MET A 1 12  ? -0.570  5.260   -13.445 1.00 0.00 ? 387 MET A HE3  1  
ATOM 207   N N    . MET A 1 13  ? -3.533  0.581   -11.246 1.00 0.00 ? 388 MET A N    1  
ATOM 208   C CA   . MET A 1 13  ? -2.577  0.330   -10.173 1.00 0.00 ? 388 MET A CA   1  
ATOM 209   C C    . MET A 1 13  ? -1.471  -0.612  -10.633 1.00 0.00 ? 388 MET A C    1  
ATOM 210   O O    . MET A 1 13  ? -1.624  -1.334  -11.618 1.00 0.00 ? 388 MET A O    1  
ATOM 211   C CB   . MET A 1 13  ? -3.289  -0.261  -8.954  1.00 0.00 ? 388 MET A CB   1  
ATOM 212   C CG   . MET A 1 13  ? -4.096  -1.511  -9.265  1.00 0.00 ? 388 MET A CG   1  
ATOM 213   S SD   . MET A 1 13  ? -5.475  -1.748  -8.129  1.00 0.00 ? 388 MET A SD   1  
ATOM 214   C CE   . MET A 1 13  ? -4.621  -1.746  -6.554  1.00 0.00 ? 388 MET A CE   1  
ATOM 215   H H    . MET A 1 13  ? -3.947  -0.179  -11.706 1.00 0.00 ? 388 MET A H    1  
ATOM 216   H HA   . MET A 1 13  ? -2.135  1.276   -9.896  1.00 0.00 ? 388 MET A HA   1  
ATOM 217   H HB2  . MET A 1 13  ? -2.550  -0.514  -8.209  1.00 0.00 ? 388 MET A HB2  1  
ATOM 218   H HB3  . MET A 1 13  ? -3.959  0.481   -8.546  1.00 0.00 ? 388 MET A HB3  1  
ATOM 219   H HG2  . MET A 1 13  ? -4.486  -1.431  -10.269 1.00 0.00 ? 388 MET A HG2  1  
ATOM 220   H HG3  . MET A 1 13  ? -3.444  -2.370  -9.202  1.00 0.00 ? 388 MET A HG3  1  
ATOM 221   H HE1  . MET A 1 13  ? -5.041  -2.508  -5.916  1.00 0.00 ? 388 MET A HE1  1  
ATOM 222   H HE2  . MET A 1 13  ? -3.571  -1.948  -6.714  1.00 0.00 ? 388 MET A HE2  1  
ATOM 223   H HE3  . MET A 1 13  ? -4.733  -0.780  -6.085  1.00 0.00 ? 388 MET A HE3  1  
ATOM 224   N N    . SER A 1 14  ? -0.355  -0.600  -9.909  1.00 0.00 ? 389 SER A N    1  
ATOM 225   C CA   . SER A 1 14  ? 0.779   -1.454  -10.237 1.00 0.00 ? 389 SER A CA   1  
ATOM 226   C C    . SER A 1 14  ? 0.614   -2.835  -9.616  1.00 0.00 ? 389 SER A C    1  
ATOM 227   O O    . SER A 1 14  ? 0.698   -2.994  -8.398  1.00 0.00 ? 389 SER A O    1  
ATOM 228   C CB   . SER A 1 14  ? 2.081   -0.816  -9.750  1.00 0.00 ? 389 SER A CB   1  
ATOM 229   O OG   . SER A 1 14  ? 2.145   -0.806  -8.334  1.00 0.00 ? 389 SER A OG   1  
ATOM 230   H H    . SER A 1 14  ? -0.296  -0.003  -9.135  1.00 0.00 ? 389 SER A H    1  
ATOM 231   H HA   . SER A 1 14  ? 0.817   -1.557  -11.311 1.00 0.00 ? 389 SER A HA   1  
ATOM 232   H HB2  . SER A 1 14  ? 2.920   -1.378  -10.132 1.00 0.00 ? 389 SER A HB2  1  
ATOM 233   H HB3  . SER A 1 14  ? 2.137   0.201   -10.108 1.00 0.00 ? 389 SER A HB3  1  
ATOM 234   H HG   . SER A 1 14  ? 1.309   -0.498  -7.978  1.00 0.00 ? 389 SER A HG   1  
ATOM 235   N N    . LEU A 1 15  ? 0.376   -3.834  -10.461 1.00 0.00 ? 390 LEU A N    1  
ATOM 236   C CA   . LEU A 1 15  ? 0.195   -5.202  -9.994  1.00 0.00 ? 390 LEU A CA   1  
ATOM 237   C C    . LEU A 1 15  ? 1.416   -5.680  -9.214  1.00 0.00 ? 390 LEU A C    1  
ATOM 238   O O    . LEU A 1 15  ? 2.346   -6.249  -9.784  1.00 0.00 ? 390 LEU A O    1  
ATOM 239   C CB   . LEU A 1 15  ? -0.065  -6.136  -11.179 1.00 0.00 ? 390 LEU A CB   1  
ATOM 240   C CG   . LEU A 1 15  ? -1.141  -7.196  -10.942 1.00 0.00 ? 390 LEU A CG   1  
ATOM 241   C CD1  . LEU A 1 15  ? -2.448  -6.544  -10.515 1.00 0.00 ? 390 LEU A CD1  1  
ATOM 242   C CD2  . LEU A 1 15  ? -1.344  -8.035  -12.195 1.00 0.00 ? 390 LEU A CD2  1  
ATOM 243   H H    . LEU A 1 15  ? 0.318   -3.643  -11.420 1.00 0.00 ? 390 LEU A H    1  
ATOM 244   H HA   . LEU A 1 15  ? -0.664  -5.219  -9.341  1.00 0.00 ? 390 LEU A HA   1  
ATOM 245   H HB2  . LEU A 1 15  ? -0.362  -5.533  -12.025 1.00 0.00 ? 390 LEU A HB2  1  
ATOM 246   H HB3  . LEU A 1 15  ? 0.857   -6.640  -11.424 1.00 0.00 ? 390 LEU A HB3  1  
ATOM 247   H HG   . LEU A 1 15  ? -0.820  -7.853  -10.147 1.00 0.00 ? 390 LEU A HG   1  
ATOM 248   H HD11 . LEU A 1 15  ? -2.464  -5.517  -10.849 1.00 0.00 ? 390 LEU A HD11 1  
ATOM 249   H HD12 . LEU A 1 15  ? -3.277  -7.078  -10.955 1.00 0.00 ? 390 LEU A HD12 1  
ATOM 250   H HD13 . LEU A 1 15  ? -2.530  -6.574  -9.439  1.00 0.00 ? 390 LEU A HD13 1  
ATOM 251   H HD21 . LEU A 1 15  ? -2.111  -7.586  -12.808 1.00 0.00 ? 390 LEU A HD21 1  
ATOM 252   H HD22 . LEU A 1 15  ? -0.419  -8.082  -12.751 1.00 0.00 ? 390 LEU A HD22 1  
ATOM 253   H HD23 . LEU A 1 15  ? -1.647  -9.033  -11.914 1.00 0.00 ? 390 LEU A HD23 1  
ATOM 254   N N    . THR A 1 16  ? 1.404   -5.445  -7.906  1.00 0.00 ? 391 THR A N    1  
ATOM 255   C CA   . THR A 1 16  ? 2.509   -5.852  -7.048  1.00 0.00 ? 391 THR A CA   1  
ATOM 256   C C    . THR A 1 16  ? 2.472   -7.357  -6.795  1.00 0.00 ? 391 THR A C    1  
ATOM 257   O O    . THR A 1 16  ? 1.476   -8.020  -7.080  1.00 0.00 ? 391 THR A O    1  
ATOM 258   C CB   . THR A 1 16  ? 2.457   -5.091  -5.721  1.00 0.00 ? 391 THR A CB   1  
ATOM 259   O OG1  . THR A 1 16  ? 3.487   -5.527  -4.851  1.00 0.00 ? 391 THR A OG1  1  
ATOM 260   C CG2  . THR A 1 16  ? 1.139   -5.246  -4.992  1.00 0.00 ? 391 THR A CG2  1  
ATOM 261   H H    . THR A 1 16  ? 0.633   -4.987  -7.509  1.00 0.00 ? 391 THR A H    1  
ATOM 262   H HA   . THR A 1 16  ? 3.430   -5.607  -7.556  1.00 0.00 ? 391 THR A HA   1  
ATOM 263   H HB   . THR A 1 16  ? 2.604   -4.039  -5.917  1.00 0.00 ? 391 THR A HB   1  
ATOM 264   H HG1  . THR A 1 16  ? 3.266   -6.391  -4.496  1.00 0.00 ? 391 THR A HG1  1  
ATOM 265   H HG21 . THR A 1 16  ? 0.467   -5.844  -5.588  1.00 0.00 ? 391 THR A HG21 1  
ATOM 266   H HG22 . THR A 1 16  ? 1.307   -5.732  -4.042  1.00 0.00 ? 391 THR A HG22 1  
ATOM 267   H HG23 . THR A 1 16  ? 0.703   -4.272  -4.825  1.00 0.00 ? 391 THR A HG23 1  
ATOM 268   N N    . SER A 1 17  ? 3.569   -7.891  -6.265  1.00 0.00 ? 392 SER A N    1  
ATOM 269   C CA   . SER A 1 17  ? 3.671   -9.320  -5.978  1.00 0.00 ? 392 SER A CA   1  
ATOM 270   C C    . SER A 1 17  ? 2.458   -9.820  -5.197  1.00 0.00 ? 392 SER A C    1  
ATOM 271   O O    . SER A 1 17  ? 2.000   -10.945 -5.397  1.00 0.00 ? 392 SER A O    1  
ATOM 272   C CB   . SER A 1 17  ? 4.951   -9.611  -5.193  1.00 0.00 ? 392 SER A CB   1  
ATOM 273   O OG   . SER A 1 17  ? 5.252   -10.995 -5.202  1.00 0.00 ? 392 SER A OG   1  
ATOM 274   H H    . SER A 1 17  ? 4.333   -7.310  -6.064  1.00 0.00 ? 392 SER A H    1  
ATOM 275   H HA   . SER A 1 17  ? 3.714   -9.843  -6.921  1.00 0.00 ? 392 SER A HA   1  
ATOM 276   H HB2  . SER A 1 17  ? 5.774   -9.074  -5.641  1.00 0.00 ? 392 SER A HB2  1  
ATOM 277   H HB3  . SER A 1 17  ? 4.825   -9.288  -4.170  1.00 0.00 ? 392 SER A HB3  1  
ATOM 278   H HG   . SER A 1 17  ? 5.367   -11.292 -6.108  1.00 0.00 ? 392 SER A HG   1  
ATOM 279   N N    . SER A 1 18  ? 1.946   -8.981  -4.302  1.00 0.00 ? 393 SER A N    1  
ATOM 280   C CA   . SER A 1 18  ? 0.790   -9.342  -3.488  1.00 0.00 ? 393 SER A CA   1  
ATOM 281   C C    . SER A 1 18  ? -0.477  -9.423  -4.335  1.00 0.00 ? 393 SER A C    1  
ATOM 282   O O    . SER A 1 18  ? -1.080  -10.489 -4.466  1.00 0.00 ? 393 SER A O    1  
ATOM 283   C CB   . SER A 1 18  ? 0.598   -8.326  -2.362  1.00 0.00 ? 393 SER A CB   1  
ATOM 284   O OG   . SER A 1 18  ? 0.145   -8.957  -1.176  1.00 0.00 ? 393 SER A OG   1  
ATOM 285   H H    . SER A 1 18  ? 2.356   -8.100  -4.185  1.00 0.00 ? 393 SER A H    1  
ATOM 286   H HA   . SER A 1 18  ? 0.982   -10.313 -3.056  1.00 0.00 ? 393 SER A HA   1  
ATOM 287   H HB2  . SER A 1 18  ? 1.538   -7.836  -2.157  1.00 0.00 ? 393 SER A HB2  1  
ATOM 288   H HB3  . SER A 1 18  ? -0.132  -7.590  -2.664  1.00 0.00 ? 393 SER A HB3  1  
ATOM 289   H HG   . SER A 1 18  ? -0.566  -9.566  -1.388  1.00 0.00 ? 393 SER A HG   1  
ATOM 290   N N    . LYS A 1 19  ? -0.878  -8.291  -4.903  1.00 0.00 ? 394 LYS A N    1  
ATOM 291   C CA   . LYS A 1 19  ? -2.078  -8.234  -5.732  1.00 0.00 ? 394 LYS A CA   1  
ATOM 292   C C    . LYS A 1 19  ? -1.992  -9.217  -6.897  1.00 0.00 ? 394 LYS A C    1  
ATOM 293   O O    . LYS A 1 19  ? -2.919  -9.991  -7.136  1.00 0.00 ? 394 LYS A O    1  
ATOM 294   C CB   . LYS A 1 19  ? -2.292  -6.813  -6.261  1.00 0.00 ? 394 LYS A CB   1  
ATOM 295   C CG   . LYS A 1 19  ? -3.479  -6.103  -5.632  1.00 0.00 ? 394 LYS A CG   1  
ATOM 296   C CD   . LYS A 1 19  ? -4.069  -5.061  -6.570  1.00 0.00 ? 394 LYS A CD   1  
ATOM 297   C CE   . LYS A 1 19  ? -5.581  -5.196  -6.683  1.00 0.00 ? 394 LYS A CE   1  
ATOM 298   N NZ   . LYS A 1 19  ? -6.030  -5.245  -8.102  1.00 0.00 ? 394 LYS A NZ   1  
ATOM 299   H H    . LYS A 1 19  ? -0.359  -7.473  -4.759  1.00 0.00 ? 394 LYS A H    1  
ATOM 300   H HA   . LYS A 1 19  ? -2.920  -8.505  -5.113  1.00 0.00 ? 394 LYS A HA   1  
ATOM 301   H HB2  . LYS A 1 19  ? -1.405  -6.230  -6.061  1.00 0.00 ? 394 LYS A HB2  1  
ATOM 302   H HB3  . LYS A 1 19  ? -2.450  -6.855  -7.329  1.00 0.00 ? 394 LYS A HB3  1  
ATOM 303   H HG2  . LYS A 1 19  ? -4.238  -6.833  -5.396  1.00 0.00 ? 394 LYS A HG2  1  
ATOM 304   H HG3  . LYS A 1 19  ? -3.153  -5.614  -4.725  1.00 0.00 ? 394 LYS A HG3  1  
ATOM 305   H HD2  . LYS A 1 19  ? -3.834  -4.078  -6.194  1.00 0.00 ? 394 LYS A HD2  1  
ATOM 306   H HD3  . LYS A 1 19  ? -3.633  -5.185  -7.551  1.00 0.00 ? 394 LYS A HD3  1  
ATOM 307   H HE2  . LYS A 1 19  ? -5.888  -6.105  -6.186  1.00 0.00 ? 394 LYS A HE2  1  
ATOM 308   H HE3  . LYS A 1 19  ? -6.041  -4.348  -6.196  1.00 0.00 ? 394 LYS A HE3  1  
ATOM 309   H HZ1  . LYS A 1 19  ? -6.359  -4.307  -8.405  1.00 0.00 ? 394 LYS A HZ1  1  
ATOM 310   H HZ2  . LYS A 1 19  ? -5.244  -5.540  -8.716  1.00 0.00 ? 394 LYS A HZ2  1  
ATOM 311   H HZ3  . LYS A 1 19  ? -6.811  -5.925  -8.205  1.00 0.00 ? 394 LYS A HZ3  1  
ATOM 312   N N    . ALA A 1 20  ? -0.876  -9.181  -7.619  1.00 0.00 ? 395 ALA A N    1  
ATOM 313   C CA   . ALA A 1 20  ? -0.672  -10.068 -8.760  1.00 0.00 ? 395 ALA A CA   1  
ATOM 314   C C    . ALA A 1 20  ? -0.946  -11.522 -8.388  1.00 0.00 ? 395 ALA A C    1  
ATOM 315   O O    . ALA A 1 20  ? -1.529  -12.275 -9.170  1.00 0.00 ? 395 ALA A O    1  
ATOM 316   C CB   . ALA A 1 20  ? 0.743   -9.918  -9.298  1.00 0.00 ? 395 ALA A CB   1  
ATOM 317   H H    . ALA A 1 20  ? -0.173  -8.541  -7.380  1.00 0.00 ? 395 ALA A H    1  
ATOM 318   H HA   . ALA A 1 20  ? -1.359  -9.771  -9.539  1.00 0.00 ? 395 ALA A HA   1  
ATOM 319   H HB1  . ALA A 1 20  ? 0.745   -10.097 -10.362 1.00 0.00 ? 395 ALA A HB1  1  
ATOM 320   H HB2  . ALA A 1 20  ? 1.099   -8.918  -9.100  1.00 0.00 ? 395 ALA A HB2  1  
ATOM 321   H HB3  . ALA A 1 20  ? 1.391   -10.633 -8.812  1.00 0.00 ? 395 ALA A HB3  1  
ATOM 322   N N    . LYS A 1 21  ? -0.524  -11.911 -7.191  1.00 0.00 ? 396 LYS A N    1  
ATOM 323   C CA   . LYS A 1 21  ? -0.726  -13.274 -6.714  1.00 0.00 ? 396 LYS A CA   1  
ATOM 324   C C    . LYS A 1 21  ? -2.145  -13.465 -6.190  1.00 0.00 ? 396 LYS A C    1  
ATOM 325   O O    . LYS A 1 21  ? -2.694  -14.565 -6.242  1.00 0.00 ? 396 LYS A O    1  
ATOM 326   C CB   . LYS A 1 21  ? 0.285   -13.604 -5.614  1.00 0.00 ? 396 LYS A CB   1  
ATOM 327   C CG   . LYS A 1 21  ? 0.358   -15.086 -5.279  1.00 0.00 ? 396 LYS A CG   1  
ATOM 328   C CD   . LYS A 1 21  ? 1.760   -15.637 -5.487  1.00 0.00 ? 396 LYS A CD   1  
ATOM 329   C CE   . LYS A 1 21  ? 2.740   -15.065 -4.475  1.00 0.00 ? 396 LYS A CE   1  
ATOM 330   N NZ   . LYS A 1 21  ? 3.705   -16.092 -3.995  1.00 0.00 ? 396 LYS A NZ   1  
ATOM 331   H H    . LYS A 1 21  ? -0.067  -11.265 -6.612  1.00 0.00 ? 396 LYS A H    1  
ATOM 332   H HA   . LYS A 1 21  ? -0.568  -13.943 -7.546  1.00 0.00 ? 396 LYS A HA   1  
ATOM 333   H HB2  . LYS A 1 21  ? 1.264   -13.278 -5.932  1.00 0.00 ? 396 LYS A HB2  1  
ATOM 334   H HB3  . LYS A 1 21  ? 0.011   -13.067 -4.717  1.00 0.00 ? 396 LYS A HB3  1  
ATOM 335   H HG2  . LYS A 1 21  ? 0.079   -15.226 -4.245  1.00 0.00 ? 396 LYS A HG2  1  
ATOM 336   H HG3  . LYS A 1 21  ? -0.329  -15.623 -5.916  1.00 0.00 ? 396 LYS A HG3  1  
ATOM 337   H HD2  . LYS A 1 21  ? 1.734   -16.711 -5.380  1.00 0.00 ? 396 LYS A HD2  1  
ATOM 338   H HD3  . LYS A 1 21  ? 2.092   -15.380 -6.482  1.00 0.00 ? 396 LYS A HD3  1  
ATOM 339   H HE2  . LYS A 1 21  ? 3.287   -14.258 -4.940  1.00 0.00 ? 396 LYS A HE2  1  
ATOM 340   H HE3  . LYS A 1 21  ? 2.184   -14.683 -3.631  1.00 0.00 ? 396 LYS A HE3  1  
ATOM 341   H HZ1  . LYS A 1 21  ? 3.314   -16.594 -3.173  1.00 0.00 ? 396 LYS A HZ1  1  
ATOM 342   H HZ2  . LYS A 1 21  ? 3.898   -16.781 -4.750  1.00 0.00 ? 396 LYS A HZ2  1  
ATOM 343   H HZ3  . LYS A 1 21  ? 4.599   -15.638 -3.717  1.00 0.00 ? 396 LYS A HZ3  1  
ATOM 344   N N    . GLU A 1 22  ? -2.735  -12.385 -5.684  1.00 0.00 ? 397 GLU A N    1  
ATOM 345   C CA   . GLU A 1 22  ? -4.091  -12.433 -5.151  1.00 0.00 ? 397 GLU A CA   1  
ATOM 346   C C    . GLU A 1 22  ? -5.100  -12.756 -6.248  1.00 0.00 ? 397 GLU A C    1  
ATOM 347   O O    . GLU A 1 22  ? -6.097  -13.437 -6.008  1.00 0.00 ? 397 GLU A O    1  
ATOM 348   C CB   . GLU A 1 22  ? -4.449  -11.100 -4.491  1.00 0.00 ? 397 GLU A CB   1  
ATOM 349   C CG   . GLU A 1 22  ? -5.431  -11.234 -3.339  1.00 0.00 ? 397 GLU A CG   1  
ATOM 350   C CD   . GLU A 1 22  ? -4.955  -10.534 -2.081  1.00 0.00 ? 397 GLU A CD   1  
ATOM 351   O OE1  . GLU A 1 22  ? -3.726  -10.444 -1.880  1.00 0.00 ? 397 GLU A OE1  1  
ATOM 352   O OE2  . GLU A 1 22  ? -5.812  -10.076 -1.296  1.00 0.00 ? 397 GLU A OE2  1  
ATOM 353   H H    . GLU A 1 22  ? -2.246  -11.536 -5.670  1.00 0.00 ? 397 GLU A H    1  
ATOM 354   H HA   . GLU A 1 22  ? -4.126  -13.214 -4.405  1.00 0.00 ? 397 GLU A HA   1  
ATOM 355   H HB2  . GLU A 1 22  ? -3.544  -10.644 -4.116  1.00 0.00 ? 397 GLU A HB2  1  
ATOM 356   H HB3  . GLU A 1 22  ? -4.885  -10.451 -5.235  1.00 0.00 ? 397 GLU A HB3  1  
ATOM 357   H HG2  . GLU A 1 22  ? -6.375  -10.803 -3.636  1.00 0.00 ? 397 GLU A HG2  1  
ATOM 358   H HG3  . GLU A 1 22  ? -5.568  -12.283 -3.120  1.00 0.00 ? 397 GLU A HG3  1  
ATOM 359   N N    . LEU A 1 23  ? -4.835  -12.261 -7.452  1.00 0.00 ? 398 LEU A N    1  
ATOM 360   C CA   . LEU A 1 23  ? -5.720  -12.494 -8.588  1.00 0.00 ? 398 LEU A CA   1  
ATOM 361   C C    . LEU A 1 23  ? -5.699  -13.960 -9.007  1.00 0.00 ? 398 LEU A C    1  
ATOM 362   O O    . LEU A 1 23  ? -6.742  -14.551 -9.287  1.00 0.00 ? 398 LEU A O    1  
ATOM 363   C CB   . LEU A 1 23  ? -5.316  -11.607 -9.767  1.00 0.00 ? 398 LEU A CB   1  
ATOM 364   C CG   . LEU A 1 23  ? -5.550  -10.110 -9.560  1.00 0.00 ? 398 LEU A CG   1  
ATOM 365   C CD1  . LEU A 1 23  ? -5.057  -9.321  -10.761 1.00 0.00 ? 398 LEU A CD1  1  
ATOM 366   C CD2  . LEU A 1 23  ? -7.025  -9.833  -9.307  1.00 0.00 ? 398 LEU A CD2  1  
ATOM 367   H H    . LEU A 1 23  ? -4.025  -11.723 -7.581  1.00 0.00 ? 398 LEU A H    1  
ATOM 368   H HA   . LEU A 1 23  ? -6.724  -12.234 -8.283  1.00 0.00 ? 398 LEU A HA   1  
ATOM 369   H HB2  . LEU A 1 23  ? -4.264  -11.763 -9.962  1.00 0.00 ? 398 LEU A HB2  1  
ATOM 370   H HB3  . LEU A 1 23  ? -5.876  -11.920 -10.635 1.00 0.00 ? 398 LEU A HB3  1  
ATOM 371   H HG   . LEU A 1 23  ? -4.994  -9.781  -8.694  1.00 0.00 ? 398 LEU A HG   1  
ATOM 372   H HD11 . LEU A 1 23  ? -5.090  -9.946  -11.642 1.00 0.00 ? 398 LEU A HD11 1  
ATOM 373   H HD12 . LEU A 1 23  ? -5.689  -8.457  -10.910 1.00 0.00 ? 398 LEU A HD12 1  
ATOM 374   H HD13 . LEU A 1 23  ? -4.042  -8.997  -10.588 1.00 0.00 ? 398 LEU A HD13 1  
ATOM 375   H HD21 . LEU A 1 23  ? -7.247  -8.807  -9.559  1.00 0.00 ? 398 LEU A HD21 1  
ATOM 376   H HD22 . LEU A 1 23  ? -7.625  -10.491 -9.918  1.00 0.00 ? 398 LEU A HD22 1  
ATOM 377   H HD23 . LEU A 1 23  ? -7.250  -10.004 -8.265  1.00 0.00 ? 398 LEU A HD23 1  
ATOM 378   N N    . LYS A 1 24  ? -4.505  -14.542 -9.046  1.00 0.00 ? 399 LYS A N    1  
ATOM 379   C CA   . LYS A 1 24  ? -4.350  -15.941 -9.431  1.00 0.00 ? 399 LYS A CA   1  
ATOM 380   C C    . LYS A 1 24  ? -5.130  -16.854 -8.492  1.00 0.00 ? 399 LYS A C    1  
ATOM 381   O O    . LYS A 1 24  ? -5.662  -17.882 -8.910  1.00 0.00 ? 399 LYS A O    1  
ATOM 382   C CB   . LYS A 1 24  ? -2.871  -16.330 -9.428  1.00 0.00 ? 399 LYS A CB   1  
ATOM 383   C CG   . LYS A 1 24  ? -2.107  -15.831 -10.644 1.00 0.00 ? 399 LYS A CG   1  
ATOM 384   C CD   . LYS A 1 24  ? -0.819  -15.128 -10.246 1.00 0.00 ? 399 LYS A CD   1  
ATOM 385   C CE   . LYS A 1 24  ? -0.237  -14.329 -11.401 1.00 0.00 ? 399 LYS A CE   1  
ATOM 386   N NZ   . LYS A 1 24  ? 1.193   -14.664 -11.644 1.00 0.00 ? 399 LYS A NZ   1  
ATOM 387   H H    . LYS A 1 24  ? -3.710  -14.021 -8.812  1.00 0.00 ? 399 LYS A H    1  
ATOM 388   H HA   . LYS A 1 24  ? -4.741  -16.055 -10.431 1.00 0.00 ? 399 LYS A HA   1  
ATOM 389   H HB2  . LYS A 1 24  ? -2.405  -15.923 -8.543  1.00 0.00 ? 399 LYS A HB2  1  
ATOM 390   H HB3  . LYS A 1 24  ? -2.795  -17.408 -9.398  1.00 0.00 ? 399 LYS A HB3  1  
ATOM 391   H HG2  . LYS A 1 24  ? -1.865  -16.674 -11.275 1.00 0.00 ? 399 LYS A HG2  1  
ATOM 392   H HG3  . LYS A 1 24  ? -2.732  -15.139 -11.189 1.00 0.00 ? 399 LYS A HG3  1  
ATOM 393   H HD2  . LYS A 1 24  ? -1.026  -14.458 -9.426  1.00 0.00 ? 399 LYS A HD2  1  
ATOM 394   H HD3  . LYS A 1 24  ? -0.098  -15.870 -9.934  1.00 0.00 ? 399 LYS A HD3  1  
ATOM 395   H HE2  . LYS A 1 24  ? -0.804  -14.543 -12.296 1.00 0.00 ? 399 LYS A HE2  1  
ATOM 396   H HE3  . LYS A 1 24  ? -0.317  -13.276 -11.170 1.00 0.00 ? 399 LYS A HE3  1  
ATOM 397   H HZ1  . LYS A 1 24  ? 1.688   -13.845 -12.051 1.00 0.00 ? 399 LYS A HZ1  1  
ATOM 398   H HZ2  . LYS A 1 24  ? 1.655   -14.926 -10.750 1.00 0.00 ? 399 LYS A HZ2  1  
ATOM 399   H HZ3  . LYS A 1 24  ? 1.265   -15.463 -12.308 1.00 0.00 ? 399 LYS A HZ3  1  
ATOM 400   N N    . ASP A 1 25  ? -5.195  -16.470 -7.222  1.00 0.00 ? 400 ASP A N    1  
ATOM 401   C CA   . ASP A 1 25  ? -5.911  -17.255 -6.222  1.00 0.00 ? 400 ASP A CA   1  
ATOM 402   C C    . ASP A 1 25  ? -7.420  -17.136 -6.417  1.00 0.00 ? 400 ASP A C    1  
ATOM 403   O O    . ASP A 1 25  ? -8.156  -18.107 -6.240  1.00 0.00 ? 400 ASP A O    1  
ATOM 404   C CB   . ASP A 1 25  ? -5.528  -16.796 -4.814  1.00 0.00 ? 400 ASP A CB   1  
ATOM 405   C CG   . ASP A 1 25  ? -4.222  -17.404 -4.343  1.00 0.00 ? 400 ASP A CG   1  
ATOM 406   O OD1  . ASP A 1 25  ? -3.256  -17.421 -5.134  1.00 0.00 ? 400 ASP A OD1  1  
ATOM 407   O OD2  . ASP A 1 25  ? -4.164  -17.863 -3.182  1.00 0.00 ? 400 ASP A OD2  1  
ATOM 408   H H    . ASP A 1 25  ? -4.751  -15.641 -6.949  1.00 0.00 ? 400 ASP A H    1  
ATOM 409   H HA   . ASP A 1 25  ? -5.625  -18.289 -6.345  1.00 0.00 ? 400 ASP A HA   1  
ATOM 410   H HB2  . ASP A 1 25  ? -5.427  -15.721 -4.807  1.00 0.00 ? 400 ASP A HB2  1  
ATOM 411   H HB3  . ASP A 1 25  ? -6.308  -17.084 -4.124  1.00 0.00 ? 400 ASP A HB3  1  
ATOM 412   N N    . ARG A 1 26  ? -7.872  -15.942 -6.781  1.00 0.00 ? 401 ARG A N    1  
ATOM 413   C CA   . ARG A 1 26  ? -9.294  -15.697 -7.000  1.00 0.00 ? 401 ARG A CA   1  
ATOM 414   C C    . ARG A 1 26  ? -9.712  -16.141 -8.397  1.00 0.00 ? 401 ARG A C    1  
ATOM 415   O O    . ARG A 1 26  ? -10.432 -17.127 -8.556  1.00 0.00 ? 401 ARG A O    1  
ATOM 416   C CB   . ARG A 1 26  ? -9.613  -14.213 -6.806  1.00 0.00 ? 401 ARG A CB   1  
ATOM 417   C CG   . ARG A 1 26  ? -9.795  -13.815 -5.350  1.00 0.00 ? 401 ARG A CG   1  
ATOM 418   C CD   . ARG A 1 26  ? -9.353  -12.381 -5.105  1.00 0.00 ? 401 ARG A CD   1  
ATOM 419   N NE   . ARG A 1 26  ? -8.875  -12.182 -3.738  1.00 0.00 ? 401 ARG A NE   1  
ATOM 420   C CZ   . ARG A 1 26  ? -9.675  -12.125 -2.675  1.00 0.00 ? 401 ARG A CZ   1  
ATOM 421   N NH1  . ARG A 1 26  ? -10.989 -12.252 -2.816  1.00 0.00 ? 401 ARG A NH1  1  
ATOM 422   N NH2  . ARG A 1 26  ? -9.159  -11.943 -1.467  1.00 0.00 ? 401 ARG A NH2  1  
ATOM 423   H H    . ARG A 1 26  ? -7.236  -15.206 -6.906  1.00 0.00 ? 401 ARG A H    1  
ATOM 424   H HA   . ARG A 1 26  ? -9.846  -16.272 -6.271  1.00 0.00 ? 401 ARG A HA   1  
ATOM 425   H HB2  . ARG A 1 26  ? -8.807  -13.626 -7.219  1.00 0.00 ? 401 ARG A HB2  1  
ATOM 426   H HB3  . ARG A 1 26  ? -10.525 -13.981 -7.336  1.00 0.00 ? 401 ARG A HB3  1  
ATOM 427   H HG2  . ARG A 1 26  ? -10.838 -13.908 -5.088  1.00 0.00 ? 401 ARG A HG2  1  
ATOM 428   H HG3  . ARG A 1 26  ? -9.206  -14.475 -4.730  1.00 0.00 ? 401 ARG A HG3  1  
ATOM 429   H HD2  . ARG A 1 26  ? -8.555  -12.141 -5.791  1.00 0.00 ? 401 ARG A HD2  1  
ATOM 430   H HD3  . ARG A 1 26  ? -10.191 -11.724 -5.283  1.00 0.00 ? 401 ARG A HD3  1  
ATOM 431   H HE   . ARG A 1 26  ? -7.910  -12.086 -3.605  1.00 0.00 ? 401 ARG A HE   1  
ATOM 432   H HH11 . ARG A 1 26  ? -11.384 -12.389 -3.725  1.00 0.00 ? 401 ARG A HH11 1  
ATOM 433   H HH12 . ARG A 1 26  ? -11.584 -12.207 -2.014  1.00 0.00 ? 401 ARG A HH12 1  
ATOM 434   H HH21 . ARG A 1 26  ? -8.171  -11.848 -1.355  1.00 0.00 ? 401 ARG A HH21 1  
ATOM 435   H HH22 . ARG A 1 26  ? -9.759  -11.900 -0.668  1.00 0.00 ? 401 ARG A HH22 1  
ATOM 436   N N    . HIS A 1 27  ? -9.255  -15.408 -9.406  1.00 0.00 ? 402 HIS A N    1  
ATOM 437   C CA   . HIS A 1 27  ? -9.579  -15.727 -10.792 1.00 0.00 ? 402 HIS A CA   1  
ATOM 438   C C    . HIS A 1 27  ? -8.460  -16.537 -11.438 1.00 0.00 ? 402 HIS A C    1  
ATOM 439   O O    . HIS A 1 27  ? -7.475  -15.978 -11.919 1.00 0.00 ? 402 HIS A O    1  
ATOM 440   C CB   . HIS A 1 27  ? -9.828  -14.443 -11.587 1.00 0.00 ? 402 HIS A CB   1  
ATOM 441   C CG   . HIS A 1 27  ? -11.258 -14.258 -11.993 1.00 0.00 ? 402 HIS A CG   1  
ATOM 442   N ND1  . HIS A 1 27  ? -11.633 -13.663 -13.178 1.00 0.00 ? 402 HIS A ND1  1  
ATOM 443   C CD2  . HIS A 1 27  ? -12.409 -14.596 -11.362 1.00 0.00 ? 402 HIS A CD2  1  
ATOM 444   C CE1  . HIS A 1 27  ? -12.951 -13.641 -13.260 1.00 0.00 ? 402 HIS A CE1  1  
ATOM 445   N NE2  . HIS A 1 27  ? -13.446 -14.201 -12.172 1.00 0.00 ? 402 HIS A NE2  1  
ATOM 446   H H    . HIS A 1 27  ? -8.683  -14.635 -9.216  1.00 0.00 ? 402 HIS A H    1  
ATOM 447   H HA   . HIS A 1 27  ? -10.481 -16.320 -10.793 1.00 0.00 ? 402 HIS A HA   1  
ATOM 448   H HB2  . HIS A 1 27  ? -9.543  -13.594 -10.985 1.00 0.00 ? 402 HIS A HB2  1  
ATOM 449   H HB3  . HIS A 1 27  ? -9.227  -14.460 -12.485 1.00 0.00 ? 402 HIS A HB3  1  
ATOM 450   H HD1  . HIS A 1 27  ? -11.023 -13.308 -13.858 1.00 0.00 ? 402 HIS A HD1  1  
ATOM 451   H HD2  . HIS A 1 27  ? -12.494 -15.084 -10.403 1.00 0.00 ? 402 HIS A HD2  1  
ATOM 452   H HE1  . HIS A 1 27  ? -13.528 -13.234 -14.079 1.00 0.00 ? 402 HIS A HE1  1  
ATOM 453   H HE2  . HIS A 1 27  ? -14.393 -14.393 -12.016 1.00 0.00 ? 402 HIS A HE2  1  
ATOM 454   N N    . ARG A 1 28  ? -8.620  -17.857 -11.449 1.00 0.00 ? 403 ARG A N    1  
ATOM 455   C CA   . ARG A 1 28  ? -7.622  -18.739 -12.039 1.00 0.00 ? 403 ARG A CA   1  
ATOM 456   C C    . ARG A 1 28  ? -7.765  -18.783 -13.557 1.00 0.00 ? 403 ARG A C    1  
ATOM 457   O O    . ARG A 1 28  ? -8.001  -19.840 -14.142 1.00 0.00 ? 403 ARG A O    1  
ATOM 458   C CB   . ARG A 1 28  ? -7.746  -20.150 -11.462 1.00 0.00 ? 403 ARG A CB   1  
ATOM 459   C CG   . ARG A 1 28  ? -6.609  -21.070 -11.875 1.00 0.00 ? 403 ARG A CG   1  
ATOM 460   C CD   . ARG A 1 28  ? -7.117  -22.288 -12.630 1.00 0.00 ? 403 ARG A CD   1  
ATOM 461   N NE   . ARG A 1 28  ? -6.055  -22.939 -13.395 1.00 0.00 ? 403 ARG A NE   1  
ATOM 462   C CZ   . ARG A 1 28  ? -5.149  -23.753 -12.859 1.00 0.00 ? 403 ARG A CZ   1  
ATOM 463   N NH1  . ARG A 1 28  ? -5.170  -24.020 -11.559 1.00 0.00 ? 403 ARG A NH1  1  
ATOM 464   N NH2  . ARG A 1 28  ? -4.217  -24.302 -13.626 1.00 0.00 ? 403 ARG A NH2  1  
ATOM 465   H H    . ARG A 1 28  ? -9.427  -18.244 -11.051 1.00 0.00 ? 403 ARG A H    1  
ATOM 466   H HA   . ARG A 1 28  ? -6.648  -18.345 -11.793 1.00 0.00 ? 403 ARG A HA   1  
ATOM 467   H HB2  . ARG A 1 28  ? -7.756  -20.086 -10.383 1.00 0.00 ? 403 ARG A HB2  1  
ATOM 468   H HB3  . ARG A 1 28  ? -8.676  -20.585 -11.798 1.00 0.00 ? 403 ARG A HB3  1  
ATOM 469   H HG2  . ARG A 1 28  ? -5.932  -20.520 -12.514 1.00 0.00 ? 403 ARG A HG2  1  
ATOM 470   H HG3  . ARG A 1 28  ? -6.085  -21.398 -10.989 1.00 0.00 ? 403 ARG A HG3  1  
ATOM 471   H HD2  . ARG A 1 28  ? -7.520  -22.994 -11.919 1.00 0.00 ? 403 ARG A HD2  1  
ATOM 472   H HD3  . ARG A 1 28  ? -7.897  -21.975 -13.309 1.00 0.00 ? 403 ARG A HD3  1  
ATOM 473   H HE   . ARG A 1 28  ? -6.017  -22.760 -14.357 1.00 0.00 ? 403 ARG A HE   1  
ATOM 474   H HH11 . ARG A 1 28  ? -5.870  -23.608 -10.976 1.00 0.00 ? 403 ARG A HH11 1  
ATOM 475   H HH12 . ARG A 1 28  ? -4.486  -24.631 -11.163 1.00 0.00 ? 403 ARG A HH12 1  
ATOM 476   H HH21 . ARG A 1 28  ? -4.195  -24.105 -14.606 1.00 0.00 ? 403 ARG A HH21 1  
ATOM 477   H HH22 . ARG A 1 28  ? -3.534  -24.913 -13.224 1.00 0.00 ? 403 ARG A HH22 1  
ATOM 478   N N    . ASP A 1 29  ? -7.616  -17.625 -14.188 1.00 0.00 ? 404 ASP A N    1  
ATOM 479   C CA   . ASP A 1 29  ? -7.723  -17.524 -15.639 1.00 0.00 ? 404 ASP A CA   1  
ATOM 480   C C    . ASP A 1 29  ? -6.718  -16.520 -16.199 1.00 0.00 ? 404 ASP A C    1  
ATOM 481   O O    . ASP A 1 29  ? -6.822  -16.104 -17.353 1.00 0.00 ? 404 ASP A O    1  
ATOM 482   C CB   . ASP A 1 29  ? -9.143  -17.116 -16.038 1.00 0.00 ? 404 ASP A CB   1  
ATOM 483   C CG   . ASP A 1 29  ? -9.394  -17.282 -17.524 1.00 0.00 ? 404 ASP A CG   1  
ATOM 484   O OD1  . ASP A 1 29  ? -9.217  -18.408 -18.035 1.00 0.00 ? 404 ASP A OD1  1  
ATOM 485   O OD2  . ASP A 1 29  ? -9.769  -16.286 -18.178 1.00 0.00 ? 404 ASP A OD2  1  
ATOM 486   H H    . ASP A 1 29  ? -7.427  -16.819 -13.666 1.00 0.00 ? 404 ASP A H    1  
ATOM 487   H HA   . ASP A 1 29  ? -7.510  -18.497 -16.054 1.00 0.00 ? 404 ASP A HA   1  
ATOM 488   H HB2  . ASP A 1 29  ? -9.851  -17.728 -15.501 1.00 0.00 ? 404 ASP A HB2  1  
ATOM 489   H HB3  . ASP A 1 29  ? -9.299  -16.079 -15.779 1.00 0.00 ? 404 ASP A HB3  1  
ATOM 490   N N    . PHE A 1 30  ? -5.743  -16.134 -15.379 1.00 0.00 ? 405 PHE A N    1  
ATOM 491   C CA   . PHE A 1 30  ? -4.723  -15.181 -15.800 1.00 0.00 ? 405 PHE A CA   1  
ATOM 492   C C    . PHE A 1 30  ? -3.390  -15.884 -16.039 1.00 0.00 ? 405 PHE A C    1  
ATOM 493   O O    . PHE A 1 30  ? -3.097  -16.905 -15.416 1.00 0.00 ? 405 PHE A O    1  
ATOM 494   C CB   . PHE A 1 30  ? -4.555  -14.084 -14.747 1.00 0.00 ? 405 PHE A CB   1  
ATOM 495   C CG   . PHE A 1 30  ? -5.642  -13.048 -14.782 1.00 0.00 ? 405 PHE A CG   1  
ATOM 496   C CD1  . PHE A 1 30  ? -5.780  -12.207 -15.875 1.00 0.00 ? 405 PHE A CD1  1  
ATOM 497   C CD2  . PHE A 1 30  ? -6.524  -12.915 -13.722 1.00 0.00 ? 405 PHE A CD2  1  
ATOM 498   C CE1  . PHE A 1 30  ? -6.779  -11.253 -15.910 1.00 0.00 ? 405 PHE A CE1  1  
ATOM 499   C CE2  . PHE A 1 30  ? -7.525  -11.962 -13.752 1.00 0.00 ? 405 PHE A CE2  1  
ATOM 500   C CZ   . PHE A 1 30  ? -7.653  -11.130 -14.847 1.00 0.00 ? 405 PHE A CZ   1  
ATOM 501   H H    . PHE A 1 30  ? -5.708  -16.499 -14.470 1.00 0.00 ? 405 PHE A H    1  
ATOM 502   H HA   . PHE A 1 30  ? -5.052  -14.733 -16.726 1.00 0.00 ? 405 PHE A HA   1  
ATOM 503   H HB2  . PHE A 1 30  ? -4.555  -14.533 -13.766 1.00 0.00 ? 405 PHE A HB2  1  
ATOM 504   H HB3  . PHE A 1 30  ? -3.611  -13.583 -14.908 1.00 0.00 ? 405 PHE A HB3  1  
ATOM 505   H HD1  . PHE A 1 30  ? -5.097  -12.302 -16.707 1.00 0.00 ? 405 PHE A HD1  1  
ATOM 506   H HD2  . PHE A 1 30  ? -6.425  -13.565 -12.866 1.00 0.00 ? 405 PHE A HD2  1  
ATOM 507   H HE1  . PHE A 1 30  ? -6.877  -10.603 -16.767 1.00 0.00 ? 405 PHE A HE1  1  
ATOM 508   H HE2  . PHE A 1 30  ? -8.207  -11.869 -12.919 1.00 0.00 ? 405 PHE A HE2  1  
ATOM 509   H HZ   . PHE A 1 30  ? -8.435  -10.386 -14.873 1.00 0.00 ? 405 PHE A HZ   1  
ATOM 510   N N    . PRO A 1 31  ? -2.561  -15.346 -16.949 1.00 0.00 ? 406 PRO A N    1  
ATOM 511   C CA   . PRO A 1 31  ? -1.253  -15.928 -17.267 1.00 0.00 ? 406 PRO A CA   1  
ATOM 512   C C    . PRO A 1 31  ? -0.408  -16.168 -16.021 1.00 0.00 ? 406 PRO A C    1  
ATOM 513   O O    . PRO A 1 31  ? -0.836  -15.880 -14.903 1.00 0.00 ? 406 PRO A O    1  
ATOM 514   C CB   . PRO A 1 31  ? -0.600  -14.872 -18.162 1.00 0.00 ? 406 PRO A CB   1  
ATOM 515   C CG   . PRO A 1 31  ? -1.741  -14.135 -18.773 1.00 0.00 ? 406 PRO A CG   1  
ATOM 516   C CD   . PRO A 1 31  ? -2.831  -14.129 -17.738 1.00 0.00 ? 406 PRO A CD   1  
ATOM 517   H HA   . PRO A 1 31  ? -1.356  -16.854 -17.814 1.00 0.00 ? 406 PRO A HA   1  
ATOM 518   H HB2  . PRO A 1 31  ? 0.017   -14.220 -17.562 1.00 0.00 ? 406 PRO A HB2  1  
ATOM 519   H HB3  . PRO A 1 31  ? 0.004   -15.357 -18.914 1.00 0.00 ? 406 PRO A HB3  1  
ATOM 520   H HG2  . PRO A 1 31  ? -1.442  -13.124 -19.008 1.00 0.00 ? 406 PRO A HG2  1  
ATOM 521   H HG3  . PRO A 1 31  ? -2.074  -14.646 -19.664 1.00 0.00 ? 406 PRO A HG3  1  
ATOM 522   H HD2  . PRO A 1 31  ? -2.761  -13.245 -17.121 1.00 0.00 ? 406 PRO A HD2  1  
ATOM 523   H HD3  . PRO A 1 31  ? -3.800  -14.184 -18.210 1.00 0.00 ? 406 PRO A HD3  1  
ATOM 524   N N    . ASP A 1 32  ? 0.796   -16.696 -16.220 1.00 0.00 ? 407 ASP A N    1  
ATOM 525   C CA   . ASP A 1 32  ? 1.702   -16.975 -15.112 1.00 0.00 ? 407 ASP A CA   1  
ATOM 526   C C    . ASP A 1 32  ? 2.737   -15.865 -14.960 1.00 0.00 ? 407 ASP A C    1  
ATOM 527   O O    . ASP A 1 32  ? 3.849   -16.100 -14.488 1.00 0.00 ? 407 ASP A O    1  
ATOM 528   C CB   . ASP A 1 32  ? 2.404   -18.317 -15.326 1.00 0.00 ? 407 ASP A CB   1  
ATOM 529   C CG   . ASP A 1 32  ? 2.557   -19.103 -14.038 1.00 0.00 ? 407 ASP A CG   1  
ATOM 530   O OD1  . ASP A 1 32  ? 2.938   -18.498 -13.015 1.00 0.00 ? 407 ASP A OD1  1  
ATOM 531   O OD2  . ASP A 1 32  ? 2.296   -20.325 -14.054 1.00 0.00 ? 407 ASP A OD2  1  
ATOM 532   H H    . ASP A 1 32  ? 1.082   -16.904 -17.134 1.00 0.00 ? 407 ASP A H    1  
ATOM 533   H HA   . ASP A 1 32  ? 1.113   -17.028 -14.208 1.00 0.00 ? 407 ASP A HA   1  
ATOM 534   H HB2  . ASP A 1 32  ? 1.830   -18.910 -16.021 1.00 0.00 ? 407 ASP A HB2  1  
ATOM 535   H HB3  . ASP A 1 32  ? 3.388   -18.141 -15.737 1.00 0.00 ? 407 ASP A HB3  1  
ATOM 536   N N    . VAL A 1 33  ? 2.363   -14.655 -15.361 1.00 0.00 ? 408 VAL A N    1  
ATOM 537   C CA   . VAL A 1 33  ? 3.259   -13.509 -15.267 1.00 0.00 ? 408 VAL A CA   1  
ATOM 538   C C    . VAL A 1 33  ? 2.911   -12.641 -14.063 1.00 0.00 ? 408 VAL A C    1  
ATOM 539   O O    . VAL A 1 33  ? 1.912   -12.877 -13.384 1.00 0.00 ? 408 VAL A O    1  
ATOM 540   C CB   . VAL A 1 33  ? 3.207   -12.645 -16.541 1.00 0.00 ? 408 VAL A CB   1  
ATOM 541   C CG1  . VAL A 1 33  ? 3.862   -13.370 -17.706 1.00 0.00 ? 408 VAL A CG1  1  
ATOM 542   C CG2  . VAL A 1 33  ? 1.769   -12.270 -16.875 1.00 0.00 ? 408 VAL A CG2  1  
ATOM 543   H H    . VAL A 1 33  ? 1.463   -14.527 -15.727 1.00 0.00 ? 408 VAL A H    1  
ATOM 544   H HA   . VAL A 1 33  ? 4.267   -13.882 -15.150 1.00 0.00 ? 408 VAL A HA   1  
ATOM 545   H HB   . VAL A 1 33  ? 3.759   -11.735 -16.357 1.00 0.00 ? 408 VAL A HB   1  
ATOM 546   H HG11 . VAL A 1 33  ? 3.822   -14.435 -17.535 1.00 0.00 ? 408 VAL A HG11 1  
ATOM 547   H HG12 . VAL A 1 33  ? 3.337   -13.132 -18.619 1.00 0.00 ? 408 VAL A HG12 1  
ATOM 548   H HG13 . VAL A 1 33  ? 4.892   -13.057 -17.790 1.00 0.00 ? 408 VAL A HG13 1  
ATOM 549   H HG21 . VAL A 1 33  ? 1.436   -12.845 -17.726 1.00 0.00 ? 408 VAL A HG21 1  
ATOM 550   H HG22 . VAL A 1 33  ? 1.134   -12.482 -16.027 1.00 0.00 ? 408 VAL A HG22 1  
ATOM 551   H HG23 . VAL A 1 33  ? 1.717   -11.217 -17.108 1.00 0.00 ? 408 VAL A HG23 1  
ATOM 552   N N    . ILE A 1 34  ? 3.740   -11.636 -13.803 1.00 0.00 ? 409 ILE A N    1  
ATOM 553   C CA   . ILE A 1 34  ? 3.515   -10.735 -12.680 1.00 0.00 ? 409 ILE A CA   1  
ATOM 554   C C    . ILE A 1 34  ? 3.802   -9.284  -13.064 1.00 0.00 ? 409 ILE A C    1  
ATOM 555   O O    . ILE A 1 34  ? 3.965   -8.425  -12.198 1.00 0.00 ? 409 ILE A O    1  
ATOM 556   C CB   . ILE A 1 34  ? 4.383   -11.120 -11.464 1.00 0.00 ? 409 ILE A CB   1  
ATOM 557   C CG1  . ILE A 1 34  ? 5.870   -10.917 -11.773 1.00 0.00 ? 409 ILE A CG1  1  
ATOM 558   C CG2  . ILE A 1 34  ? 4.112   -12.562 -11.059 1.00 0.00 ? 409 ILE A CG2  1  
ATOM 559   C CD1  . ILE A 1 34  ? 6.399   -11.847 -12.843 1.00 0.00 ? 409 ILE A CD1  1  
ATOM 560   H H    . ILE A 1 34  ? 4.518   -11.498 -14.381 1.00 0.00 ? 409 ILE A H    1  
ATOM 561   H HA   . ILE A 1 34  ? 2.478   -10.818 -12.392 1.00 0.00 ? 409 ILE A HA   1  
ATOM 562   H HB   . ILE A 1 34  ? 4.105   -10.484 -10.637 1.00 0.00 ? 409 ILE A HB   1  
ATOM 563   H HG12 . ILE A 1 34  ? 6.026   -9.903  -12.109 1.00 0.00 ? 409 ILE A HG12 1  
ATOM 564   H HG13 . ILE A 1 34  ? 6.444   -11.086 -10.874 1.00 0.00 ? 409 ILE A HG13 1  
ATOM 565   H HG21 . ILE A 1 34  ? 3.048   -12.743 -11.063 1.00 0.00 ? 409 ILE A HG21 1  
ATOM 566   H HG22 . ILE A 1 34  ? 4.594   -13.228 -11.758 1.00 0.00 ? 409 ILE A HG22 1  
ATOM 567   H HG23 . ILE A 1 34  ? 4.502   -12.737 -10.067 1.00 0.00 ? 409 ILE A HG23 1  
ATOM 568   H HD11 . ILE A 1 34  ? 7.351   -12.250 -12.531 1.00 0.00 ? 409 ILE A HD11 1  
ATOM 569   H HD12 . ILE A 1 34  ? 5.699   -12.655 -12.997 1.00 0.00 ? 409 ILE A HD12 1  
ATOM 570   H HD13 . ILE A 1 34  ? 6.525   -11.299 -13.766 1.00 0.00 ? 409 ILE A HD13 1  
ATOM 571   N N    . SER A 1 35  ? 3.860   -9.017  -14.366 1.00 0.00 ? 410 SER A N    1  
ATOM 572   C CA   . SER A 1 35  ? 4.124   -7.670  -14.858 1.00 0.00 ? 410 SER A CA   1  
ATOM 573   C C    . SER A 1 35  ? 2.929   -7.135  -15.639 1.00 0.00 ? 410 SER A C    1  
ATOM 574   O O    . SER A 1 35  ? 2.294   -7.865  -16.402 1.00 0.00 ? 410 SER A O    1  
ATOM 575   C CB   . SER A 1 35  ? 5.371   -7.662  -15.743 1.00 0.00 ? 410 SER A CB   1  
ATOM 576   O OG   . SER A 1 35  ? 5.347   -8.730  -16.672 1.00 0.00 ? 410 SER A OG   1  
ATOM 577   H H    . SER A 1 35  ? 3.720   -9.741  -15.010 1.00 0.00 ? 410 SER A H    1  
ATOM 578   H HA   . SER A 1 35  ? 4.294   -7.033  -14.004 1.00 0.00 ? 410 SER A HA   1  
ATOM 579   H HB2  . SER A 1 35  ? 5.419   -6.730  -16.286 1.00 0.00 ? 410 SER A HB2  1  
ATOM 580   H HB3  . SER A 1 35  ? 6.251   -7.761  -15.122 1.00 0.00 ? 410 SER A HB3  1  
ATOM 581   H HG   . SER A 1 35  ? 4.472   -8.793  -17.065 1.00 0.00 ? 410 SER A HG   1  
ATOM 582   N N    . GLY A 1 36  ? 2.626   -5.857  -15.444 1.00 0.00 ? 411 GLY A N    1  
ATOM 583   C CA   . GLY A 1 36  ? 1.509   -5.244  -16.135 1.00 0.00 ? 411 GLY A CA   1  
ATOM 584   C C    . GLY A 1 36  ? 0.672   -4.374  -15.219 1.00 0.00 ? 411 GLY A C    1  
ATOM 585   O O    . GLY A 1 36  ? 0.816   -4.430  -13.997 1.00 0.00 ? 411 GLY A O    1  
ATOM 586   H H    . GLY A 1 36  ? 3.168   -5.324  -14.825 1.00 0.00 ? 411 GLY A H    1  
ATOM 587   H HA2  . GLY A 1 36  ? 1.887   -4.636  -16.944 1.00 0.00 ? 411 GLY A HA2  1  
ATOM 588   H HA3  . GLY A 1 36  ? 0.883   -6.021  -16.546 1.00 0.00 ? 411 GLY A HA3  1  
ATOM 589   N N    . ALA A 1 37  ? -0.205  -3.568  -15.808 1.00 0.00 ? 412 ALA A N    1  
ATOM 590   C CA   . ALA A 1 37  ? -1.066  -2.684  -15.033 1.00 0.00 ? 412 ALA A CA   1  
ATOM 591   C C    . ALA A 1 37  ? -2.474  -3.255  -14.913 1.00 0.00 ? 412 ALA A C    1  
ATOM 592   O O    . ALA A 1 37  ? -2.994  -3.859  -15.852 1.00 0.00 ? 412 ALA A O    1  
ATOM 593   C CB   . ALA A 1 37  ? -1.108  -1.301  -15.665 1.00 0.00 ? 412 ALA A CB   1  
ATOM 594   H H    . ALA A 1 37  ? -0.275  -3.568  -16.785 1.00 0.00 ? 412 ALA A H    1  
ATOM 595   H HA   . ALA A 1 37  ? -0.643  -2.588  -14.044 1.00 0.00 ? 412 ALA A HA   1  
ATOM 596   H HB1  . ALA A 1 37  ? -0.165  -0.802  -15.500 1.00 0.00 ? 412 ALA A HB1  1  
ATOM 597   H HB2  . ALA A 1 37  ? -1.286  -1.394  -16.726 1.00 0.00 ? 412 ALA A HB2  1  
ATOM 598   H HB3  . ALA A 1 37  ? -1.904  -0.723  -15.215 1.00 0.00 ? 412 ALA A HB3  1  
ATOM 599   N N    . TYR A 1 38  ? -3.087  -3.061  -13.751 1.00 0.00 ? 413 TYR A N    1  
ATOM 600   C CA   . TYR A 1 38  ? -4.436  -3.555  -13.504 1.00 0.00 ? 413 TYR A CA   1  
ATOM 601   C C    . TYR A 1 38  ? -5.451  -2.418  -13.564 1.00 0.00 ? 413 TYR A C    1  
ATOM 602   O O    . TYR A 1 38  ? -5.271  -1.379  -12.929 1.00 0.00 ? 413 TYR A O    1  
ATOM 603   C CB   . TYR A 1 38  ? -4.499  -4.248  -12.138 1.00 0.00 ? 413 TYR A CB   1  
ATOM 604   C CG   . TYR A 1 38  ? -5.900  -4.623  -11.704 1.00 0.00 ? 413 TYR A CG   1  
ATOM 605   C CD1  . TYR A 1 38  ? -6.692  -3.729  -10.993 1.00 0.00 ? 413 TYR A CD1  1  
ATOM 606   C CD2  . TYR A 1 38  ? -6.431  -5.872  -12.004 1.00 0.00 ? 413 TYR A CD2  1  
ATOM 607   C CE1  . TYR A 1 38  ? -7.970  -4.068  -10.595 1.00 0.00 ? 413 TYR A CE1  1  
ATOM 608   C CE2  . TYR A 1 38  ? -7.709  -6.218  -11.610 1.00 0.00 ? 413 TYR A CE2  1  
ATOM 609   C CZ   . TYR A 1 38  ? -8.475  -5.313  -10.906 1.00 0.00 ? 413 TYR A CZ   1  
ATOM 610   O OH   . TYR A 1 38  ? -9.747  -5.654  -10.510 1.00 0.00 ? 413 TYR A OH   1  
ATOM 611   H H    . TYR A 1 38  ? -2.621  -2.572  -13.041 1.00 0.00 ? 413 TYR A H    1  
ATOM 612   H HA   . TYR A 1 38  ? -4.671  -4.275  -14.274 1.00 0.00 ? 413 TYR A HA   1  
ATOM 613   H HB2  . TYR A 1 38  ? -3.912  -5.153  -12.174 1.00 0.00 ? 413 TYR A HB2  1  
ATOM 614   H HB3  . TYR A 1 38  ? -4.086  -3.588  -11.390 1.00 0.00 ? 413 TYR A HB3  1  
ATOM 615   H HD1  . TYR A 1 38  ? -6.295  -2.753  -10.751 1.00 0.00 ? 413 TYR A HD1  1  
ATOM 616   H HD2  . TYR A 1 38  ? -5.828  -6.579  -12.555 1.00 0.00 ? 413 TYR A HD2  1  
ATOM 617   H HE1  . TYR A 1 38  ? -8.570  -3.359  -10.044 1.00 0.00 ? 413 TYR A HE1  1  
ATOM 618   H HE2  . TYR A 1 38  ? -8.103  -7.195  -11.853 1.00 0.00 ? 413 TYR A HE2  1  
ATOM 619   H HH   . TYR A 1 38  ? -10.318 -5.705  -11.281 1.00 0.00 ? 413 TYR A HH   1  
ATOM 620   N N    . ILE A 1 39  ? -6.521  -2.624  -14.325 1.00 0.00 ? 414 ILE A N    1  
ATOM 621   C CA   . ILE A 1 39  ? -7.565  -1.614  -14.456 1.00 0.00 ? 414 ILE A CA   1  
ATOM 622   C C    . ILE A 1 39  ? -8.499  -1.651  -13.252 1.00 0.00 ? 414 ILE A C    1  
ATOM 623   O O    . ILE A 1 39  ? -9.003  -2.710  -12.876 1.00 0.00 ? 414 ILE A O    1  
ATOM 624   C CB   . ILE A 1 39  ? -8.390  -1.810  -15.744 1.00 0.00 ? 414 ILE A CB   1  
ATOM 625   C CG1  . ILE A 1 39  ? -7.469  -2.087  -16.934 1.00 0.00 ? 414 ILE A CG1  1  
ATOM 626   C CG2  . ILE A 1 39  ? -9.249  -0.584  -16.010 1.00 0.00 ? 414 ILE A CG2  1  
ATOM 627   C CD1  . ILE A 1 39  ? -8.208  -2.508  -18.184 1.00 0.00 ? 414 ILE A CD1  1  
ATOM 628   H H    . ILE A 1 39  ? -6.615  -3.475  -14.804 1.00 0.00 ? 414 ILE A H    1  
ATOM 629   H HA   . ILE A 1 39  ? -7.088  -0.645  -14.500 1.00 0.00 ? 414 ILE A HA   1  
ATOM 630   H HB   . ILE A 1 39  ? -9.046  -2.655  -15.600 1.00 0.00 ? 414 ILE A HB   1  
ATOM 631   H HG12 . ILE A 1 39  ? -6.911  -1.191  -17.165 1.00 0.00 ? 414 ILE A HG12 1  
ATOM 632   H HG13 . ILE A 1 39  ? -6.780  -2.877  -16.672 1.00 0.00 ? 414 ILE A HG13 1  
ATOM 633   H HG21 . ILE A 1 39  ? -8.622  0.295   -16.039 1.00 0.00 ? 414 ILE A HG21 1  
ATOM 634   H HG22 . ILE A 1 39  ? -9.755  -0.696  -16.958 1.00 0.00 ? 414 ILE A HG22 1  
ATOM 635   H HG23 . ILE A 1 39  ? -9.980  -0.478  -15.223 1.00 0.00 ? 414 ILE A HG23 1  
ATOM 636   H HD11 . ILE A 1 39  ? -7.552  -3.095  -18.811 1.00 0.00 ? 414 ILE A HD11 1  
ATOM 637   H HD12 . ILE A 1 39  ? -9.070  -3.100  -17.911 1.00 0.00 ? 414 ILE A HD12 1  
ATOM 638   H HD13 . ILE A 1 39  ? -8.531  -1.631  -18.725 1.00 0.00 ? 414 ILE A HD13 1  
ATOM 639   N N    . ILE A 1 40  ? -8.718  -0.491  -12.641 1.00 0.00 ? 415 ILE A N    1  
ATOM 640   C CA   . ILE A 1 40  ? -9.582  -0.397  -11.470 1.00 0.00 ? 415 ILE A CA   1  
ATOM 641   C C    . ILE A 1 40  ? -11.000 0.023   -11.851 1.00 0.00 ? 415 ILE A C    1  
ATOM 642   O O    . ILE A 1 40  ? -11.938 -0.768  -11.742 1.00 0.00 ? 415 ILE A O    1  
ATOM 643   C CB   . ILE A 1 40  ? -9.007  0.594   -10.436 1.00 0.00 ? 415 ILE A CB   1  
ATOM 644   C CG1  . ILE A 1 40  ? -7.604  0.154   -10.016 1.00 0.00 ? 415 ILE A CG1  1  
ATOM 645   C CG2  . ILE A 1 40  ? -9.920  0.699   -9.222  1.00 0.00 ? 415 ILE A CG2  1  
ATOM 646   C CD1  . ILE A 1 40  ? -6.812  1.234   -9.313  1.00 0.00 ? 415 ILE A CD1  1  
ATOM 647   H H    . ILE A 1 40  ? -8.283  0.319   -12.982 1.00 0.00 ? 415 ILE A H    1  
ATOM 648   H HA   . ILE A 1 40  ? -9.623  -1.374  -11.011 1.00 0.00 ? 415 ILE A HA   1  
ATOM 649   H HB   . ILE A 1 40  ? -8.949  1.569   -10.897 1.00 0.00 ? 415 ILE A HB   1  
ATOM 650   H HG12 . ILE A 1 40  ? -7.685  -0.686  -9.343  1.00 0.00 ? 415 ILE A HG12 1  
ATOM 651   H HG13 . ILE A 1 40  ? -7.051  -0.146  -10.894 1.00 0.00 ? 415 ILE A HG13 1  
ATOM 652   H HG21 . ILE A 1 40  ? -10.916 0.968   -9.542  1.00 0.00 ? 415 ILE A HG21 1  
ATOM 653   H HG22 . ILE A 1 40  ? -9.951  -0.252  -8.711  1.00 0.00 ? 415 ILE A HG22 1  
ATOM 654   H HG23 . ILE A 1 40  ? -9.542  1.456   -8.551  1.00 0.00 ? 415 ILE A HG23 1  
ATOM 655   H HD11 . ILE A 1 40  ? -6.494  1.973   -10.034 1.00 0.00 ? 415 ILE A HD11 1  
ATOM 656   H HD12 . ILE A 1 40  ? -7.430  1.704   -8.563  1.00 0.00 ? 415 ILE A HD12 1  
ATOM 657   H HD13 . ILE A 1 40  ? -5.946  0.795   -8.842  1.00 0.00 ? 415 ILE A HD13 1  
ATOM 658   N N    . GLU A 1 41  ? -11.154 1.266   -12.292 1.00 0.00 ? 416 GLU A N    1  
ATOM 659   C CA   . GLU A 1 41  ? -12.464 1.775   -12.682 1.00 0.00 ? 416 GLU A CA   1  
ATOM 660   C C    . GLU A 1 41  ? -12.346 2.761   -13.838 1.00 0.00 ? 416 GLU A C    1  
ATOM 661   O O    . GLU A 1 41  ? -11.315 3.412   -14.011 1.00 0.00 ? 416 GLU A O    1  
ATOM 662   C CB   . GLU A 1 41  ? -13.150 2.443   -11.489 1.00 0.00 ? 416 GLU A CB   1  
ATOM 663   C CG   . GLU A 1 41  ? -12.462 3.716   -11.022 1.00 0.00 ? 416 GLU A CG   1  
ATOM 664   C CD   . GLU A 1 41  ? -13.347 4.941   -11.157 1.00 0.00 ? 416 GLU A CD   1  
ATOM 665   O OE1  . GLU A 1 41  ? -14.090 5.027   -12.157 1.00 0.00 ? 416 GLU A OE1  1  
ATOM 666   O OE2  . GLU A 1 41  ? -13.297 5.810   -10.263 1.00 0.00 ? 416 GLU A OE2  1  
ATOM 667   H H    . GLU A 1 41  ? -10.372 1.853   -12.356 1.00 0.00 ? 416 GLU A H    1  
ATOM 668   H HA   . GLU A 1 41  ? -13.061 0.935   -13.004 1.00 0.00 ? 416 GLU A HA   1  
ATOM 669   H HB2  . GLU A 1 41  ? -14.166 2.689   -11.766 1.00 0.00 ? 416 GLU A HB2  1  
ATOM 670   H HB3  . GLU A 1 41  ? -13.171 1.747   -10.664 1.00 0.00 ? 416 GLU A HB3  1  
ATOM 671   H HG2  . GLU A 1 41  ? -12.189 3.601   -9.983  1.00 0.00 ? 416 GLU A HG2  1  
ATOM 672   H HG3  . GLU A 1 41  ? -11.571 3.865   -11.614 1.00 0.00 ? 416 GLU A HG3  1  
ATOM 673   N N    . VAL A 1 42  ? -13.410 2.866   -14.627 1.00 0.00 ? 417 VAL A N    1  
ATOM 674   C CA   . VAL A 1 42  ? -13.429 3.772   -15.768 1.00 0.00 ? 417 VAL A CA   1  
ATOM 675   C C    . VAL A 1 42  ? -14.619 4.722   -15.697 1.00 0.00 ? 417 VAL A C    1  
ATOM 676   O O    . VAL A 1 42  ? -15.738 4.311   -15.394 1.00 0.00 ? 417 VAL A O    1  
ATOM 677   C CB   . VAL A 1 42  ? -13.490 2.998   -17.099 1.00 0.00 ? 417 VAL A CB   1  
ATOM 678   C CG1  . VAL A 1 42  ? -13.287 3.939   -18.278 1.00 0.00 ? 417 VAL A CG1  1  
ATOM 679   C CG2  . VAL A 1 42  ? -12.460 1.878   -17.114 1.00 0.00 ? 417 VAL A CG2  1  
ATOM 680   H H    . VAL A 1 42  ? -14.201 2.320   -14.437 1.00 0.00 ? 417 VAL A H    1  
ATOM 681   H HA   . VAL A 1 42  ? -12.517 4.349   -15.753 1.00 0.00 ? 417 VAL A HA   1  
ATOM 682   H HB   . VAL A 1 42  ? -14.471 2.554   -17.189 1.00 0.00 ? 417 VAL A HB   1  
ATOM 683   H HG11 . VAL A 1 42  ? -13.261 4.960   -17.925 1.00 0.00 ? 417 VAL A HG11 1  
ATOM 684   H HG12 . VAL A 1 42  ? -12.355 3.706   -18.770 1.00 0.00 ? 417 VAL A HG12 1  
ATOM 685   H HG13 . VAL A 1 42  ? -14.103 3.822   -18.976 1.00 0.00 ? 417 VAL A HG13 1  
ATOM 686   H HG21 . VAL A 1 42  ? -11.467 2.302   -17.067 1.00 0.00 ? 417 VAL A HG21 1  
ATOM 687   H HG22 . VAL A 1 42  ? -12.616 1.232   -16.262 1.00 0.00 ? 417 VAL A HG22 1  
ATOM 688   H HG23 . VAL A 1 42  ? -12.563 1.306   -18.024 1.00 0.00 ? 417 VAL A HG23 1  
ATOM 689   N N    . ILE A 1 43  ? -14.370 5.997   -15.982 1.00 0.00 ? 418 ILE A N    1  
ATOM 690   C CA   . ILE A 1 43  ? -15.421 7.003   -15.954 1.00 0.00 ? 418 ILE A CA   1  
ATOM 691   C C    . ILE A 1 43  ? -16.251 6.942   -17.243 1.00 0.00 ? 418 ILE A C    1  
ATOM 692   O O    . ILE A 1 43  ? -15.702 6.823   -18.338 1.00 0.00 ? 418 ILE A O    1  
ATOM 693   C CB   . ILE A 1 43  ? -14.828 8.420   -15.753 1.00 0.00 ? 418 ILE A CB   1  
ATOM 694   C CG1  . ILE A 1 43  ? -14.397 8.610   -14.295 1.00 0.00 ? 418 ILE A CG1  1  
ATOM 695   C CG2  . ILE A 1 43  ? -15.821 9.504   -16.155 1.00 0.00 ? 418 ILE A CG2  1  
ATOM 696   C CD1  . ILE A 1 43  ? -13.453 7.539   -13.794 1.00 0.00 ? 418 ILE A CD1  1  
ATOM 697   H H    . ILE A 1 43  ? -13.457 6.264   -16.219 1.00 0.00 ? 418 ILE A H    1  
ATOM 698   H HA   . ILE A 1 43  ? -16.062 6.783   -15.114 1.00 0.00 ? 418 ILE A HA   1  
ATOM 699   H HB   . ILE A 1 43  ? -13.960 8.512   -16.384 1.00 0.00 ? 418 ILE A HB   1  
ATOM 700   H HG12 . ILE A 1 43  ? -13.897 9.562   -14.196 1.00 0.00 ? 418 ILE A HG12 1  
ATOM 701   H HG13 . ILE A 1 43  ? -15.274 8.603   -13.665 1.00 0.00 ? 418 ILE A HG13 1  
ATOM 702   H HG21 . ILE A 1 43  ? -16.819 9.096   -16.156 1.00 0.00 ? 418 ILE A HG21 1  
ATOM 703   H HG22 . ILE A 1 43  ? -15.767 10.322  -15.451 1.00 0.00 ? 418 ILE A HG22 1  
ATOM 704   H HG23 . ILE A 1 43  ? -15.579 9.864   -17.144 1.00 0.00 ? 418 ILE A HG23 1  
ATOM 705   H HD11 . ILE A 1 43  ? -13.972 6.592   -13.755 1.00 0.00 ? 418 ILE A HD11 1  
ATOM 706   H HD12 . ILE A 1 43  ? -12.610 7.459   -14.464 1.00 0.00 ? 418 ILE A HD12 1  
ATOM 707   H HD13 . ILE A 1 43  ? -13.106 7.799   -12.805 1.00 0.00 ? 418 ILE A HD13 1  
ATOM 708   N N    . PRO A 1 44  ? -17.592 6.990   -17.122 1.00 0.00 ? 419 PRO A N    1  
ATOM 709   C CA   . PRO A 1 44  ? -18.510 6.908   -18.271 1.00 0.00 ? 419 PRO A CA   1  
ATOM 710   C C    . PRO A 1 44  ? -18.238 7.928   -19.381 1.00 0.00 ? 419 PRO A C    1  
ATOM 711   O O    . PRO A 1 44  ? -18.812 7.827   -20.465 1.00 0.00 ? 419 PRO A O    1  
ATOM 712   C CB   . PRO A 1 44  ? -19.882 7.176   -17.646 1.00 0.00 ? 419 PRO A CB   1  
ATOM 713   C CG   . PRO A 1 44  ? -19.740 6.762   -16.226 1.00 0.00 ? 419 PRO A CG   1  
ATOM 714   C CD   . PRO A 1 44  ? -18.326 7.092   -15.842 1.00 0.00 ? 419 PRO A CD   1  
ATOM 715   H HA   . PRO A 1 44  ? -18.507 5.916   -18.700 1.00 0.00 ? 419 PRO A HA   1  
ATOM 716   H HB2  . PRO A 1 44  ? -20.119 8.228   -17.730 1.00 0.00 ? 419 PRO A HB2  1  
ATOM 717   H HB3  . PRO A 1 44  ? -20.632 6.591   -18.155 1.00 0.00 ? 419 PRO A HB3  1  
ATOM 718   H HG2  . PRO A 1 44  ? -20.434 7.313   -15.609 1.00 0.00 ? 419 PRO A HG2  1  
ATOM 719   H HG3  . PRO A 1 44  ? -19.914 5.700   -16.133 1.00 0.00 ? 419 PRO A HG3  1  
ATOM 720   H HD2  . PRO A 1 44  ? -18.269 8.093   -15.442 1.00 0.00 ? 419 PRO A HD2  1  
ATOM 721   H HD3  . PRO A 1 44  ? -17.952 6.376   -15.126 1.00 0.00 ? 419 PRO A HD3  1  
ATOM 722   N N    . ASP A 1 45  ? -17.383 8.913   -19.121 1.00 0.00 ? 420 ASP A N    1  
ATOM 723   C CA   . ASP A 1 45  ? -17.085 9.932   -20.125 1.00 0.00 ? 420 ASP A CA   1  
ATOM 724   C C    . ASP A 1 45  ? -15.583 10.143  -20.294 1.00 0.00 ? 420 ASP A C    1  
ATOM 725   O O    . ASP A 1 45  ? -15.028 11.131  -19.816 1.00 0.00 ? 420 ASP A O    1  
ATOM 726   C CB   . ASP A 1 45  ? -17.756 11.254  -19.750 1.00 0.00 ? 420 ASP A CB   1  
ATOM 727   C CG   . ASP A 1 45  ? -19.186 11.338  -20.250 1.00 0.00 ? 420 ASP A CG   1  
ATOM 728   O OD1  . ASP A 1 45  ? -19.470 10.779  -21.330 1.00 0.00 ? 420 ASP A OD1  1  
ATOM 729   O OD2  . ASP A 1 45  ? -20.019 11.962  -19.561 1.00 0.00 ? 420 ASP A OD2  1  
ATOM 730   H H    . ASP A 1 45  ? -16.956 8.963   -18.244 1.00 0.00 ? 420 ASP A H    1  
ATOM 731   H HA   . ASP A 1 45  ? -17.491 9.593   -21.066 1.00 0.00 ? 420 ASP A HA   1  
ATOM 732   H HB2  . ASP A 1 45  ? -17.764 11.356  -18.676 1.00 0.00 ? 420 ASP A HB2  1  
ATOM 733   H HB3  . ASP A 1 45  ? -17.195 12.071  -20.182 1.00 0.00 ? 420 ASP A HB3  1  
ATOM 734   N N    . THR A 1 46  ? -14.933 9.213   -20.989 1.00 0.00 ? 421 THR A N    1  
ATOM 735   C CA   . THR A 1 46  ? -13.495 9.304   -21.237 1.00 0.00 ? 421 THR A CA   1  
ATOM 736   C C    . THR A 1 46  ? -13.098 8.428   -22.421 1.00 0.00 ? 421 THR A C    1  
ATOM 737   O O    . THR A 1 46  ? -13.849 7.544   -22.830 1.00 0.00 ? 421 THR A O    1  
ATOM 738   C CB   . THR A 1 46  ? -12.683 8.891   -19.999 1.00 0.00 ? 421 THR A CB   1  
ATOM 739   O OG1  . THR A 1 46  ? -12.260 7.541   -20.095 1.00 0.00 ? 421 THR A OG1  1  
ATOM 740   C CG2  . THR A 1 46  ? -13.432 9.034   -18.694 1.00 0.00 ? 421 THR A CG2  1  
ATOM 741   H H    . THR A 1 46  ? -15.433 8.453   -21.353 1.00 0.00 ? 421 THR A H    1  
ATOM 742   H HA   . THR A 1 46  ? -13.268 10.332  -21.477 1.00 0.00 ? 421 THR A HA   1  
ATOM 743   H HB   . THR A 1 46  ? -11.803 9.516   -19.941 1.00 0.00 ? 421 THR A HB   1  
ATOM 744   H HG1  . THR A 1 46  ? -11.704 7.326   -19.343 1.00 0.00 ? 421 THR A HG1  1  
ATOM 745   H HG21 . THR A 1 46  ? -14.405 8.574   -18.786 1.00 0.00 ? 421 THR A HG21 1  
ATOM 746   H HG22 . THR A 1 46  ? -12.876 8.547   -17.908 1.00 0.00 ? 421 THR A HG22 1  
ATOM 747   H HG23 . THR A 1 46  ? -13.549 10.081  -18.458 1.00 0.00 ? 421 THR A HG23 1  
ATOM 748   N N    . PRO A 1 47  ? -11.899 8.656   -22.983 1.00 0.00 ? 422 PRO A N    1  
ATOM 749   C CA   . PRO A 1 47  ? -11.403 7.875   -24.117 1.00 0.00 ? 422 PRO A CA   1  
ATOM 750   C C    . PRO A 1 47  ? -11.302 6.392   -23.776 1.00 0.00 ? 422 PRO A C    1  
ATOM 751   O O    . PRO A 1 47  ? -11.358 5.535   -24.657 1.00 0.00 ? 422 PRO A O    1  
ATOM 752   C CB   . PRO A 1 47  ? -10.010 8.459   -24.387 1.00 0.00 ? 422 PRO A CB   1  
ATOM 753   C CG   . PRO A 1 47  ? -10.020 9.802   -23.739 1.00 0.00 ? 422 PRO A CG   1  
ATOM 754   C CD   . PRO A 1 47  ? -10.933 9.682   -22.554 1.00 0.00 ? 422 PRO A CD   1  
ATOM 755   H HA   . PRO A 1 47  ? -12.028 8.001   -24.989 1.00 0.00 ? 422 PRO A HA   1  
ATOM 756   H HB2  . PRO A 1 47  ? -9.258  7.817   -23.952 1.00 0.00 ? 422 PRO A HB2  1  
ATOM 757   H HB3  . PRO A 1 47  ? -9.852  8.537   -25.452 1.00 0.00 ? 422 PRO A HB3  1  
ATOM 758   H HG2  . PRO A 1 47  ? -9.023  10.063  -23.419 1.00 0.00 ? 422 PRO A HG2  1  
ATOM 759   H HG3  . PRO A 1 47  ? -10.399 10.540  -24.431 1.00 0.00 ? 422 PRO A HG3  1  
ATOM 760   H HD2  . PRO A 1 47  ? -10.383 9.356   -21.684 1.00 0.00 ? 422 PRO A HD2  1  
ATOM 761   H HD3  . PRO A 1 47  ? -11.429 10.621  -22.360 1.00 0.00 ? 422 PRO A HD3  1  
ATOM 762   N N    . ALA A 1 48  ? -11.152 6.098   -22.487 1.00 0.00 ? 423 ALA A N    1  
ATOM 763   C CA   . ALA A 1 48  ? -11.046 4.720   -22.021 1.00 0.00 ? 423 ALA A CA   1  
ATOM 764   C C    . ALA A 1 48  ? -12.283 3.913   -22.402 1.00 0.00 ? 423 ALA A C    1  
ATOM 765   O O    . ALA A 1 48  ? -12.180 2.861   -23.034 1.00 0.00 ? 423 ALA A O    1  
ATOM 766   C CB   . ALA A 1 48  ? -10.836 4.690   -20.514 1.00 0.00 ? 423 ALA A CB   1  
ATOM 767   H H    . ALA A 1 48  ? -11.114 6.825   -21.831 1.00 0.00 ? 423 ALA A H    1  
ATOM 768   H HA   . ALA A 1 48  ? -10.180 4.278   -22.490 1.00 0.00 ? 423 ALA A HA   1  
ATOM 769   H HB1  . ALA A 1 48  ? -9.923  5.212   -20.267 1.00 0.00 ? 423 ALA A HB1  1  
ATOM 770   H HB2  . ALA A 1 48  ? -11.670 5.174   -20.025 1.00 0.00 ? 423 ALA A HB2  1  
ATOM 771   H HB3  . ALA A 1 48  ? -10.767 3.666   -20.180 1.00 0.00 ? 423 ALA A HB3  1  
ATOM 772   N N    . GLU A 1 49  ? -13.454 4.411   -22.012 1.00 0.00 ? 424 GLU A N    1  
ATOM 773   C CA   . GLU A 1 49  ? -14.707 3.732   -22.317 1.00 0.00 ? 424 GLU A CA   1  
ATOM 774   C C    . GLU A 1 49  ? -15.047 3.853   -23.798 1.00 0.00 ? 424 GLU A C    1  
ATOM 775   O O    . GLU A 1 49  ? -15.670 2.964   -24.377 1.00 0.00 ? 424 GLU A O    1  
ATOM 776   C CB   . GLU A 1 49  ? -15.845 4.309   -21.471 1.00 0.00 ? 424 GLU A CB   1  
ATOM 777   C CG   . GLU A 1 49  ? -16.966 3.317   -21.207 1.00 0.00 ? 424 GLU A CG   1  
ATOM 778   C CD   . GLU A 1 49  ? -18.342 3.941   -21.348 1.00 0.00 ? 424 GLU A CD   1  
ATOM 779   O OE1  . GLU A 1 49  ? -18.489 4.876   -22.161 1.00 0.00 ? 424 GLU A OE1  1  
ATOM 780   O OE2  . GLU A 1 49  ? -19.270 3.492   -20.643 1.00 0.00 ? 424 GLU A OE2  1  
ATOM 781   H H    . GLU A 1 49  ? -13.476 5.254   -21.510 1.00 0.00 ? 424 GLU A H    1  
ATOM 782   H HA   . GLU A 1 49  ? -14.585 2.687   -22.072 1.00 0.00 ? 424 GLU A HA   1  
ATOM 783   H HB2  . GLU A 1 49  ? -15.445 4.630   -20.521 1.00 0.00 ? 424 GLU A HB2  1  
ATOM 784   H HB3  . GLU A 1 49  ? -16.262 5.163   -21.983 1.00 0.00 ? 424 GLU A HB3  1  
ATOM 785   H HG2  . GLU A 1 49  ? -16.884 2.504   -21.912 1.00 0.00 ? 424 GLU A HG2  1  
ATOM 786   H HG3  . GLU A 1 49  ? -16.861 2.934   -20.203 1.00 0.00 ? 424 GLU A HG3  1  
ATOM 787   N N    . ALA A 1 50  ? -14.634 4.961   -24.407 1.00 0.00 ? 425 ALA A N    1  
ATOM 788   C CA   . ALA A 1 50  ? -14.895 5.197   -25.821 1.00 0.00 ? 425 ALA A CA   1  
ATOM 789   C C    . ALA A 1 50  ? -13.977 4.355   -26.701 1.00 0.00 ? 425 ALA A C    1  
ATOM 790   O O    . ALA A 1 50  ? -14.348 3.963   -27.807 1.00 0.00 ? 425 ALA A O    1  
ATOM 791   C CB   . ALA A 1 50  ? -14.731 6.674   -26.148 1.00 0.00 ? 425 ALA A CB   1  
ATOM 792   H H    . ALA A 1 50  ? -14.142 5.634   -23.892 1.00 0.00 ? 425 ALA A H    1  
ATOM 793   H HA   . ALA A 1 50  ? -15.920 4.921   -26.022 1.00 0.00 ? 425 ALA A HA   1  
ATOM 794   H HB1  . ALA A 1 50  ? -15.479 7.245   -25.618 1.00 0.00 ? 425 ALA A HB1  1  
ATOM 795   H HB2  . ALA A 1 50  ? -13.748 7.002   -25.846 1.00 0.00 ? 425 ALA A HB2  1  
ATOM 796   H HB3  . ALA A 1 50  ? -14.849 6.823   -27.211 1.00 0.00 ? 425 ALA A HB3  1  
ATOM 797   N N    . GLY A 1 51  ? -12.777 4.078   -26.202 1.00 0.00 ? 426 GLY A N    1  
ATOM 798   C CA   . GLY A 1 51  ? -11.825 3.283   -26.955 1.00 0.00 ? 426 GLY A CA   1  
ATOM 799   C C    . GLY A 1 51  ? -12.257 1.836   -27.084 1.00 0.00 ? 426 GLY A C    1  
ATOM 800   O O    . GLY A 1 51  ? -12.067 1.215   -28.129 1.00 0.00 ? 426 GLY A O    1  
ATOM 801   H H    . GLY A 1 51  ? -12.535 4.417   -25.314 1.00 0.00 ? 426 GLY A H    1  
ATOM 802   H HA2  . GLY A 1 51  ? -11.722 3.707   -27.944 1.00 0.00 ? 426 GLY A HA2  1  
ATOM 803   H HA3  . GLY A 1 51  ? -10.868 3.319   -26.458 1.00 0.00 ? 426 GLY A HA3  1  
ATOM 804   N N    . GLY A 1 52  ? -12.842 1.300   -26.018 1.00 0.00 ? 427 GLY A N    1  
ATOM 805   C CA   . GLY A 1 52  ? -13.296 -0.077  -26.036 1.00 0.00 ? 427 GLY A CA   1  
ATOM 806   C C    . GLY A 1 52  ? -12.642 -0.926  -24.963 1.00 0.00 ? 427 GLY A C    1  
ATOM 807   O O    . GLY A 1 52  ? -12.472 -2.132  -25.139 1.00 0.00 ? 427 GLY A O    1  
ATOM 808   H H    . GLY A 1 52  ? -12.969 1.846   -25.214 1.00 0.00 ? 427 GLY A H    1  
ATOM 809   H HA2  . GLY A 1 52  ? -14.366 -0.092  -25.887 1.00 0.00 ? 427 GLY A HA2  1  
ATOM 810   H HA3  . GLY A 1 52  ? -13.074 -0.505  -27.002 1.00 0.00 ? 427 GLY A HA3  1  
ATOM 811   N N    . LEU A 1 53  ? -12.275 -0.300  -23.848 1.00 0.00 ? 428 LEU A N    1  
ATOM 812   C CA   . LEU A 1 53  ? -11.640 -1.017  -22.749 1.00 0.00 ? 428 LEU A CA   1  
ATOM 813   C C    . LEU A 1 53  ? -12.667 -1.395  -21.688 1.00 0.00 ? 428 LEU A C    1  
ATOM 814   O O    . LEU A 1 53  ? -13.872 -1.356  -21.936 1.00 0.00 ? 428 LEU A O    1  
ATOM 815   C CB   . LEU A 1 53  ? -10.533 -0.168  -22.116 1.00 0.00 ? 428 LEU A CB   1  
ATOM 816   C CG   . LEU A 1 53  ? -9.881  0.870   -23.031 1.00 0.00 ? 428 LEU A CG   1  
ATOM 817   C CD1  . LEU A 1 53  ? -9.274  1.989   -22.203 1.00 0.00 ? 428 LEU A CD1  1  
ATOM 818   C CD2  . LEU A 1 53  ? -8.823  0.218   -23.909 1.00 0.00 ? 428 LEU A CD2  1  
ATOM 819   H H    . LEU A 1 53  ? -12.436 0.662   -23.760 1.00 0.00 ? 428 LEU A H    1  
ATOM 820   H HA   . LEU A 1 53  ? -11.204 -1.920  -23.150 1.00 0.00 ? 428 LEU A HA   1  
ATOM 821   H HB2  . LEU A 1 53  ? -10.951 0.350   -21.265 1.00 0.00 ? 428 LEU A HB2  1  
ATOM 822   H HB3  . LEU A 1 53  ? -9.763  -0.834  -21.764 1.00 0.00 ? 428 LEU A HB3  1  
ATOM 823   H HG   . LEU A 1 53  ? -10.633 1.303   -23.674 1.00 0.00 ? 428 LEU A HG   1  
ATOM 824   H HD11 . LEU A 1 53  ? -8.524  1.580   -21.541 1.00 0.00 ? 428 LEU A HD11 1  
ATOM 825   H HD12 . LEU A 1 53  ? -8.820  2.717   -22.858 1.00 0.00 ? 428 LEU A HD12 1  
ATOM 826   H HD13 . LEU A 1 53  ? -10.049 2.464   -21.618 1.00 0.00 ? 428 LEU A HD13 1  
ATOM 827   H HD21 . LEU A 1 53  ? -7.881  0.197   -23.382 1.00 0.00 ? 428 LEU A HD21 1  
ATOM 828   H HD22 . LEU A 1 53  ? -9.126  -0.791  -24.148 1.00 0.00 ? 428 LEU A HD22 1  
ATOM 829   H HD23 . LEU A 1 53  ? -8.713  0.786   -24.821 1.00 0.00 ? 428 LEU A HD23 1  
ATOM 830   N N    . LYS A 1 54  ? -12.185 -1.757  -20.503 1.00 0.00 ? 429 LYS A N    1  
ATOM 831   C CA   . LYS A 1 54  ? -13.064 -2.136  -19.406 1.00 0.00 ? 429 LYS A CA   1  
ATOM 832   C C    . LYS A 1 54  ? -12.311 -2.128  -18.079 1.00 0.00 ? 429 LYS A C    1  
ATOM 833   O O    . LYS A 1 54  ? -11.080 -2.122  -18.055 1.00 0.00 ? 429 LYS A O    1  
ATOM 834   C CB   . LYS A 1 54  ? -13.665 -3.521  -19.661 1.00 0.00 ? 429 LYS A CB   1  
ATOM 835   C CG   . LYS A 1 54  ? -15.167 -3.586  -19.428 1.00 0.00 ? 429 LYS A CG   1  
ATOM 836   C CD   . LYS A 1 54  ? -15.903 -4.098  -20.658 1.00 0.00 ? 429 LYS A CD   1  
ATOM 837   C CE   . LYS A 1 54  ? -15.437 -5.491  -21.051 1.00 0.00 ? 429 LYS A CE   1  
ATOM 838   N NZ   . LYS A 1 54  ? -16.538 -6.489  -20.965 1.00 0.00 ? 429 LYS A NZ   1  
ATOM 839   H H    . LYS A 1 54  ? -11.215 -1.766  -20.363 1.00 0.00 ? 429 LYS A H    1  
ATOM 840   H HA   . LYS A 1 54  ? -13.860 -1.409  -19.357 1.00 0.00 ? 429 LYS A HA   1  
ATOM 841   H HB2  . LYS A 1 54  ? -13.467 -3.802  -20.685 1.00 0.00 ? 429 LYS A HB2  1  
ATOM 842   H HB3  . LYS A 1 54  ? -13.189 -4.235  -19.004 1.00 0.00 ? 429 LYS A HB3  1  
ATOM 843   H HG2  . LYS A 1 54  ? -15.364 -4.252  -18.602 1.00 0.00 ? 429 LYS A HG2  1  
ATOM 844   H HG3  . LYS A 1 54  ? -15.527 -2.597  -19.190 1.00 0.00 ? 429 LYS A HG3  1  
ATOM 845   H HD2  . LYS A 1 54  ? -16.960 -4.131  -20.444 1.00 0.00 ? 429 LYS A HD2  1  
ATOM 846   H HD3  . LYS A 1 54  ? -15.721 -3.421  -21.480 1.00 0.00 ? 429 LYS A HD3  1  
ATOM 847   H HE2  . LYS A 1 54  ? -15.070 -5.460  -22.066 1.00 0.00 ? 429 LYS A HE2  1  
ATOM 848   H HE3  . LYS A 1 54  ? -14.637 -5.792  -20.390 1.00 0.00 ? 429 LYS A HE3  1  
ATOM 849   H HZ1  . LYS A 1 54  ? -16.807 -6.640  -19.972 1.00 0.00 ? 429 LYS A HZ1  1  
ATOM 850   H HZ2  . LYS A 1 54  ? -17.370 -6.150  -21.489 1.00 0.00 ? 429 LYS A HZ2  1  
ATOM 851   H HZ3  . LYS A 1 54  ? -16.232 -7.396  -21.372 1.00 0.00 ? 429 LYS A HZ3  1  
ATOM 852   N N    . GLU A 1 55  ? -13.055 -2.125  -16.979 1.00 0.00 ? 430 GLU A N    1  
ATOM 853   C CA   . GLU A 1 55  ? -12.454 -2.117  -15.651 1.00 0.00 ? 430 GLU A CA   1  
ATOM 854   C C    . GLU A 1 55  ? -12.326 -3.534  -15.101 1.00 0.00 ? 430 GLU A C    1  
ATOM 855   O O    . GLU A 1 55  ? -12.584 -3.781  -13.921 1.00 0.00 ? 430 GLU A O    1  
ATOM 856   C CB   . GLU A 1 55  ? -13.283 -1.253  -14.695 1.00 0.00 ? 430 GLU A CB   1  
ATOM 857   C CG   . GLU A 1 55  ? -14.659 -1.825  -14.390 1.00 0.00 ? 430 GLU A CG   1  
ATOM 858   C CD   . GLU A 1 55  ? -15.715 -1.364  -15.375 1.00 0.00 ? 430 GLU A CD   1  
ATOM 859   O OE1  . GLU A 1 55  ? -15.909 -0.136  -15.508 1.00 0.00 ? 430 GLU A OE1  1  
ATOM 860   O OE2  . GLU A 1 55  ? -16.350 -2.229  -16.013 1.00 0.00 ? 430 GLU A OE2  1  
ATOM 861   H H    . GLU A 1 55  ? -14.032 -2.128  -17.061 1.00 0.00 ? 430 GLU A H    1  
ATOM 862   H HA   . GLU A 1 55  ? -11.466 -1.690  -15.739 1.00 0.00 ? 430 GLU A HA   1  
ATOM 863   H HB2  . GLU A 1 55  ? -12.746 -1.151  -13.765 1.00 0.00 ? 430 GLU A HB2  1  
ATOM 864   H HB3  . GLU A 1 55  ? -13.413 -0.275  -15.134 1.00 0.00 ? 430 GLU A HB3  1  
ATOM 865   H HG2  . GLU A 1 55  ? -14.605 -2.902  -14.424 1.00 0.00 ? 430 GLU A HG2  1  
ATOM 866   H HG3  . GLU A 1 55  ? -14.951 -1.512  -13.398 1.00 0.00 ? 430 GLU A HG3  1  
ATOM 867   N N    . ASN A 1 56  ? -11.926 -4.463  -15.961 1.00 0.00 ? 431 ASN A N    1  
ATOM 868   C CA   . ASN A 1 56  ? -11.762 -5.856  -15.564 1.00 0.00 ? 431 ASN A CA   1  
ATOM 869   C C    . ASN A 1 56  ? -10.704 -6.543  -16.420 1.00 0.00 ? 431 ASN A C    1  
ATOM 870   O O    . ASN A 1 56  ? -10.757 -7.754  -16.637 1.00 0.00 ? 431 ASN A O    1  
ATOM 871   C CB   . ASN A 1 56  ? -13.093 -6.600  -15.679 1.00 0.00 ? 431 ASN A CB   1  
ATOM 872   C CG   . ASN A 1 56  ? -13.300 -7.593  -14.552 1.00 0.00 ? 431 ASN A CG   1  
ATOM 873   O OD1  . ASN A 1 56  ? -13.560 -8.772  -14.788 1.00 0.00 ? 431 ASN A OD1  1  
ATOM 874   N ND2  . ASN A 1 56  ? -13.185 -7.119  -13.317 1.00 0.00 ? 431 ASN A ND2  1  
ATOM 875   H H    . ASN A 1 56  ? -11.734 -4.206  -16.887 1.00 0.00 ? 431 ASN A H    1  
ATOM 876   H HA   . ASN A 1 56  ? -11.439 -5.871  -14.533 1.00 0.00 ? 431 ASN A HA   1  
ATOM 877   H HB2  . ASN A 1 56  ? -13.902 -5.885  -15.655 1.00 0.00 ? 431 ASN A HB2  1  
ATOM 878   H HB3  . ASN A 1 56  ? -13.119 -7.136  -16.616 1.00 0.00 ? 431 ASN A HB3  1  
ATOM 879   H HD21 . ASN A 1 56  ? -12.976 -6.168  -13.204 1.00 0.00 ? 431 ASN A HD21 1  
ATOM 880   H HD22 . ASN A 1 56  ? -13.312 -7.739  -12.569 1.00 0.00 ? 431 ASN A HD22 1  
ATOM 881   N N    . ASP A 1 57  ? -9.743  -5.762  -16.906 1.00 0.00 ? 432 ASP A N    1  
ATOM 882   C CA   . ASP A 1 57  ? -8.673  -6.296  -17.741 1.00 0.00 ? 432 ASP A CA   1  
ATOM 883   C C    . ASP A 1 57  ? -7.306  -5.914  -17.183 1.00 0.00 ? 432 ASP A C    1  
ATOM 884   O O    . ASP A 1 57  ? -7.208  -5.287  -16.126 1.00 0.00 ? 432 ASP A O    1  
ATOM 885   C CB   . ASP A 1 57  ? -8.813  -5.785  -19.175 1.00 0.00 ? 432 ASP A CB   1  
ATOM 886   C CG   . ASP A 1 57  ? -10.066 -6.305  -19.852 1.00 0.00 ? 432 ASP A CG   1  
ATOM 887   O OD1  . ASP A 1 57  ? -11.137 -6.291  -19.211 1.00 0.00 ? 432 ASP A OD1  1  
ATOM 888   O OD2  . ASP A 1 57  ? -9.975  -6.727  -21.025 1.00 0.00 ? 432 ASP A OD2  1  
ATOM 889   H H    . ASP A 1 57  ? -9.755  -4.806  -16.699 1.00 0.00 ? 432 ASP A H    1  
ATOM 890   H HA   . ASP A 1 57  ? -8.759  -7.372  -17.741 1.00 0.00 ? 432 ASP A HA   1  
ATOM 891   H HB2  . ASP A 1 57  ? -8.854  -4.707  -19.164 1.00 0.00 ? 432 ASP A HB2  1  
ATOM 892   H HB3  . ASP A 1 57  ? -7.957  -6.102  -19.749 1.00 0.00 ? 432 ASP A HB3  1  
ATOM 893   N N    . VAL A 1 58  ? -6.253  -6.296  -17.898 1.00 0.00 ? 433 VAL A N    1  
ATOM 894   C CA   . VAL A 1 58  ? -4.892  -5.995  -17.471 1.00 0.00 ? 433 VAL A CA   1  
ATOM 895   C C    . VAL A 1 58  ? -4.036  -5.520  -18.641 1.00 0.00 ? 433 VAL A C    1  
ATOM 896   O O    . VAL A 1 58  ? -3.895  -6.219  -19.644 1.00 0.00 ? 433 VAL A O    1  
ATOM 897   C CB   . VAL A 1 58  ? -4.223  -7.225  -16.829 1.00 0.00 ? 433 VAL A CB   1  
ATOM 898   C CG1  . VAL A 1 58  ? -2.864  -6.857  -16.252 1.00 0.00 ? 433 VAL A CG1  1  
ATOM 899   C CG2  . VAL A 1 58  ? -5.123  -7.823  -15.758 1.00 0.00 ? 433 VAL A CG2  1  
ATOM 900   H H    . VAL A 1 58  ? -6.395  -6.794  -18.731 1.00 0.00 ? 433 VAL A H    1  
ATOM 901   H HA   . VAL A 1 58  ? -4.940  -5.210  -16.730 1.00 0.00 ? 433 VAL A HA   1  
ATOM 902   H HB   . VAL A 1 58  ? -4.072  -7.969  -17.598 1.00 0.00 ? 433 VAL A HB   1  
ATOM 903   H HG11 . VAL A 1 58  ? -2.985  -6.076  -15.516 1.00 0.00 ? 433 VAL A HG11 1  
ATOM 904   H HG12 . VAL A 1 58  ? -2.424  -7.727  -15.786 1.00 0.00 ? 433 VAL A HG12 1  
ATOM 905   H HG13 . VAL A 1 58  ? -2.219  -6.509  -17.045 1.00 0.00 ? 433 VAL A HG13 1  
ATOM 906   H HG21 . VAL A 1 58  ? -4.516  -8.285  -14.993 1.00 0.00 ? 433 VAL A HG21 1  
ATOM 907   H HG22 . VAL A 1 58  ? -5.725  -7.042  -15.317 1.00 0.00 ? 433 VAL A HG22 1  
ATOM 908   H HG23 . VAL A 1 58  ? -5.768  -8.566  -16.203 1.00 0.00 ? 433 VAL A HG23 1  
ATOM 909   N N    . ILE A 1 59  ? -3.463  -4.329  -18.502 1.00 0.00 ? 434 ILE A N    1  
ATOM 910   C CA   . ILE A 1 59  ? -2.616  -3.765  -19.544 1.00 0.00 ? 434 ILE A CA   1  
ATOM 911   C C    . ILE A 1 59  ? -1.238  -4.418  -19.533 1.00 0.00 ? 434 ILE A C    1  
ATOM 912   O O    . ILE A 1 59  ? -0.817  -4.977  -18.520 1.00 0.00 ? 434 ILE A O    1  
ATOM 913   C CB   . ILE A 1 59  ? -2.451  -2.240  -19.377 1.00 0.00 ? 434 ILE A CB   1  
ATOM 914   C CG1  . ILE A 1 59  ? -3.807  -1.581  -19.109 1.00 0.00 ? 434 ILE A CG1  1  
ATOM 915   C CG2  . ILE A 1 59  ? -1.797  -1.640  -20.614 1.00 0.00 ? 434 ILE A CG2  1  
ATOM 916   C CD1  . ILE A 1 59  ? -3.917  -0.965  -17.730 1.00 0.00 ? 434 ILE A CD1  1  
ATOM 917   H H    . ILE A 1 59  ? -3.609  -3.821  -17.677 1.00 0.00 ? 434 ILE A H    1  
ATOM 918   H HA   . ILE A 1 59  ? -3.086  -3.955  -20.499 1.00 0.00 ? 434 ILE A HA   1  
ATOM 919   H HB   . ILE A 1 59  ? -1.799  -2.062  -18.535 1.00 0.00 ? 434 ILE A HB   1  
ATOM 920   H HG12 . ILE A 1 59  ? -3.972  -0.798  -19.833 1.00 0.00 ? 434 ILE A HG12 1  
ATOM 921   H HG13 . ILE A 1 59  ? -4.587  -2.322  -19.205 1.00 0.00 ? 434 ILE A HG13 1  
ATOM 922   H HG21 . ILE A 1 59  ? -2.366  -1.914  -21.490 1.00 0.00 ? 434 ILE A HG21 1  
ATOM 923   H HG22 . ILE A 1 59  ? -1.774  -0.564  -20.522 1.00 0.00 ? 434 ILE A HG22 1  
ATOM 924   H HG23 . ILE A 1 59  ? -0.790  -2.015  -20.707 1.00 0.00 ? 434 ILE A HG23 1  
ATOM 925   H HD11 . ILE A 1 59  ? -4.939  -1.025  -17.389 1.00 0.00 ? 434 ILE A HD11 1  
ATOM 926   H HD12 . ILE A 1 59  ? -3.277  -1.502  -17.045 1.00 0.00 ? 434 ILE A HD12 1  
ATOM 927   H HD13 . ILE A 1 59  ? -3.611  0.069   -17.773 1.00 0.00 ? 434 ILE A HD13 1  
ATOM 928   N N    . ILE A 1 60  ? -0.540  -4.348  -20.661 1.00 0.00 ? 435 ILE A N    1  
ATOM 929   C CA   . ILE A 1 60  ? 0.788   -4.940  -20.768 1.00 0.00 ? 435 ILE A CA   1  
ATOM 930   C C    . ILE A 1 60  ? 1.669   -4.159  -21.736 1.00 0.00 ? 435 ILE A C    1  
ATOM 931   O O    . ILE A 1 60  ? 2.823   -3.858  -21.432 1.00 0.00 ? 435 ILE A O    1  
ATOM 932   C CB   . ILE A 1 60  ? 0.714   -6.409  -21.229 1.00 0.00 ? 435 ILE A CB   1  
ATOM 933   C CG1  . ILE A 1 60  ? -0.177  -6.539  -22.467 1.00 0.00 ? 435 ILE A CG1  1  
ATOM 934   C CG2  . ILE A 1 60  ? 0.197   -7.291  -20.102 1.00 0.00 ? 435 ILE A CG2  1  
ATOM 935   C CD1  . ILE A 1 60  ? 0.598   -6.603  -23.764 1.00 0.00 ? 435 ILE A CD1  1  
ATOM 936   H H    . ILE A 1 60  ? -0.926  -3.892  -21.437 1.00 0.00 ? 435 ILE A H    1  
ATOM 937   H HA   . ILE A 1 60  ? 1.241   -4.917  -19.788 1.00 0.00 ? 435 ILE A HA   1  
ATOM 938   H HB   . ILE A 1 60  ? 1.712   -6.735  -21.477 1.00 0.00 ? 435 ILE A HB   1  
ATOM 939   H HG12 . ILE A 1 60  ? -0.764  -7.441  -22.389 1.00 0.00 ? 435 ILE A HG12 1  
ATOM 940   H HG13 . ILE A 1 60  ? -0.840  -5.688  -22.518 1.00 0.00 ? 435 ILE A HG13 1  
ATOM 941   H HG21 . ILE A 1 60  ? 0.450   -6.844  -19.151 1.00 0.00 ? 435 ILE A HG21 1  
ATOM 942   H HG22 . ILE A 1 60  ? -0.875  -7.385  -20.181 1.00 0.00 ? 435 ILE A HG22 1  
ATOM 943   H HG23 . ILE A 1 60  ? 0.651   -8.268  -20.172 1.00 0.00 ? 435 ILE A HG23 1  
ATOM 944   H HD11 . ILE A 1 60  ? 0.493   -5.667  -24.293 1.00 0.00 ? 435 ILE A HD11 1  
ATOM 945   H HD12 . ILE A 1 60  ? 1.642   -6.781  -23.552 1.00 0.00 ? 435 ILE A HD12 1  
ATOM 946   H HD13 . ILE A 1 60  ? 0.213   -7.405  -24.375 1.00 0.00 ? 435 ILE A HD13 1  
ATOM 947   N N    . SER A 1 61  ? 1.122   -3.834  -22.902 1.00 0.00 ? 436 SER A N    1  
ATOM 948   C CA   . SER A 1 61  ? 1.866   -3.090  -23.911 1.00 0.00 ? 436 SER A CA   1  
ATOM 949   C C    . SER A 1 61  ? 1.122   -1.822  -24.313 1.00 0.00 ? 436 SER A C    1  
ATOM 950   O O    . SER A 1 61  ? -0.082  -1.699  -24.087 1.00 0.00 ? 436 SER A O    1  
ATOM 951   C CB   . SER A 1 61  ? 2.111   -3.964  -25.143 1.00 0.00 ? 436 SER A CB   1  
ATOM 952   O OG   . SER A 1 61  ? 0.923   -4.127  -25.898 1.00 0.00 ? 436 SER A OG   1  
ATOM 953   H H    . SER A 1 61  ? 0.199   -4.102  -23.089 1.00 0.00 ? 436 SER A H    1  
ATOM 954   H HA   . SER A 1 61  ? 2.817   -2.813  -23.483 1.00 0.00 ? 436 SER A HA   1  
ATOM 955   H HB2  . SER A 1 61  ? 2.859   -3.499  -25.768 1.00 0.00 ? 436 SER A HB2  1  
ATOM 956   H HB3  . SER A 1 61  ? 2.459   -4.936  -24.827 1.00 0.00 ? 436 SER A HB3  1  
ATOM 957   H HG   . SER A 1 61  ? 1.064   -4.788  -26.579 1.00 0.00 ? 436 SER A HG   1  
ATOM 958   N N    . ILE A 1 62  ? 1.846   -0.879  -24.909 1.00 0.00 ? 437 ILE A N    1  
ATOM 959   C CA   . ILE A 1 62  ? 1.252   0.380   -25.341 1.00 0.00 ? 437 ILE A CA   1  
ATOM 960   C C    . ILE A 1 62  ? 2.071   1.024   -26.459 1.00 0.00 ? 437 ILE A C    1  
ATOM 961   O O    . ILE A 1 62  ? 3.247   1.341   -26.277 1.00 0.00 ? 437 ILE A O    1  
ATOM 962   C CB   . ILE A 1 62  ? 1.117   1.368   -24.163 1.00 0.00 ? 437 ILE A CB   1  
ATOM 963   C CG1  . ILE A 1 62  ? 0.236   2.554   -24.558 1.00 0.00 ? 437 ILE A CG1  1  
ATOM 964   C CG2  . ILE A 1 62  ? 2.485   1.848   -23.696 1.00 0.00 ? 437 ILE A CG2  1  
ATOM 965   C CD1  . ILE A 1 62  ? -0.680  3.020   -23.449 1.00 0.00 ? 437 ILE A CD1  1  
ATOM 966   H H    . ILE A 1 62  ? 2.802   -1.036  -25.062 1.00 0.00 ? 437 ILE A H    1  
ATOM 967   H HA   . ILE A 1 62  ? 0.262   0.165   -25.716 1.00 0.00 ? 437 ILE A HA   1  
ATOM 968   H HB   . ILE A 1 62  ? 0.651   0.846   -23.341 1.00 0.00 ? 437 ILE A HB   1  
ATOM 969   H HG12 . ILE A 1 62  ? 0.866   3.385   -24.837 1.00 0.00 ? 437 ILE A HG12 1  
ATOM 970   H HG13 . ILE A 1 62  ? -0.377  2.274   -25.403 1.00 0.00 ? 437 ILE A HG13 1  
ATOM 971   H HG21 . ILE A 1 62  ? 3.149   1.002   -23.599 1.00 0.00 ? 437 ILE A HG21 1  
ATOM 972   H HG22 . ILE A 1 62  ? 2.889   2.542   -24.419 1.00 0.00 ? 437 ILE A HG22 1  
ATOM 973   H HG23 . ILE A 1 62  ? 2.388   2.341   -22.740 1.00 0.00 ? 437 ILE A HG23 1  
ATOM 974   H HD11 . ILE A 1 62  ? -1.705  2.804   -23.715 1.00 0.00 ? 437 ILE A HD11 1  
ATOM 975   H HD12 . ILE A 1 62  ? -0.429  2.504   -22.535 1.00 0.00 ? 437 ILE A HD12 1  
ATOM 976   H HD13 . ILE A 1 62  ? -0.562  4.084   -23.308 1.00 0.00 ? 437 ILE A HD13 1  
ATOM 977   N N    . ASN A 1 63  ? 1.437   1.211   -27.616 1.00 0.00 ? 438 ASN A N    1  
ATOM 978   C CA   . ASN A 1 63  ? 2.091   1.816   -28.778 1.00 0.00 ? 438 ASN A CA   1  
ATOM 979   C C    . ASN A 1 63  ? 3.500   1.262   -28.986 1.00 0.00 ? 438 ASN A C    1  
ATOM 980   O O    . ASN A 1 63  ? 4.450   2.016   -29.204 1.00 0.00 ? 438 ASN A O    1  
ATOM 981   C CB   . ASN A 1 63  ? 2.143   3.339   -28.629 1.00 0.00 ? 438 ASN A CB   1  
ATOM 982   C CG   . ASN A 1 63  ? 2.918   3.779   -27.404 1.00 0.00 ? 438 ASN A CG   1  
ATOM 983   O OD1  . ASN A 1 63  ? 4.136   3.618   -27.333 1.00 0.00 ? 438 ASN A OD1  1  
ATOM 984   N ND2  . ASN A 1 63  ? 2.213   4.341   -26.429 1.00 0.00 ? 438 ASN A ND2  1  
ATOM 985   H H    . ASN A 1 63  ? 0.501   0.932   -27.692 1.00 0.00 ? 438 ASN A H    1  
ATOM 986   H HA   . ASN A 1 63  ? 1.498   1.574   -29.647 1.00 0.00 ? 438 ASN A HA   1  
ATOM 987   H HB2  . ASN A 1 63  ? 2.617   3.763   -29.502 1.00 0.00 ? 438 ASN A HB2  1  
ATOM 988   H HB3  . ASN A 1 63  ? 1.135   3.720   -28.552 1.00 0.00 ? 438 ASN A HB3  1  
ATOM 989   H HD21 . ASN A 1 63  ? 1.246   4.439   -26.556 1.00 0.00 ? 438 ASN A HD21 1  
ATOM 990   H HD22 . ASN A 1 63  ? 2.688   4.633   -25.624 1.00 0.00 ? 438 ASN A HD22 1  
ATOM 991   N N    . GLY A 1 64  ? 3.628   -0.059  -28.924 1.00 0.00 ? 439 GLY A N    1  
ATOM 992   C CA   . GLY A 1 64  ? 4.921   -0.690  -29.115 1.00 0.00 ? 439 GLY A CA   1  
ATOM 993   C C    . GLY A 1 64  ? 5.838   -0.519  -27.920 1.00 0.00 ? 439 GLY A C    1  
ATOM 994   O O    . GLY A 1 64  ? 7.008   -0.166  -28.071 1.00 0.00 ? 439 GLY A O    1  
ATOM 995   H H    . GLY A 1 64  ? 2.836   -0.611  -28.752 1.00 0.00 ? 439 GLY A H    1  
ATOM 996   H HA2  . GLY A 1 64  ? 4.772   -1.745  -29.291 1.00 0.00 ? 439 GLY A HA2  1  
ATOM 997   H HA3  . GLY A 1 64  ? 5.395   -0.255  -29.982 1.00 0.00 ? 439 GLY A HA3  1  
ATOM 998   N N    . GLN A 1 65  ? 5.308   -0.773  -26.728 1.00 0.00 ? 440 GLN A N    1  
ATOM 999   C CA   . GLN A 1 65  ? 6.088   -0.650  -25.502 1.00 0.00 ? 440 GLN A CA   1  
ATOM 1000  C C    . GLN A 1 65  ? 5.706   -1.742  -24.509 1.00 0.00 ? 440 GLN A C    1  
ATOM 1001  O O    . GLN A 1 65  ? 4.647   -2.356  -24.625 1.00 0.00 ? 440 GLN A O    1  
ATOM 1002  C CB   . GLN A 1 65  ? 5.874   0.727   -24.874 1.00 0.00 ? 440 GLN A CB   1  
ATOM 1003  C CG   . GLN A 1 65  ? 6.277   1.877   -25.781 1.00 0.00 ? 440 GLN A CG   1  
ATOM 1004  C CD   . GLN A 1 65  ? 6.514   3.166   -25.019 1.00 0.00 ? 440 GLN A CD   1  
ATOM 1005  O OE1  . GLN A 1 65  ? 5.618   3.677   -24.348 1.00 0.00 ? 440 GLN A OE1  1  
ATOM 1006  N NE2  . GLN A 1 65  ? 7.726   3.698   -25.118 1.00 0.00 ? 440 GLN A NE2  1  
ATOM 1007  H H    . GLN A 1 65  ? 4.371   -1.053  -26.672 1.00 0.00 ? 440 GLN A H    1  
ATOM 1008  H HA   . GLN A 1 65  ? 7.130   -0.761  -25.759 1.00 0.00 ? 440 GLN A HA   1  
ATOM 1009  H HB2  . GLN A 1 65  ? 4.829   0.841   -24.629 1.00 0.00 ? 440 GLN A HB2  1  
ATOM 1010  H HB3  . GLN A 1 65  ? 6.457   0.791   -23.967 1.00 0.00 ? 440 GLN A HB3  1  
ATOM 1011  H HG2  . GLN A 1 65  ? 7.187   1.610   -26.297 1.00 0.00 ? 440 GLN A HG2  1  
ATOM 1012  H HG3  . GLN A 1 65  ? 5.491   2.042   -26.503 1.00 0.00 ? 440 GLN A HG3  1  
ATOM 1013  H HE21 . GLN A 1 65  ? 8.391   3.235   -25.671 1.00 0.00 ? 440 GLN A HE21 1  
ATOM 1014  H HE22 . GLN A 1 65  ? 7.908   4.531   -24.635 1.00 0.00 ? 440 GLN A HE22 1  
ATOM 1015  N N    . SER A 1 66  ? 6.578   -1.982  -23.534 1.00 0.00 ? 441 SER A N    1  
ATOM 1016  C CA   . SER A 1 66  ? 6.330   -3.004  -22.523 1.00 0.00 ? 441 SER A CA   1  
ATOM 1017  C C    . SER A 1 66  ? 6.092   -2.372  -21.155 1.00 0.00 ? 441 SER A C    1  
ATOM 1018  O O    . SER A 1 66  ? 7.009   -1.822  -20.545 1.00 0.00 ? 441 SER A O    1  
ATOM 1019  C CB   . SER A 1 66  ? 7.508   -3.976  -22.450 1.00 0.00 ? 441 SER A CB   1  
ATOM 1020  O OG   . SER A 1 66  ? 7.699   -4.643  -23.687 1.00 0.00 ? 441 SER A OG   1  
ATOM 1021  H H    . SER A 1 66  ? 7.408   -1.462  -23.494 1.00 0.00 ? 441 SER A H    1  
ATOM 1022  H HA   . SER A 1 66  ? 5.444   -3.548  -22.813 1.00 0.00 ? 441 SER A HA   1  
ATOM 1023  H HB2  . SER A 1 66  ? 8.408   -3.432  -22.209 1.00 0.00 ? 441 SER A HB2  1  
ATOM 1024  H HB3  . SER A 1 66  ? 7.317   -4.714  -21.684 1.00 0.00 ? 441 SER A HB3  1  
ATOM 1025  H HG   . SER A 1 66  ? 6.864   -5.014  -23.982 1.00 0.00 ? 441 SER A HG   1  
ATOM 1026  N N    . VAL A 1 67  ? 4.854   -2.456  -20.678 1.00 0.00 ? 442 VAL A N    1  
ATOM 1027  C CA   . VAL A 1 67  ? 4.492   -1.895  -19.382 1.00 0.00 ? 442 VAL A CA   1  
ATOM 1028  C C    . VAL A 1 67  ? 4.563   -2.957  -18.290 1.00 0.00 ? 442 VAL A C    1  
ATOM 1029  O O    . VAL A 1 67  ? 4.391   -4.146  -18.557 1.00 0.00 ? 442 VAL A O    1  
ATOM 1030  C CB   . VAL A 1 67  ? 3.073   -1.292  -19.405 1.00 0.00 ? 442 VAL A CB   1  
ATOM 1031  C CG1  . VAL A 1 67  ? 2.845   -0.410  -18.185 1.00 0.00 ? 442 VAL A CG1  1  
ATOM 1032  C CG2  . VAL A 1 67  ? 2.842   -0.506  -20.689 1.00 0.00 ? 442 VAL A CG2  1  
ATOM 1033  H H    . VAL A 1 67  ? 4.167   -2.907  -21.211 1.00 0.00 ? 442 VAL A H    1  
ATOM 1034  H HA   . VAL A 1 67  ? 5.193   -1.106  -19.152 1.00 0.00 ? 442 VAL A HA   1  
ATOM 1035  H HB   . VAL A 1 67  ? 2.359   -2.102  -19.371 1.00 0.00 ? 442 VAL A HB   1  
ATOM 1036  H HG11 . VAL A 1 67  ? 3.793   -0.191  -17.717 1.00 0.00 ? 442 VAL A HG11 1  
ATOM 1037  H HG12 . VAL A 1 67  ? 2.372   0.512   -18.490 1.00 0.00 ? 442 VAL A HG12 1  
ATOM 1038  H HG13 . VAL A 1 67  ? 2.207   -0.927  -17.483 1.00 0.00 ? 442 VAL A HG13 1  
ATOM 1039  H HG21 . VAL A 1 67  ? 2.288   0.395   -20.468 1.00 0.00 ? 442 VAL A HG21 1  
ATOM 1040  H HG22 . VAL A 1 67  ? 3.793   -0.245  -21.127 1.00 0.00 ? 442 VAL A HG22 1  
ATOM 1041  H HG23 . VAL A 1 67  ? 2.280   -1.112  -21.384 1.00 0.00 ? 442 VAL A HG23 1  
ATOM 1042  N N    . VAL A 1 68  ? 4.820   -2.522  -17.060 1.00 0.00 ? 443 VAL A N    1  
ATOM 1043  C CA   . VAL A 1 68  ? 4.916   -3.442  -15.931 1.00 0.00 ? 443 VAL A CA   1  
ATOM 1044  C C    . VAL A 1 68  ? 4.059   -2.977  -14.758 1.00 0.00 ? 443 VAL A C    1  
ATOM 1045  O O    . VAL A 1 68  ? 3.380   -3.780  -14.118 1.00 0.00 ? 443 VAL A O    1  
ATOM 1046  C CB   . VAL A 1 68  ? 6.373   -3.601  -15.457 1.00 0.00 ? 443 VAL A CB   1  
ATOM 1047  C CG1  . VAL A 1 68  ? 7.213   -4.282  -16.526 1.00 0.00 ? 443 VAL A CG1  1  
ATOM 1048  C CG2  . VAL A 1 68  ? 6.964   -2.250  -15.083 1.00 0.00 ? 443 VAL A CG2  1  
ATOM 1049  H H    . VAL A 1 68  ? 4.950   -1.564  -16.909 1.00 0.00 ? 443 VAL A H    1  
ATOM 1050  H HA   . VAL A 1 68  ? 4.561   -4.408  -16.261 1.00 0.00 ? 443 VAL A HA   1  
ATOM 1051  H HB   . VAL A 1 68  ? 6.375   -4.226  -14.576 1.00 0.00 ? 443 VAL A HB   1  
ATOM 1052  H HG11 . VAL A 1 68  ? 6.779   -5.242  -16.766 1.00 0.00 ? 443 VAL A HG11 1  
ATOM 1053  H HG12 . VAL A 1 68  ? 7.237   -3.666  -17.412 1.00 0.00 ? 443 VAL A HG12 1  
ATOM 1054  H HG13 . VAL A 1 68  ? 8.218   -4.424  -16.158 1.00 0.00 ? 443 VAL A HG13 1  
ATOM 1055  H HG21 . VAL A 1 68  ? 8.029   -2.262  -15.263 1.00 0.00 ? 443 VAL A HG21 1  
ATOM 1056  H HG22 . VAL A 1 68  ? 6.506   -1.477  -15.682 1.00 0.00 ? 443 VAL A HG22 1  
ATOM 1057  H HG23 . VAL A 1 68  ? 6.779   -2.052  -14.038 1.00 0.00 ? 443 VAL A HG23 1  
ATOM 1058  N N    . SER A 1 69  ? 4.098   -1.679  -14.474 1.00 0.00 ? 444 SER A N    1  
ATOM 1059  C CA   . SER A 1 69  ? 3.325   -1.119  -13.371 1.00 0.00 ? 444 SER A CA   1  
ATOM 1060  C C    . SER A 1 69  ? 2.605   0.158   -13.793 1.00 0.00 ? 444 SER A C    1  
ATOM 1061  O O    . SER A 1 69  ? 2.823   0.675   -14.890 1.00 0.00 ? 444 SER A O    1  
ATOM 1062  C CB   . SER A 1 69  ? 4.239   -0.831  -12.179 1.00 0.00 ? 444 SER A CB   1  
ATOM 1063  O OG   . SER A 1 69  ? 5.509   -0.375  -12.608 1.00 0.00 ? 444 SER A OG   1  
ATOM 1064  H H    . SER A 1 69  ? 4.660   -1.086  -15.015 1.00 0.00 ? 444 SER A H    1  
ATOM 1065  H HA   . SER A 1 69  ? 2.588   -1.852  -13.078 1.00 0.00 ? 444 SER A HA   1  
ATOM 1066  H HB2  . SER A 1 69  ? 3.789   -0.070  -11.558 1.00 0.00 ? 444 SER A HB2  1  
ATOM 1067  H HB3  . SER A 1 69  ? 4.370   -1.736  -11.602 1.00 0.00 ? 444 SER A HB3  1  
ATOM 1068  H HG   . SER A 1 69  ? 5.398   0.300   -13.281 1.00 0.00 ? 444 SER A HG   1  
ATOM 1069  N N    . ALA A 1 70  ? 1.747   0.664   -12.912 1.00 0.00 ? 445 ALA A N    1  
ATOM 1070  C CA   . ALA A 1 70  ? 0.995   1.882   -13.186 1.00 0.00 ? 445 ALA A CA   1  
ATOM 1071  C C    . ALA A 1 70  ? 1.929   3.041   -13.517 1.00 0.00 ? 445 ALA A C    1  
ATOM 1072  O O    . ALA A 1 70  ? 1.679   3.808   -14.445 1.00 0.00 ? 445 ALA A O    1  
ATOM 1073  C CB   . ALA A 1 70  ? 0.113   2.237   -11.997 1.00 0.00 ? 445 ALA A CB   1  
ATOM 1074  H H    . ALA A 1 70  ? 1.620   0.208   -12.054 1.00 0.00 ? 445 ALA A H    1  
ATOM 1075  H HA   . ALA A 1 70  ? 0.355   1.695   -14.036 1.00 0.00 ? 445 ALA A HA   1  
ATOM 1076  H HB1  . ALA A 1 70  ? -0.886  1.862   -12.167 1.00 0.00 ? 445 ALA A HB1  1  
ATOM 1077  H HB2  . ALA A 1 70  ? 0.519   1.790   -11.103 1.00 0.00 ? 445 ALA A HB2  1  
ATOM 1078  H HB3  . ALA A 1 70  ? 0.080   3.310   -11.880 1.00 0.00 ? 445 ALA A HB3  1  
ATOM 1079  N N    . ASN A 1 71  ? 3.012   3.157   -12.751 1.00 0.00 ? 446 ASN A N    1  
ATOM 1080  C CA   . ASN A 1 71  ? 3.989   4.219   -12.966 1.00 0.00 ? 446 ASN A CA   1  
ATOM 1081  C C    . ASN A 1 71  ? 4.505   4.199   -14.400 1.00 0.00 ? 446 ASN A C    1  
ATOM 1082  O O    . ASN A 1 71  ? 4.882   5.234   -14.950 1.00 0.00 ? 446 ASN A O    1  
ATOM 1083  C CB   . ASN A 1 71  ? 5.157   4.071   -11.988 1.00 0.00 ? 446 ASN A CB   1  
ATOM 1084  C CG   . ASN A 1 71  ? 5.903   2.764   -12.171 1.00 0.00 ? 446 ASN A CG   1  
ATOM 1085  O OD1  . ASN A 1 71  ? 6.346   2.437   -13.271 1.00 0.00 ? 446 ASN A OD1  1  
ATOM 1086  N ND2  . ASN A 1 71  ? 6.049   2.009   -11.088 1.00 0.00 ? 446 ASN A ND2  1  
ATOM 1087  H H    . ASN A 1 71  ? 3.158   2.512   -12.029 1.00 0.00 ? 446 ASN A H    1  
ATOM 1088  H HA   . ASN A 1 71  ? 3.497   5.162   -12.785 1.00 0.00 ? 446 ASN A HA   1  
ATOM 1089  H HB2  . ASN A 1 71  ? 5.851   4.885   -12.141 1.00 0.00 ? 446 ASN A HB2  1  
ATOM 1090  H HB3  . ASN A 1 71  ? 4.779   4.110   -10.977 1.00 0.00 ? 446 ASN A HB3  1  
ATOM 1091  H HD21 . ASN A 1 71  ? 5.671   2.332   -10.244 1.00 0.00 ? 446 ASN A HD21 1  
ATOM 1092  H HD22 . ASN A 1 71  ? 6.527   1.159   -11.178 1.00 0.00 ? 446 ASN A HD22 1  
ATOM 1093  N N    . ASP A 1 72  ? 4.518   3.013   -15.002 1.00 0.00 ? 447 ASP A N    1  
ATOM 1094  C CA   . ASP A 1 72  ? 4.984   2.856   -16.372 1.00 0.00 ? 447 ASP A CA   1  
ATOM 1095  C C    . ASP A 1 72  ? 3.912   3.299   -17.362 1.00 0.00 ? 447 ASP A C    1  
ATOM 1096  O O    . ASP A 1 72  ? 4.218   3.861   -18.412 1.00 0.00 ? 447 ASP A O    1  
ATOM 1097  C CB   . ASP A 1 72  ? 5.372   1.401   -16.639 1.00 0.00 ? 447 ASP A CB   1  
ATOM 1098  C CG   . ASP A 1 72  ? 6.809   1.105   -16.254 1.00 0.00 ? 447 ASP A CG   1  
ATOM 1099  O OD1  . ASP A 1 72  ? 7.709   1.348   -17.087 1.00 0.00 ? 447 ASP A OD1  1  
ATOM 1100  O OD2  . ASP A 1 72  ? 7.035   0.631   -15.121 1.00 0.00 ? 447 ASP A OD2  1  
ATOM 1101  H H    . ASP A 1 72  ? 4.204   2.225   -14.511 1.00 0.00 ? 447 ASP A H    1  
ATOM 1102  H HA   . ASP A 1 72  ? 5.855   3.480   -16.499 1.00 0.00 ? 447 ASP A HA   1  
ATOM 1103  H HB2  . ASP A 1 72  ? 4.726   0.752   -16.068 1.00 0.00 ? 447 ASP A HB2  1  
ATOM 1104  H HB3  . ASP A 1 72  ? 5.250   1.189   -17.692 1.00 0.00 ? 447 ASP A HB3  1  
ATOM 1105  N N    . VAL A 1 73  ? 2.655   3.040   -17.017 1.00 0.00 ? 448 VAL A N    1  
ATOM 1106  C CA   . VAL A 1 73  ? 1.534   3.411   -17.876 1.00 0.00 ? 448 VAL A CA   1  
ATOM 1107  C C    . VAL A 1 73  ? 1.347   4.925   -17.919 1.00 0.00 ? 448 VAL A C    1  
ATOM 1108  O O    . VAL A 1 73  ? 1.081   5.499   -18.975 1.00 0.00 ? 448 VAL A O    1  
ATOM 1109  C CB   . VAL A 1 73  ? 0.220   2.763   -17.396 1.00 0.00 ? 448 VAL A CB   1  
ATOM 1110  C CG1  . VAL A 1 73  ? -0.907  3.037   -18.380 1.00 0.00 ? 448 VAL A CG1  1  
ATOM 1111  C CG2  . VAL A 1 73  ? 0.402   1.268   -17.190 1.00 0.00 ? 448 VAL A CG2  1  
ATOM 1112  H H    . VAL A 1 73  ? 2.475   2.588   -16.166 1.00 0.00 ? 448 VAL A H    1  
ATOM 1113  H HA   . VAL A 1 73  ? 1.744   3.053   -18.874 1.00 0.00 ? 448 VAL A HA   1  
ATOM 1114  H HB   . VAL A 1 73  ? -0.049  3.204   -16.447 1.00 0.00 ? 448 VAL A HB   1  
ATOM 1115  H HG11 . VAL A 1 73  ? -0.969  4.098   -18.571 1.00 0.00 ? 448 VAL A HG11 1  
ATOM 1116  H HG12 . VAL A 1 73  ? -0.711  2.515   -19.306 1.00 0.00 ? 448 VAL A HG12 1  
ATOM 1117  H HG13 . VAL A 1 73  ? -1.841  2.690   -17.963 1.00 0.00 ? 448 VAL A HG13 1  
ATOM 1118  H HG21 . VAL A 1 73  ? 0.257   0.754   -18.129 1.00 0.00 ? 448 VAL A HG21 1  
ATOM 1119  H HG22 . VAL A 1 73  ? 1.399   1.073   -16.823 1.00 0.00 ? 448 VAL A HG22 1  
ATOM 1120  H HG23 . VAL A 1 73  ? -0.322  0.914   -16.470 1.00 0.00 ? 448 VAL A HG23 1  
ATOM 1121  N N    . SER A 1 74  ? 1.480   5.565   -16.759 1.00 0.00 ? 449 SER A N    1  
ATOM 1122  C CA   . SER A 1 74  ? 1.318   7.012   -16.655 1.00 0.00 ? 449 SER A CA   1  
ATOM 1123  C C    . SER A 1 74  ? 2.236   7.750   -17.627 1.00 0.00 ? 449 SER A C    1  
ATOM 1124  O O    . SER A 1 74  ? 1.770   8.457   -18.520 1.00 0.00 ? 449 SER A O    1  
ATOM 1125  C CB   . SER A 1 74  ? 1.599   7.474   -15.225 1.00 0.00 ? 449 SER A CB   1  
ATOM 1126  O OG   . SER A 1 74  ? 1.259   8.838   -15.053 1.00 0.00 ? 449 SER A OG   1  
ATOM 1127  H H    . SER A 1 74  ? 1.687   5.049   -15.953 1.00 0.00 ? 449 SER A H    1  
ATOM 1128  H HA   . SER A 1 74  ? 0.294   7.247   -16.903 1.00 0.00 ? 449 SER A HA   1  
ATOM 1129  H HB2  . SER A 1 74  ? 1.014   6.882   -14.537 1.00 0.00 ? 449 SER A HB2  1  
ATOM 1130  H HB3  . SER A 1 74  ? 2.649   7.346   -15.007 1.00 0.00 ? 449 SER A HB3  1  
ATOM 1131  H HG   . SER A 1 74  ? 1.764   9.374   -15.669 1.00 0.00 ? 449 SER A HG   1  
ATOM 1132  N N    . ASP A 1 75  ? 3.544   7.587   -17.443 1.00 0.00 ? 450 ASP A N    1  
ATOM 1133  C CA   . ASP A 1 75  ? 4.530   8.245   -18.298 1.00 0.00 ? 450 ASP A CA   1  
ATOM 1134  C C    . ASP A 1 75  ? 4.196   8.062   -19.777 1.00 0.00 ? 450 ASP A C    1  
ATOM 1135  O O    . ASP A 1 75  ? 4.415   8.961   -20.588 1.00 0.00 ? 450 ASP A O    1  
ATOM 1136  C CB   . ASP A 1 75  ? 5.932   7.704   -18.006 1.00 0.00 ? 450 ASP A CB   1  
ATOM 1137  C CG   . ASP A 1 75  ? 6.111   6.269   -18.461 1.00 0.00 ? 450 ASP A CG   1  
ATOM 1138  O OD1  . ASP A 1 75  ? 6.277   6.048   -19.679 1.00 0.00 ? 450 ASP A OD1  1  
ATOM 1139  O OD2  . ASP A 1 75  ? 6.085   5.366   -17.599 1.00 0.00 ? 450 ASP A OD2  1  
ATOM 1140  H H    . ASP A 1 75  ? 3.855   7.015   -16.710 1.00 0.00 ? 450 ASP A H    1  
ATOM 1141  H HA   . ASP A 1 75  ? 4.509   9.300   -18.068 1.00 0.00 ? 450 ASP A HA   1  
ATOM 1142  H HB2  . ASP A 1 75  ? 6.661   8.316   -18.517 1.00 0.00 ? 450 ASP A HB2  1  
ATOM 1143  H HB3  . ASP A 1 75  ? 6.115   7.751   -16.942 1.00 0.00 ? 450 ASP A HB3  1  
ATOM 1144  N N    . VAL A 1 76  ? 3.666   6.893   -20.123 1.00 0.00 ? 451 VAL A N    1  
ATOM 1145  C CA   . VAL A 1 76  ? 3.305   6.598   -21.505 1.00 0.00 ? 451 VAL A CA   1  
ATOM 1146  C C    . VAL A 1 76  ? 2.164   7.494   -21.977 1.00 0.00 ? 451 VAL A C    1  
ATOM 1147  O O    . VAL A 1 76  ? 2.214   8.053   -23.073 1.00 0.00 ? 451 VAL A O    1  
ATOM 1148  C CB   . VAL A 1 76  ? 2.891   5.122   -21.675 1.00 0.00 ? 451 VAL A CB   1  
ATOM 1149  C CG1  . VAL A 1 76  ? 2.633   4.801   -23.140 1.00 0.00 ? 451 VAL A CG1  1  
ATOM 1150  C CG2  . VAL A 1 76  ? 3.956   4.201   -21.101 1.00 0.00 ? 451 VAL A CG2  1  
ATOM 1151  H H    . VAL A 1 76  ? 3.515   6.214   -19.433 1.00 0.00 ? 451 VAL A H    1  
ATOM 1152  H HA   . VAL A 1 76  ? 4.172   6.781   -22.122 1.00 0.00 ? 451 VAL A HA   1  
ATOM 1153  H HB   . VAL A 1 76  ? 1.974   4.961   -21.128 1.00 0.00 ? 451 VAL A HB   1  
ATOM 1154  H HG11 . VAL A 1 76  ? 2.509   5.719   -23.695 1.00 0.00 ? 451 VAL A HG11 1  
ATOM 1155  H HG12 . VAL A 1 76  ? 3.470   4.249   -23.541 1.00 0.00 ? 451 VAL A HG12 1  
ATOM 1156  H HG13 . VAL A 1 76  ? 1.735   4.206   -23.226 1.00 0.00 ? 451 VAL A HG13 1  
ATOM 1157  H HG21 . VAL A 1 76  ? 4.545   3.786   -21.905 1.00 0.00 ? 451 VAL A HG21 1  
ATOM 1158  H HG22 . VAL A 1 76  ? 4.598   4.762   -20.437 1.00 0.00 ? 451 VAL A HG22 1  
ATOM 1159  H HG23 . VAL A 1 76  ? 3.482   3.401   -20.552 1.00 0.00 ? 451 VAL A HG23 1  
ATOM 1160  N N    . ILE A 1 77  ? 1.137   7.624   -21.145 1.00 0.00 ? 452 ILE A N    1  
ATOM 1161  C CA   . ILE A 1 77  ? -0.016  8.453   -21.479 1.00 0.00 ? 452 ILE A CA   1  
ATOM 1162  C C    . ILE A 1 77  ? 0.389   9.911   -21.658 1.00 0.00 ? 452 ILE A C    1  
ATOM 1163  O O    . ILE A 1 77  ? -0.207  10.639  -22.452 1.00 0.00 ? 452 ILE A O    1  
ATOM 1164  C CB   . ILE A 1 77  ? -1.107  8.361   -20.393 1.00 0.00 ? 452 ILE A CB   1  
ATOM 1165  C CG1  . ILE A 1 77  ? -1.452  6.899   -20.103 1.00 0.00 ? 452 ILE A CG1  1  
ATOM 1166  C CG2  . ILE A 1 77  ? -2.352  9.126   -20.819 1.00 0.00 ? 452 ILE A CG2  1  
ATOM 1167  C CD1  . ILE A 1 77  ? -1.760  6.629   -18.647 1.00 0.00 ? 452 ILE A CD1  1  
ATOM 1168  H H    . ILE A 1 77  ? 1.154   7.153   -20.286 1.00 0.00 ? 452 ILE A H    1  
ATOM 1169  H HA   . ILE A 1 77  ? -0.431  8.087   -22.407 1.00 0.00 ? 452 ILE A HA   1  
ATOM 1170  H HB   . ILE A 1 77  ? -0.725  8.817   -19.492 1.00 0.00 ? 452 ILE A HB   1  
ATOM 1171  H HG12 . ILE A 1 77  ? -2.319  6.619   -20.682 1.00 0.00 ? 452 ILE A HG12 1  
ATOM 1172  H HG13 . ILE A 1 77  ? -0.617  6.275   -20.388 1.00 0.00 ? 452 ILE A HG13 1  
ATOM 1173  H HG21 . ILE A 1 77  ? -2.096  9.824   -21.603 1.00 0.00 ? 452 ILE A HG21 1  
ATOM 1174  H HG22 . ILE A 1 77  ? -3.095  8.432   -21.184 1.00 0.00 ? 452 ILE A HG22 1  
ATOM 1175  H HG23 . ILE A 1 77  ? -2.750  9.667   -19.972 1.00 0.00 ? 452 ILE A HG23 1  
ATOM 1176  H HD11 . ILE A 1 77  ? -0.906  6.161   -18.179 1.00 0.00 ? 452 ILE A HD11 1  
ATOM 1177  H HD12 . ILE A 1 77  ? -1.980  7.560   -18.147 1.00 0.00 ? 452 ILE A HD12 1  
ATOM 1178  H HD13 . ILE A 1 77  ? -2.614  5.971   -18.575 1.00 0.00 ? 452 ILE A HD13 1  
ATOM 1179  N N    . LYS A 1 78  ? 1.407   10.334  -20.916 1.00 0.00 ? 453 LYS A N    1  
ATOM 1180  C CA   . LYS A 1 78  ? 1.890   11.708  -20.993 1.00 0.00 ? 453 LYS A CA   1  
ATOM 1181  C C    . LYS A 1 78  ? 3.065   11.834  -21.962 1.00 0.00 ? 453 LYS A C    1  
ATOM 1182  O O    . LYS A 1 78  ? 3.438   12.939  -22.355 1.00 0.00 ? 453 LYS A O    1  
ATOM 1183  C CB   . LYS A 1 78  ? 2.306   12.201  -19.605 1.00 0.00 ? 453 LYS A CB   1  
ATOM 1184  C CG   . LYS A 1 78  ? 3.380   11.345  -18.954 1.00 0.00 ? 453 LYS A CG   1  
ATOM 1185  C CD   . LYS A 1 78  ? 3.857   11.951  -17.643 1.00 0.00 ? 453 LYS A CD   1  
ATOM 1186  C CE   . LYS A 1 78  ? 3.284   11.214  -16.443 1.00 0.00 ? 453 LYS A CE   1  
ATOM 1187  N NZ   . LYS A 1 78  ? 3.931   11.634  -15.169 1.00 0.00 ? 453 LYS A NZ   1  
ATOM 1188  H H    . LYS A 1 78  ? 1.842   9.708   -20.300 1.00 0.00 ? 453 LYS A H    1  
ATOM 1189  H HA   . LYS A 1 78  ? 1.078   12.323  -21.351 1.00 0.00 ? 453 LYS A HA   1  
ATOM 1190  H HB2  . LYS A 1 78  ? 2.682   13.209  -19.692 1.00 0.00 ? 453 LYS A HB2  1  
ATOM 1191  H HB3  . LYS A 1 78  ? 1.438   12.204  -18.962 1.00 0.00 ? 453 LYS A HB3  1  
ATOM 1192  H HG2  . LYS A 1 78  ? 2.975   10.364  -18.757 1.00 0.00 ? 453 LYS A HG2  1  
ATOM 1193  H HG3  . LYS A 1 78  ? 4.219   11.262  -19.628 1.00 0.00 ? 453 LYS A HG3  1  
ATOM 1194  H HD2  . LYS A 1 78  ? 4.935   11.896  -17.604 1.00 0.00 ? 453 LYS A HD2  1  
ATOM 1195  H HD3  . LYS A 1 78  ? 3.547   12.986  -17.601 1.00 0.00 ? 453 LYS A HD3  1  
ATOM 1196  H HE2  . LYS A 1 78  ? 2.226   11.419  -16.383 1.00 0.00 ? 453 LYS A HE2  1  
ATOM 1197  H HE3  . LYS A 1 78  ? 3.437   10.154  -16.582 1.00 0.00 ? 453 LYS A HE3  1  
ATOM 1198  H HZ1  . LYS A 1 78  ? 4.950   11.424  -15.199 1.00 0.00 ? 453 LYS A HZ1  1  
ATOM 1199  H HZ2  . LYS A 1 78  ? 3.805   12.657  -15.024 1.00 0.00 ? 453 LYS A HZ2  1  
ATOM 1200  H HZ3  . LYS A 1 78  ? 3.505   11.127  -14.367 1.00 0.00 ? 453 LYS A HZ3  1  
ATOM 1201  N N    . ARG A 1 79  ? 3.649   10.700  -22.342 1.00 0.00 ? 454 ARG A N    1  
ATOM 1202  C CA   . ARG A 1 79  ? 4.781   10.698  -23.263 1.00 0.00 ? 454 ARG A CA   1  
ATOM 1203  C C    . ARG A 1 79  ? 4.318   10.497  -24.702 1.00 0.00 ? 454 ARG A C    1  
ATOM 1204  O O    . ARG A 1 79  ? 4.774   11.189  -25.613 1.00 0.00 ? 454 ARG A O    1  
ATOM 1205  C CB   . ARG A 1 79  ? 5.776   9.601   -22.879 1.00 0.00 ? 454 ARG A CB   1  
ATOM 1206  C CG   . ARG A 1 79  ? 6.996   9.543   -23.783 1.00 0.00 ? 454 ARG A CG   1  
ATOM 1207  C CD   . ARG A 1 79  ? 8.227   9.066   -23.028 1.00 0.00 ? 454 ARG A CD   1  
ATOM 1208  N NE   . ARG A 1 79  ? 9.458   9.337   -23.764 1.00 0.00 ? 454 ARG A NE   1  
ATOM 1209  C CZ   . ARG A 1 79  ? 9.892   8.596   -24.781 1.00 0.00 ? 454 ARG A CZ   1  
ATOM 1210  N NH1  . ARG A 1 79  ? 9.196   7.541   -25.185 1.00 0.00 ? 454 ARG A NH1  1  
ATOM 1211  N NH2  . ARG A 1 79  ? 11.024  8.911   -25.395 1.00 0.00 ? 454 ARG A NH2  1  
ATOM 1212  H H    . ARG A 1 79  ? 3.314   9.847   -21.998 1.00 0.00 ? 454 ARG A H    1  
ATOM 1213  H HA   . ARG A 1 79  ? 5.270   11.657  -23.186 1.00 0.00 ? 454 ARG A HA   1  
ATOM 1214  H HB2  . ARG A 1 79  ? 6.112   9.774   -21.867 1.00 0.00 ? 454 ARG A HB2  1  
ATOM 1215  H HB3  . ARG A 1 79  ? 5.275   8.645   -22.924 1.00 0.00 ? 454 ARG A HB3  1  
ATOM 1216  H HG2  . ARG A 1 79  ? 6.798   8.859   -24.595 1.00 0.00 ? 454 ARG A HG2  1  
ATOM 1217  H HG3  . ARG A 1 79  ? 7.187   10.530  -24.178 1.00 0.00 ? 454 ARG A HG3  1  
ATOM 1218  H HD2  . ARG A 1 79  ? 8.268   9.574   -22.076 1.00 0.00 ? 454 ARG A HD2  1  
ATOM 1219  H HD3  . ARG A 1 79  ? 8.142   8.003   -22.864 1.00 0.00 ? 454 ARG A HD3  1  
ATOM 1220  H HE   . ARG A 1 79  ? 9.991   10.112  -23.486 1.00 0.00 ? 454 ARG A HE   1  
ATOM 1221  H HH11 . ARG A 1 79  ? 8.342   7.297   -24.726 1.00 0.00 ? 454 ARG A HH11 1  
ATOM 1222  H HH12 . ARG A 1 79  ? 9.527   6.987   -25.950 1.00 0.00 ? 454 ARG A HH12 1  
ATOM 1223  H HH21 . ARG A 1 79  ? 11.551  9.706   -25.095 1.00 0.00 ? 454 ARG A HH21 1  
ATOM 1224  H HH22 . ARG A 1 79  ? 11.351  8.354   -26.160 1.00 0.00 ? 454 ARG A HH22 1  
ATOM 1225  N N    . GLU A 1 80  ? 3.414   9.544   -24.901 1.00 0.00 ? 455 GLU A N    1  
ATOM 1226  C CA   . GLU A 1 80  ? 2.895   9.251   -26.232 1.00 0.00 ? 455 GLU A CA   1  
ATOM 1227  C C    . GLU A 1 80  ? 1.469   9.767   -26.391 1.00 0.00 ? 455 GLU A C    1  
ATOM 1228  O O    . GLU A 1 80  ? 0.600   9.481   -25.567 1.00 0.00 ? 455 GLU A O    1  
ATOM 1229  C CB   . GLU A 1 80  ? 2.936   7.743   -26.497 1.00 0.00 ? 455 GLU A CB   1  
ATOM 1230  C CG   . GLU A 1 80  ? 4.222   7.077   -26.035 1.00 0.00 ? 455 GLU A CG   1  
ATOM 1231  C CD   . GLU A 1 80  ? 5.352   7.238   -27.034 1.00 0.00 ? 455 GLU A CD   1  
ATOM 1232  O OE1  . GLU A 1 80  ? 5.383   6.475   -28.022 1.00 0.00 ? 455 GLU A OE1  1  
ATOM 1233  O OE2  . GLU A 1 80  ? 6.206   8.125   -26.826 1.00 0.00 ? 455 GLU A OE2  1  
ATOM 1234  H H    . GLU A 1 80  ? 3.091   9.024   -24.136 1.00 0.00 ? 455 GLU A H    1  
ATOM 1235  H HA   . GLU A 1 80  ? 3.527   9.749   -26.951 1.00 0.00 ? 455 GLU A HA   1  
ATOM 1236  H HB2  . GLU A 1 80  ? 2.110   7.277   -25.980 1.00 0.00 ? 455 GLU A HB2  1  
ATOM 1237  H HB3  . GLU A 1 80  ? 2.828   7.573   -27.557 1.00 0.00 ? 455 GLU A HB3  1  
ATOM 1238  H HG2  . GLU A 1 80  ? 4.526   7.517   -25.097 1.00 0.00 ? 455 GLU A HG2  1  
ATOM 1239  H HG3  . GLU A 1 80  ? 4.035   6.024   -25.892 1.00 0.00 ? 455 GLU A HG3  1  
ATOM 1240  N N    . SER A 1 81  ? 1.235   10.525  -27.457 1.00 0.00 ? 456 SER A N    1  
ATOM 1241  C CA   . SER A 1 81  ? -0.087  11.077  -27.726 1.00 0.00 ? 456 SER A CA   1  
ATOM 1242  C C    . SER A 1 81  ? -1.058  9.976   -28.135 1.00 0.00 ? 456 SER A C    1  
ATOM 1243  O O    . SER A 1 81  ? -2.231  9.997   -27.761 1.00 0.00 ? 456 SER A O    1  
ATOM 1244  C CB   . SER A 1 81  ? -0.006  12.138  -28.825 1.00 0.00 ? 456 SER A CB   1  
ATOM 1245  O OG   . SER A 1 81  ? 0.658   13.302  -28.365 1.00 0.00 ? 456 SER A OG   1  
ATOM 1246  H H    . SER A 1 81  ? 1.968   10.715  -28.079 1.00 0.00 ? 456 SER A H    1  
ATOM 1247  H HA   . SER A 1 81  ? -0.445  11.539  -26.818 1.00 0.00 ? 456 SER A HA   1  
ATOM 1248  H HB2  . SER A 1 81  ? 0.538   11.738  -29.669 1.00 0.00 ? 456 SER A HB2  1  
ATOM 1249  H HB3  . SER A 1 81  ? -1.005  12.406  -29.137 1.00 0.00 ? 456 SER A HB3  1  
ATOM 1250  H HG   . SER A 1 81  ? 1.210   13.654  -29.066 1.00 0.00 ? 456 SER A HG   1  
ATOM 1251  N N    . THR A 1 82  ? -0.559  9.012   -28.901 1.00 0.00 ? 457 THR A N    1  
ATOM 1252  C CA   . THR A 1 82  ? -1.379  7.896   -29.358 1.00 0.00 ? 457 THR A CA   1  
ATOM 1253  C C    . THR A 1 82  ? -1.056  6.634   -28.566 1.00 0.00 ? 457 THR A C    1  
ATOM 1254  O O    . THR A 1 82  ? 0.086   6.176   -28.549 1.00 0.00 ? 457 THR A O    1  
ATOM 1255  C CB   . THR A 1 82  ? -1.154  7.648   -30.851 1.00 0.00 ? 457 THR A CB   1  
ATOM 1256  O OG1  . THR A 1 82  ? 0.223   7.735   -31.171 1.00 0.00 ? 457 THR A OG1  1  
ATOM 1257  C CG2  . THR A 1 82  ? -1.894  8.627   -31.737 1.00 0.00 ? 457 THR A CG2  1  
ATOM 1258  H H    . THR A 1 82  ? 0.384   9.049   -29.162 1.00 0.00 ? 457 THR A H    1  
ATOM 1259  H HA   . THR A 1 82  ? -2.415  8.155   -29.195 1.00 0.00 ? 457 THR A HA   1  
ATOM 1260  H HB   . THR A 1 82  ? -1.498  6.654   -31.095 1.00 0.00 ? 457 THR A HB   1  
ATOM 1261  H HG1  . THR A 1 82  ? 0.732   7.228   -30.534 1.00 0.00 ? 457 THR A HG1  1  
ATOM 1262  H HG21 . THR A 1 82  ? -2.378  9.374   -31.125 1.00 0.00 ? 457 THR A HG21 1  
ATOM 1263  H HG22 . THR A 1 82  ? -1.195  9.107   -32.406 1.00 0.00 ? 457 THR A HG22 1  
ATOM 1264  H HG23 . THR A 1 82  ? -2.638  8.097   -32.314 1.00 0.00 ? 457 THR A HG23 1  
ATOM 1265  N N    . LEU A 1 83  ? -2.067  6.079   -27.908 1.00 0.00 ? 458 LEU A N    1  
ATOM 1266  C CA   . LEU A 1 83  ? -1.885  4.873   -27.108 1.00 0.00 ? 458 LEU A CA   1  
ATOM 1267  C C    . LEU A 1 83  ? -2.516  3.662   -27.788 1.00 0.00 ? 458 LEU A C    1  
ATOM 1268  O O    . LEU A 1 83  ? -3.679  3.696   -28.189 1.00 0.00 ? 458 LEU A O    1  
ATOM 1269  C CB   . LEU A 1 83  ? -2.490  5.063   -25.717 1.00 0.00 ? 458 LEU A CB   1  
ATOM 1270  C CG   . LEU A 1 83  ? -2.263  6.442   -25.094 1.00 0.00 ? 458 LEU A CG   1  
ATOM 1271  C CD1  . LEU A 1 83  ? -2.774  6.470   -23.661 1.00 0.00 ? 458 LEU A CD1  1  
ATOM 1272  C CD2  . LEU A 1 83  ? -0.787  6.815   -25.144 1.00 0.00 ? 458 LEU A CD2  1  
ATOM 1273  H H    . LEU A 1 83  ? -2.954  6.491   -27.955 1.00 0.00 ? 458 LEU A H    1  
ATOM 1274  H HA   . LEU A 1 83  ? -0.824  4.700   -27.008 1.00 0.00 ? 458 LEU A HA   1  
ATOM 1275  H HB2  . LEU A 1 83  ? -3.554  4.892   -25.784 1.00 0.00 ? 458 LEU A HB2  1  
ATOM 1276  H HB3  . LEU A 1 83  ? -2.064  4.322   -25.058 1.00 0.00 ? 458 LEU A HB3  1  
ATOM 1277  H HG   . LEU A 1 83  ? -2.814  7.179   -25.659 1.00 0.00 ? 458 LEU A HG   1  
ATOM 1278  H HD11 . LEU A 1 83  ? -2.712  5.478   -23.237 1.00 0.00 ? 458 LEU A HD11 1  
ATOM 1279  H HD12 . LEU A 1 83  ? -2.170  7.149   -23.077 1.00 0.00 ? 458 LEU A HD12 1  
ATOM 1280  H HD13 . LEU A 1 83  ? -3.801  6.802   -23.652 1.00 0.00 ? 458 LEU A HD13 1  
ATOM 1281  H HD21 . LEU A 1 83  ? -0.515  7.331   -24.235 1.00 0.00 ? 458 LEU A HD21 1  
ATOM 1282  H HD22 . LEU A 1 83  ? -0.193  5.919   -25.242 1.00 0.00 ? 458 LEU A HD22 1  
ATOM 1283  H HD23 . LEU A 1 83  ? -0.609  7.459   -25.992 1.00 0.00 ? 458 LEU A HD23 1  
ATOM 1284  N N    . ASN A 1 84  ? -1.738  2.592   -27.910 1.00 0.00 ? 459 ASN A N    1  
ATOM 1285  C CA   . ASN A 1 84  ? -2.214  1.364   -28.535 1.00 0.00 ? 459 ASN A CA   1  
ATOM 1286  C C    . ASN A 1 84  ? -1.963  0.166   -27.626 1.00 0.00 ? 459 ASN A C    1  
ATOM 1287  O O    . ASN A 1 84  ? -0.968  -0.542  -27.776 1.00 0.00 ? 459 ASN A O    1  
ATOM 1288  C CB   . ASN A 1 84  ? -1.525  1.150   -29.884 1.00 0.00 ? 459 ASN A CB   1  
ATOM 1289  C CG   . ASN A 1 84  ? -1.936  2.185   -30.913 1.00 0.00 ? 459 ASN A CG   1  
ATOM 1290  O OD1  . ASN A 1 84  ? -2.616  1.870   -31.889 1.00 0.00 ? 459 ASN A OD1  1  
ATOM 1291  N ND2  . ASN A 1 84  ? -1.523  3.428   -30.700 1.00 0.00 ? 459 ASN A ND2  1  
ATOM 1292  H H    . ASN A 1 84  ? -0.820  2.628   -27.568 1.00 0.00 ? 459 ASN A H    1  
ATOM 1293  H HA   . ASN A 1 84  ? -3.277  1.464   -28.694 1.00 0.00 ? 459 ASN A HA   1  
ATOM 1294  H HB2  . ASN A 1 84  ? -0.456  1.208   -29.749 1.00 0.00 ? 459 ASN A HB2  1  
ATOM 1295  H HB3  . ASN A 1 84  ? -1.783  0.171   -30.261 1.00 0.00 ? 459 ASN A HB3  1  
ATOM 1296  H HD21 . ASN A 1 84  ? -0.983  3.607   -29.902 1.00 0.00 ? 459 ASN A HD21 1  
ATOM 1297  H HD22 . ASN A 1 84  ? -1.775  4.117   -31.351 1.00 0.00 ? 459 ASN A HD22 1  
ATOM 1298  N N    . MET A 1 85  ? -2.870  -0.050  -26.678 1.00 0.00 ? 460 MET A N    1  
ATOM 1299  C CA   . MET A 1 85  ? -2.745  -1.158  -25.738 1.00 0.00 ? 460 MET A CA   1  
ATOM 1300  C C    . MET A 1 85  ? -3.422  -2.413  -26.279 1.00 0.00 ? 460 MET A C    1  
ATOM 1301  O O    . MET A 1 85  ? -4.525  -2.351  -26.822 1.00 0.00 ? 460 MET A O    1  
ATOM 1302  C CB   . MET A 1 85  ? -3.355  -0.777  -24.388 1.00 0.00 ? 460 MET A CB   1  
ATOM 1303  C CG   . MET A 1 85  ? -2.893  0.576   -23.871 1.00 0.00 ? 460 MET A CG   1  
ATOM 1304  S SD   . MET A 1 85  ? -4.219  1.512   -23.086 1.00 0.00 ? 460 MET A SD   1  
ATOM 1305  C CE   . MET A 1 85  ? -4.177  3.028   -24.037 1.00 0.00 ? 460 MET A CE   1  
ATOM 1306  H H    . MET A 1 85  ? -3.640  0.552   -26.606 1.00 0.00 ? 460 MET A H    1  
ATOM 1307  H HA   . MET A 1 85  ? -1.694  -1.361  -25.603 1.00 0.00 ? 460 MET A HA   1  
ATOM 1308  H HB2  . MET A 1 85  ? -4.430  -0.753  -24.487 1.00 0.00 ? 460 MET A HB2  1  
ATOM 1309  H HB3  . MET A 1 85  ? -3.086  -1.528  -23.660 1.00 0.00 ? 460 MET A HB3  1  
ATOM 1310  H HG2  . MET A 1 85  ? -2.105  0.420   -23.148 1.00 0.00 ? 460 MET A HG2  1  
ATOM 1311  H HG3  . MET A 1 85  ? -2.508  1.151   -24.700 1.00 0.00 ? 460 MET A HG3  1  
ATOM 1312  H HE1  . MET A 1 85  ? -3.890  3.848   -23.396 1.00 0.00 ? 460 MET A HE1  1  
ATOM 1313  H HE2  . MET A 1 85  ? -3.459  2.930   -24.839 1.00 0.00 ? 460 MET A HE2  1  
ATOM 1314  H HE3  . MET A 1 85  ? -5.155  3.220   -24.451 1.00 0.00 ? 460 MET A HE3  1  
ATOM 1315  N N    . VAL A 1 86  ? -2.751  -3.550  -26.127 1.00 0.00 ? 461 VAL A N    1  
ATOM 1316  C CA   . VAL A 1 86  ? -3.285  -4.822  -26.599 1.00 0.00 ? 461 VAL A CA   1  
ATOM 1317  C C    . VAL A 1 86  ? -3.924  -5.607  -25.460 1.00 0.00 ? 461 VAL A C    1  
ATOM 1318  O O    . VAL A 1 86  ? -3.296  -5.846  -24.429 1.00 0.00 ? 461 VAL A O    1  
ATOM 1319  C CB   . VAL A 1 86  ? -2.186  -5.685  -27.248 1.00 0.00 ? 461 VAL A CB   1  
ATOM 1320  C CG1  . VAL A 1 86  ? -2.790  -6.918  -27.902 1.00 0.00 ? 461 VAL A CG1  1  
ATOM 1321  C CG2  . VAL A 1 86  ? -1.388  -4.871  -28.257 1.00 0.00 ? 461 VAL A CG2  1  
ATOM 1322  H H    . VAL A 1 86  ? -1.876  -3.533  -25.686 1.00 0.00 ? 461 VAL A H    1  
ATOM 1323  H HA   . VAL A 1 86  ? -4.036  -4.611  -27.346 1.00 0.00 ? 461 VAL A HA   1  
ATOM 1324  H HB   . VAL A 1 86  ? -1.512  -6.013  -26.471 1.00 0.00 ? 461 VAL A HB   1  
ATOM 1325  H HG11 . VAL A 1 86  ? -3.776  -7.094  -27.497 1.00 0.00 ? 461 VAL A HG11 1  
ATOM 1326  H HG12 . VAL A 1 86  ? -2.862  -6.761  -28.968 1.00 0.00 ? 461 VAL A HG12 1  
ATOM 1327  H HG13 . VAL A 1 86  ? -2.163  -7.774  -27.706 1.00 0.00 ? 461 VAL A HG13 1  
ATOM 1328  H HG21 . VAL A 1 86  ? -1.569  -5.250  -29.252 1.00 0.00 ? 461 VAL A HG21 1  
ATOM 1329  H HG22 . VAL A 1 86  ? -1.693  -3.835  -28.207 1.00 0.00 ? 461 VAL A HG22 1  
ATOM 1330  H HG23 . VAL A 1 86  ? -0.335  -4.946  -28.029 1.00 0.00 ? 461 VAL A HG23 1  
ATOM 1331  N N    . VAL A 1 87  ? -5.175  -6.011  -25.654 1.00 0.00 ? 462 VAL A N    1  
ATOM 1332  C CA   . VAL A 1 87  ? -5.896  -6.775  -24.642 1.00 0.00 ? 462 VAL A CA   1  
ATOM 1333  C C    . VAL A 1 87  ? -6.343  -8.123  -25.198 1.00 0.00 ? 462 VAL A C    1  
ATOM 1334  O O    . VAL A 1 87  ? -6.946  -8.193  -26.268 1.00 0.00 ? 462 VAL A O    1  
ATOM 1335  C CB   . VAL A 1 87  ? -7.130  -6.009  -24.123 1.00 0.00 ? 462 VAL A CB   1  
ATOM 1336  C CG1  . VAL A 1 87  ? -7.692  -6.683  -22.879 1.00 0.00 ? 462 VAL A CG1  1  
ATOM 1337  C CG2  . VAL A 1 87  ? -6.782  -4.553  -23.840 1.00 0.00 ? 462 VAL A CG2  1  
ATOM 1338  H H    . VAL A 1 87  ? -5.624  -5.793  -26.499 1.00 0.00 ? 462 VAL A H    1  
ATOM 1339  H HA   . VAL A 1 87  ? -5.227  -6.944  -23.811 1.00 0.00 ? 462 VAL A HA   1  
ATOM 1340  H HB   . VAL A 1 87  ? -7.890  -6.033  -24.891 1.00 0.00 ? 462 VAL A HB   1  
ATOM 1341  H HG11 . VAL A 1 87  ? -7.328  -7.697  -22.824 1.00 0.00 ? 462 VAL A HG11 1  
ATOM 1342  H HG12 . VAL A 1 87  ? -7.375  -6.138  -22.002 1.00 0.00 ? 462 VAL A HG12 1  
ATOM 1343  H HG13 . VAL A 1 87  ? -8.770  -6.690  -22.930 1.00 0.00 ? 462 VAL A HG13 1  
ATOM 1344  H HG21 . VAL A 1 87  ? -6.900  -4.352  -22.785 1.00 0.00 ? 462 VAL A HG21 1  
ATOM 1345  H HG22 . VAL A 1 87  ? -5.760  -4.362  -24.130 1.00 0.00 ? 462 VAL A HG22 1  
ATOM 1346  H HG23 . VAL A 1 87  ? -7.441  -3.910  -24.405 1.00 0.00 ? 462 VAL A HG23 1  
ATOM 1347  N N    . ARG A 1 88  ? -6.037  -9.189  -24.468 1.00 0.00 ? 463 ARG A N    1  
ATOM 1348  C CA   . ARG A 1 88  ? -6.403  -10.534 -24.894 1.00 0.00 ? 463 ARG A CA   1  
ATOM 1349  C C    . ARG A 1 88  ? -7.782  -10.923 -24.370 1.00 0.00 ? 463 ARG A C    1  
ATOM 1350  O O    . ARG A 1 88  ? -8.015  -10.946 -23.162 1.00 0.00 ? 463 ARG A O    1  
ATOM 1351  C CB   . ARG A 1 88  ? -5.360  -11.546 -24.416 1.00 0.00 ? 463 ARG A CB   1  
ATOM 1352  C CG   . ARG A 1 88  ? -5.542  -12.933 -25.009 1.00 0.00 ? 463 ARG A CG   1  
ATOM 1353  C CD   . ARG A 1 88  ? -6.237  -13.873 -24.036 1.00 0.00 ? 463 ARG A CD   1  
ATOM 1354  N NE   . ARG A 1 88  ? -5.292  -14.515 -23.123 1.00 0.00 ? 463 ARG A NE   1  
ATOM 1355  C CZ   . ARG A 1 88  ? -5.086  -14.128 -21.864 1.00 0.00 ? 463 ARG A CZ   1  
ATOM 1356  N NH1  . ARG A 1 88  ? -5.744  -13.090 -21.358 1.00 0.00 ? 463 ARG A NH1  1  
ATOM 1357  N NH2  . ARG A 1 88  ? -4.216  -14.781 -21.107 1.00 0.00 ? 463 ARG A NH2  1  
ATOM 1358  H H    . ARG A 1 88  ? -5.550  -9.070  -23.626 1.00 0.00 ? 463 ARG A H    1  
ATOM 1359  H HA   . ARG A 1 88  ? -6.428  -10.543 -25.975 1.00 0.00 ? 463 ARG A HA   1  
ATOM 1360  H HB2  . ARG A 1 88  ? -4.378  -11.188 -24.687 1.00 0.00 ? 463 ARG A HB2  1  
ATOM 1361  H HB3  . ARG A 1 88  ? -5.420  -11.626 -23.341 1.00 0.00 ? 463 ARG A HB3  1  
ATOM 1362  H HG2  . ARG A 1 88  ? -6.140  -12.855 -25.905 1.00 0.00 ? 463 ARG A HG2  1  
ATOM 1363  H HG3  . ARG A 1 88  ? -4.572  -13.337 -25.257 1.00 0.00 ? 463 ARG A HG3  1  
ATOM 1364  H HD2  . ARG A 1 88  ? -6.957  -13.311 -23.463 1.00 0.00 ? 463 ARG A HD2  1  
ATOM 1365  H HD3  . ARG A 1 88  ? -6.749  -14.637 -24.602 1.00 0.00 ? 463 ARG A HD3  1  
ATOM 1366  H HE   . ARG A 1 88  ? -4.784  -15.279 -23.465 1.00 0.00 ? 463 ARG A HE   1  
ATOM 1367  H HH11 . ARG A 1 88  ? -6.399  -12.588 -21.919 1.00 0.00 ? 463 ARG A HH11 1  
ATOM 1368  H HH12 . ARG A 1 88  ? -5.581  -12.811 -20.412 1.00 0.00 ? 463 ARG A HH12 1  
ATOM 1369  H HH21 . ARG A 1 88  ? -3.715  -15.562 -21.481 1.00 0.00 ? 463 ARG A HH21 1  
ATOM 1370  H HH22 . ARG A 1 88  ? -4.060  -14.494 -20.162 1.00 0.00 ? 463 ARG A HH22 1  
ATOM 1371  N N    . ARG A 1 89  ? -8.689  -11.234 -25.290 1.00 0.00 ? 464 ARG A N    1  
ATOM 1372  C CA   . ARG A 1 89  ? -10.045 -11.627 -24.926 1.00 0.00 ? 464 ARG A CA   1  
ATOM 1373  C C    . ARG A 1 89  ? -10.388 -12.988 -25.524 1.00 0.00 ? 464 ARG A C    1  
ATOM 1374  O O    . ARG A 1 89  ? -10.219 -13.211 -26.723 1.00 0.00 ? 464 ARG A O    1  
ATOM 1375  C CB   . ARG A 1 89  ? -11.051 -10.578 -25.403 1.00 0.00 ? 464 ARG A CB   1  
ATOM 1376  C CG   . ARG A 1 89  ? -11.049 -9.308  -24.568 1.00 0.00 ? 464 ARG A CG   1  
ATOM 1377  C CD   . ARG A 1 89  ? -12.017 -8.274  -25.123 1.00 0.00 ? 464 ARG A CD   1  
ATOM 1378  N NE   . ARG A 1 89  ? -11.946 -7.010  -24.395 1.00 0.00 ? 464 ARG A NE   1  
ATOM 1379  C CZ   . ARG A 1 89  ? -12.888 -6.072  -24.446 1.00 0.00 ? 464 ARG A CZ   1  
ATOM 1380  N NH1  . ARG A 1 89  ? -13.974 -6.251  -25.188 1.00 0.00 ? 464 ARG A NH1  1  
ATOM 1381  N NH2  . ARG A 1 89  ? -12.745 -4.950  -23.753 1.00 0.00 ? 464 ARG A NH2  1  
ATOM 1382  H H    . ARG A 1 89  ? -8.441  -11.199 -26.237 1.00 0.00 ? 464 ARG A H    1  
ATOM 1383  H HA   . ARG A 1 89  ? -10.093 -11.696 -23.850 1.00 0.00 ? 464 ARG A HA   1  
ATOM 1384  H HB2  . ARG A 1 89  ? -10.820 -10.311 -26.424 1.00 0.00 ? 464 ARG A HB2  1  
ATOM 1385  H HB3  . ARG A 1 89  ? -12.043 -11.003 -25.369 1.00 0.00 ? 464 ARG A HB3  1  
ATOM 1386  H HG2  . ARG A 1 89  ? -11.339 -9.552  -23.558 1.00 0.00 ? 464 ARG A HG2  1  
ATOM 1387  H HG3  . ARG A 1 89  ? -10.053 -8.891  -24.568 1.00 0.00 ? 464 ARG A HG3  1  
ATOM 1388  H HD2  . ARG A 1 89  ? -11.776 -8.095  -26.160 1.00 0.00 ? 464 ARG A HD2  1  
ATOM 1389  H HD3  . ARG A 1 89  ? -13.021 -8.665  -25.050 1.00 0.00 ? 464 ARG A HD3  1  
ATOM 1390  H HE   . ARG A 1 89  ? -11.155 -6.852  -23.840 1.00 0.00 ? 464 ARG A HE   1  
ATOM 1391  H HH11 . ARG A 1 89  ? -14.088 -7.095  -25.712 1.00 0.00 ? 464 ARG A HH11 1  
ATOM 1392  H HH12 . ARG A 1 89  ? -14.680 -5.543  -25.221 1.00 0.00 ? 464 ARG A HH12 1  
ATOM 1393  H HH21 . ARG A 1 89  ? -11.930 -4.809  -23.192 1.00 0.00 ? 464 ARG A HH21 1  
ATOM 1394  H HH22 . ARG A 1 89  ? -13.454 -4.246  -23.791 1.00 0.00 ? 464 ARG A HH22 1  
ATOM 1395  N N    . GLY A 1 90  ? -10.868 -13.896 -24.680 1.00 0.00 ? 465 GLY A N    1  
ATOM 1396  C CA   . GLY A 1 90  ? -11.222 -15.223 -25.146 1.00 0.00 ? 465 GLY A CA   1  
ATOM 1397  C C    . GLY A 1 90  ? -10.004 -16.053 -25.502 1.00 0.00 ? 465 GLY A C    1  
ATOM 1398  O O    . GLY A 1 90  ? -9.334  -16.594 -24.622 1.00 0.00 ? 465 GLY A O    1  
ATOM 1399  H H    . GLY A 1 90  ? -10.979 -13.664 -23.735 1.00 0.00 ? 465 GLY A H    1  
ATOM 1400  H HA2  . GLY A 1 90  ? -11.777 -15.730 -24.372 1.00 0.00 ? 465 GLY A HA2  1  
ATOM 1401  H HA3  . GLY A 1 90  ? -11.848 -15.130 -26.022 1.00 0.00 ? 465 GLY A HA3  1  
ATOM 1402  N N    . ASN A 1 91  ? -9.715  -16.150 -26.795 1.00 0.00 ? 466 ASN A N    1  
ATOM 1403  C CA   . ASN A 1 91  ? -8.567  -16.917 -27.267 1.00 0.00 ? 466 ASN A CA   1  
ATOM 1404  C C    . ASN A 1 91  ? -7.863  -16.193 -28.412 1.00 0.00 ? 466 ASN A C    1  
ATOM 1405  O O    . ASN A 1 91  ? -7.183  -16.816 -29.226 1.00 0.00 ? 466 ASN A O    1  
ATOM 1406  C CB   . ASN A 1 91  ? -9.012  -18.306 -27.726 1.00 0.00 ? 466 ASN A CB   1  
ATOM 1407  C CG   . ASN A 1 91  ? -7.848  -19.269 -27.866 1.00 0.00 ? 466 ASN A CG   1  
ATOM 1408  O OD1  . ASN A 1 91  ? -7.575  -19.776 -28.954 1.00 0.00 ? 466 ASN A OD1  1  
ATOM 1409  N ND2  . ASN A 1 91  ? -7.156  -19.525 -26.762 1.00 0.00 ? 466 ASN A ND2  1  
ATOM 1410  H H    . ASN A 1 91  ? -10.285 -15.693 -27.448 1.00 0.00 ? 466 ASN A H    1  
ATOM 1411  H HA   . ASN A 1 91  ? -7.877  -17.022 -26.444 1.00 0.00 ? 466 ASN A HA   1  
ATOM 1412  H HB2  . ASN A 1 91  ? -9.705  -18.712 -27.006 1.00 0.00 ? 466 ASN A HB2  1  
ATOM 1413  H HB3  . ASN A 1 91  ? -9.503  -18.222 -28.685 1.00 0.00 ? 466 ASN A HB3  1  
ATOM 1414  H HD21 . ASN A 1 91  ? -7.431  -19.084 -25.931 1.00 0.00 ? 466 ASN A HD21 1  
ATOM 1415  H HD22 . ASN A 1 91  ? -6.398  -20.143 -26.825 1.00 0.00 ? 466 ASN A HD22 1  
ATOM 1416  N N    . GLU A 1 92  ? -8.035  -14.875 -28.471 1.00 0.00 ? 467 GLU A N    1  
ATOM 1417  C CA   . GLU A 1 92  ? -7.420  -14.072 -29.519 1.00 0.00 ? 467 GLU A CA   1  
ATOM 1418  C C    . GLU A 1 92  ? -6.939  -12.731 -28.974 1.00 0.00 ? 467 GLU A C    1  
ATOM 1419  O O    . GLU A 1 92  ? -7.532  -12.175 -28.049 1.00 0.00 ? 467 GLU A O    1  
ATOM 1420  C CB   . GLU A 1 92  ? -8.421  -13.844 -30.651 1.00 0.00 ? 467 GLU A CB   1  
ATOM 1421  C CG   . GLU A 1 92  ? -9.747  -13.268 -30.179 1.00 0.00 ? 467 GLU A CG   1  
ATOM 1422  C CD   . GLU A 1 92  ? -10.894 -13.611 -31.111 1.00 0.00 ? 467 GLU A CD   1  
ATOM 1423  O OE1  . GLU A 1 92  ? -10.864 -14.705 -31.712 1.00 0.00 ? 467 GLU A OE1  1  
ATOM 1424  O OE2  . GLU A 1 92  ? -11.822 -12.785 -31.239 1.00 0.00 ? 467 GLU A OE2  1  
ATOM 1425  H H    . GLU A 1 92  ? -8.591  -14.434 -27.799 1.00 0.00 ? 467 GLU A H    1  
ATOM 1426  H HA   . GLU A 1 92  ? -6.574  -14.619 -29.904 1.00 0.00 ? 467 GLU A HA   1  
ATOM 1427  H HB2  . GLU A 1 92  ? -7.990  -13.161 -31.366 1.00 0.00 ? 467 GLU A HB2  1  
ATOM 1428  H HB3  . GLU A 1 92  ? -8.616  -14.787 -31.137 1.00 0.00 ? 467 GLU A HB3  1  
ATOM 1429  H HG2  . GLU A 1 92  ? -9.970  -13.666 -29.200 1.00 0.00 ? 467 GLU A HG2  1  
ATOM 1430  H HG3  . GLU A 1 92  ? -9.659  -12.194 -30.121 1.00 0.00 ? 467 GLU A HG3  1  
ATOM 1431  N N    . ASP A 1 93  ? -5.861  -12.215 -29.557 1.00 0.00 ? 468 ASP A N    1  
ATOM 1432  C CA   . ASP A 1 93  ? -5.302  -10.936 -29.135 1.00 0.00 ? 468 ASP A CA   1  
ATOM 1433  C C    . ASP A 1 93  ? -5.898  -9.794  -29.952 1.00 0.00 ? 468 ASP A C    1  
ATOM 1434  O O    . ASP A 1 93  ? -6.042  -9.900  -31.170 1.00 0.00 ? 468 ASP A O    1  
ATOM 1435  C CB   . ASP A 1 93  ? -3.779  -10.946 -29.282 1.00 0.00 ? 468 ASP A CB   1  
ATOM 1436  C CG   . ASP A 1 93  ? -3.333  -11.397 -30.660 1.00 0.00 ? 468 ASP A CG   1  
ATOM 1437  O OD1  . ASP A 1 93  ? -3.535  -12.584 -30.990 1.00 0.00 ? 468 ASP A OD1  1  
ATOM 1438  O OD2  . ASP A 1 93  ? -2.783  -10.562 -31.408 1.00 0.00 ? 468 ASP A OD2  1  
ATOM 1439  H H    . ASP A 1 93  ? -5.435  -12.704 -30.292 1.00 0.00 ? 468 ASP A H    1  
ATOM 1440  H HA   . ASP A 1 93  ? -5.555  -10.790 -28.096 1.00 0.00 ? 468 ASP A HA   1  
ATOM 1441  H HB2  . ASP A 1 93  ? -3.401  -9.950  -29.111 1.00 0.00 ? 468 ASP A HB2  1  
ATOM 1442  H HB3  . ASP A 1 93  ? -3.358  -11.618 -28.550 1.00 0.00 ? 468 ASP A HB3  1  
ATOM 1443  N N    . ILE A 1 94  ? -6.250  -8.705  -29.276 1.00 0.00 ? 469 ILE A N    1  
ATOM 1444  C CA   . ILE A 1 94  ? -6.838  -7.550  -29.946 1.00 0.00 ? 469 ILE A CA   1  
ATOM 1445  C C    . ILE A 1 94  ? -6.064  -6.275  -29.629 1.00 0.00 ? 469 ILE A C    1  
ATOM 1446  O O    . ILE A 1 94  ? -5.534  -6.113  -28.529 1.00 0.00 ? 469 ILE A O    1  
ATOM 1447  C CB   . ILE A 1 94  ? -8.314  -7.350  -29.543 1.00 0.00 ? 469 ILE A CB   1  
ATOM 1448  C CG1  . ILE A 1 94  ? -9.058  -8.688  -29.527 1.00 0.00 ? 469 ILE A CG1  1  
ATOM 1449  C CG2  . ILE A 1 94  ? -8.993  -6.375  -30.494 1.00 0.00 ? 469 ILE A CG2  1  
ATOM 1450  C CD1  . ILE A 1 94  ? -9.917  -8.886  -28.298 1.00 0.00 ? 469 ILE A CD1  1  
ATOM 1451  H H    . ILE A 1 94  ? -6.116  -8.679  -28.305 1.00 0.00 ? 469 ILE A H    1  
ATOM 1452  H HA   . ILE A 1 94  ? -6.798  -7.727  -31.011 1.00 0.00 ? 469 ILE A HA   1  
ATOM 1453  H HB   . ILE A 1 94  ? -8.338  -6.920  -28.553 1.00 0.00 ? 469 ILE A HB   1  
ATOM 1454  H HG12 . ILE A 1 94  ? -9.702  -8.747  -30.392 1.00 0.00 ? 469 ILE A HG12 1  
ATOM 1455  H HG13 . ILE A 1 94  ? -8.341  -9.494  -29.564 1.00 0.00 ? 469 ILE A HG13 1  
ATOM 1456  H HG21 . ILE A 1 94  ? -8.345  -5.528  -30.664 1.00 0.00 ? 469 ILE A HG21 1  
ATOM 1457  H HG22 . ILE A 1 94  ? -9.194  -6.869  -31.433 1.00 0.00 ? 469 ILE A HG22 1  
ATOM 1458  H HG23 . ILE A 1 94  ? -9.922  -6.036  -30.059 1.00 0.00 ? 469 ILE A HG23 1  
ATOM 1459  H HD11 . ILE A 1 94  ? -9.417  -9.555  -27.613 1.00 0.00 ? 469 ILE A HD11 1  
ATOM 1460  H HD12 . ILE A 1 94  ? -10.080 -7.934  -27.815 1.00 0.00 ? 469 ILE A HD12 1  
ATOM 1461  H HD13 . ILE A 1 94  ? -10.867 -9.312  -28.587 1.00 0.00 ? 469 ILE A HD13 1  
ATOM 1462  N N    . MET A 1 95  ? -6.008  -5.369  -30.600 1.00 0.00 ? 470 MET A N    1  
ATOM 1463  C CA   . MET A 1 95  ? -5.304  -4.104  -30.427 1.00 0.00 ? 470 MET A CA   1  
ATOM 1464  C C    . MET A 1 95  ? -6.291  -2.973  -30.157 1.00 0.00 ? 470 MET A C    1  
ATOM 1465  O O    . MET A 1 95  ? -7.164  -2.690  -30.977 1.00 0.00 ? 470 MET A O    1  
ATOM 1466  C CB   . MET A 1 95  ? -4.468  -3.785  -31.669 1.00 0.00 ? 470 MET A CB   1  
ATOM 1467  C CG   . MET A 1 95  ? -3.003  -4.168  -31.532 1.00 0.00 ? 470 MET A CG   1  
ATOM 1468  S SD   . MET A 1 95  ? -2.372  -5.041  -32.979 1.00 0.00 ? 470 MET A SD   1  
ATOM 1469  C CE   . MET A 1 95  ? -2.204  -6.700  -32.325 1.00 0.00 ? 470 MET A CE   1  
ATOM 1470  H H    . MET A 1 95  ? -6.453  -5.554  -31.454 1.00 0.00 ? 470 MET A H    1  
ATOM 1471  H HA   . MET A 1 95  ? -4.647  -4.203  -29.576 1.00 0.00 ? 470 MET A HA   1  
ATOM 1472  H HB2  . MET A 1 95  ? -4.882  -4.319  -32.512 1.00 0.00 ? 470 MET A HB2  1  
ATOM 1473  H HB3  . MET A 1 95  ? -4.523  -2.724  -31.865 1.00 0.00 ? 470 MET A HB3  1  
ATOM 1474  H HG2  . MET A 1 95  ? -2.422  -3.269  -31.391 1.00 0.00 ? 470 MET A HG2  1  
ATOM 1475  H HG3  . MET A 1 95  ? -2.892  -4.806  -30.667 1.00 0.00 ? 470 MET A HG3  1  
ATOM 1476  H HE1  . MET A 1 95  ? -1.266  -6.785  -31.798 1.00 0.00 ? 470 MET A HE1  1  
ATOM 1477  H HE2  . MET A 1 95  ? -3.019  -6.904  -31.647 1.00 0.00 ? 470 MET A HE2  1  
ATOM 1478  H HE3  . MET A 1 95  ? -2.225  -7.411  -33.139 1.00 0.00 ? 470 MET A HE3  1  
ATOM 1479  N N    . ILE A 1 96  ? -6.148  -2.331  -29.003 1.00 0.00 ? 471 ILE A N    1  
ATOM 1480  C CA   . ILE A 1 96  ? -7.029  -1.233  -28.627 1.00 0.00 ? 471 ILE A CA   1  
ATOM 1481  C C    . ILE A 1 96  ? -6.308  0.106   -28.719 1.00 0.00 ? 471 ILE A C    1  
ATOM 1482  O O    . ILE A 1 96  ? -5.178  0.248   -28.248 1.00 0.00 ? 471 ILE A O    1  
ATOM 1483  C CB   . ILE A 1 96  ? -7.577  -1.410  -27.197 1.00 0.00 ? 471 ILE A CB   1  
ATOM 1484  C CG1  . ILE A 1 96  ? -7.977  -2.866  -26.953 1.00 0.00 ? 471 ILE A CG1  1  
ATOM 1485  C CG2  . ILE A 1 96  ? -8.763  -0.486  -26.967 1.00 0.00 ? 471 ILE A CG2  1  
ATOM 1486  C CD1  . ILE A 1 96  ? -9.006  -3.383  -27.936 1.00 0.00 ? 471 ILE A CD1  1  
ATOM 1487  H H    . ILE A 1 96  ? -5.434  -2.603  -28.390 1.00 0.00 ? 471 ILE A H    1  
ATOM 1488  H HA   . ILE A 1 96  ? -7.865  -1.226  -29.312 1.00 0.00 ? 471 ILE A HA   1  
ATOM 1489  H HB   . ILE A 1 96  ? -6.800  -1.136  -26.501 1.00 0.00 ? 471 ILE A HB   1  
ATOM 1490  H HG12 . ILE A 1 96  ? -7.101  -3.492  -27.033 1.00 0.00 ? 471 ILE A HG12 1  
ATOM 1491  H HG13 . ILE A 1 96  ? -8.390  -2.958  -25.959 1.00 0.00 ? 471 ILE A HG13 1  
ATOM 1492  H HG21 . ILE A 1 96  ? -9.380  -0.463  -27.854 1.00 0.00 ? 471 ILE A HG21 1  
ATOM 1493  H HG22 . ILE A 1 96  ? -9.346  -0.849  -26.133 1.00 0.00 ? 471 ILE A HG22 1  
ATOM 1494  H HG23 . ILE A 1 96  ? -8.407  0.510   -26.751 1.00 0.00 ? 471 ILE A HG23 1  
ATOM 1495  H HD11 . ILE A 1 96  ? -9.872  -3.737  -27.396 1.00 0.00 ? 471 ILE A HD11 1  
ATOM 1496  H HD12 . ILE A 1 96  ? -9.298  -2.586  -28.603 1.00 0.00 ? 471 ILE A HD12 1  
ATOM 1497  H HD13 . ILE A 1 96  ? -8.581  -4.195  -28.507 1.00 0.00 ? 471 ILE A HD13 1  
ATOM 1498  N N    . THR A 1 97  ? -6.964  1.086   -29.329 1.00 0.00 ? 472 THR A N    1  
ATOM 1499  C CA   . THR A 1 97  ? -6.384  2.414   -29.485 1.00 0.00 ? 472 THR A CA   1  
ATOM 1500  C C    . THR A 1 97  ? -7.173  3.450   -28.691 1.00 0.00 ? 472 THR A C    1  
ATOM 1501  O O    . THR A 1 97  ? -8.389  3.567   -28.838 1.00 0.00 ? 472 THR A O    1  
ATOM 1502  C CB   . THR A 1 97  ? -6.350  2.803   -30.962 1.00 0.00 ? 472 THR A CB   1  
ATOM 1503  O OG1  . THR A 1 97  ? -6.340  1.651   -31.786 1.00 0.00 ? 472 THR A OG1  1  
ATOM 1504  C CG2  . THR A 1 97  ? -5.145  3.641   -31.333 1.00 0.00 ? 472 THR A CG2  1  
ATOM 1505  H H    . THR A 1 97  ? -7.861  0.910   -29.685 1.00 0.00 ? 472 THR A H    1  
ATOM 1506  H HA   . THR A 1 97  ? -5.374  2.380   -29.107 1.00 0.00 ? 472 THR A HA   1  
ATOM 1507  H HB   . THR A 1 97  ? -7.235  3.378   -31.194 1.00 0.00 ? 472 THR A HB   1  
ATOM 1508  H HG1  . THR A 1 97  ? -5.596  1.092   -31.546 1.00 0.00 ? 472 THR A HG1  1  
ATOM 1509  H HG21 . THR A 1 97  ? -4.606  3.912   -30.438 1.00 0.00 ? 472 THR A HG21 1  
ATOM 1510  H HG22 . THR A 1 97  ? -4.499  3.072   -31.984 1.00 0.00 ? 472 THR A HG22 1  
ATOM 1511  H HG23 . THR A 1 97  ? -5.471  4.536   -31.842 1.00 0.00 ? 472 THR A HG23 1  
ATOM 1512  N N    . VAL A 1 98  ? -6.469  4.200   -27.848 1.00 0.00 ? 473 VAL A N    1  
ATOM 1513  C CA   . VAL A 1 98  ? -7.101  5.229   -27.031 1.00 0.00 ? 473 VAL A CA   1  
ATOM 1514  C C    . VAL A 1 98  ? -6.277  6.512   -27.033 1.00 0.00 ? 473 VAL A C    1  
ATOM 1515  O O    . VAL A 1 98  ? -5.068  6.484   -26.802 1.00 0.00 ? 473 VAL A O    1  
ATOM 1516  C CB   . VAL A 1 98  ? -7.290  4.758   -25.577 1.00 0.00 ? 473 VAL A CB   1  
ATOM 1517  C CG1  . VAL A 1 98  ? -8.136  5.752   -24.797 1.00 0.00 ? 473 VAL A CG1  1  
ATOM 1518  C CG2  . VAL A 1 98  ? -7.916  3.371   -25.543 1.00 0.00 ? 473 VAL A CG2  1  
ATOM 1519  H H    . VAL A 1 98  ? -5.503  4.060   -27.776 1.00 0.00 ? 473 VAL A H    1  
ATOM 1520  H HA   . VAL A 1 98  ? -8.075  5.438   -27.451 1.00 0.00 ? 473 VAL A HA   1  
ATOM 1521  H HB   . VAL A 1 98  ? -6.319  4.702   -25.109 1.00 0.00 ? 473 VAL A HB   1  
ATOM 1522  H HG11 . VAL A 1 98  ? -8.190  6.685   -25.340 1.00 0.00 ? 473 VAL A HG11 1  
ATOM 1523  H HG12 . VAL A 1 98  ? -9.133  5.355   -24.667 1.00 0.00 ? 473 VAL A HG12 1  
ATOM 1524  H HG13 . VAL A 1 98  ? -7.689  5.924   -23.830 1.00 0.00 ? 473 VAL A HG13 1  
ATOM 1525  H HG21 . VAL A 1 98  ? -8.974  3.448   -25.750 1.00 0.00 ? 473 VAL A HG21 1  
ATOM 1526  H HG22 . VAL A 1 98  ? -7.448  2.746   -26.289 1.00 0.00 ? 473 VAL A HG22 1  
ATOM 1527  H HG23 . VAL A 1 98  ? -7.771  2.935   -24.565 1.00 0.00 ? 473 VAL A HG23 1  
ATOM 1528  N N    . ILE A 1 99  ? -6.936  7.635   -27.296 1.00 0.00 ? 474 ILE A N    1  
ATOM 1529  C CA   . ILE A 1 99  ? -6.258  8.925   -27.328 1.00 0.00 ? 474 ILE A CA   1  
ATOM 1530  C C    . ILE A 1 99  ? -6.579  9.748   -26.079 1.00 0.00 ? 474 ILE A C    1  
ATOM 1531  O O    . ILE A 1 99  ? -7.705  10.216  -25.913 1.00 0.00 ? 474 ILE A O    1  
ATOM 1532  C CB   . ILE A 1 99  ? -6.652  9.735   -28.578 1.00 0.00 ? 474 ILE A CB   1  
ATOM 1533  C CG1  . ILE A 1 99  ? -6.510  8.874   -29.834 1.00 0.00 ? 474 ILE A CG1  1  
ATOM 1534  C CG2  . ILE A 1 99  ? -5.798  10.989  -28.690 1.00 0.00 ? 474 ILE A CG2  1  
ATOM 1535  C CD1  . ILE A 1 99  ? -5.113  8.327   -30.036 1.00 0.00 ? 474 ILE A CD1  1  
ATOM 1536  H H    . ILE A 1 99  ? -7.899  7.595   -27.474 1.00 0.00 ? 474 ILE A H    1  
ATOM 1537  H HA   . ILE A 1 99  ? -5.196  8.739   -27.368 1.00 0.00 ? 474 ILE A HA   1  
ATOM 1538  H HB   . ILE A 1 99  ? -7.683  10.038  -28.474 1.00 0.00 ? 474 ILE A HB   1  
ATOM 1539  H HG12 . ILE A 1 99  ? -7.186  8.036   -29.768 1.00 0.00 ? 474 ILE A HG12 1  
ATOM 1540  H HG13 . ILE A 1 99  ? -6.762  9.468   -30.701 1.00 0.00 ? 474 ILE A HG13 1  
ATOM 1541  H HG21 . ILE A 1 99  ? -4.781  10.758  -28.411 1.00 0.00 ? 474 ILE A HG21 1  
ATOM 1542  H HG22 . ILE A 1 99  ? -5.820  11.350  -29.708 1.00 0.00 ? 474 ILE A HG22 1  
ATOM 1543  H HG23 . ILE A 1 99  ? -6.189  11.750  -28.029 1.00 0.00 ? 474 ILE A HG23 1  
ATOM 1544  H HD11 . ILE A 1 99  ? -4.428  9.143   -30.215 1.00 0.00 ? 474 ILE A HD11 1  
ATOM 1545  H HD12 . ILE A 1 99  ? -4.807  7.787   -29.153 1.00 0.00 ? 474 ILE A HD12 1  
ATOM 1546  H HD13 . ILE A 1 99  ? -5.106  7.660   -30.885 1.00 0.00 ? 474 ILE A HD13 1  
ATOM 1547  N N    . PRO A 1 100 ? -5.594  9.936   -25.181 1.00 0.00 ? 475 PRO A N    1  
ATOM 1548  C CA   . PRO A 1 100 ? -5.788  10.707  -23.947 1.00 0.00 ? 475 PRO A CA   1  
ATOM 1549  C C    . PRO A 1 100 ? -6.244  12.135  -24.220 1.00 0.00 ? 475 PRO A C    1  
ATOM 1550  O O    . PRO A 1 100 ? -6.334  12.561  -25.371 1.00 0.00 ? 475 PRO A O    1  
ATOM 1551  C CB   . PRO A 1 100 ? -4.402  10.706  -23.287 1.00 0.00 ? 475 PRO A CB   1  
ATOM 1552  C CG   . PRO A 1 100 ? -3.452  10.322  -24.371 1.00 0.00 ? 475 PRO A CG   1  
ATOM 1553  C CD   . PRO A 1 100 ? -4.220  9.417   -25.287 1.00 0.00 ? 475 PRO A CD   1  
ATOM 1554  H HA   . PRO A 1 100 ? -6.500  10.225  -23.292 1.00 0.00 ? 475 PRO A HA   1  
ATOM 1555  H HB2  . PRO A 1 100 ? -4.183  11.691  -22.904 1.00 0.00 ? 475 PRO A HB2  1  
ATOM 1556  H HB3  . PRO A 1 100 ? -4.385  9.989   -22.479 1.00 0.00 ? 475 PRO A HB3  1  
ATOM 1557  H HG2  . PRO A 1 100 ? -3.125  11.204  -24.901 1.00 0.00 ? 475 PRO A HG2  1  
ATOM 1558  H HG3  . PRO A 1 100 ? -2.606  9.799   -23.950 1.00 0.00 ? 475 PRO A HG3  1  
ATOM 1559  H HD2  . PRO A 1 100 ? -3.850  9.499   -26.297 1.00 0.00 ? 475 PRO A HD2  1  
ATOM 1560  H HD3  . PRO A 1 100 ? -4.167  8.396   -24.942 1.00 0.00 ? 475 PRO A HD3  1  
ATOM 1561  N N    . GLU A 1 101 ? -6.532  12.872  -23.151 1.00 0.00 ? 476 GLU A N    1  
ATOM 1562  C CA   . GLU A 1 101 ? -6.981  14.255  -23.273 1.00 0.00 ? 476 GLU A CA   1  
ATOM 1563  C C    . GLU A 1 101 ? -6.077  15.193  -22.478 1.00 0.00 ? 476 GLU A C    1  
ATOM 1564  O O    . GLU A 1 101 ? -5.421  14.776  -21.523 1.00 0.00 ? 476 GLU A O    1  
ATOM 1565  C CB   . GLU A 1 101 ? -8.425  14.388  -22.788 1.00 0.00 ? 476 GLU A CB   1  
ATOM 1566  C CG   . GLU A 1 101 ? -9.089  15.692  -23.202 1.00 0.00 ? 476 GLU A CG   1  
ATOM 1567  C CD   . GLU A 1 101 ? -10.478 15.484  -23.775 1.00 0.00 ? 476 GLU A CD   1  
ATOM 1568  O OE1  . GLU A 1 101 ? -11.407 15.197  -22.993 1.00 0.00 ? 476 GLU A OE1  1  
ATOM 1569  O OE2  . GLU A 1 101 ? -10.636 15.607  -25.009 1.00 0.00 ? 476 GLU A OE2  1  
ATOM 1570  H H    . GLU A 1 101 ? -6.442  12.476  -22.259 1.00 0.00 ? 476 GLU A H    1  
ATOM 1571  H HA   . GLU A 1 101 ? -6.934  14.529  -24.316 1.00 0.00 ? 476 GLU A HA   1  
ATOM 1572  H HB2  . GLU A 1 101 ? -9.004  13.570  -23.191 1.00 0.00 ? 476 GLU A HB2  1  
ATOM 1573  H HB3  . GLU A 1 101 ? -8.438  14.329  -21.710 1.00 0.00 ? 476 GLU A HB3  1  
ATOM 1574  H HG2  . GLU A 1 101 ? -9.167  16.332  -22.336 1.00 0.00 ? 476 GLU A HG2  1  
ATOM 1575  H HG3  . GLU A 1 101 ? -8.476  16.172  -23.949 1.00 0.00 ? 476 GLU A HG3  1  
ATOM 1576  N N    . GLU A 1 102 ? -6.048  16.460  -22.878 1.00 0.00 ? 477 GLU A N    1  
ATOM 1577  C CA   . GLU A 1 102 ? -5.224  17.455  -22.201 1.00 0.00 ? 477 GLU A CA   1  
ATOM 1578  C C    . GLU A 1 102 ? -6.030  18.200  -21.142 1.00 0.00 ? 477 GLU A C    1  
ATOM 1579  O O    . GLU A 1 102 ? -7.165  18.610  -21.385 1.00 0.00 ? 477 GLU A O    1  
ATOM 1580  C CB   . GLU A 1 102 ? -4.650  18.448  -23.214 1.00 0.00 ? 477 GLU A CB   1  
ATOM 1581  C CG   . GLU A 1 102 ? -3.800  17.795  -24.290 1.00 0.00 ? 477 GLU A CG   1  
ATOM 1582  C CD   . GLU A 1 102 ? -2.782  18.748  -24.887 1.00 0.00 ? 477 GLU A CD   1  
ATOM 1583  O OE1  . GLU A 1 102 ? -3.077  19.959  -24.964 1.00 0.00 ? 477 GLU A OE1  1  
ATOM 1584  O OE2  . GLU A 1 102 ? -1.690  18.282  -25.276 1.00 0.00 ? 477 GLU A OE2  1  
ATOM 1585  H H    . GLU A 1 102 ? -6.593  16.731  -23.645 1.00 0.00 ? 477 GLU A H    1  
ATOM 1586  H HA   . GLU A 1 102 ? -4.410  16.938  -21.717 1.00 0.00 ? 477 GLU A HA   1  
ATOM 1587  H HB2  . GLU A 1 102 ? -5.467  18.967  -23.695 1.00 0.00 ? 477 GLU A HB2  1  
ATOM 1588  H HB3  . GLU A 1 102 ? -4.039  19.167  -22.689 1.00 0.00 ? 477 GLU A HB3  1  
ATOM 1589  H HG2  . GLU A 1 102 ? -3.274  16.957  -23.858 1.00 0.00 ? 477 GLU A HG2  1  
ATOM 1590  H HG3  . GLU A 1 102 ? -4.449  17.444  -25.080 1.00 0.00 ? 477 GLU A HG3  1  
ATOM 1591  N N    . ILE A 1 103 ? -5.435  18.373  -19.966 1.00 0.00 ? 478 ILE A N    1  
ATOM 1592  C CA   . ILE A 1 103 ? -6.096  19.068  -18.869 1.00 0.00 ? 478 ILE A CA   1  
ATOM 1593  C C    . ILE A 1 103 ? -5.080  19.561  -17.843 1.00 0.00 ? 478 ILE A C    1  
ATOM 1594  O O    . ILE A 1 103 ? -4.144  18.844  -17.488 1.00 0.00 ? 478 ILE A O    1  
ATOM 1595  C CB   . ILE A 1 103 ? -7.128  18.160  -18.170 1.00 0.00 ? 478 ILE A CB   1  
ATOM 1596  C CG1  . ILE A 1 103 ? -7.891  18.942  -17.095 1.00 0.00 ? 478 ILE A CG1  1  
ATOM 1597  C CG2  . ILE A 1 103 ? -6.445  16.942  -17.567 1.00 0.00 ? 478 ILE A CG2  1  
ATOM 1598  C CD1  . ILE A 1 103 ? -9.388  18.955  -17.306 1.00 0.00 ? 478 ILE A CD1  1  
ATOM 1599  H H    . ILE A 1 103 ? -4.529  18.023  -19.834 1.00 0.00 ? 478 ILE A H    1  
ATOM 1600  H HA   . ILE A 1 103 ? -6.617  19.919  -19.282 1.00 0.00 ? 478 ILE A HA   1  
ATOM 1601  H HB   . ILE A 1 103 ? -7.829  17.814  -18.915 1.00 0.00 ? 478 ILE A HB   1  
ATOM 1602  H HG12 . ILE A 1 103 ? -7.697  18.499  -16.129 1.00 0.00 ? 478 ILE A HG12 1  
ATOM 1603  H HG13 . ILE A 1 103 ? -7.547  19.966  -17.091 1.00 0.00 ? 478 ILE A HG13 1  
ATOM 1604  H HG21 . ILE A 1 103 ? -5.756  16.522  -18.286 1.00 0.00 ? 478 ILE A HG21 1  
ATOM 1605  H HG22 . ILE A 1 103 ? -5.904  17.235  -16.678 1.00 0.00 ? 478 ILE A HG22 1  
ATOM 1606  H HG23 . ILE A 1 103 ? -7.189  16.202  -17.308 1.00 0.00 ? 478 ILE A HG23 1  
ATOM 1607  H HD11 . ILE A 1 103 ? -9.613  19.419  -18.256 1.00 0.00 ? 478 ILE A HD11 1  
ATOM 1608  H HD12 . ILE A 1 103 ? -9.761  17.941  -17.304 1.00 0.00 ? 478 ILE A HD12 1  
ATOM 1609  H HD13 . ILE A 1 103 ? -9.859  19.514  -16.511 1.00 0.00 ? 478 ILE A HD13 1  
ATOM 1610  N N    . ASP A 1 104 ? -5.271  20.788  -17.369 1.00 0.00 ? 479 ASP A N    1  
ATOM 1611  C CA   . ASP A 1 104 ? -4.371  21.374  -16.383 1.00 0.00 ? 479 ASP A CA   1  
ATOM 1612  C C    . ASP A 1 104 ? -5.152  22.160  -15.330 1.00 0.00 ? 479 ASP A C    1  
ATOM 1613  O O    . ASP A 1 104 ? -5.783  23.170  -15.643 1.00 0.00 ? 479 ASP A O    1  
ATOM 1614  C CB   . ASP A 1 104 ? -3.358  22.291  -17.072 1.00 0.00 ? 479 ASP A CB   1  
ATOM 1615  C CG   . ASP A 1 104 ? -2.134  22.546  -16.215 1.00 0.00 ? 479 ASP A CG   1  
ATOM 1616  O OD1  . ASP A 1 104 ? -1.412  21.575  -15.908 1.00 0.00 ? 479 ASP A OD1  1  
ATOM 1617  O OD2  . ASP A 1 104 ? -1.897  23.717  -15.852 1.00 0.00 ? 479 ASP A OD2  1  
ATOM 1618  H H    . ASP A 1 104 ? -6.036  21.311  -17.690 1.00 0.00 ? 479 ASP A H    1  
ATOM 1619  H HA   . ASP A 1 104 ? -3.841  20.569  -15.899 1.00 0.00 ? 479 ASP A HA   1  
ATOM 1620  H HB2  . ASP A 1 104 ? -3.038  21.834  -17.996 1.00 0.00 ? 479 ASP A HB2  1  
ATOM 1621  H HB3  . ASP A 1 104 ? -3.828  23.239  -17.287 1.00 0.00 ? 479 ASP A HB3  1  
ATOM 1622  N N    . PRO A 1 105 ? -5.120  21.711  -14.061 1.00 0.00 ? 480 PRO A N    1  
ATOM 1623  C CA   . PRO A 1 105 ? -5.831  22.387  -12.970 1.00 0.00 ? 480 PRO A CA   1  
ATOM 1624  C C    . PRO A 1 105 ? -5.208  23.734  -12.620 1.00 0.00 ? 480 PRO A C    1  
ATOM 1625  O O    . PRO A 1 105 ? -4.162  24.073  -13.214 1.00 0.00 ? 480 PRO A O    1  
ATOM 1626  C CB   . PRO A 1 105 ? -5.692  21.415  -11.797 1.00 0.00 ? 480 PRO A CB   1  
ATOM 1627  C CG   . PRO A 1 105 ? -4.457  20.639  -12.093 1.00 0.00 ? 480 PRO A CG   1  
ATOM 1628  C CD   . PRO A 1 105 ? -4.392  20.517  -13.590 1.00 0.00 ? 480 PRO A CD   1  
ATOM 1629  O OXT  . PRO A 1 105 ? -5.771  24.440  -11.758 1.00 0.00 ? 480 PRO A OXT  1  
ATOM 1630  H HA   . PRO A 1 105 ? -6.875  22.525  -13.205 1.00 0.00 ? 480 PRO A HA   1  
ATOM 1631  H HB2  . PRO A 1 105 ? -5.600  21.970  -10.874 1.00 0.00 ? 480 PRO A HB2  1  
ATOM 1632  H HB3  . PRO A 1 105 ? -6.559  20.773  -11.752 1.00 0.00 ? 480 PRO A HB3  1  
ATOM 1633  H HG2  . PRO A 1 105 ? -3.592  21.168  -11.722 1.00 0.00 ? 480 PRO A HG2  1  
ATOM 1634  H HG3  . PRO A 1 105 ? -4.520  19.660  -11.640 1.00 0.00 ? 480 PRO A HG3  1  
ATOM 1635  H HD2  . PRO A 1 105 ? -3.367  20.533  -13.926 1.00 0.00 ? 480 PRO A HD2  1  
ATOM 1636  H HD3  . PRO A 1 105 ? -4.884  19.613  -13.917 1.00 0.00 ? 480 PRO A HD3  1  
ATOM 1637  N N    . ASP B 2 1   ? 0.108   -4.034  -2.113  1.00 0.00 ? 1   ASP B N    1  
ATOM 1638  C CA   . ASP B 2 1   ? -0.455  -2.677  -1.894  1.00 0.00 ? 1   ASP B CA   1  
ATOM 1639  C C    . ASP B 2 1   ? -1.378  -2.272  -3.038  1.00 0.00 ? 1   ASP B C    1  
ATOM 1640  O O    . ASP B 2 1   ? -1.382  -2.898  -4.098  1.00 0.00 ? 1   ASP B O    1  
ATOM 1641  C CB   . ASP B 2 1   ? 0.704   -1.684  -1.769  1.00 0.00 ? 1   ASP B CB   1  
ATOM 1642  C CG   . ASP B 2 1   ? 0.758   -1.026  -0.405  1.00 0.00 ? 1   ASP B CG   1  
ATOM 1643  O OD1  . ASP B 2 1   ? -0.030  -0.086  -0.168  1.00 0.00 ? 1   ASP B OD1  1  
ATOM 1644  O OD2  . ASP B 2 1   ? 1.587   -1.450  0.427   1.00 0.00 ? 1   ASP B OD2  1  
ATOM 1645  H H1   . ASP B 2 1   ? -0.656  -4.641  -2.474  1.00 0.00 ? 1   ASP B H1   1  
ATOM 1646  H H2   . ASP B 2 1   ? 0.462   -4.381  -1.199  1.00 0.00 ? 1   ASP B H2   1  
ATOM 1647  H H3   . ASP B 2 1   ? 0.876   -3.951  -2.808  1.00 0.00 ? 1   ASP B H3   1  
ATOM 1648  H HA   . ASP B 2 1   ? -1.019  -2.683  -0.972  1.00 0.00 ? 1   ASP B HA   1  
ATOM 1649  H HB2  . ASP B 2 1   ? 1.635   -2.206  -1.933  1.00 0.00 ? 1   ASP B HB2  1  
ATOM 1650  H HB3  . ASP B 2 1   ? 0.593   -0.913  -2.518  1.00 0.00 ? 1   ASP B HB3  1  
ATOM 1651  N N    . SER B 2 2   ? -2.160  -1.219  -2.817  1.00 0.00 ? 2   SER B N    1  
ATOM 1652  C CA   . SER B 2 2   ? -3.087  -0.729  -3.830  1.00 0.00 ? 2   SER B CA   1  
ATOM 1653  C C    . SER B 2 2   ? -2.368  0.155   -4.843  1.00 0.00 ? 2   SER B C    1  
ATOM 1654  O O    . SER B 2 2   ? -2.116  -0.259  -5.975  1.00 0.00 ? 2   SER B O    1  
ATOM 1655  C CB   . SER B 2 2   ? -4.226  0.052   -3.171  1.00 0.00 ? 2   SER B CB   1  
ATOM 1656  O OG   . SER B 2 2   ? -3.825  0.581   -1.918  1.00 0.00 ? 2   SER B OG   1  
ATOM 1657  H H    . SER B 2 2   ? -2.110  -0.762  -1.952  1.00 0.00 ? 2   SER B H    1  
ATOM 1658  H HA   . SER B 2 2   ? -3.499  -1.583  -4.343  1.00 0.00 ? 2   SER B HA   1  
ATOM 1659  H HB2  . SER B 2 2   ? -4.519  0.869   -3.814  1.00 0.00 ? 2   SER B HB2  1  
ATOM 1660  H HB3  . SER B 2 2   ? -5.068  -0.605  -3.017  1.00 0.00 ? 2   SER B HB3  1  
ATOM 1661  H HG   . SER B 2 2   ? -4.205  0.055   -1.212  1.00 0.00 ? 2   SER B HG   1  
ATOM 1662  N N    . ARG B 2 3   ? -2.038  1.374   -4.430  1.00 0.00 ? 3   ARG B N    1  
ATOM 1663  C CA   . ARG B 2 3   ? -1.347  2.316   -5.304  1.00 0.00 ? 3   ARG B CA   1  
ATOM 1664  C C    . ARG B 2 3   ? -2.183  2.618   -6.545  1.00 0.00 ? 3   ARG B C    1  
ATOM 1665  O O    . ARG B 2 3   ? -1.850  2.187   -7.650  1.00 0.00 ? 3   ARG B O    1  
ATOM 1666  C CB   . ARG B 2 3   ? 0.016   1.755   -5.714  1.00 0.00 ? 3   ARG B CB   1  
ATOM 1667  C CG   . ARG B 2 3   ? 1.138   2.115   -4.754  1.00 0.00 ? 3   ARG B CG   1  
ATOM 1668  C CD   . ARG B 2 3   ? 2.497   1.745   -5.325  1.00 0.00 ? 3   ARG B CD   1  
ATOM 1669  N NE   . ARG B 2 3   ? 3.112   2.859   -6.044  1.00 0.00 ? 3   ARG B NE   1  
ATOM 1670  C CZ   . ARG B 2 3   ? 3.770   3.853   -5.450  1.00 0.00 ? 3   ARG B CZ   1  
ATOM 1671  N NH1  . ARG B 2 3   ? 3.895   3.880   -4.129  1.00 0.00 ? 3   ARG B NH1  1  
ATOM 1672  N NH2  . ARG B 2 3   ? 4.303   4.823   -6.180  1.00 0.00 ? 3   ARG B NH2  1  
ATOM 1673  H H    . ARG B 2 3   ? -2.265  1.647   -3.517  1.00 0.00 ? 3   ARG B H    1  
ATOM 1674  H HA   . ARG B 2 3   ? -1.199  3.232   -4.752  1.00 0.00 ? 3   ARG B HA   1  
ATOM 1675  H HB2  . ARG B 2 3   ? -0.052  0.678   -5.768  1.00 0.00 ? 3   ARG B HB2  1  
ATOM 1676  H HB3  . ARG B 2 3   ? 0.270   2.138   -6.691  1.00 0.00 ? 3   ARG B HB3  1  
ATOM 1677  H HG2  . ARG B 2 3   ? 1.114   3.178   -4.568  1.00 0.00 ? 3   ARG B HG2  1  
ATOM 1678  H HG3  . ARG B 2 3   ? 0.989   1.582   -3.826  1.00 0.00 ? 3   ARG B HG3  1  
ATOM 1679  H HD2  . ARG B 2 3   ? 3.147   1.450   -4.514  1.00 0.00 ? 3   ARG B HD2  1  
ATOM 1680  H HD3  . ARG B 2 3   ? 2.374   0.914   -6.005  1.00 0.00 ? 3   ARG B HD3  1  
ATOM 1681  H HE   . ARG B 2 3   ? 3.031   2.866   -7.021  1.00 0.00 ? 3   ARG B HE   1  
ATOM 1682  H HH11 . ARG B 2 3   ? 3.494   3.153   -3.573  1.00 0.00 ? 3   ARG B HH11 1  
ATOM 1683  H HH12 . ARG B 2 3   ? 4.391   4.628   -3.690  1.00 0.00 ? 3   ARG B HH12 1  
ATOM 1684  H HH21 . ARG B 2 3   ? 4.212   4.808   -7.176  1.00 0.00 ? 3   ARG B HH21 1  
ATOM 1685  H HH22 . ARG B 2 3   ? 4.799   5.569   -5.735  1.00 0.00 ? 3   ARG B HH22 1  
ATOM 1686  N N    . ILE B 2 4   ? -3.268  3.361   -6.355  1.00 0.00 ? 4   ILE B N    1  
ATOM 1687  C CA   . ILE B 2 4   ? -4.150  3.721   -7.460  1.00 0.00 ? 4   ILE B CA   1  
ATOM 1688  C C    . ILE B 2 4   ? -3.644  4.963   -8.184  1.00 0.00 ? 4   ILE B C    1  
ATOM 1689  O O    . ILE B 2 4   ? -3.268  5.951   -7.555  1.00 0.00 ? 4   ILE B O    1  
ATOM 1690  C CB   . ILE B 2 4   ? -5.589  3.974   -6.976  1.00 0.00 ? 4   ILE B CB   1  
ATOM 1691  C CG1  . ILE B 2 4   ? -5.591  4.955   -5.802  1.00 0.00 ? 4   ILE B CG1  1  
ATOM 1692  C CG2  . ILE B 2 4   ? -6.254  2.664   -6.582  1.00 0.00 ? 4   ILE B CG2  1  
ATOM 1693  C CD1  . ILE B 2 4   ? -6.909  5.677   -5.621  1.00 0.00 ? 4   ILE B CD1  1  
ATOM 1694  H H    . ILE B 2 4   ? -3.481  3.676   -5.452  1.00 0.00 ? 4   ILE B H    1  
ATOM 1695  H HA   . ILE B 2 4   ? -4.166  2.893   -8.155  1.00 0.00 ? 4   ILE B HA   1  
ATOM 1696  H HB   . ILE B 2 4   ? -6.150  4.401   -7.793  1.00 0.00 ? 4   ILE B HB   1  
ATOM 1697  H HG12 . ILE B 2 4   ? -5.382  4.416   -4.890  1.00 0.00 ? 4   ILE B HG12 1  
ATOM 1698  H HG13 . ILE B 2 4   ? -4.824  5.697   -5.960  1.00 0.00 ? 4   ILE B HG13 1  
ATOM 1699  H HG21 . ILE B 2 4   ? -5.787  1.849   -7.113  1.00 0.00 ? 4   ILE B HG21 1  
ATOM 1700  H HG22 . ILE B 2 4   ? -6.146  2.511   -5.518  1.00 0.00 ? 4   ILE B HG22 1  
ATOM 1701  H HG23 . ILE B 2 4   ? -7.304  2.704   -6.834  1.00 0.00 ? 4   ILE B HG23 1  
ATOM 1702  H HD11 . ILE B 2 4   ? -6.734  6.632   -5.147  1.00 0.00 ? 4   ILE B HD11 1  
ATOM 1703  H HD12 . ILE B 2 4   ? -7.369  5.833   -6.585  1.00 0.00 ? 4   ILE B HD12 1  
ATOM 1704  H HD13 . ILE B 2 4   ? -7.563  5.082   -5.001  1.00 0.00 ? 4   ILE B HD13 1  
ATOM 1705  N N    . TRP B 2 5   ? -3.639  4.905   -9.512  1.00 0.00 ? 5   TRP B N    1  
ATOM 1706  C CA   . TRP B 2 5   ? -3.181  6.026   -10.325 1.00 0.00 ? 5   TRP B CA   1  
ATOM 1707  C C    . TRP B 2 5   ? -4.307  6.555   -11.206 1.00 0.00 ? 5   TRP B C    1  
ATOM 1708  O O    . TRP B 2 5   ? -4.502  6.088   -12.329 1.00 0.00 ? 5   TRP B O    1  
ATOM 1709  C CB   . TRP B 2 5   ? -1.996  5.601   -11.193 1.00 0.00 ? 5   TRP B CB   1  
ATOM 1710  C CG   . TRP B 2 5   ? -0.719  5.447   -10.424 1.00 0.00 ? 5   TRP B CG   1  
ATOM 1711  C CD1  . TRP B 2 5   ? -0.539  4.748   -9.264  1.00 0.00 ? 5   TRP B CD1  1  
ATOM 1712  C CD2  . TRP B 2 5   ? 0.555   6.007   -10.758 1.00 0.00 ? 5   TRP B CD2  1  
ATOM 1713  N NE1  . TRP B 2 5   ? 0.771   4.837   -8.858  1.00 0.00 ? 5   TRP B NE1  1  
ATOM 1714  C CE2  . TRP B 2 5   ? 1.463   5.604   -9.758  1.00 0.00 ? 5   TRP B CE2  1  
ATOM 1715  C CE3  . TRP B 2 5   ? 1.020   6.805   -11.806 1.00 0.00 ? 5   TRP B CE3  1  
ATOM 1716  C CZ2  . TRP B 2 5   ? 2.805   5.976   -9.779  1.00 0.00 ? 5   TRP B CZ2  1  
ATOM 1717  C CZ3  . TRP B 2 5   ? 2.351   7.175   -11.824 1.00 0.00 ? 5   TRP B CZ3  1  
ATOM 1718  C CH2  . TRP B 2 5   ? 3.230   6.759   -10.816 1.00 0.00 ? 5   TRP B CH2  1  
ATOM 1719  H H    . TRP B 2 5   ? -3.951  4.089   -9.956  1.00 0.00 ? 5   TRP B H    1  
ATOM 1720  H HA   . TRP B 2 5   ? -2.863  6.812   -9.657  1.00 0.00 ? 5   TRP B HA   1  
ATOM 1721  H HB2  . TRP B 2 5   ? -2.220  4.652   -11.658 1.00 0.00 ? 5   TRP B HB2  1  
ATOM 1722  H HB3  . TRP B 2 5   ? -1.835  6.345   -11.960 1.00 0.00 ? 5   TRP B HB3  1  
ATOM 1723  H HD1  . TRP B 2 5   ? -1.322  4.208   -8.751  1.00 0.00 ? 5   TRP B HD1  1  
ATOM 1724  H HE1  . TRP B 2 5   ? 1.147   4.421   -8.056  1.00 0.00 ? 5   TRP B HE1  1  
ATOM 1725  H HE3  . TRP B 2 5   ? 0.356   7.136   -12.592 1.00 0.00 ? 5   TRP B HE3  1  
ATOM 1726  H HZ2  . TRP B 2 5   ? 3.496   5.664   -9.010  1.00 0.00 ? 5   TRP B HZ2  1  
ATOM 1727  H HZ3  . TRP B 2 5   ? 2.726   7.793   -12.626 1.00 0.00 ? 5   TRP B HZ3  1  
ATOM 1728  H HH2  . TRP B 2 5   ? 4.263   7.072   -10.871 1.00 0.00 ? 5   TRP B HH2  1  
ATOM 1729  N N    . TRP B 2 6   ? -5.047  7.532   -10.691 1.00 0.00 ? 6   TRP B N    1  
ATOM 1730  C CA   . TRP B 2 6   ? -6.155  8.124   -11.431 1.00 0.00 ? 6   TRP B CA   1  
ATOM 1731  C C    . TRP B 2 6   ? -5.644  8.968   -12.594 1.00 0.00 ? 6   TRP B C    1  
ATOM 1732  O O    . TRP B 2 6   ? -5.702  10.198  -12.555 1.00 0.00 ? 6   TRP B O    1  
ATOM 1733  C CB   . TRP B 2 6   ? -7.016  8.982   -10.501 1.00 0.00 ? 6   TRP B CB   1  
ATOM 1734  C CG   . TRP B 2 6   ? -8.434  9.132   -10.966 1.00 0.00 ? 6   TRP B CG   1  
ATOM 1735  C CD1  . TRP B 2 6   ? -9.015  8.525   -12.042 1.00 0.00 ? 6   TRP B CD1  1  
ATOM 1736  C CD2  . TRP B 2 6   ? -9.449  9.945   -10.367 1.00 0.00 ? 6   TRP B CD2  1  
ATOM 1737  N NE1  . TRP B 2 6   ? -10.330 8.912   -12.149 1.00 0.00 ? 6   TRP B NE1  1  
ATOM 1738  C CE2  . TRP B 2 6   ? -10.620 9.783   -11.131 1.00 0.00 ? 6   TRP B CE2  1  
ATOM 1739  C CE3  . TRP B 2 6   ? -9.481  10.795  -9.258  1.00 0.00 ? 6   TRP B CE3  1  
ATOM 1740  C CZ2  . TRP B 2 6   ? -11.808 10.438  -10.821 1.00 0.00 ? 6   TRP B CZ2  1  
ATOM 1741  C CZ3  . TRP B 2 6   ? -10.661 11.444  -8.950  1.00 0.00 ? 6   TRP B CZ3  1  
ATOM 1742  C CH2  . TRP B 2 6   ? -11.811 11.264  -9.729  1.00 0.00 ? 6   TRP B CH2  1  
ATOM 1743  H H    . TRP B 2 6   ? -4.842  7.861   -9.791  1.00 0.00 ? 6   TRP B H    1  
ATOM 1744  H HA   . TRP B 2 6   ? -6.757  7.319   -11.825 1.00 0.00 ? 6   TRP B HA   1  
ATOM 1745  H HB2  . TRP B 2 6   ? -7.034  8.530   -9.521  1.00 0.00 ? 6   TRP B HB2  1  
ATOM 1746  H HB3  . TRP B 2 6   ? -6.582  9.968   -10.429 1.00 0.00 ? 6   TRP B HB3  1  
ATOM 1747  H HD1  . TRP B 2 6   ? -8.505  7.843   -12.706 1.00 0.00 ? 6   TRP B HD1  1  
ATOM 1748  H HE1  . TRP B 2 6   ? -10.958 8.612   -12.840 1.00 0.00 ? 6   TRP B HE1  1  
ATOM 1749  H HE3  . TRP B 2 6   ? -8.604  10.947  -8.645  1.00 0.00 ? 6   TRP B HE3  1  
ATOM 1750  H HZ2  . TRP B 2 6   ? -12.703 10.310  -11.411 1.00 0.00 ? 6   TRP B HZ2  1  
ATOM 1751  H HZ3  . TRP B 2 6   ? -10.705 12.105  -8.097  1.00 0.00 ? 6   TRP B HZ3  1  
ATOM 1752  H HH2  . TRP B 2 6   ? -12.712 11.792  -9.453  1.00 0.00 ? 6   TRP B HH2  1  
ATOM 1753  N N    . VAL B 2 7   ? -5.144  8.302   -13.629 1.00 0.00 ? 7   VAL B N    1  
ATOM 1754  C CA   . VAL B 2 7   ? -4.625  8.992   -14.802 1.00 0.00 ? 7   VAL B CA   1  
ATOM 1755  C C    . VAL B 2 7   ? -5.649  9.001   -15.932 1.00 0.00 ? 7   VAL B C    1  
ATOM 1756  O O    . VAL B 2 7   ? -5.436  9.740   -16.917 1.00 0.00 ? 7   VAL B O    1  
ATOM 1757  C CB   . VAL B 2 7   ? -3.324  8.343   -15.310 1.00 0.00 ? 7   VAL B CB   1  
ATOM 1758  C CG1  . VAL B 2 7   ? -2.690  9.195   -16.398 1.00 0.00 ? 7   VAL B CG1  1  
ATOM 1759  C CG2  . VAL B 2 7   ? -2.352  8.125   -14.159 1.00 0.00 ? 7   VAL B CG2  1  
ATOM 1760  O OXT  . VAL B 2 7   ? -6.656  8.270   -15.823 1.00 0.00 ? 7   VAL B OXT  1  
ATOM 1761  H H    . VAL B 2 7   ? -5.125  7.322   -13.603 1.00 0.00 ? 7   VAL B H    1  
ATOM 1762  H HA   . VAL B 2 7   ? -4.407  10.012  -14.519 1.00 0.00 ? 7   VAL B HA   1  
ATOM 1763  H HB   . VAL B 2 7   ? -3.568  7.380   -15.734 1.00 0.00 ? 7   VAL B HB   1  
ATOM 1764  H HG11 . VAL B 2 7   ? -2.722  10.234  -16.106 1.00 0.00 ? 7   VAL B HG11 1  
ATOM 1765  H HG12 . VAL B 2 7   ? -1.664  8.892   -16.540 1.00 0.00 ? 7   VAL B HG12 1  
ATOM 1766  H HG13 . VAL B 2 7   ? -3.235  9.063   -17.321 1.00 0.00 ? 7   VAL B HG13 1  
ATOM 1767  H HG21 . VAL B 2 7   ? -2.075  9.079   -13.737 1.00 0.00 ? 7   VAL B HG21 1  
ATOM 1768  H HG22 . VAL B 2 7   ? -2.823  7.518   -13.400 1.00 0.00 ? 7   VAL B HG22 1  
ATOM 1769  H HG23 . VAL B 2 7   ? -1.468  7.622   -14.525 1.00 0.00 ? 7   VAL B HG23 1  
ATOM 1770  N N    . GLY A 1 1   ? 2.748   29.597  -21.296 1.00 0.00 ? 376 GLY A N    2  
ATOM 1771  C CA   . GLY A 1 1   ? 3.806   29.041  -22.183 1.00 0.00 ? 376 GLY A CA   2  
ATOM 1772  C C    . GLY A 1 1   ? 3.458   27.661  -22.706 1.00 0.00 ? 376 GLY A C    2  
ATOM 1773  O O    . GLY A 1 1   ? 2.298   27.375  -23.000 1.00 0.00 ? 376 GLY A O    2  
ATOM 1774  H H1   . GLY A 1 1   ? 1.872   29.752  -21.838 1.00 0.00 ? 376 GLY A H1   2  
ATOM 1775  H H2   . GLY A 1 1   ? 3.058   30.505  -20.893 1.00 0.00 ? 376 GLY A H2   2  
ATOM 1776  H H3   . GLY A 1 1   ? 2.549   28.936  -20.518 1.00 0.00 ? 376 GLY A H3   2  
ATOM 1777  H HA2  . GLY A 1 1   ? 3.943   29.707  -23.022 1.00 0.00 ? 376 GLY A HA2  2  
ATOM 1778  H HA3  . GLY A 1 1   ? 4.730   28.982  -21.629 1.00 0.00 ? 376 GLY A HA3  2  
ATOM 1779  N N    . SER A 1 2   ? 4.467   26.804  -22.823 1.00 0.00 ? 377 SER A N    2  
ATOM 1780  C CA   . SER A 1 2   ? 4.264   25.446  -23.315 1.00 0.00 ? 377 SER A CA   2  
ATOM 1781  C C    . SER A 1 2   ? 3.964   24.490  -22.165 1.00 0.00 ? 377 SER A C    2  
ATOM 1782  O O    . SER A 1 2   ? 4.753   24.365  -21.227 1.00 0.00 ? 377 SER A O    2  
ATOM 1783  C CB   . SER A 1 2   ? 5.499   24.968  -24.080 1.00 0.00 ? 377 SER A CB   2  
ATOM 1784  O OG   . SER A 1 2   ? 5.628   25.648  -25.317 1.00 0.00 ? 377 SER A OG   2  
ATOM 1785  H H    . SER A 1 2   ? 5.370   27.091  -22.574 1.00 0.00 ? 377 SER A H    2  
ATOM 1786  H HA   . SER A 1 2   ? 3.419   25.459  -23.986 1.00 0.00 ? 377 SER A HA   2  
ATOM 1787  H HB2  . SER A 1 2   ? 6.381   25.157  -23.488 1.00 0.00 ? 377 SER A HB2  2  
ATOM 1788  H HB3  . SER A 1 2   ? 5.414   23.908  -24.271 1.00 0.00 ? 377 SER A HB3  2  
ATOM 1789  H HG   . SER A 1 2   ? 6.556   25.706  -25.555 1.00 0.00 ? 377 SER A HG   2  
ATOM 1790  N N    . HIS A 1 3   ? 2.820   23.819  -22.242 1.00 0.00 ? 378 HIS A N    2  
ATOM 1791  C CA   . HIS A 1 3   ? 2.418   22.875  -21.205 1.00 0.00 ? 378 HIS A CA   2  
ATOM 1792  C C    . HIS A 1 3   ? 1.174   22.099  -21.625 1.00 0.00 ? 378 HIS A C    2  
ATOM 1793  O O    . HIS A 1 3   ? 0.048   22.542  -21.397 1.00 0.00 ? 378 HIS A O    2  
ATOM 1794  C CB   . HIS A 1 3   ? 2.158   23.612  -19.889 1.00 0.00 ? 378 HIS A CB   2  
ATOM 1795  C CG   . HIS A 1 3   ? 3.174   23.319  -18.828 1.00 0.00 ? 378 HIS A CG   2  
ATOM 1796  N ND1  . HIS A 1 3   ? 3.052   23.759  -17.527 1.00 0.00 ? 378 HIS A ND1  2  
ATOM 1797  C CD2  . HIS A 1 3   ? 4.335   22.624  -18.881 1.00 0.00 ? 378 HIS A CD2  2  
ATOM 1798  C CE1  . HIS A 1 3   ? 4.094   23.349  -16.827 1.00 0.00 ? 378 HIS A CE1  2  
ATOM 1799  N NE2  . HIS A 1 3   ? 4.886   22.658  -17.624 1.00 0.00 ? 378 HIS A NE2  2  
ATOM 1800  H H    . HIS A 1 3   ? 2.233   23.961  -23.012 1.00 0.00 ? 378 HIS A H    2  
ATOM 1801  H HA   . HIS A 1 3   ? 3.230   22.177  -21.062 1.00 0.00 ? 378 HIS A HA   2  
ATOM 1802  H HB2  . HIS A 1 3   ? 2.168   24.676  -20.071 1.00 0.00 ? 378 HIS A HB2  2  
ATOM 1803  H HB3  . HIS A 1 3   ? 1.188   23.327  -19.508 1.00 0.00 ? 378 HIS A HB3  2  
ATOM 1804  H HD1  . HIS A 1 3   ? 2.312   24.294  -17.170 1.00 0.00 ? 378 HIS A HD1  2  
ATOM 1805  H HD2  . HIS A 1 3   ? 4.750   22.133  -19.751 1.00 0.00 ? 378 HIS A HD2  2  
ATOM 1806  H HE1  . HIS A 1 3   ? 4.267   23.545  -15.778 1.00 0.00 ? 378 HIS A HE1  2  
ATOM 1807  H HE2  . HIS A 1 3   ? 5.684   22.164  -17.338 1.00 0.00 ? 378 HIS A HE2  2  
ATOM 1808  N N    . MET A 1 4   ? 1.385   20.939  -22.239 1.00 0.00 ? 379 MET A N    2  
ATOM 1809  C CA   . MET A 1 4   ? 0.280   20.101  -22.688 1.00 0.00 ? 379 MET A CA   2  
ATOM 1810  C C    . MET A 1 4   ? -0.228  19.216  -21.554 1.00 0.00 ? 379 MET A C    2  
ATOM 1811  O O    . MET A 1 4   ? 0.503   18.923  -20.608 1.00 0.00 ? 379 MET A O    2  
ATOM 1812  C CB   . MET A 1 4   ? 0.719   19.234  -23.871 1.00 0.00 ? 379 MET A CB   2  
ATOM 1813  C CG   . MET A 1 4   ? 0.332   19.812  -25.223 1.00 0.00 ? 379 MET A CG   2  
ATOM 1814  S SD   . MET A 1 4   ? 0.759   18.719  -26.593 1.00 0.00 ? 379 MET A SD   2  
ATOM 1815  C CE   . MET A 1 4   ? 1.191   19.913  -27.856 1.00 0.00 ? 379 MET A CE   2  
ATOM 1816  H H    . MET A 1 4   ? 2.305   20.640  -22.391 1.00 0.00 ? 379 MET A H    2  
ATOM 1817  H HA   . MET A 1 4   ? -0.521  20.751  -23.007 1.00 0.00 ? 379 MET A HA   2  
ATOM 1818  H HB2  . MET A 1 4   ? 1.792   19.126  -23.844 1.00 0.00 ? 379 MET A HB2  2  
ATOM 1819  H HB3  . MET A 1 4   ? 0.264   18.259  -23.778 1.00 0.00 ? 379 MET A HB3  2  
ATOM 1820  H HG2  . MET A 1 4   ? -0.735  19.980  -25.236 1.00 0.00 ? 379 MET A HG2  2  
ATOM 1821  H HG3  . MET A 1 4   ? 0.845   20.752  -25.358 1.00 0.00 ? 379 MET A HG3  2  
ATOM 1822  H HE1  . MET A 1 4   ? 0.301   20.209  -28.390 1.00 0.00 ? 379 MET A HE1  2  
ATOM 1823  H HE2  . MET A 1 4   ? 1.637   20.781  -27.393 1.00 0.00 ? 379 MET A HE2  2  
ATOM 1824  H HE3  . MET A 1 4   ? 1.894   19.470  -28.545 1.00 0.00 ? 379 MET A HE3  2  
ATOM 1825  N N    . LYS A 1 5   ? -1.483  18.795  -21.655 1.00 0.00 ? 380 LYS A N    2  
ATOM 1826  C CA   . LYS A 1 5   ? -2.091  17.944  -20.638 1.00 0.00 ? 380 LYS A CA   2  
ATOM 1827  C C    . LYS A 1 5   ? -2.807  16.759  -21.277 1.00 0.00 ? 380 LYS A C    2  
ATOM 1828  O O    . LYS A 1 5   ? -3.453  16.898  -22.316 1.00 0.00 ? 380 LYS A O    2  
ATOM 1829  C CB   . LYS A 1 5   ? -3.075  18.751  -19.789 1.00 0.00 ? 380 LYS A CB   2  
ATOM 1830  C CG   . LYS A 1 5   ? -2.421  19.478  -18.624 1.00 0.00 ? 380 LYS A CG   2  
ATOM 1831  C CD   . LYS A 1 5   ? -1.972  20.876  -19.022 1.00 0.00 ? 380 LYS A CD   2  
ATOM 1832  C CE   . LYS A 1 5   ? -3.126  21.866  -18.982 1.00 0.00 ? 380 LYS A CE   2  
ATOM 1833  N NZ   . LYS A 1 5   ? -2.982  22.841  -17.866 1.00 0.00 ? 380 LYS A NZ   2  
ATOM 1834  H H    . LYS A 1 5   ? -2.016  19.063  -22.433 1.00 0.00 ? 380 LYS A H    2  
ATOM 1835  H HA   . LYS A 1 5   ? -1.300  17.573  -20.003 1.00 0.00 ? 380 LYS A HA   2  
ATOM 1836  H HB2  . LYS A 1 5   ? -3.558  19.484  -20.417 1.00 0.00 ? 380 LYS A HB2  2  
ATOM 1837  H HB3  . LYS A 1 5   ? -3.823  18.081  -19.392 1.00 0.00 ? 380 LYS A HB3  2  
ATOM 1838  H HG2  . LYS A 1 5   ? -3.134  19.557  -17.817 1.00 0.00 ? 380 LYS A HG2  2  
ATOM 1839  H HG3  . LYS A 1 5   ? -1.562  18.913  -18.295 1.00 0.00 ? 380 LYS A HG3  2  
ATOM 1840  H HD2  . LYS A 1 5   ? -1.205  21.205  -18.338 1.00 0.00 ? 380 LYS A HD2  2  
ATOM 1841  H HD3  . LYS A 1 5   ? -1.573  20.842  -20.025 1.00 0.00 ? 380 LYS A HD3  2  
ATOM 1842  H HE2  . LYS A 1 5   ? -3.154  22.406  -19.917 1.00 0.00 ? 380 LYS A HE2  2  
ATOM 1843  H HE3  . LYS A 1 5   ? -4.050  21.320  -18.855 1.00 0.00 ? 380 LYS A HE3  2  
ATOM 1844  H HZ1  . LYS A 1 5   ? -3.917  23.187  -17.570 1.00 0.00 ? 380 LYS A HZ1  2  
ATOM 1845  H HZ2  . LYS A 1 5   ? -2.518  22.389  -17.053 1.00 0.00 ? 380 LYS A HZ2  2  
ATOM 1846  H HZ3  . LYS A 1 5   ? -2.407  23.651  -18.172 1.00 0.00 ? 380 LYS A HZ3  2  
ATOM 1847  N N    . LYS A 1 6   ? -2.690  15.593  -20.649 1.00 0.00 ? 381 LYS A N    2  
ATOM 1848  C CA   . LYS A 1 6   ? -3.328  14.383  -21.156 1.00 0.00 ? 381 LYS A CA   2  
ATOM 1849  C C    . LYS A 1 6   ? -4.243  13.768  -20.100 1.00 0.00 ? 381 LYS A C    2  
ATOM 1850  O O    . LYS A 1 6   ? -3.932  13.791  -18.909 1.00 0.00 ? 381 LYS A O    2  
ATOM 1851  C CB   . LYS A 1 6   ? -2.271  13.367  -21.588 1.00 0.00 ? 381 LYS A CB   2  
ATOM 1852  C CG   . LYS A 1 6   ? -1.386  13.856  -22.725 1.00 0.00 ? 381 LYS A CG   2  
ATOM 1853  C CD   . LYS A 1 6   ? -1.958  13.475  -24.083 1.00 0.00 ? 381 LYS A CD   2  
ATOM 1854  C CE   . LYS A 1 6   ? -1.859  14.625  -25.073 1.00 0.00 ? 381 LYS A CE   2  
ATOM 1855  N NZ   . LYS A 1 6   ? -2.969  15.602  -24.903 1.00 0.00 ? 381 LYS A NZ   2  
ATOM 1856  H H    . LYS A 1 6   ? -2.163  15.545  -19.824 1.00 0.00 ? 381 LYS A H    2  
ATOM 1857  H HA   . LYS A 1 6   ? -3.924  14.658  -22.014 1.00 0.00 ? 381 LYS A HA   2  
ATOM 1858  H HB2  . LYS A 1 6   ? -1.639  13.140  -20.742 1.00 0.00 ? 381 LYS A HB2  2  
ATOM 1859  H HB3  . LYS A 1 6   ? -2.765  12.463  -21.910 1.00 0.00 ? 381 LYS A HB3  2  
ATOM 1860  H HG2  . LYS A 1 6   ? -1.305  14.931  -22.669 1.00 0.00 ? 381 LYS A HG2  2  
ATOM 1861  H HG3  . LYS A 1 6   ? -0.405  13.414  -22.621 1.00 0.00 ? 381 LYS A HG3  2  
ATOM 1862  H HD2  . LYS A 1 6   ? -1.408  12.631  -24.470 1.00 0.00 ? 381 LYS A HD2  2  
ATOM 1863  H HD3  . LYS A 1 6   ? -2.997  13.204  -23.962 1.00 0.00 ? 381 LYS A HD3  2  
ATOM 1864  H HE2  . LYS A 1 6   ? -0.918  15.133  -24.922 1.00 0.00 ? 381 LYS A HE2  2  
ATOM 1865  H HE3  . LYS A 1 6   ? -1.895  14.223  -26.074 1.00 0.00 ? 381 LYS A HE3  2  
ATOM 1866  H HZ1  . LYS A 1 6   ? -3.275  15.960  -25.830 1.00 0.00 ? 381 LYS A HZ1  2  
ATOM 1867  H HZ2  . LYS A 1 6   ? -3.779  15.147  -24.436 1.00 0.00 ? 381 LYS A HZ2  2  
ATOM 1868  H HZ3  . LYS A 1 6   ? -2.655  16.405  -24.321 1.00 0.00 ? 381 LYS A HZ3  2  
ATOM 1869  N N    . TYR A 1 7   ? -5.370  13.222  -20.543 1.00 0.00 ? 382 TYR A N    2  
ATOM 1870  C CA   . TYR A 1 7   ? -6.328  12.602  -19.634 1.00 0.00 ? 382 TYR A CA   2  
ATOM 1871  C C    . TYR A 1 7   ? -7.136  11.521  -20.345 1.00 0.00 ? 382 TYR A C    2  
ATOM 1872  O O    . TYR A 1 7   ? -7.658  11.741  -21.438 1.00 0.00 ? 382 TYR A O    2  
ATOM 1873  C CB   . TYR A 1 7   ? -7.271  13.659  -19.056 1.00 0.00 ? 382 TYR A CB   2  
ATOM 1874  C CG   . TYR A 1 7   ? -8.275  13.103  -18.071 1.00 0.00 ? 382 TYR A CG   2  
ATOM 1875  C CD1  . TYR A 1 7   ? -9.480  12.566  -18.506 1.00 0.00 ? 382 TYR A CD1  2  
ATOM 1876  C CD2  . TYR A 1 7   ? -8.018  13.117  -16.706 1.00 0.00 ? 382 TYR A CD2  2  
ATOM 1877  C CE1  . TYR A 1 7   ? -10.400 12.058  -17.609 1.00 0.00 ? 382 TYR A CE1  2  
ATOM 1878  C CE2  . TYR A 1 7   ? -8.933  12.611  -15.802 1.00 0.00 ? 382 TYR A CE2  2  
ATOM 1879  C CZ   . TYR A 1 7   ? -10.121 12.083  -16.258 1.00 0.00 ? 382 TYR A CZ   2  
ATOM 1880  O OH   . TYR A 1 7   ? -11.035 11.578  -15.360 1.00 0.00 ? 382 TYR A OH   2  
ATOM 1881  H H    . TYR A 1 7   ? -5.563  13.236  -21.504 1.00 0.00 ? 382 TYR A H    2  
ATOM 1882  H HA   . TYR A 1 7   ? -5.774  12.148  -18.827 1.00 0.00 ? 382 TYR A HA   2  
ATOM 1883  H HB2  . TYR A 1 7   ? -6.687  14.410  -18.546 1.00 0.00 ? 382 TYR A HB2  2  
ATOM 1884  H HB3  . TYR A 1 7   ? -7.819  14.123  -19.863 1.00 0.00 ? 382 TYR A HB3  2  
ATOM 1885  H HD1  . TYR A 1 7   ? -9.695  12.547  -19.563 1.00 0.00 ? 382 TYR A HD1  2  
ATOM 1886  H HD2  . TYR A 1 7   ? -7.086  13.533  -16.351 1.00 0.00 ? 382 TYR A HD2  2  
ATOM 1887  H HE1  . TYR A 1 7   ? -11.331 11.644  -17.966 1.00 0.00 ? 382 TYR A HE1  2  
ATOM 1888  H HE2  . TYR A 1 7   ? -8.714  12.631  -14.744 1.00 0.00 ? 382 TYR A HE2  2  
ATOM 1889  H HH   . TYR A 1 7   ? -11.364 12.287  -14.804 1.00 0.00 ? 382 TYR A HH   2  
ATOM 1890  N N    . ILE A 1 8   ? -7.235  10.353  -19.718 1.00 0.00 ? 383 ILE A N    2  
ATOM 1891  C CA   . ILE A 1 8   ? -7.979  9.239   -20.293 1.00 0.00 ? 383 ILE A CA   2  
ATOM 1892  C C    . ILE A 1 8   ? -9.173  8.850   -19.422 1.00 0.00 ? 383 ILE A C    2  
ATOM 1893  O O    . ILE A 1 8   ? -10.066 8.132   -19.870 1.00 0.00 ? 383 ILE A O    2  
ATOM 1894  C CB   . ILE A 1 8   ? -7.081  8.005   -20.494 1.00 0.00 ? 383 ILE A CB   2  
ATOM 1895  C CG1  . ILE A 1 8   ? -6.331  7.674   -19.204 1.00 0.00 ? 383 ILE A CG1  2  
ATOM 1896  C CG2  . ILE A 1 8   ? -6.102  8.245   -21.634 1.00 0.00 ? 383 ILE A CG2  2  
ATOM 1897  C CD1  . ILE A 1 8   ? -5.524  6.398   -19.287 1.00 0.00 ? 383 ILE A CD1  2  
ATOM 1898  H H    . ILE A 1 8   ? -6.797  10.238  -18.849 1.00 0.00 ? 383 ILE A H    2  
ATOM 1899  H HA   . ILE A 1 8   ? -8.345  9.551   -21.261 1.00 0.00 ? 383 ILE A HA   2  
ATOM 1900  H HB   . ILE A 1 8   ? -7.709  7.170   -20.762 1.00 0.00 ? 383 ILE A HB   2  
ATOM 1901  H HG12 . ILE A 1 8   ? -5.650  8.481   -18.973 1.00 0.00 ? 383 ILE A HG12 2  
ATOM 1902  H HG13 . ILE A 1 8   ? -7.043  7.568   -18.398 1.00 0.00 ? 383 ILE A HG13 2  
ATOM 1903  H HG21 . ILE A 1 8   ? -6.632  8.648   -22.484 1.00 0.00 ? 383 ILE A HG21 2  
ATOM 1904  H HG22 . ILE A 1 8   ? -5.344  8.946   -21.317 1.00 0.00 ? 383 ILE A HG22 2  
ATOM 1905  H HG23 . ILE A 1 8   ? -5.635  7.311   -21.911 1.00 0.00 ? 383 ILE A HG23 2  
ATOM 1906  H HD11 . ILE A 1 8   ? -5.401  5.984   -18.297 1.00 0.00 ? 383 ILE A HD11 2  
ATOM 1907  H HD12 . ILE A 1 8   ? -6.043  5.686   -19.912 1.00 0.00 ? 383 ILE A HD12 2  
ATOM 1908  H HD13 . ILE A 1 8   ? -4.556  6.610   -19.712 1.00 0.00 ? 383 ILE A HD13 2  
ATOM 1909  N N    . GLY A 1 9   ? -9.190  9.328   -18.179 1.00 0.00 ? 384 GLY A N    2  
ATOM 1910  C CA   . GLY A 1 9   ? -10.287 9.014   -17.281 1.00 0.00 ? 384 GLY A CA   2  
ATOM 1911  C C    . GLY A 1 9   ? -10.335 7.547   -16.899 1.00 0.00 ? 384 GLY A C    2  
ATOM 1912  O O    . GLY A 1 9   ? -11.310 6.855   -17.193 1.00 0.00 ? 384 GLY A O    2  
ATOM 1913  H H    . GLY A 1 9   ? -8.456  9.897   -17.871 1.00 0.00 ? 384 GLY A H    2  
ATOM 1914  H HA2  . GLY A 1 9   ? -10.183 9.603   -16.383 1.00 0.00 ? 384 GLY A HA2  2  
ATOM 1915  H HA3  . GLY A 1 9   ? -11.216 9.278   -17.763 1.00 0.00 ? 384 GLY A HA3  2  
ATOM 1916  N N    . ILE A 1 10  ? -9.283  7.072   -16.241 1.00 0.00 ? 385 ILE A N    2  
ATOM 1917  C CA   . ILE A 1 10  ? -9.214  5.678   -15.817 1.00 0.00 ? 385 ILE A CA   2  
ATOM 1918  C C    . ILE A 1 10  ? -8.105  5.466   -14.790 1.00 0.00 ? 385 ILE A C    2  
ATOM 1919  O O    . ILE A 1 10  ? -7.005  6.002   -14.932 1.00 0.00 ? 385 ILE A O    2  
ATOM 1920  C CB   . ILE A 1 10  ? -8.981  4.738   -17.018 1.00 0.00 ? 385 ILE A CB   2  
ATOM 1921  C CG1  . ILE A 1 10  ? -9.037  3.274   -16.571 1.00 0.00 ? 385 ILE A CG1  2  
ATOM 1922  C CG2  . ILE A 1 10  ? -7.648  5.046   -17.686 1.00 0.00 ? 385 ILE A CG2  2  
ATOM 1923  C CD1  . ILE A 1 10  ? -8.793  2.289   -17.693 1.00 0.00 ? 385 ILE A CD1  2  
ATOM 1924  H H    . ILE A 1 10  ? -8.536  7.671   -16.032 1.00 0.00 ? 385 ILE A H    2  
ATOM 1925  H HA   . ILE A 1 10  ? -10.162 5.421   -15.366 1.00 0.00 ? 385 ILE A HA   2  
ATOM 1926  H HB   . ILE A 1 10  ? -9.764  4.915   -17.740 1.00 0.00 ? 385 ILE A HB   2  
ATOM 1927  H HG12 . ILE A 1 10  ? -8.285  3.107   -15.814 1.00 0.00 ? 385 ILE A HG12 2  
ATOM 1928  H HG13 . ILE A 1 10  ? -10.013 3.070   -16.155 1.00 0.00 ? 385 ILE A HG13 2  
ATOM 1929  H HG21 . ILE A 1 10  ? -7.224  5.940   -17.252 1.00 0.00 ? 385 ILE A HG21 2  
ATOM 1930  H HG22 . ILE A 1 10  ? -6.970  4.219   -17.539 1.00 0.00 ? 385 ILE A HG22 2  
ATOM 1931  H HG23 . ILE A 1 10  ? -7.803  5.200   -18.744 1.00 0.00 ? 385 ILE A HG23 2  
ATOM 1932  H HD11 . ILE A 1 10  ? -9.680  1.693   -17.849 1.00 0.00 ? 385 ILE A HD11 2  
ATOM 1933  H HD12 . ILE A 1 10  ? -8.557  2.826   -18.599 1.00 0.00 ? 385 ILE A HD12 2  
ATOM 1934  H HD13 . ILE A 1 10  ? -7.967  1.644   -17.433 1.00 0.00 ? 385 ILE A HD13 2  
ATOM 1935  N N    . ARG A 1 11  ? -8.397  4.678   -13.760 1.00 0.00 ? 386 ARG A N    2  
ATOM 1936  C CA   . ARG A 1 11  ? -7.419  4.394   -12.716 1.00 0.00 ? 386 ARG A CA   2  
ATOM 1937  C C    . ARG A 1 11  ? -6.712  3.071   -12.983 1.00 0.00 ? 386 ARG A C    2  
ATOM 1938  O O    . ARG A 1 11  ? -7.308  2.132   -13.512 1.00 0.00 ? 386 ARG A O    2  
ATOM 1939  C CB   . ARG A 1 11  ? -8.089  4.355   -11.340 1.00 0.00 ? 386 ARG A CB   2  
ATOM 1940  C CG   . ARG A 1 11  ? -9.106  5.464   -11.116 1.00 0.00 ? 386 ARG A CG   2  
ATOM 1941  C CD   . ARG A 1 11  ? -10.369 4.939   -10.449 1.00 0.00 ? 386 ARG A CD   2  
ATOM 1942  N NE   . ARG A 1 11  ? -10.422 5.283   -9.030  1.00 0.00 ? 386 ARG A NE   2  
ATOM 1943  C CZ   . ARG A 1 11  ? -10.516 6.529   -8.573  1.00 0.00 ? 386 ARG A CZ   2  
ATOM 1944  N NH1  . ARG A 1 11  ? -10.565 7.552   -9.417  1.00 0.00 ? 386 ARG A NH1  2  
ATOM 1945  N NH2  . ARG A 1 11  ? -10.560 6.754   -7.266  1.00 0.00 ? 386 ARG A NH2  2  
ATOM 1946  H H    . ARG A 1 11  ? -9.289  4.275   -13.703 1.00 0.00 ? 386 ARG A H    2  
ATOM 1947  H HA   . ARG A 1 11  ? -6.687  5.186   -12.725 1.00 0.00 ? 386 ARG A HA   2  
ATOM 1948  H HB2  . ARG A 1 11  ? -8.593  3.408   -11.225 1.00 0.00 ? 386 ARG A HB2  2  
ATOM 1949  H HB3  . ARG A 1 11  ? -7.327  4.439   -10.580 1.00 0.00 ? 386 ARG A HB3  2  
ATOM 1950  H HG2  . ARG A 1 11  ? -8.665  6.218   -10.481 1.00 0.00 ? 386 ARG A HG2  2  
ATOM 1951  H HG3  . ARG A 1 11  ? -9.367  5.900   -12.068 1.00 0.00 ? 386 ARG A HG3  2  
ATOM 1952  H HD2  . ARG A 1 11  ? -11.228 5.367   -10.945 1.00 0.00 ? 386 ARG A HD2  2  
ATOM 1953  H HD3  . ARG A 1 11  ? -10.395 3.864   -10.551 1.00 0.00 ? 386 ARG A HD3  2  
ATOM 1954  H HE   . ARG A 1 11  ? -10.386 4.546   -8.385  1.00 0.00 ? 386 ARG A HE   2  
ATOM 1955  H HH11 . ARG A 1 11  ? -10.532 7.390   -10.403 1.00 0.00 ? 386 ARG A HH11 2  
ATOM 1956  H HH12 . ARG A 1 11  ? -10.636 8.486   -9.067  1.00 0.00 ? 386 ARG A HH12 2  
ATOM 1957  H HH21 . ARG A 1 11  ? -10.523 5.987   -6.626  1.00 0.00 ? 386 ARG A HH21 2  
ATOM 1958  H HH22 . ARG A 1 11  ? -10.630 7.690   -6.922  1.00 0.00 ? 386 ARG A HH22 2  
ATOM 1959  N N    . MET A 1 12  ? -5.437  3.003   -12.616 1.00 0.00 ? 387 MET A N    2  
ATOM 1960  C CA   . MET A 1 12  ? -4.646  1.795   -12.815 1.00 0.00 ? 387 MET A CA   2  
ATOM 1961  C C    . MET A 1 12  ? -3.715  1.558   -11.631 1.00 0.00 ? 387 MET A C    2  
ATOM 1962  O O    . MET A 1 12  ? -3.125  2.495   -11.096 1.00 0.00 ? 387 MET A O    2  
ATOM 1963  C CB   . MET A 1 12  ? -3.835  1.891   -14.110 1.00 0.00 ? 387 MET A CB   2  
ATOM 1964  C CG   . MET A 1 12  ? -3.226  3.264   -14.353 1.00 0.00 ? 387 MET A CG   2  
ATOM 1965  S SD   . MET A 1 12  ? -1.424  3.254   -14.276 1.00 0.00 ? 387 MET A SD   2  
ATOM 1966  C CE   . MET A 1 12  ? -1.081  5.005   -14.124 1.00 0.00 ? 387 MET A CE   2  
ATOM 1967  H H    . MET A 1 12  ? -5.019  3.786   -12.200 1.00 0.00 ? 387 MET A H    2  
ATOM 1968  H HA   . MET A 1 12  ? -5.330  0.963   -12.890 1.00 0.00 ? 387 MET A HA   2  
ATOM 1969  H HB2  . MET A 1 12  ? -3.036  1.166   -14.072 1.00 0.00 ? 387 MET A HB2  2  
ATOM 1970  H HB3  . MET A 1 12  ? -4.481  1.655   -14.942 1.00 0.00 ? 387 MET A HB3  2  
ATOM 1971  H HG2  . MET A 1 12  ? -3.527  3.607   -15.332 1.00 0.00 ? 387 MET A HG2  2  
ATOM 1972  H HG3  . MET A 1 12  ? -3.600  3.947   -13.604 1.00 0.00 ? 387 MET A HG3  2  
ATOM 1973  H HE1  . MET A 1 12  ? -0.494  5.330   -14.969 1.00 0.00 ? 387 MET A HE1  2  
ATOM 1974  H HE2  . MET A 1 12  ? -2.011  5.554   -14.099 1.00 0.00 ? 387 MET A HE2  2  
ATOM 1975  H HE3  . MET A 1 12  ? -0.532  5.186   -13.212 1.00 0.00 ? 387 MET A HE3  2  
ATOM 1976  N N    . MET A 1 13  ? -3.592  0.300   -11.227 1.00 0.00 ? 388 MET A N    2  
ATOM 1977  C CA   . MET A 1 13  ? -2.738  -0.061  -10.101 1.00 0.00 ? 388 MET A CA   2  
ATOM 1978  C C    . MET A 1 13  ? -1.599  -0.973  -10.545 1.00 0.00 ? 388 MET A C    2  
ATOM 1979  O O    . MET A 1 13  ? -1.648  -1.566  -11.623 1.00 0.00 ? 388 MET A O    2  
ATOM 1980  C CB   . MET A 1 13  ? -3.563  -0.749  -9.012  1.00 0.00 ? 388 MET A CB   2  
ATOM 1981  C CG   . MET A 1 13  ? -4.365  -1.938  -9.517  1.00 0.00 ? 388 MET A CG   2  
ATOM 1982  S SD   . MET A 1 13  ? -5.586  -2.522  -8.322  1.00 0.00 ? 388 MET A SD   2  
ATOM 1983  C CE   . MET A 1 13  ? -4.699  -2.297  -6.782  1.00 0.00 ? 388 MET A CE   2  
ATOM 1984  H H    . MET A 1 13  ? -4.091  -0.404  -11.692 1.00 0.00 ? 388 MET A H    2  
ATOM 1985  H HA   . MET A 1 13  ? -2.317  0.849   -9.699  1.00 0.00 ? 388 MET A HA   2  
ATOM 1986  H HB2  . MET A 1 13  ? -2.895  -1.095  -8.236  1.00 0.00 ? 388 MET A HB2  2  
ATOM 1987  H HB3  . MET A 1 13  ? -4.250  -0.031  -8.589  1.00 0.00 ? 388 MET A HB3  2  
ATOM 1988  H HG2  . MET A 1 13  ? -4.879  -1.650  -10.420 1.00 0.00 ? 388 MET A HG2  2  
ATOM 1989  H HG3  . MET A 1 13  ? -3.685  -2.745  -9.737  1.00 0.00 ? 388 MET A HG3  2  
ATOM 1990  H HE1  . MET A 1 13  ? -5.273  -2.723  -5.972  1.00 0.00 ? 388 MET A HE1  2  
ATOM 1991  H HE2  . MET A 1 13  ? -3.741  -2.792  -6.844  1.00 0.00 ? 388 MET A HE2  2  
ATOM 1992  H HE3  . MET A 1 13  ? -4.550  -1.243  -6.603  1.00 0.00 ? 388 MET A HE3  2  
ATOM 1993  N N    . SER A 1 14  ? -0.575  -1.080  -9.705  1.00 0.00 ? 389 SER A N    2  
ATOM 1994  C CA   . SER A 1 14  ? 0.577   -1.922  -10.006 1.00 0.00 ? 389 SER A CA   2  
ATOM 1995  C C    . SER A 1 14  ? 0.319   -3.364  -9.581  1.00 0.00 ? 389 SER A C    2  
ATOM 1996  O O    . SER A 1 14  ? 0.153   -3.653  -8.397  1.00 0.00 ? 389 SER A O    2  
ATOM 1997  C CB   . SER A 1 14  ? 1.824   -1.385  -9.302  1.00 0.00 ? 389 SER A CB   2  
ATOM 1998  O OG   . SER A 1 14  ? 1.524   -0.961  -7.985  1.00 0.00 ? 389 SER A OG   2  
ATOM 1999  H H    . SER A 1 14  ? -0.595  -0.584  -8.861  1.00 0.00 ? 389 SER A H    2  
ATOM 2000  H HA   . SER A 1 14  ? 0.737   -1.896  -11.073 1.00 0.00 ? 389 SER A HA   2  
ATOM 2001  H HB2  . SER A 1 14  ? 2.572   -2.162  -9.255  1.00 0.00 ? 389 SER A HB2  2  
ATOM 2002  H HB3  . SER A 1 14  ? 2.214   -0.544  -9.858  1.00 0.00 ? 389 SER A HB3  2  
ATOM 2003  H HG   . SER A 1 14  ? 2.327   -0.659  -7.554  1.00 0.00 ? 389 SER A HG   2  
ATOM 2004  N N    . LEU A 1 15  ? 0.284   -4.265  -10.557 1.00 0.00 ? 390 LEU A N    2  
ATOM 2005  C CA   . LEU A 1 15  ? 0.043   -5.677  -10.285 1.00 0.00 ? 390 LEU A CA   2  
ATOM 2006  C C    . LEU A 1 15  ? 1.226   -6.302  -9.552  1.00 0.00 ? 390 LEU A C    2  
ATOM 2007  O O    . LEU A 1 15  ? 2.101   -6.910  -10.168 1.00 0.00 ? 390 LEU A O    2  
ATOM 2008  C CB   . LEU A 1 15  ? -0.224  -6.430  -11.589 1.00 0.00 ? 390 LEU A CB   2  
ATOM 2009  C CG   . LEU A 1 15  ? -1.291  -7.523  -11.501 1.00 0.00 ? 390 LEU A CG   2  
ATOM 2010  C CD1  . LEU A 1 15  ? -2.586  -6.965  -10.929 1.00 0.00 ? 390 LEU A CD1  2  
ATOM 2011  C CD2  . LEU A 1 15  ? -1.529  -8.140  -12.872 1.00 0.00 ? 390 LEU A CD2  2  
ATOM 2012  H H    . LEU A 1 15  ? 0.421   -3.973  -11.482 1.00 0.00 ? 390 LEU A H    2  
ATOM 2013  H HA   . LEU A 1 15  ? -0.831  -5.747  -9.655  1.00 0.00 ? 390 LEU A HA   2  
ATOM 2014  H HB2  . LEU A 1 15  ? -0.534  -5.713  -12.336 1.00 0.00 ? 390 LEU A HB2  2  
ATOM 2015  H HB3  . LEU A 1 15  ? 0.699   -6.886  -11.914 1.00 0.00 ? 390 LEU A HB3  2  
ATOM 2016  H HG   . LEU A 1 15  ? -0.944  -8.302  -10.839 1.00 0.00 ? 390 LEU A HG   2  
ATOM 2017  H HD11 . LEU A 1 15  ? -2.525  -5.887  -10.877 1.00 0.00 ? 390 LEU A HD11 2  
ATOM 2018  H HD12 . LEU A 1 15  ? -3.413  -7.248  -11.564 1.00 0.00 ? 390 LEU A HD12 2  
ATOM 2019  H HD13 . LEU A 1 15  ? -2.743  -7.364  -9.937  1.00 0.00 ? 390 LEU A HD13 2  
ATOM 2020  H HD21 . LEU A 1 15  ? -2.324  -8.869  -12.804 1.00 0.00 ? 390 LEU A HD21 2  
ATOM 2021  H HD22 . LEU A 1 15  ? -1.811  -7.367  -13.571 1.00 0.00 ? 390 LEU A HD22 2  
ATOM 2022  H HD23 . LEU A 1 15  ? -0.625  -8.623  -13.212 1.00 0.00 ? 390 LEU A HD23 2  
ATOM 2023  N N    . THR A 1 16  ? 1.244   -6.148  -8.232  1.00 0.00 ? 391 THR A N    2  
ATOM 2024  C CA   . THR A 1 16  ? 2.317   -6.697  -7.412  1.00 0.00 ? 391 THR A CA   2  
ATOM 2025  C C    . THR A 1 16  ? 2.222   -8.218  -7.342  1.00 0.00 ? 391 THR A C    2  
ATOM 2026  O O    . THR A 1 16  ? 1.264   -8.813  -7.835  1.00 0.00 ? 391 THR A O    2  
ATOM 2027  C CB   . THR A 1 16  ? 2.266   -6.105  -6.002  1.00 0.00 ? 391 THR A CB   2  
ATOM 2028  O OG1  . THR A 1 16  ? 3.132   -6.809  -5.129  1.00 0.00 ? 391 THR A OG1  2  
ATOM 2029  C CG2  . THR A 1 16  ? 0.880   -6.130  -5.392  1.00 0.00 ? 391 THR A CG2  2  
ATOM 2030  H H    . THR A 1 16  ? 0.517   -5.654  -7.799  1.00 0.00 ? 391 THR A H    2  
ATOM 2031  H HA   . THR A 1 16  ? 3.257   -6.428  -7.871  1.00 0.00 ? 391 THR A HA   2  
ATOM 2032  H HB   . THR A 1 16  ? 2.590   -5.076  -6.043  1.00 0.00 ? 391 THR A HB   2  
ATOM 2033  H HG1  . THR A 1 16  ? 3.158   -6.366  -4.278  1.00 0.00 ? 391 THR A HG1  2  
ATOM 2034  H HG21 . THR A 1 16  ? 0.201   -6.633  -6.064  1.00 0.00 ? 391 THR A HG21 2  
ATOM 2035  H HG22 . THR A 1 16  ? 0.911   -6.657  -4.449  1.00 0.00 ? 391 THR A HG22 2  
ATOM 2036  H HG23 . THR A 1 16  ? 0.542   -5.118  -5.228  1.00 0.00 ? 391 THR A HG23 2  
ATOM 2037  N N    . SER A 1 17  ? 3.222   -8.841  -6.729  1.00 0.00 ? 392 SER A N    2  
ATOM 2038  C CA   . SER A 1 17  ? 3.252   -10.294 -6.596  1.00 0.00 ? 392 SER A CA   2  
ATOM 2039  C C    . SER A 1 17  ? 2.073   -10.800 -5.766  1.00 0.00 ? 392 SER A C    2  
ATOM 2040  O O    . SER A 1 17  ? 1.723   -11.979 -5.825  1.00 0.00 ? 392 SER A O    2  
ATOM 2041  C CB   . SER A 1 17  ? 4.567   -10.740 -5.953  1.00 0.00 ? 392 SER A CB   2  
ATOM 2042  O OG   . SER A 1 17  ? 5.681   -10.227 -6.664  1.00 0.00 ? 392 SER A OG   2  
ATOM 2043  H H    . SER A 1 17  ? 3.959   -8.313  -6.357  1.00 0.00 ? 392 SER A H    2  
ATOM 2044  H HA   . SER A 1 17  ? 3.186   -10.718 -7.587  1.00 0.00 ? 392 SER A HA   2  
ATOM 2045  H HB2  . SER A 1 17  ? 4.609   -10.379 -4.936  1.00 0.00 ? 392 SER A HB2  2  
ATOM 2046  H HB3  . SER A 1 17  ? 4.619   -11.819 -5.956  1.00 0.00 ? 392 SER A HB3  2  
ATOM 2047  H HG   . SER A 1 17  ? 6.479   -10.361 -6.148  1.00 0.00 ? 392 SER A HG   2  
ATOM 2048  N N    . SER A 1 18  ? 1.465   -9.905  -4.991  1.00 0.00 ? 393 SER A N    2  
ATOM 2049  C CA   . SER A 1 18  ? 0.330   -10.269 -4.152  1.00 0.00 ? 393 SER A CA   2  
ATOM 2050  C C    . SER A 1 18  ? -0.972  -10.253 -4.948  1.00 0.00 ? 393 SER A C    2  
ATOM 2051  O O    . SER A 1 18  ? -1.776  -11.180 -4.858  1.00 0.00 ? 393 SER A O    2  
ATOM 2052  C CB   . SER A 1 18  ? 0.226   -9.313  -2.961  1.00 0.00 ? 393 SER A CB   2  
ATOM 2053  O OG   . SER A 1 18  ? 0.803   -9.882  -1.798  1.00 0.00 ? 393 SER A OG   2  
ATOM 2054  H H    . SER A 1 18  ? 1.788   -8.980  -4.983  1.00 0.00 ? 393 SER A H    2  
ATOM 2055  H HA   . SER A 1 18  ? 0.499   -11.270 -3.783  1.00 0.00 ? 393 SER A HA   2  
ATOM 2056  H HB2  . SER A 1 18  ? 0.745   -8.395  -3.191  1.00 0.00 ? 393 SER A HB2  2  
ATOM 2057  H HB3  . SER A 1 18  ? -0.814  -9.098  -2.763  1.00 0.00 ? 393 SER A HB3  2  
ATOM 2058  H HG   . SER A 1 18  ? 0.107   -10.134 -1.186  1.00 0.00 ? 393 SER A HG   2  
ATOM 2059  N N    . LYS A 1 19  ? -1.173  -9.193  -5.722  1.00 0.00 ? 394 LYS A N    2  
ATOM 2060  C CA   . LYS A 1 19  ? -2.380  -9.055  -6.530  1.00 0.00 ? 394 LYS A CA   2  
ATOM 2061  C C    . LYS A 1 19  ? -2.252  -9.818  -7.846  1.00 0.00 ? 394 LYS A C    2  
ATOM 2062  O O    . LYS A 1 19  ? -3.236  -10.332 -8.375  1.00 0.00 ? 394 LYS A O    2  
ATOM 2063  C CB   . LYS A 1 19  ? -2.664  -7.577  -6.808  1.00 0.00 ? 394 LYS A CB   2  
ATOM 2064  C CG   . LYS A 1 19  ? -4.102  -7.170  -6.527  1.00 0.00 ? 394 LYS A CG   2  
ATOM 2065  C CD   . LYS A 1 19  ? -4.184  -5.761  -5.957  1.00 0.00 ? 394 LYS A CD   2  
ATOM 2066  C CE   . LYS A 1 19  ? -4.502  -5.774  -4.470  1.00 0.00 ? 394 LYS A CE   2  
ATOM 2067  N NZ   . LYS A 1 19  ? -3.363  -5.271  -3.653  1.00 0.00 ? 394 LYS A NZ   2  
ATOM 2068  H H    . LYS A 1 19  ? -0.497  -8.484  -5.750  1.00 0.00 ? 394 LYS A H    2  
ATOM 2069  H HA   . LYS A 1 19  ? -3.203  -9.470  -5.968  1.00 0.00 ? 394 LYS A HA   2  
ATOM 2070  H HB2  . LYS A 1 19  ? -2.016  -6.976  -6.188  1.00 0.00 ? 394 LYS A HB2  2  
ATOM 2071  H HB3  . LYS A 1 19  ? -2.450  -7.367  -7.845  1.00 0.00 ? 394 LYS A HB3  2  
ATOM 2072  H HG2  . LYS A 1 19  ? -4.662  -7.207  -7.449  1.00 0.00 ? 394 LYS A HG2  2  
ATOM 2073  H HG3  . LYS A 1 19  ? -4.529  -7.863  -5.817  1.00 0.00 ? 394 LYS A HG3  2  
ATOM 2074  H HD2  . LYS A 1 19  ? -3.236  -5.267  -6.107  1.00 0.00 ? 394 LYS A HD2  2  
ATOM 2075  H HD3  . LYS A 1 19  ? -4.960  -5.219  -6.477  1.00 0.00 ? 394 LYS A HD3  2  
ATOM 2076  H HE2  . LYS A 1 19  ? -5.363  -5.146  -4.294  1.00 0.00 ? 394 LYS A HE2  2  
ATOM 2077  H HE3  . LYS A 1 19  ? -4.729  -6.787  -4.170  1.00 0.00 ? 394 LYS A HE3  2  
ATOM 2078  H HZ1  . LYS A 1 19  ? -2.804  -6.069  -3.289  1.00 0.00 ? 394 LYS A HZ1  2  
ATOM 2079  H HZ2  . LYS A 1 19  ? -2.747  -4.666  -4.232  1.00 0.00 ? 394 LYS A HZ2  2  
ATOM 2080  H HZ3  . LYS A 1 19  ? -3.718  -4.714  -2.849  1.00 0.00 ? 394 LYS A HZ3  2  
ATOM 2081  N N    . ALA A 1 20  ? -1.032  -9.883  -8.370  1.00 0.00 ? 395 ALA A N    2  
ATOM 2082  C CA   . ALA A 1 20  ? -0.775  -10.579 -9.625  1.00 0.00 ? 395 ALA A CA   2  
ATOM 2083  C C    . ALA A 1 20  ? -1.024  -12.077 -9.491  1.00 0.00 ? 395 ALA A C    2  
ATOM 2084  O O    . ALA A 1 20  ? -1.740  -12.672 -10.296 1.00 0.00 ? 395 ALA A O    2  
ATOM 2085  C CB   . ALA A 1 20  ? 0.650   -10.320 -10.087 1.00 0.00 ? 395 ALA A CB   2  
ATOM 2086  H H    . ALA A 1 20  ? -0.288  -9.451  -7.902  1.00 0.00 ? 395 ALA A H    2  
ATOM 2087  H HA   . ALA A 1 20  ? -1.447  -10.179 -10.371 1.00 0.00 ? 395 ALA A HA   2  
ATOM 2088  H HB1  . ALA A 1 20  ? 0.814   -10.800 -11.040 1.00 0.00 ? 395 ALA A HB1  2  
ATOM 2089  H HB2  . ALA A 1 20  ? 0.809   -9.256  -10.187 1.00 0.00 ? 395 ALA A HB2  2  
ATOM 2090  H HB3  . ALA A 1 20  ? 1.342   -10.719 -9.360  1.00 0.00 ? 395 ALA A HB3  2  
ATOM 2091  N N    . LYS A 1 21  ? -0.426  -12.683 -8.470  1.00 0.00 ? 396 LYS A N    2  
ATOM 2092  C CA   . LYS A 1 21  ? -0.580  -14.113 -8.234  1.00 0.00 ? 396 LYS A CA   2  
ATOM 2093  C C    . LYS A 1 21  ? -1.993  -14.445 -7.762  1.00 0.00 ? 396 LYS A C    2  
ATOM 2094  O O    . LYS A 1 21  ? -2.498  -15.540 -8.009  1.00 0.00 ? 396 LYS A O    2  
ATOM 2095  C CB   . LYS A 1 21  ? 0.444   -14.593 -7.202  1.00 0.00 ? 396 LYS A CB   2  
ATOM 2096  C CG   . LYS A 1 21  ? 1.236   -15.810 -7.651  1.00 0.00 ? 396 LYS A CG   2  
ATOM 2097  C CD   . LYS A 1 21  ? 0.740   -17.080 -6.978  1.00 0.00 ? 396 LYS A CD   2  
ATOM 2098  C CE   . LYS A 1 21  ? 1.348   -18.320 -7.612  1.00 0.00 ? 396 LYS A CE   2  
ATOM 2099  N NZ   . LYS A 1 21  ? 0.548   -19.542 -7.323  1.00 0.00 ? 396 LYS A NZ   2  
ATOM 2100  H H    . LYS A 1 21  ? 0.135   -12.155 -7.864  1.00 0.00 ? 396 LYS A H    2  
ATOM 2101  H HA   . LYS A 1 21  ? -0.399  -14.624 -9.169  1.00 0.00 ? 396 LYS A HA   2  
ATOM 2102  H HB2  . LYS A 1 21  ? 1.140   -13.790 -7.005  1.00 0.00 ? 396 LYS A HB2  2  
ATOM 2103  H HB3  . LYS A 1 21  ? -0.071  -14.843 -6.287  1.00 0.00 ? 396 LYS A HB3  2  
ATOM 2104  H HG2  . LYS A 1 21  ? 1.135   -15.919 -8.720  1.00 0.00 ? 396 LYS A HG2  2  
ATOM 2105  H HG3  . LYS A 1 21  ? 2.277   -15.663 -7.400  1.00 0.00 ? 396 LYS A HG3  2  
ATOM 2106  H HD2  . LYS A 1 21  ? 1.012   -17.052 -5.934  1.00 0.00 ? 396 LYS A HD2  2  
ATOM 2107  H HD3  . LYS A 1 21  ? -0.335  -17.129 -7.071  1.00 0.00 ? 396 LYS A HD3  2  
ATOM 2108  H HE2  . LYS A 1 21  ? 1.395   -18.177 -8.681  1.00 0.00 ? 396 LYS A HE2  2  
ATOM 2109  H HE3  . LYS A 1 21  ? 2.348   -18.455 -7.224  1.00 0.00 ? 396 LYS A HE3  2  
ATOM 2110  H HZ1  . LYS A 1 21  ? 0.871   -19.979 -6.435  1.00 0.00 ? 396 LYS A HZ1  2  
ATOM 2111  H HZ2  . LYS A 1 21  ? -0.459  -19.297 -7.229  1.00 0.00 ? 396 LYS A HZ2  2  
ATOM 2112  H HZ3  . LYS A 1 21  ? 0.654   -20.232 -8.094  1.00 0.00 ? 396 LYS A HZ3  2  
ATOM 2113  N N    . GLU A 1 22  ? -2.624  -13.495 -7.079  1.00 0.00 ? 397 GLU A N    2  
ATOM 2114  C CA   . GLU A 1 22  ? -3.978  -13.691 -6.571  1.00 0.00 ? 397 GLU A CA   2  
ATOM 2115  C C    . GLU A 1 22  ? -4.976  -13.838 -7.714  1.00 0.00 ? 397 GLU A C    2  
ATOM 2116  O O    . GLU A 1 22  ? -5.914  -14.632 -7.634  1.00 0.00 ? 397 GLU A O    2  
ATOM 2117  C CB   . GLU A 1 22  ? -4.381  -12.521 -5.673  1.00 0.00 ? 397 GLU A CB   2  
ATOM 2118  C CG   . GLU A 1 22  ? -5.744  -12.695 -5.023  1.00 0.00 ? 397 GLU A CG   2  
ATOM 2119  C CD   . GLU A 1 22  ? -6.689  -11.548 -5.328  1.00 0.00 ? 397 GLU A CD   2  
ATOM 2120  O OE1  . GLU A 1 22  ? -6.918  -11.271 -6.525  1.00 0.00 ? 397 GLU A OE1  2  
ATOM 2121  O OE2  . GLU A 1 22  ? -7.198  -10.928 -4.372  1.00 0.00 ? 397 GLU A OE2  2  
ATOM 2122  H H    . GLU A 1 22  ? -2.169  -12.644 -6.911  1.00 0.00 ? 397 GLU A H    2  
ATOM 2123  H HA   . GLU A 1 22  ? -3.983  -14.599 -5.986  1.00 0.00 ? 397 GLU A HA   2  
ATOM 2124  H HB2  . GLU A 1 22  ? -3.645  -12.411 -4.891  1.00 0.00 ? 397 GLU A HB2  2  
ATOM 2125  H HB3  . GLU A 1 22  ? -4.401  -11.618 -6.266  1.00 0.00 ? 397 GLU A HB3  2  
ATOM 2126  H HG2  . GLU A 1 22  ? -6.186  -13.611 -5.384  1.00 0.00 ? 397 GLU A HG2  2  
ATOM 2127  H HG3  . GLU A 1 22  ? -5.612  -12.757 -3.953  1.00 0.00 ? 397 GLU A HG3  2  
ATOM 2128  N N    . LEU A 1 23  ? -4.770  -13.067 -8.776  1.00 0.00 ? 398 LEU A N    2  
ATOM 2129  C CA   . LEU A 1 23  ? -5.654  -13.111 -9.936  1.00 0.00 ? 398 LEU A CA   2  
ATOM 2130  C C    . LEU A 1 23  ? -5.632  -14.489 -10.590 1.00 0.00 ? 398 LEU A C    2  
ATOM 2131  O O    . LEU A 1 23  ? -6.678  -15.100 -10.809 1.00 0.00 ? 398 LEU A O    2  
ATOM 2132  C CB   . LEU A 1 23  ? -5.247  -12.044 -10.953 1.00 0.00 ? 398 LEU A CB   2  
ATOM 2133  C CG   . LEU A 1 23  ? -5.357  -10.602 -10.456 1.00 0.00 ? 398 LEU A CG   2  
ATOM 2134  C CD1  . LEU A 1 23  ? -4.267  -9.741  -11.073 1.00 0.00 ? 398 LEU A CD1  2  
ATOM 2135  C CD2  . LEU A 1 23  ? -6.732  -10.033 -10.775 1.00 0.00 ? 398 LEU A CD2  2  
ATOM 2136  H H    . LEU A 1 23  ? -4.006  -12.454 -8.781  1.00 0.00 ? 398 LEU A H    2  
ATOM 2137  H HA   . LEU A 1 23  ? -6.658  -12.905 -9.594  1.00 0.00 ? 398 LEU A HA   2  
ATOM 2138  H HB2  . LEU A 1 23  ? -4.223  -12.227 -11.244 1.00 0.00 ? 398 LEU A HB2  2  
ATOM 2139  H HB3  . LEU A 1 23  ? -5.876  -12.149 -11.825 1.00 0.00 ? 398 LEU A HB3  2  
ATOM 2140  H HG   . LEU A 1 23  ? -5.229  -10.586 -9.384  1.00 0.00 ? 398 LEU A HG   2  
ATOM 2141  H HD11 . LEU A 1 23  ? -3.396  -10.349 -11.270 1.00 0.00 ? 398 LEU A HD11 2  
ATOM 2142  H HD12 . LEU A 1 23  ? -4.624  -9.312  -11.998 1.00 0.00 ? 398 LEU A HD12 2  
ATOM 2143  H HD13 . LEU A 1 23  ? -4.003  -8.948  -10.387 1.00 0.00 ? 398 LEU A HD13 2  
ATOM 2144  H HD21 . LEU A 1 23  ? -6.744  -8.976  -10.556 1.00 0.00 ? 398 LEU A HD21 2  
ATOM 2145  H HD22 . LEU A 1 23  ? -6.951  -10.186 -11.822 1.00 0.00 ? 398 LEU A HD22 2  
ATOM 2146  H HD23 . LEU A 1 23  ? -7.477  -10.535 -10.175 1.00 0.00 ? 398 LEU A HD23 2  
ATOM 2147  N N    . LYS A 1 24  ? -4.433  -14.973 -10.900 1.00 0.00 ? 399 LYS A N    2  
ATOM 2148  C CA   . LYS A 1 24  ? -4.275  -16.279 -11.531 1.00 0.00 ? 399 LYS A CA   2  
ATOM 2149  C C    . LYS A 1 24  ? -4.860  -17.384 -10.656 1.00 0.00 ? 399 LYS A C    2  
ATOM 2150  O O    . LYS A 1 24  ? -5.323  -18.407 -11.160 1.00 0.00 ? 399 LYS A O    2  
ATOM 2151  C CB   . LYS A 1 24  ? -2.797  -16.559 -11.806 1.00 0.00 ? 399 LYS A CB   2  
ATOM 2152  C CG   . LYS A 1 24  ? -2.299  -15.970 -13.116 1.00 0.00 ? 399 LYS A CG   2  
ATOM 2153  C CD   . LYS A 1 24  ? -1.046  -15.132 -12.913 1.00 0.00 ? 399 LYS A CD   2  
ATOM 2154  C CE   . LYS A 1 24  ? 0.202   -16.000 -12.857 1.00 0.00 ? 399 LYS A CE   2  
ATOM 2155  N NZ   . LYS A 1 24  ? 0.579   -16.349 -11.458 1.00 0.00 ? 399 LYS A NZ   2  
ATOM 2156  H H    . LYS A 1 24  ? -3.637  -14.439 -10.701 1.00 0.00 ? 399 LYS A H    2  
ATOM 2157  H HA   . LYS A 1 24  ? -4.809  -16.259 -12.470 1.00 0.00 ? 399 LYS A HA   2  
ATOM 2158  H HB2  . LYS A 1 24  ? -2.209  -16.144 -11.000 1.00 0.00 ? 399 LYS A HB2  2  
ATOM 2159  H HB3  . LYS A 1 24  ? -2.645  -17.629 -11.836 1.00 0.00 ? 399 LYS A HB3  2  
ATOM 2160  H HG2  . LYS A 1 24  ? -2.073  -16.775 -13.798 1.00 0.00 ? 399 LYS A HG2  2  
ATOM 2161  H HG3  . LYS A 1 24  ? -3.074  -15.346 -13.536 1.00 0.00 ? 399 LYS A HG3  2  
ATOM 2162  H HD2  . LYS A 1 24  ? -0.952  -14.437 -13.733 1.00 0.00 ? 399 LYS A HD2  2  
ATOM 2163  H HD3  . LYS A 1 24  ? -1.136  -14.587 -11.984 1.00 0.00 ? 399 LYS A HD3  2  
ATOM 2164  H HE2  . LYS A 1 24  ? 0.016   -16.910 -13.408 1.00 0.00 ? 399 LYS A HE2  2  
ATOM 2165  H HE3  . LYS A 1 24  ? 1.019   -15.463 -13.318 1.00 0.00 ? 399 LYS A HE3  2  
ATOM 2166  H HZ1  . LYS A 1 24  ? 1.511   -15.949 -11.230 1.00 0.00 ? 399 LYS A HZ1  2  
ATOM 2167  H HZ2  . LYS A 1 24  ? -0.123  -15.968 -10.792 1.00 0.00 ? 399 LYS A HZ2  2  
ATOM 2168  H HZ3  . LYS A 1 24  ? 0.621   -17.382 -11.347 1.00 0.00 ? 399 LYS A HZ3  2  
ATOM 2169  N N    . ASP A 1 25  ? -4.831  -17.173 -9.345  1.00 0.00 ? 400 ASP A N    2  
ATOM 2170  C CA   . ASP A 1 25  ? -5.355  -18.153 -8.401  1.00 0.00 ? 400 ASP A CA   2  
ATOM 2171  C C    . ASP A 1 25  ? -6.875  -18.246 -8.497  1.00 0.00 ? 400 ASP A C    2  
ATOM 2172  O O    . ASP A 1 25  ? -7.424  -19.308 -8.791  1.00 0.00 ? 400 ASP A O    2  
ATOM 2173  C CB   . ASP A 1 25  ? -4.942  -17.786 -6.972  1.00 0.00 ? 400 ASP A CB   2  
ATOM 2174  C CG   . ASP A 1 25  ? -4.043  -18.833 -6.344  1.00 0.00 ? 400 ASP A CG   2  
ATOM 2175  O OD1  . ASP A 1 25  ? -3.095  -19.285 -7.019  1.00 0.00 ? 400 ASP A OD1  2  
ATOM 2176  O OD2  . ASP A 1 25  ? -4.288  -19.201 -5.176  1.00 0.00 ? 400 ASP A OD2  2  
ATOM 2177  H H    . ASP A 1 25  ? -4.446  -16.338 -9.003  1.00 0.00 ? 400 ASP A H    2  
ATOM 2178  H HA   . ASP A 1 25  ? -4.932  -19.113 -8.652  1.00 0.00 ? 400 ASP A HA   2  
ATOM 2179  H HB2  . ASP A 1 25  ? -4.409  -16.846 -6.988  1.00 0.00 ? 400 ASP A HB2  2  
ATOM 2180  H HB3  . ASP A 1 25  ? -5.827  -17.682 -6.361  1.00 0.00 ? 400 ASP A HB3  2  
ATOM 2181  N N    . ARG A 1 26  ? -7.551  -17.130 -8.246  1.00 0.00 ? 401 ARG A N    2  
ATOM 2182  C CA   . ARG A 1 26  ? -9.007  -17.088 -8.302  1.00 0.00 ? 401 ARG A CA   2  
ATOM 2183  C C    . ARG A 1 26  ? -9.508  -17.323 -9.724  1.00 0.00 ? 401 ARG A C    2  
ATOM 2184  O O    . ARG A 1 26  ? -10.477 -18.052 -9.938  1.00 0.00 ? 401 ARG A O    2  
ATOM 2185  C CB   . ARG A 1 26  ? -9.522  -15.743 -7.785  1.00 0.00 ? 401 ARG A CB   2  
ATOM 2186  C CG   . ARG A 1 26  ? -10.975 -15.777 -7.344  1.00 0.00 ? 401 ARG A CG   2  
ATOM 2187  C CD   . ARG A 1 26  ? -11.409 -14.448 -6.748  1.00 0.00 ? 401 ARG A CD   2  
ATOM 2188  N NE   . ARG A 1 26  ? -12.855 -14.257 -6.827  1.00 0.00 ? 401 ARG A NE   2  
ATOM 2189  C CZ   . ARG A 1 26  ? -13.725 -14.837 -6.004  1.00 0.00 ? 401 ARG A CZ   2  
ATOM 2190  N NH1  . ARG A 1 26  ? -13.302 -15.643 -5.039  1.00 0.00 ? 401 ARG A NH1  2  
ATOM 2191  N NH2  . ARG A 1 26  ? -15.024 -14.610 -6.147  1.00 0.00 ? 401 ARG A NH2  2  
ATOM 2192  H H    . ARG A 1 26  ? -7.058  -16.314 -8.015  1.00 0.00 ? 401 ARG A H    2  
ATOM 2193  H HA   . ARG A 1 26  ? -9.385  -17.874 -7.666  1.00 0.00 ? 401 ARG A HA   2  
ATOM 2194  H HB2  . ARG A 1 26  ? -8.919  -15.440 -6.942  1.00 0.00 ? 401 ARG A HB2  2  
ATOM 2195  H HB3  . ARG A 1 26  ? -9.424  -15.007 -8.569  1.00 0.00 ? 401 ARG A HB3  2  
ATOM 2196  H HG2  . ARG A 1 26  ? -11.597 -15.996 -8.199  1.00 0.00 ? 401 ARG A HG2  2  
ATOM 2197  H HG3  . ARG A 1 26  ? -11.098 -16.552 -6.601  1.00 0.00 ? 401 ARG A HG3  2  
ATOM 2198  H HD2  . ARG A 1 26  ? -11.108 -14.418 -5.711  1.00 0.00 ? 401 ARG A HD2  2  
ATOM 2199  H HD3  . ARG A 1 26  ? -10.919 -13.650 -7.287  1.00 0.00 ? 401 ARG A HD3  2  
ATOM 2200  H HE   . ARG A 1 26  ? -13.195 -13.667 -7.532  1.00 0.00 ? 401 ARG A HE   2  
ATOM 2201  H HH11 . ARG A 1 26  ? -12.324 -15.818 -4.925  1.00 0.00 ? 401 ARG A HH11 2  
ATOM 2202  H HH12 . ARG A 1 26  ? -13.962 -16.074 -4.423  1.00 0.00 ? 401 ARG A HH12 2  
ATOM 2203  H HH21 . ARG A 1 26  ? -15.350 -14.004 -6.874  1.00 0.00 ? 401 ARG A HH21 2  
ATOM 2204  H HH22 . ARG A 1 26  ? -15.679 -15.045 -5.529  1.00 0.00 ? 401 ARG A HH22 2  
ATOM 2205  N N    . HIS A 1 27  ? -8.842  -16.702 -10.692 1.00 0.00 ? 402 HIS A N    2  
ATOM 2206  C CA   . HIS A 1 27  ? -9.222  -16.845 -12.094 1.00 0.00 ? 402 HIS A CA   2  
ATOM 2207  C C    . HIS A 1 27  ? -8.078  -17.439 -12.909 1.00 0.00 ? 402 HIS A C    2  
ATOM 2208  O O    . HIS A 1 27  ? -7.029  -16.815 -13.075 1.00 0.00 ? 402 HIS A O    2  
ATOM 2209  C CB   . HIS A 1 27  ? -9.630  -15.488 -12.673 1.00 0.00 ? 402 HIS A CB   2  
ATOM 2210  C CG   . HIS A 1 27  ? -11.080 -15.406 -13.037 1.00 0.00 ? 402 HIS A CG   2  
ATOM 2211  N ND1  . HIS A 1 27  ? -11.532 -15.420 -14.340 1.00 0.00 ? 402 HIS A ND1  2  
ATOM 2212  C CD2  . HIS A 1 27  ? -12.185 -15.308 -12.260 1.00 0.00 ? 402 HIS A CD2  2  
ATOM 2213  C CE1  . HIS A 1 27  ? -12.850 -15.334 -14.348 1.00 0.00 ? 402 HIS A CE1  2  
ATOM 2214  N NE2  . HIS A 1 27  ? -13.271 -15.266 -13.100 1.00 0.00 ? 402 HIS A NE2  2  
ATOM 2215  H H    . HIS A 1 27  ? -8.078  -16.134 -10.460 1.00 0.00 ? 402 HIS A H    2  
ATOM 2216  H HA   . HIS A 1 27  ? -10.067 -17.515 -12.141 1.00 0.00 ? 402 HIS A HA   2  
ATOM 2217  H HB2  . HIS A 1 27  ? -9.428  -14.718 -11.943 1.00 0.00 ? 402 HIS A HB2  2  
ATOM 2218  H HB3  . HIS A 1 27  ? -9.052  -15.294 -13.564 1.00 0.00 ? 402 HIS A HB3  2  
ATOM 2219  H HD1  . HIS A 1 27  ? -10.969 -15.484 -15.140 1.00 0.00 ? 402 HIS A HD1  2  
ATOM 2220  H HD2  . HIS A 1 27  ? -12.209 -15.271 -11.180 1.00 0.00 ? 402 HIS A HD2  2  
ATOM 2221  H HE1  . HIS A 1 27  ? -13.477 -15.324 -15.228 1.00 0.00 ? 402 HIS A HE1  2  
ATOM 2222  H HE2  . HIS A 1 27  ? -14.198 -15.110 -12.823 1.00 0.00 ? 402 HIS A HE2  2  
ATOM 2223  N N    . ARG A 1 28  ? -8.288  -18.650 -13.417 1.00 0.00 ? 403 ARG A N    2  
ATOM 2224  C CA   . ARG A 1 28  ? -7.275  -19.330 -14.217 1.00 0.00 ? 403 ARG A CA   2  
ATOM 2225  C C    . ARG A 1 28  ? -7.322  -18.863 -15.668 1.00 0.00 ? 403 ARG A C    2  
ATOM 2226  O O    . ARG A 1 28  ? -6.312  -18.896 -16.373 1.00 0.00 ? 403 ARG A O    2  
ATOM 2227  C CB   . ARG A 1 28  ? -7.475  -20.845 -14.149 1.00 0.00 ? 403 ARG A CB   2  
ATOM 2228  C CG   . ARG A 1 28  ? -6.408  -21.633 -14.889 1.00 0.00 ? 403 ARG A CG   2  
ATOM 2229  C CD   . ARG A 1 28  ? -6.785  -23.099 -15.019 1.00 0.00 ? 403 ARG A CD   2  
ATOM 2230  N NE   . ARG A 1 28  ? -5.630  -23.935 -15.338 1.00 0.00 ? 403 ARG A NE   2  
ATOM 2231  C CZ   . ARG A 1 28  ? -5.721  -25.167 -15.836 1.00 0.00 ? 403 ARG A CZ   2  
ATOM 2232  N NH1  . ARG A 1 28  ? -6.909  -25.709 -16.071 1.00 0.00 ? 403 ARG A NH1  2  
ATOM 2233  N NH2  . ARG A 1 28  ? -4.621  -25.858 -16.100 1.00 0.00 ? 403 ARG A NH2  2  
ATOM 2234  H H    . ARG A 1 28  ? -9.144  -19.097 -13.250 1.00 0.00 ? 403 ARG A H    2  
ATOM 2235  H HA   . ARG A 1 28  ? -6.308  -19.085 -13.803 1.00 0.00 ? 403 ARG A HA   2  
ATOM 2236  H HB2  . ARG A 1 28  ? -7.466  -21.152 -13.113 1.00 0.00 ? 403 ARG A HB2  2  
ATOM 2237  H HB3  . ARG A 1 28  ? -8.436  -21.089 -14.578 1.00 0.00 ? 403 ARG A HB3  2  
ATOM 2238  H HG2  . ARG A 1 28  ? -6.285  -21.214 -15.877 1.00 0.00 ? 403 ARG A HG2  2  
ATOM 2239  H HG3  . ARG A 1 28  ? -5.476  -21.556 -14.347 1.00 0.00 ? 403 ARG A HG3  2  
ATOM 2240  H HD2  . ARG A 1 28  ? -7.210  -23.433 -14.084 1.00 0.00 ? 403 ARG A HD2  2  
ATOM 2241  H HD3  . ARG A 1 28  ? -7.519  -23.201 -15.805 1.00 0.00 ? 403 ARG A HD3  2  
ATOM 2242  H HE   . ARG A 1 28  ? -4.740  -23.560 -15.174 1.00 0.00 ? 403 ARG A HE   2  
ATOM 2243  H HH11 . ARG A 1 28  ? -7.743  -25.193 -15.874 1.00 0.00 ? 403 ARG A HH11 2  
ATOM 2244  H HH12 . ARG A 1 28  ? -6.971  -26.634 -16.444 1.00 0.00 ? 403 ARG A HH12 2  
ATOM 2245  H HH21 . ARG A 1 28  ? -3.723  -25.455 -15.924 1.00 0.00 ? 403 ARG A HH21 2  
ATOM 2246  H HH22 . ARG A 1 28  ? -4.689  -26.783 -16.474 1.00 0.00 ? 403 ARG A HH22 2  
ATOM 2247  N N    . ASP A 1 29  ? -8.498  -18.429 -16.110 1.00 0.00 ? 404 ASP A N    2  
ATOM 2248  C CA   . ASP A 1 29  ? -8.674  -17.956 -17.478 1.00 0.00 ? 404 ASP A CA   2  
ATOM 2249  C C    . ASP A 1 29  ? -7.716  -16.809 -17.792 1.00 0.00 ? 404 ASP A C    2  
ATOM 2250  O O    . ASP A 1 29  ? -7.363  -16.582 -18.948 1.00 0.00 ? 404 ASP A O    2  
ATOM 2251  C CB   . ASP A 1 29  ? -10.118 -17.504 -17.702 1.00 0.00 ? 404 ASP A CB   2  
ATOM 2252  C CG   . ASP A 1 29  ? -11.066 -18.672 -17.895 1.00 0.00 ? 404 ASP A CG   2  
ATOM 2253  O OD1  . ASP A 1 29  ? -11.091 -19.567 -17.024 1.00 0.00 ? 404 ASP A OD1  2  
ATOM 2254  O OD2  . ASP A 1 29  ? -11.784 -18.690 -18.917 1.00 0.00 ? 404 ASP A OD2  2  
ATOM 2255  H H    . ASP A 1 29  ? -9.266  -18.427 -15.502 1.00 0.00 ? 404 ASP A H    2  
ATOM 2256  H HA   . ASP A 1 29  ? -8.459  -18.780 -18.143 1.00 0.00 ? 404 ASP A HA   2  
ATOM 2257  H HB2  . ASP A 1 29  ? -10.447 -16.936 -16.844 1.00 0.00 ? 404 ASP A HB2  2  
ATOM 2258  H HB3  . ASP A 1 29  ? -10.161 -16.879 -18.581 1.00 0.00 ? 404 ASP A HB3  2  
ATOM 2259  N N    . PHE A 1 30  ? -7.299  -16.088 -16.754 1.00 0.00 ? 405 PHE A N    2  
ATOM 2260  C CA   . PHE A 1 30  ? -6.383  -14.965 -16.922 1.00 0.00 ? 405 PHE A CA   2  
ATOM 2261  C C    . PHE A 1 30  ? -5.111  -15.401 -17.646 1.00 0.00 ? 405 PHE A C    2  
ATOM 2262  O O    . PHE A 1 30  ? -4.794  -16.589 -17.703 1.00 0.00 ? 405 PHE A O    2  
ATOM 2263  C CB   . PHE A 1 30  ? -6.026  -14.365 -15.561 1.00 0.00 ? 405 PHE A CB   2  
ATOM 2264  C CG   . PHE A 1 30  ? -7.012  -13.339 -15.078 1.00 0.00 ? 405 PHE A CG   2  
ATOM 2265  C CD1  . PHE A 1 30  ? -7.477  -12.350 -15.931 1.00 0.00 ? 405 PHE A CD1  2  
ATOM 2266  C CD2  . PHE A 1 30  ? -7.473  -13.364 -13.772 1.00 0.00 ? 405 PHE A CD2  2  
ATOM 2267  C CE1  . PHE A 1 30  ? -8.384  -11.405 -15.489 1.00 0.00 ? 405 PHE A CE1  2  
ATOM 2268  C CE2  . PHE A 1 30  ? -8.380  -12.422 -13.324 1.00 0.00 ? 405 PHE A CE2  2  
ATOM 2269  C CZ   . PHE A 1 30  ? -8.836  -11.441 -14.184 1.00 0.00 ? 405 PHE A CZ   2  
ATOM 2270  H H    . PHE A 1 30  ? -7.616  -16.316 -15.855 1.00 0.00 ? 405 PHE A H    2  
ATOM 2271  H HA   . PHE A 1 30  ? -6.882  -14.215 -17.516 1.00 0.00 ? 405 PHE A HA   2  
ATOM 2272  H HB2  . PHE A 1 30  ? -5.984  -15.155 -14.826 1.00 0.00 ? 405 PHE A HB2  2  
ATOM 2273  H HB3  . PHE A 1 30  ? -5.057  -13.891 -15.627 1.00 0.00 ? 405 PHE A HB3  2  
ATOM 2274  H HD1  . PHE A 1 30  ? -7.124  -12.321 -16.951 1.00 0.00 ? 405 PHE A HD1  2  
ATOM 2275  H HD2  . PHE A 1 30  ? -7.118  -14.130 -13.099 1.00 0.00 ? 405 PHE A HD2  2  
ATOM 2276  H HE1  . PHE A 1 30  ? -8.738  -10.639 -16.163 1.00 0.00 ? 405 PHE A HE1  2  
ATOM 2277  H HE2  . PHE A 1 30  ? -8.732  -12.452 -12.303 1.00 0.00 ? 405 PHE A HE2  2  
ATOM 2278  H HZ   . PHE A 1 30  ? -9.544  -10.703 -13.836 1.00 0.00 ? 405 PHE A HZ   2  
ATOM 2279  N N    . PRO A 1 31  ? -4.360  -14.439 -18.210 1.00 0.00 ? 406 PRO A N    2  
ATOM 2280  C CA   . PRO A 1 31  ? -3.117  -14.729 -18.933 1.00 0.00 ? 406 PRO A CA   2  
ATOM 2281  C C    . PRO A 1 31  ? -2.012  -15.222 -18.005 1.00 0.00 ? 406 PRO A C    2  
ATOM 2282  O O    . PRO A 1 31  ? -2.167  -15.224 -16.784 1.00 0.00 ? 406 PRO A O    2  
ATOM 2283  C CB   . PRO A 1 31  ? -2.736  -13.380 -19.548 1.00 0.00 ? 406 PRO A CB   2  
ATOM 2284  C CG   . PRO A 1 31  ? -3.387  -12.366 -18.673 1.00 0.00 ? 406 PRO A CG   2  
ATOM 2285  C CD   . PRO A 1 31  ? -4.664  -12.995 -18.190 1.00 0.00 ? 406 PRO A CD   2  
ATOM 2286  H HA   . PRO A 1 31  ? -3.277  -15.454 -19.717 1.00 0.00 ? 406 PRO A HA   2  
ATOM 2287  H HB2  . PRO A 1 31  ? -1.661  -13.272 -19.547 1.00 0.00 ? 406 PRO A HB2  2  
ATOM 2288  H HB3  . PRO A 1 31  ? -3.108  -13.324 -20.559 1.00 0.00 ? 406 PRO A HB3  2  
ATOM 2289  H HG2  . PRO A 1 31  ? -2.744  -12.134 -17.837 1.00 0.00 ? 406 PRO A HG2  2  
ATOM 2290  H HG3  . PRO A 1 31  ? -3.603  -11.473 -19.241 1.00 0.00 ? 406 PRO A HG3  2  
ATOM 2291  H HD2  . PRO A 1 31  ? -4.893  -12.665 -17.188 1.00 0.00 ? 406 PRO A HD2  2  
ATOM 2292  H HD3  . PRO A 1 31  ? -5.477  -12.764 -18.860 1.00 0.00 ? 406 PRO A HD3  2  
ATOM 2293  N N    . ASP A 1 32  ? -0.897  -15.641 -18.593 1.00 0.00 ? 407 ASP A N    2  
ATOM 2294  C CA   . ASP A 1 32  ? 0.236   -16.136 -17.819 1.00 0.00 ? 407 ASP A CA   2  
ATOM 2295  C C    . ASP A 1 32  ? 1.288   -15.048 -17.639 1.00 0.00 ? 407 ASP A C    2  
ATOM 2296  O O    . ASP A 1 32  ? 2.483   -15.334 -17.548 1.00 0.00 ? 407 ASP A O    2  
ATOM 2297  C CB   . ASP A 1 32  ? 0.857   -17.353 -18.507 1.00 0.00 ? 407 ASP A CB   2  
ATOM 2298  C CG   . ASP A 1 32  ? 1.874   -18.057 -17.631 1.00 0.00 ? 407 ASP A CG   2  
ATOM 2299  O OD1  . ASP A 1 32  ? 1.465   -18.908 -16.813 1.00 0.00 ? 407 ASP A OD1  2  
ATOM 2300  O OD2  . ASP A 1 32  ? 3.080   -17.757 -17.762 1.00 0.00 ? 407 ASP A OD2  2  
ATOM 2301  H H    . ASP A 1 32  ? -0.832  -15.615 -19.571 1.00 0.00 ? 407 ASP A H    2  
ATOM 2302  H HA   . ASP A 1 32  ? -0.130  -16.432 -16.847 1.00 0.00 ? 407 ASP A HA   2  
ATOM 2303  H HB2  . ASP A 1 32  ? 0.076   -18.057 -18.756 1.00 0.00 ? 407 ASP A HB2  2  
ATOM 2304  H HB3  . ASP A 1 32  ? 1.349   -17.034 -19.414 1.00 0.00 ? 407 ASP A HB3  2  
ATOM 2305  N N    . VAL A 1 33  ? 0.838   -13.799 -17.586 1.00 0.00 ? 408 VAL A N    2  
ATOM 2306  C CA   . VAL A 1 33  ? 1.741   -12.668 -17.416 1.00 0.00 ? 408 VAL A CA   2  
ATOM 2307  C C    . VAL A 1 33  ? 1.498   -11.969 -16.083 1.00 0.00 ? 408 VAL A C    2  
ATOM 2308  O O    . VAL A 1 33  ? 0.372   -11.585 -15.767 1.00 0.00 ? 408 VAL A O    2  
ATOM 2309  C CB   . VAL A 1 33  ? 1.582   -11.645 -18.556 1.00 0.00 ? 408 VAL A CB   2  
ATOM 2310  C CG1  . VAL A 1 33  ? 2.149   -12.197 -19.853 1.00 0.00 ? 408 VAL A CG1  2  
ATOM 2311  C CG2  . VAL A 1 33  ? 0.120   -11.257 -18.727 1.00 0.00 ? 408 VAL A CG2  2  
ATOM 2312  H H    . VAL A 1 33  ? -0.125  -13.634 -17.664 1.00 0.00 ? 408 VAL A H    2  
ATOM 2313  H HA   . VAL A 1 33  ? 2.754   -13.043 -17.435 1.00 0.00 ? 408 VAL A HA   2  
ATOM 2314  H HB   . VAL A 1 33  ? 2.140   -10.756 -18.295 1.00 0.00 ? 408 VAL A HB   2  
ATOM 2315  H HG11 . VAL A 1 33  ? 2.857   -12.983 -19.631 1.00 0.00 ? 408 VAL A HG11 2  
ATOM 2316  H HG12 . VAL A 1 33  ? 1.347   -12.597 -20.456 1.00 0.00 ? 408 VAL A HG12 2  
ATOM 2317  H HG13 . VAL A 1 33  ? 2.648   -11.407 -20.395 1.00 0.00 ? 408 VAL A HG13 2  
ATOM 2318  H HG21 . VAL A 1 33  ? -0.287  -11.760 -19.591 1.00 0.00 ? 408 VAL A HG21 2  
ATOM 2319  H HG22 . VAL A 1 33  ? -0.436  -11.544 -17.847 1.00 0.00 ? 408 VAL A HG22 2  
ATOM 2320  H HG23 . VAL A 1 33  ? 0.045   -10.188 -18.866 1.00 0.00 ? 408 VAL A HG23 2  
ATOM 2321  N N    . ILE A 1 34  ? 2.561   -11.805 -15.303 1.00 0.00 ? 409 ILE A N    2  
ATOM 2322  C CA   . ILE A 1 34  ? 2.463   -11.153 -14.004 1.00 0.00 ? 409 ILE A CA   2  
ATOM 2323  C C    . ILE A 1 34  ? 2.673   -9.647  -14.128 1.00 0.00 ? 409 ILE A C    2  
ATOM 2324  O O    . ILE A 1 34  ? 2.124   -8.866  -13.350 1.00 0.00 ? 409 ILE A O    2  
ATOM 2325  C CB   . ILE A 1 34  ? 3.487   -11.728 -13.007 1.00 0.00 ? 409 ILE A CB   2  
ATOM 2326  C CG1  . ILE A 1 34  ? 4.914   -11.499 -13.513 1.00 0.00 ? 409 ILE A CG1  2  
ATOM 2327  C CG2  . ILE A 1 34  ? 3.228   -13.210 -12.781 1.00 0.00 ? 409 ILE A CG2  2  
ATOM 2328  C CD1  . ILE A 1 34  ? 5.630   -10.367 -12.810 1.00 0.00 ? 409 ILE A CD1  2  
ATOM 2329  H H    . ILE A 1 34  ? 3.433   -12.132 -15.609 1.00 0.00 ? 409 ILE A H    2  
ATOM 2330  H HA   . ILE A 1 34  ? 1.471   -11.335 -13.615 1.00 0.00 ? 409 ILE A HA   2  
ATOM 2331  H HB   . ILE A 1 34  ? 3.362   -11.219 -12.062 1.00 0.00 ? 409 ILE A HB   2  
ATOM 2332  H HG12 . ILE A 1 34  ? 5.492   -12.400 -13.362 1.00 0.00 ? 409 ILE A HG12 2  
ATOM 2333  H HG13 . ILE A 1 34  ? 4.883   -11.269 -14.567 1.00 0.00 ? 409 ILE A HG13 2  
ATOM 2334  H HG21 . ILE A 1 34  ? 3.300   -13.735 -13.723 1.00 0.00 ? 409 ILE A HG21 2  
ATOM 2335  H HG22 . ILE A 1 34  ? 3.961   -13.603 -12.092 1.00 0.00 ? 409 ILE A HG22 2  
ATOM 2336  H HG23 . ILE A 1 34  ? 2.239   -13.344 -12.369 1.00 0.00 ? 409 ILE A HG23 2  
ATOM 2337  H HD11 . ILE A 1 34  ? 6.597   -10.216 -13.266 1.00 0.00 ? 409 ILE A HD11 2  
ATOM 2338  H HD12 . ILE A 1 34  ? 5.046   -9.463  -12.897 1.00 0.00 ? 409 ILE A HD12 2  
ATOM 2339  H HD13 . ILE A 1 34  ? 5.758   -10.615 -11.767 1.00 0.00 ? 409 ILE A HD13 2  
ATOM 2340  N N    . SER A 1 35  ? 3.472   -9.245  -15.112 1.00 0.00 ? 410 SER A N    2  
ATOM 2341  C CA   . SER A 1 35  ? 3.754   -7.833  -15.340 1.00 0.00 ? 410 SER A CA   2  
ATOM 2342  C C    . SER A 1 35  ? 2.538   -7.125  -15.930 1.00 0.00 ? 410 SER A C    2  
ATOM 2343  O O    . SER A 1 35  ? 1.536   -7.760  -16.258 1.00 0.00 ? 410 SER A O    2  
ATOM 2344  C CB   . SER A 1 35  ? 4.956   -7.675  -16.274 1.00 0.00 ? 410 SER A CB   2  
ATOM 2345  O OG   . SER A 1 35  ? 5.183   -8.860  -17.018 1.00 0.00 ? 410 SER A OG   2  
ATOM 2346  H H    . SER A 1 35  ? 3.880   -9.914  -15.700 1.00 0.00 ? 410 SER A H    2  
ATOM 2347  H HA   . SER A 1 35  ? 3.990   -7.384  -14.387 1.00 0.00 ? 410 SER A HA   2  
ATOM 2348  H HB2  . SER A 1 35  ? 4.771   -6.864  -16.963 1.00 0.00 ? 410 SER A HB2  2  
ATOM 2349  H HB3  . SER A 1 35  ? 5.837   -7.457  -15.690 1.00 0.00 ? 410 SER A HB3  2  
ATOM 2350  H HG   . SER A 1 35  ? 5.302   -8.638  -17.945 1.00 0.00 ? 410 SER A HG   2  
ATOM 2351  N N    . GLY A 1 36  ? 2.635   -5.806  -16.061 1.00 0.00 ? 411 GLY A N    2  
ATOM 2352  C CA   . GLY A 1 36  ? 1.536   -5.034  -16.611 1.00 0.00 ? 411 GLY A CA   2  
ATOM 2353  C C    . GLY A 1 36  ? 0.777   -4.268  -15.546 1.00 0.00 ? 411 GLY A C    2  
ATOM 2354  O O    . GLY A 1 36  ? 1.039   -4.426  -14.354 1.00 0.00 ? 411 GLY A O    2  
ATOM 2355  H H    . GLY A 1 36  ? 3.458   -5.353  -15.783 1.00 0.00 ? 411 GLY A H    2  
ATOM 2356  H HA2  . GLY A 1 36  ? 1.929   -4.333  -17.332 1.00 0.00 ? 411 GLY A HA2  2  
ATOM 2357  H HA3  . GLY A 1 36  ? 0.853   -5.705  -17.111 1.00 0.00 ? 411 GLY A HA3  2  
ATOM 2358  N N    . ALA A 1 37  ? -0.167  -3.437  -15.976 1.00 0.00 ? 412 ALA A N    2  
ATOM 2359  C CA   . ALA A 1 37  ? -0.966  -2.645  -15.050 1.00 0.00 ? 412 ALA A CA   2  
ATOM 2360  C C    . ALA A 1 37  ? -2.404  -3.149  -14.994 1.00 0.00 ? 412 ALA A C    2  
ATOM 2361  O O    . ALA A 1 37  ? -2.985  -3.513  -16.016 1.00 0.00 ? 412 ALA A O    2  
ATOM 2362  C CB   . ALA A 1 37  ? -0.937  -1.178  -15.445 1.00 0.00 ? 412 ALA A CB   2  
ATOM 2363  H H    . ALA A 1 37  ? -0.330  -3.356  -16.939 1.00 0.00 ? 412 ALA A H    2  
ATOM 2364  H HA   . ALA A 1 37  ? -0.526  -2.737  -14.067 1.00 0.00 ? 412 ALA A HA   2  
ATOM 2365  H HB1  . ALA A 1 37  ? -0.893  -0.566  -14.556 1.00 0.00 ? 412 ALA A HB1  2  
ATOM 2366  H HB2  . ALA A 1 37  ? -0.069  -0.986  -16.058 1.00 0.00 ? 412 ALA A HB2  2  
ATOM 2367  H HB3  . ALA A 1 37  ? -1.831  -0.937  -16.002 1.00 0.00 ? 412 ALA A HB3  2  
ATOM 2368  N N    . TYR A 1 38  ? -2.970  -3.166  -13.794 1.00 0.00 ? 413 TYR A N    2  
ATOM 2369  C CA   . TYR A 1 38  ? -4.340  -3.624  -13.601 1.00 0.00 ? 413 TYR A CA   2  
ATOM 2370  C C    . TYR A 1 38  ? -5.318  -2.461  -13.721 1.00 0.00 ? 413 TYR A C    2  
ATOM 2371  O O    . TYR A 1 38  ? -5.157  -1.432  -13.064 1.00 0.00 ? 413 TYR A O    2  
ATOM 2372  C CB   . TYR A 1 38  ? -4.486  -4.293  -12.233 1.00 0.00 ? 413 TYR A CB   2  
ATOM 2373  C CG   . TYR A 1 38  ? -5.891  -4.762  -11.929 1.00 0.00 ? 413 TYR A CG   2  
ATOM 2374  C CD1  . TYR A 1 38  ? -6.868  -3.866  -11.514 1.00 0.00 ? 413 TYR A CD1  2  
ATOM 2375  C CD2  . TYR A 1 38  ? -6.239  -6.101  -12.053 1.00 0.00 ? 413 TYR A CD2  2  
ATOM 2376  C CE1  . TYR A 1 38  ? -8.152  -4.291  -11.232 1.00 0.00 ? 413 TYR A CE1  2  
ATOM 2377  C CE2  . TYR A 1 38  ? -7.521  -6.534  -11.773 1.00 0.00 ? 413 TYR A CE2  2  
ATOM 2378  C CZ   . TYR A 1 38  ? -8.475  -5.626  -11.364 1.00 0.00 ? 413 TYR A CZ   2  
ATOM 2379  O OH   . TYR A 1 38  ? -9.753  -6.052  -11.082 1.00 0.00 ? 413 TYR A OH   2  
ATOM 2380  H H    . TYR A 1 38  ? -2.454  -2.862  -13.017 1.00 0.00 ? 413 TYR A H    2  
ATOM 2381  H HA   . TYR A 1 38  ? -4.560  -4.346  -14.373 1.00 0.00 ? 413 TYR A HA   2  
ATOM 2382  H HB2  . TYR A 1 38  ? -3.834  -5.154  -12.191 1.00 0.00 ? 413 TYR A HB2  2  
ATOM 2383  H HB3  . TYR A 1 38  ? -4.195  -3.591  -11.465 1.00 0.00 ? 413 TYR A HB3  2  
ATOM 2384  H HD1  . TYR A 1 38  ? -6.613  -2.821  -11.413 1.00 0.00 ? 413 TYR A HD1  2  
ATOM 2385  H HD2  . TYR A 1 38  ? -5.491  -6.811  -12.375 1.00 0.00 ? 413 TYR A HD2  2  
ATOM 2386  H HE1  . TYR A 1 38  ? -8.898  -3.579  -10.912 1.00 0.00 ? 413 TYR A HE1  2  
ATOM 2387  H HE2  . TYR A 1 38  ? -7.772  -7.579  -11.876 1.00 0.00 ? 413 TYR A HE2  2  
ATOM 2388  H HH   . TYR A 1 38  ? -9.953  -6.836  -11.599 1.00 0.00 ? 413 TYR A HH   2  
ATOM 2389  N N    . ILE A 1 39  ? -6.333  -2.629  -14.563 1.00 0.00 ? 414 ILE A N    2  
ATOM 2390  C CA   . ILE A 1 39  ? -7.335  -1.591  -14.765 1.00 0.00 ? 414 ILE A CA   2  
ATOM 2391  C C    . ILE A 1 39  ? -8.361  -1.599  -13.639 1.00 0.00 ? 414 ILE A C    2  
ATOM 2392  O O    . ILE A 1 39  ? -8.938  -2.638  -13.316 1.00 0.00 ? 414 ILE A O    2  
ATOM 2393  C CB   . ILE A 1 39  ? -8.060  -1.761  -16.115 1.00 0.00 ? 414 ILE A CB   2  
ATOM 2394  C CG1  . ILE A 1 39  ? -7.044  -1.932  -17.246 1.00 0.00 ? 414 ILE A CG1  2  
ATOM 2395  C CG2  . ILE A 1 39  ? -8.963  -0.566  -16.384 1.00 0.00 ? 414 ILE A CG2  2  
ATOM 2396  C CD1  . ILE A 1 39  ? -7.537  -2.806  -18.378 1.00 0.00 ? 414 ILE A CD1  2  
ATOM 2397  H H    . ILE A 1 39  ? -6.408  -3.471  -15.059 1.00 0.00 ? 414 ILE A H    2  
ATOM 2398  H HA   . ILE A 1 39  ? -6.828  -0.637  -14.770 1.00 0.00 ? 414 ILE A HA   2  
ATOM 2399  H HB   . ILE A 1 39  ? -8.678  -2.644  -16.059 1.00 0.00 ? 414 ILE A HB   2  
ATOM 2400  H HG12 . ILE A 1 39  ? -6.806  -0.963  -17.657 1.00 0.00 ? 414 ILE A HG12 2  
ATOM 2401  H HG13 . ILE A 1 39  ? -6.145  -2.380  -16.848 1.00 0.00 ? 414 ILE A HG13 2  
ATOM 2402  H HG21 . ILE A 1 39  ? -8.485  0.334   -16.028 1.00 0.00 ? 414 ILE A HG21 2  
ATOM 2403  H HG22 . ILE A 1 39  ? -9.142  -0.482  -17.446 1.00 0.00 ? 414 ILE A HG22 2  
ATOM 2404  H HG23 . ILE A 1 39  ? -9.903  -0.701  -15.870 1.00 0.00 ? 414 ILE A HG23 2  
ATOM 2405  H HD11 . ILE A 1 39  ? -7.234  -3.829  -18.201 1.00 0.00 ? 414 ILE A HD11 2  
ATOM 2406  H HD12 . ILE A 1 39  ? -8.614  -2.754  -18.431 1.00 0.00 ? 414 ILE A HD12 2  
ATOM 2407  H HD13 . ILE A 1 39  ? -7.113  -2.462  -19.309 1.00 0.00 ? 414 ILE A HD13 2  
ATOM 2408  N N    . ILE A 1 40  ? -8.575  -0.434  -13.037 1.00 0.00 ? 415 ILE A N    2  
ATOM 2409  C CA   . ILE A 1 40  ? -9.523  -0.301  -11.938 1.00 0.00 ? 415 ILE A CA   2  
ATOM 2410  C C    . ILE A 1 40  ? -10.940 -0.073  -12.451 1.00 0.00 ? 415 ILE A C    2  
ATOM 2411  O O    . ILE A 1 40  ? -11.802 -0.945  -12.334 1.00 0.00 ? 415 ILE A O    2  
ATOM 2412  C CB   . ILE A 1 40  ? -9.135  0.862   -11.004 1.00 0.00 ? 415 ILE A CB   2  
ATOM 2413  C CG1  . ILE A 1 40  ? -7.624  0.864   -10.751 1.00 0.00 ? 415 ILE A CG1  2  
ATOM 2414  C CG2  . ILE A 1 40  ? -9.901  0.770   -9.693  1.00 0.00 ? 415 ILE A CG2  2  
ATOM 2415  C CD1  . ILE A 1 40  ? -7.140  -0.323  -9.954  1.00 0.00 ? 415 ILE A CD1  2  
ATOM 2416  H H    . ILE A 1 40  ? -8.079  0.356   -13.338 1.00 0.00 ? 415 ILE A H    2  
ATOM 2417  H HA   . ILE A 1 40  ? -9.502  -1.217  -11.366 1.00 0.00 ? 415 ILE A HA   2  
ATOM 2418  H HB   . ILE A 1 40  ? -9.413  1.785   -11.486 1.00 0.00 ? 415 ILE A HB   2  
ATOM 2419  H HG12 . ILE A 1 40  ? -7.107  0.852   -11.698 1.00 0.00 ? 415 ILE A HG12 2  
ATOM 2420  H HG13 . ILE A 1 40  ? -7.356  1.760   -10.211 1.00 0.00 ? 415 ILE A HG13 2  
ATOM 2421  H HG21 . ILE A 1 40  ? -9.872  -0.247  -9.329  1.00 0.00 ? 415 ILE A HG21 2  
ATOM 2422  H HG22 . ILE A 1 40  ? -9.447  1.426   -8.965  1.00 0.00 ? 415 ILE A HG22 2  
ATOM 2423  H HG23 . ILE A 1 40  ? -10.927 1.067   -9.853  1.00 0.00 ? 415 ILE A HG23 2  
ATOM 2424  H HD11 . ILE A 1 40  ? -6.383  -0.002  -9.254  1.00 0.00 ? 415 ILE A HD11 2  
ATOM 2425  H HD12 . ILE A 1 40  ? -7.967  -0.757  -9.414  1.00 0.00 ? 415 ILE A HD12 2  
ATOM 2426  H HD13 . ILE A 1 40  ? -6.722  -1.057  -10.625 1.00 0.00 ? 415 ILE A HD13 2  
ATOM 2427  N N    . GLU A 1 41  ? -11.177 1.105   -13.018 1.00 0.00 ? 416 GLU A N    2  
ATOM 2428  C CA   . GLU A 1 41  ? -12.491 1.449   -13.547 1.00 0.00 ? 416 GLU A CA   2  
ATOM 2429  C C    . GLU A 1 41  ? -12.387 2.596   -14.546 1.00 0.00 ? 416 GLU A C    2  
ATOM 2430  O O    . GLU A 1 41  ? -11.464 3.407   -14.480 1.00 0.00 ? 416 GLU A O    2  
ATOM 2431  C CB   . GLU A 1 41  ? -13.439 1.830   -12.409 1.00 0.00 ? 416 GLU A CB   2  
ATOM 2432  C CG   . GLU A 1 41  ? -12.966 3.023   -11.596 1.00 0.00 ? 416 GLU A CG   2  
ATOM 2433  C CD   . GLU A 1 41  ? -14.011 3.509   -10.611 1.00 0.00 ? 416 GLU A CD   2  
ATOM 2434  O OE1  . GLU A 1 41  ? -14.179 2.860   -9.556  1.00 0.00 ? 416 GLU A OE1  2  
ATOM 2435  O OE2  . GLU A 1 41  ? -14.661 4.538   -10.893 1.00 0.00 ? 416 GLU A OE2  2  
ATOM 2436  H H    . GLU A 1 41  ? -10.451 1.759   -13.082 1.00 0.00 ? 416 GLU A H    2  
ATOM 2437  H HA   . GLU A 1 41  ? -12.882 0.580   -14.055 1.00 0.00 ? 416 GLU A HA   2  
ATOM 2438  H HB2  . GLU A 1 41  ? -14.407 2.066   -12.826 1.00 0.00 ? 416 GLU A HB2  2  
ATOM 2439  H HB3  . GLU A 1 41  ? -13.541 0.986   -11.743 1.00 0.00 ? 416 GLU A HB3  2  
ATOM 2440  H HG2  . GLU A 1 41  ? -12.080 2.741   -11.047 1.00 0.00 ? 416 GLU A HG2  2  
ATOM 2441  H HG3  . GLU A 1 41  ? -12.727 3.831   -12.272 1.00 0.00 ? 416 GLU A HG3  2  
ATOM 2442  N N    . VAL A 1 42  ? -13.337 2.657   -15.470 1.00 0.00 ? 417 VAL A N    2  
ATOM 2443  C CA   . VAL A 1 42  ? -13.348 3.705   -16.483 1.00 0.00 ? 417 VAL A CA   2  
ATOM 2444  C C    . VAL A 1 42  ? -14.600 4.566   -16.371 1.00 0.00 ? 417 VAL A C    2  
ATOM 2445  O O    . VAL A 1 42  ? -15.699 4.056   -16.149 1.00 0.00 ? 417 VAL A O    2  
ATOM 2446  C CB   . VAL A 1 42  ? -13.275 3.116   -17.905 1.00 0.00 ? 417 VAL A CB   2  
ATOM 2447  C CG1  . VAL A 1 42  ? -13.006 4.212   -18.925 1.00 0.00 ? 417 VAL A CG1  2  
ATOM 2448  C CG2  . VAL A 1 42  ? -12.210 2.033   -17.982 1.00 0.00 ? 417 VAL A CG2  2  
ATOM 2449  H H    . VAL A 1 42  ? -14.047 1.982   -15.473 1.00 0.00 ? 417 VAL A H    2  
ATOM 2450  H HA   . VAL A 1 42  ? -12.479 4.328   -16.329 1.00 0.00 ? 417 VAL A HA   2  
ATOM 2451  H HB   . VAL A 1 42  ? -14.230 2.668   -18.136 1.00 0.00 ? 417 VAL A HB   2  
ATOM 2452  H HG11 . VAL A 1 42  ? -12.169 4.811   -18.596 1.00 0.00 ? 417 VAL A HG11 2  
ATOM 2453  H HG12 . VAL A 1 42  ? -12.775 3.765   -19.881 1.00 0.00 ? 417 VAL A HG12 2  
ATOM 2454  H HG13 . VAL A 1 42  ? -13.881 4.838   -19.020 1.00 0.00 ? 417 VAL A HG13 2  
ATOM 2455  H HG21 . VAL A 1 42  ? -11.710 2.086   -18.937 1.00 0.00 ? 417 VAL A HG21 2  
ATOM 2456  H HG22 . VAL A 1 42  ? -11.490 2.179   -17.190 1.00 0.00 ? 417 VAL A HG22 2  
ATOM 2457  H HG23 . VAL A 1 42  ? -12.673 1.064   -17.871 1.00 0.00 ? 417 VAL A HG23 2  
ATOM 2458  N N    . ILE A 1 43  ? -14.429 5.873   -16.533 1.00 0.00 ? 418 ILE A N    2  
ATOM 2459  C CA   . ILE A 1 43  ? -15.548 6.804   -16.457 1.00 0.00 ? 418 ILE A CA   2  
ATOM 2460  C C    . ILE A 1 43  ? -16.331 6.808   -17.769 1.00 0.00 ? 418 ILE A C    2  
ATOM 2461  O O    . ILE A 1 43  ? -15.755 6.616   -18.841 1.00 0.00 ? 418 ILE A O    2  
ATOM 2462  C CB   . ILE A 1 43  ? -15.063 8.232   -16.135 1.00 0.00 ? 418 ILE A CB   2  
ATOM 2463  C CG1  . ILE A 1 43  ? -14.081 8.209   -14.962 1.00 0.00 ? 418 ILE A CG1  2  
ATOM 2464  C CG2  . ILE A 1 43  ? -16.244 9.139   -15.825 1.00 0.00 ? 418 ILE A CG2  2  
ATOM 2465  C CD1  . ILE A 1 43  ? -14.698 7.735   -13.663 1.00 0.00 ? 418 ILE A CD1  2  
ATOM 2466  H H    . ILE A 1 43  ? -13.530 6.219   -16.713 1.00 0.00 ? 418 ILE A H    2  
ATOM 2467  H HA   . ILE A 1 43  ? -16.197 6.476   -15.659 1.00 0.00 ? 418 ILE A HA   2  
ATOM 2468  H HB   . ILE A 1 43  ? -14.561 8.623   -17.005 1.00 0.00 ? 418 ILE A HB   2  
ATOM 2469  H HG12 . ILE A 1 43  ? -13.263 7.546   -15.200 1.00 0.00 ? 418 ILE A HG12 2  
ATOM 2470  H HG13 . ILE A 1 43  ? -13.696 9.206   -14.803 1.00 0.00 ? 418 ILE A HG13 2  
ATOM 2471  H HG21 . ILE A 1 43  ? -16.857 8.682   -15.063 1.00 0.00 ? 418 ILE A HG21 2  
ATOM 2472  H HG22 . ILE A 1 43  ? -15.882 10.094  -15.472 1.00 0.00 ? 418 ILE A HG22 2  
ATOM 2473  H HG23 . ILE A 1 43  ? -16.830 9.285   -16.720 1.00 0.00 ? 418 ILE A HG23 2  
ATOM 2474  H HD11 . ILE A 1 43  ? -14.756 8.562   -12.971 1.00 0.00 ? 418 ILE A HD11 2  
ATOM 2475  H HD12 . ILE A 1 43  ? -15.691 7.355   -13.855 1.00 0.00 ? 418 ILE A HD12 2  
ATOM 2476  H HD13 . ILE A 1 43  ? -14.087 6.952   -13.239 1.00 0.00 ? 418 ILE A HD13 2  
ATOM 2477  N N    . PRO A 1 44  ? -17.663 7.006   -17.709 1.00 0.00 ? 419 PRO A N    2  
ATOM 2478  C CA   . PRO A 1 44  ? -18.523 7.009   -18.902 1.00 0.00 ? 419 PRO A CA   2  
ATOM 2479  C C    . PRO A 1 44  ? -18.308 8.217   -19.818 1.00 0.00 ? 419 PRO A C    2  
ATOM 2480  O O    . PRO A 1 44  ? -19.050 8.405   -20.781 1.00 0.00 ? 419 PRO A O    2  
ATOM 2481  C CB   . PRO A 1 44  ? -19.949 7.032   -18.326 1.00 0.00 ? 419 PRO A CB   2  
ATOM 2482  C CG   . PRO A 1 44  ? -19.800 6.713   -16.876 1.00 0.00 ? 419 PRO A CG   2  
ATOM 2483  C CD   . PRO A 1 44  ? -18.445 7.217   -16.483 1.00 0.00 ? 419 PRO A CD   2  
ATOM 2484  H HA   . PRO A 1 44  ? -18.390 6.105   -19.478 1.00 0.00 ? 419 PRO A HA   2  
ATOM 2485  H HB2  . PRO A 1 44  ? -20.379 8.014   -18.469 1.00 0.00 ? 419 PRO A HB2  2  
ATOM 2486  H HB3  . PRO A 1 44  ? -20.553 6.294   -18.831 1.00 0.00 ? 419 PRO A HB3  2  
ATOM 2487  H HG2  . PRO A 1 44  ? -20.568 7.217   -16.308 1.00 0.00 ? 419 PRO A HG2  2  
ATOM 2488  H HG3  . PRO A 1 44  ? -19.861 5.645   -16.726 1.00 0.00 ? 419 PRO A HG3  2  
ATOM 2489  H HD2  . PRO A 1 44  ? -18.492 8.264   -16.225 1.00 0.00 ? 419 PRO A HD2  2  
ATOM 2490  H HD3  . PRO A 1 44  ? -18.048 6.639   -15.664 1.00 0.00 ? 419 PRO A HD3  2  
ATOM 2491  N N    . ASP A 1 45  ? -17.300 9.035   -19.525 1.00 0.00 ? 420 ASP A N    2  
ATOM 2492  C CA   . ASP A 1 45  ? -17.020 10.210  -20.342 1.00 0.00 ? 420 ASP A CA   2  
ATOM 2493  C C    . ASP A 1 45  ? -15.523 10.352  -20.608 1.00 0.00 ? 420 ASP A C    2  
ATOM 2494  O O    . ASP A 1 45  ? -14.900 11.334  -20.204 1.00 0.00 ? 420 ASP A O    2  
ATOM 2495  C CB   . ASP A 1 45  ? -17.555 11.471  -19.658 1.00 0.00 ? 420 ASP A CB   2  
ATOM 2496  C CG   . ASP A 1 45  ? -18.955 11.827  -20.118 1.00 0.00 ? 420 ASP A CG   2  
ATOM 2497  O OD1  . ASP A 1 45  ? -19.897 11.073  -19.790 1.00 0.00 ? 420 ASP A OD1  2  
ATOM 2498  O OD2  . ASP A 1 45  ? -19.111 12.857  -20.805 1.00 0.00 ? 420 ASP A OD2  2  
ATOM 2499  H H    . ASP A 1 45  ? -16.734 8.847   -18.751 1.00 0.00 ? 420 ASP A H    2  
ATOM 2500  H HA   . ASP A 1 45  ? -17.528 10.083  -21.286 1.00 0.00 ? 420 ASP A HA   2  
ATOM 2501  H HB2  . ASP A 1 45  ? -17.576 11.312  -18.590 1.00 0.00 ? 420 ASP A HB2  2  
ATOM 2502  H HB3  . ASP A 1 45  ? -16.901 12.300  -19.882 1.00 0.00 ? 420 ASP A HB3  2  
ATOM 2503  N N    . THR A 1 46  ? -14.950 9.364   -21.289 1.00 0.00 ? 421 THR A N    2  
ATOM 2504  C CA   . THR A 1 46  ? -13.525 9.379   -21.609 1.00 0.00 ? 421 THR A CA   2  
ATOM 2505  C C    . THR A 1 46  ? -13.238 8.526   -22.842 1.00 0.00 ? 421 THR A C    2  
ATOM 2506  O O    . THR A 1 46  ? -14.114 7.812   -23.330 1.00 0.00 ? 421 THR A O    2  
ATOM 2507  C CB   . THR A 1 46  ? -12.693 8.868   -20.422 1.00 0.00 ? 421 THR A CB   2  
ATOM 2508  O OG1  . THR A 1 46  ? -12.306 7.518   -20.619 1.00 0.00 ? 421 THR A OG1  2  
ATOM 2509  C CG2  . THR A 1 46  ? -13.412 8.939   -19.094 1.00 0.00 ? 421 THR A CG2  2  
ATOM 2510  H H    . THR A 1 46  ? -15.498 8.606   -21.585 1.00 0.00 ? 421 THR A H    2  
ATOM 2511  H HA   . THR A 1 46  ? -13.245 10.400  -21.820 1.00 0.00 ? 421 THR A HA   2  
ATOM 2512  H HB   . THR A 1 46  ? -11.798 9.467   -20.343 1.00 0.00 ? 421 THR A HB   2  
ATOM 2513  H HG1  . THR A 1 46  ? -11.546 7.320   -20.067 1.00 0.00 ? 421 THR A HG1  2  
ATOM 2514  H HG21 . THR A 1 46  ? -14.400 8.518   -19.196 1.00 0.00 ? 421 THR A HG21 2  
ATOM 2515  H HG22 . THR A 1 46  ? -12.857 8.381   -18.355 1.00 0.00 ? 421 THR A HG22 2  
ATOM 2516  H HG23 . THR A 1 46  ? -13.490 9.971   -18.782 1.00 0.00 ? 421 THR A HG23 2  
ATOM 2517  N N    . PRO A 1 47  ? -11.996 8.579   -23.357 1.00 0.00 ? 422 PRO A N    2  
ATOM 2518  C CA   . PRO A 1 47  ? -11.597 7.801   -24.525 1.00 0.00 ? 422 PRO A CA   2  
ATOM 2519  C C    . PRO A 1 47  ? -11.297 6.348   -24.166 1.00 0.00 ? 422 PRO A C    2  
ATOM 2520  O O    . PRO A 1 47  ? -11.271 5.476   -25.034 1.00 0.00 ? 422 PRO A O    2  
ATOM 2521  C CB   . PRO A 1 47  ? -10.332 8.511   -24.997 1.00 0.00 ? 422 PRO A CB   2  
ATOM 2522  C CG   . PRO A 1 47  ? -9.734  9.078   -23.756 1.00 0.00 ? 422 PRO A CG   2  
ATOM 2523  C CD   . PRO A 1 47  ? -10.884 9.395   -22.832 1.00 0.00 ? 422 PRO A CD   2  
ATOM 2524  H HA   . PRO A 1 47  ? -12.347 7.833   -25.302 1.00 0.00 ? 422 PRO A HA   2  
ATOM 2525  H HB2  . PRO A 1 47  ? -9.670  7.800   -25.469 1.00 0.00 ? 422 PRO A HB2  2  
ATOM 2526  H HB3  . PRO A 1 47  ? -10.593 9.289   -25.700 1.00 0.00 ? 422 PRO A HB3  2  
ATOM 2527  H HG2  . PRO A 1 47  ? -9.079  8.351   -23.302 1.00 0.00 ? 422 PRO A HG2  2  
ATOM 2528  H HG3  . PRO A 1 47  ? -9.187  9.978   -23.993 1.00 0.00 ? 422 PRO A HG3  2  
ATOM 2529  H HD2  . PRO A 1 47  ? -10.639 9.105   -21.821 1.00 0.00 ? 422 PRO A HD2  2  
ATOM 2530  H HD3  . PRO A 1 47  ? -11.123 10.447  -22.875 1.00 0.00 ? 422 PRO A HD3  2  
ATOM 2531  N N    . ALA A 1 48  ? -11.071 6.095   -22.879 1.00 0.00 ? 423 ALA A N    2  
ATOM 2532  C CA   . ALA A 1 48  ? -10.777 4.752   -22.401 1.00 0.00 ? 423 ALA A CA   2  
ATOM 2533  C C    . ALA A 1 48  ? -11.928 3.798   -22.705 1.00 0.00 ? 423 ALA A C    2  
ATOM 2534  O O    . ALA A 1 48  ? -11.754 2.795   -23.396 1.00 0.00 ? 423 ALA A O    2  
ATOM 2535  C CB   . ALA A 1 48  ? -10.492 4.777   -20.907 1.00 0.00 ? 423 ALA A CB   2  
ATOM 2536  H H    . ALA A 1 48  ? -11.106 6.832   -22.234 1.00 0.00 ? 423 ALA A H    2  
ATOM 2537  H HA   . ALA A 1 48  ? -9.889  4.403   -22.907 1.00 0.00 ? 423 ALA A HA   2  
ATOM 2538  H HB1  . ALA A 1 48  ? -9.509  5.186   -20.733 1.00 0.00 ? 423 ALA A HB1  2  
ATOM 2539  H HB2  . ALA A 1 48  ? -11.230 5.392   -20.411 1.00 0.00 ? 423 ALA A HB2  2  
ATOM 2540  H HB3  . ALA A 1 48  ? -10.539 3.773   -20.513 1.00 0.00 ? 423 ALA A HB3  2  
ATOM 2541  N N    . GLU A 1 49  ? -13.108 4.122   -22.185 1.00 0.00 ? 424 GLU A N    2  
ATOM 2542  C CA   . GLU A 1 49  ? -14.290 3.295   -22.403 1.00 0.00 ? 424 GLU A CA   2  
ATOM 2543  C C    . GLU A 1 49  ? -14.732 3.353   -23.862 1.00 0.00 ? 424 GLU A C    2  
ATOM 2544  O O    . GLU A 1 49  ? -15.334 2.409   -24.375 1.00 0.00 ? 424 GLU A O    2  
ATOM 2545  C CB   . GLU A 1 49  ? -15.431 3.752   -21.493 1.00 0.00 ? 424 GLU A CB   2  
ATOM 2546  C CG   . GLU A 1 49  ? -16.564 2.745   -21.388 1.00 0.00 ? 424 GLU A CG   2  
ATOM 2547  C CD   . GLU A 1 49  ? -16.204 1.549   -20.529 1.00 0.00 ? 424 GLU A CD   2  
ATOM 2548  O OE1  . GLU A 1 49  ? -15.221 0.855   -20.860 1.00 0.00 ? 424 GLU A OE1  2  
ATOM 2549  O OE2  . GLU A 1 49  ? -16.906 1.308   -19.524 1.00 0.00 ? 424 GLU A OE2  2  
ATOM 2550  H H    . GLU A 1 49  ? -13.187 4.936   -21.642 1.00 0.00 ? 424 GLU A H    2  
ATOM 2551  H HA   . GLU A 1 49  ? -14.031 2.276   -22.157 1.00 0.00 ? 424 GLU A HA   2  
ATOM 2552  H HB2  . GLU A 1 49  ? -15.039 3.924   -20.502 1.00 0.00 ? 424 GLU A HB2  2  
ATOM 2553  H HB3  . GLU A 1 49  ? -15.835 4.677   -21.877 1.00 0.00 ? 424 GLU A HB3  2  
ATOM 2554  H HG2  . GLU A 1 49  ? -17.425 3.235   -20.956 1.00 0.00 ? 424 GLU A HG2  2  
ATOM 2555  H HG3  . GLU A 1 49  ? -16.811 2.396   -22.381 1.00 0.00 ? 424 GLU A HG3  2  
ATOM 2556  N N    . ALA A 1 50  ? -14.430 4.465   -24.525 1.00 0.00 ? 425 ALA A N    2  
ATOM 2557  C CA   . ALA A 1 50  ? -14.797 4.645   -25.924 1.00 0.00 ? 425 ALA A CA   2  
ATOM 2558  C C    . ALA A 1 50  ? -13.803 3.955   -26.853 1.00 0.00 ? 425 ALA A C    2  
ATOM 2559  O O    . ALA A 1 50  ? -14.129 3.635   -27.996 1.00 0.00 ? 425 ALA A O    2  
ATOM 2560  C CB   . ALA A 1 50  ? -14.891 6.126   -26.257 1.00 0.00 ? 425 ALA A CB   2  
ATOM 2561  H H    . ALA A 1 50  ? -13.949 5.182   -24.061 1.00 0.00 ? 425 ALA A H    2  
ATOM 2562  H HA   . ALA A 1 50  ? -15.774 4.206   -26.070 1.00 0.00 ? 425 ALA A HA   2  
ATOM 2563  H HB1  . ALA A 1 50  ? -15.671 6.580   -25.662 1.00 0.00 ? 425 ALA A HB1  2  
ATOM 2564  H HB2  . ALA A 1 50  ? -13.948 6.605   -26.038 1.00 0.00 ? 425 ALA A HB2  2  
ATOM 2565  H HB3  . ALA A 1 50  ? -15.122 6.246   -27.305 1.00 0.00 ? 425 ALA A HB3  2  
ATOM 2566  N N    . GLY A 1 51  ? -12.589 3.730   -26.359 1.00 0.00 ? 426 GLY A N    2  
ATOM 2567  C CA   . GLY A 1 51  ? -11.570 3.081   -27.163 1.00 0.00 ? 426 GLY A CA   2  
ATOM 2568  C C    . GLY A 1 51  ? -11.790 1.586   -27.279 1.00 0.00 ? 426 GLY A C    2  
ATOM 2569  O O    . GLY A 1 51  ? -11.584 1.002   -28.343 1.00 0.00 ? 426 GLY A O    2  
ATOM 2570  H H    . GLY A 1 51  ? -12.381 4.006   -25.442 1.00 0.00 ? 426 GLY A H    2  
ATOM 2571  H HA2  . GLY A 1 51  ? -11.580 3.513   -28.153 1.00 0.00 ? 426 GLY A HA2  2  
ATOM 2572  H HA3  . GLY A 1 51  ? -10.605 3.258   -26.714 1.00 0.00 ? 426 GLY A HA3  2  
ATOM 2573  N N    . GLY A 1 52  ? -12.215 0.967   -26.183 1.00 0.00 ? 427 GLY A N    2  
ATOM 2574  C CA   . GLY A 1 52  ? -12.460 -0.465  -26.189 1.00 0.00 ? 427 GLY A CA   2  
ATOM 2575  C C    . GLY A 1 52  ? -11.857 -1.179  -24.992 1.00 0.00 ? 427 GLY A C    2  
ATOM 2576  O O    . GLY A 1 52  ? -11.711 -2.401  -25.008 1.00 0.00 ? 427 GLY A O    2  
ATOM 2577  H H    . GLY A 1 52  ? -12.368 1.486   -25.368 1.00 0.00 ? 427 GLY A H    2  
ATOM 2578  H HA2  . GLY A 1 52  ? -13.527 -0.633  -26.192 1.00 0.00 ? 427 GLY A HA2  2  
ATOM 2579  H HA3  . GLY A 1 52  ? -12.040 -0.884  -27.091 1.00 0.00 ? 427 GLY A HA3  2  
ATOM 2580  N N    . LEU A 1 53  ? -11.509 -0.427  -23.950 1.00 0.00 ? 428 LEU A N    2  
ATOM 2581  C CA   . LEU A 1 53  ? -10.926 -1.020  -22.752 1.00 0.00 ? 428 LEU A CA   2  
ATOM 2582  C C    . LEU A 1 53  ? -12.017 -1.492  -21.800 1.00 0.00 ? 428 LEU A C    2  
ATOM 2583  O O    . LEU A 1 53  ? -13.197 -1.504  -22.147 1.00 0.00 ? 428 LEU A O    2  
ATOM 2584  C CB   . LEU A 1 53  ? -10.023 -0.017  -22.029 1.00 0.00 ? 428 LEU A CB   2  
ATOM 2585  C CG   . LEU A 1 53  ? -9.310  0.997   -22.923 1.00 0.00 ? 428 LEU A CG   2  
ATOM 2586  C CD1  . LEU A 1 53  ? -8.687  2.092   -22.073 1.00 0.00 ? 428 LEU A CD1  2  
ATOM 2587  C CD2  . LEU A 1 53  ? -8.254  0.311   -23.774 1.00 0.00 ? 428 LEU A CD2  2  
ATOM 2588  H H    . LEU A 1 53  ? -11.650 0.541   -23.984 1.00 0.00 ? 428 LEU A H    2  
ATOM 2589  H HA   . LEU A 1 53  ? -10.335 -1.871  -23.055 1.00 0.00 ? 428 LEU A HA   2  
ATOM 2590  H HB2  . LEU A 1 53  ? -10.626 0.526   -21.317 1.00 0.00 ? 428 LEU A HB2  2  
ATOM 2591  H HB3  . LEU A 1 53  ? -9.273  -0.572  -21.487 1.00 0.00 ? 428 LEU A HB3  2  
ATOM 2592  H HG   . LEU A 1 53  ? -10.029 1.456   -23.583 1.00 0.00 ? 428 LEU A HG   2  
ATOM 2593  H HD11 . LEU A 1 53  ? -9.351  2.332   -21.255 1.00 0.00 ? 428 LEU A HD11 2  
ATOM 2594  H HD12 . LEU A 1 53  ? -7.742  1.748   -21.682 1.00 0.00 ? 428 LEU A HD12 2  
ATOM 2595  H HD13 . LEU A 1 53  ? -8.530  2.971   -22.679 1.00 0.00 ? 428 LEU A HD13 2  
ATOM 2596  H HD21 . LEU A 1 53  ? -7.364  0.152   -23.184 1.00 0.00 ? 428 LEU A HD21 2  
ATOM 2597  H HD22 . LEU A 1 53  ? -8.633  -0.641  -24.119 1.00 0.00 ? 428 LEU A HD22 2  
ATOM 2598  H HD23 . LEU A 1 53  ? -8.018  0.932   -24.624 1.00 0.00 ? 428 LEU A HD23 2  
ATOM 2599  N N    . LYS A 1 54  ? -11.612 -1.873  -20.593 1.00 0.00 ? 429 LYS A N    2  
ATOM 2600  C CA   . LYS A 1 54  ? -12.554 -2.339  -19.584 1.00 0.00 ? 429 LYS A CA   2  
ATOM 2601  C C    . LYS A 1 54  ? -11.823 -2.786  -18.323 1.00 0.00 ? 429 LYS A C    2  
ATOM 2602  O O    . LYS A 1 54  ? -10.749 -3.383  -18.394 1.00 0.00 ? 429 LYS A O    2  
ATOM 2603  C CB   . LYS A 1 54  ? -13.403 -3.490  -20.132 1.00 0.00 ? 429 LYS A CB   2  
ATOM 2604  C CG   . LYS A 1 54  ? -14.865 -3.128  -20.326 1.00 0.00 ? 429 LYS A CG   2  
ATOM 2605  C CD   . LYS A 1 54  ? -15.625 -4.239  -21.034 1.00 0.00 ? 429 LYS A CD   2  
ATOM 2606  C CE   . LYS A 1 54  ? -16.476 -5.041  -20.062 1.00 0.00 ? 429 LYS A CE   2  
ATOM 2607  N NZ   . LYS A 1 54  ? -15.665 -5.605  -18.949 1.00 0.00 ? 429 LYS A NZ   2  
ATOM 2608  H H    . LYS A 1 54  ? -10.658 -1.835  -20.375 1.00 0.00 ? 429 LYS A H    2  
ATOM 2609  H HA   . LYS A 1 54  ? -13.201 -1.511  -19.336 1.00 0.00 ? 429 LYS A HA   2  
ATOM 2610  H HB2  . LYS A 1 54  ? -13.001 -3.797  -21.085 1.00 0.00 ? 429 LYS A HB2  2  
ATOM 2611  H HB3  . LYS A 1 54  ? -13.349 -4.323  -19.445 1.00 0.00 ? 429 LYS A HB3  2  
ATOM 2612  H HG2  . LYS A 1 54  ? -15.316 -2.957  -19.360 1.00 0.00 ? 429 LYS A HG2  2  
ATOM 2613  H HG3  . LYS A 1 54  ? -14.927 -2.228  -20.919 1.00 0.00 ? 429 LYS A HG3  2  
ATOM 2614  H HD2  . LYS A 1 54  ? -16.268 -3.802  -21.783 1.00 0.00 ? 429 LYS A HD2  2  
ATOM 2615  H HD3  . LYS A 1 54  ? -14.916 -4.901  -21.509 1.00 0.00 ? 429 LYS A HD3  2  
ATOM 2616  H HE2  . LYS A 1 54  ? -17.235 -4.393  -19.651 1.00 0.00 ? 429 LYS A HE2  2  
ATOM 2617  H HE3  . LYS A 1 54  ? -16.947 -5.851  -20.600 1.00 0.00 ? 429 LYS A HE3  2  
ATOM 2618  H HZ1  . LYS A 1 54  ? -15.075 -6.388  -19.296 1.00 0.00 ? 429 LYS A HZ1  2  
ATOM 2619  H HZ2  . LYS A 1 54  ? -15.047 -4.871  -18.548 1.00 0.00 ? 429 LYS A HZ2  2  
ATOM 2620  H HZ3  . LYS A 1 54  ? -16.290 -5.963  -18.198 1.00 0.00 ? 429 LYS A HZ3  2  
ATOM 2621  N N    . GLU A 1 55  ? -12.412 -2.493  -17.169 1.00 0.00 ? 430 GLU A N    2  
ATOM 2622  C CA   . GLU A 1 55  ? -11.818 -2.868  -15.893 1.00 0.00 ? 430 GLU A CA   2  
ATOM 2623  C C    . GLU A 1 55  ? -11.702 -4.383  -15.774 1.00 0.00 ? 430 GLU A C    2  
ATOM 2624  O O    . GLU A 1 55  ? -12.111 -5.119  -16.673 1.00 0.00 ? 430 GLU A O    2  
ATOM 2625  C CB   . GLU A 1 55  ? -12.649 -2.315  -14.735 1.00 0.00 ? 430 GLU A CB   2  
ATOM 2626  C CG   . GLU A 1 55  ? -14.074 -2.844  -14.700 1.00 0.00 ? 430 GLU A CG   2  
ATOM 2627  C CD   . GLU A 1 55  ? -15.076 -1.859  -15.271 1.00 0.00 ? 430 GLU A CD   2  
ATOM 2628  O OE1  . GLU A 1 55  ? -14.708 -1.108  -16.199 1.00 0.00 ? 430 GLU A OE1  2  
ATOM 2629  O OE2  . GLU A 1 55  ? -16.229 -1.840  -14.790 1.00 0.00 ? 430 GLU A OE2  2  
ATOM 2630  H H    . GLU A 1 55  ? -13.269 -2.018  -17.177 1.00 0.00 ? 430 GLU A H    2  
ATOM 2631  H HA   . GLU A 1 55  ? -10.828 -2.440  -15.850 1.00 0.00 ? 430 GLU A HA   2  
ATOM 2632  H HB2  . GLU A 1 55  ? -12.169 -2.577  -13.804 1.00 0.00 ? 430 GLU A HB2  2  
ATOM 2633  H HB3  . GLU A 1 55  ? -12.690 -1.239  -14.818 1.00 0.00 ? 430 GLU A HB3  2  
ATOM 2634  H HG2  . GLU A 1 55  ? -14.120 -3.755  -15.276 1.00 0.00 ? 430 GLU A HG2  2  
ATOM 2635  H HG3  . GLU A 1 55  ? -14.341 -3.053  -13.675 1.00 0.00 ? 430 GLU A HG3  2  
ATOM 2636  N N    . ASN A 1 56  ? -11.137 -4.844  -14.663 1.00 0.00 ? 431 ASN A N    2  
ATOM 2637  C CA   . ASN A 1 56  ? -10.964 -6.274  -14.430 1.00 0.00 ? 431 ASN A CA   2  
ATOM 2638  C C    . ASN A 1 56  ? -10.038 -6.886  -15.478 1.00 0.00 ? 431 ASN A C    2  
ATOM 2639  O O    . ASN A 1 56  ? -10.086 -8.088  -15.737 1.00 0.00 ? 431 ASN A O    2  
ATOM 2640  C CB   . ASN A 1 56  ? -12.319 -6.986  -14.449 1.00 0.00 ? 431 ASN A CB   2  
ATOM 2641  C CG   . ASN A 1 56  ? -13.250 -6.485  -13.363 1.00 0.00 ? 431 ASN A CG   2  
ATOM 2642  O OD1  . ASN A 1 56  ? -13.016 -6.711  -12.176 1.00 0.00 ? 431 ASN A OD1  2  
ATOM 2643  N ND2  . ASN A 1 56  ? -14.314 -5.800  -13.766 1.00 0.00 ? 431 ASN A ND2  2  
ATOM 2644  H H    . ASN A 1 56  ? -10.827 -4.208  -13.984 1.00 0.00 ? 431 ASN A H    2  
ATOM 2645  H HA   . ASN A 1 56  ? -10.515 -6.398  -13.456 1.00 0.00 ? 431 ASN A HA   2  
ATOM 2646  H HB2  . ASN A 1 56  ? -12.791 -6.823  -15.406 1.00 0.00 ? 431 ASN A HB2  2  
ATOM 2647  H HB3  . ASN A 1 56  ? -12.163 -8.045  -14.306 1.00 0.00 ? 431 ASN A HB3  2  
ATOM 2648  H HD21 . ASN A 1 56  ? -14.437 -5.658  -14.728 1.00 0.00 ? 431 ASN A HD21 2  
ATOM 2649  H HD22 . ASN A 1 56  ? -14.934 -5.464  -13.084 1.00 0.00 ? 431 ASN A HD22 2  
ATOM 2650  N N    . ASP A 1 57  ? -9.193  -6.049  -16.075 1.00 0.00 ? 432 ASP A N    2  
ATOM 2651  C CA   . ASP A 1 57  ? -8.254  -6.503  -17.092 1.00 0.00 ? 432 ASP A CA   2  
ATOM 2652  C C    . ASP A 1 57  ? -6.829  -6.109  -16.719 1.00 0.00 ? 432 ASP A C    2  
ATOM 2653  O O    . ASP A 1 57  ? -6.593  -5.541  -15.653 1.00 0.00 ? 432 ASP A O    2  
ATOM 2654  C CB   . ASP A 1 57  ? -8.624  -5.916  -18.455 1.00 0.00 ? 432 ASP A CB   2  
ATOM 2655  C CG   . ASP A 1 57  ? -9.771  -6.658  -19.111 1.00 0.00 ? 432 ASP A CG   2  
ATOM 2656  O OD1  . ASP A 1 57  ? -9.616  -7.865  -19.388 1.00 0.00 ? 432 ASP A OD1  2  
ATOM 2657  O OD2  . ASP A 1 57  ? -10.826 -6.031  -19.348 1.00 0.00 ? 432 ASP A OD2  2  
ATOM 2658  H H    . ASP A 1 57  ? -9.201  -5.102  -15.824 1.00 0.00 ? 432 ASP A H    2  
ATOM 2659  H HA   . ASP A 1 57  ? -8.316  -7.580  -17.145 1.00 0.00 ? 432 ASP A HA   2  
ATOM 2660  H HB2  . ASP A 1 57  ? -8.915  -4.883  -18.328 1.00 0.00 ? 432 ASP A HB2  2  
ATOM 2661  H HB3  . ASP A 1 57  ? -7.765  -5.966  -19.108 1.00 0.00 ? 432 ASP A HB3  2  
ATOM 2662  N N    . VAL A 1 58  ? -5.880  -6.414  -17.597 1.00 0.00 ? 433 VAL A N    2  
ATOM 2663  C CA   . VAL A 1 58  ? -4.481  -6.089  -17.347 1.00 0.00 ? 433 VAL A CA   2  
ATOM 2664  C C    . VAL A 1 58  ? -3.790  -5.584  -18.608 1.00 0.00 ? 433 VAL A C    2  
ATOM 2665  O O    . VAL A 1 58  ? -3.772  -6.264  -19.633 1.00 0.00 ? 433 VAL A O    2  
ATOM 2666  C CB   . VAL A 1 58  ? -3.709  -7.309  -16.808 1.00 0.00 ? 433 VAL A CB   2  
ATOM 2667  C CG1  . VAL A 1 58  ? -2.303  -6.909  -16.385 1.00 0.00 ? 433 VAL A CG1  2  
ATOM 2668  C CG2  . VAL A 1 58  ? -4.462  -7.948  -15.651 1.00 0.00 ? 433 VAL A CG2  2  
ATOM 2669  H H    . VAL A 1 58  ? -6.124  -6.869  -18.430 1.00 0.00 ? 433 VAL A H    2  
ATOM 2670  H HA   . VAL A 1 58  ? -4.450  -5.312  -16.596 1.00 0.00 ? 433 VAL A HA   2  
ATOM 2671  H HB   . VAL A 1 58  ? -3.628  -8.037  -17.602 1.00 0.00 ? 433 VAL A HB   2  
ATOM 2672  H HG11 . VAL A 1 58  ? -2.310  -5.890  -16.030 1.00 0.00 ? 433 VAL A HG11 2  
ATOM 2673  H HG12 . VAL A 1 58  ? -1.965  -7.564  -15.596 1.00 0.00 ? 433 VAL A HG12 2  
ATOM 2674  H HG13 . VAL A 1 58  ? -1.636  -6.991  -17.231 1.00 0.00 ? 433 VAL A HG13 2  
ATOM 2675  H HG21 . VAL A 1 58  ? -4.465  -7.274  -14.807 1.00 0.00 ? 433 VAL A HG21 2  
ATOM 2676  H HG22 . VAL A 1 58  ? -5.479  -8.152  -15.953 1.00 0.00 ? 433 VAL A HG22 2  
ATOM 2677  H HG23 . VAL A 1 58  ? -3.978  -8.872  -15.373 1.00 0.00 ? 433 VAL A HG23 2  
ATOM 2678  N N    . ILE A 1 59  ? -3.213  -4.389  -18.520 1.00 0.00 ? 434 ILE A N    2  
ATOM 2679  C CA   . ILE A 1 59  ? -2.509  -3.795  -19.651 1.00 0.00 ? 434 ILE A CA   2  
ATOM 2680  C C    . ILE A 1 59  ? -1.089  -4.343  -19.745 1.00 0.00 ? 434 ILE A C    2  
ATOM 2681  O O    . ILE A 1 59  ? -0.516  -4.774  -18.745 1.00 0.00 ? 434 ILE A O    2  
ATOM 2682  C CB   . ILE A 1 59  ? -2.449  -2.258  -19.533 1.00 0.00 ? 434 ILE A CB   2  
ATOM 2683  C CG1  . ILE A 1 59  ? -3.840  -1.687  -19.249 1.00 0.00 ? 434 ILE A CG1  2  
ATOM 2684  C CG2  . ILE A 1 59  ? -1.873  -1.652  -20.805 1.00 0.00 ? 434 ILE A CG2  2  
ATOM 2685  C CD1  . ILE A 1 59  ? -3.818  -0.436  -18.395 1.00 0.00 ? 434 ILE A CD1  2  
ATOM 2686  H H    . ILE A 1 59  ? -3.255  -3.898  -17.674 1.00 0.00 ? 434 ILE A H    2  
ATOM 2687  H HA   . ILE A 1 59  ? -3.046  -4.048  -20.552 1.00 0.00 ? 434 ILE A HA   2  
ATOM 2688  H HB   . ILE A 1 59  ? -1.791  -2.007  -18.716 1.00 0.00 ? 434 ILE A HB   2  
ATOM 2689  H HG12 . ILE A 1 59  ? -4.319  -1.439  -20.184 1.00 0.00 ? 434 ILE A HG12 2  
ATOM 2690  H HG13 . ILE A 1 59  ? -4.430  -2.431  -18.733 1.00 0.00 ? 434 ILE A HG13 2  
ATOM 2691  H HG21 . ILE A 1 59  ? -2.343  -2.107  -21.665 1.00 0.00 ? 434 ILE A HG21 2  
ATOM 2692  H HG22 . ILE A 1 59  ? -2.059  -0.588  -20.813 1.00 0.00 ? 434 ILE A HG22 2  
ATOM 2693  H HG23 . ILE A 1 59  ? -0.808  -1.831  -20.839 1.00 0.00 ? 434 ILE A HG23 2  
ATOM 2694  H HD11 . ILE A 1 59  ? -4.823  -0.198  -18.080 1.00 0.00 ? 434 ILE A HD11 2  
ATOM 2695  H HD12 . ILE A 1 59  ? -3.199  -0.604  -17.526 1.00 0.00 ? 434 ILE A HD12 2  
ATOM 2696  H HD13 . ILE A 1 59  ? -3.417  0.385   -18.970 1.00 0.00 ? 434 ILE A HD13 2  
ATOM 2697  N N    . ILE A 1 60  ? -0.525  -4.329  -20.949 1.00 0.00 ? 435 ILE A N    2  
ATOM 2698  C CA   . ILE A 1 60  ? 0.828   -4.834  -21.155 1.00 0.00 ? 435 ILE A CA   2  
ATOM 2699  C C    . ILE A 1 60  ? 1.600   -3.984  -22.159 1.00 0.00 ? 435 ILE A C    2  
ATOM 2700  O O    . ILE A 1 60  ? 2.733   -3.580  -21.900 1.00 0.00 ? 435 ILE A O    2  
ATOM 2701  C CB   . ILE A 1 60  ? 0.814   -6.298  -21.639 1.00 0.00 ? 435 ILE A CB   2  
ATOM 2702  C CG1  . ILE A 1 60  ? -0.140  -6.463  -22.826 1.00 0.00 ? 435 ILE A CG1  2  
ATOM 2703  C CG2  . ILE A 1 60  ? 0.420   -7.227  -20.501 1.00 0.00 ? 435 ILE A CG2  2  
ATOM 2704  C CD1  . ILE A 1 60  ? 0.553   -6.421  -24.169 1.00 0.00 ? 435 ILE A CD1  2  
ATOM 2705  H H    . ILE A 1 60  ? -1.029  -3.976  -21.712 1.00 0.00 ? 435 ILE A H    2  
ATOM 2706  H HA   . ILE A 1 60  ? 1.340   -4.800  -20.205 1.00 0.00 ? 435 ILE A HA   2  
ATOM 2707  H HB   . ILE A 1 60  ? 1.814   -6.558  -21.952 1.00 0.00 ? 435 ILE A HB   2  
ATOM 2708  H HG12 . ILE A 1 60  ? -0.645  -7.414  -22.744 1.00 0.00 ? 435 ILE A HG12 2  
ATOM 2709  H HG13 . ILE A 1 60  ? -0.873  -5.670  -22.804 1.00 0.00 ? 435 ILE A HG13 2  
ATOM 2710  H HG21 . ILE A 1 60  ? -0.420  -6.806  -19.967 1.00 0.00 ? 435 ILE A HG21 2  
ATOM 2711  H HG22 . ILE A 1 60  ? 0.144   -8.191  -20.902 1.00 0.00 ? 435 ILE A HG22 2  
ATOM 2712  H HG23 . ILE A 1 60  ? 1.254   -7.343  -19.826 1.00 0.00 ? 435 ILE A HG23 2  
ATOM 2713  H HD11 . ILE A 1 60  ? 0.163   -5.598  -24.749 1.00 0.00 ? 435 ILE A HD11 2  
ATOM 2714  H HD12 . ILE A 1 60  ? 1.615   -6.287  -24.022 1.00 0.00 ? 435 ILE A HD12 2  
ATOM 2715  H HD13 . ILE A 1 60  ? 0.376   -7.348  -24.695 1.00 0.00 ? 435 ILE A HD13 2  
ATOM 2716  N N    . SER A 1 61  ? 0.987   -3.718  -23.308 1.00 0.00 ? 436 SER A N    2  
ATOM 2717  C CA   . SER A 1 61  ? 1.630   -2.920  -24.346 1.00 0.00 ? 436 SER A CA   2  
ATOM 2718  C C    . SER A 1 61  ? 0.900   -1.598  -24.557 1.00 0.00 ? 436 SER A C    2  
ATOM 2719  O O    . SER A 1 61  ? -0.291  -1.482  -24.268 1.00 0.00 ? 436 SER A O    2  
ATOM 2720  C CB   . SER A 1 61  ? 1.679   -3.700  -25.660 1.00 0.00 ? 436 SER A CB   2  
ATOM 2721  O OG   . SER A 1 61  ? 0.404   -3.740  -26.277 1.00 0.00 ? 436 SER A OG   2  
ATOM 2722  H H    . SER A 1 61  ? 0.085   -4.068  -23.463 1.00 0.00 ? 436 SER A H    2  
ATOM 2723  H HA   . SER A 1 61  ? 2.639   -2.711  -24.026 1.00 0.00 ? 436 SER A HA   2  
ATOM 2724  H HB2  . SER A 1 61  ? 2.375   -3.223  -26.334 1.00 0.00 ? 436 SER A HB2  2  
ATOM 2725  H HB3  . SER A 1 61  ? 2.003   -4.712  -25.464 1.00 0.00 ? 436 SER A HB3  2  
ATOM 2726  H HG   . SER A 1 61  ? 0.168   -2.861  -26.583 1.00 0.00 ? 436 SER A HG   2  
ATOM 2727  N N    . ILE A 1 62  ? 1.624   -0.607  -25.065 1.00 0.00 ? 437 ILE A N    2  
ATOM 2728  C CA   . ILE A 1 62  ? 1.048   0.708   -25.320 1.00 0.00 ? 437 ILE A CA   2  
ATOM 2729  C C    . ILE A 1 62  ? 1.861   1.469   -26.364 1.00 0.00 ? 437 ILE A C    2  
ATOM 2730  O O    . ILE A 1 62  ? 3.002   1.855   -26.116 1.00 0.00 ? 437 ILE A O    2  
ATOM 2731  C CB   . ILE A 1 62  ? 0.960   1.547   -24.028 1.00 0.00 ? 437 ILE A CB   2  
ATOM 2732  C CG1  . ILE A 1 62  ? 0.221   2.863   -24.293 1.00 0.00 ? 437 ILE A CG1  2  
ATOM 2733  C CG2  . ILE A 1 62  ? 2.350   1.815   -23.466 1.00 0.00 ? 437 ILE A CG2  2  
ATOM 2734  C CD1  . ILE A 1 62  ? -0.899  3.134   -23.314 1.00 0.00 ? 437 ILE A CD1  2  
ATOM 2735  H H    . ILE A 1 62  ? 2.567   -0.764  -25.276 1.00 0.00 ? 437 ILE A H    2  
ATOM 2736  H HA   . ILE A 1 62  ? 0.046   0.563   -25.697 1.00 0.00 ? 437 ILE A HA   2  
ATOM 2737  H HB   . ILE A 1 62  ? 0.409   0.977   -23.294 1.00 0.00 ? 437 ILE A HB   2  
ATOM 2738  H HG12 . ILE A 1 62  ? 0.921   3.681   -24.227 1.00 0.00 ? 437 ILE A HG12 2  
ATOM 2739  H HG13 . ILE A 1 62  ? -0.203  2.836   -25.286 1.00 0.00 ? 437 ILE A HG13 2  
ATOM 2740  H HG21 . ILE A 1 62  ? 2.958   0.929   -23.570 1.00 0.00 ? 437 ILE A HG21 2  
ATOM 2741  H HG22 . ILE A 1 62  ? 2.806   2.630   -24.007 1.00 0.00 ? 437 ILE A HG22 2  
ATOM 2742  H HG23 . ILE A 1 62  ? 2.271   2.076   -22.421 1.00 0.00 ? 437 ILE A HG23 2  
ATOM 2743  H HD11 . ILE A 1 62  ? -1.826  2.746   -23.712 1.00 0.00 ? 437 ILE A HD11 2  
ATOM 2744  H HD12 . ILE A 1 62  ? -0.681  2.652   -22.373 1.00 0.00 ? 437 ILE A HD12 2  
ATOM 2745  H HD13 . ILE A 1 62  ? -0.992  4.200   -23.160 1.00 0.00 ? 437 ILE A HD13 2  
ATOM 2746  N N    . ASN A 1 63  ? 1.262   1.675   -27.535 1.00 0.00 ? 438 ASN A N    2  
ATOM 2747  C CA   . ASN A 1 63  ? 1.917   2.387   -28.631 1.00 0.00 ? 438 ASN A CA   2  
ATOM 2748  C C    . ASN A 1 63  ? 3.355   1.909   -28.832 1.00 0.00 ? 438 ASN A C    2  
ATOM 2749  O O    . ASN A 1 63  ? 4.260   2.711   -29.064 1.00 0.00 ? 438 ASN A O    2  
ATOM 2750  C CB   . ASN A 1 63  ? 1.893   3.899   -28.379 1.00 0.00 ? 438 ASN A CB   2  
ATOM 2751  C CG   . ASN A 1 63  ? 2.728   4.308   -27.181 1.00 0.00 ? 438 ASN A CG   2  
ATOM 2752  O OD1  . ASN A 1 63  ? 3.952   4.405   -27.267 1.00 0.00 ? 438 ASN A OD1  2  
ATOM 2753  N ND2  . ASN A 1 63  ? 2.067   4.551   -26.055 1.00 0.00 ? 438 ASN A ND2  2  
ATOM 2754  H H    . ASN A 1 63  ? 0.352   1.336   -27.668 1.00 0.00 ? 438 ASN A H    2  
ATOM 2755  H HA   . ASN A 1 63  ? 1.360   2.179   -29.532 1.00 0.00 ? 438 ASN A HA   2  
ATOM 2756  H HB2  . ASN A 1 63  ? 2.278   4.407   -29.250 1.00 0.00 ? 438 ASN A HB2  2  
ATOM 2757  H HB3  . ASN A 1 63  ? 0.874   4.211   -28.208 1.00 0.00 ? 438 ASN A HB3  2  
ATOM 2758  H HD21 . ASN A 1 63  ? 1.091   4.454   -26.061 1.00 0.00 ? 438 ASN A HD21 2  
ATOM 2759  H HD22 . ASN A 1 63  ? 2.581   4.817   -25.265 1.00 0.00 ? 438 ASN A HD22 2  
ATOM 2760  N N    . GLY A 1 64  ? 3.555   0.598   -28.747 1.00 0.00 ? 439 GLY A N    2  
ATOM 2761  C CA   . GLY A 1 64  ? 4.881   0.035   -28.928 1.00 0.00 ? 439 GLY A CA   2  
ATOM 2762  C C    . GLY A 1 64  ? 5.754   0.182   -27.697 1.00 0.00 ? 439 GLY A C    2  
ATOM 2763  O O    . GLY A 1 64  ? 6.965   0.378   -27.808 1.00 0.00 ? 439 GLY A O    2  
ATOM 2764  H H    . GLY A 1 64  ? 2.795   0.006   -28.564 1.00 0.00 ? 439 GLY A H    2  
ATOM 2765  H HA2  . GLY A 1 64  ? 4.785   -1.015  -29.161 1.00 0.00 ? 439 GLY A HA2  2  
ATOM 2766  H HA3  . GLY A 1 64  ? 5.360   0.534   -29.757 1.00 0.00 ? 439 GLY A HA3  2  
ATOM 2767  N N    . GLN A 1 65  ? 5.142   0.085   -26.523 1.00 0.00 ? 440 GLN A N    2  
ATOM 2768  C CA   . GLN A 1 65  ? 5.876   0.206   -25.268 1.00 0.00 ? 440 GLN A CA   2  
ATOM 2769  C C    . GLN A 1 65  ? 5.462   -0.887  -24.287 1.00 0.00 ? 440 GLN A C    2  
ATOM 2770  O O    . GLN A 1 65  ? 4.278   -1.050  -23.988 1.00 0.00 ? 440 GLN A O    2  
ATOM 2771  C CB   . GLN A 1 65  ? 5.644   1.582   -24.644 1.00 0.00 ? 440 GLN A CB   2  
ATOM 2772  C CG   . GLN A 1 65  ? 6.205   2.726   -25.471 1.00 0.00 ? 440 GLN A CG   2  
ATOM 2773  C CD   . GLN A 1 65  ? 7.571   3.175   -24.992 1.00 0.00 ? 440 GLN A CD   2  
ATOM 2774  O OE1  . GLN A 1 65  ? 8.242   2.468   -24.240 1.00 0.00 ? 440 GLN A OE1  2  
ATOM 2775  N NE2  . GLN A 1 65  ? 7.991   4.358   -25.423 1.00 0.00 ? 440 GLN A NE2  2  
ATOM 2776  H H    . GLN A 1 65  ? 4.176   -0.074  -26.497 1.00 0.00 ? 440 GLN A H    2  
ATOM 2777  H HA   . GLN A 1 65  ? 6.927   0.093   -25.488 1.00 0.00 ? 440 GLN A HA   2  
ATOM 2778  H HB2  . GLN A 1 65  ? 4.582   1.738   -24.528 1.00 0.00 ? 440 GLN A HB2  2  
ATOM 2779  H HB3  . GLN A 1 65  ? 6.111   1.607   -23.670 1.00 0.00 ? 440 GLN A HB3  2  
ATOM 2780  H HG2  . GLN A 1 65  ? 6.289   2.404   -26.497 1.00 0.00 ? 440 GLN A HG2  2  
ATOM 2781  H HG3  . GLN A 1 65  ? 5.525   3.564   -25.412 1.00 0.00 ? 440 GLN A HG3  2  
ATOM 2782  H HE21 . GLN A 1 65  ? 7.403   4.868   -26.020 1.00 0.00 ? 440 GLN A HE21 2  
ATOM 2783  H HE22 . GLN A 1 65  ? 8.871   4.674   -25.128 1.00 0.00 ? 440 GLN A HE22 2  
ATOM 2784  N N    . SER A 1 66  ? 6.443   -1.633  -23.793 1.00 0.00 ? 441 SER A N    2  
ATOM 2785  C CA   . SER A 1 66  ? 6.182   -2.712  -22.847 1.00 0.00 ? 441 SER A CA   2  
ATOM 2786  C C    . SER A 1 66  ? 6.012   -2.167  -21.432 1.00 0.00 ? 441 SER A C    2  
ATOM 2787  O O    . SER A 1 66  ? 6.970   -1.695  -20.819 1.00 0.00 ? 441 SER A O    2  
ATOM 2788  C CB   . SER A 1 66  ? 7.320   -3.732  -22.879 1.00 0.00 ? 441 SER A CB   2  
ATOM 2789  O OG   . SER A 1 66  ? 8.564   -3.118  -22.591 1.00 0.00 ? 441 SER A OG   2  
ATOM 2790  H H    . SER A 1 66  ? 7.365   -1.454  -24.070 1.00 0.00 ? 441 SER A H    2  
ATOM 2791  H HA   . SER A 1 66  ? 5.264   -3.198  -23.144 1.00 0.00 ? 441 SER A HA   2  
ATOM 2792  H HB2  . SER A 1 66  ? 7.132   -4.500  -22.143 1.00 0.00 ? 441 SER A HB2  2  
ATOM 2793  H HB3  . SER A 1 66  ? 7.371   -4.180  -23.860 1.00 0.00 ? 441 SER A HB3  2  
ATOM 2794  H HG   . SER A 1 66  ? 8.578   -2.840  -21.673 1.00 0.00 ? 441 SER A HG   2  
ATOM 2795  N N    . VAL A 1 67  ? 4.788   -2.238  -20.918 1.00 0.00 ? 442 VAL A N    2  
ATOM 2796  C CA   . VAL A 1 67  ? 4.493   -1.753  -19.575 1.00 0.00 ? 442 VAL A CA   2  
ATOM 2797  C C    . VAL A 1 67  ? 4.627   -2.872  -18.547 1.00 0.00 ? 442 VAL A C    2  
ATOM 2798  O O    . VAL A 1 67  ? 4.283   -4.022  -18.820 1.00 0.00 ? 442 VAL A O    2  
ATOM 2799  C CB   . VAL A 1 67  ? 3.073   -1.162  -19.486 1.00 0.00 ? 442 VAL A CB   2  
ATOM 2800  C CG1  . VAL A 1 67  ? 2.891   -0.396  -18.183 1.00 0.00 ? 442 VAL A CG1  2  
ATOM 2801  C CG2  . VAL A 1 67  ? 2.788   -0.268  -20.684 1.00 0.00 ? 442 VAL A CG2  2  
ATOM 2802  H H    . VAL A 1 67  ? 4.066   -2.625  -21.457 1.00 0.00 ? 442 VAL A H    2  
ATOM 2803  H HA   . VAL A 1 67  ? 5.202   -0.973  -19.338 1.00 0.00 ? 442 VAL A HA   2  
ATOM 2804  H HB   . VAL A 1 67  ? 2.365   -1.978  -19.498 1.00 0.00 ? 442 VAL A HB   2  
ATOM 2805  H HG11 . VAL A 1 67  ? 3.734   -0.582  -17.535 1.00 0.00 ? 442 VAL A HG11 2  
ATOM 2806  H HG12 . VAL A 1 67  ? 2.825   0.661   -18.392 1.00 0.00 ? 442 VAL A HG12 2  
ATOM 2807  H HG13 . VAL A 1 67  ? 1.985   -0.724  -17.697 1.00 0.00 ? 442 VAL A HG13 2  
ATOM 2808  H HG21 . VAL A 1 67  ? 1.913   0.333   -20.485 1.00 0.00 ? 442 VAL A HG21 2  
ATOM 2809  H HG22 . VAL A 1 67  ? 3.637   0.378   -20.861 1.00 0.00 ? 442 VAL A HG22 2  
ATOM 2810  H HG23 . VAL A 1 67  ? 2.614   -0.880  -21.556 1.00 0.00 ? 442 VAL A HG23 2  
ATOM 2811  N N    . VAL A 1 68  ? 5.130   -2.528  -17.365 1.00 0.00 ? 443 VAL A N    2  
ATOM 2812  C CA   . VAL A 1 68  ? 5.309   -3.508  -16.299 1.00 0.00 ? 443 VAL A CA   2  
ATOM 2813  C C    . VAL A 1 68  ? 4.451   -3.173  -15.082 1.00 0.00 ? 443 VAL A C    2  
ATOM 2814  O O    . VAL A 1 68  ? 3.987   -4.068  -14.376 1.00 0.00 ? 443 VAL A O    2  
ATOM 2815  C CB   . VAL A 1 68  ? 6.784   -3.604  -15.863 1.00 0.00 ? 443 VAL A CB   2  
ATOM 2816  C CG1  . VAL A 1 68  ? 7.645   -4.125  -17.003 1.00 0.00 ? 443 VAL A CG1  2  
ATOM 2817  C CG2  . VAL A 1 68  ? 7.290   -2.254  -15.374 1.00 0.00 ? 443 VAL A CG2  2  
ATOM 2818  H H    . VAL A 1 68  ? 5.388   -1.597  -17.208 1.00 0.00 ? 443 VAL A H    2  
ATOM 2819  H HA   . VAL A 1 68  ? 5.007   -4.472  -16.682 1.00 0.00 ? 443 VAL A HA   2  
ATOM 2820  H HB   . VAL A 1 68  ? 6.850   -4.307  -15.046 1.00 0.00 ? 443 VAL A HB   2  
ATOM 2821  H HG11 . VAL A 1 68  ? 7.391   -3.601  -17.914 1.00 0.00 ? 443 VAL A HG11 2  
ATOM 2822  H HG12 . VAL A 1 68  ? 8.686   -3.961  -16.772 1.00 0.00 ? 443 VAL A HG12 2  
ATOM 2823  H HG13 . VAL A 1 68  ? 7.467   -5.182  -17.135 1.00 0.00 ? 443 VAL A HG13 2  
ATOM 2824  H HG21 . VAL A 1 68  ? 8.262   -2.057  -15.802 1.00 0.00 ? 443 VAL A HG21 2  
ATOM 2825  H HG22 . VAL A 1 68  ? 6.600   -1.480  -15.673 1.00 0.00 ? 443 VAL A HG22 2  
ATOM 2826  H HG23 . VAL A 1 68  ? 7.369   -2.269  -14.296 1.00 0.00 ? 443 VAL A HG23 2  
ATOM 2827  N N    . SER A 1 69  ? 4.245   -1.881  -14.838 1.00 0.00 ? 444 SER A N    2  
ATOM 2828  C CA   . SER A 1 69  ? 3.443   -1.442  -13.700 1.00 0.00 ? 444 SER A CA   2  
ATOM 2829  C C    . SER A 1 69  ? 2.705   -0.144  -14.012 1.00 0.00 ? 444 SER A C    2  
ATOM 2830  O O    . SER A 1 69  ? 2.857   0.428   -15.093 1.00 0.00 ? 444 SER A O    2  
ATOM 2831  C CB   . SER A 1 69  ? 4.332   -1.251  -12.470 1.00 0.00 ? 444 SER A CB   2  
ATOM 2832  O OG   . SER A 1 69  ? 5.643   -0.867  -12.843 1.00 0.00 ? 444 SER A OG   2  
ATOM 2833  H H    . SER A 1 69  ? 4.640   -1.211  -15.432 1.00 0.00 ? 444 SER A H    2  
ATOM 2834  H HA   . SER A 1 69  ? 2.717   -2.213  -13.490 1.00 0.00 ? 444 SER A HA   2  
ATOM 2835  H HB2  . SER A 1 69  ? 3.911   -0.482  -11.840 1.00 0.00 ? 444 SER A HB2  2  
ATOM 2836  H HB3  . SER A 1 69  ? 4.384   -2.179  -11.919 1.00 0.00 ? 444 SER A HB3  2  
ATOM 2837  H HG   . SER A 1 69  ? 5.597   -0.144  -13.473 1.00 0.00 ? 444 SER A HG   2  
ATOM 2838  N N    . ALA A 1 70  ? 1.904   0.316   -13.054 1.00 0.00 ? 445 ALA A N    2  
ATOM 2839  C CA   . ALA A 1 70  ? 1.142   1.547   -13.221 1.00 0.00 ? 445 ALA A CA   2  
ATOM 2840  C C    . ALA A 1 70  ? 2.067   2.738   -13.433 1.00 0.00 ? 445 ALA A C    2  
ATOM 2841  O O    . ALA A 1 70  ? 1.813   3.592   -14.282 1.00 0.00 ? 445 ALA A O    2  
ATOM 2842  C CB   . ALA A 1 70  ? 0.246   1.781   -12.013 1.00 0.00 ? 445 ALA A CB   2  
ATOM 2843  H H    . ALA A 1 70  ? 1.827   -0.184  -12.216 1.00 0.00 ? 445 ALA A H    2  
ATOM 2844  H HA   . ALA A 1 70  ? 0.511   1.433   -14.091 1.00 0.00 ? 445 ALA A HA   2  
ATOM 2845  H HB1  . ALA A 1 70  ? -0.744  1.401   -12.220 1.00 0.00 ? 445 ALA A HB1  2  
ATOM 2846  H HB2  . ALA A 1 70  ? 0.656   1.268   -11.155 1.00 0.00 ? 445 ALA A HB2  2  
ATOM 2847  H HB3  . ALA A 1 70  ? 0.188   2.840   -11.806 1.00 0.00 ? 445 ALA A HB3  2  
ATOM 2848  N N    . ASN A 1 71  ? 3.147   2.787   -12.657 1.00 0.00 ? 446 ASN A N    2  
ATOM 2849  C CA   . ASN A 1 71  ? 4.115   3.873   -12.763 1.00 0.00 ? 446 ASN A CA   2  
ATOM 2850  C C    . ASN A 1 71  ? 4.608   4.023   -14.199 1.00 0.00 ? 446 ASN A C    2  
ATOM 2851  O O    . ASN A 1 71  ? 5.017   5.107   -14.617 1.00 0.00 ? 446 ASN A O    2  
ATOM 2852  C CB   . ASN A 1 71  ? 5.300   3.621   -11.828 1.00 0.00 ? 446 ASN A CB   2  
ATOM 2853  C CG   . ASN A 1 71  ? 5.951   2.274   -12.068 1.00 0.00 ? 446 ASN A CG   2  
ATOM 2854  O OD1  . ASN A 1 71  ? 6.284   1.924   -13.201 1.00 0.00 ? 446 ASN A OD1  2  
ATOM 2855  N ND2  . ASN A 1 71  ? 6.137   1.507   -11.000 1.00 0.00 ? 446 ASN A ND2  2  
ATOM 2856  H H    . ASN A 1 71  ? 3.297   2.075   -12.001 1.00 0.00 ? 446 ASN A H    2  
ATOM 2857  H HA   . ASN A 1 71  ? 3.623   4.786   -12.467 1.00 0.00 ? 446 ASN A HA   2  
ATOM 2858  H HB2  . ASN A 1 71  ? 6.041   4.391   -11.980 1.00 0.00 ? 446 ASN A HB2  2  
ATOM 2859  H HB3  . ASN A 1 71  ? 4.956   3.657   -10.804 1.00 0.00 ? 446 ASN A HB3  2  
ATOM 2860  H HD21 . ASN A 1 71  ? 5.848   1.850   -10.128 1.00 0.00 ? 446 ASN A HD21 2  
ATOM 2861  H HD22 . ASN A 1 71  ? 6.557   0.630   -11.126 1.00 0.00 ? 446 ASN A HD22 2  
ATOM 2862  N N    . ASP A 1 72  ? 4.561   2.928   -14.953 1.00 0.00 ? 447 ASP A N    2  
ATOM 2863  C CA   . ASP A 1 72  ? 4.998   2.938   -16.342 1.00 0.00 ? 447 ASP A CA   2  
ATOM 2864  C C    . ASP A 1 72  ? 3.914   3.521   -17.244 1.00 0.00 ? 447 ASP A C    2  
ATOM 2865  O O    . ASP A 1 72  ? 4.176   4.419   -18.043 1.00 0.00 ? 447 ASP A O    2  
ATOM 2866  C CB   . ASP A 1 72  ? 5.350   1.522   -16.799 1.00 0.00 ? 447 ASP A CB   2  
ATOM 2867  C CG   . ASP A 1 72  ? 6.808   1.183   -16.556 1.00 0.00 ? 447 ASP A CG   2  
ATOM 2868  O OD1  . ASP A 1 72  ? 7.166   0.899   -15.394 1.00 0.00 ? 447 ASP A OD1  2  
ATOM 2869  O OD2  . ASP A 1 72  ? 7.592   1.201   -17.529 1.00 0.00 ? 447 ASP A OD2  2  
ATOM 2870  H H    . ASP A 1 72  ? 4.223   2.094   -14.565 1.00 0.00 ? 447 ASP A H    2  
ATOM 2871  H HA   . ASP A 1 72  ? 5.878   3.558   -16.410 1.00 0.00 ? 447 ASP A HA   2  
ATOM 2872  H HB2  . ASP A 1 72  ? 4.741   0.814   -16.258 1.00 0.00 ? 447 ASP A HB2  2  
ATOM 2873  H HB3  . ASP A 1 72  ? 5.149   1.429   -17.857 1.00 0.00 ? 447 ASP A HB3  2  
ATOM 2874  N N    . VAL A 1 73  ? 2.696   3.005   -17.107 1.00 0.00 ? 448 VAL A N    2  
ATOM 2875  C CA   . VAL A 1 73  ? 1.570   3.476   -17.909 1.00 0.00 ? 448 VAL A CA   2  
ATOM 2876  C C    . VAL A 1 73  ? 1.360   4.978   -17.741 1.00 0.00 ? 448 VAL A C    2  
ATOM 2877  O O    . VAL A 1 73  ? 1.010   5.676   -18.694 1.00 0.00 ? 448 VAL A O    2  
ATOM 2878  C CB   . VAL A 1 73  ? 0.265   2.746   -17.532 1.00 0.00 ? 448 VAL A CB   2  
ATOM 2879  C CG1  . VAL A 1 73  ? -0.872  3.168   -18.451 1.00 0.00 ? 448 VAL A CG1  2  
ATOM 2880  C CG2  . VAL A 1 73  ? 0.461   1.238   -17.579 1.00 0.00 ? 448 VAL A CG2  2  
ATOM 2881  H H    . VAL A 1 73  ? 2.551   2.291   -16.450 1.00 0.00 ? 448 VAL A H    2  
ATOM 2882  H HA   . VAL A 1 73  ? 1.789   3.265   -18.946 1.00 0.00 ? 448 VAL A HA   2  
ATOM 2883  H HB   . VAL A 1 73  ? 0.002   3.022   -16.521 1.00 0.00 ? 448 VAL A HB   2  
ATOM 2884  H HG11 . VAL A 1 73  ? -0.966  4.244   -18.436 1.00 0.00 ? 448 VAL A HG11 2  
ATOM 2885  H HG12 . VAL A 1 73  ? -0.663  2.838   -19.458 1.00 0.00 ? 448 VAL A HG12 2  
ATOM 2886  H HG13 . VAL A 1 73  ? -1.794  2.721   -18.110 1.00 0.00 ? 448 VAL A HG13 2  
ATOM 2887  H HG21 . VAL A 1 73  ? -0.484  0.748   -17.401 1.00 0.00 ? 448 VAL A HG21 2  
ATOM 2888  H HG22 . VAL A 1 73  ? 0.837   0.954   -18.550 1.00 0.00 ? 448 VAL A HG22 2  
ATOM 2889  H HG23 . VAL A 1 73  ? 1.168   0.943   -16.817 1.00 0.00 ? 448 VAL A HG23 2  
ATOM 2890  N N    . SER A 1 74  ? 1.567   5.468   -16.524 1.00 0.00 ? 449 SER A N    2  
ATOM 2891  C CA   . SER A 1 74  ? 1.393   6.886   -16.226 1.00 0.00 ? 449 SER A CA   2  
ATOM 2892  C C    . SER A 1 74  ? 2.272   7.755   -17.121 1.00 0.00 ? 449 SER A C    2  
ATOM 2893  O O    . SER A 1 74  ? 1.771   8.529   -17.937 1.00 0.00 ? 449 SER A O    2  
ATOM 2894  C CB   . SER A 1 74  ? 1.716   7.160   -14.757 1.00 0.00 ? 449 SER A CB   2  
ATOM 2895  O OG   . SER A 1 74  ? 1.422   8.503   -14.411 1.00 0.00 ? 449 SER A OG   2  
ATOM 2896  H H    . SER A 1 74  ? 1.838   4.859   -15.805 1.00 0.00 ? 449 SER A H    2  
ATOM 2897  H HA   . SER A 1 74  ? 0.359   7.137   -16.408 1.00 0.00 ? 449 SER A HA   2  
ATOM 2898  H HB2  . SER A 1 74  ? 1.127   6.505   -14.132 1.00 0.00 ? 449 SER A HB2  2  
ATOM 2899  H HB3  . SER A 1 74  ? 2.766   6.978   -14.581 1.00 0.00 ? 449 SER A HB3  2  
ATOM 2900  H HG   . SER A 1 74  ? 1.811   9.092   -15.062 1.00 0.00 ? 449 SER A HG   2  
ATOM 2901  N N    . ASP A 1 75  ? 3.586   7.629   -16.957 1.00 0.00 ? 450 ASP A N    2  
ATOM 2902  C CA   . ASP A 1 75  ? 4.536   8.410   -17.744 1.00 0.00 ? 450 ASP A CA   2  
ATOM 2903  C C    . ASP A 1 75  ? 4.248   8.294   -19.239 1.00 0.00 ? 450 ASP A C    2  
ATOM 2904  O O    . ASP A 1 75  ? 4.482   9.233   -19.999 1.00 0.00 ? 450 ASP A O    2  
ATOM 2905  C CB   . ASP A 1 75  ? 5.969   7.959   -17.451 1.00 0.00 ? 450 ASP A CB   2  
ATOM 2906  C CG   . ASP A 1 75  ? 6.224   6.525   -17.871 1.00 0.00 ? 450 ASP A CG   2  
ATOM 2907  O OD1  . ASP A 1 75  ? 6.340   6.275   -19.089 1.00 0.00 ? 450 ASP A OD1  2  
ATOM 2908  O OD2  . ASP A 1 75  ? 6.312   5.653   -16.981 1.00 0.00 ? 450 ASP A OD2  2  
ATOM 2909  H H    . ASP A 1 75  ? 3.926   7.000   -16.287 1.00 0.00 ? 450 ASP A H    2  
ATOM 2910  H HA   . ASP A 1 75  ? 4.431   9.444   -17.452 1.00 0.00 ? 450 ASP A HA   2  
ATOM 2911  H HB2  . ASP A 1 75  ? 6.657   8.598   -17.983 1.00 0.00 ? 450 ASP A HB2  2  
ATOM 2912  H HB3  . ASP A 1 75  ? 6.155   8.043   -16.390 1.00 0.00 ? 450 ASP A HB3  2  
ATOM 2913  N N    . VAL A 1 76  ? 3.742   7.137   -19.655 1.00 0.00 ? 451 VAL A N    2  
ATOM 2914  C CA   . VAL A 1 76  ? 3.425   6.906   -21.060 1.00 0.00 ? 451 VAL A CA   2  
ATOM 2915  C C    . VAL A 1 76  ? 2.275   7.796   -21.520 1.00 0.00 ? 451 VAL A C    2  
ATOM 2916  O O    . VAL A 1 76  ? 2.371   8.468   -22.547 1.00 0.00 ? 451 VAL A O    2  
ATOM 2917  C CB   . VAL A 1 76  ? 3.054   5.432   -21.319 1.00 0.00 ? 451 VAL A CB   2  
ATOM 2918  C CG1  . VAL A 1 76  ? 2.834   5.184   -22.804 1.00 0.00 ? 451 VAL A CG1  2  
ATOM 2919  C CG2  . VAL A 1 76  ? 4.130   4.505   -20.773 1.00 0.00 ? 451 VAL A CG2  2  
ATOM 2920  H H    . VAL A 1 76  ? 3.577   6.424   -19.003 1.00 0.00 ? 451 VAL A H    2  
ATOM 2921  H HA   . VAL A 1 76  ? 4.304   7.141   -21.643 1.00 0.00 ? 451 VAL A HA   2  
ATOM 2922  H HB   . VAL A 1 76  ? 2.130   5.219   -20.802 1.00 0.00 ? 451 VAL A HB   2  
ATOM 2923  H HG11 . VAL A 1 76  ? 2.243   5.987   -23.220 1.00 0.00 ? 451 VAL A HG11 2  
ATOM 2924  H HG12 . VAL A 1 76  ? 3.789   5.142   -23.308 1.00 0.00 ? 451 VAL A HG12 2  
ATOM 2925  H HG13 . VAL A 1 76  ? 2.313   4.248   -22.938 1.00 0.00 ? 451 VAL A HG13 2  
ATOM 2926  H HG21 . VAL A 1 76  ? 4.728   4.127   -21.589 1.00 0.00 ? 451 VAL A HG21 2  
ATOM 2927  H HG22 . VAL A 1 76  ? 4.761   5.050   -20.087 1.00 0.00 ? 451 VAL A HG22 2  
ATOM 2928  H HG23 . VAL A 1 76  ? 3.665   3.679   -20.255 1.00 0.00 ? 451 VAL A HG23 2  
ATOM 2929  N N    . ILE A 1 77  ? 1.188   7.799   -20.755 1.00 0.00 ? 452 ILE A N    2  
ATOM 2930  C CA   . ILE A 1 77  ? 0.022   8.608   -21.089 1.00 0.00 ? 452 ILE A CA   2  
ATOM 2931  C C    . ILE A 1 77  ? 0.389   10.086  -21.184 1.00 0.00 ? 452 ILE A C    2  
ATOM 2932  O O    . ILE A 1 77  ? -0.227  10.842  -21.934 1.00 0.00 ? 452 ILE A O    2  
ATOM 2933  C CB   . ILE A 1 77  ? -1.103  8.433   -20.049 1.00 0.00 ? 452 ILE A CB   2  
ATOM 2934  C CG1  . ILE A 1 77  ? -1.442  6.951   -19.876 1.00 0.00 ? 452 ILE A CG1  2  
ATOM 2935  C CG2  . ILE A 1 77  ? -2.341  9.217   -20.463 1.00 0.00 ? 452 ILE A CG2  2  
ATOM 2936  C CD1  . ILE A 1 77  ? -1.864  6.587   -18.469 1.00 0.00 ? 452 ILE A CD1  2  
ATOM 2937  H H    . ILE A 1 77  ? 1.170   7.242   -19.949 1.00 0.00 ? 452 ILE A H    2  
ATOM 2938  H HA   . ILE A 1 77  ? -0.350  8.278   -22.048 1.00 0.00 ? 452 ILE A HA   2  
ATOM 2939  H HB   . ILE A 1 77  ? -0.756  8.829   -19.106 1.00 0.00 ? 452 ILE A HB   2  
ATOM 2940  H HG12 . ILE A 1 77  ? -2.252  6.694   -20.541 1.00 0.00 ? 452 ILE A HG12 2  
ATOM 2941  H HG13 . ILE A 1 77  ? -0.574  6.358   -20.127 1.00 0.00 ? 452 ILE A HG13 2  
ATOM 2942  H HG21 . ILE A 1 77  ? -2.400  9.253   -21.540 1.00 0.00 ? 452 ILE A HG21 2  
ATOM 2943  H HG22 . ILE A 1 77  ? -3.222  8.733   -20.070 1.00 0.00 ? 452 ILE A HG22 2  
ATOM 2944  H HG23 . ILE A 1 77  ? -2.278  10.222  -20.072 1.00 0.00 ? 452 ILE A HG23 2  
ATOM 2945  H HD11 . ILE A 1 77  ? -0.988  6.417   -17.862 1.00 0.00 ? 452 ILE A HD11 2  
ATOM 2946  H HD12 . ILE A 1 77  ? -2.445  7.394   -18.047 1.00 0.00 ? 452 ILE A HD12 2  
ATOM 2947  H HD13 . ILE A 1 77  ? -2.463  5.688   -18.494 1.00 0.00 ? 452 ILE A HD13 2  
ATOM 2948  N N    . LYS A 1 78  ? 1.397   10.490  -20.417 1.00 0.00 ? 453 LYS A N    2  
ATOM 2949  C CA   . LYS A 1 78  ? 1.845   11.877  -20.415 1.00 0.00 ? 453 LYS A CA   2  
ATOM 2950  C C    . LYS A 1 78  ? 3.049   12.076  -21.335 1.00 0.00 ? 453 LYS A C    2  
ATOM 2951  O O    . LYS A 1 78  ? 3.403   13.207  -21.668 1.00 0.00 ? 453 LYS A O    2  
ATOM 2952  C CB   . LYS A 1 78  ? 2.199   12.320  -18.992 1.00 0.00 ? 453 LYS A CB   2  
ATOM 2953  C CG   . LYS A 1 78  ? 3.325   11.513  -18.366 1.00 0.00 ? 453 LYS A CG   2  
ATOM 2954  C CD   . LYS A 1 78  ? 3.432   11.773  -16.871 1.00 0.00 ? 453 LYS A CD   2  
ATOM 2955  C CE   . LYS A 1 78  ? 4.664   12.596  -16.534 1.00 0.00 ? 453 LYS A CE   2  
ATOM 2956  N NZ   . LYS A 1 78  ? 5.124   12.363  -15.137 1.00 0.00 ? 453 LYS A NZ   2  
ATOM 2957  H H    . LYS A 1 78  ? 1.848   9.840   -19.840 1.00 0.00 ? 453 LYS A H    2  
ATOM 2958  H HA   . LYS A 1 78  ? 1.030   12.487  -20.776 1.00 0.00 ? 453 LYS A HA   2  
ATOM 2959  H HB2  . LYS A 1 78  ? 2.498   13.357  -19.015 1.00 0.00 ? 453 LYS A HB2  2  
ATOM 2960  H HB3  . LYS A 1 78  ? 1.323   12.220  -18.370 1.00 0.00 ? 453 LYS A HB3  2  
ATOM 2961  H HG2  . LYS A 1 78  ? 3.134   10.464  -18.525 1.00 0.00 ? 453 LYS A HG2  2  
ATOM 2962  H HG3  . LYS A 1 78  ? 4.256   11.788  -18.838 1.00 0.00 ? 453 LYS A HG3  2  
ATOM 2963  H HD2  . LYS A 1 78  ? 2.554   12.308  -16.543 1.00 0.00 ? 453 LYS A HD2  2  
ATOM 2964  H HD3  . LYS A 1 78  ? 3.490   10.826  -16.355 1.00 0.00 ? 453 LYS A HD3  2  
ATOM 2965  H HE2  . LYS A 1 78  ? 5.458   12.326  -17.214 1.00 0.00 ? 453 LYS A HE2  2  
ATOM 2966  H HE3  . LYS A 1 78  ? 4.426   13.643  -16.656 1.00 0.00 ? 453 LYS A HE3  2  
ATOM 2967  H HZ1  . LYS A 1 78  ? 4.766   13.114  -14.513 1.00 0.00 ? 453 LYS A HZ1  2  
ATOM 2968  H HZ2  . LYS A 1 78  ? 4.774   11.446  -14.793 1.00 0.00 ? 453 LYS A HZ2  2  
ATOM 2969  H HZ3  . LYS A 1 78  ? 6.163   12.362  -15.098 1.00 0.00 ? 453 LYS A HZ3  2  
ATOM 2970  N N    . ARG A 1 79  ? 3.676   10.975  -21.745 1.00 0.00 ? 454 ARG A N    2  
ATOM 2971  C CA   . ARG A 1 79  ? 4.838   11.043  -22.625 1.00 0.00 ? 454 ARG A CA   2  
ATOM 2972  C C    . ARG A 1 79  ? 4.433   10.815  -24.078 1.00 0.00 ? 454 ARG A C    2  
ATOM 2973  O O    . ARG A 1 79  ? 4.725   11.633  -24.951 1.00 0.00 ? 454 ARG A O    2  
ATOM 2974  C CB   . ARG A 1 79  ? 5.882   10.006  -22.207 1.00 0.00 ? 454 ARG A CB   2  
ATOM 2975  C CG   . ARG A 1 79  ? 7.134   10.018  -23.069 1.00 0.00 ? 454 ARG A CG   2  
ATOM 2976  C CD   . ARG A 1 79  ? 8.343   9.513   -22.300 1.00 0.00 ? 454 ARG A CD   2  
ATOM 2977  N NE   . ARG A 1 79  ? 9.598   9.988   -22.879 1.00 0.00 ? 454 ARG A NE   2  
ATOM 2978  C CZ   . ARG A 1 79  ? 10.189  9.426   -23.932 1.00 0.00 ? 454 ARG A CZ   2  
ATOM 2979  N NH1  . ARG A 1 79  ? 9.640   8.376   -24.530 1.00 0.00 ? 454 ARG A NH1  2  
ATOM 2980  N NH2  . ARG A 1 79  ? 11.333  9.917   -24.389 1.00 0.00 ? 454 ARG A NH2  2  
ATOM 2981  H H    . ARG A 1 79  ? 3.352   10.100  -21.449 1.00 0.00 ? 454 ARG A H    2  
ATOM 2982  H HA   . ARG A 1 79  ? 5.266   12.030  -22.533 1.00 0.00 ? 454 ARG A HA   2  
ATOM 2983  H HB2  . ARG A 1 79  ? 6.173   10.198  -21.185 1.00 0.00 ? 454 ARG A HB2  2  
ATOM 2984  H HB3  . ARG A 1 79  ? 5.440   9.023   -22.267 1.00 0.00 ? 454 ARG A HB3  2  
ATOM 2985  H HG2  . ARG A 1 79  ? 6.974   9.384   -23.928 1.00 0.00 ? 454 ARG A HG2  2  
ATOM 2986  H HG3  . ARG A 1 79  ? 7.322   11.031  -23.396 1.00 0.00 ? 454 ARG A HG3  2  
ATOM 2987  H HD2  . ARG A 1 79  ? 8.276   9.860   -21.280 1.00 0.00 ? 454 ARG A HD2  2  
ATOM 2988  H HD3  . ARG A 1 79  ? 8.336   8.433   -22.313 1.00 0.00 ? 454 ARG A HD3  2  
ATOM 2989  H HE   . ARG A 1 79  ? 10.025  10.763  -22.460 1.00 0.00 ? 454 ARG A HE   2  
ATOM 2990  H HH11 . ARG A 1 79  ? 8.777   8.001   -24.193 1.00 0.00 ? 454 ARG A HH11 2  
ATOM 2991  H HH12 . ARG A 1 79  ? 10.090  7.959   -25.320 1.00 0.00 ? 454 ARG A HH12 2  
ATOM 2992  H HH21 . ARG A 1 79  ? 11.750  10.709  -23.942 1.00 0.00 ? 454 ARG A HH21 2  
ATOM 2993  H HH22 . ARG A 1 79  ? 11.778  9.496   -25.179 1.00 0.00 ? 454 ARG A HH22 2  
ATOM 2994  N N    . GLU A 1 80  ? 3.760   9.698   -24.329 1.00 0.00 ? 455 GLU A N    2  
ATOM 2995  C CA   . GLU A 1 80  ? 3.313   9.358   -25.676 1.00 0.00 ? 455 GLU A CA   2  
ATOM 2996  C C    . GLU A 1 80  ? 1.958   9.990   -25.976 1.00 0.00 ? 455 GLU A C    2  
ATOM 2997  O O    . GLU A 1 80  ? 1.000   9.812   -25.225 1.00 0.00 ? 455 GLU A O    2  
ATOM 2998  C CB   . GLU A 1 80  ? 3.228   7.838   -25.839 1.00 0.00 ? 455 GLU A CB   2  
ATOM 2999  C CG   . GLU A 1 80  ? 4.395   7.091   -25.215 1.00 0.00 ? 455 GLU A CG   2  
ATOM 3000  C CD   . GLU A 1 80  ? 5.658   7.186   -26.047 1.00 0.00 ? 455 GLU A CD   2  
ATOM 3001  O OE1  . GLU A 1 80  ? 5.555   7.132   -27.291 1.00 0.00 ? 455 GLU A OE1  2  
ATOM 3002  O OE2  . GLU A 1 80  ? 6.751   7.317   -25.456 1.00 0.00 ? 455 GLU A OE2  2  
ATOM 3003  H H    . GLU A 1 80  ? 3.557   9.086   -23.591 1.00 0.00 ? 455 GLU A H    2  
ATOM 3004  H HA   . GLU A 1 80  ? 4.041   9.745   -26.373 1.00 0.00 ? 455 GLU A HA   2  
ATOM 3005  H HB2  . GLU A 1 80  ? 2.317   7.489   -25.377 1.00 0.00 ? 455 GLU A HB2  2  
ATOM 3006  H HB3  . GLU A 1 80  ? 3.200   7.603   -26.892 1.00 0.00 ? 455 GLU A HB3  2  
ATOM 3007  H HG2  . GLU A 1 80  ? 4.593   7.509   -24.240 1.00 0.00 ? 455 GLU A HG2  2  
ATOM 3008  H HG3  . GLU A 1 80  ? 4.126   6.050   -25.112 1.00 0.00 ? 455 GLU A HG3  2  
ATOM 3009  N N    . SER A 1 81  ? 1.885   10.727  -27.079 1.00 0.00 ? 456 SER A N    2  
ATOM 3010  C CA   . SER A 1 81  ? 0.645   11.385  -27.477 1.00 0.00 ? 456 SER A CA   2  
ATOM 3011  C C    . SER A 1 81  ? -0.398  10.361  -27.911 1.00 0.00 ? 456 SER A C    2  
ATOM 3012  O O    . SER A 1 81  ? -1.589  10.524  -27.649 1.00 0.00 ? 456 SER A O    2  
ATOM 3013  C CB   . SER A 1 81  ? 0.908   12.373  -28.614 1.00 0.00 ? 456 SER A CB   2  
ATOM 3014  O OG   . SER A 1 81  ? 1.721   13.450  -28.178 1.00 0.00 ? 456 SER A OG   2  
ATOM 3015  H H    . SER A 1 81  ? 2.683   10.833  -27.638 1.00 0.00 ? 456 SER A H    2  
ATOM 3016  H HA   . SER A 1 81  ? 0.268   11.925  -26.622 1.00 0.00 ? 456 SER A HA   2  
ATOM 3017  H HB2  . SER A 1 81  ? 1.413   11.865  -29.422 1.00 0.00 ? 456 SER A HB2  2  
ATOM 3018  H HB3  . SER A 1 81  ? -0.032  12.769  -28.969 1.00 0.00 ? 456 SER A HB3  2  
ATOM 3019  H HG   . SER A 1 81  ? 2.471   13.546  -28.770 1.00 0.00 ? 456 SER A HG   2  
ATOM 3020  N N    . THR A 1 82  ? 0.059   9.304   -28.576 1.00 0.00 ? 457 THR A N    2  
ATOM 3021  C CA   . THR A 1 82  ? -0.835  8.251   -29.046 1.00 0.00 ? 457 THR A CA   2  
ATOM 3022  C C    . THR A 1 82  ? -0.647  6.979   -28.228 1.00 0.00 ? 457 THR A C    2  
ATOM 3023  O O    . THR A 1 82  ? 0.481   6.577   -27.940 1.00 0.00 ? 457 THR A O    2  
ATOM 3024  C CB   . THR A 1 82  ? -0.585  7.963   -30.527 1.00 0.00 ? 457 THR A CB   2  
ATOM 3025  O OG1  . THR A 1 82  ? 0.794   8.066   -30.831 1.00 0.00 ? 457 THR A OG1  2  
ATOM 3026  C CG2  . THR A 1 82  ? -1.330  8.899   -31.454 1.00 0.00 ? 457 THR A CG2  2  
ATOM 3027  H H    . THR A 1 82  ? 1.020   9.230   -28.754 1.00 0.00 ? 457 THR A H    2  
ATOM 3028  H HA   . THR A 1 82  ? -1.850  8.599   -28.921 1.00 0.00 ? 457 THR A HA   2  
ATOM 3029  H HB   . THR A 1 82  ? -0.907  6.955   -30.747 1.00 0.00 ? 457 THR A HB   2  
ATOM 3030  H HG1  . THR A 1 82  ? 1.072   8.982   -30.752 1.00 0.00 ? 457 THR A HG1  2  
ATOM 3031  H HG21 . THR A 1 82  ? -1.758  9.708   -30.880 1.00 0.00 ? 457 THR A HG21 2  
ATOM 3032  H HG22 . THR A 1 82  ? -0.646  9.300   -32.187 1.00 0.00 ? 457 THR A HG22 2  
ATOM 3033  H HG23 . THR A 1 82  ? -2.119  8.356   -31.956 1.00 0.00 ? 457 THR A HG23 2  
ATOM 3034  N N    . LEU A 1 83  ? -1.756  6.349   -27.854 1.00 0.00 ? 458 LEU A N    2  
ATOM 3035  C CA   . LEU A 1 83  ? -1.707  5.122   -27.067 1.00 0.00 ? 458 LEU A CA   2  
ATOM 3036  C C    . LEU A 1 83  ? -2.375  3.969   -27.808 1.00 0.00 ? 458 LEU A C    2  
ATOM 3037  O O    . LEU A 1 83  ? -3.406  4.146   -28.455 1.00 0.00 ? 458 LEU A O    2  
ATOM 3038  C CB   . LEU A 1 83  ? -2.383  5.329   -25.709 1.00 0.00 ? 458 LEU A CB   2  
ATOM 3039  C CG   . LEU A 1 83  ? -2.201  6.719   -25.093 1.00 0.00 ? 458 LEU A CG   2  
ATOM 3040  C CD1  . LEU A 1 83  ? -2.801  6.765   -23.696 1.00 0.00 ? 458 LEU A CD1  2  
ATOM 3041  C CD2  . LEU A 1 83  ? -0.727  7.100   -25.058 1.00 0.00 ? 458 LEU A CD2  2  
ATOM 3042  H H    . LEU A 1 83  ? -2.627  6.717   -28.112 1.00 0.00 ? 458 LEU A H    2  
ATOM 3043  H HA   . LEU A 1 83  ? -0.669  4.874   -26.906 1.00 0.00 ? 458 LEU A HA   2  
ATOM 3044  H HB2  . LEU A 1 83  ? -3.440  5.145   -25.825 1.00 0.00 ? 458 LEU A HB2  2  
ATOM 3045  H HB3  . LEU A 1 83  ? -1.983  4.602   -25.018 1.00 0.00 ? 458 LEU A HB3  2  
ATOM 3046  H HG   . LEU A 1 83  ? -2.721  7.445   -25.703 1.00 0.00 ? 458 LEU A HG   2  
ATOM 3047  H HD11 . LEU A 1 83  ? -2.520  5.875   -23.154 1.00 0.00 ? 458 LEU A HD11 2  
ATOM 3048  H HD12 . LEU A 1 83  ? -2.431  7.636   -23.175 1.00 0.00 ? 458 LEU A HD12 2  
ATOM 3049  H HD13 . LEU A 1 83  ? -3.877  6.819   -23.767 1.00 0.00 ? 458 LEU A HD13 2  
ATOM 3050  H HD21 . LEU A 1 83  ? -0.503  7.585   -24.119 1.00 0.00 ? 458 LEU A HD21 2  
ATOM 3051  H HD22 . LEU A 1 83  ? -0.124  6.210   -25.157 1.00 0.00 ? 458 LEU A HD22 2  
ATOM 3052  H HD23 . LEU A 1 83  ? -0.511  7.775   -25.873 1.00 0.00 ? 458 LEU A HD23 2  
ATOM 3053  N N    . ASN A 1 84  ? -1.780  2.786   -27.703 1.00 0.00 ? 459 ASN A N    2  
ATOM 3054  C CA   . ASN A 1 84  ? -2.313  1.596   -28.359 1.00 0.00 ? 459 ASN A CA   2  
ATOM 3055  C C    . ASN A 1 84  ? -2.144  0.371   -27.467 1.00 0.00 ? 459 ASN A C    2  
ATOM 3056  O O    . ASN A 1 84  ? -1.111  -0.298  -27.505 1.00 0.00 ? 459 ASN A O    2  
ATOM 3057  C CB   . ASN A 1 84  ? -1.612  1.369   -29.699 1.00 0.00 ? 459 ASN A CB   2  
ATOM 3058  C CG   . ASN A 1 84  ? -1.766  2.548   -30.640 1.00 0.00 ? 459 ASN A CG   2  
ATOM 3059  O OD1  . ASN A 1 84  ? -2.486  2.472   -31.635 1.00 0.00 ? 459 ASN A OD1  2  
ATOM 3060  N ND2  . ASN A 1 84  ? -1.088  3.647   -30.328 1.00 0.00 ? 459 ASN A ND2  2  
ATOM 3061  H H    . ASN A 1 84  ? -0.961  2.710   -27.171 1.00 0.00 ? 459 ASN A H    2  
ATOM 3062  H HA   . ASN A 1 84  ? -3.366  1.758   -28.534 1.00 0.00 ? 459 ASN A HA   2  
ATOM 3063  H HB2  . ASN A 1 84  ? -0.559  1.207   -29.525 1.00 0.00 ? 459 ASN A HB2  2  
ATOM 3064  H HB3  . ASN A 1 84  ? -2.033  0.495   -30.174 1.00 0.00 ? 459 ASN A HB3  2  
ATOM 3065  H HD21 . ASN A 1 84  ? -0.533  3.635   -29.521 1.00 0.00 ? 459 ASN A HD21 2  
ATOM 3066  H HD22 . ASN A 1 84  ? -1.170  4.424   -30.919 1.00 0.00 ? 459 ASN A HD22 2  
ATOM 3067  N N    . MET A 1 85  ? -3.160  0.087   -26.662 1.00 0.00 ? 460 MET A N    2  
ATOM 3068  C CA   . MET A 1 85  ? -3.119  -1.054  -25.755 1.00 0.00 ? 460 MET A CA   2  
ATOM 3069  C C    . MET A 1 85  ? -3.822  -2.265  -26.359 1.00 0.00 ? 460 MET A C    2  
ATOM 3070  O O    . MET A 1 85  ? -4.645  -2.132  -27.266 1.00 0.00 ? 460 MET A O    2  
ATOM 3071  C CB   . MET A 1 85  ? -3.764  -0.691  -24.417 1.00 0.00 ? 460 MET A CB   2  
ATOM 3072  C CG   . MET A 1 85  ? -3.271  0.628   -23.842 1.00 0.00 ? 460 MET A CG   2  
ATOM 3073  S SD   . MET A 1 85  ? -4.606  1.643   -23.181 1.00 0.00 ? 460 MET A SD   2  
ATOM 3074  C CE   . MET A 1 85  ? -4.534  3.058   -24.277 1.00 0.00 ? 460 MET A CE   2  
ATOM 3075  H H    . MET A 1 85  ? -3.954  0.660   -26.673 1.00 0.00 ? 460 MET A H    2  
ATOM 3076  H HA   . MET A 1 85  ? -2.082  -1.303  -25.587 1.00 0.00 ? 460 MET A HA   2  
ATOM 3077  H HB2  . MET A 1 85  ? -4.834  -0.622  -24.554 1.00 0.00 ? 460 MET A HB2  2  
ATOM 3078  H HB3  . MET A 1 85  ? -3.551  -1.472  -23.703 1.00 0.00 ? 460 MET A HB3  2  
ATOM 3079  H HG2  . MET A 1 85  ? -2.571  0.418   -23.048 1.00 0.00 ? 460 MET A HG2  2  
ATOM 3080  H HG3  . MET A 1 85  ? -2.771  1.181   -24.624 1.00 0.00 ? 460 MET A HG3  2  
ATOM 3081  H HE1  . MET A 1 85  ? -4.773  3.954   -23.725 1.00 0.00 ? 460 MET A HE1  2  
ATOM 3082  H HE2  . MET A 1 85  ? -3.540  3.143   -24.690 1.00 0.00 ? 460 MET A HE2  2  
ATOM 3083  H HE3  . MET A 1 85  ? -5.247  2.928   -25.079 1.00 0.00 ? 460 MET A HE3  2  
ATOM 3084  N N    . VAL A 1 86  ? -3.493  -3.445  -25.845 1.00 0.00 ? 461 VAL A N    2  
ATOM 3085  C CA   . VAL A 1 86  ? -4.090  -4.686  -26.324 1.00 0.00 ? 461 VAL A CA   2  
ATOM 3086  C C    . VAL A 1 86  ? -4.612  -5.522  -25.161 1.00 0.00 ? 461 VAL A C    2  
ATOM 3087  O O    . VAL A 1 86  ? -3.860  -5.874  -24.252 1.00 0.00 ? 461 VAL A O    2  
ATOM 3088  C CB   . VAL A 1 86  ? -3.079  -5.523  -27.130 1.00 0.00 ? 461 VAL A CB   2  
ATOM 3089  C CG1  . VAL A 1 86  ? -3.764  -6.723  -27.767 1.00 0.00 ? 461 VAL A CG1  2  
ATOM 3090  C CG2  . VAL A 1 86  ? -2.397  -4.667  -28.187 1.00 0.00 ? 461 VAL A CG2  2  
ATOM 3091  H H    . VAL A 1 86  ? -2.832  -3.483  -25.123 1.00 0.00 ? 461 VAL A H    2  
ATOM 3092  H HA   . VAL A 1 86  ? -4.916  -4.431  -26.973 1.00 0.00 ? 461 VAL A HA   2  
ATOM 3093  H HB   . VAL A 1 86  ? -2.322  -5.888  -26.452 1.00 0.00 ? 461 VAL A HB   2  
ATOM 3094  H HG11 . VAL A 1 86  ? -4.674  -6.402  -28.252 1.00 0.00 ? 461 VAL A HG11 2  
ATOM 3095  H HG12 . VAL A 1 86  ? -3.105  -7.169  -28.497 1.00 0.00 ? 461 VAL A HG12 2  
ATOM 3096  H HG13 . VAL A 1 86  ? -4.000  -7.449  -27.003 1.00 0.00 ? 461 VAL A HG13 2  
ATOM 3097  H HG21 . VAL A 1 86  ? -2.186  -5.270  -29.057 1.00 0.00 ? 461 VAL A HG21 2  
ATOM 3098  H HG22 . VAL A 1 86  ? -3.048  -3.851  -28.465 1.00 0.00 ? 461 VAL A HG22 2  
ATOM 3099  H HG23 . VAL A 1 86  ? -1.474  -4.272  -27.789 1.00 0.00 ? 461 VAL A HG23 2  
ATOM 3100  N N    . VAL A 1 87  ? -5.903  -5.836  -25.193 1.00 0.00 ? 462 VAL A N    2  
ATOM 3101  C CA   . VAL A 1 87  ? -6.520  -6.629  -24.137 1.00 0.00 ? 462 VAL A CA   2  
ATOM 3102  C C    . VAL A 1 87  ? -6.957  -7.993  -24.656 1.00 0.00 ? 462 VAL A C    2  
ATOM 3103  O O    . VAL A 1 87  ? -7.341  -8.132  -25.818 1.00 0.00 ? 462 VAL A O    2  
ATOM 3104  C CB   . VAL A 1 87  ? -7.740  -5.908  -23.529 1.00 0.00 ? 462 VAL A CB   2  
ATOM 3105  C CG1  . VAL A 1 87  ? -8.150  -6.567  -22.221 1.00 0.00 ? 462 VAL A CG1  2  
ATOM 3106  C CG2  . VAL A 1 87  ? -7.444  -4.429  -23.322 1.00 0.00 ? 462 VAL A CG2  2  
ATOM 3107  H H    . VAL A 1 87  ? -6.454  -5.526  -25.943 1.00 0.00 ? 462 VAL A H    2  
ATOM 3108  H HA   . VAL A 1 87  ? -5.787  -6.771  -23.356 1.00 0.00 ? 462 VAL A HA   2  
ATOM 3109  H HB   . VAL A 1 87  ? -8.565  -5.996  -24.222 1.00 0.00 ? 462 VAL A HB   2  
ATOM 3110  H HG11 . VAL A 1 87  ? -7.301  -7.082  -21.795 1.00 0.00 ? 462 VAL A HG11 2  
ATOM 3111  H HG12 . VAL A 1 87  ? -8.496  -5.812  -21.529 1.00 0.00 ? 462 VAL A HG12 2  
ATOM 3112  H HG13 . VAL A 1 87  ? -8.944  -7.276  -22.406 1.00 0.00 ? 462 VAL A HG13 2  
ATOM 3113  H HG21 . VAL A 1 87  ? -7.728  -4.140  -22.321 1.00 0.00 ? 462 VAL A HG21 2  
ATOM 3114  H HG22 . VAL A 1 87  ? -6.389  -4.249  -23.463 1.00 0.00 ? 462 VAL A HG22 2  
ATOM 3115  H HG23 . VAL A 1 87  ? -8.006  -3.846  -24.037 1.00 0.00 ? 462 VAL A HG23 2  
ATOM 3116  N N    . ARG A 1 88  ? -6.896  -8.998  -23.789 1.00 0.00 ? 463 ARG A N    2  
ATOM 3117  C CA   . ARG A 1 88  ? -7.287  -10.352 -24.160 1.00 0.00 ? 463 ARG A CA   2  
ATOM 3118  C C    . ARG A 1 88  ? -8.518  -10.798 -23.378 1.00 0.00 ? 463 ARG A C    2  
ATOM 3119  O O    . ARG A 1 88  ? -8.638  -10.526 -22.183 1.00 0.00 ? 463 ARG A O    2  
ATOM 3120  C CB   . ARG A 1 88  ? -6.132  -11.325 -23.912 1.00 0.00 ? 463 ARG A CB   2  
ATOM 3121  C CG   . ARG A 1 88  ? -6.250  -12.623 -24.694 1.00 0.00 ? 463 ARG A CG   2  
ATOM 3122  C CD   . ARG A 1 88  ? -7.028  -13.672 -23.915 1.00 0.00 ? 463 ARG A CD   2  
ATOM 3123  N NE   . ARG A 1 88  ? -6.226  -14.267 -22.848 1.00 0.00 ? 463 ARG A NE   2  
ATOM 3124  C CZ   . ARG A 1 88  ? -6.742  -14.861 -21.773 1.00 0.00 ? 463 ARG A CZ   2  
ATOM 3125  N NH1  . ARG A 1 88  ? -8.057  -14.947 -21.620 1.00 0.00 ? 463 ARG A NH1  2  
ATOM 3126  N NH2  . ARG A 1 88  ? -5.939  -15.374 -20.851 1.00 0.00 ? 463 ARG A NH2  2  
ATOM 3127  H H    . ARG A 1 88  ? -6.583  -8.824  -22.878 1.00 0.00 ? 463 ARG A H    2  
ATOM 3128  H HA   . ARG A 1 88  ? -7.525  -10.352 -25.214 1.00 0.00 ? 463 ARG A HA   2  
ATOM 3129  H HB2  . ARG A 1 88  ? -5.206  -10.845 -24.192 1.00 0.00 ? 463 ARG A HB2  2  
ATOM 3130  H HB3  . ARG A 1 88  ? -6.100  -11.565 -22.860 1.00 0.00 ? 463 ARG A HB3  2  
ATOM 3131  H HG2  . ARG A 1 88  ? -6.763  -12.427 -25.624 1.00 0.00 ? 463 ARG A HG2  2  
ATOM 3132  H HG3  . ARG A 1 88  ? -5.260  -13.000 -24.898 1.00 0.00 ? 463 ARG A HG3  2  
ATOM 3133  H HD2  . ARG A 1 88  ? -7.900  -13.207 -23.481 1.00 0.00 ? 463 ARG A HD2  2  
ATOM 3134  H HD3  . ARG A 1 88  ? -7.338  -14.451 -24.596 1.00 0.00 ? 463 ARG A HD3  2  
ATOM 3135  H HE   . ARG A 1 88  ? -5.251  -14.221 -22.935 1.00 0.00 ? 463 ARG A HE   2  
ATOM 3136  H HH11 . ARG A 1 88  ? -8.669  -14.566 -22.312 1.00 0.00 ? 463 ARG A HH11 2  
ATOM 3137  H HH12 . ARG A 1 88  ? -8.437  -15.395 -20.811 1.00 0.00 ? 463 ARG A HH12 2  
ATOM 3138  H HH21 . ARG A 1 88  ? -4.947  -15.313 -20.962 1.00 0.00 ? 463 ARG A HH21 2  
ATOM 3139  H HH22 . ARG A 1 88  ? -6.326  -15.821 -20.044 1.00 0.00 ? 463 ARG A HH22 2  
ATOM 3140  N N    . ARG A 1 89  ? -9.430  -11.483 -24.059 1.00 0.00 ? 464 ARG A N    2  
ATOM 3141  C CA   . ARG A 1 89  ? -10.652 -11.966 -23.425 1.00 0.00 ? 464 ARG A CA   2  
ATOM 3142  C C    . ARG A 1 89  ? -10.897 -13.431 -23.768 1.00 0.00 ? 464 ARG A C    2  
ATOM 3143  O O    . ARG A 1 89  ? -10.922 -13.809 -24.939 1.00 0.00 ? 464 ARG A O    2  
ATOM 3144  C CB   . ARG A 1 89  ? -11.848 -11.118 -23.862 1.00 0.00 ? 464 ARG A CB   2  
ATOM 3145  C CG   . ARG A 1 89  ? -12.180 -11.246 -25.340 1.00 0.00 ? 464 ARG A CG   2  
ATOM 3146  C CD   . ARG A 1 89  ? -13.275 -10.275 -25.751 1.00 0.00 ? 464 ARG A CD   2  
ATOM 3147  N NE   . ARG A 1 89  ? -13.217 -9.954  -27.174 1.00 0.00 ? 464 ARG A NE   2  
ATOM 3148  C CZ   . ARG A 1 89  ? -13.886 -8.951  -27.737 1.00 0.00 ? 464 ARG A CZ   2  
ATOM 3149  N NH1  . ARG A 1 89  ? -14.667 -8.169  -27.000 1.00 0.00 ? 464 ARG A NH1  2  
ATOM 3150  N NH2  . ARG A 1 89  ? -13.777 -8.729  -29.039 1.00 0.00 ? 464 ARG A NH2  2  
ATOM 3151  H H    . ARG A 1 89  ? -9.278  -11.668 -25.008 1.00 0.00 ? 464 ARG A H    2  
ATOM 3152  H HA   . ARG A 1 89  ? -10.529 -11.874 -22.357 1.00 0.00 ? 464 ARG A HA   2  
ATOM 3153  H HB2  . ARG A 1 89  ? -12.715 -11.419 -23.293 1.00 0.00 ? 464 ARG A HB2  2  
ATOM 3154  H HB3  . ARG A 1 89  ? -11.634 -10.080 -23.652 1.00 0.00 ? 464 ARG A HB3  2  
ATOM 3155  H HG2  . ARG A 1 89  ? -11.293 -11.038 -25.918 1.00 0.00 ? 464 ARG A HG2  2  
ATOM 3156  H HG3  . ARG A 1 89  ? -12.513 -12.255 -25.537 1.00 0.00 ? 464 ARG A HG3  2  
ATOM 3157  H HD2  . ARG A 1 89  ? -14.235 -10.721 -25.532 1.00 0.00 ? 464 ARG A HD2  2  
ATOM 3158  H HD3  . ARG A 1 89  ? -13.165 -9.365  -25.181 1.00 0.00 ? 464 ARG A HD3  2  
ATOM 3159  H HE   . ARG A 1 89  ? -12.647 -10.515 -27.742 1.00 0.00 ? 464 ARG A HE   2  
ATOM 3160  H HH11 . ARG A 1 89  ? -14.753 -8.331  -26.018 1.00 0.00 ? 464 ARG A HH11 2  
ATOM 3161  H HH12 . ARG A 1 89  ? -15.168 -7.417  -27.429 1.00 0.00 ? 464 ARG A HH12 2  
ATOM 3162  H HH21 . ARG A 1 89  ? -13.191 -9.315  -29.599 1.00 0.00 ? 464 ARG A HH21 2  
ATOM 3163  H HH22 . ARG A 1 89  ? -14.281 -7.976  -29.462 1.00 0.00 ? 464 ARG A HH22 2  
ATOM 3164  N N    . GLY A 1 90  ? -11.079 -14.252 -22.740 1.00 0.00 ? 465 GLY A N    2  
ATOM 3165  C CA   . GLY A 1 90  ? -11.321 -15.667 -22.954 1.00 0.00 ? 465 GLY A CA   2  
ATOM 3166  C C    . GLY A 1 90  ? -10.183 -16.346 -23.690 1.00 0.00 ? 465 GLY A C    2  
ATOM 3167  O O    . GLY A 1 90  ? -9.190  -16.744 -23.080 1.00 0.00 ? 465 GLY A O    2  
ATOM 3168  H H    . GLY A 1 90  ? -11.049 -13.895 -21.827 1.00 0.00 ? 465 GLY A H    2  
ATOM 3169  H HA2  . GLY A 1 90  ? -11.455 -16.147 -21.997 1.00 0.00 ? 465 GLY A HA2  2  
ATOM 3170  H HA3  . GLY A 1 90  ? -12.227 -15.782 -23.532 1.00 0.00 ? 465 GLY A HA3  2  
ATOM 3171  N N    . ASN A 1 91  ? -10.327 -16.483 -25.005 1.00 0.00 ? 466 ASN A N    2  
ATOM 3172  C CA   . ASN A 1 91  ? -9.303  -17.122 -25.822 1.00 0.00 ? 466 ASN A CA   2  
ATOM 3173  C C    . ASN A 1 91  ? -9.071  -16.344 -27.113 1.00 0.00 ? 466 ASN A C    2  
ATOM 3174  O O    . ASN A 1 91  ? -8.694  -16.918 -28.135 1.00 0.00 ? 466 ASN A O    2  
ATOM 3175  C CB   . ASN A 1 91  ? -9.712  -18.558 -26.147 1.00 0.00 ? 466 ASN A CB   2  
ATOM 3176  C CG   . ASN A 1 91  ? -8.542  -19.403 -26.601 1.00 0.00 ? 466 ASN A CG   2  
ATOM 3177  O OD1  . ASN A 1 91  ? -7.610  -19.657 -25.838 1.00 0.00 ? 466 ASN A OD1  2  
ATOM 3178  N ND2  . ASN A 1 91  ? -8.584  -19.844 -27.852 1.00 0.00 ? 466 ASN A ND2  2  
ATOM 3179  H H    . ASN A 1 91  ? -11.141 -16.150 -25.434 1.00 0.00 ? 466 ASN A H    2  
ATOM 3180  H HA   . ASN A 1 91  ? -8.386  -17.138 -25.253 1.00 0.00 ? 466 ASN A HA   2  
ATOM 3181  H HB2  . ASN A 1 91  ? -10.141 -19.012 -25.267 1.00 0.00 ? 466 ASN A HB2  2  
ATOM 3182  H HB3  . ASN A 1 91  ? -10.451 -18.545 -26.936 1.00 0.00 ? 466 ASN A HB3  2  
ATOM 3183  H HD21 . ASN A 1 91  ? -9.358  -19.602 -28.401 1.00 0.00 ? 466 ASN A HD21 2  
ATOM 3184  H HD22 . ASN A 1 91  ? -7.840  -20.392 -28.173 1.00 0.00 ? 466 ASN A HD22 2  
ATOM 3185  N N    . GLU A 1 92  ? -9.298  -15.035 -27.062 1.00 0.00 ? 467 GLU A N    2  
ATOM 3186  C CA   . GLU A 1 92  ? -9.114  -14.182 -28.229 1.00 0.00 ? 467 GLU A CA   2  
ATOM 3187  C C    . GLU A 1 92  ? -8.444  -12.866 -27.846 1.00 0.00 ? 467 GLU A C    2  
ATOM 3188  O O    . GLU A 1 92  ? -8.702  -12.315 -26.775 1.00 0.00 ? 467 GLU A O    2  
ATOM 3189  C CB   . GLU A 1 92  ? -10.462 -13.905 -28.895 1.00 0.00 ? 467 GLU A CB   2  
ATOM 3190  C CG   . GLU A 1 92  ? -11.502 -13.336 -27.944 1.00 0.00 ? 467 GLU A CG   2  
ATOM 3191  C CD   . GLU A 1 92  ? -12.879 -13.246 -28.572 1.00 0.00 ? 467 GLU A CD   2  
ATOM 3192  O OE1  . GLU A 1 92  ? -13.432 -14.301 -28.945 1.00 0.00 ? 467 GLU A OE1  2  
ATOM 3193  O OE2  . GLU A 1 92  ? -13.405 -12.118 -28.690 1.00 0.00 ? 467 GLU A OE2  2  
ATOM 3194  H H    . GLU A 1 92  ? -9.598  -14.634 -26.220 1.00 0.00 ? 467 GLU A H    2  
ATOM 3195  H HA   . GLU A 1 92  ? -8.478  -14.707 -28.927 1.00 0.00 ? 467 GLU A HA   2  
ATOM 3196  H HB2  . GLU A 1 92  ? -10.315 -13.199 -29.700 1.00 0.00 ? 467 GLU A HB2  2  
ATOM 3197  H HB3  . GLU A 1 92  ? -10.844 -14.828 -29.302 1.00 0.00 ? 467 GLU A HB3  2  
ATOM 3198  H HG2  . GLU A 1 92  ? -11.562 -13.974 -27.074 1.00 0.00 ? 467 GLU A HG2  2  
ATOM 3199  H HG3  . GLU A 1 92  ? -11.194 -12.345 -27.644 1.00 0.00 ? 467 GLU A HG3  2  
ATOM 3200  N N    . ASP A 1 93  ? -7.587  -12.365 -28.728 1.00 0.00 ? 468 ASP A N    2  
ATOM 3201  C CA   . ASP A 1 93  ? -6.883  -11.111 -28.486 1.00 0.00 ? 468 ASP A CA   2  
ATOM 3202  C C    . ASP A 1 93  ? -7.687  -9.930  -29.021 1.00 0.00 ? 468 ASP A C    2  
ATOM 3203  O O    . ASP A 1 93  ? -8.314  -10.022 -30.076 1.00 0.00 ? 468 ASP A O    2  
ATOM 3204  C CB   . ASP A 1 93  ? -5.502  -11.141 -29.142 1.00 0.00 ? 468 ASP A CB   2  
ATOM 3205  C CG   . ASP A 1 93  ? -4.540  -12.066 -28.420 1.00 0.00 ? 468 ASP A CG   2  
ATOM 3206  O OD1  . ASP A 1 93  ? -4.987  -13.129 -27.941 1.00 0.00 ? 468 ASP A OD1  2  
ATOM 3207  O OD2  . ASP A 1 93  ? -3.342  -11.727 -28.336 1.00 0.00 ? 468 ASP A OD2  2  
ATOM 3208  H H    . ASP A 1 93  ? -7.426  -12.849 -29.565 1.00 0.00 ? 468 ASP A H    2  
ATOM 3209  H HA   . ASP A 1 93  ? -6.765  -10.997 -27.419 1.00 0.00 ? 468 ASP A HA   2  
ATOM 3210  H HB2  . ASP A 1 93  ? -5.601  -11.480 -30.162 1.00 0.00 ? 468 ASP A HB2  2  
ATOM 3211  H HB3  . ASP A 1 93  ? -5.085  -10.144 -29.136 1.00 0.00 ? 468 ASP A HB3  2  
ATOM 3212  N N    . ILE A 1 94  ? -7.667  -8.823  -28.286 1.00 0.00 ? 469 ILE A N    2  
ATOM 3213  C CA   . ILE A 1 94  ? -8.399  -7.628  -28.690 1.00 0.00 ? 469 ILE A CA   2  
ATOM 3214  C C    . ILE A 1 94  ? -7.487  -6.406  -28.715 1.00 0.00 ? 469 ILE A C    2  
ATOM 3215  O O    . ILE A 1 94  ? -6.833  -6.086  -27.722 1.00 0.00 ? 469 ILE A O    2  
ATOM 3216  C CB   . ILE A 1 94  ? -9.590  -7.340  -27.751 1.00 0.00 ? 469 ILE A CB   2  
ATOM 3217  C CG1  . ILE A 1 94  ? -10.228 -8.643  -27.260 1.00 0.00 ? 469 ILE A CG1  2  
ATOM 3218  C CG2  . ILE A 1 94  ? -10.625 -6.477  -28.459 1.00 0.00 ? 469 ILE A CG2  2  
ATOM 3219  C CD1  . ILE A 1 94  ? -10.004 -8.905  -25.786 1.00 0.00 ? 469 ILE A CD1  2  
ATOM 3220  H H    . ILE A 1 94  ? -7.151  -8.810  -27.453 1.00 0.00 ? 469 ILE A H    2  
ATOM 3221  H HA   . ILE A 1 94  ? -8.786  -7.795  -29.686 1.00 0.00 ? 469 ILE A HA   2  
ATOM 3222  H HB   . ILE A 1 94  ? -9.221  -6.785  -26.900 1.00 0.00 ? 469 ILE A HB   2  
ATOM 3223  H HG12 . ILE A 1 94  ? -11.294 -8.603  -27.427 1.00 0.00 ? 469 ILE A HG12 2  
ATOM 3224  H HG13 . ILE A 1 94  ? -9.814  -9.472  -27.811 1.00 0.00 ? 469 ILE A HG13 2  
ATOM 3225  H HG21 . ILE A 1 94  ? -10.156 -5.955  -29.280 1.00 0.00 ? 469 ILE A HG21 2  
ATOM 3226  H HG22 . ILE A 1 94  ? -11.418 -7.105  -28.838 1.00 0.00 ? 469 ILE A HG22 2  
ATOM 3227  H HG23 . ILE A 1 94  ? -11.033 -5.760  -27.763 1.00 0.00 ? 469 ILE A HG23 2  
ATOM 3228  H HD11 . ILE A 1 94  ? -9.374  -9.774  -25.667 1.00 0.00 ? 469 ILE A HD11 2  
ATOM 3229  H HD12 . ILE A 1 94  ? -9.524  -8.049  -25.337 1.00 0.00 ? 469 ILE A HD12 2  
ATOM 3230  H HD13 . ILE A 1 94  ? -10.954 -9.079  -25.302 1.00 0.00 ? 469 ILE A HD13 2  
ATOM 3231  N N    . MET A 1 95  ? -7.449  -5.725  -29.857 1.00 0.00 ? 470 MET A N    2  
ATOM 3232  C CA   . MET A 1 95  ? -6.620  -4.535  -30.010 1.00 0.00 ? 470 MET A CA   2  
ATOM 3233  C C    . MET A 1 95  ? -7.436  -3.272  -29.760 1.00 0.00 ? 470 MET A C    2  
ATOM 3234  O O    . MET A 1 95  ? -8.475  -3.059  -30.385 1.00 0.00 ? 470 MET A O    2  
ATOM 3235  C CB   . MET A 1 95  ? -6.007  -4.492  -31.412 1.00 0.00 ? 470 MET A CB   2  
ATOM 3236  C CG   . MET A 1 95  ? -4.627  -5.127  -31.493 1.00 0.00 ? 470 MET A CG   2  
ATOM 3237  S SD   . MET A 1 95  ? -4.611  -6.644  -32.468 1.00 0.00 ? 470 MET A SD   2  
ATOM 3238  C CE   . MET A 1 95  ? -3.570  -7.690  -31.452 1.00 0.00 ? 470 MET A CE   2  
ATOM 3239  H H    . MET A 1 95  ? -7.995  -6.028  -30.612 1.00 0.00 ? 470 MET A H    2  
ATOM 3240  H HA   . MET A 1 95  ? -5.826  -4.587  -29.281 1.00 0.00 ? 470 MET A HA   2  
ATOM 3241  H HB2  . MET A 1 95  ? -6.662  -5.014  -32.094 1.00 0.00 ? 470 MET A HB2  2  
ATOM 3242  H HB3  . MET A 1 95  ? -5.924  -3.462  -31.724 1.00 0.00 ? 470 MET A HB3  2  
ATOM 3243  H HG2  . MET A 1 95  ? -3.947  -4.421  -31.944 1.00 0.00 ? 470 MET A HG2  2  
ATOM 3244  H HG3  . MET A 1 95  ? -4.293  -5.356  -30.491 1.00 0.00 ? 470 MET A HG3  2  
ATOM 3245  H HE1  . MET A 1 95  ? -2.721  -8.024  -32.030 1.00 0.00 ? 470 MET A HE1  2  
ATOM 3246  H HE2  . MET A 1 95  ? -3.226  -7.132  -30.595 1.00 0.00 ? 470 MET A HE2  2  
ATOM 3247  H HE3  . MET A 1 95  ? -4.137  -8.548  -31.119 1.00 0.00 ? 470 MET A HE3  2  
ATOM 3248  N N    . ILE A 1 96  ? -6.963  -2.439  -28.839 1.00 0.00 ? 471 ILE A N    2  
ATOM 3249  C CA   . ILE A 1 96  ? -7.653  -1.198  -28.505 1.00 0.00 ? 471 ILE A CA   2  
ATOM 3250  C C    . ILE A 1 96  ? -6.727  0.006   -28.636 1.00 0.00 ? 471 ILE A C    2  
ATOM 3251  O O    . ILE A 1 96  ? -5.600  -0.006  -28.142 1.00 0.00 ? 471 ILE A O    2  
ATOM 3252  C CB   . ILE A 1 96  ? -8.222  -1.243  -27.072 1.00 0.00 ? 471 ILE A CB   2  
ATOM 3253  C CG1  . ILE A 1 96  ? -9.128  -2.464  -26.896 1.00 0.00 ? 471 ILE A CG1  2  
ATOM 3254  C CG2  . ILE A 1 96  ? -8.985  0.036   -26.760 1.00 0.00 ? 471 ILE A CG2  2  
ATOM 3255  C CD1  . ILE A 1 96  ? -8.369  -3.764  -26.746 1.00 0.00 ? 471 ILE A CD1  2  
ATOM 3256  H H    . ILE A 1 96  ? -6.131  -2.663  -28.373 1.00 0.00 ? 471 ILE A H    2  
ATOM 3257  H HA   . ILE A 1 96  ? -8.479  -1.081  -29.192 1.00 0.00 ? 471 ILE A HA   2  
ATOM 3258  H HB   . ILE A 1 96  ? -7.395  -1.316  -26.382 1.00 0.00 ? 471 ILE A HB   2  
ATOM 3259  H HG12 . ILE A 1 96  ? -9.732  -2.331  -26.012 1.00 0.00 ? 471 ILE A HG12 2  
ATOM 3260  H HG13 . ILE A 1 96  ? -9.773  -2.552  -27.758 1.00 0.00 ? 471 ILE A HG13 2  
ATOM 3261  H HG21 . ILE A 1 96  ? -9.627  0.284   -27.592 1.00 0.00 ? 471 ILE A HG21 2  
ATOM 3262  H HG22 . ILE A 1 96  ? -9.585  -0.108  -25.873 1.00 0.00 ? 471 ILE A HG22 2  
ATOM 3263  H HG23 . ILE A 1 96  ? -8.285  0.842   -26.594 1.00 0.00 ? 471 ILE A HG23 2  
ATOM 3264  H HD11 . ILE A 1 96  ? -8.450  -4.335  -27.659 1.00 0.00 ? 471 ILE A HD11 2  
ATOM 3265  H HD12 . ILE A 1 96  ? -7.329  -3.552  -26.545 1.00 0.00 ? 471 ILE A HD12 2  
ATOM 3266  H HD13 . ILE A 1 96  ? -8.786  -4.330  -25.928 1.00 0.00 ? 471 ILE A HD13 2  
ATOM 3267  N N    . THR A 1 97  ? -7.216  1.048   -29.302 1.00 0.00 ? 472 THR A N    2  
ATOM 3268  C CA   . THR A 1 97  ? -6.441  2.268   -29.494 1.00 0.00 ? 472 THR A CA   2  
ATOM 3269  C C    . THR A 1 97  ? -7.121  3.445   -28.803 1.00 0.00 ? 472 THR A C    2  
ATOM 3270  O O    . THR A 1 97  ? -8.260  3.788   -29.121 1.00 0.00 ? 472 THR A O    2  
ATOM 3271  C CB   . THR A 1 97  ? -6.273  2.563   -30.986 1.00 0.00 ? 472 THR A CB   2  
ATOM 3272  O OG1  . THR A 1 97  ? -6.178  1.361   -31.728 1.00 0.00 ? 472 THR A OG1  2  
ATOM 3273  C CG2  . THR A 1 97  ? -5.049  3.395   -31.298 1.00 0.00 ? 472 THR A CG2  2  
ATOM 3274  H H    . THR A 1 97  ? -8.124  0.998   -29.666 1.00 0.00 ? 472 THR A H    2  
ATOM 3275  H HA   . THR A 1 97  ? -5.467  2.118   -29.052 1.00 0.00 ? 472 THR A HA   2  
ATOM 3276  H HB   . THR A 1 97  ? -7.140  3.108   -31.333 1.00 0.00 ? 472 THR A HB   2  
ATOM 3277  H HG1  . THR A 1 97  ? -6.960  1.258   -32.274 1.00 0.00 ? 472 THR A HG1  2  
ATOM 3278  H HG21 . THR A 1 97  ? -4.296  3.226   -30.542 1.00 0.00 ? 472 THR A HG21 2  
ATOM 3279  H HG22 . THR A 1 97  ? -4.659  3.113   -32.265 1.00 0.00 ? 472 THR A HG22 2  
ATOM 3280  H HG23 . THR A 1 97  ? -5.317  4.441   -31.309 1.00 0.00 ? 472 THR A HG23 2  
ATOM 3281  N N    . VAL A 1 98  ? -6.421  4.059   -27.855 1.00 0.00 ? 473 VAL A N    2  
ATOM 3282  C CA   . VAL A 1 98  ? -6.967  5.193   -27.120 1.00 0.00 ? 473 VAL A CA   2  
ATOM 3283  C C    . VAL A 1 98  ? -6.048  6.406   -27.206 1.00 0.00 ? 473 VAL A C    2  
ATOM 3284  O O    . VAL A 1 98  ? -4.825  6.279   -27.149 1.00 0.00 ? 473 VAL A O    2  
ATOM 3285  C CB   . VAL A 1 98  ? -7.194  4.841   -25.636 1.00 0.00 ? 473 VAL A CB   2  
ATOM 3286  C CG1  . VAL A 1 98  ? -7.951  5.955   -24.930 1.00 0.00 ? 473 VAL A CG1  2  
ATOM 3287  C CG2  . VAL A 1 98  ? -7.935  3.518   -25.509 1.00 0.00 ? 473 VAL A CG2  2  
ATOM 3288  H H    . VAL A 1 98  ? -5.520  3.738   -27.642 1.00 0.00 ? 473 VAL A H    2  
ATOM 3289  H HA   . VAL A 1 98  ? -7.921  5.445   -27.556 1.00 0.00 ? 473 VAL A HA   2  
ATOM 3290  H HB   . VAL A 1 98  ? -6.230  4.735   -25.161 1.00 0.00 ? 473 VAL A HB   2  
ATOM 3291  H HG11 . VAL A 1 98  ? -7.883  6.862   -25.511 1.00 0.00 ? 473 VAL A HG11 2  
ATOM 3292  H HG12 . VAL A 1 98  ? -8.988  5.673   -24.823 1.00 0.00 ? 473 VAL A HG12 2  
ATOM 3293  H HG13 . VAL A 1 98  ? -7.521  6.120   -23.953 1.00 0.00 ? 473 VAL A HG13 2  
ATOM 3294  H HG21 . VAL A 1 98  ? -8.641  3.577   -24.694 1.00 0.00 ? 473 VAL A HG21 2  
ATOM 3295  H HG22 . VAL A 1 98  ? -8.463  3.311   -26.429 1.00 0.00 ? 473 VAL A HG22 2  
ATOM 3296  H HG23 . VAL A 1 98  ? -7.228  2.726   -25.315 1.00 0.00 ? 473 VAL A HG23 2  
ATOM 3297  N N    . ILE A 1 99  ? -6.649  7.584   -27.341 1.00 0.00 ? 474 ILE A N    2  
ATOM 3298  C CA   . ILE A 1 99  ? -5.890  8.824   -27.431 1.00 0.00 ? 474 ILE A CA   2  
ATOM 3299  C C    . ILE A 1 99  ? -6.336  9.811   -26.351 1.00 0.00 ? 474 ILE A C    2  
ATOM 3300  O O    . ILE A 1 99  ? -7.459  10.315  -26.391 1.00 0.00 ? 474 ILE A O    2  
ATOM 3301  C CB   . ILE A 1 99  ? -6.056  9.486   -28.812 1.00 0.00 ? 474 ILE A CB   2  
ATOM 3302  C CG1  . ILE A 1 99  ? -5.821  8.463   -29.925 1.00 0.00 ? 474 ILE A CG1  2  
ATOM 3303  C CG2  . ILE A 1 99  ? -5.100  10.661  -28.955 1.00 0.00 ? 474 ILE A CG2  2  
ATOM 3304  C CD1  . ILE A 1 99  ? -4.416  7.903   -29.945 1.00 0.00 ? 474 ILE A CD1  2  
ATOM 3305  H H    . ILE A 1 99  ? -7.627  7.618   -27.377 1.00 0.00 ? 474 ILE A H    2  
ATOM 3306  H HA   . ILE A 1 99  ? -4.847  8.588   -27.290 1.00 0.00 ? 474 ILE A HA   2  
ATOM 3307  H HB   . ILE A 1 99  ? -7.065  9.864   -28.888 1.00 0.00 ? 474 ILE A HB   2  
ATOM 3308  H HG12 . ILE A 1 99  ? -6.505  7.637   -29.798 1.00 0.00 ? 474 ILE A HG12 2  
ATOM 3309  H HG13 . ILE A 1 99  ? -6.005  8.932   -30.881 1.00 0.00 ? 474 ILE A HG13 2  
ATOM 3310  H HG21 . ILE A 1 99  ? -4.217  10.480  -28.361 1.00 0.00 ? 474 ILE A HG21 2  
ATOM 3311  H HG22 . ILE A 1 99  ? -4.821  10.773  -29.992 1.00 0.00 ? 474 ILE A HG22 2  
ATOM 3312  H HG23 . ILE A 1 99  ? -5.586  11.564  -28.613 1.00 0.00 ? 474 ILE A HG23 2  
ATOM 3313  H HD11 . ILE A 1 99  ? -3.855  8.364   -30.743 1.00 0.00 ? 474 ILE A HD11 2  
ATOM 3314  H HD12 . ILE A 1 99  ? -3.934  8.107   -29.001 1.00 0.00 ? 474 ILE A HD12 2  
ATOM 3315  H HD13 . ILE A 1 99  ? -4.456  6.835   -30.105 1.00 0.00 ? 474 ILE A HD13 2  
ATOM 3316  N N    . PRO A 1 100 ? -5.465  10.101  -25.365 1.00 0.00 ? 475 PRO A N    2  
ATOM 3317  C CA   . PRO A 1 100 ? -5.792  11.030  -24.278 1.00 0.00 ? 475 PRO A CA   2  
ATOM 3318  C C    . PRO A 1 100 ? -6.072  12.440  -24.785 1.00 0.00 ? 475 PRO A C    2  
ATOM 3319  O O    . PRO A 1 100 ? -5.450  12.904  -25.740 1.00 0.00 ? 475 PRO A O    2  
ATOM 3320  C CB   . PRO A 1 100 ? -4.539  11.018  -23.395 1.00 0.00 ? 475 PRO A CB   2  
ATOM 3321  C CG   . PRO A 1 100 ? -3.449  10.501  -24.270 1.00 0.00 ? 475 PRO A CG   2  
ATOM 3322  C CD   . PRO A 1 100 ? -4.106  9.550   -25.229 1.00 0.00 ? 475 PRO A CD   2  
ATOM 3323  H HA   . PRO A 1 100 ? -6.640  10.683  -23.707 1.00 0.00 ? 475 PRO A HA   2  
ATOM 3324  H HB2  . PRO A 1 100 ? -4.328  12.021  -23.053 1.00 0.00 ? 475 PRO A HB2  2  
ATOM 3325  H HB3  . PRO A 1 100 ? -4.702  10.371  -22.545 1.00 0.00 ? 475 PRO A HB3  2  
ATOM 3326  H HG2  . PRO A 1 100 ? -2.991  11.318  -24.807 1.00 0.00 ? 475 PRO A HG2  2  
ATOM 3327  H HG3  . PRO A 1 100 ? -2.714  9.983   -23.673 1.00 0.00 ? 475 PRO A HG3  2  
ATOM 3328  H HD2  . PRO A 1 100 ? -3.589  9.555   -26.177 1.00 0.00 ? 475 PRO A HD2  2  
ATOM 3329  H HD3  . PRO A 1 100 ? -4.133  8.553   -24.816 1.00 0.00 ? 475 PRO A HD3  2  
ATOM 3330  N N    . GLU A 1 101 ? -7.016  13.116  -24.138 1.00 0.00 ? 476 GLU A N    2  
ATOM 3331  C CA   . GLU A 1 101 ? -7.385  14.474  -24.521 1.00 0.00 ? 476 GLU A CA   2  
ATOM 3332  C C    . GLU A 1 101 ? -6.839  15.490  -23.523 1.00 0.00 ? 476 GLU A C    2  
ATOM 3333  O O    . GLU A 1 101 ? -6.316  15.121  -22.470 1.00 0.00 ? 476 GLU A O    2  
ATOM 3334  C CB   . GLU A 1 101 ? -8.906  14.603  -24.615 1.00 0.00 ? 476 GLU A CB   2  
ATOM 3335  C CG   . GLU A 1 101 ? -9.623  14.324  -23.303 1.00 0.00 ? 476 GLU A CG   2  
ATOM 3336  C CD   . GLU A 1 101 ? -10.090 15.591  -22.613 1.00 0.00 ? 476 GLU A CD   2  
ATOM 3337  O OE1  . GLU A 1 101 ? -9.295  16.178  -21.850 1.00 0.00 ? 476 GLU A OE1  2  
ATOM 3338  O OE2  . GLU A 1 101 ? -11.250 15.996  -22.837 1.00 0.00 ? 476 GLU A OE2  2  
ATOM 3339  H H    . GLU A 1 101 ? -7.477  12.691  -23.386 1.00 0.00 ? 476 GLU A H    2  
ATOM 3340  H HA   . GLU A 1 101 ? -6.956  14.673  -25.491 1.00 0.00 ? 476 GLU A HA   2  
ATOM 3341  H HB2  . GLU A 1 101 ? -9.152  15.608  -24.929 1.00 0.00 ? 476 GLU A HB2  2  
ATOM 3342  H HB3  . GLU A 1 101 ? -9.271  13.906  -25.355 1.00 0.00 ? 476 GLU A HB3  2  
ATOM 3343  H HG2  . GLU A 1 101 ? -10.484 13.704  -23.503 1.00 0.00 ? 476 GLU A HG2  2  
ATOM 3344  H HG3  . GLU A 1 101 ? -8.948  13.800  -22.644 1.00 0.00 ? 476 GLU A HG3  2  
ATOM 3345  N N    . GLU A 1 102 ? -6.964  16.770  -23.859 1.00 0.00 ? 477 GLU A N    2  
ATOM 3346  C CA   . GLU A 1 102 ? -6.484  17.839  -22.992 1.00 0.00 ? 477 GLU A CA   2  
ATOM 3347  C C    . GLU A 1 102 ? -7.589  18.320  -22.058 1.00 0.00 ? 477 GLU A C    2  
ATOM 3348  O O    . GLU A 1 102 ? -8.729  18.520  -22.479 1.00 0.00 ? 477 GLU A O    2  
ATOM 3349  C CB   . GLU A 1 102 ? -5.963  19.008  -23.831 1.00 0.00 ? 477 GLU A CB   2  
ATOM 3350  C CG   . GLU A 1 102 ? -7.029  19.653  -24.703 1.00 0.00 ? 477 GLU A CG   2  
ATOM 3351  C CD   . GLU A 1 102 ? -6.745  19.495  -26.185 1.00 0.00 ? 477 GLU A CD   2  
ATOM 3352  O OE1  . GLU A 1 102 ? -5.619  19.825  -26.612 1.00 0.00 ? 477 GLU A OE1  2  
ATOM 3353  O OE2  . GLU A 1 102 ? -7.649  19.040  -26.916 1.00 0.00 ? 477 GLU A OE2  2  
ATOM 3354  H H    . GLU A 1 102 ? -7.391  17.000  -24.712 1.00 0.00 ? 477 GLU A H    2  
ATOM 3355  H HA   . GLU A 1 102 ? -5.673  17.445  -22.398 1.00 0.00 ? 477 GLU A HA   2  
ATOM 3356  H HB2  . GLU A 1 102 ? -5.567  19.763  -23.167 1.00 0.00 ? 477 GLU A HB2  2  
ATOM 3357  H HB3  . GLU A 1 102 ? -5.170  18.653  -24.470 1.00 0.00 ? 477 GLU A HB3  2  
ATOM 3358  H HG2  . GLU A 1 102 ? -7.981  19.195  -24.484 1.00 0.00 ? 477 GLU A HG2  2  
ATOM 3359  H HG3  . GLU A 1 102 ? -7.076  20.707  -24.471 1.00 0.00 ? 477 GLU A HG3  2  
ATOM 3360  N N    . ILE A 1 103 ? -7.244  18.507  -20.789 1.00 0.00 ? 478 ILE A N    2  
ATOM 3361  C CA   . ILE A 1 103 ? -8.206  18.966  -19.794 1.00 0.00 ? 478 ILE A CA   2  
ATOM 3362  C C    . ILE A 1 103 ? -7.541  19.881  -18.770 1.00 0.00 ? 478 ILE A C    2  
ATOM 3363  O O    . ILE A 1 103 ? -6.456  19.585  -18.271 1.00 0.00 ? 478 ILE A O    2  
ATOM 3364  C CB   . ILE A 1 103 ? -8.867  17.779  -19.063 1.00 0.00 ? 478 ILE A CB   2  
ATOM 3365  C CG1  . ILE A 1 103 ? -9.946  18.277  -18.097 1.00 0.00 ? 478 ILE A CG1  2  
ATOM 3366  C CG2  . ILE A 1 103 ? -7.820  16.959  -18.324 1.00 0.00 ? 478 ILE A CG2  2  
ATOM 3367  C CD1  . ILE A 1 103 ? -11.344 17.833  -18.473 1.00 0.00 ? 478 ILE A CD1  2  
ATOM 3368  H H    . ILE A 1 103 ? -6.320  18.332  -20.514 1.00 0.00 ? 478 ILE A H    2  
ATOM 3369  H HA   . ILE A 1 103 ? -8.978  19.519  -20.310 1.00 0.00 ? 478 ILE A HA   2  
ATOM 3370  H HB   . ILE A 1 103 ? -9.325  17.142  -19.805 1.00 0.00 ? 478 ILE A HB   2  
ATOM 3371  H HG12 . ILE A 1 103 ? -9.737  17.904  -17.106 1.00 0.00 ? 478 ILE A HG12 2  
ATOM 3372  H HG13 . ILE A 1 103 ? -9.936  19.357  -18.080 1.00 0.00 ? 478 ILE A HG13 2  
ATOM 3373  H HG21 . ILE A 1 103 ? -6.986  16.761  -18.981 1.00 0.00 ? 478 ILE A HG21 2  
ATOM 3374  H HG22 . ILE A 1 103 ? -7.474  17.510  -17.460 1.00 0.00 ? 478 ILE A HG22 2  
ATOM 3375  H HG23 . ILE A 1 103 ? -8.255  16.023  -18.003 1.00 0.00 ? 478 ILE A HG23 2  
ATOM 3376  H HD11 . ILE A 1 103 ? -11.945 18.698  -18.710 1.00 0.00 ? 478 ILE A HD11 2  
ATOM 3377  H HD12 . ILE A 1 103 ? -11.296 17.180  -19.332 1.00 0.00 ? 478 ILE A HD12 2  
ATOM 3378  H HD13 . ILE A 1 103 ? -11.788 17.302  -17.643 1.00 0.00 ? 478 ILE A HD13 2  
ATOM 3379  N N    . ASP A 1 104 ? -8.200  20.994  -18.463 1.00 0.00 ? 479 ASP A N    2  
ATOM 3380  C CA   . ASP A 1 104 ? -7.671  21.953  -17.500 1.00 0.00 ? 479 ASP A CA   2  
ATOM 3381  C C    . ASP A 1 104 ? -8.269  21.719  -16.113 1.00 0.00 ? 479 ASP A C    2  
ATOM 3382  O O    . ASP A 1 104 ? -9.452  21.975  -15.890 1.00 0.00 ? 479 ASP A O    2  
ATOM 3383  C CB   . ASP A 1 104 ? -7.968  23.382  -17.959 1.00 0.00 ? 479 ASP A CB   2  
ATOM 3384  C CG   . ASP A 1 104 ? -6.829  23.980  -18.762 1.00 0.00 ? 479 ASP A CG   2  
ATOM 3385  O OD1  . ASP A 1 104 ? -6.288  23.276  -19.640 1.00 0.00 ? 479 ASP A OD1  2  
ATOM 3386  O OD2  . ASP A 1 104 ? -6.480  25.153  -18.514 1.00 0.00 ? 479 ASP A OD2  2  
ATOM 3387  H H    . ASP A 1 104 ? -9.060  21.176  -18.896 1.00 0.00 ? 479 ASP A H    2  
ATOM 3388  H HA   . ASP A 1 104 ? -6.602  21.816  -17.450 1.00 0.00 ? 479 ASP A HA   2  
ATOM 3389  H HB2  . ASP A 1 104 ? -8.855  23.379  -18.576 1.00 0.00 ? 479 ASP A HB2  2  
ATOM 3390  H HB3  . ASP A 1 104 ? -8.139  24.004  -17.093 1.00 0.00 ? 479 ASP A HB3  2  
ATOM 3391  N N    . PRO A 1 105 ? -7.459  21.228  -15.155 1.00 0.00 ? 480 PRO A N    2  
ATOM 3392  C CA   . PRO A 1 105 ? -7.923  20.965  -13.789 1.00 0.00 ? 480 PRO A CA   2  
ATOM 3393  C C    . PRO A 1 105 ? -8.613  22.177  -13.169 1.00 0.00 ? 480 PRO A C    2  
ATOM 3394  O O    . PRO A 1 105 ? -9.859  22.172  -13.092 1.00 0.00 ? 480 PRO A O    2  
ATOM 3395  C CB   . PRO A 1 105 ? -6.636  20.637  -13.030 1.00 0.00 ? 480 PRO A CB   2  
ATOM 3396  C CG   . PRO A 1 105 ? -5.699  20.135  -14.072 1.00 0.00 ? 480 PRO A CG   2  
ATOM 3397  C CD   . PRO A 1 105 ? -6.033  20.893  -15.327 1.00 0.00 ? 480 PRO A CD   2  
ATOM 3398  O OXT  . PRO A 1 105 ? -7.900  23.120  -12.767 1.00 0.00 ? 480 PRO A OXT  2  
ATOM 3399  H HA   . PRO A 1 105 ? -8.592  20.117  -13.755 1.00 0.00 ? 480 PRO A HA   2  
ATOM 3400  H HB2  . PRO A 1 105 ? -6.258  21.531  -12.555 1.00 0.00 ? 480 PRO A HB2  2  
ATOM 3401  H HB3  . PRO A 1 105 ? -6.837  19.883  -12.284 1.00 0.00 ? 480 PRO A HB3  2  
ATOM 3402  H HG2  . PRO A 1 105 ? -4.680  20.331  -13.775 1.00 0.00 ? 480 PRO A HG2  2  
ATOM 3403  H HG3  . PRO A 1 105 ? -5.852  19.076  -14.223 1.00 0.00 ? 480 PRO A HG3  2  
ATOM 3404  H HD2  . PRO A 1 105 ? -5.432  21.788  -15.398 1.00 0.00 ? 480 PRO A HD2  2  
ATOM 3405  H HD3  . PRO A 1 105 ? -5.886  20.268  -16.195 1.00 0.00 ? 480 PRO A HD3  2  
ATOM 3406  N N    . ASP B 2 1   ? -0.594  -1.969  -0.956  1.00 0.00 ? 1   ASP B N    2  
ATOM 3407  C CA   . ASP B 2 1   ? -1.291  -0.681  -0.698  1.00 0.00 ? 1   ASP B CA   2  
ATOM 3408  C C    . ASP B 2 1   ? -2.463  -0.487  -1.655  1.00 0.00 ? 1   ASP B C    2  
ATOM 3409  O O    . ASP B 2 1   ? -3.450  0.168   -1.319  1.00 0.00 ? 1   ASP B O    2  
ATOM 3410  C CB   . ASP B 2 1   ? -0.285  0.460   -0.858  1.00 0.00 ? 1   ASP B CB   2  
ATOM 3411  C CG   . ASP B 2 1   ? 0.389   0.824   0.451   1.00 0.00 ? 1   ASP B CG   2  
ATOM 3412  O OD1  . ASP B 2 1   ? -0.278  0.744   1.504   1.00 0.00 ? 1   ASP B OD1  2  
ATOM 3413  O OD2  . ASP B 2 1   ? 1.583   1.189   0.423   1.00 0.00 ? 1   ASP B OD2  2  
ATOM 3414  H H1   . ASP B 2 1   ? -0.028  -2.197  -0.115  1.00 0.00 ? 1   ASP B H1   2  
ATOM 3415  H H2   . ASP B 2 1   ? 0.011   -1.839  -1.793  1.00 0.00 ? 1   ASP B H2   2  
ATOM 3416  H H3   . ASP B 2 1   ? -1.319  -2.695  -1.127  1.00 0.00 ? 1   ASP B H3   2  
ATOM 3417  H HA   . ASP B 2 1   ? -1.662  -0.690  0.316   1.00 0.00 ? 1   ASP B HA   2  
ATOM 3418  H HB2  . ASP B 2 1   ? 0.478   0.163   -1.562  1.00 0.00 ? 1   ASP B HB2  2  
ATOM 3419  H HB3  . ASP B 2 1   ? -0.797  1.333   -1.234  1.00 0.00 ? 1   ASP B HB3  2  
ATOM 3420  N N    . SER B 2 2   ? -2.347  -1.060  -2.849  1.00 0.00 ? 2   SER B N    2  
ATOM 3421  C CA   . SER B 2 2   ? -3.397  -0.949  -3.856  1.00 0.00 ? 2   SER B CA   2  
ATOM 3422  C C    . SER B 2 2   ? -3.585  0.503   -4.286  1.00 0.00 ? 2   SER B C    2  
ATOM 3423  O O    . SER B 2 2   ? -4.687  0.915   -4.650  1.00 0.00 ? 2   SER B O    2  
ATOM 3424  C CB   . SER B 2 2   ? -4.715  -1.508  -3.314  1.00 0.00 ? 2   SER B CB   2  
ATOM 3425  O OG   . SER B 2 2   ? -4.482  -2.543  -2.377  1.00 0.00 ? 2   SER B OG   2  
ATOM 3426  H H    . SER B 2 2   ? -1.536  -1.569  -3.059  1.00 0.00 ? 2   SER B H    2  
ATOM 3427  H HA   . SER B 2 2   ? -3.096  -1.529  -4.715  1.00 0.00 ? 2   SER B HA   2  
ATOM 3428  H HB2  . SER B 2 2   ? -5.265  -0.716  -2.828  1.00 0.00 ? 2   SER B HB2  2  
ATOM 3429  H HB3  . SER B 2 2   ? -5.298  -1.903  -4.132  1.00 0.00 ? 2   SER B HB3  2  
ATOM 3430  H HG   . SER B 2 2   ? -5.289  -2.720  -1.887  1.00 0.00 ? 2   SER B HG   2  
ATOM 3431  N N    . ARG B 2 3   ? -2.503  1.274   -4.243  1.00 0.00 ? 3   ARG B N    2  
ATOM 3432  C CA   . ARG B 2 3   ? -2.551  2.678   -4.631  1.00 0.00 ? 3   ARG B CA   2  
ATOM 3433  C C    . ARG B 2 3   ? -2.863  2.820   -6.117  1.00 0.00 ? 3   ARG B C    2  
ATOM 3434  O O    . ARG B 2 3   ? -1.980  2.675   -6.962  1.00 0.00 ? 3   ARG B O    2  
ATOM 3435  C CB   . ARG B 2 3   ? -1.223  3.366   -4.306  1.00 0.00 ? 3   ARG B CB   2  
ATOM 3436  C CG   . ARG B 2 3   ? -1.115  3.828   -2.862  1.00 0.00 ? 3   ARG B CG   2  
ATOM 3437  C CD   . ARG B 2 3   ? -0.357  5.141   -2.752  1.00 0.00 ? 3   ARG B CD   2  
ATOM 3438  N NE   . ARG B 2 3   ? -0.336  5.648   -1.381  1.00 0.00 ? 3   ARG B NE   2  
ATOM 3439  C CZ   . ARG B 2 3   ? -0.055  6.910   -1.062  1.00 0.00 ? 3   ARG B CZ   2  
ATOM 3440  N NH1  . ARG B 2 3   ? 0.233   7.794   -2.010  1.00 0.00 ? 3   ARG B NH1  2  
ATOM 3441  N NH2  . ARG B 2 3   ? -0.061  7.289   0.209   1.00 0.00 ? 3   ARG B NH2  2  
ATOM 3442  H H    . ARG B 2 3   ? -1.653  0.889   -3.945  1.00 0.00 ? 3   ARG B H    2  
ATOM 3443  H HA   . ARG B 2 3   ? -3.339  3.151   -4.063  1.00 0.00 ? 3   ARG B HA   2  
ATOM 3444  H HB2  . ARG B 2 3   ? -0.416  2.676   -4.503  1.00 0.00 ? 3   ARG B HB2  2  
ATOM 3445  H HB3  . ARG B 2 3   ? -1.111  4.228   -4.947  1.00 0.00 ? 3   ARG B HB3  2  
ATOM 3446  H HG2  . ARG B 2 3   ? -2.108  3.964   -2.462  1.00 0.00 ? 3   ARG B HG2  2  
ATOM 3447  H HG3  . ARG B 2 3   ? -0.595  3.073   -2.290  1.00 0.00 ? 3   ARG B HG3  2  
ATOM 3448  H HD2  . ARG B 2 3   ? 0.659   4.984   -3.082  1.00 0.00 ? 3   ARG B HD2  2  
ATOM 3449  H HD3  . ARG B 2 3   ? -0.832  5.871   -3.389  1.00 0.00 ? 3   ARG B HD3  2  
ATOM 3450  H HE   . ARG B 2 3   ? -0.542  5.016   -0.661  1.00 0.00 ? 3   ARG B HE   2  
ATOM 3451  H HH11 . ARG B 2 3   ? 0.239   7.515   -2.970  1.00 0.00 ? 3   ARG B HH11 2  
ATOM 3452  H HH12 . ARG B 2 3   ? 0.442   8.740   -1.762  1.00 0.00 ? 3   ARG B HH12 2  
ATOM 3453  H HH21 . ARG B 2 3   ? -0.276  6.627   0.927   1.00 0.00 ? 3   ARG B HH21 2  
ATOM 3454  H HH22 . ARG B 2 3   ? 0.150   8.236   0.450   1.00 0.00 ? 3   ARG B HH22 2  
ATOM 3455  N N    . ILE B 2 4   ? -4.123  3.101   -6.428  1.00 0.00 ? 4   ILE B N    2  
ATOM 3456  C CA   . ILE B 2 4   ? -4.552  3.259   -7.812  1.00 0.00 ? 4   ILE B CA   2  
ATOM 3457  C C    . ILE B 2 4   ? -3.975  4.530   -8.427  1.00 0.00 ? 4   ILE B C    2  
ATOM 3458  O O    . ILE B 2 4   ? -3.616  5.469   -7.715  1.00 0.00 ? 4   ILE B O    2  
ATOM 3459  C CB   . ILE B 2 4   ? -6.088  3.300   -7.923  1.00 0.00 ? 4   ILE B CB   2  
ATOM 3460  C CG1  . ILE B 2 4   ? -6.661  4.375   -6.999  1.00 0.00 ? 4   ILE B CG1  2  
ATOM 3461  C CG2  . ILE B 2 4   ? -6.678  1.937   -7.590  1.00 0.00 ? 4   ILE B CG2  2  
ATOM 3462  C CD1  . ILE B 2 4   ? -7.760  5.195   -7.638  1.00 0.00 ? 4   ILE B CD1  2  
ATOM 3463  H H    . ILE B 2 4   ? -4.782  3.203   -5.709  1.00 0.00 ? 4   ILE B H    2  
ATOM 3464  H HA   . ILE B 2 4   ? -4.194  2.407   -8.370  1.00 0.00 ? 4   ILE B HA   2  
ATOM 3465  H HB   . ILE B 2 4   ? -6.346  3.536   -8.944  1.00 0.00 ? 4   ILE B HB   2  
ATOM 3466  H HG12 . ILE B 2 4   ? -7.071  3.904   -6.118  1.00 0.00 ? 4   ILE B HG12 2  
ATOM 3467  H HG13 . ILE B 2 4   ? -5.870  5.049   -6.706  1.00 0.00 ? 4   ILE B HG13 2  
ATOM 3468  H HG21 . ILE B 2 4   ? -5.923  1.176   -7.722  1.00 0.00 ? 4   ILE B HG21 2  
ATOM 3469  H HG22 . ILE B 2 4   ? -7.017  1.933   -6.564  1.00 0.00 ? 4   ILE B HG22 2  
ATOM 3470  H HG23 . ILE B 2 4   ? -7.511  1.736   -8.246  1.00 0.00 ? 4   ILE B HG23 2  
ATOM 3471  H HD11 . ILE B 2 4   ? -7.603  6.241   -7.416  1.00 0.00 ? 4   ILE B HD11 2  
ATOM 3472  H HD12 . ILE B 2 4   ? -7.743  5.048   -8.707  1.00 0.00 ? 4   ILE B HD12 2  
ATOM 3473  H HD13 . ILE B 2 4   ? -8.716  4.884   -7.247  1.00 0.00 ? 4   ILE B HD13 2  
ATOM 3474  N N    . TRP B 2 5   ? -3.889  4.550   -9.752  1.00 0.00 ? 5   TRP B N    2  
ATOM 3475  C CA   . TRP B 2 5   ? -3.355  5.702   -10.468 1.00 0.00 ? 5   TRP B CA   2  
ATOM 3476  C C    . TRP B 2 5   ? -4.406  6.299   -11.399 1.00 0.00 ? 5   TRP B C    2  
ATOM 3477  O O    . TRP B 2 5   ? -4.536  5.885   -12.551 1.00 0.00 ? 5   TRP B O    2  
ATOM 3478  C CB   . TRP B 2 5   ? -2.118  5.298   -11.274 1.00 0.00 ? 5   TRP B CB   2  
ATOM 3479  C CG   . TRP B 2 5   ? -0.951  4.907   -10.420 1.00 0.00 ? 5   TRP B CG   2  
ATOM 3480  C CD1  . TRP B 2 5   ? -0.953  4.019   -9.383  1.00 0.00 ? 5   TRP B CD1  2  
ATOM 3481  C CD2  . TRP B 2 5   ? 0.393   5.390   -10.531 1.00 0.00 ? 5   TRP B CD2  2  
ATOM 3482  N NE1  . TRP B 2 5   ? 0.306   3.922   -8.841  1.00 0.00 ? 5   TRP B NE1  2  
ATOM 3483  C CE2  . TRP B 2 5   ? 1.150   4.755   -9.529  1.00 0.00 ? 5   TRP B CE2  2  
ATOM 3484  C CE3  . TRP B 2 5   ? 1.028   6.299   -11.382 1.00 0.00 ? 5   TRP B CE3  2  
ATOM 3485  C CZ2  . TRP B 2 5   ? 2.509   4.999   -9.355  1.00 0.00 ? 5   TRP B CZ2  2  
ATOM 3486  C CZ3  . TRP B 2 5   ? 2.378   6.541   -11.208 1.00 0.00 ? 5   TRP B CZ3  2  
ATOM 3487  C CH2  . TRP B 2 5   ? 3.106   5.893   -10.202 1.00 0.00 ? 5   TRP B CH2  2  
ATOM 3488  H H    . TRP B 2 5   ? -4.192  3.770   -10.262 1.00 0.00 ? 5   TRP B H    2  
ATOM 3489  H HA   . TRP B 2 5   ? -3.072  6.446   -9.739  1.00 0.00 ? 5   TRP B HA   2  
ATOM 3490  H HB2  . TRP B 2 5   ? -2.367  4.457   -11.904 1.00 0.00 ? 5   TRP B HB2  2  
ATOM 3491  H HB3  . TRP B 2 5   ? -1.816  6.128   -11.895 1.00 0.00 ? 5   TRP B HB3  2  
ATOM 3492  H HD1  . TRP B 2 5   ? -1.826  3.480   -9.046  1.00 0.00 ? 5   TRP B HD1  2  
ATOM 3493  H HE1  . TRP B 2 5   ? 0.558   3.351   -8.086  1.00 0.00 ? 5   TRP B HE1  2  
ATOM 3494  H HE3  . TRP B 2 5   ? 0.484   6.807   -12.163 1.00 0.00 ? 5   TRP B HE3  2  
ATOM 3495  H HZ2  . TRP B 2 5   ? 3.085   4.507   -8.585  1.00 0.00 ? 5   TRP B HZ2  2  
ATOM 3496  H HZ3  . TRP B 2 5   ? 2.886   7.241   -11.855 1.00 0.00 ? 5   TRP B HZ3  2  
ATOM 3497  H HH2  . TRP B 2 5   ? 4.159   6.114   -10.103 1.00 0.00 ? 5   TRP B HH2  2  
ATOM 3498  N N    . TRP B 2 6   ? -5.155  7.273   -10.892 1.00 0.00 ? 6   TRP B N    2  
ATOM 3499  C CA   . TRP B 2 6   ? -6.195  7.924   -11.681 1.00 0.00 ? 6   TRP B CA   2  
ATOM 3500  C C    . TRP B 2 6   ? -5.583  8.844   -12.733 1.00 0.00 ? 6   TRP B C    2  
ATOM 3501  O O    . TRP B 2 6   ? -5.526  10.060  -12.551 1.00 0.00 ? 6   TRP B O    2  
ATOM 3502  C CB   . TRP B 2 6   ? -7.131  8.722   -10.772 1.00 0.00 ? 6   TRP B CB   2  
ATOM 3503  C CG   . TRP B 2 6   ? -8.455  9.028   -11.405 1.00 0.00 ? 6   TRP B CG   2  
ATOM 3504  C CD1  . TRP B 2 6   ? -9.041  8.363   -12.445 1.00 0.00 ? 6   TRP B CD1  2  
ATOM 3505  C CD2  . TRP B 2 6   ? -9.358  10.079  -11.041 1.00 0.00 ? 6   TRP B CD2  2  
ATOM 3506  N NE1  . TRP B 2 6   ? -10.252 8.935   -12.748 1.00 0.00 ? 6   TRP B NE1  2  
ATOM 3507  C CE2  . TRP B 2 6   ? -10.470 9.990   -11.901 1.00 0.00 ? 6   TRP B CE2  2  
ATOM 3508  C CE3  . TRP B 2 6   ? -9.336  11.085  -10.072 1.00 0.00 ? 6   TRP B CE3  2  
ATOM 3509  C CZ2  . TRP B 2 6   ? -11.547 10.869  -11.818 1.00 0.00 ? 6   TRP B CZ2  2  
ATOM 3510  C CZ3  . TRP B 2 6   ? -10.405 11.958  -9.991  1.00 0.00 ? 6   TRP B CZ3  2  
ATOM 3511  C CH2  . TRP B 2 6   ? -11.498 11.845  -10.860 1.00 0.00 ? 6   TRP B CH2  2  
ATOM 3512  H H    . TRP B 2 6   ? -5.006  7.560   -9.967  1.00 0.00 ? 6   TRP B H    2  
ATOM 3513  H HA   . TRP B 2 6   ? -6.763  7.155   -12.181 1.00 0.00 ? 6   TRP B HA   2  
ATOM 3514  H HB2  . TRP B 2 6   ? -7.316  8.157   -9.871  1.00 0.00 ? 6   TRP B HB2  2  
ATOM 3515  H HB3  . TRP B 2 6   ? -6.660  9.659   -10.513 1.00 0.00 ? 6   TRP B HB3  2  
ATOM 3516  H HD1  . TRP B 2 6   ? -8.603  7.513   -12.946 1.00 0.00 ? 6   TRP B HD1  2  
ATOM 3517  H HE1  . TRP B 2 6   ? -10.862 8.637   -13.456 1.00 0.00 ? 6   TRP B HE1  2  
ATOM 3518  H HE3  . TRP B 2 6   ? -8.502  11.188  -9.393  1.00 0.00 ? 6   TRP B HE3  2  
ATOM 3519  H HZ2  . TRP B 2 6   ? -12.397 10.794  -12.480 1.00 0.00 ? 6   TRP B HZ2  2  
ATOM 3520  H HZ3  . TRP B 2 6   ? -10.405 12.742  -9.249  1.00 0.00 ? 6   TRP B HZ3  2  
ATOM 3521  H HH2  . TRP B 2 6   ? -12.311 12.548  -10.762 1.00 0.00 ? 6   TRP B HH2  2  
ATOM 3522  N N    . VAL B 2 7   ? -5.128  8.256   -13.834 1.00 0.00 ? 7   VAL B N    2  
ATOM 3523  C CA   . VAL B 2 7   ? -4.521  9.021   -14.915 1.00 0.00 ? 7   VAL B CA   2  
ATOM 3524  C C    . VAL B 2 7   ? -5.360  8.940   -16.186 1.00 0.00 ? 7   VAL B C    2  
ATOM 3525  O O    . VAL B 2 7   ? -5.477  9.969   -16.884 1.00 0.00 ? 7   VAL B O    2  
ATOM 3526  C CB   . VAL B 2 7   ? -3.096  8.526   -15.224 1.00 0.00 ? 7   VAL B CB   2  
ATOM 3527  C CG1  . VAL B 2 7   ? -2.405  9.460   -16.206 1.00 0.00 ? 7   VAL B CG1  2  
ATOM 3528  C CG2  . VAL B 2 7   ? -2.287  8.394   -13.942 1.00 0.00 ? 7   VAL B CG2  2  
ATOM 3529  O OXT  . VAL B 2 7   ? -5.893  7.848   -16.472 1.00 0.00 ? 7   VAL B OXT  2  
ATOM 3530  H H    . VAL B 2 7   ? -5.202  7.282   -13.921 1.00 0.00 ? 7   VAL B H    2  
ATOM 3531  H HA   . VAL B 2 7   ? -4.460  10.054  -14.600 1.00 0.00 ? 7   VAL B HA   2  
ATOM 3532  H HB   . VAL B 2 7   ? -3.167  7.550   -15.680 1.00 0.00 ? 7   VAL B HB   2  
ATOM 3533  H HG11 . VAL B 2 7   ? -3.149  10.001  -16.771 1.00 0.00 ? 7   VAL B HG11 2  
ATOM 3534  H HG12 . VAL B 2 7   ? -1.786  10.160  -15.663 1.00 0.00 ? 7   VAL B HG12 2  
ATOM 3535  H HG13 . VAL B 2 7   ? -1.790  8.882   -16.880 1.00 0.00 ? 7   VAL B HG13 2  
ATOM 3536  H HG21 . VAL B 2 7   ? -1.234  8.397   -14.180 1.00 0.00 ? 7   VAL B HG21 2  
ATOM 3537  H HG22 . VAL B 2 7   ? -2.511  9.225   -13.289 1.00 0.00 ? 7   VAL B HG22 2  
ATOM 3538  H HG23 . VAL B 2 7   ? -2.543  7.469   -13.448 1.00 0.00 ? 7   VAL B HG23 2  
ATOM 3539  N N    . GLY A 1 1   ? 1.624   31.069  -25.097 1.00 0.00 ? 376 GLY A N    3  
ATOM 3540  C CA   . GLY A 1 1   ? 2.364   29.884  -24.581 1.00 0.00 ? 376 GLY A CA   3  
ATOM 3541  C C    . GLY A 1 1   ? 1.584   29.130  -23.522 1.00 0.00 ? 376 GLY A C    3  
ATOM 3542  O O    . GLY A 1 1   ? 2.015   29.035  -22.373 1.00 0.00 ? 376 GLY A O    3  
ATOM 3543  H H1   . GLY A 1 1   ? 2.086   31.432  -25.956 1.00 0.00 ? 376 GLY A H1   3  
ATOM 3544  H H2   . GLY A 1 1   ? 1.610   31.822  -24.381 1.00 0.00 ? 376 GLY A H2   3  
ATOM 3545  H H3   . GLY A 1 1   ? 0.645   30.806  -25.327 1.00 0.00 ? 376 GLY A H3   3  
ATOM 3546  H HA2  . GLY A 1 1   ? 2.572   29.216  -25.404 1.00 0.00 ? 376 GLY A HA2  3  
ATOM 3547  H HA3  . GLY A 1 1   ? 3.299   30.215  -24.155 1.00 0.00 ? 376 GLY A HA3  3  
ATOM 3548  N N    . SER A 1 2   ? 0.433   28.590  -23.911 1.00 0.00 ? 377 SER A N    3  
ATOM 3549  C CA   . SER A 1 2   ? -0.409  27.839  -22.986 1.00 0.00 ? 377 SER A CA   3  
ATOM 3550  C C    . SER A 1 2   ? 0.147   26.437  -22.760 1.00 0.00 ? 377 SER A C    3  
ATOM 3551  O O    . SER A 1 2   ? 0.316   25.666  -23.703 1.00 0.00 ? 377 SER A O    3  
ATOM 3552  C CB   . SER A 1 2   ? -1.840  27.752  -23.523 1.00 0.00 ? 377 SER A CB   3  
ATOM 3553  O OG   . SER A 1 2   ? -2.655  28.769  -22.968 1.00 0.00 ? 377 SER A OG   3  
ATOM 3554  H H    . SER A 1 2   ? 0.142   28.699  -24.840 1.00 0.00 ? 377 SER A H    3  
ATOM 3555  H HA   . SER A 1 2   ? -0.419  28.367  -22.045 1.00 0.00 ? 377 SER A HA   3  
ATOM 3556  H HB2  . SER A 1 2   ? -1.827  27.865  -24.596 1.00 0.00 ? 377 SER A HB2  3  
ATOM 3557  H HB3  . SER A 1 2   ? -2.260  26.790  -23.267 1.00 0.00 ? 377 SER A HB3  3  
ATOM 3558  H HG   . SER A 1 2   ? -2.455  29.608  -23.391 1.00 0.00 ? 377 SER A HG   3  
ATOM 3559  N N    . HIS A 1 3   ? 0.430   26.115  -21.501 1.00 0.00 ? 378 HIS A N    3  
ATOM 3560  C CA   . HIS A 1 3   ? 0.966   24.806  -21.150 1.00 0.00 ? 378 HIS A CA   3  
ATOM 3561  C C    . HIS A 1 3   ? -0.081  23.967  -20.425 1.00 0.00 ? 378 HIS A C    3  
ATOM 3562  O O    . HIS A 1 3   ? -0.587  24.360  -19.374 1.00 0.00 ? 378 HIS A O    3  
ATOM 3563  C CB   . HIS A 1 3   ? 2.209   24.959  -20.272 1.00 0.00 ? 378 HIS A CB   3  
ATOM 3564  C CG   . HIS A 1 3   ? 3.076   23.738  -20.244 1.00 0.00 ? 378 HIS A CG   3  
ATOM 3565  N ND1  . HIS A 1 3   ? 2.631   22.509  -19.803 1.00 0.00 ? 378 HIS A ND1  3  
ATOM 3566  C CD2  . HIS A 1 3   ? 4.367   23.560  -20.607 1.00 0.00 ? 378 HIS A CD2  3  
ATOM 3567  C CE1  . HIS A 1 3   ? 3.612   21.630  -19.896 1.00 0.00 ? 378 HIS A CE1  3  
ATOM 3568  N NE2  . HIS A 1 3   ? 4.676   22.241  -20.382 1.00 0.00 ? 378 HIS A NE2  3  
ATOM 3569  H H    . HIS A 1 3   ? 0.273   26.773  -20.793 1.00 0.00 ? 378 HIS A H    3  
ATOM 3570  H HA   . HIS A 1 3   ? 1.242   24.305  -22.065 1.00 0.00 ? 378 HIS A HA   3  
ATOM 3571  H HB2  . HIS A 1 3   ? 2.805   25.780  -20.643 1.00 0.00 ? 378 HIS A HB2  3  
ATOM 3572  H HB3  . HIS A 1 3   ? 1.902   25.173  -19.259 1.00 0.00 ? 378 HIS A HB3  3  
ATOM 3573  H HD1  . HIS A 1 3   ? 1.730   22.313  -19.471 1.00 0.00 ? 378 HIS A HD1  3  
ATOM 3574  H HD2  . HIS A 1 3   ? 5.033   24.315  -21.002 1.00 0.00 ? 378 HIS A HD2  3  
ATOM 3575  H HE1  . HIS A 1 3   ? 3.552   20.586  -19.623 1.00 0.00 ? 378 HIS A HE1  3  
ATOM 3576  H HE2  . HIS A 1 3   ? 5.513   21.801  -20.636 1.00 0.00 ? 378 HIS A HE2  3  
ATOM 3577  N N    . MET A 1 4   ? -0.401  22.810  -20.994 1.00 0.00 ? 379 MET A N    3  
ATOM 3578  C CA   . MET A 1 4   ? -1.387  21.915  -20.402 1.00 0.00 ? 379 MET A CA   3  
ATOM 3579  C C    . MET A 1 4   ? -0.832  20.498  -20.278 1.00 0.00 ? 379 MET A C    3  
ATOM 3580  O O    . MET A 1 4   ? 0.301   20.228  -20.677 1.00 0.00 ? 379 MET A O    3  
ATOM 3581  C CB   . MET A 1 4   ? -2.667  21.904  -21.242 1.00 0.00 ? 379 MET A CB   3  
ATOM 3582  C CG   . MET A 1 4   ? -3.932  22.114  -20.425 1.00 0.00 ? 379 MET A CG   3  
ATOM 3583  S SD   . MET A 1 4   ? -5.419  22.154  -21.445 1.00 0.00 ? 379 MET A SD   3  
ATOM 3584  C CE   . MET A 1 4   ? -5.154  23.663  -22.371 1.00 0.00 ? 379 MET A CE   3  
ATOM 3585  H H    . MET A 1 4   ? 0.037   22.550  -21.832 1.00 0.00 ? 379 MET A H    3  
ATOM 3586  H HA   . MET A 1 4   ? -1.619  22.284  -19.414 1.00 0.00 ? 379 MET A HA   3  
ATOM 3587  H HB2  . MET A 1 4   ? -2.606  22.692  -21.978 1.00 0.00 ? 379 MET A HB2  3  
ATOM 3588  H HB3  . MET A 1 4   ? -2.746  20.954  -21.750 1.00 0.00 ? 379 MET A HB3  3  
ATOM 3589  H HG2  . MET A 1 4   ? -4.022  21.307  -19.713 1.00 0.00 ? 379 MET A HG2  3  
ATOM 3590  H HG3  . MET A 1 4   ? -3.850  23.051  -19.896 1.00 0.00 ? 379 MET A HG3  3  
ATOM 3591  H HE1  . MET A 1 4   ? -5.774  24.448  -21.965 1.00 0.00 ? 379 MET A HE1  3  
ATOM 3592  H HE2  . MET A 1 4   ? -4.115  23.951  -22.301 1.00 0.00 ? 379 MET A HE2  3  
ATOM 3593  H HE3  . MET A 1 4   ? -5.413  23.500  -23.406 1.00 0.00 ? 379 MET A HE3  3  
ATOM 3594  N N    . LYS A 1 5   ? -1.637  19.600  -19.721 1.00 0.00 ? 380 LYS A N    3  
ATOM 3595  C CA   . LYS A 1 5   ? -1.226  18.212  -19.544 1.00 0.00 ? 380 LYS A CA   3  
ATOM 3596  C C    . LYS A 1 5   ? -2.253  17.259  -20.148 1.00 0.00 ? 380 LYS A C    3  
ATOM 3597  O O    . LYS A 1 5   ? -3.367  17.662  -20.482 1.00 0.00 ? 380 LYS A O    3  
ATOM 3598  C CB   . LYS A 1 5   ? -1.034  17.900  -18.060 1.00 0.00 ? 380 LYS A CB   3  
ATOM 3599  C CG   . LYS A 1 5   ? -0.062  16.761  -17.798 1.00 0.00 ? 380 LYS A CG   3  
ATOM 3600  C CD   . LYS A 1 5   ? 0.751   17.001  -16.536 1.00 0.00 ? 380 LYS A CD   3  
ATOM 3601  C CE   . LYS A 1 5   ? 0.195   16.219  -15.357 1.00 0.00 ? 380 LYS A CE   3  
ATOM 3602  N NZ   . LYS A 1 5   ? -1.207  16.610  -15.042 1.00 0.00 ? 380 LYS A NZ   3  
ATOM 3603  H H    . LYS A 1 5   ? -2.529  19.876  -19.423 1.00 0.00 ? 380 LYS A H    3  
ATOM 3604  H HA   . LYS A 1 5   ? -0.285  18.077  -20.056 1.00 0.00 ? 380 LYS A HA   3  
ATOM 3605  H HB2  . LYS A 1 5   ? -0.662  18.784  -17.563 1.00 0.00 ? 380 LYS A HB2  3  
ATOM 3606  H HB3  . LYS A 1 5   ? -1.990  17.634  -17.632 1.00 0.00 ? 380 LYS A HB3  3  
ATOM 3607  H HG2  . LYS A 1 5   ? -0.618  15.843  -17.686 1.00 0.00 ? 380 LYS A HG2  3  
ATOM 3608  H HG3  . LYS A 1 5   ? 0.611   16.676  -18.639 1.00 0.00 ? 380 LYS A HG3  3  
ATOM 3609  H HD2  . LYS A 1 5   ? 1.771   16.690  -16.712 1.00 0.00 ? 380 LYS A HD2  3  
ATOM 3610  H HD3  . LYS A 1 5   ? 0.729   18.054  -16.300 1.00 0.00 ? 380 LYS A HD3  3  
ATOM 3611  H HE2  . LYS A 1 5   ? 0.220   15.165  -15.596 1.00 0.00 ? 380 LYS A HE2  3  
ATOM 3612  H HE3  . LYS A 1 5   ? 0.815   16.405  -14.493 1.00 0.00 ? 380 LYS A HE3  3  
ATOM 3613  H HZ1  . LYS A 1 5   ? -1.229  17.570  -14.645 1.00 0.00 ? 380 LYS A HZ1  3  
ATOM 3614  H HZ2  . LYS A 1 5   ? -1.786  16.591  -15.906 1.00 0.00 ? 380 LYS A HZ2  3  
ATOM 3615  H HZ3  . LYS A 1 5   ? -1.615  15.951  -14.348 1.00 0.00 ? 380 LYS A HZ3  3  
ATOM 3616  N N    . LYS A 1 6   ? -1.870  15.993  -20.285 1.00 0.00 ? 381 LYS A N    3  
ATOM 3617  C CA   . LYS A 1 6   ? -2.756  14.982  -20.850 1.00 0.00 ? 381 LYS A CA   3  
ATOM 3618  C C    . LYS A 1 6   ? -3.532  14.263  -19.751 1.00 0.00 ? 381 LYS A C    3  
ATOM 3619  O O    . LYS A 1 6   ? -3.025  14.063  -18.648 1.00 0.00 ? 381 LYS A O    3  
ATOM 3620  C CB   . LYS A 1 6   ? -1.951  13.972  -21.671 1.00 0.00 ? 381 LYS A CB   3  
ATOM 3621  C CG   . LYS A 1 6   ? -2.110  14.145  -23.174 1.00 0.00 ? 381 LYS A CG   3  
ATOM 3622  C CD   . LYS A 1 6   ? -0.790  14.501  -23.843 1.00 0.00 ? 381 LYS A CD   3  
ATOM 3623  C CE   . LYS A 1 6   ? -0.549  13.656  -25.085 1.00 0.00 ? 381 LYS A CE   3  
ATOM 3624  N NZ   . LYS A 1 6   ? -1.593  13.879  -26.124 1.00 0.00 ? 381 LYS A NZ   3  
ATOM 3625  H H    . LYS A 1 6   ? -0.968  15.734  -20.001 1.00 0.00 ? 381 LYS A H    3  
ATOM 3626  H HA   . LYS A 1 6   ? -3.456  15.483  -21.501 1.00 0.00 ? 381 LYS A HA   3  
ATOM 3627  H HB2  . LYS A 1 6   ? -0.904  14.079  -21.426 1.00 0.00 ? 381 LYS A HB2  3  
ATOM 3628  H HB3  . LYS A 1 6   ? -2.271  12.974  -21.410 1.00 0.00 ? 381 LYS A HB3  3  
ATOM 3629  H HG2  . LYS A 1 6   ? -2.477  13.220  -23.595 1.00 0.00 ? 381 LYS A HG2  3  
ATOM 3630  H HG3  . LYS A 1 6   ? -2.823  14.934  -23.361 1.00 0.00 ? 381 LYS A HG3  3  
ATOM 3631  H HD2  . LYS A 1 6   ? -0.812  15.542  -24.127 1.00 0.00 ? 381 LYS A HD2  3  
ATOM 3632  H HD3  . LYS A 1 6   ? 0.015   14.333  -23.143 1.00 0.00 ? 381 LYS A HD3  3  
ATOM 3633  H HE2  . LYS A 1 6   ? 0.416   13.914  -25.497 1.00 0.00 ? 381 LYS A HE2  3  
ATOM 3634  H HE3  . LYS A 1 6   ? -0.551  12.615  -24.802 1.00 0.00 ? 381 LYS A HE3  3  
ATOM 3635  H HZ1  . LYS A 1 6   ? -2.103  12.993  -26.314 1.00 0.00 ? 381 LYS A HZ1  3  
ATOM 3636  H HZ2  . LYS A 1 6   ? -2.275  14.595  -25.801 1.00 0.00 ? 381 LYS A HZ2  3  
ATOM 3637  H HZ3  . LYS A 1 6   ? -1.154  14.208  -27.007 1.00 0.00 ? 381 LYS A HZ3  3  
ATOM 3638  N N    . TYR A 1 7   ? -4.765  13.877  -20.062 1.00 0.00 ? 382 TYR A N    3  
ATOM 3639  C CA   . TYR A 1 7   ? -5.612  13.180  -19.103 1.00 0.00 ? 382 TYR A CA   3  
ATOM 3640  C C    . TYR A 1 7   ? -6.647  12.321  -19.818 1.00 0.00 ? 382 TYR A C    3  
ATOM 3641  O O    . TYR A 1 7   ? -6.957  12.550  -20.988 1.00 0.00 ? 382 TYR A O    3  
ATOM 3642  C CB   . TYR A 1 7   ? -6.311  14.182  -18.183 1.00 0.00 ? 382 TYR A CB   3  
ATOM 3643  C CG   . TYR A 1 7   ? -7.199  13.535  -17.144 1.00 0.00 ? 382 TYR A CG   3  
ATOM 3644  C CD1  . TYR A 1 7   ? -6.653  12.903  -16.032 1.00 0.00 ? 382 TYR A CD1  3  
ATOM 3645  C CD2  . TYR A 1 7   ? -8.581  13.554  -17.275 1.00 0.00 ? 382 TYR A CD2  3  
ATOM 3646  C CE1  . TYR A 1 7   ? -7.462  12.310  -15.081 1.00 0.00 ? 382 TYR A CE1  3  
ATOM 3647  C CE2  . TYR A 1 7   ? -9.396  12.963  -16.329 1.00 0.00 ? 382 TYR A CE2  3  
ATOM 3648  C CZ   . TYR A 1 7   ? -8.832  12.343  -15.234 1.00 0.00 ? 382 TYR A CZ   3  
ATOM 3649  O OH   . TYR A 1 7   ? -9.641  11.752  -14.290 1.00 0.00 ? 382 TYR A OH   3  
ATOM 3650  H H    . TYR A 1 7   ? -5.113  14.066  -20.958 1.00 0.00 ? 382 TYR A H    3  
ATOM 3651  H HA   . TYR A 1 7   ? -4.980  12.539  -18.507 1.00 0.00 ? 382 TYR A HA   3  
ATOM 3652  H HB2  . TYR A 1 7   ? -5.567  14.768  -17.666 1.00 0.00 ? 382 TYR A HB2  3  
ATOM 3653  H HB3  . TYR A 1 7   ? -6.926  14.839  -18.782 1.00 0.00 ? 382 TYR A HB3  3  
ATOM 3654  H HD1  . TYR A 1 7   ? -5.581  12.880  -15.915 1.00 0.00 ? 382 TYR A HD1  3  
ATOM 3655  H HD2  . TYR A 1 7   ? -9.020  14.040  -18.134 1.00 0.00 ? 382 TYR A HD2  3  
ATOM 3656  H HE1  . TYR A 1 7   ? -7.020  11.823  -14.225 1.00 0.00 ? 382 TYR A HE1  3  
ATOM 3657  H HE2  . TYR A 1 7   ? -10.469 12.989  -16.450 1.00 0.00 ? 382 TYR A HE2  3  
ATOM 3658  H HH   . TYR A 1 7   ? -9.324  11.975  -13.412 1.00 0.00 ? 382 TYR A HH   3  
ATOM 3659  N N    . ILE A 1 8   ? -7.182  11.331  -19.110 1.00 0.00 ? 383 ILE A N    3  
ATOM 3660  C CA   . ILE A 1 8   ? -8.183  10.440  -19.682 1.00 0.00 ? 383 ILE A CA   3  
ATOM 3661  C C    . ILE A 1 8   ? -9.340  10.209  -18.714 1.00 0.00 ? 383 ILE A C    3  
ATOM 3662  O O    . ILE A 1 8   ? -10.490 10.514  -19.028 1.00 0.00 ? 383 ILE A O    3  
ATOM 3663  C CB   . ILE A 1 8   ? -7.574  9.077   -20.088 1.00 0.00 ? 383 ILE A CB   3  
ATOM 3664  C CG1  . ILE A 1 8   ? -6.386  8.716   -19.185 1.00 0.00 ? 383 ILE A CG1  3  
ATOM 3665  C CG2  . ILE A 1 8   ? -7.148  9.107   -21.551 1.00 0.00 ? 383 ILE A CG2  3  
ATOM 3666  C CD1  . ILE A 1 8   ? -5.648  7.467   -19.619 1.00 0.00 ? 383 ILE A CD1  3  
ATOM 3667  H H    . ILE A 1 8   ? -6.894  11.197  -18.182 1.00 0.00 ? 383 ILE A H    3  
ATOM 3668  H HA   . ILE A 1 8   ? -8.569  10.913  -20.574 1.00 0.00 ? 383 ILE A HA   3  
ATOM 3669  H HB   . ILE A 1 8   ? -8.340  8.323   -19.981 1.00 0.00 ? 383 ILE A HB   3  
ATOM 3670  H HG12 . ILE A 1 8   ? -5.680  9.533   -19.186 1.00 0.00 ? 383 ILE A HG12 3  
ATOM 3671  H HG13 . ILE A 1 8   ? -6.742  8.557   -18.179 1.00 0.00 ? 383 ILE A HG13 3  
ATOM 3672  H HG21 . ILE A 1 8   ? -7.303  10.098  -21.952 1.00 0.00 ? 383 ILE A HG21 3  
ATOM 3673  H HG22 . ILE A 1 8   ? -6.101  8.849   -21.627 1.00 0.00 ? 383 ILE A HG22 3  
ATOM 3674  H HG23 . ILE A 1 8   ? -7.735  8.395   -22.112 1.00 0.00 ? 383 ILE A HG23 3  
ATOM 3675  H HD11 . ILE A 1 8   ? -6.320  6.622   -19.586 1.00 0.00 ? 383 ILE A HD11 3  
ATOM 3676  H HD12 . ILE A 1 8   ? -5.281  7.597   -20.625 1.00 0.00 ? 383 ILE A HD12 3  
ATOM 3677  H HD13 . ILE A 1 8   ? -4.816  7.291   -18.951 1.00 0.00 ? 383 ILE A HD13 3  
ATOM 3678  N N    . GLY A 1 9   ? -9.032  9.673   -17.536 1.00 0.00 ? 384 GLY A N    3  
ATOM 3679  C CA   . GLY A 1 9   ? -10.063 9.415   -16.547 1.00 0.00 ? 384 GLY A CA   3  
ATOM 3680  C C    . GLY A 1 9   ? -10.228 7.935   -16.258 1.00 0.00 ? 384 GLY A C    3  
ATOM 3681  O O    . GLY A 1 9   ? -11.343 7.414   -16.270 1.00 0.00 ? 384 GLY A O    3  
ATOM 3682  H H    . GLY A 1 9   ? -8.100  9.454   -17.337 1.00 0.00 ? 384 GLY A H    3  
ATOM 3683  H HA2  . GLY A 1 9   ? -9.803  9.923   -15.630 1.00 0.00 ? 384 GLY A HA2  3  
ATOM 3684  H HA3  . GLY A 1 9   ? -11.002 9.806   -16.910 1.00 0.00 ? 384 GLY A HA3  3  
ATOM 3685  N N    . ILE A 1 10  ? -9.115  7.257   -15.999 1.00 0.00 ? 385 ILE A N    3  
ATOM 3686  C CA   . ILE A 1 10  ? -9.139  5.829   -15.708 1.00 0.00 ? 385 ILE A CA   3  
ATOM 3687  C C    . ILE A 1 10  ? -8.178  5.485   -14.573 1.00 0.00 ? 385 ILE A C    3  
ATOM 3688  O O    . ILE A 1 10  ? -7.024  5.914   -14.571 1.00 0.00 ? 385 ILE A O    3  
ATOM 3689  C CB   . ILE A 1 10  ? -8.770  5.000   -16.959 1.00 0.00 ? 385 ILE A CB   3  
ATOM 3690  C CG1  . ILE A 1 10  ? -8.701  3.507   -16.624 1.00 0.00 ? 385 ILE A CG1  3  
ATOM 3691  C CG2  . ILE A 1 10  ? -7.449  5.480   -17.540 1.00 0.00 ? 385 ILE A CG2  3  
ATOM 3692  C CD1  . ILE A 1 10  ? -10.016 2.934   -16.145 1.00 0.00 ? 385 ILE A CD1  3  
ATOM 3693  H H    . ILE A 1 10  ? -8.256  7.729   -16.006 1.00 0.00 ? 385 ILE A H    3  
ATOM 3694  H HA   . ILE A 1 10  ? -10.143 5.565   -15.410 1.00 0.00 ? 385 ILE A HA   3  
ATOM 3695  H HB   . ILE A 1 10  ? -9.537  5.158   -17.703 1.00 0.00 ? 385 ILE A HB   3  
ATOM 3696  H HG12 . ILE A 1 10  ? -8.404  2.960   -17.506 1.00 0.00 ? 385 ILE A HG12 3  
ATOM 3697  H HG13 . ILE A 1 10  ? -7.968  3.352   -15.846 1.00 0.00 ? 385 ILE A HG13 3  
ATOM 3698  H HG21 . ILE A 1 10  ? -6.704  5.515   -16.759 1.00 0.00 ? 385 ILE A HG21 3  
ATOM 3699  H HG22 . ILE A 1 10  ? -7.128  4.799   -18.314 1.00 0.00 ? 385 ILE A HG22 3  
ATOM 3700  H HG23 . ILE A 1 10  ? -7.577  6.466   -17.959 1.00 0.00 ? 385 ILE A HG23 3  
ATOM 3701  H HD11 . ILE A 1 10  ? -9.859  2.394   -15.224 1.00 0.00 ? 385 ILE A HD11 3  
ATOM 3702  H HD12 . ILE A 1 10  ? -10.716 3.737   -15.977 1.00 0.00 ? 385 ILE A HD12 3  
ATOM 3703  H HD13 . ILE A 1 10  ? -10.409 2.262   -16.894 1.00 0.00 ? 385 ILE A HD13 3  
ATOM 3704  N N    . ARG A 1 11  ? -8.661  4.705   -13.610 1.00 0.00 ? 386 ARG A N    3  
ATOM 3705  C CA   . ARG A 1 11  ? -7.844  4.301   -12.473 1.00 0.00 ? 386 ARG A CA   3  
ATOM 3706  C C    . ARG A 1 11  ? -7.109  2.999   -12.777 1.00 0.00 ? 386 ARG A C    3  
ATOM 3707  O O    . ARG A 1 11  ? -7.715  2.024   -13.222 1.00 0.00 ? 386 ARG A O    3  
ATOM 3708  C CB   . ARG A 1 11  ? -8.713  4.129   -11.225 1.00 0.00 ? 386 ARG A CB   3  
ATOM 3709  C CG   . ARG A 1 11  ? -9.460  5.389   -10.820 1.00 0.00 ? 386 ARG A CG   3  
ATOM 3710  C CD   . ARG A 1 11  ? -10.639 5.070   -9.914  1.00 0.00 ? 386 ARG A CD   3  
ATOM 3711  N NE   . ARG A 1 11  ? -10.711 5.974   -8.767  1.00 0.00 ? 386 ARG A NE   3  
ATOM 3712  C CZ   . ARG A 1 11  ? -11.335 7.150   -8.784  1.00 0.00 ? 386 ARG A CZ   3  
ATOM 3713  N NH1  . ARG A 1 11  ? -11.929 7.583   -9.890  1.00 0.00 ? 386 ARG A NH1  3  
ATOM 3714  N NH2  . ARG A 1 11  ? -11.360 7.902   -7.690  1.00 0.00 ? 386 ARG A NH2  3  
ATOM 3715  H H    . ARG A 1 11  ? -9.588  4.392   -13.668 1.00 0.00 ? 386 ARG A H    3  
ATOM 3716  H HA   . ARG A 1 11  ? -7.117  5.078   -12.292 1.00 0.00 ? 386 ARG A HA   3  
ATOM 3717  H HB2  . ARG A 1 11  ? -9.438  3.351   -11.411 1.00 0.00 ? 386 ARG A HB2  3  
ATOM 3718  H HB3  . ARG A 1 11  ? -8.082  3.830   -10.400 1.00 0.00 ? 386 ARG A HB3  3  
ATOM 3719  H HG2  . ARG A 1 11  ? -8.783  6.045   -10.294 1.00 0.00 ? 386 ARG A HG2  3  
ATOM 3720  H HG3  . ARG A 1 11  ? -9.823  5.882   -11.709 1.00 0.00 ? 386 ARG A HG3  3  
ATOM 3721  H HD2  . ARG A 1 11  ? -11.551 5.157   -10.486 1.00 0.00 ? 386 ARG A HD2  3  
ATOM 3722  H HD3  . ARG A 1 11  ? -10.537 4.057   -9.554  1.00 0.00 ? 386 ARG A HD3  3  
ATOM 3723  H HE   . ARG A 1 11  ? -10.276 5.686   -7.937  1.00 0.00 ? 386 ARG A HE   3  
ATOM 3724  H HH11 . ARG A 1 11  ? -11.910 7.026   -10.720 1.00 0.00 ? 386 ARG A HH11 3  
ATOM 3725  H HH12 . ARG A 1 11  ? -12.397 8.466   -9.892  1.00 0.00 ? 386 ARG A HH12 3  
ATOM 3726  H HH21 . ARG A 1 11  ? -10.913 7.583   -6.855  1.00 0.00 ? 386 ARG A HH21 3  
ATOM 3727  H HH22 . ARG A 1 11  ? -11.828 8.785   -7.702  1.00 0.00 ? 386 ARG A HH22 3  
ATOM 3728  N N    . MET A 1 12  ? -5.802  2.990   -12.539 1.00 0.00 ? 387 MET A N    3  
ATOM 3729  C CA   . MET A 1 12  ? -4.991  1.804   -12.792 1.00 0.00 ? 387 MET A CA   3  
ATOM 3730  C C    . MET A 1 12  ? -3.984  1.578   -11.670 1.00 0.00 ? 387 MET A C    3  
ATOM 3731  O O    . MET A 1 12  ? -3.630  2.505   -10.943 1.00 0.00 ? 387 MET A O    3  
ATOM 3732  C CB   . MET A 1 12  ? -4.260  1.935   -14.132 1.00 0.00 ? 387 MET A CB   3  
ATOM 3733  C CG   . MET A 1 12  ? -3.646  3.307   -14.364 1.00 0.00 ? 387 MET A CG   3  
ATOM 3734  S SD   . MET A 1 12  ? -1.842  3.278   -14.333 1.00 0.00 ? 387 MET A SD   3  
ATOM 3735  C CE   . MET A 1 12  ? -1.482  4.992   -13.965 1.00 0.00 ? 387 MET A CE   3  
ATOM 3736  H H    . MET A 1 12  ? -5.374  3.797   -12.184 1.00 0.00 ? 387 MET A H    3  
ATOM 3737  H HA   . MET A 1 12  ? -5.655  0.955   -12.838 1.00 0.00 ? 387 MET A HA   3  
ATOM 3738  H HB2  . MET A 1 12  ? -3.471  1.199   -14.171 1.00 0.00 ? 387 MET A HB2  3  
ATOM 3739  H HB3  . MET A 1 12  ? -4.961  1.739   -14.931 1.00 0.00 ? 387 MET A HB3  3  
ATOM 3740  H HG2  . MET A 1 12  ? -3.967  3.671   -15.328 1.00 0.00 ? 387 MET A HG2  3  
ATOM 3741  H HG3  . MET A 1 12  ? -3.993  3.979   -13.593 1.00 0.00 ? 387 MET A HG3  3  
ATOM 3742  H HE1  . MET A 1 12  ? -1.161  5.495   -14.865 1.00 0.00 ? 387 MET A HE1  3  
ATOM 3743  H HE2  . MET A 1 12  ? -2.370  5.473   -13.581 1.00 0.00 ? 387 MET A HE2  3  
ATOM 3744  H HE3  . MET A 1 12  ? -0.697  5.044   -13.224 1.00 0.00 ? 387 MET A HE3  3  
ATOM 3745  N N    . MET A 1 13  ? -3.527  0.338   -11.537 1.00 0.00 ? 388 MET A N    3  
ATOM 3746  C CA   . MET A 1 13  ? -2.558  -0.017  -10.506 1.00 0.00 ? 388 MET A CA   3  
ATOM 3747  C C    . MET A 1 13  ? -1.444  -0.880  -11.087 1.00 0.00 ? 388 MET A C    3  
ATOM 3748  O O    . MET A 1 13  ? -1.441  -1.179  -12.280 1.00 0.00 ? 388 MET A O    3  
ATOM 3749  C CB   . MET A 1 13  ? -3.247  -0.757  -9.360  1.00 0.00 ? 388 MET A CB   3  
ATOM 3750  C CG   . MET A 1 13  ? -4.116  -1.918  -9.820  1.00 0.00 ? 388 MET A CG   3  
ATOM 3751  S SD   . MET A 1 13  ? -5.669  -2.029  -8.910  1.00 0.00 ? 388 MET A SD   3  
ATOM 3752  C CE   . MET A 1 13  ? -5.089  -1.857  -7.224  1.00 0.00 ? 388 MET A CE   3  
ATOM 3753  H H    . MET A 1 13  ? -3.848  -0.357  -12.149 1.00 0.00 ? 388 MET A H    3  
ATOM 3754  H HA   . MET A 1 13  ? -2.128  0.898   -10.126 1.00 0.00 ? 388 MET A HA   3  
ATOM 3755  H HB2  . MET A 1 13  ? -2.493  -1.144  -8.691  1.00 0.00 ? 388 MET A HB2  3  
ATOM 3756  H HB3  . MET A 1 13  ? -3.872  -0.061  -8.821  1.00 0.00 ? 388 MET A HB3  3  
ATOM 3757  H HG2  . MET A 1 13  ? -4.339  -1.788  -10.868 1.00 0.00 ? 388 MET A HG2  3  
ATOM 3758  H HG3  . MET A 1 13  ? -3.567  -2.837  -9.681  1.00 0.00 ? 388 MET A HG3  3  
ATOM 3759  H HE1  . MET A 1 13  ? -4.612  -2.773  -6.912  1.00 0.00 ? 388 MET A HE1  3  
ATOM 3760  H HE2  . MET A 1 13  ? -4.381  -1.043  -7.168  1.00 0.00 ? 388 MET A HE2  3  
ATOM 3761  H HE3  . MET A 1 13  ? -5.927  -1.649  -6.575  1.00 0.00 ? 388 MET A HE3  3  
ATOM 3762  N N    . SER A 1 14  ? -0.501  -1.276  -10.240 1.00 0.00 ? 389 SER A N    3  
ATOM 3763  C CA   . SER A 1 14  ? 0.618   -2.105  -10.678 1.00 0.00 ? 389 SER A CA   3  
ATOM 3764  C C    . SER A 1 14  ? 0.336   -3.587  -10.447 1.00 0.00 ? 389 SER A C    3  
ATOM 3765  O O    . SER A 1 14  ? 1.251   -4.412  -10.480 1.00 0.00 ? 389 SER A O    3  
ATOM 3766  C CB   . SER A 1 14  ? 1.897   -1.697  -9.944  1.00 0.00 ? 389 SER A CB   3  
ATOM 3767  O OG   . SER A 1 14  ? 1.640   -1.446  -8.572  1.00 0.00 ? 389 SER A OG   3  
ATOM 3768  H H    . SER A 1 14  ? -0.557  -1.005  -9.300  1.00 0.00 ? 389 SER A H    3  
ATOM 3769  H HA   . SER A 1 14  ? 0.755   -1.939  -11.736 1.00 0.00 ? 389 SER A HA   3  
ATOM 3770  H HB2  . SER A 1 14  ? 2.623   -2.492  -10.021 1.00 0.00 ? 389 SER A HB2  3  
ATOM 3771  H HB3  . SER A 1 14  ? 2.296   -0.799  -10.392 1.00 0.00 ? 389 SER A HB3  3  
ATOM 3772  H HG   . SER A 1 14  ? 1.544   -0.501  -8.431  1.00 0.00 ? 389 SER A HG   3  
ATOM 3773  N N    . LEU A 1 15  ? -0.931  -3.923  -10.216 1.00 0.00 ? 390 LEU A N    3  
ATOM 3774  C CA   . LEU A 1 15  ? -1.333  -5.308  -9.983  1.00 0.00 ? 390 LEU A CA   3  
ATOM 3775  C C    . LEU A 1 15  ? -0.418  -5.993  -8.971  1.00 0.00 ? 390 LEU A C    3  
ATOM 3776  O O    . LEU A 1 15  ? 0.647   -6.500  -9.324  1.00 0.00 ? 390 LEU A O    3  
ATOM 3777  C CB   . LEU A 1 15  ? -1.330  -6.089  -11.298 1.00 0.00 ? 390 LEU A CB   3  
ATOM 3778  C CG   . LEU A 1 15  ? -2.196  -7.351  -11.305 1.00 0.00 ? 390 LEU A CG   3  
ATOM 3779  C CD1  . LEU A 1 15  ? -3.614  -7.032  -10.850 1.00 0.00 ? 390 LEU A CD1  3  
ATOM 3780  C CD2  . LEU A 1 15  ? -2.206  -7.981  -12.690 1.00 0.00 ? 390 LEU A CD2  3  
ATOM 3781  H H    . LEU A 1 15  ? -1.615  -3.223  -10.205 1.00 0.00 ? 390 LEU A H    3  
ATOM 3782  H HA   . LEU A 1 15  ? -2.337  -5.296  -9.588  1.00 0.00 ? 390 LEU A HA   3  
ATOM 3783  H HB2  . LEU A 1 15  ? -1.681  -5.433  -12.083 1.00 0.00 ? 390 LEU A HB2  3  
ATOM 3784  H HB3  . LEU A 1 15  ? -0.314  -6.377  -11.520 1.00 0.00 ? 390 LEU A HB3  3  
ATOM 3785  H HG   . LEU A 1 15  ? -1.778  -8.069  -10.613 1.00 0.00 ? 390 LEU A HG   3  
ATOM 3786  H HD11 . LEU A 1 15  ? -3.742  -5.962  -10.790 1.00 0.00 ? 390 LEU A HD11 3  
ATOM 3787  H HD12 . LEU A 1 15  ? -4.320  -7.438  -11.558 1.00 0.00 ? 390 LEU A HD12 3  
ATOM 3788  H HD13 . LEU A 1 15  ? -3.786  -7.470  -9.878  1.00 0.00 ? 390 LEU A HD13 3  
ATOM 3789  H HD21 . LEU A 1 15  ? -3.125  -8.529  -12.830 1.00 0.00 ? 390 LEU A HD21 3  
ATOM 3790  H HD22 . LEU A 1 15  ? -2.130  -7.206  -13.439 1.00 0.00 ? 390 LEU A HD22 3  
ATOM 3791  H HD23 . LEU A 1 15  ? -1.367  -8.656  -12.785 1.00 0.00 ? 390 LEU A HD23 3  
ATOM 3792  N N    . THR A 1 16  ? -0.843  -6.006  -7.712  1.00 0.00 ? 391 THR A N    3  
ATOM 3793  C CA   . THR A 1 16  ? -0.064  -6.631  -6.650  1.00 0.00 ? 391 THR A CA   3  
ATOM 3794  C C    . THR A 1 16  ? -0.092  -8.152  -6.778  1.00 0.00 ? 391 THR A C    3  
ATOM 3795  O O    . THR A 1 16  ? -1.011  -8.717  -7.372  1.00 0.00 ? 391 THR A O    3  
ATOM 3796  C CB   . THR A 1 16  ? -0.603  -6.213  -5.282  1.00 0.00 ? 391 THR A CB   3  
ATOM 3797  O OG1  . THR A 1 16  ? 0.012   -6.963  -4.250  1.00 0.00 ? 391 THR A OG1  3  
ATOM 3798  C CG2  . THR A 1 16  ? -2.100  -6.389  -5.149  1.00 0.00 ? 391 THR A CG2  3  
ATOM 3799  H H    . THR A 1 16  ? -1.701  -5.589  -7.493  1.00 0.00 ? 391 THR A H    3  
ATOM 3800  H HA   . THR A 1 16  ? 0.957   -6.294  -6.744  1.00 0.00 ? 391 THR A HA   3  
ATOM 3801  H HB   . THR A 1 16  ? -0.378  -5.168  -5.121  1.00 0.00 ? 391 THR A HB   3  
ATOM 3802  H HG1  . THR A 1 16  ? 0.965   -6.861  -4.303  1.00 0.00 ? 391 THR A HG1  3  
ATOM 3803  H HG21 . THR A 1 16  ? -2.475  -6.938  -6.000  1.00 0.00 ? 391 THR A HG21 3  
ATOM 3804  H HG22 . THR A 1 16  ? -2.319  -6.935  -4.243  1.00 0.00 ? 391 THR A HG22 3  
ATOM 3805  H HG23 . THR A 1 16  ? -2.574  -5.420  -5.108  1.00 0.00 ? 391 THR A HG23 3  
ATOM 3806  N N    . SER A 1 17  ? 0.920   -8.806  -6.219  1.00 0.00 ? 392 SER A N    3  
ATOM 3807  C CA   . SER A 1 17  ? 1.013   -10.260 -6.273  1.00 0.00 ? 392 SER A CA   3  
ATOM 3808  C C    . SER A 1 17  ? -0.180  -10.911 -5.580  1.00 0.00 ? 392 SER A C    3  
ATOM 3809  O O    . SER A 1 17  ? -0.606  -12.004 -5.952  1.00 0.00 ? 392 SER A O    3  
ATOM 3810  C CB   . SER A 1 17  ? 2.315   -10.733 -5.623  1.00 0.00 ? 392 SER A CB   3  
ATOM 3811  O OG   . SER A 1 17  ? 3.346   -9.776  -5.793  1.00 0.00 ? 392 SER A OG   3  
ATOM 3812  H H    . SER A 1 17  ? 1.622   -8.299  -5.762  1.00 0.00 ? 392 SER A H    3  
ATOM 3813  H HA   . SER A 1 17  ? 1.014   -10.554 -7.311  1.00 0.00 ? 392 SER A HA   3  
ATOM 3814  H HB2  . SER A 1 17  ? 2.152   -10.884 -4.566  1.00 0.00 ? 392 SER A HB2  3  
ATOM 3815  H HB3  . SER A 1 17  ? 2.624   -11.663 -6.076  1.00 0.00 ? 392 SER A HB3  3  
ATOM 3816  H HG   . SER A 1 17  ? 3.335   -9.159  -5.058  1.00 0.00 ? 392 SER A HG   3  
ATOM 3817  N N    . SER A 1 18  ? -0.715  -10.234 -4.568  1.00 0.00 ? 393 SER A N    3  
ATOM 3818  C CA   . SER A 1 18  ? -1.858  -10.749 -3.824  1.00 0.00 ? 393 SER A CA   3  
ATOM 3819  C C    . SER A 1 18  ? -3.104  -10.802 -4.704  1.00 0.00 ? 393 SER A C    3  
ATOM 3820  O O    . SER A 1 18  ? -3.715  -11.857 -4.868  1.00 0.00 ? 393 SER A O    3  
ATOM 3821  C CB   . SER A 1 18  ? -2.125  -9.881  -2.593  1.00 0.00 ? 393 SER A CB   3  
ATOM 3822  O OG   . SER A 1 18  ? -0.923  -9.591  -1.901  1.00 0.00 ? 393 SER A OG   3  
ATOM 3823  H H    . SER A 1 18  ? -0.330  -9.368  -4.317  1.00 0.00 ? 393 SER A H    3  
ATOM 3824  H HA   . SER A 1 18  ? -1.618  -11.750 -3.501  1.00 0.00 ? 393 SER A HA   3  
ATOM 3825  H HB2  . SER A 1 18  ? -2.580  -8.952  -2.903  1.00 0.00 ? 393 SER A HB2  3  
ATOM 3826  H HB3  . SER A 1 18  ? -2.794  -10.404 -1.925  1.00 0.00 ? 393 SER A HB3  3  
ATOM 3827  H HG   . SER A 1 18  ? -0.951  -8.688  -1.576  1.00 0.00 ? 393 SER A HG   3  
ATOM 3828  N N    . LYS A 1 19  ? -3.473  -9.655  -5.266  1.00 0.00 ? 394 LYS A N    3  
ATOM 3829  C CA   . LYS A 1 19  ? -4.647  -9.571  -6.127  1.00 0.00 ? 394 LYS A CA   3  
ATOM 3830  C C    . LYS A 1 19  ? -4.394  -10.263 -7.465  1.00 0.00 ? 394 LYS A C    3  
ATOM 3831  O O    . LYS A 1 19  ? -5.318  -10.783 -8.090  1.00 0.00 ? 394 LYS A O    3  
ATOM 3832  C CB   . LYS A 1 19  ? -5.030  -8.107  -6.358  1.00 0.00 ? 394 LYS A CB   3  
ATOM 3833  C CG   . LYS A 1 19  ? -6.464  -7.785  -5.971  1.00 0.00 ? 394 LYS A CG   3  
ATOM 3834  C CD   . LYS A 1 19  ? -7.457  -8.444  -6.915  1.00 0.00 ? 394 LYS A CD   3  
ATOM 3835  C CE   . LYS A 1 19  ? -8.871  -8.395  -6.359  1.00 0.00 ? 394 LYS A CE   3  
ATOM 3836  N NZ   . LYS A 1 19  ? -8.947  -8.962  -4.984  1.00 0.00 ? 394 LYS A NZ   3  
ATOM 3837  H H    . LYS A 1 19  ? -2.946  -8.848  -5.096  1.00 0.00 ? 394 LYS A H    3  
ATOM 3838  H HA   . LYS A 1 19  ? -5.462  -10.072 -5.627  1.00 0.00 ? 394 LYS A HA   3  
ATOM 3839  H HB2  . LYS A 1 19  ? -4.374  -7.479  -5.772  1.00 0.00 ? 394 LYS A HB2  3  
ATOM 3840  H HB3  . LYS A 1 19  ? -4.900  -7.869  -7.403  1.00 0.00 ? 394 LYS A HB3  3  
ATOM 3841  H HG2  . LYS A 1 19  ? -6.646  -8.142  -4.969  1.00 0.00 ? 394 LYS A HG2  3  
ATOM 3842  H HG3  . LYS A 1 19  ? -6.605  -6.715  -6.006  1.00 0.00 ? 394 LYS A HG3  3  
ATOM 3843  H HD2  . LYS A 1 19  ? -7.435  -7.927  -7.863  1.00 0.00 ? 394 LYS A HD2  3  
ATOM 3844  H HD3  . LYS A 1 19  ? -7.172  -9.476  -7.058  1.00 0.00 ? 394 LYS A HD3  3  
ATOM 3845  H HE2  . LYS A 1 19  ? -9.199  -7.367  -6.333  1.00 0.00 ? 394 LYS A HE2  3  
ATOM 3846  H HE3  . LYS A 1 19  ? -9.520  -8.963  -7.011  1.00 0.00 ? 394 LYS A HE3  3  
ATOM 3847  H HZ1  . LYS A 1 19  ? -9.860  -9.443  -4.846  1.00 0.00 ? 394 LYS A HZ1  3  
ATOM 3848  H HZ2  . LYS A 1 19  ? -8.181  -9.650  -4.838  1.00 0.00 ? 394 LYS A HZ2  3  
ATOM 3849  H HZ3  . LYS A 1 19  ? -8.856  -8.204  -4.279  1.00 0.00 ? 394 LYS A HZ3  3  
ATOM 3850  N N    . ALA A 1 20  ? -3.137  -10.262 -7.898  1.00 0.00 ? 395 ALA A N    3  
ATOM 3851  C CA   . ALA A 1 20  ? -2.763  -10.888 -9.160  1.00 0.00 ? 395 ALA A CA   3  
ATOM 3852  C C    . ALA A 1 20  ? -3.148  -12.363 -9.182  1.00 0.00 ? 395 ALA A C    3  
ATOM 3853  O O    . ALA A 1 20  ? -3.926  -12.799 -10.031 1.00 0.00 ? 395 ALA A O    3  
ATOM 3854  C CB   . ALA A 1 20  ? -1.269  -10.728 -9.404  1.00 0.00 ? 395 ALA A CB   3  
ATOM 3855  H H    . ALA A 1 20  ? -2.445  -9.831  -7.355  1.00 0.00 ? 395 ALA A H    3  
ATOM 3856  H HA   . ALA A 1 20  ? -3.289  -10.377 -9.954  1.00 0.00 ? 395 ALA A HA   3  
ATOM 3857  H HB1  . ALA A 1 20  ? -1.011  -11.166 -10.356 1.00 0.00 ? 395 ALA A HB1  3  
ATOM 3858  H HB2  . ALA A 1 20  ? -1.017  -9.678  -9.411  1.00 0.00 ? 395 ALA A HB2  3  
ATOM 3859  H HB3  . ALA A 1 20  ? -0.722  -11.225 -8.617  1.00 0.00 ? 395 ALA A HB3  3  
ATOM 3860  N N    . LYS A 1 21  ? -2.597  -13.128 -8.244  1.00 0.00 ? 396 LYS A N    3  
ATOM 3861  C CA   . LYS A 1 21  ? -2.884  -14.555 -8.157  1.00 0.00 ? 396 LYS A CA   3  
ATOM 3862  C C    . LYS A 1 21  ? -4.354  -14.798 -7.828  1.00 0.00 ? 396 LYS A C    3  
ATOM 3863  O O    . LYS A 1 21  ? -4.936  -15.799 -8.242  1.00 0.00 ? 396 LYS A O    3  
ATOM 3864  C CB   . LYS A 1 21  ? -1.995  -15.210 -7.097  1.00 0.00 ? 396 LYS A CB   3  
ATOM 3865  C CG   . LYS A 1 21  ? -0.779  -15.917 -7.674  1.00 0.00 ? 396 LYS A CG   3  
ATOM 3866  C CD   . LYS A 1 21  ? 0.043   -16.588 -6.587  1.00 0.00 ? 396 LYS A CD   3  
ATOM 3867  C CE   . LYS A 1 21  ? 1.411   -17.007 -7.101  1.00 0.00 ? 396 LYS A CE   3  
ATOM 3868  N NZ   . LYS A 1 21  ? 1.309   -18.002 -8.204  1.00 0.00 ? 396 LYS A NZ   3  
ATOM 3869  H H    . LYS A 1 21  ? -1.984  -12.723 -7.596  1.00 0.00 ? 396 LYS A H    3  
ATOM 3870  H HA   . LYS A 1 21  ? -2.665  -14.996 -9.118  1.00 0.00 ? 396 LYS A HA   3  
ATOM 3871  H HB2  . LYS A 1 21  ? -1.651  -14.449 -6.413  1.00 0.00 ? 396 LYS A HB2  3  
ATOM 3872  H HB3  . LYS A 1 21  ? -2.579  -15.935 -6.550  1.00 0.00 ? 396 LYS A HB3  3  
ATOM 3873  H HG2  . LYS A 1 21  ? -1.109  -16.667 -8.377  1.00 0.00 ? 396 LYS A HG2  3  
ATOM 3874  H HG3  . LYS A 1 21  ? -0.161  -15.191 -8.184  1.00 0.00 ? 396 LYS A HG3  3  
ATOM 3875  H HD2  . LYS A 1 21  ? 0.174   -15.897 -5.768  1.00 0.00 ? 396 LYS A HD2  3  
ATOM 3876  H HD3  . LYS A 1 21  ? -0.485  -17.464 -6.240  1.00 0.00 ? 396 LYS A HD3  3  
ATOM 3877  H HE2  . LYS A 1 21  ? 1.929   -16.131 -7.465  1.00 0.00 ? 396 LYS A HE2  3  
ATOM 3878  H HE3  . LYS A 1 21  ? 1.971   -17.442 -6.286  1.00 0.00 ? 396 LYS A HE3  3  
ATOM 3879  H HZ1  . LYS A 1 21  ? 2.259   -18.310 -8.497  1.00 0.00 ? 396 LYS A HZ1  3  
ATOM 3880  H HZ2  . LYS A 1 21  ? 0.769   -18.832 -7.889  1.00 0.00 ? 396 LYS A HZ2  3  
ATOM 3881  H HZ3  . LYS A 1 21  ? 0.827   -17.580 -9.024  1.00 0.00 ? 396 LYS A HZ3  3  
ATOM 3882  N N    . GLU A 1 22  ? -4.948  -13.873 -7.080  1.00 0.00 ? 397 GLU A N    3  
ATOM 3883  C CA   . GLU A 1 22  ? -6.349  -13.987 -6.695  1.00 0.00 ? 397 GLU A CA   3  
ATOM 3884  C C    . GLU A 1 22  ? -7.253  -13.986 -7.924  1.00 0.00 ? 397 GLU A C    3  
ATOM 3885  O O    . GLU A 1 22  ? -8.267  -14.683 -7.961  1.00 0.00 ? 397 GLU A O    3  
ATOM 3886  C CB   . GLU A 1 22  ? -6.738  -12.840 -5.761  1.00 0.00 ? 397 GLU A CB   3  
ATOM 3887  C CG   . GLU A 1 22  ? -7.941  -13.149 -4.885  1.00 0.00 ? 397 GLU A CG   3  
ATOM 3888  C CD   . GLU A 1 22  ? -9.252  -12.753 -5.534  1.00 0.00 ? 397 GLU A CD   3  
ATOM 3889  O OE1  . GLU A 1 22  ? -9.603  -11.555 -5.481  1.00 0.00 ? 397 GLU A OE1  3  
ATOM 3890  O OE2  . GLU A 1 22  ? -9.930  -13.640 -6.095  1.00 0.00 ? 397 GLU A OE2  3  
ATOM 3891  H H    . GLU A 1 22  ? -4.431  -13.096 -6.781  1.00 0.00 ? 397 GLU A H    3  
ATOM 3892  H HA   . GLU A 1 22  ? -6.474  -14.923 -6.173  1.00 0.00 ? 397 GLU A HA   3  
ATOM 3893  H HB2  . GLU A 1 22  ? -5.900  -12.614 -5.118  1.00 0.00 ? 397 GLU A HB2  3  
ATOM 3894  H HB3  . GLU A 1 22  ? -6.969  -11.969 -6.356  1.00 0.00 ? 397 GLU A HB3  3  
ATOM 3895  H HG2  . GLU A 1 22  ? -7.962  -14.211 -4.686  1.00 0.00 ? 397 GLU A HG2  3  
ATOM 3896  H HG3  . GLU A 1 22  ? -7.840  -12.612 -3.953  1.00 0.00 ? 397 GLU A HG3  3  
ATOM 3897  N N    . LEU A 1 23  ? -6.878  -13.201 -8.927  1.00 0.00 ? 398 LEU A N    3  
ATOM 3898  C CA   . LEU A 1 23  ? -7.656  -13.109 -10.158 1.00 0.00 ? 398 LEU A CA   3  
ATOM 3899  C C    . LEU A 1 23  ? -7.739  -14.466 -10.851 1.00 0.00 ? 398 LEU A C    3  
ATOM 3900  O O    . LEU A 1 23  ? -8.801  -14.867 -11.327 1.00 0.00 ? 398 LEU A O    3  
ATOM 3901  C CB   . LEU A 1 23  ? -7.035  -12.077 -11.102 1.00 0.00 ? 398 LEU A CB   3  
ATOM 3902  C CG   . LEU A 1 23  ? -7.032  -10.640 -10.576 1.00 0.00 ? 398 LEU A CG   3  
ATOM 3903  C CD1  . LEU A 1 23  ? -5.758  -9.921  -10.994 1.00 0.00 ? 398 LEU A CD1  3  
ATOM 3904  C CD2  . LEU A 1 23  ? -8.257  -9.889  -11.073 1.00 0.00 ? 398 LEU A CD2  3  
ATOM 3905  H H    . LEU A 1 23  ? -6.059  -12.669 -8.839  1.00 0.00 ? 398 LEU A H    3  
ATOM 3906  H HA   . LEU A 1 23  ? -8.653  -12.790 -9.897  1.00 0.00 ? 398 LEU A HA   3  
ATOM 3907  H HB2  . LEU A 1 23  ? -6.014  -12.370 -11.300 1.00 0.00 ? 398 LEU A HB2  3  
ATOM 3908  H HB3  . LEU A 1 23  ? -7.584  -12.095 -12.032 1.00 0.00 ? 398 LEU A HB3  3  
ATOM 3909  H HG   . LEU A 1 23  ? -7.064  -10.659 -9.497  1.00 0.00 ? 398 LEU A HG   3  
ATOM 3910  H HD11 . LEU A 1 23  ? -4.989  -10.648 -11.215 1.00 0.00 ? 398 LEU A HD11 3  
ATOM 3911  H HD12 . LEU A 1 23  ? -5.952  -9.325  -11.873 1.00 0.00 ? 398 LEU A HD12 3  
ATOM 3912  H HD13 . LEU A 1 23  ? -5.426  -9.280  -10.191 1.00 0.00 ? 398 LEU A HD13 3  
ATOM 3913  H HD21 . LEU A 1 23  ? -8.013  -9.362  -11.983 1.00 0.00 ? 398 LEU A HD21 3  
ATOM 3914  H HD22 . LEU A 1 23  ? -9.056  -10.590 -11.266 1.00 0.00 ? 398 LEU A HD22 3  
ATOM 3915  H HD23 . LEU A 1 23  ? -8.574  -9.181  -10.322 1.00 0.00 ? 398 LEU A HD23 3  
ATOM 3916  N N    . LYS A 1 24  ? -6.612  -15.167 -10.906 1.00 0.00 ? 399 LYS A N    3  
ATOM 3917  C CA   . LYS A 1 24  ? -6.558  -16.478 -11.540 1.00 0.00 ? 399 LYS A CA   3  
ATOM 3918  C C    . LYS A 1 24  ? -7.393  -17.494 -10.767 1.00 0.00 ? 399 LYS A C    3  
ATOM 3919  O O    . LYS A 1 24  ? -7.940  -18.432 -11.345 1.00 0.00 ? 399 LYS A O    3  
ATOM 3920  C CB   . LYS A 1 24  ? -5.110  -16.961 -11.638 1.00 0.00 ? 399 LYS A CB   3  
ATOM 3921  C CG   . LYS A 1 24  ? -4.261  -16.148 -12.602 1.00 0.00 ? 399 LYS A CG   3  
ATOM 3922  C CD   . LYS A 1 24  ? -2.901  -15.816 -12.008 1.00 0.00 ? 399 LYS A CD   3  
ATOM 3923  C CE   . LYS A 1 24  ? -2.410  -14.453 -12.467 1.00 0.00 ? 399 LYS A CE   3  
ATOM 3924  N NZ   . LYS A 1 24  ? -1.217  -14.003 -11.697 1.00 0.00 ? 399 LYS A NZ   3  
ATOM 3925  H H    . LYS A 1 24  ? -5.798  -14.794 -10.508 1.00 0.00 ? 399 LYS A H    3  
ATOM 3926  H HA   . LYS A 1 24  ? -6.963  -16.381 -12.537 1.00 0.00 ? 399 LYS A HA   3  
ATOM 3927  H HB2  . LYS A 1 24  ? -4.657  -16.907 -10.659 1.00 0.00 ? 399 LYS A HB2  3  
ATOM 3928  H HB3  . LYS A 1 24  ? -5.107  -17.989 -11.969 1.00 0.00 ? 399 LYS A HB3  3  
ATOM 3929  H HG2  . LYS A 1 24  ? -4.116  -16.718 -13.507 1.00 0.00 ? 399 LYS A HG2  3  
ATOM 3930  H HG3  . LYS A 1 24  ? -4.778  -15.227 -12.833 1.00 0.00 ? 399 LYS A HG3  3  
ATOM 3931  H HD2  . LYS A 1 24  ? -2.980  -15.816 -10.931 1.00 0.00 ? 399 LYS A HD2  3  
ATOM 3932  H HD3  . LYS A 1 24  ? -2.190  -16.569 -12.318 1.00 0.00 ? 399 LYS A HD3  3  
ATOM 3933  H HE2  . LYS A 1 24  ? -2.150  -14.512 -13.513 1.00 0.00 ? 399 LYS A HE2  3  
ATOM 3934  H HE3  . LYS A 1 24  ? -3.206  -13.735 -12.334 1.00 0.00 ? 399 LYS A HE3  3  
ATOM 3935  H HZ1  . LYS A 1 24  ? -1.506  -13.353 -10.939 1.00 0.00 ? 399 LYS A HZ1  3  
ATOM 3936  H HZ2  . LYS A 1 24  ? -0.736  -14.822 -11.272 1.00 0.00 ? 399 LYS A HZ2  3  
ATOM 3937  H HZ3  . LYS A 1 24  ? -0.550  -13.512 -12.326 1.00 0.00 ? 399 LYS A HZ3  3  
ATOM 3938  N N    . ASP A 1 25  ? -7.486  -17.299 -9.456  1.00 0.00 ? 400 ASP A N    3  
ATOM 3939  C CA   . ASP A 1 25  ? -8.254  -18.198 -8.602  1.00 0.00 ? 400 ASP A CA   3  
ATOM 3940  C C    . ASP A 1 25  ? -9.717  -18.246 -9.036  1.00 0.00 ? 400 ASP A C    3  
ATOM 3941  O O    . ASP A 1 25  ? -10.235 -19.306 -9.389  1.00 0.00 ? 400 ASP A O    3  
ATOM 3942  C CB   . ASP A 1 25  ? -8.155  -17.754 -7.140  1.00 0.00 ? 400 ASP A CB   3  
ATOM 3943  C CG   . ASP A 1 25  ? -7.491  -18.796 -6.262  1.00 0.00 ? 400 ASP A CG   3  
ATOM 3944  O OD1  . ASP A 1 25  ? -7.782  -19.997 -6.444  1.00 0.00 ? 400 ASP A OD1  3  
ATOM 3945  O OD2  . ASP A 1 25  ? -6.681  -18.412 -5.394  1.00 0.00 ? 400 ASP A OD2  3  
ATOM 3946  H H    . ASP A 1 25  ? -7.027  -16.533 -9.052  1.00 0.00 ? 400 ASP A H    3  
ATOM 3947  H HA   . ASP A 1 25  ? -7.831  -19.186 -8.697  1.00 0.00 ? 400 ASP A HA   3  
ATOM 3948  H HB2  . ASP A 1 25  ? -7.576  -16.844 -7.086  1.00 0.00 ? 400 ASP A HB2  3  
ATOM 3949  H HB3  . ASP A 1 25  ? -9.148  -17.566 -6.757  1.00 0.00 ? 400 ASP A HB3  3  
ATOM 3950  N N    . ARG A 1 26  ? -10.376 -17.092 -9.009  1.00 0.00 ? 401 ARG A N    3  
ATOM 3951  C CA   . ARG A 1 26  ? -11.778 -17.004 -9.400  1.00 0.00 ? 401 ARG A CA   3  
ATOM 3952  C C    . ARG A 1 26  ? -11.942 -17.246 -10.897 1.00 0.00 ? 401 ARG A C    3  
ATOM 3953  O O    . ARG A 1 26  ? -12.623 -18.185 -11.312 1.00 0.00 ? 401 ARG A O    3  
ATOM 3954  C CB   . ARG A 1 26  ? -12.346 -15.633 -9.028  1.00 0.00 ? 401 ARG A CB   3  
ATOM 3955  C CG   . ARG A 1 26  ? -12.572 -15.453 -7.535  1.00 0.00 ? 401 ARG A CG   3  
ATOM 3956  C CD   . ARG A 1 26  ? -12.885 -14.006 -7.190  1.00 0.00 ? 401 ARG A CD   3  
ATOM 3957  N NE   . ARG A 1 26  ? -12.557 -13.692 -5.801  1.00 0.00 ? 401 ARG A NE   3  
ATOM 3958  C CZ   . ARG A 1 26  ? -12.401 -12.454 -5.339  1.00 0.00 ? 401 ARG A CZ   3  
ATOM 3959  N NH1  . ARG A 1 26  ? -12.541 -11.412 -6.149  1.00 0.00 ? 401 ARG A NH1  3  
ATOM 3960  N NH2  . ARG A 1 26  ? -12.104 -12.256 -4.062  1.00 0.00 ? 401 ARG A NH2  3  
ATOM 3961  H H    . ARG A 1 26  ? -9.908  -16.281 -8.719  1.00 0.00 ? 401 ARG A H    3  
ATOM 3962  H HA   . ARG A 1 26  ? -12.320 -17.766 -8.862  1.00 0.00 ? 401 ARG A HA   3  
ATOM 3963  H HB2  . ARG A 1 26  ? -11.660 -14.868 -9.362  1.00 0.00 ? 401 ARG A HB2  3  
ATOM 3964  H HB3  . ARG A 1 26  ? -13.292 -15.500 -9.532  1.00 0.00 ? 401 ARG A HB3  3  
ATOM 3965  H HG2  . ARG A 1 26  ? -13.401 -16.072 -7.230  1.00 0.00 ? 401 ARG A HG2  3  
ATOM 3966  H HG3  . ARG A 1 26  ? -11.679 -15.755 -7.008  1.00 0.00 ? 401 ARG A HG3  3  
ATOM 3967  H HD2  . ARG A 1 26  ? -12.311 -13.362 -7.840  1.00 0.00 ? 401 ARG A HD2  3  
ATOM 3968  H HD3  . ARG A 1 26  ? -13.938 -13.832 -7.350  1.00 0.00 ? 401 ARG A HD3  3  
ATOM 3969  H HE   . ARG A 1 26  ? -12.447 -14.442 -5.181  1.00 0.00 ? 401 ARG A HE   3  
ATOM 3970  H HH11 . ARG A 1 26  ? -12.766 -11.553 -7.112  1.00 0.00 ? 401 ARG A HH11 3  
ATOM 3971  H HH12 . ARG A 1 26  ? -12.423 -10.484 -5.795  1.00 0.00 ? 401 ARG A HH12 3  
ATOM 3972  H HH21 . ARG A 1 26  ? -11.996 -13.037 -3.447  1.00 0.00 ? 401 ARG A HH21 3  
ATOM 3973  H HH22 . ARG A 1 26  ? -11.986 -11.326 -3.714  1.00 0.00 ? 401 ARG A HH22 3  
ATOM 3974  N N    . HIS A 1 27  ? -11.314 -16.395 -11.702 1.00 0.00 ? 402 HIS A N    3  
ATOM 3975  C CA   . HIS A 1 27  ? -11.391 -16.519 -13.153 1.00 0.00 ? 402 HIS A CA   3  
ATOM 3976  C C    . HIS A 1 27  ? -10.112 -17.130 -13.714 1.00 0.00 ? 402 HIS A C    3  
ATOM 3977  O O    . HIS A 1 27  ? -9.202  -16.414 -14.133 1.00 0.00 ? 402 HIS A O    3  
ATOM 3978  C CB   . HIS A 1 27  ? -11.642 -15.149 -13.788 1.00 0.00 ? 402 HIS A CB   3  
ATOM 3979  C CG   . HIS A 1 27  ? -12.948 -15.058 -14.517 1.00 0.00 ? 402 HIS A CG   3  
ATOM 3980  N ND1  . HIS A 1 27  ? -13.193 -14.133 -15.509 1.00 0.00 ? 402 HIS A ND1  3  
ATOM 3981  C CD2  . HIS A 1 27  ? -14.083 -15.785 -14.393 1.00 0.00 ? 402 HIS A CD2  3  
ATOM 3982  C CE1  . HIS A 1 27  ? -14.423 -14.294 -15.964 1.00 0.00 ? 402 HIS A CE1  3  
ATOM 3983  N NE2  . HIS A 1 27  ? -14.984 -15.290 -15.303 1.00 0.00 ? 402 HIS A NE2  3  
ATOM 3984  H H    . HIS A 1 27  ? -10.787 -15.668 -11.311 1.00 0.00 ? 402 HIS A H    3  
ATOM 3985  H HA   . HIS A 1 27  ? -12.218 -17.171 -13.387 1.00 0.00 ? 402 HIS A HA   3  
ATOM 3986  H HB2  . HIS A 1 27  ? -11.643 -14.395 -13.015 1.00 0.00 ? 402 HIS A HB2  3  
ATOM 3987  H HB3  . HIS A 1 27  ? -10.852 -14.934 -14.493 1.00 0.00 ? 402 HIS A HB3  3  
ATOM 3988  H HD1  . HIS A 1 27  ? -12.560 -13.459 -15.832 1.00 0.00 ? 402 HIS A HD1  3  
ATOM 3989  H HD2  . HIS A 1 27  ? -14.250 -16.603 -13.706 1.00 0.00 ? 402 HIS A HD2  3  
ATOM 3990  H HE1  . HIS A 1 27  ? -14.890 -13.711 -16.744 1.00 0.00 ? 402 HIS A HE1  3  
ATOM 3991  H HE2  . HIS A 1 27  ? -15.865 -15.672 -15.498 1.00 0.00 ? 402 HIS A HE2  3  
ATOM 3992  N N    . ARG A 1 28  ? -10.049 -18.458 -13.721 1.00 0.00 ? 403 ARG A N    3  
ATOM 3993  C CA   . ARG A 1 28  ? -8.880  -19.161 -14.232 1.00 0.00 ? 403 ARG A CA   3  
ATOM 3994  C C    . ARG A 1 28  ? -8.850  -19.128 -15.756 1.00 0.00 ? 403 ARG A C    3  
ATOM 3995  O O    . ARG A 1 28  ? -8.963  -20.160 -16.417 1.00 0.00 ? 403 ARG A O    3  
ATOM 3996  C CB   . ARG A 1 28  ? -8.868  -20.608 -13.740 1.00 0.00 ? 403 ARG A CB   3  
ATOM 3997  C CG   . ARG A 1 28  ? -7.467  -21.172 -13.573 1.00 0.00 ? 403 ARG A CG   3  
ATOM 3998  C CD   . ARG A 1 28  ? -7.272  -21.794 -12.198 1.00 0.00 ? 403 ARG A CD   3  
ATOM 3999  N NE   . ARG A 1 28  ? -7.365  -23.252 -12.240 1.00 0.00 ? 403 ARG A NE   3  
ATOM 4000  C CZ   . ARG A 1 28  ? -7.629  -24.009 -11.177 1.00 0.00 ? 403 ARG A CZ   3  
ATOM 4001  N NH1  . ARG A 1 28  ? -7.825  -23.453 -9.988  1.00 0.00 ? 403 ARG A NH1  3  
ATOM 4002  N NH2  . ARG A 1 28  ? -7.697  -25.328 -11.303 1.00 0.00 ? 403 ARG A NH2  3  
ATOM 4003  H H    . ARG A 1 28  ? -10.806 -18.975 -13.373 1.00 0.00 ? 403 ARG A H    3  
ATOM 4004  H HA   . ARG A 1 28  ? -8.003  -18.657 -13.857 1.00 0.00 ? 403 ARG A HA   3  
ATOM 4005  H HB2  . ARG A 1 28  ? -9.373  -20.656 -12.786 1.00 0.00 ? 403 ARG A HB2  3  
ATOM 4006  H HB3  . ARG A 1 28  ? -9.399  -21.224 -14.451 1.00 0.00 ? 403 ARG A HB3  3  
ATOM 4007  H HG2  . ARG A 1 28  ? -7.301  -21.927 -14.326 1.00 0.00 ? 403 ARG A HG2  3  
ATOM 4008  H HG3  . ARG A 1 28  ? -6.753  -20.370 -13.701 1.00 0.00 ? 403 ARG A HG3  3  
ATOM 4009  H HD2  . ARG A 1 28  ? -6.297  -21.517 -11.827 1.00 0.00 ? 403 ARG A HD2  3  
ATOM 4010  H HD3  . ARG A 1 28  ? -8.033  -21.412 -11.533 1.00 0.00 ? 403 ARG A HD3  3  
ATOM 4011  H HE   . ARG A 1 28  ? -7.224  -23.690 -13.105 1.00 0.00 ? 403 ARG A HE   3  
ATOM 4012  H HH11 . ARG A 1 28  ? -7.773  -22.460 -9.884  1.00 0.00 ? 403 ARG A HH11 3  
ATOM 4013  H HH12 . ARG A 1 28  ? -8.022  -24.027 -9.194  1.00 0.00 ? 403 ARG A HH12 3  
ATOM 4014  H HH21 . ARG A 1 28  ? -7.550  -25.752 -12.197 1.00 0.00 ? 403 ARG A HH21 3  
ATOM 4015  H HH22 . ARG A 1 28  ? -7.895  -25.896 -10.505 1.00 0.00 ? 403 ARG A HH22 3  
ATOM 4016  N N    . ASP A 1 29  ? -8.695  -17.929 -16.305 1.00 0.00 ? 404 ASP A N    3  
ATOM 4017  C CA   . ASP A 1 29  ? -8.648  -17.748 -17.752 1.00 0.00 ? 404 ASP A CA   3  
ATOM 4018  C C    . ASP A 1 29  ? -8.162  -16.347 -18.111 1.00 0.00 ? 404 ASP A C    3  
ATOM 4019  O O    . ASP A 1 29  ? -8.517  -15.807 -19.158 1.00 0.00 ? 404 ASP A O    3  
ATOM 4020  C CB   . ASP A 1 29  ? -10.028 -17.995 -18.363 1.00 0.00 ? 404 ASP A CB   3  
ATOM 4021  C CG   . ASP A 1 29  ? -9.945  -18.608 -19.748 1.00 0.00 ? 404 ASP A CG   3  
ATOM 4022  O OD1  . ASP A 1 29  ? -9.356  -17.971 -20.645 1.00 0.00 ? 404 ASP A OD1  3  
ATOM 4023  O OD2  . ASP A 1 29  ? -10.470 -19.726 -19.933 1.00 0.00 ? 404 ASP A OD2  3  
ATOM 4024  H H    . ASP A 1 29  ? -8.610  -17.148 -15.721 1.00 0.00 ? 404 ASP A H    3  
ATOM 4025  H HA   . ASP A 1 29  ? -7.952  -18.471 -18.152 1.00 0.00 ? 404 ASP A HA   3  
ATOM 4026  H HB2  . ASP A 1 29  ? -10.583 -18.666 -17.725 1.00 0.00 ? 404 ASP A HB2  3  
ATOM 4027  H HB3  . ASP A 1 29  ? -10.555 -17.055 -18.436 1.00 0.00 ? 404 ASP A HB3  3  
ATOM 4028  N N    . PHE A 1 30  ? -7.347  -15.763 -17.237 1.00 0.00 ? 405 PHE A N    3  
ATOM 4029  C CA   . PHE A 1 30  ? -6.812  -14.426 -17.465 1.00 0.00 ? 405 PHE A CA   3  
ATOM 4030  C C    . PHE A 1 30  ? -5.492  -14.494 -18.230 1.00 0.00 ? 405 PHE A C    3  
ATOM 4031  O O    . PHE A 1 30  ? -4.901  -15.565 -18.367 1.00 0.00 ? 405 PHE A O    3  
ATOM 4032  C CB   . PHE A 1 30  ? -6.607  -13.704 -16.132 1.00 0.00 ? 405 PHE A CB   3  
ATOM 4033  C CG   . PHE A 1 30  ? -7.806  -12.920 -15.682 1.00 0.00 ? 405 PHE A CG   3  
ATOM 4034  C CD1  . PHE A 1 30  ? -8.268  -11.846 -16.427 1.00 0.00 ? 405 PHE A CD1  3  
ATOM 4035  C CD2  . PHE A 1 30  ? -8.471  -13.254 -14.513 1.00 0.00 ? 405 PHE A CD2  3  
ATOM 4036  C CE1  . PHE A 1 30  ? -9.370  -11.122 -16.016 1.00 0.00 ? 405 PHE A CE1  3  
ATOM 4037  C CE2  . PHE A 1 30  ? -9.574  -12.534 -14.097 1.00 0.00 ? 405 PHE A CE2  3  
ATOM 4038  C CZ   . PHE A 1 30  ? -10.024 -11.466 -14.849 1.00 0.00 ? 405 PHE A CZ   3  
ATOM 4039  H H    . PHE A 1 30  ? -7.098  -16.244 -16.421 1.00 0.00 ? 405 PHE A H    3  
ATOM 4040  H HA   . PHE A 1 30  ? -7.530  -13.877 -18.056 1.00 0.00 ? 405 PHE A HA   3  
ATOM 4041  H HB2  . PHE A 1 30  ? -6.383  -14.433 -15.367 1.00 0.00 ? 405 PHE A HB2  3  
ATOM 4042  H HB3  . PHE A 1 30  ? -5.776  -13.022 -16.224 1.00 0.00 ? 405 PHE A HB3  3  
ATOM 4043  H HD1  . PHE A 1 30  ? -7.758  -11.577 -17.340 1.00 0.00 ? 405 PHE A HD1  3  
ATOM 4044  H HD2  . PHE A 1 30  ? -8.120  -14.089 -13.925 1.00 0.00 ? 405 PHE A HD2  3  
ATOM 4045  H HE1  . PHE A 1 30  ? -9.720  -10.288 -16.606 1.00 0.00 ? 405 PHE A HE1  3  
ATOM 4046  H HE2  . PHE A 1 30  ? -10.083 -12.805 -13.184 1.00 0.00 ? 405 PHE A HE2  3  
ATOM 4047  H HZ   . PHE A 1 30  ? -10.886 -10.901 -14.525 1.00 0.00 ? 405 PHE A HZ   3  
ATOM 4048  N N    . PRO A 1 31  ? -5.010  -13.347 -18.741 1.00 0.00 ? 406 PRO A N    3  
ATOM 4049  C CA   . PRO A 1 31  ? -3.753  -13.286 -19.494 1.00 0.00 ? 406 PRO A CA   3  
ATOM 4050  C C    . PRO A 1 31  ? -2.599  -13.959 -18.758 1.00 0.00 ? 406 PRO A C    3  
ATOM 4051  O O    . PRO A 1 31  ? -1.629  -14.398 -19.376 1.00 0.00 ? 406 PRO A O    3  
ATOM 4052  C CB   . PRO A 1 31  ? -3.497  -11.784 -19.632 1.00 0.00 ? 406 PRO A CB   3  
ATOM 4053  C CG   . PRO A 1 31  ? -4.849  -11.163 -19.562 1.00 0.00 ? 406 PRO A CG   3  
ATOM 4054  C CD   . PRO A 1 31  ? -5.652  -12.023 -18.626 1.00 0.00 ? 406 PRO A CD   3  
ATOM 4055  H HA   . PRO A 1 31  ? -3.859  -13.726 -20.474 1.00 0.00 ? 406 PRO A HA   3  
ATOM 4056  H HB2  . PRO A 1 31  ? -2.864  -11.448 -18.824 1.00 0.00 ? 406 PRO A HB2  3  
ATOM 4057  H HB3  . PRO A 1 31  ? -3.019  -11.582 -20.580 1.00 0.00 ? 406 PRO A HB3  3  
ATOM 4058  H HG2  . PRO A 1 31  ? -4.772  -10.157 -19.176 1.00 0.00 ? 406 PRO A HG2  3  
ATOM 4059  H HG3  . PRO A 1 31  ? -5.301  -11.155 -20.543 1.00 0.00 ? 406 PRO A HG3  3  
ATOM 4060  H HD2  . PRO A 1 31  ? -5.582  -11.647 -17.615 1.00 0.00 ? 406 PRO A HD2  3  
ATOM 4061  H HD3  . PRO A 1 31  ? -6.683  -12.066 -18.943 1.00 0.00 ? 406 PRO A HD3  3  
ATOM 4062  N N    . ASP A 1 32  ? -2.710  -14.039 -17.434 1.00 0.00 ? 407 ASP A N    3  
ATOM 4063  C CA   . ASP A 1 32  ? -1.677  -14.660 -16.613 1.00 0.00 ? 407 ASP A CA   3  
ATOM 4064  C C    . ASP A 1 32  ? -0.400  -13.822 -16.616 1.00 0.00 ? 407 ASP A C    3  
ATOM 4065  O O    . ASP A 1 32  ? 0.689   -14.330 -16.884 1.00 0.00 ? 407 ASP A O    3  
ATOM 4066  C CB   . ASP A 1 32  ? -1.375  -16.077 -17.113 1.00 0.00 ? 407 ASP A CB   3  
ATOM 4067  C CG   . ASP A 1 32  ? -1.153  -17.056 -15.978 1.00 0.00 ? 407 ASP A CG   3  
ATOM 4068  O OD1  . ASP A 1 32  ? -0.589  -16.646 -14.941 1.00 0.00 ? 407 ASP A OD1  3  
ATOM 4069  O OD2  . ASP A 1 32  ? -1.544  -18.234 -16.124 1.00 0.00 ? 407 ASP A OD2  3  
ATOM 4070  H H    . ASP A 1 32  ? -3.507  -13.672 -16.999 1.00 0.00 ? 407 ASP A H    3  
ATOM 4071  H HA   . ASP A 1 32  ? -2.049  -14.719 -15.601 1.00 0.00 ? 407 ASP A HA   3  
ATOM 4072  H HB2  . ASP A 1 32  ? -2.206  -16.426 -17.707 1.00 0.00 ? 407 ASP A HB2  3  
ATOM 4073  H HB3  . ASP A 1 32  ? -0.485  -16.055 -17.724 1.00 0.00 ? 407 ASP A HB3  3  
ATOM 4074  N N    . VAL A 1 33  ? -0.544  -12.536 -16.315 1.00 0.00 ? 408 VAL A N    3  
ATOM 4075  C CA   . VAL A 1 33  ? 0.596   -11.627 -16.282 1.00 0.00 ? 408 VAL A CA   3  
ATOM 4076  C C    . VAL A 1 33  ? 0.816   -11.076 -14.877 1.00 0.00 ? 408 VAL A C    3  
ATOM 4077  O O    . VAL A 1 33  ? 0.260   -10.040 -14.511 1.00 0.00 ? 408 VAL A O    3  
ATOM 4078  C CB   . VAL A 1 33  ? 0.410   -10.450 -17.259 1.00 0.00 ? 408 VAL A CB   3  
ATOM 4079  C CG1  . VAL A 1 33  ? 0.702   -10.889 -18.686 1.00 0.00 ? 408 VAL A CG1  3  
ATOM 4080  C CG2  . VAL A 1 33  ? -0.996  -9.876  -17.148 1.00 0.00 ? 408 VAL A CG2  3  
ATOM 4081  H H    . VAL A 1 33  ? -1.438  -12.190 -16.110 1.00 0.00 ? 408 VAL A H    3  
ATOM 4082  H HA   . VAL A 1 33  ? 1.473   -12.181 -16.581 1.00 0.00 ? 408 VAL A HA   3  
ATOM 4083  H HB   . VAL A 1 33  ? 1.114   -9.674  -16.996 1.00 0.00 ? 408 VAL A HB   3  
ATOM 4084  H HG11 . VAL A 1 33  ? 0.544   -11.954 -18.775 1.00 0.00 ? 408 VAL A HG11 3  
ATOM 4085  H HG12 . VAL A 1 33  ? 0.042   -10.370 -19.365 1.00 0.00 ? 408 VAL A HG12 3  
ATOM 4086  H HG13 . VAL A 1 33  ? 1.728   -10.656 -18.931 1.00 0.00 ? 408 VAL A HG13 3  
ATOM 4087  H HG21 . VAL A 1 33  ? -1.109  -9.065  -17.853 1.00 0.00 ? 408 VAL A HG21 3  
ATOM 4088  H HG22 . VAL A 1 33  ? -1.718  -10.647 -17.368 1.00 0.00 ? 408 VAL A HG22 3  
ATOM 4089  H HG23 . VAL A 1 33  ? -1.155  -9.506  -16.147 1.00 0.00 ? 408 VAL A HG23 3  
ATOM 4090  N N    . ILE A 1 34  ? 1.630   -11.777 -14.092 1.00 0.00 ? 409 ILE A N    3  
ATOM 4091  C CA   . ILE A 1 34  ? 1.925   -11.364 -12.721 1.00 0.00 ? 409 ILE A CA   3  
ATOM 4092  C C    . ILE A 1 34  ? 2.259   -9.875  -12.645 1.00 0.00 ? 409 ILE A C    3  
ATOM 4093  O O    . ILE A 1 34  ? 1.987   -9.219  -11.639 1.00 0.00 ? 409 ILE A O    3  
ATOM 4094  C CB   . ILE A 1 34  ? 3.093   -12.178 -12.124 1.00 0.00 ? 409 ILE A CB   3  
ATOM 4095  C CG1  . ILE A 1 34  ? 4.408   -11.856 -12.844 1.00 0.00 ? 409 ILE A CG1  3  
ATOM 4096  C CG2  . ILE A 1 34  ? 2.793   -13.667 -12.198 1.00 0.00 ? 409 ILE A CG2  3  
ATOM 4097  C CD1  . ILE A 1 34  ? 4.454   -12.342 -14.277 1.00 0.00 ? 409 ILE A CD1  3  
ATOM 4098  H H    . ILE A 1 34  ? 2.038   -12.596 -14.441 1.00 0.00 ? 409 ILE A H    3  
ATOM 4099  H HA   . ILE A 1 34  ? 1.045   -11.552 -12.125 1.00 0.00 ? 409 ILE A HA   3  
ATOM 4100  H HB   . ILE A 1 34  ? 3.189   -11.910 -11.081 1.00 0.00 ? 409 ILE A HB   3  
ATOM 4101  H HG12 . ILE A 1 34  ? 4.553   -10.787 -12.854 1.00 0.00 ? 409 ILE A HG12 3  
ATOM 4102  H HG13 . ILE A 1 34  ? 5.224   -12.320 -12.310 1.00 0.00 ? 409 ILE A HG13 3  
ATOM 4103  H HG21 . ILE A 1 34  ? 1.778   -13.846 -11.875 1.00 0.00 ? 409 ILE A HG21 3  
ATOM 4104  H HG22 . ILE A 1 34  ? 2.913   -14.008 -13.215 1.00 0.00 ? 409 ILE A HG22 3  
ATOM 4105  H HG23 . ILE A 1 34  ? 3.475   -14.204 -11.555 1.00 0.00 ? 409 ILE A HG23 3  
ATOM 4106  H HD11 . ILE A 1 34  ? 5.474   -12.327 -14.629 1.00 0.00 ? 409 ILE A HD11 3  
ATOM 4107  H HD12 . ILE A 1 34  ? 4.070   -13.351 -14.327 1.00 0.00 ? 409 ILE A HD12 3  
ATOM 4108  H HD13 . ILE A 1 34  ? 3.850   -11.697 -14.896 1.00 0.00 ? 409 ILE A HD13 3  
ATOM 4109  N N    . SER A 1 35  ? 2.847   -9.348  -13.714 1.00 0.00 ? 410 SER A N    3  
ATOM 4110  C CA   . SER A 1 35  ? 3.216   -7.938  -13.767 1.00 0.00 ? 410 SER A CA   3  
ATOM 4111  C C    . SER A 1 35  ? 2.444   -7.215  -14.865 1.00 0.00 ? 410 SER A C    3  
ATOM 4112  O O    . SER A 1 35  ? 2.390   -7.674  -16.006 1.00 0.00 ? 410 SER A O    3  
ATOM 4113  C CB   . SER A 1 35  ? 4.720   -7.788  -14.001 1.00 0.00 ? 410 SER A CB   3  
ATOM 4114  O OG   . SER A 1 35  ? 5.454   -8.706  -13.210 1.00 0.00 ? 410 SER A OG   3  
ATOM 4115  H H    . SER A 1 35  ? 3.038   -9.921  -14.486 1.00 0.00 ? 410 SER A H    3  
ATOM 4116  H HA   . SER A 1 35  ? 2.964   -7.494  -12.815 1.00 0.00 ? 410 SER A HA   3  
ATOM 4117  H HB2  . SER A 1 35  ? 4.940   -7.972  -15.043 1.00 0.00 ? 410 SER A HB2  3  
ATOM 4118  H HB3  . SER A 1 35  ? 5.023   -6.784  -13.743 1.00 0.00 ? 410 SER A HB3  3  
ATOM 4119  H HG   . SER A 1 35  ? 5.948   -9.297  -13.782 1.00 0.00 ? 410 SER A HG   3  
ATOM 4120  N N    . GLY A 1 36  ? 1.848   -6.082  -14.512 1.00 0.00 ? 411 GLY A N    3  
ATOM 4121  C CA   . GLY A 1 36  ? 1.086   -5.312  -15.478 1.00 0.00 ? 411 GLY A CA   3  
ATOM 4122  C C    . GLY A 1 36  ? 0.175   -4.299  -14.817 1.00 0.00 ? 411 GLY A C    3  
ATOM 4123  O O    . GLY A 1 36  ? 0.115   -4.215  -13.591 1.00 0.00 ? 411 GLY A O    3  
ATOM 4124  H H    . GLY A 1 36  ? 1.926   -5.765  -13.587 1.00 0.00 ? 411 GLY A H    3  
ATOM 4125  H HA2  . GLY A 1 36  ? 1.771   -4.793  -16.131 1.00 0.00 ? 411 GLY A HA2  3  
ATOM 4126  H HA3  . GLY A 1 36  ? 0.485   -5.989  -16.068 1.00 0.00 ? 411 GLY A HA3  3  
ATOM 4127  N N    . ALA A 1 37  ? -0.536  -3.525  -15.629 1.00 0.00 ? 412 ALA A N    3  
ATOM 4128  C CA   . ALA A 1 37  ? -1.446  -2.513  -15.110 1.00 0.00 ? 412 ALA A CA   3  
ATOM 4129  C C    . ALA A 1 37  ? -2.881  -3.024  -15.088 1.00 0.00 ? 412 ALA A C    3  
ATOM 4130  O O    . ALA A 1 37  ? -3.419  -3.438  -16.115 1.00 0.00 ? 412 ALA A O    3  
ATOM 4131  C CB   . ALA A 1 37  ? -1.347  -1.240  -15.934 1.00 0.00 ? 412 ALA A CB   3  
ATOM 4132  H H    . ALA A 1 37  ? -0.447  -3.637  -16.598 1.00 0.00 ? 412 ALA A H    3  
ATOM 4133  H HA   . ALA A 1 37  ? -1.143  -2.283  -14.101 1.00 0.00 ? 412 ALA A HA   3  
ATOM 4134  H HB1  . ALA A 1 37  ? -0.615  -0.584  -15.490 1.00 0.00 ? 412 ALA A HB1  3  
ATOM 4135  H HB2  . ALA A 1 37  ? -1.047  -1.484  -16.942 1.00 0.00 ? 412 ALA A HB2  3  
ATOM 4136  H HB3  . ALA A 1 37  ? -2.307  -0.746  -15.953 1.00 0.00 ? 412 ALA A HB3  3  
ATOM 4137  N N    . TYR A 1 38  ? -3.496  -2.995  -13.910 1.00 0.00 ? 413 TYR A N    3  
ATOM 4138  C CA   . TYR A 1 38  ? -4.869  -3.461  -13.753 1.00 0.00 ? 413 TYR A CA   3  
ATOM 4139  C C    . TYR A 1 38  ? -5.855  -2.298  -13.783 1.00 0.00 ? 413 TYR A C    3  
ATOM 4140  O O    . TYR A 1 38  ? -5.686  -1.308  -13.071 1.00 0.00 ? 413 TYR A O    3  
ATOM 4141  C CB   . TYR A 1 38  ? -5.016  -4.232  -12.440 1.00 0.00 ? 413 TYR A CB   3  
ATOM 4142  C CG   . TYR A 1 38  ? -6.409  -4.774  -12.206 1.00 0.00 ? 413 TYR A CG   3  
ATOM 4143  C CD1  . TYR A 1 38  ? -7.371  -4.013  -11.549 1.00 0.00 ? 413 TYR A CD1  3  
ATOM 4144  C CD2  . TYR A 1 38  ? -6.762  -6.046  -12.640 1.00 0.00 ? 413 TYR A CD2  3  
ATOM 4145  C CE1  . TYR A 1 38  ? -8.644  -4.506  -11.333 1.00 0.00 ? 413 TYR A CE1  3  
ATOM 4146  C CE2  . TYR A 1 38  ? -8.033  -6.545  -12.426 1.00 0.00 ? 413 TYR A CE2  3  
ATOM 4147  C CZ   . TYR A 1 38  ? -8.969  -5.772  -11.772 1.00 0.00 ? 413 TYR A CZ   3  
ATOM 4148  O OH   . TYR A 1 38  ? -10.235 -6.266  -11.557 1.00 0.00 ? 413 TYR A OH   3  
ATOM 4149  H H    . TYR A 1 38  ? -3.013  -2.655  -13.127 1.00 0.00 ? 413 TYR A H    3  
ATOM 4150  H HA   . TYR A 1 38  ? -5.089  -4.125  -14.576 1.00 0.00 ? 413 TYR A HA   3  
ATOM 4151  H HB2  . TYR A 1 38  ? -4.332  -5.068  -12.444 1.00 0.00 ? 413 TYR A HB2  3  
ATOM 4152  H HB3  . TYR A 1 38  ? -4.771  -3.577  -11.618 1.00 0.00 ? 413 TYR A HB3  3  
ATOM 4153  H HD1  . TYR A 1 38  ? -7.114  -3.022  -11.206 1.00 0.00 ? 413 TYR A HD1  3  
ATOM 4154  H HD2  . TYR A 1 38  ? -6.027  -6.648  -13.150 1.00 0.00 ? 413 TYR A HD2  3  
ATOM 4155  H HE1  . TYR A 1 38  ? -9.377  -3.901  -10.821 1.00 0.00 ? 413 TYR A HE1  3  
ATOM 4156  H HE2  . TYR A 1 38  ? -8.289  -7.537  -12.771 1.00 0.00 ? 413 TYR A HE2  3  
ATOM 4157  H HH   . TYR A 1 38  ? -10.386 -6.361  -10.614 1.00 0.00 ? 413 TYR A HH   3  
ATOM 4158  N N    . ILE A 1 39  ? -6.889  -2.429  -14.607 1.00 0.00 ? 414 ILE A N    3  
ATOM 4159  C CA   . ILE A 1 39  ? -7.911  -1.397  -14.725 1.00 0.00 ? 414 ILE A CA   3  
ATOM 4160  C C    . ILE A 1 39  ? -8.917  -1.505  -13.584 1.00 0.00 ? 414 ILE A C    3  
ATOM 4161  O O    . ILE A 1 39  ? -9.703  -2.450  -13.524 1.00 0.00 ? 414 ILE A O    3  
ATOM 4162  C CB   . ILE A 1 39  ? -8.656  -1.494  -16.072 1.00 0.00 ? 414 ILE A CB   3  
ATOM 4163  C CG1  . ILE A 1 39  ? -7.654  -1.531  -17.228 1.00 0.00 ? 414 ILE A CG1  3  
ATOM 4164  C CG2  . ILE A 1 39  ? -9.622  -0.329  -16.236 1.00 0.00 ? 414 ILE A CG2  3  
ATOM 4165  C CD1  . ILE A 1 39  ? -8.217  -2.133  -18.496 1.00 0.00 ? 414 ILE A CD1  3  
ATOM 4166  H H    . ILE A 1 39  ? -6.972  -3.246  -15.144 1.00 0.00 ? 414 ILE A H    3  
ATOM 4167  H HA   . ILE A 1 39  ? -7.422  -0.435  -14.673 1.00 0.00 ? 414 ILE A HA   3  
ATOM 4168  H HB   . ILE A 1 39  ? -9.230  -2.408  -16.074 1.00 0.00 ? 414 ILE A HB   3  
ATOM 4169  H HG12 . ILE A 1 39  ? -7.335  -0.525  -17.452 1.00 0.00 ? 414 ILE A HG12 3  
ATOM 4170  H HG13 . ILE A 1 39  ? -6.797  -2.119  -16.933 1.00 0.00 ? 414 ILE A HG13 3  
ATOM 4171  H HG21 . ILE A 1 39  ? -9.478  0.376   -15.431 1.00 0.00 ? 414 ILE A HG21 3  
ATOM 4172  H HG22 . ILE A 1 39  ? -9.438  0.162   -17.181 1.00 0.00 ? 414 ILE A HG22 3  
ATOM 4173  H HG23 . ILE A 1 39  ? -10.637 -0.697  -16.214 1.00 0.00 ? 414 ILE A HG23 3  
ATOM 4174  H HD11 . ILE A 1 39  ? -7.408  -2.397  -19.160 1.00 0.00 ? 414 ILE A HD11 3  
ATOM 4175  H HD12 . ILE A 1 39  ? -8.787  -3.017  -18.253 1.00 0.00 ? 414 ILE A HD12 3  
ATOM 4176  H HD13 . ILE A 1 39  ? -8.859  -1.413  -18.981 1.00 0.00 ? 414 ILE A HD13 3  
ATOM 4177  N N    . ILE A 1 40  ? -8.878  -0.538  -12.673 1.00 0.00 ? 415 ILE A N    3  
ATOM 4178  C CA   . ILE A 1 40  ? -9.780  -0.534  -11.527 1.00 0.00 ? 415 ILE A CA   3  
ATOM 4179  C C    . ILE A 1 40  ? -11.205 -0.176  -11.944 1.00 0.00 ? 415 ILE A C    3  
ATOM 4180  O O    . ILE A 1 40  ? -12.134 -0.954  -11.728 1.00 0.00 ? 415 ILE A O    3  
ATOM 4181  C CB   . ILE A 1 40  ? -9.291  0.443   -10.435 1.00 0.00 ? 415 ILE A CB   3  
ATOM 4182  C CG1  . ILE A 1 40  ? -7.964  -0.048  -9.847  1.00 0.00 ? 415 ILE A CG1  3  
ATOM 4183  C CG2  . ILE A 1 40  ? -10.336 0.591   -9.337  1.00 0.00 ? 415 ILE A CG2  3  
ATOM 4184  C CD1  . ILE A 1 40  ? -6.821  0.928   -10.026 1.00 0.00 ? 415 ILE A CD1  3  
ATOM 4185  H H    . ILE A 1 40  ? -8.224  0.184   -12.770 1.00 0.00 ? 415 ILE A H    3  
ATOM 4186  H HA   . ILE A 1 40  ? -9.784  -1.531  -11.110 1.00 0.00 ? 415 ILE A HA   3  
ATOM 4187  H HB   . ILE A 1 40  ? -9.140  1.410   -10.887 1.00 0.00 ? 415 ILE A HB   3  
ATOM 4188  H HG12 . ILE A 1 40  ? -8.087  -0.218  -8.788  1.00 0.00 ? 415 ILE A HG12 3  
ATOM 4189  H HG13 . ILE A 1 40  ? -7.687  -0.976  -10.324 1.00 0.00 ? 415 ILE A HG13 3  
ATOM 4190  H HG21 . ILE A 1 40  ? -10.568 -0.382  -8.928  1.00 0.00 ? 415 ILE A HG21 3  
ATOM 4191  H HG22 . ILE A 1 40  ? -9.949  1.228   -8.555  1.00 0.00 ? 415 ILE A HG22 3  
ATOM 4192  H HG23 . ILE A 1 40  ? -11.232 1.032   -9.749  1.00 0.00 ? 415 ILE A HG23 3  
ATOM 4193  H HD11 . ILE A 1 40  ? -6.115  0.525   -10.737 1.00 0.00 ? 415 ILE A HD11 3  
ATOM 4194  H HD12 . ILE A 1 40  ? -7.204  1.868   -10.392 1.00 0.00 ? 415 ILE A HD12 3  
ATOM 4195  H HD13 . ILE A 1 40  ? -6.329  1.083   -9.077  1.00 0.00 ? 415 ILE A HD13 3  
ATOM 4196  N N    . GLU A 1 41  ? -11.376 1.000   -12.535 1.00 0.00 ? 416 GLU A N    3  
ATOM 4197  C CA   . GLU A 1 41  ? -12.697 1.443   -12.971 1.00 0.00 ? 416 GLU A CA   3  
ATOM 4198  C C    . GLU A 1 41  ? -12.591 2.543   -14.021 1.00 0.00 ? 416 GLU A C    3  
ATOM 4199  O O    . GLU A 1 41  ? -11.661 3.351   -13.997 1.00 0.00 ? 416 GLU A O    3  
ATOM 4200  C CB   . GLU A 1 41  ? -13.511 1.939   -11.776 1.00 0.00 ? 416 GLU A CB   3  
ATOM 4201  C CG   . GLU A 1 41  ? -12.921 3.170   -11.106 1.00 0.00 ? 416 GLU A CG   3  
ATOM 4202  C CD   . GLU A 1 41  ? -13.703 3.598   -9.880  1.00 0.00 ? 416 GLU A CD   3  
ATOM 4203  O OE1  . GLU A 1 41  ? -14.950 3.537   -9.920  1.00 0.00 ? 416 GLU A OE1  3  
ATOM 4204  O OE2  . GLU A 1 41  ? -13.068 3.994   -8.880  1.00 0.00 ? 416 GLU A OE2  3  
ATOM 4205  H H    . GLU A 1 41  ? -10.602 1.584   -12.681 1.00 0.00 ? 416 GLU A H    3  
ATOM 4206  H HA   . GLU A 1 41  ? -13.201 0.594   -13.409 1.00 0.00 ? 416 GLU A HA   3  
ATOM 4207  H HB2  . GLU A 1 41  ? -14.509 2.181   -12.109 1.00 0.00 ? 416 GLU A HB2  3  
ATOM 4208  H HB3  . GLU A 1 41  ? -13.569 1.149   -11.041 1.00 0.00 ? 416 GLU A HB3  3  
ATOM 4209  H HG2  . GLU A 1 41  ? -11.906 2.950   -10.808 1.00 0.00 ? 416 GLU A HG2  3  
ATOM 4210  H HG3  . GLU A 1 41  ? -12.918 3.983   -11.817 1.00 0.00 ? 416 GLU A HG3  3  
ATOM 4211  N N    . VAL A 1 42  ? -13.553 2.570   -14.936 1.00 0.00 ? 417 VAL A N    3  
ATOM 4212  C CA   . VAL A 1 42  ? -13.575 3.572   -15.995 1.00 0.00 ? 417 VAL A CA   3  
ATOM 4213  C C    . VAL A 1 42  ? -14.697 4.579   -15.769 1.00 0.00 ? 417 VAL A C    3  
ATOM 4214  O O    . VAL A 1 42  ? -15.831 4.203   -15.476 1.00 0.00 ? 417 VAL A O    3  
ATOM 4215  C CB   . VAL A 1 42  ? -13.757 2.923   -17.382 1.00 0.00 ? 417 VAL A CB   3  
ATOM 4216  C CG1  . VAL A 1 42  ? -13.608 3.964   -18.482 1.00 0.00 ? 417 VAL A CG1  3  
ATOM 4217  C CG2  . VAL A 1 42  ? -12.764 1.786   -17.576 1.00 0.00 ? 417 VAL A CG2  3  
ATOM 4218  H H    . VAL A 1 42  ? -14.268 1.900   -14.899 1.00 0.00 ? 417 VAL A H    3  
ATOM 4219  H HA   . VAL A 1 42  ? -12.630 4.092   -15.984 1.00 0.00 ? 417 VAL A HA   3  
ATOM 4220  H HB   . VAL A 1 42  ? -14.754 2.515   -17.438 1.00 0.00 ? 417 VAL A HB   3  
ATOM 4221  H HG11 . VAL A 1 42  ? -13.778 4.948   -18.070 1.00 0.00 ? 417 VAL A HG11 3  
ATOM 4222  H HG12 . VAL A 1 42  ? -12.613 3.912   -18.895 1.00 0.00 ? 417 VAL A HG12 3  
ATOM 4223  H HG13 . VAL A 1 42  ? -14.332 3.770   -19.260 1.00 0.00 ? 417 VAL A HG13 3  
ATOM 4224  H HG21 . VAL A 1 42  ? -11.951 2.121   -18.204 1.00 0.00 ? 417 VAL A HG21 3  
ATOM 4225  H HG22 . VAL A 1 42  ? -12.375 1.478   -16.618 1.00 0.00 ? 417 VAL A HG22 3  
ATOM 4226  H HG23 . VAL A 1 42  ? -13.261 0.951   -18.049 1.00 0.00 ? 417 VAL A HG23 3  
ATOM 4227  N N    . ILE A 1 43  ? -14.372 5.860   -15.903 1.00 0.00 ? 418 ILE A N    3  
ATOM 4228  C CA   . ILE A 1 43  ? -15.354 6.919   -15.710 1.00 0.00 ? 418 ILE A CA   3  
ATOM 4229  C C    . ILE A 1 43  ? -16.221 7.093   -16.959 1.00 0.00 ? 418 ILE A C    3  
ATOM 4230  O O    . ILE A 1 43  ? -15.814 6.729   -18.062 1.00 0.00 ? 418 ILE A O    3  
ATOM 4231  C CB   . ILE A 1 43  ? -14.662 8.259   -15.342 1.00 0.00 ? 418 ILE A CB   3  
ATOM 4232  C CG1  . ILE A 1 43  ? -15.135 8.739   -13.968 1.00 0.00 ? 418 ILE A CG1  3  
ATOM 4233  C CG2  . ILE A 1 43  ? -14.912 9.332   -16.396 1.00 0.00 ? 418 ILE A CG2  3  
ATOM 4234  C CD1  . ILE A 1 43  ? -14.231 8.306   -12.835 1.00 0.00 ? 418 ILE A CD1  3  
ATOM 4235  H H    . ILE A 1 43  ? -13.449 6.098   -16.137 1.00 0.00 ? 418 ILE A H    3  
ATOM 4236  H HA   . ILE A 1 43  ? -15.991 6.629   -14.886 1.00 0.00 ? 418 ILE A HA   3  
ATOM 4237  H HB   . ILE A 1 43  ? -13.598 8.082   -15.299 1.00 0.00 ? 418 ILE A HB   3  
ATOM 4238  H HG12 . ILE A 1 43  ? -15.176 9.818   -13.966 1.00 0.00 ? 418 ILE A HG12 3  
ATOM 4239  H HG13 . ILE A 1 43  ? -16.122 8.344   -13.776 1.00 0.00 ? 418 ILE A HG13 3  
ATOM 4240  H HG21 . ILE A 1 43  ? -14.562 8.982   -17.356 1.00 0.00 ? 418 ILE A HG21 3  
ATOM 4241  H HG22 . ILE A 1 43  ? -15.970 9.541   -16.454 1.00 0.00 ? 418 ILE A HG22 3  
ATOM 4242  H HG23 . ILE A 1 43  ? -14.381 10.233  -16.126 1.00 0.00 ? 418 ILE A HG23 3  
ATOM 4243  H HD11 . ILE A 1 43  ? -14.829 7.897   -12.034 1.00 0.00 ? 418 ILE A HD11 3  
ATOM 4244  H HD12 . ILE A 1 43  ? -13.542 7.554   -13.191 1.00 0.00 ? 418 ILE A HD12 3  
ATOM 4245  H HD13 . ILE A 1 43  ? -13.677 9.159   -12.471 1.00 0.00 ? 418 ILE A HD13 3  
ATOM 4246  N N    . PRO A 1 44  ? -17.434 7.653   -16.799 1.00 0.00 ? 419 PRO A N    3  
ATOM 4247  C CA   . PRO A 1 44  ? -18.357 7.874   -17.911 1.00 0.00 ? 419 PRO A CA   3  
ATOM 4248  C C    . PRO A 1 44  ? -18.070 9.172   -18.662 1.00 0.00 ? 419 PRO A C    3  
ATOM 4249  O O    . PRO A 1 44  ? -18.987 9.926   -18.987 1.00 0.00 ? 419 PRO A O    3  
ATOM 4250  C CB   . PRO A 1 44  ? -19.709 7.950   -17.210 1.00 0.00 ? 419 PRO A CB   3  
ATOM 4251  C CG   . PRO A 1 44  ? -19.405 8.547   -15.877 1.00 0.00 ? 419 PRO A CG   3  
ATOM 4252  C CD   . PRO A 1 44  ? -18.004 8.113   -15.517 1.00 0.00 ? 419 PRO A CD   3  
ATOM 4253  H HA   . PRO A 1 44  ? -18.352 7.045   -18.605 1.00 0.00 ? 419 PRO A HA   3  
ATOM 4254  H HB2  . PRO A 1 44  ? -20.379 8.575   -17.782 1.00 0.00 ? 419 PRO A HB2  3  
ATOM 4255  H HB3  . PRO A 1 44  ? -20.125 6.958   -17.113 1.00 0.00 ? 419 PRO A HB3  3  
ATOM 4256  H HG2  . PRO A 1 44  ? -19.459 9.623   -15.938 1.00 0.00 ? 419 PRO A HG2  3  
ATOM 4257  H HG3  . PRO A 1 44  ? -20.109 8.178   -15.144 1.00 0.00 ? 419 PRO A HG3  3  
ATOM 4258  H HD2  . PRO A 1 44  ? -17.442 8.949   -15.127 1.00 0.00 ? 419 PRO A HD2  3  
ATOM 4259  H HD3  . PRO A 1 44  ? -18.032 7.309   -14.798 1.00 0.00 ? 419 PRO A HD3  3  
ATOM 4260  N N    . ASP A 1 45  ? -16.793 9.428   -18.929 1.00 0.00 ? 420 ASP A N    3  
ATOM 4261  C CA   . ASP A 1 45  ? -16.382 10.636  -19.637 1.00 0.00 ? 420 ASP A CA   3  
ATOM 4262  C C    . ASP A 1 45  ? -14.890 10.592  -19.950 1.00 0.00 ? 420 ASP A C    3  
ATOM 4263  O O    . ASP A 1 45  ? -14.209 11.618  -19.925 1.00 0.00 ? 420 ASP A O    3  
ATOM 4264  C CB   . ASP A 1 45  ? -16.701 11.874  -18.797 1.00 0.00 ? 420 ASP A CB   3  
ATOM 4265  C CG   . ASP A 1 45  ? -18.048 12.479  -19.144 1.00 0.00 ? 420 ASP A CG   3  
ATOM 4266  O OD1  . ASP A 1 45  ? -18.357 12.588  -20.349 1.00 0.00 ? 420 ASP A OD1  3  
ATOM 4267  O OD2  . ASP A 1 45  ? -18.794 12.842  -18.210 1.00 0.00 ? 420 ASP A OD2  3  
ATOM 4268  H H    . ASP A 1 45  ? -16.108 8.790   -18.642 1.00 0.00 ? 420 ASP A H    3  
ATOM 4269  H HA   . ASP A 1 45  ? -16.935 10.684  -20.563 1.00 0.00 ? 420 ASP A HA   3  
ATOM 4270  H HB2  . ASP A 1 45  ? -16.709 11.601  -17.753 1.00 0.00 ? 420 ASP A HB2  3  
ATOM 4271  H HB3  . ASP A 1 45  ? -15.939 12.621  -18.964 1.00 0.00 ? 420 ASP A HB3  3  
ATOM 4272  N N    . THR A 1 46  ? -14.387 9.397   -20.240 1.00 0.00 ? 421 THR A N    3  
ATOM 4273  C CA   . THR A 1 46  ? -12.973 9.217   -20.550 1.00 0.00 ? 421 THR A CA   3  
ATOM 4274  C C    . THR A 1 46  ? -12.792 8.430   -21.848 1.00 0.00 ? 421 THR A C    3  
ATOM 4275  O O    . THR A 1 46  ? -13.666 7.656   -22.240 1.00 0.00 ? 421 THR A O    3  
ATOM 4276  C CB   . THR A 1 46  ? -12.273 8.498   -19.396 1.00 0.00 ? 421 THR A CB   3  
ATOM 4277  O OG1  . THR A 1 46  ? -10.929 8.190   -19.730 1.00 0.00 ? 421 THR A OG1  3  
ATOM 4278  C CG2  . THR A 1 46  ? -12.962 7.212   -18.993 1.00 0.00 ? 421 THR A CG2  3  
ATOM 4279  H H    . THR A 1 46  ? -14.978 8.616   -20.240 1.00 0.00 ? 421 THR A H    3  
ATOM 4280  H HA   . THR A 1 46  ? -12.535 10.195  -20.672 1.00 0.00 ? 421 THR A HA   3  
ATOM 4281  H HB   . THR A 1 46  ? -12.266 9.151   -18.534 1.00 0.00 ? 421 THR A HB   3  
ATOM 4282  H HG1  . THR A 1 46  ? -10.831 7.243   -19.853 1.00 0.00 ? 421 THR A HG1  3  
ATOM 4283  H HG21 . THR A 1 46  ? -13.468 6.794   -19.851 1.00 0.00 ? 421 THR A HG21 3  
ATOM 4284  H HG22 . THR A 1 46  ? -12.226 6.510   -18.631 1.00 0.00 ? 421 THR A HG22 3  
ATOM 4285  H HG23 . THR A 1 46  ? -13.680 7.418   -18.215 1.00 0.00 ? 421 THR A HG23 3  
ATOM 4286  N N    . PRO A 1 47  ? -11.653 8.622   -22.536 1.00 0.00 ? 422 PRO A N    3  
ATOM 4287  C CA   . PRO A 1 47  ? -11.361 7.931   -23.797 1.00 0.00 ? 422 PRO A CA   3  
ATOM 4288  C C    . PRO A 1 47  ? -11.309 6.417   -23.629 1.00 0.00 ? 422 PRO A C    3  
ATOM 4289  O O    . PRO A 1 47  ? -11.522 5.669   -24.582 1.00 0.00 ? 422 PRO A O    3  
ATOM 4290  C CB   . PRO A 1 47  ? -9.983  8.472   -24.198 1.00 0.00 ? 422 PRO A CB   3  
ATOM 4291  C CG   . PRO A 1 47  ? -9.833  9.744   -23.437 1.00 0.00 ? 422 PRO A CG   3  
ATOM 4292  C CD   . PRO A 1 47  ? -10.561 9.528   -22.144 1.00 0.00 ? 422 PRO A CD   3  
ATOM 4293  H HA   . PRO A 1 47  ? -12.085 8.180   -24.559 1.00 0.00 ? 422 PRO A HA   3  
ATOM 4294  H HB2  . PRO A 1 47  ? -9.220  7.758   -23.926 1.00 0.00 ? 422 PRO A HB2  3  
ATOM 4295  H HB3  . PRO A 1 47  ? -9.957  8.646   -25.263 1.00 0.00 ? 422 PRO A HB3  3  
ATOM 4296  H HG2  . PRO A 1 47  ? -8.788  9.943   -23.252 1.00 0.00 ? 422 PRO A HG2  3  
ATOM 4297  H HG3  . PRO A 1 47  ? -10.279 10.558  -23.988 1.00 0.00 ? 422 PRO A HG3  3  
ATOM 4298  H HD2  . PRO A 1 47  ? -9.911  9.062   -21.420 1.00 0.00 ? 422 PRO A HD2  3  
ATOM 4299  H HD3  . PRO A 1 47  ? -10.950 10.459  -21.762 1.00 0.00 ? 422 PRO A HD3  3  
ATOM 4300  N N    . ALA A 1 48  ? -11.025 5.971   -22.408 1.00 0.00 ? 423 ALA A N    3  
ATOM 4301  C CA   . ALA A 1 48  ? -10.946 4.545   -22.112 1.00 0.00 ? 423 ALA A CA   3  
ATOM 4302  C C    . ALA A 1 48  ? -12.217 3.821   -22.546 1.00 0.00 ? 423 ALA A C    3  
ATOM 4303  O O    . ALA A 1 48  ? -12.163 2.701   -23.051 1.00 0.00 ? 423 ALA A O    3  
ATOM 4304  C CB   . ALA A 1 48  ? -10.692 4.329   -20.629 1.00 0.00 ? 423 ALA A CB   3  
ATOM 4305  H H    . ALA A 1 48  ? -10.865 6.616   -21.689 1.00 0.00 ? 423 ALA A H    3  
ATOM 4306  H HA   . ALA A 1 48  ? -10.108 4.138   -22.660 1.00 0.00 ? 423 ALA A HA   3  
ATOM 4307  H HB1  . ALA A 1 48  ? -9.634  4.403   -20.430 1.00 0.00 ? 423 ALA A HB1  3  
ATOM 4308  H HB2  . ALA A 1 48  ? -11.219 5.081   -20.060 1.00 0.00 ? 423 ALA A HB2  3  
ATOM 4309  H HB3  . ALA A 1 48  ? -11.045 3.349   -20.341 1.00 0.00 ? 423 ALA A HB3  3  
ATOM 4310  N N    . GLU A 1 49  ? -13.358 4.473   -22.348 1.00 0.00 ? 424 GLU A N    3  
ATOM 4311  C CA   . GLU A 1 49  ? -14.641 3.892   -22.722 1.00 0.00 ? 424 GLU A CA   3  
ATOM 4312  C C    . GLU A 1 49  ? -14.845 3.956   -24.232 1.00 0.00 ? 424 GLU A C    3  
ATOM 4313  O O    . GLU A 1 49  ? -15.518 3.107   -24.815 1.00 0.00 ? 424 GLU A O    3  
ATOM 4314  C CB   . GLU A 1 49  ? -15.783 4.619   -22.010 1.00 0.00 ? 424 GLU A CB   3  
ATOM 4315  C CG   . GLU A 1 49  ? -17.115 3.890   -22.095 1.00 0.00 ? 424 GLU A CG   3  
ATOM 4316  C CD   . GLU A 1 49  ? -18.239 4.783   -22.583 1.00 0.00 ? 424 GLU A CD   3  
ATOM 4317  O OE1  . GLU A 1 49  ? -17.959 5.726   -23.353 1.00 0.00 ? 424 GLU A OE1  3  
ATOM 4318  O OE2  . GLU A 1 49  ? -19.401 4.538   -22.197 1.00 0.00 ? 424 GLU A OE2  3  
ATOM 4319  H H    . GLU A 1 49  ? -13.337 5.365   -21.943 1.00 0.00 ? 424 GLU A H    3  
ATOM 4320  H HA   . GLU A 1 49  ? -14.639 2.856   -22.416 1.00 0.00 ? 424 GLU A HA   3  
ATOM 4321  H HB2  . GLU A 1 49  ? -15.527 4.734   -20.967 1.00 0.00 ? 424 GLU A HB2  3  
ATOM 4322  H HB3  . GLU A 1 49  ? -15.903 5.598   -22.452 1.00 0.00 ? 424 GLU A HB3  3  
ATOM 4323  H HG2  . GLU A 1 49  ? -17.014 3.061   -22.777 1.00 0.00 ? 424 GLU A HG2  3  
ATOM 4324  H HG3  . GLU A 1 49  ? -17.371 3.519   -21.114 1.00 0.00 ? 424 GLU A HG3  3  
ATOM 4325  N N    . ALA A 1 50  ? -14.255 4.969   -24.860 1.00 0.00 ? 425 ALA A N    3  
ATOM 4326  C CA   . ALA A 1 50  ? -14.369 5.143   -26.302 1.00 0.00 ? 425 ALA A CA   3  
ATOM 4327  C C    . ALA A 1 50  ? -13.479 4.151   -27.043 1.00 0.00 ? 425 ALA A C    3  
ATOM 4328  O O    . ALA A 1 50  ? -13.845 3.645   -28.103 1.00 0.00 ? 425 ALA A O    3  
ATOM 4329  C CB   . ALA A 1 50  ? -14.014 6.570   -26.693 1.00 0.00 ? 425 ALA A CB   3  
ATOM 4330  H H    . ALA A 1 50  ? -13.730 5.614   -24.342 1.00 0.00 ? 425 ALA A H    3  
ATOM 4331  H HA   . ALA A 1 50  ? -15.398 4.964   -26.579 1.00 0.00 ? 425 ALA A HA   3  
ATOM 4332  H HB1  . ALA A 1 50  ? -14.813 7.233   -26.398 1.00 0.00 ? 425 ALA A HB1  3  
ATOM 4333  H HB2  . ALA A 1 50  ? -13.101 6.863   -26.196 1.00 0.00 ? 425 ALA A HB2  3  
ATOM 4334  H HB3  . ALA A 1 50  ? -13.875 6.627   -27.762 1.00 0.00 ? 425 ALA A HB3  3  
ATOM 4335  N N    . GLY A 1 51  ? -12.309 3.874   -26.474 1.00 0.00 ? 426 GLY A N    3  
ATOM 4336  C CA   . GLY A 1 51  ? -11.389 2.939   -27.094 1.00 0.00 ? 426 GLY A CA   3  
ATOM 4337  C C    . GLY A 1 51  ? -11.916 1.519   -27.079 1.00 0.00 ? 426 GLY A C    3  
ATOM 4338  O O    . GLY A 1 51  ? -12.267 0.969   -28.123 1.00 0.00 ? 426 GLY A O    3  
ATOM 4339  H H    . GLY A 1 51  ? -12.072 4.304   -25.626 1.00 0.00 ? 426 GLY A H    3  
ATOM 4340  H HA2  . GLY A 1 51  ? -11.222 3.240   -28.118 1.00 0.00 ? 426 GLY A HA2  3  
ATOM 4341  H HA3  . GLY A 1 51  ? -10.449 2.970   -26.562 1.00 0.00 ? 426 GLY A HA3  3  
ATOM 4342  N N    . GLY A 1 52  ? -11.974 0.925   -25.891 1.00 0.00 ? 427 GLY A N    3  
ATOM 4343  C CA   . GLY A 1 52  ? -12.467 -0.434  -25.766 1.00 0.00 ? 427 GLY A CA   3  
ATOM 4344  C C    . GLY A 1 52  ? -11.865 -1.172  -24.584 1.00 0.00 ? 427 GLY A C    3  
ATOM 4345  O O    . GLY A 1 52  ? -11.555 -2.359  -24.681 1.00 0.00 ? 427 GLY A O    3  
ATOM 4346  H H    . GLY A 1 52  ? -11.682 1.415   -25.094 1.00 0.00 ? 427 GLY A H    3  
ATOM 4347  H HA2  . GLY A 1 52  ? -13.540 -0.405  -25.649 1.00 0.00 ? 427 GLY A HA2  3  
ATOM 4348  H HA3  . GLY A 1 52  ? -12.230 -0.975  -26.672 1.00 0.00 ? 427 GLY A HA3  3  
ATOM 4349  N N    . LEU A 1 53  ? -11.702 -0.471  -23.465 1.00 0.00 ? 428 LEU A N    3  
ATOM 4350  C CA   . LEU A 1 53  ? -11.137 -1.074  -22.265 1.00 0.00 ? 428 LEU A CA   3  
ATOM 4351  C C    . LEU A 1 53  ? -12.237 -1.488  -21.295 1.00 0.00 ? 428 LEU A C    3  
ATOM 4352  O O    . LEU A 1 53  ? -13.411 -1.552  -21.661 1.00 0.00 ? 428 LEU A O    3  
ATOM 4353  C CB   . LEU A 1 53  ? -10.184 -0.101  -21.568 1.00 0.00 ? 428 LEU A CB   3  
ATOM 4354  C CG   . LEU A 1 53  ? -9.508  0.928   -22.473 1.00 0.00 ? 428 LEU A CG   3  
ATOM 4355  C CD1  . LEU A 1 53  ? -8.810  1.983   -21.632 1.00 0.00 ? 428 LEU A CD1  3  
ATOM 4356  C CD2  . LEU A 1 53  ? -8.520  0.248   -23.408 1.00 0.00 ? 428 LEU A CD2  3  
ATOM 4357  H H    . LEU A 1 53  ? -11.967 0.469   -23.444 1.00 0.00 ? 428 LEU A H    3  
ATOM 4358  H HA   . LEU A 1 53  ? -10.586 -1.953  -22.562 1.00 0.00 ? 428 LEU A HA   3  
ATOM 4359  H HB2  . LEU A 1 53  ? -10.739 0.432   -20.810 1.00 0.00 ? 428 LEU A HB2  3  
ATOM 4360  H HB3  . LEU A 1 53  ? -9.414  -0.678  -21.084 1.00 0.00 ? 428 LEU A HB3  3  
ATOM 4361  H HG   . LEU A 1 53  ? -10.258 1.420   -23.075 1.00 0.00 ? 428 LEU A HG   3  
ATOM 4362  H HD11 . LEU A 1 53  ? -9.412  2.202   -20.761 1.00 0.00 ? 428 LEU A HD11 3  
ATOM 4363  H HD12 . LEU A 1 53  ? -7.846  1.612   -21.318 1.00 0.00 ? 428 LEU A HD12 3  
ATOM 4364  H HD13 . LEU A 1 53  ? -8.680  2.881   -22.215 1.00 0.00 ? 428 LEU A HD13 3  
ATOM 4365  H HD21 . LEU A 1 53  ? -7.740  -0.221  -22.827 1.00 0.00 ? 428 LEU A HD21 3  
ATOM 4366  H HD22 . LEU A 1 53  ? -9.034  -0.502  -23.990 1.00 0.00 ? 428 LEU A HD22 3  
ATOM 4367  H HD23 . LEU A 1 53  ? -8.085  0.982   -24.069 1.00 0.00 ? 428 LEU A HD23 3  
ATOM 4368  N N    . LYS A 1 54  ? -11.848 -1.762  -20.054 1.00 0.00 ? 429 LYS A N    3  
ATOM 4369  C CA   . LYS A 1 54  ? -12.794 -2.165  -19.023 1.00 0.00 ? 429 LYS A CA   3  
ATOM 4370  C C    . LYS A 1 54  ? -12.075 -2.389  -17.697 1.00 0.00 ? 429 LYS A C    3  
ATOM 4371  O O    . LYS A 1 54  ? -10.845 -2.403  -17.644 1.00 0.00 ? 429 LYS A O    3  
ATOM 4372  C CB   . LYS A 1 54  ? -13.528 -3.442  -19.446 1.00 0.00 ? 429 LYS A CB   3  
ATOM 4373  C CG   . LYS A 1 54  ? -14.933 -3.568  -18.874 1.00 0.00 ? 429 LYS A CG   3  
ATOM 4374  C CD   . LYS A 1 54  ? -15.769 -2.331  -19.160 1.00 0.00 ? 429 LYS A CD   3  
ATOM 4375  C CE   . LYS A 1 54  ? -17.254 -2.612  -18.996 1.00 0.00 ? 429 LYS A CE   3  
ATOM 4376  N NZ   . LYS A 1 54  ? -17.662 -3.870  -19.682 1.00 0.00 ? 429 LYS A NZ   3  
ATOM 4377  H H    . LYS A 1 54  ? -10.898 -1.689  -19.825 1.00 0.00 ? 429 LYS A H    3  
ATOM 4378  H HA   . LYS A 1 54  ? -13.509 -1.366  -18.903 1.00 0.00 ? 429 LYS A HA   3  
ATOM 4379  H HB2  . LYS A 1 54  ? -13.601 -3.461  -20.524 1.00 0.00 ? 429 LYS A HB2  3  
ATOM 4380  H HB3  . LYS A 1 54  ? -12.953 -4.296  -19.120 1.00 0.00 ? 429 LYS A HB3  3  
ATOM 4381  H HG2  . LYS A 1 54  ? -15.415 -4.425  -19.320 1.00 0.00 ? 429 LYS A HG2  3  
ATOM 4382  H HG3  . LYS A 1 54  ? -14.866 -3.708  -17.806 1.00 0.00 ? 429 LYS A HG3  3  
ATOM 4383  H HD2  . LYS A 1 54  ? -15.484 -1.549  -18.473 1.00 0.00 ? 429 LYS A HD2  3  
ATOM 4384  H HD3  . LYS A 1 54  ? -15.582 -2.008  -20.174 1.00 0.00 ? 429 LYS A HD3  3  
ATOM 4385  H HE2  . LYS A 1 54  ? -17.478 -2.698  -17.943 1.00 0.00 ? 429 LYS A HE2  3  
ATOM 4386  H HE3  . LYS A 1 54  ? -17.812 -1.787  -19.416 1.00 0.00 ? 429 LYS A HE3  3  
ATOM 4387  H HZ1  . LYS A 1 54  ? -18.633 -3.781  -20.044 1.00 0.00 ? 429 LYS A HZ1  3  
ATOM 4388  H HZ2  . LYS A 1 54  ? -17.023 -4.066  -20.479 1.00 0.00 ? 429 LYS A HZ2  3  
ATOM 4389  H HZ3  . LYS A 1 54  ? -17.623 -4.668  -19.017 1.00 0.00 ? 429 LYS A HZ3  3  
ATOM 4390  N N    . GLU A 1 55  ? -12.845 -2.569  -16.629 1.00 0.00 ? 430 GLU A N    3  
ATOM 4391  C CA   . GLU A 1 55  ? -12.274 -2.795  -15.306 1.00 0.00 ? 430 GLU A CA   3  
ATOM 4392  C C    . GLU A 1 55  ? -12.039 -4.283  -15.054 1.00 0.00 ? 430 GLU A C    3  
ATOM 4393  O O    . GLU A 1 55  ? -12.070 -4.741  -13.912 1.00 0.00 ? 430 GLU A O    3  
ATOM 4394  C CB   . GLU A 1 55  ? -13.195 -2.227  -14.225 1.00 0.00 ? 430 GLU A CB   3  
ATOM 4395  C CG   . GLU A 1 55  ? -14.592 -2.825  -14.240 1.00 0.00 ? 430 GLU A CG   3  
ATOM 4396  C CD   . GLU A 1 55  ? -15.600 -1.936  -14.943 1.00 0.00 ? 430 GLU A CD   3  
ATOM 4397  O OE1  . GLU A 1 55  ? -15.718 -0.754  -14.558 1.00 0.00 ? 430 GLU A OE1  3  
ATOM 4398  O OE2  . GLU A 1 55  ? -16.272 -2.423  -15.875 1.00 0.00 ? 430 GLU A OE2  3  
ATOM 4399  H H    . GLU A 1 55  ? -13.818 -2.549  -16.732 1.00 0.00 ? 430 GLU A H    3  
ATOM 4400  H HA   . GLU A 1 55  ? -11.325 -2.283  -15.262 1.00 0.00 ? 430 GLU A HA   3  
ATOM 4401  H HB2  . GLU A 1 55  ? -12.756 -2.418  -13.259 1.00 0.00 ? 430 GLU A HB2  3  
ATOM 4402  H HB3  . GLU A 1 55  ? -13.281 -1.159  -14.368 1.00 0.00 ? 430 GLU A HB3  3  
ATOM 4403  H HG2  . GLU A 1 55  ? -14.557 -3.775  -14.751 1.00 0.00 ? 430 GLU A HG2  3  
ATOM 4404  H HG3  . GLU A 1 55  ? -14.915 -2.976  -13.221 1.00 0.00 ? 430 GLU A HG3  3  
ATOM 4405  N N    . ASN A 1 56  ? -11.802 -5.032  -16.128 1.00 0.00 ? 431 ASN A N    3  
ATOM 4406  C CA   . ASN A 1 56  ? -11.558 -6.466  -16.021 1.00 0.00 ? 431 ASN A CA   3  
ATOM 4407  C C    . ASN A 1 56  ? -10.389 -6.891  -16.910 1.00 0.00 ? 431 ASN A C    3  
ATOM 4408  O O    . ASN A 1 56  ? -10.178 -8.081  -17.142 1.00 0.00 ? 431 ASN A O    3  
ATOM 4409  C CB   . ASN A 1 56  ? -12.818 -7.246  -16.404 1.00 0.00 ? 431 ASN A CB   3  
ATOM 4410  C CG   . ASN A 1 56  ? -13.431 -7.969  -15.220 1.00 0.00 ? 431 ASN A CG   3  
ATOM 4411  O OD1  . ASN A 1 56  ? -13.142 -9.140  -14.976 1.00 0.00 ? 431 ASN A OD1  3  
ATOM 4412  N ND2  . ASN A 1 56  ? -14.284 -7.273  -14.478 1.00 0.00 ? 431 ASN A ND2  3  
ATOM 4413  H H    . ASN A 1 56  ? -11.787 -4.613  -17.010 1.00 0.00 ? 431 ASN A H    3  
ATOM 4414  H HA   . ASN A 1 56  ? -11.309 -6.684  -14.993 1.00 0.00 ? 431 ASN A HA   3  
ATOM 4415  H HB2  . ASN A 1 56  ? -13.552 -6.560  -16.801 1.00 0.00 ? 431 ASN A HB2  3  
ATOM 4416  H HB3  . ASN A 1 56  ? -12.569 -7.976  -17.160 1.00 0.00 ? 431 ASN A HB3  3  
ATOM 4417  H HD21 . ASN A 1 56  ? -14.468 -6.343  -14.732 1.00 0.00 ? 431 ASN A HD21 3  
ATOM 4418  H HD22 . ASN A 1 56  ? -14.694 -7.715  -13.706 1.00 0.00 ? 431 ASN A HD22 3  
ATOM 4419  N N    . ASP A 1 57  ? -9.632  -5.913  -17.404 1.00 0.00 ? 432 ASP A N    3  
ATOM 4420  C CA   . ASP A 1 57  ? -8.487  -6.193  -18.262 1.00 0.00 ? 432 ASP A CA   3  
ATOM 4421  C C    . ASP A 1 57  ? -7.201  -5.679  -17.626 1.00 0.00 ? 432 ASP A C    3  
ATOM 4422  O O    . ASP A 1 57  ? -7.234  -5.014  -16.590 1.00 0.00 ? 432 ASP A O    3  
ATOM 4423  C CB   . ASP A 1 57  ? -8.684  -5.553  -19.639 1.00 0.00 ? 432 ASP A CB   3  
ATOM 4424  C CG   . ASP A 1 57  ? -10.067 -5.812  -20.205 1.00 0.00 ? 432 ASP A CG   3  
ATOM 4425  O OD1  . ASP A 1 57  ? -10.519 -6.975  -20.161 1.00 0.00 ? 432 ASP A OD1  3  
ATOM 4426  O OD2  . ASP A 1 57  ? -10.697 -4.851  -20.692 1.00 0.00 ? 432 ASP A OD2  3  
ATOM 4427  H H    . ASP A 1 57  ? -9.845  -4.983  -17.185 1.00 0.00 ? 432 ASP A H    3  
ATOM 4428  H HA   . ASP A 1 57  ? -8.414  -7.263  -18.378 1.00 0.00 ? 432 ASP A HA   3  
ATOM 4429  H HB2  . ASP A 1 57  ? -8.543  -4.487  -19.557 1.00 0.00 ? 432 ASP A HB2  3  
ATOM 4430  H HB3  . ASP A 1 57  ? -7.953  -5.958  -20.324 1.00 0.00 ? 432 ASP A HB3  3  
ATOM 4431  N N    . VAL A 1 58  ? -6.069  -5.993  -18.245 1.00 0.00 ? 433 VAL A N    3  
ATOM 4432  C CA   . VAL A 1 58  ? -4.777  -5.561  -17.729 1.00 0.00 ? 433 VAL A CA   3  
ATOM 4433  C C    . VAL A 1 58  ? -3.860  -5.089  -18.852 1.00 0.00 ? 433 VAL A C    3  
ATOM 4434  O O    . VAL A 1 58  ? -3.497  -5.863  -19.737 1.00 0.00 ? 433 VAL A O    3  
ATOM 4435  C CB   . VAL A 1 58  ? -4.076  -6.693  -16.954 1.00 0.00 ? 433 VAL A CB   3  
ATOM 4436  C CG1  . VAL A 1 58  ? -2.805  -6.184  -16.291 1.00 0.00 ? 433 VAL A CG1  3  
ATOM 4437  C CG2  . VAL A 1 58  ? -5.018  -7.297  -15.923 1.00 0.00 ? 433 VAL A CG2  3  
ATOM 4438  H H    . VAL A 1 58  ? -6.103  -6.528  -19.066 1.00 0.00 ? 433 VAL A H    3  
ATOM 4439  H HA   . VAL A 1 58  ? -4.948  -4.740  -17.048 1.00 0.00 ? 433 VAL A HA   3  
ATOM 4440  H HB   . VAL A 1 58  ? -3.803  -7.466  -17.656 1.00 0.00 ? 433 VAL A HB   3  
ATOM 4441  H HG11 . VAL A 1 58  ? -2.438  -5.322  -16.827 1.00 0.00 ? 433 VAL A HG11 3  
ATOM 4442  H HG12 . VAL A 1 58  ? -3.018  -5.909  -15.268 1.00 0.00 ? 433 VAL A HG12 3  
ATOM 4443  H HG13 . VAL A 1 58  ? -2.056  -6.962  -16.305 1.00 0.00 ? 433 VAL A HG13 3  
ATOM 4444  H HG21 . VAL A 1 58  ? -5.136  -6.611  -15.097 1.00 0.00 ? 433 VAL A HG21 3  
ATOM 4445  H HG22 . VAL A 1 58  ? -5.980  -7.481  -16.379 1.00 0.00 ? 433 VAL A HG22 3  
ATOM 4446  H HG23 . VAL A 1 58  ? -4.607  -8.228  -15.562 1.00 0.00 ? 433 VAL A HG23 3  
ATOM 4447  N N    . ILE A 1 59  ? -3.480  -3.816  -18.804 1.00 0.00 ? 434 ILE A N    3  
ATOM 4448  C CA   . ILE A 1 59  ? -2.596  -3.248  -19.813 1.00 0.00 ? 434 ILE A CA   3  
ATOM 4449  C C    . ILE A 1 59  ? -1.214  -3.887  -19.731 1.00 0.00 ? 434 ILE A C    3  
ATOM 4450  O O    . ILE A 1 59  ? -0.724  -4.183  -18.642 1.00 0.00 ? 434 ILE A O    3  
ATOM 4451  C CB   . ILE A 1 59  ? -2.461  -1.720  -19.657 1.00 0.00 ? 434 ILE A CB   3  
ATOM 4452  C CG1  . ILE A 1 59  ? -3.845  -1.067  -19.601 1.00 0.00 ? 434 ILE A CG1  3  
ATOM 4453  C CG2  . ILE A 1 59  ? -1.641  -1.141  -20.802 1.00 0.00 ? 434 ILE A CG2  3  
ATOM 4454  C CD1  . ILE A 1 59  ? -4.284  -0.699  -18.200 1.00 0.00 ? 434 ILE A CD1  3  
ATOM 4455  H H    . ILE A 1 59  ? -3.796  -3.248  -18.071 1.00 0.00 ? 434 ILE A H    3  
ATOM 4456  H HA   . ILE A 1 59  ? -3.021  -3.456  -20.784 1.00 0.00 ? 434 ILE A HA   3  
ATOM 4457  H HB   . ILE A 1 59  ? -1.937  -1.518  -18.733 1.00 0.00 ? 434 ILE A HB   3  
ATOM 4458  H HG12 . ILE A 1 59  ? -3.835  -0.164  -20.192 1.00 0.00 ? 434 ILE A HG12 3  
ATOM 4459  H HG13 . ILE A 1 59  ? -4.575  -1.752  -20.008 1.00 0.00 ? 434 ILE A HG13 3  
ATOM 4460  H HG21 . ILE A 1 59  ? -1.662  -1.821  -21.639 1.00 0.00 ? 434 ILE A HG21 3  
ATOM 4461  H HG22 . ILE A 1 59  ? -2.060  -0.191  -21.100 1.00 0.00 ? 434 ILE A HG22 3  
ATOM 4462  H HG23 . ILE A 1 59  ? -0.621  -0.998  -20.477 1.00 0.00 ? 434 ILE A HG23 3  
ATOM 4463  H HD11 . ILE A 1 59  ? -5.228  -1.176  -17.981 1.00 0.00 ? 434 ILE A HD11 3  
ATOM 4464  H HD12 . ILE A 1 59  ? -3.541  -1.029  -17.490 1.00 0.00 ? 434 ILE A HD12 3  
ATOM 4465  H HD13 . ILE A 1 59  ? -4.397  0.373   -18.129 1.00 0.00 ? 434 ILE A HD13 3  
ATOM 4466  N N    . ILE A 1 60  ? -0.594  -4.105  -20.885 1.00 0.00 ? 435 ILE A N    3  
ATOM 4467  C CA   . ILE A 1 60  ? 0.726   -4.719  -20.929 1.00 0.00 ? 435 ILE A CA   3  
ATOM 4468  C C    . ILE A 1 60  ? 1.643   -4.006  -21.916 1.00 0.00 ? 435 ILE A C    3  
ATOM 4469  O O    . ILE A 1 60  ? 2.797   -3.716  -21.604 1.00 0.00 ? 435 ILE A O    3  
ATOM 4470  C CB   . ILE A 1 60  ? 0.641   -6.211  -21.307 1.00 0.00 ? 435 ILE A CB   3  
ATOM 4471  C CG1  . ILE A 1 60  ? -0.212  -6.400  -22.565 1.00 0.00 ? 435 ILE A CG1  3  
ATOM 4472  C CG2  . ILE A 1 60  ? 0.072   -7.016  -20.148 1.00 0.00 ? 435 ILE A CG2  3  
ATOM 4473  C CD1  . ILE A 1 60  ? 0.602   -6.534  -23.833 1.00 0.00 ? 435 ILE A CD1  3  
ATOM 4474  H H    . ILE A 1 60  ? -1.036  -3.853  -21.722 1.00 0.00 ? 435 ILE A H    3  
ATOM 4475  H HA   . ILE A 1 60  ? 1.158   -4.646  -19.941 1.00 0.00 ? 435 ILE A HA   3  
ATOM 4476  H HB   . ILE A 1 60  ? 1.641   -6.567  -21.503 1.00 0.00 ? 435 ILE A HB   3  
ATOM 4477  H HG12 . ILE A 1 60  ? -0.808  -7.294  -22.459 1.00 0.00 ? 435 ILE A HG12 3  
ATOM 4478  H HG13 . ILE A 1 60  ? -0.867  -5.549  -22.680 1.00 0.00 ? 435 ILE A HG13 3  
ATOM 4479  H HG21 . ILE A 1 60  ? -0.514  -6.369  -19.512 1.00 0.00 ? 435 ILE A HG21 3  
ATOM 4480  H HG22 . ILE A 1 60  ? -0.554  -7.807  -20.532 1.00 0.00 ? 435 ILE A HG22 3  
ATOM 4481  H HG23 . ILE A 1 60  ? 0.882   -7.444  -19.575 1.00 0.00 ? 435 ILE A HG23 3  
ATOM 4482  H HD11 . ILE A 1 60  ? 0.511   -5.631  -24.416 1.00 0.00 ? 435 ILE A HD11 3  
ATOM 4483  H HD12 . ILE A 1 60  ? 1.639   -6.697  -23.580 1.00 0.00 ? 435 ILE A HD12 3  
ATOM 4484  H HD13 . ILE A 1 60  ? 0.236   -7.373  -24.408 1.00 0.00 ? 435 ILE A HD13 3  
ATOM 4485  N N    . SER A 1 61  ? 1.126   -3.729  -23.108 1.00 0.00 ? 436 SER A N    3  
ATOM 4486  C CA   . SER A 1 61  ? 1.909   -3.052  -24.135 1.00 0.00 ? 436 SER A CA   3  
ATOM 4487  C C    . SER A 1 61  ? 1.236   -1.755  -24.571 1.00 0.00 ? 436 SER A C    3  
ATOM 4488  O O    . SER A 1 61  ? 0.025   -1.593  -24.427 1.00 0.00 ? 436 SER A O    3  
ATOM 4489  C CB   . SER A 1 61  ? 2.106   -3.968  -25.345 1.00 0.00 ? 436 SER A CB   3  
ATOM 4490  O OG   . SER A 1 61  ? 0.951   -3.987  -26.165 1.00 0.00 ? 436 SER A OG   3  
ATOM 4491  H H    . SER A 1 61  ? 0.201   -3.987  -23.302 1.00 0.00 ? 436 SER A H    3  
ATOM 4492  H HA   . SER A 1 61  ? 2.875   -2.816  -23.714 1.00 0.00 ? 436 SER A HA   3  
ATOM 4493  H HB2  . SER A 1 61  ? 2.941   -3.613  -25.930 1.00 0.00 ? 436 SER A HB2  3  
ATOM 4494  H HB3  . SER A 1 61  ? 2.307   -4.972  -25.003 1.00 0.00 ? 436 SER A HB3  3  
ATOM 4495  H HG   . SER A 1 61  ? 0.168   -4.061  -25.613 1.00 0.00 ? 436 SER A HG   3  
ATOM 4496  N N    . ILE A 1 62  ? 2.032   -0.836  -25.106 1.00 0.00 ? 437 ILE A N    3  
ATOM 4497  C CA   . ILE A 1 62  ? 1.517   0.448   -25.567 1.00 0.00 ? 437 ILE A CA   3  
ATOM 4498  C C    . ILE A 1 62  ? 2.370   1.003   -26.704 1.00 0.00 ? 437 ILE A C    3  
ATOM 4499  O O    . ILE A 1 62  ? 3.582   1.158   -26.564 1.00 0.00 ? 437 ILE A O    3  
ATOM 4500  C CB   . ILE A 1 62  ? 1.463   1.479   -24.420 1.00 0.00 ? 437 ILE A CB   3  
ATOM 4501  C CG1  . ILE A 1 62  ? 0.769   2.763   -24.887 1.00 0.00 ? 437 ILE A CG1  3  
ATOM 4502  C CG2  . ILE A 1 62  ? 2.862   1.781   -23.904 1.00 0.00 ? 437 ILE A CG2  3  
ATOM 4503  C CD1  . ILE A 1 62  ? -0.486  3.087   -24.107 1.00 0.00 ? 437 ILE A CD1  3  
ATOM 4504  H H    . ILE A 1 62  ? 2.989   -1.026  -25.194 1.00 0.00 ? 437 ILE A H    3  
ATOM 4505  H HA   . ILE A 1 62  ? 0.511   0.290   -25.930 1.00 0.00 ? 437 ILE A HA   3  
ATOM 4506  H HB   . ILE A 1 62  ? 0.894   1.049   -23.609 1.00 0.00 ? 437 ILE A HB   3  
ATOM 4507  H HG12 . ILE A 1 62  ? 1.449   3.594   -24.778 1.00 0.00 ? 437 ILE A HG12 3  
ATOM 4508  H HG13 . ILE A 1 62  ? 0.496   2.661   -25.928 1.00 0.00 ? 437 ILE A HG13 3  
ATOM 4509  H HG21 . ILE A 1 62  ? 3.376   0.854   -23.693 1.00 0.00 ? 437 ILE A HG21 3  
ATOM 4510  H HG22 . ILE A 1 62  ? 3.412   2.335   -24.651 1.00 0.00 ? 437 ILE A HG22 3  
ATOM 4511  H HG23 . ILE A 1 62  ? 2.794   2.367   -22.999 1.00 0.00 ? 437 ILE A HG23 3  
ATOM 4512  H HD11 . ILE A 1 62  ? -1.351  2.754   -24.661 1.00 0.00 ? 437 ILE A HD11 3  
ATOM 4513  H HD12 . ILE A 1 62  ? -0.456  2.585   -23.151 1.00 0.00 ? 437 ILE A HD12 3  
ATOM 4514  H HD13 . ILE A 1 62  ? -0.547  4.154   -23.952 1.00 0.00 ? 437 ILE A HD13 3  
ATOM 4515  N N    . ASN A 1 63  ? 1.724   1.295   -27.832 1.00 0.00 ? 438 ASN A N    3  
ATOM 4516  C CA   . ASN A 1 63  ? 2.412   1.832   -29.005 1.00 0.00 ? 438 ASN A CA   3  
ATOM 4517  C C    . ASN A 1 63  ? 3.713   1.080   -29.287 1.00 0.00 ? 438 ASN A C    3  
ATOM 4518  O O    . ASN A 1 63  ? 4.672   1.653   -29.805 1.00 0.00 ? 438 ASN A O    3  
ATOM 4519  C CB   . ASN A 1 63  ? 2.701   3.325   -28.815 1.00 0.00 ? 438 ASN A CB   3  
ATOM 4520  C CG   . ASN A 1 63  ? 3.727   3.588   -27.730 1.00 0.00 ? 438 ASN A CG   3  
ATOM 4521  O OD1  . ASN A 1 63  ? 4.928   3.420   -27.941 1.00 0.00 ? 438 ASN A OD1  3  
ATOM 4522  N ND2  . ASN A 1 63  ? 3.255   4.002   -26.560 1.00 0.00 ? 438 ASN A ND2  3  
ATOM 4523  H H    . ASN A 1 63  ? 0.757   1.144   -27.877 1.00 0.00 ? 438 ASN A H    3  
ATOM 4524  H HA   . ASN A 1 63  ? 1.755   1.713   -29.853 1.00 0.00 ? 438 ASN A HA   3  
ATOM 4525  H HB2  . ASN A 1 63  ? 3.074   3.734   -29.742 1.00 0.00 ? 438 ASN A HB2  3  
ATOM 4526  H HB3  . ASN A 1 63  ? 1.784   3.830   -28.548 1.00 0.00 ? 438 ASN A HB3  3  
ATOM 4527  H HD21 . ASN A 1 63  ? 2.287   4.113   -26.465 1.00 0.00 ? 438 ASN A HD21 3  
ATOM 4528  H HD22 . ASN A 1 63  ? 3.896   4.178   -25.839 1.00 0.00 ? 438 ASN A HD22 3  
ATOM 4529  N N    . GLY A 1 64  ? 3.737   -0.204  -28.946 1.00 0.00 ? 439 GLY A N    3  
ATOM 4530  C CA   . GLY A 1 64  ? 4.924   -1.008  -29.174 1.00 0.00 ? 439 GLY A CA   3  
ATOM 4531  C C    . GLY A 1 64  ? 5.888   -0.970  -28.004 1.00 0.00 ? 439 GLY A C    3  
ATOM 4532  O O    . GLY A 1 64  ? 7.094   -1.146  -28.179 1.00 0.00 ? 439 GLY A O    3  
ATOM 4533  H H    . GLY A 1 64  ? 2.944   -0.609  -28.538 1.00 0.00 ? 439 GLY A H    3  
ATOM 4534  H HA2  . GLY A 1 64  ? 4.624   -2.031  -29.344 1.00 0.00 ? 439 GLY A HA2  3  
ATOM 4535  H HA3  . GLY A 1 64  ? 5.429   -0.641  -30.055 1.00 0.00 ? 439 GLY A HA3  3  
ATOM 4536  N N    . GLN A 1 65  ? 5.357   -0.741  -26.808 1.00 0.00 ? 440 GLN A N    3  
ATOM 4537  C CA   . GLN A 1 65  ? 6.179   -0.682  -25.604 1.00 0.00 ? 440 GLN A CA   3  
ATOM 4538  C C    . GLN A 1 65  ? 5.777   -1.778  -24.622 1.00 0.00 ? 440 GLN A C    3  
ATOM 4539  O O    . GLN A 1 65  ? 4.763   -2.449  -24.809 1.00 0.00 ? 440 GLN A O    3  
ATOM 4540  C CB   . GLN A 1 65  ? 6.050   0.690   -24.940 1.00 0.00 ? 440 GLN A CB   3  
ATOM 4541  C CG   . GLN A 1 65  ? 6.726   1.806   -25.717 1.00 0.00 ? 440 GLN A CG   3  
ATOM 4542  C CD   . GLN A 1 65  ? 8.072   2.190   -25.135 1.00 0.00 ? 440 GLN A CD   3  
ATOM 4543  O OE1  . GLN A 1 65  ? 9.119   1.788   -25.642 1.00 0.00 ? 440 GLN A OE1  3  
ATOM 4544  N NE2  . GLN A 1 65  ? 8.051   2.974   -24.063 1.00 0.00 ? 440 GLN A NE2  3  
ATOM 4545  H H    . GLN A 1 65  ? 4.389   -0.610  -26.732 1.00 0.00 ? 440 GLN A H    3  
ATOM 4546  H HA   . GLN A 1 65  ? 7.207   -0.836  -25.896 1.00 0.00 ? 440 GLN A HA   3  
ATOM 4547  H HB2  . GLN A 1 65  ? 5.004   0.932   -24.840 1.00 0.00 ? 440 GLN A HB2  3  
ATOM 4548  H HB3  . GLN A 1 65  ? 6.496   0.644   -23.956 1.00 0.00 ? 440 GLN A HB3  3  
ATOM 4549  H HG2  . GLN A 1 65  ? 6.873   1.481   -26.736 1.00 0.00 ? 440 GLN A HG2  3  
ATOM 4550  H HG3  . GLN A 1 65  ? 6.084   2.675   -25.706 1.00 0.00 ? 440 GLN A HG3  3  
ATOM 4551  H HE21 . GLN A 1 65  ? 7.180   3.257   -23.713 1.00 0.00 ? 440 GLN A HE21 3  
ATOM 4552  H HE22 . GLN A 1 65  ? 8.907   3.238   -23.666 1.00 0.00 ? 440 GLN A HE22 3  
ATOM 4553  N N    . SER A 1 66  ? 6.580   -1.957  -23.579 1.00 0.00 ? 441 SER A N    3  
ATOM 4554  C CA   . SER A 1 66  ? 6.307   -2.976  -22.571 1.00 0.00 ? 441 SER A CA   3  
ATOM 4555  C C    . SER A 1 66  ? 6.092   -2.348  -21.198 1.00 0.00 ? 441 SER A C    3  
ATOM 4556  O O    . SER A 1 66  ? 7.026   -1.821  -20.592 1.00 0.00 ? 441 SER A O    3  
ATOM 4557  C CB   . SER A 1 66  ? 7.457   -3.982  -22.508 1.00 0.00 ? 441 SER A CB   3  
ATOM 4558  O OG   . SER A 1 66  ? 7.403   -4.888  -23.596 1.00 0.00 ? 441 SER A OG   3  
ATOM 4559  H H    . SER A 1 66  ? 7.376   -1.393  -23.485 1.00 0.00 ? 441 SER A H    3  
ATOM 4560  H HA   . SER A 1 66  ? 5.405   -3.494  -22.861 1.00 0.00 ? 441 SER A HA   3  
ATOM 4561  H HB2  . SER A 1 66  ? 8.398   -3.453  -22.543 1.00 0.00 ? 441 SER A HB2  3  
ATOM 4562  H HB3  . SER A 1 66  ? 7.395   -4.540  -21.586 1.00 0.00 ? 441 SER A HB3  3  
ATOM 4563  H HG   . SER A 1 66  ? 8.257   -5.315  -23.700 1.00 0.00 ? 441 SER A HG   3  
ATOM 4564  N N    . VAL A 1 67  ? 4.857   -2.411  -20.710 1.00 0.00 ? 442 VAL A N    3  
ATOM 4565  C CA   . VAL A 1 67  ? 4.519   -1.853  -19.406 1.00 0.00 ? 442 VAL A CA   3  
ATOM 4566  C C    . VAL A 1 67  ? 4.516   -2.939  -18.334 1.00 0.00 ? 442 VAL A C    3  
ATOM 4567  O O    . VAL A 1 67  ? 4.436   -4.128  -18.644 1.00 0.00 ? 442 VAL A O    3  
ATOM 4568  C CB   . VAL A 1 67  ? 3.140   -1.164  -19.427 1.00 0.00 ? 442 VAL A CB   3  
ATOM 4569  C CG1  . VAL A 1 67  ? 2.939   -0.337  -18.167 1.00 0.00 ? 442 VAL A CG1  3  
ATOM 4570  C CG2  . VAL A 1 67  ? 2.990   -0.297  -20.668 1.00 0.00 ? 442 VAL A CG2  3  
ATOM 4571  H H    . VAL A 1 67  ? 4.157   -2.846  -21.240 1.00 0.00 ? 442 VAL A H    3  
ATOM 4572  H HA   . VAL A 1 67  ? 5.266   -1.114  -19.155 1.00 0.00 ? 442 VAL A HA   3  
ATOM 4573  H HB   . VAL A 1 67  ? 2.378   -1.929  -19.453 1.00 0.00 ? 442 VAL A HB   3  
ATOM 4574  H HG11 . VAL A 1 67  ? 3.896   0.003   -17.802 1.00 0.00 ? 442 VAL A HG11 3  
ATOM 4575  H HG12 . VAL A 1 67  ? 2.317   0.516   -18.394 1.00 0.00 ? 442 VAL A HG12 3  
ATOM 4576  H HG13 . VAL A 1 67  ? 2.459   -0.942  -17.411 1.00 0.00 ? 442 VAL A HG13 3  
ATOM 4577  H HG21 . VAL A 1 67  ? 2.457   0.609   -20.413 1.00 0.00 ? 442 VAL A HG21 3  
ATOM 4578  H HG22 . VAL A 1 67  ? 3.967   -0.042  -21.050 1.00 0.00 ? 442 VAL A HG22 3  
ATOM 4579  H HG23 . VAL A 1 67  ? 2.440   -0.839  -21.421 1.00 0.00 ? 442 VAL A HG23 3  
ATOM 4580  N N    . VAL A 1 68  ? 4.604   -2.526  -17.073 1.00 0.00 ? 443 VAL A N    3  
ATOM 4581  C CA   . VAL A 1 68  ? 4.614   -3.472  -15.964 1.00 0.00 ? 443 VAL A CA   3  
ATOM 4582  C C    . VAL A 1 68  ? 3.776   -2.968  -14.792 1.00 0.00 ? 443 VAL A C    3  
ATOM 4583  O O    . VAL A 1 68  ? 2.955   -3.705  -14.244 1.00 0.00 ? 443 VAL A O    3  
ATOM 4584  C CB   . VAL A 1 68  ? 6.048   -3.748  -15.471 1.00 0.00 ? 443 VAL A CB   3  
ATOM 4585  C CG1  . VAL A 1 68  ? 6.799   -4.617  -16.470 1.00 0.00 ? 443 VAL A CG1  3  
ATOM 4586  C CG2  . VAL A 1 68  ? 6.789   -2.443  -15.220 1.00 0.00 ? 443 VAL A CG2  3  
ATOM 4587  H H    . VAL A 1 68  ? 4.668   -1.567  -16.886 1.00 0.00 ? 443 VAL A H    3  
ATOM 4588  H HA   . VAL A 1 68  ? 4.194   -4.402  -16.317 1.00 0.00 ? 443 VAL A HA   3  
ATOM 4589  H HB   . VAL A 1 68  ? 5.987   -4.286  -14.536 1.00 0.00 ? 443 VAL A HB   3  
ATOM 4590  H HG11 . VAL A 1 68  ? 6.224   -4.700  -17.380 1.00 0.00 ? 443 VAL A HG11 3  
ATOM 4591  H HG12 . VAL A 1 68  ? 7.757   -4.170  -16.689 1.00 0.00 ? 443 VAL A HG12 3  
ATOM 4592  H HG13 . VAL A 1 68  ? 6.950   -5.600  -16.048 1.00 0.00 ? 443 VAL A HG13 3  
ATOM 4593  H HG21 . VAL A 1 68  ? 7.833   -2.569  -15.466 1.00 0.00 ? 443 VAL A HG21 3  
ATOM 4594  H HG22 . VAL A 1 68  ? 6.365   -1.662  -15.835 1.00 0.00 ? 443 VAL A HG22 3  
ATOM 4595  H HG23 . VAL A 1 68  ? 6.696   -2.170  -14.179 1.00 0.00 ? 443 VAL A HG23 3  
ATOM 4596  N N    . SER A 1 69  ? 3.989   -1.713  -14.406 1.00 0.00 ? 444 SER A N    3  
ATOM 4597  C CA   . SER A 1 69  ? 3.252   -1.123  -13.294 1.00 0.00 ? 444 SER A CA   3  
ATOM 4598  C C    . SER A 1 69  ? 2.577   0.181   -13.707 1.00 0.00 ? 444 SER A C    3  
ATOM 4599  O O    . SER A 1 69  ? 2.861   0.732   -14.770 1.00 0.00 ? 444 SER A O    3  
ATOM 4600  C CB   . SER A 1 69  ? 4.190   -0.872  -12.112 1.00 0.00 ? 444 SER A CB   3  
ATOM 4601  O OG   . SER A 1 69  ? 5.510   -0.609  -12.555 1.00 0.00 ? 444 SER A OG   3  
ATOM 4602  H H    . SER A 1 69  ? 4.658   -1.174  -14.877 1.00 0.00 ? 444 SER A H    3  
ATOM 4603  H HA   . SER A 1 69  ? 2.491   -1.826  -12.993 1.00 0.00 ? 444 SER A HA   3  
ATOM 4604  H HB2  . SER A 1 69  ? 3.836   -0.020  -11.549 1.00 0.00 ? 444 SER A HB2  3  
ATOM 4605  H HB3  . SER A 1 69  ? 4.203   -1.744  -11.475 1.00 0.00 ? 444 SER A HB3  3  
ATOM 4606  H HG   . SER A 1 69  ? 6.051   -1.392  -12.432 1.00 0.00 ? 444 SER A HG   3  
ATOM 4607  N N    . ALA A 1 70  ? 1.680   0.670   -12.854 1.00 0.00 ? 445 ALA A N    3  
ATOM 4608  C CA   . ALA A 1 70  ? 0.959   1.909   -13.121 1.00 0.00 ? 445 ALA A CA   3  
ATOM 4609  C C    . ALA A 1 70  ? 1.923   3.072   -13.327 1.00 0.00 ? 445 ALA A C    3  
ATOM 4610  O O    . ALA A 1 70  ? 1.729   3.904   -14.213 1.00 0.00 ? 445 ALA A O    3  
ATOM 4611  C CB   . ALA A 1 70  ? -0.002  2.215   -11.983 1.00 0.00 ? 445 ALA A CB   3  
ATOM 4612  H H    . ALA A 1 70  ? 1.499   0.183   -12.023 1.00 0.00 ? 445 ALA A H    3  
ATOM 4613  H HA   . ALA A 1 70  ? 0.380   1.771   -14.023 1.00 0.00 ? 445 ALA A HA   3  
ATOM 4614  H HB1  . ALA A 1 70  ? -0.827  1.519   -12.013 1.00 0.00 ? 445 ALA A HB1  3  
ATOM 4615  H HB2  . ALA A 1 70  ? 0.515   2.120   -11.039 1.00 0.00 ? 445 ALA A HB2  3  
ATOM 4616  H HB3  . ALA A 1 70  ? -0.376  3.222   -12.089 1.00 0.00 ? 445 ALA A HB3  3  
ATOM 4617  N N    . ASN A 1 71  ? 2.967   3.123   -12.504 1.00 0.00 ? 446 ASN A N    3  
ATOM 4618  C CA   . ASN A 1 71  ? 3.964   4.183   -12.598 1.00 0.00 ? 446 ASN A CA   3  
ATOM 4619  C C    . ASN A 1 71  ? 4.560   4.243   -14.000 1.00 0.00 ? 446 ASN A C    3  
ATOM 4620  O O    . ASN A 1 71  ? 5.022   5.294   -14.446 1.00 0.00 ? 446 ASN A O    3  
ATOM 4621  C CB   . ASN A 1 71  ? 5.073   3.962   -11.567 1.00 0.00 ? 446 ASN A CB   3  
ATOM 4622  C CG   . ASN A 1 71  ? 5.633   2.554   -11.615 1.00 0.00 ? 446 ASN A CG   3  
ATOM 4623  O OD1  . ASN A 1 71  ? 5.607   1.897   -12.656 1.00 0.00 ? 446 ASN A OD1  3  
ATOM 4624  N ND2  . ASN A 1 71  ? 6.145   2.082   -10.484 1.00 0.00 ? 446 ASN A ND2  3  
ATOM 4625  H H    . ASN A 1 71  ? 3.069   2.429   -11.819 1.00 0.00 ? 446 ASN A H    3  
ATOM 4626  H HA   . ASN A 1 71  ? 3.472   5.121   -12.389 1.00 0.00 ? 446 ASN A HA   3  
ATOM 4627  H HB2  . ASN A 1 71  ? 5.877   4.656   -11.760 1.00 0.00 ? 446 ASN A HB2  3  
ATOM 4628  H HB3  . ASN A 1 71  ? 4.677   4.141   -10.578 1.00 0.00 ? 446 ASN A HB3  3  
ATOM 4629  H HD21 . ASN A 1 71  ? 6.133   2.660   -9.693  1.00 0.00 ? 446 ASN A HD21 3  
ATOM 4630  H HD22 . ASN A 1 71  ? 6.514   1.174   -10.486 1.00 0.00 ? 446 ASN A HD22 3  
ATOM 4631  N N    . ASP A 1 72  ? 4.543   3.109   -14.693 1.00 0.00 ? 447 ASP A N    3  
ATOM 4632  C CA   . ASP A 1 72  ? 5.078   3.031   -16.046 1.00 0.00 ? 447 ASP A CA   3  
ATOM 4633  C C    . ASP A 1 72  ? 4.015   3.418   -17.070 1.00 0.00 ? 447 ASP A C    3  
ATOM 4634  O O    . ASP A 1 72  ? 4.330   3.937   -18.139 1.00 0.00 ? 447 ASP A O    3  
ATOM 4635  C CB   . ASP A 1 72  ? 5.588   1.618   -16.334 1.00 0.00 ? 447 ASP A CB   3  
ATOM 4636  C CG   . ASP A 1 72  ? 7.003   1.399   -15.835 1.00 0.00 ? 447 ASP A CG   3  
ATOM 4637  O OD1  . ASP A 1 72  ? 7.928   2.043   -16.373 1.00 0.00 ? 447 ASP A OD1  3  
ATOM 4638  O OD2  . ASP A 1 72  ? 7.186   0.585   -14.906 1.00 0.00 ? 447 ASP A OD2  3  
ATOM 4639  H H    . ASP A 1 72  ? 4.159   2.305   -14.286 1.00 0.00 ? 447 ASP A H    3  
ATOM 4640  H HA   . ASP A 1 72  ? 5.902   3.724   -16.118 1.00 0.00 ? 447 ASP A HA   3  
ATOM 4641  H HB2  . ASP A 1 72  ? 4.942   0.901   -15.849 1.00 0.00 ? 447 ASP A HB2  3  
ATOM 4642  H HB3  . ASP A 1 72  ? 5.571   1.445   -17.401 1.00 0.00 ? 447 ASP A HB3  3  
ATOM 4643  N N    . VAL A 1 73  ? 2.754   3.160   -16.733 1.00 0.00 ? 448 VAL A N    3  
ATOM 4644  C CA   . VAL A 1 73  ? 1.642   3.478   -17.621 1.00 0.00 ? 448 VAL A CA   3  
ATOM 4645  C C    . VAL A 1 73  ? 1.399   4.985   -17.689 1.00 0.00 ? 448 VAL A C    3  
ATOM 4646  O O    . VAL A 1 73  ? 1.194   5.542   -18.767 1.00 0.00 ? 448 VAL A O    3  
ATOM 4647  C CB   . VAL A 1 73  ? 0.339   2.793   -17.162 1.00 0.00 ? 448 VAL A CB   3  
ATOM 4648  C CG1  . VAL A 1 73  ? -0.734  2.907   -18.233 1.00 0.00 ? 448 VAL A CG1  3  
ATOM 4649  C CG2  . VAL A 1 73  ? 0.588   1.335   -16.803 1.00 0.00 ? 448 VAL A CG2  3  
ATOM 4650  H H    . VAL A 1 73  ? 2.568   2.744   -15.866 1.00 0.00 ? 448 VAL A H    3  
ATOM 4651  H HA   . VAL A 1 73  ? 1.886   3.116   -18.609 1.00 0.00 ? 448 VAL A HA   3  
ATOM 4652  H HB   . VAL A 1 73  ? -0.016  3.301   -16.277 1.00 0.00 ? 448 VAL A HB   3  
ATOM 4653  H HG11 . VAL A 1 73  ? -0.661  3.871   -18.715 1.00 0.00 ? 448 VAL A HG11 3  
ATOM 4654  H HG12 . VAL A 1 73  ? -0.595  2.127   -18.967 1.00 0.00 ? 448 VAL A HG12 3  
ATOM 4655  H HG13 . VAL A 1 73  ? -1.709  2.805   -17.779 1.00 0.00 ? 448 VAL A HG13 3  
ATOM 4656  H HG21 . VAL A 1 73  ? 0.215   0.699   -17.593 1.00 0.00 ? 448 VAL A HG21 3  
ATOM 4657  H HG22 . VAL A 1 73  ? 1.647   1.168   -16.678 1.00 0.00 ? 448 VAL A HG22 3  
ATOM 4658  H HG23 . VAL A 1 73  ? 0.076   1.102   -15.882 1.00 0.00 ? 448 VAL A HG23 3  
ATOM 4659  N N    . SER A 1 74  ? 1.416   5.633   -16.528 1.00 0.00 ? 449 SER A N    3  
ATOM 4660  C CA   . SER A 1 74  ? 1.187   7.073   -16.442 1.00 0.00 ? 449 SER A CA   3  
ATOM 4661  C C    . SER A 1 74  ? 2.078   7.844   -17.415 1.00 0.00 ? 449 SER A C    3  
ATOM 4662  O O    . SER A 1 74  ? 1.586   8.490   -18.340 1.00 0.00 ? 449 SER A O    3  
ATOM 4663  C CB   . SER A 1 74  ? 1.435   7.564   -15.015 1.00 0.00 ? 449 SER A CB   3  
ATOM 4664  O OG   . SER A 1 74  ? 0.764   8.789   -14.772 1.00 0.00 ? 449 SER A OG   3  
ATOM 4665  H H    . SER A 1 74  ? 1.577   5.127   -15.703 1.00 0.00 ? 449 SER A H    3  
ATOM 4666  H HA   . SER A 1 74  ? 0.155   7.258   -16.698 1.00 0.00 ? 449 SER A HA   3  
ATOM 4667  H HB2  . SER A 1 74  ? 1.074   6.826   -14.314 1.00 0.00 ? 449 SER A HB2  3  
ATOM 4668  H HB3  . SER A 1 74  ? 2.495   7.713   -14.866 1.00 0.00 ? 449 SER A HB3  3  
ATOM 4669  H HG   . SER A 1 74  ? 1.407   9.471   -14.567 1.00 0.00 ? 449 SER A HG   3  
ATOM 4670  N N    . ASP A 1 75  ? 3.387   7.778   -17.194 1.00 0.00 ? 450 ASP A N    3  
ATOM 4671  C CA   . ASP A 1 75  ? 4.349   8.478   -18.045 1.00 0.00 ? 450 ASP A CA   3  
ATOM 4672  C C    . ASP A 1 75  ? 4.045   8.263   -19.527 1.00 0.00 ? 450 ASP A C    3  
ATOM 4673  O O    . ASP A 1 75  ? 4.221   9.168   -20.342 1.00 0.00 ? 450 ASP A O    3  
ATOM 4674  C CB   . ASP A 1 75  ? 5.771   8.011   -17.730 1.00 0.00 ? 450 ASP A CB   3  
ATOM 4675  C CG   . ASP A 1 75  ? 5.979   6.541   -18.034 1.00 0.00 ? 450 ASP A CG   3  
ATOM 4676  O OD1  . ASP A 1 75  ? 6.187   6.204   -19.218 1.00 0.00 ? 450 ASP A OD1  3  
ATOM 4677  O OD2  . ASP A 1 75  ? 5.932   5.728   -17.087 1.00 0.00 ? 450 ASP A OD2  3  
ATOM 4678  H H    . ASP A 1 75  ? 3.718   7.252   -16.436 1.00 0.00 ? 450 ASP A H    3  
ATOM 4679  H HA   . ASP A 1 75  ? 4.272   9.533   -17.827 1.00 0.00 ? 450 ASP A HA   3  
ATOM 4680  H HB2  . ASP A 1 75  ? 6.471   8.584   -18.321 1.00 0.00 ? 450 ASP A HB2  3  
ATOM 4681  H HB3  . ASP A 1 75  ? 5.973   8.176   -16.682 1.00 0.00 ? 450 ASP A HB3  3  
ATOM 4682  N N    . VAL A 1 76  ? 3.592   7.062   -19.868 1.00 0.00 ? 451 VAL A N    3  
ATOM 4683  C CA   . VAL A 1 76  ? 3.268   6.735   -21.253 1.00 0.00 ? 451 VAL A CA   3  
ATOM 4684  C C    . VAL A 1 76  ? 2.121   7.598   -21.770 1.00 0.00 ? 451 VAL A C    3  
ATOM 4685  O O    . VAL A 1 76  ? 2.217   8.196   -22.843 1.00 0.00 ? 451 VAL A O    3  
ATOM 4686  C CB   . VAL A 1 76  ? 2.890   5.249   -21.406 1.00 0.00 ? 451 VAL A CB   3  
ATOM 4687  C CG1  . VAL A 1 76  ? 2.665   4.896   -22.869 1.00 0.00 ? 451 VAL A CG1  3  
ATOM 4688  C CG2  . VAL A 1 76  ? 3.964   4.361   -20.798 1.00 0.00 ? 451 VAL A CG2  3  
ATOM 4689  H H    . VAL A 1 76  ? 3.472   6.380   -19.176 1.00 0.00 ? 451 VAL A H    3  
ATOM 4690  H HA   . VAL A 1 76  ? 4.146   6.925   -21.854 1.00 0.00 ? 451 VAL A HA   3  
ATOM 4691  H HB   . VAL A 1 76  ? 1.967   5.076   -20.872 1.00 0.00 ? 451 VAL A HB   3  
ATOM 4692  H HG11 . VAL A 1 76  ? 2.591   5.802   -23.452 1.00 0.00 ? 451 VAL A HG11 3  
ATOM 4693  H HG12 . VAL A 1 76  ? 3.493   4.303   -23.229 1.00 0.00 ? 451 VAL A HG12 3  
ATOM 4694  H HG13 . VAL A 1 76  ? 1.749   4.330   -22.967 1.00 0.00 ? 451 VAL A HG13 3  
ATOM 4695  H HG21 . VAL A 1 76  ? 4.596   3.971   -21.582 1.00 0.00 ? 451 VAL A HG21 3  
ATOM 4696  H HG22 . VAL A 1 76  ? 4.563   4.939   -20.109 1.00 0.00 ? 451 VAL A HG22 3  
ATOM 4697  H HG23 . VAL A 1 76  ? 3.499   3.542   -20.270 1.00 0.00 ? 451 VAL A HG23 3  
ATOM 4698  N N    . ILE A 1 77  ? 1.036   7.658   -21.005 1.00 0.00 ? 452 ILE A N    3  
ATOM 4699  C CA   . ILE A 1 77  ? -0.129  8.448   -21.390 1.00 0.00 ? 452 ILE A CA   3  
ATOM 4700  C C    . ILE A 1 77  ? 0.240   9.917   -21.574 1.00 0.00 ? 452 ILE A C    3  
ATOM 4701  O O    . ILE A 1 77  ? -0.277  10.589  -22.467 1.00 0.00 ? 452 ILE A O    3  
ATOM 4702  C CB   . ILE A 1 77  ? -1.256  8.339   -20.343 1.00 0.00 ? 452 ILE A CB   3  
ATOM 4703  C CG1  . ILE A 1 77  ? -1.580  6.871   -20.060 1.00 0.00 ? 452 ILE A CG1  3  
ATOM 4704  C CG2  . ILE A 1 77  ? -2.499  9.077   -20.819 1.00 0.00 ? 452 ILE A CG2  3  
ATOM 4705  C CD1  . ILE A 1 77  ? -1.908  6.594   -18.609 1.00 0.00 ? 452 ILE A CD1  3  
ATOM 4706  H H    . ILE A 1 77  ? 1.018   7.160   -20.161 1.00 0.00 ? 452 ILE A H    3  
ATOM 4707  H HA   . ILE A 1 77  ? -0.498  8.060   -22.328 1.00 0.00 ? 452 ILE A HA   3  
ATOM 4708  H HB   . ILE A 1 77  ? -0.916  8.807   -19.432 1.00 0.00 ? 452 ILE A HB   3  
ATOM 4709  H HG12 . ILE A 1 77  ? -2.434  6.578   -20.654 1.00 0.00 ? 452 ILE A HG12 3  
ATOM 4710  H HG13 . ILE A 1 77  ? -0.731  6.262   -20.332 1.00 0.00 ? 452 ILE A HG13 3  
ATOM 4711  H HG21 . ILE A 1 77  ? -2.586  8.981   -21.891 1.00 0.00 ? 452 ILE A HG21 3  
ATOM 4712  H HG22 . ILE A 1 77  ? -3.372  8.654   -20.347 1.00 0.00 ? 452 ILE A HG22 3  
ATOM 4713  H HG23 . ILE A 1 77  ? -2.419  10.122  -20.556 1.00 0.00 ? 452 ILE A HG23 3  
ATOM 4714  H HD11 . ILE A 1 77  ? -1.620  5.583   -18.363 1.00 0.00 ? 452 ILE A HD11 3  
ATOM 4715  H HD12 . ILE A 1 77  ? -1.369  7.286   -17.980 1.00 0.00 ? 452 ILE A HD12 3  
ATOM 4716  H HD13 . ILE A 1 77  ? -2.970  6.714   -18.451 1.00 0.00 ? 452 ILE A HD13 3  
ATOM 4717  N N    . LYS A 1 78  ? 1.137   10.408  -20.726 1.00 0.00 ? 453 LYS A N    3  
ATOM 4718  C CA   . LYS A 1 78  ? 1.574   11.798  -20.797 1.00 0.00 ? 453 LYS A CA   3  
ATOM 4719  C C    . LYS A 1 78  ? 2.793   11.954  -21.708 1.00 0.00 ? 453 LYS A C    3  
ATOM 4720  O O    . LYS A 1 78  ? 3.248   13.070  -21.958 1.00 0.00 ? 453 LYS A O    3  
ATOM 4721  C CB   . LYS A 1 78  ? 1.898   12.324  -19.398 1.00 0.00 ? 453 LYS A CB   3  
ATOM 4722  C CG   . LYS A 1 78  ? 2.949   11.503  -18.667 1.00 0.00 ? 453 LYS A CG   3  
ATOM 4723  C CD   . LYS A 1 78  ? 3.345   12.153  -17.351 1.00 0.00 ? 453 LYS A CD   3  
ATOM 4724  C CE   . LYS A 1 78  ? 2.192   12.157  -16.362 1.00 0.00 ? 453 LYS A CE   3  
ATOM 4725  N NZ   . LYS A 1 78  ? 2.496   12.974  -15.156 1.00 0.00 ? 453 LYS A NZ   3  
ATOM 4726  H H    . LYS A 1 78  ? 1.514   9.823   -20.036 1.00 0.00 ? 453 LYS A H    3  
ATOM 4727  H HA   . LYS A 1 78  ? 0.760   12.378  -21.207 1.00 0.00 ? 453 LYS A HA   3  
ATOM 4728  H HB2  . LYS A 1 78  ? 2.258   13.338  -19.480 1.00 0.00 ? 453 LYS A HB2  3  
ATOM 4729  H HB3  . LYS A 1 78  ? 0.994   12.319  -18.806 1.00 0.00 ? 453 LYS A HB3  3  
ATOM 4730  H HG2  . LYS A 1 78  ? 2.549   10.521  -18.466 1.00 0.00 ? 453 LYS A HG2  3  
ATOM 4731  H HG3  . LYS A 1 78  ? 3.824   11.417  -19.295 1.00 0.00 ? 453 LYS A HG3  3  
ATOM 4732  H HD2  . LYS A 1 78  ? 4.171   11.604  -16.924 1.00 0.00 ? 453 LYS A HD2  3  
ATOM 4733  H HD3  . LYS A 1 78  ? 3.648   13.173  -17.541 1.00 0.00 ? 453 LYS A HD3  3  
ATOM 4734  H HE2  . LYS A 1 78  ? 1.317   12.563  -16.849 1.00 0.00 ? 453 LYS A HE2  3  
ATOM 4735  H HE3  . LYS A 1 78  ? 1.992   11.140  -16.057 1.00 0.00 ? 453 LYS A HE3  3  
ATOM 4736  H HZ1  . LYS A 1 78  ? 3.304   12.566  -14.642 1.00 0.00 ? 453 LYS A HZ1  3  
ATOM 4737  H HZ2  . LYS A 1 78  ? 2.733   13.948  -15.434 1.00 0.00 ? 453 LYS A HZ2  3  
ATOM 4738  H HZ3  . LYS A 1 78  ? 1.672   12.997  -14.522 1.00 0.00 ? 453 LYS A HZ3  3  
ATOM 4739  N N    . ARG A 1 79  ? 3.320   10.835  -22.200 1.00 0.00 ? 454 ARG A N    3  
ATOM 4740  C CA   . ARG A 1 79  ? 4.484   10.863  -23.078 1.00 0.00 ? 454 ARG A CA   3  
ATOM 4741  C C    . ARG A 1 79  ? 4.068   10.718  -24.540 1.00 0.00 ? 454 ARG A C    3  
ATOM 4742  O O    . ARG A 1 79  ? 4.466   11.514  -25.390 1.00 0.00 ? 454 ARG A O    3  
ATOM 4743  C CB   . ARG A 1 79  ? 5.461   9.747   -22.699 1.00 0.00 ? 454 ARG A CB   3  
ATOM 4744  C CG   . ARG A 1 79  ? 6.661   9.642   -23.627 1.00 0.00 ? 454 ARG A CG   3  
ATOM 4745  C CD   . ARG A 1 79  ? 7.729   8.719   -23.059 1.00 0.00 ? 454 ARG A CD   3  
ATOM 4746  N NE   . ARG A 1 79  ? 8.148   7.707   -24.026 1.00 0.00 ? 454 ARG A NE   3  
ATOM 4747  C CZ   . ARG A 1 79  ? 8.986   7.946   -25.033 1.00 0.00 ? 454 ARG A CZ   3  
ATOM 4748  N NH1  . ARG A 1 79  ? 9.492   9.160   -25.210 1.00 0.00 ? 454 ARG A NH1  3  
ATOM 4749  N NH2  . ARG A 1 79  ? 9.319   6.968   -25.865 1.00 0.00 ? 454 ARG A NH2  3  
ATOM 4750  H H    . ARG A 1 79  ? 2.919   9.973   -21.969 1.00 0.00 ? 454 ARG A H    3  
ATOM 4751  H HA   . ARG A 1 79  ? 4.973   11.817  -22.950 1.00 0.00 ? 454 ARG A HA   3  
ATOM 4752  H HB2  . ARG A 1 79  ? 5.824   9.929   -21.699 1.00 0.00 ? 454 ARG A HB2  3  
ATOM 4753  H HB3  . ARG A 1 79  ? 4.936   8.803   -22.716 1.00 0.00 ? 454 ARG A HB3  3  
ATOM 4754  H HG2  . ARG A 1 79  ? 6.334   9.252   -24.579 1.00 0.00 ? 454 ARG A HG2  3  
ATOM 4755  H HG3  . ARG A 1 79  ? 7.086   10.626  -23.765 1.00 0.00 ? 454 ARG A HG3  3  
ATOM 4756  H HD2  . ARG A 1 79  ? 8.587   9.311   -22.778 1.00 0.00 ? 454 ARG A HD2  3  
ATOM 4757  H HD3  . ARG A 1 79  ? 7.331   8.223   -22.185 1.00 0.00 ? 454 ARG A HD3  3  
ATOM 4758  H HE   . ARG A 1 79  ? 7.789   6.802   -23.920 1.00 0.00 ? 454 ARG A HE   3  
ATOM 4759  H HH11 . ARG A 1 79  ? 9.246   9.901   -24.586 1.00 0.00 ? 454 ARG A HH11 3  
ATOM 4760  H HH12 . ARG A 1 79  ? 10.122  9.332   -25.968 1.00 0.00 ? 454 ARG A HH12 3  
ATOM 4761  H HH21 . ARG A 1 79  ? 8.940   6.051   -25.737 1.00 0.00 ? 454 ARG A HH21 3  
ATOM 4762  H HH22 . ARG A 1 79  ? 9.948   7.148   -26.621 1.00 0.00 ? 454 ARG A HH22 3  
ATOM 4763  N N    . GLU A 1 80  ? 3.270   9.695   -24.824 1.00 0.00 ? 455 GLU A N    3  
ATOM 4764  C CA   . GLU A 1 80  ? 2.806   9.444   -26.184 1.00 0.00 ? 455 GLU A CA   3  
ATOM 4765  C C    . GLU A 1 80  ? 1.418   10.035  -26.407 1.00 0.00 ? 455 GLU A C    3  
ATOM 4766  O O    . GLU A 1 80  ? 0.567   10.001  -25.520 1.00 0.00 ? 455 GLU A O    3  
ATOM 4767  C CB   . GLU A 1 80  ? 2.782   7.940   -26.467 1.00 0.00 ? 455 GLU A CB   3  
ATOM 4768  C CG   . GLU A 1 80  ? 4.020   7.207   -25.973 1.00 0.00 ? 455 GLU A CG   3  
ATOM 4769  C CD   . GLU A 1 80  ? 5.188   7.323   -26.934 1.00 0.00 ? 455 GLU A CD   3  
ATOM 4770  O OE1  . GLU A 1 80  ? 5.007   7.005   -28.128 1.00 0.00 ? 455 GLU A OE1  3  
ATOM 4771  O OE2  . GLU A 1 80  ? 6.281   7.730   -26.491 1.00 0.00 ? 455 GLU A OE2  3  
ATOM 4772  H H    . GLU A 1 80  ? 2.990   9.092   -24.104 1.00 0.00 ? 455 GLU A H    3  
ATOM 4773  H HA   . GLU A 1 80  ? 3.499   9.916   -26.863 1.00 0.00 ? 455 GLU A HA   3  
ATOM 4774  H HB2  . GLU A 1 80  ? 1.918   7.508   -25.984 1.00 0.00 ? 455 GLU A HB2  3  
ATOM 4775  H HB3  . GLU A 1 80  ? 2.701   7.787   -27.533 1.00 0.00 ? 455 GLU A HB3  3  
ATOM 4776  H HG2  . GLU A 1 80  ? 4.313   7.624   -25.022 1.00 0.00 ? 455 GLU A HG2  3  
ATOM 4777  H HG3  . GLU A 1 80  ? 3.777   6.163   -25.848 1.00 0.00 ? 455 GLU A HG3  3  
ATOM 4778  N N    . SER A 1 81  ? 1.197   10.573  -27.603 1.00 0.00 ? 456 SER A N    3  
ATOM 4779  C CA   . SER A 1 81  ? -0.089  11.169  -27.947 1.00 0.00 ? 456 SER A CA   3  
ATOM 4780  C C    . SER A 1 81  ? -1.089  10.093  -28.355 1.00 0.00 ? 456 SER A C    3  
ATOM 4781  O O    . SER A 1 81  ? -2.272  10.171  -28.024 1.00 0.00 ? 456 SER A O    3  
ATOM 4782  C CB   . SER A 1 81  ? 0.083   12.180  -29.081 1.00 0.00 ? 456 SER A CB   3  
ATOM 4783  O OG   . SER A 1 81  ? -1.015  13.073  -29.140 1.00 0.00 ? 456 SER A OG   3  
ATOM 4784  H H    . SER A 1 81  ? 1.915   10.567  -28.270 1.00 0.00 ? 456 SER A H    3  
ATOM 4785  H HA   . SER A 1 81  ? -0.463  11.680  -27.073 1.00 0.00 ? 456 SER A HA   3  
ATOM 4786  H HB2  . SER A 1 81  ? 0.986   12.749  -28.920 1.00 0.00 ? 456 SER A HB2  3  
ATOM 4787  H HB3  . SER A 1 81  ? 0.152   11.652  -30.022 1.00 0.00 ? 456 SER A HB3  3  
ATOM 4788  H HG   . SER A 1 81  ? -0.833  13.762  -29.784 1.00 0.00 ? 456 SER A HG   3  
ATOM 4789  N N    . THR A 1 82  ? -0.602  9.086   -29.073 1.00 0.00 ? 457 THR A N    3  
ATOM 4790  C CA   . THR A 1 82  ? -1.450  7.988   -29.523 1.00 0.00 ? 457 THR A CA   3  
ATOM 4791  C C    . THR A 1 82  ? -1.163  6.725   -28.720 1.00 0.00 ? 457 THR A C    3  
ATOM 4792  O O    . THR A 1 82  ? -0.050  6.202   -28.744 1.00 0.00 ? 457 THR A O    3  
ATOM 4793  C CB   . THR A 1 82  ? -1.227  7.720   -31.013 1.00 0.00 ? 457 THR A CB   3  
ATOM 4794  O OG1  . THR A 1 82  ? 0.121   7.965   -31.371 1.00 0.00 ? 457 THR A OG1  3  
ATOM 4795  C CG2  . THR A 1 82  ? -2.102  8.568   -31.911 1.00 0.00 ? 457 THR A CG2  3  
ATOM 4796  H H    . THR A 1 82  ? 0.351   9.078   -29.301 1.00 0.00 ? 457 THR A H    3  
ATOM 4797  H HA   . THR A 1 82  ? -2.478  8.275   -29.367 1.00 0.00 ? 457 THR A HA   3  
ATOM 4798  H HB   . THR A 1 82  ? -1.450  6.683   -31.218 1.00 0.00 ? 457 THR A HB   3  
ATOM 4799  H HG1  . THR A 1 82  ? 0.703   7.501   -30.763 1.00 0.00 ? 457 THR A HG1  3  
ATOM 4800  H HG21 . THR A 1 82  ? -2.555  9.358   -31.331 1.00 0.00 ? 457 THR A HG21 3  
ATOM 4801  H HG22 . THR A 1 82  ? -1.499  8.999   -32.697 1.00 0.00 ? 457 THR A HG22 3  
ATOM 4802  H HG23 . THR A 1 82  ? -2.875  7.952   -32.347 1.00 0.00 ? 457 THR A HG23 3  
ATOM 4803  N N    . LEU A 1 83  ? -2.172  6.245   -28.001 1.00 0.00 ? 458 LEU A N    3  
ATOM 4804  C CA   . LEU A 1 83  ? -2.023  5.048   -27.183 1.00 0.00 ? 458 LEU A CA   3  
ATOM 4805  C C    . LEU A 1 83  ? -2.643  3.834   -27.868 1.00 0.00 ? 458 LEU A C    3  
ATOM 4806  O O    . LEU A 1 83  ? -3.808  3.857   -28.262 1.00 0.00 ? 458 LEU A O    3  
ATOM 4807  C CB   . LEU A 1 83  ? -2.666  5.261   -25.812 1.00 0.00 ? 458 LEU A CB   3  
ATOM 4808  C CG   . LEU A 1 83  ? -2.501  6.666   -25.229 1.00 0.00 ? 458 LEU A CG   3  
ATOM 4809  C CD1  . LEU A 1 83  ? -3.070  6.730   -23.820 1.00 0.00 ? 458 LEU A CD1  3  
ATOM 4810  C CD2  . LEU A 1 83  ? -1.037  7.079   -25.234 1.00 0.00 ? 458 LEU A CD2  3  
ATOM 4811  H H    . LEU A 1 83  ? -3.035  6.709   -28.018 1.00 0.00 ? 458 LEU A H    3  
ATOM 4812  H HA   . LEU A 1 83  ? -0.967  4.869   -27.051 1.00 0.00 ? 458 LEU A HA   3  
ATOM 4813  H HB2  . LEU A 1 83  ? -3.723  5.050   -25.897 1.00 0.00 ? 458 LEU A HB2  3  
ATOM 4814  H HB3  . LEU A 1 83  ? -2.230  4.555   -25.120 1.00 0.00 ? 458 LEU A HB3  3  
ATOM 4815  H HG   . LEU A 1 83  ? -3.049  7.368   -25.841 1.00 0.00 ? 458 LEU A HG   3  
ATOM 4816  H HD11 . LEU A 1 83  ? -2.979  5.761   -23.350 1.00 0.00 ? 458 LEU A HD11 3  
ATOM 4817  H HD12 . LEU A 1 83  ? -2.523  7.461   -23.243 1.00 0.00 ? 458 LEU A HD12 3  
ATOM 4818  H HD13 . LEU A 1 83  ? -4.111  7.012   -23.864 1.00 0.00 ? 458 LEU A HD13 3  
ATOM 4819  H HD21 . LEU A 1 83  ? -0.822  7.661   -24.350 1.00 0.00 ? 458 LEU A HD21 3  
ATOM 4820  H HD22 . LEU A 1 83  ? -0.414  6.196   -25.244 1.00 0.00 ? 458 LEU A HD22 3  
ATOM 4821  H HD23 . LEU A 1 83  ? -0.833  7.672   -26.114 1.00 0.00 ? 458 LEU A HD23 3  
ATOM 4822  N N    . ASN A 1 84  ? -1.851  2.774   -28.001 1.00 0.00 ? 459 ASN A N    3  
ATOM 4823  C CA   . ASN A 1 84  ? -2.315  1.543   -28.632 1.00 0.00 ? 459 ASN A CA   3  
ATOM 4824  C C    . ASN A 1 84  ? -1.949  0.332   -27.781 1.00 0.00 ? 459 ASN A C    3  
ATOM 4825  O O    . ASN A 1 84  ? -0.855  -0.217  -27.904 1.00 0.00 ? 459 ASN A O    3  
ATOM 4826  C CB   . ASN A 1 84  ? -1.708  1.403   -30.029 1.00 0.00 ? 459 ASN A CB   3  
ATOM 4827  C CG   . ASN A 1 84  ? -2.572  2.036   -31.101 1.00 0.00 ? 459 ASN A CG   3  
ATOM 4828  O OD1  . ASN A 1 84  ? -3.676  1.570   -31.382 1.00 0.00 ? 459 ASN A OD1  3  
ATOM 4829  N ND2  . ASN A 1 84  ? -2.071  3.106   -31.709 1.00 0.00 ? 459 ASN A ND2  3  
ATOM 4830  H H    . ASN A 1 84  ? -0.933  2.819   -27.662 1.00 0.00 ? 459 ASN A H    3  
ATOM 4831  H HA   . ASN A 1 84  ? -3.390  1.599   -28.718 1.00 0.00 ? 459 ASN A HA   3  
ATOM 4832  H HB2  . ASN A 1 84  ? -0.741  1.882   -30.044 1.00 0.00 ? 459 ASN A HB2  3  
ATOM 4833  H HB3  . ASN A 1 84  ? -1.590  0.354   -30.259 1.00 0.00 ? 459 ASN A HB3  3  
ATOM 4834  H HD21 . ASN A 1 84  ? -1.185  3.421   -31.435 1.00 0.00 ? 459 ASN A HD21 3  
ATOM 4835  H HD22 . ASN A 1 84  ? -2.609  3.535   -32.408 1.00 0.00 ? 459 ASN A HD22 3  
ATOM 4836  N N    . MET A 1 85  ? -2.870  -0.075  -26.913 1.00 0.00 ? 460 MET A N    3  
ATOM 4837  C CA   . MET A 1 85  ? -2.640  -1.219  -26.038 1.00 0.00 ? 460 MET A CA   3  
ATOM 4838  C C    . MET A 1 85  ? -3.248  -2.489  -26.620 1.00 0.00 ? 460 MET A C    3  
ATOM 4839  O O    . MET A 1 85  ? -4.232  -2.438  -27.357 1.00 0.00 ? 460 MET A O    3  
ATOM 4840  C CB   . MET A 1 85  ? -3.224  -0.950  -24.650 1.00 0.00 ? 460 MET A CB   3  
ATOM 4841  C CG   . MET A 1 85  ? -2.921  0.445   -24.122 1.00 0.00 ? 460 MET A CG   3  
ATOM 4842  S SD   . MET A 1 85  ? -4.410  1.386   -23.735 1.00 0.00 ? 460 MET A SD   3  
ATOM 4843  C CE   . MET A 1 85  ? -4.074  2.922   -24.591 1.00 0.00 ? 460 MET A CE   3  
ATOM 4844  H H    . MET A 1 85  ? -3.722  0.405   -26.858 1.00 0.00 ? 460 MET A H    3  
ATOM 4845  H HA   . MET A 1 85  ? -1.572  -1.355  -25.948 1.00 0.00 ? 460 MET A HA   3  
ATOM 4846  H HB2  . MET A 1 85  ? -4.296  -1.071  -24.694 1.00 0.00 ? 460 MET A HB2  3  
ATOM 4847  H HB3  . MET A 1 85  ? -2.817  -1.670  -23.955 1.00 0.00 ? 460 MET A HB3  3  
ATOM 4848  H HG2  . MET A 1 85  ? -2.328  0.353   -23.224 1.00 0.00 ? 460 MET A HG2  3  
ATOM 4849  H HG3  . MET A 1 85  ? -2.357  0.982   -24.871 1.00 0.00 ? 460 MET A HG3  3  
ATOM 4850  H HE1  . MET A 1 85  ? -3.832  3.691   -23.871 1.00 0.00 ? 460 MET A HE1  3  
ATOM 4851  H HE2  . MET A 1 85  ? -3.240  2.785   -25.264 1.00 0.00 ? 460 MET A HE2  3  
ATOM 4852  H HE3  . MET A 1 85  ? -4.946  3.220   -25.154 1.00 0.00 ? 460 MET A HE3  3  
ATOM 4853  N N    . VAL A 1 86  ? -2.655  -3.629  -26.281 1.00 0.00 ? 461 VAL A N    3  
ATOM 4854  C CA   . VAL A 1 86  ? -3.135  -4.917  -26.763 1.00 0.00 ? 461 VAL A CA   3  
ATOM 4855  C C    . VAL A 1 86  ? -3.573  -5.806  -25.604 1.00 0.00 ? 461 VAL A C    3  
ATOM 4856  O O    . VAL A 1 86  ? -2.787  -6.101  -24.704 1.00 0.00 ? 461 VAL A O    3  
ATOM 4857  C CB   . VAL A 1 86  ? -2.052  -5.652  -27.577 1.00 0.00 ? 461 VAL A CB   3  
ATOM 4858  C CG1  . VAL A 1 86  ? -2.601  -6.945  -28.158 1.00 0.00 ? 461 VAL A CG1  3  
ATOM 4859  C CG2  . VAL A 1 86  ? -1.510  -4.752  -28.678 1.00 0.00 ? 461 VAL A CG2  3  
ATOM 4860  H H    . VAL A 1 86  ? -1.874  -3.602  -25.688 1.00 0.00 ? 461 VAL A H    3  
ATOM 4861  H HA   . VAL A 1 86  ? -3.983  -4.738  -27.409 1.00 0.00 ? 461 VAL A HA   3  
ATOM 4862  H HB   . VAL A 1 86  ? -1.238  -5.899  -26.912 1.00 0.00 ? 461 VAL A HB   3  
ATOM 4863  H HG11 . VAL A 1 86  ? -3.015  -7.549  -27.364 1.00 0.00 ? 461 VAL A HG11 3  
ATOM 4864  H HG12 . VAL A 1 86  ? -3.374  -6.718  -28.877 1.00 0.00 ? 461 VAL A HG12 3  
ATOM 4865  H HG13 . VAL A 1 86  ? -1.804  -7.489  -28.645 1.00 0.00 ? 461 VAL A HG13 3  
ATOM 4866  H HG21 . VAL A 1 86  ? -1.293  -5.345  -29.554 1.00 0.00 ? 461 VAL A HG21 3  
ATOM 4867  H HG22 . VAL A 1 86  ? -2.245  -4.001  -28.925 1.00 0.00 ? 461 VAL A HG22 3  
ATOM 4868  H HG23 . VAL A 1 86  ? -0.605  -4.271  -28.337 1.00 0.00 ? 461 VAL A HG23 3  
ATOM 4869  N N    . VAL A 1 87  ? -4.832  -6.230  -25.633 1.00 0.00 ? 462 VAL A N    3  
ATOM 4870  C CA   . VAL A 1 87  ? -5.373  -7.087  -24.584 1.00 0.00 ? 462 VAL A CA   3  
ATOM 4871  C C    . VAL A 1 87  ? -5.566  -8.512  -25.090 1.00 0.00 ? 462 VAL A C    3  
ATOM 4872  O O    . VAL A 1 87  ? -5.607  -8.752  -26.296 1.00 0.00 ? 462 VAL A O    3  
ATOM 4873  C CB   . VAL A 1 87  ? -6.718  -6.552  -24.054 1.00 0.00 ? 462 VAL A CB   3  
ATOM 4874  C CG1  . VAL A 1 87  ? -7.106  -7.262  -22.767 1.00 0.00 ? 462 VAL A CG1  3  
ATOM 4875  C CG2  . VAL A 1 87  ? -6.650  -5.047  -23.840 1.00 0.00 ? 462 VAL A CG2  3  
ATOM 4876  H H    . VAL A 1 87  ? -5.412  -5.963  -26.376 1.00 0.00 ? 462 VAL A H    3  
ATOM 4877  H HA   . VAL A 1 87  ? -4.666  -7.099  -23.766 1.00 0.00 ? 462 VAL A HA   3  
ATOM 4878  H HB   . VAL A 1 87  ? -7.479  -6.756  -24.793 1.00 0.00 ? 462 VAL A HB   3  
ATOM 4879  H HG11 . VAL A 1 87  ? -6.220  -7.449  -22.178 1.00 0.00 ? 462 VAL A HG11 3  
ATOM 4880  H HG12 . VAL A 1 87  ? -7.788  -6.642  -22.205 1.00 0.00 ? 462 VAL A HG12 3  
ATOM 4881  H HG13 . VAL A 1 87  ? -7.585  -8.201  -23.004 1.00 0.00 ? 462 VAL A HG13 3  
ATOM 4882  H HG21 . VAL A 1 87  ? -7.493  -4.732  -23.243 1.00 0.00 ? 462 VAL A HG21 3  
ATOM 4883  H HG22 . VAL A 1 87  ? -5.733  -4.798  -23.330 1.00 0.00 ? 462 VAL A HG22 3  
ATOM 4884  H HG23 . VAL A 1 87  ? -6.680  -4.547  -24.796 1.00 0.00 ? 462 VAL A HG23 3  
ATOM 4885  N N    . ARG A 1 88  ? -5.682  -9.457  -24.162 1.00 0.00 ? 463 ARG A N    3  
ATOM 4886  C CA   . ARG A 1 88  ? -5.869  -10.858 -24.518 1.00 0.00 ? 463 ARG A CA   3  
ATOM 4887  C C    . ARG A 1 88  ? -7.117  -11.429 -23.853 1.00 0.00 ? 463 ARG A C    3  
ATOM 4888  O O    . ARG A 1 88  ? -7.391  -11.155 -22.685 1.00 0.00 ? 463 ARG A O    3  
ATOM 4889  C CB   . ARG A 1 88  ? -4.642  -11.678 -24.115 1.00 0.00 ? 463 ARG A CB   3  
ATOM 4890  C CG   . ARG A 1 88  ? -4.636  -13.086 -24.684 1.00 0.00 ? 463 ARG A CG   3  
ATOM 4891  C CD   . ARG A 1 88  ? -5.308  -14.072 -23.740 1.00 0.00 ? 463 ARG A CD   3  
ATOM 4892  N NE   . ARG A 1 88  ? -5.202  -15.449 -24.217 1.00 0.00 ? 463 ARG A NE   3  
ATOM 4893  C CZ   . ARG A 1 88  ? -4.136  -16.223 -24.020 1.00 0.00 ? 463 ARG A CZ   3  
ATOM 4894  N NH1  . ARG A 1 88  ? -3.081  -15.760 -23.359 1.00 0.00 ? 463 ARG A NH1  3  
ATOM 4895  N NH2  . ARG A 1 88  ? -4.123  -17.463 -24.488 1.00 0.00 ? 463 ARG A NH2  3  
ATOM 4896  H H    . ARG A 1 88  ? -5.639  -9.206  -23.216 1.00 0.00 ? 463 ARG A H    3  
ATOM 4897  H HA   . ARG A 1 88  ? -5.991  -10.914 -25.590 1.00 0.00 ? 463 ARG A HA   3  
ATOM 4898  H HB2  . ARG A 1 88  ? -3.755  -11.169 -24.460 1.00 0.00 ? 463 ARG A HB2  3  
ATOM 4899  H HB3  . ARG A 1 88  ? -4.610  -11.748 -23.037 1.00 0.00 ? 463 ARG A HB3  3  
ATOM 4900  H HG2  . ARG A 1 88  ? -5.166  -13.086 -25.624 1.00 0.00 ? 463 ARG A HG2  3  
ATOM 4901  H HG3  . ARG A 1 88  ? -3.613  -13.396 -24.843 1.00 0.00 ? 463 ARG A HG3  3  
ATOM 4902  H HD2  . ARG A 1 88  ? -4.840  -13.998 -22.770 1.00 0.00 ? 463 ARG A HD2  3  
ATOM 4903  H HD3  . ARG A 1 88  ? -6.353  -13.810 -23.655 1.00 0.00 ? 463 ARG A HD3  3  
ATOM 4904  H HE   . ARG A 1 88  ? -5.964  -15.816 -24.711 1.00 0.00 ? 463 ARG A HE   3  
ATOM 4905  H HH11 . ARG A 1 88  ? -3.082  -14.825 -23.004 1.00 0.00 ? 463 ARG A HH11 3  
ATOM 4906  H HH12 . ARG A 1 88  ? -2.285  -16.348 -23.215 1.00 0.00 ? 463 ARG A HH12 3  
ATOM 4907  H HH21 . ARG A 1 88  ? -4.914  -17.816 -24.988 1.00 0.00 ? 463 ARG A HH21 3  
ATOM 4908  H HH22 . ARG A 1 88  ? -3.324  -18.045 -24.341 1.00 0.00 ? 463 ARG A HH22 3  
ATOM 4909  N N    . ARG A 1 89  ? -7.868  -12.226 -24.605 1.00 0.00 ? 464 ARG A N    3  
ATOM 4910  C CA   . ARG A 1 89  ? -9.087  -12.840 -24.090 1.00 0.00 ? 464 ARG A CA   3  
ATOM 4911  C C    . ARG A 1 89  ? -9.314  -14.207 -24.727 1.00 0.00 ? 464 ARG A C    3  
ATOM 4912  O O    . ARG A 1 89  ? -9.423  -14.325 -25.948 1.00 0.00 ? 464 ARG A O    3  
ATOM 4913  C CB   . ARG A 1 89  ? -10.291 -11.931 -24.352 1.00 0.00 ? 464 ARG A CB   3  
ATOM 4914  C CG   . ARG A 1 89  ? -10.752 -11.162 -23.124 1.00 0.00 ? 464 ARG A CG   3  
ATOM 4915  C CD   . ARG A 1 89  ? -10.987 -9.694  -23.438 1.00 0.00 ? 464 ARG A CD   3  
ATOM 4916  N NE   . ARG A 1 89  ? -12.123 -9.149  -22.697 1.00 0.00 ? 464 ARG A NE   3  
ATOM 4917  C CZ   . ARG A 1 89  ? -12.320 -7.849  -22.491 1.00 0.00 ? 464 ARG A CZ   3  
ATOM 4918  N NH1  . ARG A 1 89  ? -11.461 -6.957  -22.969 1.00 0.00 ? 464 ARG A NH1  3  
ATOM 4919  N NH2  . ARG A 1 89  ? -13.379 -7.438  -21.808 1.00 0.00 ? 464 ARG A NH2  3  
ATOM 4920  H H    . ARG A 1 89  ? -7.596  -12.408 -25.529 1.00 0.00 ? 464 ARG A H    3  
ATOM 4921  H HA   . ARG A 1 89  ? -8.969  -12.967 -23.025 1.00 0.00 ? 464 ARG A HA   3  
ATOM 4922  H HB2  . ARG A 1 89  ? -10.028 -11.219 -25.120 1.00 0.00 ? 464 ARG A HB2  3  
ATOM 4923  H HB3  . ARG A 1 89  ? -11.116 -12.535 -24.703 1.00 0.00 ? 464 ARG A HB3  3  
ATOM 4924  H HG2  . ARG A 1 89  ? -11.673 -11.595 -22.765 1.00 0.00 ? 464 ARG A HG2  3  
ATOM 4925  H HG3  . ARG A 1 89  ? -9.994  -11.241 -22.358 1.00 0.00 ? 464 ARG A HG3  3  
ATOM 4926  H HD2  . ARG A 1 89  ? -10.100 -9.136  -23.177 1.00 0.00 ? 464 ARG A HD2  3  
ATOM 4927  H HD3  . ARG A 1 89  ? -11.177 -9.591  -24.496 1.00 0.00 ? 464 ARG A HD3  3  
ATOM 4928  H HE   . ARG A 1 89  ? -12.774 -9.786  -22.334 1.00 0.00 ? 464 ARG A HE   3  
ATOM 4929  H HH11 . ARG A 1 89  ? -10.661 -7.259  -23.486 1.00 0.00 ? 464 ARG A HH11 3  
ATOM 4930  H HH12 . ARG A 1 89  ? -11.614 -5.981  -22.811 1.00 0.00 ? 464 ARG A HH12 3  
ATOM 4931  H HH21 . ARG A 1 89  ? -14.031 -8.106  -21.447 1.00 0.00 ? 464 ARG A HH21 3  
ATOM 4932  H HH22 . ARG A 1 89  ? -13.527 -6.462  -21.652 1.00 0.00 ? 464 ARG A HH22 3  
ATOM 4933  N N    . GLY A 1 90  ? -9.383  -15.239 -23.892 1.00 0.00 ? 465 GLY A N    3  
ATOM 4934  C CA   . GLY A 1 90  ? -9.593  -16.583 -24.393 1.00 0.00 ? 465 GLY A CA   3  
ATOM 4935  C C    . GLY A 1 90  ? -8.418  -17.089 -25.206 1.00 0.00 ? 465 GLY A C    3  
ATOM 4936  O O    . GLY A 1 90  ? -7.328  -17.294 -24.672 1.00 0.00 ? 465 GLY A O    3  
ATOM 4937  H H    . GLY A 1 90  ? -9.287  -15.086 -22.929 1.00 0.00 ? 465 GLY A H    3  
ATOM 4938  H HA2  . GLY A 1 90  ? -9.750  -17.248 -23.556 1.00 0.00 ? 465 GLY A HA2  3  
ATOM 4939  H HA3  . GLY A 1 90  ? -10.477 -16.591 -25.014 1.00 0.00 ? 465 GLY A HA3  3  
ATOM 4940  N N    . ASN A 1 91  ? -8.640  -17.292 -26.501 1.00 0.00 ? 466 ASN A N    3  
ATOM 4941  C CA   . ASN A 1 91  ? -7.591  -17.779 -27.389 1.00 0.00 ? 466 ASN A CA   3  
ATOM 4942  C C    . ASN A 1 91  ? -7.406  -16.844 -28.580 1.00 0.00 ? 466 ASN A C    3  
ATOM 4943  O O    . ASN A 1 91  ? -7.018  -17.278 -29.665 1.00 0.00 ? 466 ASN A O    3  
ATOM 4944  C CB   . ASN A 1 91  ? -7.930  -19.186 -27.881 1.00 0.00 ? 466 ASN A CB   3  
ATOM 4945  C CG   . ASN A 1 91  ? -6.693  -20.015 -28.161 1.00 0.00 ? 466 ASN A CG   3  
ATOM 4946  O OD1  . ASN A 1 91  ? -5.738  -19.540 -28.776 1.00 0.00 ? 466 ASN A OD1  3  
ATOM 4947  N ND2  . ASN A 1 91  ? -6.704  -21.264 -27.710 1.00 0.00 ? 466 ASN A ND2  3  
ATOM 4948  H H    . ASN A 1 91  ? -9.530  -17.113 -26.867 1.00 0.00 ? 466 ASN A H    3  
ATOM 4949  H HA   . ASN A 1 91  ? -6.670  -17.816 -26.827 1.00 0.00 ? 466 ASN A HA   3  
ATOM 4950  H HB2  . ASN A 1 91  ? -8.517  -19.691 -27.129 1.00 0.00 ? 466 ASN A HB2  3  
ATOM 4951  H HB3  . ASN A 1 91  ? -8.506  -19.112 -28.793 1.00 0.00 ? 466 ASN A HB3  3  
ATOM 4952  H HD21 . ASN A 1 91  ? -7.499  -21.575 -27.229 1.00 0.00 ? 466 ASN A HD21 3  
ATOM 4953  H HD22 . ASN A 1 91  ? -5.918  -21.822 -27.876 1.00 0.00 ? 466 ASN A HD22 3  
ATOM 4954  N N    . GLU A 1 92  ? -7.689  -15.562 -28.374 1.00 0.00 ? 467 GLU A N    3  
ATOM 4955  C CA   . GLU A 1 92  ? -7.555  -14.573 -29.438 1.00 0.00 ? 467 GLU A CA   3  
ATOM 4956  C C    . GLU A 1 92  ? -6.983  -13.263 -28.906 1.00 0.00 ? 467 GLU A C    3  
ATOM 4957  O O    . GLU A 1 92  ? -7.194  -12.906 -27.745 1.00 0.00 ? 467 GLU A O    3  
ATOM 4958  C CB   . GLU A 1 92  ? -8.912  -14.318 -30.093 1.00 0.00 ? 467 GLU A CB   3  
ATOM 4959  C CG   . GLU A 1 92  ? -9.980  -13.851 -29.119 1.00 0.00 ? 467 GLU A CG   3  
ATOM 4960  C CD   . GLU A 1 92  ? -11.376 -13.918 -29.707 1.00 0.00 ? 467 GLU A CD   3  
ATOM 4961  O OE1  . GLU A 1 92  ? -11.629 -13.224 -30.714 1.00 0.00 ? 467 GLU A OE1  3  
ATOM 4962  O OE2  . GLU A 1 92  ? -12.215 -14.665 -29.162 1.00 0.00 ? 467 GLU A OE2  3  
ATOM 4963  H H    . GLU A 1 92  ? -7.997  -15.275 -27.490 1.00 0.00 ? 467 GLU A H    3  
ATOM 4964  H HA   . GLU A 1 92  ? -6.878  -14.973 -30.178 1.00 0.00 ? 467 GLU A HA   3  
ATOM 4965  H HB2  . GLU A 1 92  ? -8.795  -13.564 -30.856 1.00 0.00 ? 467 GLU A HB2  3  
ATOM 4966  H HB3  . GLU A 1 92  ? -9.253  -15.234 -30.555 1.00 0.00 ? 467 GLU A HB3  3  
ATOM 4967  H HG2  . GLU A 1 92  ? -9.947  -14.478 -28.240 1.00 0.00 ? 467 GLU A HG2  3  
ATOM 4968  H HG3  . GLU A 1 92  ? -9.772  -12.829 -28.839 1.00 0.00 ? 467 GLU A HG3  3  
ATOM 4969  N N    . ASP A 1 93  ? -6.264  -12.549 -29.765 1.00 0.00 ? 468 ASP A N    3  
ATOM 4970  C CA   . ASP A 1 93  ? -5.664  -11.274 -29.390 1.00 0.00 ? 468 ASP A CA   3  
ATOM 4971  C C    . ASP A 1 93  ? -6.582  -10.118 -29.772 1.00 0.00 ? 468 ASP A C    3  
ATOM 4972  O O    . ASP A 1 93  ? -7.301  -10.189 -30.768 1.00 0.00 ? 468 ASP A O    3  
ATOM 4973  C CB   . ASP A 1 93  ? -4.303  -11.106 -30.066 1.00 0.00 ? 468 ASP A CB   3  
ATOM 4974  C CG   . ASP A 1 93  ? -3.330  -12.205 -29.687 1.00 0.00 ? 468 ASP A CG   3  
ATOM 4975  O OD1  . ASP A 1 93  ? -3.596  -13.378 -30.027 1.00 0.00 ? 468 ASP A OD1  3  
ATOM 4976  O OD2  . ASP A 1 93  ? -2.302  -11.894 -29.051 1.00 0.00 ? 468 ASP A OD2  3  
ATOM 4977  H H    . ASP A 1 93  ? -6.136  -12.886 -30.677 1.00 0.00 ? 468 ASP A H    3  
ATOM 4978  H HA   . ASP A 1 93  ? -5.529  -11.273 -28.319 1.00 0.00 ? 468 ASP A HA   3  
ATOM 4979  H HB2  . ASP A 1 93  ? -4.436  -11.124 -31.138 1.00 0.00 ? 468 ASP A HB2  3  
ATOM 4980  H HB3  . ASP A 1 93  ? -3.878  -10.157 -29.776 1.00 0.00 ? 468 ASP A HB3  3  
ATOM 4981  N N    . ILE A 1 94  ? -6.558  -9.056  -28.973 1.00 0.00 ? 469 ILE A N    3  
ATOM 4982  C CA   . ILE A 1 94  ? -7.397  -7.891  -29.232 1.00 0.00 ? 469 ILE A CA   3  
ATOM 4983  C C    . ILE A 1 94  ? -6.573  -6.608  -29.244 1.00 0.00 ? 469 ILE A C    3  
ATOM 4984  O O    . ILE A 1 94  ? -5.769  -6.367  -28.345 1.00 0.00 ? 469 ILE A O    3  
ATOM 4985  C CB   . ILE A 1 94  ? -8.519  -7.753  -28.184 1.00 0.00 ? 469 ILE A CB   3  
ATOM 4986  C CG1  . ILE A 1 94  ? -9.058  -9.129  -27.783 1.00 0.00 ? 469 ILE A CG1  3  
ATOM 4987  C CG2  . ILE A 1 94  ? -9.639  -6.876  -28.723 1.00 0.00 ? 469 ILE A CG2  3  
ATOM 4988  C CD1  . ILE A 1 94  ? -8.653  -9.553  -26.388 1.00 0.00 ? 469 ILE A CD1  3  
ATOM 4989  H H    . ILE A 1 94  ? -5.967  -9.057  -28.191 1.00 0.00 ? 469 ILE A H    3  
ATOM 4990  H HA   . ILE A 1 94  ? -7.855  -8.020  -30.203 1.00 0.00 ? 469 ILE A HA   3  
ATOM 4991  H HB   . ILE A 1 94  ? -8.107  -7.268  -27.311 1.00 0.00 ? 469 ILE A HB   3  
ATOM 4992  H HG12 . ILE A 1 94  ? -10.136 -9.114  -27.823 1.00 0.00 ? 469 ILE A HG12 3  
ATOM 4993  H HG13 . ILE A 1 94  ? -8.686  -9.869  -28.475 1.00 0.00 ? 469 ILE A HG13 3  
ATOM 4994  H HG21 . ILE A 1 94  ? -9.247  -6.222  -29.487 1.00 0.00 ? 469 ILE A HG21 3  
ATOM 4995  H HG22 . ILE A 1 94  ? -10.413 -7.500  -29.146 1.00 0.00 ? 469 ILE A HG22 3  
ATOM 4996  H HG23 . ILE A 1 94  ? -10.054 -6.285  -27.920 1.00 0.00 ? 469 ILE A HG23 3  
ATOM 4997  H HD11 . ILE A 1 94  ? -8.367  -10.595 -26.396 1.00 0.00 ? 469 ILE A HD11 3  
ATOM 4998  H HD12 . ILE A 1 94  ? -7.818  -8.953  -26.058 1.00 0.00 ? 469 ILE A HD12 3  
ATOM 4999  H HD13 . ILE A 1 94  ? -9.486  -9.413  -25.714 1.00 0.00 ? 469 ILE A HD13 3  
ATOM 5000  N N    . MET A 1 95  ? -6.787  -5.786  -30.266 1.00 0.00 ? 470 MET A N    3  
ATOM 5001  C CA   . MET A 1 95  ? -6.070  -4.523  -30.394 1.00 0.00 ? 470 MET A CA   3  
ATOM 5002  C C    . MET A 1 95  ? -6.948  -3.359  -29.950 1.00 0.00 ? 470 MET A C    3  
ATOM 5003  O O    . MET A 1 95  ? -8.018  -3.125  -30.514 1.00 0.00 ? 470 MET A O    3  
ATOM 5004  C CB   . MET A 1 95  ? -5.615  -4.312  -31.839 1.00 0.00 ? 470 MET A CB   3  
ATOM 5005  C CG   . MET A 1 95  ? -4.226  -4.858  -32.125 1.00 0.00 ? 470 MET A CG   3  
ATOM 5006  S SD   . MET A 1 95  ? -4.258  -6.568  -32.698 1.00 0.00 ? 470 MET A SD   3  
ATOM 5007  C CE   . MET A 1 95  ? -2.557  -7.051  -32.419 1.00 0.00 ? 470 MET A CE   3  
ATOM 5008  H H    . MET A 1 95  ? -7.444  -6.032  -30.949 1.00 0.00 ? 470 MET A H    3  
ATOM 5009  H HA   . MET A 1 95  ? -5.201  -4.568  -29.753 1.00 0.00 ? 470 MET A HA   3  
ATOM 5010  H HB2  . MET A 1 95  ? -6.315  -4.802  -32.500 1.00 0.00 ? 470 MET A HB2  3  
ATOM 5011  H HB3  . MET A 1 95  ? -5.612  -3.253  -32.052 1.00 0.00 ? 470 MET A HB3  3  
ATOM 5012  H HG2  . MET A 1 95  ? -3.763  -4.249  -32.886 1.00 0.00 ? 470 MET A HG2  3  
ATOM 5013  H HG3  . MET A 1 95  ? -3.639  -4.808  -31.219 1.00 0.00 ? 470 MET A HG3  3  
ATOM 5014  H HE1  . MET A 1 95  ? -2.129  -7.415  -33.341 1.00 0.00 ? 470 MET A HE1  3  
ATOM 5015  H HE2  . MET A 1 95  ? -1.992  -6.197  -32.074 1.00 0.00 ? 470 MET A HE2  3  
ATOM 5016  H HE3  . MET A 1 95  ? -2.521  -7.831  -31.672 1.00 0.00 ? 470 MET A HE3  3  
ATOM 5017  N N    . ILE A 1 96  ? -6.493  -2.634  -28.934 1.00 0.00 ? 471 ILE A N    3  
ATOM 5018  C CA   . ILE A 1 96  ? -7.241  -1.497  -28.414 1.00 0.00 ? 471 ILE A CA   3  
ATOM 5019  C C    . ILE A 1 96  ? -6.514  -0.187  -28.691 1.00 0.00 ? 471 ILE A C    3  
ATOM 5020  O O    . ILE A 1 96  ? -5.312  -0.069  -28.454 1.00 0.00 ? 471 ILE A O    3  
ATOM 5021  C CB   . ILE A 1 96  ? -7.482  -1.624  -26.896 1.00 0.00 ? 471 ILE A CB   3  
ATOM 5022  C CG1  . ILE A 1 96  ? -7.881  -3.057  -26.536 1.00 0.00 ? 471 ILE A CG1  3  
ATOM 5023  C CG2  . ILE A 1 96  ? -8.550  -0.640  -26.444 1.00 0.00 ? 471 ILE A CG2  3  
ATOM 5024  C CD1  . ILE A 1 96  ? -9.201  -3.486  -27.139 1.00 0.00 ? 471 ILE A CD1  3  
ATOM 5025  H H    . ILE A 1 96  ? -5.636  -2.871  -28.523 1.00 0.00 ? 471 ILE A H    3  
ATOM 5026  H HA   . ILE A 1 96  ? -8.203  -1.475  -28.908 1.00 0.00 ? 471 ILE A HA   3  
ATOM 5027  H HB   . ILE A 1 96  ? -6.562  -1.376  -26.388 1.00 0.00 ? 471 ILE A HB   3  
ATOM 5028  H HG12 . ILE A 1 96  ? -7.119  -3.736  -26.889 1.00 0.00 ? 471 ILE A HG12 3  
ATOM 5029  H HG13 . ILE A 1 96  ? -7.963  -3.142  -25.462 1.00 0.00 ? 471 ILE A HG13 3  
ATOM 5030  H HG21 . ILE A 1 96  ? -9.033  -0.208  -27.309 1.00 0.00 ? 471 ILE A HG21 3  
ATOM 5031  H HG22 . ILE A 1 96  ? -9.285  -1.155  -25.842 1.00 0.00 ? 471 ILE A HG22 3  
ATOM 5032  H HG23 . ILE A 1 96  ? -8.092  0.145   -25.859 1.00 0.00 ? 471 ILE A HG23 3  
ATOM 5033  H HD11 . ILE A 1 96  ? -10.012 -3.023  -26.598 1.00 0.00 ? 471 ILE A HD11 3  
ATOM 5034  H HD12 . ILE A 1 96  ? -9.239  -3.184  -28.175 1.00 0.00 ? 471 ILE A HD12 3  
ATOM 5035  H HD13 . ILE A 1 96  ? -9.294  -4.561  -27.075 1.00 0.00 ? 471 ILE A HD13 3  
ATOM 5036  N N    . THR A 1 97  ? -7.251  0.798   -29.197 1.00 0.00 ? 472 THR A N    3  
ATOM 5037  C CA   . THR A 1 97  ? -6.676  2.101   -29.507 1.00 0.00 ? 472 THR A CA   3  
ATOM 5038  C C    . THR A 1 97  ? -7.404  3.212   -28.756 1.00 0.00 ? 472 THR A C    3  
ATOM 5039  O O    . THR A 1 97  ? -8.606  3.408   -28.932 1.00 0.00 ? 472 THR A O    3  
ATOM 5040  C CB   . THR A 1 97  ? -6.737  2.362   -31.013 1.00 0.00 ? 472 THR A CB   3  
ATOM 5041  O OG1  . THR A 1 97  ? -6.190  1.272   -31.733 1.00 0.00 ? 472 THR A OG1  3  
ATOM 5042  C CG2  . THR A 1 97  ? -5.995  3.611   -31.435 1.00 0.00 ? 472 THR A CG2  3  
ATOM 5043  H H    . THR A 1 97  ? -8.204  0.644   -29.363 1.00 0.00 ? 472 THR A H    3  
ATOM 5044  H HA   . THR A 1 97  ? -5.641  2.091   -29.195 1.00 0.00 ? 472 THR A HA   3  
ATOM 5045  H HB   . THR A 1 97  ? -7.772  2.476   -31.305 1.00 0.00 ? 472 THR A HB   3  
ATOM 5046  H HG1  . THR A 1 97  ? -6.832  0.957   -32.374 1.00 0.00 ? 472 THR A HG1  3  
ATOM 5047  H HG21 . THR A 1 97  ? -6.233  4.418   -30.759 1.00 0.00 ? 472 THR A HG21 3  
ATOM 5048  H HG22 . THR A 1 97  ? -4.932  3.423   -31.412 1.00 0.00 ? 472 THR A HG22 3  
ATOM 5049  H HG23 . THR A 1 97  ? -6.291  3.884   -32.439 1.00 0.00 ? 472 THR A HG23 3  
ATOM 5050  N N    . VAL A 1 98  ? -6.666  3.938   -27.925 1.00 0.00 ? 473 VAL A N    3  
ATOM 5051  C CA   . VAL A 1 98  ? -7.239  5.033   -27.150 1.00 0.00 ? 473 VAL A CA   3  
ATOM 5052  C C    . VAL A 1 98  ? -6.402  6.298   -27.296 1.00 0.00 ? 473 VAL A C    3  
ATOM 5053  O O    . VAL A 1 98  ? -5.176  6.258   -27.193 1.00 0.00 ? 473 VAL A O    3  
ATOM 5054  C CB   . VAL A 1 98  ? -7.345  4.678   -25.654 1.00 0.00 ? 473 VAL A CB   3  
ATOM 5055  C CG1  . VAL A 1 98  ? -8.098  5.762   -24.899 1.00 0.00 ? 473 VAL A CG1  3  
ATOM 5056  C CG2  . VAL A 1 98  ? -8.017  3.325   -25.468 1.00 0.00 ? 473 VAL A CG2  3  
ATOM 5057  H H    . VAL A 1 98  ? -5.712  3.735   -27.831 1.00 0.00 ? 473 VAL A H    3  
ATOM 5058  H HA   . VAL A 1 98  ? -8.233  5.224   -27.526 1.00 0.00 ? 473 VAL A HA   3  
ATOM 5059  H HB   . VAL A 1 98  ? -6.346  4.617   -25.248 1.00 0.00 ? 473 VAL A HB   3  
ATOM 5060  H HG11 . VAL A 1 98  ? -8.765  6.276   -25.577 1.00 0.00 ? 473 VAL A HG11 3  
ATOM 5061  H HG12 . VAL A 1 98  ? -8.672  5.316   -24.101 1.00 0.00 ? 473 VAL A HG12 3  
ATOM 5062  H HG13 . VAL A 1 98  ? -7.394  6.469   -24.484 1.00 0.00 ? 473 VAL A HG13 3  
ATOM 5063  H HG21 . VAL A 1 98  ? -9.057  3.472   -25.210 1.00 0.00 ? 473 VAL A HG21 3  
ATOM 5064  H HG22 . VAL A 1 98  ? -7.950  2.759   -26.384 1.00 0.00 ? 473 VAL A HG22 3  
ATOM 5065  H HG23 . VAL A 1 98  ? -7.524  2.786   -24.672 1.00 0.00 ? 473 VAL A HG23 3  
ATOM 5066  N N    . ILE A 1 99  ? -7.070  7.421   -27.534 1.00 0.00 ? 474 ILE A N    3  
ATOM 5067  C CA   . ILE A 1 99  ? -6.383  8.696   -27.692 1.00 0.00 ? 474 ILE A CA   3  
ATOM 5068  C C    . ILE A 1 99  ? -6.811  9.686   -26.611 1.00 0.00 ? 474 ILE A C    3  
ATOM 5069  O O    . ILE A 1 99  ? -7.939  10.179  -26.625 1.00 0.00 ? 474 ILE A O    3  
ATOM 5070  C CB   . ILE A 1 99  ? -6.661  9.315   -29.075 1.00 0.00 ? 474 ILE A CB   3  
ATOM 5071  C CG1  . ILE A 1 99  ? -6.468  8.271   -30.176 1.00 0.00 ? 474 ILE A CG1  3  
ATOM 5072  C CG2  . ILE A 1 99  ? -5.755  10.514  -29.311 1.00 0.00 ? 474 ILE A CG2  3  
ATOM 5073  C CD1  . ILE A 1 99  ? -5.088  7.647   -30.184 1.00 0.00 ? 474 ILE A CD1  3  
ATOM 5074  H H    . ILE A 1 99  ? -8.048  7.392   -27.605 1.00 0.00 ? 474 ILE A H    3  
ATOM 5075  H HA   . ILE A 1 99  ? -5.322  8.515   -27.609 1.00 0.00 ? 474 ILE A HA   3  
ATOM 5076  H HB   . ILE A 1 99  ? -7.683  9.660   -29.091 1.00 0.00 ? 474 ILE A HB   3  
ATOM 5077  H HG12 . ILE A 1 99  ? -7.188  7.477   -30.040 1.00 0.00 ? 474 ILE A HG12 3  
ATOM 5078  H HG13 . ILE A 1 99  ? -6.628  8.736   -31.137 1.00 0.00 ? 474 ILE A HG13 3  
ATOM 5079  H HG21 . ILE A 1 99  ? -5.416  10.902  -28.362 1.00 0.00 ? 474 ILE A HG21 3  
ATOM 5080  H HG22 . ILE A 1 99  ? -4.903  10.211  -29.901 1.00 0.00 ? 474 ILE A HG22 3  
ATOM 5081  H HG23 . ILE A 1 99  ? -6.303  11.281  -29.839 1.00 0.00 ? 474 ILE A HG23 3  
ATOM 5082  H HD11 . ILE A 1 99  ? -4.991  7.000   -31.042 1.00 0.00 ? 474 ILE A HD11 3  
ATOM 5083  H HD12 . ILE A 1 99  ? -4.342  8.426   -30.233 1.00 0.00 ? 474 ILE A HD12 3  
ATOM 5084  H HD13 . ILE A 1 99  ? -4.947  7.072   -29.281 1.00 0.00 ? 474 ILE A HD13 3  
ATOM 5085  N N    . PRO A 1 100 ? -5.916  9.996   -25.654 1.00 0.00 ? 475 PRO A N    3  
ATOM 5086  C CA   . PRO A 1 100 ? -6.218  10.934  -24.568 1.00 0.00 ? 475 PRO A CA   3  
ATOM 5087  C C    . PRO A 1 100 ? -6.410  12.360  -25.074 1.00 0.00 ? 475 PRO A C    3  
ATOM 5088  O O    . PRO A 1 100 ? -6.440  12.604  -26.280 1.00 0.00 ? 475 PRO A O    3  
ATOM 5089  C CB   . PRO A 1 100 ? -4.987  10.849  -23.663 1.00 0.00 ? 475 PRO A CB   3  
ATOM 5090  C CG   . PRO A 1 100 ? -3.893  10.369  -24.552 1.00 0.00 ? 475 PRO A CG   3  
ATOM 5091  C CD   . PRO A 1 100 ? -4.547  9.458   -25.551 1.00 0.00 ? 475 PRO A CD   3  
ATOM 5092  H HA   . PRO A 1 100 ? -7.096  10.630  -24.017 1.00 0.00 ? 475 PRO A HA   3  
ATOM 5093  H HB2  . PRO A 1 100 ? -4.767  11.826  -23.257 1.00 0.00 ? 475 PRO A HB2  3  
ATOM 5094  H HB3  . PRO A 1 100 ? -5.176  10.154  -22.859 1.00 0.00 ? 475 PRO A HB3  3  
ATOM 5095  H HG2  . PRO A 1 100 ? -3.431  11.206  -25.053 1.00 0.00 ? 475 PRO A HG2  3  
ATOM 5096  H HG3  . PRO A 1 100 ? -3.160  9.826   -23.973 1.00 0.00 ? 475 PRO A HG3  3  
ATOM 5097  H HD2  . PRO A 1 100 ? -4.036  9.511   -26.501 1.00 0.00 ? 475 PRO A HD2  3  
ATOM 5098  H HD3  . PRO A 1 100 ? -4.559  8.442   -25.183 1.00 0.00 ? 475 PRO A HD3  3  
ATOM 5099  N N    . GLU A 1 101 ? -6.538  13.298  -24.143 1.00 0.00 ? 476 GLU A N    3  
ATOM 5100  C CA   . GLU A 1 101 ? -6.727  14.700  -24.492 1.00 0.00 ? 476 GLU A CA   3  
ATOM 5101  C C    . GLU A 1 101 ? -5.987  15.608  -23.514 1.00 0.00 ? 476 GLU A C    3  
ATOM 5102  O O    . GLU A 1 101 ? -5.439  15.143  -22.515 1.00 0.00 ? 476 GLU A O    3  
ATOM 5103  C CB   . GLU A 1 101 ? -8.216  15.049  -24.504 1.00 0.00 ? 476 GLU A CB   3  
ATOM 5104  C CG   . GLU A 1 101 ? -8.961  14.584  -23.262 1.00 0.00 ? 476 GLU A CG   3  
ATOM 5105  C CD   . GLU A 1 101 ? -10.466 14.614  -23.440 1.00 0.00 ? 476 GLU A CD   3  
ATOM 5106  O OE1  . GLU A 1 101 ? -10.944 14.204  -24.518 1.00 0.00 ? 476 GLU A OE1  3  
ATOM 5107  O OE2  . GLU A 1 101 ? -11.166 15.047  -22.501 1.00 0.00 ? 476 GLU A OE2  3  
ATOM 5108  H H    . GLU A 1 101 ? -6.506  13.041  -23.197 1.00 0.00 ? 476 GLU A H    3  
ATOM 5109  H HA   . GLU A 1 101 ? -6.322  14.852  -25.480 1.00 0.00 ? 476 GLU A HA   3  
ATOM 5110  H HB2  . GLU A 1 101 ? -8.323  16.121  -24.580 1.00 0.00 ? 476 GLU A HB2  3  
ATOM 5111  H HB3  . GLU A 1 101 ? -8.675  14.587  -25.365 1.00 0.00 ? 476 GLU A HB3  3  
ATOM 5112  H HG2  . GLU A 1 101 ? -8.660  13.572  -23.036 1.00 0.00 ? 476 GLU A HG2  3  
ATOM 5113  H HG3  . GLU A 1 101 ? -8.697  15.230  -22.437 1.00 0.00 ? 476 GLU A HG3  3  
ATOM 5114  N N    . GLU A 1 102 ? -5.976  16.903  -23.809 1.00 0.00 ? 477 GLU A N    3  
ATOM 5115  C CA   . GLU A 1 102 ? -5.303  17.874  -22.956 1.00 0.00 ? 477 GLU A CA   3  
ATOM 5116  C C    . GLU A 1 102 ? -6.310  18.645  -22.108 1.00 0.00 ? 477 GLU A C    3  
ATOM 5117  O O    . GLU A 1 102 ? -7.303  19.161  -22.622 1.00 0.00 ? 477 GLU A O    3  
ATOM 5118  C CB   . GLU A 1 102 ? -4.481  18.847  -23.803 1.00 0.00 ? 477 GLU A CB   3  
ATOM 5119  C CG   . GLU A 1 102 ? -3.303  18.194  -24.507 1.00 0.00 ? 477 GLU A CG   3  
ATOM 5120  C CD   . GLU A 1 102 ? -2.504  19.176  -25.341 1.00 0.00 ? 477 GLU A CD   3  
ATOM 5121  O OE1  . GLU A 1 102 ? -2.517  20.382  -25.012 1.00 0.00 ? 477 GLU A OE1  3  
ATOM 5122  O OE2  . GLU A 1 102 ? -1.867  18.742  -26.323 1.00 0.00 ? 477 GLU A OE2  3  
ATOM 5123  H H    . GLU A 1 102 ? -6.431  17.213  -24.619 1.00 0.00 ? 477 GLU A H    3  
ATOM 5124  H HA   . GLU A 1 102 ? -4.638  17.334  -22.299 1.00 0.00 ? 477 GLU A HA   3  
ATOM 5125  H HB2  . GLU A 1 102 ? -5.124  19.284  -24.553 1.00 0.00 ? 477 GLU A HB2  3  
ATOM 5126  H HB3  . GLU A 1 102 ? -4.102  19.631  -23.165 1.00 0.00 ? 477 GLU A HB3  3  
ATOM 5127  H HG2  . GLU A 1 102 ? -2.650  17.762  -23.764 1.00 0.00 ? 477 GLU A HG2  3  
ATOM 5128  H HG3  . GLU A 1 102 ? -3.675  17.414  -25.155 1.00 0.00 ? 477 GLU A HG3  3  
ATOM 5129  N N    . ILE A 1 103 ? -6.048  18.717  -20.807 1.00 0.00 ? 478 ILE A N    3  
ATOM 5130  C CA   . ILE A 1 103 ? -6.931  19.424  -19.888 1.00 0.00 ? 478 ILE A CA   3  
ATOM 5131  C C    . ILE A 1 103 ? -6.143  20.034  -18.732 1.00 0.00 ? 478 ILE A C    3  
ATOM 5132  O O    . ILE A 1 103 ? -5.056  19.567  -18.393 1.00 0.00 ? 478 ILE A O    3  
ATOM 5133  C CB   . ILE A 1 103 ? -8.020  18.488  -19.324 1.00 0.00 ? 478 ILE A CB   3  
ATOM 5134  C CG1  . ILE A 1 103 ? -8.997  19.273  -18.445 1.00 0.00 ? 478 ILE A CG1  3  
ATOM 5135  C CG2  . ILE A 1 103 ? -7.389  17.348  -18.537 1.00 0.00 ? 478 ILE A CG2  3  
ATOM 5136  C CD1  . ILE A 1 103 ? -10.170 18.449  -17.961 1.00 0.00 ? 478 ILE A CD1  3  
ATOM 5137  H H    . ILE A 1 103 ? -5.241  18.285  -20.457 1.00 0.00 ? 478 ILE A H    3  
ATOM 5138  H HA   . ILE A 1 103 ? -7.417  20.217  -20.437 1.00 0.00 ? 478 ILE A HA   3  
ATOM 5139  H HB   . ILE A 1 103 ? -8.560  18.060  -20.155 1.00 0.00 ? 478 ILE A HB   3  
ATOM 5140  H HG12 . ILE A 1 103 ? -8.473  19.644  -17.579 1.00 0.00 ? 478 ILE A HG12 3  
ATOM 5141  H HG13 . ILE A 1 103 ? -9.387  20.108  -19.011 1.00 0.00 ? 478 ILE A HG13 3  
ATOM 5142  H HG21 . ILE A 1 103 ? -6.434  17.095  -18.974 1.00 0.00 ? 478 ILE A HG21 3  
ATOM 5143  H HG22 . ILE A 1 103 ? -7.246  17.655  -17.511 1.00 0.00 ? 478 ILE A HG22 3  
ATOM 5144  H HG23 . ILE A 1 103 ? -8.038  16.486  -18.568 1.00 0.00 ? 478 ILE A HG23 3  
ATOM 5145  H HD11 . ILE A 1 103 ? -11.025 19.093  -17.814 1.00 0.00 ? 478 ILE A HD11 3  
ATOM 5146  H HD12 . ILE A 1 103 ? -10.409 17.696  -18.697 1.00 0.00 ? 478 ILE A HD12 3  
ATOM 5147  H HD13 . ILE A 1 103 ? -9.913  17.973  -17.027 1.00 0.00 ? 478 ILE A HD13 3  
ATOM 5148  N N    . ASP A 1 104 ? -6.700  21.080  -18.130 1.00 0.00 ? 479 ASP A N    3  
ATOM 5149  C CA   . ASP A 1 104 ? -6.052  21.754  -17.012 1.00 0.00 ? 479 ASP A CA   3  
ATOM 5150  C C    . ASP A 1 104 ? -6.948  21.738  -15.773 1.00 0.00 ? 479 ASP A C    3  
ATOM 5151  O O    . ASP A 1 104 ? -8.071  22.243  -15.807 1.00 0.00 ? 479 ASP A O    3  
ATOM 5152  C CB   . ASP A 1 104 ? -5.709  23.197  -17.388 1.00 0.00 ? 479 ASP A CB   3  
ATOM 5153  C CG   . ASP A 1 104 ? -4.336  23.612  -16.899 1.00 0.00 ? 479 ASP A CG   3  
ATOM 5154  O OD1  . ASP A 1 104 ? -3.387  22.813  -17.045 1.00 0.00 ? 479 ASP A OD1  3  
ATOM 5155  O OD2  . ASP A 1 104 ? -4.209  24.736  -16.368 1.00 0.00 ? 479 ASP A OD2  3  
ATOM 5156  H H    . ASP A 1 104 ? -7.569  21.406  -18.445 1.00 0.00 ? 479 ASP A H    3  
ATOM 5157  H HA   . ASP A 1 104 ? -5.138  21.224  -16.791 1.00 0.00 ? 479 ASP A HA   3  
ATOM 5158  H HB2  . ASP A 1 104 ? -5.731  23.297  -18.464 1.00 0.00 ? 479 ASP A HB2  3  
ATOM 5159  H HB3  . ASP A 1 104 ? -6.442  23.861  -16.955 1.00 0.00 ? 479 ASP A HB3  3  
ATOM 5160  N N    . PRO A 1 105 ? -6.468  21.156  -14.658 1.00 0.00 ? 480 PRO A N    3  
ATOM 5161  C CA   . PRO A 1 105 ? -7.242  21.082  -13.414 1.00 0.00 ? 480 PRO A CA   3  
ATOM 5162  C C    . PRO A 1 105 ? -7.763  22.446  -12.975 1.00 0.00 ? 480 PRO A C    3  
ATOM 5163  O O    . PRO A 1 105 ? -8.994  22.585  -12.813 1.00 0.00 ? 480 PRO A O    3  
ATOM 5164  C CB   . PRO A 1 105 ? -6.234  20.544  -12.396 1.00 0.00 ? 480 PRO A CB   3  
ATOM 5165  C CG   . PRO A 1 105 ? -5.237  19.795  -13.211 1.00 0.00 ? 480 PRO A CG   3  
ATOM 5166  C CD   . PRO A 1 105 ? -5.141  20.526  -14.520 1.00 0.00 ? 480 PRO A CD   3  
ATOM 5167  O OXT  . PRO A 1 105 ? -6.936  23.366  -12.796 1.00 0.00 ? 480 PRO A OXT  3  
ATOM 5168  H HA   . PRO A 1 105 ? -8.070  20.395  -13.504 1.00 0.00 ? 480 PRO A HA   3  
ATOM 5169  H HB2  . PRO A 1 105 ? -5.775  21.367  -11.870 1.00 0.00 ? 480 PRO A HB2  3  
ATOM 5170  H HB3  . PRO A 1 105 ? -6.738  19.895  -11.696 1.00 0.00 ? 480 PRO A HB3  3  
ATOM 5171  H HG2  . PRO A 1 105 ? -4.280  19.794  -12.710 1.00 0.00 ? 480 PRO A HG2  3  
ATOM 5172  H HG3  . PRO A 1 105 ? -5.579  18.783  -13.371 1.00 0.00 ? 480 PRO A HG3  3  
ATOM 5173  H HD2  . PRO A 1 105 ? -4.362  21.272  -14.479 1.00 0.00 ? 480 PRO A HD2  3  
ATOM 5174  H HD3  . PRO A 1 105 ? -4.960  19.832  -15.328 1.00 0.00 ? 480 PRO A HD3  3  
ATOM 5175  N N    . ASP B 2 1   ? -0.728  -2.861  -1.782  1.00 0.00 ? 1   ASP B N    3  
ATOM 5176  C CA   . ASP B 2 1   ? -1.439  -1.644  -1.307  1.00 0.00 ? 1   ASP B CA   3  
ATOM 5177  C C    . ASP B 2 1   ? -2.629  -1.313  -2.202  1.00 0.00 ? 1   ASP B C    3  
ATOM 5178  O O    . ASP B 2 1   ? -3.589  -0.678  -1.764  1.00 0.00 ? 1   ASP B O    3  
ATOM 5179  C CB   . ASP B 2 1   ? -0.451  -0.478  -1.291  1.00 0.00 ? 1   ASP B CB   3  
ATOM 5180  C CG   . ASP B 2 1   ? 0.322   -0.391  0.011   1.00 0.00 ? 1   ASP B CG   3  
ATOM 5181  O OD1  . ASP B 2 1   ? -0.212  0.188   0.980   1.00 0.00 ? 1   ASP B OD1  3  
ATOM 5182  O OD2  . ASP B 2 1   ? 1.460   -0.903  0.061   1.00 0.00 ? 1   ASP B OD2  3  
ATOM 5183  H H1   . ASP B 2 1   ? -1.445  -3.559  -2.062  1.00 0.00 ? 1   ASP B H1   3  
ATOM 5184  H H2   . ASP B 2 1   ? -0.147  -3.215  -0.995  1.00 0.00 ? 1   ASP B H2   3  
ATOM 5185  H H3   . ASP B 2 1   ? -0.137  -2.586  -2.592  1.00 0.00 ? 1   ASP B H3   3  
ATOM 5186  H HA   . ASP B 2 1   ? -1.793  -1.824  -0.303  1.00 0.00 ? 1   ASP B HA   3  
ATOM 5187  H HB2  . ASP B 2 1   ? 0.255   -0.600  -2.098  1.00 0.00 ? 1   ASP B HB2  3  
ATOM 5188  H HB3  . ASP B 2 1   ? -0.992  0.447   -1.429  1.00 0.00 ? 1   ASP B HB3  3  
ATOM 5189  N N    . SER B 2 2   ? -2.560  -1.745  -3.459  1.00 0.00 ? 2   SER B N    3  
ATOM 5190  C CA   . SER B 2 2   ? -3.631  -1.493  -4.417  1.00 0.00 ? 2   SER B CA   3  
ATOM 5191  C C    . SER B 2 2   ? -3.783  0.000   -4.686  1.00 0.00 ? 2   SER B C    3  
ATOM 5192  O O    . SER B 2 2   ? -4.893  0.498   -4.873  1.00 0.00 ? 2   SER B O    3  
ATOM 5193  C CB   . SER B 2 2   ? -4.955  -2.067  -3.903  1.00 0.00 ? 2   SER B CB   3  
ATOM 5194  O OG   . SER B 2 2   ? -4.847  -3.458  -3.658  1.00 0.00 ? 2   SER B OG   3  
ATOM 5195  H H    . SER B 2 2   ? -1.769  -2.245  -3.750  1.00 0.00 ? 2   SER B H    3  
ATOM 5196  H HA   . SER B 2 2   ? -3.372  -1.987  -5.341  1.00 0.00 ? 2   SER B HA   3  
ATOM 5197  H HB2  . SER B 2 2   ? -5.226  -1.572  -2.982  1.00 0.00 ? 2   SER B HB2  3  
ATOM 5198  H HB3  . SER B 2 2   ? -5.726  -1.902  -4.640  1.00 0.00 ? 2   SER B HB3  3  
ATOM 5199  H HG   . SER B 2 2   ? -5.700  -3.802  -3.383  1.00 0.00 ? 2   SER B HG   3  
ATOM 5200  N N    . ARG B 2 3   ? -2.659  0.710   -4.710  1.00 0.00 ? 3   ARG B N    3  
ATOM 5201  C CA   . ARG B 2 3   ? -2.670  2.146   -4.961  1.00 0.00 ? 3   ARG B CA   3  
ATOM 5202  C C    . ARG B 2 3   ? -3.281  2.452   -6.325  1.00 0.00 ? 3   ARG B C    3  
ATOM 5203  O O    . ARG B 2 3   ? -2.720  2.096   -7.361  1.00 0.00 ? 3   ARG B O    3  
ATOM 5204  C CB   . ARG B 2 3   ? -1.250  2.709   -4.884  1.00 0.00 ? 3   ARG B CB   3  
ATOM 5205  C CG   . ARG B 2 3   ? -0.916  3.331   -3.535  1.00 0.00 ? 3   ARG B CG   3  
ATOM 5206  C CD   . ARG B 2 3   ? -0.491  4.786   -3.671  1.00 0.00 ? 3   ARG B CD   3  
ATOM 5207  N NE   . ARG B 2 3   ? 0.886   4.996   -3.231  1.00 0.00 ? 3   ARG B NE   3  
ATOM 5208  C CZ   . ARG B 2 3   ? 1.953   4.644   -3.944  1.00 0.00 ? 3   ARG B CZ   3  
ATOM 5209  N NH1  . ARG B 2 3   ? 1.806   4.072   -5.133  1.00 0.00 ? 3   ARG B NH1  3  
ATOM 5210  N NH2  . ARG B 2 3   ? 3.171   4.867   -3.468  1.00 0.00 ? 3   ARG B NH2  3  
ATOM 5211  H H    . ARG B 2 3   ? -1.804  0.257   -4.557  1.00 0.00 ? 3   ARG B H    3  
ATOM 5212  H HA   . ARG B 2 3   ? -3.275  2.612   -4.197  1.00 0.00 ? 3   ARG B HA   3  
ATOM 5213  H HB2  . ARG B 2 3   ? -0.548  1.910   -5.070  1.00 0.00 ? 3   ARG B HB2  3  
ATOM 5214  H HB3  . ARG B 2 3   ? -1.131  3.465   -5.645  1.00 0.00 ? 3   ARG B HB3  3  
ATOM 5215  H HG2  . ARG B 2 3   ? -1.789  3.281   -2.902  1.00 0.00 ? 3   ARG B HG2  3  
ATOM 5216  H HG3  . ARG B 2 3   ? -0.110  2.771   -3.083  1.00 0.00 ? 3   ARG B HG3  3  
ATOM 5217  H HD2  . ARG B 2 3   ? -0.577  5.080   -4.707  1.00 0.00 ? 3   ARG B HD2  3  
ATOM 5218  H HD3  . ARG B 2 3   ? -1.148  5.396   -3.069  1.00 0.00 ? 3   ARG B HD3  3  
ATOM 5219  H HE   . ARG B 2 3   ? 1.023   5.419   -2.358  1.00 0.00 ? 3   ARG B HE   3  
ATOM 5220  H HH11 . ARG B 2 3   ? 0.892   3.902   -5.499  1.00 0.00 ? 3   ARG B HH11 3  
ATOM 5221  H HH12 . ARG B 2 3   ? 2.613   3.810   -5.664  1.00 0.00 ? 3   ARG B HH12 3  
ATOM 5222  H HH21 . ARG B 2 3   ? 3.287   5.300   -2.575  1.00 0.00 ? 3   ARG B HH21 3  
ATOM 5223  H HH22 . ARG B 2 3   ? 3.972   4.604   -4.004  1.00 0.00 ? 3   ARG B HH22 3  
ATOM 5224  N N    . ILE B 2 4   ? -4.436  3.109   -6.316  1.00 0.00 ? 4   ILE B N    3  
ATOM 5225  C CA   . ILE B 2 4   ? -5.126  3.459   -7.552  1.00 0.00 ? 4   ILE B CA   3  
ATOM 5226  C C    . ILE B 2 4   ? -4.537  4.719   -8.178  1.00 0.00 ? 4   ILE B C    3  
ATOM 5227  O O    . ILE B 2 4   ? -4.570  5.796   -7.581  1.00 0.00 ? 4   ILE B O    3  
ATOM 5228  C CB   . ILE B 2 4   ? -6.634  3.673   -7.314  1.00 0.00 ? 4   ILE B CB   3  
ATOM 5229  C CG1  . ILE B 2 4   ? -6.862  4.587   -6.108  1.00 0.00 ? 4   ILE B CG1  3  
ATOM 5230  C CG2  . ILE B 2 4   ? -7.334  2.336   -7.112  1.00 0.00 ? 4   ILE B CG2  3  
ATOM 5231  C CD1  . ILE B 2 4   ? -8.062  5.496   -6.255  1.00 0.00 ? 4   ILE B CD1  3  
ATOM 5232  H H    . ILE B 2 4   ? -4.834  3.363   -5.457  1.00 0.00 ? 4   ILE B H    3  
ATOM 5233  H HA   . ILE B 2 4   ? -5.006  2.637   -8.242  1.00 0.00 ? 4   ILE B HA   3  
ATOM 5234  H HB   . ILE B 2 4   ? -7.051  4.139   -8.193  1.00 0.00 ? 4   ILE B HB   3  
ATOM 5235  H HG12 . ILE B 2 4   ? -7.015  3.980   -5.228  1.00 0.00 ? 4   ILE B HG12 3  
ATOM 5236  H HG13 . ILE B 2 4   ? -5.990  5.207   -5.963  1.00 0.00 ? 4   ILE B HG13 3  
ATOM 5237  H HG21 . ILE B 2 4   ? -6.609  1.592   -6.817  1.00 0.00 ? 4   ILE B HG21 3  
ATOM 5238  H HG22 . ILE B 2 4   ? -8.083  2.435   -6.342  1.00 0.00 ? 4   ILE B HG22 3  
ATOM 5239  H HG23 . ILE B 2 4   ? -7.805  2.034   -8.035  1.00 0.00 ? 4   ILE B HG23 3  
ATOM 5240  H HD11 . ILE B 2 4   ? -8.019  6.274   -5.506  1.00 0.00 ? 4   ILE B HD11 3  
ATOM 5241  H HD12 . ILE B 2 4   ? -8.057  5.943   -7.238  1.00 0.00 ? 4   ILE B HD12 3  
ATOM 5242  H HD13 . ILE B 2 4   ? -8.967  4.922   -6.125  1.00 0.00 ? 4   ILE B HD13 3  
ATOM 5243  N N    . TRP B 2 5   ? -4.001  4.579   -9.387  1.00 0.00 ? 5   TRP B N    3  
ATOM 5244  C CA   . TRP B 2 5   ? -3.407  5.706   -10.096 1.00 0.00 ? 5   TRP B CA   3  
ATOM 5245  C C    . TRP B 2 5   ? -4.418  6.346   -11.041 1.00 0.00 ? 5   TRP B C    3  
ATOM 5246  O O    . TRP B 2 5   ? -4.558  5.929   -12.192 1.00 0.00 ? 5   TRP B O    3  
ATOM 5247  C CB   . TRP B 2 5   ? -2.174  5.254   -10.882 1.00 0.00 ? 5   TRP B CB   3  
ATOM 5248  C CG   . TRP B 2 5   ? -0.951  5.096   -10.032 1.00 0.00 ? 5   TRP B CG   3  
ATOM 5249  C CD1  . TRP B 2 5   ? -0.828  4.333   -8.907  1.00 0.00 ? 5   TRP B CD1  3  
ATOM 5250  C CD2  . TRP B 2 5   ? 0.322   5.717   -10.238 1.00 0.00 ? 5   TRP B CD2  3  
ATOM 5251  N NE1  . TRP B 2 5   ? 0.446   4.440   -8.401  1.00 0.00 ? 5   TRP B NE1  3  
ATOM 5252  C CE2  . TRP B 2 5   ? 1.170   5.285   -9.202  1.00 0.00 ? 5   TRP B CE2  3  
ATOM 5253  C CE3  . TRP B 2 5   ? 0.829   6.596   -11.200 1.00 0.00 ? 5   TRP B CE3  3  
ATOM 5254  C CZ2  . TRP B 2 5   ? 2.495   5.701   -9.100  1.00 0.00 ? 5   TRP B CZ2  3  
ATOM 5255  C CZ3  . TRP B 2 5   ? 2.144   7.008   -11.098 1.00 0.00 ? 5   TRP B CZ3  3  
ATOM 5256  C CH2  . TRP B 2 5   ? 2.965   6.561   -10.055 1.00 0.00 ? 5   TRP B CH2  3  
ATOM 5257  H H    . TRP B 2 5   ? -4.007  3.696   -9.812  1.00 0.00 ? 5   TRP B H    3  
ATOM 5258  H HA   . TRP B 2 5   ? -3.106  6.438   -9.361  1.00 0.00 ? 5   TRP B HA   3  
ATOM 5259  H HB2  . TRP B 2 5   ? -2.382  4.302   -11.347 1.00 0.00 ? 5   TRP B HB2  3  
ATOM 5260  H HB3  . TRP B 2 5   ? -1.957  5.984   -11.648 1.00 0.00 ? 5   TRP B HB3  3  
ATOM 5261  H HD1  . TRP B 2 5   ? -1.624  3.736   -8.486  1.00 0.00 ? 5   TRP B HD1  3  
ATOM 5262  H HE1  . TRP B 2 5   ? 0.779   3.987   -7.600  1.00 0.00 ? 5   TRP B HE1  3  
ATOM 5263  H HE3  . TRP B 2 5   ? 0.211   6.952   -12.012 1.00 0.00 ? 5   TRP B HE3  3  
ATOM 5264  H HZ2  . TRP B 2 5   ? 3.141   5.365   -8.302  1.00 0.00 ? 5   TRP B HZ2  3  
ATOM 5265  H HZ3  . TRP B 2 5   ? 2.553   7.687   -11.832 1.00 0.00 ? 5   TRP B HZ3  3  
ATOM 5266  H HH2  . TRP B 2 5   ? 3.985   6.911   -10.015 1.00 0.00 ? 5   TRP B HH2  3  
ATOM 5267  N N    . TRP B 2 6   ? -5.120  7.362   -10.550 1.00 0.00 ? 6   TRP B N    3  
ATOM 5268  C CA   . TRP B 2 6   ? -6.118  8.059   -11.351 1.00 0.00 ? 6   TRP B CA   3  
ATOM 5269  C C    . TRP B 2 6   ? -5.458  8.845   -12.479 1.00 0.00 ? 6   TRP B C    3  
ATOM 5270  O O    . TRP B 2 6   ? -5.173  10.034  -12.338 1.00 0.00 ? 6   TRP B O    3  
ATOM 5271  C CB   . TRP B 2 6   ? -6.939  9.003   -10.470 1.00 0.00 ? 6   TRP B CB   3  
ATOM 5272  C CG   . TRP B 2 6   ? -8.306  9.294   -11.015 1.00 0.00 ? 6   TRP B CG   3  
ATOM 5273  C CD1  . TRP B 2 6   ? -8.785  8.969   -12.252 1.00 0.00 ? 6   TRP B CD1  3  
ATOM 5274  C CD2  . TRP B 2 6   ? -9.369  9.971   -10.338 1.00 0.00 ? 6   TRP B CD2  3  
ATOM 5275  N NE1  . TRP B 2 6   ? -10.082 9.402   -12.384 1.00 0.00 ? 6   TRP B NE1  3  
ATOM 5276  C CE2  . TRP B 2 6   ? -10.463 10.022  -11.223 1.00 0.00 ? 6   TRP B CE2  3  
ATOM 5277  C CE3  . TRP B 2 6   ? -9.504  10.540  -9.068  1.00 0.00 ? 6   TRP B CE3  3  
ATOM 5278  C CZ2  . TRP B 2 6   ? -11.673 10.618  -10.878 1.00 0.00 ? 6   TRP B CZ2  3  
ATOM 5279  C CZ3  . TRP B 2 6   ? -10.706 11.131  -8.728  1.00 0.00 ? 6   TRP B CZ3  3  
ATOM 5280  C CH2  . TRP B 2 6   ? -11.777 11.166  -9.629  1.00 0.00 ? 6   TRP B CH2  3  
ATOM 5281  H H    . TRP B 2 6   ? -4.963  7.648   -9.627  1.00 0.00 ? 6   TRP B H    3  
ATOM 5282  H HA   . TRP B 2 6   ? -6.775  7.318   -11.780 1.00 0.00 ? 6   TRP B HA   3  
ATOM 5283  H HB2  . TRP B 2 6   ? -7.058  8.559   -9.494  1.00 0.00 ? 6   TRP B HB2  3  
ATOM 5284  H HB3  . TRP B 2 6   ? -6.412  9.941   -10.371 1.00 0.00 ? 6   TRP B HB3  3  
ATOM 5285  H HD1  . TRP B 2 6   ? -8.216  8.447   -13.006 1.00 0.00 ? 6   TRP B HD1  3  
ATOM 5286  H HE1  . TRP B 2 6   ? -10.642 9.288   -13.180 1.00 0.00 ? 6   TRP B HE1  3  
ATOM 5287  H HE3  . TRP B 2 6   ? -8.689  10.523  -8.359  1.00 0.00 ? 6   TRP B HE3  3  
ATOM 5288  H HZ2  . TRP B 2 6   ? -12.509 10.651  -11.561 1.00 0.00 ? 6   TRP B HZ2  3  
ATOM 5289  H HZ3  . TRP B 2 6   ? -10.828 11.576  -7.751  1.00 0.00 ? 6   TRP B HZ3  3  
ATOM 5290  H HH2  . TRP B 2 6   ? -12.698 11.638  -9.320  1.00 0.00 ? 6   TRP B HH2  3  
ATOM 5291  N N    . VAL B 2 7   ? -5.218  8.172   -13.600 1.00 0.00 ? 7   VAL B N    3  
ATOM 5292  C CA   . VAL B 2 7   ? -4.593  8.809   -14.753 1.00 0.00 ? 7   VAL B CA   3  
ATOM 5293  C C    . VAL B 2 7   ? -5.467  8.677   -15.994 1.00 0.00 ? 7   VAL B C    3  
ATOM 5294  O O    . VAL B 2 7   ? -6.186  9.646   -16.316 1.00 0.00 ? 7   VAL B O    3  
ATOM 5295  C CB   . VAL B 2 7   ? -3.208  8.204   -15.048 1.00 0.00 ? 7   VAL B CB   3  
ATOM 5296  C CG1  . VAL B 2 7   ? -2.488  9.011   -16.116 1.00 0.00 ? 7   VAL B CG1  3  
ATOM 5297  C CG2  . VAL B 2 7   ? -2.377  8.127   -13.776 1.00 0.00 ? 7   VAL B CG2  3  
ATOM 5298  O OXT  . VAL B 2 7   ? -5.426  7.605   -16.635 1.00 0.00 ? 7   VAL B OXT  3  
ATOM 5299  H H    . VAL B 2 7   ? -5.469  7.227   -13.654 1.00 0.00 ? 7   VAL B H    3  
ATOM 5300  H HA   . VAL B 2 7   ? -4.463  9.858   -14.526 1.00 0.00 ? 7   VAL B HA   3  
ATOM 5301  H HB   . VAL B 2 7   ? -3.348  7.199   -15.421 1.00 0.00 ? 7   VAL B HB   3  
ATOM 5302  H HG11 . VAL B 2 7   ? -2.867  10.023  -16.120 1.00 0.00 ? 7   VAL B HG11 3  
ATOM 5303  H HG12 . VAL B 2 7   ? -1.428  9.025   -15.904 1.00 0.00 ? 7   VAL B HG12 3  
ATOM 5304  H HG13 . VAL B 2 7   ? -2.655  8.560   -17.083 1.00 0.00 ? 7   VAL B HG13 3  
ATOM 5305  H HG21 . VAL B 2 7   ? -2.039  9.117   -13.507 1.00 0.00 ? 7   VAL B HG21 3  
ATOM 5306  H HG22 . VAL B 2 7   ? -2.980  7.723   -12.975 1.00 0.00 ? 7   VAL B HG22 3  
ATOM 5307  H HG23 . VAL B 2 7   ? -1.524  7.487   -13.941 1.00 0.00 ? 7   VAL B HG23 3  
ATOM 5308  N N    . GLY A 1 1   ? 5.787   28.979  -17.874 1.00 0.00 ? 376 GLY A N    4  
ATOM 5309  C CA   . GLY A 1 1   ? 4.662   28.181  -17.313 1.00 0.00 ? 376 GLY A CA   4  
ATOM 5310  C C    . GLY A 1 1   ? 4.119   27.168  -18.303 1.00 0.00 ? 376 GLY A C    4  
ATOM 5311  O O    . GLY A 1 1   ? 3.045   27.359  -18.872 1.00 0.00 ? 376 GLY A O    4  
ATOM 5312  H H1   . GLY A 1 1   ? 5.453   29.926  -18.145 1.00 0.00 ? 376 GLY A H1   4  
ATOM 5313  H H2   . GLY A 1 1   ? 6.178   28.508  -18.713 1.00 0.00 ? 376 GLY A H2   4  
ATOM 5314  H H3   . GLY A 1 1   ? 6.541   29.080  -17.164 1.00 0.00 ? 376 GLY A H3   4  
ATOM 5315  H HA2  . GLY A 1 1   ? 5.008   27.659  -16.434 1.00 0.00 ? 376 GLY A HA2  4  
ATOM 5316  H HA3  . GLY A 1 1   ? 3.865   28.852  -17.029 1.00 0.00 ? 376 GLY A HA3  4  
ATOM 5317  N N    . SER A 1 2   ? 4.864   26.087  -18.508 1.00 0.00 ? 377 SER A N    4  
ATOM 5318  C CA   . SER A 1 2   ? 4.453   25.039  -19.434 1.00 0.00 ? 377 SER A CA   4  
ATOM 5319  C C    . SER A 1 2   ? 4.148   23.743  -18.688 1.00 0.00 ? 377 SER A C    4  
ATOM 5320  O O    . SER A 1 2   ? 4.981   23.239  -17.935 1.00 0.00 ? 377 SER A O    4  
ATOM 5321  C CB   . SER A 1 2   ? 5.544   24.794  -20.479 1.00 0.00 ? 377 SER A CB   4  
ATOM 5322  O OG   . SER A 1 2   ? 4.981   24.537  -21.754 1.00 0.00 ? 377 SER A OG   4  
ATOM 5323  H H    . SER A 1 2   ? 5.711   25.991  -18.024 1.00 0.00 ? 377 SER A H    4  
ATOM 5324  H HA   . SER A 1 2   ? 3.556   25.371  -19.935 1.00 0.00 ? 377 SER A HA   4  
ATOM 5325  H HB2  . SER A 1 2   ? 6.176   25.667  -20.547 1.00 0.00 ? 377 SER A HB2  4  
ATOM 5326  H HB3  . SER A 1 2   ? 6.139   23.942  -20.183 1.00 0.00 ? 377 SER A HB3  4  
ATOM 5327  H HG   . SER A 1 2   ? 5.428   23.788  -22.156 1.00 0.00 ? 377 SER A HG   4  
ATOM 5328  N N    . HIS A 1 3   ? 2.950   23.210  -18.901 1.00 0.00 ? 378 HIS A N    4  
ATOM 5329  C CA   . HIS A 1 3   ? 2.535   21.974  -18.246 1.00 0.00 ? 378 HIS A CA   4  
ATOM 5330  C C    . HIS A 1 3   ? 2.227   20.890  -19.275 1.00 0.00 ? 378 HIS A C    4  
ATOM 5331  O O    . HIS A 1 3   ? 2.953   19.903  -19.388 1.00 0.00 ? 378 HIS A O    4  
ATOM 5332  C CB   . HIS A 1 3   ? 1.309   22.226  -17.365 1.00 0.00 ? 378 HIS A CB   4  
ATOM 5333  C CG   . HIS A 1 3   ? 1.616   22.224  -15.900 1.00 0.00 ? 378 HIS A CG   4  
ATOM 5334  N ND1  . HIS A 1 3   ? 2.879   22.454  -15.394 1.00 0.00 ? 378 HIS A ND1  4  
ATOM 5335  C CD2  . HIS A 1 3   ? 0.816   22.018  -14.828 1.00 0.00 ? 378 HIS A CD2  4  
ATOM 5336  C CE1  . HIS A 1 3   ? 2.842   22.389  -14.075 1.00 0.00 ? 378 HIS A CE1  4  
ATOM 5337  N NE2  . HIS A 1 3   ? 1.602   22.126  -13.706 1.00 0.00 ? 378 HIS A NE2  4  
ATOM 5338  H H    . HIS A 1 3   ? 2.328   23.659  -19.512 1.00 0.00 ? 378 HIS A H    4  
ATOM 5339  H HA   . HIS A 1 3   ? 3.352   21.640  -17.625 1.00 0.00 ? 378 HIS A HA   4  
ATOM 5340  H HB2  . HIS A 1 3   ? 0.887   23.188  -17.614 1.00 0.00 ? 378 HIS A HB2  4  
ATOM 5341  H HB3  . HIS A 1 3   ? 0.574   21.457  -17.552 1.00 0.00 ? 378 HIS A HB3  4  
ATOM 5342  H HD1  . HIS A 1 3   ? 3.682   22.637  -15.924 1.00 0.00 ? 378 HIS A HD1  4  
ATOM 5343  H HD2  . HIS A 1 3   ? -0.244  21.808  -14.850 1.00 0.00 ? 378 HIS A HD2  4  
ATOM 5344  H HE1  . HIS A 1 3   ? 3.682   22.528  -13.413 1.00 0.00 ? 378 HIS A HE1  4  
ATOM 5345  H HE2  . HIS A 1 3   ? 1.314   21.933  -12.790 1.00 0.00 ? 378 HIS A HE2  4  
ATOM 5346  N N    . MET A 1 4   ? 1.144   21.082  -20.023 1.00 0.00 ? 379 MET A N    4  
ATOM 5347  C CA   . MET A 1 4   ? 0.738   20.119  -21.041 1.00 0.00 ? 379 MET A CA   4  
ATOM 5348  C C    . MET A 1 4   ? 0.477   18.750  -20.419 1.00 0.00 ? 379 MET A C    4  
ATOM 5349  O O    . MET A 1 4   ? 1.404   17.971  -20.198 1.00 0.00 ? 379 MET A O    4  
ATOM 5350  C CB   . MET A 1 4   ? 1.814   20.009  -22.125 1.00 0.00 ? 379 MET A CB   4  
ATOM 5351  C CG   . MET A 1 4   ? 1.316   20.376  -23.514 1.00 0.00 ? 379 MET A CG   4  
ATOM 5352  S SD   . MET A 1 4   ? 1.556   22.120  -23.898 1.00 0.00 ? 379 MET A SD   4  
ATOM 5353  C CE   . MET A 1 4   ? -0.137  22.648  -24.145 1.00 0.00 ? 379 MET A CE   4  
ATOM 5354  H H    . MET A 1 4   ? 0.605   21.888  -19.885 1.00 0.00 ? 379 MET A H    4  
ATOM 5355  H HA   . MET A 1 4   ? -0.176  20.477  -21.489 1.00 0.00 ? 379 MET A HA   4  
ATOM 5356  H HB2  . MET A 1 4   ? 2.631   20.668  -21.873 1.00 0.00 ? 379 MET A HB2  4  
ATOM 5357  H HB3  . MET A 1 4   ? 2.179   18.993  -22.155 1.00 0.00 ? 379 MET A HB3  4  
ATOM 5358  H HG2  . MET A 1 4   ? 1.853   19.785  -24.242 1.00 0.00 ? 379 MET A HG2  4  
ATOM 5359  H HG3  . MET A 1 4   ? 0.262   20.149  -23.575 1.00 0.00 ? 379 MET A HG3  4  
ATOM 5360  H HE1  . MET A 1 4   ? -0.455  22.387  -25.144 1.00 0.00 ? 379 MET A HE1  4  
ATOM 5361  H HE2  . MET A 1 4   ? -0.776  22.157  -23.425 1.00 0.00 ? 379 MET A HE2  4  
ATOM 5362  H HE3  . MET A 1 4   ? -0.204  23.718  -24.014 1.00 0.00 ? 379 MET A HE3  4  
ATOM 5363  N N    . LYS A 1 5   ? -0.791  18.466  -20.139 1.00 0.00 ? 380 LYS A N    4  
ATOM 5364  C CA   . LYS A 1 5   ? -1.173  17.193  -19.542 1.00 0.00 ? 380 LYS A CA   4  
ATOM 5365  C C    . LYS A 1 5   ? -2.447  16.652  -20.182 1.00 0.00 ? 380 LYS A C    4  
ATOM 5366  O O    . LYS A 1 5   ? -3.326  17.416  -20.582 1.00 0.00 ? 380 LYS A O    4  
ATOM 5367  C CB   . LYS A 1 5   ? -1.378  17.356  -18.034 1.00 0.00 ? 380 LYS A CB   4  
ATOM 5368  C CG   . LYS A 1 5   ? -2.291  18.514  -17.667 1.00 0.00 ? 380 LYS A CG   4  
ATOM 5369  C CD   . LYS A 1 5   ? -2.862  18.352  -16.267 1.00 0.00 ? 380 LYS A CD   4  
ATOM 5370  C CE   . LYS A 1 5   ? -4.298  18.844  -16.191 1.00 0.00 ? 380 LYS A CE   4  
ATOM 5371  N NZ   . LYS A 1 5   ? -4.408  20.290  -16.527 1.00 0.00 ? 380 LYS A NZ   4  
ATOM 5372  H H    . LYS A 1 5   ? -1.484  19.130  -20.338 1.00 0.00 ? 380 LYS A H    4  
ATOM 5373  H HA   . LYS A 1 5   ? -0.372  16.491  -19.713 1.00 0.00 ? 380 LYS A HA   4  
ATOM 5374  H HB2  . LYS A 1 5   ? -1.808  16.447  -17.640 1.00 0.00 ? 380 LYS A HB2  4  
ATOM 5375  H HB3  . LYS A 1 5   ? -0.418  17.521  -17.568 1.00 0.00 ? 380 LYS A HB3  4  
ATOM 5376  H HG2  . LYS A 1 5   ? -1.725  19.433  -17.709 1.00 0.00 ? 380 LYS A HG2  4  
ATOM 5377  H HG3  . LYS A 1 5   ? -3.105  18.556  -18.375 1.00 0.00 ? 380 LYS A HG3  4  
ATOM 5378  H HD2  . LYS A 1 5   ? -2.835  17.307  -15.997 1.00 0.00 ? 380 LYS A HD2  4  
ATOM 5379  H HD3  . LYS A 1 5   ? -2.258  18.920  -15.575 1.00 0.00 ? 380 LYS A HD3  4  
ATOM 5380  H HE2  . LYS A 1 5   ? -4.897  18.276  -16.886 1.00 0.00 ? 380 LYS A HE2  4  
ATOM 5381  H HE3  . LYS A 1 5   ? -4.665  18.687  -15.188 1.00 0.00 ? 380 LYS A HE3  4  
ATOM 5382  H HZ1  . LYS A 1 5   ? -5.188  20.724  -15.992 1.00 0.00 ? 380 LYS A HZ1  4  
ATOM 5383  H HZ2  . LYS A 1 5   ? -3.523  20.782  -16.286 1.00 0.00 ? 380 LYS A HZ2  4  
ATOM 5384  H HZ3  . LYS A 1 5   ? -4.592  20.409  -17.543 1.00 0.00 ? 380 LYS A HZ3  4  
ATOM 5385  N N    . LYS A 1 6   ? -2.541  15.331  -20.273 1.00 0.00 ? 381 LYS A N    4  
ATOM 5386  C CA   . LYS A 1 6   ? -3.710  14.685  -20.863 1.00 0.00 ? 381 LYS A CA   4  
ATOM 5387  C C    . LYS A 1 6   ? -4.514  13.949  -19.798 1.00 0.00 ? 381 LYS A C    4  
ATOM 5388  O O    . LYS A 1 6   ? -3.977  13.556  -18.762 1.00 0.00 ? 381 LYS A O    4  
ATOM 5389  C CB   . LYS A 1 6   ? -3.280  13.712  -21.962 1.00 0.00 ? 381 LYS A CB   4  
ATOM 5390  C CG   . LYS A 1 6   ? -2.902  14.395  -23.265 1.00 0.00 ? 381 LYS A CG   4  
ATOM 5391  C CD   . LYS A 1 6   ? -1.680  13.751  -23.901 1.00 0.00 ? 381 LYS A CD   4  
ATOM 5392  C CE   . LYS A 1 6   ? -1.684  13.913  -25.413 1.00 0.00 ? 381 LYS A CE   4  
ATOM 5393  N NZ   . LYS A 1 6   ? -0.519  14.708  -25.889 1.00 0.00 ? 381 LYS A NZ   4  
ATOM 5394  H H    . LYS A 1 6   ? -1.809  14.774  -19.935 1.00 0.00 ? 381 LYS A H    4  
ATOM 5395  H HA   . LYS A 1 6   ? -4.330  15.455  -21.298 1.00 0.00 ? 381 LYS A HA   4  
ATOM 5396  H HB2  . LYS A 1 6   ? -2.426  13.148  -21.614 1.00 0.00 ? 381 LYS A HB2  4  
ATOM 5397  H HB3  . LYS A 1 6   ? -4.094  13.029  -22.160 1.00 0.00 ? 381 LYS A HB3  4  
ATOM 5398  H HG2  . LYS A 1 6   ? -3.732  14.323  -23.953 1.00 0.00 ? 381 LYS A HG2  4  
ATOM 5399  H HG3  . LYS A 1 6   ? -2.687  15.435  -23.066 1.00 0.00 ? 381 LYS A HG3  4  
ATOM 5400  H HD2  . LYS A 1 6   ? -0.791  14.217  -23.503 1.00 0.00 ? 381 LYS A HD2  4  
ATOM 5401  H HD3  . LYS A 1 6   ? -1.674  12.698  -23.661 1.00 0.00 ? 381 LYS A HD3  4  
ATOM 5402  H HE2  . LYS A 1 6   ? -1.649  12.933  -25.868 1.00 0.00 ? 381 LYS A HE2  4  
ATOM 5403  H HE3  . LYS A 1 6   ? -2.595  14.412  -25.709 1.00 0.00 ? 381 LYS A HE3  4  
ATOM 5404  H HZ1  . LYS A 1 6   ? -0.652  15.712  -25.655 1.00 0.00 ? 381 LYS A HZ1  4  
ATOM 5405  H HZ2  . LYS A 1 6   ? 0.354   14.370  -25.436 1.00 0.00 ? 381 LYS A HZ2  4  
ATOM 5406  H HZ3  . LYS A 1 6   ? -0.420  14.613  -26.920 1.00 0.00 ? 381 LYS A HZ3  4  
ATOM 5407  N N    . TYR A 1 7   ? -5.804  13.764  -20.059 1.00 0.00 ? 382 TYR A N    4  
ATOM 5408  C CA   . TYR A 1 7   ? -6.680  13.073  -19.119 1.00 0.00 ? 382 TYR A CA   4  
ATOM 5409  C C    . TYR A 1 7   ? -7.497  11.997  -19.824 1.00 0.00 ? 382 TYR A C    4  
ATOM 5410  O O    . TYR A 1 7   ? -8.170  12.267  -20.820 1.00 0.00 ? 382 TYR A O    4  
ATOM 5411  C CB   . TYR A 1 7   ? -7.615  14.070  -18.431 1.00 0.00 ? 382 TYR A CB   4  
ATOM 5412  C CG   . TYR A 1 7   ? -8.544  13.433  -17.423 1.00 0.00 ? 382 TYR A CG   4  
ATOM 5413  C CD1  . TYR A 1 7   ? -8.138  13.224  -16.111 1.00 0.00 ? 382 TYR A CD1  4  
ATOM 5414  C CD2  . TYR A 1 7   ? -9.826  13.038  -17.784 1.00 0.00 ? 382 TYR A CD2  4  
ATOM 5415  C CE1  . TYR A 1 7   ? -8.984  12.641  -15.187 1.00 0.00 ? 382 TYR A CE1  4  
ATOM 5416  C CE2  . TYR A 1 7   ? -10.678 12.454  -16.866 1.00 0.00 ? 382 TYR A CE2  4  
ATOM 5417  C CZ   . TYR A 1 7   ? -10.253 12.258  -15.570 1.00 0.00 ? 382 TYR A CZ   4  
ATOM 5418  O OH   . TYR A 1 7   ? -11.097 11.676  -14.653 1.00 0.00 ? 382 TYR A OH   4  
ATOM 5419  H H    . TYR A 1 7   ? -6.176  14.099  -20.901 1.00 0.00 ? 382 TYR A H    4  
ATOM 5420  H HA   . TYR A 1 7   ? -6.058  12.603  -18.372 1.00 0.00 ? 382 TYR A HA   4  
ATOM 5421  H HB2  . TYR A 1 7   ? -7.023  14.811  -17.914 1.00 0.00 ? 382 TYR A HB2  4  
ATOM 5422  H HB3  . TYR A 1 7   ? -8.220  14.561  -19.179 1.00 0.00 ? 382 TYR A HB3  4  
ATOM 5423  H HD1  . TYR A 1 7   ? -7.145  13.526  -15.814 1.00 0.00 ? 382 TYR A HD1  4  
ATOM 5424  H HD2  . TYR A 1 7   ? -10.156 13.192  -18.801 1.00 0.00 ? 382 TYR A HD2  4  
ATOM 5425  H HE1  . TYR A 1 7   ? -8.650  12.487  -14.171 1.00 0.00 ? 382 TYR A HE1  4  
ATOM 5426  H HE2  . TYR A 1 7   ? -11.671 12.155  -17.166 1.00 0.00 ? 382 TYR A HE2  4  
ATOM 5427  H HH   . TYR A 1 7   ? -11.905 12.192  -14.589 1.00 0.00 ? 382 TYR A HH   4  
ATOM 5428  N N    . ILE A 1 8   ? -7.437  10.778  -19.299 1.00 0.00 ? 383 ILE A N    4  
ATOM 5429  C CA   . ILE A 1 8   ? -8.174  9.659   -19.875 1.00 0.00 ? 383 ILE A CA   4  
ATOM 5430  C C    . ILE A 1 8   ? -9.217  9.115   -18.898 1.00 0.00 ? 383 ILE A C    4  
ATOM 5431  O O    . ILE A 1 8   ? -9.988  8.221   -19.241 1.00 0.00 ? 383 ILE A O    4  
ATOM 5432  C CB   . ILE A 1 8   ? -7.229  8.515   -20.289 1.00 0.00 ? 383 ILE A CB   4  
ATOM 5433  C CG1  . ILE A 1 8   ? -6.219  8.228   -19.177 1.00 0.00 ? 383 ILE A CG1  4  
ATOM 5434  C CG2  . ILE A 1 8   ? -6.512  8.861   -21.584 1.00 0.00 ? 383 ILE A CG2  4  
ATOM 5435  C CD1  . ILE A 1 8   ? -5.308  7.057   -19.473 1.00 0.00 ? 383 ILE A CD1  4  
ATOM 5436  H H    . ILE A 1 8   ? -6.886  10.628  -18.504 1.00 0.00 ? 383 ILE A H    4  
ATOM 5437  H HA   . ILE A 1 8   ? -8.681  10.015  -20.761 1.00 0.00 ? 383 ILE A HA   4  
ATOM 5438  H HB   . ILE A 1 8   ? -7.824  7.630   -20.462 1.00 0.00 ? 383 ILE A HB   4  
ATOM 5439  H HG12 . ILE A 1 8   ? -5.599  9.099   -19.028 1.00 0.00 ? 383 ILE A HG12 4  
ATOM 5440  H HG13 . ILE A 1 8   ? -6.753  8.012   -18.262 1.00 0.00 ? 383 ILE A HG13 4  
ATOM 5441  H HG21 . ILE A 1 8   ? -7.140  9.508   -22.180 1.00 0.00 ? 383 ILE A HG21 4  
ATOM 5442  H HG22 . ILE A 1 8   ? -5.586  9.368   -21.360 1.00 0.00 ? 383 ILE A HG22 4  
ATOM 5443  H HG23 . ILE A 1 8   ? -6.304  7.955   -22.135 1.00 0.00 ? 383 ILE A HG23 4  
ATOM 5444  H HD11 . ILE A 1 8   ? -5.115  6.510   -18.562 1.00 0.00 ? 383 ILE A HD11 4  
ATOM 5445  H HD12 . ILE A 1 8   ? -5.784  6.402   -20.190 1.00 0.00 ? 383 ILE A HD12 4  
ATOM 5446  H HD13 . ILE A 1 8   ? -4.376  7.419   -19.879 1.00 0.00 ? 383 ILE A HD13 4  
ATOM 5447  N N    . GLY A 1 9   ? -9.239  9.660   -17.682 1.00 0.00 ? 384 GLY A N    4  
ATOM 5448  C CA   . GLY A 1 9   ? -10.196 9.214   -16.683 1.00 0.00 ? 384 GLY A CA   4  
ATOM 5449  C C    . GLY A 1 9   ? -10.219 7.706   -16.521 1.00 0.00 ? 384 GLY A C    4  
ATOM 5450  O O    . GLY A 1 9   ? -11.208 7.054   -16.855 1.00 0.00 ? 384 GLY A O    4  
ATOM 5451  H H    . GLY A 1 9   ? -8.603  10.371  -17.461 1.00 0.00 ? 384 GLY A H    4  
ATOM 5452  H HA2  . GLY A 1 9   ? -9.940  9.661   -15.734 1.00 0.00 ? 384 GLY A HA2  4  
ATOM 5453  H HA3  . GLY A 1 9   ? -11.181 9.549   -16.971 1.00 0.00 ? 384 GLY A HA3  4  
ATOM 5454  N N    . ILE A 1 10  ? -9.127  7.152   -16.006 1.00 0.00 ? 385 ILE A N    4  
ATOM 5455  C CA   . ILE A 1 10  ? -9.024  5.713   -15.797 1.00 0.00 ? 385 ILE A CA   4  
ATOM 5456  C C    . ILE A 1 10  ? -8.084  5.399   -14.638 1.00 0.00 ? 385 ILE A C    4  
ATOM 5457  O O    . ILE A 1 10  ? -6.938  5.849   -14.615 1.00 0.00 ? 385 ILE A O    4  
ATOM 5458  C CB   . ILE A 1 10  ? -8.526  4.996   -17.070 1.00 0.00 ? 385 ILE A CB   4  
ATOM 5459  C CG1  . ILE A 1 10  ? -8.350  3.495   -16.813 1.00 0.00 ? 385 ILE A CG1  4  
ATOM 5460  C CG2  . ILE A 1 10  ? -7.223  5.613   -17.554 1.00 0.00 ? 385 ILE A CG2  4  
ATOM 5461  C CD1  . ILE A 1 10  ? -9.598  2.820   -16.287 1.00 0.00 ? 385 ILE A CD1  4  
ATOM 5462  H H    . ILE A 1 10  ? -8.372  7.726   -15.759 1.00 0.00 ? 385 ILE A H    4  
ATOM 5463  H HA   . ILE A 1 10  ? -10.010 5.340   -15.560 1.00 0.00 ? 385 ILE A HA   4  
ATOM 5464  H HB   . ILE A 1 10  ? -9.266  5.134   -17.843 1.00 0.00 ? 385 ILE A HB   4  
ATOM 5465  H HG12 . ILE A 1 10  ? -8.076  3.007   -17.735 1.00 0.00 ? 385 ILE A HG12 4  
ATOM 5466  H HG13 . ILE A 1 10  ? -7.563  3.351   -16.087 1.00 0.00 ? 385 ILE A HG13 4  
ATOM 5467  H HG21 . ILE A 1 10  ? -6.851  6.303   -16.810 1.00 0.00 ? 385 ILE A HG21 4  
ATOM 5468  H HG22 . ILE A 1 10  ? -6.493  4.835   -17.720 1.00 0.00 ? 385 ILE A HG22 4  
ATOM 5469  H HG23 . ILE A 1 10  ? -7.399  6.143   -18.479 1.00 0.00 ? 385 ILE A HG23 4  
ATOM 5470  H HD11 . ILE A 1 10  ? -9.472  2.599   -15.237 1.00 0.00 ? 385 ILE A HD11 4  
ATOM 5471  H HD12 . ILE A 1 10  ? -10.445 3.477   -16.418 1.00 0.00 ? 385 ILE A HD12 4  
ATOM 5472  H HD13 . ILE A 1 10  ? -9.767  1.902   -16.830 1.00 0.00 ? 385 ILE A HD13 4  
ATOM 5473  N N    . ARG A 1 11  ? -8.577  4.625   -13.677 1.00 0.00 ? 386 ARG A N    4  
ATOM 5474  C CA   . ARG A 1 11  ? -7.780  4.251   -12.516 1.00 0.00 ? 386 ARG A CA   4  
ATOM 5475  C C    . ARG A 1 11  ? -7.016  2.958   -12.776 1.00 0.00 ? 386 ARG A C    4  
ATOM 5476  O O    . ARG A 1 11  ? -7.602  1.941   -13.146 1.00 0.00 ? 386 ARG A O    4  
ATOM 5477  C CB   . ARG A 1 11  ? -8.678  4.089   -11.287 1.00 0.00 ? 386 ARG A CB   4  
ATOM 5478  C CG   . ARG A 1 11  ? -8.850  5.370   -10.486 1.00 0.00 ? 386 ARG A CG   4  
ATOM 5479  C CD   . ARG A 1 11  ? -10.074 5.304   -9.587  1.00 0.00 ? 386 ARG A CD   4  
ATOM 5480  N NE   . ARG A 1 11  ? -10.149 6.450   -8.682  1.00 0.00 ? 386 ARG A NE   4  
ATOM 5481  C CZ   . ARG A 1 11  ? -11.064 7.415   -8.770  1.00 0.00 ? 386 ARG A CZ   4  
ATOM 5482  N NH1  . ARG A 1 11  ? -11.990 7.389   -9.722  1.00 0.00 ? 386 ARG A NH1  4  
ATOM 5483  N NH2  . ARG A 1 11  ? -11.052 8.416   -7.901  1.00 0.00 ? 386 ARG A NH2  4  
ATOM 5484  H H    . ARG A 1 11  ? -9.498  4.297   -13.750 1.00 0.00 ? 386 ARG A H    4  
ATOM 5485  H HA   . ARG A 1 11  ? -7.071  5.045   -12.331 1.00 0.00 ? 386 ARG A HA   4  
ATOM 5486  H HB2  . ARG A 1 11  ? -9.653  3.758   -11.608 1.00 0.00 ? 386 ARG A HB2  4  
ATOM 5487  H HB3  . ARG A 1 11  ? -8.248  3.340   -10.639 1.00 0.00 ? 386 ARG A HB3  4  
ATOM 5488  H HG2  . ARG A 1 11  ? -7.972  5.520   -9.873  1.00 0.00 ? 386 ARG A HG2  4  
ATOM 5489  H HG3  . ARG A 1 11  ? -8.959  6.199   -11.169 1.00 0.00 ? 386 ARG A HG3  4  
ATOM 5490  H HD2  . ARG A 1 11  ? -10.956 5.281   -10.206 1.00 0.00 ? 386 ARG A HD2  4  
ATOM 5491  H HD3  . ARG A 1 11  ? -10.023 4.398   -9.001  1.00 0.00 ? 386 ARG A HD3  4  
ATOM 5492  H HE   . ARG A 1 11  ? -9.481  6.504   -7.967  1.00 0.00 ? 386 ARG A HE   4  
ATOM 5493  H HH11 . ARG A 1 11  ? -12.010 6.642   -10.385 1.00 0.00 ? 386 ARG A HH11 4  
ATOM 5494  H HH12 . ARG A 1 11  ? -12.671 8.120   -9.776  1.00 0.00 ? 386 ARG A HH12 4  
ATOM 5495  H HH21 . ARG A 1 11  ? -10.358 8.445   -7.181  1.00 0.00 ? 386 ARG A HH21 4  
ATOM 5496  H HH22 . ARG A 1 11  ? -11.735 9.143   -7.964  1.00 0.00 ? 386 ARG A HH22 4  
ATOM 5497  N N    . MET A 1 12  ? -5.703  3.007   -12.579 1.00 0.00 ? 387 MET A N    4  
ATOM 5498  C CA   . MET A 1 12  ? -4.852  1.841   -12.792 1.00 0.00 ? 387 MET A CA   4  
ATOM 5499  C C    . MET A 1 12  ? -3.882  1.661   -11.629 1.00 0.00 ? 387 MET A C    4  
ATOM 5500  O O    . MET A 1 12  ? -3.374  2.636   -11.075 1.00 0.00 ? 387 MET A O    4  
ATOM 5501  C CB   . MET A 1 12  ? -4.076  1.979   -14.105 1.00 0.00 ? 387 MET A CB   4  
ATOM 5502  C CG   . MET A 1 12  ? -3.532  3.378   -14.349 1.00 0.00 ? 387 MET A CG   4  
ATOM 5503  S SD   . MET A 1 12  ? -1.750  3.395   -14.627 1.00 0.00 ? 387 MET A SD   4  
ATOM 5504  C CE   . MET A 1 12  ? -1.342  5.061   -14.106 1.00 0.00 ? 387 MET A CE   4  
ATOM 5505  H H    . MET A 1 12  ? -5.295  3.848   -12.284 1.00 0.00 ? 387 MET A H    4  
ATOM 5506  H HA   . MET A 1 12  ? -5.491  0.972   -12.850 1.00 0.00 ? 387 MET A HA   4  
ATOM 5507  H HB2  . MET A 1 12  ? -3.247  1.288   -14.093 1.00 0.00 ? 387 MET A HB2  4  
ATOM 5508  H HB3  . MET A 1 12  ? -4.732  1.723   -14.925 1.00 0.00 ? 387 MET A HB3  4  
ATOM 5509  H HG2  . MET A 1 12  ? -4.020  3.792   -15.219 1.00 0.00 ? 387 MET A HG2  4  
ATOM 5510  H HG3  . MET A 1 12  ? -3.754  3.991   -13.488 1.00 0.00 ? 387 MET A HG3  4  
ATOM 5511  H HE1  . MET A 1 12  ? -0.780  5.553   -14.886 1.00 0.00 ? 387 MET A HE1  4  
ATOM 5512  H HE2  . MET A 1 12  ? -2.251  5.611   -13.916 1.00 0.00 ? 387 MET A HE2  4  
ATOM 5513  H HE3  . MET A 1 12  ? -0.750  5.021   -13.205 1.00 0.00 ? 387 MET A HE3  4  
ATOM 5514  N N    . MET A 1 13  ? -3.631  0.409   -11.260 1.00 0.00 ? 388 MET A N    4  
ATOM 5515  C CA   . MET A 1 13  ? -2.723  0.104   -10.161 1.00 0.00 ? 388 MET A CA   4  
ATOM 5516  C C    . MET A 1 13  ? -1.629  -0.860  -10.605 1.00 0.00 ? 388 MET A C    4  
ATOM 5517  O O    . MET A 1 13  ? -1.795  -1.599  -11.575 1.00 0.00 ? 388 MET A O    4  
ATOM 5518  C CB   . MET A 1 13  ? -3.496  -0.494  -8.985  1.00 0.00 ? 388 MET A CB   4  
ATOM 5519  C CG   . MET A 1 13  ? -4.305  -1.727  -9.354  1.00 0.00 ? 388 MET A CG   4  
ATOM 5520  S SD   . MET A 1 13  ? -5.639  -2.057  -8.186  1.00 0.00 ? 388 MET A SD   4  
ATOM 5521  C CE   . MET A 1 13  ? -4.762  -1.931  -6.630  1.00 0.00 ? 388 MET A CE   4  
ATOM 5522  H H    . MET A 1 13  ? -4.067  -0.326  -11.739 1.00 0.00 ? 388 MET A H    4  
ATOM 5523  H HA   . MET A 1 13  ? -2.264  1.029   -9.844  1.00 0.00 ? 388 MET A HA   4  
ATOM 5524  H HB2  . MET A 1 13  ? -2.796  -0.768  -8.210  1.00 0.00 ? 388 MET A HB2  4  
ATOM 5525  H HB3  . MET A 1 13  ? -4.174  0.252   -8.597  1.00 0.00 ? 388 MET A HB3  4  
ATOM 5526  H HG2  . MET A 1 13  ? -4.733  -1.581  -10.334 1.00 0.00 ? 388 MET A HG2  4  
ATOM 5527  H HG3  . MET A 1 13  ? -3.644  -2.582  -9.374  1.00 0.00 ? 388 MET A HG3  4  
ATOM 5528  H HE1  . MET A 1 13  ? -5.442  -2.135  -5.815  1.00 0.00 ? 388 MET A HE1  4  
ATOM 5529  H HE2  . MET A 1 13  ? -3.954  -2.648  -6.613  1.00 0.00 ? 388 MET A HE2  4  
ATOM 5530  H HE3  . MET A 1 13  ? -4.360  -0.934  -6.522  1.00 0.00 ? 388 MET A HE3  4  
ATOM 5531  N N    . SER A 1 14  ? -0.512  -0.847  -9.887  1.00 0.00 ? 389 SER A N    4  
ATOM 5532  C CA   . SER A 1 14  ? 0.611   -1.721  -10.202 1.00 0.00 ? 389 SER A CA   4  
ATOM 5533  C C    . SER A 1 14  ? 0.419   -3.098  -9.577  1.00 0.00 ? 389 SER A C    4  
ATOM 5534  O O    . SER A 1 14  ? 0.410   -3.240  -8.355  1.00 0.00 ? 389 SER A O    4  
ATOM 5535  C CB   . SER A 1 14  ? 1.921   -1.103  -9.710  1.00 0.00 ? 389 SER A CB   4  
ATOM 5536  O OG   . SER A 1 14  ? 1.848   -0.786  -8.331  1.00 0.00 ? 389 SER A OG   4  
ATOM 5537  H H    . SER A 1 14  ? -0.442  -0.235  -9.124  1.00 0.00 ? 389 SER A H    4  
ATOM 5538  H HA   . SER A 1 14  ? 0.655   -1.829  -11.276 1.00 0.00 ? 389 SER A HA   4  
ATOM 5539  H HB2  . SER A 1 14  ? 2.728   -1.804  -9.863  1.00 0.00 ? 389 SER A HB2  4  
ATOM 5540  H HB3  . SER A 1 14  ? 2.120   -0.197  -10.265 1.00 0.00 ? 389 SER A HB3  4  
ATOM 5541  H HG   . SER A 1 14  ? 1.440   -1.514  -7.856  1.00 0.00 ? 389 SER A HG   4  
ATOM 5542  N N    . LEU A 1 15  ? 0.265   -4.111  -10.423 1.00 0.00 ? 390 LEU A N    4  
ATOM 5543  C CA   . LEU A 1 15  ? 0.071   -5.477  -9.952  1.00 0.00 ? 390 LEU A CA   4  
ATOM 5544  C C    . LEU A 1 15  ? 1.299   -5.972  -9.194  1.00 0.00 ? 390 LEU A C    4  
ATOM 5545  O O    . LEU A 1 15  ? 2.139   -6.681  -9.748  1.00 0.00 ? 390 LEU A O    4  
ATOM 5546  C CB   . LEU A 1 15  ? -0.228  -6.406  -11.129 1.00 0.00 ? 390 LEU A CB   4  
ATOM 5547  C CG   . LEU A 1 15  ? -1.256  -7.502  -10.841 1.00 0.00 ? 390 LEU A CG   4  
ATOM 5548  C CD1  . LEU A 1 15  ? -2.572  -6.894  -10.378 1.00 0.00 ? 390 LEU A CD1  4  
ATOM 5549  C CD2  . LEU A 1 15  ? -1.466  -8.371  -12.073 1.00 0.00 ? 390 LEU A CD2  4  
ATOM 5550  H H    . LEU A 1 15  ? 0.280   -3.936  -11.387 1.00 0.00 ? 390 LEU A H    4  
ATOM 5551  H HA   . LEU A 1 15  ? -0.776  -5.478  -9.281  1.00 0.00 ? 390 LEU A HA   4  
ATOM 5552  H HB2  . LEU A 1 15  ? -0.592  -5.805  -11.950 1.00 0.00 ? 390 LEU A HB2  4  
ATOM 5553  H HB3  . LEU A 1 15  ? 0.693   -6.879  -11.433 1.00 0.00 ? 390 LEU A HB3  4  
ATOM 5554  H HG   . LEU A 1 15  ? -0.883  -8.133  -10.046 1.00 0.00 ? 390 LEU A HG   4  
ATOM 5555  H HD11 . LEU A 1 15  ? -2.469  -5.820  -10.307 1.00 0.00 ? 390 LEU A HD11 4  
ATOM 5556  H HD12 . LEU A 1 15  ? -3.351  -7.134  -11.087 1.00 0.00 ? 390 LEU A HD12 4  
ATOM 5557  H HD13 . LEU A 1 15  ? -2.831  -7.294  -9.409  1.00 0.00 ? 390 LEU A HD13 4  
ATOM 5558  H HD21 . LEU A 1 15  ? -2.507  -8.649  -12.145 1.00 0.00 ? 390 LEU A HD21 4  
ATOM 5559  H HD22 . LEU A 1 15  ? -1.179  -7.819  -12.956 1.00 0.00 ? 390 LEU A HD22 4  
ATOM 5560  H HD23 . LEU A 1 15  ? -0.860  -9.262  -11.994 1.00 0.00 ? 390 LEU A HD23 4  
ATOM 5561  N N    . THR A 1 16  ? 1.396   -5.594  -7.924  1.00 0.00 ? 391 THR A N    4  
ATOM 5562  C CA   . THR A 1 16  ? 2.521   -6.000  -7.090  1.00 0.00 ? 391 THR A CA   4  
ATOM 5563  C C    . THR A 1 16  ? 2.565   -7.517  -6.938  1.00 0.00 ? 391 THR A C    4  
ATOM 5564  O O    . THR A 1 16  ? 1.560   -8.201  -7.132  1.00 0.00 ? 391 THR A O    4  
ATOM 5565  C CB   . THR A 1 16  ? 2.428   -5.338  -5.713  1.00 0.00 ? 391 THR A CB   4  
ATOM 5566  O OG1  . THR A 1 16  ? 3.327   -5.946  -4.804  1.00 0.00 ? 391 THR A OG1  4  
ATOM 5567  C CG2  . THR A 1 16  ? 1.043   -5.409  -5.106  1.00 0.00 ? 391 THR A CG2  4  
ATOM 5568  H H    . THR A 1 16  ? 0.694   -5.029  -7.539  1.00 0.00 ? 391 THR A H    4  
ATOM 5569  H HA   . THR A 1 16  ? 3.427   -5.672  -7.576  1.00 0.00 ? 391 THR A HA   4  
ATOM 5570  H HB   . THR A 1 16  ? 2.694   -4.295  -5.808  1.00 0.00 ? 391 THR A HB   4  
ATOM 5571  H HG1  . THR A 1 16  ? 3.574   -5.313  -4.125  1.00 0.00 ? 391 THR A HG1  4  
ATOM 5572  H HG21 . THR A 1 16  ? 0.382   -5.939  -5.775  1.00 0.00 ? 391 THR A HG21 4  
ATOM 5573  H HG22 . THR A 1 16  ? 1.091   -5.929  -4.160  1.00 0.00 ? 391 THR A HG22 4  
ATOM 5574  H HG23 . THR A 1 16  ? 0.668   -4.408  -4.947  1.00 0.00 ? 391 THR A HG23 4  
ATOM 5575  N N    . SER A 1 17  ? 3.738   -8.038  -6.594  1.00 0.00 ? 392 SER A N    4  
ATOM 5576  C CA   . SER A 1 17  ? 3.917   -9.475  -6.418  1.00 0.00 ? 392 SER A CA   4  
ATOM 5577  C C    . SER A 1 17  ? 2.954   -10.026 -5.369  1.00 0.00 ? 392 SER A C    4  
ATOM 5578  O O    . SER A 1 17  ? 2.641   -11.217 -5.366  1.00 0.00 ? 392 SER A O    4  
ATOM 5579  C CB   . SER A 1 17  ? 5.360   -9.783  -6.013  1.00 0.00 ? 392 SER A CB   4  
ATOM 5580  O OG   . SER A 1 17  ? 6.279   -9.252  -6.951  1.00 0.00 ? 392 SER A OG   4  
ATOM 5581  H H    . SER A 1 17  ? 4.504   -7.441  -6.455  1.00 0.00 ? 392 SER A H    4  
ATOM 5582  H HA   . SER A 1 17  ? 3.710   -9.952  -7.364  1.00 0.00 ? 392 SER A HA   4  
ATOM 5583  H HB2  . SER A 1 17  ? 5.560   -9.346  -5.045  1.00 0.00 ? 392 SER A HB2  4  
ATOM 5584  H HB3  . SER A 1 17  ? 5.495   -10.853 -5.958  1.00 0.00 ? 392 SER A HB3  4  
ATOM 5585  H HG   . SER A 1 17  ? 6.021   -9.518  -7.837  1.00 0.00 ? 392 SER A HG   4  
ATOM 5586  N N    . SER A 1 18  ? 2.489   -9.156  -4.478  1.00 0.00 ? 393 SER A N    4  
ATOM 5587  C CA   . SER A 1 18  ? 1.566   -9.562  -3.425  1.00 0.00 ? 393 SER A CA   4  
ATOM 5588  C C    . SER A 1 18  ? 0.139   -9.664  -3.955  1.00 0.00 ? 393 SER A C    4  
ATOM 5589  O O    . SER A 1 18  ? -0.510  -10.700 -3.817  1.00 0.00 ? 393 SER A O    4  
ATOM 5590  C CB   . SER A 1 18  ? 1.618   -8.570  -2.262  1.00 0.00 ? 393 SER A CB   4  
ATOM 5591  O OG   . SER A 1 18  ? 1.511   -9.238  -1.016  1.00 0.00 ? 393 SER A OG   4  
ATOM 5592  H H    . SER A 1 18  ? 2.776   -8.220  -4.527  1.00 0.00 ? 393 SER A H    4  
ATOM 5593  H HA   . SER A 1 18  ? 1.875   -10.534 -3.071  1.00 0.00 ? 393 SER A HA   4  
ATOM 5594  H HB2  . SER A 1 18  ? 2.555   -8.035  -2.289  1.00 0.00 ? 393 SER A HB2  4  
ATOM 5595  H HB3  . SER A 1 18  ? 0.801   -7.869  -2.351  1.00 0.00 ? 393 SER A HB3  4  
ATOM 5596  H HG   . SER A 1 18  ? 2.247   -8.986  -0.453  1.00 0.00 ? 393 SER A HG   4  
ATOM 5597  N N    . LYS A 1 19  ? -0.345  -8.582  -4.558  1.00 0.00 ? 394 LYS A N    4  
ATOM 5598  C CA   . LYS A 1 19  ? -1.697  -8.551  -5.102  1.00 0.00 ? 394 LYS A CA   4  
ATOM 5599  C C    . LYS A 1 19  ? -1.858  -9.559  -6.235  1.00 0.00 ? 394 LYS A C    4  
ATOM 5600  O O    . LYS A 1 19  ? -2.848  -10.289 -6.293  1.00 0.00 ? 394 LYS A O    4  
ATOM 5601  C CB   . LYS A 1 19  ? -2.033  -7.146  -5.603  1.00 0.00 ? 394 LYS A CB   4  
ATOM 5602  C CG   . LYS A 1 19  ? -3.492  -6.765  -5.413  1.00 0.00 ? 394 LYS A CG   4  
ATOM 5603  C CD   . LYS A 1 19  ? -3.838  -6.609  -3.941  1.00 0.00 ? 394 LYS A CD   4  
ATOM 5604  C CE   . LYS A 1 19  ? -5.234  -7.129  -3.641  1.00 0.00 ? 394 LYS A CE   4  
ATOM 5605  N NZ   . LYS A 1 19  ? -6.281  -6.365  -4.375  1.00 0.00 ? 394 LYS A NZ   4  
ATOM 5606  H H    . LYS A 1 19  ? 0.220   -7.785  -4.636  1.00 0.00 ? 394 LYS A H    4  
ATOM 5607  H HA   . LYS A 1 19  ? -2.379  -8.811  -4.306  1.00 0.00 ? 394 LYS A HA   4  
ATOM 5608  H HB2  . LYS A 1 19  ? -1.425  -6.430  -5.071  1.00 0.00 ? 394 LYS A HB2  4  
ATOM 5609  H HB3  . LYS A 1 19  ? -1.803  -7.087  -6.657  1.00 0.00 ? 394 LYS A HB3  4  
ATOM 5610  H HG2  . LYS A 1 19  ? -3.680  -5.830  -5.919  1.00 0.00 ? 394 LYS A HG2  4  
ATOM 5611  H HG3  . LYS A 1 19  ? -4.115  -7.539  -5.840  1.00 0.00 ? 394 LYS A HG3  4  
ATOM 5612  H HD2  . LYS A 1 19  ? -3.124  -7.165  -3.352  1.00 0.00 ? 394 LYS A HD2  4  
ATOM 5613  H HD3  . LYS A 1 19  ? -3.790  -5.563  -3.679  1.00 0.00 ? 394 LYS A HD3  4  
ATOM 5614  H HE2  . LYS A 1 19  ? -5.288  -8.168  -3.933  1.00 0.00 ? 394 LYS A HE2  4  
ATOM 5615  H HE3  . LYS A 1 19  ? -5.416  -7.045  -2.579  1.00 0.00 ? 394 LYS A HE3  4  
ATOM 5616  H HZ1  . LYS A 1 19  ? -6.719  -5.664  -3.745  1.00 0.00 ? 394 LYS A HZ1  4  
ATOM 5617  H HZ2  . LYS A 1 19  ? -5.860  -5.871  -5.187  1.00 0.00 ? 394 LYS A HZ2  4  
ATOM 5618  H HZ3  . LYS A 1 19  ? -7.018  -7.012  -4.722  1.00 0.00 ? 394 LYS A HZ3  4  
ATOM 5619  N N    . ALA A 1 20  ? -0.882  -9.595  -7.136  1.00 0.00 ? 395 ALA A N    4  
ATOM 5620  C CA   . ALA A 1 20  ? -0.920  -10.513 -8.267  1.00 0.00 ? 395 ALA A CA   4  
ATOM 5621  C C    . ALA A 1 20  ? -0.992  -11.963 -7.798  1.00 0.00 ? 395 ALA A C    4  
ATOM 5622  O O    . ALA A 1 20  ? -1.704  -12.780 -8.381  1.00 0.00 ? 395 ALA A O    4  
ATOM 5623  C CB   . ALA A 1 20  ? 0.296   -10.304 -9.157  1.00 0.00 ? 395 ALA A CB   4  
ATOM 5624  H H    . ALA A 1 20  ? -0.118  -8.988  -7.038  1.00 0.00 ? 395 ALA A H    4  
ATOM 5625  H HA   . ALA A 1 20  ? -1.803  -10.290 -8.848  1.00 0.00 ? 395 ALA A HA   4  
ATOM 5626  H HB1  . ALA A 1 20  ? -0.007  -10.328 -10.193 1.00 0.00 ? 395 ALA A HB1  4  
ATOM 5627  H HB2  . ALA A 1 20  ? 0.744   -9.346  -8.935  1.00 0.00 ? 395 ALA A HB2  4  
ATOM 5628  H HB3  . ALA A 1 20  ? 1.016   -11.089 -8.974  1.00 0.00 ? 395 ALA A HB3  4  
ATOM 5629  N N    . LYS A 1 21  ? -0.248  -12.276 -6.743  1.00 0.00 ? 396 LYS A N    4  
ATOM 5630  C CA   . LYS A 1 21  ? -0.223  -13.628 -6.197  1.00 0.00 ? 396 LYS A CA   4  
ATOM 5631  C C    . LYS A 1 21  ? -1.471  -13.907 -5.363  1.00 0.00 ? 396 LYS A C    4  
ATOM 5632  O O    . LYS A 1 21  ? -1.926  -15.047 -5.272  1.00 0.00 ? 396 LYS A O    4  
ATOM 5633  C CB   . LYS A 1 21  ? 1.030   -13.833 -5.344  1.00 0.00 ? 396 LYS A CB   4  
ATOM 5634  C CG   . LYS A 1 21  ? 1.402   -15.294 -5.150  1.00 0.00 ? 396 LYS A CG   4  
ATOM 5635  C CD   . LYS A 1 21  ? 2.899   -15.465 -4.943  1.00 0.00 ? 396 LYS A CD   4  
ATOM 5636  C CE   . LYS A 1 21  ? 3.432   -16.681 -5.685  1.00 0.00 ? 396 LYS A CE   4  
ATOM 5637  N NZ   . LYS A 1 21  ? 4.045   -17.673 -4.757  1.00 0.00 ? 396 LYS A NZ   4  
ATOM 5638  H H    . LYS A 1 21  ? 0.301   -11.581 -6.322  1.00 0.00 ? 396 LYS A H    4  
ATOM 5639  H HA   . LYS A 1 21  ? -0.200  -14.318 -7.026  1.00 0.00 ? 396 LYS A HA   4  
ATOM 5640  H HB2  . LYS A 1 21  ? 1.860   -13.332 -5.820  1.00 0.00 ? 396 LYS A HB2  4  
ATOM 5641  H HB3  . LYS A 1 21  ? 0.865   -13.393 -4.372  1.00 0.00 ? 396 LYS A HB3  4  
ATOM 5642  H HG2  . LYS A 1 21  ? 0.883   -15.676 -4.284  1.00 0.00 ? 396 LYS A HG2  4  
ATOM 5643  H HG3  . LYS A 1 21  ? 1.102   -15.851 -6.026  1.00 0.00 ? 396 LYS A HG3  4  
ATOM 5644  H HD2  . LYS A 1 21  ? 3.406   -14.584 -5.308  1.00 0.00 ? 396 LYS A HD2  4  
ATOM 5645  H HD3  . LYS A 1 21  ? 3.095   -15.584 -3.887  1.00 0.00 ? 396 LYS A HD3  4  
ATOM 5646  H HE2  . LYS A 1 21  ? 2.617   -17.153 -6.214  1.00 0.00 ? 396 LYS A HE2  4  
ATOM 5647  H HE3  . LYS A 1 21  ? 4.179   -16.356 -6.394  1.00 0.00 ? 396 LYS A HE3  4  
ATOM 5648  H HZ1  . LYS A 1 21  ? 4.880   -18.107 -5.200  1.00 0.00 ? 396 LYS A HZ1  4  
ATOM 5649  H HZ2  . LYS A 1 21  ? 4.337   -17.206 -3.876  1.00 0.00 ? 396 LYS A HZ2  4  
ATOM 5650  H HZ3  . LYS A 1 21  ? 3.358   -18.420 -4.530  1.00 0.00 ? 396 LYS A HZ3  4  
ATOM 5651  N N    . GLU A 1 22  ? -2.019  -12.860 -4.754  1.00 0.00 ? 397 GLU A N    4  
ATOM 5652  C CA   . GLU A 1 22  ? -3.213  -12.996 -3.926  1.00 0.00 ? 397 GLU A CA   4  
ATOM 5653  C C    . GLU A 1 22  ? -4.440  -13.309 -4.777  1.00 0.00 ? 397 GLU A C    4  
ATOM 5654  O O    . GLU A 1 22  ? -5.211  -14.216 -4.463  1.00 0.00 ? 397 GLU A O    4  
ATOM 5655  C CB   . GLU A 1 22  ? -3.451  -11.716 -3.122  1.00 0.00 ? 397 GLU A CB   4  
ATOM 5656  C CG   . GLU A 1 22  ? -3.977  -11.968 -1.719  1.00 0.00 ? 397 GLU A CG   4  
ATOM 5657  C CD   . GLU A 1 22  ? -4.009  -10.709 -0.876  1.00 0.00 ? 397 GLU A CD   4  
ATOM 5658  O OE1  . GLU A 1 22  ? -2.924  -10.186 -0.545  1.00 0.00 ? 397 GLU A OE1  4  
ATOM 5659  O OE2  . GLU A 1 22  ? -5.121  -10.244 -0.545  1.00 0.00 ? 397 GLU A OE2  4  
ATOM 5660  H H    . GLU A 1 22  ? -1.611  -11.976 -4.863  1.00 0.00 ? 397 GLU A H    4  
ATOM 5661  H HA   . GLU A 1 22  ? -3.048  -13.813 -3.240  1.00 0.00 ? 397 GLU A HA   4  
ATOM 5662  H HB2  . GLU A 1 22  ? -2.520  -11.177 -3.043  1.00 0.00 ? 397 GLU A HB2  4  
ATOM 5663  H HB3  . GLU A 1 22  ? -4.168  -11.103 -3.648  1.00 0.00 ? 397 GLU A HB3  4  
ATOM 5664  H HG2  . GLU A 1 22  ? -4.979  -12.361 -1.789  1.00 0.00 ? 397 GLU A HG2  4  
ATOM 5665  H HG3  . GLU A 1 22  ? -3.339  -12.692 -1.235  1.00 0.00 ? 397 GLU A HG3  4  
ATOM 5666  N N    . LEU A 1 23  ? -4.615  -12.552 -5.854  1.00 0.00 ? 398 LEU A N    4  
ATOM 5667  C CA   . LEU A 1 23  ? -5.751  -12.745 -6.750  1.00 0.00 ? 398 LEU A CA   4  
ATOM 5668  C C    . LEU A 1 23  ? -5.769  -14.161 -7.318  1.00 0.00 ? 398 LEU A C    4  
ATOM 5669  O O    . LEU A 1 23  ? -6.819  -14.802 -7.378  1.00 0.00 ? 398 LEU A O    4  
ATOM 5670  C CB   . LEU A 1 23  ? -5.707  -11.725 -7.889  1.00 0.00 ? 398 LEU A CB   4  
ATOM 5671  C CG   . LEU A 1 23  ? -5.881  -10.268 -7.459  1.00 0.00 ? 398 LEU A CG   4  
ATOM 5672  C CD1  . LEU A 1 23  ? -5.455  -9.327  -8.575  1.00 0.00 ? 398 LEU A CD1  4  
ATOM 5673  C CD2  . LEU A 1 23  ? -7.324  -10.000 -7.057  1.00 0.00 ? 398 LEU A CD2  4  
ATOM 5674  H H    . LEU A 1 23  ? -3.968  -11.842 -6.051  1.00 0.00 ? 398 LEU A H    4  
ATOM 5675  H HA   . LEU A 1 23  ? -6.653  -12.589 -6.177  1.00 0.00 ? 398 LEU A HA   4  
ATOM 5676  H HB2  . LEU A 1 23  ? -4.755  -11.820 -8.391  1.00 0.00 ? 398 LEU A HB2  4  
ATOM 5677  H HB3  . LEU A 1 23  ? -6.492  -11.966 -8.591  1.00 0.00 ? 398 LEU A HB3  4  
ATOM 5678  H HG   . LEU A 1 23  ? -5.253  -10.074 -6.602  1.00 0.00 ? 398 LEU A HG   4  
ATOM 5679  H HD11 . LEU A 1 23  ? -5.600  -9.812  -9.530  1.00 0.00 ? 398 LEU A HD11 4  
ATOM 5680  H HD12 . LEU A 1 23  ? -6.050  -8.426  -8.535  1.00 0.00 ? 398 LEU A HD12 4  
ATOM 5681  H HD13 . LEU A 1 23  ? -4.412  -9.075  -8.455  1.00 0.00 ? 398 LEU A HD13 4  
ATOM 5682  H HD21 . LEU A 1 23  ? -7.484  -8.935  -6.975  1.00 0.00 ? 398 LEU A HD21 4  
ATOM 5683  H HD22 . LEU A 1 23  ? -7.988  -10.407 -7.806  1.00 0.00 ? 398 LEU A HD22 4  
ATOM 5684  H HD23 . LEU A 1 23  ? -7.525  -10.468 -6.105  1.00 0.00 ? 398 LEU A HD23 4  
ATOM 5685  N N    . LYS A 1 24  ? -4.603  -14.642 -7.737  1.00 0.00 ? 399 LYS A N    4  
ATOM 5686  C CA   . LYS A 1 24  ? -4.489  -15.982 -8.302  1.00 0.00 ? 399 LYS A CA   4  
ATOM 5687  C C    . LYS A 1 24  ? -4.790  -17.046 -7.251  1.00 0.00 ? 399 LYS A C    4  
ATOM 5688  O O    . LYS A 1 24  ? -5.308  -18.117 -7.568  1.00 0.00 ? 399 LYS A O    4  
ATOM 5689  C CB   . LYS A 1 24  ? -3.087  -16.199 -8.876  1.00 0.00 ? 399 LYS A CB   4  
ATOM 5690  C CG   . LYS A 1 24  ? -2.944  -15.746 -10.320 1.00 0.00 ? 399 LYS A CG   4  
ATOM 5691  C CD   . LYS A 1 24  ? -1.558  -15.185 -10.593 1.00 0.00 ? 399 LYS A CD   4  
ATOM 5692  C CE   . LYS A 1 24  ? -1.435  -14.678 -12.021 1.00 0.00 ? 399 LYS A CE   4  
ATOM 5693  N NZ   . LYS A 1 24  ? -0.030  -14.732 -12.511 1.00 0.00 ? 399 LYS A NZ   4  
ATOM 5694  H H    . LYS A 1 24  ? -3.801  -14.084 -7.665  1.00 0.00 ? 399 LYS A H    4  
ATOM 5695  H HA   . LYS A 1 24  ? -5.211  -16.067 -9.100  1.00 0.00 ? 399 LYS A HA   4  
ATOM 5696  H HB2  . LYS A 1 24  ? -2.376  -15.649 -8.276  1.00 0.00 ? 399 LYS A HB2  4  
ATOM 5697  H HB3  . LYS A 1 24  ? -2.850  -17.251 -8.826  1.00 0.00 ? 399 LYS A HB3  4  
ATOM 5698  H HG2  . LYS A 1 24  ? -3.114  -16.590 -10.970 1.00 0.00 ? 399 LYS A HG2  4  
ATOM 5699  H HG3  . LYS A 1 24  ? -3.679  -14.980 -10.521 1.00 0.00 ? 399 LYS A HG3  4  
ATOM 5700  H HD2  . LYS A 1 24  ? -1.370  -14.368 -9.914  1.00 0.00 ? 399 LYS A HD2  4  
ATOM 5701  H HD3  . LYS A 1 24  ? -0.828  -15.964 -10.433 1.00 0.00 ? 399 LYS A HD3  4  
ATOM 5702  H HE2  . LYS A 1 24  ? -2.053  -15.289 -12.661 1.00 0.00 ? 399 LYS A HE2  4  
ATOM 5703  H HE3  . LYS A 1 24  ? -1.780  -13.655 -12.056 1.00 0.00 ? 399 LYS A HE3  4  
ATOM 5704  H HZ1  . LYS A 1 24  ? 0.046   -14.258 -13.434 1.00 0.00 ? 399 LYS A HZ1  4  
ATOM 5705  H HZ2  . LYS A 1 24  ? 0.604   -14.257 -11.837 1.00 0.00 ? 399 LYS A HZ2  4  
ATOM 5706  H HZ3  . LYS A 1 24  ? 0.274   -15.721 -12.618 1.00 0.00 ? 399 LYS A HZ3  4  
ATOM 5707  N N    . ASP A 1 25  ? -4.462  -16.745 -5.999  1.00 0.00 ? 400 ASP A N    4  
ATOM 5708  C CA   . ASP A 1 25  ? -4.696  -17.678 -4.902  1.00 0.00 ? 400 ASP A CA   4  
ATOM 5709  C C    . ASP A 1 25  ? -6.178  -18.014 -4.778  1.00 0.00 ? 400 ASP A C    4  
ATOM 5710  O O    . ASP A 1 25  ? -6.549  -19.173 -4.586  1.00 0.00 ? 400 ASP A O    4  
ATOM 5711  C CB   . ASP A 1 25  ? -4.184  -17.088 -3.587  1.00 0.00 ? 400 ASP A CB   4  
ATOM 5712  C CG   . ASP A 1 25  ? -3.654  -18.151 -2.645  1.00 0.00 ? 400 ASP A CG   4  
ATOM 5713  O OD1  . ASP A 1 25  ? -2.704  -18.865 -3.030  1.00 0.00 ? 400 ASP A OD1  4  
ATOM 5714  O OD2  . ASP A 1 25  ? -4.188  -18.271 -1.523  1.00 0.00 ? 400 ASP A OD2  4  
ATOM 5715  H H    . ASP A 1 25  ? -4.052  -15.876 -5.808  1.00 0.00 ? 400 ASP A H    4  
ATOM 5716  H HA   . ASP A 1 25  ? -4.150  -18.584 -5.116  1.00 0.00 ? 400 ASP A HA   4  
ATOM 5717  H HB2  . ASP A 1 25  ? -3.387  -16.391 -3.799  1.00 0.00 ? 400 ASP A HB2  4  
ATOM 5718  H HB3  . ASP A 1 25  ? -4.992  -16.567 -3.095  1.00 0.00 ? 400 ASP A HB3  4  
ATOM 5719  N N    . ARG A 1 26  ? -7.024  -16.996 -4.888  1.00 0.00 ? 401 ARG A N    4  
ATOM 5720  C CA   . ARG A 1 26  ? -8.467  -17.185 -4.787  1.00 0.00 ? 401 ARG A CA   4  
ATOM 5721  C C    . ARG A 1 26  ? -9.097  -17.392 -6.162  1.00 0.00 ? 401 ARG A C    4  
ATOM 5722  O O    . ARG A 1 26  ? -10.199 -17.929 -6.272  1.00 0.00 ? 401 ARG A O    4  
ATOM 5723  C CB   . ARG A 1 26  ? -9.111  -15.981 -4.097  1.00 0.00 ? 401 ARG A CB   4  
ATOM 5724  C CG   . ARG A 1 26  ? -10.575 -16.193 -3.748  1.00 0.00 ? 401 ARG A CG   4  
ATOM 5725  C CD   . ARG A 1 26  ? -11.244 -14.893 -3.333  1.00 0.00 ? 401 ARG A CD   4  
ATOM 5726  N NE   . ARG A 1 26  ? -11.345 -14.768 -1.881  1.00 0.00 ? 401 ARG A NE   4  
ATOM 5727  C CZ   . ARG A 1 26  ? -12.162 -15.504 -1.130  1.00 0.00 ? 401 ARG A CZ   4  
ATOM 5728  N NH1  . ARG A 1 26  ? -12.948 -16.416 -1.689  1.00 0.00 ? 401 ARG A NH1  4  
ATOM 5729  N NH2  . ARG A 1 26  ? -12.192 -15.327 0.183   1.00 0.00 ? 401 ARG A NH2  4  
ATOM 5730  H H    . ARG A 1 26  ? -6.670  -16.094 -5.040  1.00 0.00 ? 401 ARG A H    4  
ATOM 5731  H HA   . ARG A 1 26  ? -8.643  -18.066 -4.188  1.00 0.00 ? 401 ARG A HA   4  
ATOM 5732  H HB2  . ARG A 1 26  ? -8.573  -15.773 -3.184  1.00 0.00 ? 401 ARG A HB2  4  
ATOM 5733  H HB3  . ARG A 1 26  ? -9.040  -15.124 -4.751  1.00 0.00 ? 401 ARG A HB3  4  
ATOM 5734  H HG2  . ARG A 1 26  ? -11.087 -16.591 -4.610  1.00 0.00 ? 401 ARG A HG2  4  
ATOM 5735  H HG3  . ARG A 1 26  ? -10.641 -16.898 -2.931  1.00 0.00 ? 401 ARG A HG3  4  
ATOM 5736  H HD2  . ARG A 1 26  ? -10.664 -14.066 -3.717  1.00 0.00 ? 401 ARG A HD2  4  
ATOM 5737  H HD3  . ARG A 1 26  ? -12.237 -14.862 -3.759  1.00 0.00 ? 401 ARG A HD3  4  
ATOM 5738  H HE   . ARG A 1 26  ? -10.776 -14.102 -1.443  1.00 0.00 ? 401 ARG A HE   4  
ATOM 5739  H HH11 . ARG A 1 26  ? -12.930 -16.554 -2.679  1.00 0.00 ? 401 ARG A HH11 4  
ATOM 5740  H HH12 . ARG A 1 26  ? -13.559 -16.965 -1.119  1.00 0.00 ? 401 ARG A HH12 4  
ATOM 5741  H HH21 . ARG A 1 26  ? -11.602 -14.643 0.610   1.00 0.00 ? 401 ARG A HH21 4  
ATOM 5742  H HH22 . ARG A 1 26  ? -12.806 -15.880 0.748   1.00 0.00 ? 401 ARG A HH22 4  
ATOM 5743  N N    . HIS A 1 27  ? -8.393  -16.968 -7.208  1.00 0.00 ? 402 HIS A N    4  
ATOM 5744  C CA   . HIS A 1 27  ? -8.892  -17.111 -8.571  1.00 0.00 ? 402 HIS A CA   4  
ATOM 5745  C C    . HIS A 1 27  ? -7.795  -17.616 -9.502  1.00 0.00 ? 402 HIS A C    4  
ATOM 5746  O O    . HIS A 1 27  ? -7.194  -16.843 -10.247 1.00 0.00 ? 402 HIS A O    4  
ATOM 5747  C CB   . HIS A 1 27  ? -9.436  -15.776 -9.082  1.00 0.00 ? 402 HIS A CB   4  
ATOM 5748  C CG   . HIS A 1 27  ? -10.535 -15.215 -8.233  1.00 0.00 ? 402 HIS A CG   4  
ATOM 5749  N ND1  . HIS A 1 27  ? -11.754 -15.838 -8.072  1.00 0.00 ? 402 HIS A ND1  4  
ATOM 5750  C CD2  . HIS A 1 27  ? -10.593 -14.081 -7.494  1.00 0.00 ? 402 HIS A CD2  4  
ATOM 5751  C CE1  . HIS A 1 27  ? -12.515 -15.113 -7.271  1.00 0.00 ? 402 HIS A CE1  4  
ATOM 5752  N NE2  . HIS A 1 27  ? -11.834 -14.043 -6.906  1.00 0.00 ? 402 HIS A NE2  4  
ATOM 5753  H H    . HIS A 1 27  ? -7.521  -16.549 -7.062  1.00 0.00 ? 402 HIS A H    4  
ATOM 5754  H HA   . HIS A 1 27  ? -9.694  -17.834 -8.556  1.00 0.00 ? 402 HIS A HA   4  
ATOM 5755  H HB2  . HIS A 1 27  ? -8.633  -15.053 -9.105  1.00 0.00 ? 402 HIS A HB2  4  
ATOM 5756  H HB3  . HIS A 1 27  ? -9.822  -15.910 -10.081 1.00 0.00 ? 402 HIS A HB3  4  
ATOM 5757  H HD1  . HIS A 1 27  ? -12.022 -16.686 -8.484  1.00 0.00 ? 402 HIS A HD1  4  
ATOM 5758  H HD2  . HIS A 1 27  ? -9.809  -13.346 -7.386  1.00 0.00 ? 402 HIS A HD2  4  
ATOM 5759  H HE1  . HIS A 1 27  ? -13.522 -15.356 -6.965  1.00 0.00 ? 402 HIS A HE1  4  
ATOM 5760  H HE2  . HIS A 1 27  ? -12.191 -13.298 -6.378  1.00 0.00 ? 402 HIS A HE2  4  
ATOM 5761  N N    . ARG A 1 28  ? -7.538  -18.919 -9.451  1.00 0.00 ? 403 ARG A N    4  
ATOM 5762  C CA   . ARG A 1 28  ? -6.512  -19.530 -10.288 1.00 0.00 ? 403 ARG A CA   4  
ATOM 5763  C C    . ARG A 1 28  ? -6.925  -19.523 -11.757 1.00 0.00 ? 403 ARG A C    4  
ATOM 5764  O O    . ARG A 1 28  ? -6.079  -19.593 -12.648 1.00 0.00 ? 403 ARG A O    4  
ATOM 5765  C CB   . ARG A 1 28  ? -6.242  -20.963 -9.828  1.00 0.00 ? 403 ARG A CB   4  
ATOM 5766  C CG   . ARG A 1 28  ? -5.968  -21.080 -8.338  1.00 0.00 ? 403 ARG A CG   4  
ATOM 5767  C CD   . ARG A 1 28  ? -5.740  -22.525 -7.921  1.00 0.00 ? 403 ARG A CD   4  
ATOM 5768  N NE   . ARG A 1 28  ? -4.504  -22.686 -7.159  1.00 0.00 ? 403 ARG A NE   4  
ATOM 5769  C CZ   . ARG A 1 28  ? -3.294  -22.735 -7.709  1.00 0.00 ? 403 ARG A CZ   4  
ATOM 5770  N NH1  . ARG A 1 28  ? -3.151  -22.633 -9.025  1.00 0.00 ? 403 ARG A NH1  4  
ATOM 5771  N NH2  . ARG A 1 28  ? -2.222  -22.885 -6.943  1.00 0.00 ? 403 ARG A NH2  4  
ATOM 5772  H H    . ARG A 1 28  ? -8.051  -19.483 -8.835  1.00 0.00 ? 403 ARG A H    4  
ATOM 5773  H HA   . ARG A 1 28  ? -5.608  -18.950 -10.179 1.00 0.00 ? 403 ARG A HA   4  
ATOM 5774  H HB2  . ARG A 1 28  ? -7.101  -21.572 -10.064 1.00 0.00 ? 403 ARG A HB2  4  
ATOM 5775  H HB3  . ARG A 1 28  ? -5.383  -21.344 -10.361 1.00 0.00 ? 403 ARG A HB3  4  
ATOM 5776  H HG2  . ARG A 1 28  ? -5.087  -20.504 -8.097  1.00 0.00 ? 403 ARG A HG2  4  
ATOM 5777  H HG3  . ARG A 1 28  ? -6.816  -20.688 -7.796  1.00 0.00 ? 403 ARG A HG3  4  
ATOM 5778  H HD2  . ARG A 1 28  ? -6.571  -22.846 -7.312  1.00 0.00 ? 403 ARG A HD2  4  
ATOM 5779  H HD3  . ARG A 1 28  ? -5.687  -23.139 -8.808  1.00 0.00 ? 403 ARG A HD3  4  
ATOM 5780  H HE   . ARG A 1 28  ? -4.580  -22.763 -6.185  1.00 0.00 ? 403 ARG A HE   4  
ATOM 5781  H HH11 . ARG A 1 28  ? -3.954  -22.520 -9.609  1.00 0.00 ? 403 ARG A HH11 4  
ATOM 5782  H HH12 . ARG A 1 28  ? -2.238  -22.668 -9.432  1.00 0.00 ? 403 ARG A HH12 4  
ATOM 5783  H HH21 . ARG A 1 28  ? -2.324  -22.961 -5.951  1.00 0.00 ? 403 ARG A HH21 4  
ATOM 5784  H HH22 . ARG A 1 28  ? -1.313  -22.922 -7.356  1.00 0.00 ? 403 ARG A HH22 4  
ATOM 5785  N N    . ASP A 1 29  ? -8.230  -19.437 -12.005 1.00 0.00 ? 404 ASP A N    4  
ATOM 5786  C CA   . ASP A 1 29  ? -8.753  -19.419 -13.369 1.00 0.00 ? 404 ASP A CA   4  
ATOM 5787  C C    . ASP A 1 29  ? -8.052  -18.355 -14.212 1.00 0.00 ? 404 ASP A C    4  
ATOM 5788  O O    . ASP A 1 29  ? -7.966  -18.476 -15.434 1.00 0.00 ? 404 ASP A O    4  
ATOM 5789  C CB   . ASP A 1 29  ? -10.263 -19.167 -13.355 1.00 0.00 ? 404 ASP A CB   4  
ATOM 5790  C CG   . ASP A 1 29  ? -11.058 -20.398 -13.740 1.00 0.00 ? 404 ASP A CG   4  
ATOM 5791  O OD1  . ASP A 1 29  ? -10.568 -21.522 -13.498 1.00 0.00 ? 404 ASP A OD1  4  
ATOM 5792  O OD2  . ASP A 1 29  ? -12.170 -20.240 -14.286 1.00 0.00 ? 404 ASP A OD2  4  
ATOM 5793  H H    . ASP A 1 29  ? -8.857  -19.383 -11.254 1.00 0.00 ? 404 ASP A H    4  
ATOM 5794  H HA   . ASP A 1 29  ? -8.563  -20.388 -13.807 1.00 0.00 ? 404 ASP A HA   4  
ATOM 5795  H HB2  . ASP A 1 29  ? -10.561 -18.867 -12.361 1.00 0.00 ? 404 ASP A HB2  4  
ATOM 5796  H HB3  . ASP A 1 29  ? -10.499 -18.375 -14.051 1.00 0.00 ? 404 ASP A HB3  4  
ATOM 5797  N N    . PHE A 1 30  ? -7.553  -17.314 -13.551 1.00 0.00 ? 405 PHE A N    4  
ATOM 5798  C CA   . PHE A 1 30  ? -6.859  -16.233 -14.241 1.00 0.00 ? 405 PHE A CA   4  
ATOM 5799  C C    . PHE A 1 30  ? -5.567  -16.738 -14.881 1.00 0.00 ? 405 PHE A C    4  
ATOM 5800  O O    . PHE A 1 30  ? -5.046  -17.786 -14.498 1.00 0.00 ? 405 PHE A O    4  
ATOM 5801  C CB   . PHE A 1 30  ? -6.548  -15.095 -13.265 1.00 0.00 ? 405 PHE A CB   4  
ATOM 5802  C CG   . PHE A 1 30  ? -7.715  -14.181 -13.018 1.00 0.00 ? 405 PHE A CG   4  
ATOM 5803  C CD1  . PHE A 1 30  ? -8.018  -13.165 -13.910 1.00 0.00 ? 405 PHE A CD1  4  
ATOM 5804  C CD2  . PHE A 1 30  ? -8.508  -14.339 -11.892 1.00 0.00 ? 405 PHE A CD2  4  
ATOM 5805  C CE1  . PHE A 1 30  ? -9.090  -12.322 -13.683 1.00 0.00 ? 405 PHE A CE1  4  
ATOM 5806  C CE2  . PHE A 1 30  ? -9.581  -13.500 -11.660 1.00 0.00 ? 405 PHE A CE2  4  
ATOM 5807  C CZ   . PHE A 1 30  ? -9.873  -12.491 -12.557 1.00 0.00 ? 405 PHE A CZ   4  
ATOM 5808  H H    . PHE A 1 30  ? -7.650  -17.274 -12.577 1.00 0.00 ? 405 PHE A H    4  
ATOM 5809  H HA   . PHE A 1 30  ? -7.510  -15.862 -15.019 1.00 0.00 ? 405 PHE A HA   4  
ATOM 5810  H HB2  . PHE A 1 30  ? -6.250  -15.516 -12.317 1.00 0.00 ? 405 PHE A HB2  4  
ATOM 5811  H HB3  . PHE A 1 30  ? -5.737  -14.502 -13.662 1.00 0.00 ? 405 PHE A HB3  4  
ATOM 5812  H HD1  . PHE A 1 30  ? -7.406  -13.032 -14.790 1.00 0.00 ? 405 PHE A HD1  4  
ATOM 5813  H HD2  . PHE A 1 30  ? -8.279  -15.127 -11.191 1.00 0.00 ? 405 PHE A HD2  4  
ATOM 5814  H HE1  . PHE A 1 30  ? -9.316  -11.534 -14.386 1.00 0.00 ? 405 PHE A HE1  4  
ATOM 5815  H HE2  . PHE A 1 30  ? -10.191 -13.634 -10.780 1.00 0.00 ? 405 PHE A HE2  4  
ATOM 5816  H HZ   . PHE A 1 30  ? -10.711 -11.833 -12.378 1.00 0.00 ? 405 PHE A HZ   4  
ATOM 5817  N N    . PRO A 1 31  ? -5.031  -15.998 -15.866 1.00 0.00 ? 406 PRO A N    4  
ATOM 5818  C CA   . PRO A 1 31  ? -3.794  -16.379 -16.556 1.00 0.00 ? 406 PRO A CA   4  
ATOM 5819  C C    . PRO A 1 31  ? -2.613  -16.500 -15.599 1.00 0.00 ? 406 PRO A C    4  
ATOM 5820  O O    . PRO A 1 31  ? -2.789  -16.523 -14.381 1.00 0.00 ? 406 PRO A O    4  
ATOM 5821  C CB   . PRO A 1 31  ? -3.560  -15.237 -17.554 1.00 0.00 ? 406 PRO A CB   4  
ATOM 5822  C CG   . PRO A 1 31  ? -4.398  -14.107 -17.059 1.00 0.00 ? 406 PRO A CG   4  
ATOM 5823  C CD   . PRO A 1 31  ? -5.582  -14.736 -16.385 1.00 0.00 ? 406 PRO A CD   4  
ATOM 5824  H HA   . PRO A 1 31  ? -3.914  -17.309 -17.093 1.00 0.00 ? 406 PRO A HA   4  
ATOM 5825  H HB2  . PRO A 1 31  ? -2.512  -14.975 -17.566 1.00 0.00 ? 406 PRO A HB2  4  
ATOM 5826  H HB3  . PRO A 1 31  ? -3.867  -15.552 -18.541 1.00 0.00 ? 406 PRO A HB3  4  
ATOM 5827  H HG2  . PRO A 1 31  ? -3.835  -13.513 -16.354 1.00 0.00 ? 406 PRO A HG2  4  
ATOM 5828  H HG3  . PRO A 1 31  ? -4.720  -13.497 -17.891 1.00 0.00 ? 406 PRO A HG3  4  
ATOM 5829  H HD2  . PRO A 1 31  ? -5.937  -14.108 -15.581 1.00 0.00 ? 406 PRO A HD2  4  
ATOM 5830  H HD3  . PRO A 1 31  ? -6.370  -14.923 -17.099 1.00 0.00 ? 406 PRO A HD3  4  
ATOM 5831  N N    . ASP A 1 32  ? -1.409  -16.582 -16.158 1.00 0.00 ? 407 ASP A N    4  
ATOM 5832  C CA   . ASP A 1 32  ? -0.198  -16.704 -15.353 1.00 0.00 ? 407 ASP A CA   4  
ATOM 5833  C C    . ASP A 1 32  ? 0.713   -15.495 -15.548 1.00 0.00 ? 407 ASP A C    4  
ATOM 5834  O O    . ASP A 1 32  ? 1.935   -15.609 -15.466 1.00 0.00 ? 407 ASP A O    4  
ATOM 5835  C CB   . ASP A 1 32  ? 0.553   -17.986 -15.714 1.00 0.00 ? 407 ASP A CB   4  
ATOM 5836  C CG   . ASP A 1 32  ? -0.184  -19.233 -15.266 1.00 0.00 ? 407 ASP A CG   4  
ATOM 5837  O OD1  . ASP A 1 32  ? -0.932  -19.155 -14.268 1.00 0.00 ? 407 ASP A OD1  4  
ATOM 5838  O OD2  . ASP A 1 32  ? -0.012  -20.288 -15.911 1.00 0.00 ? 407 ASP A OD2  4  
ATOM 5839  H H    . ASP A 1 32  ? -1.333  -16.560 -17.135 1.00 0.00 ? 407 ASP A H    4  
ATOM 5840  H HA   . ASP A 1 32  ? -0.495  -16.751 -14.315 1.00 0.00 ? 407 ASP A HA   4  
ATOM 5841  H HB2  . ASP A 1 32  ? 0.680   -18.031 -16.785 1.00 0.00 ? 407 ASP A HB2  4  
ATOM 5842  H HB3  . ASP A 1 32  ? 1.523   -17.973 -15.239 1.00 0.00 ? 407 ASP A HB3  4  
ATOM 5843  N N    . VAL A 1 33  ? 0.110   -14.340 -15.805 1.00 0.00 ? 408 VAL A N    4  
ATOM 5844  C CA   . VAL A 1 33  ? 0.868   -13.112 -16.009 1.00 0.00 ? 408 VAL A CA   4  
ATOM 5845  C C    . VAL A 1 33  ? 1.044   -12.352 -14.698 1.00 0.00 ? 408 VAL A C    4  
ATOM 5846  O O    . VAL A 1 33  ? 0.087   -12.154 -13.951 1.00 0.00 ? 408 VAL A O    4  
ATOM 5847  C CB   . VAL A 1 33  ? 0.184   -12.190 -17.036 1.00 0.00 ? 408 VAL A CB   4  
ATOM 5848  C CG1  . VAL A 1 33  ? 0.334   -12.750 -18.443 1.00 0.00 ? 408 VAL A CG1  4  
ATOM 5849  C CG2  . VAL A 1 33  ? -1.283  -11.996 -16.687 1.00 0.00 ? 408 VAL A CG2  4  
ATOM 5850  H H    . VAL A 1 33  ? -0.869  -14.312 -15.857 1.00 0.00 ? 408 VAL A H    4  
ATOM 5851  H HA   . VAL A 1 33  ? 1.843   -13.382 -16.391 1.00 0.00 ? 408 VAL A HA   4  
ATOM 5852  H HB   . VAL A 1 33  ? 0.670   -11.226 -17.004 1.00 0.00 ? 408 VAL A HB   4  
ATOM 5853  H HG11 . VAL A 1 33  ? 0.471   -13.820 -18.391 1.00 0.00 ? 408 VAL A HG11 4  
ATOM 5854  H HG12 . VAL A 1 33  ? -0.552  -12.526 -19.016 1.00 0.00 ? 408 VAL A HG12 4  
ATOM 5855  H HG13 . VAL A 1 33  ? 1.193   -12.300 -18.918 1.00 0.00 ? 408 VAL A HG13 4  
ATOM 5856  H HG21 . VAL A 1 33  ? -1.886  -12.677 -17.270 1.00 0.00 ? 408 VAL A HG21 4  
ATOM 5857  H HG22 . VAL A 1 33  ? -1.432  -12.194 -15.635 1.00 0.00 ? 408 VAL A HG22 4  
ATOM 5858  H HG23 . VAL A 1 33  ? -1.574  -10.979 -16.906 1.00 0.00 ? 408 VAL A HG23 4  
ATOM 5859  N N    . ILE A 1 34  ? 2.274   -11.927 -14.426 1.00 0.00 ? 409 ILE A N    4  
ATOM 5860  C CA   . ILE A 1 34  ? 2.574   -11.187 -13.205 1.00 0.00 ? 409 ILE A CA   4  
ATOM 5861  C C    . ILE A 1 34  ? 2.910   -9.728  -13.510 1.00 0.00 ? 409 ILE A C    4  
ATOM 5862  O O    . ILE A 1 34  ? 2.864   -8.874  -12.624 1.00 0.00 ? 409 ILE A O    4  
ATOM 5863  C CB   . ILE A 1 34  ? 3.746   -11.819 -12.426 1.00 0.00 ? 409 ILE A CB   4  
ATOM 5864  C CG1  . ILE A 1 34  ? 5.011   -11.858 -13.296 1.00 0.00 ? 409 ILE A CG1  4  
ATOM 5865  C CG2  . ILE A 1 34  ? 3.372   -13.213 -11.938 1.00 0.00 ? 409 ILE A CG2  4  
ATOM 5866  C CD1  . ILE A 1 34  ? 5.099   -13.063 -14.212 1.00 0.00 ? 409 ILE A CD1  4  
ATOM 5867  H H    . ILE A 1 34  ? 2.996   -12.113 -15.062 1.00 0.00 ? 409 ILE A H    4  
ATOM 5868  H HA   . ILE A 1 34  ? 1.696   -11.217 -12.576 1.00 0.00 ? 409 ILE A HA   4  
ATOM 5869  H HB   . ILE A 1 34  ? 3.938   -11.206 -11.558 1.00 0.00 ? 409 ILE A HB   4  
ATOM 5870  H HG12 . ILE A 1 34  ? 5.040   -10.973 -13.913 1.00 0.00 ? 409 ILE A HG12 4  
ATOM 5871  H HG13 . ILE A 1 34  ? 5.879   -11.867 -12.652 1.00 0.00 ? 409 ILE A HG13 4  
ATOM 5872  H HG21 . ILE A 1 34  ? 3.140   -13.841 -12.785 1.00 0.00 ? 409 ILE A HG21 4  
ATOM 5873  H HG22 . ILE A 1 34  ? 4.202   -13.638 -11.392 1.00 0.00 ? 409 ILE A HG22 4  
ATOM 5874  H HG23 . ILE A 1 34  ? 2.511   -13.149 -11.290 1.00 0.00 ? 409 ILE A HG23 4  
ATOM 5875  H HD11 . ILE A 1 34  ? 5.802   -13.774 -13.805 1.00 0.00 ? 409 ILE A HD11 4  
ATOM 5876  H HD12 . ILE A 1 34  ? 4.126   -13.525 -14.293 1.00 0.00 ? 409 ILE A HD12 4  
ATOM 5877  H HD13 . ILE A 1 34  ? 5.431   -12.747 -15.189 1.00 0.00 ? 409 ILE A HD13 4  
ATOM 5878  N N    . SER A 1 35  ? 3.248   -9.448  -14.766 1.00 0.00 ? 410 SER A N    4  
ATOM 5879  C CA   . SER A 1 35  ? 3.590   -8.092  -15.180 1.00 0.00 ? 410 SER A CA   4  
ATOM 5880  C C    . SER A 1 35  ? 2.411   -7.423  -15.880 1.00 0.00 ? 410 SER A C    4  
ATOM 5881  O O    . SER A 1 35  ? 1.551   -8.095  -16.449 1.00 0.00 ? 410 SER A O    4  
ATOM 5882  C CB   . SER A 1 35  ? 4.805   -8.114  -16.110 1.00 0.00 ? 410 SER A CB   4  
ATOM 5883  O OG   . SER A 1 35  ? 4.925   -9.366  -16.763 1.00 0.00 ? 410 SER A OG   4  
ATOM 5884  H H    . SER A 1 35  ? 3.268   -10.168 -15.430 1.00 0.00 ? 410 SER A H    4  
ATOM 5885  H HA   . SER A 1 35  ? 3.836   -7.527  -14.295 1.00 0.00 ? 410 SER A HA   4  
ATOM 5886  H HB2  . SER A 1 35  ? 4.700   -7.341  -16.856 1.00 0.00 ? 410 SER A HB2  4  
ATOM 5887  H HB3  . SER A 1 35  ? 5.701   -7.937  -15.532 1.00 0.00 ? 410 SER A HB3  4  
ATOM 5888  H HG   . SER A 1 35  ? 5.064   -9.224  -17.703 1.00 0.00 ? 410 SER A HG   4  
ATOM 5889  N N    . GLY A 1 36  ? 2.377   -6.094  -15.831 1.00 0.00 ? 411 GLY A N    4  
ATOM 5890  C CA   . GLY A 1 36  ? 1.299   -5.355  -16.463 1.00 0.00 ? 411 GLY A CA   4  
ATOM 5891  C C    . GLY A 1 36  ? 0.466   -4.578  -15.463 1.00 0.00 ? 411 GLY A C    4  
ATOM 5892  O O    . GLY A 1 36  ? 0.467   -4.887  -14.271 1.00 0.00 ? 411 GLY A O    4  
ATOM 5893  H H    . GLY A 1 36  ? 3.090   -5.612  -15.363 1.00 0.00 ? 411 GLY A H    4  
ATOM 5894  H HA2  . GLY A 1 36  ? 1.722   -4.664  -17.177 1.00 0.00 ? 411 GLY A HA2  4  
ATOM 5895  H HA3  . GLY A 1 36  ? 0.659   -6.050  -16.987 1.00 0.00 ? 411 GLY A HA3  4  
ATOM 5896  N N    . ALA A 1 37  ? -0.247  -3.566  -15.948 1.00 0.00 ? 412 ALA A N    4  
ATOM 5897  C CA   . ALA A 1 37  ? -1.087  -2.742  -15.085 1.00 0.00 ? 412 ALA A CA   4  
ATOM 5898  C C    . ALA A 1 37  ? -2.499  -3.310  -14.988 1.00 0.00 ? 412 ALA A C    4  
ATOM 5899  O O    . ALA A 1 37  ? -3.007  -3.907  -15.936 1.00 0.00 ? 412 ALA A O    4  
ATOM 5900  C CB   . ALA A 1 37  ? -1.127  -1.311  -15.598 1.00 0.00 ? 412 ALA A CB   4  
ATOM 5901  H H    . ALA A 1 37  ? -0.207  -3.368  -16.906 1.00 0.00 ? 412 ALA A H    4  
ATOM 5902  H HA   . ALA A 1 37  ? -0.646  -2.735  -14.100 1.00 0.00 ? 412 ALA A HA   4  
ATOM 5903  H HB1  . ALA A 1 37  ? -1.726  -0.707  -14.932 1.00 0.00 ? 412 ALA A HB1  4  
ATOM 5904  H HB2  . ALA A 1 37  ? -0.123  -0.916  -15.637 1.00 0.00 ? 412 ALA A HB2  4  
ATOM 5905  H HB3  . ALA A 1 37  ? -1.560  -1.294  -16.587 1.00 0.00 ? 412 ALA A HB3  4  
ATOM 5906  N N    . TYR A 1 38  ? -3.128  -3.120  -13.832 1.00 0.00 ? 413 TYR A N    4  
ATOM 5907  C CA   . TYR A 1 38  ? -4.481  -3.615  -13.606 1.00 0.00 ? 413 TYR A CA   4  
ATOM 5908  C C    . TYR A 1 38  ? -5.502  -2.485  -13.717 1.00 0.00 ? 413 TYR A C    4  
ATOM 5909  O O    . TYR A 1 38  ? -5.337  -1.424  -13.115 1.00 0.00 ? 413 TYR A O    4  
ATOM 5910  C CB   . TYR A 1 38  ? -4.575  -4.273  -12.225 1.00 0.00 ? 413 TYR A CB   4  
ATOM 5911  C CG   . TYR A 1 38  ? -5.976  -4.698  -11.842 1.00 0.00 ? 413 TYR A CG   4  
ATOM 5912  C CD1  . TYR A 1 38  ? -6.483  -5.927  -12.243 1.00 0.00 ? 413 TYR A CD1  4  
ATOM 5913  C CD2  . TYR A 1 38  ? -6.789  -3.868  -11.080 1.00 0.00 ? 413 TYR A CD2  4  
ATOM 5914  C CE1  . TYR A 1 38  ? -7.763  -6.318  -11.895 1.00 0.00 ? 413 TYR A CE1  4  
ATOM 5915  C CE2  . TYR A 1 38  ? -8.069  -4.253  -10.728 1.00 0.00 ? 413 TYR A CE2  4  
ATOM 5916  C CZ   . TYR A 1 38  ? -8.551  -5.477  -11.138 1.00 0.00 ? 413 TYR A CZ   4  
ATOM 5917  O OH   . TYR A 1 38  ? -9.825  -5.863  -10.790 1.00 0.00 ? 413 TYR A OH   4  
ATOM 5918  H H    . TYR A 1 38  ? -2.669  -2.638  -13.113 1.00 0.00 ? 413 TYR A H    4  
ATOM 5919  H HA   . TYR A 1 38  ? -4.695  -4.354  -14.362 1.00 0.00 ? 413 TYR A HA   4  
ATOM 5920  H HB2  . TYR A 1 38  ? -3.948  -5.151  -12.211 1.00 0.00 ? 413 TYR A HB2  4  
ATOM 5921  H HB3  . TYR A 1 38  ? -4.223  -3.575  -11.479 1.00 0.00 ? 413 TYR A HB3  4  
ATOM 5922  H HD1  . TYR A 1 38  ? -5.863  -6.583  -12.836 1.00 0.00 ? 413 TYR A HD1  4  
ATOM 5923  H HD2  . TYR A 1 38  ? -6.409  -2.908  -10.761 1.00 0.00 ? 413 TYR A HD2  4  
ATOM 5924  H HE1  . TYR A 1 38  ? -8.140  -7.278  -12.216 1.00 0.00 ? 413 TYR A HE1  4  
ATOM 5925  H HE2  . TYR A 1 38  ? -8.686  -3.594  -10.136 1.00 0.00 ? 413 TYR A HE2  4  
ATOM 5926  H HH   . TYR A 1 38  ? -10.444 -5.165  -11.018 1.00 0.00 ? 413 TYR A HH   4  
ATOM 5927  N N    . ILE A 1 39  ? -6.562  -2.723  -14.485 1.00 0.00 ? 414 ILE A N    4  
ATOM 5928  C CA   . ILE A 1 39  ? -7.611  -1.726  -14.665 1.00 0.00 ? 414 ILE A CA   4  
ATOM 5929  C C    . ILE A 1 39  ? -8.561  -1.726  -13.473 1.00 0.00 ? 414 ILE A C    4  
ATOM 5930  O O    . ILE A 1 39  ? -9.143  -2.754  -13.130 1.00 0.00 ? 414 ILE A O    4  
ATOM 5931  C CB   . ILE A 1 39  ? -8.417  -1.980  -15.954 1.00 0.00 ? 414 ILE A CB   4  
ATOM 5932  C CG1  . ILE A 1 39  ? -7.475  -2.258  -17.127 1.00 0.00 ? 414 ILE A CG1  4  
ATOM 5933  C CG2  . ILE A 1 39  ? -9.315  -0.789  -16.260 1.00 0.00 ? 414 ILE A CG2  4  
ATOM 5934  C CD1  . ILE A 1 39  ? -8.194  -2.619  -18.408 1.00 0.00 ? 414 ILE A CD1  4  
ATOM 5935  H H    . ILE A 1 39  ? -6.642  -3.589  -14.935 1.00 0.00 ? 414 ILE A H    4  
ATOM 5936  H HA   . ILE A 1 39  ? -7.142  -0.756  -14.742 1.00 0.00 ? 414 ILE A HA   4  
ATOM 5937  H HB   . ILE A 1 39  ? -9.048  -2.842  -15.796 1.00 0.00 ? 414 ILE A HB   4  
ATOM 5938  H HG12 . ILE A 1 39  ? -6.880  -1.377  -17.319 1.00 0.00 ? 414 ILE A HG12 4  
ATOM 5939  H HG13 . ILE A 1 39  ? -6.822  -3.079  -16.868 1.00 0.00 ? 414 ILE A HG13 4  
ATOM 5940  H HG21 . ILE A 1 39  ? -9.502  -0.236  -15.352 1.00 0.00 ? 414 ILE A HG21 4  
ATOM 5941  H HG22 . ILE A 1 39  ? -8.827  -0.146  -16.979 1.00 0.00 ? 414 ILE A HG22 4  
ATOM 5942  H HG23 . ILE A 1 39  ? -10.251 -1.139  -16.669 1.00 0.00 ? 414 ILE A HG23 4  
ATOM 5943  H HD11 . ILE A 1 39  ? -7.495  -3.069  -19.099 1.00 0.00 ? 414 ILE A HD11 4  
ATOM 5944  H HD12 . ILE A 1 39  ? -8.987  -3.318  -18.191 1.00 0.00 ? 414 ILE A HD12 4  
ATOM 5945  H HD13 . ILE A 1 39  ? -8.611  -1.726  -18.851 1.00 0.00 ? 414 ILE A HD13 4  
ATOM 5946  N N    . ILE A 1 40  ? -8.702  -0.570  -12.834 1.00 0.00 ? 415 ILE A N    4  
ATOM 5947  C CA   . ILE A 1 40  ? -9.569  -0.444  -11.668 1.00 0.00 ? 415 ILE A CA   4  
ATOM 5948  C C    . ILE A 1 40  ? -10.982 -0.017  -12.055 1.00 0.00 ? 415 ILE A C    4  
ATOM 5949  O O    . ILE A 1 40  ? -11.945 -0.739  -11.804 1.00 0.00 ? 415 ILE A O    4  
ATOM 5950  C CB   . ILE A 1 40  ? -8.994  0.562   -10.653 1.00 0.00 ? 415 ILE A CB   4  
ATOM 5951  C CG1  . ILE A 1 40  ? -7.529  0.228   -10.360 1.00 0.00 ? 415 ILE A CG1  4  
ATOM 5952  C CG2  . ILE A 1 40  ? -9.821  0.559   -9.373  1.00 0.00 ? 415 ILE A CG2  4  
ATOM 5953  C CD1  . ILE A 1 40  ? -6.913  1.080   -9.271  1.00 0.00 ? 415 ILE A CD1  4  
ATOM 5954  H H    . ILE A 1 40  ? -8.203  0.214   -13.146 1.00 0.00 ? 415 ILE A H    4  
ATOM 5955  H HA   . ILE A 1 40  ? -9.619  -1.411  -11.189 1.00 0.00 ? 415 ILE A HA   4  
ATOM 5956  H HB   . ILE A 1 40  ? -9.052  1.549   -11.087 1.00 0.00 ? 415 ILE A HB   4  
ATOM 5957  H HG12 . ILE A 1 40  ? -7.457  -0.804  -10.051 1.00 0.00 ? 415 ILE A HG12 4  
ATOM 5958  H HG13 . ILE A 1 40  ? -6.948  0.369   -11.260 1.00 0.00 ? 415 ILE A HG13 4  
ATOM 5959  H HG21 . ILE A 1 40  ? -10.570 -0.217  -9.430  1.00 0.00 ? 415 ILE A HG21 4  
ATOM 5960  H HG22 . ILE A 1 40  ? -9.175  0.374   -8.527  1.00 0.00 ? 415 ILE A HG22 4  
ATOM 5961  H HG23 . ILE A 1 40  ? -10.304 1.517   -9.255  1.00 0.00 ? 415 ILE A HG23 4  
ATOM 5962  H HD11 . ILE A 1 40  ? -6.092  1.650   -9.681  1.00 0.00 ? 415 ILE A HD11 4  
ATOM 5963  H HD12 . ILE A 1 40  ? -7.657  1.754   -8.876  1.00 0.00 ? 415 ILE A HD12 4  
ATOM 5964  H HD13 . ILE A 1 40  ? -6.548  0.442   -8.480  1.00 0.00 ? 415 ILE A HD13 4  
ATOM 5965  N N    . GLU A 1 41  ? -11.105 1.161   -12.660 1.00 0.00 ? 416 GLU A N    4  
ATOM 5966  C CA   . GLU A 1 41  ? -12.411 1.669   -13.066 1.00 0.00 ? 416 GLU A CA   4  
ATOM 5967  C C    . GLU A 1 41  ? -12.284 2.709   -14.174 1.00 0.00 ? 416 GLU A C    4  
ATOM 5968  O O    . GLU A 1 41  ? -11.295 3.437   -14.248 1.00 0.00 ? 416 GLU A O    4  
ATOM 5969  C CB   . GLU A 1 41  ? -13.136 2.275   -11.863 1.00 0.00 ? 416 GLU A CB   4  
ATOM 5970  C CG   . GLU A 1 41  ? -12.298 3.277   -11.087 1.00 0.00 ? 416 GLU A CG   4  
ATOM 5971  C CD   . GLU A 1 41  ? -12.888 3.607   -9.730  1.00 0.00 ? 416 GLU A CD   4  
ATOM 5972  O OE1  . GLU A 1 41  ? -13.250 2.663   -8.996  1.00 0.00 ? 416 GLU A OE1  4  
ATOM 5973  O OE2  . GLU A 1 41  ? -12.989 4.808   -9.402  1.00 0.00 ? 416 GLU A OE2  4  
ATOM 5974  H H    . GLU A 1 41  ? -10.305 1.700   -12.831 1.00 0.00 ? 416 GLU A H    4  
ATOM 5975  H HA   . GLU A 1 41  ? -12.988 0.834   -13.438 1.00 0.00 ? 416 GLU A HA   4  
ATOM 5976  H HB2  . GLU A 1 41  ? -14.028 2.776   -12.210 1.00 0.00 ? 416 GLU A HB2  4  
ATOM 5977  H HB3  . GLU A 1 41  ? -13.421 1.479   -11.191 1.00 0.00 ? 416 GLU A HB3  4  
ATOM 5978  H HG2  . GLU A 1 41  ? -11.310 2.864   -10.942 1.00 0.00 ? 416 GLU A HG2  4  
ATOM 5979  H HG3  . GLU A 1 41  ? -12.224 4.188   -11.663 1.00 0.00 ? 416 GLU A HG3  4  
ATOM 5980  N N    . VAL A 1 42  ? -13.299 2.774   -15.031 1.00 0.00 ? 417 VAL A N    4  
ATOM 5981  C CA   . VAL A 1 42  ? -13.313 3.728   -16.136 1.00 0.00 ? 417 VAL A CA   4  
ATOM 5982  C C    . VAL A 1 42  ? -14.474 4.704   -15.994 1.00 0.00 ? 417 VAL A C    4  
ATOM 5983  O O    . VAL A 1 42  ? -15.575 4.321   -15.601 1.00 0.00 ? 417 VAL A O    4  
ATOM 5984  C CB   . VAL A 1 42  ? -13.421 3.015   -17.497 1.00 0.00 ? 417 VAL A CB   4  
ATOM 5985  C CG1  . VAL A 1 42  ? -13.219 4.002   -18.636 1.00 0.00 ? 417 VAL A CG1  4  
ATOM 5986  C CG2  . VAL A 1 42  ? -12.419 1.874   -17.586 1.00 0.00 ? 417 VAL A CG2  4  
ATOM 5987  H H    . VAL A 1 42  ? -14.062 2.170   -14.915 1.00 0.00 ? 417 VAL A H    4  
ATOM 5988  H HA   . VAL A 1 42  ? -12.384 4.280   -16.112 1.00 0.00 ? 417 VAL A HA   4  
ATOM 5989  H HB   . VAL A 1 42  ? -14.415 2.600   -17.584 1.00 0.00 ? 417 VAL A HB   4  
ATOM 5990  H HG11 . VAL A 1 42  ? -13.945 4.798   -18.557 1.00 0.00 ? 417 VAL A HG11 4  
ATOM 5991  H HG12 . VAL A 1 42  ? -12.223 4.417   -18.580 1.00 0.00 ? 417 VAL A HG12 4  
ATOM 5992  H HG13 . VAL A 1 42  ? -13.344 3.493   -19.581 1.00 0.00 ? 417 VAL A HG13 4  
ATOM 5993  H HG21 . VAL A 1 42  ? -11.448 2.267   -17.847 1.00 0.00 ? 417 VAL A HG21 4  
ATOM 5994  H HG22 . VAL A 1 42  ? -12.360 1.371   -16.632 1.00 0.00 ? 417 VAL A HG22 4  
ATOM 5995  H HG23 . VAL A 1 42  ? -12.739 1.173   -18.343 1.00 0.00 ? 417 VAL A HG23 4  
ATOM 5996  N N    . ILE A 1 43  ? -14.221 5.968   -16.315 1.00 0.00 ? 418 ILE A N    4  
ATOM 5997  C CA   . ILE A 1 43  ? -15.247 6.998   -16.219 1.00 0.00 ? 418 ILE A CA   4  
ATOM 5998  C C    . ILE A 1 43  ? -16.073 7.062   -17.507 1.00 0.00 ? 418 ILE A C    4  
ATOM 5999  O O    . ILE A 1 43  ? -15.521 7.024   -18.607 1.00 0.00 ? 418 ILE A O    4  
ATOM 6000  C CB   . ILE A 1 43  ? -14.621 8.384   -15.930 1.00 0.00 ? 418 ILE A CB   4  
ATOM 6001  C CG1  . ILE A 1 43  ? -14.116 8.457   -14.485 1.00 0.00 ? 418 ILE A CG1  4  
ATOM 6002  C CG2  . ILE A 1 43  ? -15.627 9.500   -16.192 1.00 0.00 ? 418 ILE A CG2  4  
ATOM 6003  C CD1  . ILE A 1 43  ? -13.218 7.304   -14.088 1.00 0.00 ? 418 ILE A CD1  4  
ATOM 6004  H H    . ILE A 1 43  ? -13.323 6.214   -16.620 1.00 0.00 ? 418 ILE A H    4  
ATOM 6005  H HA   . ILE A 1 43  ? -15.895 6.741   -15.396 1.00 0.00 ? 418 ILE A HA   4  
ATOM 6006  H HB   . ILE A 1 43  ? -13.787 8.523   -16.600 1.00 0.00 ? 418 ILE A HB   4  
ATOM 6007  H HG12 . ILE A 1 43  ? -13.555 9.370   -14.353 1.00 0.00 ? 418 ILE A HG12 4  
ATOM 6008  H HG13 . ILE A 1 43  ? -14.965 8.462   -13.815 1.00 0.00 ? 418 ILE A HG13 4  
ATOM 6009  H HG21 . ILE A 1 43  ? -16.550 9.280   -15.677 1.00 0.00 ? 418 ILE A HG21 4  
ATOM 6010  H HG22 . ILE A 1 43  ? -15.226 10.437  -15.831 1.00 0.00 ? 418 ILE A HG22 4  
ATOM 6011  H HG23 . ILE A 1 43  ? -15.813 9.573   -17.253 1.00 0.00 ? 418 ILE A HG23 4  
ATOM 6012  H HD11 . ILE A 1 43  ? -13.796 6.391   -14.059 1.00 0.00 ? 418 ILE A HD11 4  
ATOM 6013  H HD12 . ILE A 1 43  ? -12.422 7.202   -14.811 1.00 0.00 ? 418 ILE A HD12 4  
ATOM 6014  H HD13 . ILE A 1 43  ? -12.796 7.494   -13.112 1.00 0.00 ? 418 ILE A HD13 4  
ATOM 6015  N N    . PRO A 1 44  ? -17.413 7.154   -17.392 1.00 0.00 ? 419 PRO A N    4  
ATOM 6016  C CA   . PRO A 1 44  ? -18.308 7.217   -18.554 1.00 0.00 ? 419 PRO A CA   4  
ATOM 6017  C C    . PRO A 1 44  ? -18.238 8.564   -19.274 1.00 0.00 ? 419 PRO A C    4  
ATOM 6018  O O    . PRO A 1 44  ? -19.252 9.238   -19.450 1.00 0.00 ? 419 PRO A O    4  
ATOM 6019  C CB   . PRO A 1 44  ? -19.711 7.004   -17.956 1.00 0.00 ? 419 PRO A CB   4  
ATOM 6020  C CG   . PRO A 1 44  ? -19.491 6.611   -16.531 1.00 0.00 ? 419 PRO A CG   4  
ATOM 6021  C CD   . PRO A 1 44  ? -18.168 7.195   -16.134 1.00 0.00 ? 419 PRO A CD   4  
ATOM 6022  H HA   . PRO A 1 44  ? -18.092 6.426   -19.259 1.00 0.00 ? 419 PRO A HA   4  
ATOM 6023  H HB2  . PRO A 1 44  ? -20.276 7.922   -18.026 1.00 0.00 ? 419 PRO A HB2  4  
ATOM 6024  H HB3  . PRO A 1 44  ? -20.219 6.224   -18.503 1.00 0.00 ? 419 PRO A HB3  4  
ATOM 6025  H HG2  . PRO A 1 44  ? -20.280 7.015   -15.914 1.00 0.00 ? 419 PRO A HG2  4  
ATOM 6026  H HG3  . PRO A 1 44  ? -19.465 5.534   -16.449 1.00 0.00 ? 419 PRO A HG3  4  
ATOM 6027  H HD2  . PRO A 1 44  ? -18.291 8.211   -15.787 1.00 0.00 ? 419 PRO A HD2  4  
ATOM 6028  H HD3  . PRO A 1 44  ? -17.698 6.587   -15.378 1.00 0.00 ? 419 PRO A HD3  4  
ATOM 6029  N N    . ASP A 1 45  ? -17.034 8.949   -19.691 1.00 0.00 ? 420 ASP A N    4  
ATOM 6030  C CA   . ASP A 1 45  ? -16.831 10.212  -20.394 1.00 0.00 ? 420 ASP A CA   4  
ATOM 6031  C C    . ASP A 1 45  ? -15.354 10.414  -20.713 1.00 0.00 ? 420 ASP A C    4  
ATOM 6032  O O    . ASP A 1 45  ? -14.820 11.516  -20.587 1.00 0.00 ? 420 ASP A O    4  
ATOM 6033  C CB   . ASP A 1 45  ? -17.358 11.383  -19.557 1.00 0.00 ? 420 ASP A CB   4  
ATOM 6034  C CG   . ASP A 1 45  ? -18.727 11.850  -20.014 1.00 0.00 ? 420 ASP A CG   4  
ATOM 6035  O OD1  . ASP A 1 45  ? -19.070 11.623  -21.193 1.00 0.00 ? 420 ASP A OD1  4  
ATOM 6036  O OD2  . ASP A 1 45  ? -19.457 12.442  -19.191 1.00 0.00 ? 420 ASP A OD2  4  
ATOM 6037  H H    . ASP A 1 45  ? -16.264 8.369   -19.525 1.00 0.00 ? 420 ASP A H    4  
ATOM 6038  H HA   . ASP A 1 45  ? -17.384 10.166  -21.322 1.00 0.00 ? 420 ASP A HA   4  
ATOM 6039  H HB2  . ASP A 1 45  ? -17.430 11.076  -18.525 1.00 0.00 ? 420 ASP A HB2  4  
ATOM 6040  H HB3  . ASP A 1 45  ? -16.671 12.213  -19.634 1.00 0.00 ? 420 ASP A HB3  4  
ATOM 6041  N N    . THR A 1 46  ? -14.697 9.335   -21.125 1.00 0.00 ? 421 THR A N    4  
ATOM 6042  C CA   . THR A 1 46  ? -13.278 9.379   -21.461 1.00 0.00 ? 421 THR A CA   4  
ATOM 6043  C C    . THR A 1 46  ? -12.987 8.475   -22.657 1.00 0.00 ? 421 THR A C    4  
ATOM 6044  O O    . THR A 1 46  ? -13.865 7.745   -23.116 1.00 0.00 ? 421 THR A O    4  
ATOM 6045  C CB   . THR A 1 46  ? -12.429 8.953   -20.255 1.00 0.00 ? 421 THR A CB   4  
ATOM 6046  O OG1  . THR A 1 46  ? -12.078 7.583   -20.341 1.00 0.00 ? 421 THR A OG1  4  
ATOM 6047  C CG2  . THR A 1 46  ? -13.117 9.160   -18.922 1.00 0.00 ? 421 THR A CG2  4  
ATOM 6048  H H    . THR A 1 46  ? -15.178 8.485   -21.203 1.00 0.00 ? 421 THR A H    4  
ATOM 6049  H HA   . THR A 1 46  ? -13.031 10.397  -21.726 1.00 0.00 ? 421 THR A HA   4  
ATOM 6050  H HB   . THR A 1 46  ? -11.520 9.535   -20.247 1.00 0.00 ? 421 THR A HB   4  
ATOM 6051  H HG1  . THR A 1 46  ? -12.874 7.052   -20.423 1.00 0.00 ? 421 THR A HG1  4  
ATOM 6052  H HG21 . THR A 1 46  ? -14.100 8.714   -18.952 1.00 0.00 ? 421 THR A HG21 4  
ATOM 6053  H HG22 . THR A 1 46  ? -12.535 8.696   -18.141 1.00 0.00 ? 421 THR A HG22 4  
ATOM 6054  H HG23 . THR A 1 46  ? -13.207 10.218  -18.724 1.00 0.00 ? 421 THR A HG23 4  
ATOM 6055  N N    . PRO A 1 47  ? -11.746 8.499   -23.175 1.00 0.00 ? 422 PRO A N    4  
ATOM 6056  C CA   . PRO A 1 47  ? -11.362 7.665   -24.313 1.00 0.00 ? 422 PRO A CA   4  
ATOM 6057  C C    . PRO A 1 47  ? -11.156 6.208   -23.906 1.00 0.00 ? 422 PRO A C    4  
ATOM 6058  O O    . PRO A 1 47  ? -11.089 5.319   -24.756 1.00 0.00 ? 422 PRO A O    4  
ATOM 6059  C CB   . PRO A 1 47  ? -10.050 8.291   -24.782 1.00 0.00 ? 422 PRO A CB   4  
ATOM 6060  C CG   . PRO A 1 47  ? -9.465  8.910   -23.559 1.00 0.00 ? 422 PRO A CG   4  
ATOM 6061  C CD   . PRO A 1 47  ? -10.624 9.328   -22.692 1.00 0.00 ? 422 PRO A CD   4  
ATOM 6062  H HA   . PRO A 1 47  ? -12.094 7.716   -25.105 1.00 0.00 ? 422 PRO A HA   4  
ATOM 6063  H HB2  . PRO A 1 47  ? -9.406  7.525   -25.186 1.00 0.00 ? 422 PRO A HB2  4  
ATOM 6064  H HB3  . PRO A 1 47  ? -10.254 9.035   -25.539 1.00 0.00 ? 422 PRO A HB3  4  
ATOM 6065  H HG2  . PRO A 1 47  ? -8.853  8.185   -23.041 1.00 0.00 ? 422 PRO A HG2  4  
ATOM 6066  H HG3  . PRO A 1 47  ? -8.873  9.771   -23.833 1.00 0.00 ? 422 PRO A HG3  4  
ATOM 6067  H HD2  . PRO A 1 47  ? -10.408 9.115   -21.656 1.00 0.00 ? 422 PRO A HD2  4  
ATOM 6068  H HD3  . PRO A 1 47  ? -10.836 10.378  -22.825 1.00 0.00 ? 422 PRO A HD3  4  
ATOM 6069  N N    . ALA A 1 48  ? -11.066 5.970   -22.599 1.00 0.00 ? 423 ALA A N    4  
ATOM 6070  C CA   . ALA A 1 48  ? -10.880 4.624   -22.075 1.00 0.00 ? 423 ALA A CA   4  
ATOM 6071  C C    . ALA A 1 48  ? -12.105 3.760   -22.357 1.00 0.00 ? 423 ALA A C    4  
ATOM 6072  O O    . ALA A 1 48  ? -12.007 2.708   -22.988 1.00 0.00 ? 423 ALA A O    4  
ATOM 6073  C CB   . ALA A 1 48  ? -10.601 4.676   -20.581 1.00 0.00 ? 423 ALA A CB   4  
ATOM 6074  H H    . ALA A 1 48  ? -11.132 6.719   -21.970 1.00 0.00 ? 423 ALA A H    4  
ATOM 6075  H HA   . ALA A 1 48  ? -10.021 4.189   -22.565 1.00 0.00 ? 423 ALA A HA   4  
ATOM 6076  H HB1  . ALA A 1 48  ? -9.547  4.843   -20.416 1.00 0.00 ? 423 ALA A HB1  4  
ATOM 6077  H HB2  . ALA A 1 48  ? -11.167 5.484   -20.138 1.00 0.00 ? 423 ALA A HB2  4  
ATOM 6078  H HB3  . ALA A 1 48  ? -10.894 3.741   -20.127 1.00 0.00 ? 423 ALA A HB3  4  
ATOM 6079  N N    . GLU A 1 49  ? -13.261 4.220   -21.889 1.00 0.00 ? 424 GLU A N    4  
ATOM 6080  C CA   . GLU A 1 49  ? -14.509 3.496   -22.096 1.00 0.00 ? 424 GLU A CA   4  
ATOM 6081  C C    . GLU A 1 49  ? -14.917 3.546   -23.565 1.00 0.00 ? 424 GLU A C    4  
ATOM 6082  O O    . GLU A 1 49  ? -15.525 2.610   -24.084 1.00 0.00 ? 424 GLU A O    4  
ATOM 6083  C CB   . GLU A 1 49  ? -15.618 4.089   -21.224 1.00 0.00 ? 424 GLU A CB   4  
ATOM 6084  C CG   . GLU A 1 49  ? -16.871 3.230   -21.167 1.00 0.00 ? 424 GLU A CG   4  
ATOM 6085  C CD   . GLU A 1 49  ? -17.756 3.567   -19.983 1.00 0.00 ? 424 GLU A CD   4  
ATOM 6086  O OE1  . GLU A 1 49  ? -17.216 3.755   -18.874 1.00 0.00 ? 424 GLU A OE1  4  
ATOM 6087  O OE2  . GLU A 1 49  ? -18.989 3.639   -20.166 1.00 0.00 ? 424 GLU A OE2  4  
ATOM 6088  H H    . GLU A 1 49  ? -13.275 5.067   -21.399 1.00 0.00 ? 424 GLU A H    4  
ATOM 6089  H HA   . GLU A 1 49  ? -14.349 2.467   -21.813 1.00 0.00 ? 424 GLU A HA   4  
ATOM 6090  H HB2  . GLU A 1 49  ? -15.244 4.208   -20.219 1.00 0.00 ? 424 GLU A HB2  4  
ATOM 6091  H HB3  . GLU A 1 49  ? -15.889 5.058   -21.615 1.00 0.00 ? 424 GLU A HB3  4  
ATOM 6092  H HG2  . GLU A 1 49  ? -17.437 3.381   -22.074 1.00 0.00 ? 424 GLU A HG2  4  
ATOM 6093  H HG3  . GLU A 1 49  ? -16.577 2.192   -21.096 1.00 0.00 ? 424 GLU A HG3  4  
ATOM 6094  N N    . ALA A 1 50  ? -14.570 4.645   -24.229 1.00 0.00 ? 425 ALA A N    4  
ATOM 6095  C CA   . ALA A 1 50  ? -14.891 4.821   -25.640 1.00 0.00 ? 425 ALA A CA   4  
ATOM 6096  C C    . ALA A 1 50  ? -13.963 3.988   -26.515 1.00 0.00 ? 425 ALA A C    4  
ATOM 6097  O O    . ALA A 1 50  ? -14.350 3.536   -27.593 1.00 0.00 ? 425 ALA A O    4  
ATOM 6098  C CB   . ALA A 1 50  ? -14.803 6.291   -26.022 1.00 0.00 ? 425 ALA A CB   4  
ATOM 6099  H H    . ALA A 1 50  ? -14.082 5.353   -23.760 1.00 0.00 ? 425 ALA A H    4  
ATOM 6100  H HA   . ALA A 1 50  ? -15.908 4.492   -25.794 1.00 0.00 ? 425 ALA A HA   4  
ATOM 6101  H HB1  . ALA A 1 50  ? -15.678 6.810   -25.661 1.00 0.00 ? 425 ALA A HB1  4  
ATOM 6102  H HB2  . ALA A 1 50  ? -13.918 6.725   -25.579 1.00 0.00 ? 425 ALA A HB2  4  
ATOM 6103  H HB3  . ALA A 1 50  ? -14.747 6.381   -27.096 1.00 0.00 ? 425 ALA A HB3  4  
ATOM 6104  N N    . GLY A 1 51  ? -12.736 3.786   -26.044 1.00 0.00 ? 426 GLY A N    4  
ATOM 6105  C CA   . GLY A 1 51  ? -11.774 3.004   -26.796 1.00 0.00 ? 426 GLY A CA   4  
ATOM 6106  C C    . GLY A 1 51  ? -12.172 1.546   -26.895 1.00 0.00 ? 426 GLY A C    4  
ATOM 6107  O O    . GLY A 1 51  ? -11.915 0.892   -27.906 1.00 0.00 ? 426 GLY A O    4  
ATOM 6108  H H    . GLY A 1 51  ? -12.484 4.169   -25.178 1.00 0.00 ? 426 GLY A H    4  
ATOM 6109  H HA2  . GLY A 1 51  ? -11.692 3.414   -27.791 1.00 0.00 ? 426 GLY A HA2  4  
ATOM 6110  H HA3  . GLY A 1 51  ? -10.812 3.071   -26.309 1.00 0.00 ? 426 GLY A HA3  4  
ATOM 6111  N N    . GLY A 1 52  ? -12.806 1.037   -25.843 1.00 0.00 ? 427 GLY A N    4  
ATOM 6112  C CA   . GLY A 1 52  ? -13.235 -0.349  -25.837 1.00 0.00 ? 427 GLY A CA   4  
ATOM 6113  C C    . GLY A 1 52  ? -12.612 -1.153  -24.713 1.00 0.00 ? 427 GLY A C    4  
ATOM 6114  O O    . GLY A 1 52  ? -12.458 -2.369  -24.827 1.00 0.00 ? 427 GLY A O    4  
ATOM 6115  H H    . GLY A 1 52  ? -12.986 1.607   -25.068 1.00 0.00 ? 427 GLY A H    4  
ATOM 6116  H HA2  . GLY A 1 52  ? -14.309 -0.379  -25.732 1.00 0.00 ? 427 GLY A HA2  4  
ATOM 6117  H HA3  . GLY A 1 52  ? -12.965 -0.802  -26.780 1.00 0.00 ? 427 GLY A HA3  4  
ATOM 6118  N N    . LEU A 1 53  ? -12.253 -0.480  -23.623 1.00 0.00 ? 428 LEU A N    4  
ATOM 6119  C CA   . LEU A 1 53  ? -11.649 -1.154  -22.480 1.00 0.00 ? 428 LEU A CA   4  
ATOM 6120  C C    . LEU A 1 53  ? -12.699 -1.475  -21.426 1.00 0.00 ? 428 LEU A C    4  
ATOM 6121  O O    . LEU A 1 53  ? -13.885 -1.198  -21.610 1.00 0.00 ? 428 LEU A O    4  
ATOM 6122  C CB   . LEU A 1 53  ? -10.548 -0.294  -21.854 1.00 0.00 ? 428 LEU A CB   4  
ATOM 6123  C CG   . LEU A 1 53  ? -9.871  0.711   -22.787 1.00 0.00 ? 428 LEU A CG   4  
ATOM 6124  C CD1  . LEU A 1 53  ? -9.317  1.874   -21.983 1.00 0.00 ? 428 LEU A CD1  4  
ATOM 6125  C CD2  . LEU A 1 53  ? -8.768  0.037   -23.586 1.00 0.00 ? 428 LEU A CD2  4  
ATOM 6126  H H    . LEU A 1 53  ? -12.401 0.487   -23.583 1.00 0.00 ? 428 LEU A H    4  
ATOM 6127  H HA   . LEU A 1 53  ? -11.216 -2.077  -22.832 1.00 0.00 ? 428 LEU A HA   4  
ATOM 6128  H HB2  . LEU A 1 53  ? -10.977 0.253   -21.027 1.00 0.00 ? 428 LEU A HB2  4  
ATOM 6129  H HB3  . LEU A 1 53  ? -9.790  -0.954  -21.467 1.00 0.00 ? 428 LEU A HB3  4  
ATOM 6130  H HG   . LEU A 1 53  ? -10.598 1.102   -23.481 1.00 0.00 ? 428 LEU A HG   4  
ATOM 6131  H HD11 . LEU A 1 53  ? -10.118 2.347   -21.436 1.00 0.00 ? 428 LEU A HD11 4  
ATOM 6132  H HD12 . LEU A 1 53  ? -8.574  1.508   -21.288 1.00 0.00 ? 428 LEU A HD12 4  
ATOM 6133  H HD13 . LEU A 1 53  ? -8.863  2.590   -22.650 1.00 0.00 ? 428 LEU A HD13 4  
ATOM 6134  H HD21 . LEU A 1 53  ? -8.015  -0.341  -22.912 1.00 0.00 ? 428 LEU A HD21 4  
ATOM 6135  H HD22 . LEU A 1 53  ? -9.184  -0.780  -24.156 1.00 0.00 ? 428 LEU A HD22 4  
ATOM 6136  H HD23 . LEU A 1 53  ? -8.323  0.754   -24.259 1.00 0.00 ? 428 LEU A HD23 4  
ATOM 6137  N N    . LYS A 1 54  ? -12.252 -2.052  -20.316 1.00 0.00 ? 429 LYS A N    4  
ATOM 6138  C CA   . LYS A 1 54  ? -13.150 -2.403  -19.225 1.00 0.00 ? 429 LYS A CA   4  
ATOM 6139  C C    . LYS A 1 54  ? -12.377 -2.570  -17.921 1.00 0.00 ? 429 LYS A C    4  
ATOM 6140  O O    . LYS A 1 54  ? -11.159 -2.746  -17.929 1.00 0.00 ? 429 LYS A O    4  
ATOM 6141  C CB   . LYS A 1 54  ? -13.908 -3.693  -19.549 1.00 0.00 ? 429 LYS A CB   4  
ATOM 6142  C CG   . LYS A 1 54  ? -15.246 -3.464  -20.234 1.00 0.00 ? 429 LYS A CG   4  
ATOM 6143  C CD   . LYS A 1 54  ? -16.149 -2.559  -19.411 1.00 0.00 ? 429 LYS A CD   4  
ATOM 6144  C CE   . LYS A 1 54  ? -17.592 -2.642  -19.878 1.00 0.00 ? 429 LYS A CE   4  
ATOM 6145  N NZ   . LYS A 1 54  ? -18.323 -1.363  -19.658 1.00 0.00 ? 429 LYS A NZ   4  
ATOM 6146  H H    . LYS A 1 54  ? -11.295 -2.240  -20.228 1.00 0.00 ? 429 LYS A H    4  
ATOM 6147  H HA   . LYS A 1 54  ? -13.858 -1.596  -19.109 1.00 0.00 ? 429 LYS A HA   4  
ATOM 6148  H HB2  . LYS A 1 54  ? -13.297 -4.302  -20.199 1.00 0.00 ? 429 LYS A HB2  4  
ATOM 6149  H HB3  . LYS A 1 54  ? -14.088 -4.232  -18.631 1.00 0.00 ? 429 LYS A HB3  4  
ATOM 6150  H HG2  . LYS A 1 54  ? -15.074 -3.004  -21.196 1.00 0.00 ? 429 LYS A HG2  4  
ATOM 6151  H HG3  . LYS A 1 54  ? -15.736 -4.416  -20.372 1.00 0.00 ? 429 LYS A HG3  4  
ATOM 6152  H HD2  . LYS A 1 54  ? -16.099 -2.862  -18.376 1.00 0.00 ? 429 LYS A HD2  4  
ATOM 6153  H HD3  . LYS A 1 54  ? -15.807 -1.539  -19.507 1.00 0.00 ? 429 LYS A HD3  4  
ATOM 6154  H HE2  . LYS A 1 54  ? -17.604 -2.875  -20.932 1.00 0.00 ? 429 LYS A HE2  4  
ATOM 6155  H HE3  . LYS A 1 54  ? -18.090 -3.429  -19.332 1.00 0.00 ? 429 LYS A HE3  4  
ATOM 6156  H HZ1  . LYS A 1 54  ? -19.340 -1.546  -19.551 1.00 0.00 ? 429 LYS A HZ1  4  
ATOM 6157  H HZ2  . LYS A 1 54  ? -17.973 -0.896  -18.797 1.00 0.00 ? 429 LYS A HZ2  4  
ATOM 6158  H HZ3  . LYS A 1 54  ? -18.180 -0.726  -20.468 1.00 0.00 ? 429 LYS A HZ3  4  
ATOM 6159  N N    . GLU A 1 55  ? -13.092 -2.512  -16.803 1.00 0.00 ? 430 GLU A N    4  
ATOM 6160  C CA   . GLU A 1 55  ? -12.472 -2.656  -15.492 1.00 0.00 ? 430 GLU A CA   4  
ATOM 6161  C C    . GLU A 1 55  ? -12.346 -4.127  -15.106 1.00 0.00 ? 430 GLU A C    4  
ATOM 6162  O O    . GLU A 1 55  ? -12.835 -4.549  -14.057 1.00 0.00 ? 430 GLU A O    4  
ATOM 6163  C CB   . GLU A 1 55  ? -13.286 -1.904  -14.436 1.00 0.00 ? 430 GLU A CB   4  
ATOM 6164  C CG   . GLU A 1 55  ? -14.670 -2.490  -14.202 1.00 0.00 ? 430 GLU A CG   4  
ATOM 6165  C CD   . GLU A 1 55  ? -15.772 -1.643  -14.806 1.00 0.00 ? 430 GLU A CD   4  
ATOM 6166  O OE1  . GLU A 1 55  ? -15.884 -1.614  -16.050 1.00 0.00 ? 430 GLU A OE1  4  
ATOM 6167  O OE2  . GLU A 1 55  ? -16.523 -1.008  -14.036 1.00 0.00 ? 430 GLU A OE2  4  
ATOM 6168  H H    . GLU A 1 55  ? -14.060 -2.369  -16.861 1.00 0.00 ? 430 GLU A H    4  
ATOM 6169  H HA   . GLU A 1 55  ? -11.484 -2.224  -15.544 1.00 0.00 ? 430 GLU A HA   4  
ATOM 6170  H HB2  . GLU A 1 55  ? -12.747 -1.927  -13.501 1.00 0.00 ? 430 GLU A HB2  4  
ATOM 6171  H HB3  . GLU A 1 55  ? -13.401 -0.878  -14.750 1.00 0.00 ? 430 GLU A HB3  4  
ATOM 6172  H HG2  . GLU A 1 55  ? -14.710 -3.474  -14.644 1.00 0.00 ? 430 GLU A HG2  4  
ATOM 6173  H HG3  . GLU A 1 55  ? -14.837 -2.567  -13.138 1.00 0.00 ? 430 GLU A HG3  4  
ATOM 6174  N N    . ASN A 1 56  ? -11.686 -4.904  -15.958 1.00 0.00 ? 431 ASN A N    4  
ATOM 6175  C CA   . ASN A 1 56  ? -11.498 -6.328  -15.704 1.00 0.00 ? 431 ASN A CA   4  
ATOM 6176  C C    . ASN A 1 56  ? -10.422 -6.910  -16.617 1.00 0.00 ? 431 ASN A C    4  
ATOM 6177  O O    . ASN A 1 56  ? -10.483 -8.080  -16.995 1.00 0.00 ? 431 ASN A O    4  
ATOM 6178  C CB   . ASN A 1 56  ? -12.816 -7.080  -15.901 1.00 0.00 ? 431 ASN A CB   4  
ATOM 6179  C CG   . ASN A 1 56  ? -13.081 -8.081  -14.795 1.00 0.00 ? 431 ASN A CG   4  
ATOM 6180  O OD1  . ASN A 1 56  ? -13.385 -9.246  -15.054 1.00 0.00 ? 431 ASN A OD1  4  
ATOM 6181  N ND2  . ASN A 1 56  ? -12.968 -7.632  -13.550 1.00 0.00 ? 431 ASN A ND2  4  
ATOM 6182  H H    . ASN A 1 56  ? -11.318 -4.513  -16.778 1.00 0.00 ? 431 ASN A H    4  
ATOM 6183  H HA   . ASN A 1 56  ? -11.181 -6.441  -14.678 1.00 0.00 ? 431 ASN A HA   4  
ATOM 6184  H HB2  . ASN A 1 56  ? -13.629 -6.369  -15.919 1.00 0.00 ? 431 ASN A HB2  4  
ATOM 6185  H HB3  . ASN A 1 56  ? -12.785 -7.609  -16.842 1.00 0.00 ? 431 ASN A HB3  4  
ATOM 6186  H HD21 . ASN A 1 56  ? -12.723 -6.692  -13.417 1.00 0.00 ? 431 ASN A HD21 4  
ATOM 6187  H HD22 . ASN A 1 56  ? -13.134 -8.258  -12.815 1.00 0.00 ? 431 ASN A HD22 4  
ATOM 6188  N N    . ASP A 1 57  ? -9.437  -6.088  -16.966 1.00 0.00 ? 432 ASP A N    4  
ATOM 6189  C CA   . ASP A 1 57  ? -8.348  -6.525  -17.832 1.00 0.00 ? 432 ASP A CA   4  
ATOM 6190  C C    . ASP A 1 57  ? -7.002  -6.054  -17.290 1.00 0.00 ? 432 ASP A C    4  
ATOM 6191  O O    . ASP A 1 57  ? -6.926  -5.486  -16.200 1.00 0.00 ? 432 ASP A O    4  
ATOM 6192  C CB   . ASP A 1 57  ? -8.554  -5.999  -19.253 1.00 0.00 ? 432 ASP A CB   4  
ATOM 6193  C CG   . ASP A 1 57  ? -9.954  -6.264  -19.772 1.00 0.00 ? 432 ASP A CG   4  
ATOM 6194  O OD1  . ASP A 1 57  ? -10.267 -7.439  -20.061 1.00 0.00 ? 432 ASP A OD1  4  
ATOM 6195  O OD2  . ASP A 1 57  ? -10.737 -5.299  -19.890 1.00 0.00 ? 432 ASP A OD2  4  
ATOM 6196  H H    . ASP A 1 57  ? -9.442  -5.167  -16.631 1.00 0.00 ? 432 ASP A H    4  
ATOM 6197  H HA   . ASP A 1 57  ? -8.355  -7.604  -17.853 1.00 0.00 ? 432 ASP A HA   4  
ATOM 6198  H HB2  . ASP A 1 57  ? -8.383  -4.933  -19.265 1.00 0.00 ? 432 ASP A HB2  4  
ATOM 6199  H HB3  . ASP A 1 57  ? -7.847  -6.479  -19.915 1.00 0.00 ? 432 ASP A HB3  4  
ATOM 6200  N N    . VAL A 1 58  ? -5.942  -6.292  -18.056 1.00 0.00 ? 433 VAL A N    4  
ATOM 6201  C CA   . VAL A 1 58  ? -4.601  -5.893  -17.646 1.00 0.00 ? 433 VAL A CA   4  
ATOM 6202  C C    . VAL A 1 58  ? -3.783  -5.395  -18.834 1.00 0.00 ? 433 VAL A C    4  
ATOM 6203  O O    . VAL A 1 58  ? -3.609  -6.107  -19.823 1.00 0.00 ? 433 VAL A O    4  
ATOM 6204  C CB   . VAL A 1 58  ? -3.848  -7.059  -16.975 1.00 0.00 ? 433 VAL A CB   4  
ATOM 6205  C CG1  . VAL A 1 58  ? -2.504  -6.594  -16.435 1.00 0.00 ? 433 VAL A CG1  4  
ATOM 6206  C CG2  . VAL A 1 58  ? -4.690  -7.672  -15.867 1.00 0.00 ? 433 VAL A CG2  4  
ATOM 6207  H H    . VAL A 1 58  ? -6.064  -6.750  -18.913 1.00 0.00 ? 433 VAL A H    4  
ATOM 6208  H HA   . VAL A 1 58  ? -4.696  -5.093  -16.926 1.00 0.00 ? 433 VAL A HA   4  
ATOM 6209  H HB   . VAL A 1 58  ? -3.666  -7.819  -17.721 1.00 0.00 ? 433 VAL A HB   4  
ATOM 6210  H HG11 . VAL A 1 58  ? -2.038  -5.931  -17.150 1.00 0.00 ? 433 VAL A HG11 4  
ATOM 6211  H HG12 . VAL A 1 58  ? -2.653  -6.070  -15.503 1.00 0.00 ? 433 VAL A HG12 4  
ATOM 6212  H HG13 . VAL A 1 58  ? -1.867  -7.449  -16.270 1.00 0.00 ? 433 VAL A HG13 4  
ATOM 6213  H HG21 . VAL A 1 58  ? -4.092  -8.374  -15.308 1.00 0.00 ? 433 VAL A HG21 4  
ATOM 6214  H HG22 . VAL A 1 58  ? -5.041  -6.891  -15.208 1.00 0.00 ? 433 VAL A HG22 4  
ATOM 6215  H HG23 . VAL A 1 58  ? -5.538  -8.184  -16.300 1.00 0.00 ? 433 VAL A HG23 4  
ATOM 6216  N N    . ILE A 1 59  ? -3.277  -4.172  -18.724 1.00 0.00 ? 434 ILE A N    4  
ATOM 6217  C CA   . ILE A 1 59  ? -2.469  -3.582  -19.784 1.00 0.00 ? 434 ILE A CA   4  
ATOM 6218  C C    . ILE A 1 59  ? -1.066  -4.181  -19.790 1.00 0.00 ? 434 ILE A C    4  
ATOM 6219  O O    . ILE A 1 59  ? -0.536  -4.549  -18.741 1.00 0.00 ? 434 ILE A O    4  
ATOM 6220  C CB   . ILE A 1 59  ? -2.363  -2.052  -19.629 1.00 0.00 ? 434 ILE A CB   4  
ATOM 6221  C CG1  . ILE A 1 59  ? -3.747  -1.439  -19.393 1.00 0.00 ? 434 ILE A CG1  4  
ATOM 6222  C CG2  . ILE A 1 59  ? -1.706  -1.438  -20.857 1.00 0.00 ? 434 ILE A CG2  4  
ATOM 6223  C CD1  . ILE A 1 59  ? -3.800  -0.506  -18.202 1.00 0.00 ? 434 ILE A CD1  4  
ATOM 6224  H H    . ILE A 1 59  ? -3.445  -3.655  -17.909 1.00 0.00 ? 434 ILE A H    4  
ATOM 6225  H HA   . ILE A 1 59  ? -2.948  -3.797  -20.729 1.00 0.00 ? 434 ILE A HA   4  
ATOM 6226  H HB   . ILE A 1 59  ? -1.735  -1.843  -18.775 1.00 0.00 ? 434 ILE A HB   4  
ATOM 6227  H HG12 . ILE A 1 59  ? -4.039  -0.876  -20.268 1.00 0.00 ? 434 ILE A HG12 4  
ATOM 6228  H HG13 . ILE A 1 59  ? -4.462  -2.231  -19.227 1.00 0.00 ? 434 ILE A HG13 4  
ATOM 6229  H HG21 . ILE A 1 59  ? -1.811  -2.111  -21.695 1.00 0.00 ? 434 ILE A HG21 4  
ATOM 6230  H HG22 . ILE A 1 59  ? -2.181  -0.497  -21.088 1.00 0.00 ? 434 ILE A HG22 4  
ATOM 6231  H HG23 . ILE A 1 59  ? -0.657  -1.273  -20.658 1.00 0.00 ? 434 ILE A HG23 4  
ATOM 6232  H HD11 . ILE A 1 59  ? -4.401  -0.950  -17.424 1.00 0.00 ? 434 ILE A HD11 4  
ATOM 6233  H HD12 . ILE A 1 59  ? -2.799  -0.335  -17.833 1.00 0.00 ? 434 ILE A HD12 4  
ATOM 6234  H HD13 . ILE A 1 59  ? -4.237  0.435   -18.502 1.00 0.00 ? 434 ILE A HD13 4  
ATOM 6235  N N    . ILE A 1 60  ? -0.470  -4.282  -20.973 1.00 0.00 ? 435 ILE A N    4  
ATOM 6236  C CA   . ILE A 1 60  ? 0.870   -4.843  -21.102 1.00 0.00 ? 435 ILE A CA   4  
ATOM 6237  C C    . ILE A 1 60  ? 1.712   -4.047  -22.093 1.00 0.00 ? 435 ILE A C    4  
ATOM 6238  O O    . ILE A 1 60  ? 2.862   -3.710  -21.813 1.00 0.00 ? 435 ILE A O    4  
ATOM 6239  C CB   . ILE A 1 60  ? 0.821   -6.317  -21.551 1.00 0.00 ? 435 ILE A CB   4  
ATOM 6240  C CG1  . ILE A 1 60  ? -0.050  -6.468  -22.801 1.00 0.00 ? 435 ILE A CG1  4  
ATOM 6241  C CG2  . ILE A 1 60  ? 0.296   -7.193  -20.423 1.00 0.00 ? 435 ILE A CG2  4  
ATOM 6242  C CD1  . ILE A 1 60  ? 0.734   -6.424  -24.094 1.00 0.00 ? 435 ILE A CD1  4  
ATOM 6243  H H    . ILE A 1 60  ? -0.940  -3.977  -21.776 1.00 0.00 ? 435 ILE A H    4  
ATOM 6244  H HA   . ILE A 1 60  ? 1.342   -4.802  -20.132 1.00 0.00 ? 435 ILE A HA   4  
ATOM 6245  H HB   . ILE A 1 60  ? 1.827   -6.634  -21.781 1.00 0.00 ? 435 ILE A HB   4  
ATOM 6246  H HG12 . ILE A 1 60  ? -0.566  -7.415  -22.758 1.00 0.00 ? 435 ILE A HG12 4  
ATOM 6247  H HG13 . ILE A 1 60  ? -0.776  -5.668  -22.823 1.00 0.00 ? 435 ILE A HG13 4  
ATOM 6248  H HG21 . ILE A 1 60  ? -0.292  -6.593  -19.745 1.00 0.00 ? 435 ILE A HG21 4  
ATOM 6249  H HG22 . ILE A 1 60  ? -0.319  -7.979  -20.836 1.00 0.00 ? 435 ILE A HG22 4  
ATOM 6250  H HG23 . ILE A 1 60  ? 1.128   -7.630  -19.890 1.00 0.00 ? 435 ILE A HG23 4  
ATOM 6251  H HD11 . ILE A 1 60  ? 0.177   -5.870  -24.834 1.00 0.00 ? 435 ILE A HD11 4  
ATOM 6252  H HD12 . ILE A 1 60  ? 1.684   -5.939  -23.922 1.00 0.00 ? 435 ILE A HD12 4  
ATOM 6253  H HD13 . ILE A 1 60  ? 0.902   -7.430  -24.447 1.00 0.00 ? 435 ILE A HD13 4  
ATOM 6254  N N    . SER A 1 61  ? 1.134   -3.750  -23.252 1.00 0.00 ? 436 SER A N    4  
ATOM 6255  C CA   . SER A 1 61  ? 1.835   -2.993  -24.283 1.00 0.00 ? 436 SER A CA   4  
ATOM 6256  C C    . SER A 1 61  ? 1.134   -1.665  -24.548 1.00 0.00 ? 436 SER A C    4  
ATOM 6257  O O    . SER A 1 61  ? -0.060  -1.520  -24.285 1.00 0.00 ? 436 SER A O    4  
ATOM 6258  C CB   . SER A 1 61  ? 1.917   -3.807  -25.576 1.00 0.00 ? 436 SER A CB   4  
ATOM 6259  O OG   . SER A 1 61  ? 0.626   -4.073  -26.096 1.00 0.00 ? 436 SER A OG   4  
ATOM 6260  H H    . SER A 1 61  ? 0.215   -4.048  -23.417 1.00 0.00 ? 436 SER A H    4  
ATOM 6261  H HA   . SER A 1 61  ? 2.835   -2.794  -23.927 1.00 0.00 ? 436 SER A HA   4  
ATOM 6262  H HB2  . SER A 1 61  ? 2.480   -3.251  -26.313 1.00 0.00 ? 436 SER A HB2  4  
ATOM 6263  H HB3  . SER A 1 61  ? 2.413   -4.745  -25.377 1.00 0.00 ? 436 SER A HB3  4  
ATOM 6264  H HG   . SER A 1 61  ? 0.636   -4.912  -26.563 1.00 0.00 ? 436 SER A HG   4  
ATOM 6265  N N    . ILE A 1 62  ? 1.882   -0.697  -25.067 1.00 0.00 ? 437 ILE A N    4  
ATOM 6266  C CA   . ILE A 1 62  ? 1.328   0.617   -25.364 1.00 0.00 ? 437 ILE A CA   4  
ATOM 6267  C C    . ILE A 1 62  ? 2.141   1.328   -26.446 1.00 0.00 ? 437 ILE A C    4  
ATOM 6268  O O    . ILE A 1 62  ? 3.309   1.659   -26.244 1.00 0.00 ? 437 ILE A O    4  
ATOM 6269  C CB   . ILE A 1 62  ? 1.259   1.497   -24.096 1.00 0.00 ? 437 ILE A CB   4  
ATOM 6270  C CG1  . ILE A 1 62  ? 0.408   2.741   -24.353 1.00 0.00 ? 437 ILE A CG1  4  
ATOM 6271  C CG2  . ILE A 1 62  ? 2.655   1.889   -23.628 1.00 0.00 ? 437 ILE A CG2  4  
ATOM 6272  C CD1  . ILE A 1 62  ? -0.379  3.191   -23.142 1.00 0.00 ? 437 ILE A CD1  4  
ATOM 6273  H H    . ILE A 1 62  ? 2.828   -0.872  -25.254 1.00 0.00 ? 437 ILE A H    4  
ATOM 6274  H HA   . ILE A 1 62  ? 0.320   0.473   -25.728 1.00 0.00 ? 437 ILE A HA   4  
ATOM 6275  H HB   . ILE A 1 62  ? 0.799   0.915   -23.310 1.00 0.00 ? 437 ILE A HB   4  
ATOM 6276  H HG12 . ILE A 1 62  ? 1.051   3.555   -24.650 1.00 0.00 ? 437 ILE A HG12 4  
ATOM 6277  H HG13 . ILE A 1 62  ? -0.294  2.531   -25.147 1.00 0.00 ? 437 ILE A HG13 4  
ATOM 6278  H HG21 . ILE A 1 62  ? 3.302   1.025   -23.664 1.00 0.00 ? 437 ILE A HG21 4  
ATOM 6279  H HG22 . ILE A 1 62  ? 3.048   2.662   -24.273 1.00 0.00 ? 437 ILE A HG22 4  
ATOM 6280  H HG23 . ILE A 1 62  ? 2.604   2.259   -22.614 1.00 0.00 ? 437 ILE A HG23 4  
ATOM 6281  H HD11 . ILE A 1 62  ? -1.178  3.848   -23.455 1.00 0.00 ? 437 ILE A HD11 4  
ATOM 6282  H HD12 . ILE A 1 62  ? -0.796  2.330   -22.641 1.00 0.00 ? 437 ILE A HD12 4  
ATOM 6283  H HD13 . ILE A 1 62  ? 0.275   3.720   -22.463 1.00 0.00 ? 437 ILE A HD13 4  
ATOM 6284  N N    . ASN A 1 63  ? 1.511   1.549   -27.598 1.00 0.00 ? 438 ASN A N    4  
ATOM 6285  C CA   . ASN A 1 63  ? 2.159   2.216   -28.729 1.00 0.00 ? 438 ASN A CA   4  
ATOM 6286  C C    . ASN A 1 63  ? 3.573   1.684   -28.956 1.00 0.00 ? 438 ASN A C    4  
ATOM 6287  O O    . ASN A 1 63  ? 4.464   2.425   -29.376 1.00 0.00 ? 438 ASN A O    4  
ATOM 6288  C CB   . ASN A 1 63  ? 2.198   3.730   -28.508 1.00 0.00 ? 438 ASN A CB   4  
ATOM 6289  C CG   . ASN A 1 63  ? 3.042   4.123   -27.312 1.00 0.00 ? 438 ASN A CG   4  
ATOM 6290  O OD1  . ASN A 1 63  ? 4.269   4.034   -27.347 1.00 0.00 ? 438 ASN A OD1  4  
ATOM 6291  N ND2  . ASN A 1 63  ? 2.385   4.562   -26.247 1.00 0.00 ? 438 ASN A ND2  4  
ATOM 6292  H H    . ASN A 1 63  ? 0.580   1.255   -27.694 1.00 0.00 ? 438 ASN A H    4  
ATOM 6293  H HA   . ASN A 1 63  ? 1.570   2.010   -29.610 1.00 0.00 ? 438 ASN A HA   4  
ATOM 6294  H HB2  . ASN A 1 63  ? 2.610   4.205   -29.386 1.00 0.00 ? 438 ASN A HB2  4  
ATOM 6295  H HB3  . ASN A 1 63  ? 1.192   4.090   -28.349 1.00 0.00 ? 438 ASN A HB3  4  
ATOM 6296  H HD21 . ASN A 1 63  ? 1.407   4.609   -26.292 1.00 0.00 ? 438 ASN A HD21 4  
ATOM 6297  H HD22 . ASN A 1 63  ? 2.904   4.819   -25.456 1.00 0.00 ? 438 ASN A HD22 4  
ATOM 6298  N N    . GLY A 1 64  ? 3.772   0.399   -28.683 1.00 0.00 ? 439 GLY A N    4  
ATOM 6299  C CA   . GLY A 1 64  ? 5.077   -0.206  -28.871 1.00 0.00 ? 439 GLY A CA   4  
ATOM 6300  C C    . GLY A 1 64  ? 5.977   -0.048  -27.661 1.00 0.00 ? 439 GLY A C    4  
ATOM 6301  O O    . GLY A 1 64  ? 7.187   0.128   -27.798 1.00 0.00 ? 439 GLY A O    4  
ATOM 6302  H H    . GLY A 1 64  ? 3.024   -0.143  -28.355 1.00 0.00 ? 439 GLY A H    4  
ATOM 6303  H HA2  . GLY A 1 64  ? 4.947   -1.259  -29.073 1.00 0.00 ? 439 GLY A HA2  4  
ATOM 6304  H HA3  . GLY A 1 64  ? 5.555   0.255   -29.723 1.00 0.00 ? 439 GLY A HA3  4  
ATOM 6305  N N    . GLN A 1 65  ? 5.387   -0.115  -26.472 1.00 0.00 ? 440 GLN A N    4  
ATOM 6306  C CA   . GLN A 1 65  ? 6.146   0.019   -25.234 1.00 0.00 ? 440 GLN A CA   4  
ATOM 6307  C C    . GLN A 1 65  ? 5.669   -0.990  -24.193 1.00 0.00 ? 440 GLN A C    4  
ATOM 6308  O O    . GLN A 1 65  ? 4.534   -0.923  -23.723 1.00 0.00 ? 440 GLN A O    4  
ATOM 6309  C CB   . GLN A 1 65  ? 6.018   1.439   -24.682 1.00 0.00 ? 440 GLN A CB   4  
ATOM 6310  C CG   . GLN A 1 65  ? 6.536   2.508   -25.631 1.00 0.00 ? 440 GLN A CG   4  
ATOM 6311  C CD   . GLN A 1 65  ? 7.706   3.282   -25.057 1.00 0.00 ? 440 GLN A CD   4  
ATOM 6312  O OE1  . GLN A 1 65  ? 8.705   3.512   -25.737 1.00 0.00 ? 440 GLN A OE1  4  
ATOM 6313  N NE2  . GLN A 1 65  ? 7.588   3.687   -23.798 1.00 0.00 ? 440 GLN A NE2  4  
ATOM 6314  H H    . GLN A 1 65  ? 4.419   -0.259  -26.426 1.00 0.00 ? 440 GLN A H    4  
ATOM 6315  H HA   . GLN A 1 65  ? 7.184   -0.178  -25.458 1.00 0.00 ? 440 GLN A HA   4  
ATOM 6316  H HB2  . GLN A 1 65  ? 4.978   1.642   -24.479 1.00 0.00 ? 440 GLN A HB2  4  
ATOM 6317  H HB3  . GLN A 1 65  ? 6.575   1.507   -23.759 1.00 0.00 ? 440 GLN A HB3  4  
ATOM 6318  H HG2  . GLN A 1 65  ? 6.852   2.034   -26.548 1.00 0.00 ? 440 GLN A HG2  4  
ATOM 6319  H HG3  . GLN A 1 65  ? 5.733   3.200   -25.843 1.00 0.00 ? 440 GLN A HG3  4  
ATOM 6320  H HE21 . GLN A 1 65  ? 6.764   3.467   -23.316 1.00 0.00 ? 440 GLN A HE21 4  
ATOM 6321  H HE22 . GLN A 1 65  ? 8.330   4.189   -23.402 1.00 0.00 ? 440 GLN A HE22 4  
ATOM 6322  N N    . SER A 1 66  ? 6.545   -1.926  -23.840 1.00 0.00 ? 441 SER A N    4  
ATOM 6323  C CA   . SER A 1 66  ? 6.215   -2.952  -22.857 1.00 0.00 ? 441 SER A CA   4  
ATOM 6324  C C    . SER A 1 66  ? 6.103   -2.354  -21.458 1.00 0.00 ? 441 SER A C    4  
ATOM 6325  O O    . SER A 1 66  ? 7.088   -1.877  -20.895 1.00 0.00 ? 441 SER A O    4  
ATOM 6326  C CB   . SER A 1 66  ? 7.272   -4.057  -22.868 1.00 0.00 ? 441 SER A CB   4  
ATOM 6327  O OG   . SER A 1 66  ? 7.156   -4.864  -24.028 1.00 0.00 ? 441 SER A OG   4  
ATOM 6328  H H    . SER A 1 66  ? 7.435   -1.928  -24.251 1.00 0.00 ? 441 SER A H    4  
ATOM 6329  H HA   . SER A 1 66  ? 5.261   -3.376  -23.130 1.00 0.00 ? 441 SER A HA   4  
ATOM 6330  H HB2  . SER A 1 66  ? 8.255   -3.613  -22.853 1.00 0.00 ? 441 SER A HB2  4  
ATOM 6331  H HB3  . SER A 1 66  ? 7.146   -4.682  -21.996 1.00 0.00 ? 441 SER A HB3  4  
ATOM 6332  H HG   . SER A 1 66  ? 7.755   -5.612  -23.958 1.00 0.00 ? 441 SER A HG   4  
ATOM 6333  N N    . VAL A 1 67  ? 4.896   -2.387  -20.904 1.00 0.00 ? 442 VAL A N    4  
ATOM 6334  C CA   . VAL A 1 67  ? 4.650   -1.852  -19.569 1.00 0.00 ? 442 VAL A CA   4  
ATOM 6335  C C    . VAL A 1 67  ? 4.667   -2.965  -18.525 1.00 0.00 ? 442 VAL A C    4  
ATOM 6336  O O    . VAL A 1 67  ? 4.544   -4.143  -18.860 1.00 0.00 ? 442 VAL A O    4  
ATOM 6337  C CB   . VAL A 1 67  ? 3.297   -1.114  -19.492 1.00 0.00 ? 442 VAL A CB   4  
ATOM 6338  C CG1  . VAL A 1 67  ? 3.269   -0.172  -18.297 1.00 0.00 ? 442 VAL A CG1  4  
ATOM 6339  C CG2  . VAL A 1 67  ? 3.020   -0.355  -20.784 1.00 0.00 ? 442 VAL A CG2  4  
ATOM 6340  H H    . VAL A 1 67  ? 4.151   -2.782  -21.403 1.00 0.00 ? 442 VAL A H    4  
ATOM 6341  H HA   . VAL A 1 67  ? 5.436   -1.146  -19.343 1.00 0.00 ? 442 VAL A HA   4  
ATOM 6342  H HB   . VAL A 1 67  ? 2.517   -1.850  -19.359 1.00 0.00 ? 442 VAL A HB   4  
ATOM 6343  H HG11 . VAL A 1 67  ? 4.274   -0.022  -17.933 1.00 0.00 ? 442 VAL A HG11 4  
ATOM 6344  H HG12 . VAL A 1 67  ? 2.851   0.777   -18.595 1.00 0.00 ? 442 VAL A HG12 4  
ATOM 6345  H HG13 . VAL A 1 67  ? 2.663   -0.603  -17.514 1.00 0.00 ? 442 VAL A HG13 4  
ATOM 6346  H HG21 . VAL A 1 67  ? 2.306   0.431   -20.592 1.00 0.00 ? 442 VAL A HG21 4  
ATOM 6347  H HG22 . VAL A 1 67  ? 3.940   0.075   -21.152 1.00 0.00 ? 442 VAL A HG22 4  
ATOM 6348  H HG23 . VAL A 1 67  ? 2.620   -1.035  -21.521 1.00 0.00 ? 442 VAL A HG23 4  
ATOM 6349  N N    . VAL A 1 68  ? 4.821   -2.587  -17.259 1.00 0.00 ? 443 VAL A N    4  
ATOM 6350  C CA   . VAL A 1 68  ? 4.855   -3.560  -16.174 1.00 0.00 ? 443 VAL A CA   4  
ATOM 6351  C C    . VAL A 1 68  ? 3.969   -3.126  -15.010 1.00 0.00 ? 443 VAL A C    4  
ATOM 6352  O O    . VAL A 1 68  ? 3.209   -3.927  -14.466 1.00 0.00 ? 443 VAL A O    4  
ATOM 6353  C CB   . VAL A 1 68  ? 6.290   -3.778  -15.659 1.00 0.00 ? 443 VAL A CB   4  
ATOM 6354  C CG1  . VAL A 1 68  ? 7.126   -4.508  -16.700 1.00 0.00 ? 443 VAL A CG1  4  
ATOM 6355  C CG2  . VAL A 1 68  ? 6.932   -2.451  -15.286 1.00 0.00 ? 443 VAL A CG2  4  
ATOM 6356  H H    . VAL A 1 68  ? 4.915   -1.634  -17.051 1.00 0.00 ? 443 VAL A H    4  
ATOM 6357  H HA   . VAL A 1 68  ? 4.488   -4.500  -16.560 1.00 0.00 ? 443 VAL A HA   4  
ATOM 6358  H HB   . VAL A 1 68  ? 6.243   -4.393  -14.772 1.00 0.00 ? 443 VAL A HB   4  
ATOM 6359  H HG11 . VAL A 1 68  ? 7.058   -3.989  -17.644 1.00 0.00 ? 443 VAL A HG11 4  
ATOM 6360  H HG12 . VAL A 1 68  ? 8.156   -4.537  -16.378 1.00 0.00 ? 443 VAL A HG12 4  
ATOM 6361  H HG13 . VAL A 1 68  ? 6.756   -5.516  -16.815 1.00 0.00 ? 443 VAL A HG13 4  
ATOM 6362  H HG21 . VAL A 1 68  ? 7.970   -2.611  -15.034 1.00 0.00 ? 443 VAL A HG21 4  
ATOM 6363  H HG22 . VAL A 1 68  ? 6.865   -1.771  -16.123 1.00 0.00 ? 443 VAL A HG22 4  
ATOM 6364  H HG23 . VAL A 1 68  ? 6.417   -2.027  -14.437 1.00 0.00 ? 443 VAL A HG23 4  
ATOM 6365  N N    . SER A 1 69  ? 4.071   -1.855  -14.629 1.00 0.00 ? 444 SER A N    4  
ATOM 6366  C CA   . SER A 1 69  ? 3.276   -1.325  -13.526 1.00 0.00 ? 444 SER A CA   4  
ATOM 6367  C C    . SER A 1 69  ? 2.592   -0.019  -13.918 1.00 0.00 ? 444 SER A C    4  
ATOM 6368  O O    . SER A 1 69  ? 2.831   0.521   -14.997 1.00 0.00 ? 444 SER A O    4  
ATOM 6369  C CB   . SER A 1 69  ? 4.158   -1.101  -12.297 1.00 0.00 ? 444 SER A CB   4  
ATOM 6370  O OG   . SER A 1 69  ? 5.458   -0.677  -12.671 1.00 0.00 ? 444 SER A OG   4  
ATOM 6371  H H    . SER A 1 69  ? 4.695   -1.263  -15.099 1.00 0.00 ? 444 SER A H    4  
ATOM 6372  H HA   . SER A 1 69  ? 2.518   -2.054  -13.283 1.00 0.00 ? 444 SER A HA   4  
ATOM 6373  H HB2  . SER A 1 69  ? 3.713   -0.343  -11.670 1.00 0.00 ? 444 SER A HB2  4  
ATOM 6374  H HB3  . SER A 1 69  ? 4.240   -2.024  -11.741 1.00 0.00 ? 444 SER A HB3  4  
ATOM 6375  H HG   . SER A 1 69  ? 5.391   0.004   -13.343 1.00 0.00 ? 444 SER A HG   4  
ATOM 6376  N N    . ALA A 1 70  ? 1.739   0.483   -13.030 1.00 0.00 ? 445 ALA A N    4  
ATOM 6377  C CA   . ALA A 1 70  ? 1.017   1.725   -13.276 1.00 0.00 ? 445 ALA A CA   4  
ATOM 6378  C C    . ALA A 1 70  ? 1.982   2.893   -13.458 1.00 0.00 ? 445 ALA A C    4  
ATOM 6379  O O    . ALA A 1 70  ? 1.780   3.749   -14.320 1.00 0.00 ? 445 ALA A O    4  
ATOM 6380  C CB   . ALA A 1 70  ? 0.050   2.008   -12.136 1.00 0.00 ? 445 ALA A CB   4  
ATOM 6381  H H    . ALA A 1 70  ? 1.591   0.005   -12.187 1.00 0.00 ? 445 ALA A H    4  
ATOM 6382  H HA   . ALA A 1 70  ? 0.443   1.602   -14.183 1.00 0.00 ? 445 ALA A HA   4  
ATOM 6383  H HB1  . ALA A 1 70  ? -0.964  1.961   -12.504 1.00 0.00 ? 445 ALA A HB1  4  
ATOM 6384  H HB2  . ALA A 1 70  ? 0.185   1.270   -11.358 1.00 0.00 ? 445 ALA A HB2  4  
ATOM 6385  H HB3  . ALA A 1 70  ? 0.241   2.992   -11.734 1.00 0.00 ? 445 ALA A HB3  4  
ATOM 6386  N N    . ASN A 1 71  ? 3.029   2.922   -12.638 1.00 0.00 ? 446 ASN A N    4  
ATOM 6387  C CA   . ASN A 1 71  ? 4.026   3.986   -12.706 1.00 0.00 ? 446 ASN A CA   4  
ATOM 6388  C C    . ASN A 1 71  ? 4.589   4.122   -14.118 1.00 0.00 ? 446 ASN A C    4  
ATOM 6389  O O    . ASN A 1 71  ? 5.037   5.197   -14.516 1.00 0.00 ? 446 ASN A O    4  
ATOM 6390  C CB   . ASN A 1 71  ? 5.159   3.713   -11.716 1.00 0.00 ? 446 ASN A CB   4  
ATOM 6391  C CG   . ASN A 1 71  ? 5.819   2.368   -11.948 1.00 0.00 ? 446 ASN A CG   4  
ATOM 6392  O OD1  . ASN A 1 71  ? 5.585   1.412   -11.209 1.00 0.00 ? 446 ASN A OD1  4  
ATOM 6393  N ND2  . ASN A 1 71  ? 6.652   2.288   -12.980 1.00 0.00 ? 446 ASN A ND2  4  
ATOM 6394  H H    . ASN A 1 71  ? 3.132   2.212   -11.972 1.00 0.00 ? 446 ASN A H    4  
ATOM 6395  H HA   . ASN A 1 71  ? 3.541   4.910   -12.436 1.00 0.00 ? 446 ASN A HA   4  
ATOM 6396  H HB2  . ASN A 1 71  ? 5.910   4.482   -11.816 1.00 0.00 ? 446 ASN A HB2  4  
ATOM 6397  H HB3  . ASN A 1 71  ? 4.763   3.731   -10.712 1.00 0.00 ? 446 ASN A HB3  4  
ATOM 6398  H HD21 . ASN A 1 71  ? 6.791   3.089   -13.526 1.00 0.00 ? 446 ASN A HD21 4  
ATOM 6399  H HD22 . ASN A 1 71  ? 7.092   1.429   -13.153 1.00 0.00 ? 446 ASN A HD22 4  
ATOM 6400  N N    . ASP A 1 72  ? 4.562   3.027   -14.871 1.00 0.00 ? 447 ASP A N    4  
ATOM 6401  C CA   . ASP A 1 72  ? 5.069   3.028   -16.239 1.00 0.00 ? 447 ASP A CA   4  
ATOM 6402  C C    . ASP A 1 72  ? 3.985   3.465   -17.220 1.00 0.00 ? 447 ASP A C    4  
ATOM 6403  O O    . ASP A 1 72  ? 4.246   4.226   -18.150 1.00 0.00 ? 447 ASP A O    4  
ATOM 6404  C CB   . ASP A 1 72  ? 5.583   1.636   -16.614 1.00 0.00 ? 447 ASP A CB   4  
ATOM 6405  C CG   . ASP A 1 72  ? 7.005   1.400   -16.145 1.00 0.00 ? 447 ASP A CG   4  
ATOM 6406  O OD1  . ASP A 1 72  ? 7.866   2.268   -16.397 1.00 0.00 ? 447 ASP A OD1  4  
ATOM 6407  O OD2  . ASP A 1 72  ? 7.257   0.346   -15.524 1.00 0.00 ? 447 ASP A OD2  4  
ATOM 6408  H H    . ASP A 1 72  ? 4.192   2.199   -14.500 1.00 0.00 ? 447 ASP A H    4  
ATOM 6409  H HA   . ASP A 1 72  ? 5.887   3.729   -16.288 1.00 0.00 ? 447 ASP A HA   4  
ATOM 6410  H HB2  . ASP A 1 72  ? 4.946   0.890   -16.165 1.00 0.00 ? 447 ASP A HB2  4  
ATOM 6411  H HB3  . ASP A 1 72  ? 5.555   1.527   -17.689 1.00 0.00 ? 447 ASP A HB3  4  
ATOM 6412  N N    . VAL A 1 73  ? 2.768   2.978   -17.001 1.00 0.00 ? 448 VAL A N    4  
ATOM 6413  C CA   . VAL A 1 73  ? 1.642   3.316   -17.861 1.00 0.00 ? 448 VAL A CA   4  
ATOM 6414  C C    . VAL A 1 73  ? 1.335   4.811   -17.804 1.00 0.00 ? 448 VAL A C    4  
ATOM 6415  O O    . VAL A 1 73  ? 0.862   5.396   -18.778 1.00 0.00 ? 448 VAL A O    4  
ATOM 6416  C CB   . VAL A 1 73  ? 0.377   2.524   -17.463 1.00 0.00 ? 448 VAL A CB   4  
ATOM 6417  C CG1  . VAL A 1 73  ? -0.774  2.821   -18.413 1.00 0.00 ? 448 VAL A CG1  4  
ATOM 6418  C CG2  . VAL A 1 73  ? 0.672   1.032   -17.425 1.00 0.00 ? 448 VAL A CG2  4  
ATOM 6419  H H    . VAL A 1 73  ? 2.625   2.376   -16.241 1.00 0.00 ? 448 VAL A H    4  
ATOM 6420  H HA   . VAL A 1 73  ? 1.902   3.049   -18.875 1.00 0.00 ? 448 VAL A HA   4  
ATOM 6421  H HB   . VAL A 1 73  ? 0.084   2.834   -16.470 1.00 0.00 ? 448 VAL A HB   4  
ATOM 6422  H HG11 . VAL A 1 73  ? -0.547  3.704   -18.991 1.00 0.00 ? 448 VAL A HG11 4  
ATOM 6423  H HG12 . VAL A 1 73  ? -0.918  1.983   -19.078 1.00 0.00 ? 448 VAL A HG12 4  
ATOM 6424  H HG13 . VAL A 1 73  ? -1.677  2.986   -17.842 1.00 0.00 ? 448 VAL A HG13 4  
ATOM 6425  H HG21 . VAL A 1 73  ? 0.879   0.681   -18.425 1.00 0.00 ? 448 VAL A HG21 4  
ATOM 6426  H HG22 . VAL A 1 73  ? 1.528   0.849   -16.794 1.00 0.00 ? 448 VAL A HG22 4  
ATOM 6427  H HG23 . VAL A 1 73  ? -0.185  0.506   -17.030 1.00 0.00 ? 448 VAL A HG23 4  
ATOM 6428  N N    . SER A 1 74  ? 1.606   5.421   -16.655 1.00 0.00 ? 449 SER A N    4  
ATOM 6429  C CA   . SER A 1 74  ? 1.355   6.847   -16.467 1.00 0.00 ? 449 SER A CA   4  
ATOM 6430  C C    . SER A 1 74  ? 2.215   7.693   -17.403 1.00 0.00 ? 449 SER A C    4  
ATOM 6431  O O    . SER A 1 74  ? 1.697   8.404   -18.264 1.00 0.00 ? 449 SER A O    4  
ATOM 6432  C CB   . SER A 1 74  ? 1.623   7.244   -15.015 1.00 0.00 ? 449 SER A CB   4  
ATOM 6433  O OG   . SER A 1 74  ? 0.975   8.462   -14.689 1.00 0.00 ? 449 SER A OG   4  
ATOM 6434  H H    . SER A 1 74  ? 1.980   4.901   -15.914 1.00 0.00 ? 449 SER A H    4  
ATOM 6435  H HA   . SER A 1 74  ? 0.315   7.031   -16.692 1.00 0.00 ? 449 SER A HA   4  
ATOM 6436  H HB2  . SER A 1 74  ? 1.255   6.469   -14.359 1.00 0.00 ? 449 SER A HB2  4  
ATOM 6437  H HB3  . SER A 1 74  ? 2.687   7.364   -14.867 1.00 0.00 ? 449 SER A HB3  4  
ATOM 6438  H HG   . SER A 1 74  ? 1.088   9.087   -15.409 1.00 0.00 ? 449 SER A HG   4  
ATOM 6439  N N    . ASP A 1 75  ? 3.532   7.618   -17.224 1.00 0.00 ? 450 ASP A N    4  
ATOM 6440  C CA   . ASP A 1 75  ? 4.464   8.387   -18.047 1.00 0.00 ? 450 ASP A CA   4  
ATOM 6441  C C    . ASP A 1 75  ? 4.188   8.192   -19.536 1.00 0.00 ? 450 ASP A C    4  
ATOM 6442  O O    . ASP A 1 75  ? 4.326   9.125   -20.327 1.00 0.00 ? 450 ASP A O    4  
ATOM 6443  C CB   . ASP A 1 75  ? 5.907   7.991   -17.729 1.00 0.00 ? 450 ASP A CB   4  
ATOM 6444  C CG   . ASP A 1 75  ? 6.102   6.489   -17.689 1.00 0.00 ? 450 ASP A CG   4  
ATOM 6445  O OD1  . ASP A 1 75  ? 6.173   5.870   -18.771 1.00 0.00 ? 450 ASP A OD1  4  
ATOM 6446  O OD2  . ASP A 1 75  ? 6.186   5.930   -16.575 1.00 0.00 ? 450 ASP A OD2  4  
ATOM 6447  H H    . ASP A 1 75  ? 3.885   7.040   -16.517 1.00 0.00 ? 450 ASP A H    4  
ATOM 6448  H HA   . ASP A 1 75  ? 4.329   9.430   -17.805 1.00 0.00 ? 450 ASP A HA   4  
ATOM 6449  H HB2  . ASP A 1 75  ? 6.560   8.399   -18.485 1.00 0.00 ? 450 ASP A HB2  4  
ATOM 6450  H HB3  . ASP A 1 75  ? 6.181   8.397   -16.766 1.00 0.00 ? 450 ASP A HB3  4  
ATOM 6451  N N    . VAL A 1 76  ? 3.800   6.978   -19.913 1.00 0.00 ? 451 VAL A N    4  
ATOM 6452  C CA   . VAL A 1 76  ? 3.509   6.673   -21.308 1.00 0.00 ? 451 VAL A CA   4  
ATOM 6453  C C    . VAL A 1 76  ? 2.367   7.538   -21.833 1.00 0.00 ? 451 VAL A C    4  
ATOM 6454  O O    . VAL A 1 76  ? 2.464   8.123   -22.912 1.00 0.00 ? 451 VAL A O    4  
ATOM 6455  C CB   . VAL A 1 76  ? 3.142   5.187   -21.496 1.00 0.00 ? 451 VAL A CB   4  
ATOM 6456  C CG1  . VAL A 1 76  ? 2.954   4.862   -22.971 1.00 0.00 ? 451 VAL A CG1  4  
ATOM 6457  C CG2  . VAL A 1 76  ? 4.207   4.290   -20.877 1.00 0.00 ? 451 VAL A CG2  4  
ATOM 6458  H H    . VAL A 1 76  ? 3.709   6.273   -19.239 1.00 0.00 ? 451 VAL A H    4  
ATOM 6459  H HA   . VAL A 1 76  ? 4.398   6.879   -21.888 1.00 0.00 ? 451 VAL A HA   4  
ATOM 6460  H HB   . VAL A 1 76  ? 2.208   5.001   -20.989 1.00 0.00 ? 451 VAL A HB   4  
ATOM 6461  H HG11 . VAL A 1 76  ? 2.837   5.778   -23.531 1.00 0.00 ? 451 VAL A HG11 4  
ATOM 6462  H HG12 . VAL A 1 76  ? 3.818   4.325   -23.335 1.00 0.00 ? 451 VAL A HG12 4  
ATOM 6463  H HG13 . VAL A 1 76  ? 2.073   4.251   -23.094 1.00 0.00 ? 451 VAL A HG13 4  
ATOM 6464  H HG21 . VAL A 1 76  ? 4.756   3.788   -21.661 1.00 0.00 ? 451 VAL A HG21 4  
ATOM 6465  H HG22 . VAL A 1 76  ? 4.886   4.890   -20.291 1.00 0.00 ? 451 VAL A HG22 4  
ATOM 6466  H HG23 . VAL A 1 76  ? 3.733   3.557   -20.242 1.00 0.00 ? 451 VAL A HG23 4  
ATOM 6467  N N    . ILE A 1 77  ? 1.286   7.614   -21.064 1.00 0.00 ? 452 ILE A N    4  
ATOM 6468  C CA   . ILE A 1 77  ? 0.127   8.409   -21.454 1.00 0.00 ? 452 ILE A CA   4  
ATOM 6469  C C    . ILE A 1 77  ? 0.490   9.885   -21.575 1.00 0.00 ? 452 ILE A C    4  
ATOM 6470  O O    . ILE A 1 77  ? 0.001   10.585  -22.461 1.00 0.00 ? 452 ILE A O    4  
ATOM 6471  C CB   . ILE A 1 77  ? -1.029  8.254   -20.445 1.00 0.00 ? 452 ILE A CB   4  
ATOM 6472  C CG1  . ILE A 1 77  ? -1.327  6.774   -20.199 1.00 0.00 ? 452 ILE A CG1  4  
ATOM 6473  C CG2  . ILE A 1 77  ? -2.273  8.972   -20.947 1.00 0.00 ? 452 ILE A CG2  4  
ATOM 6474  C CD1  . ILE A 1 77  ? -1.674  6.459   -18.760 1.00 0.00 ? 452 ILE A CD1  4  
ATOM 6475  H H    . ILE A 1 77  ? 1.268   7.125   -20.215 1.00 0.00 ? 452 ILE A H    4  
ATOM 6476  H HA   . ILE A 1 77  ? -0.213  8.052   -22.416 1.00 0.00 ? 452 ILE A HA   4  
ATOM 6477  H HB   . ILE A 1 77  ? -0.729  8.714   -19.515 1.00 0.00 ? 452 ILE A HB   4  
ATOM 6478  H HG12 . ILE A 1 77  ? -2.162  6.475   -20.812 1.00 0.00 ? 452 ILE A HG12 4  
ATOM 6479  H HG13 . ILE A 1 77  ? -0.461  6.188   -20.467 1.00 0.00 ? 452 ILE A HG13 4  
ATOM 6480  H HG21 . ILE A 1 77  ? -1.992  9.706   -21.689 1.00 0.00 ? 452 ILE A HG21 4  
ATOM 6481  H HG22 . ILE A 1 77  ? -2.949  8.254   -21.389 1.00 0.00 ? 452 ILE A HG22 4  
ATOM 6482  H HG23 . ILE A 1 77  ? -2.763  9.466   -20.121 1.00 0.00 ? 452 ILE A HG23 4  
ATOM 6483  H HD11 . ILE A 1 77  ? -1.363  5.451   -18.527 1.00 0.00 ? 452 ILE A HD11 4  
ATOM 6484  H HD12 . ILE A 1 77  ? -1.165  7.152   -18.106 1.00 0.00 ? 452 ILE A HD12 4  
ATOM 6485  H HD13 . ILE A 1 77  ? -2.740  6.548   -18.618 1.00 0.00 ? 452 ILE A HD13 4  
ATOM 6486  N N    . LYS A 1 78  ? 1.355   10.351  -20.679 1.00 0.00 ? 453 LYS A N    4  
ATOM 6487  C CA   . LYS A 1 78  ? 1.786   11.745  -20.686 1.00 0.00 ? 453 LYS A CA   4  
ATOM 6488  C C    . LYS A 1 78  ? 3.003   11.944  -21.592 1.00 0.00 ? 453 LYS A C    4  
ATOM 6489  O O    . LYS A 1 78  ? 3.420   13.076  -21.840 1.00 0.00 ? 453 LYS A O    4  
ATOM 6490  C CB   . LYS A 1 78  ? 2.118   12.204  -19.265 1.00 0.00 ? 453 LYS A CB   4  
ATOM 6491  C CG   . LYS A 1 78  ? 1.078   11.796  -18.235 1.00 0.00 ? 453 LYS A CG   4  
ATOM 6492  C CD   . LYS A 1 78  ? 1.605   11.959  -16.818 1.00 0.00 ? 453 LYS A CD   4  
ATOM 6493  C CE   . LYS A 1 78  ? 2.832   11.096  -16.577 1.00 0.00 ? 453 LYS A CE   4  
ATOM 6494  N NZ   . LYS A 1 78  ? 3.148   10.970  -15.127 1.00 0.00 ? 453 LYS A NZ   4  
ATOM 6495  H H    . LYS A 1 78  ? 1.712   9.744   -19.998 1.00 0.00 ? 453 LYS A H    4  
ATOM 6496  H HA   . LYS A 1 78  ? 0.970   12.342  -21.065 1.00 0.00 ? 453 LYS A HA   4  
ATOM 6497  H HB2  . LYS A 1 78  ? 3.068   11.780  -18.975 1.00 0.00 ? 453 LYS A HB2  4  
ATOM 6498  H HB3  . LYS A 1 78  ? 2.198   13.281  -19.257 1.00 0.00 ? 453 LYS A HB3  4  
ATOM 6499  H HG2  . LYS A 1 78  ? 0.202   12.415  -18.356 1.00 0.00 ? 453 LYS A HG2  4  
ATOM 6500  H HG3  . LYS A 1 78  ? 0.815   10.760  -18.394 1.00 0.00 ? 453 LYS A HG3  4  
ATOM 6501  H HD2  . LYS A 1 78  ? 1.869   12.994  -16.660 1.00 0.00 ? 453 LYS A HD2  4  
ATOM 6502  H HD3  . LYS A 1 78  ? 0.831   11.673  -16.121 1.00 0.00 ? 453 LYS A HD3  4  
ATOM 6503  H HE2  . LYS A 1 78  ? 2.649   10.112  -16.982 1.00 0.00 ? 453 LYS A HE2  4  
ATOM 6504  H HE3  . LYS A 1 78  ? 3.675   11.541  -17.084 1.00 0.00 ? 453 LYS A HE3  4  
ATOM 6505  H HZ1  . LYS A 1 78  ? 4.130   10.651  -15.002 1.00 0.00 ? 453 LYS A HZ1  4  
ATOM 6506  H HZ2  . LYS A 1 78  ? 3.032   11.890  -14.655 1.00 0.00 ? 453 LYS A HZ2  4  
ATOM 6507  H HZ3  . LYS A 1 78  ? 2.512   10.280  -14.681 1.00 0.00 ? 453 LYS A HZ3  4  
ATOM 6508  N N    . ARG A 1 79  ? 3.569   10.844  -22.081 1.00 0.00 ? 454 ARG A N    4  
ATOM 6509  C CA   . ARG A 1 79  ? 4.735   10.909  -22.953 1.00 0.00 ? 454 ARG A CA   4  
ATOM 6510  C C    . ARG A 1 79  ? 4.326   10.778  -24.417 1.00 0.00 ? 454 ARG A C    4  
ATOM 6511  O O    . ARG A 1 79  ? 4.774   11.546  -25.268 1.00 0.00 ? 454 ARG A O    4  
ATOM 6512  C CB   . ARG A 1 79  ? 5.730   9.806   -22.587 1.00 0.00 ? 454 ARG A CB   4  
ATOM 6513  C CG   . ARG A 1 79  ? 6.941   9.743   -23.504 1.00 0.00 ? 454 ARG A CG   4  
ATOM 6514  C CD   . ARG A 1 79  ? 8.043   8.876   -22.917 1.00 0.00 ? 454 ARG A CD   4  
ATOM 6515  N NE   . ARG A 1 79  ? 9.249   8.891   -23.741 1.00 0.00 ? 454 ARG A NE   4  
ATOM 6516  C CZ   . ARG A 1 79  ? 10.151  9.870   -23.721 1.00 0.00 ? 454 ARG A CZ   4  
ATOM 6517  N NH1  . ARG A 1 79  ? 9.986   10.916  -22.921 1.00 0.00 ? 454 ARG A NH1  4  
ATOM 6518  N NH2  . ARG A 1 79  ? 11.220  9.802   -24.502 1.00 0.00 ? 454 ARG A NH2  4  
ATOM 6519  H H    . ARG A 1 79  ? 3.197   9.968   -21.850 1.00 0.00 ? 454 ARG A H    4  
ATOM 6520  H HA   . ARG A 1 79  ? 5.206   11.869  -22.807 1.00 0.00 ? 454 ARG A HA   4  
ATOM 6521  H HB2  . ARG A 1 79  ? 6.080   9.972   -21.578 1.00 0.00 ? 454 ARG A HB2  4  
ATOM 6522  H HB3  . ARG A 1 79  ? 5.225   8.852   -22.629 1.00 0.00 ? 454 ARG A HB3  4  
ATOM 6523  H HG2  . ARG A 1 79  ? 6.638   9.328   -24.454 1.00 0.00 ? 454 ARG A HG2  4  
ATOM 6524  H HG3  . ARG A 1 79  ? 7.321   10.743  -23.652 1.00 0.00 ? 454 ARG A HG3  4  
ATOM 6525  H HD2  . ARG A 1 79  ? 8.287   9.245   -21.933 1.00 0.00 ? 454 ARG A HD2  4  
ATOM 6526  H HD3  . ARG A 1 79  ? 7.682   7.861   -22.842 1.00 0.00 ? 454 ARG A HD3  4  
ATOM 6527  H HE   . ARG A 1 79  ? 9.396   8.130   -24.342 1.00 0.00 ? 454 ARG A HE   4  
ATOM 6528  H HH11 . ARG A 1 79  ? 9.182   10.974  -22.329 1.00 0.00 ? 454 ARG A HH11 4  
ATOM 6529  H HH12 . ARG A 1 79  ? 10.667  11.648  -22.909 1.00 0.00 ? 454 ARG A HH12 4  
ATOM 6530  H HH21 . ARG A 1 79  ? 11.349  9.017   -25.106 1.00 0.00 ? 454 ARG A HH21 4  
ATOM 6531  H HH22 . ARG A 1 79  ? 11.897  10.538  -24.486 1.00 0.00 ? 454 ARG A HH22 4  
ATOM 6532  N N    . GLU A 1 80  ? 3.475   9.799   -24.702 1.00 0.00 ? 455 GLU A N    4  
ATOM 6533  C CA   . GLU A 1 80  ? 3.007   9.564   -26.063 1.00 0.00 ? 455 GLU A CA   4  
ATOM 6534  C C    . GLU A 1 80  ? 1.596   10.109  -26.257 1.00 0.00 ? 455 GLU A C    4  
ATOM 6535  O O    . GLU A 1 80  ? 0.746   9.989   -25.373 1.00 0.00 ? 455 GLU A O    4  
ATOM 6536  C CB   . GLU A 1 80  ? 3.039   8.069   -26.384 1.00 0.00 ? 455 GLU A CB   4  
ATOM 6537  C CG   . GLU A 1 80  ? 4.272   7.357   -25.852 1.00 0.00 ? 455 GLU A CG   4  
ATOM 6538  C CD   . GLU A 1 80  ? 5.513   7.651   -26.672 1.00 0.00 ? 455 GLU A CD   4  
ATOM 6539  O OE1  . GLU A 1 80  ? 5.397   7.746   -27.912 1.00 0.00 ? 455 GLU A OE1  4  
ATOM 6540  O OE2  . GLU A 1 80  ? 6.602   7.785   -26.075 1.00 0.00 ? 455 GLU A OE2  4  
ATOM 6541  H H    . GLU A 1 80  ? 3.155   9.218   -23.981 1.00 0.00 ? 455 GLU A H    4  
ATOM 6542  H HA   . GLU A 1 80  ? 3.675   10.082  -26.736 1.00 0.00 ? 455 GLU A HA   4  
ATOM 6543  H HB2  . GLU A 1 80  ? 2.166   7.602   -25.953 1.00 0.00 ? 455 GLU A HB2  4  
ATOM 6544  H HB3  . GLU A 1 80  ? 3.012   7.943   -27.456 1.00 0.00 ? 455 GLU A HB3  4  
ATOM 6545  H HG2  . GLU A 1 80  ? 4.447   7.674   -24.835 1.00 0.00 ? 455 GLU A HG2  4  
ATOM 6546  H HG3  . GLU A 1 80  ? 4.092   6.293   -25.868 1.00 0.00 ? 455 GLU A HG3  4  
ATOM 6547  N N    . SER A 1 81  ? 1.352   10.705  -27.419 1.00 0.00 ? 456 SER A N    4  
ATOM 6548  C CA   . SER A 1 81  ? 0.043   11.265  -27.731 1.00 0.00 ? 456 SER A CA   4  
ATOM 6549  C C    . SER A 1 81  ? -0.885  10.191  -28.287 1.00 0.00 ? 456 SER A C    4  
ATOM 6550  O O    . SER A 1 81  ? -2.093  10.211  -28.043 1.00 0.00 ? 456 SER A O    4  
ATOM 6551  C CB   . SER A 1 81  ? 0.182   12.408  -28.738 1.00 0.00 ? 456 SER A CB   4  
ATOM 6552  O OG   . SER A 1 81  ? -1.088  12.901  -29.130 1.00 0.00 ? 456 SER A OG   4  
ATOM 6553  H H    . SER A 1 81  ? 2.070   10.767  -28.083 1.00 0.00 ? 456 SER A H    4  
ATOM 6554  H HA   . SER A 1 81  ? -0.380  11.652  -26.817 1.00 0.00 ? 456 SER A HA   4  
ATOM 6555  H HB2  . SER A 1 81  ? 0.745   13.213  -28.290 1.00 0.00 ? 456 SER A HB2  4  
ATOM 6556  H HB3  . SER A 1 81  ? 0.702   12.050  -29.615 1.00 0.00 ? 456 SER A HB3  4  
ATOM 6557  H HG   . SER A 1 81  ? -1.257  12.661  -30.044 1.00 0.00 ? 456 SER A HG   4  
ATOM 6558  N N    . THR A 1 82  ? -0.313  9.253   -29.034 1.00 0.00 ? 457 THR A N    4  
ATOM 6559  C CA   . THR A 1 82  ? -1.085  8.166   -29.623 1.00 0.00 ? 457 THR A CA   4  
ATOM 6560  C C    . THR A 1 82  ? -0.769  6.844   -28.934 1.00 0.00 ? 457 THR A C    4  
ATOM 6561  O O    . THR A 1 82  ? 0.251   6.215   -29.215 1.00 0.00 ? 457 THR A O    4  
ATOM 6562  C CB   . THR A 1 82  ? -0.795  8.057   -31.121 1.00 0.00 ? 457 THR A CB   4  
ATOM 6563  O OG1  . THR A 1 82  ? 0.576   8.300   -31.384 1.00 0.00 ? 457 THR A OG1  4  
ATOM 6564  C CG2  . THR A 1 82  ? -1.601  9.024   -31.959 1.00 0.00 ? 457 THR A CG2  4  
ATOM 6565  H H    . THR A 1 82  ? 0.654   9.291   -29.190 1.00 0.00 ? 457 THR A H    4  
ATOM 6566  H HA   . THR A 1 82  ? -2.133  8.389   -29.484 1.00 0.00 ? 457 THR A HA   4  
ATOM 6567  H HB   . THR A 1 82  ? -1.032  7.056   -31.451 1.00 0.00 ? 457 THR A HB   4  
ATOM 6568  H HG1  . THR A 1 82  ? 1.027   7.465   -31.533 1.00 0.00 ? 457 THR A HG1  4  
ATOM 6569  H HG21 . THR A 1 82  ? -2.372  9.472   -31.349 1.00 0.00 ? 457 THR A HG21 4  
ATOM 6570  H HG22 . THR A 1 82  ? -0.952  9.798   -32.342 1.00 0.00 ? 457 THR A HG22 4  
ATOM 6571  H HG23 . THR A 1 82  ? -2.056  8.495   -32.782 1.00 0.00 ? 457 THR A HG23 4  
ATOM 6572  N N    . LEU A 1 83  ? -1.646  6.431   -28.026 1.00 0.00 ? 458 LEU A N    4  
ATOM 6573  C CA   . LEU A 1 83  ? -1.455  5.188   -27.291 1.00 0.00 ? 458 LEU A CA   4  
ATOM 6574  C C    . LEU A 1 83  ? -2.189  4.032   -27.964 1.00 0.00 ? 458 LEU A C    4  
ATOM 6575  O O    . LEU A 1 83  ? -3.337  4.172   -28.386 1.00 0.00 ? 458 LEU A O    4  
ATOM 6576  C CB   . LEU A 1 83  ? -1.942  5.343   -25.849 1.00 0.00 ? 458 LEU A CB   4  
ATOM 6577  C CG   . LEU A 1 83  ? -1.642  6.699   -25.206 1.00 0.00 ? 458 LEU A CG   4  
ATOM 6578  C CD1  . LEU A 1 83  ? -2.133  6.728   -23.767 1.00 0.00 ? 458 LEU A CD1  4  
ATOM 6579  C CD2  . LEU A 1 83  ? -0.153  7.000   -25.269 1.00 0.00 ? 458 LEU A CD2  4  
ATOM 6580  H H    . LEU A 1 83  ? -2.438  6.979   -27.843 1.00 0.00 ? 458 LEU A H    4  
ATOM 6581  H HA   . LEU A 1 83  ? -0.398  4.968   -27.282 1.00 0.00 ? 458 LEU A HA   4  
ATOM 6582  H HB2  . LEU A 1 83  ? -3.011  5.188   -25.832 1.00 0.00 ? 458 LEU A HB2  4  
ATOM 6583  H HB3  . LEU A 1 83  ? -1.475  4.576   -25.250 1.00 0.00 ? 458 LEU A HB3  4  
ATOM 6584  H HG   . LEU A 1 83  ? -2.164  7.471   -25.752 1.00 0.00 ? 458 LEU A HG   4  
ATOM 6585  H HD11 . LEU A 1 83  ? -3.154  6.376   -23.728 1.00 0.00 ? 458 LEU A HD11 4  
ATOM 6586  H HD12 . LEU A 1 83  ? -1.508  6.091   -23.160 1.00 0.00 ? 458 LEU A HD12 4  
ATOM 6587  H HD13 . LEU A 1 83  ? -2.088  7.740   -23.392 1.00 0.00 ? 458 LEU A HD13 4  
ATOM 6588  H HD21 . LEU A 1 83  ? 0.142   7.545   -24.384 1.00 0.00 ? 458 LEU A HD21 4  
ATOM 6589  H HD22 . LEU A 1 83  ? 0.400   6.073   -25.323 1.00 0.00 ? 458 LEU A HD22 4  
ATOM 6590  H HD23 . LEU A 1 83  ? 0.057   7.596   -26.146 1.00 0.00 ? 458 LEU A HD23 4  
ATOM 6591  N N    . ASN A 1 84  ? -1.516  2.891   -28.057 1.00 0.00 ? 459 ASN A N    4  
ATOM 6592  C CA   . ASN A 1 84  ? -2.098  1.704   -28.672 1.00 0.00 ? 459 ASN A CA   4  
ATOM 6593  C C    . ASN A 1 84  ? -1.849  0.474   -27.807 1.00 0.00 ? 459 ASN A C    4  
ATOM 6594  O O    . ASN A 1 84  ? -0.845  -0.219  -27.970 1.00 0.00 ? 459 ASN A O    4  
ATOM 6595  C CB   . ASN A 1 84  ? -1.513  1.490   -30.069 1.00 0.00 ? 459 ASN A CB   4  
ATOM 6596  C CG   . ASN A 1 84  ? -2.214  2.323   -31.125 1.00 0.00 ? 459 ASN A CG   4  
ATOM 6597  O OD1  . ASN A 1 84  ? -2.916  1.793   -31.985 1.00 0.00 ? 459 ASN A OD1  4  
ATOM 6598  N ND2  . ASN A 1 84  ? -2.026  3.636   -31.064 1.00 0.00 ? 459 ASN A ND2  4  
ATOM 6599  H H    . ASN A 1 84  ? -0.606  2.844   -27.699 1.00 0.00 ? 459 ASN A H    4  
ATOM 6600  H HA   . ASN A 1 84  ? -3.163  1.862   -28.757 1.00 0.00 ? 459 ASN A HA   4  
ATOM 6601  H HB2  . ASN A 1 84  ? -0.467  1.760   -30.061 1.00 0.00 ? 459 ASN A HB2  4  
ATOM 6602  H HB3  . ASN A 1 84  ? -1.608  0.448   -30.337 1.00 0.00 ? 459 ASN A HB3  4  
ATOM 6603  H HD21 . ASN A 1 84  ? -1.454  3.990   -30.352 1.00 0.00 ? 459 ASN A HD21 4  
ATOM 6604  H HD22 . ASN A 1 84  ? -2.468  4.198   -31.734 1.00 0.00 ? 459 ASN A HD22 4  
ATOM 6605  N N    . MET A 1 85  ? -2.766  0.215   -26.882 1.00 0.00 ? 460 MET A N    4  
ATOM 6606  C CA   . MET A 1 85  ? -2.643  -0.929  -25.984 1.00 0.00 ? 460 MET A CA   4  
ATOM 6607  C C    . MET A 1 85  ? -3.360  -2.150  -26.549 1.00 0.00 ? 460 MET A C    4  
ATOM 6608  O O    . MET A 1 85  ? -4.039  -2.067  -27.573 1.00 0.00 ? 460 MET A O    4  
ATOM 6609  C CB   . MET A 1 85  ? -3.210  -0.585  -24.606 1.00 0.00 ? 460 MET A CB   4  
ATOM 6610  C CG   . MET A 1 85  ? -2.715  0.744   -24.057 1.00 0.00 ? 460 MET A CG   4  
ATOM 6611  S SD   . MET A 1 85  ? -4.000  1.661   -23.186 1.00 0.00 ? 460 MET A SD   4  
ATOM 6612  C CE   . MET A 1 85  ? -4.001  3.199   -24.103 1.00 0.00 ? 460 MET A CE   4  
ATOM 6613  H H    . MET A 1 85  ? -3.542  0.807   -26.797 1.00 0.00 ? 460 MET A H    4  
ATOM 6614  H HA   . MET A 1 85  ? -1.593  -1.158  -25.882 1.00 0.00 ? 460 MET A HA   4  
ATOM 6615  H HB2  . MET A 1 85  ? -4.288  -0.542  -24.673 1.00 0.00 ? 460 MET A HB2  4  
ATOM 6616  H HB3  . MET A 1 85  ? -2.933  -1.362  -23.911 1.00 0.00 ? 460 MET A HB3  4  
ATOM 6617  H HG2  . MET A 1 85  ? -1.902  0.555   -23.373 1.00 0.00 ? 460 MET A HG2  4  
ATOM 6618  H HG3  . MET A 1 85  ? -2.357  1.347   -24.879 1.00 0.00 ? 460 MET A HG3  4  
ATOM 6619  H HE1  . MET A 1 85  ? -4.557  3.946   -23.554 1.00 0.00 ? 460 MET A HE1  4  
ATOM 6620  H HE2  . MET A 1 85  ? -2.985  3.536   -24.242 1.00 0.00 ? 460 MET A HE2  4  
ATOM 6621  H HE3  . MET A 1 85  ? -4.464  3.043   -25.066 1.00 0.00 ? 460 MET A HE3  4  
ATOM 6622  N N    . VAL A 1 86  ? -3.202  -3.282  -25.872 1.00 0.00 ? 461 VAL A N    4  
ATOM 6623  C CA   . VAL A 1 86  ? -3.832  -4.525  -26.298 1.00 0.00 ? 461 VAL A CA   4  
ATOM 6624  C C    . VAL A 1 86  ? -4.473  -5.242  -25.116 1.00 0.00 ? 461 VAL A C    4  
ATOM 6625  O O    . VAL A 1 86  ? -3.966  -5.182  -23.995 1.00 0.00 ? 461 VAL A O    4  
ATOM 6626  C CB   . VAL A 1 86  ? -2.816  -5.471  -26.968 1.00 0.00 ? 461 VAL A CB   4  
ATOM 6627  C CG1  . VAL A 1 86  ? -3.529  -6.630  -27.646 1.00 0.00 ? 461 VAL A CG1  4  
ATOM 6628  C CG2  . VAL A 1 86  ? -1.955  -4.711  -27.965 1.00 0.00 ? 461 VAL A CG2  4  
ATOM 6629  H H    . VAL A 1 86  ? -2.649  -3.281  -25.063 1.00 0.00 ? 461 VAL A H    4  
ATOM 6630  H HA   . VAL A 1 86  ? -4.599  -4.282  -27.019 1.00 0.00 ? 461 VAL A HA   4  
ATOM 6631  H HB   . VAL A 1 86  ? -2.172  -5.874  -26.201 1.00 0.00 ? 461 VAL A HB   4  
ATOM 6632  H HG11 . VAL A 1 86  ? -4.233  -7.073  -26.956 1.00 0.00 ? 461 VAL A HG11 4  
ATOM 6633  H HG12 . VAL A 1 86  ? -4.057  -6.269  -28.516 1.00 0.00 ? 461 VAL A HG12 4  
ATOM 6634  H HG13 . VAL A 1 86  ? -2.804  -7.372  -27.947 1.00 0.00 ? 461 VAL A HG13 4  
ATOM 6635  H HG21 . VAL A 1 86  ? -1.457  -5.412  -28.618 1.00 0.00 ? 461 VAL A HG21 4  
ATOM 6636  H HG22 . VAL A 1 86  ? -2.579  -4.053  -28.552 1.00 0.00 ? 461 VAL A HG22 4  
ATOM 6637  H HG23 . VAL A 1 86  ? -1.218  -4.129  -27.433 1.00 0.00 ? 461 VAL A HG23 4  
ATOM 6638  N N    . VAL A 1 87  ? -5.589  -5.917  -25.368 1.00 0.00 ? 462 VAL A N    4  
ATOM 6639  C CA   . VAL A 1 87  ? -6.291  -6.641  -24.315 1.00 0.00 ? 462 VAL A CA   4  
ATOM 6640  C C    . VAL A 1 87  ? -6.825  -7.972  -24.830 1.00 0.00 ? 462 VAL A C    4  
ATOM 6641  O O    . VAL A 1 87  ? -7.088  -8.130  -26.022 1.00 0.00 ? 462 VAL A O    4  
ATOM 6642  C CB   . VAL A 1 87  ? -7.461  -5.815  -23.745 1.00 0.00 ? 462 VAL A CB   4  
ATOM 6643  C CG1  . VAL A 1 87  ? -7.968  -6.429  -22.450 1.00 0.00 ? 462 VAL A CG1  4  
ATOM 6644  C CG2  . VAL A 1 87  ? -7.040  -4.369  -23.525 1.00 0.00 ? 462 VAL A CG2  4  
ATOM 6645  H H    . VAL A 1 87  ? -5.947  -5.930  -26.280 1.00 0.00 ? 462 VAL A H    4  
ATOM 6646  H HA   . VAL A 1 87  ? -5.590  -6.831  -23.517 1.00 0.00 ? 462 VAL A HA   4  
ATOM 6647  H HB   . VAL A 1 87  ? -8.268  -5.826  -24.463 1.00 0.00 ? 462 VAL A HB   4  
ATOM 6648  H HG11 . VAL A 1 87  ? -7.173  -6.996  -21.986 1.00 0.00 ? 462 VAL A HG11 4  
ATOM 6649  H HG12 . VAL A 1 87  ? -8.288  -5.645  -21.781 1.00 0.00 ? 462 VAL A HG12 4  
ATOM 6650  H HG13 . VAL A 1 87  ? -8.799  -7.085  -22.663 1.00 0.00 ? 462 VAL A HG13 4  
ATOM 6651  H HG21 . VAL A 1 87  ? -7.630  -3.938  -22.731 1.00 0.00 ? 462 VAL A HG21 4  
ATOM 6652  H HG22 . VAL A 1 87  ? -5.995  -4.335  -23.256 1.00 0.00 ? 462 VAL A HG22 4  
ATOM 6653  H HG23 . VAL A 1 87  ? -7.195  -3.806  -24.434 1.00 0.00 ? 462 VAL A HG23 4  
ATOM 6654  N N    . ARG A 1 88  ? -6.981  -8.930  -23.923 1.00 0.00 ? 463 ARG A N    4  
ATOM 6655  C CA   . ARG A 1 88  ? -7.480  -10.250 -24.284 1.00 0.00 ? 463 ARG A CA   4  
ATOM 6656  C C    . ARG A 1 88  ? -8.952  -10.398 -23.912 1.00 0.00 ? 463 ARG A C    4  
ATOM 6657  O O    . ARG A 1 88  ? -9.322  -10.291 -22.742 1.00 0.00 ? 463 ARG A O    4  
ATOM 6658  C CB   . ARG A 1 88  ? -6.655  -11.336 -23.592 1.00 0.00 ? 463 ARG A CB   4  
ATOM 6659  C CG   . ARG A 1 88  ? -6.769  -12.700 -24.253 1.00 0.00 ? 463 ARG A CG   4  
ATOM 6660  C CD   . ARG A 1 88  ? -7.931  -13.499 -23.684 1.00 0.00 ? 463 ARG A CD   4  
ATOM 6661  N NE   . ARG A 1 88  ? -7.669  -13.954 -22.321 1.00 0.00 ? 463 ARG A NE   4  
ATOM 6662  C CZ   . ARG A 1 88  ? -8.349  -14.926 -21.720 1.00 0.00 ? 463 ARG A CZ   4  
ATOM 6663  N NH1  . ARG A 1 88  ? -9.335  -15.548 -22.358 1.00 0.00 ? 463 ARG A NH1  4  
ATOM 6664  N NH2  . ARG A 1 88  ? -8.045  -15.279 -20.479 1.00 0.00 ? 463 ARG A NH2  4  
ATOM 6665  H H    . ARG A 1 88  ? -6.752  -8.744  -22.987 1.00 0.00 ? 463 ARG A H    4  
ATOM 6666  H HA   . ARG A 1 88  ? -7.379  -10.360 -25.354 1.00 0.00 ? 463 ARG A HA   4  
ATOM 6667  H HB2  . ARG A 1 88  ? -5.616  -11.042 -23.599 1.00 0.00 ? 463 ARG A HB2  4  
ATOM 6668  H HB3  . ARG A 1 88  ? -6.987  -11.428 -22.569 1.00 0.00 ? 463 ARG A HB3  4  
ATOM 6669  H HG2  . ARG A 1 88  ? -6.925  -12.564 -25.313 1.00 0.00 ? 463 ARG A HG2  4  
ATOM 6670  H HG3  . ARG A 1 88  ? -5.853  -13.247 -24.088 1.00 0.00 ? 463 ARG A HG3  4  
ATOM 6671  H HD2  . ARG A 1 88  ? -8.813  -12.875 -23.682 1.00 0.00 ? 463 ARG A HD2  4  
ATOM 6672  H HD3  . ARG A 1 88  ? -8.103  -14.359 -24.315 1.00 0.00 ? 463 ARG A HD3  4  
ATOM 6673  H HE   . ARG A 1 88  ? -6.947  -13.510 -21.827 1.00 0.00 ? 463 ARG A HE   4  
ATOM 6674  H HH11 . ARG A 1 88  ? -9.570  -15.287 -23.293 1.00 0.00 ? 463 ARG A HH11 4  
ATOM 6675  H HH12 . ARG A 1 88  ? -9.843  -16.278 -21.901 1.00 0.00 ? 463 ARG A HH12 4  
ATOM 6676  H HH21 . ARG A 1 88  ? -7.304  -14.814 -19.995 1.00 0.00 ? 463 ARG A HH21 4  
ATOM 6677  H HH22 . ARG A 1 88  ? -8.556  -16.010 -20.027 1.00 0.00 ? 463 ARG A HH22 4  
ATOM 6678  N N    . ARG A 1 89  ? -9.786  -10.651 -24.914 1.00 0.00 ? 464 ARG A N    4  
ATOM 6679  C CA   . ARG A 1 89  ? -11.217 -10.822 -24.697 1.00 0.00 ? 464 ARG A CA   4  
ATOM 6680  C C    . ARG A 1 89  ? -11.703 -12.124 -25.324 1.00 0.00 ? 464 ARG A C    4  
ATOM 6681  O O    . ARG A 1 89  ? -11.277 -12.493 -26.420 1.00 0.00 ? 464 ARG A O    4  
ATOM 6682  C CB   . ARG A 1 89  ? -11.992 -9.640  -25.281 1.00 0.00 ? 464 ARG A CB   4  
ATOM 6683  C CG   . ARG A 1 89  ? -12.138 -8.472  -24.320 1.00 0.00 ? 464 ARG A CG   4  
ATOM 6684  C CD   . ARG A 1 89  ? -12.067 -7.141  -25.050 1.00 0.00 ? 464 ARG A CD   4  
ATOM 6685  N NE   . ARG A 1 89  ? -13.364 -6.749  -25.599 1.00 0.00 ? 464 ARG A NE   4  
ATOM 6686  C CZ   . ARG A 1 89  ? -13.530 -6.180  -26.794 1.00 0.00 ? 464 ARG A CZ   4  
ATOM 6687  N NH1  . ARG A 1 89  ? -12.485 -5.925  -27.572 1.00 0.00 ? 464 ARG A NH1  4  
ATOM 6688  N NH2  . ARG A 1 89  ? -14.748 -5.861  -27.209 1.00 0.00 ? 464 ARG A NH2  4  
ATOM 6689  H H    . ARG A 1 89  ? -9.429  -10.729 -25.824 1.00 0.00 ? 464 ARG A H    4  
ATOM 6690  H HA   . ARG A 1 89  ? -11.388 -10.863 -23.632 1.00 0.00 ? 464 ARG A HA   4  
ATOM 6691  H HB2  . ARG A 1 89  ? -11.478 -9.290  -26.162 1.00 0.00 ? 464 ARG A HB2  4  
ATOM 6692  H HB3  . ARG A 1 89  ? -12.980 -9.975  -25.560 1.00 0.00 ? 464 ARG A HB3  4  
ATOM 6693  H HG2  . ARG A 1 89  ? -13.092 -8.547  -23.820 1.00 0.00 ? 464 ARG A HG2  4  
ATOM 6694  H HG3  . ARG A 1 89  ? -11.342 -8.516  -23.591 1.00 0.00 ? 464 ARG A HG3  4  
ATOM 6695  H HD2  . ARG A 1 89  ? -11.736 -6.381  -24.357 1.00 0.00 ? 464 ARG A HD2  4  
ATOM 6696  H HD3  . ARG A 1 89  ? -11.354 -7.228  -25.855 1.00 0.00 ? 464 ARG A HD3  4  
ATOM 6697  H HE   . ARG A 1 89  ? -14.156 -6.920  -25.049 1.00 0.00 ? 464 ARG A HE   4  
ATOM 6698  H HH11 . ARG A 1 89  ? -11.562 -6.157  -27.269 1.00 0.00 ? 464 ARG A HH11 4  
ATOM 6699  H HH12 . ARG A 1 89  ? -12.622 -5.499  -28.467 1.00 0.00 ? 464 ARG A HH12 4  
ATOM 6700  H HH21 . ARG A 1 89  ? -15.540 -6.049  -26.627 1.00 0.00 ? 464 ARG A HH21 4  
ATOM 6701  H HH22 . ARG A 1 89  ? -14.876 -5.433  -28.103 1.00 0.00 ? 464 ARG A HH22 4  
ATOM 6702  N N    . GLY A 1 90  ? -12.589 -12.821 -24.622 1.00 0.00 ? 465 GLY A N    4  
ATOM 6703  C CA   . GLY A 1 90  ? -13.109 -14.078 -25.128 1.00 0.00 ? 465 GLY A CA   4  
ATOM 6704  C C    . GLY A 1 90  ? -12.067 -15.177 -25.108 1.00 0.00 ? 465 GLY A C    4  
ATOM 6705  O O    . GLY A 1 90  ? -11.783 -15.755 -24.059 1.00 0.00 ? 465 GLY A O    4  
ATOM 6706  H H    . GLY A 1 90  ? -12.890 -12.483 -23.754 1.00 0.00 ? 465 GLY A H    4  
ATOM 6707  H HA2  . GLY A 1 90  ? -13.949 -14.379 -24.523 1.00 0.00 ? 465 GLY A HA2  4  
ATOM 6708  H HA3  . GLY A 1 90  ? -13.443 -13.932 -26.145 1.00 0.00 ? 465 GLY A HA3  4  
ATOM 6709  N N    . ASN A 1 91  ? -11.491 -15.462 -26.271 1.00 0.00 ? 466 ASN A N    4  
ATOM 6710  C CA   . ASN A 1 91  ? -10.467 -16.494 -26.385 1.00 0.00 ? 466 ASN A CA   4  
ATOM 6711  C C    . ASN A 1 91  ? -9.356  -16.052 -27.334 1.00 0.00 ? 466 ASN A C    4  
ATOM 6712  O O    . ASN A 1 91  ? -8.615  -16.878 -27.867 1.00 0.00 ? 466 ASN A O    4  
ATOM 6713  C CB   . ASN A 1 91  ? -11.086 -17.803 -26.881 1.00 0.00 ? 466 ASN A CB   4  
ATOM 6714  C CG   . ASN A 1 91  ? -10.218 -19.006 -26.572 1.00 0.00 ? 466 ASN A CG   4  
ATOM 6715  O OD1  . ASN A 1 91  ? -9.692  -19.655 -27.477 1.00 0.00 ? 466 ASN A OD1  4  
ATOM 6716  N ND2  . ASN A 1 91  ? -10.063 -19.311 -25.289 1.00 0.00 ? 466 ASN A ND2  4  
ATOM 6717  H H    . ASN A 1 91  ? -11.757 -14.962 -27.070 1.00 0.00 ? 466 ASN A H    4  
ATOM 6718  H HA   . ASN A 1 91  ? -10.046 -16.654 -25.404 1.00 0.00 ? 466 ASN A HA   4  
ATOM 6719  H HB2  . ASN A 1 91  ? -12.045 -17.943 -26.405 1.00 0.00 ? 466 ASN A HB2  4  
ATOM 6720  H HB3  . ASN A 1 91  ? -11.226 -17.746 -27.951 1.00 0.00 ? 466 ASN A HB3  4  
ATOM 6721  H HD21 . ASN A 1 91  ? -10.512 -18.751 -24.623 1.00 0.00 ? 466 ASN A HD21 4  
ATOM 6722  H HD22 . ASN A 1 91  ? -9.506  -20.085 -25.062 1.00 0.00 ? 466 ASN A HD22 4  
ATOM 6723  N N    . GLU A 1 92  ? -9.251  -14.743 -27.548 1.00 0.00 ? 467 GLU A N    4  
ATOM 6724  C CA   . GLU A 1 92  ? -8.239  -14.189 -28.435 1.00 0.00 ? 467 GLU A CA   4  
ATOM 6725  C C    . GLU A 1 92  ? -7.750  -12.835 -27.930 1.00 0.00 ? 467 GLU A C    4  
ATOM 6726  O O    . GLU A 1 92  ? -8.344  -12.247 -27.028 1.00 0.00 ? 467 GLU A O    4  
ATOM 6727  C CB   . GLU A 1 92  ? -8.815  -14.043 -29.841 1.00 0.00 ? 467 GLU A CB   4  
ATOM 6728  C CG   . GLU A 1 92  ? -10.141 -13.299 -29.876 1.00 0.00 ? 467 GLU A CG   4  
ATOM 6729  C CD   . GLU A 1 92  ? -10.882 -13.492 -31.185 1.00 0.00 ? 467 GLU A CD   4  
ATOM 6730  O OE1  . GLU A 1 92  ? -10.397 -12.993 -32.221 1.00 0.00 ? 467 GLU A OE1  4  
ATOM 6731  O OE2  . GLU A 1 92  ? -11.948 -14.143 -31.172 1.00 0.00 ? 467 GLU A OE2  4  
ATOM 6732  H H    . GLU A 1 92  ? -9.872  -14.134 -27.103 1.00 0.00 ? 467 GLU A H    4  
ATOM 6733  H HA   . GLU A 1 92  ? -7.407  -14.877 -28.465 1.00 0.00 ? 467 GLU A HA   4  
ATOM 6734  H HB2  . GLU A 1 92  ? -8.108  -13.507 -30.455 1.00 0.00 ? 467 GLU A HB2  4  
ATOM 6735  H HB3  . GLU A 1 92  ? -8.969  -15.027 -30.255 1.00 0.00 ? 467 GLU A HB3  4  
ATOM 6736  H HG2  . GLU A 1 92  ? -10.763 -13.660 -29.070 1.00 0.00 ? 467 GLU A HG2  4  
ATOM 6737  H HG3  . GLU A 1 92  ? -9.951  -12.245 -29.738 1.00 0.00 ? 467 GLU A HG3  4  
ATOM 6738  N N    . ASP A 1 93  ? -6.665  -12.345 -28.521 1.00 0.00 ? 468 ASP A N    4  
ATOM 6739  C CA   . ASP A 1 93  ? -6.098  -11.058 -28.136 1.00 0.00 ? 468 ASP A CA   4  
ATOM 6740  C C    . ASP A 1 93  ? -6.481  -9.978  -29.144 1.00 0.00 ? 468 ASP A C    4  
ATOM 6741  O O    . ASP A 1 93  ? -6.432  -10.201 -30.353 1.00 0.00 ? 468 ASP A O    4  
ATOM 6742  C CB   . ASP A 1 93  ? -4.576  -11.157 -28.026 1.00 0.00 ? 468 ASP A CB   4  
ATOM 6743  C CG   . ASP A 1 93  ? -4.139  -12.176 -26.992 1.00 0.00 ? 468 ASP A CG   4  
ATOM 6744  O OD1  . ASP A 1 93  ? -4.026  -11.807 -25.805 1.00 0.00 ? 468 ASP A OD1  4  
ATOM 6745  O OD2  . ASP A 1 93  ? -3.908  -13.344 -27.370 1.00 0.00 ? 468 ASP A OD2  4  
ATOM 6746  H H    . ASP A 1 93  ? -6.237  -12.860 -29.238 1.00 0.00 ? 468 ASP A H    4  
ATOM 6747  H HA   . ASP A 1 93  ? -6.505  -10.792 -27.171 1.00 0.00 ? 468 ASP A HA   4  
ATOM 6748  H HB2  . ASP A 1 93  ? -4.170  -11.446 -28.983 1.00 0.00 ? 468 ASP A HB2  4  
ATOM 6749  H HB3  . ASP A 1 93  ? -4.177  -10.193 -27.746 1.00 0.00 ? 468 ASP A HB3  4  
ATOM 6750  N N    . ILE A 1 94  ? -6.871  -8.812  -28.638 1.00 0.00 ? 469 ILE A N    4  
ATOM 6751  C CA   . ILE A 1 94  ? -7.272  -7.704  -29.499 1.00 0.00 ? 469 ILE A CA   4  
ATOM 6752  C C    . ILE A 1 94  ? -6.512  -6.429  -29.152 1.00 0.00 ? 469 ILE A C    4  
ATOM 6753  O O    . ILE A 1 94  ? -6.229  -6.162  -27.985 1.00 0.00 ? 469 ILE A O    4  
ATOM 6754  C CB   . ILE A 1 94  ? -8.786  -7.427  -29.390 1.00 0.00 ? 469 ILE A CB   4  
ATOM 6755  C CG1  . ILE A 1 94  ? -9.578  -8.737  -29.427 1.00 0.00 ? 469 ILE A CG1  4  
ATOM 6756  C CG2  . ILE A 1 94  ? -9.236  -6.499  -30.508 1.00 0.00 ? 469 ILE A CG2  4  
ATOM 6757  C CD1  . ILE A 1 94  ? -10.715 -8.783  -28.431 1.00 0.00 ? 469 ILE A CD1  4  
ATOM 6758  H H    . ILE A 1 94  ? -6.896  -8.696  -27.666 1.00 0.00 ? 469 ILE A H    4  
ATOM 6759  H HA   . ILE A 1 94  ? -7.051  -7.978  -30.520 1.00 0.00 ? 469 ILE A HA   4  
ATOM 6760  H HB   . ILE A 1 94  ? -8.970  -6.931  -28.450 1.00 0.00 ? 469 ILE A HB   4  
ATOM 6761  H HG12 . ILE A 1 94  ? -9.998  -8.869  -30.413 1.00 0.00 ? 469 ILE A HG12 4  
ATOM 6762  H HG13 . ILE A 1 94  ? -8.914  -9.559  -29.211 1.00 0.00 ? 469 ILE A HG13 4  
ATOM 6763  H HG21 . ILE A 1 94  ? -8.449  -5.795  -30.732 1.00 0.00 ? 469 ILE A HG21 4  
ATOM 6764  H HG22 . ILE A 1 94  ? -9.460  -7.081  -31.390 1.00 0.00 ? 469 ILE A HG22 4  
ATOM 6765  H HG23 . ILE A 1 94  ? -10.120 -5.962  -30.196 1.00 0.00 ? 469 ILE A HG23 4  
ATOM 6766  H HD11 . ILE A 1 94  ? -10.914 -9.810  -28.160 1.00 0.00 ? 469 ILE A HD11 4  
ATOM 6767  H HD12 . ILE A 1 94  ? -10.441 -8.225  -27.547 1.00 0.00 ? 469 ILE A HD12 4  
ATOM 6768  H HD13 . ILE A 1 94  ? -11.598 -8.347  -28.871 1.00 0.00 ? 469 ILE A HD13 4  
ATOM 6769  N N    . MET A 1 95  ? -6.191  -5.643  -30.174 1.00 0.00 ? 470 MET A N    4  
ATOM 6770  C CA   . MET A 1 95  ? -5.470  -4.390  -29.979 1.00 0.00 ? 470 MET A CA   4  
ATOM 6771  C C    . MET A 1 95  ? -6.443  -3.233  -29.782 1.00 0.00 ? 470 MET A C    4  
ATOM 6772  O O    . MET A 1 95  ? -7.263  -2.943  -30.654 1.00 0.00 ? 470 MET A O    4  
ATOM 6773  C CB   . MET A 1 95  ? -4.562  -4.107  -31.177 1.00 0.00 ? 470 MET A CB   4  
ATOM 6774  C CG   . MET A 1 95  ? -3.204  -4.785  -31.083 1.00 0.00 ? 470 MET A CG   4  
ATOM 6775  S SD   . MET A 1 95  ? -2.969  -6.054  -32.343 1.00 0.00 ? 470 MET A SD   4  
ATOM 6776  C CE   . MET A 1 95  ? -2.045  -7.280  -31.421 1.00 0.00 ? 470 MET A CE   4  
ATOM 6777  H H    . MET A 1 95  ? -6.450  -5.908  -31.081 1.00 0.00 ? 470 MET A H    4  
ATOM 6778  H HA   . MET A 1 95  ? -4.864  -4.492  -29.092 1.00 0.00 ? 470 MET A HA   4  
ATOM 6779  H HB2  . MET A 1 95  ? -5.053  -4.450  -32.075 1.00 0.00 ? 470 MET A HB2  4  
ATOM 6780  H HB3  . MET A 1 95  ? -4.403  -3.042  -31.248 1.00 0.00 ? 470 MET A HB3  4  
ATOM 6781  H HG2  . MET A 1 95  ? -2.435  -4.036  -31.200 1.00 0.00 ? 470 MET A HG2  4  
ATOM 6782  H HG3  . MET A 1 95  ? -3.112  -5.243  -30.110 1.00 0.00 ? 470 MET A HG3  4  
ATOM 6783  H HE1  . MET A 1 95  ? -1.080  -7.427  -31.884 1.00 0.00 ? 470 MET A HE1  4  
ATOM 6784  H HE2  . MET A 1 95  ? -1.908  -6.939  -30.405 1.00 0.00 ? 470 MET A HE2  4  
ATOM 6785  H HE3  . MET A 1 95  ? -2.588  -8.213  -31.417 1.00 0.00 ? 470 MET A HE3  4  
ATOM 6786  N N    . ILE A 1 96  ? -6.350  -2.577  -28.630 1.00 0.00 ? 471 ILE A N    4  
ATOM 6787  C CA   . ILE A 1 96  ? -7.225  -1.454  -28.322 1.00 0.00 ? 471 ILE A CA   4  
ATOM 6788  C C    . ILE A 1 96  ? -6.495  -0.125  -28.486 1.00 0.00 ? 471 ILE A C    4  
ATOM 6789  O O    . ILE A 1 96  ? -5.395  0.060   -27.964 1.00 0.00 ? 471 ILE A O    4  
ATOM 6790  C CB   . ILE A 1 96  ? -7.780  -1.547  -26.888 1.00 0.00 ? 471 ILE A CB   4  
ATOM 6791  C CG1  . ILE A 1 96  ? -8.297  -2.960  -26.608 1.00 0.00 ? 471 ILE A CG1  4  
ATOM 6792  C CG2  . ILE A 1 96  ? -8.886  -0.523  -26.681 1.00 0.00 ? 471 ILE A CG2  4  
ATOM 6793  C CD1  . ILE A 1 96  ? -9.455  -3.367  -27.492 1.00 0.00 ? 471 ILE A CD1  4  
ATOM 6794  H H    . ILE A 1 96  ? -5.678  -2.855  -27.974 1.00 0.00 ? 471 ILE A H    4  
ATOM 6795  H HA   . ILE A 1 96  ? -8.058  -1.482  -29.009 1.00 0.00 ? 471 ILE A HA   4  
ATOM 6796  H HB   . ILE A 1 96  ? -6.980  -1.320  -26.200 1.00 0.00 ? 471 ILE A HB   4  
ATOM 6797  H HG12 . ILE A 1 96  ? -7.497  -3.668  -26.764 1.00 0.00 ? 471 ILE A HG12 4  
ATOM 6798  H HG13 . ILE A 1 96  ? -8.627  -3.019  -25.580 1.00 0.00 ? 471 ILE A HG13 4  
ATOM 6799  H HG21 . ILE A 1 96  ? -9.294  -0.236  -27.639 1.00 0.00 ? 471 ILE A HG21 4  
ATOM 6800  H HG22 . ILE A 1 96  ? -9.667  -0.954  -26.072 1.00 0.00 ? 471 ILE A HG22 4  
ATOM 6801  H HG23 . ILE A 1 96  ? -8.482  0.347   -26.186 1.00 0.00 ? 471 ILE A HG23 4  
ATOM 6802  H HD11 . ILE A 1 96  ? -9.916  -4.259  -27.095 1.00 0.00 ? 471 ILE A HD11 4  
ATOM 6803  H HD12 . ILE A 1 96  ? -10.182 -2.568  -27.525 1.00 0.00 ? 471 ILE A HD12 4  
ATOM 6804  H HD13 . ILE A 1 96  ? -9.093  -3.564  -28.491 1.00 0.00 ? 471 ILE A HD13 4  
ATOM 6805  N N    . THR A 1 97  ? -7.113  0.796   -29.217 1.00 0.00 ? 472 THR A N    4  
ATOM 6806  C CA   . THR A 1 97  ? -6.523  2.108   -29.453 1.00 0.00 ? 472 THR A CA   4  
ATOM 6807  C C    . THR A 1 97  ? -7.177  3.168   -28.573 1.00 0.00 ? 472 THR A C    4  
ATOM 6808  O O    . THR A 1 97  ? -8.402  3.287   -28.532 1.00 0.00 ? 472 THR A O    4  
ATOM 6809  C CB   . THR A 1 97  ? -6.662  2.495   -30.926 1.00 0.00 ? 472 THR A CB   4  
ATOM 6810  O OG1  . THR A 1 97  ? -6.690  1.342   -31.747 1.00 0.00 ? 472 THR A OG1  4  
ATOM 6811  C CG2  . THR A 1 97  ? -5.541  3.383   -31.420 1.00 0.00 ? 472 THR A CG2  4  
ATOM 6812  H H    . THR A 1 97  ? -7.988  0.589   -29.608 1.00 0.00 ? 472 THR A H    4  
ATOM 6813  H HA   . THR A 1 97  ? -5.474  2.048   -29.205 1.00 0.00 ? 472 THR A HA   4  
ATOM 6814  H HB   . THR A 1 97  ? -7.592  3.030   -31.060 1.00 0.00 ? 472 THR A HB   4  
ATOM 6815  H HG1  . THR A 1 97  ? -7.236  1.510   -32.518 1.00 0.00 ? 472 THR A HG1  4  
ATOM 6816  H HG21 . THR A 1 97  ? -4.619  3.102   -30.933 1.00 0.00 ? 472 THR A HG21 4  
ATOM 6817  H HG22 . THR A 1 97  ? -5.433  3.268   -32.488 1.00 0.00 ? 472 THR A HG22 4  
ATOM 6818  H HG23 . THR A 1 97  ? -5.770  4.414   -31.190 1.00 0.00 ? 472 THR A HG23 4  
ATOM 6819  N N    . VAL A 1 98  ? -6.351  3.937   -27.871 1.00 0.00 ? 473 VAL A N    4  
ATOM 6820  C CA   . VAL A 1 98  ? -6.846  4.990   -26.993 1.00 0.00 ? 473 VAL A CA   4  
ATOM 6821  C C    . VAL A 1 98  ? -5.965  6.231   -27.081 1.00 0.00 ? 473 VAL A C    4  
ATOM 6822  O O    . VAL A 1 98  ? -4.771  6.179   -26.787 1.00 0.00 ? 473 VAL A O    4  
ATOM 6823  C CB   . VAL A 1 98  ? -6.906  4.520   -25.528 1.00 0.00 ? 473 VAL A CB   4  
ATOM 6824  C CG1  . VAL A 1 98  ? -7.633  5.541   -24.668 1.00 0.00 ? 473 VAL A CG1  4  
ATOM 6825  C CG2  . VAL A 1 98  ? -7.574  3.157   -25.430 1.00 0.00 ? 473 VAL A CG2  4  
ATOM 6826  H H    . VAL A 1 98  ? -5.384  3.793   -27.948 1.00 0.00 ? 473 VAL A H    4  
ATOM 6827  H HA   . VAL A 1 98  ? -7.847  5.246   -27.310 1.00 0.00 ? 473 VAL A HA   4  
ATOM 6828  H HB   . VAL A 1 98  ? -5.895  4.429   -25.159 1.00 0.00 ? 473 VAL A HB   4  
ATOM 6829  H HG11 . VAL A 1 98  ? -8.627  5.699   -25.061 1.00 0.00 ? 473 VAL A HG11 4  
ATOM 6830  H HG12 . VAL A 1 98  ? -7.702  5.175   -23.654 1.00 0.00 ? 473 VAL A HG12 4  
ATOM 6831  H HG13 . VAL A 1 98  ? -7.089  6.474   -24.678 1.00 0.00 ? 473 VAL A HG13 4  
ATOM 6832  H HG21 . VAL A 1 98  ? -8.099  3.079   -24.490 1.00 0.00 ? 473 VAL A HG21 4  
ATOM 6833  H HG22 . VAL A 1 98  ? -8.275  3.039   -26.244 1.00 0.00 ? 473 VAL A HG22 4  
ATOM 6834  H HG23 . VAL A 1 98  ? -6.822  2.382   -25.489 1.00 0.00 ? 473 VAL A HG23 4  
ATOM 6835  N N    . ILE A 1 99  ? -6.561  7.347   -27.490 1.00 0.00 ? 474 ILE A N    4  
ATOM 6836  C CA   . ILE A 1 99  ? -5.826  8.599   -27.617 1.00 0.00 ? 474 ILE A CA   4  
ATOM 6837  C C    . ILE A 1 99  ? -6.222  9.585   -26.519 1.00 0.00 ? 474 ILE A C    4  
ATOM 6838  O O    . ILE A 1 99  ? -7.335  10.111  -26.522 1.00 0.00 ? 474 ILE A O    4  
ATOM 6839  C CB   . ILE A 1 99  ? -6.071  9.256   -28.989 1.00 0.00 ? 474 ILE A CB   4  
ATOM 6840  C CG1  . ILE A 1 99  ? -5.935  8.222   -30.109 1.00 0.00 ? 474 ILE A CG1  4  
ATOM 6841  C CG2  . ILE A 1 99  ? -5.102  10.409  -29.206 1.00 0.00 ? 474 ILE A CG2  4  
ATOM 6842  C CD1  . ILE A 1 99  ? -4.547  7.630   -30.220 1.00 0.00 ? 474 ILE A CD1  4  
ATOM 6843  H H    . ILE A 1 99  ? -7.515  7.327   -27.711 1.00 0.00 ? 474 ILE A H    4  
ATOM 6844  H HA   . ILE A 1 99  ? -4.773  8.379   -27.531 1.00 0.00 ? 474 ILE A HA   4  
ATOM 6845  H HB   . ILE A 1 99  ? -7.074  9.656   -28.998 1.00 0.00 ? 474 ILE A HB   4  
ATOM 6846  H HG12 . ILE A 1 99  ? -6.626  7.412   -29.927 1.00 0.00 ? 474 ILE A HG12 4  
ATOM 6847  H HG13 . ILE A 1 99  ? -6.175  8.689   -31.053 1.00 0.00 ? 474 ILE A HG13 4  
ATOM 6848  H HG21 . ILE A 1 99  ? -4.940  10.924  -28.272 1.00 0.00 ? 474 ILE A HG21 4  
ATOM 6849  H HG22 . ILE A 1 99  ? -4.162  10.024  -29.574 1.00 0.00 ? 474 ILE A HG22 4  
ATOM 6850  H HG23 . ILE A 1 99  ? -5.516  11.096  -29.929 1.00 0.00 ? 474 ILE A HG23 4  
ATOM 6851  H HD11 . ILE A 1 99  ? -3.846  8.405   -30.491 1.00 0.00 ? 474 ILE A HD11 4  
ATOM 6852  H HD12 . ILE A 1 99  ? -4.261  7.201   -29.272 1.00 0.00 ? 474 ILE A HD12 4  
ATOM 6853  H HD13 . ILE A 1 99  ? -4.543  6.861   -30.980 1.00 0.00 ? 474 ILE A HD13 4  
ATOM 6854  N N    . PRO A 1 100 ? -5.316  9.853   -25.560 1.00 0.00 ? 475 PRO A N    4  
ATOM 6855  C CA   . PRO A 1 100 ? -5.588  10.782  -24.459 1.00 0.00 ? 475 PRO A CA   4  
ATOM 6856  C C    . PRO A 1 100 ? -6.106  12.129  -24.952 1.00 0.00 ? 475 PRO A C    4  
ATOM 6857  O O    . PRO A 1 100 ? -5.532  12.732  -25.859 1.00 0.00 ? 475 PRO A O    4  
ATOM 6858  C CB   . PRO A 1 100 ? -4.223  10.947  -23.788 1.00 0.00 ? 475 PRO A CB   4  
ATOM 6859  C CG   . PRO A 1 100 ? -3.486  9.695   -24.112 1.00 0.00 ? 475 PRO A CG   4  
ATOM 6860  C CD   . PRO A 1 100 ? -3.962  9.272   -25.473 1.00 0.00 ? 475 PRO A CD   4  
ATOM 6861  H HA   . PRO A 1 100 ? -6.290  10.363  -23.754 1.00 0.00 ? 475 PRO A HA   4  
ATOM 6862  H HB2  . PRO A 1 100 ? -3.724  11.817  -24.191 1.00 0.00 ? 475 PRO A HB2  4  
ATOM 6863  H HB3  . PRO A 1 100 ? -4.355  11.063  -22.723 1.00 0.00 ? 475 PRO A HB3  4  
ATOM 6864  H HG2  . PRO A 1 100 ? -2.423  9.889   -24.129 1.00 0.00 ? 475 PRO A HG2  4  
ATOM 6865  H HG3  . PRO A 1 100 ? -3.716  8.934   -23.382 1.00 0.00 ? 475 PRO A HG3  4  
ATOM 6866  H HD2  . PRO A 1 100 ? -3.319  9.676   -26.241 1.00 0.00 ? 475 PRO A HD2  4  
ATOM 6867  H HD3  . PRO A 1 100 ? -4.001  8.195   -25.541 1.00 0.00 ? 475 PRO A HD3  4  
ATOM 6868  N N    . GLU A 1 101 ? -7.194  12.595  -24.349 1.00 0.00 ? 476 GLU A N    4  
ATOM 6869  C CA   . GLU A 1 101 ? -7.791  13.871  -24.727 1.00 0.00 ? 476 GLU A CA   4  
ATOM 6870  C C    . GLU A 1 101 ? -7.308  14.992  -23.812 1.00 0.00 ? 476 GLU A C    4  
ATOM 6871  O O    . GLU A 1 101 ? -6.660  14.742  -22.796 1.00 0.00 ? 476 GLU A O    4  
ATOM 6872  C CB   . GLU A 1 101 ? -9.317  13.781  -24.678 1.00 0.00 ? 476 GLU A CB   4  
ATOM 6873  C CG   . GLU A 1 101 ? -9.848  13.130  -23.411 1.00 0.00 ? 476 GLU A CG   4  
ATOM 6874  C CD   . GLU A 1 101 ? -11.085 13.823  -22.874 1.00 0.00 ? 476 GLU A CD   4  
ATOM 6875  O OE1  . GLU A 1 101 ? -11.098 15.072  -22.840 1.00 0.00 ? 476 GLU A OE1  4  
ATOM 6876  O OE2  . GLU A 1 101 ? -12.041 13.118  -22.486 1.00 0.00 ? 476 GLU A OE2  4  
ATOM 6877  H H    . GLU A 1 101 ? -7.607  12.068  -23.633 1.00 0.00 ? 476 GLU A H    4  
ATOM 6878  H HA   . GLU A 1 101 ? -7.486  14.092  -25.739 1.00 0.00 ? 476 GLU A HA   4  
ATOM 6879  H HB2  . GLU A 1 101 ? -9.728  14.777  -24.743 1.00 0.00 ? 476 GLU A HB2  4  
ATOM 6880  H HB3  . GLU A 1 101 ? -9.660  13.203  -25.524 1.00 0.00 ? 476 GLU A HB3  4  
ATOM 6881  H HG2  . GLU A 1 101 ? -10.096 12.101  -23.626 1.00 0.00 ? 476 GLU A HG2  4  
ATOM 6882  H HG3  . GLU A 1 101 ? -9.078  13.162  -22.655 1.00 0.00 ? 476 GLU A HG3  4  
ATOM 6883  N N    . GLU A 1 102 ? -7.631  16.229  -24.178 1.00 0.00 ? 477 GLU A N    4  
ATOM 6884  C CA   . GLU A 1 102 ? -7.231  17.389  -23.391 1.00 0.00 ? 477 GLU A CA   4  
ATOM 6885  C C    . GLU A 1 102 ? -8.426  17.982  -22.653 1.00 0.00 ? 477 GLU A C    4  
ATOM 6886  O O    . GLU A 1 102 ? -9.474  18.233  -23.248 1.00 0.00 ? 477 GLU A O    4  
ATOM 6887  C CB   . GLU A 1 102 ? -6.594  18.448  -24.291 1.00 0.00 ? 477 GLU A CB   4  
ATOM 6888  C CG   . GLU A 1 102 ? -7.366  18.696  -25.577 1.00 0.00 ? 477 GLU A CG   4  
ATOM 6889  C CD   . GLU A 1 102 ? -7.440  20.167  -25.937 1.00 0.00 ? 477 GLU A CD   4  
ATOM 6890  O OE1  . GLU A 1 102 ? -7.888  20.965  -25.086 1.00 0.00 ? 477 GLU A OE1  4  
ATOM 6891  O OE2  . GLU A 1 102 ? -7.049  20.522  -27.068 1.00 0.00 ? 477 GLU A OE2  4  
ATOM 6892  H H    . GLU A 1 102 ? -8.150  16.364  -24.999 1.00 0.00 ? 477 GLU A H    4  
ATOM 6893  H HA   . GLU A 1 102 ? -6.501  17.060  -22.665 1.00 0.00 ? 477 GLU A HA   4  
ATOM 6894  H HB2  . GLU A 1 102 ? -6.537  19.379  -23.746 1.00 0.00 ? 477 GLU A HB2  4  
ATOM 6895  H HB3  . GLU A 1 102 ? -5.596  18.130  -24.551 1.00 0.00 ? 477 GLU A HB3  4  
ATOM 6896  H HG2  . GLU A 1 102 ? -6.876  18.170  -26.383 1.00 0.00 ? 477 GLU A HG2  4  
ATOM 6897  H HG3  . GLU A 1 102 ? -8.371  18.318  -25.458 1.00 0.00 ? 477 GLU A HG3  4  
ATOM 6898  N N    . ILE A 1 103 ? -8.262  18.203  -21.351 1.00 0.00 ? 478 ILE A N    4  
ATOM 6899  C CA   . ILE A 1 103 ? -9.330  18.766  -20.533 1.00 0.00 ? 478 ILE A CA   4  
ATOM 6900  C C    . ILE A 1 103 ? -8.775  19.758  -19.514 1.00 0.00 ? 478 ILE A C    4  
ATOM 6901  O O    . ILE A 1 103 ? -7.623  19.654  -19.095 1.00 0.00 ? 478 ILE A O    4  
ATOM 6902  C CB   . ILE A 1 103 ? -10.110 17.660  -19.793 1.00 0.00 ? 478 ILE A CB   4  
ATOM 6903  C CG1  . ILE A 1 103 ? -11.289 18.260  -19.025 1.00 0.00 ? 478 ILE A CG1  4  
ATOM 6904  C CG2  . ILE A 1 103 ? -9.190  16.896  -18.852 1.00 0.00 ? 478 ILE A CG2  4  
ATOM 6905  C CD1  . ILE A 1 103 ? -12.256 17.223  -18.497 1.00 0.00 ? 478 ILE A CD1  4  
ATOM 6906  H H    . ILE A 1 103 ? -7.405  17.982  -20.934 1.00 0.00 ? 478 ILE A H    4  
ATOM 6907  H HA   . ILE A 1 103 ? -10.014 19.283  -21.188 1.00 0.00 ? 478 ILE A HA   4  
ATOM 6908  H HB   . ILE A 1 103 ? -10.486 16.965  -20.528 1.00 0.00 ? 478 ILE A HB   4  
ATOM 6909  H HG12 . ILE A 1 103 ? -10.915 18.821  -18.182 1.00 0.00 ? 478 ILE A HG12 4  
ATOM 6910  H HG13 . ILE A 1 103 ? -11.837 18.922  -19.678 1.00 0.00 ? 478 ILE A HG13 4  
ATOM 6911  H HG21 . ILE A 1 103 ? -8.303  16.588  -19.386 1.00 0.00 ? 478 ILE A HG21 4  
ATOM 6912  H HG22 . ILE A 1 103 ? -8.909  17.533  -18.027 1.00 0.00 ? 478 ILE A HG22 4  
ATOM 6913  H HG23 . ILE A 1 103 ? -9.704  16.024  -18.474 1.00 0.00 ? 478 ILE A HG23 4  
ATOM 6914  H HD11 . ILE A 1 103 ? -13.255 17.457  -18.833 1.00 0.00 ? 478 ILE A HD11 4  
ATOM 6915  H HD12 . ILE A 1 103 ? -11.973 16.247  -18.864 1.00 0.00 ? 478 ILE A HD12 4  
ATOM 6916  H HD13 . ILE A 1 103 ? -12.230 17.222  -17.417 1.00 0.00 ? 478 ILE A HD13 4  
ATOM 6917  N N    . ASP A 1 104 ? -9.605  20.718  -19.118 1.00 0.00 ? 479 ASP A N    4  
ATOM 6918  C CA   . ASP A 1 104 ? -9.200  21.727  -18.149 1.00 0.00 ? 479 ASP A CA   4  
ATOM 6919  C C    . ASP A 1 104 ? -10.386 22.162  -17.289 1.00 0.00 ? 479 ASP A C    4  
ATOM 6920  O O    . ASP A 1 104 ? -11.375 22.682  -17.806 1.00 0.00 ? 479 ASP A O    4  
ATOM 6921  C CB   . ASP A 1 104 ? -8.605  22.941  -18.866 1.00 0.00 ? 479 ASP A CB   4  
ATOM 6922  C CG   . ASP A 1 104 ? -7.135  22.759  -19.189 1.00 0.00 ? 479 ASP A CG   4  
ATOM 6923  O OD1  . ASP A 1 104 ? -6.306  22.852  -18.260 1.00 0.00 ? 479 ASP A OD1  4  
ATOM 6924  O OD2  . ASP A 1 104 ? -6.813  22.522  -20.373 1.00 0.00 ? 479 ASP A OD2  4  
ATOM 6925  H H    . ASP A 1 104 ? -10.513 20.747  -19.488 1.00 0.00 ? 479 ASP A H    4  
ATOM 6926  H HA   . ASP A 1 104 ? -8.445  21.290  -17.514 1.00 0.00 ? 479 ASP A HA   4  
ATOM 6927  H HB2  . ASP A 1 104 ? -9.140  23.104  -19.788 1.00 0.00 ? 479 ASP A HB2  4  
ATOM 6928  H HB3  . ASP A 1 104 ? -8.710  23.811  -18.234 1.00 0.00 ? 479 ASP A HB3  4  
ATOM 6929  N N    . PRO A 1 105 ? -10.307 21.959  -15.961 1.00 0.00 ? 480 PRO A N    4  
ATOM 6930  C CA   . PRO A 1 105 ? -11.385 22.338  -15.041 1.00 0.00 ? 480 PRO A CA   4  
ATOM 6931  C C    . PRO A 1 105 ? -11.524 23.850  -14.904 1.00 0.00 ? 480 PRO A C    4  
ATOM 6932  O O    . PRO A 1 105 ? -10.586 24.484  -14.377 1.00 0.00 ? 480 PRO A O    4  
ATOM 6933  C CB   . PRO A 1 105 ? -10.954 21.718  -13.711 1.00 0.00 ? 480 PRO A CB   4  
ATOM 6934  C CG   . PRO A 1 105 ? -9.472  21.614  -13.804 1.00 0.00 ? 480 PRO A CG   4  
ATOM 6935  C CD   . PRO A 1 105 ? -9.166  21.348  -15.252 1.00 0.00 ? 480 PRO A CD   4  
ATOM 6936  O OXT  . PRO A 1 105 ? -12.570 24.387  -15.325 1.00 0.00 ? 480 PRO A OXT  4  
ATOM 6937  H HA   . PRO A 1 105 ? -12.332 21.918  -15.349 1.00 0.00 ? 480 PRO A HA   4  
ATOM 6938  H HB2  . PRO A 1 105 ? -11.257 22.361  -12.897 1.00 0.00 ? 480 PRO A HB2  4  
ATOM 6939  H HB3  . PRO A 1 105 ? -11.411 20.746  -13.599 1.00 0.00 ? 480 PRO A HB3  4  
ATOM 6940  H HG2  . PRO A 1 105 ? -9.019  22.544  -13.490 1.00 0.00 ? 480 PRO A HG2  4  
ATOM 6941  H HG3  . PRO A 1 105 ? -9.121  20.799  -13.190 1.00 0.00 ? 480 PRO A HG3  4  
ATOM 6942  H HD2  . PRO A 1 105 ? -8.238  21.820  -15.534 1.00 0.00 ? 480 PRO A HD2  4  
ATOM 6943  H HD3  . PRO A 1 105 ? -9.123  20.284  -15.438 1.00 0.00 ? 480 PRO A HD3  4  
ATOM 6944  N N    . ASP B 2 1   ? 0.931   -2.752  -2.442  1.00 0.00 ? 1   ASP B N    4  
ATOM 6945  C CA   . ASP B 2 1   ? 0.682   -1.287  -2.408  1.00 0.00 ? 1   ASP B CA   4  
ATOM 6946  C C    . ASP B 2 1   ? -0.729  -0.955  -2.881  1.00 0.00 ? 1   ASP B C    4  
ATOM 6947  O O    . ASP B 2 1   ? -1.430  -0.155  -2.261  1.00 0.00 ? 1   ASP B O    4  
ATOM 6948  C CB   . ASP B 2 1   ? 1.715   -0.591  -3.299  1.00 0.00 ? 1   ASP B CB   4  
ATOM 6949  C CG   . ASP B 2 1   ? 1.686   -1.097  -4.729  1.00 0.00 ? 1   ASP B CG   4  
ATOM 6950  O OD1  . ASP B 2 1   ? 1.997   -2.287  -4.944  1.00 0.00 ? 1   ASP B OD1  4  
ATOM 6951  O OD2  . ASP B 2 1   ? 1.351   -0.303  -5.633  1.00 0.00 ? 1   ASP B OD2  4  
ATOM 6952  H H1   . ASP B 2 1   ? 1.836   -2.931  -1.963  1.00 0.00 ? 1   ASP B H1   4  
ATOM 6953  H H2   . ASP B 2 1   ? 0.967   -3.046  -3.439  1.00 0.00 ? 1   ASP B H2   4  
ATOM 6954  H H3   . ASP B 2 1   ? 0.147   -3.219  -1.942  1.00 0.00 ? 1   ASP B H3   4  
ATOM 6955  H HA   . ASP B 2 1   ? 0.801   -0.943  -1.392  1.00 0.00 ? 1   ASP B HA   4  
ATOM 6956  H HB2  . ASP B 2 1   ? 1.515   0.470   -3.310  1.00 0.00 ? 1   ASP B HB2  4  
ATOM 6957  H HB3  . ASP B 2 1   ? 2.702   -0.762  -2.896  1.00 0.00 ? 1   ASP B HB3  4  
ATOM 6958  N N    . SER B 2 2   ? -1.140  -1.572  -3.985  1.00 0.00 ? 2   SER B N    4  
ATOM 6959  C CA   . SER B 2 2   ? -2.467  -1.340  -4.543  1.00 0.00 ? 2   SER B CA   4  
ATOM 6960  C C    . SER B 2 2   ? -2.699  0.145   -4.808  1.00 0.00 ? 2   SER B C    4  
ATOM 6961  O O    . SER B 2 2   ? -3.837  0.616   -4.806  1.00 0.00 ? 2   SER B O    4  
ATOM 6962  C CB   . SER B 2 2   ? -3.544  -1.874  -3.595  1.00 0.00 ? 2   SER B CB   4  
ATOM 6963  O OG   . SER B 2 2   ? -3.512  -3.289  -3.531  1.00 0.00 ? 2   SER B OG   4  
ATOM 6964  H H    . SER B 2 2   ? -0.535  -2.197  -4.435  1.00 0.00 ? 2   SER B H    4  
ATOM 6965  H HA   . SER B 2 2   ? -2.530  -1.873  -5.480  1.00 0.00 ? 2   SER B HA   4  
ATOM 6966  H HB2  . SER B 2 2   ? -3.378  -1.477  -2.604  1.00 0.00 ? 2   SER B HB2  4  
ATOM 6967  H HB3  . SER B 2 2   ? -4.517  -1.563  -3.948  1.00 0.00 ? 2   SER B HB3  4  
ATOM 6968  H HG   . SER B 2 2   ? -4.107  -3.653  -4.189  1.00 0.00 ? 2   SER B HG   4  
ATOM 6969  N N    . ARG B 2 3   ? -1.613  0.878   -5.034  1.00 0.00 ? 3   ARG B N    4  
ATOM 6970  C CA   . ARG B 2 3   ? -1.699  2.309   -5.300  1.00 0.00 ? 3   ARG B CA   4  
ATOM 6971  C C    . ARG B 2 3   ? -2.533  2.581   -6.548  1.00 0.00 ? 3   ARG B C    4  
ATOM 6972  O O    . ARG B 2 3   ? -2.171  2.168   -7.650  1.00 0.00 ? 3   ARG B O    4  
ATOM 6973  C CB   . ARG B 2 3   ? -0.298  2.902   -5.470  1.00 0.00 ? 3   ARG B CB   4  
ATOM 6974  C CG   . ARG B 2 3   ? 0.601   2.696   -4.262  1.00 0.00 ? 3   ARG B CG   4  
ATOM 6975  C CD   . ARG B 2 3   ? 0.785   3.984   -3.475  1.00 0.00 ? 3   ARG B CD   4  
ATOM 6976  N NE   . ARG B 2 3   ? 1.290   3.735   -2.127  1.00 0.00 ? 3   ARG B NE   4  
ATOM 6977  C CZ   . ARG B 2 3   ? 0.529   3.324   -1.114  1.00 0.00 ? 3   ARG B CZ   4  
ATOM 6978  N NH1  . ARG B 2 3   ? -0.770  3.121   -1.293  1.00 0.00 ? 3   ARG B NH1  4  
ATOM 6979  N NH2  . ARG B 2 3   ? 1.068   3.117   0.079   1.00 0.00 ? 3   ARG B NH2  4  
ATOM 6980  H H    . ARG B 2 3   ? -0.733  0.447   -5.024  1.00 0.00 ? 3   ARG B H    4  
ATOM 6981  H HA   . ARG B 2 3   ? -2.177  2.777   -4.452  1.00 0.00 ? 3   ARG B HA   4  
ATOM 6982  H HB2  . ARG B 2 3   ? 0.174   2.440   -6.325  1.00 0.00 ? 3   ARG B HB2  4  
ATOM 6983  H HB3  . ARG B 2 3   ? -0.387  3.963   -5.651  1.00 0.00 ? 3   ARG B HB3  4  
ATOM 6984  H HG2  . ARG B 2 3   ? 0.155   1.954   -3.617  1.00 0.00 ? 3   ARG B HG2  4  
ATOM 6985  H HG3  . ARG B 2 3   ? 1.566   2.349   -4.598  1.00 0.00 ? 3   ARG B HG3  4  
ATOM 6986  H HD2  . ARG B 2 3   ? 1.488   4.614   -4.000  1.00 0.00 ? 3   ARG B HD2  4  
ATOM 6987  H HD3  . ARG B 2 3   ? -0.167  4.489   -3.406  1.00 0.00 ? 3   ARG B HD3  4  
ATOM 6988  H HE   . ARG B 2 3   ? 2.246   3.879   -1.967  1.00 0.00 ? 3   ARG B HE   4  
ATOM 6989  H HH11 . ARG B 2 3   ? -1.184  3.275   -2.190  1.00 0.00 ? 3   ARG B HH11 4  
ATOM 6990  H HH12 . ARG B 2 3   ? -1.336  2.812   -0.528  1.00 0.00 ? 3   ARG B HH12 4  
ATOM 6991  H HH21 . ARG B 2 3   ? 2.047   3.270   0.218   1.00 0.00 ? 3   ARG B HH21 4  
ATOM 6992  H HH22 . ARG B 2 3   ? 0.497   2.810   0.839   1.00 0.00 ? 3   ARG B HH22 4  
ATOM 6993  N N    . ILE B 2 4   ? -3.651  3.277   -6.368  1.00 0.00 ? 4   ILE B N    4  
ATOM 6994  C CA   . ILE B 2 4   ? -4.533  3.601   -7.482  1.00 0.00 ? 4   ILE B CA   4  
ATOM 6995  C C    . ILE B 2 4   ? -4.063  4.858   -8.206  1.00 0.00 ? 4   ILE B C    4  
ATOM 6996  O O    . ILE B 2 4   ? -3.921  5.920   -7.599  1.00 0.00 ? 4   ILE B O    4  
ATOM 6997  C CB   . ILE B 2 4   ? -5.987  3.805   -7.013  1.00 0.00 ? 4   ILE B CB   4  
ATOM 6998  C CG1  . ILE B 2 4   ? -6.039  4.804   -5.854  1.00 0.00 ? 4   ILE B CG1  4  
ATOM 6999  C CG2  . ILE B 2 4   ? -6.604  2.476   -6.604  1.00 0.00 ? 4   ILE B CG2  4  
ATOM 7000  C CD1  . ILE B 2 4   ? -7.134  5.839   -5.997  1.00 0.00 ? 4   ILE B CD1  4  
ATOM 7001  H H    . ILE B 2 4   ? -3.888  3.579   -5.467  1.00 0.00 ? 4   ILE B H    4  
ATOM 7002  H HA   . ILE B 2 4   ? -4.514  2.772   -8.174  1.00 0.00 ? 4   ILE B HA   4  
ATOM 7003  H HB   . ILE B 2 4   ? -6.556  4.198   -7.842  1.00 0.00 ? 4   ILE B HB   4  
ATOM 7004  H HG12 . ILE B 2 4   ? -6.209  4.269   -4.932  1.00 0.00 ? 4   ILE B HG12 4  
ATOM 7005  H HG13 . ILE B 2 4   ? -5.095  5.326   -5.793  1.00 0.00 ? 4   ILE B HG13 4  
ATOM 7006  H HG21 . ILE B 2 4   ? -6.013  1.665   -7.006  1.00 0.00 ? 4   ILE B HG21 4  
ATOM 7007  H HG22 . ILE B 2 4   ? -6.625  2.405   -5.527  1.00 0.00 ? 4   ILE B HG22 4  
ATOM 7008  H HG23 . ILE B 2 4   ? -7.610  2.412   -6.990  1.00 0.00 ? 4   ILE B HG23 4  
ATOM 7009  H HD11 . ILE B 2 4   ? -6.919  6.682   -5.358  1.00 0.00 ? 4   ILE B HD11 4  
ATOM 7010  H HD12 . ILE B 2 4   ? -7.183  6.171   -7.025  1.00 0.00 ? 4   ILE B HD12 4  
ATOM 7011  H HD13 . ILE B 2 4   ? -8.081  5.403   -5.714  1.00 0.00 ? 4   ILE B HD13 4  
ATOM 7012  N N    . TRP B 2 5   ? -3.820  4.730   -9.506  1.00 0.00 ? 5   TRP B N    4  
ATOM 7013  C CA   . TRP B 2 5   ? -3.366  5.856   -10.312 1.00 0.00 ? 5   TRP B CA   4  
ATOM 7014  C C    . TRP B 2 5   ? -4.469  6.332   -11.251 1.00 0.00 ? 5   TRP B C    4  
ATOM 7015  O O    . TRP B 2 5   ? -4.643  5.793   -12.343 1.00 0.00 ? 5   TRP B O    4  
ATOM 7016  C CB   . TRP B 2 5   ? -2.127  5.463   -11.120 1.00 0.00 ? 5   TRP B CB   4  
ATOM 7017  C CG   . TRP B 2 5   ? -0.901  5.286   -10.279 1.00 0.00 ? 5   TRP B CG   4  
ATOM 7018  C CD1  . TRP B 2 5   ? -0.808  4.612   -9.095  1.00 0.00 ? 5   TRP B CD1  4  
ATOM 7019  C CD2  . TRP B 2 5   ? 0.410   5.794   -10.556 1.00 0.00 ? 5   TRP B CD2  4  
ATOM 7020  N NE1  . TRP B 2 5   ? 0.480   4.667   -8.620  1.00 0.00 ? 5   TRP B NE1  4  
ATOM 7021  C CE2  . TRP B 2 5   ? 1.246   5.387   -9.499  1.00 0.00 ? 5   TRP B CE2  4  
ATOM 7022  C CE3  . TRP B 2 5   ? 0.957   6.550   -11.595 1.00 0.00 ? 5   TRP B CE3  4  
ATOM 7023  C CZ2  . TRP B 2 5   ? 2.600   5.713   -9.453  1.00 0.00 ? 5   TRP B CZ2  4  
ATOM 7024  C CZ3  . TRP B 2 5   ? 2.301   6.873   -11.549 1.00 0.00 ? 5   TRP B CZ3  4  
ATOM 7025  C CH2  . TRP B 2 5   ? 3.108   6.454   -10.484 1.00 0.00 ? 5   TRP B CH2  4  
ATOM 7026  H H    . TRP B 2 5   ? -3.951  3.858   -9.933  1.00 0.00 ? 5   TRP B H    4  
ATOM 7027  H HA   . TRP B 2 5   ? -3.107  6.661   -9.642  1.00 0.00 ? 5   TRP B HA   4  
ATOM 7028  H HB2  . TRP B 2 5   ? -2.318  4.531   -11.630 1.00 0.00 ? 5   TRP B HB2  4  
ATOM 7029  H HB3  . TRP B 2 5   ? -1.923  6.232   -11.851 1.00 0.00 ? 5   TRP B HB3  4  
ATOM 7030  H HD1  . TRP B 2 5   ? -1.635  4.112   -8.614  1.00 0.00 ? 5   TRP B HD1  4  
ATOM 7031  H HE1  . TRP B 2 5   ? 0.797   4.258   -7.789  1.00 0.00 ? 5   TRP B HE1  4  
ATOM 7032  H HE3  . TRP B 2 5   ? 0.351   6.883   -12.425 1.00 0.00 ? 5   TRP B HE3  4  
ATOM 7033  H HZ2  . TRP B 2 5   ? 3.237   5.397   -8.640  1.00 0.00 ? 5   TRP B HZ2  4  
ATOM 7034  H HZ3  . TRP B 2 5   ? 2.740   7.457   -12.343 1.00 0.00 ? 5   TRP B HZ3  4  
ATOM 7035  H HH2  . TRP B 2 5   ? 4.152   6.730   -10.489 1.00 0.00 ? 5   TRP B HH2  4  
ATOM 7036  N N    . TRP B 2 6   ? -5.210  7.346   -10.818 1.00 0.00 ? 6   TRP B N    4  
ATOM 7037  C CA   . TRP B 2 6   ? -6.295  7.895   -11.621 1.00 0.00 ? 6   TRP B CA   4  
ATOM 7038  C C    . TRP B 2 6   ? -5.749  8.780   -12.737 1.00 0.00 ? 6   TRP B C    4  
ATOM 7039  O O    . TRP B 2 6   ? -6.021  9.981   -12.783 1.00 0.00 ? 6   TRP B O    4  
ATOM 7040  C CB   . TRP B 2 6   ? -7.260  8.692   -10.741 1.00 0.00 ? 6   TRP B CB   4  
ATOM 7041  C CG   . TRP B 2 6   ? -8.592  8.939   -11.385 1.00 0.00 ? 6   TRP B CG   4  
ATOM 7042  C CD1  . TRP B 2 6   ? -9.098  8.314   -12.489 1.00 0.00 ? 6   TRP B CD1  4  
ATOM 7043  C CD2  . TRP B 2 6   ? -9.588  9.879   -10.964 1.00 0.00 ? 6   TRP B CD2  4  
ATOM 7044  N NE1  . TRP B 2 6   ? -10.347 8.808   -12.780 1.00 0.00 ? 6   TRP B NE1  4  
ATOM 7045  C CE2  . TRP B 2 6   ? -10.669 9.769   -11.858 1.00 0.00 ? 6   TRP B CE2  4  
ATOM 7046  C CE3  . TRP B 2 6   ? -9.669  10.802  -9.918  1.00 0.00 ? 6   TRP B CE3  4  
ATOM 7047  C CZ2  . TRP B 2 6   ? -11.817 10.548  -11.737 1.00 0.00 ? 6   TRP B CZ2  4  
ATOM 7048  C CZ3  . TRP B 2 6   ? -10.810 11.574  -9.798  1.00 0.00 ? 6   TRP B CZ3  4  
ATOM 7049  C CH2  . TRP B 2 6   ? -11.870 11.442  -10.703 1.00 0.00 ? 6   TRP B CH2  4  
ATOM 7050  H H    . TRP B 2 6   ? -5.023  7.735   -9.938  1.00 0.00 ? 6   TRP B H    4  
ATOM 7051  H HA   . TRP B 2 6   ? -6.829  7.067   -12.065 1.00 0.00 ? 6   TRP B HA   4  
ATOM 7052  H HB2  . TRP B 2 6   ? -7.430  8.152   -9.822  1.00 0.00 ? 6   TRP B HB2  4  
ATOM 7053  H HB3  . TRP B 2 6   ? -6.817  9.651   -10.512 1.00 0.00 ? 6   TRP B HB3  4  
ATOM 7054  H HD1  . TRP B 2 6   ? -8.580  7.546   -13.045 1.00 0.00 ? 6   TRP B HD1  4  
ATOM 7055  H HE1  . TRP B 2 6   ? -10.913 8.519   -13.525 1.00 0.00 ? 6   TRP B HE1  4  
ATOM 7056  H HE3  . TRP B 2 6   ? -8.862  10.917  -9.210  1.00 0.00 ? 6   TRP B HE3  4  
ATOM 7057  H HZ2  . TRP B 2 6   ? -12.644 10.458  -12.425 1.00 0.00 ? 6   TRP B HZ2  4  
ATOM 7058  H HZ3  . TRP B 2 6   ? -10.890 12.292  -8.996  1.00 0.00 ? 6   TRP B HZ3  4  
ATOM 7059  H HH2  . TRP B 2 6   ? -12.742 12.066  -10.572 1.00 0.00 ? 6   TRP B HH2  4  
ATOM 7060  N N    . VAL B 2 7   ? -4.977  8.179   -13.636 1.00 0.00 ? 7   VAL B N    4  
ATOM 7061  C CA   . VAL B 2 7   ? -4.392  8.912   -14.751 1.00 0.00 ? 7   VAL B CA   4  
ATOM 7062  C C    . VAL B 2 7   ? -5.267  8.808   -15.994 1.00 0.00 ? 7   VAL B C    4  
ATOM 7063  O O    . VAL B 2 7   ? -5.162  7.786   -16.704 1.00 0.00 ? 7   VAL B O    4  
ATOM 7064  C CB   . VAL B 2 7   ? -2.980  8.395   -15.088 1.00 0.00 ? 7   VAL B CB   4  
ATOM 7065  C CG1  . VAL B 2 7   ? -2.294  9.321   -16.081 1.00 0.00 ? 7   VAL B CG1  4  
ATOM 7066  C CG2  . VAL B 2 7   ? -2.148  8.248   -13.823 1.00 0.00 ? 7   VAL B CG2  4  
ATOM 7067  O OXT  . VAL B 2 7   ? -6.051  9.747   -16.246 1.00 0.00 ? 7   VAL B OXT  4  
ATOM 7068  H H    . VAL B 2 7   ? -4.795  7.220   -13.547 1.00 0.00 ? 7   VAL B H    4  
ATOM 7069  H HA   . VAL B 2 7   ? -4.314  9.950   -14.463 1.00 0.00 ? 7   VAL B HA   4  
ATOM 7070  H HB   . VAL B 2 7   ? -3.075  7.421   -15.546 1.00 0.00 ? 7   VAL B HB   4  
ATOM 7071  H HG11 . VAL B 2 7   ? -3.032  9.950   -16.555 1.00 0.00 ? 7   VAL B HG11 4  
ATOM 7072  H HG12 . VAL B 2 7   ? -1.576  9.939   -15.561 1.00 0.00 ? 7   VAL B HG12 4  
ATOM 7073  H HG13 . VAL B 2 7   ? -1.786  8.732   -16.831 1.00 0.00 ? 7   VAL B HG13 4  
ATOM 7074  H HG21 . VAL B 2 7   ? -2.045  9.211   -13.345 1.00 0.00 ? 7   VAL B HG21 4  
ATOM 7075  H HG22 . VAL B 2 7   ? -2.638  7.561   -13.148 1.00 0.00 ? 7   VAL B HG22 4  
ATOM 7076  H HG23 . VAL B 2 7   ? -1.170  7.865   -14.078 1.00 0.00 ? 7   VAL B HG23 4  
ATOM 7077  N N    . GLY A 1 1   ? 7.712   21.745  -20.238 1.00 0.00 ? 376 GLY A N    5  
ATOM 7078  C CA   . GLY A 1 1   ? 6.692   21.485  -19.186 1.00 0.00 ? 376 GLY A CA   5  
ATOM 7079  C C    . GLY A 1 1   ? 5.573   20.584  -19.673 1.00 0.00 ? 376 GLY A C    5  
ATOM 7080  O O    . GLY A 1 1   ? 5.823   19.551  -20.293 1.00 0.00 ? 376 GLY A O    5  
ATOM 7081  H H1   . GLY A 1 1   ? 7.973   20.857  -20.712 1.00 0.00 ? 376 GLY A H1   5  
ATOM 7082  H H2   . GLY A 1 1   ? 8.565   22.162  -19.812 1.00 0.00 ? 376 GLY A H2   5  
ATOM 7083  H H3   . GLY A 1 1   ? 7.334   22.406  -20.947 1.00 0.00 ? 376 GLY A H3   5  
ATOM 7084  H HA2  . GLY A 1 1   ? 7.173   21.016  -18.341 1.00 0.00 ? 376 GLY A HA2  5  
ATOM 7085  H HA3  . GLY A 1 1   ? 6.268   22.426  -18.869 1.00 0.00 ? 376 GLY A HA3  5  
ATOM 7086  N N    . SER A 1 2   ? 4.335   20.976  -19.390 1.00 0.00 ? 377 SER A N    5  
ATOM 7087  C CA   . SER A 1 2   ? 3.173   20.197  -19.803 1.00 0.00 ? 377 SER A CA   5  
ATOM 7088  C C    . SER A 1 2   ? 2.156   21.073  -20.527 1.00 0.00 ? 377 SER A C    5  
ATOM 7089  O O    . SER A 1 2   ? 1.607   20.681  -21.556 1.00 0.00 ? 377 SER A O    5  
ATOM 7090  C CB   . SER A 1 2   ? 2.520   19.535  -18.587 1.00 0.00 ? 377 SER A CB   5  
ATOM 7091  O OG   . SER A 1 2   ? 1.375   18.790  -18.966 1.00 0.00 ? 377 SER A OG   5  
ATOM 7092  H H    . SER A 1 2   ? 4.200   21.809  -18.892 1.00 0.00 ? 377 SER A H    5  
ATOM 7093  H HA   . SER A 1 2   ? 3.514   19.428  -20.479 1.00 0.00 ? 377 SER A HA   5  
ATOM 7094  H HB2  . SER A 1 2   ? 3.228   18.869  -18.118 1.00 0.00 ? 377 SER A HB2  5  
ATOM 7095  H HB3  . SER A 1 2   ? 2.221   20.297  -17.882 1.00 0.00 ? 377 SER A HB3  5  
ATOM 7096  H HG   . SER A 1 2   ? 0.730   19.377  -19.368 1.00 0.00 ? 377 SER A HG   5  
ATOM 7097  N N    . HIS A 1 3   ? 1.908   22.261  -19.982 1.00 0.00 ? 378 HIS A N    5  
ATOM 7098  C CA   . HIS A 1 3   ? 0.955   23.193  -20.575 1.00 0.00 ? 378 HIS A CA   5  
ATOM 7099  C C    . HIS A 1 3   ? -0.464  22.640  -20.501 1.00 0.00 ? 378 HIS A C    5  
ATOM 7100  O O    . HIS A 1 3   ? -1.265  23.066  -19.669 1.00 0.00 ? 378 HIS A O    5  
ATOM 7101  C CB   . HIS A 1 3   ? 1.331   23.488  -22.031 1.00 0.00 ? 378 HIS A CB   5  
ATOM 7102  C CG   . HIS A 1 3   ? 1.744   24.908  -22.268 1.00 0.00 ? 378 HIS A CG   5  
ATOM 7103  N ND1  . HIS A 1 3   ? 0.914   25.983  -22.029 1.00 0.00 ? 378 HIS A ND1  5  
ATOM 7104  C CD2  . HIS A 1 3   ? 2.908   25.427  -22.725 1.00 0.00 ? 378 HIS A CD2  5  
ATOM 7105  C CE1  . HIS A 1 3   ? 1.549   27.102  -22.329 1.00 0.00 ? 378 HIS A CE1  5  
ATOM 7106  N NE2  . HIS A 1 3   ? 2.760   26.792  -22.753 1.00 0.00 ? 378 HIS A NE2  5  
ATOM 7107  H H    . HIS A 1 3   ? 2.376   22.517  -19.160 1.00 0.00 ? 378 HIS A H    5  
ATOM 7108  H HA   . HIS A 1 3   ? 0.998   24.112  -20.010 1.00 0.00 ? 378 HIS A HA   5  
ATOM 7109  H HB2  . HIS A 1 3   ? 2.155   22.852  -22.319 1.00 0.00 ? 378 HIS A HB2  5  
ATOM 7110  H HB3  . HIS A 1 3   ? 0.482   23.278  -22.666 1.00 0.00 ? 378 HIS A HB3  5  
ATOM 7111  H HD1  . HIS A 1 3   ? -0.003  25.934  -21.689 1.00 0.00 ? 378 HIS A HD1  5  
ATOM 7112  H HD2  . HIS A 1 3   ? 3.789   24.871  -23.014 1.00 0.00 ? 378 HIS A HD2  5  
ATOM 7113  H HE1  . HIS A 1 3   ? 1.147   28.101  -22.241 1.00 0.00 ? 378 HIS A HE1  5  
ATOM 7114  H HE2  . HIS A 1 3   ? 3.410   27.427  -23.121 1.00 0.00 ? 378 HIS A HE2  5  
ATOM 7115  N N    . MET A 1 4   ? -0.770  21.686  -21.375 1.00 0.00 ? 379 MET A N    5  
ATOM 7116  C CA   . MET A 1 4   ? -2.092  21.074  -21.406 1.00 0.00 ? 379 MET A CA   5  
ATOM 7117  C C    . MET A 1 4   ? -2.074  19.709  -20.727 1.00 0.00 ? 379 MET A C    5  
ATOM 7118  O O    . MET A 1 4   ? -1.459  18.765  -21.222 1.00 0.00 ? 379 MET A O    5  
ATOM 7119  C CB   . MET A 1 4   ? -2.577  20.930  -22.850 1.00 0.00 ? 379 MET A CB   5  
ATOM 7120  C CG   . MET A 1 4   ? -3.090  22.230  -23.452 1.00 0.00 ? 379 MET A CG   5  
ATOM 7121  S SD   . MET A 1 4   ? -2.019  22.868  -24.754 1.00 0.00 ? 379 MET A SD   5  
ATOM 7122  C CE   . MET A 1 4   ? -2.230  24.634  -24.533 1.00 0.00 ? 379 MET A CE   5  
ATOM 7123  H H    . MET A 1 4   ? -0.089  21.388  -22.013 1.00 0.00 ? 379 MET A H    5  
ATOM 7124  H HA   . MET A 1 4   ? -2.771  21.721  -20.871 1.00 0.00 ? 379 MET A HA   5  
ATOM 7125  H HB2  . MET A 1 4   ? -1.759  20.574  -23.459 1.00 0.00 ? 379 MET A HB2  5  
ATOM 7126  H HB3  . MET A 1 4   ? -3.377  20.206  -22.878 1.00 0.00 ? 379 MET A HB3  5  
ATOM 7127  H HG2  . MET A 1 4   ? -4.072  22.055  -23.868 1.00 0.00 ? 379 MET A HG2  5  
ATOM 7128  H HG3  . MET A 1 4   ? -3.161  22.969  -22.668 1.00 0.00 ? 379 MET A HG3  5  
ATOM 7129  H HE1  . MET A 1 4   ? -3.079  24.970  -25.111 1.00 0.00 ? 379 MET A HE1  5  
ATOM 7130  H HE2  . MET A 1 4   ? -2.399  24.848  -23.488 1.00 0.00 ? 379 MET A HE2  5  
ATOM 7131  H HE3  . MET A 1 4   ? -1.341  25.147  -24.866 1.00 0.00 ? 379 MET A HE3  5  
ATOM 7132  N N    . LYS A 1 5   ? -2.754  19.612  -19.589 1.00 0.00 ? 380 LYS A N    5  
ATOM 7133  C CA   . LYS A 1 5   ? -2.816  18.363  -18.840 1.00 0.00 ? 380 LYS A CA   5  
ATOM 7134  C C    . LYS A 1 5   ? -3.675  17.333  -19.569 1.00 0.00 ? 380 LYS A C    5  
ATOM 7135  O O    . LYS A 1 5   ? -4.638  17.684  -20.251 1.00 0.00 ? 380 LYS A O    5  
ATOM 7136  C CB   . LYS A 1 5   ? -3.376  18.610  -17.439 1.00 0.00 ? 380 LYS A CB   5  
ATOM 7137  C CG   . LYS A 1 5   ? -2.303  18.861  -16.390 1.00 0.00 ? 380 LYS A CG   5  
ATOM 7138  C CD   . LYS A 1 5   ? -2.103  17.649  -15.495 1.00 0.00 ? 380 LYS A CD   5  
ATOM 7139  C CE   . LYS A 1 5   ? -1.174  16.630  -16.135 1.00 0.00 ? 380 LYS A CE   5  
ATOM 7140  N NZ   . LYS A 1 5   ? -1.104  15.368  -15.347 1.00 0.00 ? 380 LYS A NZ   5  
ATOM 7141  H H    . LYS A 1 5   ? -3.225  20.400  -19.244 1.00 0.00 ? 380 LYS A H    5  
ATOM 7142  H HA   . LYS A 1 5   ? -1.811  17.979  -18.754 1.00 0.00 ? 380 LYS A HA   5  
ATOM 7143  H HB2  . LYS A 1 5   ? -4.025  19.473  -17.470 1.00 0.00 ? 380 LYS A HB2  5  
ATOM 7144  H HB3  . LYS A 1 5   ? -3.952  17.749  -17.135 1.00 0.00 ? 380 LYS A HB3  5  
ATOM 7145  H HG2  . LYS A 1 5   ? -1.372  19.084  -16.888 1.00 0.00 ? 380 LYS A HG2  5  
ATOM 7146  H HG3  . LYS A 1 5   ? -2.599  19.702  -15.781 1.00 0.00 ? 380 LYS A HG3  5  
ATOM 7147  H HD2  . LYS A 1 5   ? -1.676  17.972  -14.558 1.00 0.00 ? 380 LYS A HD2  5  
ATOM 7148  H HD3  . LYS A 1 5   ? -3.062  17.186  -15.314 1.00 0.00 ? 380 LYS A HD3  5  
ATOM 7149  H HE2  . LYS A 1 5   ? -1.537  16.405  -17.126 1.00 0.00 ? 380 LYS A HE2  5  
ATOM 7150  H HE3  . LYS A 1 5   ? -0.184  17.058  -16.202 1.00 0.00 ? 380 LYS A HE3  5  
ATOM 7151  H HZ1  . LYS A 1 5   ? -0.124  15.023  -15.311 1.00 0.00 ? 380 LYS A HZ1  5  
ATOM 7152  H HZ2  . LYS A 1 5   ? -1.439  15.533  -14.376 1.00 0.00 ? 380 LYS A HZ2  5  
ATOM 7153  H HZ3  . LYS A 1 5   ? -1.700  14.638  -15.787 1.00 0.00 ? 380 LYS A HZ3  5  
ATOM 7154  N N    . LYS A 1 6   ? -3.320  16.062  -19.417 1.00 0.00 ? 381 LYS A N    5  
ATOM 7155  C CA   . LYS A 1 6   ? -4.059  14.980  -20.058 1.00 0.00 ? 381 LYS A CA   5  
ATOM 7156  C C    . LYS A 1 6   ? -4.936  14.250  -19.045 1.00 0.00 ? 381 LYS A C    5  
ATOM 7157  O O    . LYS A 1 6   ? -4.623  14.210  -17.855 1.00 0.00 ? 381 LYS A O    5  
ATOM 7158  C CB   . LYS A 1 6   ? -3.093  13.996  -20.721 1.00 0.00 ? 381 LYS A CB   5  
ATOM 7159  C CG   . LYS A 1 6   ? -2.035  14.667  -21.582 1.00 0.00 ? 381 LYS A CG   5  
ATOM 7160  C CD   . LYS A 1 6   ? -2.491  14.805  -23.026 1.00 0.00 ? 381 LYS A CD   5  
ATOM 7161  C CE   . LYS A 1 6   ? -1.722  13.873  -23.950 1.00 0.00 ? 381 LYS A CE   5  
ATOM 7162  N NZ   . LYS A 1 6   ? -1.342  14.545  -25.223 1.00 0.00 ? 381 LYS A NZ   5  
ATOM 7163  H H    . LYS A 1 6   ? -2.544  15.845  -18.860 1.00 0.00 ? 381 LYS A H    5  
ATOM 7164  H HA   . LYS A 1 6   ? -4.692  15.416  -20.817 1.00 0.00 ? 381 LYS A HA   5  
ATOM 7165  H HB2  . LYS A 1 6   ? -2.593  13.427  -19.951 1.00 0.00 ? 381 LYS A HB2  5  
ATOM 7166  H HB3  . LYS A 1 6   ? -3.659  13.321  -21.346 1.00 0.00 ? 381 LYS A HB3  5  
ATOM 7167  H HG2  . LYS A 1 6   ? -1.833  15.650  -21.184 1.00 0.00 ? 381 LYS A HG2  5  
ATOM 7168  H HG3  . LYS A 1 6   ? -1.132  14.074  -21.552 1.00 0.00 ? 381 LYS A HG3  5  
ATOM 7169  H HD2  . LYS A 1 6   ? -3.543  14.565  -23.086 1.00 0.00 ? 381 LYS A HD2  5  
ATOM 7170  H HD3  . LYS A 1 6   ? -2.335  15.825  -23.345 1.00 0.00 ? 381 LYS A HD3  5  
ATOM 7171  H HE2  . LYS A 1 6   ? -0.826  13.545  -23.446 1.00 0.00 ? 381 LYS A HE2  5  
ATOM 7172  H HE3  . LYS A 1 6   ? -2.342  13.018  -24.175 1.00 0.00 ? 381 LYS A HE3  5  
ATOM 7173  H HZ1  . LYS A 1 6   ? -2.117  14.469  -25.912 1.00 0.00 ? 381 LYS A HZ1  5  
ATOM 7174  H HZ2  . LYS A 1 6   ? -1.143  15.551  -25.052 1.00 0.00 ? 381 LYS A HZ2  5  
ATOM 7175  H HZ3  . LYS A 1 6   ? -0.492  14.099  -25.623 1.00 0.00 ? 381 LYS A HZ3  5  
ATOM 7176  N N    . TYR A 1 7   ? -6.035  13.677  -19.523 1.00 0.00 ? 382 TYR A N    5  
ATOM 7177  C CA   . TYR A 1 7   ? -6.957  12.951  -18.657 1.00 0.00 ? 382 TYR A CA   5  
ATOM 7178  C C    . TYR A 1 7   ? -7.694  11.863  -19.432 1.00 0.00 ? 382 TYR A C    5  
ATOM 7179  O O    . TYR A 1 7   ? -8.337  12.136  -20.444 1.00 0.00 ? 382 TYR A O    5  
ATOM 7180  C CB   . TYR A 1 7   ? -7.965  13.919  -18.030 1.00 0.00 ? 382 TYR A CB   5  
ATOM 7181  C CG   . TYR A 1 7   ? -8.972  13.248  -17.122 1.00 0.00 ? 382 TYR A CG   5  
ATOM 7182  C CD1  . TYR A 1 7   ? -8.559  12.533  -16.004 1.00 0.00 ? 382 TYR A CD1  5  
ATOM 7183  C CD2  . TYR A 1 7   ? -10.333 13.332  -17.381 1.00 0.00 ? 382 TYR A CD2  5  
ATOM 7184  C CE1  . TYR A 1 7   ? -9.478  11.920  -15.171 1.00 0.00 ? 382 TYR A CE1  5  
ATOM 7185  C CE2  . TYR A 1 7   ? -11.257 12.723  -16.554 1.00 0.00 ? 382 TYR A CE2  5  
ATOM 7186  C CZ   . TYR A 1 7   ? -10.824 12.018  -15.451 1.00 0.00 ? 382 TYR A CZ   5  
ATOM 7187  O OH   . TYR A 1 7   ? -11.741 11.411  -14.624 1.00 0.00 ? 382 TYR A OH   5  
ATOM 7188  H H    . TYR A 1 7   ? -6.232  13.744  -20.481 1.00 0.00 ? 382 TYR A H    5  
ATOM 7189  H HA   . TYR A 1 7   ? -6.379  12.489  -17.871 1.00 0.00 ? 382 TYR A HA   5  
ATOM 7190  H HB2  . TYR A 1 7   ? -7.432  14.653  -17.447 1.00 0.00 ? 382 TYR A HB2  5  
ATOM 7191  H HB3  . TYR A 1 7   ? -8.509  14.418  -18.818 1.00 0.00 ? 382 TYR A HB3  5  
ATOM 7192  H HD1  . TYR A 1 7   ? -7.504  12.459  -15.788 1.00 0.00 ? 382 TYR A HD1  5  
ATOM 7193  H HD2  . TYR A 1 7   ? -10.670 13.884  -18.247 1.00 0.00 ? 382 TYR A HD2  5  
ATOM 7194  H HE1  . TYR A 1 7   ? -9.137  11.369  -14.307 1.00 0.00 ? 382 TYR A HE1  5  
ATOM 7195  H HE2  . TYR A 1 7   ? -12.312 12.799  -16.773 1.00 0.00 ? 382 TYR A HE2  5  
ATOM 7196  H HH   . TYR A 1 7   ? -11.388 10.574  -14.311 1.00 0.00 ? 382 TYR A HH   5  
ATOM 7197  N N    . ILE A 1 8   ? -7.596  10.629  -18.948 1.00 0.00 ? 383 ILE A N    5  
ATOM 7198  C CA   . ILE A 1 8   ? -8.257  9.499   -19.594 1.00 0.00 ? 383 ILE A CA   5  
ATOM 7199  C C    . ILE A 1 8   ? -9.366  8.923   -18.715 1.00 0.00 ? 383 ILE A C    5  
ATOM 7200  O O    . ILE A 1 8   ? -10.086 8.014   -19.129 1.00 0.00 ? 383 ILE A O    5  
ATOM 7201  C CB   . ILE A 1 8   ? -7.255  8.381   -19.934 1.00 0.00 ? 383 ILE A CB   5  
ATOM 7202  C CG1  . ILE A 1 8   ? -6.438  8.002   -18.697 1.00 0.00 ? 383 ILE A CG1  5  
ATOM 7203  C CG2  . ILE A 1 8   ? -6.338  8.816   -21.067 1.00 0.00 ? 383 ILE A CG2  5  
ATOM 7204  C CD1  . ILE A 1 8   ? -5.517  6.824   -18.922 1.00 0.00 ? 383 ILE A CD1  5  
ATOM 7205  H H    . ILE A 1 8   ? -7.071  10.473  -18.136 1.00 0.00 ? 383 ILE A H    5  
ATOM 7206  H HA   . ILE A 1 8   ? -8.692  9.854   -20.517 1.00 0.00 ? 383 ILE A HA   5  
ATOM 7207  H HB   . ILE A 1 8   ? -7.812  7.518   -20.266 1.00 0.00 ? 383 ILE A HB   5  
ATOM 7208  H HG12 . ILE A 1 8   ? -5.832  8.845   -18.401 1.00 0.00 ? 383 ILE A HG12 5  
ATOM 7209  H HG13 . ILE A 1 8   ? -7.112  7.749   -17.891 1.00 0.00 ? 383 ILE A HG13 5  
ATOM 7210  H HG21 . ILE A 1 8   ? -6.814  9.604   -21.632 1.00 0.00 ? 383 ILE A HG21 5  
ATOM 7211  H HG22 . ILE A 1 8   ? -5.407  9.180   -20.657 1.00 0.00 ? 383 ILE A HG22 5  
ATOM 7212  H HG23 . ILE A 1 8   ? -6.143  7.974   -21.715 1.00 0.00 ? 383 ILE A HG23 5  
ATOM 7213  H HD11 . ILE A 1 8   ? -5.259  6.382   -17.971 1.00 0.00 ? 383 ILE A HD11 5  
ATOM 7214  H HD12 . ILE A 1 8   ? -6.017  6.090   -19.536 1.00 0.00 ? 383 ILE A HD12 5  
ATOM 7215  H HD13 . ILE A 1 8   ? -4.620  7.159   -19.419 1.00 0.00 ? 383 ILE A HD13 5  
ATOM 7216  N N    . GLY A 1 9   ? -9.503  9.455   -17.502 1.00 0.00 ? 384 GLY A N    5  
ATOM 7217  C CA   . GLY A 1 9   ? -10.529 8.979   -16.592 1.00 0.00 ? 384 GLY A CA   5  
ATOM 7218  C C    . GLY A 1 9   ? -10.474 7.478   -16.380 1.00 0.00 ? 384 GLY A C    5  
ATOM 7219  O O    . GLY A 1 9   ? -11.393 6.756   -16.768 1.00 0.00 ? 384 GLY A O    5  
ATOM 7220  H H    . GLY A 1 9   ? -8.904  10.178  -17.222 1.00 0.00 ? 384 GLY A H    5  
ATOM 7221  H HA2  . GLY A 1 9   ? -10.403 9.469   -15.638 1.00 0.00 ? 384 GLY A HA2  5  
ATOM 7222  H HA3  . GLY A 1 9   ? -11.497 9.240   -16.991 1.00 0.00 ? 384 GLY A HA3  5  
ATOM 7223  N N    . ILE A 1 10  ? -9.395  7.009   -15.763 1.00 0.00 ? 385 ILE A N    5  
ATOM 7224  C CA   . ILE A 1 10  ? -9.226  5.586   -15.498 1.00 0.00 ? 385 ILE A CA   5  
ATOM 7225  C C    . ILE A 1 10  ? -8.115  5.349   -14.479 1.00 0.00 ? 385 ILE A C    5  
ATOM 7226  O O    . ILE A 1 10  ? -6.983  5.797   -14.662 1.00 0.00 ? 385 ILE A O    5  
ATOM 7227  C CB   . ILE A 1 10  ? -8.920  4.807   -16.796 1.00 0.00 ? 385 ILE A CB   5  
ATOM 7228  C CG1  . ILE A 1 10  ? -8.822  3.299   -16.516 1.00 0.00 ? 385 ILE A CG1  5  
ATOM 7229  C CG2  . ILE A 1 10  ? -7.649  5.332   -17.454 1.00 0.00 ? 385 ILE A CG2  5  
ATOM 7230  C CD1  . ILE A 1 10  ? -7.501  2.854   -15.916 1.00 0.00 ? 385 ILE A CD1  5  
ATOM 7231  H H    . ILE A 1 10  ? -8.698  7.635   -15.477 1.00 0.00 ? 385 ILE A H    5  
ATOM 7232  H HA   . ILE A 1 10  ? -10.155 5.212   -15.092 1.00 0.00 ? 385 ILE A HA   5  
ATOM 7233  H HB   . ILE A 1 10  ? -9.736  4.978   -17.481 1.00 0.00 ? 385 ILE A HB   5  
ATOM 7234  H HG12 . ILE A 1 10  ? -9.604  3.019   -15.827 1.00 0.00 ? 385 ILE A HG12 5  
ATOM 7235  H HG13 . ILE A 1 10  ? -8.960  2.762   -17.443 1.00 0.00 ? 385 ILE A HG13 5  
ATOM 7236  H HG21 . ILE A 1 10  ? -7.189  6.071   -16.816 1.00 0.00 ? 385 ILE A HG21 5  
ATOM 7237  H HG22 . ILE A 1 10  ? -6.959  4.517   -17.615 1.00 0.00 ? 385 ILE A HG22 5  
ATOM 7238  H HG23 . ILE A 1 10  ? -7.897  5.785   -18.403 1.00 0.00 ? 385 ILE A HG23 5  
ATOM 7239  H HD11 . ILE A 1 10  ? -7.047  2.112   -16.555 1.00 0.00 ? 385 ILE A HD11 5  
ATOM 7240  H HD12 . ILE A 1 10  ? -6.841  3.703   -15.824 1.00 0.00 ? 385 ILE A HD12 5  
ATOM 7241  H HD13 . ILE A 1 10  ? -7.676  2.429   -14.939 1.00 0.00 ? 385 ILE A HD13 5  
ATOM 7242  N N    . ARG A 1 11  ? -8.446  4.644   -13.402 1.00 0.00 ? 386 ARG A N    5  
ATOM 7243  C CA   . ARG A 1 11  ? -7.477  4.352   -12.353 1.00 0.00 ? 386 ARG A CA   5  
ATOM 7244  C C    . ARG A 1 11  ? -6.789  3.014   -12.606 1.00 0.00 ? 386 ARG A C    5  
ATOM 7245  O O    . ARG A 1 11  ? -7.448  1.985   -12.760 1.00 0.00 ? 386 ARG A O    5  
ATOM 7246  C CB   . ARG A 1 11  ? -8.161  4.338   -10.986 1.00 0.00 ? 386 ARG A CB   5  
ATOM 7247  C CG   . ARG A 1 11  ? -8.985  5.584   -10.704 1.00 0.00 ? 386 ARG A CG   5  
ATOM 7248  C CD   . ARG A 1 11  ? -10.220 5.261   -9.879  1.00 0.00 ? 386 ARG A CD   5  
ATOM 7249  N NE   . ARG A 1 11  ? -10.215 5.955   -8.593  1.00 0.00 ? 386 ARG A NE   5  
ATOM 7250  C CZ   . ARG A 1 11  ? -10.732 5.452   -7.472  1.00 0.00 ? 386 ARG A CZ   5  
ATOM 7251  N NH1  . ARG A 1 11  ? -11.305 4.255   -7.470  1.00 0.00 ? 386 ARG A NH1  5  
ATOM 7252  N NH2  . ARG A 1 11  ? -10.675 6.153   -6.347  1.00 0.00 ? 386 ARG A NH2  5  
ATOM 7253  H H    . ARG A 1 11  ? -9.365  4.315   -13.309 1.00 0.00 ? 386 ARG A H    5  
ATOM 7254  H HA   . ARG A 1 11  ? -6.731  5.133   -12.364 1.00 0.00 ? 386 ARG A HA   5  
ATOM 7255  H HB2  . ARG A 1 11  ? -8.816  3.482   -10.934 1.00 0.00 ? 386 ARG A HB2  5  
ATOM 7256  H HB3  . ARG A 1 11  ? -7.406  4.251   -10.219 1.00 0.00 ? 386 ARG A HB3  5  
ATOM 7257  H HG2  . ARG A 1 11  ? -8.375  6.291   -10.160 1.00 0.00 ? 386 ARG A HG2  5  
ATOM 7258  H HG3  . ARG A 1 11  ? -9.293  6.020   -11.643 1.00 0.00 ? 386 ARG A HG3  5  
ATOM 7259  H HD2  . ARG A 1 11  ? -11.097 5.559   -10.435 1.00 0.00 ? 386 ARG A HD2  5  
ATOM 7260  H HD3  . ARG A 1 11  ? -10.251 4.196   -9.705  1.00 0.00 ? 386 ARG A HD3  5  
ATOM 7261  H HE   . ARG A 1 11  ? -9.802  6.843   -8.561  1.00 0.00 ? 386 ARG A HE   5  
ATOM 7262  H HH11 . ARG A 1 11  ? -11.354 3.721   -8.312  1.00 0.00 ? 386 ARG A HH11 5  
ATOM 7263  H HH12 . ARG A 1 11  ? -11.688 3.887   -6.623  1.00 0.00 ? 386 ARG A HH12 5  
ATOM 7264  H HH21 . ARG A 1 11  ? -10.247 7.056   -6.341  1.00 0.00 ? 386 ARG A HH21 5  
ATOM 7265  H HH22 . ARG A 1 11  ? -11.062 5.777   -5.505  1.00 0.00 ? 386 ARG A HH22 5  
ATOM 7266  N N    . MET A 1 12  ? -5.462  3.036   -12.645 1.00 0.00 ? 387 MET A N    5  
ATOM 7267  C CA   . MET A 1 12  ? -4.684  1.824   -12.878 1.00 0.00 ? 387 MET A CA   5  
ATOM 7268  C C    . MET A 1 12  ? -3.632  1.634   -11.792 1.00 0.00 ? 387 MET A C    5  
ATOM 7269  O O    . MET A 1 12  ? -2.967  2.586   -11.384 1.00 0.00 ? 387 MET A O    5  
ATOM 7270  C CB   . MET A 1 12  ? -4.011  1.869   -14.254 1.00 0.00 ? 387 MET A CB   5  
ATOM 7271  C CG   . MET A 1 12  ? -3.375  3.209   -14.589 1.00 0.00 ? 387 MET A CG   5  
ATOM 7272  S SD   . MET A 1 12  ? -1.632  3.278   -14.143 1.00 0.00 ? 387 MET A SD   5  
ATOM 7273  C CE   . MET A 1 12  ? -1.361  5.048   -14.096 1.00 0.00 ? 387 MET A CE   5  
ATOM 7274  H H    . MET A 1 12  ? -4.994  3.886   -12.512 1.00 0.00 ? 387 MET A H    5  
ATOM 7275  H HA   . MET A 1 12  ? -5.364  0.985   -12.850 1.00 0.00 ? 387 MET A HA   5  
ATOM 7276  H HB2  . MET A 1 12  ? -3.241  1.113   -14.288 1.00 0.00 ? 387 MET A HB2  5  
ATOM 7277  H HB3  . MET A 1 12  ? -4.752  1.648   -15.009 1.00 0.00 ? 387 MET A HB3  5  
ATOM 7278  H HG2  . MET A 1 12  ? -3.465  3.379   -15.651 1.00 0.00 ? 387 MET A HG2  5  
ATOM 7279  H HG3  . MET A 1 12  ? -3.899  3.988   -14.057 1.00 0.00 ? 387 MET A HG3  5  
ATOM 7280  H HE1  . MET A 1 12  ? -1.112  5.400   -15.086 1.00 0.00 ? 387 MET A HE1  5  
ATOM 7281  H HE2  . MET A 1 12  ? -2.260  5.539   -13.753 1.00 0.00 ? 387 MET A HE2  5  
ATOM 7282  H HE3  . MET A 1 12  ? -0.549  5.271   -13.420 1.00 0.00 ? 387 MET A HE3  5  
ATOM 7283  N N    . MET A 1 13  ? -3.489  0.398   -11.324 1.00 0.00 ? 388 MET A N    5  
ATOM 7284  C CA   . MET A 1 13  ? -2.520  0.081   -10.281 1.00 0.00 ? 388 MET A CA   5  
ATOM 7285  C C    . MET A 1 13  ? -1.447  -0.869  -10.802 1.00 0.00 ? 388 MET A C    5  
ATOM 7286  O O    . MET A 1 13  ? -1.537  -1.370  -11.923 1.00 0.00 ? 388 MET A O    5  
ATOM 7287  C CB   . MET A 1 13  ? -3.227  -0.546  -9.078  1.00 0.00 ? 388 MET A CB   5  
ATOM 7288  C CG   . MET A 1 13  ? -3.924  -1.858  -9.400  1.00 0.00 ? 388 MET A CG   5  
ATOM 7289  S SD   . MET A 1 13  ? -5.512  -2.026  -8.565  1.00 0.00 ? 388 MET A SD   5  
ATOM 7290  C CE   . MET A 1 13  ? -4.979  -2.293  -6.876  1.00 0.00 ? 388 MET A CE   5  
ATOM 7291  H H    . MET A 1 13  ? -4.050  -0.318  -11.688 1.00 0.00 ? 388 MET A H    5  
ATOM 7292  H HA   . MET A 1 13  ? -2.050  1.002   -9.971  1.00 0.00 ? 388 MET A HA   5  
ATOM 7293  H HB2  . MET A 1 13  ? -2.498  -0.732  -8.303  1.00 0.00 ? 388 MET A HB2  5  
ATOM 7294  H HB3  . MET A 1 13  ? -3.966  0.148   -8.707  1.00 0.00 ? 388 MET A HB3  5  
ATOM 7295  H HG2  . MET A 1 13  ? -4.088  -1.911  -10.466 1.00 0.00 ? 388 MET A HG2  5  
ATOM 7296  H HG3  . MET A 1 13  ? -3.285  -2.674  -9.096  1.00 0.00 ? 388 MET A HG3  5  
ATOM 7297  H HE1  . MET A 1 13  ? -5.171  -3.319  -6.596  1.00 0.00 ? 388 MET A HE1  5  
ATOM 7298  H HE2  . MET A 1 13  ? -3.922  -2.090  -6.796  1.00 0.00 ? 388 MET A HE2  5  
ATOM 7299  H HE3  . MET A 1 13  ? -5.524  -1.632  -6.218  1.00 0.00 ? 388 MET A HE3  5  
ATOM 7300  N N    . SER A 1 14  ? -0.435  -1.116  -9.978  1.00 0.00 ? 389 SER A N    5  
ATOM 7301  C CA   . SER A 1 14  ? 0.654   -2.010  -10.350 1.00 0.00 ? 389 SER A CA   5  
ATOM 7302  C C    . SER A 1 14  ? 0.427   -3.403  -9.772  1.00 0.00 ? 389 SER A C    5  
ATOM 7303  O O    . SER A 1 14  ? 0.595   -3.623  -8.572  1.00 0.00 ? 389 SER A O    5  
ATOM 7304  C CB   . SER A 1 14  ? 1.991   -1.451  -9.860  1.00 0.00 ? 389 SER A CB   5  
ATOM 7305  O OG   . SER A 1 14  ? 2.156   -1.664  -8.469  1.00 0.00 ? 389 SER A OG   5  
ATOM 7306  H H    . SER A 1 14  ? -0.423  -0.689  -9.095  1.00 0.00 ? 389 SER A H    5  
ATOM 7307  H HA   . SER A 1 14  ? 0.674   -2.079  -11.428 1.00 0.00 ? 389 SER A HA   5  
ATOM 7308  H HB2  . SER A 1 14  ? 2.797   -1.942  -10.385 1.00 0.00 ? 389 SER A HB2  5  
ATOM 7309  H HB3  . SER A 1 14  ? 2.028   -0.390  -10.056 1.00 0.00 ? 389 SER A HB3  5  
ATOM 7310  H HG   . SER A 1 14  ? 1.580   -1.070  -7.984  1.00 0.00 ? 389 SER A HG   5  
ATOM 7311  N N    . LEU A 1 15  ? 0.041   -4.340  -10.633 1.00 0.00 ? 390 LEU A N    5  
ATOM 7312  C CA   . LEU A 1 15  ? -0.215  -5.713  -10.209 1.00 0.00 ? 390 LEU A CA   5  
ATOM 7313  C C    . LEU A 1 15  ? 0.989   -6.295  -9.472  1.00 0.00 ? 390 LEU A C    5  
ATOM 7314  O O    . LEU A 1 15  ? 1.947   -6.756  -10.093 1.00 0.00 ? 390 LEU A O    5  
ATOM 7315  C CB   . LEU A 1 15  ? -0.560  -6.586  -11.419 1.00 0.00 ? 390 LEU A CB   5  
ATOM 7316  C CG   . LEU A 1 15  ? -1.714  -7.567  -11.200 1.00 0.00 ? 390 LEU A CG   5  
ATOM 7317  C CD1  . LEU A 1 15  ? -2.952  -6.835  -10.699 1.00 0.00 ? 390 LEU A CD1  5  
ATOM 7318  C CD2  . LEU A 1 15  ? -2.020  -8.323  -12.485 1.00 0.00 ? 390 LEU A CD2  5  
ATOM 7319  H H    . LEU A 1 15  ? -0.078  -4.102  -11.575 1.00 0.00 ? 390 LEU A H    5  
ATOM 7320  H HA   . LEU A 1 15  ? -1.058  -5.698  -9.536  1.00 0.00 ? 390 LEU A HA   5  
ATOM 7321  H HB2  . LEU A 1 15  ? -0.819  -5.936  -12.242 1.00 0.00 ? 390 LEU A HB2  5  
ATOM 7322  H HB3  . LEU A 1 15  ? 0.318   -7.153  -11.691 1.00 0.00 ? 390 LEU A HB3  5  
ATOM 7323  H HG   . LEU A 1 15  ? -1.427  -8.288  -10.448 1.00 0.00 ? 390 LEU A HG   5  
ATOM 7324  H HD11 . LEU A 1 15  ? -2.744  -5.777  -10.629 1.00 0.00 ? 390 LEU A HD11 5  
ATOM 7325  H HD12 . LEU A 1 15  ? -3.770  -6.997  -11.385 1.00 0.00 ? 390 LEU A HD12 5  
ATOM 7326  H HD13 . LEU A 1 15  ? -3.223  -7.213  -9.724  1.00 0.00 ? 390 LEU A HD13 5  
ATOM 7327  H HD21 . LEU A 1 15  ? -2.430  -7.641  -13.215 1.00 0.00 ? 390 LEU A HD21 5  
ATOM 7328  H HD22 . LEU A 1 15  ? -1.111  -8.759  -12.871 1.00 0.00 ? 390 LEU A HD22 5  
ATOM 7329  H HD23 . LEU A 1 15  ? -2.736  -9.105  -12.281 1.00 0.00 ? 390 LEU A HD23 5  
ATOM 7330  N N    . THR A 1 16  ? 0.929   -6.274  -8.145  1.00 0.00 ? 391 THR A N    5  
ATOM 7331  C CA   . THR A 1 16  ? 2.011   -6.802  -7.322  1.00 0.00 ? 391 THR A CA   5  
ATOM 7332  C C    . THR A 1 16  ? 1.832   -8.298  -7.085  1.00 0.00 ? 391 THR A C    5  
ATOM 7333  O O    . THR A 1 16  ? 0.756   -8.848  -7.320  1.00 0.00 ? 391 THR A O    5  
ATOM 7334  C CB   . THR A 1 16  ? 2.075   -6.063  -5.983  1.00 0.00 ? 391 THR A CB   5  
ATOM 7335  O OG1  . THR A 1 16  ? 2.938   -6.732  -5.081  1.00 0.00 ? 391 THR A OG1  5  
ATOM 7336  C CG2  . THR A 1 16  ? 0.726   -5.925  -5.309  1.00 0.00 ? 391 THR A CG2  5  
ATOM 7337  H H    . THR A 1 16  ? 0.138   -5.895  -7.708  1.00 0.00 ? 391 THR A H    5  
ATOM 7338  H HA   . THR A 1 16  ? 2.938   -6.644  -7.853  1.00 0.00 ? 391 THR A HA   5  
ATOM 7339  H HB   . THR A 1 16  ? 2.463   -5.069  -6.151  1.00 0.00 ? 391 THR A HB   5  
ATOM 7340  H HG1  . THR A 1 16  ? 3.820   -6.358  -5.145  1.00 0.00 ? 391 THR A HG1  5  
ATOM 7341  H HG21 . THR A 1 16  ? 0.183   -6.854  -5.396  1.00 0.00 ? 391 THR A HG21 5  
ATOM 7342  H HG22 . THR A 1 16  ? 0.868   -5.687  -4.265  1.00 0.00 ? 391 THR A HG22 5  
ATOM 7343  H HG23 . THR A 1 16  ? 0.165   -5.134  -5.786  1.00 0.00 ? 391 THR A HG23 5  
ATOM 7344  N N    . SER A 1 17  ? 2.892   -8.951  -6.619  1.00 0.00 ? 392 SER A N    5  
ATOM 7345  C CA   . SER A 1 17  ? 2.850   -10.386 -6.353  1.00 0.00 ? 392 SER A CA   5  
ATOM 7346  C C    . SER A 1 17  ? 1.768   -10.723 -5.331  1.00 0.00 ? 392 SER A C    5  
ATOM 7347  O O    . SER A 1 17  ? 1.199   -11.814 -5.355  1.00 0.00 ? 392 SER A O    5  
ATOM 7348  C CB   . SER A 1 17  ? 4.211   -10.872 -5.852  1.00 0.00 ? 392 SER A CB   5  
ATOM 7349  O OG   . SER A 1 17  ? 5.263   -10.355 -6.650  1.00 0.00 ? 392 SER A OG   5  
ATOM 7350  H H    . SER A 1 17  ? 3.722   -8.458  -6.452  1.00 0.00 ? 392 SER A H    5  
ATOM 7351  H HA   . SER A 1 17  ? 2.619   -10.886 -7.281  1.00 0.00 ? 392 SER A HA   5  
ATOM 7352  H HB2  . SER A 1 17  ? 4.355   -10.545 -4.833  1.00 0.00 ? 392 SER A HB2  5  
ATOM 7353  H HB3  . SER A 1 17  ? 4.242   -11.950 -5.892  1.00 0.00 ? 392 SER A HB3  5  
ATOM 7354  H HG   . SER A 1 17  ? 5.032   -10.437 -7.577  1.00 0.00 ? 392 SER A HG   5  
ATOM 7355  N N    . SER A 1 18  ? 1.490   -9.783  -4.435  1.00 0.00 ? 393 SER A N    5  
ATOM 7356  C CA   . SER A 1 18  ? 0.477   -9.983  -3.404  1.00 0.00 ? 393 SER A CA   5  
ATOM 7357  C C    . SER A 1 18  ? -0.930  -9.792  -3.968  1.00 0.00 ? 393 SER A C    5  
ATOM 7358  O O    . SER A 1 18  ? -1.910  -10.245 -3.376  1.00 0.00 ? 393 SER A O    5  
ATOM 7359  C CB   . SER A 1 18  ? 0.705   -9.017  -2.241  1.00 0.00 ? 393 SER A CB   5  
ATOM 7360  O OG   . SER A 1 18  ? 1.912   -9.316  -1.559  1.00 0.00 ? 393 SER A OG   5  
ATOM 7361  H H    . SER A 1 18  ? 1.978   -8.933  -4.466  1.00 0.00 ? 393 SER A H    5  
ATOM 7362  H HA   . SER A 1 18  ? 0.571   -10.996 -3.041  1.00 0.00 ? 393 SER A HA   5  
ATOM 7363  H HB2  . SER A 1 18  ? 0.762   -8.008  -2.618  1.00 0.00 ? 393 SER A HB2  5  
ATOM 7364  H HB3  . SER A 1 18  ? -0.116  -9.096  -1.544  1.00 0.00 ? 393 SER A HB3  5  
ATOM 7365  H HG   . SER A 1 18  ? 2.608   -9.482  -2.199  1.00 0.00 ? 393 SER A HG   5  
ATOM 7366  N N    . LYS A 1 19  ? -1.026  -9.120  -5.112  1.00 0.00 ? 394 LYS A N    5  
ATOM 7367  C CA   . LYS A 1 19  ? -2.317  -8.871  -5.745  1.00 0.00 ? 394 LYS A CA   5  
ATOM 7368  C C    . LYS A 1 19  ? -2.591  -9.886  -6.849  1.00 0.00 ? 394 LYS A C    5  
ATOM 7369  O O    . LYS A 1 19  ? -3.651  -10.511 -6.883  1.00 0.00 ? 394 LYS A O    5  
ATOM 7370  C CB   . LYS A 1 19  ? -2.359  -7.453  -6.319  1.00 0.00 ? 394 LYS A CB   5  
ATOM 7371  C CG   . LYS A 1 19  ? -2.845  -6.409  -5.326  1.00 0.00 ? 394 LYS A CG   5  
ATOM 7372  C CD   . LYS A 1 19  ? -4.229  -5.894  -5.688  1.00 0.00 ? 394 LYS A CD   5  
ATOM 7373  C CE   . LYS A 1 19  ? -5.306  -6.915  -5.358  1.00 0.00 ? 394 LYS A CE   5  
ATOM 7374  N NZ   . LYS A 1 19  ? -5.551  -7.009  -3.892  1.00 0.00 ? 394 LYS A NZ   5  
ATOM 7375  H H    . LYS A 1 19  ? -0.212  -8.780  -5.537  1.00 0.00 ? 394 LYS A H    5  
ATOM 7376  H HA   . LYS A 1 19  ? -3.080  -8.966  -4.987  1.00 0.00 ? 394 LYS A HA   5  
ATOM 7377  H HB2  . LYS A 1 19  ? -1.366  -7.177  -6.641  1.00 0.00 ? 394 LYS A HB2  5  
ATOM 7378  H HB3  . LYS A 1 19  ? -3.021  -7.442  -7.173  1.00 0.00 ? 394 LYS A HB3  5  
ATOM 7379  H HG2  . LYS A 1 19  ? -2.884  -6.852  -4.342  1.00 0.00 ? 394 LYS A HG2  5  
ATOM 7380  H HG3  . LYS A 1 19  ? -2.152  -5.580  -5.322  1.00 0.00 ? 394 LYS A HG3  5  
ATOM 7381  H HD2  . LYS A 1 19  ? -4.424  -4.988  -5.134  1.00 0.00 ? 394 LYS A HD2  5  
ATOM 7382  H HD3  . LYS A 1 19  ? -4.258  -5.684  -6.747  1.00 0.00 ? 394 LYS A HD3  5  
ATOM 7383  H HE2  . LYS A 1 19  ? -6.224  -6.623  -5.848  1.00 0.00 ? 394 LYS A HE2  5  
ATOM 7384  H HE3  . LYS A 1 19  ? -4.994  -7.880  -5.727  1.00 0.00 ? 394 LYS A HE3  5  
ATOM 7385  H HZ1  . LYS A 1 19  ? -6.198  -7.796  -3.687  1.00 0.00 ? 394 LYS A HZ1  5  
ATOM 7386  H HZ2  . LYS A 1 19  ? -4.654  -7.173  -3.390  1.00 0.00 ? 394 LYS A HZ2  5  
ATOM 7387  H HZ3  . LYS A 1 19  ? -5.974  -6.126  -3.542  1.00 0.00 ? 394 LYS A HZ3  5  
ATOM 7388  N N    . ALA A 1 20  ? -1.630  -10.044 -7.753  1.00 0.00 ? 395 ALA A N    5  
ATOM 7389  C CA   . ALA A 1 20  ? -1.769  -10.982 -8.861  1.00 0.00 ? 395 ALA A CA   5  
ATOM 7390  C C    . ALA A 1 20  ? -2.030  -12.398 -8.359  1.00 0.00 ? 395 ALA A C    5  
ATOM 7391  O O    . ALA A 1 20  ? -2.909  -13.095 -8.866  1.00 0.00 ? 395 ALA A O    5  
ATOM 7392  C CB   . ALA A 1 20  ? -0.523  -10.953 -9.733  1.00 0.00 ? 395 ALA A CB   5  
ATOM 7393  H H    . ALA A 1 20  ? -0.809  -9.515  -7.674  1.00 0.00 ? 395 ALA A H    5  
ATOM 7394  H HA   . ALA A 1 20  ? -2.607  -10.664 -9.463  1.00 0.00 ? 395 ALA A HA   5  
ATOM 7395  H HB1  . ALA A 1 20  ? -0.774  -11.279 -10.731 1.00 0.00 ? 395 ALA A HB1  5  
ATOM 7396  H HB2  . ALA A 1 20  ? -0.133  -9.946  -9.771  1.00 0.00 ? 395 ALA A HB2  5  
ATOM 7397  H HB3  . ALA A 1 20  ? 0.224   -11.612 -9.316  1.00 0.00 ? 395 ALA A HB3  5  
ATOM 7398  N N    . LYS A 1 21  ? -1.259  -12.819 -7.362  1.00 0.00 ? 396 LYS A N    5  
ATOM 7399  C CA   . LYS A 1 21  ? -1.405  -14.153 -6.791  1.00 0.00 ? 396 LYS A CA   5  
ATOM 7400  C C    . LYS A 1 21  ? -2.742  -14.299 -6.072  1.00 0.00 ? 396 LYS A C    5  
ATOM 7401  O O    . LYS A 1 21  ? -3.302  -15.394 -6.000  1.00 0.00 ? 396 LYS A O    5  
ATOM 7402  C CB   . LYS A 1 21  ? -0.256  -14.443 -5.824  1.00 0.00 ? 396 LYS A CB   5  
ATOM 7403  C CG   . LYS A 1 21  ? 0.170   -15.903 -5.807  1.00 0.00 ? 396 LYS A CG   5  
ATOM 7404  C CD   . LYS A 1 21  ? 0.620   -16.367 -7.182  1.00 0.00 ? 396 LYS A CD   5  
ATOM 7405  C CE   . LYS A 1 21  ? 1.812   -17.306 -7.091  1.00 0.00 ? 396 LYS A CE   5  
ATOM 7406  N NZ   . LYS A 1 21  ? 1.418   -18.659 -6.610  1.00 0.00 ? 396 LYS A NZ   5  
ATOM 7407  H H    . LYS A 1 21  ? -0.574  -12.217 -7.000  1.00 0.00 ? 396 LYS A H    5  
ATOM 7408  H HA   . LYS A 1 21  ? -1.368  -14.864 -7.603  1.00 0.00 ? 396 LYS A HA   5  
ATOM 7409  H HB2  . LYS A 1 21  ? 0.597   -13.844 -6.106  1.00 0.00 ? 396 LYS A HB2  5  
ATOM 7410  H HB3  . LYS A 1 21  ? -0.564  -14.169 -4.825  1.00 0.00 ? 396 LYS A HB3  5  
ATOM 7411  H HG2  . LYS A 1 21  ? 0.988   -16.021 -5.113  1.00 0.00 ? 396 LYS A HG2  5  
ATOM 7412  H HG3  . LYS A 1 21  ? -0.666  -16.508 -5.487  1.00 0.00 ? 396 LYS A HG3  5  
ATOM 7413  H HD2  . LYS A 1 21  ? -0.197  -16.886 -7.661  1.00 0.00 ? 396 LYS A HD2  5  
ATOM 7414  H HD3  . LYS A 1 21  ? 0.896   -15.505 -7.771  1.00 0.00 ? 396 LYS A HD3  5  
ATOM 7415  H HE2  . LYS A 1 21  ? 2.259   -17.397 -8.070  1.00 0.00 ? 396 LYS A HE2  5  
ATOM 7416  H HE3  . LYS A 1 21  ? 2.533   -16.884 -6.405  1.00 0.00 ? 396 LYS A HE3  5  
ATOM 7417  H HZ1  . LYS A 1 21  ? 1.582   -18.736 -5.586  1.00 0.00 ? 396 LYS A HZ1  5  
ATOM 7418  H HZ2  . LYS A 1 21  ? 0.411   -18.828 -6.803  1.00 0.00 ? 396 LYS A HZ2  5  
ATOM 7419  H HZ3  . LYS A 1 21  ? 1.979   -19.388 -7.095  1.00 0.00 ? 396 LYS A HZ3  5  
ATOM 7420  N N    . GLU A 1 22  ? -3.248  -13.192 -5.539  1.00 0.00 ? 397 GLU A N    5  
ATOM 7421  C CA   . GLU A 1 22  ? -4.519  -13.202 -4.822  1.00 0.00 ? 397 GLU A CA   5  
ATOM 7422  C C    . GLU A 1 22  ? -5.692  -13.335 -5.790  1.00 0.00 ? 397 GLU A C    5  
ATOM 7423  O O    . GLU A 1 22  ? -6.650  -14.059 -5.521  1.00 0.00 ? 397 GLU A O    5  
ATOM 7424  C CB   . GLU A 1 22  ? -4.670  -11.928 -3.990  1.00 0.00 ? 397 GLU A CB   5  
ATOM 7425  C CG   . GLU A 1 22  ? -5.445  -12.135 -2.699  1.00 0.00 ? 397 GLU A CG   5  
ATOM 7426  C CD   . GLU A 1 22  ? -6.340  -10.959 -2.360  1.00 0.00 ? 397 GLU A CD   5  
ATOM 7427  O OE1  . GLU A 1 22  ? -7.488  -10.926 -2.850  1.00 0.00 ? 397 GLU A OE1  5  
ATOM 7428  O OE2  . GLU A 1 22  ? -5.894  -10.071 -1.603  1.00 0.00 ? 397 GLU A OE2  5  
ATOM 7429  H H    . GLU A 1 22  ? -2.756  -12.350 -5.627  1.00 0.00 ? 397 GLU A H    5  
ATOM 7430  H HA   . GLU A 1 22  ? -4.518  -14.055 -4.160  1.00 0.00 ? 397 GLU A HA   5  
ATOM 7431  H HB2  . GLU A 1 22  ? -3.688  -11.556 -3.740  1.00 0.00 ? 397 GLU A HB2  5  
ATOM 7432  H HB3  . GLU A 1 22  ? -5.188  -11.186 -4.580  1.00 0.00 ? 397 GLU A HB3  5  
ATOM 7433  H HG2  . GLU A 1 22  ? -6.059  -13.018 -2.800  1.00 0.00 ? 397 GLU A HG2  5  
ATOM 7434  H HG3  . GLU A 1 22  ? -4.741  -12.278 -1.891  1.00 0.00 ? 397 GLU A HG3  5  
ATOM 7435  N N    . LEU A 1 23  ? -5.609  -12.630 -6.913  1.00 0.00 ? 398 LEU A N    5  
ATOM 7436  C CA   . LEU A 1 23  ? -6.665  -12.671 -7.919  1.00 0.00 ? 398 LEU A CA   5  
ATOM 7437  C C    . LEU A 1 23  ? -6.864  -14.089 -8.442  1.00 0.00 ? 398 LEU A C    5  
ATOM 7438  O O    . LEU A 1 23  ? -7.991  -14.516 -8.694  1.00 0.00 ? 398 LEU A O    5  
ATOM 7439  C CB   . LEU A 1 23  ? -6.329  -11.730 -9.078  1.00 0.00 ? 398 LEU A CB   5  
ATOM 7440  C CG   . LEU A 1 23  ? -6.152  -10.262 -8.692  1.00 0.00 ? 398 LEU A CG   5  
ATOM 7441  C CD1  . LEU A 1 23  ? -5.144  -9.586  -9.609  1.00 0.00 ? 398 LEU A CD1  5  
ATOM 7442  C CD2  . LEU A 1 23  ? -7.487  -9.535  -8.738  1.00 0.00 ? 398 LEU A CD2  5  
ATOM 7443  H H    . LEU A 1 23  ? -4.820  -12.070 -7.071  1.00 0.00 ? 398 LEU A H    5  
ATOM 7444  H HA   . LEU A 1 23  ? -7.580  -12.339 -7.452  1.00 0.00 ? 398 LEU A HA   5  
ATOM 7445  H HB2  . LEU A 1 23  ? -5.414  -12.073 -9.538  1.00 0.00 ? 398 LEU A HB2  5  
ATOM 7446  H HB3  . LEU A 1 23  ? -7.122  -11.794 -9.807  1.00 0.00 ? 398 LEU A HB3  5  
ATOM 7447  H HG   . LEU A 1 23  ? -5.773  -10.205 -7.682  1.00 0.00 ? 398 LEU A HG   5  
ATOM 7448  H HD11 . LEU A 1 23  ? -4.506  -10.335 -10.057 1.00 0.00 ? 398 LEU A HD11 5  
ATOM 7449  H HD12 . LEU A 1 23  ? -5.668  -9.049  -10.387 1.00 0.00 ? 398 LEU A HD12 5  
ATOM 7450  H HD13 . LEU A 1 23  ? -4.541  -8.896  -9.037  1.00 0.00 ? 398 LEU A HD13 5  
ATOM 7451  H HD21 . LEU A 1 23  ? -7.319  -8.482  -8.907  1.00 0.00 ? 398 LEU A HD21 5  
ATOM 7452  H HD22 . LEU A 1 23  ? -8.088  -9.936  -9.541  1.00 0.00 ? 398 LEU A HD22 5  
ATOM 7453  H HD23 . LEU A 1 23  ? -8.004  -9.671  -7.799  1.00 0.00 ? 398 LEU A HD23 5  
ATOM 7454  N N    . LYS A 1 24  ? -5.763  -14.813 -8.608  1.00 0.00 ? 399 LYS A N    5  
ATOM 7455  C CA   . LYS A 1 24  ? -5.814  -16.184 -9.104  1.00 0.00 ? 399 LYS A CA   5  
ATOM 7456  C C    . LYS A 1 24  ? -6.374  -17.128 -8.044  1.00 0.00 ? 399 LYS A C    5  
ATOM 7457  O O    . LYS A 1 24  ? -7.062  -18.098 -8.363  1.00 0.00 ? 399 LYS A O    5  
ATOM 7458  C CB   . LYS A 1 24  ? -4.421  -16.646 -9.531  1.00 0.00 ? 399 LYS A CB   5  
ATOM 7459  C CG   . LYS A 1 24  ? -4.134  -16.432 -11.009 1.00 0.00 ? 399 LYS A CG   5  
ATOM 7460  C CD   . LYS A 1 24  ? -3.753  -17.732 -11.700 1.00 0.00 ? 399 LYS A CD   5  
ATOM 7461  C CE   . LYS A 1 24  ? -4.981  -18.542 -12.084 1.00 0.00 ? 399 LYS A CE   5  
ATOM 7462  N NZ   . LYS A 1 24  ? -4.880  -19.956 -11.625 1.00 0.00 ? 399 LYS A NZ   5  
ATOM 7463  H H    . LYS A 1 24  ? -4.892  -14.416 -8.392  1.00 0.00 ? 399 LYS A H    5  
ATOM 7464  H HA   . LYS A 1 24  ? -6.468  -16.200 -9.963  1.00 0.00 ? 399 LYS A HA   5  
ATOM 7465  H HB2  . LYS A 1 24  ? -3.683  -16.099 -8.961  1.00 0.00 ? 399 LYS A HB2  5  
ATOM 7466  H HB3  . LYS A 1 24  ? -4.320  -17.699 -9.314  1.00 0.00 ? 399 LYS A HB3  5  
ATOM 7467  H HG2  . LYS A 1 24  ? -5.018  -16.031 -11.483 1.00 0.00 ? 399 LYS A HG2  5  
ATOM 7468  H HG3  . LYS A 1 24  ? -3.320  -15.729 -11.109 1.00 0.00 ? 399 LYS A HG3  5  
ATOM 7469  H HD2  . LYS A 1 24  ? -3.192  -17.503 -12.593 1.00 0.00 ? 399 LYS A HD2  5  
ATOM 7470  H HD3  . LYS A 1 24  ? -3.141  -18.319 -11.030 1.00 0.00 ? 399 LYS A HD3  5  
ATOM 7471  H HE2  . LYS A 1 24  ? -5.852  -18.089 -11.636 1.00 0.00 ? 399 LYS A HE2  5  
ATOM 7472  H HE3  . LYS A 1 24  ? -5.083  -18.529 -13.159 1.00 0.00 ? 399 LYS A HE3  5  
ATOM 7473  H HZ1  . LYS A 1 24  ? -5.294  -20.592 -12.335 1.00 0.00 ? 399 LYS A HZ1  5  
ATOM 7474  H HZ2  . LYS A 1 24  ? -3.883  -20.215 -11.482 1.00 0.00 ? 399 LYS A HZ2  5  
ATOM 7475  H HZ3  . LYS A 1 24  ? -5.391  -20.076 -10.727 1.00 0.00 ? 399 LYS A HZ3  5  
ATOM 7476  N N    . ASP A 1 25  ? -6.072  -16.840 -6.783  1.00 0.00 ? 400 ASP A N    5  
ATOM 7477  C CA   . ASP A 1 25  ? -6.544  -17.664 -5.676  1.00 0.00 ? 400 ASP A CA   5  
ATOM 7478  C C    . ASP A 1 25  ? -8.011  -17.380 -5.368  1.00 0.00 ? 400 ASP A C    5  
ATOM 7479  O O    . ASP A 1 25  ? -8.737  -18.255 -4.897  1.00 0.00 ? 400 ASP A O    5  
ATOM 7480  C CB   . ASP A 1 25  ? -5.692  -17.418 -4.429  1.00 0.00 ? 400 ASP A CB   5  
ATOM 7481  C CG   . ASP A 1 25  ? -4.355  -18.130 -4.493  1.00 0.00 ? 400 ASP A CG   5  
ATOM 7482  O OD1  . ASP A 1 25  ? -4.319  -19.284 -4.970  1.00 0.00 ? 400 ASP A OD1  5  
ATOM 7483  O OD2  . ASP A 1 25  ? -3.344  -17.535 -4.064  1.00 0.00 ? 400 ASP A OD2  5  
ATOM 7484  H H    . ASP A 1 25  ? -5.519  -16.054 -6.590  1.00 0.00 ? 400 ASP A H    5  
ATOM 7485  H HA   . ASP A 1 25  ? -6.444  -18.699 -5.969  1.00 0.00 ? 400 ASP A HA   5  
ATOM 7486  H HB2  . ASP A 1 25  ? -5.510  -16.358 -4.329  1.00 0.00 ? 400 ASP A HB2  5  
ATOM 7487  H HB3  . ASP A 1 25  ? -6.228  -17.769 -3.560  1.00 0.00 ? 400 ASP A HB3  5  
ATOM 7488  N N    . ARG A 1 26  ? -8.442  -16.152 -5.637  1.00 0.00 ? 401 ARG A N    5  
ATOM 7489  C CA   . ARG A 1 26  ? -9.823  -15.755 -5.386  1.00 0.00 ? 401 ARG A CA   5  
ATOM 7490  C C    . ARG A 1 26  ? -10.712 -16.084 -6.582  1.00 0.00 ? 401 ARG A C    5  
ATOM 7491  O O    . ARG A 1 26  ? -11.738 -16.747 -6.440  1.00 0.00 ? 401 ARG A O    5  
ATOM 7492  C CB   . ARG A 1 26  ? -9.896  -14.258 -5.073  1.00 0.00 ? 401 ARG A CB   5  
ATOM 7493  C CG   . ARG A 1 26  ? -10.439 -13.954 -3.686  1.00 0.00 ? 401 ARG A CG   5  
ATOM 7494  C CD   . ARG A 1 26  ? -10.175 -12.511 -3.285  1.00 0.00 ? 401 ARG A CD   5  
ATOM 7495  N NE   . ARG A 1 26  ? -9.539  -12.413 -1.974  1.00 0.00 ? 401 ARG A NE   5  
ATOM 7496  C CZ   . ARG A 1 26  ? -10.179 -12.607 -0.823  1.00 0.00 ? 401 ARG A CZ   5  
ATOM 7497  N NH1  . ARG A 1 26  ? -11.472 -12.908 -0.817  1.00 0.00 ? 401 ARG A NH1  5  
ATOM 7498  N NH2  . ARG A 1 26  ? -9.525  -12.500 0.325   1.00 0.00 ? 401 ARG A NH2  5  
ATOM 7499  H H    . ARG A 1 26  ? -7.817  -15.496 -6.011  1.00 0.00 ? 401 ARG A H    5  
ATOM 7500  H HA   . ARG A 1 26  ? -10.175 -16.310 -4.529  1.00 0.00 ? 401 ARG A HA   5  
ATOM 7501  H HB2  . ARG A 1 26  ? -8.904  -13.839 -5.146  1.00 0.00 ? 401 ARG A HB2  5  
ATOM 7502  H HB3  . ARG A 1 26  ? -10.535 -13.779 -5.799  1.00 0.00 ? 401 ARG A HB3  5  
ATOM 7503  H HG2  . ARG A 1 26  ? -11.505 -14.129 -3.680  1.00 0.00 ? 401 ARG A HG2  5  
ATOM 7504  H HG3  . ARG A 1 26  ? -9.961  -14.610 -2.971  1.00 0.00 ? 401 ARG A HG3  5  
ATOM 7505  H HD2  . ARG A 1 26  ? -9.529  -12.057 -4.022  1.00 0.00 ? 401 ARG A HD2  5  
ATOM 7506  H HD3  . ARG A 1 26  ? -11.116 -11.981 -3.259  1.00 0.00 ? 401 ARG A HD3  5  
ATOM 7507  H HE   . ARG A 1 26  ? -8.585  -12.192 -1.949  1.00 0.00 ? 401 ARG A HE   5  
ATOM 7508  H HH11 . ARG A 1 26  ? -11.971 -12.989 -1.680  1.00 0.00 ? 401 ARG A HH11 5  
ATOM 7509  H HH12 . ARG A 1 26  ? -11.947 -13.052 0.051   1.00 0.00 ? 401 ARG A HH12 5  
ATOM 7510  H HH21 . ARG A 1 26  ? -8.551  -12.273 0.327   1.00 0.00 ? 401 ARG A HH21 5  
ATOM 7511  H HH22 . ARG A 1 26  ? -10.005 -12.644 1.190   1.00 0.00 ? 401 ARG A HH22 5  
ATOM 7512  N N    . HIS A 1 27  ? -10.310 -15.616 -7.759  1.00 0.00 ? 402 HIS A N    5  
ATOM 7513  C CA   . HIS A 1 27  ? -11.070 -15.859 -8.980  1.00 0.00 ? 402 HIS A CA   5  
ATOM 7514  C C    . HIS A 1 27  ? -10.265 -16.695 -9.967  1.00 0.00 ? 402 HIS A C    5  
ATOM 7515  O O    . HIS A 1 27  ? -9.224  -16.260 -10.461 1.00 0.00 ? 402 HIS A O    5  
ATOM 7516  C CB   . HIS A 1 27  ? -11.475 -14.533 -9.626  1.00 0.00 ? 402 HIS A CB   5  
ATOM 7517  C CG   . HIS A 1 27  ? -12.551 -13.807 -8.879  1.00 0.00 ? 402 HIS A CG   5  
ATOM 7518  N ND1  . HIS A 1 27  ? -13.171 -12.675 -9.364  1.00 0.00 ? 402 HIS A ND1  5  
ATOM 7519  C CD2  . HIS A 1 27  ? -13.118 -14.057 -7.675  1.00 0.00 ? 402 HIS A CD2  5  
ATOM 7520  C CE1  . HIS A 1 27  ? -14.071 -12.260 -8.491  1.00 0.00 ? 402 HIS A CE1  5  
ATOM 7521  N NE2  . HIS A 1 27  ? -14.059 -13.082 -7.458  1.00 0.00 ? 402 HIS A NE2  5  
ATOM 7522  H H    . HIS A 1 27  ? -9.483  -15.093 -7.809  1.00 0.00 ? 402 HIS A H    5  
ATOM 7523  H HA   . HIS A 1 27  ? -11.962 -16.405 -8.711  1.00 0.00 ? 402 HIS A HA   5  
ATOM 7524  H HB2  . HIS A 1 27  ? -10.612 -13.887 -9.676  1.00 0.00 ? 402 HIS A HB2  5  
ATOM 7525  H HB3  . HIS A 1 27  ? -11.835 -14.723 -10.626 1.00 0.00 ? 402 HIS A HB3  5  
ATOM 7526  H HD1  . HIS A 1 27  ? -12.979 -12.240 -10.221 1.00 0.00 ? 402 HIS A HD1  5  
ATOM 7527  H HD2  . HIS A 1 27  ? -12.874 -14.873 -7.009  1.00 0.00 ? 402 HIS A HD2  5  
ATOM 7528  H HE1  . HIS A 1 27  ? -14.711 -11.396 -8.604  1.00 0.00 ? 402 HIS A HE1  5  
ATOM 7529  H HE2  . HIS A 1 27  ? -14.571 -12.958 -6.631  1.00 0.00 ? 402 HIS A HE2  5  
ATOM 7530  N N    . ARG A 1 28  ? -10.753 -17.898 -10.253 1.00 0.00 ? 403 ARG A N    5  
ATOM 7531  C CA   . ARG A 1 28  ? -10.080 -18.795 -11.183 1.00 0.00 ? 403 ARG A CA   5  
ATOM 7532  C C    . ARG A 1 28  ? -10.535 -18.533 -12.615 1.00 0.00 ? 403 ARG A C    5  
ATOM 7533  O O    . ARG A 1 28  ? -11.005 -19.437 -13.306 1.00 0.00 ? 403 ARG A O    5  
ATOM 7534  C CB   . ARG A 1 28  ? -10.349 -20.252 -10.807 1.00 0.00 ? 403 ARG A CB   5  
ATOM 7535  C CG   . ARG A 1 28  ? -9.638  -21.247 -11.710 1.00 0.00 ? 403 ARG A CG   5  
ATOM 7536  C CD   . ARG A 1 28  ? -10.536 -22.420 -12.072 1.00 0.00 ? 403 ARG A CD   5  
ATOM 7537  N NE   . ARG A 1 28  ? -10.036 -23.680 -11.528 1.00 0.00 ? 403 ARG A NE   5  
ATOM 7538  C CZ   . ARG A 1 28  ? -9.057  -24.392 -12.082 1.00 0.00 ? 403 ARG A CZ   5  
ATOM 7539  N NH1  . ARG A 1 28  ? -8.467  -23.970 -13.195 1.00 0.00 ? 403 ARG A NH1  5  
ATOM 7540  N NH2  . ARG A 1 28  ? -8.665  -25.528 -11.522 1.00 0.00 ? 403 ARG A NH2  5  
ATOM 7541  H H    . ARG A 1 28  ? -11.587 -18.189 -9.829  1.00 0.00 ? 403 ARG A H    5  
ATOM 7542  H HA   . ARG A 1 28  ? -9.019  -18.605 -11.116 1.00 0.00 ? 403 ARG A HA   5  
ATOM 7543  H HB2  . ARG A 1 28  ? -10.019 -20.416 -9.792  1.00 0.00 ? 403 ARG A HB2  5  
ATOM 7544  H HB3  . ARG A 1 28  ? -11.411 -20.436 -10.867 1.00 0.00 ? 403 ARG A HB3  5  
ATOM 7545  H HG2  . ARG A 1 28  ? -9.338  -20.742 -12.616 1.00 0.00 ? 403 ARG A HG2  5  
ATOM 7546  H HG3  . ARG A 1 28  ? -8.763  -21.619 -11.197 1.00 0.00 ? 403 ARG A HG3  5  
ATOM 7547  H HD2  . ARG A 1 28  ? -11.525 -22.238 -11.679 1.00 0.00 ? 403 ARG A HD2  5  
ATOM 7548  H HD3  . ARG A 1 28  ? -10.586 -22.499 -13.148 1.00 0.00 ? 403 ARG A HD3  5  
ATOM 7549  H HE   . ARG A 1 28  ? -10.452 -24.015 -10.707 1.00 0.00 ? 403 ARG A HE   5  
ATOM 7550  H HH11 . ARG A 1 28  ? -8.758  -23.114 -13.622 1.00 0.00 ? 403 ARG A HH11 5  
ATOM 7551  H HH12 . ARG A 1 28  ? -7.733  -24.510 -13.606 1.00 0.00 ? 403 ARG A HH12 5  
ATOM 7552  H HH21 . ARG A 1 28  ? -9.105  -25.850 -10.684 1.00 0.00 ? 403 ARG A HH21 5  
ATOM 7553  H HH22 . ARG A 1 28  ? -7.930  -26.063 -11.939 1.00 0.00 ? 403 ARG A HH22 5  
ATOM 7554  N N    . ASP A 1 29  ? -10.393 -17.287 -13.051 1.00 0.00 ? 404 ASP A N    5  
ATOM 7555  C CA   . ASP A 1 29  ? -10.786 -16.898 -14.400 1.00 0.00 ? 404 ASP A CA   5  
ATOM 7556  C C    . ASP A 1 29  ? -9.873  -15.802 -14.944 1.00 0.00 ? 404 ASP A C    5  
ATOM 7557  O O    . ASP A 1 29  ? -10.233 -15.093 -15.884 1.00 0.00 ? 404 ASP A O    5  
ATOM 7558  C CB   . ASP A 1 29  ? -12.240 -16.420 -14.408 1.00 0.00 ? 404 ASP A CB   5  
ATOM 7559  C CG   . ASP A 1 29  ? -12.440 -15.156 -13.594 1.00 0.00 ? 404 ASP A CG   5  
ATOM 7560  O OD1  . ASP A 1 29  ? -11.514 -14.777 -12.845 1.00 0.00 ? 404 ASP A OD1  5  
ATOM 7561  O OD2  . ASP A 1 29  ? -13.523 -14.543 -13.705 1.00 0.00 ? 404 ASP A OD2  5  
ATOM 7562  H H    . ASP A 1 29  ? -10.013 -16.614 -12.452 1.00 0.00 ? 404 ASP A H    5  
ATOM 7563  H HA   . ASP A 1 29  ? -10.701 -17.768 -15.034 1.00 0.00 ? 404 ASP A HA   5  
ATOM 7564  H HB2  . ASP A 1 29  ? -12.542 -16.222 -15.425 1.00 0.00 ? 404 ASP A HB2  5  
ATOM 7565  H HB3  . ASP A 1 29  ? -12.868 -17.195 -13.994 1.00 0.00 ? 404 ASP A HB3  5  
ATOM 7566  N N    . PHE A 1 30  ? -8.691  -15.667 -14.350 1.00 0.00 ? 405 PHE A N    5  
ATOM 7567  C CA   . PHE A 1 30  ? -7.731  -14.656 -14.778 1.00 0.00 ? 405 PHE A CA   5  
ATOM 7568  C C    . PHE A 1 30  ? -6.529  -15.302 -15.462 1.00 0.00 ? 405 PHE A C    5  
ATOM 7569  O O    . PHE A 1 30  ? -6.247  -16.481 -15.257 1.00 0.00 ? 405 PHE A O    5  
ATOM 7570  C CB   . PHE A 1 30  ? -7.267  -13.824 -13.581 1.00 0.00 ? 405 PHE A CB   5  
ATOM 7571  C CG   . PHE A 1 30  ? -8.271  -12.799 -13.137 1.00 0.00 ? 405 PHE A CG   5  
ATOM 7572  C CD1  . PHE A 1 30  ? -8.603  -11.734 -13.959 1.00 0.00 ? 405 PHE A CD1  5  
ATOM 7573  C CD2  . PHE A 1 30  ? -8.881  -12.900 -11.897 1.00 0.00 ? 405 PHE A CD2  5  
ATOM 7574  C CE1  . PHE A 1 30  ? -9.527  -10.790 -13.554 1.00 0.00 ? 405 PHE A CE1  5  
ATOM 7575  C CE2  . PHE A 1 30  ? -9.805  -11.958 -11.486 1.00 0.00 ? 405 PHE A CE2  5  
ATOM 7576  C CZ   . PHE A 1 30  ? -10.128 -10.901 -12.315 1.00 0.00 ? 405 PHE A CZ   5  
ATOM 7577  H H    . PHE A 1 30  ? -8.458  -16.260 -13.605 1.00 0.00 ? 405 PHE A H    5  
ATOM 7578  H HA   . PHE A 1 30  ? -8.227  -14.007 -15.485 1.00 0.00 ? 405 PHE A HA   5  
ATOM 7579  H HB2  . PHE A 1 30  ? -7.073  -14.483 -12.747 1.00 0.00 ? 405 PHE A HB2  5  
ATOM 7580  H HB3  . PHE A 1 30  ? -6.355  -13.307 -13.843 1.00 0.00 ? 405 PHE A HB3  5  
ATOM 7581  H HD1  . PHE A 1 30  ? -8.134  -11.645 -14.928 1.00 0.00 ? 405 PHE A HD1  5  
ATOM 7582  H HD2  . PHE A 1 30  ? -8.631  -13.726 -11.248 1.00 0.00 ? 405 PHE A HD2  5  
ATOM 7583  H HE1  . PHE A 1 30  ? -9.777  -9.964  -14.203 1.00 0.00 ? 405 PHE A HE1  5  
ATOM 7584  H HE2  . PHE A 1 30  ? -10.274 -12.048 -10.518 1.00 0.00 ? 405 PHE A HE2  5  
ATOM 7585  H HZ   . PHE A 1 30  ? -10.850 -10.164 -11.996 1.00 0.00 ? 405 PHE A HZ   5  
ATOM 7586  N N    . PRO A 1 31  ? -5.800  -14.530 -16.288 1.00 0.00 ? 406 PRO A N    5  
ATOM 7587  C CA   . PRO A 1 31  ? -4.623  -15.032 -17.005 1.00 0.00 ? 406 PRO A CA   5  
ATOM 7588  C C    . PRO A 1 31  ? -3.485  -15.399 -16.059 1.00 0.00 ? 406 PRO A C    5  
ATOM 7589  O O    . PRO A 1 31  ? -3.650  -15.392 -14.839 1.00 0.00 ? 406 PRO A O    5  
ATOM 7590  C CB   . PRO A 1 31  ? -4.216  -13.857 -17.899 1.00 0.00 ? 406 PRO A CB   5  
ATOM 7591  C CG   . PRO A 1 31  ? -4.792  -12.654 -17.236 1.00 0.00 ? 406 PRO A CG   5  
ATOM 7592  C CD   . PRO A 1 31  ? -6.067  -13.112 -16.588 1.00 0.00 ? 406 PRO A CD   5  
ATOM 7593  H HA   . PRO A 1 31  ? -4.869  -15.887 -17.617 1.00 0.00 ? 406 PRO A HA   5  
ATOM 7594  H HB2  . PRO A 1 31  ? -3.138  -13.800 -17.955 1.00 0.00 ? 406 PRO A HB2  5  
ATOM 7595  H HB3  . PRO A 1 31  ? -4.626  -13.995 -18.889 1.00 0.00 ? 406 PRO A HB3  5  
ATOM 7596  H HG2  . PRO A 1 31  ? -4.105  -12.281 -16.492 1.00 0.00 ? 406 PRO A HG2  5  
ATOM 7597  H HG3  . PRO A 1 31  ? -4.999  -11.892 -17.974 1.00 0.00 ? 406 PRO A HG3  5  
ATOM 7598  H HD2  . PRO A 1 31  ? -6.252  -12.553 -15.683 1.00 0.00 ? 406 PRO A HD2  5  
ATOM 7599  H HD3  . PRO A 1 31  ? -6.896  -13.013 -17.273 1.00 0.00 ? 406 PRO A HD3  5  
ATOM 7600  N N    . ASP A 1 32  ? -2.328  -15.721 -16.630 1.00 0.00 ? 407 ASP A N    5  
ATOM 7601  C CA   . ASP A 1 32  ? -1.161  -16.091 -15.838 1.00 0.00 ? 407 ASP A CA   5  
ATOM 7602  C C    . ASP A 1 32  ? -0.098  -14.999 -15.896 1.00 0.00 ? 407 ASP A C    5  
ATOM 7603  O O    . ASP A 1 32  ? 1.098   -15.279 -15.834 1.00 0.00 ? 407 ASP A O    5  
ATOM 7604  C CB   . ASP A 1 32  ? -0.579  -17.415 -16.337 1.00 0.00 ? 407 ASP A CB   5  
ATOM 7605  C CG   . ASP A 1 32  ? -0.379  -17.430 -17.839 1.00 0.00 ? 407 ASP A CG   5  
ATOM 7606  O OD1  . ASP A 1 32  ? -0.021  -16.374 -18.402 1.00 0.00 ? 407 ASP A OD1  5  
ATOM 7607  O OD2  . ASP A 1 32  ? -0.580  -18.499 -18.454 1.00 0.00 ? 407 ASP A OD2  5  
ATOM 7608  H H    . ASP A 1 32  ? -2.258  -15.708 -17.608 1.00 0.00 ? 407 ASP A H    5  
ATOM 7609  H HA   . ASP A 1 32  ? -1.481  -16.211 -14.814 1.00 0.00 ? 407 ASP A HA   5  
ATOM 7610  H HB2  . ASP A 1 32  ? 0.377   -17.581 -15.864 1.00 0.00 ? 407 ASP A HB2  5  
ATOM 7611  H HB3  . ASP A 1 32  ? -1.251  -18.218 -16.072 1.00 0.00 ? 407 ASP A HB3  5  
ATOM 7612  N N    . VAL A 1 33  ? -0.544  -13.752 -16.013 1.00 0.00 ? 408 VAL A N    5  
ATOM 7613  C CA   . VAL A 1 33  ? 0.368   -12.618 -16.077 1.00 0.00 ? 408 VAL A CA   5  
ATOM 7614  C C    . VAL A 1 33  ? 0.432   -11.887 -14.740 1.00 0.00 ? 408 VAL A C    5  
ATOM 7615  O O    . VAL A 1 33  ? -0.598  -11.543 -14.159 1.00 0.00 ? 408 VAL A O    5  
ATOM 7616  C CB   . VAL A 1 33  ? -0.052  -11.620 -17.174 1.00 0.00 ? 408 VAL A CB   5  
ATOM 7617  C CG1  . VAL A 1 33  ? 0.223   -12.196 -18.554 1.00 0.00 ? 408 VAL A CG1  5  
ATOM 7618  C CG2  . VAL A 1 33  ? -1.520  -11.250 -17.026 1.00 0.00 ? 408 VAL A CG2  5  
ATOM 7619  H H    . VAL A 1 33  ? -1.510  -13.592 -16.056 1.00 0.00 ? 408 VAL A H    5  
ATOM 7620  H HA   . VAL A 1 33  ? 1.351   -12.993 -16.319 1.00 0.00 ? 408 VAL A HA   5  
ATOM 7621  H HB   . VAL A 1 33  ? 0.537   -10.722 -17.060 1.00 0.00 ? 408 VAL A HB   5  
ATOM 7622  H HG11 . VAL A 1 33  ? 0.957   -12.984 -18.475 1.00 0.00 ? 408 VAL A HG11 5  
ATOM 7623  H HG12 . VAL A 1 33  ? -0.692  -12.597 -18.966 1.00 0.00 ? 408 VAL A HG12 5  
ATOM 7624  H HG13 . VAL A 1 33  ? 0.598   -11.418 -19.201 1.00 0.00 ? 408 VAL A HG13 5  
ATOM 7625  H HG21 . VAL A 1 33  ? -2.132  -12.111 -17.249 1.00 0.00 ? 408 VAL A HG21 5  
ATOM 7626  H HG22 . VAL A 1 33  ? -1.709  -10.925 -16.014 1.00 0.00 ? 408 VAL A HG22 5  
ATOM 7627  H HG23 . VAL A 1 33  ? -1.760  -10.451 -17.712 1.00 0.00 ? 408 VAL A HG23 5  
ATOM 7628  N N    . ILE A 1 34  ? 1.648   -11.655 -14.256 1.00 0.00 ? 409 ILE A N    5  
ATOM 7629  C CA   . ILE A 1 34  ? 1.846   -10.966 -12.986 1.00 0.00 ? 409 ILE A CA   5  
ATOM 7630  C C    . ILE A 1 34  ? 2.260   -9.515  -13.207 1.00 0.00 ? 409 ILE A C    5  
ATOM 7631  O O    . ILE A 1 34  ? 1.912   -8.634  -12.420 1.00 0.00 ? 409 ILE A O    5  
ATOM 7632  C CB   . ILE A 1 34  ? 2.913   -11.668 -12.124 1.00 0.00 ? 409 ILE A CB   5  
ATOM 7633  C CG1  . ILE A 1 34  ? 4.147   -12.002 -12.964 1.00 0.00 ? 409 ILE A CG1  5  
ATOM 7634  C CG2  . ILE A 1 34  ? 2.338   -12.927 -11.493 1.00 0.00 ? 409 ILE A CG2  5  
ATOM 7635  C CD1  . ILE A 1 34  ? 5.453   -11.745 -12.247 1.00 0.00 ? 409 ILE A CD1  5  
ATOM 7636  H H    . ILE A 1 34  ? 2.430   -11.954 -14.766 1.00 0.00 ? 409 ILE A H    5  
ATOM 7637  H HA   . ILE A 1 34  ? 0.909   -10.984 -12.449 1.00 0.00 ? 409 ILE A HA   5  
ATOM 7638  H HB   . ILE A 1 34  ? 3.199   -10.997 -11.327 1.00 0.00 ? 409 ILE A HB   5  
ATOM 7639  H HG12 . ILE A 1 34  ? 4.119   -13.045 -13.237 1.00 0.00 ? 409 ILE A HG12 5  
ATOM 7640  H HG13 . ILE A 1 34  ? 4.138   -11.400 -13.861 1.00 0.00 ? 409 ILE A HG13 5  
ATOM 7641  H HG21 . ILE A 1 34  ? 1.511   -13.282 -12.089 1.00 0.00 ? 409 ILE A HG21 5  
ATOM 7642  H HG22 . ILE A 1 34  ? 3.103   -13.689 -11.449 1.00 0.00 ? 409 ILE A HG22 5  
ATOM 7643  H HG23 . ILE A 1 34  ? 1.994   -12.705 -10.494 1.00 0.00 ? 409 ILE A HG23 5  
ATOM 7644  H HD11 . ILE A 1 34  ? 5.969   -10.923 -12.721 1.00 0.00 ? 409 ILE A HD11 5  
ATOM 7645  H HD12 . ILE A 1 34  ? 5.253   -11.497 -11.215 1.00 0.00 ? 409 ILE A HD12 5  
ATOM 7646  H HD13 . ILE A 1 34  ? 6.068   -12.631 -12.292 1.00 0.00 ? 409 ILE A HD13 5  
ATOM 7647  N N    . SER A 1 35  ? 3.003   -9.272  -14.282 1.00 0.00 ? 410 SER A N    5  
ATOM 7648  C CA   . SER A 1 35  ? 3.462   -7.928  -14.605 1.00 0.00 ? 410 SER A CA   5  
ATOM 7649  C C    . SER A 1 35  ? 2.427   -7.191  -15.446 1.00 0.00 ? 410 SER A C    5  
ATOM 7650  O O    . SER A 1 35  ? 1.681   -7.806  -16.209 1.00 0.00 ? 410 SER A O    5  
ATOM 7651  C CB   . SER A 1 35  ? 4.796   -7.985  -15.352 1.00 0.00 ? 410 SER A CB   5  
ATOM 7652  O OG   . SER A 1 35  ? 5.627   -9.010  -14.836 1.00 0.00 ? 410 SER A OG   5  
ATOM 7653  H H    . SER A 1 35  ? 3.247   -10.016 -14.872 1.00 0.00 ? 410 SER A H    5  
ATOM 7654  H HA   . SER A 1 35  ? 3.602   -7.392  -13.678 1.00 0.00 ? 410 SER A HA   5  
ATOM 7655  H HB2  . SER A 1 35  ? 4.611   -8.181  -16.398 1.00 0.00 ? 410 SER A HB2  5  
ATOM 7656  H HB3  . SER A 1 35  ? 5.305   -7.038  -15.248 1.00 0.00 ? 410 SER A HB3  5  
ATOM 7657  H HG   . SER A 1 35  ? 5.935   -8.762  -13.961 1.00 0.00 ? 410 SER A HG   5  
ATOM 7658  N N    . GLY A 1 36  ? 2.384   -5.871  -15.301 1.00 0.00 ? 411 GLY A N    5  
ATOM 7659  C CA   . GLY A 1 36  ? 1.434   -5.074  -16.056 1.00 0.00 ? 411 GLY A CA   5  
ATOM 7660  C C    . GLY A 1 36  ? 0.689   -4.083  -15.185 1.00 0.00 ? 411 GLY A C    5  
ATOM 7661  O O    . GLY A 1 36  ? 1.161   -3.712  -14.110 1.00 0.00 ? 411 GLY A O    5  
ATOM 7662  H H    . GLY A 1 36  ? 3.002   -5.434  -14.678 1.00 0.00 ? 411 GLY A H    5  
ATOM 7663  H HA2  . GLY A 1 36  ? 1.967   -4.533  -16.824 1.00 0.00 ? 411 GLY A HA2  5  
ATOM 7664  H HA3  . GLY A 1 36  ? 0.719   -5.733  -16.524 1.00 0.00 ? 411 GLY A HA3  5  
ATOM 7665  N N    . ALA A 1 37  ? -0.477  -3.649  -15.653 1.00 0.00 ? 412 ALA A N    5  
ATOM 7666  C CA   . ALA A 1 37  ? -1.289  -2.694  -14.912 1.00 0.00 ? 412 ALA A CA   5  
ATOM 7667  C C    . ALA A 1 37  ? -2.747  -3.139  -14.856 1.00 0.00 ? 412 ALA A C    5  
ATOM 7668  O O    . ALA A 1 37  ? -3.357  -3.432  -15.884 1.00 0.00 ? 412 ALA A O    5  
ATOM 7669  C CB   . ALA A 1 37  ? -1.179  -1.313  -15.541 1.00 0.00 ? 412 ALA A CB   5  
ATOM 7670  H H    . ALA A 1 37  ? -0.799  -3.981  -16.517 1.00 0.00 ? 412 ALA A H    5  
ATOM 7671  H HA   . ALA A 1 37  ? -0.902  -2.636  -13.905 1.00 0.00 ? 412 ALA A HA   5  
ATOM 7672  H HB1  . ALA A 1 37  ? -1.766  -0.610  -14.968 1.00 0.00 ? 412 ALA A HB1  5  
ATOM 7673  H HB2  . ALA A 1 37  ? -0.145  -1.001  -15.544 1.00 0.00 ? 412 ALA A HB2  5  
ATOM 7674  H HB3  . ALA A 1 37  ? -1.548  -1.349  -16.555 1.00 0.00 ? 412 ALA A HB3  5  
ATOM 7675  N N    . TYR A 1 38  ? -3.299  -3.188  -13.648 1.00 0.00 ? 413 TYR A N    5  
ATOM 7676  C CA   . TYR A 1 38  ? -4.686  -3.598  -13.457 1.00 0.00 ? 413 TYR A CA   5  
ATOM 7677  C C    . TYR A 1 38  ? -5.623  -2.397  -13.514 1.00 0.00 ? 413 TYR A C    5  
ATOM 7678  O O    . TYR A 1 38  ? -5.421  -1.406  -12.811 1.00 0.00 ? 413 TYR A O    5  
ATOM 7679  C CB   . TYR A 1 38  ? -4.844  -4.319  -12.115 1.00 0.00 ? 413 TYR A CB   5  
ATOM 7680  C CG   . TYR A 1 38  ? -6.263  -4.747  -11.817 1.00 0.00 ? 413 TYR A CG   5  
ATOM 7681  C CD1  . TYR A 1 38  ? -7.175  -3.860  -11.255 1.00 0.00 ? 413 TYR A CD1  5  
ATOM 7682  C CD2  . TYR A 1 38  ? -6.693  -6.039  -12.097 1.00 0.00 ? 413 TYR A CD2  5  
ATOM 7683  C CE1  . TYR A 1 38  ? -8.473  -4.249  -10.981 1.00 0.00 ? 413 TYR A CE1  5  
ATOM 7684  C CE2  . TYR A 1 38  ? -7.989  -6.434  -11.826 1.00 0.00 ? 413 TYR A CE2  5  
ATOM 7685  C CZ   . TYR A 1 38  ? -8.873  -5.536  -11.268 1.00 0.00 ? 413 TYR A CZ   5  
ATOM 7686  O OH   . TYR A 1 38  ? -10.165 -5.927  -10.996 1.00 0.00 ? 413 TYR A OH   5  
ATOM 7687  H H    . TYR A 1 38  ? -2.761  -2.943  -12.867 1.00 0.00 ? 413 TYR A H    5  
ATOM 7688  H HA   . TYR A 1 38  ? -4.943  -4.280  -14.253 1.00 0.00 ? 413 TYR A HA   5  
ATOM 7689  H HB2  . TYR A 1 38  ? -4.224  -5.203  -12.115 1.00 0.00 ? 413 TYR A HB2  5  
ATOM 7690  H HB3  . TYR A 1 38  ? -4.521  -3.660  -11.322 1.00 0.00 ? 413 TYR A HB3  5  
ATOM 7691  H HD1  . TYR A 1 38  ? -6.858  -2.851  -11.033 1.00 0.00 ? 413 TYR A HD1  5  
ATOM 7692  H HD2  . TYR A 1 38  ? -5.997  -6.740  -12.533 1.00 0.00 ? 413 TYR A HD2  5  
ATOM 7693  H HE1  . TYR A 1 38  ? -9.166  -3.546  -10.545 1.00 0.00 ? 413 TYR A HE1  5  
ATOM 7694  H HE2  . TYR A 1 38  ? -8.303  -7.443  -12.050 1.00 0.00 ? 413 TYR A HE2  5  
ATOM 7695  H HH   . TYR A 1 38  ? -10.485 -6.491  -11.704 1.00 0.00 ? 413 TYR A HH   5  
ATOM 7696  N N    . ILE A 1 39  ? -6.652  -2.493  -14.349 1.00 0.00 ? 414 ILE A N    5  
ATOM 7697  C CA   . ILE A 1 39  ? -7.622  -1.415  -14.490 1.00 0.00 ? 414 ILE A CA   5  
ATOM 7698  C C    . ILE A 1 39  ? -8.644  -1.456  -13.359 1.00 0.00 ? 414 ILE A C    5  
ATOM 7699  O O    . ILE A 1 39  ? -9.479  -2.359  -13.295 1.00 0.00 ? 414 ILE A O    5  
ATOM 7700  C CB   . ILE A 1 39  ? -8.361  -1.488  -15.840 1.00 0.00 ? 414 ILE A CB   5  
ATOM 7701  C CG1  . ILE A 1 39  ? -7.368  -1.718  -16.982 1.00 0.00 ? 414 ILE A CG1  5  
ATOM 7702  C CG2  . ILE A 1 39  ? -9.161  -0.214  -16.075 1.00 0.00 ? 414 ILE A CG2  5  
ATOM 7703  C CD1  . ILE A 1 39  ? -8.018  -2.191  -18.264 1.00 0.00 ? 414 ILE A CD1  5  
ATOM 7704  H H    . ILE A 1 39  ? -6.763  -3.309  -14.880 1.00 0.00 ? 414 ILE A H    5  
ATOM 7705  H HA   . ILE A 1 39  ? -7.087  -0.478  -14.445 1.00 0.00 ? 414 ILE A HA   5  
ATOM 7706  H HB   . ILE A 1 39  ? -9.053  -2.316  -15.802 1.00 0.00 ? 414 ILE A HB   5  
ATOM 7707  H HG12 . ILE A 1 39  ? -6.852  -0.794  -17.194 1.00 0.00 ? 414 ILE A HG12 5  
ATOM 7708  H HG13 . ILE A 1 39  ? -6.648  -2.465  -16.679 1.00 0.00 ? 414 ILE A HG13 5  
ATOM 7709  H HG21 . ILE A 1 39  ? -9.308  0.297   -15.135 1.00 0.00 ? 414 ILE A HG21 5  
ATOM 7710  H HG22 . ILE A 1 39  ? -8.622  0.429   -16.754 1.00 0.00 ? 414 ILE A HG22 5  
ATOM 7711  H HG23 . ILE A 1 39  ? -10.121 -0.466  -16.502 1.00 0.00 ? 414 ILE A HG23 5  
ATOM 7712  H HD11 . ILE A 1 39  ? -7.258  -2.546  -18.943 1.00 0.00 ? 414 ILE A HD11 5  
ATOM 7713  H HD12 . ILE A 1 39  ? -8.707  -2.992  -18.044 1.00 0.00 ? 414 ILE A HD12 5  
ATOM 7714  H HD13 . ILE A 1 39  ? -8.552  -1.370  -18.720 1.00 0.00 ? 414 ILE A HD13 5  
ATOM 7715  N N    . ILE A 1 40  ? -8.568  -0.476  -12.466 1.00 0.00 ? 415 ILE A N    5  
ATOM 7716  C CA   . ILE A 1 40  ? -9.480  -0.400  -11.331 1.00 0.00 ? 415 ILE A CA   5  
ATOM 7717  C C    . ILE A 1 40  ? -10.889 -0.015  -11.777 1.00 0.00 ? 415 ILE A C    5  
ATOM 7718  O O    . ILE A 1 40  ? -11.847 -0.749  -11.535 1.00 0.00 ? 415 ILE A O    5  
ATOM 7719  C CB   . ILE A 1 40  ? -8.975  0.613   -10.281 1.00 0.00 ? 415 ILE A CB   5  
ATOM 7720  C CG1  . ILE A 1 40  ? -7.643  0.142   -9.689  1.00 0.00 ? 415 ILE A CG1  5  
ATOM 7721  C CG2  . ILE A 1 40  ? -10.006 0.811   -9.178  1.00 0.00 ? 415 ILE A CG2  5  
ATOM 7722  C CD1  . ILE A 1 40  ? -6.463  0.992   -10.107 1.00 0.00 ? 415 ILE A CD1  5  
ATOM 7723  H H    . ILE A 1 40  ? -7.877  0.211   -12.569 1.00 0.00 ? 415 ILE A H    5  
ATOM 7724  H HA   . ILE A 1 40  ? -9.516  -1.376  -10.870 1.00 0.00 ? 415 ILE A HA   5  
ATOM 7725  H HB   . ILE A 1 40  ? -8.825  1.561   -10.773 1.00 0.00 ? 415 ILE A HB   5  
ATOM 7726  H HG12 . ILE A 1 40  ? -7.703  0.170   -8.612  1.00 0.00 ? 415 ILE A HG12 5  
ATOM 7727  H HG13 . ILE A 1 40  ? -7.452  -0.871  -10.009 1.00 0.00 ? 415 ILE A HG13 5  
ATOM 7728  H HG21 . ILE A 1 40  ? -10.216 -0.138  -8.707  1.00 0.00 ? 415 ILE A HG21 5  
ATOM 7729  H HG22 . ILE A 1 40  ? -9.618  1.500   -8.442  1.00 0.00 ? 415 ILE A HG22 5  
ATOM 7730  H HG23 . ILE A 1 40  ? -10.915 1.212   -9.602  1.00 0.00 ? 415 ILE A HG23 5  
ATOM 7731  H HD11 . ILE A 1 40  ? -6.069  0.625   -11.043 1.00 0.00 ? 415 ILE A HD11 5  
ATOM 7732  H HD12 . ILE A 1 40  ? -6.782  2.017   -10.229 1.00 0.00 ? 415 ILE A HD12 5  
ATOM 7733  H HD13 . ILE A 1 40  ? -5.696  0.941   -9.350  1.00 0.00 ? 415 ILE A HD13 5  
ATOM 7734  N N    . GLU A 1 41  ? -11.011 1.139   -12.424 1.00 0.00 ? 416 GLU A N    5  
ATOM 7735  C CA   . GLU A 1 41  ? -12.308 1.612   -12.895 1.00 0.00 ? 416 GLU A CA   5  
ATOM 7736  C C    . GLU A 1 41  ? -12.150 2.626   -14.024 1.00 0.00 ? 416 GLU A C    5  
ATOM 7737  O O    . GLU A 1 41  ? -11.145 3.331   -14.105 1.00 0.00 ? 416 GLU A O    5  
ATOM 7738  C CB   . GLU A 1 41  ? -13.093 2.235   -11.740 1.00 0.00 ? 416 GLU A CB   5  
ATOM 7739  C CG   . GLU A 1 41  ? -12.347 3.353   -11.031 1.00 0.00 ? 416 GLU A CG   5  
ATOM 7740  C CD   . GLU A 1 41  ? -13.261 4.221   -10.188 1.00 0.00 ? 416 GLU A CD   5  
ATOM 7741  O OE1  . GLU A 1 41  ? -13.881 3.689   -9.243  1.00 0.00 ? 416 GLU A OE1  5  
ATOM 7742  O OE2  . GLU A 1 41  ? -13.358 5.433   -10.474 1.00 0.00 ? 416 GLU A OE2  5  
ATOM 7743  H H    . GLU A 1 41  ? -10.213 1.685   -12.587 1.00 0.00 ? 416 GLU A H    5  
ATOM 7744  H HA   . GLU A 1 41  ? -12.854 0.760   -13.267 1.00 0.00 ? 416 GLU A HA   5  
ATOM 7745  H HB2  . GLU A 1 41  ? -14.018 2.638   -12.125 1.00 0.00 ? 416 GLU A HB2  5  
ATOM 7746  H HB3  . GLU A 1 41  ? -13.319 1.466   -11.017 1.00 0.00 ? 416 GLU A HB3  5  
ATOM 7747  H HG2  . GLU A 1 41  ? -11.598 2.915   -10.387 1.00 0.00 ? 416 GLU A HG2  5  
ATOM 7748  H HG3  . GLU A 1 41  ? -11.866 3.973   -11.771 1.00 0.00 ? 416 GLU A HG3  5  
ATOM 7749  N N    . VAL A 1 42  ? -13.156 2.692   -14.890 1.00 0.00 ? 417 VAL A N    5  
ATOM 7750  C CA   . VAL A 1 42  ? -13.141 3.619   -16.015 1.00 0.00 ? 417 VAL A CA   5  
ATOM 7751  C C    . VAL A 1 42  ? -14.417 4.452   -16.052 1.00 0.00 ? 417 VAL A C    5  
ATOM 7752  O O    . VAL A 1 42  ? -15.515 3.930   -15.861 1.00 0.00 ? 417 VAL A O    5  
ATOM 7753  C CB   . VAL A 1 42  ? -12.990 2.875   -17.356 1.00 0.00 ? 417 VAL A CB   5  
ATOM 7754  C CG1  . VAL A 1 42  ? -12.792 3.862   -18.497 1.00 0.00 ? 417 VAL A CG1  5  
ATOM 7755  C CG2  . VAL A 1 42  ? -11.838 1.881   -17.292 1.00 0.00 ? 417 VAL A CG2  5  
ATOM 7756  H H    . VAL A 1 42  ? -13.930 2.103   -14.768 1.00 0.00 ? 417 VAL A H    5  
ATOM 7757  H HA   . VAL A 1 42  ? -12.293 4.278   -15.895 1.00 0.00 ? 417 VAL A HA   5  
ATOM 7758  H HB   . VAL A 1 42  ? -13.900 2.324   -17.542 1.00 0.00 ? 417 VAL A HB   5  
ATOM 7759  H HG11 . VAL A 1 42  ? -12.094 4.629   -18.193 1.00 0.00 ? 417 VAL A HG11 5  
ATOM 7760  H HG12 . VAL A 1 42  ? -12.403 3.342   -19.360 1.00 0.00 ? 417 VAL A HG12 5  
ATOM 7761  H HG13 . VAL A 1 42  ? -13.739 4.316   -18.747 1.00 0.00 ? 417 VAL A HG13 5  
ATOM 7762  H HG21 . VAL A 1 42  ? -11.199 2.013   -18.153 1.00 0.00 ? 417 VAL A HG21 5  
ATOM 7763  H HG22 . VAL A 1 42  ? -11.267 2.049   -16.391 1.00 0.00 ? 417 VAL A HG22 5  
ATOM 7764  H HG23 . VAL A 1 42  ? -12.231 0.876   -17.287 1.00 0.00 ? 417 VAL A HG23 5  
ATOM 7765  N N    . ILE A 1 43  ? -14.265 5.749   -16.297 1.00 0.00 ? 418 ILE A N    5  
ATOM 7766  C CA   . ILE A 1 43  ? -15.409 6.652   -16.358 1.00 0.00 ? 418 ILE A CA   5  
ATOM 7767  C C    . ILE A 1 43  ? -16.112 6.550   -17.713 1.00 0.00 ? 418 ILE A C    5  
ATOM 7768  O O    . ILE A 1 43  ? -15.467 6.320   -18.737 1.00 0.00 ? 418 ILE A O    5  
ATOM 7769  C CB   . ILE A 1 43  ? -14.990 8.117   -16.116 1.00 0.00 ? 418 ILE A CB   5  
ATOM 7770  C CG1  . ILE A 1 43  ? -13.931 8.202   -15.012 1.00 0.00 ? 418 ILE A CG1  5  
ATOM 7771  C CG2  . ILE A 1 43  ? -16.202 8.962   -15.760 1.00 0.00 ? 418 ILE A CG2  5  
ATOM 7772  C CD1  . ILE A 1 43  ? -14.356 7.563   -13.706 1.00 0.00 ? 418 ILE A CD1  5  
ATOM 7773  H H    . ILE A 1 43  ? -13.365 6.106   -16.443 1.00 0.00 ? 418 ILE A H    5  
ATOM 7774  H HA   . ILE A 1 43  ? -16.100 6.363   -15.581 1.00 0.00 ? 418 ILE A HA   5  
ATOM 7775  H HB   . ILE A 1 43  ? -14.574 8.502   -17.032 1.00 0.00 ? 418 ILE A HB   5  
ATOM 7776  H HG12 . ILE A 1 43  ? -13.032 7.706   -15.345 1.00 0.00 ? 418 ILE A HG12 5  
ATOM 7777  H HG13 . ILE A 1 43  ? -13.710 9.242   -14.815 1.00 0.00 ? 418 ILE A HG13 5  
ATOM 7778  H HG21 . ILE A 1 43  ? -16.849 8.405   -15.100 1.00 0.00 ? 418 ILE A HG21 5  
ATOM 7779  H HG22 . ILE A 1 43  ? -15.878 9.867   -15.266 1.00 0.00 ? 418 ILE A HG22 5  
ATOM 7780  H HG23 . ILE A 1 43  ? -16.740 9.217   -16.661 1.00 0.00 ? 418 ILE A HG23 5  
ATOM 7781  H HD11 . ILE A 1 43  ? -14.665 8.331   -13.013 1.00 0.00 ? 418 ILE A HD11 5  
ATOM 7782  H HD12 . ILE A 1 43  ? -15.180 6.889   -13.887 1.00 0.00 ? 418 ILE A HD12 5  
ATOM 7783  H HD13 . ILE A 1 43  ? -13.526 7.012   -13.287 1.00 0.00 ? 418 ILE A HD13 5  
ATOM 7784  N N    . PRO A 1 44  ? -17.449 6.711   -17.739 1.00 0.00 ? 419 PRO A N    5  
ATOM 7785  C CA   . PRO A 1 44  ? -18.236 6.625   -18.977 1.00 0.00 ? 419 PRO A CA   5  
ATOM 7786  C C    . PRO A 1 44  ? -18.020 7.814   -19.916 1.00 0.00 ? 419 PRO A C    5  
ATOM 7787  O O    . PRO A 1 44  ? -18.627 7.880   -20.985 1.00 0.00 ? 419 PRO A O    5  
ATOM 7788  C CB   . PRO A 1 44  ? -19.694 6.604   -18.488 1.00 0.00 ? 419 PRO A CB   5  
ATOM 7789  C CG   . PRO A 1 44  ? -19.624 6.404   -17.008 1.00 0.00 ? 419 PRO A CG   5  
ATOM 7790  C CD   . PRO A 1 44  ? -18.306 6.972   -16.575 1.00 0.00 ? 419 PRO A CD   5  
ATOM 7791  H HA   . PRO A 1 44  ? -18.025 5.711   -19.511 1.00 0.00 ? 419 PRO A HA   5  
ATOM 7792  H HB2  . PRO A 1 44  ? -20.171 7.541   -18.733 1.00 0.00 ? 419 PRO A HB2  5  
ATOM 7793  H HB3  . PRO A 1 44  ? -20.222 5.792   -18.968 1.00 0.00 ? 419 PRO A HB3  5  
ATOM 7794  H HG2  . PRO A 1 44  ? -20.435 6.931   -16.528 1.00 0.00 ? 419 PRO A HG2  5  
ATOM 7795  H HG3  . PRO A 1 44  ? -19.672 5.350   -16.778 1.00 0.00 ? 419 PRO A HG3  5  
ATOM 7796  H HD2  . PRO A 1 44  ? -18.395 8.032   -16.386 1.00 0.00 ? 419 PRO A HD2  5  
ATOM 7797  H HD3  . PRO A 1 44  ? -17.942 6.456   -15.700 1.00 0.00 ? 419 PRO A HD3  5  
ATOM 7798  N N    . ASP A 1 45  ? -17.163 8.754   -19.521 1.00 0.00 ? 420 ASP A N    5  
ATOM 7799  C CA   . ASP A 1 45  ? -16.895 9.929   -20.346 1.00 0.00 ? 420 ASP A CA   5  
ATOM 7800  C C    . ASP A 1 45  ? -15.397 10.113  -20.577 1.00 0.00 ? 420 ASP A C    5  
ATOM 7801  O O    . ASP A 1 45  ? -14.817 11.127  -20.184 1.00 0.00 ? 420 ASP A O    5  
ATOM 7802  C CB   . ASP A 1 45  ? -17.483 11.181  -19.691 1.00 0.00 ? 420 ASP A CB   5  
ATOM 7803  C CG   . ASP A 1 45  ? -18.992 11.112  -19.566 1.00 0.00 ? 420 ASP A CG   5  
ATOM 7804  O OD1  . ASP A 1 45  ? -19.687 11.527  -20.518 1.00 0.00 ? 420 ASP A OD1  5  
ATOM 7805  O OD2  . ASP A 1 45  ? -19.480 10.644  -18.516 1.00 0.00 ? 420 ASP A OD2  5  
ATOM 7806  H H    . ASP A 1 45  ? -16.707 8.661   -18.660 1.00 0.00 ? 420 ASP A H    5  
ATOM 7807  H HA   . ASP A 1 45  ? -17.376 9.777   -21.301 1.00 0.00 ? 420 ASP A HA   5  
ATOM 7808  H HB2  . ASP A 1 45  ? -17.063 11.295  -18.703 1.00 0.00 ? 420 ASP A HB2  5  
ATOM 7809  H HB3  . ASP A 1 45  ? -17.229 12.045  -20.288 1.00 0.00 ? 420 ASP A HB3  5  
ATOM 7810  N N    . THR A 1 46  ? -14.777 9.131   -21.221 1.00 0.00 ? 421 THR A N    5  
ATOM 7811  C CA   . THR A 1 46  ? -13.346 9.186   -21.510 1.00 0.00 ? 421 THR A CA   5  
ATOM 7812  C C    . THR A 1 46  ? -13.019 8.368   -22.756 1.00 0.00 ? 421 THR A C    5  
ATOM 7813  O O    . THR A 1 46  ? -13.855 7.605   -23.243 1.00 0.00 ? 421 THR A O    5  
ATOM 7814  C CB   . THR A 1 46  ? -12.529 8.666   -20.320 1.00 0.00 ? 421 THR A CB   5  
ATOM 7815  O OG1  . THR A 1 46  ? -12.268 7.280   -20.452 1.00 0.00 ? 421 THR A OG1  5  
ATOM 7816  C CG2  . THR A 1 46  ? -13.199 8.873   -18.983 1.00 0.00 ? 421 THR A CG2  5  
ATOM 7817  H H    . THR A 1 46  ? -15.294 8.350   -21.511 1.00 0.00 ? 421 THR A H    5  
ATOM 7818  H HA   . THR A 1 46  ? -13.086 10.217  -21.693 1.00 0.00 ? 421 THR A HA   5  
ATOM 7819  H HB   . THR A 1 46  ? -11.583 9.187   -20.294 1.00 0.00 ? 421 THR A HB   5  
ATOM 7820  H HG1  . THR A 1 46  ? -13.086 6.788   -20.352 1.00 0.00 ? 421 THR A HG1  5  
ATOM 7821  H HG21 . THR A 1 46  ? -14.226 8.542   -19.039 1.00 0.00 ? 421 THR A HG21 5  
ATOM 7822  H HG22 . THR A 1 46  ? -12.678 8.303   -18.229 1.00 0.00 ? 421 THR A HG22 5  
ATOM 7823  H HG23 . THR A 1 46  ? -13.171 9.922   -18.725 1.00 0.00 ? 421 THR A HG23 5  
ATOM 7824  N N    . PRO A 1 47  ? -11.790 8.500   -23.283 1.00 0.00 ? 422 PRO A N    5  
ATOM 7825  C CA   . PRO A 1 47  ? -11.363 7.752   -24.462 1.00 0.00 ? 422 PRO A CA   5  
ATOM 7826  C C    . PRO A 1 47  ? -11.091 6.289   -24.127 1.00 0.00 ? 422 PRO A C    5  
ATOM 7827  O O    . PRO A 1 47  ? -11.056 5.432   -25.011 1.00 0.00 ? 422 PRO A O    5  
ATOM 7828  C CB   . PRO A 1 47  ? -10.081 8.464   -24.891 1.00 0.00 ? 422 PRO A CB   5  
ATOM 7829  C CG   . PRO A 1 47  ? -9.536  9.063   -23.642 1.00 0.00 ? 422 PRO A CG   5  
ATOM 7830  C CD   . PRO A 1 47  ? -10.719 9.370   -22.759 1.00 0.00 ? 422 PRO A CD   5  
ATOM 7831  H HA   . PRO A 1 47  ? -12.097 7.809   -25.254 1.00 0.00 ? 422 PRO A HA   5  
ATOM 7832  H HB2  . PRO A 1 47  ? -9.395  7.747   -25.318 1.00 0.00 ? 422 PRO A HB2  5  
ATOM 7833  H HB3  . PRO A 1 47  ? -10.315 9.223   -25.622 1.00 0.00 ? 422 PRO A HB3  5  
ATOM 7834  H HG2  . PRO A 1 47  ? -8.880  8.358   -23.153 1.00 0.00 ? 422 PRO A HG2  5  
ATOM 7835  H HG3  . PRO A 1 47  ? -9.000  9.971   -23.875 1.00 0.00 ? 422 PRO A HG3  5  
ATOM 7836  H HD2  . PRO A 1 47  ? -10.490 9.121   -21.734 1.00 0.00 ? 422 PRO A HD2  5  
ATOM 7837  H HD3  . PRO A 1 47  ? -10.994 10.411  -22.841 1.00 0.00 ? 422 PRO A HD3  5  
ATOM 7838  N N    . ALA A 1 48  ? -10.911 6.010   -22.837 1.00 0.00 ? 423 ALA A N    5  
ATOM 7839  C CA   . ALA A 1 48  ? -10.657 4.655   -22.370 1.00 0.00 ? 423 ALA A CA   5  
ATOM 7840  C C    . ALA A 1 48  ? -11.835 3.745   -22.701 1.00 0.00 ? 423 ALA A C    5  
ATOM 7841  O O    . ALA A 1 48  ? -11.689 2.751   -23.413 1.00 0.00 ? 423 ALA A O    5  
ATOM 7842  C CB   . ALA A 1 48  ? -10.397 4.660   -20.871 1.00 0.00 ? 423 ALA A CB   5  
ATOM 7843  H H    . ALA A 1 48  ? -10.960 6.736   -22.181 1.00 0.00 ? 423 ALA A H    5  
ATOM 7844  H HA   . ALA A 1 48  ? -9.773  4.286   -22.869 1.00 0.00 ? 423 ALA A HA   5  
ATOM 7845  H HB1  . ALA A 1 48  ? -9.334  4.725   -20.690 1.00 0.00 ? 423 ALA A HB1  5  
ATOM 7846  H HB2  . ALA A 1 48  ? -10.889 5.511   -20.423 1.00 0.00 ? 423 ALA A HB2  5  
ATOM 7847  H HB3  . ALA A 1 48  ? -10.783 3.752   -20.434 1.00 0.00 ? 423 ALA A HB3  5  
ATOM 7848  N N    . GLU A 1 49  ? -13.007 4.099   -22.184 1.00 0.00 ? 424 GLU A N    5  
ATOM 7849  C CA   . GLU A 1 49  ? -14.216 3.324   -22.426 1.00 0.00 ? 424 GLU A CA   5  
ATOM 7850  C C    . GLU A 1 49  ? -14.655 3.456   -23.882 1.00 0.00 ? 424 GLU A C    5  
ATOM 7851  O O    . GLU A 1 49  ? -15.302 2.562   -24.429 1.00 0.00 ? 424 GLU A O    5  
ATOM 7852  C CB   . GLU A 1 49  ? -15.337 3.790   -21.496 1.00 0.00 ? 424 GLU A CB   5  
ATOM 7853  C CG   . GLU A 1 49  ? -16.588 2.931   -21.572 1.00 0.00 ? 424 GLU A CG   5  
ATOM 7854  C CD   . GLU A 1 49  ? -17.490 3.317   -22.727 1.00 0.00 ? 424 GLU A CD   5  
ATOM 7855  O OE1  . GLU A 1 49  ? -17.935 4.484   -22.769 1.00 0.00 ? 424 GLU A OE1  5  
ATOM 7856  O OE2  . GLU A 1 49  ? -17.751 2.453   -23.591 1.00 0.00 ? 424 GLU A OE2  5  
ATOM 7857  H H    . GLU A 1 49  ? -13.061 4.907   -21.629 1.00 0.00 ? 424 GLU A H    5  
ATOM 7858  H HA   . GLU A 1 49  ? -13.994 2.288   -22.221 1.00 0.00 ? 424 GLU A HA   5  
ATOM 7859  H HB2  . GLU A 1 49  ? -14.976 3.770   -20.479 1.00 0.00 ? 424 GLU A HB2  5  
ATOM 7860  H HB3  . GLU A 1 49  ? -15.606 4.803   -21.754 1.00 0.00 ? 424 GLU A HB3  5  
ATOM 7861  H HG2  . GLU A 1 49  ? -16.294 1.899   -21.693 1.00 0.00 ? 424 GLU A HG2  5  
ATOM 7862  H HG3  . GLU A 1 49  ? -17.141 3.042   -20.650 1.00 0.00 ? 424 GLU A HG3  5  
ATOM 7863  N N    . ALA A 1 50  ? -14.299 4.577   -24.503 1.00 0.00 ? 425 ALA A N    5  
ATOM 7864  C CA   . ALA A 1 50  ? -14.654 4.827   -25.895 1.00 0.00 ? 425 ALA A CA   5  
ATOM 7865  C C    . ALA A 1 50  ? -13.749 4.045   -26.842 1.00 0.00 ? 425 ALA A C    5  
ATOM 7866  O O    . ALA A 1 50  ? -14.165 3.658   -27.933 1.00 0.00 ? 425 ALA A O    5  
ATOM 7867  C CB   . ALA A 1 50  ? -14.575 6.316   -26.197 1.00 0.00 ? 425 ALA A CB   5  
ATOM 7868  H H    . ALA A 1 50  ? -13.784 5.252   -24.014 1.00 0.00 ? 425 ALA A H    5  
ATOM 7869  H HA   . ALA A 1 50  ? -15.675 4.507   -26.042 1.00 0.00 ? 425 ALA A HA   5  
ATOM 7870  H HB1  . ALA A 1 50  ? -15.541 6.769   -26.026 1.00 0.00 ? 425 ALA A HB1  5  
ATOM 7871  H HB2  . ALA A 1 50  ? -13.842 6.777   -25.552 1.00 0.00 ? 425 ALA A HB2  5  
ATOM 7872  H HB3  . ALA A 1 50  ? -14.289 6.459   -27.229 1.00 0.00 ? 425 ALA A HB3  5  
ATOM 7873  N N    . GLY A 1 51  ? -12.510 3.816   -26.416 1.00 0.00 ? 426 GLY A N    5  
ATOM 7874  C CA   . GLY A 1 51  ? -11.569 3.081   -27.241 1.00 0.00 ? 426 GLY A CA   5  
ATOM 7875  C C    . GLY A 1 51  ? -11.901 1.604   -27.315 1.00 0.00 ? 426 GLY A C    5  
ATOM 7876  O O    . GLY A 1 51  ? -12.326 1.107   -28.357 1.00 0.00 ? 426 GLY A O    5  
ATOM 7877  H H    . GLY A 1 51  ? -12.233 4.148   -25.537 1.00 0.00 ? 426 GLY A H    5  
ATOM 7878  H HA2  . GLY A 1 51  ? -11.582 3.493   -28.239 1.00 0.00 ? 426 GLY A HA2  5  
ATOM 7879  H HA3  . GLY A 1 51  ? -10.579 3.196   -26.828 1.00 0.00 ? 426 GLY A HA3  5  
ATOM 7880  N N    . GLY A 1 52  ? -11.708 0.902   -26.204 1.00 0.00 ? 427 GLY A N    5  
ATOM 7881  C CA   . GLY A 1 52  ? -11.997 -0.519  -26.166 1.00 0.00 ? 427 GLY A CA   5  
ATOM 7882  C C    . GLY A 1 52  ? -11.449 -1.200  -24.926 1.00 0.00 ? 427 GLY A C    5  
ATOM 7883  O O    . GLY A 1 52  ? -11.074 -2.371  -24.971 1.00 0.00 ? 427 GLY A O    5  
ATOM 7884  H H    . GLY A 1 52  ? -11.368 1.354   -25.404 1.00 0.00 ? 427 GLY A H    5  
ATOM 7885  H HA2  . GLY A 1 52  ? -13.068 -0.657  -26.194 1.00 0.00 ? 427 GLY A HA2  5  
ATOM 7886  H HA3  . GLY A 1 52  ? -11.564 -0.985  -27.040 1.00 0.00 ? 427 GLY A HA3  5  
ATOM 7887  N N    . LEU A 1 53  ? -11.400 -0.468  -23.816 1.00 0.00 ? 428 LEU A N    5  
ATOM 7888  C CA   . LEU A 1 53  ? -10.894 -1.014  -22.566 1.00 0.00 ? 428 LEU A CA   5  
ATOM 7889  C C    . LEU A 1 53  ? -12.030 -1.240  -21.574 1.00 0.00 ? 428 LEU A C    5  
ATOM 7890  O O    . LEU A 1 53  ? -13.204 -1.174  -21.935 1.00 0.00 ? 428 LEU A O    5  
ATOM 7891  C CB   . LEU A 1 53  ? -9.850  -0.074  -21.957 1.00 0.00 ? 428 LEU A CB   5  
ATOM 7892  C CG   . LEU A 1 53  ? -9.212  0.920   -22.930 1.00 0.00 ? 428 LEU A CG   5  
ATOM 7893  C CD1  . LEU A 1 53  ? -8.441  1.987   -22.168 1.00 0.00 ? 428 LEU A CD1  5  
ATOM 7894  C CD2  . LEU A 1 53  ? -8.299  0.197   -23.909 1.00 0.00 ? 428 LEU A CD2  5  
ATOM 7895  H H    . LEU A 1 53  ? -11.710 0.460   -23.836 1.00 0.00 ? 428 LEU A H    5  
ATOM 7896  H HA   . LEU A 1 53  ? -10.427 -1.963  -22.783 1.00 0.00 ? 428 LEU A HA   5  
ATOM 7897  H HB2  . LEU A 1 53  ? -10.321 0.487   -21.162 1.00 0.00 ? 428 LEU A HB2  5  
ATOM 7898  H HB3  . LEU A 1 53  ? -9.067  -0.675  -21.531 1.00 0.00 ? 428 LEU A HB3  5  
ATOM 7899  H HG   . LEU A 1 53  ? -9.988  1.410   -23.496 1.00 0.00 ? 428 LEU A HG   5  
ATOM 7900  H HD11 . LEU A 1 53  ? -7.912  1.531   -21.344 1.00 0.00 ? 428 LEU A HD11 5  
ATOM 7901  H HD12 . LEU A 1 53  ? -7.735  2.463   -22.831 1.00 0.00 ? 428 LEU A HD12 5  
ATOM 7902  H HD13 . LEU A 1 53  ? -9.131  2.725   -21.787 1.00 0.00 ? 428 LEU A HD13 5  
ATOM 7903  H HD21 . LEU A 1 53  ? -7.280  0.250   -23.556 1.00 0.00 ? 428 LEU A HD21 5  
ATOM 7904  H HD22 . LEU A 1 53  ? -8.601  -0.837  -23.985 1.00 0.00 ? 428 LEU A HD22 5  
ATOM 7905  H HD23 . LEU A 1 53  ? -8.371  0.665   -24.879 1.00 0.00 ? 428 LEU A HD23 5  
ATOM 7906  N N    . LYS A 1 54  ? -11.672 -1.503  -20.321 1.00 0.00 ? 429 LYS A N    5  
ATOM 7907  C CA   . LYS A 1 54  ? -12.661 -1.735  -19.276 1.00 0.00 ? 429 LYS A CA   5  
ATOM 7908  C C    . LYS A 1 54  ? -11.982 -1.953  -17.927 1.00 0.00 ? 429 LYS A C    5  
ATOM 7909  O O    . LYS A 1 54  ? -10.763 -2.110  -17.855 1.00 0.00 ? 429 LYS A O    5  
ATOM 7910  C CB   . LYS A 1 54  ? -13.534 -2.942  -19.627 1.00 0.00 ? 429 LYS A CB   5  
ATOM 7911  C CG   . LYS A 1 54  ? -15.022 -2.628  -19.655 1.00 0.00 ? 429 LYS A CG   5  
ATOM 7912  C CD   . LYS A 1 54  ? -15.654 -2.791  -18.283 1.00 0.00 ? 429 LYS A CD   5  
ATOM 7913  C CE   . LYS A 1 54  ? -16.970 -3.549  -18.360 1.00 0.00 ? 429 LYS A CE   5  
ATOM 7914  N NZ   . LYS A 1 54  ? -18.057 -2.718  -18.945 1.00 0.00 ? 429 LYS A NZ   5  
ATOM 7915  H H    . LYS A 1 54  ? -10.720 -1.539  -20.094 1.00 0.00 ? 429 LYS A H    5  
ATOM 7916  H HA   . LYS A 1 54  ? -13.284 -0.856  -19.212 1.00 0.00 ? 429 LYS A HA   5  
ATOM 7917  H HB2  . LYS A 1 54  ? -13.248 -3.307  -20.602 1.00 0.00 ? 429 LYS A HB2  5  
ATOM 7918  H HB3  . LYS A 1 54  ? -13.368 -3.721  -18.898 1.00 0.00 ? 429 LYS A HB3  5  
ATOM 7919  H HG2  . LYS A 1 54  ? -15.159 -1.609  -19.984 1.00 0.00 ? 429 LYS A HG2  5  
ATOM 7920  H HG3  . LYS A 1 54  ? -15.507 -3.300  -20.349 1.00 0.00 ? 429 LYS A HG3  5  
ATOM 7921  H HD2  . LYS A 1 54  ? -14.974 -3.337  -17.646 1.00 0.00 ? 429 LYS A HD2  5  
ATOM 7922  H HD3  . LYS A 1 54  ? -15.836 -1.813  -17.863 1.00 0.00 ? 429 LYS A HD3  5  
ATOM 7923  H HE2  . LYS A 1 54  ? -16.830 -4.425  -18.975 1.00 0.00 ? 429 LYS A HE2  5  
ATOM 7924  H HE3  . LYS A 1 54  ? -17.256 -3.852  -17.364 1.00 0.00 ? 429 LYS A HE3  5  
ATOM 7925  H HZ1  . LYS A 1 54  ? -18.979 -3.020  -18.570 1.00 0.00 ? 429 LYS A HZ1  5  
ATOM 7926  H HZ2  . LYS A 1 54  ? -17.910 -1.716  -18.706 1.00 0.00 ? 429 LYS A HZ2  5  
ATOM 7927  H HZ3  . LYS A 1 54  ? -18.067 -2.818  -19.980 1.00 0.00 ? 429 LYS A HZ3  5  
ATOM 7928  N N    . GLU A 1 55  ? -12.777 -1.962  -16.863 1.00 0.00 ? 430 GLU A N    5  
ATOM 7929  C CA   . GLU A 1 55  ? -12.249 -2.159  -15.518 1.00 0.00 ? 430 GLU A CA   5  
ATOM 7930  C C    . GLU A 1 55  ? -12.219 -3.642  -15.152 1.00 0.00 ? 430 GLU A C    5  
ATOM 7931  O O    . GLU A 1 55  ? -12.691 -4.041  -14.088 1.00 0.00 ? 430 GLU A O    5  
ATOM 7932  C CB   . GLU A 1 55  ? -13.087 -1.379  -14.500 1.00 0.00 ? 430 GLU A CB   5  
ATOM 7933  C CG   . GLU A 1 55  ? -14.468 -1.968  -14.259 1.00 0.00 ? 430 GLU A CG   5  
ATOM 7934  C CD   . GLU A 1 55  ? -15.570 -0.929  -14.350 1.00 0.00 ? 430 GLU A CD   5  
ATOM 7935  O OE1  . GLU A 1 55  ? -15.392 0.176   -13.795 1.00 0.00 ? 430 GLU A OE1  5  
ATOM 7936  O OE2  . GLU A 1 55  ? -16.611 -1.220  -14.977 1.00 0.00 ? 430 GLU A OE2  5  
ATOM 7937  H H    . GLU A 1 55  ? -13.741 -1.831  -16.984 1.00 0.00 ? 430 GLU A H    5  
ATOM 7938  H HA   . GLU A 1 55  ? -11.239 -1.779  -15.502 1.00 0.00 ? 430 GLU A HA   5  
ATOM 7939  H HB2  . GLU A 1 55  ? -12.560 -1.361  -13.558 1.00 0.00 ? 430 GLU A HB2  5  
ATOM 7940  H HB3  . GLU A 1 55  ? -13.208 -0.366  -14.854 1.00 0.00 ? 430 GLU A HB3  5  
ATOM 7941  H HG2  . GLU A 1 55  ? -14.654 -2.732  -14.998 1.00 0.00 ? 430 GLU A HG2  5  
ATOM 7942  H HG3  . GLU A 1 55  ? -14.490 -2.409  -13.273 1.00 0.00 ? 430 GLU A HG3  5  
ATOM 7943  N N    . ASN A 1 56  ? -11.655 -4.453  -16.042 1.00 0.00 ? 431 ASN A N    5  
ATOM 7944  C CA   . ASN A 1 56  ? -11.559 -5.889  -15.815 1.00 0.00 ? 431 ASN A CA   5  
ATOM 7945  C C    . ASN A 1 56  ? -10.486 -6.508  -16.704 1.00 0.00 ? 431 ASN A C    5  
ATOM 7946  O O    . ASN A 1 56  ? -10.573 -7.677  -17.079 1.00 0.00 ? 431 ASN A O    5  
ATOM 7947  C CB   . ASN A 1 56  ? -12.906 -6.561  -16.083 1.00 0.00 ? 431 ASN A CB   5  
ATOM 7948  C CG   . ASN A 1 56  ? -13.431 -6.266  -17.475 1.00 0.00 ? 431 ASN A CG   5  
ATOM 7949  O OD1  . ASN A 1 56  ? -12.785 -6.585  -18.474 1.00 0.00 ? 431 ASN A OD1  5  
ATOM 7950  N ND2  . ASN A 1 56  ? -14.607 -5.655  -17.548 1.00 0.00 ? 431 ASN A ND2  5  
ATOM 7951  H H    . ASN A 1 56  ? -11.295 -4.076  -16.870 1.00 0.00 ? 431 ASN A H    5  
ATOM 7952  H HA   . ASN A 1 56  ? -11.289 -6.045  -14.781 1.00 0.00 ? 431 ASN A HA   5  
ATOM 7953  H HB2  . ASN A 1 56  ? -12.795 -7.629  -15.980 1.00 0.00 ? 431 ASN A HB2  5  
ATOM 7954  H HB3  . ASN A 1 56  ? -13.629 -6.206  -15.363 1.00 0.00 ? 431 ASN A HB3  5  
ATOM 7955  H HD21 . ASN A 1 56  ? -15.065 -5.431  -16.710 1.00 0.00 ? 431 ASN A HD21 5  
ATOM 7956  H HD22 . ASN A 1 56  ? -14.969 -5.452  -18.435 1.00 0.00 ? 431 ASN A HD22 5  
ATOM 7957  N N    . ASP A 1 57  ? -9.474  -5.714  -17.037 1.00 0.00 ? 432 ASP A N    5  
ATOM 7958  C CA   . ASP A 1 57  ? -8.382  -6.182  -17.881 1.00 0.00 ? 432 ASP A CA   5  
ATOM 7959  C C    . ASP A 1 57  ? -7.033  -5.768  -17.303 1.00 0.00 ? 432 ASP A C    5  
ATOM 7960  O O    . ASP A 1 57  ? -6.965  -5.167  -16.230 1.00 0.00 ? 432 ASP A O    5  
ATOM 7961  C CB   . ASP A 1 57  ? -8.537  -5.631  -19.300 1.00 0.00 ? 432 ASP A CB   5  
ATOM 7962  C CG   . ASP A 1 57  ? -9.903  -5.924  -19.887 1.00 0.00 ? 432 ASP A CG   5  
ATOM 7963  O OD1  . ASP A 1 57  ? -10.216 -7.115  -20.097 1.00 0.00 ? 432 ASP A OD1  5  
ATOM 7964  O OD2  . ASP A 1 57  ? -10.661 -4.963  -20.137 1.00 0.00 ? 432 ASP A OD2  5  
ATOM 7965  H H    . ASP A 1 57  ? -9.460  -4.793  -16.707 1.00 0.00 ? 432 ASP A H    5  
ATOM 7966  H HA   . ASP A 1 57  ? -8.429  -7.260  -17.917 1.00 0.00 ? 432 ASP A HA   5  
ATOM 7967  H HB2  . ASP A 1 57  ? -8.396  -4.560  -19.281 1.00 0.00 ? 432 ASP A HB2  5  
ATOM 7968  H HB3  . ASP A 1 57  ? -7.787  -6.077  -19.936 1.00 0.00 ? 432 ASP A HB3  5  
ATOM 7969  N N    . VAL A 1 58  ? -5.961  -6.093  -18.018 1.00 0.00 ? 433 VAL A N    5  
ATOM 7970  C CA   . VAL A 1 58  ? -4.616  -5.755  -17.571 1.00 0.00 ? 433 VAL A CA   5  
ATOM 7971  C C    . VAL A 1 58  ? -3.750  -5.287  -18.736 1.00 0.00 ? 433 VAL A C    5  
ATOM 7972  O O    . VAL A 1 58  ? -3.494  -6.040  -19.674 1.00 0.00 ? 433 VAL A O    5  
ATOM 7973  C CB   . VAL A 1 58  ? -3.932  -6.956  -16.890 1.00 0.00 ? 433 VAL A CB   5  
ATOM 7974  C CG1  . VAL A 1 58  ? -2.572  -6.557  -16.334 1.00 0.00 ? 433 VAL A CG1  5  
ATOM 7975  C CG2  . VAL A 1 58  ? -4.821  -7.525  -15.794 1.00 0.00 ? 433 VAL A CG2  5  
ATOM 7976  H H    . VAL A 1 58  ? -6.078  -6.574  -18.864 1.00 0.00 ? 433 VAL A H    5  
ATOM 7977  H HA   . VAL A 1 58  ? -4.695  -4.956  -16.850 1.00 0.00 ? 433 VAL A HA   5  
ATOM 7978  H HB   . VAL A 1 58  ? -3.779  -7.725  -17.634 1.00 0.00 ? 433 VAL A HB   5  
ATOM 7979  H HG11 . VAL A 1 58  ? -2.504  -5.481  -16.286 1.00 0.00 ? 433 VAL A HG11 5  
ATOM 7980  H HG12 . VAL A 1 58  ? -2.450  -6.971  -15.344 1.00 0.00 ? 433 VAL A HG12 5  
ATOM 7981  H HG13 . VAL A 1 58  ? -1.794  -6.938  -16.980 1.00 0.00 ? 433 VAL A HG13 5  
ATOM 7982  H HG21 . VAL A 1 58  ? -4.208  -7.850  -14.966 1.00 0.00 ? 433 VAL A HG21 5  
ATOM 7983  H HG22 . VAL A 1 58  ? -5.509  -6.764  -15.457 1.00 0.00 ? 433 VAL A HG22 5  
ATOM 7984  H HG23 . VAL A 1 58  ? -5.376  -8.367  -16.182 1.00 0.00 ? 433 VAL A HG23 5  
ATOM 7985  N N    . ILE A 1 59  ? -3.294  -4.040  -18.664 1.00 0.00 ? 434 ILE A N    5  
ATOM 7986  C CA   . ILE A 1 59  ? -2.451  -3.477  -19.710 1.00 0.00 ? 434 ILE A CA   5  
ATOM 7987  C C    . ILE A 1 59  ? -1.086  -4.156  -19.728 1.00 0.00 ? 434 ILE A C    5  
ATOM 7988  O O    . ILE A 1 59  ? -0.596  -4.610  -18.694 1.00 0.00 ? 434 ILE A O    5  
ATOM 7989  C CB   . ILE A 1 59  ? -2.259  -1.959  -19.524 1.00 0.00 ? 434 ILE A CB   5  
ATOM 7990  C CG1  . ILE A 1 59  ? -3.607  -1.274  -19.284 1.00 0.00 ? 434 ILE A CG1  5  
ATOM 7991  C CG2  . ILE A 1 59  ? -1.561  -1.363  -20.737 1.00 0.00 ? 434 ILE A CG2  5  
ATOM 7992  C CD1  . ILE A 1 59  ? -3.750  -0.689  -17.895 1.00 0.00 ? 434 ILE A CD1  5  
ATOM 7993  H H    . ILE A 1 59  ? -3.527  -3.488  -17.889 1.00 0.00 ? 434 ILE A H    5  
ATOM 7994  H HA   . ILE A 1 59  ? -2.940  -3.644  -20.660 1.00 0.00 ? 434 ILE A HA   5  
ATOM 7995  H HB   . ILE A 1 59  ? -1.625  -1.802  -18.664 1.00 0.00 ? 434 ILE A HB   5  
ATOM 7996  H HG12 . ILE A 1 59  ? -3.729  -0.470  -19.994 1.00 0.00 ? 434 ILE A HG12 5  
ATOM 7997  H HG13 . ILE A 1 59  ? -4.400  -1.994  -19.423 1.00 0.00 ? 434 ILE A HG13 5  
ATOM 7998  H HG21 . ILE A 1 59  ? -0.635  -1.887  -20.914 1.00 0.00 ? 434 ILE A HG21 5  
ATOM 7999  H HG22 . ILE A 1 59  ? -2.200  -1.460  -21.602 1.00 0.00 ? 434 ILE A HG22 5  
ATOM 8000  H HG23 . ILE A 1 59  ? -1.355  -0.318  -20.556 1.00 0.00 ? 434 ILE A HG23 5  
ATOM 8001  H HD11 . ILE A 1 59  ? -4.765  -0.348  -17.751 1.00 0.00 ? 434 ILE A HD11 5  
ATOM 8002  H HD12 . ILE A 1 59  ? -3.517  -1.445  -17.160 1.00 0.00 ? 434 ILE A HD12 5  
ATOM 8003  H HD13 . ILE A 1 59  ? -3.071  0.143   -17.784 1.00 0.00 ? 434 ILE A HD13 5  
ATOM 8004  N N    . ILE A 1 60  ? -0.478  -4.232  -20.908 1.00 0.00 ? 435 ILE A N    5  
ATOM 8005  C CA   . ILE A 1 60  ? 0.828   -4.864  -21.052 1.00 0.00 ? 435 ILE A CA   5  
ATOM 8006  C C    . ILE A 1 60  ? 1.703   -4.116  -22.051 1.00 0.00 ? 435 ILE A C    5  
ATOM 8007  O O    . ILE A 1 60  ? 2.870   -3.836  -21.779 1.00 0.00 ? 435 ILE A O    5  
ATOM 8008  C CB   . ILE A 1 60  ? 0.694   -6.333  -21.500 1.00 0.00 ? 435 ILE A CB   5  
ATOM 8009  C CG1  . ILE A 1 60  ? -0.245  -6.443  -22.704 1.00 0.00 ? 435 ILE A CG1  5  
ATOM 8010  C CG2  . ILE A 1 60  ? 0.190   -7.191  -20.350 1.00 0.00 ? 435 ILE A CG2  5  
ATOM 8011  C CD1  . ILE A 1 60  ? 0.472   -6.426  -24.037 1.00 0.00 ? 435 ILE A CD1  5  
ATOM 8012  H H    . ILE A 1 60  ? -0.919  -3.857  -21.699 1.00 0.00 ? 435 ILE A H    5  
ATOM 8013  H HA   . ILE A 1 60  ? 1.311   -4.849  -20.086 1.00 0.00 ? 435 ILE A HA   5  
ATOM 8014  H HB   . ILE A 1 60  ? 1.672   -6.690  -21.782 1.00 0.00 ? 435 ILE A HB   5  
ATOM 8015  H HG12 . ILE A 1 60  ? -0.796  -7.369  -22.640 1.00 0.00 ? 435 ILE A HG12 5  
ATOM 8016  H HG13 . ILE A 1 60  ? -0.939  -5.616  -22.690 1.00 0.00 ? 435 ILE A HG13 5  
ATOM 8017  H HG21 . ILE A 1 60  ? -0.463  -6.606  -19.721 1.00 0.00 ? 435 ILE A HG21 5  
ATOM 8018  H HG22 . ILE A 1 60  ? -0.353  -8.038  -20.743 1.00 0.00 ? 435 ILE A HG22 5  
ATOM 8019  H HG23 . ILE A 1 60  ? 1.031   -7.543  -19.768 1.00 0.00 ? 435 ILE A HG23 5  
ATOM 8020  H HD11 . ILE A 1 60  ? -0.061  -5.787  -24.724 1.00 0.00 ? 435 ILE A HD11 5  
ATOM 8021  H HD12 . ILE A 1 60  ? 1.476   -6.048  -23.900 1.00 0.00 ? 435 ILE A HD12 5  
ATOM 8022  H HD13 . ILE A 1 60  ? 0.516   -7.429  -24.435 1.00 0.00 ? 435 ILE A HD13 5  
ATOM 8023  N N    . SER A 1 61  ? 1.135   -3.799  -23.208 1.00 0.00 ? 436 SER A N    5  
ATOM 8024  C CA   . SER A 1 61  ? 1.867   -3.085  -24.248 1.00 0.00 ? 436 SER A CA   5  
ATOM 8025  C C    . SER A 1 61  ? 1.144   -1.802  -24.639 1.00 0.00 ? 436 SER A C    5  
ATOM 8026  O O    . SER A 1 61  ? -0.086  -1.750  -24.652 1.00 0.00 ? 436 SER A O    5  
ATOM 8027  C CB   . SER A 1 61  ? 2.048   -3.977  -25.478 1.00 0.00 ? 436 SER A CB   5  
ATOM 8028  O OG   . SER A 1 61  ? 0.804   -4.248  -26.099 1.00 0.00 ? 436 SER A OG   5  
ATOM 8029  H H    . SER A 1 61  ? 0.201   -4.049  -23.368 1.00 0.00 ? 436 SER A H    5  
ATOM 8030  H HA   . SER A 1 61  ? 2.839   -2.830  -23.854 1.00 0.00 ? 436 SER A HA   5  
ATOM 8031  H HB2  . SER A 1 61  ? 2.690   -3.480  -26.190 1.00 0.00 ? 436 SER A HB2  5  
ATOM 8032  H HB3  . SER A 1 61  ? 2.498   -4.913  -25.179 1.00 0.00 ? 436 SER A HB3  5  
ATOM 8033  H HG   . SER A 1 61  ? 0.858   -5.078  -26.577 1.00 0.00 ? 436 SER A HG   5  
ATOM 8034  N N    . ILE A 1 62  ? 1.914   -0.767  -24.959 1.00 0.00 ? 437 ILE A N    5  
ATOM 8035  C CA   . ILE A 1 62  ? 1.342   0.515   -25.351 1.00 0.00 ? 437 ILE A CA   5  
ATOM 8036  C C    . ILE A 1 62  ? 2.176   1.182   -26.444 1.00 0.00 ? 437 ILE A C    5  
ATOM 8037  O O    . ILE A 1 62  ? 3.356   1.471   -26.249 1.00 0.00 ? 437 ILE A O    5  
ATOM 8038  C CB   . ILE A 1 62  ? 1.214   1.464   -24.139 1.00 0.00 ? 437 ILE A CB   5  
ATOM 8039  C CG1  . ILE A 1 62  ? 0.316   2.651   -24.485 1.00 0.00 ? 437 ILE A CG1  5  
ATOM 8040  C CG2  . ILE A 1 62  ? 2.582   1.944   -23.675 1.00 0.00 ? 437 ILE A CG2  5  
ATOM 8041  C CD1  . ILE A 1 62  ? -0.531  3.125   -23.323 1.00 0.00 ? 437 ILE A CD1  5  
ATOM 8042  H H    . ILE A 1 62  ? 2.888   -0.869  -24.931 1.00 0.00 ? 437 ILE A H    5  
ATOM 8043  H HA   . ILE A 1 62  ? 0.351   0.328   -25.737 1.00 0.00 ? 437 ILE A HA   5  
ATOM 8044  H HB   . ILE A 1 62  ? 0.764   0.911   -23.327 1.00 0.00 ? 437 ILE A HB   5  
ATOM 8045  H HG12 . ILE A 1 62  ? 0.930   3.479   -24.806 1.00 0.00 ? 437 ILE A HG12 5  
ATOM 8046  H HG13 . ILE A 1 62  ? -0.349  2.369   -25.288 1.00 0.00 ? 437 ILE A HG13 5  
ATOM 8047  H HG21 . ILE A 1 62  ? 3.252   1.099   -23.596 1.00 0.00 ? 437 ILE A HG21 5  
ATOM 8048  H HG22 . ILE A 1 62  ? 2.977   2.651   -24.388 1.00 0.00 ? 437 ILE A HG22 5  
ATOM 8049  H HG23 . ILE A 1 62  ? 2.489   2.420   -22.710 1.00 0.00 ? 437 ILE A HG23 5  
ATOM 8050  H HD11 . ILE A 1 62  ? -1.495  2.640   -23.359 1.00 0.00 ? 437 ILE A HD11 5  
ATOM 8051  H HD12 . ILE A 1 62  ? -0.038  2.877   -22.394 1.00 0.00 ? 437 ILE A HD12 5  
ATOM 8052  H HD13 . ILE A 1 62  ? -0.663  4.195   -23.386 1.00 0.00 ? 437 ILE A HD13 5  
ATOM 8053  N N    . ASN A 1 63  ? 1.548   1.417   -27.594 1.00 0.00 ? 438 ASN A N    5  
ATOM 8054  C CA   . ASN A 1 63  ? 2.215   2.048   -28.733 1.00 0.00 ? 438 ASN A CA   5  
ATOM 8055  C C    . ASN A 1 63  ? 3.602   1.455   -28.976 1.00 0.00 ? 438 ASN A C    5  
ATOM 8056  O O    . ASN A 1 63  ? 4.504   2.138   -29.461 1.00 0.00 ? 438 ASN A O    5  
ATOM 8057  C CB   . ASN A 1 63  ? 2.322   3.561   -28.523 1.00 0.00 ? 438 ASN A CB   5  
ATOM 8058  C CG   . ASN A 1 63  ? 3.181   3.926   -27.329 1.00 0.00 ? 438 ASN A CG   5  
ATOM 8059  O OD1  . ASN A 1 63  ? 4.400   3.754   -27.351 1.00 0.00 ? 438 ASN A OD1  5  
ATOM 8060  N ND2  . ASN A 1 63  ? 2.549   4.435   -26.280 1.00 0.00 ? 438 ASN A ND2  5  
ATOM 8061  H H    . ASN A 1 63  ? 0.608   1.157   -27.681 1.00 0.00 ? 438 ASN A H    5  
ATOM 8062  H HA   . ASN A 1 63  ? 1.608   1.864   -29.606 1.00 0.00 ? 438 ASN A HA   5  
ATOM 8063  H HB2  . ASN A 1 63  ? 2.755   4.010   -29.404 1.00 0.00 ? 438 ASN A HB2  5  
ATOM 8064  H HB3  . ASN A 1 63  ? 1.333   3.966   -28.369 1.00 0.00 ? 438 ASN A HB3  5  
ATOM 8065  H HD21 . ASN A 1 63  ? 1.576   4.545   -26.334 1.00 0.00 ? 438 ASN A HD21 5  
ATOM 8066  H HD22 . ASN A 1 63  ? 3.079   4.679   -25.493 1.00 0.00 ? 438 ASN A HD22 5  
ATOM 8067  N N    . GLY A 1 64  ? 3.763   0.177   -28.644 1.00 0.00 ? 439 GLY A N    5  
ATOM 8068  C CA   . GLY A 1 64  ? 5.040   -0.485  -28.845 1.00 0.00 ? 439 GLY A CA   5  
ATOM 8069  C C    . GLY A 1 64  ? 5.965   -0.376  -27.647 1.00 0.00 ? 439 GLY A C    5  
ATOM 8070  O O    . GLY A 1 64  ? 7.176   -0.545  -27.777 1.00 0.00 ? 439 GLY A O    5  
ATOM 8071  H H    . GLY A 1 64  ? 3.008   -0.321  -28.268 1.00 0.00 ? 439 GLY A H    5  
ATOM 8072  H HA2  . GLY A 1 64  ? 4.859   -1.531  -29.049 1.00 0.00 ? 439 GLY A HA2  5  
ATOM 8073  H HA3  . GLY A 1 64  ? 5.527   -0.044  -29.702 1.00 0.00 ? 439 GLY A HA3  5  
ATOM 8074  N N    . GLN A 1 65  ? 5.398   -0.097  -26.478 1.00 0.00 ? 440 GLN A N    5  
ATOM 8075  C CA   . GLN A 1 65  ? 6.190   0.027   -25.259 1.00 0.00 ? 440 GLN A CA   5  
ATOM 8076  C C    . GLN A 1 65  ? 5.878   -1.111  -24.293 1.00 0.00 ? 440 GLN A C    5  
ATOM 8077  O O    . GLN A 1 65  ? 4.817   -1.730  -24.370 1.00 0.00 ? 440 GLN A O    5  
ATOM 8078  C CB   . GLN A 1 65  ? 5.926   1.374   -24.586 1.00 0.00 ? 440 GLN A CB   5  
ATOM 8079  C CG   . GLN A 1 65  ? 6.633   2.538   -25.260 1.00 0.00 ? 440 GLN A CG   5  
ATOM 8080  C CD   . GLN A 1 65  ? 6.877   3.697   -24.315 1.00 0.00 ? 440 GLN A CD   5  
ATOM 8081  O OE1  . GLN A 1 65  ? 7.895   3.746   -23.624 1.00 0.00 ? 440 GLN A OE1  5  
ATOM 8082  N NE2  . GLN A 1 65  ? 5.941   4.639   -24.278 1.00 0.00 ? 440 GLN A NE2  5  
ATOM 8083  H H    . GLN A 1 65  ? 4.427   0.024   -26.432 1.00 0.00 ? 440 GLN A H    5  
ATOM 8084  H HA   . GLN A 1 65  ? 7.232   -0.029  -25.535 1.00 0.00 ? 440 GLN A HA   5  
ATOM 8085  H HB2  . GLN A 1 65  ? 4.864   1.569   -24.601 1.00 0.00 ? 440 GLN A HB2  5  
ATOM 8086  H HB3  . GLN A 1 65  ? 6.260   1.322   -23.560 1.00 0.00 ? 440 GLN A HB3  5  
ATOM 8087  H HG2  . GLN A 1 65  ? 7.585   2.194   -25.637 1.00 0.00 ? 440 GLN A HG2  5  
ATOM 8088  H HG3  . GLN A 1 65  ? 6.024   2.884   -26.082 1.00 0.00 ? 440 GLN A HG3  5  
ATOM 8089  H HE21 . GLN A 1 65  ? 5.157   4.534   -24.856 1.00 0.00 ? 440 GLN A HE21 5  
ATOM 8090  H HE22 . GLN A 1 65  ? 6.074   5.400   -23.677 1.00 0.00 ? 440 GLN A HE22 5  
ATOM 8091  N N    . SER A 1 66  ? 6.813   -1.385  -23.389 1.00 0.00 ? 441 SER A N    5  
ATOM 8092  C CA   . SER A 1 66  ? 6.639   -2.452  -22.411 1.00 0.00 ? 441 SER A CA   5  
ATOM 8093  C C    . SER A 1 66  ? 6.068   -1.913  -21.104 1.00 0.00 ? 441 SER A C    5  
ATOM 8094  O O    . SER A 1 66  ? 6.686   -1.080  -20.440 1.00 0.00 ? 441 SER A O    5  
ATOM 8095  C CB   . SER A 1 66  ? 7.974   -3.152  -22.147 1.00 0.00 ? 441 SER A CB   5  
ATOM 8096  O OG   . SER A 1 66  ? 7.803   -4.553  -22.029 1.00 0.00 ? 441 SER A OG   5  
ATOM 8097  H H    . SER A 1 66  ? 7.639   -0.858  -23.381 1.00 0.00 ? 441 SER A H    5  
ATOM 8098  H HA   . SER A 1 66  ? 5.945   -3.169  -22.825 1.00 0.00 ? 441 SER A HA   5  
ATOM 8099  H HB2  . SER A 1 66  ? 8.650   -2.953  -22.965 1.00 0.00 ? 441 SER A HB2  5  
ATOM 8100  H HB3  . SER A 1 66  ? 8.401   -2.774  -21.229 1.00 0.00 ? 441 SER A HB3  5  
ATOM 8101  H HG   . SER A 1 66  ? 7.434   -4.901  -22.844 1.00 0.00 ? 441 SER A HG   5  
ATOM 8102  N N    . VAL A 1 67  ? 4.884   -2.396  -20.740 1.00 0.00 ? 442 VAL A N    5  
ATOM 8103  C CA   . VAL A 1 67  ? 4.228   -1.968  -19.511 1.00 0.00 ? 442 VAL A CA   5  
ATOM 8104  C C    . VAL A 1 67  ? 4.228   -3.090  -18.475 1.00 0.00 ? 442 VAL A C    5  
ATOM 8105  O O    . VAL A 1 67  ? 3.804   -4.209  -18.760 1.00 0.00 ? 442 VAL A O    5  
ATOM 8106  C CB   . VAL A 1 67  ? 2.776   -1.524  -19.775 1.00 0.00 ? 442 VAL A CB   5  
ATOM 8107  C CG1  . VAL A 1 67  ? 2.108   -1.070  -18.485 1.00 0.00 ? 442 VAL A CG1  5  
ATOM 8108  C CG2  . VAL A 1 67  ? 2.738   -0.418  -20.817 1.00 0.00 ? 442 VAL A CG2  5  
ATOM 8109  H H    . VAL A 1 67  ? 4.443   -3.059  -21.310 1.00 0.00 ? 442 VAL A H    5  
ATOM 8110  H HA   . VAL A 1 67  ? 4.776   -1.125  -19.115 1.00 0.00 ? 442 VAL A HA   5  
ATOM 8111  H HB   . VAL A 1 67  ? 2.225   -2.370  -20.159 1.00 0.00 ? 442 VAL A HB   5  
ATOM 8112  H HG11 . VAL A 1 67  ? 2.746   -0.359  -17.980 1.00 0.00 ? 442 VAL A HG11 5  
ATOM 8113  H HG12 . VAL A 1 67  ? 1.161   -0.606  -18.714 1.00 0.00 ? 442 VAL A HG12 5  
ATOM 8114  H HG13 . VAL A 1 67  ? 1.944   -1.925  -17.844 1.00 0.00 ? 442 VAL A HG13 5  
ATOM 8115  H HG21 . VAL A 1 67  ? 1.869   0.202   -20.654 1.00 0.00 ? 442 VAL A HG21 5  
ATOM 8116  H HG22 . VAL A 1 67  ? 3.631   0.185   -20.735 1.00 0.00 ? 442 VAL A HG22 5  
ATOM 8117  H HG23 . VAL A 1 67  ? 2.689   -0.855  -21.804 1.00 0.00 ? 442 VAL A HG23 5  
ATOM 8118  N N    . VAL A 1 68  ? 4.708   -2.783  -17.274 1.00 0.00 ? 443 VAL A N    5  
ATOM 8119  C CA   . VAL A 1 68  ? 4.762   -3.772  -16.203 1.00 0.00 ? 443 VAL A CA   5  
ATOM 8120  C C    . VAL A 1 68  ? 4.296   -3.193  -14.866 1.00 0.00 ? 443 VAL A C    5  
ATOM 8121  O O    . VAL A 1 68  ? 4.389   -3.856  -13.834 1.00 0.00 ? 443 VAL A O    5  
ATOM 8122  C CB   . VAL A 1 68  ? 6.187   -4.333  -16.036 1.00 0.00 ? 443 VAL A CB   5  
ATOM 8123  C CG1  . VAL A 1 68  ? 6.634   -5.039  -17.306 1.00 0.00 ? 443 VAL A CG1  5  
ATOM 8124  C CG2  . VAL A 1 68  ? 7.161   -3.225  -15.663 1.00 0.00 ? 443 VAL A CG2  5  
ATOM 8125  H H    . VAL A 1 68  ? 5.035   -1.874  -17.106 1.00 0.00 ? 443 VAL A H    5  
ATOM 8126  H HA   . VAL A 1 68  ? 4.109   -4.588  -16.474 1.00 0.00 ? 443 VAL A HA   5  
ATOM 8127  H HB   . VAL A 1 68  ? 6.174   -5.057  -15.234 1.00 0.00 ? 443 VAL A HB   5  
ATOM 8128  H HG11 . VAL A 1 68  ? 5.767   -5.331  -17.881 1.00 0.00 ? 443 VAL A HG11 5  
ATOM 8129  H HG12 . VAL A 1 68  ? 7.246   -4.371  -17.894 1.00 0.00 ? 443 VAL A HG12 5  
ATOM 8130  H HG13 . VAL A 1 68  ? 7.207   -5.918  -17.048 1.00 0.00 ? 443 VAL A HG13 5  
ATOM 8131  H HG21 . VAL A 1 68  ? 7.717   -2.925  -16.539 1.00 0.00 ? 443 VAL A HG21 5  
ATOM 8132  H HG22 . VAL A 1 68  ? 6.613   -2.377  -15.278 1.00 0.00 ? 443 VAL A HG22 5  
ATOM 8133  H HG23 . VAL A 1 68  ? 7.845   -3.585  -14.909 1.00 0.00 ? 443 VAL A HG23 5  
ATOM 8134  N N    . SER A 1 69  ? 3.794   -1.959  -14.884 1.00 0.00 ? 444 SER A N    5  
ATOM 8135  C CA   . SER A 1 69  ? 3.322   -1.316  -13.662 1.00 0.00 ? 444 SER A CA   5  
ATOM 8136  C C    . SER A 1 69  ? 2.584   -0.017  -13.973 1.00 0.00 ? 444 SER A C    5  
ATOM 8137  O O    . SER A 1 69  ? 2.730   0.549   -15.057 1.00 0.00 ? 444 SER A O    5  
ATOM 8138  C CB   . SER A 1 69  ? 4.496   -1.036  -12.723 1.00 0.00 ? 444 SER A CB   5  
ATOM 8139  O OG   . SER A 1 69  ? 5.687   -0.799  -13.452 1.00 0.00 ? 444 SER A OG   5  
ATOM 8140  H H    . SER A 1 69  ? 3.741   -1.472  -15.731 1.00 0.00 ? 444 SER A H    5  
ATOM 8141  H HA   . SER A 1 69  ? 2.638   -1.995  -13.175 1.00 0.00 ? 444 SER A HA   5  
ATOM 8142  H HB2  . SER A 1 69  ? 4.276   -0.164  -12.124 1.00 0.00 ? 444 SER A HB2  5  
ATOM 8143  H HB3  . SER A 1 69  ? 4.647   -1.887  -12.075 1.00 0.00 ? 444 SER A HB3  5  
ATOM 8144  H HG   . SER A 1 69  ? 5.525   -0.131  -14.122 1.00 0.00 ? 444 SER A HG   5  
ATOM 8145  N N    . ALA A 1 70  ? 1.793   0.454   -13.011 1.00 0.00 ? 445 ALA A N    5  
ATOM 8146  C CA   . ALA A 1 70  ? 1.035   1.686   -13.178 1.00 0.00 ? 445 ALA A CA   5  
ATOM 8147  C C    . ALA A 1 70  ? 1.959   2.861   -13.478 1.00 0.00 ? 445 ALA A C    5  
ATOM 8148  O O    . ALA A 1 70  ? 1.692   3.660   -14.376 1.00 0.00 ? 445 ALA A O    5  
ATOM 8149  C CB   . ALA A 1 70  ? 0.207   1.968   -11.933 1.00 0.00 ? 445 ALA A CB   5  
ATOM 8150  H H    . ALA A 1 70  ? 1.719   -0.041  -12.169 1.00 0.00 ? 445 ALA A H    5  
ATOM 8151  H HA   . ALA A 1 70  ? 0.359   1.550   -14.009 1.00 0.00 ? 445 ALA A HA   5  
ATOM 8152  H HB1  . ALA A 1 70  ? -0.786  1.564   -12.063 1.00 0.00 ? 445 ALA A HB1  5  
ATOM 8153  H HB2  . ALA A 1 70  ? 0.675   1.506   -11.076 1.00 0.00 ? 445 ALA A HB2  5  
ATOM 8154  H HB3  . ALA A 1 70  ? 0.144   3.035   -11.777 1.00 0.00 ? 445 ALA A HB3  5  
ATOM 8155  N N    . ASN A 1 71  ? 3.050   2.956   -12.725 1.00 0.00 ? 446 ASN A N    5  
ATOM 8156  C CA   . ASN A 1 71  ? 4.018   4.031   -12.912 1.00 0.00 ? 446 ASN A CA   5  
ATOM 8157  C C    . ASN A 1 71  ? 4.537   4.047   -14.346 1.00 0.00 ? 446 ASN A C    5  
ATOM 8158  O O    . ASN A 1 71  ? 4.916   5.095   -14.869 1.00 0.00 ? 446 ASN A O    5  
ATOM 8159  C CB   . ASN A 1 71  ? 5.184   3.871   -11.935 1.00 0.00 ? 446 ASN A CB   5  
ATOM 8160  C CG   . ASN A 1 71  ? 5.844   2.511   -12.043 1.00 0.00 ? 446 ASN A CG   5  
ATOM 8161  O OD1  . ASN A 1 71  ? 5.437   1.671   -12.845 1.00 0.00 ? 446 ASN A OD1  5  
ATOM 8162  N ND2  . ASN A 1 71  ? 6.873   2.286   -11.232 1.00 0.00 ? 446 ASN A ND2  5  
ATOM 8163  H H    . ASN A 1 71  ? 3.209   2.286   -12.027 1.00 0.00 ? 446 ASN A H    5  
ATOM 8164  H HA   . ASN A 1 71  ? 3.517   4.967   -12.713 1.00 0.00 ? 446 ASN A HA   5  
ATOM 8165  H HB2  . ASN A 1 71  ? 5.926   4.628   -12.142 1.00 0.00 ? 446 ASN A HB2  5  
ATOM 8166  H HB3  . ASN A 1 71  ? 4.820   3.997   -10.927 1.00 0.00 ? 446 ASN A HB3  5  
ATOM 8167  H HD21 . ASN A 1 71  ? 7.142   3.001   -10.619 1.00 0.00 ? 446 ASN A HD21 5  
ATOM 8168  H HD22 . ASN A 1 71  ? 7.318   1.415   -11.280 1.00 0.00 ? 446 ASN A HD22 5  
ATOM 8169  N N    . ASP A 1 72  ? 4.547   2.878   -14.979 1.00 0.00 ? 447 ASP A N    5  
ATOM 8170  C CA   . ASP A 1 72  ? 5.015   2.755   -16.353 1.00 0.00 ? 447 ASP A CA   5  
ATOM 8171  C C    . ASP A 1 72  ? 3.953   3.247   -17.332 1.00 0.00 ? 447 ASP A C    5  
ATOM 8172  O O    . ASP A 1 72  ? 4.273   3.805   -18.382 1.00 0.00 ? 447 ASP A O    5  
ATOM 8173  C CB   . ASP A 1 72  ? 5.377   1.301   -16.662 1.00 0.00 ? 447 ASP A CB   5  
ATOM 8174  C CG   . ASP A 1 72  ? 6.814   0.976   -16.309 1.00 0.00 ? 447 ASP A CG   5  
ATOM 8175  O OD1  . ASP A 1 72  ? 7.174   1.087   -15.118 1.00 0.00 ? 447 ASP A OD1  5  
ATOM 8176  O OD2  . ASP A 1 72  ? 7.582   0.610   -17.224 1.00 0.00 ? 447 ASP A OD2  5  
ATOM 8177  H H    . ASP A 1 72  ? 4.230   2.078   -14.510 1.00 0.00 ? 447 ASP A H    5  
ATOM 8178  H HA   . ASP A 1 72  ? 5.898   3.367   -16.460 1.00 0.00 ? 447 ASP A HA   5  
ATOM 8179  H HB2  . ASP A 1 72  ? 4.731   0.648   -16.095 1.00 0.00 ? 447 ASP A HB2  5  
ATOM 8180  H HB3  . ASP A 1 72  ? 5.233   1.117   -17.717 1.00 0.00 ? 447 ASP A HB3  5  
ATOM 8181  N N    . VAL A 1 73  ? 2.689   3.034   -16.980 1.00 0.00 ? 448 VAL A N    5  
ATOM 8182  C CA   . VAL A 1 73  ? 1.577   3.455   -17.825 1.00 0.00 ? 448 VAL A CA   5  
ATOM 8183  C C    . VAL A 1 73  ? 1.377   4.965   -17.761 1.00 0.00 ? 448 VAL A C    5  
ATOM 8184  O O    . VAL A 1 73  ? 1.047   5.602   -18.762 1.00 0.00 ? 448 VAL A O    5  
ATOM 8185  C CB   . VAL A 1 73  ? 0.263   2.764   -17.413 1.00 0.00 ? 448 VAL A CB   5  
ATOM 8186  C CG1  . VAL A 1 73  ? -0.826  3.034   -18.440 1.00 0.00 ? 448 VAL A CG1  5  
ATOM 8187  C CG2  . VAL A 1 73  ? 0.475   1.268   -17.227 1.00 0.00 ? 448 VAL A CG2  5  
ATOM 8188  H H    . VAL A 1 73  ? 2.499   2.584   -16.130 1.00 0.00 ? 448 VAL A H    5  
ATOM 8189  H HA   . VAL A 1 73  ? 1.805   3.173   -18.844 1.00 0.00 ? 448 VAL A HA   5  
ATOM 8190  H HB   . VAL A 1 73  ? -0.056  3.180   -16.469 1.00 0.00 ? 448 VAL A HB   5  
ATOM 8191  H HG11 . VAL A 1 73  ? -0.892  4.095   -18.625 1.00 0.00 ? 448 VAL A HG11 5  
ATOM 8192  H HG12 . VAL A 1 73  ? -0.587  2.522   -19.361 1.00 0.00 ? 448 VAL A HG12 5  
ATOM 8193  H HG13 . VAL A 1 73  ? -1.773  2.674   -18.064 1.00 0.00 ? 448 VAL A HG13 5  
ATOM 8194  H HG21 . VAL A 1 73  ? -0.072  0.728   -17.986 1.00 0.00 ? 448 VAL A HG21 5  
ATOM 8195  H HG22 . VAL A 1 73  ? 1.527   1.040   -17.310 1.00 0.00 ? 448 VAL A HG22 5  
ATOM 8196  H HG23 . VAL A 1 73  ? 0.120   0.974   -16.250 1.00 0.00 ? 448 VAL A HG23 5  
ATOM 8197  N N    . SER A 1 74  ? 1.572   5.531   -16.574 1.00 0.00 ? 449 SER A N    5  
ATOM 8198  C CA   . SER A 1 74  ? 1.409   6.967   -16.370 1.00 0.00 ? 449 SER A CA   5  
ATOM 8199  C C    . SER A 1 74  ? 2.277   7.767   -17.337 1.00 0.00 ? 449 SER A C    5  
ATOM 8200  O O    . SER A 1 74  ? 1.775   8.593   -18.099 1.00 0.00 ? 449 SER A O    5  
ATOM 8201  C CB   . SER A 1 74  ? 1.760   7.337   -14.928 1.00 0.00 ? 449 SER A CB   5  
ATOM 8202  O OG   . SER A 1 74  ? 1.270   8.624   -14.597 1.00 0.00 ? 449 SER A OG   5  
ATOM 8203  H H    . SER A 1 74  ? 1.831   4.968   -15.815 1.00 0.00 ? 449 SER A H    5  
ATOM 8204  H HA   . SER A 1 74  ? 0.373   7.210   -16.551 1.00 0.00 ? 449 SER A HA   5  
ATOM 8205  H HB2  . SER A 1 74  ? 1.319   6.615   -14.256 1.00 0.00 ? 449 SER A HB2  5  
ATOM 8206  H HB3  . SER A 1 74  ? 2.833   7.331   -14.809 1.00 0.00 ? 449 SER A HB3  5  
ATOM 8207  H HG   . SER A 1 74  ? 1.632   9.271   -15.208 1.00 0.00 ? 449 SER A HG   5  
ATOM 8208  N N    . ASP A 1 75  ? 3.582   7.520   -17.295 1.00 0.00 ? 450 ASP A N    5  
ATOM 8209  C CA   . ASP A 1 75  ? 4.522   8.222   -18.162 1.00 0.00 ? 450 ASP A CA   5  
ATOM 8210  C C    . ASP A 1 75  ? 4.132   8.084   -19.631 1.00 0.00 ? 450 ASP A C    5  
ATOM 8211  O O    . ASP A 1 75  ? 4.218   9.044   -20.398 1.00 0.00 ? 450 ASP A O    5  
ATOM 8212  C CB   . ASP A 1 75  ? 5.940   7.688   -17.947 1.00 0.00 ? 450 ASP A CB   5  
ATOM 8213  C CG   . ASP A 1 75  ? 6.068   6.223   -18.312 1.00 0.00 ? 450 ASP A CG   5  
ATOM 8214  O OD1  . ASP A 1 75  ? 6.291   5.925   -19.504 1.00 0.00 ? 450 ASP A OD1  5  
ATOM 8215  O OD2  . ASP A 1 75  ? 5.946   5.374   -17.404 1.00 0.00 ? 450 ASP A OD2  5  
ATOM 8216  H H    . ASP A 1 75  ? 3.922   6.853   -16.663 1.00 0.00 ? 450 ASP A H    5  
ATOM 8217  H HA   . ASP A 1 75  ? 4.499   9.267   -17.895 1.00 0.00 ? 450 ASP A HA   5  
ATOM 8218  H HB2  . ASP A 1 75  ? 6.628   8.254   -18.559 1.00 0.00 ? 450 ASP A HB2  5  
ATOM 8219  H HB3  . ASP A 1 75  ? 6.209   7.807   -16.907 1.00 0.00 ? 450 ASP A HB3  5  
ATOM 8220  N N    . VAL A 1 76  ? 3.704   6.888   -20.020 1.00 0.00 ? 451 VAL A N    5  
ATOM 8221  C CA   . VAL A 1 76  ? 3.304   6.631   -21.400 1.00 0.00 ? 451 VAL A CA   5  
ATOM 8222  C C    . VAL A 1 76  ? 2.169   7.558   -21.826 1.00 0.00 ? 451 VAL A C    5  
ATOM 8223  O O    . VAL A 1 76  ? 2.217   8.159   -22.899 1.00 0.00 ? 451 VAL A O    5  
ATOM 8224  C CB   . VAL A 1 76  ? 2.859   5.168   -21.596 1.00 0.00 ? 451 VAL A CB   5  
ATOM 8225  C CG1  . VAL A 1 76  ? 2.567   4.890   -23.063 1.00 0.00 ? 451 VAL A CG1  5  
ATOM 8226  C CG2  . VAL A 1 76  ? 3.916   4.211   -21.065 1.00 0.00 ? 451 VAL A CG2  5  
ATOM 8227  H H    . VAL A 1 76  ? 3.658   6.160   -19.365 1.00 0.00 ? 451 VAL A H    5  
ATOM 8228  H HA   . VAL A 1 76  ? 4.160   6.813   -22.032 1.00 0.00 ? 451 VAL A HA   5  
ATOM 8229  H HB   . VAL A 1 76  ? 1.949   5.012   -21.036 1.00 0.00 ? 451 VAL A HB   5  
ATOM 8230  H HG11 . VAL A 1 76  ? 2.378   5.820   -23.577 1.00 0.00 ? 451 VAL A HG11 5  
ATOM 8231  H HG12 . VAL A 1 76  ? 3.417   4.396   -23.512 1.00 0.00 ? 451 VAL A HG12 5  
ATOM 8232  H HG13 . VAL A 1 76  ? 1.699   4.252   -23.142 1.00 0.00 ? 451 VAL A HG13 5  
ATOM 8233  H HG21 . VAL A 1 76  ? 4.453   3.772   -21.894 1.00 0.00 ? 451 VAL A HG21 5  
ATOM 8234  H HG22 . VAL A 1 76  ? 4.607   4.750   -20.434 1.00 0.00 ? 451 VAL A HG22 5  
ATOM 8235  H HG23 . VAL A 1 76  ? 3.439   3.430   -20.492 1.00 0.00 ? 451 VAL A HG23 5  
ATOM 8236  N N    . ILE A 1 77  ? 1.150   7.670   -20.981 1.00 0.00 ? 452 ILE A N    5  
ATOM 8237  C CA   . ILE A 1 77  ? 0.005   8.523   -21.276 1.00 0.00 ? 452 ILE A CA   5  
ATOM 8238  C C    . ILE A 1 77  ? 0.442   9.971   -21.482 1.00 0.00 ? 452 ILE A C    5  
ATOM 8239  O O    . ILE A 1 77  ? -0.113  10.684  -22.317 1.00 0.00 ? 452 ILE A O    5  
ATOM 8240  C CB   . ILE A 1 77  ? -1.047  8.463   -20.151 1.00 0.00 ? 452 ILE A CB   5  
ATOM 8241  C CG1  . ILE A 1 77  ? -1.445  7.012   -19.875 1.00 0.00 ? 452 ILE A CG1  5  
ATOM 8242  C CG2  . ILE A 1 77  ? -2.270  9.292   -20.518 1.00 0.00 ? 452 ILE A CG2  5  
ATOM 8243  C CD1  . ILE A 1 77  ? -1.755  6.736   -18.420 1.00 0.00 ? 452 ILE A CD1  5  
ATOM 8244  H H    . ILE A 1 77  ? 1.167   7.165   -20.140 1.00 0.00 ? 452 ILE A H    5  
ATOM 8245  H HA   . ILE A 1 77  ? -0.452  8.163   -22.187 1.00 0.00 ? 452 ILE A HA   5  
ATOM 8246  H HB   . ILE A 1 77  ? -0.612  8.886   -19.258 1.00 0.00 ? 452 ILE A HB   5  
ATOM 8247  H HG12 . ILE A 1 77  ? -2.326  6.772   -20.451 1.00 0.00 ? 452 ILE A HG12 5  
ATOM 8248  H HG13 . ILE A 1 77  ? -0.636  6.361   -20.173 1.00 0.00 ? 452 ILE A HG13 5  
ATOM 8249  H HG21 . ILE A 1 77  ? -1.955  10.263  -20.870 1.00 0.00 ? 452 ILE A HG21 5  
ATOM 8250  H HG22 . ILE A 1 77  ? -2.824  8.789   -21.298 1.00 0.00 ? 452 ILE A HG22 5  
ATOM 8251  H HG23 . ILE A 1 77  ? -2.900  9.409   -19.649 1.00 0.00 ? 452 ILE A HG23 5  
ATOM 8252  H HD11 . ILE A 1 77  ? -0.854  6.424   -17.913 1.00 0.00 ? 452 ILE A HD11 5  
ATOM 8253  H HD12 . ILE A 1 77  ? -2.136  7.634   -17.956 1.00 0.00 ? 452 ILE A HD12 5  
ATOM 8254  H HD13 . ILE A 1 77  ? -2.495  5.953   -18.352 1.00 0.00 ? 452 ILE A HD13 5  
ATOM 8255  N N    . LYS A 1 78  ? 1.442   10.397  -20.716 1.00 0.00 ? 453 LYS A N    5  
ATOM 8256  C CA   . LYS A 1 78  ? 1.957   11.757  -20.819 1.00 0.00 ? 453 LYS A CA   5  
ATOM 8257  C C    . LYS A 1 78  ? 3.164   11.825  -21.755 1.00 0.00 ? 453 LYS A C    5  
ATOM 8258  O O    . LYS A 1 78  ? 3.727   12.897  -21.976 1.00 0.00 ? 453 LYS A O    5  
ATOM 8259  C CB   . LYS A 1 78  ? 2.342   12.284  -19.435 1.00 0.00 ? 453 LYS A CB   5  
ATOM 8260  C CG   . LYS A 1 78  ? 1.236   12.144  -18.401 1.00 0.00 ? 453 LYS A CG   5  
ATOM 8261  C CD   . LYS A 1 78  ? 1.694   11.340  -17.195 1.00 0.00 ? 453 LYS A CD   5  
ATOM 8262  C CE   . LYS A 1 78  ? 2.275   12.237  -16.113 1.00 0.00 ? 453 LYS A CE   5  
ATOM 8263  N NZ   . LYS A 1 78  ? 1.228   13.077  -15.467 1.00 0.00 ? 453 LYS A NZ   5  
ATOM 8264  H H    . LYS A 1 78  ? 1.845   9.780   -20.070 1.00 0.00 ? 453 LYS A H    5  
ATOM 8265  H HA   . LYS A 1 78  ? 1.171   12.379  -21.223 1.00 0.00 ? 453 LYS A HA   5  
ATOM 8266  H HB2  . LYS A 1 78  ? 3.207   11.738  -19.085 1.00 0.00 ? 453 LYS A HB2  5  
ATOM 8267  H HB3  . LYS A 1 78  ? 2.598   13.330  -19.519 1.00 0.00 ? 453 LYS A HB3  5  
ATOM 8268  H HG2  . LYS A 1 78  ? 0.939   13.129  -18.072 1.00 0.00 ? 453 LYS A HG2  5  
ATOM 8269  H HG3  . LYS A 1 78  ? 0.393   11.646  -18.855 1.00 0.00 ? 453 LYS A HG3  5  
ATOM 8270  H HD2  . LYS A 1 78  ? 0.849   10.805  -16.788 1.00 0.00 ? 453 LYS A HD2  5  
ATOM 8271  H HD3  . LYS A 1 78  ? 2.450   10.637  -17.510 1.00 0.00 ? 453 LYS A HD3  5  
ATOM 8272  H HE2  . LYS A 1 78  ? 2.741   11.618  -15.362 1.00 0.00 ? 453 LYS A HE2  5  
ATOM 8273  H HE3  . LYS A 1 78  ? 3.017   12.882  -16.560 1.00 0.00 ? 453 LYS A HE3  5  
ATOM 8274  H HZ1  . LYS A 1 78  ? 1.624   14.002  -15.206 1.00 0.00 ? 453 LYS A HZ1  5  
ATOM 8275  H HZ2  . LYS A 1 78  ? 0.433   13.225  -16.121 1.00 0.00 ? 453 LYS A HZ2  5  
ATOM 8276  H HZ3  . LYS A 1 78  ? 0.874   12.609  -14.609 1.00 0.00 ? 453 LYS A HZ3  5  
ATOM 8277  N N    . ARG A 1 79  ? 3.560   10.677  -22.300 1.00 0.00 ? 454 ARG A N    5  
ATOM 8278  C CA   . ARG A 1 79  ? 4.700   10.614  -23.206 1.00 0.00 ? 454 ARG A CA   5  
ATOM 8279  C C    . ARG A 1 79  ? 4.239   10.564  -24.658 1.00 0.00 ? 454 ARG A C    5  
ATOM 8280  O O    . ARG A 1 79  ? 4.744   11.298  -25.507 1.00 0.00 ? 454 ARG A O    5  
ATOM 8281  C CB   . ARG A 1 79  ? 5.556   9.387   -22.892 1.00 0.00 ? 454 ARG A CB   5  
ATOM 8282  C CG   . ARG A 1 79  ? 6.793   9.270   -23.765 1.00 0.00 ? 454 ARG A CG   5  
ATOM 8283  C CD   . ARG A 1 79  ? 7.703   8.149   -23.291 1.00 0.00 ? 454 ARG A CD   5  
ATOM 8284  N NE   . ARG A 1 79  ? 9.085   8.595   -23.132 1.00 0.00 ? 454 ARG A NE   5  
ATOM 8285  C CZ   . ARG A 1 79  ? 9.898   8.870   -24.150 1.00 0.00 ? 454 ARG A CZ   5  
ATOM 8286  N NH1  . ARG A 1 79  ? 9.471   8.746   -25.401 1.00 0.00 ? 454 ARG A NH1  5  
ATOM 8287  N NH2  . ARG A 1 79  ? 11.140  9.270   -23.917 1.00 0.00 ? 454 ARG A NH2  5  
ATOM 8288  H H    . ARG A 1 79  ? 3.077   9.852   -22.088 1.00 0.00 ? 454 ARG A H    5  
ATOM 8289  H HA   . ARG A 1 79  ? 5.294   11.502  -23.058 1.00 0.00 ? 454 ARG A HA   5  
ATOM 8290  H HB2  . ARG A 1 79  ? 5.872   9.438   -21.860 1.00 0.00 ? 454 ARG A HB2  5  
ATOM 8291  H HB3  . ARG A 1 79  ? 4.958   8.500   -23.033 1.00 0.00 ? 454 ARG A HB3  5  
ATOM 8292  H HG2  . ARG A 1 79  ? 6.488   9.068   -24.780 1.00 0.00 ? 454 ARG A HG2  5  
ATOM 8293  H HG3  . ARG A 1 79  ? 7.337   10.203  -23.728 1.00 0.00 ? 454 ARG A HG3  5  
ATOM 8294  H HD2  . ARG A 1 79  ? 7.342   7.786   -22.342 1.00 0.00 ? 454 ARG A HD2  5  
ATOM 8295  H HD3  . ARG A 1 79  ? 7.674   7.350   -24.016 1.00 0.00 ? 454 ARG A HD3  5  
ATOM 8296  H HE   . ARG A 1 79  ? 9.426   8.695   -22.219 1.00 0.00 ? 454 ARG A HE   5  
ATOM 8297  H HH11 . ARG A 1 79  ? 8.535   8.445   -25.584 1.00 0.00 ? 454 ARG A HH11 5  
ATOM 8298  H HH12 . ARG A 1 79  ? 10.086  8.955   -26.161 1.00 0.00 ? 454 ARG A HH12 5  
ATOM 8299  H HH21 . ARG A 1 79  ? 11.466  9.364   -22.976 1.00 0.00 ? 454 ARG A HH21 5  
ATOM 8300  H HH22 . ARG A 1 79  ? 11.751  9.475   -24.682 1.00 0.00 ? 454 ARG A HH22 5  
ATOM 8301  N N    . GLU A 1 80  ? 3.279   9.689   -24.936 1.00 0.00 ? 455 GLU A N    5  
ATOM 8302  C CA   . GLU A 1 80  ? 2.749   9.534   -26.286 1.00 0.00 ? 455 GLU A CA   5  
ATOM 8303  C C    . GLU A 1 80  ? 1.281   9.946   -26.341 1.00 0.00 ? 455 GLU A C    5  
ATOM 8304  O O    . GLU A 1 80  ? 0.565   9.859   -25.343 1.00 0.00 ? 455 GLU A O    5  
ATOM 8305  C CB   . GLU A 1 80  ? 2.898   8.083   -26.757 1.00 0.00 ? 455 GLU A CB   5  
ATOM 8306  C CG   . GLU A 1 80  ? 4.123   7.373   -26.198 1.00 0.00 ? 455 GLU A CG   5  
ATOM 8307  C CD   . GLU A 1 80  ? 5.385   7.681   -26.978 1.00 0.00 ? 455 GLU A CD   5  
ATOM 8308  O OE1  . GLU A 1 80  ? 5.843   8.842   -26.933 1.00 0.00 ? 455 GLU A OE1  5  
ATOM 8309  O OE2  . GLU A 1 80  ? 5.916   6.760   -27.635 1.00 0.00 ? 455 GLU A OE2  5  
ATOM 8310  H H    . GLU A 1 80  ? 2.921   9.129   -24.216 1.00 0.00 ? 455 GLU A H    5  
ATOM 8311  H HA   . GLU A 1 80  ? 3.316   10.178  -26.942 1.00 0.00 ? 455 GLU A HA   5  
ATOM 8312  H HB2  . GLU A 1 80  ? 2.022   7.529   -26.458 1.00 0.00 ? 455 GLU A HB2  5  
ATOM 8313  H HB3  . GLU A 1 80  ? 2.967   8.074   -27.835 1.00 0.00 ? 455 GLU A HB3  5  
ATOM 8314  H HG2  . GLU A 1 80  ? 4.268   7.681   -25.174 1.00 0.00 ? 455 GLU A HG2  5  
ATOM 8315  H HG3  . GLU A 1 80  ? 3.949   6.308   -26.227 1.00 0.00 ? 455 GLU A HG3  5  
ATOM 8316  N N    . SER A 1 81  ? 0.837   10.387  -27.514 1.00 0.00 ? 456 SER A N    5  
ATOM 8317  C CA   . SER A 1 81  ? -0.548  10.806  -27.694 1.00 0.00 ? 456 SER A CA   5  
ATOM 8318  C C    . SER A 1 81  ? -1.395  9.654   -28.228 1.00 0.00 ? 456 SER A C    5  
ATOM 8319  O O    . SER A 1 81  ? -2.563  9.510   -27.866 1.00 0.00 ? 456 SER A O    5  
ATOM 8320  C CB   . SER A 1 81  ? -0.626  12.000  -28.648 1.00 0.00 ? 456 SER A CB   5  
ATOM 8321  O OG   . SER A 1 81  ? -1.787  12.774  -28.402 1.00 0.00 ? 456 SER A OG   5  
ATOM 8322  H H    . SER A 1 81  ? 1.453   10.431  -28.274 1.00 0.00 ? 456 SER A H    5  
ATOM 8323  H HA   . SER A 1 81  ? -0.933  11.103  -26.730 1.00 0.00 ? 456 SER A HA   5  
ATOM 8324  H HB2  . SER A 1 81  ? 0.243   12.625  -28.511 1.00 0.00 ? 456 SER A HB2  5  
ATOM 8325  H HB3  . SER A 1 81  ? -0.656  11.643  -29.667 1.00 0.00 ? 456 SER A HB3  5  
ATOM 8326  H HG   . SER A 1 81  ? -1.552  13.705  -28.372 1.00 0.00 ? 456 SER A HG   5  
ATOM 8327  N N    . THR A 1 82  ? -0.795  8.833   -29.084 1.00 0.00 ? 457 THR A N    5  
ATOM 8328  C CA   . THR A 1 82  ? -1.490  7.688   -29.662 1.00 0.00 ? 457 THR A CA   5  
ATOM 8329  C C    . THR A 1 82  ? -1.128  6.411   -28.912 1.00 0.00 ? 457 THR A C    5  
ATOM 8330  O O    . THR A 1 82  ? -0.119  5.771   -29.206 1.00 0.00 ? 457 THR A O    5  
ATOM 8331  C CB   . THR A 1 82  ? -1.144  7.543   -31.146 1.00 0.00 ? 457 THR A CB   5  
ATOM 8332  O OG1  . THR A 1 82  ? -0.041  8.363   -31.489 1.00 0.00 ? 457 THR A OG1  5  
ATOM 8333  C CG2  . THR A 1 82  ? -2.290  7.909   -32.064 1.00 0.00 ? 457 THR A CG2  5  
ATOM 8334  H H    . THR A 1 82  ? 0.139   8.998   -29.329 1.00 0.00 ? 457 THR A H    5  
ATOM 8335  H HA   . THR A 1 82  ? -2.551  7.861   -29.562 1.00 0.00 ? 457 THR A HA   5  
ATOM 8336  H HB   . THR A 1 82  ? -0.878  6.515   -31.345 1.00 0.00 ? 457 THR A HB   5  
ATOM 8337  H HG1  . THR A 1 82  ? 0.181   8.229   -32.414 1.00 0.00 ? 457 THR A HG1  5  
ATOM 8338  H HG21 . THR A 1 82  ? -3.212  7.917   -31.502 1.00 0.00 ? 457 THR A HG21 5  
ATOM 8339  H HG22 . THR A 1 82  ? -2.117  8.889   -32.484 1.00 0.00 ? 457 THR A HG22 5  
ATOM 8340  H HG23 . THR A 1 82  ? -2.360  7.182   -32.860 1.00 0.00 ? 457 THR A HG23 5  
ATOM 8341  N N    . LEU A 1 83  ? -1.954  6.052   -27.935 1.00 0.00 ? 458 LEU A N    5  
ATOM 8342  C CA   . LEU A 1 83  ? -1.718  4.857   -27.136 1.00 0.00 ? 458 LEU A CA   5  
ATOM 8343  C C    . LEU A 1 83  ? -2.386  3.636   -27.761 1.00 0.00 ? 458 LEU A C    5  
ATOM 8344  O O    . LEU A 1 83  ? -3.596  3.624   -27.985 1.00 0.00 ? 458 LEU A O    5  
ATOM 8345  C CB   . LEU A 1 83  ? -2.239  5.067   -25.714 1.00 0.00 ? 458 LEU A CB   5  
ATOM 8346  C CG   . LEU A 1 83  ? -1.920  6.431   -25.101 1.00 0.00 ? 458 LEU A CG   5  
ATOM 8347  C CD1  . LEU A 1 83  ? -2.456  6.518   -23.681 1.00 0.00 ? 458 LEU A CD1  5  
ATOM 8348  C CD2  . LEU A 1 83  ? -0.419  6.684   -25.124 1.00 0.00 ? 458 LEU A CD2  5  
ATOM 8349  H H    . LEU A 1 83  ? -2.738  6.608   -27.744 1.00 0.00 ? 458 LEU A H    5  
ATOM 8350  H HA   . LEU A 1 83  ? -0.653  4.689   -27.097 1.00 0.00 ? 458 LEU A HA   5  
ATOM 8351  H HB2  . LEU A 1 83  ? -3.313  4.942   -25.724 1.00 0.00 ? 458 LEU A HB2  5  
ATOM 8352  H HB3  . LEU A 1 83  ? -1.812  4.304   -25.080 1.00 0.00 ? 458 LEU A HB3  5  
ATOM 8353  H HG   . LEU A 1 83  ? -2.399  7.202   -25.687 1.00 0.00 ? 458 LEU A HG   5  
ATOM 8354  H HD11 . LEU A 1 83  ? -2.214  5.610   -23.147 1.00 0.00 ? 458 LEU A HD11 5  
ATOM 8355  H HD12 . LEU A 1 83  ? -2.009  7.363   -23.179 1.00 0.00 ? 458 LEU A HD12 5  
ATOM 8356  H HD13 . LEU A 1 83  ? -3.529  6.643   -23.709 1.00 0.00 ? 458 LEU A HD13 5  
ATOM 8357  H HD21 . LEU A 1 83  ? -0.131  7.217   -24.230 1.00 0.00 ? 458 LEU A HD21 5  
ATOM 8358  H HD22 . LEU A 1 83  ? 0.104   5.741   -25.165 1.00 0.00 ? 458 LEU A HD22 5  
ATOM 8359  H HD23 . LEU A 1 83  ? -0.167  7.275   -25.992 1.00 0.00 ? 458 LEU A HD23 5  
ATOM 8360  N N    . ASN A 1 84  ? -1.588  2.610   -28.035 1.00 0.00 ? 459 ASN A N    5  
ATOM 8361  C CA   . ASN A 1 84  ? -2.098  1.379   -28.630 1.00 0.00 ? 459 ASN A CA   5  
ATOM 8362  C C    . ASN A 1 84  ? -2.032  0.231   -27.629 1.00 0.00 ? 459 ASN A C    5  
ATOM 8363  O O    . ASN A 1 84  ? -1.086  -0.556  -27.633 1.00 0.00 ? 459 ASN A O    5  
ATOM 8364  C CB   . ASN A 1 84  ? -1.300  1.025   -29.886 1.00 0.00 ? 459 ASN A CB   5  
ATOM 8365  C CG   . ASN A 1 84  ? -1.615  1.946   -31.049 1.00 0.00 ? 459 ASN A CG   5  
ATOM 8366  O OD1  . ASN A 1 84  ? -2.196  1.526   -32.050 1.00 0.00 ? 459 ASN A OD1  5  
ATOM 8367  N ND2  . ASN A 1 84  ? -1.233  3.212   -30.921 1.00 0.00 ? 459 ASN A ND2  5  
ATOM 8368  H H    . ASN A 1 84  ? -0.632  2.680   -27.830 1.00 0.00 ? 459 ASN A H    5  
ATOM 8369  H HA   . ASN A 1 84  ? -3.129  1.546   -28.903 1.00 0.00 ? 459 ASN A HA   5  
ATOM 8370  H HB2  . ASN A 1 84  ? -0.245  1.099   -29.669 1.00 0.00 ? 459 ASN A HB2  5  
ATOM 8371  H HB3  . ASN A 1 84  ? -1.532  0.013   -30.180 1.00 0.00 ? 459 ASN A HB3  5  
ATOM 8372  H HD21 . ASN A 1 84  ? -0.775  3.476   -30.096 1.00 0.00 ? 459 ASN A HD21 5  
ATOM 8373  H HD22 . ASN A 1 84  ? -1.423  3.830   -31.657 1.00 0.00 ? 459 ASN A HD22 5  
ATOM 8374  N N    . MET A 1 85  ? -3.041  0.147   -26.769 1.00 0.00 ? 460 MET A N    5  
ATOM 8375  C CA   . MET A 1 85  ? -3.099  -0.901  -25.755 1.00 0.00 ? 460 MET A CA   5  
ATOM 8376  C C    . MET A 1 85  ? -3.831  -2.131  -26.280 1.00 0.00 ? 460 MET A C    5  
ATOM 8377  O O    . MET A 1 85  ? -4.904  -2.023  -26.873 1.00 0.00 ? 460 MET A O    5  
ATOM 8378  C CB   . MET A 1 85  ? -3.791  -0.379  -24.494 1.00 0.00 ? 460 MET A CB   5  
ATOM 8379  C CG   . MET A 1 85  ? -3.262  0.965   -24.021 1.00 0.00 ? 460 MET A CG   5  
ATOM 8380  S SD   . MET A 1 85  ? -4.508  1.937   -23.153 1.00 0.00 ? 460 MET A SD   5  
ATOM 8381  C CE   . MET A 1 85  ? -4.211  3.565   -23.840 1.00 0.00 ? 460 MET A CE   5  
ATOM 8382  H H    . MET A 1 85  ? -3.764  0.807   -26.814 1.00 0.00 ? 460 MET A H    5  
ATOM 8383  H HA   . MET A 1 85  ? -2.085  -1.180  -25.509 1.00 0.00 ? 460 MET A HA   5  
ATOM 8384  H HB2  . MET A 1 85  ? -4.847  -0.275  -24.695 1.00 0.00 ? 460 MET A HB2  5  
ATOM 8385  H HB3  . MET A 1 85  ? -3.653  -1.096  -23.699 1.00 0.00 ? 460 MET A HB3  5  
ATOM 8386  H HG2  . MET A 1 85  ? -2.430  0.794   -23.353 1.00 0.00 ? 460 MET A HG2  5  
ATOM 8387  H HG3  . MET A 1 85  ? -2.922  1.526   -24.879 1.00 0.00 ? 460 MET A HG3  5  
ATOM 8388  H HE1  . MET A 1 85  ? -4.840  4.287   -23.341 1.00 0.00 ? 460 MET A HE1  5  
ATOM 8389  H HE2  . MET A 1 85  ? -3.173  3.832   -23.697 1.00 0.00 ? 460 MET A HE2  5  
ATOM 8390  H HE3  . MET A 1 85  ? -4.437  3.558   -24.896 1.00 0.00 ? 460 MET A HE3  5  
ATOM 8391  N N    . VAL A 1 86  ? -3.243  -3.301  -26.053 1.00 0.00 ? 461 VAL A N    5  
ATOM 8392  C CA   . VAL A 1 86  ? -3.837  -4.555  -26.499 1.00 0.00 ? 461 VAL A CA   5  
ATOM 8393  C C    . VAL A 1 86  ? -4.376  -5.353  -25.316 1.00 0.00 ? 461 VAL A C    5  
ATOM 8394  O O    . VAL A 1 86  ? -3.647  -5.644  -24.368 1.00 0.00 ? 461 VAL A O    5  
ATOM 8395  C CB   . VAL A 1 86  ? -2.815  -5.419  -27.261 1.00 0.00 ? 461 VAL A CB   5  
ATOM 8396  C CG1  . VAL A 1 86  ? -3.486  -6.650  -27.853 1.00 0.00 ? 461 VAL A CG1  5  
ATOM 8397  C CG2  . VAL A 1 86  ? -2.132  -4.601  -28.347 1.00 0.00 ? 461 VAL A CG2  5  
ATOM 8398  H H    . VAL A 1 86  ? -2.389  -3.321  -25.573 1.00 0.00 ? 461 VAL A H    5  
ATOM 8399  H HA   . VAL A 1 86  ? -4.653  -4.321  -27.167 1.00 0.00 ? 461 VAL A HA   5  
ATOM 8400  H HB   . VAL A 1 86  ? -2.061  -5.750  -26.562 1.00 0.00 ? 461 VAL A HB   5  
ATOM 8401  H HG11 . VAL A 1 86  ? -4.312  -6.946  -27.224 1.00 0.00 ? 461 VAL A HG11 5  
ATOM 8402  H HG12 . VAL A 1 86  ? -3.852  -6.420  -28.842 1.00 0.00 ? 461 VAL A HG12 5  
ATOM 8403  H HG13 . VAL A 1 86  ? -2.771  -7.456  -27.912 1.00 0.00 ? 461 VAL A HG13 5  
ATOM 8404  H HG21 . VAL A 1 86  ? -2.780  -4.533  -29.208 1.00 0.00 ? 461 VAL A HG21 5  
ATOM 8405  H HG22 . VAL A 1 86  ? -1.923  -3.610  -27.974 1.00 0.00 ? 461 VAL A HG22 5  
ATOM 8406  H HG23 . VAL A 1 86  ? -1.207  -5.082  -28.630 1.00 0.00 ? 461 VAL A HG23 5  
ATOM 8407  N N    . VAL A 1 87  ? -5.656  -5.705  -25.379 1.00 0.00 ? 462 VAL A N    5  
ATOM 8408  C CA   . VAL A 1 87  ? -6.289  -6.472  -24.312 1.00 0.00 ? 462 VAL A CA   5  
ATOM 8409  C C    . VAL A 1 87  ? -6.631  -7.881  -24.784 1.00 0.00 ? 462 VAL A C    5  
ATOM 8410  O O    . VAL A 1 87  ? -6.657  -8.153  -25.984 1.00 0.00 ? 462 VAL A O    5  
ATOM 8411  C CB   . VAL A 1 87  ? -7.572  -5.784  -23.801 1.00 0.00 ? 462 VAL A CB   5  
ATOM 8412  C CG1  . VAL A 1 87  ? -7.959  -6.330  -22.434 1.00 0.00 ? 462 VAL A CG1  5  
ATOM 8413  C CG2  . VAL A 1 87  ? -7.391  -4.272  -23.745 1.00 0.00 ? 462 VAL A CG2  5  
ATOM 8414  H H    . VAL A 1 87  ? -6.187  -5.446  -26.161 1.00 0.00 ? 462 VAL A H    5  
ATOM 8415  H HA   . VAL A 1 87  ? -5.589  -6.539  -23.490 1.00 0.00 ? 462 VAL A HA   5  
ATOM 8416  H HB   . VAL A 1 87  ? -8.373  -6.005  -24.490 1.00 0.00 ? 462 VAL A HB   5  
ATOM 8417  H HG11 . VAL A 1 87  ? -7.081  -6.713  -21.937 1.00 0.00 ? 462 VAL A HG11 5  
ATOM 8418  H HG12 . VAL A 1 87  ? -8.392  -5.538  -21.840 1.00 0.00 ? 462 VAL A HG12 5  
ATOM 8419  H HG13 . VAL A 1 87  ? -8.680  -7.124  -22.555 1.00 0.00 ? 462 VAL A HG13 5  
ATOM 8420  H HG21 . VAL A 1 87  ? -7.750  -3.900  -22.797 1.00 0.00 ? 462 VAL A HG21 5  
ATOM 8421  H HG22 . VAL A 1 87  ? -6.344  -4.030  -23.853 1.00 0.00 ? 462 VAL A HG22 5  
ATOM 8422  H HG23 . VAL A 1 87  ? -7.950  -3.814  -24.547 1.00 0.00 ? 462 VAL A HG23 5  
ATOM 8423  N N    . ARG A 1 88  ? -6.887  -8.775  -23.834 1.00 0.00 ? 463 ARG A N    5  
ATOM 8424  C CA   . ARG A 1 88  ? -7.222  -10.157 -24.158 1.00 0.00 ? 463 ARG A CA   5  
ATOM 8425  C C    . ARG A 1 88  ? -8.551  -10.561 -23.527 1.00 0.00 ? 463 ARG A C    5  
ATOM 8426  O O    . ARG A 1 88  ? -8.876  -10.143 -22.417 1.00 0.00 ? 463 ARG A O    5  
ATOM 8427  C CB   . ARG A 1 88  ? -6.113  -11.096 -23.681 1.00 0.00 ? 463 ARG A CB   5  
ATOM 8428  C CG   . ARG A 1 88  ? -6.380  -12.561 -23.992 1.00 0.00 ? 463 ARG A CG   5  
ATOM 8429  C CD   . ARG A 1 88  ? -6.550  -13.380 -22.723 1.00 0.00 ? 463 ARG A CD   5  
ATOM 8430  N NE   . ARG A 1 88  ? -6.259  -14.795 -22.941 1.00 0.00 ? 463 ARG A NE   5  
ATOM 8431  C CZ   . ARG A 1 88  ? -5.953  -15.649 -21.965 1.00 0.00 ? 463 ARG A CZ   5  
ATOM 8432  N NH1  . ARG A 1 88  ? -5.899  -15.237 -20.704 1.00 0.00 ? 463 ARG A NH1  5  
ATOM 8433  N NH2  . ARG A 1 88  ? -5.702  -16.918 -22.252 1.00 0.00 ? 463 ARG A NH2  5  
ATOM 8434  H H    . ARG A 1 88  ? -6.846  -8.501  -22.895 1.00 0.00 ? 463 ARG A H    5  
ATOM 8435  H HA   . ARG A 1 88  ? -7.308  -10.235 -25.231 1.00 0.00 ? 463 ARG A HA   5  
ATOM 8436  H HB2  . ARG A 1 88  ? -5.186  -10.811 -24.158 1.00 0.00 ? 463 ARG A HB2  5  
ATOM 8437  H HB3  . ARG A 1 88  ? -6.003  -10.990 -22.612 1.00 0.00 ? 463 ARG A HB3  5  
ATOM 8438  H HG2  . ARG A 1 88  ? -7.281  -12.635 -24.580 1.00 0.00 ? 463 ARG A HG2  5  
ATOM 8439  H HG3  . ARG A 1 88  ? -5.546  -12.956 -24.555 1.00 0.00 ? 463 ARG A HG3  5  
ATOM 8440  H HD2  . ARG A 1 88  ? -5.879  -12.996 -21.969 1.00 0.00 ? 463 ARG A HD2  5  
ATOM 8441  H HD3  . ARG A 1 88  ? -7.570  -13.280 -22.380 1.00 0.00 ? 463 ARG A HD3  5  
ATOM 8442  H HE   . ARG A 1 88  ? -6.292  -15.128 -23.861 1.00 0.00 ? 463 ARG A HE   5  
ATOM 8443  H HH11 . ARG A 1 88  ? -6.089  -14.280 -20.481 1.00 0.00 ? 463 ARG A HH11 5  
ATOM 8444  H HH12 . ARG A 1 88  ? -5.670  -15.883 -19.977 1.00 0.00 ? 463 ARG A HH12 5  
ATOM 8445  H HH21 . ARG A 1 88  ? -5.742  -17.234 -23.200 1.00 0.00 ? 463 ARG A HH21 5  
ATOM 8446  H HH22 . ARG A 1 88  ? -5.470  -17.560 -21.520 1.00 0.00 ? 463 ARG A HH22 5  
ATOM 8447  N N    . ARG A 1 89  ? -9.313  -11.380 -24.246 1.00 0.00 ? 464 ARG A N    5  
ATOM 8448  C CA   . ARG A 1 89  ? -10.605 -11.848 -23.759 1.00 0.00 ? 464 ARG A CA   5  
ATOM 8449  C C    . ARG A 1 89  ? -10.866 -13.282 -24.207 1.00 0.00 ? 464 ARG A C    5  
ATOM 8450  O O    . ARG A 1 89  ? -10.719 -13.612 -25.384 1.00 0.00 ? 464 ARG A O    5  
ATOM 8451  C CB   . ARG A 1 89  ? -11.727 -10.933 -24.258 1.00 0.00 ? 464 ARG A CB   5  
ATOM 8452  C CG   . ARG A 1 89  ? -12.192 -9.923  -23.224 1.00 0.00 ? 464 ARG A CG   5  
ATOM 8453  C CD   . ARG A 1 89  ? -13.373 -9.112  -23.731 1.00 0.00 ? 464 ARG A CD   5  
ATOM 8454  N NE   . ARG A 1 89  ? -14.638 -9.825  -23.564 1.00 0.00 ? 464 ARG A NE   5  
ATOM 8455  C CZ   . ARG A 1 89  ? -15.830 -9.292  -23.822 1.00 0.00 ? 464 ARG A CZ   5  
ATOM 8456  N NH1  . ARG A 1 89  ? -15.925 -8.041  -24.258 1.00 0.00 ? 464 ARG A NH1  5  
ATOM 8457  N NH2  . ARG A 1 89  ? -16.930 -10.009 -23.642 1.00 0.00 ? 464 ARG A NH2  5  
ATOM 8458  H H    . ARG A 1 89  ? -8.996  -11.681 -25.123 1.00 0.00 ? 464 ARG A H    5  
ATOM 8459  H HA   . ARG A 1 89  ? -10.584 -11.820 -22.679 1.00 0.00 ? 464 ARG A HA   5  
ATOM 8460  H HB2  . ARG A 1 89  ? -11.376 -10.394 -25.125 1.00 0.00 ? 464 ARG A HB2  5  
ATOM 8461  H HB3  . ARG A 1 89  ? -12.573 -11.540 -24.542 1.00 0.00 ? 464 ARG A HB3  5  
ATOM 8462  H HG2  . ARG A 1 89  ? -12.488 -10.449 -22.329 1.00 0.00 ? 464 ARG A HG2  5  
ATOM 8463  H HG3  . ARG A 1 89  ? -11.377 -9.251  -22.997 1.00 0.00 ? 464 ARG A HG3  5  
ATOM 8464  H HD2  . ARG A 1 89  ? -13.420 -8.183  -23.181 1.00 0.00 ? 464 ARG A HD2  5  
ATOM 8465  H HD3  . ARG A 1 89  ? -13.225 -8.901  -24.781 1.00 0.00 ? 464 ARG A HD3  5  
ATOM 8466  H HE   . ARG A 1 89  ? -14.596 -10.750 -23.243 1.00 0.00 ? 464 ARG A HE   5  
ATOM 8467  H HH11 . ARG A 1 89  ? -15.100 -7.494  -24.396 1.00 0.00 ? 464 ARG A HH11 5  
ATOM 8468  H HH12 . ARG A 1 89  ? -16.823 -7.647  -24.449 1.00 0.00 ? 464 ARG A HH12 5  
ATOM 8469  H HH21 . ARG A 1 89  ? -16.864 -10.951 -23.314 1.00 0.00 ? 464 ARG A HH21 5  
ATOM 8470  H HH22 . ARG A 1 89  ? -17.825 -9.608  -23.837 1.00 0.00 ? 464 ARG A HH22 5  
ATOM 8471  N N    . GLY A 1 90  ? -11.251 -14.131 -23.261 1.00 0.00 ? 465 GLY A N    5  
ATOM 8472  C CA   . GLY A 1 90  ? -11.525 -15.519 -23.580 1.00 0.00 ? 465 GLY A CA   5  
ATOM 8473  C C    . GLY A 1 90  ? -10.309 -16.237 -24.130 1.00 0.00 ? 465 GLY A C    5  
ATOM 8474  O O    . GLY A 1 90  ? -9.438  -16.666 -23.373 1.00 0.00 ? 465 GLY A O    5  
ATOM 8475  H H    . GLY A 1 90  ? -11.352 -13.812 -22.340 1.00 0.00 ? 465 GLY A H    5  
ATOM 8476  H HA2  . GLY A 1 90  ? -11.853 -16.024 -22.684 1.00 0.00 ? 465 GLY A HA2  5  
ATOM 8477  H HA3  . GLY A 1 90  ? -12.315 -15.558 -24.315 1.00 0.00 ? 465 GLY A HA3  5  
ATOM 8478  N N    . ASN A 1 91  ? -10.250 -16.371 -25.450 1.00 0.00 ? 466 ASN A N    5  
ATOM 8479  C CA   . ASN A 1 91  ? -9.133  -17.046 -26.102 1.00 0.00 ? 466 ASN A CA   5  
ATOM 8480  C C    . ASN A 1 91  ? -8.732  -16.323 -27.383 1.00 0.00 ? 466 ASN A C    5  
ATOM 8481  O O    . ASN A 1 91  ? -8.265  -16.945 -28.337 1.00 0.00 ? 466 ASN A O    5  
ATOM 8482  C CB   . ASN A 1 91  ? -9.507  -18.494 -26.417 1.00 0.00 ? 466 ASN A CB   5  
ATOM 8483  C CG   . ASN A 1 91  ? -8.306  -19.421 -26.388 1.00 0.00 ? 466 ASN A CG   5  
ATOM 8484  O OD1  . ASN A 1 91  ? -7.509  -19.454 -27.325 1.00 0.00 ? 466 ASN A OD1  5  
ATOM 8485  N ND2  . ASN A 1 91  ? -8.173  -20.180 -25.307 1.00 0.00 ? 466 ASN A ND2  5  
ATOM 8486  H H    . ASN A 1 91  ? -10.976 -16.010 -26.001 1.00 0.00 ? 466 ASN A H    5  
ATOM 8487  H HA   . ASN A 1 91  ? -8.298  -17.038 -25.419 1.00 0.00 ? 466 ASN A HA   5  
ATOM 8488  H HB2  . ASN A 1 91  ? -10.223 -18.841 -25.688 1.00 0.00 ? 466 ASN A HB2  5  
ATOM 8489  H HB3  . ASN A 1 91  ? -9.949  -18.539 -27.401 1.00 0.00 ? 466 ASN A HB3  5  
ATOM 8490  H HD21 . ASN A 1 91  ? -8.847  -20.103 -24.601 1.00 0.00 ? 466 ASN A HD21 5  
ATOM 8491  H HD22 . ASN A 1 91  ? -7.405  -20.788 -25.260 1.00 0.00 ? 466 ASN A HD22 5  
ATOM 8492  N N    . GLU A 1 92  ? -8.919  -15.006 -27.400 1.00 0.00 ? 467 GLU A N    5  
ATOM 8493  C CA   . GLU A 1 92  ? -8.578  -14.203 -28.568 1.00 0.00 ? 467 GLU A CA   5  
ATOM 8494  C C    . GLU A 1 92  ? -7.916  -12.892 -28.159 1.00 0.00 ? 467 GLU A C    5  
ATOM 8495  O O    . GLU A 1 92  ? -8.145  -12.384 -27.061 1.00 0.00 ? 467 GLU A O    5  
ATOM 8496  C CB   . GLU A 1 92  ? -9.834  -13.914 -29.392 1.00 0.00 ? 467 GLU A CB   5  
ATOM 8497  C CG   . GLU A 1 92  ? -10.949 -13.265 -28.588 1.00 0.00 ? 467 GLU A CG   5  
ATOM 8498  C CD   . GLU A 1 92  ? -12.309 -13.435 -29.234 1.00 0.00 ? 467 GLU A CD   5  
ATOM 8499  O OE1  . GLU A 1 92  ? -12.833 -14.568 -29.225 1.00 0.00 ? 467 GLU A OE1  5  
ATOM 8500  O OE2  . GLU A 1 92  ? -12.850 -12.434 -29.750 1.00 0.00 ? 467 GLU A OE2  5  
ATOM 8501  H H    . GLU A 1 92  ? -9.297  -14.567 -26.611 1.00 0.00 ? 467 GLU A H    5  
ATOM 8502  H HA   . GLU A 1 92  ? -7.886  -14.771 -29.172 1.00 0.00 ? 467 GLU A HA   5  
ATOM 8503  H HB2  . GLU A 1 92  ? -9.573  -13.255 -30.205 1.00 0.00 ? 467 GLU A HB2  5  
ATOM 8504  H HB3  . GLU A 1 92  ? -10.206 -14.844 -29.796 1.00 0.00 ? 467 GLU A HB3  5  
ATOM 8505  H HG2  . GLU A 1 92  ? -10.975 -13.715 -27.606 1.00 0.00 ? 467 GLU A HG2  5  
ATOM 8506  H HG3  . GLU A 1 92  ? -10.739 -12.209 -28.494 1.00 0.00 ? 467 GLU A HG3  5  
ATOM 8507  N N    . ASP A 1 93  ? -7.095  -12.346 -29.052 1.00 0.00 ? 468 ASP A N    5  
ATOM 8508  C CA   . ASP A 1 93  ? -6.402  -11.090 -28.789 1.00 0.00 ? 468 ASP A CA   5  
ATOM 8509  C C    . ASP A 1 93  ? -7.206  -9.910  -29.326 1.00 0.00 ? 468 ASP A C    5  
ATOM 8510  O O    . ASP A 1 93  ? -7.865  -10.017 -30.359 1.00 0.00 ? 468 ASP A O    5  
ATOM 8511  C CB   . ASP A 1 93  ? -5.010  -11.107 -29.423 1.00 0.00 ? 468 ASP A CB   5  
ATOM 8512  C CG   . ASP A 1 93  ? -3.970  -11.739 -28.518 1.00 0.00 ? 468 ASP A CG   5  
ATOM 8513  O OD1  . ASP A 1 93  ? -4.093  -11.598 -27.282 1.00 0.00 ? 468 ASP A OD1  5  
ATOM 8514  O OD2  . ASP A 1 93  ? -3.033  -12.376 -29.044 1.00 0.00 ? 468 ASP A OD2  5  
ATOM 8515  H H    . ASP A 1 93  ? -6.955  -12.798 -29.910 1.00 0.00 ? 468 ASP A H    5  
ATOM 8516  H HA   . ASP A 1 93  ? -6.301  -10.986 -27.718 1.00 0.00 ? 468 ASP A HA   5  
ATOM 8517  H HB2  . ASP A 1 93  ? -5.048  -11.670 -30.343 1.00 0.00 ? 468 ASP A HB2  5  
ATOM 8518  H HB3  . ASP A 1 93  ? -4.707  -10.094 -29.637 1.00 0.00 ? 468 ASP A HB3  5  
ATOM 8519  N N    . ILE A 1 94  ? -7.152  -8.788  -28.616 1.00 0.00 ? 469 ILE A N    5  
ATOM 8520  C CA   . ILE A 1 94  ? -7.883  -7.592  -29.025 1.00 0.00 ? 469 ILE A CA   5  
ATOM 8521  C C    . ILE A 1 94  ? -6.971  -6.371  -29.063 1.00 0.00 ? 469 ILE A C    5  
ATOM 8522  O O    . ILE A 1 94  ? -6.258  -6.084  -28.102 1.00 0.00 ? 469 ILE A O    5  
ATOM 8523  C CB   . ILE A 1 94  ? -9.066  -7.302  -28.078 1.00 0.00 ? 469 ILE A CB   5  
ATOM 8524  C CG1  . ILE A 1 94  ? -9.796  -8.598  -27.712 1.00 0.00 ? 469 ILE A CG1  5  
ATOM 8525  C CG2  . ILE A 1 94  ? -10.028 -6.314  -28.721 1.00 0.00 ? 469 ILE A CG2  5  
ATOM 8526  C CD1  . ILE A 1 94  ? -9.692  -8.954  -26.245 1.00 0.00 ? 469 ILE A CD1  5  
ATOM 8527  H H    . ILE A 1 94  ? -6.612  -8.763  -27.798 1.00 0.00 ? 469 ILE A H    5  
ATOM 8528  H HA   . ILE A 1 94  ? -8.276  -7.767  -30.016 1.00 0.00 ? 469 ILE A HA   5  
ATOM 8529  H HB   . ILE A 1 94  ? -8.676  -6.851  -27.178 1.00 0.00 ? 469 ILE A HB   5  
ATOM 8530  H HG12 . ILE A 1 94  ? -10.843 -8.497  -27.953 1.00 0.00 ? 469 ILE A HG12 5  
ATOM 8531  H HG13 . ILE A 1 94  ? -9.378  -9.414  -28.281 1.00 0.00 ? 469 ILE A HG13 5  
ATOM 8532  H HG21 . ILE A 1 94  ? -9.516  -5.766  -29.497 1.00 0.00 ? 469 ILE A HG21 5  
ATOM 8533  H HG22 . ILE A 1 94  ? -10.863 -6.850  -29.148 1.00 0.00 ? 469 ILE A HG22 5  
ATOM 8534  H HG23 . ILE A 1 94  ? -10.389 -5.625  -27.971 1.00 0.00 ? 469 ILE A HG23 5  
ATOM 8535  H HD11 . ILE A 1 94  ? -9.535  -10.018 -26.143 1.00 0.00 ? 469 ILE A HD11 5  
ATOM 8536  H HD12 . ILE A 1 94  ? -8.862  -8.424  -25.804 1.00 0.00 ? 469 ILE A HD12 5  
ATOM 8537  H HD13 . ILE A 1 94  ? -10.606 -8.674  -25.741 1.00 0.00 ? 469 ILE A HD13 5  
ATOM 8538  N N    . MET A 1 95  ? -7.007  -5.648  -30.179 1.00 0.00 ? 470 MET A N    5  
ATOM 8539  C CA   . MET A 1 95  ? -6.192  -4.450  -30.343 1.00 0.00 ? 470 MET A CA   5  
ATOM 8540  C C    . MET A 1 95  ? -7.030  -3.198  -30.108 1.00 0.00 ? 470 MET A C    5  
ATOM 8541  O O    . MET A 1 95  ? -8.071  -3.011  -30.737 1.00 0.00 ? 470 MET A O    5  
ATOM 8542  C CB   . MET A 1 95  ? -5.575  -4.413  -31.743 1.00 0.00 ? 470 MET A CB   5  
ATOM 8543  C CG   . MET A 1 95  ? -4.180  -5.016  -31.809 1.00 0.00 ? 470 MET A CG   5  
ATOM 8544  S SD   . MET A 1 95  ? -4.146  -6.603  -32.663 1.00 0.00 ? 470 MET A SD   5  
ATOM 8545  C CE   . MET A 1 95  ? -2.856  -7.449  -31.754 1.00 0.00 ? 470 MET A CE   5  
ATOM 8546  H H    . MET A 1 95  ? -7.600  -5.925  -30.908 1.00 0.00 ? 470 MET A H    5  
ATOM 8547  H HA   . MET A 1 95  ? -5.399  -4.484  -29.610 1.00 0.00 ? 470 MET A HA   5  
ATOM 8548  H HB2  . MET A 1 95  ? -6.214  -4.960  -32.420 1.00 0.00 ? 470 MET A HB2  5  
ATOM 8549  H HB3  . MET A 1 95  ? -5.515  -3.386  -32.070 1.00 0.00 ? 470 MET A HB3  5  
ATOM 8550  H HG2  . MET A 1 95  ? -3.531  -4.329  -32.333 1.00 0.00 ? 470 MET A HG2  5  
ATOM 8551  H HG3  . MET A 1 95  ? -3.815  -5.156  -30.803 1.00 0.00 ? 470 MET A HG3  5  
ATOM 8552  H HE1  . MET A 1 95  ? -2.389  -8.185  -32.393 1.00 0.00 ? 470 MET A HE1  5  
ATOM 8553  H HE2  . MET A 1 95  ? -2.115  -6.733  -31.430 1.00 0.00 ? 470 MET A HE2  5  
ATOM 8554  H HE3  . MET A 1 95  ? -3.284  -7.939  -30.894 1.00 0.00 ? 470 MET A HE3  5  
ATOM 8555  N N    . ILE A 1 96  ? -6.577  -2.346  -29.193 1.00 0.00 ? 471 ILE A N    5  
ATOM 8556  C CA   . ILE A 1 96  ? -7.299  -1.120  -28.876 1.00 0.00 ? 471 ILE A CA   5  
ATOM 8557  C C    . ILE A 1 96  ? -6.369  0.087   -28.844 1.00 0.00 ? 471 ILE A C    5  
ATOM 8558  O O    . ILE A 1 96  ? -5.222  -0.007  -28.406 1.00 0.00 ? 471 ILE A O    5  
ATOM 8559  C CB   . ILE A 1 96  ? -8.017  -1.232  -27.518 1.00 0.00 ? 471 ILE A CB   5  
ATOM 8560  C CG1  . ILE A 1 96  ? -8.824  -2.532  -27.448 1.00 0.00 ? 471 ILE A CG1  5  
ATOM 8561  C CG2  . ILE A 1 96  ? -8.921  -0.029  -27.295 1.00 0.00 ? 471 ILE A CG2  5  
ATOM 8562  C CD1  . ILE A 1 96  ? -8.001  -3.733  -27.036 1.00 0.00 ? 471 ILE A CD1  5  
ATOM 8563  H H    . ILE A 1 96  ? -5.745  -2.550  -28.718 1.00 0.00 ? 471 ILE A H    5  
ATOM 8564  H HA   . ILE A 1 96  ? -8.046  -0.967  -29.640 1.00 0.00 ? 471 ILE A HA   5  
ATOM 8565  H HB   . ILE A 1 96  ? -7.270  -1.238  -26.739 1.00 0.00 ? 471 ILE A HB   5  
ATOM 8566  H HG12 . ILE A 1 96  ? -9.621  -2.414  -26.730 1.00 0.00 ? 471 ILE A HG12 5  
ATOM 8567  H HG13 . ILE A 1 96  ? -9.248  -2.736  -28.420 1.00 0.00 ? 471 ILE A HG13 5  
ATOM 8568  H HG21 . ILE A 1 96  ? -9.566  0.099   -28.153 1.00 0.00 ? 471 ILE A HG21 5  
ATOM 8569  H HG22 . ILE A 1 96  ? -9.522  -0.188  -26.412 1.00 0.00 ? 471 ILE A HG22 5  
ATOM 8570  H HG23 . ILE A 1 96  ? -8.316  0.856   -27.165 1.00 0.00 ? 471 ILE A HG23 5  
ATOM 8571  H HD11 . ILE A 1 96  ? -7.619  -4.227  -27.916 1.00 0.00 ? 471 ILE A HD11 5  
ATOM 8572  H HD12 . ILE A 1 96  ? -7.177  -3.410  -26.416 1.00 0.00 ? 471 ILE A HD12 5  
ATOM 8573  H HD13 . ILE A 1 96  ? -8.622  -4.420  -26.478 1.00 0.00 ? 471 ILE A HD13 5  
ATOM 8574  N N    . THR A 1 97  ? -6.879  1.225   -29.306 1.00 0.00 ? 472 THR A N    5  
ATOM 8575  C CA   . THR A 1 97  ? -6.106  2.462   -29.329 1.00 0.00 ? 472 THR A CA   5  
ATOM 8576  C C    . THR A 1 97  ? -6.842  3.564   -28.574 1.00 0.00 ? 472 THR A C    5  
ATOM 8577  O O    . THR A 1 97  ? -8.052  3.731   -28.727 1.00 0.00 ? 472 THR A O    5  
ATOM 8578  C CB   . THR A 1 97  ? -5.847  2.899   -30.771 1.00 0.00 ? 472 THR A CB   5  
ATOM 8579  O OG1  . THR A 1 97  ? -5.773  1.775   -31.631 1.00 0.00 ? 472 THR A OG1  5  
ATOM 8580  C CG2  . THR A 1 97  ? -4.566  3.688   -30.935 1.00 0.00 ? 472 THR A CG2  5  
ATOM 8581  H H    . THR A 1 97  ? -7.802  1.234   -29.636 1.00 0.00 ? 472 THR A H    5  
ATOM 8582  H HA   . THR A 1 97  ? -5.162  2.274   -28.842 1.00 0.00 ? 472 THR A HA   5  
ATOM 8583  H HB   . THR A 1 97  ? -6.665  3.525   -31.099 1.00 0.00 ? 472 THR A HB   5  
ATOM 8584  H HG1  . THR A 1 97  ? -6.651  1.405   -31.750 1.00 0.00 ? 472 THR A HG1  5  
ATOM 8585  H HG21 . THR A 1 97  ? -3.844  3.359   -30.202 1.00 0.00 ? 472 THR A HG21 5  
ATOM 8586  H HG22 . THR A 1 97  ? -4.168  3.527   -31.927 1.00 0.00 ? 472 THR A HG22 5  
ATOM 8587  H HG23 . THR A 1 97  ? -4.768  4.739   -30.795 1.00 0.00 ? 472 THR A HG23 5  
ATOM 8588  N N    . VAL A 1 98  ? -6.108  4.310   -27.753 1.00 0.00 ? 473 VAL A N    5  
ATOM 8589  C CA   . VAL A 1 98  ? -6.703  5.388   -26.972 1.00 0.00 ? 473 VAL A CA   5  
ATOM 8590  C C    . VAL A 1 98  ? -5.840  6.645   -27.003 1.00 0.00 ? 473 VAL A C    5  
ATOM 8591  O O    . VAL A 1 98  ? -4.621  6.579   -26.841 1.00 0.00 ? 473 VAL A O    5  
ATOM 8592  C CB   . VAL A 1 98  ? -6.913  4.964   -25.506 1.00 0.00 ? 473 VAL A CB   5  
ATOM 8593  C CG1  . VAL A 1 98  ? -7.711  6.017   -24.754 1.00 0.00 ? 473 VAL A CG1  5  
ATOM 8594  C CG2  . VAL A 1 98  ? -7.602  3.611   -25.436 1.00 0.00 ? 473 VAL A CG2  5  
ATOM 8595  H H    . VAL A 1 98  ? -5.150  4.127   -27.666 1.00 0.00 ? 473 VAL A H    5  
ATOM 8596  H HA   . VAL A 1 98  ? -7.668  5.616   -27.399 1.00 0.00 ? 473 VAL A HA   5  
ATOM 8597  H HB   . VAL A 1 98  ? -5.945  4.876   -25.036 1.00 0.00 ? 473 VAL A HB   5  
ATOM 8598  H HG11 . VAL A 1 98  ? -7.536  6.986   -25.196 1.00 0.00 ? 473 VAL A HG11 5  
ATOM 8599  H HG12 . VAL A 1 98  ? -8.763  5.780   -24.812 1.00 0.00 ? 473 VAL A HG12 5  
ATOM 8600  H HG13 . VAL A 1 98  ? -7.402  6.032   -23.719 1.00 0.00 ? 473 VAL A HG13 5  
ATOM 8601  H HG21 . VAL A 1 98  ? -8.254  3.582   -24.575 1.00 0.00 ? 473 VAL A HG21 5  
ATOM 8602  H HG22 . VAL A 1 98  ? -8.184  3.456   -26.334 1.00 0.00 ? 473 VAL A HG22 5  
ATOM 8603  H HG23 . VAL A 1 98  ? -6.858  2.832   -25.352 1.00 0.00 ? 473 VAL A HG23 5  
ATOM 8604  N N    . ILE A 1 99  ? -6.484  7.791   -27.205 1.00 0.00 ? 474 ILE A N    5  
ATOM 8605  C CA   . ILE A 1 99  ? -5.781  9.068   -27.248 1.00 0.00 ? 474 ILE A CA   5  
ATOM 8606  C C    . ILE A 1 99  ? -6.297  10.004  -26.151 1.00 0.00 ? 474 ILE A C    5  
ATOM 8607  O O    . ILE A 1 99  ? -7.421  10.497  -26.229 1.00 0.00 ? 474 ILE A O    5  
ATOM 8608  C CB   . ILE A 1 99  ? -5.945  9.754   -28.628 1.00 0.00 ? 474 ILE A CB   5  
ATOM 8609  C CG1  . ILE A 1 99  ? -5.131  9.020   -29.696 1.00 0.00 ? 474 ILE A CG1  5  
ATOM 8610  C CG2  . ILE A 1 99  ? -5.522  11.218  -28.562 1.00 0.00 ? 474 ILE A CG2  5  
ATOM 8611  C CD1  . ILE A 1 99  ? -5.489  7.558   -29.842 1.00 0.00 ? 474 ILE A CD1  5  
ATOM 8612  H H    . ILE A 1 99  ? -7.456  7.778   -27.320 1.00 0.00 ? 474 ILE A H    5  
ATOM 8613  H HA   . ILE A 1 99  ? -4.730  8.877   -27.087 1.00 0.00 ? 474 ILE A HA   5  
ATOM 8614  H HB   . ILE A 1 99  ? -6.990  9.721   -28.897 1.00 0.00 ? 474 ILE A HB   5  
ATOM 8615  H HG12 . ILE A 1 99  ? -5.293  9.495   -30.650 1.00 0.00 ? 474 ILE A HG12 5  
ATOM 8616  H HG13 . ILE A 1 99  ? -4.083  9.082   -29.444 1.00 0.00 ? 474 ILE A HG13 5  
ATOM 8617  H HG21 . ILE A 1 99  ? -4.583  11.297  -28.033 1.00 0.00 ? 474 ILE A HG21 5  
ATOM 8618  H HG22 . ILE A 1 99  ? -5.405  11.604  -29.563 1.00 0.00 ? 474 ILE A HG22 5  
ATOM 8619  H HG23 . ILE A 1 99  ? -6.277  11.787  -28.041 1.00 0.00 ? 474 ILE A HG23 5  
ATOM 8620  H HD11 . ILE A 1 99  ? -4.811  6.960   -29.250 1.00 0.00 ? 474 ILE A HD11 5  
ATOM 8621  H HD12 . ILE A 1 99  ? -6.501  7.398   -29.502 1.00 0.00 ? 474 ILE A HD12 5  
ATOM 8622  H HD13 . ILE A 1 99  ? -5.408  7.270   -30.879 1.00 0.00 ? 474 ILE A HD13 5  
ATOM 8623  N N    . PRO A 1 100 ? -5.481  10.262  -25.111 1.00 0.00 ? 475 PRO A N    5  
ATOM 8624  C CA   . PRO A 1 100 ? -5.871  11.143  -24.005 1.00 0.00 ? 475 PRO A CA   5  
ATOM 8625  C C    . PRO A 1 100 ? -6.395  12.490  -24.495 1.00 0.00 ? 475 PRO A C    5  
ATOM 8626  O O    . PRO A 1 100 ? -6.068  12.929  -25.597 1.00 0.00 ? 475 PRO A O    5  
ATOM 8627  C CB   . PRO A 1 100 ? -4.569  11.331  -23.224 1.00 0.00 ? 475 PRO A CB   5  
ATOM 8628  C CG   . PRO A 1 100 ? -3.771  10.110  -23.522 1.00 0.00 ? 475 PRO A CG   5  
ATOM 8629  C CD   . PRO A 1 100 ? -4.123  9.715   -24.930 1.00 0.00 ? 475 PRO A CD   5  
ATOM 8630  H HA   . PRO A 1 100 ? -6.612  10.680  -23.371 1.00 0.00 ? 475 PRO A HA   5  
ATOM 8631  H HB2  . PRO A 1 100 ? -4.068  12.225  -23.564 1.00 0.00 ? 475 PRO A HB2  5  
ATOM 8632  H HB3  . PRO A 1 100 ? -4.786  11.412  -22.170 1.00 0.00 ? 475 PRO A HB3  5  
ATOM 8633  H HG2  . PRO A 1 100 ? -2.716  10.334  -23.448 1.00 0.00 ? 475 PRO A HG2  5  
ATOM 8634  H HG3  . PRO A 1 100 ? -4.036  9.321   -22.835 1.00 0.00 ? 475 PRO A HG3  5  
ATOM 8635  H HD2  . PRO A 1 100 ? -3.431  10.158  -25.631 1.00 0.00 ? 475 PRO A HD2  5  
ATOM 8636  H HD3  . PRO A 1 100 ? -4.125  8.640   -25.031 1.00 0.00 ? 475 PRO A HD3  5  
ATOM 8637  N N    . GLU A 1 101 ? -7.207  13.142  -23.669 1.00 0.00 ? 476 GLU A N    5  
ATOM 8638  C CA   . GLU A 1 101 ? -7.774  14.439  -24.021 1.00 0.00 ? 476 GLU A CA   5  
ATOM 8639  C C    . GLU A 1 101 ? -7.223  15.537  -23.119 1.00 0.00 ? 476 GLU A C    5  
ATOM 8640  O O    . GLU A 1 101 ? -6.545  15.261  -22.129 1.00 0.00 ? 476 GLU A O    5  
ATOM 8641  C CB   . GLU A 1 101 ? -9.300  14.397  -23.921 1.00 0.00 ? 476 GLU A CB   5  
ATOM 8642  C CG   . GLU A 1 101 ? -9.810  14.048  -22.533 1.00 0.00 ? 476 GLU A CG   5  
ATOM 8643  C CD   . GLU A 1 101 ? -11.292 13.735  -22.518 1.00 0.00 ? 476 GLU A CD   5  
ATOM 8644  O OE1  . GLU A 1 101 ? -11.733 12.912  -23.347 1.00 0.00 ? 476 GLU A OE1  5  
ATOM 8645  O OE2  . GLU A 1 101 ? -12.013 14.311  -21.675 1.00 0.00 ? 476 GLU A OE2  5  
ATOM 8646  H H    . GLU A 1 101 ? -7.430  12.741  -22.802 1.00 0.00 ? 476 GLU A H    5  
ATOM 8647  H HA   . GLU A 1 101 ? -7.496  14.655  -25.042 1.00 0.00 ? 476 GLU A HA   5  
ATOM 8648  H HB2  . GLU A 1 101 ? -9.694  15.365  -24.193 1.00 0.00 ? 476 GLU A HB2  5  
ATOM 8649  H HB3  . GLU A 1 101 ? -9.675  13.658  -24.614 1.00 0.00 ? 476 GLU A HB3  5  
ATOM 8650  H HG2  . GLU A 1 101 ? -9.272  13.185  -22.172 1.00 0.00 ? 476 GLU A HG2  5  
ATOM 8651  H HG3  . GLU A 1 101 ? -9.626  14.886  -21.875 1.00 0.00 ? 476 GLU A HG3  5  
ATOM 8652  N N    . GLU A 1 102 ? -7.518  16.785  -23.468 1.00 0.00 ? 477 GLU A N    5  
ATOM 8653  C CA   . GLU A 1 102 ? -7.051  17.927  -22.690 1.00 0.00 ? 477 GLU A CA   5  
ATOM 8654  C C    . GLU A 1 102 ? -8.096  18.352  -21.663 1.00 0.00 ? 477 GLU A C    5  
ATOM 8655  O O    . GLU A 1 102 ? -9.298  18.276  -21.918 1.00 0.00 ? 477 GLU A O    5  
ATOM 8656  C CB   . GLU A 1 102 ? -6.723  19.101  -23.615 1.00 0.00 ? 477 GLU A CB   5  
ATOM 8657  C CG   . GLU A 1 102 ? -5.594  18.809  -24.591 1.00 0.00 ? 477 GLU A CG   5  
ATOM 8658  C CD   . GLU A 1 102 ? -5.971  19.114  -26.028 1.00 0.00 ? 477 GLU A CD   5  
ATOM 8659  O OE1  . GLU A 1 102 ? -7.170  19.007  -26.361 1.00 0.00 ? 477 GLU A OE1  5  
ATOM 8660  O OE2  . GLU A 1 102 ? -5.068  19.459  -26.819 1.00 0.00 ? 477 GLU A OE2  5  
ATOM 8661  H H    . GLU A 1 102 ? -8.062  16.943  -24.268 1.00 0.00 ? 477 GLU A H    5  
ATOM 8662  H HA   . GLU A 1 102 ? -6.153  17.628  -22.170 1.00 0.00 ? 477 GLU A HA   5  
ATOM 8663  H HB2  . GLU A 1 102 ? -7.606  19.353  -24.183 1.00 0.00 ? 477 GLU A HB2  5  
ATOM 8664  H HB3  . GLU A 1 102 ? -6.439  19.950  -23.012 1.00 0.00 ? 477 GLU A HB3  5  
ATOM 8665  H HG2  . GLU A 1 102 ? -4.740  19.414  -24.323 1.00 0.00 ? 477 GLU A HG2  5  
ATOM 8666  H HG3  . GLU A 1 102 ? -5.331  17.764  -24.516 1.00 0.00 ? 477 GLU A HG3  5  
ATOM 8667  N N    . ILE A 1 103 ? -7.630  18.800  -20.502 1.00 0.00 ? 478 ILE A N    5  
ATOM 8668  C CA   . ILE A 1 103 ? -8.523  19.238  -19.436 1.00 0.00 ? 478 ILE A CA   5  
ATOM 8669  C C    . ILE A 1 103 ? -7.938  20.432  -18.687 1.00 0.00 ? 478 ILE A C    5  
ATOM 8670  O O    . ILE A 1 103 ? -6.779  20.410  -18.273 1.00 0.00 ? 478 ILE A O    5  
ATOM 8671  C CB   . ILE A 1 103 ? -8.806  18.099  -18.435 1.00 0.00 ? 478 ILE A CB   5  
ATOM 8672  C CG1  . ILE A 1 103 ? -9.826  18.550  -17.387 1.00 0.00 ? 478 ILE A CG1  5  
ATOM 8673  C CG2  . ILE A 1 103 ? -7.518  17.642  -17.767 1.00 0.00 ? 478 ILE A CG2  5  
ATOM 8674  C CD1  . ILE A 1 103 ? -10.551 17.403  -16.715 1.00 0.00 ? 478 ILE A CD1  5  
ATOM 8675  H H    . ILE A 1 103 ? -6.661  18.838  -20.359 1.00 0.00 ? 478 ILE A H    5  
ATOM 8676  H HA   . ILE A 1 103 ? -9.459  19.534  -19.888 1.00 0.00 ? 478 ILE A HA   5  
ATOM 8677  H HB   . ILE A 1 103 ? -9.213  17.262  -18.984 1.00 0.00 ? 478 ILE A HB   5  
ATOM 8678  H HG12 . ILE A 1 103 ? -9.318  19.114  -16.619 1.00 0.00 ? 478 ILE A HG12 5  
ATOM 8679  H HG13 . ILE A 1 103 ? -10.566 19.179  -17.861 1.00 0.00 ? 478 ILE A HG13 5  
ATOM 8680  H HG21 . ILE A 1 103 ? -6.814  17.326  -18.522 1.00 0.00 ? 478 ILE A HG21 5  
ATOM 8681  H HG22 . ILE A 1 103 ? -7.095  18.460  -17.202 1.00 0.00 ? 478 ILE A HG22 5  
ATOM 8682  H HG23 . ILE A 1 103 ? -7.728  16.817  -17.104 1.00 0.00 ? 478 ILE A HG23 5  
ATOM 8683  H HD11 . ILE A 1 103 ? -11.264 17.794  -16.006 1.00 0.00 ? 478 ILE A HD11 5  
ATOM 8684  H HD12 . ILE A 1 103 ? -11.068 16.818  -17.460 1.00 0.00 ? 478 ILE A HD12 5  
ATOM 8685  H HD13 . ILE A 1 103 ? -9.836  16.780  -16.199 1.00 0.00 ? 478 ILE A HD13 5  
ATOM 8686  N N    . ASP A 1 104 ? -8.747  21.473  -18.516 1.00 0.00 ? 479 ASP A N    5  
ATOM 8687  C CA   . ASP A 1 104 ? -8.311  22.676  -17.817 1.00 0.00 ? 479 ASP A CA   5  
ATOM 8688  C C    . ASP A 1 104 ? -9.105  22.873  -16.525 1.00 0.00 ? 479 ASP A C    5  
ATOM 8689  O O    . ASP A 1 104 ? -10.303 23.152  -16.564 1.00 0.00 ? 479 ASP A O    5  
ATOM 8690  C CB   . ASP A 1 104 ? -8.475  23.901  -18.718 1.00 0.00 ? 479 ASP A CB   5  
ATOM 8691  C CG   . ASP A 1 104 ? -7.496  25.006  -18.376 1.00 0.00 ? 479 ASP A CG   5  
ATOM 8692  O OD1  . ASP A 1 104 ? -6.321  24.907  -18.789 1.00 0.00 ? 479 ASP A OD1  5  
ATOM 8693  O OD2  . ASP A 1 104 ? -7.903  25.969  -17.694 1.00 0.00 ? 479 ASP A OD2  5  
ATOM 8694  H H    . ASP A 1 104 ? -9.661  21.430  -18.870 1.00 0.00 ? 479 ASP A H    5  
ATOM 8695  H HA   . ASP A 1 104 ? -7.266  22.557  -17.575 1.00 0.00 ? 479 ASP A HA   5  
ATOM 8696  H HB2  . ASP A 1 104 ? -8.314  23.608  -19.745 1.00 0.00 ? 479 ASP A HB2  5  
ATOM 8697  H HB3  . ASP A 1 104 ? -9.478  24.287  -18.612 1.00 0.00 ? 479 ASP A HB3  5  
ATOM 8698  N N    . PRO A 1 105 ? -8.447  22.732  -15.359 1.00 0.00 ? 480 PRO A N    5  
ATOM 8699  C CA   . PRO A 1 105 ? -9.107  22.899  -14.060 1.00 0.00 ? 480 PRO A CA   5  
ATOM 8700  C C    . PRO A 1 105 ? -9.506  24.348  -13.794 1.00 0.00 ? 480 PRO A C    5  
ATOM 8701  O O    . PRO A 1 105 ? -9.226  25.205  -14.658 1.00 0.00 ? 480 PRO A O    5  
ATOM 8702  C CB   . PRO A 1 105 ? -8.044  22.446  -13.057 1.00 0.00 ? 480 PRO A CB   5  
ATOM 8703  C CG   . PRO A 1 105 ? -6.748  22.660  -13.757 1.00 0.00 ? 480 PRO A CG   5  
ATOM 8704  C CD   . PRO A 1 105 ? -7.018  22.402  -15.213 1.00 0.00 ? 480 PRO A CD   5  
ATOM 8705  O OXT  . PRO A 1 105 ? -10.094 24.612  -12.725 1.00 0.00 ? 480 PRO A OXT  5  
ATOM 8706  H HA   . PRO A 1 105 ? -9.979  22.268  -13.975 1.00 0.00 ? 480 PRO A HA   5  
ATOM 8707  H HB2  . PRO A 1 105 ? -8.113  23.043  -12.160 1.00 0.00 ? 480 PRO A HB2  5  
ATOM 8708  H HB3  . PRO A 1 105 ? -8.194  21.404  -12.814 1.00 0.00 ? 480 PRO A HB3  5  
ATOM 8709  H HG2  . PRO A 1 105 ? -6.414  23.677  -13.611 1.00 0.00 ? 480 PRO A HG2  5  
ATOM 8710  H HG3  . PRO A 1 105 ? -6.009  21.965  -13.384 1.00 0.00 ? 480 PRO A HG3  5  
ATOM 8711  H HD2  . PRO A 1 105 ? -6.407  23.045  -15.829 1.00 0.00 ? 480 PRO A HD2  5  
ATOM 8712  H HD3  . PRO A 1 105 ? -6.836  21.365  -15.452 1.00 0.00 ? 480 PRO A HD3  5  
ATOM 8713  N N    . ASP B 2 1   ? -0.199  -3.625  -2.274  1.00 0.00 ? 1   ASP B N    5  
ATOM 8714  C CA   . ASP B 2 1   ? -0.890  -2.323  -2.081  1.00 0.00 ? 1   ASP B CA   5  
ATOM 8715  C C    . ASP B 2 1   ? -1.790  -1.995  -3.268  1.00 0.00 ? 1   ASP B C    5  
ATOM 8716  O O    . ASP B 2 1   ? -1.511  -2.392  -4.400  1.00 0.00 ? 1   ASP B O    5  
ATOM 8717  C CB   . ASP B 2 1   ? 0.171   -1.234  -1.904  1.00 0.00 ? 1   ASP B CB   5  
ATOM 8718  C CG   . ASP B 2 1   ? 0.391   -0.873  -0.448  1.00 0.00 ? 1   ASP B CG   5  
ATOM 8719  O OD1  . ASP B 2 1   ? 0.207   -1.757  0.416   1.00 0.00 ? 1   ASP B OD1  5  
ATOM 8720  O OD2  . ASP B 2 1   ? 0.749   0.290   -0.172  1.00 0.00 ? 1   ASP B OD2  5  
ATOM 8721  H H1   . ASP B 2 1   ? -0.908  -4.378  -2.169  1.00 0.00 ? 1   ASP B H1   5  
ATOM 8722  H H2   . ASP B 2 1   ? 0.540   -3.701  -1.548  1.00 0.00 ? 1   ASP B H2   5  
ATOM 8723  H H3   . ASP B 2 1   ? 0.210   -3.629  -3.230  1.00 0.00 ? 1   ASP B H3   5  
ATOM 8724  H HA   . ASP B 2 1   ? -1.492  -2.382  -1.187  1.00 0.00 ? 1   ASP B HA   5  
ATOM 8725  H HB2  . ASP B 2 1   ? 1.106   -1.581  -2.315  1.00 0.00 ? 1   ASP B HB2  5  
ATOM 8726  H HB3  . ASP B 2 1   ? -0.143  -0.345  -2.432  1.00 0.00 ? 1   ASP B HB3  5  
ATOM 8727  N N    . SER B 2 2   ? -2.871  -1.268  -3.004  1.00 0.00 ? 2   SER B N    5  
ATOM 8728  C CA   . SER B 2 2   ? -3.811  -0.889  -4.053  1.00 0.00 ? 2   SER B CA   5  
ATOM 8729  C C    . SER B 2 2   ? -3.531  0.526   -4.549  1.00 0.00 ? 2   SER B C    5  
ATOM 8730  O O    . SER B 2 2   ? -4.444  1.341   -4.685  1.00 0.00 ? 2   SER B O    5  
ATOM 8731  C CB   . SER B 2 2   ? -5.248  -0.988  -3.537  1.00 0.00 ? 2   SER B CB   5  
ATOM 8732  O OG   . SER B 2 2   ? -5.615  -2.337  -3.305  1.00 0.00 ? 2   SER B OG   5  
ATOM 8733  H H    . SER B 2 2   ? -3.040  -0.981  -2.083  1.00 0.00 ? 2   SER B H    5  
ATOM 8734  H HA   . SER B 2 2   ? -3.685  -1.576  -4.875  1.00 0.00 ? 2   SER B HA   5  
ATOM 8735  H HB2  . SER B 2 2   ? -5.336  -0.441  -2.611  1.00 0.00 ? 2   SER B HB2  5  
ATOM 8736  H HB3  . SER B 2 2   ? -5.921  -0.567  -4.270  1.00 0.00 ? 2   SER B HB3  5  
ATOM 8737  H HG   . SER B 2 2   ? -6.265  -2.376  -2.600  1.00 0.00 ? 2   SER B HG   5  
ATOM 8738  N N    . ARG B 2 3   ? -2.262  0.811   -4.821  1.00 0.00 ? 3   ARG B N    5  
ATOM 8739  C CA   . ARG B 2 3   ? -1.862  2.127   -5.305  1.00 0.00 ? 3   ARG B CA   5  
ATOM 8740  C C    . ARG B 2 3   ? -2.525  2.438   -6.642  1.00 0.00 ? 3   ARG B C    5  
ATOM 8741  O O    . ARG B 2 3   ? -1.973  2.145   -7.703  1.00 0.00 ? 3   ARG B O    5  
ATOM 8742  C CB   . ARG B 2 3   ? -0.341  2.202   -5.446  1.00 0.00 ? 3   ARG B CB   5  
ATOM 8743  C CG   . ARG B 2 3   ? 0.365   2.673   -4.184  1.00 0.00 ? 3   ARG B CG   5  
ATOM 8744  C CD   . ARG B 2 3   ? 1.826   2.996   -4.450  1.00 0.00 ? 3   ARG B CD   5  
ATOM 8745  N NE   . ARG B 2 3   ? 2.694   2.545   -3.365  1.00 0.00 ? 3   ARG B NE   5  
ATOM 8746  C CZ   . ARG B 2 3   ? 2.849   3.202   -2.217  1.00 0.00 ? 3   ARG B CZ   5  
ATOM 8747  N NH1  . ARG B 2 3   ? 2.199   4.339   -2.002  1.00 0.00 ? 3   ARG B NH1  5  
ATOM 8748  N NH2  . ARG B 2 3   ? 3.658   2.721   -1.282  1.00 0.00 ? 3   ARG B NH2  5  
ATOM 8749  H H    . ARG B 2 3   ? -1.579  0.120   -4.695  1.00 0.00 ? 3   ARG B H    5  
ATOM 8750  H HA   . ARG B 2 3   ? -2.184  2.858   -4.578  1.00 0.00 ? 3   ARG B HA   5  
ATOM 8751  H HB2  . ARG B 2 3   ? 0.034   1.222   -5.698  1.00 0.00 ? 3   ARG B HB2  5  
ATOM 8752  H HB3  . ARG B 2 3   ? -0.098  2.887   -6.244  1.00 0.00 ? 3   ARG B HB3  5  
ATOM 8753  H HG2  . ARG B 2 3   ? -0.129  3.559   -3.816  1.00 0.00 ? 3   ARG B HG2  5  
ATOM 8754  H HG3  . ARG B 2 3   ? 0.308   1.892   -3.439  1.00 0.00 ? 3   ARG B HG3  5  
ATOM 8755  H HD2  . ARG B 2 3   ? 2.129   2.509   -5.365  1.00 0.00 ? 3   ARG B HD2  5  
ATOM 8756  H HD3  . ARG B 2 3   ? 1.930   4.065   -4.561  1.00 0.00 ? 3   ARG B HD3  5  
ATOM 8757  H HE   . ARG B 2 3   ? 3.186   1.708   -3.497  1.00 0.00 ? 3   ARG B HE   5  
ATOM 8758  H HH11 . ARG B 2 3   ? 1.589   4.707   -2.702  1.00 0.00 ? 3   ARG B HH11 5  
ATOM 8759  H HH12 . ARG B 2 3   ? 2.320   4.828   -1.138  1.00 0.00 ? 3   ARG B HH12 5  
ATOM 8760  H HH21 . ARG B 2 3   ? 4.150   1.865   -1.440  1.00 0.00 ? 3   ARG B HH21 5  
ATOM 8761  H HH22 . ARG B 2 3   ? 3.776   3.215   -0.420  1.00 0.00 ? 3   ARG B HH22 5  
ATOM 8762  N N    . ILE B 2 4   ? -3.712  3.031   -6.584  1.00 0.00 ? 4   ILE B N    5  
ATOM 8763  C CA   . ILE B 2 4   ? -4.450  3.383   -7.791  1.00 0.00 ? 4   ILE B CA   5  
ATOM 8764  C C    . ILE B 2 4   ? -3.933  4.686   -8.390  1.00 0.00 ? 4   ILE B C    5  
ATOM 8765  O O    . ILE B 2 4   ? -3.733  5.671   -7.679  1.00 0.00 ? 4   ILE B O    5  
ATOM 8766  C CB   . ILE B 2 4   ? -5.959  3.522   -7.507  1.00 0.00 ? 4   ILE B CB   5  
ATOM 8767  C CG1  . ILE B 2 4   ? -6.208  4.618   -6.469  1.00 0.00 ? 4   ILE B CG1  5  
ATOM 8768  C CG2  . ILE B 2 4   ? -6.533  2.194   -7.034  1.00 0.00 ? 4   ILE B CG2  5  
ATOM 8769  C CD1  . ILE B 2 4   ? -6.651  5.934   -7.074  1.00 0.00 ? 4   ILE B CD1  5  
ATOM 8770  H H    . ILE B 2 4   ? -4.100  3.239   -5.708  1.00 0.00 ? 4   ILE B H    5  
ATOM 8771  H HA   . ILE B 2 4   ? -4.312  2.587   -8.509  1.00 0.00 ? 4   ILE B HA   5  
ATOM 8772  H HB   . ILE B 2 4   ? -6.451  3.789   -8.429  1.00 0.00 ? 4   ILE B HB   5  
ATOM 8773  H HG12 . ILE B 2 4   ? -6.979  4.293   -5.787  1.00 0.00 ? 4   ILE B HG12 5  
ATOM 8774  H HG13 . ILE B 2 4   ? -5.297  4.797   -5.917  1.00 0.00 ? 4   ILE B HG13 5  
ATOM 8775  H HG21 . ILE B 2 4   ? -5.943  1.383   -7.436  1.00 0.00 ? 4   ILE B HG21 5  
ATOM 8776  H HG22 . ILE B 2 4   ? -6.509  2.156   -5.955  1.00 0.00 ? 4   ILE B HG22 5  
ATOM 8777  H HG23 . ILE B 2 4   ? -7.552  2.100   -7.375  1.00 0.00 ? 4   ILE B HG23 5  
ATOM 8778  H HD11 . ILE B 2 4   ? -5.887  6.296   -7.745  1.00 0.00 ? 4   ILE B HD11 5  
ATOM 8779  H HD12 . ILE B 2 4   ? -7.570  5.787   -7.621  1.00 0.00 ? 4   ILE B HD12 5  
ATOM 8780  H HD13 . ILE B 2 4   ? -6.812  6.657   -6.287  1.00 0.00 ? 4   ILE B HD13 5  
ATOM 8781  N N    . TRP B 2 5   ? -3.717  4.685   -9.701  1.00 0.00 ? 5   TRP B N    5  
ATOM 8782  C CA   . TRP B 2 5   ? -3.224  5.869   -10.394 1.00 0.00 ? 5   TRP B CA   5  
ATOM 8783  C C    . TRP B 2 5   ? -4.291  6.443   -11.322 1.00 0.00 ? 5   TRP B C    5  
ATOM 8784  O O    . TRP B 2 5   ? -4.352  6.097   -12.502 1.00 0.00 ? 5   TRP B O    5  
ATOM 8785  C CB   . TRP B 2 5   ? -1.965  5.529   -11.196 1.00 0.00 ? 5   TRP B CB   5  
ATOM 8786  C CG   . TRP B 2 5   ? -0.757  5.308   -10.339 1.00 0.00 ? 5   TRP B CG   5  
ATOM 8787  C CD1  . TRP B 2 5   ? -0.695  4.595   -9.176  1.00 0.00 ? 5   TRP B CD1  5  
ATOM 8788  C CD2  . TRP B 2 5   ? 0.565   5.804   -10.576 1.00 0.00 ? 5   TRP B CD2  5  
ATOM 8789  N NE1  . TRP B 2 5   ? 0.583   4.618   -8.676  1.00 0.00 ? 5   TRP B NE1  5  
ATOM 8790  C CE2  . TRP B 2 5   ? 1.376   5.354   -9.517  1.00 0.00 ? 5   TRP B CE2  5  
ATOM 8791  C CE3  . TRP B 2 5   ? 1.144   6.586   -11.580 1.00 0.00 ? 5   TRP B CE3  5  
ATOM 8792  C CZ2  . TRP B 2 5   ? 2.733   5.659   -9.435  1.00 0.00 ? 5   TRP B CZ2  5  
ATOM 8793  C CZ3  . TRP B 2 5   ? 2.490   6.889   -11.498 1.00 0.00 ? 5   TRP B CZ3  5  
ATOM 8794  C CH2  . TRP B 2 5   ? 3.271   6.425   -10.432 1.00 0.00 ? 5   TRP B CH2  5  
ATOM 8795  H H    . TRP B 2 5   ? -3.895  3.869   -10.214 1.00 0.00 ? 5   TRP B H    5  
ATOM 8796  H HA   . TRP B 2 5   ? -2.975  6.610   -9.650  1.00 0.00 ? 5   TRP B HA   5  
ATOM 8797  H HB2  . TRP B 2 5   ? -2.141  4.627   -11.763 1.00 0.00 ? 5   TRP B HB2  5  
ATOM 8798  H HB3  . TRP B 2 5   ? -1.749  6.339   -11.875 1.00 0.00 ? 5   TRP B HB3  5  
ATOM 8799  H HD1  . TRP B 2 5   ? -1.539  4.092   -8.726  1.00 0.00 ? 5   TRP B HD1  5  
ATOM 8800  H HE1  . TRP B 2 5   ? 0.880   4.178   -7.851  1.00 0.00 ? 5   TRP B HE1  5  
ATOM 8801  H HE3  . TRP B 2 5   ? 0.557   6.951   -12.410 1.00 0.00 ? 5   TRP B HE3  5  
ATOM 8802  H HZ2  . TRP B 2 5   ? 3.349   5.310   -8.619  1.00 0.00 ? 5   TRP B HZ2  5  
ATOM 8803  H HZ3  . TRP B 2 5   ? 2.953   7.492   -12.265 1.00 0.00 ? 5   TRP B HZ3  5  
ATOM 8804  H HH2  . TRP B 2 5   ? 4.319   6.686   -10.408 1.00 0.00 ? 5   TRP B HH2  5  
ATOM 8805  N N    . TRP B 2 6   ? -5.127  7.322   -10.779 1.00 0.00 ? 6   TRP B N    5  
ATOM 8806  C CA   . TRP B 2 6   ? -6.192  7.945   -11.557 1.00 0.00 ? 6   TRP B CA   5  
ATOM 8807  C C    . TRP B 2 6   ? -5.618  8.944   -12.557 1.00 0.00 ? 6   TRP B C    5  
ATOM 8808  O O    . TRP B 2 6   ? -5.813  10.153  -12.424 1.00 0.00 ? 6   TRP B O    5  
ATOM 8809  C CB   . TRP B 2 6   ? -7.187  8.643   -10.629 1.00 0.00 ? 6   TRP B CB   5  
ATOM 8810  C CG   . TRP B 2 6   ? -8.492  8.969   -11.289 1.00 0.00 ? 6   TRP B CG   5  
ATOM 8811  C CD1  . TRP B 2 6   ? -9.004  8.401   -12.420 1.00 0.00 ? 6   TRP B CD1  5  
ATOM 8812  C CD2  . TRP B 2 6   ? -9.450  9.942   -10.859 1.00 0.00 ? 6   TRP B CD2  5  
ATOM 8813  N NE1  . TRP B 2 6   ? -10.224 8.960   -12.717 1.00 0.00 ? 6   TRP B NE1  5  
ATOM 8814  C CE2  . TRP B 2 6   ? -10.519 9.908   -11.774 1.00 0.00 ? 6   TRP B CE2  5  
ATOM 8815  C CE3  . TRP B 2 6   ? -9.508  10.837  -9.787  1.00 0.00 ? 6   TRP B CE3  5  
ATOM 8816  C CZ2  . TRP B 2 6   ? -11.633 10.735  -11.649 1.00 0.00 ? 6   TRP B CZ2  5  
ATOM 8817  C CZ3  . TRP B 2 6   ? -10.614 11.658  -9.665  1.00 0.00 ? 6   TRP B CZ3  5  
ATOM 8818  C CH2  . TRP B 2 6   ? -11.663 11.602  -10.591 1.00 0.00 ? 6   TRP B CH2  5  
ATOM 8819  H H    . TRP B 2 6   ? -5.027  7.557   -9.833  1.00 0.00 ? 6   TRP B H    5  
ATOM 8820  H HA   . TRP B 2 6   ? -6.705  7.166   -12.100 1.00 0.00 ? 6   TRP B HA   5  
ATOM 8821  H HB2  . TRP B 2 6   ? -7.391  8.002   -9.784  1.00 0.00 ? 6   TRP B HB2  5  
ATOM 8822  H HB3  . TRP B 2 6   ? -6.751  9.567   -10.276 1.00 0.00 ? 6   TRP B HB3  5  
ATOM 8823  H HD1  . TRP B 2 6   ? -8.512  7.625   -12.988 1.00 0.00 ? 6   TRP B HD1  5  
ATOM 8824  H HE1  . TRP B 2 6   ? -10.790 8.717   -13.481 1.00 0.00 ? 6   TRP B HE1  5  
ATOM 8825  H HE3  . TRP B 2 6   ? -8.710  10.894  -9.064  1.00 0.00 ? 6   TRP B HE3  5  
ATOM 8826  H HZ2  . TRP B 2 6   ? -12.450 10.704  -12.355 1.00 0.00 ? 6   TRP B HZ2  5  
ATOM 8827  H HZ3  . TRP B 2 6   ? -10.676 12.356  -8.843  1.00 0.00 ? 6   TRP B HZ3  5  
ATOM 8828  H HH2  . TRP B 2 6   ? -12.507 12.262  -10.456 1.00 0.00 ? 6   TRP B HH2  5  
ATOM 8829  N N    . VAL B 2 7   ? -4.908  8.432   -13.555 1.00 0.00 ? 7   VAL B N    5  
ATOM 8830  C CA   . VAL B 2 7   ? -4.302  9.278   -14.575 1.00 0.00 ? 7   VAL B CA   5  
ATOM 8831  C C    . VAL B 2 7   ? -5.288  9.579   -15.699 1.00 0.00 ? 7   VAL B C    5  
ATOM 8832  O O    . VAL B 2 7   ? -5.224  10.694  -16.257 1.00 0.00 ? 7   VAL B O    5  
ATOM 8833  C CB   . VAL B 2 7   ? -3.044  8.624   -15.172 1.00 0.00 ? 7   VAL B CB   5  
ATOM 8834  C CG1  . VAL B 2 7   ? -2.310  9.602   -16.077 1.00 0.00 ? 7   VAL B CG1  5  
ATOM 8835  C CG2  . VAL B 2 7   ? -2.129  8.119   -14.067 1.00 0.00 ? 7   VAL B CG2  5  
ATOM 8836  O OXT  . VAL B 2 7   ? -6.116  8.697   -16.011 1.00 0.00 ? 7   VAL B OXT  5  
ATOM 8837  H H    . VAL B 2 7   ? -4.785  7.461   -13.605 1.00 0.00 ? 7   VAL B H    5  
ATOM 8838  H HA   . VAL B 2 7   ? -4.011  10.207  -14.106 1.00 0.00 ? 7   VAL B HA   5  
ATOM 8839  H HB   . VAL B 2 7   ? -3.352  7.778   -15.771 1.00 0.00 ? 7   VAL B HB   5  
ATOM 8840  H HG11 . VAL B 2 7   ? -2.033  10.477  -15.509 1.00 0.00 ? 7   VAL B HG11 5  
ATOM 8841  H HG12 . VAL B 2 7   ? -1.422  9.131   -16.471 1.00 0.00 ? 7   VAL B HG12 5  
ATOM 8842  H HG13 . VAL B 2 7   ? -2.956  9.891   -16.892 1.00 0.00 ? 7   VAL B HG13 5  
ATOM 8843  H HG21 . VAL B 2 7   ? -1.706  8.959   -13.537 1.00 0.00 ? 7   VAL B HG21 5  
ATOM 8844  H HG22 . VAL B 2 7   ? -2.697  7.509   -13.380 1.00 0.00 ? 7   VAL B HG22 5  
ATOM 8845  H HG23 . VAL B 2 7   ? -1.334  7.530   -14.499 1.00 0.00 ? 7   VAL B HG23 5  
ATOM 8846  N N    . GLY A 1 1   ? 7.003   26.207  -20.033 1.00 0.00 ? 376 GLY A N    6  
ATOM 8847  C CA   . GLY A 1 1   ? 5.776   25.665  -19.389 1.00 0.00 ? 376 GLY A CA   6  
ATOM 8848  C C    . GLY A 1 1   ? 5.908   24.197  -19.032 1.00 0.00 ? 376 GLY A C    6  
ATOM 8849  O O    . GLY A 1 1   ? 6.418   23.402  -19.822 1.00 0.00 ? 376 GLY A O    6  
ATOM 8850  H H1   . GLY A 1 1   ? 7.834   26.017  -19.436 1.00 0.00 ? 376 GLY A H1   6  
ATOM 8851  H H2   . GLY A 1 1   ? 6.914   27.235  -20.165 1.00 0.00 ? 376 GLY A H2   6  
ATOM 8852  H H3   . GLY A 1 1   ? 7.147   25.761  -20.961 1.00 0.00 ? 376 GLY A H3   6  
ATOM 8853  H HA2  . GLY A 1 1   ? 5.577   26.226  -18.488 1.00 0.00 ? 376 GLY A HA2  6  
ATOM 8854  H HA3  . GLY A 1 1   ? 4.944   25.785  -20.067 1.00 0.00 ? 376 GLY A HA3  6  
ATOM 8855  N N    . SER A 1 2   ? 5.449   23.836  -17.838 1.00 0.00 ? 377 SER A N    6  
ATOM 8856  C CA   . SER A 1 2   ? 5.518   22.454  -17.378 1.00 0.00 ? 377 SER A CA   6  
ATOM 8857  C C    . SER A 1 2   ? 4.176   21.999  -16.817 1.00 0.00 ? 377 SER A C    6  
ATOM 8858  O O    . SER A 1 2   ? 4.120   21.178  -15.902 1.00 0.00 ? 377 SER A O    6  
ATOM 8859  C CB   . SER A 1 2   ? 6.607   22.302  -16.315 1.00 0.00 ? 377 SER A CB   6  
ATOM 8860  O OG   . SER A 1 2   ? 7.843   21.930  -16.900 1.00 0.00 ? 377 SER A OG   6  
ATOM 8861  H H    . SER A 1 2   ? 5.052   24.515  -17.253 1.00 0.00 ? 377 SER A H    6  
ATOM 8862  H HA   . SER A 1 2   ? 5.769   21.835  -18.227 1.00 0.00 ? 377 SER A HA   6  
ATOM 8863  H HB2  . SER A 1 2   ? 6.736   23.241  -15.799 1.00 0.00 ? 377 SER A HB2  6  
ATOM 8864  H HB3  . SER A 1 2   ? 6.314   21.539  -15.608 1.00 0.00 ? 377 SER A HB3  6  
ATOM 8865  H HG   . SER A 1 2   ? 7.719   21.148  -17.443 1.00 0.00 ? 377 SER A HG   6  
ATOM 8866  N N    . HIS A 1 3   ? 3.096   22.538  -17.372 1.00 0.00 ? 378 HIS A N    6  
ATOM 8867  C CA   . HIS A 1 3   ? 1.753   22.187  -16.927 1.00 0.00 ? 378 HIS A CA   6  
ATOM 8868  C C    . HIS A 1 3   ? 1.098   21.203  -17.891 1.00 0.00 ? 378 HIS A C    6  
ATOM 8869  O O    . HIS A 1 3   ? -0.125  21.171  -18.025 1.00 0.00 ? 378 HIS A O    6  
ATOM 8870  C CB   . HIS A 1 3   ? 0.892   23.445  -16.799 1.00 0.00 ? 378 HIS A CB   6  
ATOM 8871  C CG   . HIS A 1 3   ? 1.563   24.556  -16.054 1.00 0.00 ? 378 HIS A CG   6  
ATOM 8872  N ND1  . HIS A 1 3   ? 2.656   24.360  -15.235 1.00 0.00 ? 378 HIS A ND1  6  
ATOM 8873  C CD2  . HIS A 1 3   ? 1.294   25.882  -16.008 1.00 0.00 ? 378 HIS A CD2  6  
ATOM 8874  C CE1  . HIS A 1 3   ? 3.027   25.517  -14.715 1.00 0.00 ? 378 HIS A CE1  6  
ATOM 8875  N NE2  . HIS A 1 3   ? 2.219   26.455  -15.170 1.00 0.00 ? 378 HIS A NE2  6  
ATOM 8876  H H    . HIS A 1 3   ? 3.204   23.187  -18.098 1.00 0.00 ? 378 HIS A H    6  
ATOM 8877  H HA   . HIS A 1 3   ? 1.837   21.721  -15.957 1.00 0.00 ? 378 HIS A HA   6  
ATOM 8878  H HB2  . HIS A 1 3   ? 0.648   23.808  -17.787 1.00 0.00 ? 378 HIS A HB2  6  
ATOM 8879  H HB3  . HIS A 1 3   ? -0.021  23.196  -16.278 1.00 0.00 ? 378 HIS A HB3  6  
ATOM 8880  H HD1  . HIS A 1 3   ? 3.093   23.500  -15.059 1.00 0.00 ? 378 HIS A HD1  6  
ATOM 8881  H HD2  . HIS A 1 3   ? 0.500   26.394  -16.534 1.00 0.00 ? 378 HIS A HD2  6  
ATOM 8882  H HE1  . HIS A 1 3   ? 3.854   25.668  -14.037 1.00 0.00 ? 378 HIS A HE1  6  
ATOM 8883  H HE2  . HIS A 1 3   ? 2.224   27.393  -14.884 1.00 0.00 ? 378 HIS A HE2  6  
ATOM 8884  N N    . MET A 1 4   ? 1.921   20.399  -18.558 1.00 0.00 ? 379 MET A N    6  
ATOM 8885  C CA   . MET A 1 4   ? 1.422   19.412  -19.509 1.00 0.00 ? 379 MET A CA   6  
ATOM 8886  C C    . MET A 1 4   ? 0.925   18.165  -18.785 1.00 0.00 ? 379 MET A C    6  
ATOM 8887  O O    . MET A 1 4   ? 1.687   17.500  -18.082 1.00 0.00 ? 379 MET A O    6  
ATOM 8888  C CB   . MET A 1 4   ? 2.519   19.035  -20.506 1.00 0.00 ? 379 MET A CB   6  
ATOM 8889  C CG   . MET A 1 4   ? 3.734   18.391  -19.857 1.00 0.00 ? 379 MET A CG   6  
ATOM 8890  S SD   . MET A 1 4   ? 5.286   18.924  -20.605 1.00 0.00 ? 379 MET A SD   6  
ATOM 8891  C CE   . MET A 1 4   ? 6.330   19.062  -19.156 1.00 0.00 ? 379 MET A CE   6  
ATOM 8892  H H    . MET A 1 4   ? 2.887   20.471  -18.408 1.00 0.00 ? 379 MET A H    6  
ATOM 8893  H HA   . MET A 1 4   ? 0.597   19.856  -20.045 1.00 0.00 ? 379 MET A HA   6  
ATOM 8894  H HB2  . MET A 1 4   ? 2.112   18.341  -21.227 1.00 0.00 ? 379 MET A HB2  6  
ATOM 8895  H HB3  . MET A 1 4   ? 2.843   19.927  -21.022 1.00 0.00 ? 379 MET A HB3  6  
ATOM 8896  H HG2  . MET A 1 4   ? 3.747   18.654  -18.810 1.00 0.00 ? 379 MET A HG2  6  
ATOM 8897  H HG3  . MET A 1 4   ? 3.653   17.319  -19.957 1.00 0.00 ? 379 MET A HG3  6  
ATOM 8898  H HE1  . MET A 1 4   ? 7.013   19.889  -19.281 1.00 0.00 ? 379 MET A HE1  6  
ATOM 8899  H HE2  . MET A 1 4   ? 5.715   19.230  -18.284 1.00 0.00 ? 379 MET A HE2  6  
ATOM 8900  H HE3  . MET A 1 4   ? 6.892   18.148  -19.030 1.00 0.00 ? 379 MET A HE3  6  
ATOM 8901  N N    . LYS A 1 5   ? -0.355  17.856  -18.958 1.00 0.00 ? 380 LYS A N    6  
ATOM 8902  C CA   . LYS A 1 5   ? -0.950  16.689  -18.316 1.00 0.00 ? 380 LYS A CA   6  
ATOM 8903  C C    . LYS A 1 5   ? -2.111  16.143  -19.142 1.00 0.00 ? 380 LYS A C    6  
ATOM 8904  O O    . LYS A 1 5   ? -3.075  16.856  -19.423 1.00 0.00 ? 380 LYS A O    6  
ATOM 8905  C CB   . LYS A 1 5   ? -1.431  17.047  -16.908 1.00 0.00 ? 380 LYS A CB   6  
ATOM 8906  C CG   . LYS A 1 5   ? -0.606  16.411  -15.802 1.00 0.00 ? 380 LYS A CG   6  
ATOM 8907  C CD   . LYS A 1 5   ? -0.783  17.144  -14.481 1.00 0.00 ? 380 LYS A CD   6  
ATOM 8908  C CE   . LYS A 1 5   ? 0.435   17.992  -14.148 1.00 0.00 ? 380 LYS A CE   6  
ATOM 8909  N NZ   . LYS A 1 5   ? 1.613   17.153  -13.793 1.00 0.00 ? 380 LYS A NZ   6  
ATOM 8910  H H    . LYS A 1 5   ? -0.913  18.425  -19.528 1.00 0.00 ? 380 LYS A H    6  
ATOM 8911  H HA   . LYS A 1 5   ? -0.188  15.927  -18.242 1.00 0.00 ? 380 LYS A HA   6  
ATOM 8912  H HB2  . LYS A 1 5   ? -1.389  18.119  -16.788 1.00 0.00 ? 380 LYS A HB2  6  
ATOM 8913  H HB3  . LYS A 1 5   ? -2.456  16.723  -16.794 1.00 0.00 ? 380 LYS A HB3  6  
ATOM 8914  H HG2  . LYS A 1 5   ? -0.919  15.386  -15.677 1.00 0.00 ? 380 LYS A HG2  6  
ATOM 8915  H HG3  . LYS A 1 5   ? 0.436   16.440  -16.083 1.00 0.00 ? 380 LYS A HG3  6  
ATOM 8916  H HD2  . LYS A 1 5   ? -1.648  17.786  -14.548 1.00 0.00 ? 380 LYS A HD2  6  
ATOM 8917  H HD3  . LYS A 1 5   ? -0.930  16.417  -13.696 1.00 0.00 ? 380 LYS A HD3  6  
ATOM 8918  H HE2  . LYS A 1 5   ? 0.681   18.599  -15.005 1.00 0.00 ? 380 LYS A HE2  6  
ATOM 8919  H HE3  . LYS A 1 5   ? 0.193   18.632  -13.312 1.00 0.00 ? 380 LYS A HE3  6  
ATOM 8920  H HZ1  . LYS A 1 5   ? 1.469   16.709  -12.865 1.00 0.00 ? 380 LYS A HZ1  6  
ATOM 8921  H HZ2  . LYS A 1 5   ? 1.749   16.408  -14.505 1.00 0.00 ? 380 LYS A HZ2  6  
ATOM 8922  H HZ3  . LYS A 1 5   ? 2.471   17.742  -13.753 1.00 0.00 ? 380 LYS A HZ3  6  
ATOM 8923  N N    . LYS A 1 6   ? -2.015  14.874  -19.523 1.00 0.00 ? 381 LYS A N    6  
ATOM 8924  C CA   . LYS A 1 6   ? -3.059  14.231  -20.311 1.00 0.00 ? 381 LYS A CA   6  
ATOM 8925  C C    . LYS A 1 6   ? -4.165  13.698  -19.404 1.00 0.00 ? 381 LYS A C    6  
ATOM 8926  O O    . LYS A 1 6   ? -4.041  13.723  -18.180 1.00 0.00 ? 381 LYS A O    6  
ATOM 8927  C CB   . LYS A 1 6   ? -2.469  13.093  -21.147 1.00 0.00 ? 381 LYS A CB   6  
ATOM 8928  C CG   . LYS A 1 6   ? -2.377  13.415  -22.630 1.00 0.00 ? 381 LYS A CG   6  
ATOM 8929  C CD   . LYS A 1 6   ? -1.070  14.112  -22.969 1.00 0.00 ? 381 LYS A CD   6  
ATOM 8930  C CE   . LYS A 1 6   ? -0.751  14.007  -24.452 1.00 0.00 ? 381 LYS A CE   6  
ATOM 8931  N NZ   . LYS A 1 6   ? 0.060   15.161  -24.930 1.00 0.00 ? 381 LYS A NZ   6  
ATOM 8932  H H    . LYS A 1 6   ? -1.224  14.356  -19.264 1.00 0.00 ? 381 LYS A H    6  
ATOM 8933  H HA   . LYS A 1 6   ? -3.479  14.974  -20.972 1.00 0.00 ? 381 LYS A HA   6  
ATOM 8934  H HB2  . LYS A 1 6   ? -1.475  12.875  -20.786 1.00 0.00 ? 381 LYS A HB2  6  
ATOM 8935  H HB3  . LYS A 1 6   ? -3.087  12.215  -21.029 1.00 0.00 ? 381 LYS A HB3  6  
ATOM 8936  H HG2  . LYS A 1 6   ? -2.439  12.495  -23.193 1.00 0.00 ? 381 LYS A HG2  6  
ATOM 8937  H HG3  . LYS A 1 6   ? -3.201  14.060  -22.901 1.00 0.00 ? 381 LYS A HG3  6  
ATOM 8938  H HD2  . LYS A 1 6   ? -1.150  15.156  -22.702 1.00 0.00 ? 381 LYS A HD2  6  
ATOM 8939  H HD3  . LYS A 1 6   ? -0.271  13.654  -22.404 1.00 0.00 ? 381 LYS A HD3  6  
ATOM 8940  H HE2  . LYS A 1 6   ? -0.199  13.095  -24.623 1.00 0.00 ? 381 LYS A HE2  6  
ATOM 8941  H HE3  . LYS A 1 6   ? -1.678  13.976  -25.005 1.00 0.00 ? 381 LYS A HE3  6  
ATOM 8942  H HZ1  . LYS A 1 6   ? -0.285  15.480  -25.857 1.00 0.00 ? 381 LYS A HZ1  6  
ATOM 8943  H HZ2  . LYS A 1 6   ? -0.007  15.950  -24.256 1.00 0.00 ? 381 LYS A HZ2  6  
ATOM 8944  H HZ3  . LYS A 1 6   ? 1.058   14.883  -25.023 1.00 0.00 ? 381 LYS A HZ3  6  
ATOM 8945  N N    . TYR A 1 7   ? -5.247  13.220  -20.010 1.00 0.00 ? 382 TYR A N    6  
ATOM 8946  C CA   . TYR A 1 7   ? -6.370  12.683  -19.250 1.00 0.00 ? 382 TYR A CA   6  
ATOM 8947  C C    . TYR A 1 7   ? -7.180  11.696  -20.084 1.00 0.00 ? 382 TYR A C    6  
ATOM 8948  O O    . TYR A 1 7   ? -7.706  12.045  -21.141 1.00 0.00 ? 382 TYR A O    6  
ATOM 8949  C CB   . TYR A 1 7   ? -7.275  13.818  -18.766 1.00 0.00 ? 382 TYR A CB   6  
ATOM 8950  C CG   . TYR A 1 7   ? -8.231  13.403  -17.671 1.00 0.00 ? 382 TYR A CG   6  
ATOM 8951  C CD1  . TYR A 1 7   ? -9.347  12.626  -17.955 1.00 0.00 ? 382 TYR A CD1  6  
ATOM 8952  C CD2  . TYR A 1 7   ? -8.017  13.785  -16.352 1.00 0.00 ? 382 TYR A CD2  6  
ATOM 8953  C CE1  . TYR A 1 7   ? -10.224 12.244  -16.957 1.00 0.00 ? 382 TYR A CE1  6  
ATOM 8954  C CE2  . TYR A 1 7   ? -8.888  13.406  -15.348 1.00 0.00 ? 382 TYR A CE2  6  
ATOM 8955  C CZ   . TYR A 1 7   ? -9.989  12.636  -15.656 1.00 0.00 ? 382 TYR A CZ   6  
ATOM 8956  O OH   . TYR A 1 7   ? -10.859 12.257  -14.659 1.00 0.00 ? 382 TYR A OH   6  
ATOM 8957  H H    . TYR A 1 7   ? -5.291  13.227  -20.990 1.00 0.00 ? 382 TYR A H    6  
ATOM 8958  H HA   . TYR A 1 7   ? -5.969  12.165  -18.392 1.00 0.00 ? 382 TYR A HA   6  
ATOM 8959  H HB2  . TYR A 1 7   ? -6.661  14.620  -18.383 1.00 0.00 ? 382 TYR A HB2  6  
ATOM 8960  H HB3  . TYR A 1 7   ? -7.858  14.183  -19.597 1.00 0.00 ? 382 TYR A HB3  6  
ATOM 8961  H HD1  . TYR A 1 7   ? -9.528  12.319  -18.975 1.00 0.00 ? 382 TYR A HD1  6  
ATOM 8962  H HD2  . TYR A 1 7   ? -7.153  14.388  -16.115 1.00 0.00 ? 382 TYR A HD2  6  
ATOM 8963  H HE1  . TYR A 1 7   ? -11.086 11.640  -17.198 1.00 0.00 ? 382 TYR A HE1  6  
ATOM 8964  H HE2  . TYR A 1 7   ? -8.704  13.714  -14.330 1.00 0.00 ? 382 TYR A HE2  6  
ATOM 8965  H HH   . TYR A 1 7   ? -10.362 12.012  -13.876 1.00 0.00 ? 382 TYR A HH   6  
ATOM 8966  N N    . ILE A 1 8   ? -7.281  10.465  -19.595 1.00 0.00 ? 383 ILE A N    6  
ATOM 8967  C CA   . ILE A 1 8   ? -8.035  9.425   -20.286 1.00 0.00 ? 383 ILE A CA   6  
ATOM 8968  C C    . ILE A 1 8   ? -9.295  9.047   -19.510 1.00 0.00 ? 383 ILE A C    6  
ATOM 8969  O O    . ILE A 1 8   ? -10.178 8.370   -20.037 1.00 0.00 ? 383 ILE A O    6  
ATOM 8970  C CB   . ILE A 1 8   ? -7.186  8.158   -20.512 1.00 0.00 ? 383 ILE A CB   6  
ATOM 8971  C CG1  . ILE A 1 8   ? -6.319  7.863   -19.286 1.00 0.00 ? 383 ILE A CG1  6  
ATOM 8972  C CG2  . ILE A 1 8   ? -6.321  8.311   -21.754 1.00 0.00 ? 383 ILE A CG2  6  
ATOM 8973  C CD1  . ILE A 1 8   ? -5.634  6.515   -19.343 1.00 0.00 ? 383 ILE A CD1  6  
ATOM 8974  H H    . ILE A 1 8   ? -6.845  10.252  -18.744 1.00 0.00 ? 383 ILE A H    6  
ATOM 8975  H HA   . ILE A 1 8   ? -8.326  9.813   -21.252 1.00 0.00 ? 383 ILE A HA   6  
ATOM 8976  H HB   . ILE A 1 8   ? -7.858  7.328   -20.675 1.00 0.00 ? 383 ILE A HB   6  
ATOM 8977  H HG12 . ILE A 1 8   ? -5.553  8.620   -19.206 1.00 0.00 ? 383 ILE A HG12 6  
ATOM 8978  H HG13 . ILE A 1 8   ? -6.937  7.886   -18.401 1.00 0.00 ? 383 ILE A HG13 6  
ATOM 8979  H HG21 . ILE A 1 8   ? -6.696  9.125   -22.357 1.00 0.00 ? 383 ILE A HG21 6  
ATOM 8980  H HG22 . ILE A 1 8   ? -5.303  8.520   -21.461 1.00 0.00 ? 383 ILE A HG22 6  
ATOM 8981  H HG23 . ILE A 1 8   ? -6.350  7.396   -22.327 1.00 0.00 ? 383 ILE A HG23 6  
ATOM 8982  H HD11 . ILE A 1 8   ? -5.301  6.238   -18.354 1.00 0.00 ? 383 ILE A HD11 6  
ATOM 8983  H HD12 . ILE A 1 8   ? -6.329  5.773   -19.708 1.00 0.00 ? 383 ILE A HD12 6  
ATOM 8984  H HD13 . ILE A 1 8   ? -4.785  6.570   -20.008 1.00 0.00 ? 383 ILE A HD13 6  
ATOM 8985  N N    . GLY A 1 9   ? -9.374  9.489   -18.256 1.00 0.00 ? 384 GLY A N    6  
ATOM 8986  C CA   . GLY A 1 9   ? -10.532 9.187   -17.434 1.00 0.00 ? 384 GLY A CA   6  
ATOM 8987  C C    . GLY A 1 9   ? -10.601 7.726   -17.033 1.00 0.00 ? 384 GLY A C    6  
ATOM 8988  O O    . GLY A 1 9   ? -11.620 7.067   -17.239 1.00 0.00 ? 384 GLY A O    6  
ATOM 8989  H H    . GLY A 1 9   ? -8.643  10.024  -17.887 1.00 0.00 ? 384 GLY A H    6  
ATOM 8990  H HA2  . GLY A 1 9   ? -10.491 9.791   -16.540 1.00 0.00 ? 384 GLY A HA2  6  
ATOM 8991  H HA3  . GLY A 1 9   ? -11.425 9.440   -17.985 1.00 0.00 ? 384 GLY A HA3  6  
ATOM 8992  N N    . ILE A 1 10  ? -9.515  7.221   -16.460 1.00 0.00 ? 385 ILE A N    6  
ATOM 8993  C CA   . ILE A 1 10  ? -9.458  5.830   -16.027 1.00 0.00 ? 385 ILE A CA   6  
ATOM 8994  C C    . ILE A 1 10  ? -8.275  5.595   -15.094 1.00 0.00 ? 385 ILE A C    6  
ATOM 8995  O O    . ILE A 1 10  ? -7.171  6.081   -15.340 1.00 0.00 ? 385 ILE A O    6  
ATOM 8996  C CB   . ILE A 1 10  ? -9.352  4.873   -17.232 1.00 0.00 ? 385 ILE A CB   6  
ATOM 8997  C CG1  . ILE A 1 10  ? -9.361  3.416   -16.760 1.00 0.00 ? 385 ILE A CG1  6  
ATOM 8998  C CG2  . ILE A 1 10  ? -8.094  5.167   -18.036 1.00 0.00 ? 385 ILE A CG2  6  
ATOM 8999  C CD1  . ILE A 1 10  ? -9.257  2.414   -17.889 1.00 0.00 ? 385 ILE A CD1  6  
ATOM 9000  H H    . ILE A 1 10  ? -8.735  7.797   -16.323 1.00 0.00 ? 385 ILE A H    6  
ATOM 9001  H HA   . ILE A 1 10  ? -10.372 5.608   -15.497 1.00 0.00 ? 385 ILE A HA   6  
ATOM 9002  H HB   . ILE A 1 10  ? -10.205 5.041   -17.871 1.00 0.00 ? 385 ILE A HB   6  
ATOM 9003  H HG12 . ILE A 1 10  ? -8.526  3.254   -16.096 1.00 0.00 ? 385 ILE A HG12 6  
ATOM 9004  H HG13 . ILE A 1 10  ? -10.281 3.224   -16.227 1.00 0.00 ? 385 ILE A HG13 6  
ATOM 9005  H HG21 . ILE A 1 10  ? -7.781  6.184   -17.855 1.00 0.00 ? 385 ILE A HG21 6  
ATOM 9006  H HG22 . ILE A 1 10  ? -7.308  4.489   -17.736 1.00 0.00 ? 385 ILE A HG22 6  
ATOM 9007  H HG23 . ILE A 1 10  ? -8.301  5.036   -19.088 1.00 0.00 ? 385 ILE A HG23 6  
ATOM 9008  H HD11 . ILE A 1 10  ? -9.934  1.593   -17.704 1.00 0.00 ? 385 ILE A HD11 6  
ATOM 9009  H HD12 . ILE A 1 10  ? -9.517  2.893   -18.820 1.00 0.00 ? 385 ILE A HD12 6  
ATOM 9010  H HD13 . ILE A 1 10  ? -8.245  2.041   -17.946 1.00 0.00 ? 385 ILE A HD13 6  
ATOM 9011  N N    . ARG A 1 11  ? -8.511  4.842   -14.025 1.00 0.00 ? 386 ARG A N    6  
ATOM 9012  C CA   . ARG A 1 11  ? -7.461  4.539   -13.061 1.00 0.00 ? 386 ARG A CA   6  
ATOM 9013  C C    . ARG A 1 11  ? -6.728  3.260   -13.455 1.00 0.00 ? 386 ARG A C    6  
ATOM 9014  O O    . ARG A 1 11  ? -7.258  2.435   -14.199 1.00 0.00 ? 386 ARG A O    6  
ATOM 9015  C CB   . ARG A 1 11  ? -8.046  4.399   -11.653 1.00 0.00 ? 386 ARG A CB   6  
ATOM 9016  C CG   . ARG A 1 11  ? -9.098  5.449   -11.322 1.00 0.00 ? 386 ARG A CG   6  
ATOM 9017  C CD   . ARG A 1 11  ? -10.410 4.815   -10.886 1.00 0.00 ? 386 ARG A CD   6  
ATOM 9018  N NE   . ARG A 1 11  ? -10.652 4.984   -9.455  1.00 0.00 ? 386 ARG A NE   6  
ATOM 9019  C CZ   . ARG A 1 11  ? -11.140 6.097   -8.911  1.00 0.00 ? 386 ARG A CZ   6  
ATOM 9020  N NH1  . ARG A 1 11  ? -11.437 7.142   -9.673  1.00 0.00 ? 386 ARG A NH1  6  
ATOM 9021  N NH2  . ARG A 1 11  ? -11.331 6.164   -7.601  1.00 0.00 ? 386 ARG A NH2  6  
ATOM 9022  H H    . ARG A 1 11  ? -9.410  4.478   -13.884 1.00 0.00 ? 386 ARG A H    6  
ATOM 9023  H HA   . ARG A 1 11  ? -6.758  5.358   -13.069 1.00 0.00 ? 386 ARG A HA   6  
ATOM 9024  H HB2  . ARG A 1 11  ? -8.496  3.424   -11.559 1.00 0.00 ? 386 ARG A HB2  6  
ATOM 9025  H HB3  . ARG A 1 11  ? -7.244  4.486   -10.934 1.00 0.00 ? 386 ARG A HB3  6  
ATOM 9026  H HG2  . ARG A 1 11  ? -8.729  6.072   -10.522 1.00 0.00 ? 386 ARG A HG2  6  
ATOM 9027  H HG3  . ARG A 1 11  ? -9.274  6.057   -12.198 1.00 0.00 ? 386 ARG A HG3  6  
ATOM 9028  H HD2  . ARG A 1 11  ? -11.217 5.277   -11.434 1.00 0.00 ? 386 ARG A HD2  6  
ATOM 9029  H HD3  . ARG A 1 11  ? -10.380 3.760   -11.114 1.00 0.00 ? 386 ARG A HD3  6  
ATOM 9030  H HE   . ARG A 1 11  ? -10.439 4.228   -8.868  1.00 0.00 ? 386 ARG A HE   6  
ATOM 9031  H HH11 . ARG A 1 11  ? -11.294 7.099   -10.661 1.00 0.00 ? 386 ARG A HH11 6  
ATOM 9032  H HH12 . ARG A 1 11  ? -11.804 7.974   -9.257  1.00 0.00 ? 386 ARG A HH12 6  
ATOM 9033  H HH21 . ARG A 1 11  ? -11.109 5.380   -7.021  1.00 0.00 ? 386 ARG A HH21 6  
ATOM 9034  H HH22 . ARG A 1 11  ? -11.699 7.000   -7.192  1.00 0.00 ? 386 ARG A HH22 6  
ATOM 9035  N N    . MET A 1 12  ? -5.507  3.106   -12.958 1.00 0.00 ? 387 MET A N    6  
ATOM 9036  C CA   . MET A 1 12  ? -4.702  1.928   -13.266 1.00 0.00 ? 387 MET A CA   6  
ATOM 9037  C C    . MET A 1 12  ? -3.705  1.642   -12.148 1.00 0.00 ? 387 MET A C    6  
ATOM 9038  O O    . MET A 1 12  ? -3.025  2.546   -11.663 1.00 0.00 ? 387 MET A O    6  
ATOM 9039  C CB   . MET A 1 12  ? -3.959  2.123   -14.593 1.00 0.00 ? 387 MET A CB   6  
ATOM 9040  C CG   . MET A 1 12  ? -3.559  3.566   -14.864 1.00 0.00 ? 387 MET A CG   6  
ATOM 9041  S SD   . MET A 1 12  ? -1.922  3.706   -15.603 1.00 0.00 ? 387 MET A SD   6  
ATOM 9042  C CE   . MET A 1 12  ? -1.124  4.819   -14.448 1.00 0.00 ? 387 MET A CE   6  
ATOM 9043  H H    . MET A 1 12  ? -5.135  3.800   -12.375 1.00 0.00 ? 387 MET A H    6  
ATOM 9044  H HA   . MET A 1 12  ? -5.370  1.086   -13.360 1.00 0.00 ? 387 MET A HA   6  
ATOM 9045  H HB2  . MET A 1 12  ? -3.065  1.519   -14.583 1.00 0.00 ? 387 MET A HB2  6  
ATOM 9046  H HB3  . MET A 1 12  ? -4.597  1.792   -15.400 1.00 0.00 ? 387 MET A HB3  6  
ATOM 9047  H HG2  . MET A 1 12  ? -4.280  4.005   -15.537 1.00 0.00 ? 387 MET A HG2  6  
ATOM 9048  H HG3  . MET A 1 12  ? -3.564  4.108   -13.930 1.00 0.00 ? 387 MET A HG3  6  
ATOM 9049  H HE1  . MET A 1 12  ? -0.293  5.307   -14.934 1.00 0.00 ? 387 MET A HE1  6  
ATOM 9050  H HE2  . MET A 1 12  ? -1.835  5.562   -14.117 1.00 0.00 ? 387 MET A HE2  6  
ATOM 9051  H HE3  . MET A 1 12  ? -0.767  4.258   -13.597 1.00 0.00 ? 387 MET A HE3  6  
ATOM 9052  N N    . MET A 1 13  ? -3.625  0.379   -11.743 1.00 0.00 ? 388 MET A N    6  
ATOM 9053  C CA   . MET A 1 13  ? -2.713  -0.027  -10.681 1.00 0.00 ? 388 MET A CA   6  
ATOM 9054  C C    . MET A 1 13  ? -1.579  -0.884  -11.232 1.00 0.00 ? 388 MET A C    6  
ATOM 9055  O O    . MET A 1 13  ? -1.577  -1.250  -12.408 1.00 0.00 ? 388 MET A O    6  
ATOM 9056  C CB   . MET A 1 13  ? -3.468  -0.798  -9.597  1.00 0.00 ? 388 MET A CB   6  
ATOM 9057  C CG   . MET A 1 13  ? -4.037  -2.122  -10.078 1.00 0.00 ? 388 MET A CG   6  
ATOM 9058  S SD   . MET A 1 13  ? -3.817  -3.455  -8.884  1.00 0.00 ? 388 MET A SD   6  
ATOM 9059  C CE   . MET A 1 13  ? -4.469  -2.695  -7.399  1.00 0.00 ? 388 MET A CE   6  
ATOM 9060  H H    . MET A 1 13  ? -4.194  -0.296  -12.168 1.00 0.00 ? 388 MET A H    6  
ATOM 9061  H HA   . MET A 1 13  ? -2.292  0.868   -10.246 1.00 0.00 ? 388 MET A HA   6  
ATOM 9062  H HB2  . MET A 1 13  ? -2.793  -0.999  -8.777  1.00 0.00 ? 388 MET A HB2  6  
ATOM 9063  H HB3  . MET A 1 13  ? -4.283  -0.189  -9.238  1.00 0.00 ? 388 MET A HB3  6  
ATOM 9064  H HG2  . MET A 1 13  ? -5.093  -1.997  -10.265 1.00 0.00 ? 388 MET A HG2  6  
ATOM 9065  H HG3  . MET A 1 13  ? -3.541  -2.396  -10.997 1.00 0.00 ? 388 MET A HG3  6  
ATOM 9066  H HE1  . MET A 1 13  ? -4.095  -3.219  -6.532  1.00 0.00 ? 388 MET A HE1  6  
ATOM 9067  H HE2  . MET A 1 13  ? -4.157  -1.662  -7.357  1.00 0.00 ? 388 MET A HE2  6  
ATOM 9068  H HE3  . MET A 1 13  ? -5.547  -2.745  -7.413  1.00 0.00 ? 388 MET A HE3  6  
ATOM 9069  N N    . SER A 1 14  ? -0.619  -1.203  -10.371 1.00 0.00 ? 389 SER A N    6  
ATOM 9070  C CA   . SER A 1 14  ? 0.522   -2.020  -10.766 1.00 0.00 ? 389 SER A CA   6  
ATOM 9071  C C    . SER A 1 14  ? 0.333   -3.466  -10.322 1.00 0.00 ? 389 SER A C    6  
ATOM 9072  O O    . SER A 1 14  ? 0.331   -3.766  -9.129  1.00 0.00 ? 389 SER A O    6  
ATOM 9073  C CB   . SER A 1 14  ? 1.812   -1.454  -10.170 1.00 0.00 ? 389 SER A CB   6  
ATOM 9074  O OG   . SER A 1 14  ? 1.633   -1.095  -8.811  1.00 0.00 ? 389 SER A OG   6  
ATOM 9075  H H    . SER A 1 14  ? -0.680  -0.883  -9.447  1.00 0.00 ? 389 SER A H    6  
ATOM 9076  H HA   . SER A 1 14  ? 0.591   -1.994  -11.843 1.00 0.00 ? 389 SER A HA   6  
ATOM 9077  H HB2  . SER A 1 14  ? 2.592   -2.198  -10.233 1.00 0.00 ? 389 SER A HB2  6  
ATOM 9078  H HB3  . SER A 1 14  ? 2.108   -0.575  -10.725 1.00 0.00 ? 389 SER A HB3  6  
ATOM 9079  H HG   . SER A 1 14  ? 1.224   -1.824  -8.338  1.00 0.00 ? 389 SER A HG   6  
ATOM 9080  N N    . LEU A 1 15  ? 0.171   -4.357  -11.294 1.00 0.00 ? 390 LEU A N    6  
ATOM 9081  C CA   . LEU A 1 15  ? -0.022  -5.773  -11.010 1.00 0.00 ? 390 LEU A CA   6  
ATOM 9082  C C    . LEU A 1 15  ? 1.203   -6.368  -10.326 1.00 0.00 ? 390 LEU A C    6  
ATOM 9083  O O    . LEU A 1 15  ? 2.106   -6.886  -10.985 1.00 0.00 ? 390 LEU A O    6  
ATOM 9084  C CB   . LEU A 1 15  ? -0.322  -6.534  -12.303 1.00 0.00 ? 390 LEU A CB   6  
ATOM 9085  C CG   . LEU A 1 15  ? -1.467  -7.544  -12.210 1.00 0.00 ? 390 LEU A CG   6  
ATOM 9086  C CD1  . LEU A 1 15  ? -2.719  -6.880  -11.657 1.00 0.00 ? 390 LEU A CD1  6  
ATOM 9087  C CD2  . LEU A 1 15  ? -1.742  -8.160  -13.573 1.00 0.00 ? 390 LEU A CD2  6  
ATOM 9088  H H    . LEU A 1 15  ? 0.181   -4.054  -12.226 1.00 0.00 ? 390 LEU A H    6  
ATOM 9089  H HA   . LEU A 1 15  ? -0.869  -5.864  -10.346 1.00 0.00 ? 390 LEU A HA   6  
ATOM 9090  H HB2  . LEU A 1 15  ? -0.568  -5.814  -13.070 1.00 0.00 ? 390 LEU A HB2  6  
ATOM 9091  H HB3  . LEU A 1 15  ? 0.570   -7.064  -12.602 1.00 0.00 ? 390 LEU A HB3  6  
ATOM 9092  H HG   . LEU A 1 15  ? -1.184  -8.337  -11.533 1.00 0.00 ? 390 LEU A HG   6  
ATOM 9093  H HD11 . LEU A 1 15  ? -2.657  -5.812  -11.806 1.00 0.00 ? 390 LEU A HD11 6  
ATOM 9094  H HD12 . LEU A 1 15  ? -3.589  -7.265  -12.170 1.00 0.00 ? 390 LEU A HD12 6  
ATOM 9095  H HD13 . LEU A 1 15  ? -2.803  -7.091  -10.601 1.00 0.00 ? 390 LEU A HD13 6  
ATOM 9096  H HD21 . LEU A 1 15  ? -2.251  -7.440  -14.197 1.00 0.00 ? 390 LEU A HD21 6  
ATOM 9097  H HD22 . LEU A 1 15  ? -0.808  -8.440  -14.036 1.00 0.00 ? 390 LEU A HD22 6  
ATOM 9098  H HD23 . LEU A 1 15  ? -2.362  -9.035  -13.453 1.00 0.00 ? 390 LEU A HD23 6  
ATOM 9099  N N    . THR A 1 16  ? 1.227   -6.296  -9.000  1.00 0.00 ? 391 THR A N    6  
ATOM 9100  C CA   . THR A 1 16  ? 2.340   -6.832  -8.226  1.00 0.00 ? 391 THR A CA   6  
ATOM 9101  C C    . THR A 1 16  ? 2.137   -8.321  -7.954  1.00 0.00 ? 391 THR A C    6  
ATOM 9102  O O    . THR A 1 16  ? 1.051   -8.857  -8.168  1.00 0.00 ? 391 THR A O    6  
ATOM 9103  C CB   . THR A 1 16  ? 2.491   -6.066  -6.910  1.00 0.00 ? 391 THR A CB   6  
ATOM 9104  O OG1  . THR A 1 16  ? 3.423   -6.708  -6.058  1.00 0.00 ? 391 THR A OG1  6  
ATOM 9105  C CG2  . THR A 1 16  ? 1.191   -5.919  -6.148  1.00 0.00 ? 391 THR A CG2  6  
ATOM 9106  H H    . THR A 1 16  ? 0.477   -5.874  -8.530  1.00 0.00 ? 391 THR A H    6  
ATOM 9107  H HA   . THR A 1 16  ? 3.239   -6.706  -8.811  1.00 0.00 ? 391 THR A HA   6  
ATOM 9108  H HB   . THR A 1 16  ? 2.860   -5.074  -7.127  1.00 0.00 ? 391 THR A HB   6  
ATOM 9109  H HG1  . THR A 1 16  ? 3.030   -7.503  -5.692  1.00 0.00 ? 391 THR A HG1  6  
ATOM 9110  H HG21 . THR A 1 16  ? 0.442   -6.558  -6.590  1.00 0.00 ? 391 THR A HG21 6  
ATOM 9111  H HG22 . THR A 1 16  ? 1.344   -6.204  -5.117  1.00 0.00 ? 391 THR A HG22 6  
ATOM 9112  H HG23 . THR A 1 16  ? 0.861   -4.892  -6.192  1.00 0.00 ? 391 THR A HG23 6  
ATOM 9113  N N    . SER A 1 17  ? 3.193   -8.982  -7.488  1.00 0.00 ? 392 SER A N    6  
ATOM 9114  C CA   . SER A 1 17  ? 3.141   -10.414 -7.193  1.00 0.00 ? 392 SER A CA   6  
ATOM 9115  C C    . SER A 1 17  ? 1.876   -10.787 -6.420  1.00 0.00 ? 392 SER A C    6  
ATOM 9116  O O    . SER A 1 17  ? 1.271   -11.830 -6.670  1.00 0.00 ? 392 SER A O    6  
ATOM 9117  C CB   . SER A 1 17  ? 4.377   -10.832 -6.396  1.00 0.00 ? 392 SER A CB   6  
ATOM 9118  O OG   . SER A 1 17  ? 4.758   -12.163 -6.705  1.00 0.00 ? 392 SER A OG   6  
ATOM 9119  H H    . SER A 1 17  ? 4.033   -8.498  -7.343  1.00 0.00 ? 392 SER A H    6  
ATOM 9120  H HA   . SER A 1 17  ? 3.139   -10.943 -8.133  1.00 0.00 ? 392 SER A HA   6  
ATOM 9121  H HB2  . SER A 1 17  ? 5.198   -10.173 -6.635  1.00 0.00 ? 392 SER A HB2  6  
ATOM 9122  H HB3  . SER A 1 17  ? 4.161   -10.770 -5.339  1.00 0.00 ? 392 SER A HB3  6  
ATOM 9123  H HG   . SER A 1 17  ? 4.802   -12.269 -7.659  1.00 0.00 ? 392 SER A HG   6  
ATOM 9124  N N    . SER A 1 18  ? 1.484   -9.934  -5.480  1.00 0.00 ? 393 SER A N    6  
ATOM 9125  C CA   . SER A 1 18  ? 0.295   -10.182 -4.672  1.00 0.00 ? 393 SER A CA   6  
ATOM 9126  C C    . SER A 1 18  ? -0.976  -10.070 -5.510  1.00 0.00 ? 393 SER A C    6  
ATOM 9127  O O    . SER A 1 18  ? -1.759  -11.016 -5.598  1.00 0.00 ? 393 SER A O    6  
ATOM 9128  C CB   . SER A 1 18  ? 0.235   -9.198  -3.501  1.00 0.00 ? 393 SER A CB   6  
ATOM 9129  O OG   . SER A 1 18  ? 1.515   -9.015  -2.923  1.00 0.00 ? 393 SER A OG   6  
ATOM 9130  H H    . SER A 1 18  ? 2.007   -9.121  -5.323  1.00 0.00 ? 393 SER A H    6  
ATOM 9131  H HA   . SER A 1 18  ? 0.365   -11.185 -4.281  1.00 0.00 ? 393 SER A HA   6  
ATOM 9132  H HB2  . SER A 1 18  ? -0.126  -8.244  -3.854  1.00 0.00 ? 393 SER A HB2  6  
ATOM 9133  H HB3  . SER A 1 18  ? -0.437  -9.580  -2.747  1.00 0.00 ? 393 SER A HB3  6  
ATOM 9134  H HG   . SER A 1 18  ? 1.727   -9.770  -2.368  1.00 0.00 ? 393 SER A HG   6  
ATOM 9135  N N    . LYS A 1 19  ? -1.178  -8.906  -6.118  1.00 0.00 ? 394 LYS A N    6  
ATOM 9136  C CA   . LYS A 1 19  ? -2.357  -8.668  -6.943  1.00 0.00 ? 394 LYS A CA   6  
ATOM 9137  C C    . LYS A 1 19  ? -2.408  -9.628  -8.128  1.00 0.00 ? 394 LYS A C    6  
ATOM 9138  O O    . LYS A 1 19  ? -3.417  -10.297 -8.352  1.00 0.00 ? 394 LYS A O    6  
ATOM 9139  C CB   . LYS A 1 19  ? -2.371  -7.219  -7.441  1.00 0.00 ? 394 LYS A CB   6  
ATOM 9140  C CG   . LYS A 1 19  ? -3.504  -6.388  -6.862  1.00 0.00 ? 394 LYS A CG   6  
ATOM 9141  C CD   . LYS A 1 19  ? -4.830  -6.710  -7.534  1.00 0.00 ? 394 LYS A CD   6  
ATOM 9142  C CE   . LYS A 1 19  ? -5.960  -6.812  -6.520  1.00 0.00 ? 394 LYS A CE   6  
ATOM 9143  N NZ   . LYS A 1 19  ? -6.328  -5.482  -5.959  1.00 0.00 ? 394 LYS A NZ   6  
ATOM 9144  H H    . LYS A 1 19  ? -0.520  -8.189  -6.006  1.00 0.00 ? 394 LYS A H    6  
ATOM 9145  H HA   . LYS A 1 19  ? -3.228  -8.832  -6.327  1.00 0.00 ? 394 LYS A HA   6  
ATOM 9146  H HB2  . LYS A 1 19  ? -1.436  -6.751  -7.171  1.00 0.00 ? 394 LYS A HB2  6  
ATOM 9147  H HB3  . LYS A 1 19  ? -2.465  -7.218  -8.517  1.00 0.00 ? 394 LYS A HB3  6  
ATOM 9148  H HG2  . LYS A 1 19  ? -3.587  -6.598  -5.806  1.00 0.00 ? 394 LYS A HG2  6  
ATOM 9149  H HG3  . LYS A 1 19  ? -3.281  -5.343  -7.008  1.00 0.00 ? 394 LYS A HG3  6  
ATOM 9150  H HD2  . LYS A 1 19  ? -5.064  -5.928  -8.240  1.00 0.00 ? 394 LYS A HD2  6  
ATOM 9151  H HD3  . LYS A 1 19  ? -4.741  -7.652  -8.055  1.00 0.00 ? 394 LYS A HD3  6  
ATOM 9152  H HE2  . LYS A 1 19  ? -6.824  -7.239  -7.005  1.00 0.00 ? 394 LYS A HE2  6  
ATOM 9153  H HE3  . LYS A 1 19  ? -5.645  -7.458  -5.714  1.00 0.00 ? 394 LYS A HE3  6  
ATOM 9154  H HZ1  . LYS A 1 19  ? -6.234  -5.492  -4.923  1.00 0.00 ? 394 LYS A HZ1  6  
ATOM 9155  H HZ2  . LYS A 1 19  ? -5.704  -4.744  -6.345  1.00 0.00 ? 394 LYS A HZ2  6  
ATOM 9156  H HZ3  . LYS A 1 19  ? -7.313  -5.251  -6.204  1.00 0.00 ? 394 LYS A HZ3  6  
ATOM 9157  N N    . ALA A 1 20  ? -1.318  -9.688  -8.889  1.00 0.00 ? 395 ALA A N    6  
ATOM 9158  C CA   . ALA A 1 20  ? -1.243  -10.563 -10.055 1.00 0.00 ? 395 ALA A CA   6  
ATOM 9159  C C    . ALA A 1 20  ? -1.666  -11.988 -9.712  1.00 0.00 ? 395 ALA A C    6  
ATOM 9160  O O    . ALA A 1 20  ? -2.255  -12.687 -10.537 1.00 0.00 ? 395 ALA A O    6  
ATOM 9161  C CB   . ALA A 1 20  ? 0.165   -10.552 -10.632 1.00 0.00 ? 395 ALA A CB   6  
ATOM 9162  H H    . ALA A 1 20  ? -0.548  -9.127  -8.661  1.00 0.00 ? 395 ALA A H    6  
ATOM 9163  H HA   . ALA A 1 20  ? -1.914  -10.172 -10.805 1.00 0.00 ? 395 ALA A HA   6  
ATOM 9164  H HB1  . ALA A 1 20  ? 0.114   -10.415 -11.702 1.00 0.00 ? 395 ALA A HB1  6  
ATOM 9165  H HB2  . ALA A 1 20  ? 0.728   -9.743  -10.192 1.00 0.00 ? 395 ALA A HB2  6  
ATOM 9166  H HB3  . ALA A 1 20  ? 0.653   -11.491 -10.412 1.00 0.00 ? 395 ALA A HB3  6  
ATOM 9167  N N    . LYS A 1 21  ? -1.363  -12.414 -8.491  1.00 0.00 ? 396 LYS A N    6  
ATOM 9168  C CA   . LYS A 1 21  ? -1.713  -13.757 -8.040  1.00 0.00 ? 396 LYS A CA   6  
ATOM 9169  C C    . LYS A 1 21  ? -3.092  -13.774 -7.389  1.00 0.00 ? 396 LYS A C    6  
ATOM 9170  O O    . LYS A 1 21  ? -3.794  -14.785 -7.427  1.00 0.00 ? 396 LYS A O    6  
ATOM 9171  C CB   . LYS A 1 21  ? -0.664  -14.276 -7.056  1.00 0.00 ? 396 LYS A CB   6  
ATOM 9172  C CG   . LYS A 1 21  ? -0.387  -15.764 -7.190  1.00 0.00 ? 396 LYS A CG   6  
ATOM 9173  C CD   . LYS A 1 21  ? 0.319   -16.084 -8.498  1.00 0.00 ? 396 LYS A CD   6  
ATOM 9174  C CE   . LYS A 1 21  ? -0.021  -17.481 -8.989  1.00 0.00 ? 396 LYS A CE   6  
ATOM 9175  N NZ   . LYS A 1 21  ? 0.039   -17.578 -10.473 1.00 0.00 ? 396 LYS A NZ   6  
ATOM 9176  H H    . LYS A 1 21  ? -0.893  -11.812 -7.877  1.00 0.00 ? 396 LYS A H    6  
ATOM 9177  H HA   . LYS A 1 21  ? -1.729  -14.402 -8.906  1.00 0.00 ? 396 LYS A HA   6  
ATOM 9178  H HB2  . LYS A 1 21  ? 0.261   -13.744 -7.220  1.00 0.00 ? 396 LYS A HB2  6  
ATOM 9179  H HB3  . LYS A 1 21  ? -1.005  -14.084 -6.049  1.00 0.00 ? 396 LYS A HB3  6  
ATOM 9180  H HG2  . LYS A 1 21  ? 0.238   -16.081 -6.369  1.00 0.00 ? 396 LYS A HG2  6  
ATOM 9181  H HG3  . LYS A 1 21  ? -1.326  -16.300 -7.158  1.00 0.00 ? 396 LYS A HG3  6  
ATOM 9182  H HD2  . LYS A 1 21  ? 0.013   -15.367 -9.246  1.00 0.00 ? 396 LYS A HD2  6  
ATOM 9183  H HD3  . LYS A 1 21  ? 1.386   -16.014 -8.346  1.00 0.00 ? 396 LYS A HD3  6  
ATOM 9184  H HE2  . LYS A 1 21  ? 0.685   -18.179 -8.563  1.00 0.00 ? 396 LYS A HE2  6  
ATOM 9185  H HE3  . LYS A 1 21  ? -1.018  -17.732 -8.661  1.00 0.00 ? 396 LYS A HE3  6  
ATOM 9186  H HZ1  . LYS A 1 21  ? -0.441  -18.442 -10.795 1.00 0.00 ? 396 LYS A HZ1  6  
ATOM 9187  H HZ2  . LYS A 1 21  ? -0.428  -16.755 -10.905 1.00 0.00 ? 396 LYS A HZ2  6  
ATOM 9188  H HZ3  . LYS A 1 21  ? 1.030   -17.606 -10.791 1.00 0.00 ? 396 LYS A HZ3  6  
ATOM 9189  N N    . GLU A 1 22  ? -3.474  -12.651 -6.789  1.00 0.00 ? 397 GLU A N    6  
ATOM 9190  C CA   . GLU A 1 22  ? -4.769  -12.539 -6.127  1.00 0.00 ? 397 GLU A CA   6  
ATOM 9191  C C    . GLU A 1 22  ? -5.910  -12.648 -7.134  1.00 0.00 ? 397 GLU A C    6  
ATOM 9192  O O    . GLU A 1 22  ? -6.901  -13.337 -6.889  1.00 0.00 ? 397 GLU A O    6  
ATOM 9193  C CB   . GLU A 1 22  ? -4.865  -11.213 -5.371  1.00 0.00 ? 397 GLU A CB   6  
ATOM 9194  C CG   . GLU A 1 22  ? -6.038  -11.147 -4.406  1.00 0.00 ? 397 GLU A CG   6  
ATOM 9195  C CD   . GLU A 1 22  ? -7.169  -10.278 -4.921  1.00 0.00 ? 397 GLU A CD   6  
ATOM 9196  O OE1  . GLU A 1 22  ? -6.890  -9.325  -5.679  1.00 0.00 ? 397 GLU A OE1  6  
ATOM 9197  O OE2  . GLU A 1 22  ? -8.335  -10.550 -4.564  1.00 0.00 ? 397 GLU A OE2  6  
ATOM 9198  H H    . GLU A 1 22  ? -2.870  -11.880 -6.791  1.00 0.00 ? 397 GLU A H    6  
ATOM 9199  H HA   . GLU A 1 22  ? -4.850  -13.352 -5.421  1.00 0.00 ? 397 GLU A HA   6  
ATOM 9200  H HB2  . GLU A 1 22  ? -3.955  -11.066 -4.809  1.00 0.00 ? 397 GLU A HB2  6  
ATOM 9201  H HB3  . GLU A 1 22  ? -4.969  -10.411 -6.087  1.00 0.00 ? 397 GLU A HB3  6  
ATOM 9202  H HG2  . GLU A 1 22  ? -6.415  -12.146 -4.249  1.00 0.00 ? 397 GLU A HG2  6  
ATOM 9203  H HG3  . GLU A 1 22  ? -5.692  -10.742 -3.466  1.00 0.00 ? 397 GLU A HG3  6  
ATOM 9204  N N    . LEU A 1 23  ? -5.766  -11.964 -8.264  1.00 0.00 ? 398 LEU A N    6  
ATOM 9205  C CA   . LEU A 1 23  ? -6.787  -11.984 -9.305  1.00 0.00 ? 398 LEU A CA   6  
ATOM 9206  C C    . LEU A 1 23  ? -7.042  -13.406 -9.795  1.00 0.00 ? 398 LEU A C    6  
ATOM 9207  O O    . LEU A 1 23  ? -8.183  -13.787 -10.057 1.00 0.00 ? 398 LEU A O    6  
ATOM 9208  C CB   . LEU A 1 23  ? -6.363  -11.097 -10.477 1.00 0.00 ? 398 LEU A CB   6  
ATOM 9209  C CG   . LEU A 1 23  ? -5.991  -9.662  -10.102 1.00 0.00 ? 398 LEU A CG   6  
ATOM 9210  C CD1  . LEU A 1 23  ? -4.850  -9.162  -10.973 1.00 0.00 ? 398 LEU A CD1  6  
ATOM 9211  C CD2  . LEU A 1 23  ? -7.201  -8.748  -10.229 1.00 0.00 ? 398 LEU A CD2  6  
ATOM 9212  H H    . LEU A 1 23  ? -4.954  -11.431 -8.399  1.00 0.00 ? 398 LEU A H    6  
ATOM 9213  H HA   . LEU A 1 23  ? -7.699  -11.593 -8.881  1.00 0.00 ? 398 LEU A HA   6  
ATOM 9214  H HB2  . LEU A 1 23  ? -5.512  -11.555 -10.958 1.00 0.00 ? 398 LEU A HB2  6  
ATOM 9215  H HB3  . LEU A 1 23  ? -7.179  -11.060 -11.185 1.00 0.00 ? 398 LEU A HB3  6  
ATOM 9216  H HG   . LEU A 1 23  ? -5.661  -9.640  -9.074  1.00 0.00 ? 398 LEU A HG   6  
ATOM 9217  H HD11 . LEU A 1 23  ? -4.154  -9.967  -11.155 1.00 0.00 ? 398 LEU A HD11 6  
ATOM 9218  H HD12 . LEU A 1 23  ? -5.243  -8.807  -11.914 1.00 0.00 ? 398 LEU A HD12 6  
ATOM 9219  H HD13 . LEU A 1 23  ? -4.341  -8.353  -10.469 1.00 0.00 ? 398 LEU A HD13 6  
ATOM 9220  H HD21 . LEU A 1 23  ? -7.341  -8.478  -11.264 1.00 0.00 ? 398 LEU A HD21 6  
ATOM 9221  H HD22 . LEU A 1 23  ? -8.080  -9.263  -9.870  1.00 0.00 ? 398 LEU A HD22 6  
ATOM 9222  H HD23 . LEU A 1 23  ? -7.041  -7.856  -9.641  1.00 0.00 ? 398 LEU A HD23 6  
ATOM 9223  N N    . LYS A 1 24  ? -5.973  -14.186 -9.917  1.00 0.00 ? 399 LYS A N    6  
ATOM 9224  C CA   . LYS A 1 24  ? -6.082  -15.566 -10.376 1.00 0.00 ? 399 LYS A CA   6  
ATOM 9225  C C    . LYS A 1 24  ? -6.823  -16.425 -9.356  1.00 0.00 ? 399 LYS A C    6  
ATOM 9226  O O    . LYS A 1 24  ? -7.494  -17.393 -9.716  1.00 0.00 ? 399 LYS A O    6  
ATOM 9227  C CB   . LYS A 1 24  ? -4.692  -16.150 -10.637 1.00 0.00 ? 399 LYS A CB   6  
ATOM 9228  C CG   . LYS A 1 24  ? -4.138  -15.811 -12.011 1.00 0.00 ? 399 LYS A CG   6  
ATOM 9229  C CD   . LYS A 1 24  ? -2.782  -16.459 -12.241 1.00 0.00 ? 399 LYS A CD   6  
ATOM 9230  C CE   . LYS A 1 24  ? -2.528  -16.713 -13.718 1.00 0.00 ? 399 LYS A CE   6  
ATOM 9231  N NZ   . LYS A 1 24  ? -2.680  -18.152 -14.068 1.00 0.00 ? 399 LYS A NZ   6  
ATOM 9232  H H    . LYS A 1 24  ? -5.089  -13.825 -9.694  1.00 0.00 ? 399 LYS A H    6  
ATOM 9233  H HA   . LYS A 1 24  ? -6.640  -15.563 -11.301 1.00 0.00 ? 399 LYS A HA   6  
ATOM 9234  H HB2  . LYS A 1 24  ? -4.008  -15.768 -9.893  1.00 0.00 ? 399 LYS A HB2  6  
ATOM 9235  H HB3  . LYS A 1 24  ? -4.744  -17.224 -10.549 1.00 0.00 ? 399 LYS A HB3  6  
ATOM 9236  H HG2  . LYS A 1 24  ? -4.827  -16.165 -12.764 1.00 0.00 ? 399 LYS A HG2  6  
ATOM 9237  H HG3  . LYS A 1 24  ? -4.033  -14.739 -12.092 1.00 0.00 ? 399 LYS A HG3  6  
ATOM 9238  H HD2  . LYS A 1 24  ? -2.013  -15.804 -11.861 1.00 0.00 ? 399 LYS A HD2  6  
ATOM 9239  H HD3  . LYS A 1 24  ? -2.751  -17.400 -11.712 1.00 0.00 ? 399 LYS A HD3  6  
ATOM 9240  H HE2  . LYS A 1 24  ? -3.233  -16.135 -14.297 1.00 0.00 ? 399 LYS A HE2  6  
ATOM 9241  H HE3  . LYS A 1 24  ? -1.523  -16.397 -13.956 1.00 0.00 ? 399 LYS A HE3  6  
ATOM 9242  H HZ1  . LYS A 1 24  ? -2.012  -18.408 -14.824 1.00 0.00 ? 399 LYS A HZ1  6  
ATOM 9243  H HZ2  . LYS A 1 24  ? -2.488  -18.745 -13.236 1.00 0.00 ? 399 LYS A HZ2  6  
ATOM 9244  H HZ3  . LYS A 1 24  ? -3.648  -18.340 -14.398 1.00 0.00 ? 399 LYS A HZ3  6  
ATOM 9245  N N    . ASP A 1 25  ? -6.698  -16.065 -8.084  1.00 0.00 ? 400 ASP A N    6  
ATOM 9246  C CA   . ASP A 1 25  ? -7.357  -16.803 -7.012  1.00 0.00 ? 400 ASP A CA   6  
ATOM 9247  C C    . ASP A 1 25  ? -8.870  -16.620 -7.074  1.00 0.00 ? 400 ASP A C    6  
ATOM 9248  O O    . ASP A 1 25  ? -9.619  -17.587 -7.211  1.00 0.00 ? 400 ASP A O    6  
ATOM 9249  C CB   . ASP A 1 25  ? -6.831  -16.346 -5.651  1.00 0.00 ? 400 ASP A CB   6  
ATOM 9250  C CG   . ASP A 1 25  ? -6.773  -17.477 -4.643  1.00 0.00 ? 400 ASP A CG   6  
ATOM 9251  O OD1  . ASP A 1 25  ? -7.709  -18.304 -4.624  1.00 0.00 ? 400 ASP A OD1  6  
ATOM 9252  O OD2  . ASP A 1 25  ? -5.792  -17.537 -3.874  1.00 0.00 ? 400 ASP A OD2  6  
ATOM 9253  H H    . ASP A 1 25  ? -6.149  -15.285 -7.859  1.00 0.00 ? 400 ASP A H    6  
ATOM 9254  H HA   . ASP A 1 25  ? -7.129  -17.851 -7.143  1.00 0.00 ? 400 ASP A HA   6  
ATOM 9255  H HB2  . ASP A 1 25  ? -5.836  -15.946 -5.771  1.00 0.00 ? 400 ASP A HB2  6  
ATOM 9256  H HB3  . ASP A 1 25  ? -7.480  -15.575 -5.262  1.00 0.00 ? 400 ASP A HB3  6  
ATOM 9257  N N    . ARG A 1 26  ? -9.313  -15.370 -6.974  1.00 0.00 ? 401 ARG A N    6  
ATOM 9258  C CA   . ARG A 1 26  ? -10.738 -15.059 -7.018  1.00 0.00 ? 401 ARG A CA   6  
ATOM 9259  C C    . ARG A 1 26  ? -11.320 -15.379 -8.391  1.00 0.00 ? 401 ARG A C    6  
ATOM 9260  O O    . ARG A 1 26  ? -12.445 -15.867 -8.501  1.00 0.00 ? 401 ARG A O    6  
ATOM 9261  C CB   . ARG A 1 26  ? -10.968 -13.583 -6.681  1.00 0.00 ? 401 ARG A CB   6  
ATOM 9262  C CG   . ARG A 1 26  ? -11.535 -13.361 -5.288  1.00 0.00 ? 401 ARG A CG   6  
ATOM 9263  C CD   . ARG A 1 26  ? -10.442 -13.007 -4.291  1.00 0.00 ? 401 ARG A CD   6  
ATOM 9264  N NE   . ARG A 1 26  ? -10.976 -12.786 -2.951  1.00 0.00 ? 401 ARG A NE   6  
ATOM 9265  C CZ   . ARG A 1 26  ? -10.233 -12.792 -1.846  1.00 0.00 ? 401 ARG A CZ   6  
ATOM 9266  N NH1  . ARG A 1 26  ? -8.925  -13.004 -1.918  1.00 0.00 ? 401 ARG A NH1  6  
ATOM 9267  N NH2  . ARG A 1 26  ? -10.800 -12.584 -0.666  1.00 0.00 ? 401 ARG A NH2  6  
ATOM 9268  H H    . ARG A 1 26  ? -8.667  -14.641 -6.866  1.00 0.00 ? 401 ARG A H    6  
ATOM 9269  H HA   . ARG A 1 26  ? -11.233 -15.670 -6.279  1.00 0.00 ? 401 ARG A HA   6  
ATOM 9270  H HB2  . ARG A 1 26  ? -10.028 -13.059 -6.751  1.00 0.00 ? 401 ARG A HB2  6  
ATOM 9271  H HB3  . ARG A 1 26  ? -11.659 -13.164 -7.398  1.00 0.00 ? 401 ARG A HB3  6  
ATOM 9272  H HG2  . ARG A 1 26  ? -12.249 -12.551 -5.326  1.00 0.00 ? 401 ARG A HG2  6  
ATOM 9273  H HG3  . ARG A 1 26  ? -12.028 -14.264 -4.962  1.00 0.00 ? 401 ARG A HG3  6  
ATOM 9274  H HD2  . ARG A 1 26  ? -9.730  -13.818 -4.255  1.00 0.00 ? 401 ARG A HD2  6  
ATOM 9275  H HD3  . ARG A 1 26  ? -9.947  -12.107 -4.624  1.00 0.00 ? 401 ARG A HD3  6  
ATOM 9276  H HE   . ARG A 1 26  ? -11.940 -12.626 -2.868  1.00 0.00 ? 401 ARG A HE   6  
ATOM 9277  H HH11 . ARG A 1 26  ? -8.492  -13.161 -2.806  1.00 0.00 ? 401 ARG A HH11 6  
ATOM 9278  H HH12 . ARG A 1 26  ? -8.373  -13.006 -1.086  1.00 0.00 ? 401 ARG A HH12 6  
ATOM 9279  H HH21 . ARG A 1 26  ? -11.785 -12.423 -0.605  1.00 0.00 ? 401 ARG A HH21 6  
ATOM 9280  H HH22 . ARG A 1 26  ? -10.243 -12.588 0.164   1.00 0.00 ? 401 ARG A HH22 6  
ATOM 9281  N N    . HIS A 1 27  ? -10.548 -15.100 -9.436  1.00 0.00 ? 402 HIS A N    6  
ATOM 9282  C CA   . HIS A 1 27  ? -10.985 -15.358 -10.802 1.00 0.00 ? 402 HIS A CA   6  
ATOM 9283  C C    . HIS A 1 27  ? -9.978  -16.233 -11.540 1.00 0.00 ? 402 HIS A C    6  
ATOM 9284  O O    . HIS A 1 27  ? -8.968  -15.742 -12.046 1.00 0.00 ? 402 HIS A O    6  
ATOM 9285  C CB   . HIS A 1 27  ? -11.181 -14.041 -11.555 1.00 0.00 ? 402 HIS A CB   6  
ATOM 9286  C CG   . HIS A 1 27  ? -12.123 -13.097 -10.874 1.00 0.00 ? 402 HIS A CG   6  
ATOM 9287  N ND1  . HIS A 1 27  ? -13.471 -13.354 -10.726 1.00 0.00 ? 402 HIS A ND1  6  
ATOM 9288  C CD2  . HIS A 1 27  ? -11.907 -11.891 -10.296 1.00 0.00 ? 402 HIS A CD2  6  
ATOM 9289  C CE1  . HIS A 1 27  ? -14.041 -12.347 -10.088 1.00 0.00 ? 402 HIS A CE1  6  
ATOM 9290  N NE2  . HIS A 1 27  ? -13.114 -11.447 -9.816  1.00 0.00 ? 402 HIS A NE2  6  
ATOM 9291  H H    . HIS A 1 27  ? -9.660  -14.712 -9.284  1.00 0.00 ? 402 HIS A H    6  
ATOM 9292  H HA   . HIS A 1 27  ? -11.929 -15.879 -10.756 1.00 0.00 ? 402 HIS A HA   6  
ATOM 9293  H HB2  . HIS A 1 27  ? -10.228 -13.544 -11.651 1.00 0.00 ? 402 HIS A HB2  6  
ATOM 9294  H HB3  . HIS A 1 27  ? -11.573 -14.251 -12.538 1.00 0.00 ? 402 HIS A HB3  6  
ATOM 9295  H HD1  . HIS A 1 27  ? -13.939 -14.155 -11.042 1.00 0.00 ? 402 HIS A HD1  6  
ATOM 9296  H HD2  . HIS A 1 27  ? -10.959 -11.374 -10.228 1.00 0.00 ? 402 HIS A HD2  6  
ATOM 9297  H HE1  . HIS A 1 27  ? -15.088 -12.273 -9.833  1.00 0.00 ? 402 HIS A HE1  6  
ATOM 9298  H HE2  . HIS A 1 27  ? -13.278 -10.571 -9.410  1.00 0.00 ? 402 HIS A HE2  6  
ATOM 9299  N N    . ARG A 1 28  ? -10.259 -17.530 -11.599 1.00 0.00 ? 403 ARG A N    6  
ATOM 9300  C CA   . ARG A 1 28  ? -9.376  -18.471 -12.277 1.00 0.00 ? 403 ARG A CA   6  
ATOM 9301  C C    . ARG A 1 28  ? -9.628  -18.463 -13.781 1.00 0.00 ? 403 ARG A C    6  
ATOM 9302  O O    . ARG A 1 28  ? -9.976  -19.486 -14.372 1.00 0.00 ? 403 ARG A O    6  
ATOM 9303  C CB   . ARG A 1 28  ? -9.570  -19.882 -11.721 1.00 0.00 ? 403 ARG A CB   6  
ATOM 9304  C CG   . ARG A 1 28  ? -8.533  -20.873 -12.220 1.00 0.00 ? 403 ARG A CG   6  
ATOM 9305  C CD   . ARG A 1 28  ? -9.110  -22.275 -12.336 1.00 0.00 ? 403 ARG A CD   6  
ATOM 9306  N NE   . ARG A 1 28  ? -8.084  -23.303 -12.181 1.00 0.00 ? 403 ARG A NE   6  
ATOM 9307  C CZ   . ARG A 1 28  ? -7.452  -23.553 -11.038 1.00 0.00 ? 403 ARG A CZ   6  
ATOM 9308  N NH1  . ARG A 1 28  ? -7.739  -22.856 -9.945  1.00 0.00 ? 403 ARG A NH1  6  
ATOM 9309  N NH2  . ARG A 1 28  ? -6.529  -24.505 -10.984 1.00 0.00 ? 403 ARG A NH2  6  
ATOM 9310  H H    . ARG A 1 28  ? -11.079 -17.863 -11.178 1.00 0.00 ? 403 ARG A H    6  
ATOM 9311  H HA   . ARG A 1 28  ? -8.359  -18.159 -12.094 1.00 0.00 ? 403 ARG A HA   6  
ATOM 9312  H HB2  . ARG A 1 28  ? -9.513  -19.844 -10.643 1.00 0.00 ? 403 ARG A HB2  6  
ATOM 9313  H HB3  . ARG A 1 28  ? -10.547 -20.240 -12.010 1.00 0.00 ? 403 ARG A HB3  6  
ATOM 9314  H HG2  . ARG A 1 28  ? -8.185  -20.556 -13.192 1.00 0.00 ? 403 ARG A HG2  6  
ATOM 9315  H HG3  . ARG A 1 28  ? -7.704  -20.890 -11.527 1.00 0.00 ? 403 ARG A HG3  6  
ATOM 9316  H HD2  . ARG A 1 28  ? -9.858  -22.407 -11.569 1.00 0.00 ? 403 ARG A HD2  6  
ATOM 9317  H HD3  . ARG A 1 28  ? -9.570  -22.381 -13.308 1.00 0.00 ? 403 ARG A HD3  6  
ATOM 9318  H HE   . ARG A 1 28  ? -7.854  -23.835 -12.972 1.00 0.00 ? 403 ARG A HE   6  
ATOM 9319  H HH11 . ARG A 1 28  ? -8.434  -22.138 -9.979  1.00 0.00 ? 403 ARG A HH11 6  
ATOM 9320  H HH12 . ARG A 1 28  ? -7.260  -23.049 -9.089  1.00 0.00 ? 403 ARG A HH12 6  
ATOM 9321  H HH21 . ARG A 1 28  ? -6.309  -25.034 -11.803 1.00 0.00 ? 403 ARG A HH21 6  
ATOM 9322  H HH22 . ARG A 1 28  ? -6.053  -24.693 -10.125 1.00 0.00 ? 403 ARG A HH22 6  
ATOM 9323  N N    . ASP A 1 29  ? -9.447  -17.299 -14.395 1.00 0.00 ? 404 ASP A N    6  
ATOM 9324  C CA   . ASP A 1 29  ? -9.652  -17.151 -15.831 1.00 0.00 ? 404 ASP A CA   6  
ATOM 9325  C C    . ASP A 1 29  ? -8.820  -15.996 -16.385 1.00 0.00 ? 404 ASP A C    6  
ATOM 9326  O O    . ASP A 1 29  ? -9.145  -15.432 -17.431 1.00 0.00 ? 404 ASP A O    6  
ATOM 9327  C CB   . ASP A 1 29  ? -11.135 -16.923 -16.134 1.00 0.00 ? 404 ASP A CB   6  
ATOM 9328  C CG   . ASP A 1 29  ? -11.676 -17.909 -17.151 1.00 0.00 ? 404 ASP A CG   6  
ATOM 9329  O OD1  . ASP A 1 29  ? -11.540 -17.645 -18.365 1.00 0.00 ? 404 ASP A OD1  6  
ATOM 9330  O OD2  . ASP A 1 29  ? -12.234 -18.945 -16.733 1.00 0.00 ? 404 ASP A OD2  6  
ATOM 9331  H H    . ASP A 1 29  ? -9.169  -16.522 -13.869 1.00 0.00 ? 404 ASP A H    6  
ATOM 9332  H HA   . ASP A 1 29  ? -9.334  -18.067 -16.307 1.00 0.00 ? 404 ASP A HA   6  
ATOM 9333  H HB2  . ASP A 1 29  ? -11.703 -17.029 -15.223 1.00 0.00 ? 404 ASP A HB2  6  
ATOM 9334  H HB3  . ASP A 1 29  ? -11.269 -15.923 -16.523 1.00 0.00 ? 404 ASP A HB3  6  
ATOM 9335  N N    . PHE A 1 30  ? -7.746  -15.652 -15.682 1.00 0.00 ? 405 PHE A N    6  
ATOM 9336  C CA   . PHE A 1 30  ? -6.869  -14.566 -16.109 1.00 0.00 ? 405 PHE A CA   6  
ATOM 9337  C C    . PHE A 1 30  ? -5.704  -15.104 -16.935 1.00 0.00 ? 405 PHE A C    6  
ATOM 9338  O O    . PHE A 1 30  ? -5.217  -16.208 -16.691 1.00 0.00 ? 405 PHE A O    6  
ATOM 9339  C CB   . PHE A 1 30  ? -6.339  -13.803 -14.893 1.00 0.00 ? 405 PHE A CB   6  
ATOM 9340  C CG   . PHE A 1 30  ? -7.214  -12.657 -14.472 1.00 0.00 ? 405 PHE A CG   6  
ATOM 9341  C CD1  . PHE A 1 30  ? -8.538  -12.871 -14.120 1.00 0.00 ? 405 PHE A CD1  6  
ATOM 9342  C CD2  . PHE A 1 30  ? -6.713  -11.366 -14.427 1.00 0.00 ? 405 PHE A CD2  6  
ATOM 9343  C CE1  . PHE A 1 30  ? -9.344  -11.819 -13.731 1.00 0.00 ? 405 PHE A CE1  6  
ATOM 9344  C CE2  . PHE A 1 30  ? -7.516  -10.310 -14.039 1.00 0.00 ? 405 PHE A CE2  6  
ATOM 9345  C CZ   . PHE A 1 30  ? -8.833  -10.537 -13.690 1.00 0.00 ? 405 PHE A CZ   6  
ATOM 9346  H H    . PHE A 1 30  ? -7.535  -16.138 -14.858 1.00 0.00 ? 405 PHE A H    6  
ATOM 9347  H HA   . PHE A 1 30  ? -7.451  -13.893 -16.720 1.00 0.00 ? 405 PHE A HA   6  
ATOM 9348  H HB2  . PHE A 1 30  ? -6.257  -14.482 -14.058 1.00 0.00 ? 405 PHE A HB2  6  
ATOM 9349  H HB3  . PHE A 1 30  ? -5.361  -13.407 -15.125 1.00 0.00 ? 405 PHE A HB3  6  
ATOM 9350  H HD1  . PHE A 1 30  ? -8.939  -13.874 -14.152 1.00 0.00 ? 405 PHE A HD1  6  
ATOM 9351  H HD2  . PHE A 1 30  ? -5.684  -11.187 -14.699 1.00 0.00 ? 405 PHE A HD2  6  
ATOM 9352  H HE1  . PHE A 1 30  ? -10.374 -11.999 -13.460 1.00 0.00 ? 405 PHE A HE1  6  
ATOM 9353  H HE2  . PHE A 1 30  ? -7.114  -9.308  -14.007 1.00 0.00 ? 405 PHE A HE2  6  
ATOM 9354  H HZ   . PHE A 1 30  ? -9.462  -9.713  -13.387 1.00 0.00 ? 405 PHE A HZ   6  
ATOM 9355  N N    . PRO A 1 31  ? -5.237  -14.327 -17.929 1.00 0.00 ? 406 PRO A N    6  
ATOM 9356  C CA   . PRO A 1 31  ? -4.122  -14.734 -18.791 1.00 0.00 ? 406 PRO A CA   6  
ATOM 9357  C C    . PRO A 1 31  ? -2.893  -15.144 -17.990 1.00 0.00 ? 406 PRO A C    6  
ATOM 9358  O O    . PRO A 1 31  ? -2.901  -15.111 -16.759 1.00 0.00 ? 406 PRO A O    6  
ATOM 9359  C CB   . PRO A 1 31  ? -3.829  -13.478 -19.615 1.00 0.00 ? 406 PRO A CB   6  
ATOM 9360  C CG   . PRO A 1 31  ? -5.111  -12.718 -19.618 1.00 0.00 ? 406 PRO A CG   6  
ATOM 9361  C CD   . PRO A 1 31  ? -5.759  -12.995 -18.291 1.00 0.00 ? 406 PRO A CD   6  
ATOM 9362  H HA   . PRO A 1 31  ? -4.406  -15.541 -19.450 1.00 0.00 ? 406 PRO A HA   6  
ATOM 9363  H HB2  . PRO A 1 31  ? -3.036  -12.914 -19.146 1.00 0.00 ? 406 PRO A HB2  6  
ATOM 9364  H HB3  . PRO A 1 31  ? -3.537  -13.760 -20.615 1.00 0.00 ? 406 PRO A HB3  6  
ATOM 9365  H HG2  . PRO A 1 31  ? -4.912  -11.662 -19.726 1.00 0.00 ? 406 PRO A HG2  6  
ATOM 9366  H HG3  . PRO A 1 31  ? -5.742  -13.066 -20.423 1.00 0.00 ? 406 PRO A HG3  6  
ATOM 9367  H HD2  . PRO A 1 31  ? -5.461  -12.255 -17.564 1.00 0.00 ? 406 PRO A HD2  6  
ATOM 9368  H HD3  . PRO A 1 31  ? -6.834  -13.017 -18.392 1.00 0.00 ? 406 PRO A HD3  6  
ATOM 9369  N N    . ASP A 1 32  ? -1.835  -15.530 -18.695 1.00 0.00 ? 407 ASP A N    6  
ATOM 9370  C CA   . ASP A 1 32  ? -0.597  -15.947 -18.050 1.00 0.00 ? 407 ASP A CA   6  
ATOM 9371  C C    . ASP A 1 32  ? 0.449   -14.838 -18.116 1.00 0.00 ? 407 ASP A C    6  
ATOM 9372  O O    . ASP A 1 32  ? 1.637   -15.102 -18.304 1.00 0.00 ? 407 ASP A O    6  
ATOM 9373  C CB   . ASP A 1 32  ? -0.055  -17.218 -18.708 1.00 0.00 ? 407 ASP A CB   6  
ATOM 9374  C CG   . ASP A 1 32  ? 0.491   -18.205 -17.696 1.00 0.00 ? 407 ASP A CG   6  
ATOM 9375  O OD1  . ASP A 1 32  ? -0.293  -19.037 -17.194 1.00 0.00 ? 407 ASP A OD1  6  
ATOM 9376  O OD2  . ASP A 1 32  ? 1.705   -18.147 -17.406 1.00 0.00 ? 407 ASP A OD2  6  
ATOM 9377  H H    . ASP A 1 32  ? -1.890  -15.536 -19.675 1.00 0.00 ? 407 ASP A H    6  
ATOM 9378  H HA   . ASP A 1 32  ? -0.817  -16.156 -17.013 1.00 0.00 ? 407 ASP A HA   6  
ATOM 9379  H HB2  . ASP A 1 32  ? -0.850  -17.698 -19.258 1.00 0.00 ? 407 ASP A HB2  6  
ATOM 9380  H HB3  . ASP A 1 32  ? 0.739   -16.953 -19.391 1.00 0.00 ? 407 ASP A HB3  6  
ATOM 9381  N N    . VAL A 1 33  ? -0.001  -13.598 -17.958 1.00 0.00 ? 408 VAL A N    6  
ATOM 9382  C CA   . VAL A 1 33  ? 0.895   -12.449 -17.997 1.00 0.00 ? 408 VAL A CA   6  
ATOM 9383  C C    . VAL A 1 33  ? 1.052   -11.828 -16.613 1.00 0.00 ? 408 VAL A C    6  
ATOM 9384  O O    . VAL A 1 33  ? 0.085   -11.343 -16.026 1.00 0.00 ? 408 VAL A O    6  
ATOM 9385  C CB   . VAL A 1 33  ? 0.393   -11.373 -18.981 1.00 0.00 ? 408 VAL A CB   6  
ATOM 9386  C CG1  . VAL A 1 33  ? 0.338   -11.928 -20.396 1.00 0.00 ? 408 VAL A CG1  6  
ATOM 9387  C CG2  . VAL A 1 33  ? -0.970  -10.846 -18.555 1.00 0.00 ? 408 VAL A CG2  6  
ATOM 9388  H H    . VAL A 1 33  ? -0.958  -13.454 -17.810 1.00 0.00 ? 408 VAL A H    6  
ATOM 9389  H HA   . VAL A 1 33  ? 1.862   -12.793 -18.337 1.00 0.00 ? 408 VAL A HA   6  
ATOM 9390  H HB   . VAL A 1 33  ? 1.092   -10.550 -18.969 1.00 0.00 ? 408 VAL A HB   6  
ATOM 9391  H HG11 . VAL A 1 33  ? 0.047   -12.967 -20.365 1.00 0.00 ? 408 VAL A HG11 6  
ATOM 9392  H HG12 . VAL A 1 33  ? -0.384  -11.369 -20.975 1.00 0.00 ? 408 VAL A HG12 6  
ATOM 9393  H HG13 . VAL A 1 33  ? 1.312   -11.841 -20.855 1.00 0.00 ? 408 VAL A HG13 6  
ATOM 9394  H HG21 . VAL A 1 33  ? -1.410  -10.289 -19.369 1.00 0.00 ? 408 VAL A HG21 6  
ATOM 9395  H HG22 . VAL A 1 33  ? -1.613  -11.675 -18.297 1.00 0.00 ? 408 VAL A HG22 6  
ATOM 9396  H HG23 . VAL A 1 33  ? -0.854  -10.200 -17.697 1.00 0.00 ? 408 VAL A HG23 6  
ATOM 9397  N N    . ILE A 1 34  ? 2.277   -11.848 -16.096 1.00 0.00 ? 409 ILE A N    6  
ATOM 9398  C CA   . ILE A 1 34  ? 2.560   -11.289 -14.781 1.00 0.00 ? 409 ILE A CA   6  
ATOM 9399  C C    . ILE A 1 34  ? 2.855   -9.795  -14.870 1.00 0.00 ? 409 ILE A C    6  
ATOM 9400  O O    . ILE A 1 34  ? 2.592   -9.044  -13.930 1.00 0.00 ? 409 ILE A O    6  
ATOM 9401  C CB   . ILE A 1 34  ? 3.753   -11.998 -14.111 1.00 0.00 ? 409 ILE A CB   6  
ATOM 9402  C CG1  . ILE A 1 34  ? 4.949   -12.050 -15.066 1.00 0.00 ? 409 ILE A CG1  6  
ATOM 9403  C CG2  . ILE A 1 34  ? 3.357   -13.399 -13.670 1.00 0.00 ? 409 ILE A CG2  6  
ATOM 9404  C CD1  . ILE A 1 34  ? 6.246   -11.591 -14.436 1.00 0.00 ? 409 ILE A CD1  6  
ATOM 9405  H H    . ILE A 1 34  ? 3.007   -12.251 -16.613 1.00 0.00 ? 409 ILE A H    6  
ATOM 9406  H HA   . ILE A 1 34  ? 1.687   -11.437 -14.161 1.00 0.00 ? 409 ILE A HA   6  
ATOM 9407  H HB   . ILE A 1 34  ? 4.029   -11.435 -13.232 1.00 0.00 ? 409 ILE A HB   6  
ATOM 9408  H HG12 . ILE A 1 34  ? 5.088   -13.066 -15.406 1.00 0.00 ? 409 ILE A HG12 6  
ATOM 9409  H HG13 . ILE A 1 34  ? 4.751   -11.416 -15.917 1.00 0.00 ? 409 ILE A HG13 6  
ATOM 9410  H HG21 . ILE A 1 34  ? 2.285   -13.447 -13.543 1.00 0.00 ? 409 ILE A HG21 6  
ATOM 9411  H HG22 . ILE A 1 34  ? 3.662   -14.113 -14.420 1.00 0.00 ? 409 ILE A HG22 6  
ATOM 9412  H HG23 . ILE A 1 34  ? 3.841   -13.633 -12.733 1.00 0.00 ? 409 ILE A HG23 6  
ATOM 9413  H HD11 . ILE A 1 34  ? 6.794   -10.985 -15.142 1.00 0.00 ? 409 ILE A HD11 6  
ATOM 9414  H HD12 . ILE A 1 34  ? 6.030   -11.009 -13.553 1.00 0.00 ? 409 ILE A HD12 6  
ATOM 9415  H HD13 . ILE A 1 34  ? 6.838   -12.452 -14.163 1.00 0.00 ? 409 ILE A HD13 6  
ATOM 9416  N N    . SER A 1 35  ? 3.405   -9.370  -16.003 1.00 0.00 ? 410 SER A N    6  
ATOM 9417  C CA   . SER A 1 35  ? 3.736   -7.965  -16.212 1.00 0.00 ? 410 SER A CA   6  
ATOM 9418  C C    . SER A 1 35  ? 2.541   -7.199  -16.769 1.00 0.00 ? 410 SER A C    6  
ATOM 9419  O O    . SER A 1 35  ? 1.718   -7.755  -17.496 1.00 0.00 ? 410 SER A O    6  
ATOM 9420  C CB   . SER A 1 35  ? 4.927   -7.837  -17.162 1.00 0.00 ? 410 SER A CB   6  
ATOM 9421  O OG   . SER A 1 35  ? 5.049   -8.983  -17.986 1.00 0.00 ? 410 SER A OG   6  
ATOM 9422  H H    . SER A 1 35  ? 3.592   -10.016 -16.716 1.00 0.00 ? 410 SER A H    6  
ATOM 9423  H HA   . SER A 1 35  ? 4.003   -7.543  -15.255 1.00 0.00 ? 410 SER A HA   6  
ATOM 9424  H HB2  . SER A 1 35  ? 4.793   -6.970  -17.792 1.00 0.00 ? 410 SER A HB2  6  
ATOM 9425  H HB3  . SER A 1 35  ? 5.834   -7.725  -16.586 1.00 0.00 ? 410 SER A HB3  6  
ATOM 9426  H HG   . SER A 1 35  ? 5.827   -9.482  -17.728 1.00 0.00 ? 410 SER A HG   6  
ATOM 9427  N N    . GLY A 1 36  ? 2.453   -5.920  -16.422 1.00 0.00 ? 411 GLY A N    6  
ATOM 9428  C CA   . GLY A 1 36  ? 1.357   -5.095  -16.893 1.00 0.00 ? 411 GLY A CA   6  
ATOM 9429  C C    . GLY A 1 36  ? 0.562   -4.484  -15.755 1.00 0.00 ? 411 GLY A C    6  
ATOM 9430  O O    . GLY A 1 36  ? 0.756   -4.841  -14.593 1.00 0.00 ? 411 GLY A O    6  
ATOM 9431  H H    . GLY A 1 36  ? 3.139   -5.531  -15.839 1.00 0.00 ? 411 GLY A H    6  
ATOM 9432  H HA2  . GLY A 1 36  ? 1.755   -4.301  -17.507 1.00 0.00 ? 411 GLY A HA2  6  
ATOM 9433  H HA3  . GLY A 1 36  ? 0.695   -5.702  -17.493 1.00 0.00 ? 411 GLY A HA3  6  
ATOM 9434  N N    . ALA A 1 37  ? -0.334  -3.561  -16.089 1.00 0.00 ? 412 ALA A N    6  
ATOM 9435  C CA   . ALA A 1 37  ? -1.159  -2.901  -15.086 1.00 0.00 ? 412 ALA A CA   6  
ATOM 9436  C C    . ALA A 1 37  ? -2.606  -3.372  -15.172 1.00 0.00 ? 412 ALA A C    6  
ATOM 9437  O O    . ALA A 1 37  ? -3.076  -3.777  -16.235 1.00 0.00 ? 412 ALA A O    6  
ATOM 9438  C CB   . ALA A 1 37  ? -1.083  -1.390  -15.249 1.00 0.00 ? 412 ALA A CB   6  
ATOM 9439  H H    . ALA A 1 37  ? -0.443  -3.319  -17.032 1.00 0.00 ? 412 ALA A H    6  
ATOM 9440  H HA   . ALA A 1 37  ? -0.766  -3.154  -14.111 1.00 0.00 ? 412 ALA A HA   6  
ATOM 9441  H HB1  . ALA A 1 37  ? -0.331  -0.994  -14.581 1.00 0.00 ? 412 ALA A HB1  6  
ATOM 9442  H HB2  . ALA A 1 37  ? -0.821  -1.151  -16.268 1.00 0.00 ? 412 ALA A HB2  6  
ATOM 9443  H HB3  . ALA A 1 37  ? -2.042  -0.953  -15.011 1.00 0.00 ? 412 ALA A HB3  6  
ATOM 9444  N N    . TYR A 1 38  ? -3.308  -3.314  -14.045 1.00 0.00 ? 413 TYR A N    6  
ATOM 9445  C CA   . TYR A 1 38  ? -4.703  -3.736  -13.993 1.00 0.00 ? 413 TYR A CA   6  
ATOM 9446  C C    . TYR A 1 38  ? -5.636  -2.556  -14.246 1.00 0.00 ? 413 TYR A C    6  
ATOM 9447  O O    . TYR A 1 38  ? -5.462  -1.480  -13.673 1.00 0.00 ? 413 TYR A O    6  
ATOM 9448  C CB   . TYR A 1 38  ? -5.013  -4.370  -12.635 1.00 0.00 ? 413 TYR A CB   6  
ATOM 9449  C CG   . TYR A 1 38  ? -6.465  -4.755  -12.455 1.00 0.00 ? 413 TYR A CG   6  
ATOM 9450  C CD1  . TYR A 1 38  ? -7.415  -3.807  -12.099 1.00 0.00 ? 413 TYR A CD1  6  
ATOM 9451  C CD2  . TYR A 1 38  ? -6.886  -6.066  -12.644 1.00 0.00 ? 413 TYR A CD2  6  
ATOM 9452  C CE1  . TYR A 1 38  ? -8.743  -4.153  -11.934 1.00 0.00 ? 413 TYR A CE1  6  
ATOM 9453  C CE2  . TYR A 1 38  ? -8.211  -6.420  -12.482 1.00 0.00 ? 413 TYR A CE2  6  
ATOM 9454  C CZ   . TYR A 1 38  ? -9.136  -5.460  -12.127 1.00 0.00 ? 413 TYR A CZ   6  
ATOM 9455  O OH   . TYR A 1 38  ? -10.457 -5.809  -11.965 1.00 0.00 ? 413 TYR A OH   6  
ATOM 9456  H H    . TYR A 1 38  ? -2.878  -2.981  -13.230 1.00 0.00 ? 413 TYR A H    6  
ATOM 9457  H HA   . TYR A 1 38  ? -4.856  -4.473  -14.767 1.00 0.00 ? 413 TYR A HA   6  
ATOM 9458  H HB2  . TYR A 1 38  ? -4.417  -5.262  -12.518 1.00 0.00 ? 413 TYR A HB2  6  
ATOM 9459  H HB3  . TYR A 1 38  ? -4.758  -3.670  -11.854 1.00 0.00 ? 413 TYR A HB3  6  
ATOM 9460  H HD1  . TYR A 1 38  ? -7.105  -2.782  -11.950 1.00 0.00 ? 413 TYR A HD1  6  
ATOM 9461  H HD2  . TYR A 1 38  ? -6.159  -6.815  -12.921 1.00 0.00 ? 413 TYR A HD2  6  
ATOM 9462  H HE1  . TYR A 1 38  ? -9.467  -3.401  -11.657 1.00 0.00 ? 413 TYR A HE1  6  
ATOM 9463  H HE2  . TYR A 1 38  ? -8.519  -7.445  -12.631 1.00 0.00 ? 413 TYR A HE2  6  
ATOM 9464  H HH   . TYR A 1 38  ? -10.984 -5.394  -12.653 1.00 0.00 ? 413 TYR A HH   6  
ATOM 9465  N N    . ILE A 1 39  ? -6.628  -2.767  -15.104 1.00 0.00 ? 414 ILE A N    6  
ATOM 9466  C CA   . ILE A 1 39  ? -7.590  -1.722  -15.431 1.00 0.00 ? 414 ILE A CA   6  
ATOM 9467  C C    . ILE A 1 39  ? -8.654  -1.600  -14.348 1.00 0.00 ? 414 ILE A C    6  
ATOM 9468  O O    . ILE A 1 39  ? -9.361  -2.560  -14.047 1.00 0.00 ? 414 ILE A O    6  
ATOM 9469  C CB   . ILE A 1 39  ? -8.277  -1.991  -16.784 1.00 0.00 ? 414 ILE A CB   6  
ATOM 9470  C CG1  . ILE A 1 39  ? -7.233  -2.282  -17.863 1.00 0.00 ? 414 ILE A CG1  6  
ATOM 9471  C CG2  . ILE A 1 39  ? -9.144  -0.806  -17.183 1.00 0.00 ? 414 ILE A CG2  6  
ATOM 9472  C CD1  . ILE A 1 39  ? -7.832  -2.604  -19.214 1.00 0.00 ? 414 ILE A CD1  6  
ATOM 9473  H H    . ILE A 1 39  ? -6.715  -3.646  -15.528 1.00 0.00 ? 414 ILE A H    6  
ATOM 9474  H HA   . ILE A 1 39  ? -7.054  -0.786  -15.504 1.00 0.00 ? 414 ILE A HA   6  
ATOM 9475  H HB   . ILE A 1 39  ? -8.917  -2.853  -16.671 1.00 0.00 ? 414 ILE A HB   6  
ATOM 9476  H HG12 . ILE A 1 39  ? -6.596  -1.418  -17.981 1.00 0.00 ? 414 ILE A HG12 6  
ATOM 9477  H HG13 . ILE A 1 39  ? -6.632  -3.127  -17.556 1.00 0.00 ? 414 ILE A HG13 6  
ATOM 9478  H HG21 . ILE A 1 39  ? -8.720  0.101   -16.780 1.00 0.00 ? 414 ILE A HG21 6  
ATOM 9479  H HG22 . ILE A 1 39  ? -9.187  -0.738  -18.259 1.00 0.00 ? 414 ILE A HG22 6  
ATOM 9480  H HG23 . ILE A 1 39  ? -10.142 -0.942  -16.791 1.00 0.00 ? 414 ILE A HG23 6  
ATOM 9481  H HD11 . ILE A 1 39  ? -7.364  -3.492  -19.613 1.00 0.00 ? 414 ILE A HD11 6  
ATOM 9482  H HD12 . ILE A 1 39  ? -8.893  -2.773  -19.105 1.00 0.00 ? 414 ILE A HD12 6  
ATOM 9483  H HD13 . ILE A 1 39  ? -7.667  -1.776  -19.887 1.00 0.00 ? 414 ILE A HD13 6  
ATOM 9484  N N    . ILE A 1 40  ? -8.765  -0.410  -13.768 1.00 0.00 ? 415 ILE A N    6  
ATOM 9485  C CA   . ILE A 1 40  ? -9.746  -0.156  -12.719 1.00 0.00 ? 415 ILE A CA   6  
ATOM 9486  C C    . ILE A 1 40  ? -11.074 0.302   -13.335 1.00 0.00 ? 415 ILE A C    6  
ATOM 9487  O O    . ILE A 1 40  ? -11.386 -0.060  -14.468 1.00 0.00 ? 415 ILE A O    6  
ATOM 9488  C CB   . ILE A 1 40  ? -9.234  0.897   -11.703 1.00 0.00 ? 415 ILE A CB   6  
ATOM 9489  C CG1  . ILE A 1 40  ? -7.704  0.850   -11.585 1.00 0.00 ? 415 ILE A CG1  6  
ATOM 9490  C CG2  . ILE A 1 40  ? -9.873  0.677   -10.338 1.00 0.00 ? 415 ILE A CG2  6  
ATOM 9491  C CD1  . ILE A 1 40  ? -7.183  -0.416  -10.937 1.00 0.00 ? 415 ILE A CD1  6  
ATOM 9492  H H    . ILE A 1 40  ? -8.175  0.317   -14.057 1.00 0.00 ? 415 ILE A H    6  
ATOM 9493  H HA   . ILE A 1 40  ? -9.911  -1.085  -12.191 1.00 0.00 ? 415 ILE A HA   6  
ATOM 9494  H HB   . ILE A 1 40  ? -9.530  1.874   -12.056 1.00 0.00 ? 415 ILE A HB   6  
ATOM 9495  H HG12 . ILE A 1 40  ? -7.268  0.920   -12.568 1.00 0.00 ? 415 ILE A HG12 6  
ATOM 9496  H HG13 . ILE A 1 40  ? -7.372  1.688   -10.989 1.00 0.00 ? 415 ILE A HG13 6  
ATOM 9497  H HG21 . ILE A 1 40  ? -10.542 -0.169  -10.385 1.00 0.00 ? 415 ILE A HG21 6  
ATOM 9498  H HG22 . ILE A 1 40  ? -9.103  0.487   -9.604  1.00 0.00 ? 415 ILE A HG22 6  
ATOM 9499  H HG23 . ILE A 1 40  ? -10.429 1.559   -10.054 1.00 0.00 ? 415 ILE A HG23 6  
ATOM 9500  H HD11 . ILE A 1 40  ? -6.988  -0.231  -9.891  1.00 0.00 ? 415 ILE A HD11 6  
ATOM 9501  H HD12 . ILE A 1 40  ? -7.919  -1.200  -11.033 1.00 0.00 ? 415 ILE A HD12 6  
ATOM 9502  H HD13 . ILE A 1 40  ? -6.268  -0.719  -11.425 1.00 0.00 ? 415 ILE A HD13 6  
ATOM 9503  N N    . GLU A 1 41  ? -11.857 1.088   -12.597 1.00 0.00 ? 416 GLU A N    6  
ATOM 9504  C CA   . GLU A 1 41  ? -13.140 1.568   -13.098 1.00 0.00 ? 416 GLU A CA   6  
ATOM 9505  C C    . GLU A 1 41  ? -12.952 2.748   -14.045 1.00 0.00 ? 416 GLU A C    6  
ATOM 9506  O O    . GLU A 1 41  ? -12.056 3.571   -13.860 1.00 0.00 ? 416 GLU A O    6  
ATOM 9507  C CB   . GLU A 1 41  ? -14.046 1.974   -11.935 1.00 0.00 ? 416 GLU A CB   6  
ATOM 9508  C CG   . GLU A 1 41  ? -13.482 3.105   -11.091 1.00 0.00 ? 416 GLU A CG   6  
ATOM 9509  C CD   . GLU A 1 41  ? -14.394 3.484   -9.942  1.00 0.00 ? 416 GLU A CD   6  
ATOM 9510  O OE1  . GLU A 1 41  ? -15.575 3.801   -10.199 1.00 0.00 ? 416 GLU A OE1  6  
ATOM 9511  O OE2  . GLU A 1 41  ? -13.929 3.465   -8.783  1.00 0.00 ? 416 GLU A OE2  6  
ATOM 9512  H H    . GLU A 1 41  ? -11.572 1.349   -11.701 1.00 0.00 ? 416 GLU A H    6  
ATOM 9513  H HA   . GLU A 1 41  ? -13.606 0.759   -13.640 1.00 0.00 ? 416 GLU A HA   6  
ATOM 9514  H HB2  . GLU A 1 41  ? -15.000 2.290   -12.331 1.00 0.00 ? 416 GLU A HB2  6  
ATOM 9515  H HB3  . GLU A 1 41  ? -14.198 1.117   -11.296 1.00 0.00 ? 416 GLU A HB3  6  
ATOM 9516  H HG2  . GLU A 1 41  ? -12.530 2.795   -10.688 1.00 0.00 ? 416 GLU A HG2  6  
ATOM 9517  H HG3  . GLU A 1 41  ? -13.341 3.970   -11.721 1.00 0.00 ? 416 GLU A HG3  6  
ATOM 9518  N N    . VAL A 1 42  ? -13.805 2.822   -15.060 1.00 0.00 ? 417 VAL A N    6  
ATOM 9519  C CA   . VAL A 1 42  ? -13.738 3.900   -16.039 1.00 0.00 ? 417 VAL A CA   6  
ATOM 9520  C C    . VAL A 1 42  ? -14.935 4.835   -15.906 1.00 0.00 ? 417 VAL A C    6  
ATOM 9521  O O    . VAL A 1 42  ? -15.967 4.461   -15.349 1.00 0.00 ? 417 VAL A O    6  
ATOM 9522  C CB   . VAL A 1 42  ? -13.695 3.351   -17.478 1.00 0.00 ? 417 VAL A CB   6  
ATOM 9523  C CG1  . VAL A 1 42  ? -13.359 4.461   -18.463 1.00 0.00 ? 417 VAL A CG1  6  
ATOM 9524  C CG2  . VAL A 1 42  ? -12.693 2.211   -17.587 1.00 0.00 ? 417 VAL A CG2  6  
ATOM 9525  H H    . VAL A 1 42  ? -14.498 2.135   -15.153 1.00 0.00 ? 417 VAL A H    6  
ATOM 9526  H HA   . VAL A 1 42  ? -12.833 4.459   -15.861 1.00 0.00 ? 417 VAL A HA   6  
ATOM 9527  H HB   . VAL A 1 42  ? -14.674 2.966   -17.725 1.00 0.00 ? 417 VAL A HB   6  
ATOM 9528  H HG11 . VAL A 1 42  ? -12.646 5.136   -18.013 1.00 0.00 ? 417 VAL A HG11 6  
ATOM 9529  H HG12 . VAL A 1 42  ? -12.934 4.032   -19.357 1.00 0.00 ? 417 VAL A HG12 6  
ATOM 9530  H HG13 . VAL A 1 42  ? -14.258 5.002   -18.715 1.00 0.00 ? 417 VAL A HG13 6  
ATOM 9531  H HG21 . VAL A 1 42  ? -11.695 2.595   -17.440 1.00 0.00 ? 417 VAL A HG21 6  
ATOM 9532  H HG22 . VAL A 1 42  ? -12.909 1.470   -16.833 1.00 0.00 ? 417 VAL A HG22 6  
ATOM 9533  H HG23 . VAL A 1 42  ? -12.766 1.760   -18.566 1.00 0.00 ? 417 VAL A HG23 6  
ATOM 9534  N N    . ILE A 1 43  ? -14.791 6.050   -16.423 1.00 0.00 ? 418 ILE A N    6  
ATOM 9535  C CA   . ILE A 1 43  ? -15.862 7.035   -16.364 1.00 0.00 ? 418 ILE A CA   6  
ATOM 9536  C C    . ILE A 1 43  ? -16.663 7.046   -17.666 1.00 0.00 ? 418 ILE A C    6  
ATOM 9537  O O    . ILE A 1 43  ? -16.088 7.005   -18.754 1.00 0.00 ? 418 ILE A O    6  
ATOM 9538  C CB   . ILE A 1 43  ? -15.310 8.451   -16.099 1.00 0.00 ? 418 ILE A CB   6  
ATOM 9539  C CG1  . ILE A 1 43  ? -14.279 8.422   -14.969 1.00 0.00 ? 418 ILE A CG1  6  
ATOM 9540  C CG2  . ILE A 1 43  ? -16.444 9.408   -15.764 1.00 0.00 ? 418 ILE A CG2  6  
ATOM 9541  C CD1  . ILE A 1 43  ? -14.847 7.962   -13.644 1.00 0.00 ? 418 ILE A CD1  6  
ATOM 9542  H H    . ILE A 1 43  ? -13.944 6.287   -16.856 1.00 0.00 ? 418 ILE A H    6  
ATOM 9543  H HA   . ILE A 1 43  ? -16.517 6.767   -15.548 1.00 0.00 ? 418 ILE A HA   6  
ATOM 9544  H HB   . ILE A 1 43  ? -14.834 8.801   -17.002 1.00 0.00 ? 418 ILE A HB   6  
ATOM 9545  H HG12 . ILE A 1 43  ? -13.479 7.749   -15.237 1.00 0.00 ? 418 ILE A HG12 6  
ATOM 9546  H HG13 . ILE A 1 43  ? -13.877 9.416   -14.832 1.00 0.00 ? 418 ILE A HG13 6  
ATOM 9547  H HG21 . ILE A 1 43  ? -17.179 9.387   -16.556 1.00 0.00 ? 418 ILE A HG21 6  
ATOM 9548  H HG22 . ILE A 1 43  ? -16.906 9.108   -14.835 1.00 0.00 ? 418 ILE A HG22 6  
ATOM 9549  H HG23 . ILE A 1 43  ? -16.052 10.410  -15.665 1.00 0.00 ? 418 ILE A HG23 6  
ATOM 9550  H HD11 . ILE A 1 43  ? -15.164 8.821   -13.071 1.00 0.00 ? 418 ILE A HD11 6  
ATOM 9551  H HD12 . ILE A 1 43  ? -15.692 7.313   -13.818 1.00 0.00 ? 418 ILE A HD12 6  
ATOM 9552  H HD13 . ILE A 1 43  ? -14.087 7.424   -13.095 1.00 0.00 ? 418 ILE A HD13 6  
ATOM 9553  N N    . PRO A 1 44  ? -18.005 7.095   -17.575 1.00 0.00 ? 419 PRO A N    6  
ATOM 9554  C CA   . PRO A 1 44  ? -18.876 7.103   -18.756 1.00 0.00 ? 419 PRO A CA   6  
ATOM 9555  C C    . PRO A 1 44  ? -18.860 8.443   -19.487 1.00 0.00 ? 419 PRO A C    6  
ATOM 9556  O O    . PRO A 1 44  ? -19.897 9.086   -19.646 1.00 0.00 ? 419 PRO A O    6  
ATOM 9557  C CB   . PRO A 1 44  ? -20.260 6.829   -18.171 1.00 0.00 ? 419 PRO A CB   6  
ATOM 9558  C CG   . PRO A 1 44  ? -20.193 7.366   -16.783 1.00 0.00 ? 419 PRO A CG   6  
ATOM 9559  C CD   . PRO A 1 44  ? -18.779 7.140   -16.318 1.00 0.00 ? 419 PRO A CD   6  
ATOM 9560  H HA   . PRO A 1 44  ? -18.613 6.316   -19.447 1.00 0.00 ? 419 PRO A HA   6  
ATOM 9561  H HB2  . PRO A 1 44  ? -21.011 7.340   -18.757 1.00 0.00 ? 419 PRO A HB2  6  
ATOM 9562  H HB3  . PRO A 1 44  ? -20.454 5.767   -18.173 1.00 0.00 ? 419 PRO A HB3  6  
ATOM 9563  H HG2  . PRO A 1 44  ? -20.422 8.422   -16.787 1.00 0.00 ? 419 PRO A HG2  6  
ATOM 9564  H HG3  . PRO A 1 44  ? -20.885 6.833   -16.148 1.00 0.00 ? 419 PRO A HG3  6  
ATOM 9565  H HD2  . PRO A 1 44  ? -18.453 7.958   -15.694 1.00 0.00 ? 419 PRO A HD2  6  
ATOM 9566  H HD3  . PRO A 1 44  ? -18.702 6.203   -15.787 1.00 0.00 ? 419 PRO A HD3  6  
ATOM 9567  N N    . ASP A 1 45  ? -17.676 8.855   -19.933 1.00 0.00 ? 420 ASP A N    6  
ATOM 9568  C CA   . ASP A 1 45  ? -17.516 10.116  -20.651 1.00 0.00 ? 420 ASP A CA   6  
ATOM 9569  C C    . ASP A 1 45  ? -16.040 10.391  -20.931 1.00 0.00 ? 420 ASP A C    6  
ATOM 9570  O O    . ASP A 1 45  ? -15.556 11.506  -20.739 1.00 0.00 ? 420 ASP A O    6  
ATOM 9571  C CB   . ASP A 1 45  ? -18.123 11.273  -19.849 1.00 0.00 ? 420 ASP A CB   6  
ATOM 9572  C CG   . ASP A 1 45  ? -19.500 11.666  -20.353 1.00 0.00 ? 420 ASP A CG   6  
ATOM 9573  O OD1  . ASP A 1 45  ? -19.760 11.494  -21.562 1.00 0.00 ? 420 ASP A OD1  6  
ATOM 9574  O OD2  . ASP A 1 45  ? -20.315 12.145  -19.538 1.00 0.00 ? 420 ASP A OD2  6  
ATOM 9575  H H    . ASP A 1 45  ? -16.888 8.295   -19.776 1.00 0.00 ? 420 ASP A H    6  
ATOM 9576  H HA   . ASP A 1 45  ? -18.038 10.029  -21.593 1.00 0.00 ? 420 ASP A HA   6  
ATOM 9577  H HB2  . ASP A 1 45  ? -18.212 10.978  -18.814 1.00 0.00 ? 420 ASP A HB2  6  
ATOM 9578  H HB3  . ASP A 1 45  ? -17.476 12.134  -19.918 1.00 0.00 ? 420 ASP A HB3  6  
ATOM 9579  N N    . THR A 1 46  ? -15.330 9.362   -21.380 1.00 0.00 ? 421 THR A N    6  
ATOM 9580  C CA   . THR A 1 46  ? -13.907 9.488   -21.682 1.00 0.00 ? 421 THR A CA   6  
ATOM 9581  C C    . THR A 1 46  ? -13.502 8.510   -22.783 1.00 0.00 ? 421 THR A C    6  
ATOM 9582  O O    . THR A 1 46  ? -14.300 7.666   -23.196 1.00 0.00 ? 421 THR A O    6  
ATOM 9583  C CB   . THR A 1 46  ? -13.066 9.239   -20.420 1.00 0.00 ? 421 THR A CB   6  
ATOM 9584  O OG1  . THR A 1 46  ? -12.578 7.909   -20.389 1.00 0.00 ? 421 THR A OG1  6  
ATOM 9585  C CG2  . THR A 1 46  ? -13.820 9.473   -19.127 1.00 0.00 ? 421 THR A CG2  6  
ATOM 9586  H H    . THR A 1 46  ? -15.771 8.496   -21.509 1.00 0.00 ? 421 THR A H    6  
ATOM 9587  H HA   . THR A 1 46  ? -13.730 10.495  -22.029 1.00 0.00 ? 421 THR A HA   6  
ATOM 9588  H HB   . THR A 1 46  ? -12.220 9.910   -20.430 1.00 0.00 ? 421 THR A HB   6  
ATOM 9589  H HG1  . THR A 1 46  ? -12.052 7.779   -19.597 1.00 0.00 ? 421 THR A HG1  6  
ATOM 9590  H HG21 . THR A 1 46  ? -14.796 9.018   -19.192 1.00 0.00 ? 421 THR A HG21 6  
ATOM 9591  H HG22 . THR A 1 46  ? -13.274 9.032   -18.309 1.00 0.00 ? 421 THR A HG22 6  
ATOM 9592  H HG23 . THR A 1 46  ? -13.927 10.534  -18.960 1.00 0.00 ? 421 THR A HG23 6  
ATOM 9593  N N    . PRO A 1 47  ? -12.253 8.602   -23.273 1.00 0.00 ? 422 PRO A N    6  
ATOM 9594  C CA   . PRO A 1 47  ? -11.758 7.713   -24.323 1.00 0.00 ? 422 PRO A CA   6  
ATOM 9595  C C    . PRO A 1 47  ? -11.423 6.324   -23.788 1.00 0.00 ? 422 PRO A C    6  
ATOM 9596  O O    . PRO A 1 47  ? -11.288 5.371   -24.553 1.00 0.00 ? 422 PRO A O    6  
ATOM 9597  C CB   . PRO A 1 47  ? -10.500 8.422   -24.821 1.00 0.00 ? 422 PRO A CB   6  
ATOM 9598  C CG   . PRO A 1 47  ? -10.011 9.202   -23.649 1.00 0.00 ? 422 PRO A CG   6  
ATOM 9599  C CD   . PRO A 1 47  ? -11.228 9.571   -22.838 1.00 0.00 ? 422 PRO A CD   6  
ATOM 9600  H HA   . PRO A 1 47  ? -12.469 7.623   -25.131 1.00 0.00 ? 422 PRO A HA   6  
ATOM 9601  H HB2  . PRO A 1 47  ? -9.773  7.689   -25.139 1.00 0.00 ? 422 PRO A HB2  6  
ATOM 9602  H HB3  . PRO A 1 47  ? -10.751 9.069   -25.647 1.00 0.00 ? 422 PRO A HB3  6  
ATOM 9603  H HG2  . PRO A 1 47  ? -9.341  8.594   -23.059 1.00 0.00 ? 422 PRO A HG2  6  
ATOM 9604  H HG3  . PRO A 1 47  ? -9.505  10.093  -23.989 1.00 0.00 ? 422 PRO A HG3  6  
ATOM 9605  H HD2  . PRO A 1 47  ? -11.019 9.463   -21.786 1.00 0.00 ? 422 PRO A HD2  6  
ATOM 9606  H HD3  . PRO A 1 47  ? -11.536 10.582  -23.060 1.00 0.00 ? 422 PRO A HD3  6  
ATOM 9607  N N    . ALA A 1 48  ? -11.297 6.216   -22.467 1.00 0.00 ? 423 ALA A N    6  
ATOM 9608  C CA   . ALA A 1 48  ? -10.988 4.942   -21.832 1.00 0.00 ? 423 ALA A CA   6  
ATOM 9609  C C    . ALA A 1 48  ? -12.072 3.911   -22.126 1.00 0.00 ? 423 ALA A C    6  
ATOM 9610  O O    . ALA A 1 48  ? -11.806 2.863   -22.716 1.00 0.00 ? 423 ALA A O    6  
ATOM 9611  C CB   . ALA A 1 48  ? -10.829 5.132   -20.330 1.00 0.00 ? 423 ALA A CB   6  
ATOM 9612  H H    . ALA A 1 48  ? -11.418 7.009   -21.907 1.00 0.00 ? 423 ALA A H    6  
ATOM 9613  H HA   . ALA A 1 48  ? -10.047 4.589   -22.229 1.00 0.00 ? 423 ALA A HA   6  
ATOM 9614  H HB1  . ALA A 1 48  ? -9.920  5.682   -20.131 1.00 0.00 ? 423 ALA A HB1  6  
ATOM 9615  H HB2  . ALA A 1 48  ? -11.674 5.684   -19.946 1.00 0.00 ? 423 ALA A HB2  6  
ATOM 9616  H HB3  . ALA A 1 48  ? -10.780 4.168   -19.848 1.00 0.00 ? 423 ALA A HB3  6  
ATOM 9617  N N    . GLU A 1 49  ? -13.296 4.217   -21.714 1.00 0.00 ? 424 GLU A N    6  
ATOM 9618  C CA   . GLU A 1 49  ? -14.423 3.320   -21.939 1.00 0.00 ? 424 GLU A CA   6  
ATOM 9619  C C    . GLU A 1 49  ? -14.857 3.345   -23.401 1.00 0.00 ? 424 GLU A C    6  
ATOM 9620  O O    . GLU A 1 49  ? -15.471 2.399   -23.894 1.00 0.00 ? 424 GLU A O    6  
ATOM 9621  C CB   . GLU A 1 49  ? -15.598 3.709   -21.039 1.00 0.00 ? 424 GLU A CB   6  
ATOM 9622  C CG   . GLU A 1 49  ? -16.700 2.664   -20.992 1.00 0.00 ? 424 GLU A CG   6  
ATOM 9623  C CD   . GLU A 1 49  ? -16.408 1.555   -20.000 1.00 0.00 ? 424 GLU A CD   6  
ATOM 9624  O OE1  . GLU A 1 49  ? -16.306 1.851   -18.792 1.00 0.00 ? 424 GLU A OE1  6  
ATOM 9625  O OE2  . GLU A 1 49  ? -16.282 0.390   -20.433 1.00 0.00 ? 424 GLU A OE2  6  
ATOM 9626  H H    . GLU A 1 49  ? -13.447 5.069   -21.254 1.00 0.00 ? 424 GLU A H    6  
ATOM 9627  H HA   . GLU A 1 49  ? -14.105 2.319   -21.687 1.00 0.00 ? 424 GLU A HA   6  
ATOM 9628  H HB2  . GLU A 1 49  ? -15.233 3.862   -20.034 1.00 0.00 ? 424 GLU A HB2  6  
ATOM 9629  H HB3  . GLU A 1 49  ? -16.023 4.634   -21.403 1.00 0.00 ? 424 GLU A HB3  6  
ATOM 9630  H HG2  . GLU A 1 49  ? -17.624 3.146   -20.709 1.00 0.00 ? 424 GLU A HG2  6  
ATOM 9631  H HG3  . GLU A 1 49  ? -16.809 2.229   -21.975 1.00 0.00 ? 424 GLU A HG3  6  
ATOM 9632  N N    . ALA A 1 50  ? -14.535 4.436   -24.092 1.00 0.00 ? 425 ALA A N    6  
ATOM 9633  C CA   . ALA A 1 50  ? -14.893 4.585   -25.497 1.00 0.00 ? 425 ALA A CA   6  
ATOM 9634  C C    . ALA A 1 50  ? -13.896 3.868   -26.404 1.00 0.00 ? 425 ALA A C    6  
ATOM 9635  O O    . ALA A 1 50  ? -14.236 3.466   -27.517 1.00 0.00 ? 425 ALA A O    6  
ATOM 9636  C CB   . ALA A 1 50  ? -14.976 6.058   -25.865 1.00 0.00 ? 425 ALA A CB   6  
ATOM 9637  H H    . ALA A 1 50  ? -14.047 5.159   -23.645 1.00 0.00 ? 425 ALA A H    6  
ATOM 9638  H HA   . ALA A 1 50  ? -15.870 4.149   -25.640 1.00 0.00 ? 425 ALA A HA   6  
ATOM 9639  H HB1  . ALA A 1 50  ? -15.426 6.161   -26.840 1.00 0.00 ? 425 ALA A HB1  6  
ATOM 9640  H HB2  . ALA A 1 50  ? -15.578 6.579   -25.134 1.00 0.00 ? 425 ALA A HB2  6  
ATOM 9641  H HB3  . ALA A 1 50  ? -13.983 6.482   -25.880 1.00 0.00 ? 425 ALA A HB3  6  
ATOM 9642  N N    . GLY A 1 51  ? -12.665 3.712   -25.926 1.00 0.00 ? 426 GLY A N    6  
ATOM 9643  C CA   . GLY A 1 51  ? -11.646 3.046   -26.712 1.00 0.00 ? 426 GLY A CA   6  
ATOM 9644  C C    . GLY A 1 51  ? -11.822 1.542   -26.732 1.00 0.00 ? 426 GLY A C    6  
ATOM 9645  O O    . GLY A 1 51  ? -12.181 0.966   -27.759 1.00 0.00 ? 426 GLY A O    6  
ATOM 9646  H H    . GLY A 1 51  ? -12.448 4.053   -25.032 1.00 0.00 ? 426 GLY A H    6  
ATOM 9647  H HA2  . GLY A 1 51  ? -11.689 3.416   -27.726 1.00 0.00 ? 426 GLY A HA2  6  
ATOM 9648  H HA3  . GLY A 1 51  ? -10.675 3.278   -26.296 1.00 0.00 ? 426 GLY A HA3  6  
ATOM 9649  N N    . GLY A 1 52  ? -11.574 0.904   -25.593 1.00 0.00 ? 427 GLY A N    6  
ATOM 9650  C CA   . GLY A 1 52  ? -11.717 -0.536  -25.506 1.00 0.00 ? 427 GLY A CA   6  
ATOM 9651  C C    . GLY A 1 52  ? -11.199 -1.105  -24.199 1.00 0.00 ? 427 GLY A C    6  
ATOM 9652  O O    . GLY A 1 52  ? -10.728 -2.242  -24.157 1.00 0.00 ? 427 GLY A O    6  
ATOM 9653  H H    . GLY A 1 52  ? -11.292 1.417   -24.808 1.00 0.00 ? 427 GLY A H    6  
ATOM 9654  H HA2  . GLY A 1 52  ? -12.763 -0.787  -25.604 1.00 0.00 ? 427 GLY A HA2  6  
ATOM 9655  H HA3  . GLY A 1 52  ? -11.174 -0.989  -26.322 1.00 0.00 ? 427 GLY A HA3  6  
ATOM 9656  N N    . LEU A 1 53  ? -11.284 -0.321  -23.127 1.00 0.00 ? 428 LEU A N    6  
ATOM 9657  C CA   . LEU A 1 53  ? -10.818 -0.766  -21.822 1.00 0.00 ? 428 LEU A CA   6  
ATOM 9658  C C    . LEU A 1 53  ? -11.998 -1.051  -20.898 1.00 0.00 ? 428 LEU A C    6  
ATOM 9659  O O    . LEU A 1 53  ? -13.151 -0.824  -21.262 1.00 0.00 ? 428 LEU A O    6  
ATOM 9660  C CB   . LEU A 1 53  ? -9.906  0.290   -21.188 1.00 0.00 ? 428 LEU A CB   6  
ATOM 9661  C CG   . LEU A 1 53  ? -9.297  1.305   -22.158 1.00 0.00 ? 428 LEU A CG   6  
ATOM 9662  C CD1  . LEU A 1 53  ? -8.764  2.508   -21.398 1.00 0.00 ? 428 LEU A CD1  6  
ATOM 9663  C CD2  . LEU A 1 53  ? -8.196  0.661   -22.985 1.00 0.00 ? 428 LEU A CD2  6  
ATOM 9664  H H    . LEU A 1 53  ? -11.667 0.575   -23.214 1.00 0.00 ? 428 LEU A H    6  
ATOM 9665  H HA   . LEU A 1 53  ? -10.257 -1.677  -21.962 1.00 0.00 ? 428 LEU A HA   6  
ATOM 9666  H HB2  . LEU A 1 53  ? -10.477 0.831   -20.448 1.00 0.00 ? 428 LEU A HB2  6  
ATOM 9667  H HB3  . LEU A 1 53  ? -9.102  -0.221  -20.691 1.00 0.00 ? 428 LEU A HB3  6  
ATOM 9668  H HG   . LEU A 1 53  ? -10.062 1.651   -22.835 1.00 0.00 ? 428 LEU A HG   6  
ATOM 9669  H HD11 . LEU A 1 53  ? -8.142  2.170   -20.582 1.00 0.00 ? 428 LEU A HD11 6  
ATOM 9670  H HD12 . LEU A 1 53  ? -8.182  3.126   -22.063 1.00 0.00 ? 428 LEU A HD12 6  
ATOM 9671  H HD13 . LEU A 1 53  ? -9.591  3.080   -21.006 1.00 0.00 ? 428 LEU A HD13 6  
ATOM 9672  H HD21 . LEU A 1 53  ? -7.253  0.757   -22.465 1.00 0.00 ? 428 LEU A HD21 6  
ATOM 9673  H HD22 . LEU A 1 53  ? -8.422  -0.384  -23.133 1.00 0.00 ? 428 LEU A HD22 6  
ATOM 9674  H HD23 . LEU A 1 53  ? -8.130  1.156   -23.943 1.00 0.00 ? 428 LEU A HD23 6  
ATOM 9675  N N    . LYS A 1 54  ? -11.700 -1.544  -19.700 1.00 0.00 ? 429 LYS A N    6  
ATOM 9676  C CA   . LYS A 1 54  ? -12.739 -1.855  -18.725 1.00 0.00 ? 429 LYS A CA   6  
ATOM 9677  C C    . LYS A 1 54  ? -12.133 -2.405  -17.437 1.00 0.00 ? 429 LYS A C    6  
ATOM 9678  O O    . LYS A 1 54  ? -11.012 -2.912  -17.433 1.00 0.00 ? 429 LYS A O    6  
ATOM 9679  C CB   . LYS A 1 54  ? -13.735 -2.860  -19.308 1.00 0.00 ? 429 LYS A CB   6  
ATOM 9680  C CG   . LYS A 1 54  ? -15.187 -2.438  -19.150 1.00 0.00 ? 429 LYS A CG   6  
ATOM 9681  C CD   . LYS A 1 54  ? -15.832 -3.100  -17.942 1.00 0.00 ? 429 LYS A CD   6  
ATOM 9682  C CE   . LYS A 1 54  ? -16.711 -2.125  -17.175 1.00 0.00 ? 429 LYS A CE   6  
ATOM 9683  N NZ   . LYS A 1 54  ? -17.979 -2.761  -16.720 1.00 0.00 ? 429 LYS A NZ   6  
ATOM 9684  H H    . LYS A 1 54  ? -10.762 -1.700  -19.466 1.00 0.00 ? 429 LYS A H    6  
ATOM 9685  H HA   . LYS A 1 54  ? -13.260 -0.936  -18.498 1.00 0.00 ? 429 LYS A HA   6  
ATOM 9686  H HB2  . LYS A 1 54  ? -13.531 -2.981  -20.362 1.00 0.00 ? 429 LYS A HB2  6  
ATOM 9687  H HB3  . LYS A 1 54  ? -13.604 -3.811  -18.815 1.00 0.00 ? 429 LYS A HB3  6  
ATOM 9688  H HG2  . LYS A 1 54  ? -15.229 -1.366  -19.026 1.00 0.00 ? 429 LYS A HG2  6  
ATOM 9689  H HG3  . LYS A 1 54  ? -15.732 -2.721  -20.038 1.00 0.00 ? 429 LYS A HG3  6  
ATOM 9690  H HD2  . LYS A 1 54  ? -16.438 -3.927  -18.278 1.00 0.00 ? 429 LYS A HD2  6  
ATOM 9691  H HD3  . LYS A 1 54  ? -15.055 -3.464  -17.285 1.00 0.00 ? 429 LYS A HD3  6  
ATOM 9692  H HE2  . LYS A 1 54  ? -16.167 -1.771  -16.312 1.00 0.00 ? 429 LYS A HE2  6  
ATOM 9693  H HE3  . LYS A 1 54  ? -16.948 -1.290  -17.819 1.00 0.00 ? 429 LYS A HE3  6  
ATOM 9694  H HZ1  . LYS A 1 54  ? -18.756 -2.070  -16.749 1.00 0.00 ? 429 LYS A HZ1  6  
ATOM 9695  H HZ2  . LYS A 1 54  ? -18.219 -3.562  -17.339 1.00 0.00 ? 429 LYS A HZ2  6  
ATOM 9696  H HZ3  . LYS A 1 54  ? -17.874 -3.108  -15.745 1.00 0.00 ? 429 LYS A HZ3  6  
ATOM 9697  N N    . GLU A 1 55  ? -12.883 -2.300  -16.345 1.00 0.00 ? 430 GLU A N    6  
ATOM 9698  C CA   . GLU A 1 55  ? -12.422 -2.786  -15.050 1.00 0.00 ? 430 GLU A CA   6  
ATOM 9699  C C    . GLU A 1 55  ? -12.402 -4.311  -15.013 1.00 0.00 ? 430 GLU A C    6  
ATOM 9700  O O    . GLU A 1 55  ? -13.288 -4.939  -14.432 1.00 0.00 ? 430 GLU A O    6  
ATOM 9701  C CB   . GLU A 1 55  ? -13.317 -2.249  -13.932 1.00 0.00 ? 430 GLU A CB   6  
ATOM 9702  C CG   . GLU A 1 55  ? -14.784 -2.610  -14.102 1.00 0.00 ? 430 GLU A CG   6  
ATOM 9703  C CD   . GLU A 1 55  ? -15.426 -3.070  -12.808 1.00 0.00 ? 430 GLU A CD   6  
ATOM 9704  O OE1  . GLU A 1 55  ? -15.140 -2.462  -11.755 1.00 0.00 ? 430 GLU A OE1  6  
ATOM 9705  O OE2  . GLU A 1 55  ? -16.215 -4.037  -12.847 1.00 0.00 ? 430 GLU A OE2  6  
ATOM 9706  H H    . GLU A 1 55  ? -13.769 -1.885  -16.412 1.00 0.00 ? 430 GLU A H    6  
ATOM 9707  H HA   . GLU A 1 55  ? -11.417 -2.422  -14.899 1.00 0.00 ? 430 GLU A HA   6  
ATOM 9708  H HB2  . GLU A 1 55  ? -12.977 -2.650  -12.990 1.00 0.00 ? 430 GLU A HB2  6  
ATOM 9709  H HB3  . GLU A 1 55  ? -13.235 -1.172  -13.907 1.00 0.00 ? 430 GLU A HB3  6  
ATOM 9710  H HG2  . GLU A 1 55  ? -15.316 -1.741  -14.459 1.00 0.00 ? 430 GLU A HG2  6  
ATOM 9711  H HG3  . GLU A 1 55  ? -14.864 -3.404  -14.830 1.00 0.00 ? 430 GLU A HG3  6  
ATOM 9712  N N    . ASN A 1 56  ? -11.387 -4.901  -15.635 1.00 0.00 ? 431 ASN A N    6  
ATOM 9713  C CA   . ASN A 1 56  ? -11.253 -6.353  -15.672 1.00 0.00 ? 431 ASN A CA   6  
ATOM 9714  C C    . ASN A 1 56  ? -10.019 -6.769  -16.469 1.00 0.00 ? 431 ASN A C    6  
ATOM 9715  O O    . ASN A 1 56  ? -9.293  -7.682  -16.078 1.00 0.00 ? 431 ASN A O    6  
ATOM 9716  C CB   . ASN A 1 56  ? -12.506 -6.989  -16.282 1.00 0.00 ? 431 ASN A CB   6  
ATOM 9717  C CG   . ASN A 1 56  ? -13.185 -7.955  -15.333 1.00 0.00 ? 431 ASN A CG   6  
ATOM 9718  O OD1  . ASN A 1 56  ? -12.826 -9.131  -15.262 1.00 0.00 ? 431 ASN A OD1  6  
ATOM 9719  N ND2  . ASN A 1 56  ? -14.175 -7.464  -14.597 1.00 0.00 ? 431 ASN A ND2  6  
ATOM 9720  H H    . ASN A 1 56  ? -10.711 -4.347  -16.079 1.00 0.00 ? 431 ASN A H    6  
ATOM 9721  H HA   . ASN A 1 56  ? -11.143 -6.702  -14.656 1.00 0.00 ? 431 ASN A HA   6  
ATOM 9722  H HB2  . ASN A 1 56  ? -13.209 -6.210  -16.536 1.00 0.00 ? 431 ASN A HB2  6  
ATOM 9723  H HB3  . ASN A 1 56  ? -12.232 -7.526  -17.179 1.00 0.00 ? 431 ASN A HB3  6  
ATOM 9724  H HD21 . ASN A 1 56  ? -14.408 -6.518  -14.707 1.00 0.00 ? 431 ASN A HD21 6  
ATOM 9725  H HD22 . ASN A 1 56  ? -14.632 -8.067  -13.974 1.00 0.00 ? 431 ASN A HD22 6  
ATOM 9726  N N    . ASP A 1 57  ? -9.791  -6.092  -17.590 1.00 0.00 ? 432 ASP A N    6  
ATOM 9727  C CA   . ASP A 1 57  ? -8.648  -6.392  -18.444 1.00 0.00 ? 432 ASP A CA   6  
ATOM 9728  C C    . ASP A 1 57  ? -7.346  -5.926  -17.798 1.00 0.00 ? 432 ASP A C    6  
ATOM 9729  O O    . ASP A 1 57  ? -7.351  -5.366  -16.702 1.00 0.00 ? 432 ASP A O    6  
ATOM 9730  C CB   . ASP A 1 57  ? -8.819  -5.728  -19.811 1.00 0.00 ? 432 ASP A CB   6  
ATOM 9731  C CG   . ASP A 1 57  ? -9.878  -6.410  -20.656 1.00 0.00 ? 432 ASP A CG   6  
ATOM 9732  O OD1  . ASP A 1 57  ? -9.629  -7.541  -21.121 1.00 0.00 ? 432 ASP A OD1  6  
ATOM 9733  O OD2  . ASP A 1 57  ? -10.957 -5.811  -20.851 1.00 0.00 ? 432 ASP A OD2  6  
ATOM 9734  H H    . ASP A 1 57  ? -10.408 -5.377  -17.851 1.00 0.00 ? 432 ASP A H    6  
ATOM 9735  H HA   . ASP A 1 57  ? -8.606  -7.462  -18.577 1.00 0.00 ? 432 ASP A HA   6  
ATOM 9736  H HB2  . ASP A 1 57  ? -9.106  -4.697  -19.672 1.00 0.00 ? 432 ASP A HB2  6  
ATOM 9737  H HB3  . ASP A 1 57  ? -7.880  -5.768  -20.343 1.00 0.00 ? 432 ASP A HB3  6  
ATOM 9738  N N    . VAL A 1 58  ? -6.234  -6.162  -18.485 1.00 0.00 ? 433 VAL A N    6  
ATOM 9739  C CA   . VAL A 1 58  ? -4.924  -5.767  -17.981 1.00 0.00 ? 433 VAL A CA   6  
ATOM 9740  C C    . VAL A 1 58  ? -4.048  -5.213  -19.099 1.00 0.00 ? 433 VAL A C    6  
ATOM 9741  O O    . VAL A 1 58  ? -3.925  -5.820  -20.163 1.00 0.00 ? 433 VAL A O    6  
ATOM 9742  C CB   . VAL A 1 58  ? -4.197  -6.952  -17.316 1.00 0.00 ? 433 VAL A CB   6  
ATOM 9743  C CG1  . VAL A 1 58  ? -2.918  -6.484  -16.639 1.00 0.00 ? 433 VAL A CG1  6  
ATOM 9744  C CG2  . VAL A 1 58  ? -5.112  -7.648  -16.320 1.00 0.00 ? 433 VAL A CG2  6  
ATOM 9745  H H    . VAL A 1 58  ? -6.295  -6.612  -19.354 1.00 0.00 ? 433 VAL A H    6  
ATOM 9746  H HA   . VAL A 1 58  ? -5.070  -4.998  -17.237 1.00 0.00 ? 433 VAL A HA   6  
ATOM 9747  H HB   . VAL A 1 58  ? -3.931  -7.662  -18.085 1.00 0.00 ? 433 VAL A HB   6  
ATOM 9748  H HG11 . VAL A 1 58  ? -2.463  -5.704  -17.231 1.00 0.00 ? 433 VAL A HG11 6  
ATOM 9749  H HG12 . VAL A 1 58  ? -3.150  -6.102  -15.657 1.00 0.00 ? 433 VAL A HG12 6  
ATOM 9750  H HG13 . VAL A 1 58  ? -2.233  -7.314  -16.550 1.00 0.00 ? 433 VAL A HG13 6  
ATOM 9751  H HG21 . VAL A 1 58  ? -4.516  -8.128  -15.557 1.00 0.00 ? 433 VAL A HG21 6  
ATOM 9752  H HG22 . VAL A 1 58  ? -5.766  -6.920  -15.861 1.00 0.00 ? 433 VAL A HG22 6  
ATOM 9753  H HG23 . VAL A 1 58  ? -5.705  -8.390  -16.834 1.00 0.00 ? 433 VAL A HG23 6  
ATOM 9754  N N    . ILE A 1 59  ? -3.442  -4.056  -18.852 1.00 0.00 ? 434 ILE A N    6  
ATOM 9755  C CA   . ILE A 1 59  ? -2.576  -3.419  -19.839 1.00 0.00 ? 434 ILE A CA   6  
ATOM 9756  C C    . ILE A 1 59  ? -1.150  -3.951  -19.743 1.00 0.00 ? 434 ILE A C    6  
ATOM 9757  O O    . ILE A 1 59  ? -0.665  -4.262  -18.655 1.00 0.00 ? 434 ILE A O    6  
ATOM 9758  C CB   . ILE A 1 59  ? -2.555  -1.888  -19.662 1.00 0.00 ? 434 ILE A CB   6  
ATOM 9759  C CG1  . ILE A 1 59  ? -3.982  -1.341  -19.566 1.00 0.00 ? 434 ILE A CG1  6  
ATOM 9760  C CG2  . ILE A 1 59  ? -1.805  -1.233  -20.813 1.00 0.00 ? 434 ILE A CG2  6  
ATOM 9761  C CD1  . ILE A 1 59  ? -4.186  -0.386  -18.410 1.00 0.00 ? 434 ILE A CD1  6  
ATOM 9762  H H    . ILE A 1 59  ? -3.579  -3.620  -17.985 1.00 0.00 ? 434 ILE A H    6  
ATOM 9763  H HA   . ILE A 1 59  ? -2.969  -3.641  -20.821 1.00 0.00 ? 434 ILE A HA   6  
ATOM 9764  H HB   . ILE A 1 59  ? -2.029  -1.661  -18.748 1.00 0.00 ? 434 ILE A HB   6  
ATOM 9765  H HG12 . ILE A 1 59  ? -4.221  -0.812  -20.477 1.00 0.00 ? 434 ILE A HG12 6  
ATOM 9766  H HG13 . ILE A 1 59  ? -4.671  -2.164  -19.442 1.00 0.00 ? 434 ILE A HG13 6  
ATOM 9767  H HG21 . ILE A 1 59  ? -1.849  -1.874  -21.682 1.00 0.00 ? 434 ILE A HG21 6  
ATOM 9768  H HG22 . ILE A 1 59  ? -2.261  -0.282  -21.044 1.00 0.00 ? 434 ILE A HG22 6  
ATOM 9769  H HG23 . ILE A 1 59  ? -0.774  -1.079  -20.530 1.00 0.00 ? 434 ILE A HG23 6  
ATOM 9770  H HD11 . ILE A 1 59  ? -4.566  -0.930  -17.558 1.00 0.00 ? 434 ILE A HD11 6  
ATOM 9771  H HD12 . ILE A 1 59  ? -3.243  0.074   -18.152 1.00 0.00 ? 434 ILE A HD12 6  
ATOM 9772  H HD13 . ILE A 1 59  ? -4.894  0.378   -18.695 1.00 0.00 ? 434 ILE A HD13 6  
ATOM 9773  N N    . ILE A 1 60  ? -0.482  -4.052  -20.888 1.00 0.00 ? 435 ILE A N    6  
ATOM 9774  C CA   . ILE A 1 60  ? 0.889   -4.547  -20.932 1.00 0.00 ? 435 ILE A CA   6  
ATOM 9775  C C    . ILE A 1 60  ? 1.728   -3.760  -21.934 1.00 0.00 ? 435 ILE A C    6  
ATOM 9776  O O    . ILE A 1 60  ? 2.832   -3.317  -21.619 1.00 0.00 ? 435 ILE A O    6  
ATOM 9777  C CB   . ILE A 1 60  ? 0.938   -6.044  -21.301 1.00 0.00 ? 435 ILE A CB   6  
ATOM 9778  C CG1  . ILE A 1 60  ? 0.084   -6.317  -22.543 1.00 0.00 ? 435 ILE A CG1  6  
ATOM 9779  C CG2  . ILE A 1 60  ? 0.471   -6.896  -20.130 1.00 0.00 ? 435 ILE A CG2  6  
ATOM 9780  C CD1  . ILE A 1 60  ? 0.879   -6.344  -23.830 1.00 0.00 ? 435 ILE A CD1  6  
ATOM 9781  H H    . ILE A 1 60  ? -0.922  -3.788  -21.723 1.00 0.00 ? 435 ILE A H    6  
ATOM 9782  H HA   . ILE A 1 60  ? 1.317   -4.427  -19.947 1.00 0.00 ? 435 ILE A HA   6  
ATOM 9783  H HB   . ILE A 1 60  ? 1.964   -6.304  -21.515 1.00 0.00 ? 435 ILE A HB   6  
ATOM 9784  H HG12 . ILE A 1 60  ? -0.400  -7.277  -22.434 1.00 0.00 ? 435 ILE A HG12 6  
ATOM 9785  H HG13 . ILE A 1 60  ? -0.669  -5.548  -22.633 1.00 0.00 ? 435 ILE A HG13 6  
ATOM 9786  H HG21 . ILE A 1 60  ? -0.009  -6.266  -19.395 1.00 0.00 ? 435 ILE A HG21 6  
ATOM 9787  H HG22 . ILE A 1 60  ? -0.231  -7.638  -20.480 1.00 0.00 ? 435 ILE A HG22 6  
ATOM 9788  H HG23 . ILE A 1 60  ? 1.322   -7.389  -19.682 1.00 0.00 ? 435 ILE A HG23 6  
ATOM 9789  H HD11 . ILE A 1 60  ? 0.466   -5.625  -24.523 1.00 0.00 ? 435 ILE A HD11 6  
ATOM 9790  H HD12 . ILE A 1 60  ? 1.909   -6.093  -23.623 1.00 0.00 ? 435 ILE A HD12 6  
ATOM 9791  H HD13 . ILE A 1 60  ? 0.829   -7.332  -24.264 1.00 0.00 ? 435 ILE A HD13 6  
ATOM 9792  N N    . SER A 1 61  ? 1.198   -3.590  -23.141 1.00 0.00 ? 436 SER A N    6  
ATOM 9793  C CA   . SER A 1 61  ? 1.902   -2.855  -24.186 1.00 0.00 ? 436 SER A CA   6  
ATOM 9794  C C    . SER A 1 61  ? 1.216   -1.522  -24.467 1.00 0.00 ? 436 SER A C    6  
ATOM 9795  O O    . SER A 1 61  ? 0.038   -1.344  -24.163 1.00 0.00 ? 436 SER A O    6  
ATOM 9796  C CB   . SER A 1 61  ? 1.969   -3.688  -25.468 1.00 0.00 ? 436 SER A CB   6  
ATOM 9797  O OG   . SER A 1 61  ? 0.755   -3.604  -26.195 1.00 0.00 ? 436 SER A OG   6  
ATOM 9798  H H    . SER A 1 61  ? 0.314   -3.966  -23.332 1.00 0.00 ? 436 SER A H    6  
ATOM 9799  H HA   . SER A 1 61  ? 2.905   -2.664  -23.838 1.00 0.00 ? 436 SER A HA   6  
ATOM 9800  H HB2  . SER A 1 61  ? 2.771   -3.321  -26.090 1.00 0.00 ? 436 SER A HB2  6  
ATOM 9801  H HB3  . SER A 1 61  ? 2.153   -4.720  -25.215 1.00 0.00 ? 436 SER A HB3  6  
ATOM 9802  H HG   . SER A 1 61  ? 0.068   -4.085  -25.728 1.00 0.00 ? 436 SER A HG   6  
ATOM 9803  N N    . ILE A 1 62  ? 1.962   -0.589  -25.050 1.00 0.00 ? 437 ILE A N    6  
ATOM 9804  C CA   . ILE A 1 62  ? 1.424   0.726   -25.371 1.00 0.00 ? 437 ILE A CA   6  
ATOM 9805  C C    . ILE A 1 62  ? 2.243   1.408   -26.464 1.00 0.00 ? 437 ILE A C    6  
ATOM 9806  O O    . ILE A 1 62  ? 3.421   1.706   -26.276 1.00 0.00 ? 437 ILE A O    6  
ATOM 9807  C CB   . ILE A 1 62  ? 1.377   1.633   -24.123 1.00 0.00 ? 437 ILE A CB   6  
ATOM 9808  C CG1  . ILE A 1 62  ? 0.683   2.957   -24.449 1.00 0.00 ? 437 ILE A CG1  6  
ATOM 9809  C CG2  . ILE A 1 62  ? 2.780   1.879   -23.587 1.00 0.00 ? 437 ILE A CG2  6  
ATOM 9810  C CD1  . ILE A 1 62  ? -0.396  3.333   -23.457 1.00 0.00 ? 437 ILE A CD1  6  
ATOM 9811  H H    . ILE A 1 62  ? 2.897   -0.790  -25.268 1.00 0.00 ? 437 ILE A H    6  
ATOM 9812  H HA   . ILE A 1 62  ? 0.412   0.591   -25.727 1.00 0.00 ? 437 ILE A HA   6  
ATOM 9813  H HB   . ILE A 1 62  ? 0.814   1.121   -23.358 1.00 0.00 ? 437 ILE A HB   6  
ATOM 9814  H HG12 . ILE A 1 62  ? 1.416   3.750   -24.455 1.00 0.00 ? 437 ILE A HG12 6  
ATOM 9815  H HG13 . ILE A 1 62  ? 0.226   2.888   -25.426 1.00 0.00 ? 437 ILE A HG13 6  
ATOM 9816  H HG21 . ILE A 1 62  ? 3.316   0.943   -23.539 1.00 0.00 ? 437 ILE A HG21 6  
ATOM 9817  H HG22 . ILE A 1 62  ? 3.303   2.559   -24.243 1.00 0.00 ? 437 ILE A HG22 6  
ATOM 9818  H HG23 . ILE A 1 62  ? 2.718   2.309   -22.598 1.00 0.00 ? 437 ILE A HG23 6  
ATOM 9819  H HD11 . ILE A 1 62  ? -1.345  2.941   -23.793 1.00 0.00 ? 437 ILE A HD11 6  
ATOM 9820  H HD12 . ILE A 1 62  ? -0.156  2.915   -22.490 1.00 0.00 ? 437 ILE A HD12 6  
ATOM 9821  H HD13 . ILE A 1 62  ? -0.457  4.407   -23.380 1.00 0.00 ? 437 ILE A HD13 6  
ATOM 9822  N N    . ASN A 1 63  ? 1.605   1.648   -27.610 1.00 0.00 ? 438 ASN A N    6  
ATOM 9823  C CA   . ASN A 1 63  ? 2.260   2.294   -28.747 1.00 0.00 ? 438 ASN A CA   6  
ATOM 9824  C C    . ASN A 1 63  ? 3.672   1.753   -28.966 1.00 0.00 ? 438 ASN A C    6  
ATOM 9825  O O    . ASN A 1 63  ? 4.630   2.517   -29.086 1.00 0.00 ? 438 ASN A O    6  
ATOM 9826  C CB   . ASN A 1 63  ? 2.301   3.811   -28.549 1.00 0.00 ? 438 ASN A CB   6  
ATOM 9827  C CG   . ASN A 1 63  ? 2.954   4.211   -27.242 1.00 0.00 ? 438 ASN A CG   6  
ATOM 9828  O OD1  . ASN A 1 63  ? 4.140   3.960   -27.025 1.00 0.00 ? 438 ASN A OD1  6  
ATOM 9829  N ND2  . ASN A 1 63  ? 2.183   4.839   -26.363 1.00 0.00 ? 438 ASN A ND2  6  
ATOM 9830  H H    . ASN A 1 63  ? 0.665   1.382   -27.692 1.00 0.00 ? 438 ASN A H    6  
ATOM 9831  H HA   . ASN A 1 63  ? 1.671   2.076   -29.627 1.00 0.00 ? 438 ASN A HA   6  
ATOM 9832  H HB2  . ASN A 1 63  ? 2.859   4.258   -29.359 1.00 0.00 ? 438 ASN A HB2  6  
ATOM 9833  H HB3  . ASN A 1 63  ? 1.292   4.196   -28.560 1.00 0.00 ? 438 ASN A HB3  6  
ATOM 9834  H HD21 . ASN A 1 63  ? 1.247   5.006   -26.604 1.00 0.00 ? 438 ASN A HD21 6  
ATOM 9835  H HD22 . ASN A 1 63  ? 2.578   5.110   -25.509 1.00 0.00 ? 438 ASN A HD22 6  
ATOM 9836  N N    . GLY A 1 64  ? 3.793   0.430   -29.021 1.00 0.00 ? 439 GLY A N    6  
ATOM 9837  C CA   . GLY A 1 64  ? 5.087   -0.189  -29.230 1.00 0.00 ? 439 GLY A CA   6  
ATOM 9838  C C    . GLY A 1 64  ? 6.002   -0.057  -28.029 1.00 0.00 ? 439 GLY A C    6  
ATOM 9839  O O    . GLY A 1 64  ? 7.182   0.267   -28.172 1.00 0.00 ? 439 GLY A O    6  
ATOM 9840  H H    . GLY A 1 64  ? 2.994   -0.129  -28.922 1.00 0.00 ? 439 GLY A H    6  
ATOM 9841  H HA2  . GLY A 1 64  ? 4.942   -1.239  -29.441 1.00 0.00 ? 439 GLY A HA2  6  
ATOM 9842  H HA3  . GLY A 1 64  ? 5.562   0.275   -30.082 1.00 0.00 ? 439 GLY A HA3  6  
ATOM 9843  N N    . GLN A 1 65  ? 5.461   -0.309  -26.842 1.00 0.00 ? 440 GLN A N    6  
ATOM 9844  C CA   . GLN A 1 65  ? 6.240   -0.219  -25.611 1.00 0.00 ? 440 GLN A CA   6  
ATOM 9845  C C    . GLN A 1 65  ? 5.915   -1.381  -24.680 1.00 0.00 ? 440 GLN A C    6  
ATOM 9846  O O    . GLN A 1 65  ? 4.817   -1.937  -24.724 1.00 0.00 ? 440 GLN A O    6  
ATOM 9847  C CB   . GLN A 1 65  ? 5.968   1.109   -24.903 1.00 0.00 ? 440 GLN A CB   6  
ATOM 9848  C CG   . GLN A 1 65  ? 6.384   2.326   -25.713 1.00 0.00 ? 440 GLN A CG   6  
ATOM 9849  C CD   . GLN A 1 65  ? 7.711   2.904   -25.259 1.00 0.00 ? 440 GLN A CD   6  
ATOM 9850  O OE1  . GLN A 1 65  ? 8.704   2.851   -25.984 1.00 0.00 ? 440 GLN A OE1  6  
ATOM 9851  N NE2  . GLN A 1 65  ? 7.733   3.460   -24.053 1.00 0.00 ? 440 GLN A NE2  6  
ATOM 9852  H H    . GLN A 1 65  ? 4.516   -0.565  -26.791 1.00 0.00 ? 440 GLN A H    6  
ATOM 9853  H HA   . GLN A 1 65  ? 7.285   -0.268  -25.877 1.00 0.00 ? 440 GLN A HA   6  
ATOM 9854  H HB2  . GLN A 1 65  ? 4.911   1.185   -24.696 1.00 0.00 ? 440 GLN A HB2  6  
ATOM 9855  H HB3  . GLN A 1 65  ? 6.511   1.124   -23.969 1.00 0.00 ? 440 GLN A HB3  6  
ATOM 9856  H HG2  . GLN A 1 65  ? 6.470   2.040   -26.750 1.00 0.00 ? 440 GLN A HG2  6  
ATOM 9857  H HG3  . GLN A 1 65  ? 5.624   3.087   -25.613 1.00 0.00 ? 440 GLN A HG3  6  
ATOM 9858  H HE21 . GLN A 1 65  ? 6.903   3.465   -23.531 1.00 0.00 ? 440 GLN A HE21 6  
ATOM 9859  H HE22 . GLN A 1 65  ? 8.577   3.842   -23.734 1.00 0.00 ? 440 GLN A HE22 6  
ATOM 9860  N N    . SER A 1 66  ? 6.875   -1.747  -23.837 1.00 0.00 ? 441 SER A N    6  
ATOM 9861  C CA   . SER A 1 66  ? 6.688   -2.846  -22.896 1.00 0.00 ? 441 SER A CA   6  
ATOM 9862  C C    . SER A 1 66  ? 6.445   -2.321  -21.484 1.00 0.00 ? 441 SER A C    6  
ATOM 9863  O O    . SER A 1 66  ? 7.363   -1.827  -20.829 1.00 0.00 ? 441 SER A O    6  
ATOM 9864  C CB   . SER A 1 66  ? 7.910   -3.766  -22.908 1.00 0.00 ? 441 SER A CB   6  
ATOM 9865  O OG   . SER A 1 66  ? 7.994   -4.488  -24.124 1.00 0.00 ? 441 SER A OG   6  
ATOM 9866  H H    . SER A 1 66  ? 7.729   -1.267  -23.849 1.00 0.00 ? 441 SER A H    6  
ATOM 9867  H HA   . SER A 1 66  ? 5.822   -3.408  -23.212 1.00 0.00 ? 441 SER A HA   6  
ATOM 9868  H HB2  . SER A 1 66  ? 8.805   -3.173  -22.794 1.00 0.00 ? 441 SER A HB2  6  
ATOM 9869  H HB3  . SER A 1 66  ? 7.837   -4.468  -22.091 1.00 0.00 ? 441 SER A HB3  6  
ATOM 9870  H HG   . SER A 1 66  ? 8.886   -4.826  -24.235 1.00 0.00 ? 441 SER A HG   6  
ATOM 9871  N N    . VAL A 1 67  ? 5.204   -2.433  -21.022 1.00 0.00 ? 442 VAL A N    6  
ATOM 9872  C CA   . VAL A 1 67  ? 4.841   -1.971  -19.687 1.00 0.00 ? 442 VAL A CA   6  
ATOM 9873  C C    . VAL A 1 67  ? 4.772   -3.133  -18.702 1.00 0.00 ? 442 VAL A C    6  
ATOM 9874  O O    . VAL A 1 67  ? 4.338   -4.230  -19.052 1.00 0.00 ? 442 VAL A O    6  
ATOM 9875  C CB   . VAL A 1 67  ? 3.484   -1.240  -19.693 1.00 0.00 ? 442 VAL A CB   6  
ATOM 9876  C CG1  . VAL A 1 67  ? 3.253   -0.533  -18.365 1.00 0.00 ? 442 VAL A CG1  6  
ATOM 9877  C CG2  . VAL A 1 67  ? 3.403   -0.258  -20.855 1.00 0.00 ? 442 VAL A CG2  6  
ATOM 9878  H H    . VAL A 1 67  ? 4.517   -2.836  -21.592 1.00 0.00 ? 442 VAL A H    6  
ATOM 9879  H HA   . VAL A 1 67  ? 5.599   -1.276  -19.356 1.00 0.00 ? 442 VAL A HA   6  
ATOM 9880  H HB   . VAL A 1 67  ? 2.704   -1.977  -19.819 1.00 0.00 ? 442 VAL A HB   6  
ATOM 9881  H HG11 . VAL A 1 67  ? 4.091   -0.715  -17.709 1.00 0.00 ? 442 VAL A HG11 6  
ATOM 9882  H HG12 . VAL A 1 67  ? 3.153   0.530   -18.534 1.00 0.00 ? 442 VAL A HG12 6  
ATOM 9883  H HG13 . VAL A 1 67  ? 2.351   -0.910  -17.908 1.00 0.00 ? 442 VAL A HG13 6  
ATOM 9884  H HG21 . VAL A 1 67  ? 3.286   0.745   -20.471 1.00 0.00 ? 442 VAL A HG21 6  
ATOM 9885  H HG22 . VAL A 1 67  ? 4.310   -0.316  -21.440 1.00 0.00 ? 442 VAL A HG22 6  
ATOM 9886  H HG23 . VAL A 1 67  ? 2.557   -0.506  -21.477 1.00 0.00 ? 442 VAL A HG23 6  
ATOM 9887  N N    . VAL A 1 68  ? 5.202   -2.886  -17.467 1.00 0.00 ? 443 VAL A N    6  
ATOM 9888  C CA   . VAL A 1 68  ? 5.188   -3.917  -16.435 1.00 0.00 ? 443 VAL A CA   6  
ATOM 9889  C C    . VAL A 1 68  ? 4.424   -3.467  -15.188 1.00 0.00 ? 443 VAL A C    6  
ATOM 9890  O O    . VAL A 1 68  ? 4.250   -4.244  -14.250 1.00 0.00 ? 443 VAL A O    6  
ATOM 9891  C CB   . VAL A 1 68  ? 6.617   -4.320  -16.026 1.00 0.00 ? 443 VAL A CB   6  
ATOM 9892  C CG1  . VAL A 1 68  ? 7.355   -4.938  -17.204 1.00 0.00 ? 443 VAL A CG1  6  
ATOM 9893  C CG2  . VAL A 1 68  ? 7.378   -3.124  -15.479 1.00 0.00 ? 443 VAL A CG2  6  
ATOM 9894  H H    . VAL A 1 68  ? 5.538   -1.992  -17.248 1.00 0.00 ? 443 VAL A H    6  
ATOM 9895  H HA   . VAL A 1 68  ? 4.698   -4.787  -16.845 1.00 0.00 ? 443 VAL A HA   6  
ATOM 9896  H HB   . VAL A 1 68  ? 6.549   -5.063  -15.245 1.00 0.00 ? 443 VAL A HB   6  
ATOM 9897  H HG11 . VAL A 1 68  ? 6.748   -5.715  -17.643 1.00 0.00 ? 443 VAL A HG11 6  
ATOM 9898  H HG12 . VAL A 1 68  ? 7.554   -4.175  -17.942 1.00 0.00 ? 443 VAL A HG12 6  
ATOM 9899  H HG13 . VAL A 1 68  ? 8.289   -5.360  -16.862 1.00 0.00 ? 443 VAL A HG13 6  
ATOM 9900  H HG21 . VAL A 1 68  ? 8.434   -3.249  -15.671 1.00 0.00 ? 443 VAL A HG21 6  
ATOM 9901  H HG22 . VAL A 1 68  ? 7.030   -2.223  -15.963 1.00 0.00 ? 443 VAL A HG22 6  
ATOM 9902  H HG23 . VAL A 1 68  ? 7.212   -3.047  -14.414 1.00 0.00 ? 443 VAL A HG23 6  
ATOM 9903  N N    . SER A 1 69  ? 3.970   -2.215  -15.176 1.00 0.00 ? 444 SER A N    6  
ATOM 9904  C CA   . SER A 1 69  ? 3.231   -1.687  -14.035 1.00 0.00 ? 444 SER A CA   6  
ATOM 9905  C C    . SER A 1 69  ? 2.612   -0.331  -14.357 1.00 0.00 ? 444 SER A C    6  
ATOM 9906  O O    . SER A 1 69  ? 2.935   0.285   -15.374 1.00 0.00 ? 444 SER A O    6  
ATOM 9907  C CB   . SER A 1 69  ? 4.150   -1.562  -12.819 1.00 0.00 ? 444 SER A CB   6  
ATOM 9908  O OG   . SER A 1 69  ? 5.466   -1.206  -13.209 1.00 0.00 ? 444 SER A OG   6  
ATOM 9909  H H    . SER A 1 69  ? 4.135   -1.635  -15.947 1.00 0.00 ? 444 SER A H    6  
ATOM 9910  H HA   . SER A 1 69  ? 2.439   -2.385  -13.804 1.00 0.00 ? 444 SER A HA   6  
ATOM 9911  H HB2  . SER A 1 69  ? 3.766   -0.801  -12.157 1.00 0.00 ? 444 SER A HB2  6  
ATOM 9912  H HB3  . SER A 1 69  ? 4.185   -2.508  -12.298 1.00 0.00 ? 444 SER A HB3  6  
ATOM 9913  H HG   . SER A 1 69  ? 5.430   -0.465  -13.817 1.00 0.00 ? 444 SER A HG   6  
ATOM 9914  N N    . ALA A 1 70  ? 1.722   0.129   -13.482 1.00 0.00 ? 445 ALA A N    6  
ATOM 9915  C CA   . ALA A 1 70  ? 1.057   1.413   -13.668 1.00 0.00 ? 445 ALA A CA   6  
ATOM 9916  C C    . ALA A 1 70  ? 2.069   2.549   -13.765 1.00 0.00 ? 445 ALA A C    6  
ATOM 9917  O O    . ALA A 1 70  ? 1.951   3.428   -14.620 1.00 0.00 ? 445 ALA A O    6  
ATOM 9918  C CB   . ALA A 1 70  ? 0.082   1.671   -12.527 1.00 0.00 ? 445 ALA A CB   6  
ATOM 9919  H H    . ALA A 1 70  ? 1.509   -0.409  -12.691 1.00 0.00 ? 445 ALA A H    6  
ATOM 9920  H HA   . ALA A 1 70  ? 0.492   1.367   -14.587 1.00 0.00 ? 445 ALA A HA   6  
ATOM 9921  H HB1  . ALA A 1 70  ? -0.824  1.108   -12.694 1.00 0.00 ? 445 ALA A HB1  6  
ATOM 9922  H HB2  . ALA A 1 70  ? 0.532   1.363   -11.594 1.00 0.00 ? 445 ALA A HB2  6  
ATOM 9923  H HB3  . ALA A 1 70  ? -0.150  2.725   -12.483 1.00 0.00 ? 445 ALA A HB3  6  
ATOM 9924  N N    . ASN A 1 71  ? 3.067   2.523   -12.886 1.00 0.00 ? 446 ASN A N    6  
ATOM 9925  C CA   . ASN A 1 71  ? 4.104   3.550   -12.873 1.00 0.00 ? 446 ASN A CA   6  
ATOM 9926  C C    . ASN A 1 71  ? 4.739   3.702   -14.252 1.00 0.00 ? 446 ASN A C    6  
ATOM 9927  O O    . ASN A 1 71  ? 5.240   4.771   -14.602 1.00 0.00 ? 446 ASN A O    6  
ATOM 9928  C CB   . ASN A 1 71  ? 5.177   3.208   -11.839 1.00 0.00 ? 446 ASN A CB   6  
ATOM 9929  C CG   . ASN A 1 71  ? 5.832   1.867   -12.108 1.00 0.00 ? 446 ASN A CG   6  
ATOM 9930  O OD1  . ASN A 1 71  ? 6.574   1.709   -13.076 1.00 0.00 ? 446 ASN A OD1  6  
ATOM 9931  N ND2  . ASN A 1 71  ? 5.560   0.892   -11.247 1.00 0.00 ? 446 ASN A ND2  6  
ATOM 9932  H H    . ASN A 1 71  ? 3.107   1.796   -12.231 1.00 0.00 ? 446 ASN A H    6  
ATOM 9933  H HA   . ASN A 1 71  ? 3.639   4.486   -12.600 1.00 0.00 ? 446 ASN A HA   6  
ATOM 9934  H HB2  . ASN A 1 71  ? 5.942   3.970   -11.856 1.00 0.00 ? 446 ASN A HB2  6  
ATOM 9935  H HB3  . ASN A 1 71  ? 4.726   3.178   -10.857 1.00 0.00 ? 446 ASN A HB3  6  
ATOM 9936  H HD21 . ASN A 1 71  ? 4.960   1.090   -10.498 1.00 0.00 ? 446 ASN A HD21 6  
ATOM 9937  H HD22 . ASN A 1 71  ? 5.970   0.015   -11.397 1.00 0.00 ? 446 ASN A HD22 6  
ATOM 9938  N N    . ASP A 1 72  ? 4.714   2.626   -15.033 1.00 0.00 ? 447 ASP A N    6  
ATOM 9939  C CA   . ASP A 1 72  ? 5.285   2.641   -16.373 1.00 0.00 ? 447 ASP A CA   6  
ATOM 9940  C C    . ASP A 1 72  ? 4.278   3.182   -17.384 1.00 0.00 ? 447 ASP A C    6  
ATOM 9941  O O    . ASP A 1 72  ? 4.650   3.843   -18.353 1.00 0.00 ? 447 ASP A O    6  
ATOM 9942  C CB   . ASP A 1 72  ? 5.725   1.231   -16.775 1.00 0.00 ? 447 ASP A CB   6  
ATOM 9943  C CG   . ASP A 1 72  ? 7.059   0.847   -16.167 1.00 0.00 ? 447 ASP A CG   6  
ATOM 9944  O OD1  . ASP A 1 72  ? 8.079   1.470   -16.531 1.00 0.00 ? 447 ASP A OD1  6  
ATOM 9945  O OD2  . ASP A 1 72  ? 7.085   -0.078  -15.328 1.00 0.00 ? 447 ASP A OD2  6  
ATOM 9946  H H    . ASP A 1 72  ? 4.300   1.803   -14.699 1.00 0.00 ? 447 ASP A H    6  
ATOM 9947  H HA   . ASP A 1 72  ? 6.148   3.287   -16.360 1.00 0.00 ? 447 ASP A HA   6  
ATOM 9948  H HB2  . ASP A 1 72  ? 4.982   0.521   -16.444 1.00 0.00 ? 447 ASP A HB2  6  
ATOM 9949  H HB3  . ASP A 1 72  ? 5.811   1.180   -17.852 1.00 0.00 ? 447 ASP A HB3  6  
ATOM 9950  N N    . VAL A 1 73  ? 3.002   2.897   -17.148 1.00 0.00 ? 448 VAL A N    6  
ATOM 9951  C CA   . VAL A 1 73  ? 1.937   3.353   -18.035 1.00 0.00 ? 448 VAL A CA   6  
ATOM 9952  C C    . VAL A 1 73  ? 1.697   4.853   -17.884 1.00 0.00 ? 448 VAL A C    6  
ATOM 9953  O O    . VAL A 1 73  ? 1.420   5.547   -18.862 1.00 0.00 ? 448 VAL A O    6  
ATOM 9954  C CB   . VAL A 1 73  ? 0.620   2.603   -17.755 1.00 0.00 ? 448 VAL A CB   6  
ATOM 9955  C CG1  . VAL A 1 73  ? -0.461  3.021   -18.741 1.00 0.00 ? 448 VAL A CG1  6  
ATOM 9956  C CG2  . VAL A 1 73  ? 0.840   1.100   -17.803 1.00 0.00 ? 448 VAL A CG2  6  
ATOM 9957  H H    . VAL A 1 73  ? 2.770   2.366   -16.357 1.00 0.00 ? 448 VAL A H    6  
ATOM 9958  H HA   . VAL A 1 73  ? 2.237   3.145   -19.052 1.00 0.00 ? 448 VAL A HA   6  
ATOM 9959  H HB   . VAL A 1 73  ? 0.287   2.863   -16.762 1.00 0.00 ? 448 VAL A HB   6  
ATOM 9960  H HG11 . VAL A 1 73  ? -0.516  4.099   -18.780 1.00 0.00 ? 448 VAL A HG11 6  
ATOM 9961  H HG12 . VAL A 1 73  ? -0.222  2.638   -19.722 1.00 0.00 ? 448 VAL A HG12 6  
ATOM 9962  H HG13 . VAL A 1 73  ? -1.413  2.624   -18.422 1.00 0.00 ? 448 VAL A HG13 6  
ATOM 9963  H HG21 . VAL A 1 73  ? 1.149   0.812   -18.798 1.00 0.00 ? 448 VAL A HG21 6  
ATOM 9964  H HG22 . VAL A 1 73  ? 1.606   0.826   -17.094 1.00 0.00 ? 448 VAL A HG22 6  
ATOM 9965  H HG23 . VAL A 1 73  ? -0.080  0.593   -17.552 1.00 0.00 ? 448 VAL A HG23 6  
ATOM 9966  N N    . SER A 1 74  ? 1.801   5.345   -16.653 1.00 0.00 ? 449 SER A N    6  
ATOM 9967  C CA   . SER A 1 74  ? 1.590   6.763   -16.372 1.00 0.00 ? 449 SER A CA   6  
ATOM 9968  C C    . SER A 1 74  ? 2.502   7.636   -17.231 1.00 0.00 ? 449 SER A C    6  
ATOM 9969  O O    . SER A 1 74  ? 2.029   8.474   -18.000 1.00 0.00 ? 449 SER A O    6  
ATOM 9970  C CB   . SER A 1 74  ? 1.837   7.052   -14.891 1.00 0.00 ? 449 SER A CB   6  
ATOM 9971  O OG   . SER A 1 74  ? 1.977   8.443   -14.658 1.00 0.00 ? 449 SER A OG   6  
ATOM 9972  H H    . SER A 1 74  ? 2.022   4.740   -15.914 1.00 0.00 ? 449 SER A H    6  
ATOM 9973  H HA   . SER A 1 74  ? 0.563   6.997   -16.609 1.00 0.00 ? 449 SER A HA   6  
ATOM 9974  H HB2  . SER A 1 74  ? 1.002   6.686   -14.311 1.00 0.00 ? 449 SER A HB2  6  
ATOM 9975  H HB3  . SER A 1 74  ? 2.741   6.553   -14.574 1.00 0.00 ? 449 SER A HB3  6  
ATOM 9976  H HG   . SER A 1 74  ? 1.414   8.704   -13.925 1.00 0.00 ? 449 SER A HG   6  
ATOM 9977  N N    . ASP A 1 75  ? 3.808   7.434   -17.094 1.00 0.00 ? 450 ASP A N    6  
ATOM 9978  C CA   . ASP A 1 75  ? 4.787   8.204   -17.855 1.00 0.00 ? 450 ASP A CA   6  
ATOM 9979  C C    . ASP A 1 75  ? 4.501   8.137   -19.354 1.00 0.00 ? 450 ASP A C    6  
ATOM 9980  O O    . ASP A 1 75  ? 4.891   9.027   -20.109 1.00 0.00 ? 450 ASP A O    6  
ATOM 9981  C CB   . ASP A 1 75  ? 6.201   7.692   -17.571 1.00 0.00 ? 450 ASP A CB   6  
ATOM 9982  C CG   . ASP A 1 75  ? 6.394   6.253   -18.003 1.00 0.00 ? 450 ASP A CG   6  
ATOM 9983  O OD1  . ASP A 1 75  ? 6.516   6.009   -19.222 1.00 0.00 ? 450 ASP A OD1  6  
ATOM 9984  O OD2  . ASP A 1 75  ? 6.423   5.367   -17.123 1.00 0.00 ? 450 ASP A OD2  6  
ATOM 9985  H H    . ASP A 1 75  ? 4.123   6.752   -16.465 1.00 0.00 ? 450 ASP A H    6  
ATOM 9986  H HA   . ASP A 1 75  ? 4.717   9.233   -17.536 1.00 0.00 ? 450 ASP A HA   6  
ATOM 9987  H HB2  . ASP A 1 75  ? 6.912   8.306   -18.103 1.00 0.00 ? 450 ASP A HB2  6  
ATOM 9988  H HB3  . ASP A 1 75  ? 6.394   7.760   -16.510 1.00 0.00 ? 450 ASP A HB3  6  
ATOM 9989  N N    . VAL A 1 76  ? 3.820   7.077   -19.780 1.00 0.00 ? 451 VAL A N    6  
ATOM 9990  C CA   . VAL A 1 76  ? 3.486   6.901   -21.188 1.00 0.00 ? 451 VAL A CA   6  
ATOM 9991  C C    . VAL A 1 76  ? 2.326   7.804   -21.596 1.00 0.00 ? 451 VAL A C    6  
ATOM 9992  O O    . VAL A 1 76  ? 2.411   8.530   -22.586 1.00 0.00 ? 451 VAL A O    6  
ATOM 9993  C CB   . VAL A 1 76  ? 3.118   5.438   -21.502 1.00 0.00 ? 451 VAL A CB   6  
ATOM 9994  C CG1  . VAL A 1 76  ? 2.906   5.247   -22.996 1.00 0.00 ? 451 VAL A CG1  6  
ATOM 9995  C CG2  . VAL A 1 76  ? 4.192   4.493   -20.982 1.00 0.00 ? 451 VAL A CG2  6  
ATOM 9996  H H    . VAL A 1 76  ? 3.535   6.398   -19.133 1.00 0.00 ? 451 VAL A H    6  
ATOM 9997  H HA   . VAL A 1 76  ? 4.356   7.164   -21.773 1.00 0.00 ? 451 VAL A HA   6  
ATOM 9998  H HB   . VAL A 1 76  ? 2.191   5.206   -20.997 1.00 0.00 ? 451 VAL A HB   6  
ATOM 9999  H HG11 . VAL A 1 76  ? 3.391   6.047   -23.534 1.00 0.00 ? 451 VAL A HG11 6  
ATOM 10000 H HG12 . VAL A 1 76  ? 3.327   4.301   -23.302 1.00 0.00 ? 451 VAL A HG12 6  
ATOM 10001 H HG13 . VAL A 1 76  ? 1.848   5.256   -23.214 1.00 0.00 ? 451 VAL A HG13 6  
ATOM 10002 H HG21 . VAL A 1 76  ? 4.809   4.163   -21.805 1.00 0.00 ? 451 VAL A HG21 6  
ATOM 10003 H HG22 . VAL A 1 76  ? 4.804   5.007   -20.257 1.00 0.00 ? 451 VAL A HG22 6  
ATOM 10004 H HG23 . VAL A 1 76  ? 3.724   3.637   -20.518 1.00 0.00 ? 451 VAL A HG23 6  
ATOM 10005 N N    . ILE A 1 77  ? 1.242   7.754   -20.827 1.00 0.00 ? 452 ILE A N    6  
ATOM 10006 C CA   . ILE A 1 77  ? 0.066   8.570   -21.114 1.00 0.00 ? 452 ILE A CA   6  
ATOM 10007 C C    . ILE A 1 77  ? 0.426   10.052  -21.171 1.00 0.00 ? 452 ILE A C    6  
ATOM 10008 O O    . ILE A 1 77  ? -0.233  10.834  -21.857 1.00 0.00 ? 452 ILE A O    6  
ATOM 10009 C CB   . ILE A 1 77  ? -1.038  8.357   -20.058 1.00 0.00 ? 452 ILE A CB   6  
ATOM 10010 C CG1  . ILE A 1 77  ? -1.383  6.870   -19.939 1.00 0.00 ? 452 ILE A CG1  6  
ATOM 10011 C CG2  . ILE A 1 77  ? -2.279  9.163   -20.417 1.00 0.00 ? 452 ILE A CG2  6  
ATOM 10012 C CD1  . ILE A 1 77  ? -1.716  6.439   -18.527 1.00 0.00 ? 452 ILE A CD1  6  
ATOM 10013 H H    . ILE A 1 77  ? 1.232   7.156   -20.051 1.00 0.00 ? 452 ILE A H    6  
ATOM 10014 H HA   . ILE A 1 77  ? -0.322  8.267   -22.075 1.00 0.00 ? 452 ILE A HA   6  
ATOM 10015 H HB   . ILE A 1 77  ? -0.671  8.711   -19.108 1.00 0.00 ? 452 ILE A HB   6  
ATOM 10016 H HG12 . ILE A 1 77  ? -2.239  6.654   -20.561 1.00 0.00 ? 452 ILE A HG12 6  
ATOM 10017 H HG13 . ILE A 1 77  ? -0.542  6.284   -20.276 1.00 0.00 ? 452 ILE A HG13 6  
ATOM 10018 H HG21 . ILE A 1 77  ? -2.556  8.961   -21.442 1.00 0.00 ? 452 ILE A HG21 6  
ATOM 10019 H HG22 . ILE A 1 77  ? -3.092  8.882   -19.763 1.00 0.00 ? 452 ILE A HG22 6  
ATOM 10020 H HG23 . ILE A 1 77  ? -2.071  10.216  -20.301 1.00 0.00 ? 452 ILE A HG23 6  
ATOM 10021 H HD11 . ILE A 1 77  ? -0.825  6.478   -17.919 1.00 0.00 ? 452 ILE A HD11 6  
ATOM 10022 H HD12 . ILE A 1 77  ? -2.463  7.102   -18.115 1.00 0.00 ? 452 ILE A HD12 6  
ATOM 10023 H HD13 . ILE A 1 77  ? -2.099  5.429   -18.539 1.00 0.00 ? 452 ILE A HD13 6  
ATOM 10024 N N    . LYS A 1 78  ? 1.472   10.434  -20.446 1.00 0.00 ? 453 LYS A N    6  
ATOM 10025 C CA   . LYS A 1 78  ? 1.914   11.824  -20.417 1.00 0.00 ? 453 LYS A CA   6  
ATOM 10026 C C    . LYS A 1 78  ? 3.084   12.058  -21.375 1.00 0.00 ? 453 LYS A C    6  
ATOM 10027 O O    . LYS A 1 78  ? 3.449   13.201  -21.648 1.00 0.00 ? 453 LYS A O    6  
ATOM 10028 C CB   . LYS A 1 78  ? 2.318   12.224  -18.996 1.00 0.00 ? 453 LYS A CB   6  
ATOM 10029 C CG   . LYS A 1 78  ? 3.211   11.205  -18.308 1.00 0.00 ? 453 LYS A CG   6  
ATOM 10030 C CD   . LYS A 1 78  ? 4.301   11.880  -17.491 1.00 0.00 ? 453 LYS A CD   6  
ATOM 10031 C CE   . LYS A 1 78  ? 5.631   11.882  -18.229 1.00 0.00 ? 453 LYS A CE   6  
ATOM 10032 N NZ   . LYS A 1 78  ? 6.771   12.182  -17.320 1.00 0.00 ? 453 LYS A NZ   6  
ATOM 10033 H H    . LYS A 1 78  ? 1.958   9.766   -19.918 1.00 0.00 ? 453 LYS A H    6  
ATOM 10034 H HA   . LYS A 1 78  ? 1.085   12.439  -20.730 1.00 0.00 ? 453 LYS A HA   6  
ATOM 10035 H HB2  . LYS A 1 78  ? 2.845   13.165  -19.036 1.00 0.00 ? 453 LYS A HB2  6  
ATOM 10036 H HB3  . LYS A 1 78  ? 1.425   12.347  -18.402 1.00 0.00 ? 453 LYS A HB3  6  
ATOM 10037 H HG2  . LYS A 1 78  ? 2.608   10.598  -17.650 1.00 0.00 ? 453 LYS A HG2  6  
ATOM 10038 H HG3  . LYS A 1 78  ? 3.671   10.579  -19.058 1.00 0.00 ? 453 LYS A HG3  6  
ATOM 10039 H HD2  . LYS A 1 78  ? 4.010   12.900  -17.291 1.00 0.00 ? 453 LYS A HD2  6  
ATOM 10040 H HD3  . LYS A 1 78  ? 4.419   11.348  -16.557 1.00 0.00 ? 453 LYS A HD3  6  
ATOM 10041 H HE2  . LYS A 1 78  ? 5.782   10.910  -18.673 1.00 0.00 ? 453 LYS A HE2  6  
ATOM 10042 H HE3  . LYS A 1 78  ? 5.594   12.631  -19.007 1.00 0.00 ? 453 LYS A HE3  6  
ATOM 10043 H HZ1  . LYS A 1 78  ? 7.002   13.195  -17.358 1.00 0.00 ? 453 LYS A HZ1  6  
ATOM 10044 H HZ2  . LYS A 1 78  ? 6.523   11.931  -16.341 1.00 0.00 ? 453 LYS A HZ2  6  
ATOM 10045 H HZ3  . LYS A 1 78  ? 7.609   11.635  -17.604 1.00 0.00 ? 453 LYS A HZ3  6  
ATOM 10046 N N    . ARG A 1 79  ? 3.670   10.974  -21.880 1.00 0.00 ? 454 ARG A N    6  
ATOM 10047 C CA   . ARG A 1 79  ? 4.796   11.079  -22.803 1.00 0.00 ? 454 ARG A CA   6  
ATOM 10048 C C    . ARG A 1 79  ? 4.338   10.894  -24.246 1.00 0.00 ? 454 ARG A C    6  
ATOM 10049 O O    . ARG A 1 79  ? 4.648   11.708  -25.115 1.00 0.00 ? 454 ARG A O    6  
ATOM 10050 C CB   . ARG A 1 79  ? 5.863   10.037  -22.454 1.00 0.00 ? 454 ARG A CB   6  
ATOM 10051 C CG   . ARG A 1 79  ? 7.061   10.051  -23.389 1.00 0.00 ? 454 ARG A CG   6  
ATOM 10052 C CD   . ARG A 1 79  ? 8.313   9.539   -22.698 1.00 0.00 ? 454 ARG A CD   6  
ATOM 10053 N NE   . ARG A 1 79  ? 9.514   10.239  -23.147 1.00 0.00 ? 454 ARG A NE   6  
ATOM 10054 C CZ   . ARG A 1 79  ? 9.752   11.528  -22.914 1.00 0.00 ? 454 ARG A CZ   6  
ATOM 10055 N NH1  . ARG A 1 79  ? 8.875   12.259  -22.238 1.00 0.00 ? 454 ARG A NH1  6  
ATOM 10056 N NH2  . ARG A 1 79  ? 10.869  12.087  -23.360 1.00 0.00 ? 454 ARG A NH2  6  
ATOM 10057 H H    . ARG A 1 79  ? 3.341   10.088  -21.629 1.00 0.00 ? 454 ARG A H    6  
ATOM 10058 H HA   . ARG A 1 79  ? 5.221   12.065  -22.696 1.00 0.00 ? 454 ARG A HA   6  
ATOM 10059 H HB2  . ARG A 1 79  ? 6.215   10.223  -21.450 1.00 0.00 ? 454 ARG A HB2  6  
ATOM 10060 H HB3  . ARG A 1 79  ? 5.415   9.055   -22.493 1.00 0.00 ? 454 ARG A HB3  6  
ATOM 10061 H HG2  . ARG A 1 79  ? 6.849   9.421   -24.240 1.00 0.00 ? 454 ARG A HG2  6  
ATOM 10062 H HG3  . ARG A 1 79  ? 7.234   11.064  -23.723 1.00 0.00 ? 454 ARG A HG3  6  
ATOM 10063 H HD2  . ARG A 1 79  ? 8.204   9.680   -21.633 1.00 0.00 ? 454 ARG A HD2  6  
ATOM 10064 H HD3  . ARG A 1 79  ? 8.421   8.484   -22.910 1.00 0.00 ? 454 ARG A HD3  6  
ATOM 10065 H HE   . ARG A 1 79  ? 10.179  9.721   -23.649 1.00 0.00 ? 454 ARG A HE   6  
ATOM 10066 H HH11 . ARG A 1 79  ? 8.031   11.844  -21.900 1.00 0.00 ? 454 ARG A HH11 6  
ATOM 10067 H HH12 . ARG A 1 79  ? 9.059   13.227  -22.068 1.00 0.00 ? 454 ARG A HH12 6  
ATOM 10068 H HH21 . ARG A 1 79  ? 11.532  11.540  -23.869 1.00 0.00 ? 454 ARG A HH21 6  
ATOM 10069 H HH22 . ARG A 1 79  ? 11.047  13.054  -23.185 1.00 0.00 ? 454 ARG A HH22 6  
ATOM 10070 N N    . GLU A 1 80  ? 3.600   9.817   -24.493 1.00 0.00 ? 455 GLU A N    6  
ATOM 10071 C CA   . GLU A 1 80  ? 3.102   9.522   -25.832 1.00 0.00 ? 455 GLU A CA   6  
ATOM 10072 C C    . GLU A 1 80  ? 1.683   10.052  -26.016 1.00 0.00 ? 455 GLU A C    6  
ATOM 10073 O O    . GLU A 1 80  ? 0.828   9.877   -25.149 1.00 0.00 ? 455 GLU A O    6  
ATOM 10074 C CB   . GLU A 1 80  ? 3.132   8.015   -26.090 1.00 0.00 ? 455 GLU A CB   6  
ATOM 10075 C CG   . GLU A 1 80  ? 4.366   7.324   -25.533 1.00 0.00 ? 455 GLU A CG   6  
ATOM 10076 C CD   . GLU A 1 80  ? 5.611   7.599   -26.354 1.00 0.00 ? 455 GLU A CD   6  
ATOM 10077 O OE1  . GLU A 1 80  ? 6.089   8.753   -26.340 1.00 0.00 ? 455 GLU A OE1  6  
ATOM 10078 O OE2  . GLU A 1 80  ? 6.107   6.660   -27.012 1.00 0.00 ? 455 GLU A OE2  6  
ATOM 10079 H H    . GLU A 1 80  ? 3.388   9.204   -23.759 1.00 0.00 ? 455 GLU A H    6  
ATOM 10080 H HA   . GLU A 1 80  ? 3.750   10.013  -26.542 1.00 0.00 ? 455 GLU A HA   6  
ATOM 10081 H HB2  . GLU A 1 80  ? 2.260   7.566   -25.637 1.00 0.00 ? 455 GLU A HB2  6  
ATOM 10082 H HB3  . GLU A 1 80  ? 3.101   7.843   -27.156 1.00 0.00 ? 455 GLU A HB3  6  
ATOM 10083 H HG2  . GLU A 1 80  ? 4.535   7.675   -24.525 1.00 0.00 ? 455 GLU A HG2  6  
ATOM 10084 H HG3  . GLU A 1 80  ? 4.191   6.259   -25.516 1.00 0.00 ? 455 GLU A HG3  6  
ATOM 10085 N N    . SER A 1 81  ? 1.441   10.696  -27.153 1.00 0.00 ? 456 SER A N    6  
ATOM 10086 C CA   . SER A 1 81  ? 0.125   11.247  -27.451 1.00 0.00 ? 456 SER A CA   6  
ATOM 10087 C C    . SER A 1 81  ? -0.820  10.154  -27.941 1.00 0.00 ? 456 SER A C    6  
ATOM 10088 O O    . SER A 1 81  ? -2.017  10.180  -27.656 1.00 0.00 ? 456 SER A O    6  
ATOM 10089 C CB   . SER A 1 81  ? 0.239   12.355  -28.501 1.00 0.00 ? 456 SER A CB   6  
ATOM 10090 O OG   . SER A 1 81  ? -0.110  13.615  -27.953 1.00 0.00 ? 456 SER A OG   6  
ATOM 10091 H H    . SER A 1 81  ? 2.163   10.801  -27.807 1.00 0.00 ? 456 SER A H    6  
ATOM 10092 H HA   . SER A 1 81  ? -0.274  11.667  -26.540 1.00 0.00 ? 456 SER A HA   6  
ATOM 10093 H HB2  . SER A 1 81  ? 1.255   12.402  -28.861 1.00 0.00 ? 456 SER A HB2  6  
ATOM 10094 H HB3  . SER A 1 81  ? -0.426  12.138  -29.325 1.00 0.00 ? 456 SER A HB3  6  
ATOM 10095 H HG   . SER A 1 81  ? -0.470  14.176  -28.644 1.00 0.00 ? 456 SER A HG   6  
ATOM 10096 N N    . THR A 1 82  ? -0.272  9.194   -28.678 1.00 0.00 ? 457 THR A N    6  
ATOM 10097 C CA   . THR A 1 82  ? -1.064  8.089   -29.206 1.00 0.00 ? 457 THR A CA   6  
ATOM 10098 C C    . THR A 1 82  ? -0.827  6.822   -28.392 1.00 0.00 ? 457 THR A C    6  
ATOM 10099 O O    . THR A 1 82  ? 0.280   6.286   -28.368 1.00 0.00 ? 457 THR A O    6  
ATOM 10100 C CB   . THR A 1 82  ? -0.714  7.839   -30.674 1.00 0.00 ? 457 THR A CB   6  
ATOM 10101 O OG1  . THR A 1 82  ? 0.686   7.915   -30.876 1.00 0.00 ? 457 THR A OG1  6  
ATOM 10102 C CG2  . THR A 1 82  ? -1.368  8.820   -31.621 1.00 0.00 ? 457 THR A CG2  6  
ATOM 10103 H H    . THR A 1 82  ? 0.688   9.228   -28.869 1.00 0.00 ? 457 THR A H    6  
ATOM 10104 H HA   . THR A 1 82  ? -2.105  8.361   -29.134 1.00 0.00 ? 457 THR A HA   6  
ATOM 10105 H HB   . THR A 1 82  ? -1.041  6.846   -30.947 1.00 0.00 ? 457 THR A HB   6  
ATOM 10106 H HG1  . THR A 1 82  ? 1.134   7.371   -30.223 1.00 0.00 ? 457 THR A HG1  6  
ATOM 10107 H HG21 . THR A 1 82  ? -2.435  8.825   -31.454 1.00 0.00 ? 457 THR A HG21 6  
ATOM 10108 H HG22 . THR A 1 82  ? -0.973  9.810   -31.446 1.00 0.00 ? 457 THR A HG22 6  
ATOM 10109 H HG23 . THR A 1 82  ? -1.165  8.527   -32.641 1.00 0.00 ? 457 THR A HG23 6  
ATOM 10110 N N    . LEU A 1 83  ? -1.872  6.350   -27.721 1.00 0.00 ? 458 LEU A N    6  
ATOM 10111 C CA   . LEU A 1 83  ? -1.773  5.149   -26.901 1.00 0.00 ? 458 LEU A CA   6  
ATOM 10112 C C    . LEU A 1 83  ? -2.480  3.970   -27.561 1.00 0.00 ? 458 LEU A C    6  
ATOM 10113 O O    . LEU A 1 83  ? -3.609  4.095   -28.037 1.00 0.00 ? 458 LEU A O    6  
ATOM 10114 C CB   . LEU A 1 83  ? -2.366  5.404   -25.513 1.00 0.00 ? 458 LEU A CB   6  
ATOM 10115 C CG   . LEU A 1 83  ? -2.041  6.773   -24.910 1.00 0.00 ? 458 LEU A CG   6  
ATOM 10116 C CD1  . LEU A 1 83  ? -2.585  6.874   -23.494 1.00 0.00 ? 458 LEU A CD1  6  
ATOM 10117 C CD2  . LEU A 1 83  ? -0.540  7.020   -24.927 1.00 0.00 ? 458 LEU A CD2  6  
ATOM 10118 H H    . LEU A 1 83  ? -2.730  6.823   -27.776 1.00 0.00 ? 458 LEU A H    6  
ATOM 10119 H HA   . LEU A 1 83  ? -0.726  4.909   -26.794 1.00 0.00 ? 458 LEU A HA   6  
ATOM 10120 H HB2  . LEU A 1 83  ? -3.440  5.308   -25.581 1.00 0.00 ? 458 LEU A HB2  6  
ATOM 10121 H HB3  . LEU A 1 83  ? -1.996  4.645   -24.842 1.00 0.00 ? 458 LEU A HB3  6  
ATOM 10122 H HG   . LEU A 1 83  ? -2.514  7.541   -25.505 1.00 0.00 ? 458 LEU A HG   6  
ATOM 10123 H HD11 . LEU A 1 83  ? -3.405  6.181   -23.371 1.00 0.00 ? 458 LEU A HD11 6  
ATOM 10124 H HD12 . LEU A 1 83  ? -1.802  6.633   -22.790 1.00 0.00 ? 458 LEU A HD12 6  
ATOM 10125 H HD13 . LEU A 1 83  ? -2.934  7.880   -23.314 1.00 0.00 ? 458 LEU A HD13 6  
ATOM 10126 H HD21 . LEU A 1 83  ? -0.256  7.569   -24.042 1.00 0.00 ? 458 LEU A HD21 6  
ATOM 10127 H HD22 . LEU A 1 83  ? -0.020  6.073   -24.945 1.00 0.00 ? 458 LEU A HD22 6  
ATOM 10128 H HD23 . LEU A 1 83  ? -0.279  7.591   -25.805 1.00 0.00 ? 458 LEU A HD23 6  
ATOM 10129 N N    . ASN A 1 84  ? -1.807  2.824   -27.582 1.00 0.00 ? 459 ASN A N    6  
ATOM 10130 C CA   . ASN A 1 84  ? -2.363  1.615   -28.176 1.00 0.00 ? 459 ASN A CA   6  
ATOM 10131 C C    . ASN A 1 84  ? -2.091  0.408   -27.285 1.00 0.00 ? 459 ASN A C    6  
ATOM 10132 O O    . ASN A 1 84  ? -1.062  -0.255  -27.419 1.00 0.00 ? 459 ASN A O    6  
ATOM 10133 C CB   . ASN A 1 84  ? -1.768  1.382   -29.566 1.00 0.00 ? 459 ASN A CB   6  
ATOM 10134 C CG   . ASN A 1 84  ? -2.351  2.316   -30.609 1.00 0.00 ? 459 ASN A CG   6  
ATOM 10135 O OD1  . ASN A 1 84  ? -3.339  1.990   -31.268 1.00 0.00 ? 459 ASN A OD1  6  
ATOM 10136 N ND2  . ASN A 1 84  ? -1.739  3.484   -30.765 1.00 0.00 ? 459 ASN A ND2  6  
ATOM 10137 H H    . ASN A 1 84  ? -0.912  2.791   -27.182 1.00 0.00 ? 459 ASN A H    6  
ATOM 10138 H HA   . ASN A 1 84  ? -3.431  1.749   -28.267 1.00 0.00 ? 459 ASN A HA   6  
ATOM 10139 H HB2  . ASN A 1 84  ? -0.701  1.541   -29.525 1.00 0.00 ? 459 ASN A HB2  6  
ATOM 10140 H HB3  . ASN A 1 84  ? -1.966  0.365   -29.869 1.00 0.00 ? 459 ASN A HB3  6  
ATOM 10141 H HD21 . ASN A 1 84  ? -0.957  3.676   -30.206 1.00 0.00 ? 459 ASN A HD21 6  
ATOM 10142 H HD22 . ASN A 1 84  ? -2.095  4.107   -31.433 1.00 0.00 ? 459 ASN A HD22 6  
ATOM 10143 N N    . MET A 1 85  ? -3.015  0.132   -26.371 1.00 0.00 ? 460 MET A N    6  
ATOM 10144 C CA   . MET A 1 85  ? -2.867  -0.991  -25.452 1.00 0.00 ? 460 MET A CA   6  
ATOM 10145 C C    . MET A 1 85  ? -3.628  -2.216  -25.947 1.00 0.00 ? 460 MET A C    6  
ATOM 10146 O O    . MET A 1 85  ? -4.661  -2.096  -26.607 1.00 0.00 ? 460 MET A O    6  
ATOM 10147 C CB   . MET A 1 85  ? -3.362  -0.601  -24.057 1.00 0.00 ? 460 MET A CB   6  
ATOM 10148 C CG   . MET A 1 85  ? -2.810  0.726   -23.563 1.00 0.00 ? 460 MET A CG   6  
ATOM 10149 S SD   . MET A 1 85  ? -4.046  1.716   -22.700 1.00 0.00 ? 460 MET A SD   6  
ATOM 10150 C CE   . MET A 1 85  ? -3.894  3.279   -23.562 1.00 0.00 ? 460 MET A CE   6  
ATOM 10151 H H    . MET A 1 85  ? -3.812  0.700   -26.308 1.00 0.00 ? 460 MET A H    6  
ATOM 10152 H HA   . MET A 1 85  ? -1.817  -1.234  -25.394 1.00 0.00 ? 460 MET A HA   6  
ATOM 10153 H HB2  . MET A 1 85  ? -4.440  -0.535  -24.075 1.00 0.00 ? 460 MET A HB2  6  
ATOM 10154 H HB3  . MET A 1 85  ? -3.070  -1.371  -23.357 1.00 0.00 ? 460 MET A HB3  6  
ATOM 10155 H HG2  . MET A 1 85  ? -1.991  0.531   -22.887 1.00 0.00 ? 460 MET A HG2  6  
ATOM 10156 H HG3  . MET A 1 85  ? -2.448  1.288   -24.412 1.00 0.00 ? 460 MET A HG3  6  
ATOM 10157 H HE1  . MET A 1 85  ? -3.039  3.819   -23.181 1.00 0.00 ? 460 MET A HE1  6  
ATOM 10158 H HE2  . MET A 1 85  ? -3.763  3.096   -24.618 1.00 0.00 ? 460 MET A HE2  6  
ATOM 10159 H HE3  . MET A 1 85  ? -4.788  3.865   -23.406 1.00 0.00 ? 460 MET A HE3  6  
ATOM 10160 N N    . VAL A 1 86  ? -3.108  -3.394  -25.620 1.00 0.00 ? 461 VAL A N    6  
ATOM 10161 C CA   . VAL A 1 86  ? -3.730  -4.649  -26.021 1.00 0.00 ? 461 VAL A CA   6  
ATOM 10162 C C    . VAL A 1 86  ? -4.098  -5.486  -24.801 1.00 0.00 ? 461 VAL A C    6  
ATOM 10163 O O    . VAL A 1 86  ? -3.250  -5.770  -23.955 1.00 0.00 ? 461 VAL A O    6  
ATOM 10164 C CB   . VAL A 1 86  ? -2.798  -5.472  -26.931 1.00 0.00 ? 461 VAL A CB   6  
ATOM 10165 C CG1  . VAL A 1 86  ? -3.518  -6.696  -27.473 1.00 0.00 ? 461 VAL A CG1  6  
ATOM 10166 C CG2  . VAL A 1 86  ? -2.263  -4.611  -28.065 1.00 0.00 ? 461 VAL A CG2  6  
ATOM 10167 H H    . VAL A 1 86  ? -2.284  -3.420  -25.090 1.00 0.00 ? 461 VAL A H    6  
ATOM 10168 H HA   . VAL A 1 86  ? -4.629  -4.416  -26.574 1.00 0.00 ? 461 VAL A HA   6  
ATOM 10169 H HB   . VAL A 1 86  ? -1.959  -5.809  -26.339 1.00 0.00 ? 461 VAL A HB   6  
ATOM 10170 H HG11 . VAL A 1 86  ? -4.241  -7.039  -26.748 1.00 0.00 ? 461 VAL A HG11 6  
ATOM 10171 H HG12 . VAL A 1 86  ? -4.024  -6.438  -28.392 1.00 0.00 ? 461 VAL A HG12 6  
ATOM 10172 H HG13 . VAL A 1 86  ? -2.801  -7.479  -27.666 1.00 0.00 ? 461 VAL A HG13 6  
ATOM 10173 H HG21 . VAL A 1 86  ? -1.992  -5.243  -28.900 1.00 0.00 ? 461 VAL A HG21 6  
ATOM 10174 H HG22 . VAL A 1 86  ? -3.024  -3.911  -28.377 1.00 0.00 ? 461 VAL A HG22 6  
ATOM 10175 H HG23 . VAL A 1 86  ? -1.392  -4.070  -27.727 1.00 0.00 ? 461 VAL A HG23 6  
ATOM 10176 N N    . VAL A 1 87  ? -5.366  -5.874  -24.709 1.00 0.00 ? 462 VAL A N    6  
ATOM 10177 C CA   . VAL A 1 87  ? -5.836  -6.676  -23.585 1.00 0.00 ? 462 VAL A CA   6  
ATOM 10178 C C    . VAL A 1 87  ? -6.337  -8.039  -24.047 1.00 0.00 ? 462 VAL A C    6  
ATOM 10179 O O    . VAL A 1 87  ? -6.305  -8.352  -25.237 1.00 0.00 ? 462 VAL A O    6  
ATOM 10180 C CB   . VAL A 1 87  ? -6.963  -5.963  -22.813 1.00 0.00 ? 462 VAL A CB   6  
ATOM 10181 C CG1  . VAL A 1 87  ? -6.416  -4.754  -22.069 1.00 0.00 ? 462 VAL A CG1  6  
ATOM 10182 C CG2  . VAL A 1 87  ? -8.085  -5.556  -23.755 1.00 0.00 ? 462 VAL A CG2  6  
ATOM 10183 H H    . VAL A 1 87  ? -5.999  -5.616  -25.414 1.00 0.00 ? 462 VAL A H    6  
ATOM 10184 H HA   . VAL A 1 87  ? -5.005  -6.821  -22.910 1.00 0.00 ? 462 VAL A HA   6  
ATOM 10185 H HB   . VAL A 1 87  ? -7.365  -6.651  -22.085 1.00 0.00 ? 462 VAL A HB   6  
ATOM 10186 H HG11 . VAL A 1 87  ? -5.967  -4.070  -22.773 1.00 0.00 ? 462 VAL A HG11 6  
ATOM 10187 H HG12 . VAL A 1 87  ? -7.223  -4.257  -21.549 1.00 0.00 ? 462 VAL A HG12 6  
ATOM 10188 H HG13 . VAL A 1 87  ? -5.673  -5.077  -21.355 1.00 0.00 ? 462 VAL A HG13 6  
ATOM 10189 H HG21 . VAL A 1 87  ? -8.018  -4.498  -23.961 1.00 0.00 ? 462 VAL A HG21 6  
ATOM 10190 H HG22 . VAL A 1 87  ? -7.999  -6.110  -24.678 1.00 0.00 ? 462 VAL A HG22 6  
ATOM 10191 H HG23 . VAL A 1 87  ? -9.038  -5.774  -23.294 1.00 0.00 ? 462 VAL A HG23 6  
ATOM 10192 N N    . ARG A 1 88  ? -6.795  -8.848  -23.097 1.00 0.00 ? 463 ARG A N    6  
ATOM 10193 C CA   . ARG A 1 88  ? -7.299  -10.181 -23.406 1.00 0.00 ? 463 ARG A CA   6  
ATOM 10194 C C    . ARG A 1 88  ? -8.760  -10.326 -22.997 1.00 0.00 ? 463 ARG A C    6  
ATOM 10195 O O    . ARG A 1 88  ? -9.123  -10.078 -21.847 1.00 0.00 ? 463 ARG A O    6  
ATOM 10196 C CB   . ARG A 1 88  ? -6.455  -11.242 -22.697 1.00 0.00 ? 463 ARG A CB   6  
ATOM 10197 C CG   . ARG A 1 88  ? -6.888  -12.667 -23.005 1.00 0.00 ? 463 ARG A CG   6  
ATOM 10198 C CD   . ARG A 1 88  ? -5.900  -13.363 -23.928 1.00 0.00 ? 463 ARG A CD   6  
ATOM 10199 N NE   . ARG A 1 88  ? -6.207  -14.783 -24.090 1.00 0.00 ? 463 ARG A NE   6  
ATOM 10200 C CZ   . ARG A 1 88  ? -5.883  -15.717 -23.199 1.00 0.00 ? 463 ARG A CZ   6  
ATOM 10201 N NH1  . ARG A 1 88  ? -5.247  -15.387 -22.082 1.00 0.00 ? 463 ARG A NH1  6  
ATOM 10202 N NH2  . ARG A 1 88  ? -6.197  -16.985 -23.426 1.00 0.00 ? 463 ARG A NH2  6  
ATOM 10203 H H    . ARG A 1 88  ? -6.792  -8.541  -22.166 1.00 0.00 ? 463 ARG A H    6  
ATOM 10204 H HA   . ARG A 1 88  ? -7.220  -10.326 -24.472 1.00 0.00 ? 463 ARG A HA   6  
ATOM 10205 H HB2  . ARG A 1 88  ? -5.425  -11.127 -22.999 1.00 0.00 ? 463 ARG A HB2  6  
ATOM 10206 H HB3  . ARG A 1 88  ? -6.527  -11.090 -21.630 1.00 0.00 ? 463 ARG A HB3  6  
ATOM 10207 H HG2  . ARG A 1 88  ? -6.952  -13.222 -22.082 1.00 0.00 ? 463 ARG A HG2  6  
ATOM 10208 H HG3  . ARG A 1 88  ? -7.857  -12.644 -23.482 1.00 0.00 ? 463 ARG A HG3  6  
ATOM 10209 H HD2  . ARG A 1 88  ? -5.935  -12.886 -24.897 1.00 0.00 ? 463 ARG A HD2  6  
ATOM 10210 H HD3  . ARG A 1 88  ? -4.908  -13.264 -23.514 1.00 0.00 ? 463 ARG A HD3  6  
ATOM 10211 H HE   . ARG A 1 88  ? -6.678  -15.054 -24.905 1.00 0.00 ? 463 ARG A HE   6  
ATOM 10212 H HH11 . ARG A 1 88  ? -5.008  -14.433 -21.904 1.00 0.00 ? 463 ARG A HH11 6  
ATOM 10213 H HH12 . ARG A 1 88  ? -5.007  -16.095 -21.417 1.00 0.00 ? 463 ARG A HH12 6  
ATOM 10214 H HH21 . ARG A 1 88  ? -6.677  -17.239 -24.266 1.00 0.00 ? 463 ARG A HH21 6  
ATOM 10215 H HH22 . ARG A 1 88  ? -5.953  -17.687 -22.757 1.00 0.00 ? 463 ARG A HH22 6  
ATOM 10216 N N    . ARG A 1 89  ? -9.595  -10.737 -23.946 1.00 0.00 ? 464 ARG A N    6  
ATOM 10217 C CA   . ARG A 1 89  ? -11.018 -10.926 -23.687 1.00 0.00 ? 464 ARG A CA   6  
ATOM 10218 C C    . ARG A 1 89  ? -11.415 -12.380 -23.915 1.00 0.00 ? 464 ARG A C    6  
ATOM 10219 O O    . ARG A 1 89  ? -11.256 -12.909 -25.015 1.00 0.00 ? 464 ARG A O    6  
ATOM 10220 C CB   . ARG A 1 89  ? -11.852 -10.014 -24.588 1.00 0.00 ? 464 ARG A CB   6  
ATOM 10221 C CG   . ARG A 1 89  ? -13.333 -10.017 -24.254 1.00 0.00 ? 464 ARG A CG   6  
ATOM 10222 C CD   . ARG A 1 89  ? -14.151 -9.353  -25.349 1.00 0.00 ? 464 ARG A CD   6  
ATOM 10223 N NE   . ARG A 1 89  ? -15.069 -8.352  -24.812 1.00 0.00 ? 464 ARG A NE   6  
ATOM 10224 C CZ   . ARG A 1 89  ? -14.820 -7.044  -24.786 1.00 0.00 ? 464 ARG A CZ   6  
ATOM 10225 N NH1  . ARG A 1 89  ? -13.669 -6.564  -25.246 1.00 0.00 ? 464 ARG A NH1  6  
ATOM 10226 N NH2  . ARG A 1 89  ? -15.722 -6.210  -24.287 1.00 0.00 ? 464 ARG A NH2  6  
ATOM 10227 H H    . ARG A 1 89  ? -9.244  -10.924 -24.842 1.00 0.00 ? 464 ARG A H    6  
ATOM 10228 H HA   . ARG A 1 89  ? -11.206 -10.671 -22.655 1.00 0.00 ? 464 ARG A HA   6  
ATOM 10229 H HB2  . ARG A 1 89  ? -11.487 -9.001  -24.494 1.00 0.00 ? 464 ARG A HB2  6  
ATOM 10230 H HB3  . ARG A 1 89  ? -11.736 -10.337 -25.610 1.00 0.00 ? 464 ARG A HB3  6  
ATOM 10231 H HG2  . ARG A 1 89  ? -13.664 -11.039 -24.141 1.00 0.00 ? 464 ARG A HG2  6  
ATOM 10232 H HG3  . ARG A 1 89  ? -13.485 -9.482  -23.328 1.00 0.00 ? 464 ARG A HG3  6  
ATOM 10233 H HD2  . ARG A 1 89  ? -13.481 -8.878  -26.048 1.00 0.00 ? 464 ARG A HD2  6  
ATOM 10234 H HD3  . ARG A 1 89  ? -14.723 -10.113 -25.862 1.00 0.00 ? 464 ARG A HD3  6  
ATOM 10235 H HE   . ARG A 1 89  ? -15.922 -8.671  -24.452 1.00 0.00 ? 464 ARG A HE   6  
ATOM 10236 H HH11 . ARG A 1 89  ? -12.980 -7.184  -25.618 1.00 0.00 ? 464 ARG A HH11 6  
ATOM 10237 H HH12 . ARG A 1 89  ? -13.495 -5.580  -25.223 1.00 0.00 ? 464 ARG A HH12 6  
ATOM 10238 H HH21 . ARG A 1 89  ? -16.587 -6.564  -23.933 1.00 0.00 ? 464 ARG A HH21 6  
ATOM 10239 H HH22 . ARG A 1 89  ? -15.537 -5.228  -24.265 1.00 0.00 ? 464 ARG A HH22 6  
ATOM 10240 N N    . GLY A 1 90  ? -11.927 -13.021 -22.871 1.00 0.00 ? 465 GLY A N    6  
ATOM 10241 C CA   . GLY A 1 90  ? -12.330 -14.409 -22.984 1.00 0.00 ? 465 GLY A CA   6  
ATOM 10242 C C    . GLY A 1 90  ? -11.143 -15.345 -23.090 1.00 0.00 ? 465 GLY A C    6  
ATOM 10243 O O    . GLY A 1 90  ? -10.572 -15.749 -22.078 1.00 0.00 ? 465 GLY A O    6  
ATOM 10244 H H    . GLY A 1 90  ? -12.027 -12.549 -22.018 1.00 0.00 ? 465 GLY A H    6  
ATOM 10245 H HA2  . GLY A 1 90  ? -12.911 -14.675 -22.115 1.00 0.00 ? 465 GLY A HA2  6  
ATOM 10246 H HA3  . GLY A 1 90  ? -12.946 -14.523 -23.864 1.00 0.00 ? 465 GLY A HA3  6  
ATOM 10247 N N    . ASN A 1 91  ? -10.772 -15.685 -24.318 1.00 0.00 ? 466 ASN A N    6  
ATOM 10248 C CA   . ASN A 1 91  ? -9.642  -16.574 -24.558 1.00 0.00 ? 466 ASN A CA   6  
ATOM 10249 C C    . ASN A 1 91  ? -8.825  -16.099 -25.755 1.00 0.00 ? 466 ASN A C    6  
ATOM 10250 O O    . ASN A 1 91  ? -8.175  -16.895 -26.432 1.00 0.00 ? 466 ASN A O    6  
ATOM 10251 C CB   . ASN A 1 91  ? -10.132 -18.004 -24.793 1.00 0.00 ? 466 ASN A CB   6  
ATOM 10252 C CG   . ASN A 1 91  ? -9.125  -19.042 -24.339 1.00 0.00 ? 466 ASN A CG   6  
ATOM 10253 O OD1  . ASN A 1 91  ? -8.243  -19.442 -25.099 1.00 0.00 ? 466 ASN A OD1  6  
ATOM 10254 N ND2  . ASN A 1 91  ? -9.253  -19.485 -23.093 1.00 0.00 ? 466 ASN A ND2  6  
ATOM 10255 H H    . ASN A 1 91  ? -11.267 -15.326 -25.083 1.00 0.00 ? 466 ASN A H    6  
ATOM 10256 H HA   . ASN A 1 91  ? -9.014  -16.558 -23.679 1.00 0.00 ? 466 ASN A HA   6  
ATOM 10257 H HB2  . ASN A 1 91  ? -11.051 -18.157 -24.246 1.00 0.00 ? 466 ASN A HB2  6  
ATOM 10258 H HB3  . ASN A 1 91  ? -10.318 -18.145 -25.847 1.00 0.00 ? 466 ASN A HB3  6  
ATOM 10259 H HD21 . ASN A 1 91  ? -9.979  -19.121 -22.544 1.00 0.00 ? 466 ASN A HD21 6  
ATOM 10260 H HD22 . ASN A 1 91  ? -8.614  -20.157 -22.773 1.00 0.00 ? 466 ASN A HD22 6  
ATOM 10261 N N    . GLU A 1 92  ? -8.868  -14.795 -26.013 1.00 0.00 ? 467 GLU A N    6  
ATOM 10262 C CA   . GLU A 1 92  ? -8.140  -14.211 -27.130 1.00 0.00 ? 467 GLU A CA   6  
ATOM 10263 C C    . GLU A 1 92  ? -7.615  -12.824 -26.774 1.00 0.00 ? 467 GLU A C    6  
ATOM 10264 O O    . GLU A 1 92  ? -7.999  -12.246 -25.758 1.00 0.00 ? 467 GLU A O    6  
ATOM 10265 C CB   . GLU A 1 92  ? -9.050  -14.122 -28.353 1.00 0.00 ? 467 GLU A CB   6  
ATOM 10266 C CG   . GLU A 1 92  ? -10.326 -13.334 -28.101 1.00 0.00 ? 467 GLU A CG   6  
ATOM 10267 C CD   . GLU A 1 92  ? -11.374 -13.563 -29.173 1.00 0.00 ? 467 GLU A CD   6  
ATOM 10268 O OE1  . GLU A 1 92  ? -11.175 -13.085 -30.310 1.00 0.00 ? 467 GLU A OE1  6  
ATOM 10269 O OE2  . GLU A 1 92  ? -12.393 -14.221 -28.876 1.00 0.00 ? 467 GLU A OE2  6  
ATOM 10270 H H    . GLU A 1 92  ? -9.408  -14.212 -25.441 1.00 0.00 ? 467 GLU A H    6  
ATOM 10271 H HA   . GLU A 1 92  ? -7.305  -14.855 -27.359 1.00 0.00 ? 467 GLU A HA   6  
ATOM 10272 H HB2  . GLU A 1 92  ? -8.511  -13.645 -29.157 1.00 0.00 ? 467 GLU A HB2  6  
ATOM 10273 H HB3  . GLU A 1 92  ? -9.324  -15.121 -28.656 1.00 0.00 ? 467 GLU A HB3  6  
ATOM 10274 H HG2  . GLU A 1 92  ? -10.737 -13.634 -27.148 1.00 0.00 ? 467 GLU A HG2  6  
ATOM 10275 H HG3  . GLU A 1 92  ? -10.085 -12.282 -28.072 1.00 0.00 ? 467 GLU A HG3  6  
ATOM 10276 N N    . ASP A 1 93  ? -6.739  -12.293 -27.621 1.00 0.00 ? 468 ASP A N    6  
ATOM 10277 C CA   . ASP A 1 93  ? -6.166  -10.971 -27.401 1.00 0.00 ? 468 ASP A CA   6  
ATOM 10278 C C    . ASP A 1 93  ? -6.723  -9.972  -28.410 1.00 0.00 ? 468 ASP A C    6  
ATOM 10279 O O    . ASP A 1 93  ? -6.905  -10.298 -29.582 1.00 0.00 ? 468 ASP A O    6  
ATOM 10280 C CB   . ASP A 1 93  ? -4.641  -11.026 -27.504 1.00 0.00 ? 468 ASP A CB   6  
ATOM 10281 C CG   . ASP A 1 93  ? -4.012  -11.804 -26.365 1.00 0.00 ? 468 ASP A CG   6  
ATOM 10282 O OD1  . ASP A 1 93  ? -4.135  -13.047 -26.356 1.00 0.00 ? 468 ASP A OD1  6  
ATOM 10283 O OD2  . ASP A 1 93  ? -3.395  -11.171 -25.482 1.00 0.00 ? 468 ASP A OD2  6  
ATOM 10284 H H    . ASP A 1 93  ? -6.476  -12.801 -28.417 1.00 0.00 ? 468 ASP A H    6  
ATOM 10285 H HA   . ASP A 1 93  ? -6.443  -10.650 -26.407 1.00 0.00 ? 468 ASP A HA   6  
ATOM 10286 H HB2  . ASP A 1 93  ? -4.366  -11.501 -28.434 1.00 0.00 ? 468 ASP A HB2  6  
ATOM 10287 H HB3  . ASP A 1 93  ? -4.248  -10.020 -27.489 1.00 0.00 ? 468 ASP A HB3  6  
ATOM 10288 N N    . ILE A 1 94  ? -7.000  -8.758  -27.946 1.00 0.00 ? 469 ILE A N    6  
ATOM 10289 C CA   . ILE A 1 94  ? -7.547  -7.721  -28.812 1.00 0.00 ? 469 ILE A CA   6  
ATOM 10290 C C    . ILE A 1 94  ? -6.732  -6.437  -28.718 1.00 0.00 ? 469 ILE A C    6  
ATOM 10291 O O    . ILE A 1 94  ? -6.186  -6.109  -27.664 1.00 0.00 ? 469 ILE A O    6  
ATOM 10292 C CB   . ILE A 1 94  ? -9.015  -7.402  -28.460 1.00 0.00 ? 469 ILE A CB   6  
ATOM 10293 C CG1  . ILE A 1 94  ? -9.786  -8.682  -28.128 1.00 0.00 ? 469 ILE A CG1  6  
ATOM 10294 C CG2  . ILE A 1 94  ? -9.685  -6.664  -29.608 1.00 0.00 ? 469 ILE A CG2  6  
ATOM 10295 C CD1  . ILE A 1 94  ? -10.745 -8.519  -26.971 1.00 0.00 ? 469 ILE A CD1  6  
ATOM 10296 H H    . ILE A 1 94  ? -6.840  -8.559  -27.000 1.00 0.00 ? 469 ILE A H    6  
ATOM 10297 H HA   . ILE A 1 94  ? -7.513  -8.083  -29.828 1.00 0.00 ? 469 ILE A HA   6  
ATOM 10298 H HB   . ILE A 1 94  ? -9.021  -6.753  -27.597 1.00 0.00 ? 469 ILE A HB   6  
ATOM 10299 H HG12 . ILE A 1 94  ? -10.358 -8.985  -28.991 1.00 0.00 ? 469 ILE A HG12 6  
ATOM 10300 H HG13 . ILE A 1 94  ? -9.088  -9.464  -27.872 1.00 0.00 ? 469 ILE A HG13 6  
ATOM 10301 H HG21 . ILE A 1 94  ? -9.442  -7.151  -30.540 1.00 0.00 ? 469 ILE A HG21 6  
ATOM 10302 H HG22 . ILE A 1 94  ? -10.756 -6.674  -29.466 1.00 0.00 ? 469 ILE A HG22 6  
ATOM 10303 H HG23 . ILE A 1 94  ? -9.336  -5.643  -29.633 1.00 0.00 ? 469 ILE A HG23 6  
ATOM 10304 H HD11 . ILE A 1 94  ? -10.254 -8.811  -26.054 1.00 0.00 ? 469 ILE A HD11 6  
ATOM 10305 H HD12 . ILE A 1 94  ? -11.052 -7.487  -26.900 1.00 0.00 ? 469 ILE A HD12 6  
ATOM 10306 H HD13 . ILE A 1 94  ? -11.611 -9.143  -27.132 1.00 0.00 ? 469 ILE A HD13 6  
ATOM 10307 N N    . MET A 1 95  ? -6.658  -5.711  -29.828 1.00 0.00 ? 470 MET A N    6  
ATOM 10308 C CA   . MET A 1 95  ? -5.916  -4.457  -29.876 1.00 0.00 ? 470 MET A CA   6  
ATOM 10309 C C    . MET A 1 95  ? -6.843  -3.272  -29.628 1.00 0.00 ? 470 MET A C    6  
ATOM 10310 O O    . MET A 1 95  ? -7.857  -3.112  -30.310 1.00 0.00 ? 470 MET A O    6  
ATOM 10311 C CB   . MET A 1 95  ? -5.219  -4.303  -31.229 1.00 0.00 ? 470 MET A CB   6  
ATOM 10312 C CG   . MET A 1 95  ? -3.821  -4.897  -31.261 1.00 0.00 ? 470 MET A CG   6  
ATOM 10313 S SD   . MET A 1 95  ? -3.791  -6.569  -31.939 1.00 0.00 ? 470 MET A SD   6  
ATOM 10314 C CE   . MET A 1 95  ? -2.222  -7.161  -31.309 1.00 0.00 ? 470 MET A CE   6  
ATOM 10315 H H    . MET A 1 95  ? -7.118  -6.023  -30.635 1.00 0.00 ? 470 MET A H    6  
ATOM 10316 H HA   . MET A 1 95  ? -5.169  -4.484  -29.096 1.00 0.00 ? 470 MET A HA   6  
ATOM 10317 H HB2  . MET A 1 95  ? -5.813  -4.796  -31.985 1.00 0.00 ? 470 MET A HB2  6  
ATOM 10318 H HB3  . MET A 1 95  ? -5.147  -3.253  -31.466 1.00 0.00 ? 470 MET A HB3  6  
ATOM 10319 H HG2  . MET A 1 95  ? -3.191  -4.267  -31.871 1.00 0.00 ? 470 MET A HG2  6  
ATOM 10320 H HG3  . MET A 1 95  ? -3.432  -4.926  -30.254 1.00 0.00 ? 470 MET A HG3  6  
ATOM 10321 H HE1  . MET A 1 95  ? -1.544  -7.328  -32.132 1.00 0.00 ? 470 MET A HE1  6  
ATOM 10322 H HE2  . MET A 1 95  ? -1.802  -6.426  -30.639 1.00 0.00 ? 470 MET A HE2  6  
ATOM 10323 H HE3  . MET A 1 95  ? -2.376  -8.088  -30.776 1.00 0.00 ? 470 MET A HE3  6  
ATOM 10324 N N    . ILE A 1 96  ? -6.496  -2.449  -28.646 1.00 0.00 ? 471 ILE A N    6  
ATOM 10325 C CA   . ILE A 1 96  ? -7.303  -1.283  -28.304 1.00 0.00 ? 471 ILE A CA   6  
ATOM 10326 C C    . ILE A 1 96  ? -6.496  0.006   -28.434 1.00 0.00 ? 471 ILE A C    6  
ATOM 10327 O O    . ILE A 1 96  ? -5.403  0.127   -27.878 1.00 0.00 ? 471 ILE A O    6  
ATOM 10328 C CB   . ILE A 1 96  ? -7.861  -1.391  -26.871 1.00 0.00 ? 471 ILE A CB   6  
ATOM 10329 C CG1  . ILE A 1 96  ? -8.648  -2.692  -26.707 1.00 0.00 ? 471 ILE A CG1  6  
ATOM 10330 C CG2  . ILE A 1 96  ? -8.739  -0.193  -26.544 1.00 0.00 ? 471 ILE A CG2  6  
ATOM 10331 C CD1  . ILE A 1 96  ? -7.782  -3.885  -26.365 1.00 0.00 ? 471 ILE A CD1  6  
ATOM 10332 H H    . ILE A 1 96  ? -5.680  -2.631  -28.135 1.00 0.00 ? 471 ILE A H    6  
ATOM 10333 H HA   . ILE A 1 96  ? -8.137  -1.243  -28.990 1.00 0.00 ? 471 ILE A HA   6  
ATOM 10334 H HB   . ILE A 1 96  ? -7.029  -1.395  -26.184 1.00 0.00 ? 471 ILE A HB   6  
ATOM 10335 H HG12 . ILE A 1 96  ? -9.371  -2.571  -25.915 1.00 0.00 ? 471 ILE A HG12 6  
ATOM 10336 H HG13 . ILE A 1 96  ? -9.165  -2.911  -27.630 1.00 0.00 ? 471 ILE A HG13 6  
ATOM 10337 H HG21 . ILE A 1 96  ? -9.536  -0.122  -27.270 1.00 0.00 ? 471 ILE A HG21 6  
ATOM 10338 H HG22 . ILE A 1 96  ? -9.160  -0.315  -25.557 1.00 0.00 ? 471 ILE A HG22 6  
ATOM 10339 H HG23 . ILE A 1 96  ? -8.144  0.708   -26.574 1.00 0.00 ? 471 ILE A HG23 6  
ATOM 10340 H HD11 . ILE A 1 96  ? -7.202  -4.170  -27.230 1.00 0.00 ? 471 ILE A HD11 6  
ATOM 10341 H HD12 . ILE A 1 96  ? -7.117  -3.626  -25.555 1.00 0.00 ? 471 ILE A HD12 6  
ATOM 10342 H HD13 . ILE A 1 96  ? -8.410  -4.711  -26.065 1.00 0.00 ? 471 ILE A HD13 6  
ATOM 10343 N N    . THR A 1 97  ? -7.043  0.964   -29.174 1.00 0.00 ? 472 THR A N    6  
ATOM 10344 C CA   . THR A 1 97  ? -6.380  2.247   -29.380 1.00 0.00 ? 472 THR A CA   6  
ATOM 10345 C C    . THR A 1 97  ? -7.072  3.350   -28.587 1.00 0.00 ? 472 THR A C    6  
ATOM 10346 O O    . THR A 1 97  ? -8.269  3.587   -28.750 1.00 0.00 ? 472 THR A O    6  
ATOM 10347 C CB   . THR A 1 97  ? -6.367  2.605   -30.866 1.00 0.00 ? 472 THR A CB   6  
ATOM 10348 O OG1  . THR A 1 97  ? -5.768  1.571   -31.626 1.00 0.00 ? 472 THR A OG1  6  
ATOM 10349 C CG2  . THR A 1 97  ? -5.621  3.887   -31.168 1.00 0.00 ? 472 THR A CG2  6  
ATOM 10350 H H    . THR A 1 97  ? -7.916  0.807   -29.590 1.00 0.00 ? 472 THR A H    6  
ATOM 10351 H HA   . THR A 1 97  ? -5.362  2.154   -29.032 1.00 0.00 ? 472 THR A HA   6  
ATOM 10352 H HB   . THR A 1 97  ? -7.387  2.728   -31.205 1.00 0.00 ? 472 THR A HB   6  
ATOM 10353 H HG1  . THR A 1 97  ? -6.329  0.792   -31.605 1.00 0.00 ? 472 THR A HG1  6  
ATOM 10354 H HG21 . THR A 1 97  ? -4.600  3.799   -30.827 1.00 0.00 ? 472 THR A HG21 6  
ATOM 10355 H HG22 . THR A 1 97  ? -5.631  4.067   -32.233 1.00 0.00 ? 472 THR A HG22 6  
ATOM 10356 H HG23 . THR A 1 97  ? -6.101  4.710   -30.659 1.00 0.00 ? 472 THR A HG23 6  
ATOM 10357 N N    . VAL A 1 98  ? -6.313  4.022   -27.729 1.00 0.00 ? 473 VAL A N    6  
ATOM 10358 C CA   . VAL A 1 98  ? -6.855  5.100   -26.911 1.00 0.00 ? 473 VAL A CA   6  
ATOM 10359 C C    . VAL A 1 98  ? -6.020  6.368   -27.053 1.00 0.00 ? 473 VAL A C    6  
ATOM 10360 O O    . VAL A 1 98  ? -4.790  6.316   -27.056 1.00 0.00 ? 473 VAL A O    6  
ATOM 10361 C CB   . VAL A 1 98  ? -6.919  4.703   -25.424 1.00 0.00 ? 473 VAL A CB   6  
ATOM 10362 C CG1  . VAL A 1 98  ? -7.631  5.776   -24.613 1.00 0.00 ? 473 VAL A CG1  6  
ATOM 10363 C CG2  . VAL A 1 98  ? -7.607  3.356   -25.257 1.00 0.00 ? 473 VAL A CG2  6  
ATOM 10364 H H    . VAL A 1 98  ? -5.365  3.788   -27.643 1.00 0.00 ? 473 VAL A H    6  
ATOM 10365 H HA   . VAL A 1 98  ? -7.861  5.304   -27.252 1.00 0.00 ? 473 VAL A HA   6  
ATOM 10366 H HB   . VAL A 1 98  ? -5.908  4.616   -25.052 1.00 0.00 ? 473 VAL A HB   6  
ATOM 10367 H HG11 . VAL A 1 98  ? -7.307  6.751   -24.943 1.00 0.00 ? 473 VAL A HG11 6  
ATOM 10368 H HG12 . VAL A 1 98  ? -8.698  5.684   -24.754 1.00 0.00 ? 473 VAL A HG12 6  
ATOM 10369 H HG13 . VAL A 1 98  ? -7.395  5.653   -23.567 1.00 0.00 ? 473 VAL A HG13 6  
ATOM 10370 H HG21 . VAL A 1 98  ? -8.620  3.509   -24.918 1.00 0.00 ? 473 VAL A HG21 6  
ATOM 10371 H HG22 . VAL A 1 98  ? -7.618  2.837   -26.204 1.00 0.00 ? 473 VAL A HG22 6  
ATOM 10372 H HG23 . VAL A 1 98  ? -7.069  2.765   -24.531 1.00 0.00 ? 473 VAL A HG23 6  
ATOM 10373 N N    . ILE A 1 99  ? -6.695  7.507   -27.170 1.00 0.00 ? 474 ILE A N    6  
ATOM 10374 C CA   . ILE A 1 99  ? -6.013  8.788   -27.312 1.00 0.00 ? 474 ILE A CA   6  
ATOM 10375 C C    . ILE A 1 99  ? -6.426  9.758   -26.206 1.00 0.00 ? 474 ILE A C    6  
ATOM 10376 O O    . ILE A 1 99  ? -7.557  10.243  -26.189 1.00 0.00 ? 474 ILE A O    6  
ATOM 10377 C CB   . ILE A 1 99  ? -6.315  9.433   -28.680 1.00 0.00 ? 474 ILE A CB   6  
ATOM 10378 C CG1  . ILE A 1 99  ? -6.129  8.413   -29.804 1.00 0.00 ? 474 ILE A CG1  6  
ATOM 10379 C CG2  . ILE A 1 99  ? -5.420  10.644  -28.903 1.00 0.00 ? 474 ILE A CG2  6  
ATOM 10380 C CD1  . ILE A 1 99  ? -4.731  7.839   -29.877 1.00 0.00 ? 474 ILE A CD1  6  
ATOM 10381 H H    . ILE A 1 99  ? -7.674  7.485   -27.162 1.00 0.00 ? 474 ILE A H    6  
ATOM 10382 H HA   . ILE A 1 99  ? -4.950  8.609   -27.249 1.00 0.00 ? 474 ILE A HA   6  
ATOM 10383 H HB   . ILE A 1 99  ? -7.339  9.771   -28.675 1.00 0.00 ? 474 ILE A HB   6  
ATOM 10384 H HG12 . ILE A 1 99  ? -6.815  7.592   -29.654 1.00 0.00 ? 474 ILE A HG12 6  
ATOM 10385 H HG13 . ILE A 1 99  ? -6.344  8.886   -30.750 1.00 0.00 ? 474 ILE A HG13 6  
ATOM 10386 H HG21 . ILE A 1 99  ? -5.051  11.000  -27.953 1.00 0.00 ? 474 ILE A HG21 6  
ATOM 10387 H HG22 . ILE A 1 99  ? -4.586  10.364  -29.531 1.00 0.00 ? 474 ILE A HG22 6  
ATOM 10388 H HG23 . ILE A 1 99  ? -5.987  11.426  -29.385 1.00 0.00 ? 474 ILE A HG23 6  
ATOM 10389 H HD11 . ILE A 1 99  ? -4.069  8.561   -30.331 1.00 0.00 ? 474 ILE A HD11 6  
ATOM 10390 H HD12 . ILE A 1 99  ? -4.384  7.608   -28.881 1.00 0.00 ? 474 ILE A HD12 6  
ATOM 10391 H HD13 . ILE A 1 99  ? -4.742  6.938   -30.472 1.00 0.00 ? 474 ILE A HD13 6  
ATOM 10392 N N    . PRO A 1 100 ? -5.513  10.059  -25.263 1.00 0.00 ? 475 PRO A N    6  
ATOM 10393 C CA   . PRO A 1 100 ? -5.799  10.978  -24.157 1.00 0.00 ? 475 PRO A CA   6  
ATOM 10394 C C    . PRO A 1 100 ? -5.970  12.418  -24.629 1.00 0.00 ? 475 PRO A C    6  
ATOM 10395 O O    . PRO A 1 100 ? -5.514  12.784  -25.712 1.00 0.00 ? 475 PRO A O    6  
ATOM 10396 C CB   . PRO A 1 100 ? -4.565  10.855  -23.260 1.00 0.00 ? 475 PRO A CB   6  
ATOM 10397 C CG   . PRO A 1 100 ? -3.477  10.406  -24.172 1.00 0.00 ? 475 PRO A CG   6  
ATOM 10398 C CD   . PRO A 1 100 ? -4.138  9.530   -25.199 1.00 0.00 ? 475 PRO A CD   6  
ATOM 10399 H HA   . PRO A 1 100 ? -6.678  10.674  -23.607 1.00 0.00 ? 475 PRO A HA   6  
ATOM 10400 H HB2  . PRO A 1 100 ? -4.341  11.816  -22.818 1.00 0.00 ? 475 PRO A HB2  6  
ATOM 10401 H HB3  . PRO A 1 100 ? -4.752  10.130  -22.482 1.00 0.00 ? 475 PRO A HB3  6  
ATOM 10402 H HG2  . PRO A 1 100 ? -3.019  11.261  -24.647 1.00 0.00 ? 475 PRO A HG2  6  
ATOM 10403 H HG3  . PRO A 1 100 ? -2.741  9.844   -23.617 1.00 0.00 ? 475 PRO A HG3  6  
ATOM 10404 H HD2  . PRO A 1 100 ? -3.641  9.627   -26.153 1.00 0.00 ? 475 PRO A HD2  6  
ATOM 10405 H HD3  . PRO A 1 100 ? -4.136  8.500   -24.875 1.00 0.00 ? 475 PRO A HD3  6  
ATOM 10406 N N    . GLU A 1 101 ? -6.630  13.230  -23.809 1.00 0.00 ? 476 GLU A N    6  
ATOM 10407 C CA   . GLU A 1 101 ? -6.860  14.630  -24.143 1.00 0.00 ? 476 GLU A CA   6  
ATOM 10408 C C    . GLU A 1 101 ? -6.004  15.544  -23.272 1.00 0.00 ? 476 GLU A C    6  
ATOM 10409 O O    . GLU A 1 101 ? -5.194  15.075  -22.473 1.00 0.00 ? 476 GLU A O    6  
ATOM 10410 C CB   . GLU A 1 101 ? -8.339  14.981  -23.970 1.00 0.00 ? 476 GLU A CB   6  
ATOM 10411 C CG   . GLU A 1 101 ? -8.831  14.855  -22.538 1.00 0.00 ? 476 GLU A CG   6  
ATOM 10412 C CD   . GLU A 1 101 ? -10.343 14.783  -22.447 1.00 0.00 ? 476 GLU A CD   6  
ATOM 10413 O OE1  . GLU A 1 101 ? -10.983 15.852  -22.347 1.00 0.00 ? 476 GLU A OE1  6  
ATOM 10414 O OE2  . GLU A 1 101 ? -10.887 13.660  -22.473 1.00 0.00 ? 476 GLU A OE2  6  
ATOM 10415 H H    . GLU A 1 101 ? -6.970  12.879  -22.960 1.00 0.00 ? 476 GLU A H    6  
ATOM 10416 H HA   . GLU A 1 101 ? -6.584  14.775  -25.176 1.00 0.00 ? 476 GLU A HA   6  
ATOM 10417 H HB2  . GLU A 1 101 ? -8.496  15.999  -24.294 1.00 0.00 ? 476 GLU A HB2  6  
ATOM 10418 H HB3  . GLU A 1 101 ? -8.928  14.321  -24.591 1.00 0.00 ? 476 GLU A HB3  6  
ATOM 10419 H HG2  . GLU A 1 101 ? -8.417  13.956  -22.107 1.00 0.00 ? 476 GLU A HG2  6  
ATOM 10420 H HG3  . GLU A 1 101 ? -8.490  15.711  -21.977 1.00 0.00 ? 476 GLU A HG3  6  
ATOM 10421 N N    . GLU A 1 102 ? -6.189  16.850  -23.432 1.00 0.00 ? 477 GLU A N    6  
ATOM 10422 C CA   . GLU A 1 102 ? -5.433  17.830  -22.660 1.00 0.00 ? 477 GLU A CA   6  
ATOM 10423 C C    . GLU A 1 102 ? -6.358  18.654  -21.770 1.00 0.00 ? 477 GLU A C    6  
ATOM 10424 O O    . GLU A 1 102 ? -7.387  19.156  -22.224 1.00 0.00 ? 477 GLU A O    6  
ATOM 10425 C CB   . GLU A 1 102 ? -4.649  18.753  -23.594 1.00 0.00 ? 477 GLU A CB   6  
ATOM 10426 C CG   . GLU A 1 102 ? -3.730  18.012  -24.551 1.00 0.00 ? 477 GLU A CG   6  
ATOM 10427 C CD   . GLU A 1 102 ? -2.340  17.805  -23.981 1.00 0.00 ? 477 GLU A CD   6  
ATOM 10428 O OE1  . GLU A 1 102 ? -2.227  17.573  -22.759 1.00 0.00 ? 477 GLU A OE1  6  
ATOM 10429 O OE2  . GLU A 1 102 ? -1.364  17.876  -24.757 1.00 0.00 ? 477 GLU A OE2  6  
ATOM 10430 H H    . GLU A 1 102 ? -6.849  17.163  -24.085 1.00 0.00 ? 477 GLU A H    6  
ATOM 10431 H HA   . GLU A 1 102 ? -4.737  17.291  -22.033 1.00 0.00 ? 477 GLU A HA   6  
ATOM 10432 H HB2  . GLU A 1 102 ? -5.348  19.333  -24.178 1.00 0.00 ? 477 GLU A HB2  6  
ATOM 10433 H HB3  . GLU A 1 102 ? -4.048  19.424  -22.999 1.00 0.00 ? 477 GLU A HB3  6  
ATOM 10434 H HG2  . GLU A 1 102 ? -4.160  17.045  -24.767 1.00 0.00 ? 477 GLU A HG2  6  
ATOM 10435 H HG3  . GLU A 1 102 ? -3.648  18.581  -25.465 1.00 0.00 ? 477 GLU A HG3  6  
ATOM 10436 N N    . ILE A 1 103 ? -5.986  18.787  -20.502 1.00 0.00 ? 478 ILE A N    6  
ATOM 10437 C CA   . ILE A 1 103 ? -6.782  19.550  -19.548 1.00 0.00 ? 478 ILE A CA   6  
ATOM 10438 C C    . ILE A 1 103 ? -5.896  20.202  -18.490 1.00 0.00 ? 478 ILE A C    6  
ATOM 10439 O O    . ILE A 1 103 ? -4.836  19.679  -18.146 1.00 0.00 ? 478 ILE A O    6  
ATOM 10440 C CB   . ILE A 1 103 ? -7.832  18.659  -18.853 1.00 0.00 ? 478 ILE A CB   6  
ATOM 10441 C CG1  . ILE A 1 103 ? -8.725  19.499  -17.938 1.00 0.00 ? 478 ILE A CG1  6  
ATOM 10442 C CG2  . ILE A 1 103 ? -7.152  17.548  -18.066 1.00 0.00 ? 478 ILE A CG2  6  
ATOM 10443 C CD1  . ILE A 1 103 ? -9.906  18.736  -17.379 1.00 0.00 ? 478 ILE A CD1  6  
ATOM 10444 H H    . ILE A 1 103 ? -5.156  18.364  -20.200 1.00 0.00 ? 478 ILE A H    6  
ATOM 10445 H HA   . ILE A 1 103 ? -7.302  20.325  -20.094 1.00 0.00 ? 478 ILE A HA   6  
ATOM 10446 H HB   . ILE A 1 103 ? -8.443  18.202  -19.616 1.00 0.00 ? 478 ILE A HB   6  
ATOM 10447 H HG12 . ILE A 1 103 ? -8.138  19.858  -17.104 1.00 0.00 ? 478 ILE A HG12 6  
ATOM 10448 H HG13 . ILE A 1 103 ? -9.106  20.343  -18.493 1.00 0.00 ? 478 ILE A HG13 6  
ATOM 10449 H HG21 . ILE A 1 103 ? -6.458  17.980  -17.360 1.00 0.00 ? 478 ILE A HG21 6  
ATOM 10450 H HG22 . ILE A 1 103 ? -7.897  16.975  -17.535 1.00 0.00 ? 478 ILE A HG22 6  
ATOM 10451 H HG23 . ILE A 1 103 ? -6.616  16.901  -18.746 1.00 0.00 ? 478 ILE A HG23 6  
ATOM 10452 H HD11 . ILE A 1 103 ? -10.576 19.422  -16.882 1.00 0.00 ? 478 ILE A HD11 6  
ATOM 10453 H HD12 . ILE A 1 103 ? -10.428 18.241  -18.184 1.00 0.00 ? 478 ILE A HD12 6  
ATOM 10454 H HD13 . ILE A 1 103 ? -9.555  17.999  -16.670 1.00 0.00 ? 478 ILE A HD13 6  
ATOM 10455 N N    . ASP A 1 104 ? -6.338  21.345  -17.977 1.00 0.00 ? 479 ASP A N    6  
ATOM 10456 C CA   . ASP A 1 104 ? -5.585  22.067  -16.958 1.00 0.00 ? 479 ASP A CA   6  
ATOM 10457 C C    . ASP A 1 104 ? -6.187  21.836  -15.572 1.00 0.00 ? 479 ASP A C    6  
ATOM 10458 O O    . ASP A 1 104 ? -7.355  22.143  -15.337 1.00 0.00 ? 479 ASP A O    6  
ATOM 10459 C CB   . ASP A 1 104 ? -5.566  23.563  -17.275 1.00 0.00 ? 479 ASP A CB   6  
ATOM 10460 C CG   . ASP A 1 104 ? -4.896  23.866  -18.600 1.00 0.00 ? 479 ASP A CG   6  
ATOM 10461 O OD1  . ASP A 1 104 ? -5.499  23.564  -19.652 1.00 0.00 ? 479 ASP A OD1  6  
ATOM 10462 O OD2  . ASP A 1 104 ? -3.770  24.406  -18.587 1.00 0.00 ? 479 ASP A OD2  6  
ATOM 10463 H H    . ASP A 1 104 ? -7.190  21.712  -18.291 1.00 0.00 ? 479 ASP A H    6  
ATOM 10464 H HA   . ASP A 1 104 ? -4.572  21.693  -16.969 1.00 0.00 ? 479 ASP A HA   6  
ATOM 10465 H HB2  . ASP A 1 104 ? -6.581  23.929  -17.313 1.00 0.00 ? 479 ASP A HB2  6  
ATOM 10466 H HB3  . ASP A 1 104 ? -5.030  24.083  -16.493 1.00 0.00 ? 479 ASP A HB3  6  
ATOM 10467 N N    . PRO A 1 105 ? -5.395  21.290  -14.628 1.00 0.00 ? 480 PRO A N    6  
ATOM 10468 C CA   . PRO A 1 105 ? -5.867  21.024  -13.266 1.00 0.00 ? 480 PRO A CA   6  
ATOM 10469 C C    . PRO A 1 105 ? -6.081  22.306  -12.467 1.00 0.00 ? 480 PRO A C    6  
ATOM 10470 O O    . PRO A 1 105 ? -7.252  22.698  -12.280 1.00 0.00 ? 480 PRO A O    6  
ATOM 10471 C CB   . PRO A 1 105 ? -4.737  20.195  -12.653 1.00 0.00 ? 480 PRO A CB   6  
ATOM 10472 C CG   . PRO A 1 105 ? -3.521  20.593  -13.415 1.00 0.00 ? 480 PRO A CG   6  
ATOM 10473 C CD   . PRO A 1 105 ? -3.987  20.890  -14.813 1.00 0.00 ? 480 PRO A CD   6  
ATOM 10474 O OXT  . PRO A 1 105 ? -5.076  22.907  -12.034 1.00 0.00 ? 480 PRO A OXT  6  
ATOM 10475 H HA   . PRO A 1 105 ? -6.780  20.447  -13.268 1.00 0.00 ? 480 PRO A HA   6  
ATOM 10476 H HB2  . PRO A 1 105 ? -4.642  20.431  -11.602 1.00 0.00 ? 480 PRO A HB2  6  
ATOM 10477 H HB3  . PRO A 1 105 ? -4.951  19.144  -12.773 1.00 0.00 ? 480 PRO A HB3  6  
ATOM 10478 H HG2  . PRO A 1 105 ? -3.082  21.476  -12.971 1.00 0.00 ? 480 PRO A HG2  6  
ATOM 10479 H HG3  . PRO A 1 105 ? -2.809  19.782  -13.421 1.00 0.00 ? 480 PRO A HG3  6  
ATOM 10480 H HD2  . PRO A 1 105 ? -3.410  21.696  -15.240 1.00 0.00 ? 480 PRO A HD2  6  
ATOM 10481 H HD3  . PRO A 1 105 ? -3.916  20.006  -15.429 1.00 0.00 ? 480 PRO A HD3  6  
ATOM 10482 N N    . ASP B 2 1   ? -3.980  -2.407  -0.061  1.00 0.00 ? 1   ASP B N    6  
ATOM 10483 C CA   . ASP B 2 1   ? -4.415  -1.083  -0.580  1.00 0.00 ? 1   ASP B CA   6  
ATOM 10484 C C    . ASP B 2 1   ? -4.590  -1.114  -2.094  1.00 0.00 ? 1   ASP B C    6  
ATOM 10485 O O    . ASP B 2 1   ? -3.991  -1.941  -2.782  1.00 0.00 ? 1   ASP B O    6  
ATOM 10486 C CB   . ASP B 2 1   ? -3.368  -0.039  -0.191  1.00 0.00 ? 1   ASP B CB   6  
ATOM 10487 C CG   . ASP B 2 1   ? -3.992  1.272   0.247   1.00 0.00 ? 1   ASP B CG   6  
ATOM 10488 O OD1  . ASP B 2 1   ? -4.360  2.077   -0.634  1.00 0.00 ? 1   ASP B OD1  6  
ATOM 10489 O OD2  . ASP B 2 1   ? -4.112  1.491   1.470   1.00 0.00 ? 1   ASP B OD2  6  
ATOM 10490 H H1   . ASP B 2 1   ? -4.535  -3.137  -0.548  1.00 0.00 ? 1   ASP B H1   6  
ATOM 10491 H H2   . ASP B 2 1   ? -4.159  -2.418  0.964   1.00 0.00 ? 1   ASP B H2   6  
ATOM 10492 H H3   . ASP B 2 1   ? -2.966  -2.508  -0.267  1.00 0.00 ? 1   ASP B H3   6  
ATOM 10493 H HA   . ASP B 2 1   ? -5.359  -0.828  -0.121  1.00 0.00 ? 1   ASP B HA   6  
ATOM 10494 H HB2  . ASP B 2 1   ? -2.772  -0.422  0.624   1.00 0.00 ? 1   ASP B HB2  6  
ATOM 10495 H HB3  . ASP B 2 1   ? -2.727  0.153   -1.040  1.00 0.00 ? 1   ASP B HB3  6  
ATOM 10496 N N    . SER B 2 2   ? -5.414  -0.205  -2.608  1.00 0.00 ? 2   SER B N    6  
ATOM 10497 C CA   . SER B 2 2   ? -5.666  -0.127  -4.042  1.00 0.00 ? 2   SER B CA   6  
ATOM 10498 C C    . SER B 2 2   ? -4.452  0.435   -4.774  1.00 0.00 ? 2   SER B C    6  
ATOM 10499 O O    . SER B 2 2   ? -3.942  -0.178  -5.711  1.00 0.00 ? 2   SER B O    6  
ATOM 10500 C CB   . SER B 2 2   ? -6.892  0.743   -4.318  1.00 0.00 ? 2   SER B CB   6  
ATOM 10501 O OG   . SER B 2 2   ? -8.026  0.268   -3.612  1.00 0.00 ? 2   SER B OG   6  
ATOM 10502 H H    . SER B 2 2   ? -5.861  0.427   -2.008  1.00 0.00 ? 2   SER B H    6  
ATOM 10503 H HA   . SER B 2 2   ? -5.857  -1.128  -4.400  1.00 0.00 ? 2   SER B HA   6  
ATOM 10504 H HB2  . SER B 2 2   ? -6.690  1.757   -4.005  1.00 0.00 ? 2   SER B HB2  6  
ATOM 10505 H HB3  . SER B 2 2   ? -7.111  0.729   -5.376  1.00 0.00 ? 2   SER B HB3  6  
ATOM 10506 H HG   . SER B 2 2   ? -8.304  0.927   -2.971  1.00 0.00 ? 2   SER B HG   6  
ATOM 10507 N N    . ARG B 2 3   ? -3.993  1.605   -4.338  1.00 0.00 ? 3   ARG B N    6  
ATOM 10508 C CA   . ARG B 2 3   ? -2.837  2.249   -4.951  1.00 0.00 ? 3   ARG B CA   6  
ATOM 10509 C C    . ARG B 2 3   ? -3.056  2.452   -6.448  1.00 0.00 ? 3   ARG B C    6  
ATOM 10510 O O    . ARG B 2 3   ? -2.138  2.280   -7.250  1.00 0.00 ? 3   ARG B O    6  
ATOM 10511 C CB   . ARG B 2 3   ? -1.578  1.411   -4.714  1.00 0.00 ? 3   ARG B CB   6  
ATOM 10512 C CG   . ARG B 2 3   ? -0.843  1.768   -3.432  1.00 0.00 ? 3   ARG B CG   6  
ATOM 10513 C CD   . ARG B 2 3   ? 0.476   1.020   -3.319  1.00 0.00 ? 3   ARG B CD   6  
ATOM 10514 N NE   . ARG B 2 3   ? 0.288   -0.429  -3.327  1.00 0.00 ? 3   ARG B NE   6  
ATOM 10515 C CZ   . ARG B 2 3   ? 1.196   -1.297  -2.888  1.00 0.00 ? 3   ARG B CZ   6  
ATOM 10516 N NH1  . ARG B 2 3   ? 2.355   -0.869  -2.405  1.00 0.00 ? 3   ARG B NH1  6  
ATOM 10517 N NH2  . ARG B 2 3   ? 0.944   -2.598  -2.931  1.00 0.00 ? 3   ARG B NH2  6  
ATOM 10518 H H    . ARG B 2 3   ? -4.441  2.044   -3.586  1.00 0.00 ? 3   ARG B H    6  
ATOM 10519 H HA   . ARG B 2 3   ? -2.710  3.214   -4.484  1.00 0.00 ? 3   ARG B HA   6  
ATOM 10520 H HB2  . ARG B 2 3   ? -1.856  0.370   -4.666  1.00 0.00 ? 3   ARG B HB2  6  
ATOM 10521 H HB3  . ARG B 2 3   ? -0.900  1.556   -5.543  1.00 0.00 ? 3   ARG B HB3  6  
ATOM 10522 H HG2  . ARG B 2 3   ? -0.645  2.828   -3.424  1.00 0.00 ? 3   ARG B HG2  6  
ATOM 10523 H HG3  . ARG B 2 3   ? -1.467  1.510   -2.588  1.00 0.00 ? 3   ARG B HG3  6  
ATOM 10524 H HD2  . ARG B 2 3   ? 1.104   1.296   -4.153  1.00 0.00 ? 3   ARG B HD2  6  
ATOM 10525 H HD3  . ARG B 2 3   ? 0.958   1.306   -2.396  1.00 0.00 ? 3   ARG B HD3  6  
ATOM 10526 H HE   . ARG B 2 3   ? -0.559  -0.773  -3.680  1.00 0.00 ? 3   ARG B HE   6  
ATOM 10527 H HH11 . ARG B 2 3   ? 2.552   0.111   -2.369  1.00 0.00 ? 3   ARG B HH11 6  
ATOM 10528 H HH12 . ARG B 2 3   ? 3.033   -1.526  -2.076  1.00 0.00 ? 3   ARG B HH12 6  
ATOM 10529 H HH21 . ARG B 2 3   ? 0.072   -2.927  -3.295  1.00 0.00 ? 3   ARG B HH21 6  
ATOM 10530 H HH22 . ARG B 2 3   ? 1.626   -3.252  -2.602  1.00 0.00 ? 3   ARG B HH22 6  
ATOM 10531 N N    . ILE B 2 4   ? -4.280  2.817   -6.817  1.00 0.00 ? 4   ILE B N    6  
ATOM 10532 C CA   . ILE B 2 4   ? -4.622  3.043   -8.218  1.00 0.00 ? 4   ILE B CA   6  
ATOM 10533 C C    . ILE B 2 4   ? -4.056  4.369   -8.717  1.00 0.00 ? 4   ILE B C    6  
ATOM 10534 O O    . ILE B 2 4   ? -3.937  5.330   -7.957  1.00 0.00 ? 4   ILE B O    6  
ATOM 10535 C CB   . ILE B 2 4   ? -6.148  3.037   -8.430  1.00 0.00 ? 4   ILE B CB   6  
ATOM 10536 C CG1  . ILE B 2 4   ? -6.811  4.108   -7.560  1.00 0.00 ? 4   ILE B CG1  6  
ATOM 10537 C CG2  . ILE B 2 4   ? -6.720  1.662   -8.121  1.00 0.00 ? 4   ILE B CG2  6  
ATOM 10538 C CD1  . ILE B 2 4   ? -7.243  5.334   -8.333  1.00 0.00 ? 4   ILE B CD1  6  
ATOM 10539 H H    . ILE B 2 4   ? -4.969  2.937   -6.131  1.00 0.00 ? 4   ILE B H    6  
ATOM 10540 H HA   . ILE B 2 4   ? -4.195  2.239   -8.799  1.00 0.00 ? 4   ILE B HA   6  
ATOM 10541 H HB   . ILE B 2 4   ? -6.344  3.256   -9.469  1.00 0.00 ? 4   ILE B HB   6  
ATOM 10542 H HG12 . ILE B 2 4   ? -7.688  3.689   -7.089  1.00 0.00 ? 4   ILE B HG12 6  
ATOM 10543 H HG13 . ILE B 2 4   ? -6.116  4.425   -6.796  1.00 0.00 ? 4   ILE B HG13 6  
ATOM 10544 H HG21 . ILE B 2 4   ? -5.931  0.924   -8.169  1.00 0.00 ? 4   ILE B HG21 6  
ATOM 10545 H HG22 . ILE B 2 4   ? -7.150  1.665   -7.131  1.00 0.00 ? 4   ILE B HG22 6  
ATOM 10546 H HG23 . ILE B 2 4   ? -7.484  1.419   -8.845  1.00 0.00 ? 4   ILE B HG23 6  
ATOM 10547 H HD11 . ILE B 2 4   ? -7.469  6.134   -7.645  1.00 0.00 ? 4   ILE B HD11 6  
ATOM 10548 H HD12 . ILE B 2 4   ? -6.445  5.642   -8.994  1.00 0.00 ? 4   ILE B HD12 6  
ATOM 10549 H HD13 . ILE B 2 4   ? -8.122  5.100   -8.915  1.00 0.00 ? 4   ILE B HD13 6  
ATOM 10550 N N    . TRP B 2 5   ? -3.710  4.412   -10.000 1.00 0.00 ? 5   TRP B N    6  
ATOM 10551 C CA   . TRP B 2 5   ? -3.157  5.618   -10.605 1.00 0.00 ? 5   TRP B CA   6  
ATOM 10552 C C    . TRP B 2 5   ? -4.155  6.246   -11.572 1.00 0.00 ? 5   TRP B C    6  
ATOM 10553 O O    . TRP B 2 5   ? -4.441  5.688   -12.632 1.00 0.00 ? 5   TRP B O    6  
ATOM 10554 C CB   . TRP B 2 5   ? -1.853  5.295   -11.339 1.00 0.00 ? 5   TRP B CB   6  
ATOM 10555 C CG   . TRP B 2 5   ? -0.754  4.827   -10.434 1.00 0.00 ? 5   TRP B CG   6  
ATOM 10556 C CD1  . TRP B 2 5   ? -0.863  3.940   -9.402  1.00 0.00 ? 5   TRP B CD1  6  
ATOM 10557 C CD2  . TRP B 2 5   ? 0.622   5.219   -10.482 1.00 0.00 ? 5   TRP B CD2  6  
ATOM 10558 N NE1  . TRP B 2 5   ? 0.361   3.759   -8.805  1.00 0.00 ? 5   TRP B NE1  6  
ATOM 10559 C CE2  . TRP B 2 5   ? 1.289   4.533   -9.450  1.00 0.00 ? 5   TRP B CE2  6  
ATOM 10560 C CE3  . TRP B 2 5   ? 1.355   6.084   -11.299 1.00 0.00 ? 5   TRP B CE3  6  
ATOM 10561 C CZ2  . TRP B 2 5   ? 2.653   4.685   -9.214  1.00 0.00 ? 5   TRP B CZ2  6  
ATOM 10562 C CZ3  . TRP B 2 5   ? 2.709   6.235   -11.064 1.00 0.00 ? 5   TRP B CZ3  6  
ATOM 10563 C CH2  . TRP B 2 5   ? 3.346   5.538   -10.029 1.00 0.00 ? 5   TRP B CH2  6  
ATOM 10564 H H    . TRP B 2 5   ? -3.829  3.612   -10.554 1.00 0.00 ? 5   TRP B H    6  
ATOM 10565 H HA   . TRP B 2 5   ? -2.949  6.322   -9.812  1.00 0.00 ? 5   TRP B HA   6  
ATOM 10566 H HB2  . TRP B 2 5   ? -2.041  4.518   -12.064 1.00 0.00 ? 5   TRP B HB2  6  
ATOM 10567 H HB3  . TRP B 2 5   ? -1.509  6.182   -11.851 1.00 0.00 ? 5   TRP B HB3  6  
ATOM 10568 H HD1  . TRP B 2 5   ? -1.783  3.459   -9.106  1.00 0.00 ? 5   TRP B HD1  6  
ATOM 10569 H HE1  . TRP B 2 5   ? 0.541   3.171   -8.042  1.00 0.00 ? 5   TRP B HE1  6  
ATOM 10570 H HE3  . TRP B 2 5   ? 0.881   6.629   -12.102 1.00 0.00 ? 5   TRP B HE3  6  
ATOM 10571 H HZ2  . TRP B 2 5   ? 3.159   4.155   -8.421  1.00 0.00 ? 5   TRP B HZ2  6  
ATOM 10572 H HZ3  . TRP B 2 5   ? 3.291   6.899   -11.685 1.00 0.00 ? 5   TRP B HZ3  6  
ATOM 10573 H HH2  . TRP B 2 5   ? 4.405   5.687   -9.881  1.00 0.00 ? 5   TRP B HH2  6  
ATOM 10574 N N    . TRP B 2 6   ? -4.680  7.410   -11.205 1.00 0.00 ? 6   TRP B N    6  
ATOM 10575 C CA   . TRP B 2 6   ? -5.644  8.111   -12.046 1.00 0.00 ? 6   TRP B CA   6  
ATOM 10576 C C    . TRP B 2 6   ? -4.937  8.880   -13.157 1.00 0.00 ? 6   TRP B C    6  
ATOM 10577 O O    . TRP B 2 6   ? -4.803  10.102  -13.093 1.00 0.00 ? 6   TRP B O    6  
ATOM 10578 C CB   . TRP B 2 6   ? -6.489  9.070   -11.204 1.00 0.00 ? 6   TRP B CB   6  
ATOM 10579 C CG   . TRP B 2 6   ? -7.790  9.438   -11.852 1.00 0.00 ? 6   TRP B CG   6  
ATOM 10580 C CD1  . TRP B 2 6   ? -8.040  9.530   -13.190 1.00 0.00 ? 6   TRP B CD1  6  
ATOM 10581 C CD2  . TRP B 2 6   ? -9.017  9.764   -11.190 1.00 0.00 ? 6   TRP B CD2  6  
ATOM 10582 N NE1  . TRP B 2 6   ? -9.348  9.892   -13.402 1.00 0.00 ? 6   TRP B NE1  6  
ATOM 10583 C CE2  . TRP B 2 6   ? -9.969  10.041  -12.189 1.00 0.00 ? 6   TRP B CE2  6  
ATOM 10584 C CE3  . TRP B 2 6   ? -9.405  9.847   -9.850  1.00 0.00 ? 6   TRP B CE3  6  
ATOM 10585 C CZ2  . TRP B 2 6   ? -11.282 10.396  -11.891 1.00 0.00 ? 6   TRP B CZ2  6  
ATOM 10586 C CZ3  . TRP B 2 6   ? -10.709 10.199  -9.554  1.00 0.00 ? 6   TRP B CZ3  6  
ATOM 10587 C CH2  . TRP B 2 6   ? -11.634 10.469  -10.571 1.00 0.00 ? 6   TRP B CH2  6  
ATOM 10588 H H    . TRP B 2 6   ? -4.413  7.808   -10.350 1.00 0.00 ? 6   TRP B H    6  
ATOM 10589 H HA   . TRP B 2 6   ? -6.292  7.372   -12.493 1.00 0.00 ? 6   TRP B HA   6  
ATOM 10590 H HB2  . TRP B 2 6   ? -6.709  8.607   -10.254 1.00 0.00 ? 6   TRP B HB2  6  
ATOM 10591 H HB3  . TRP B 2 6   ? -5.931  9.979   -11.036 1.00 0.00 ? 6   TRP B HB3  6  
ATOM 10592 H HD1  . TRP B 2 6   ? -7.307  9.343   -13.961 1.00 0.00 ? 6   TRP B HD1  6  
ATOM 10593 H HE1  . TRP B 2 6   ? -9.769  10.022  -14.278 1.00 0.00 ? 6   TRP B HE1  6  
ATOM 10594 H HE3  . TRP B 2 6   ? -8.707  9.641   -9.052  1.00 0.00 ? 6   TRP B HE3  6  
ATOM 10595 H HZ2  . TRP B 2 6   ? -12.008 10.606  -12.662 1.00 0.00 ? 6   TRP B HZ2  6  
ATOM 10596 H HZ3  . TRP B 2 6   ? -11.027 10.268  -8.525  1.00 0.00 ? 6   TRP B HZ3  6  
ATOM 10597 H HH2  . TRP B 2 6   ? -12.642 10.742  -10.294 1.00 0.00 ? 6   TRP B HH2  6  
ATOM 10598 N N    . VAL B 2 7   ? -4.481  8.155   -14.174 1.00 0.00 ? 7   VAL B N    6  
ATOM 10599 C CA   . VAL B 2 7   ? -3.786  8.769   -15.298 1.00 0.00 ? 7   VAL B CA   6  
ATOM 10600 C C    . VAL B 2 7   ? -4.498  8.472   -16.614 1.00 0.00 ? 7   VAL B C    6  
ATOM 10601 O O    . VAL B 2 7   ? -3.940  8.812   -17.678 1.00 0.00 ? 7   VAL B O    6  
ATOM 10602 C CB   . VAL B 2 7   ? -2.329  8.275   -15.397 1.00 0.00 ? 7   VAL B CB   6  
ATOM 10603 C CG1  . VAL B 2 7   ? -1.536  9.138   -16.366 1.00 0.00 ? 7   VAL B CG1  6  
ATOM 10604 C CG2  . VAL B 2 7   ? -1.673  8.264   -14.024 1.00 0.00 ? 7   VAL B CG2  6  
ATOM 10605 O OXT  . VAL B 2 7   ? -5.608  7.901   -16.569 1.00 0.00 ? 7   VAL B OXT  6  
ATOM 10606 H H    . VAL B 2 7   ? -4.617  7.184   -14.168 1.00 0.00 ? 7   VAL B H    6  
ATOM 10607 H HA   . VAL B 2 7   ? -3.773  9.837   -15.140 1.00 0.00 ? 7   VAL B HA   6  
ATOM 10608 H HB   . VAL B 2 7   ? -2.337  7.264   -15.776 1.00 0.00 ? 7   VAL B HB   6  
ATOM 10609 H HG11 . VAL B 2 7   ? -1.844  10.169  -16.265 1.00 0.00 ? 7   VAL B HG11 6  
ATOM 10610 H HG12 . VAL B 2 7   ? -0.483  9.054   -16.143 1.00 0.00 ? 7   VAL B HG12 6  
ATOM 10611 H HG13 . VAL B 2 7   ? -1.718  8.805   -17.377 1.00 0.00 ? 7   VAL B HG13 6  
ATOM 10612 H HG21 . VAL B 2 7   ? -0.603  8.169   -14.137 1.00 0.00 ? 7   VAL B HG21 6  
ATOM 10613 H HG22 . VAL B 2 7   ? -1.901  9.185   -13.508 1.00 0.00 ? 7   VAL B HG22 6  
ATOM 10614 H HG23 . VAL B 2 7   ? -2.050  7.428   -13.452 1.00 0.00 ? 7   VAL B HG23 6  
ATOM 10615 N N    . GLY A 1 1   ? -1.245  26.607  -14.232 1.00 0.00 ? 376 GLY A N    7  
ATOM 10616 C CA   . GLY A 1 1   ? -1.755  26.673  -15.629 1.00 0.00 ? 376 GLY A CA   7  
ATOM 10617 C C    . GLY A 1 1   ? -0.735  26.194  -16.643 1.00 0.00 ? 376 GLY A C    7  
ATOM 10618 O O    . GLY A 1 1   ? 0.359   26.748  -16.743 1.00 0.00 ? 376 GLY A O    7  
ATOM 10619 H H1   . GLY A 1 1   ? -0.742  27.485  -13.993 1.00 0.00 ? 376 GLY A H1   7  
ATOM 10620 H H2   . GLY A 1 1   ? -0.590  25.806  -14.128 1.00 0.00 ? 376 GLY A H2   7  
ATOM 10621 H H3   . GLY A 1 1   ? -2.036  26.481  -13.569 1.00 0.00 ? 376 GLY A H3   7  
ATOM 10622 H HA2  . GLY A 1 1   ? -2.640  26.058  -15.707 1.00 0.00 ? 376 GLY A HA2  7  
ATOM 10623 H HA3  . GLY A 1 1   ? -2.020  27.696  -15.856 1.00 0.00 ? 376 GLY A HA3  7  
ATOM 10624 N N    . SER A 1 2   ? -1.097  25.163  -17.400 1.00 0.00 ? 377 SER A N    7  
ATOM 10625 C CA   . SER A 1 2   ? -0.209  24.607  -18.413 1.00 0.00 ? 377 SER A CA   7  
ATOM 10626 C C    . SER A 1 2   ? -1.008  23.969  -19.545 1.00 0.00 ? 377 SER A C    7  
ATOM 10627 O O    . SER A 1 2   ? -2.230  23.848  -19.462 1.00 0.00 ? 377 SER A O    7  
ATOM 10628 C CB   . SER A 1 2   ? 0.730   23.573  -17.790 1.00 0.00 ? 377 SER A CB   7  
ATOM 10629 O OG   . SER A 1 2   ? 1.407   22.832  -18.789 1.00 0.00 ? 377 SER A OG   7  
ATOM 10630 H H    . SER A 1 2   ? -1.984  24.765  -17.274 1.00 0.00 ? 377 SER A H    7  
ATOM 10631 H HA   . SER A 1 2   ? 0.380   25.417  -18.818 1.00 0.00 ? 377 SER A HA   7  
ATOM 10632 H HB2  . SER A 1 2   ? 1.461   24.077  -17.175 1.00 0.00 ? 377 SER A HB2  7  
ATOM 10633 H HB3  . SER A 1 2   ? 0.156   22.892  -17.179 1.00 0.00 ? 377 SER A HB3  7  
ATOM 10634 H HG   . SER A 1 2   ? 1.064   21.935  -18.811 1.00 0.00 ? 377 SER A HG   7  
ATOM 10635 N N    . HIS A 1 3   ? -0.310  23.562  -20.600 1.00 0.00 ? 378 HIS A N    7  
ATOM 10636 C CA   . HIS A 1 3   ? -0.954  22.936  -21.749 1.00 0.00 ? 378 HIS A CA   7  
ATOM 10637 C C    . HIS A 1 3   ? -0.317  21.588  -22.065 1.00 0.00 ? 378 HIS A C    7  
ATOM 10638 O O    . HIS A 1 3   ? -0.100  21.251  -23.229 1.00 0.00 ? 378 HIS A O    7  
ATOM 10639 C CB   . HIS A 1 3   ? -0.868  23.855  -22.969 1.00 0.00 ? 378 HIS A CB   7  
ATOM 10640 C CG   . HIS A 1 3   ? 0.533   24.254  -23.318 1.00 0.00 ? 378 HIS A CG   7  
ATOM 10641 N ND1  . HIS A 1 3   ? 1.178   25.322  -22.730 1.00 0.00 ? 378 HIS A ND1  7  
ATOM 10642 C CD2  . HIS A 1 3   ? 1.414   23.721  -24.196 1.00 0.00 ? 378 HIS A CD2  7  
ATOM 10643 C CE1  . HIS A 1 3   ? 2.395   25.430  -23.234 1.00 0.00 ? 378 HIS A CE1  7  
ATOM 10644 N NE2  . HIS A 1 3   ? 2.564   24.470  -24.125 1.00 0.00 ? 378 HIS A NE2  7  
ATOM 10645 H H    . HIS A 1 3   ? 0.663   23.686  -20.607 1.00 0.00 ? 378 HIS A H    7  
ATOM 10646 H HA   . HIS A 1 3   ? -1.994  22.781  -21.500 1.00 0.00 ? 378 HIS A HA   7  
ATOM 10647 H HB2  . HIS A 1 3   ? -1.290  23.347  -23.824 1.00 0.00 ? 378 HIS A HB2  7  
ATOM 10648 H HB3  . HIS A 1 3   ? -1.433  24.754  -22.775 1.00 0.00 ? 378 HIS A HB3  7  
ATOM 10649 H HD1  . HIS A 1 3   ? 0.800   25.914  -22.047 1.00 0.00 ? 378 HIS A HD1  7  
ATOM 10650 H HD2  . HIS A 1 3   ? 1.245   22.866  -24.836 1.00 0.00 ? 378 HIS A HD2  7  
ATOM 10651 H HE1  . HIS A 1 3   ? 3.127   26.177  -22.964 1.00 0.00 ? 378 HIS A HE1  7  
ATOM 10652 H HE2  . HIS A 1 3   ? 3.411   24.256  -24.569 1.00 0.00 ? 378 HIS A HE2  7  
ATOM 10653 N N    . MET A 1 4   ? -0.019  20.819  -21.022 1.00 0.00 ? 379 MET A N    7  
ATOM 10654 C CA   . MET A 1 4   ? 0.594   19.506  -21.193 1.00 0.00 ? 379 MET A CA   7  
ATOM 10655 C C    . MET A 1 4   ? 0.138   18.544  -20.098 1.00 0.00 ? 379 MET A C    7  
ATOM 10656 O O    . MET A 1 4   ? 0.925   18.147  -19.238 1.00 0.00 ? 379 MET A O    7  
ATOM 10657 C CB   . MET A 1 4   ? 2.119   19.626  -21.184 1.00 0.00 ? 379 MET A CB   7  
ATOM 10658 C CG   . MET A 1 4   ? 2.663   20.406  -19.998 1.00 0.00 ? 379 MET A CG   7  
ATOM 10659 S SD   . MET A 1 4   ? 4.401   20.051  -19.672 1.00 0.00 ? 379 MET A SD   7  
ATOM 10660 C CE   . MET A 1 4   ? 4.634   20.906  -18.115 1.00 0.00 ? 379 MET A CE   7  
ATOM 10661 H H    . MET A 1 4   ? -0.216  21.142  -20.119 1.00 0.00 ? 379 MET A H    7  
ATOM 10662 H HA   . MET A 1 4   ? 0.278   19.117  -22.148 1.00 0.00 ? 379 MET A HA   7  
ATOM 10663 H HB2  . MET A 1 4   ? 2.547   18.634  -21.162 1.00 0.00 ? 379 MET A HB2  7  
ATOM 10664 H HB3  . MET A 1 4   ? 2.434   20.123  -22.090 1.00 0.00 ? 379 MET A HB3  7  
ATOM 10665 H HG2  . MET A 1 4   ? 2.559   21.462  -20.200 1.00 0.00 ? 379 MET A HG2  7  
ATOM 10666 H HG3  . MET A 1 4   ? 2.087   20.150  -19.121 1.00 0.00 ? 379 MET A HG3  7  
ATOM 10667 H HE1  . MET A 1 4   ? 5.669   20.835  -17.818 1.00 0.00 ? 379 MET A HE1  7  
ATOM 10668 H HE2  . MET A 1 4   ? 4.363   21.945  -18.231 1.00 0.00 ? 379 MET A HE2  7  
ATOM 10669 H HE3  . MET A 1 4   ? 4.009   20.453  -17.360 1.00 0.00 ? 379 MET A HE3  7  
ATOM 10670 N N    . LYS A 1 5   ? -1.137  18.173  -20.139 1.00 0.00 ? 380 LYS A N    7  
ATOM 10671 C CA   . LYS A 1 5   ? -1.700  17.256  -19.154 1.00 0.00 ? 380 LYS A CA   7  
ATOM 10672 C C    . LYS A 1 5   ? -2.726  16.329  -19.801 1.00 0.00 ? 380 LYS A C    7  
ATOM 10673 O O    . LYS A 1 5   ? -3.861  16.730  -20.060 1.00 0.00 ? 380 LYS A O    7  
ATOM 10674 C CB   . LYS A 1 5   ? -2.352  18.037  -18.011 1.00 0.00 ? 380 LYS A CB   7  
ATOM 10675 C CG   . LYS A 1 5   ? -1.376  18.443  -16.919 1.00 0.00 ? 380 LYS A CG   7  
ATOM 10676 C CD   . LYS A 1 5   ? -1.916  19.597  -16.090 1.00 0.00 ? 380 LYS A CD   7  
ATOM 10677 C CE   . LYS A 1 5   ? -1.207  20.902  -16.418 1.00 0.00 ? 380 LYS A CE   7  
ATOM 10678 N NZ   . LYS A 1 5   ? -0.907  21.695  -15.194 1.00 0.00 ? 380 LYS A NZ   7  
ATOM 10679 H H    . LYS A 1 5   ? -1.714  18.523  -20.850 1.00 0.00 ? 380 LYS A H    7  
ATOM 10680 H HA   . LYS A 1 5   ? -0.893  16.660  -18.758 1.00 0.00 ? 380 LYS A HA   7  
ATOM 10681 H HB2  . LYS A 1 5   ? -2.803  18.932  -18.412 1.00 0.00 ? 380 LYS A HB2  7  
ATOM 10682 H HB3  . LYS A 1 5   ? -3.121  17.424  -17.566 1.00 0.00 ? 380 LYS A HB3  7  
ATOM 10683 H HG2  . LYS A 1 5   ? -1.204  17.596  -16.270 1.00 0.00 ? 380 LYS A HG2  7  
ATOM 10684 H HG3  . LYS A 1 5   ? -0.444  18.743  -17.375 1.00 0.00 ? 380 LYS A HG3  7  
ATOM 10685 H HD2  . LYS A 1 5   ? -2.971  19.712  -16.292 1.00 0.00 ? 380 LYS A HD2  7  
ATOM 10686 H HD3  . LYS A 1 5   ? -1.771  19.374  -15.043 1.00 0.00 ? 380 LYS A HD3  7  
ATOM 10687 H HE2  . LYS A 1 5   ? -0.281  20.676  -16.926 1.00 0.00 ? 380 LYS A HE2  7  
ATOM 10688 H HE3  . LYS A 1 5   ? -1.840  21.486  -17.071 1.00 0.00 ? 380 LYS A HE3  7  
ATOM 10689 H HZ1  . LYS A 1 5   ? -1.017  22.710  -15.391 1.00 0.00 ? 380 LYS A HZ1  7  
ATOM 10690 H HZ2  . LYS A 1 5   ? -1.558  21.430  -14.428 1.00 0.00 ? 380 LYS A HZ2  7  
ATOM 10691 H HZ3  . LYS A 1 5   ? 0.069   21.515  -14.883 1.00 0.00 ? 380 LYS A HZ3  7  
ATOM 10692 N N    . LYS A 1 6   ? -2.319  15.091  -20.059 1.00 0.00 ? 381 LYS A N    7  
ATOM 10693 C CA   . LYS A 1 6   ? -3.203  14.109  -20.677 1.00 0.00 ? 381 LYS A CA   7  
ATOM 10694 C C    . LYS A 1 6   ? -4.103  13.452  -19.633 1.00 0.00 ? 381 LYS A C    7  
ATOM 10695 O O    . LYS A 1 6   ? -3.701  13.258  -18.485 1.00 0.00 ? 381 LYS A O    7  
ATOM 10696 C CB   . LYS A 1 6   ? -2.381  13.043  -21.409 1.00 0.00 ? 381 LYS A CB   7  
ATOM 10697 C CG   . LYS A 1 6   ? -2.505  13.117  -22.923 1.00 0.00 ? 381 LYS A CG   7  
ATOM 10698 C CD   . LYS A 1 6   ? -1.184  13.491  -23.576 1.00 0.00 ? 381 LYS A CD   7  
ATOM 10699 C CE   . LYS A 1 6   ? -1.335  13.667  -25.079 1.00 0.00 ? 381 LYS A CE   7  
ATOM 10700 N NZ   . LYS A 1 6   ? -1.570  15.090  -25.452 1.00 0.00 ? 381 LYS A NZ   7  
ATOM 10701 H H    . LYS A 1 6   ? -1.403  14.832  -19.829 1.00 0.00 ? 381 LYS A H    7  
ATOM 10702 H HA   . LYS A 1 6   ? -3.823  14.627  -21.392 1.00 0.00 ? 381 LYS A HA   7  
ATOM 10703 H HB2  . LYS A 1 6   ? -1.341  13.164  -21.146 1.00 0.00 ? 381 LYS A HB2  7  
ATOM 10704 H HB3  . LYS A 1 6   ? -2.712  12.066  -21.090 1.00 0.00 ? 381 LYS A HB3  7  
ATOM 10705 H HG2  . LYS A 1 6   ? -2.818  12.153  -23.297 1.00 0.00 ? 381 LYS A HG2  7  
ATOM 10706 H HG3  . LYS A 1 6   ? -3.245  13.862  -23.177 1.00 0.00 ? 381 LYS A HG3  7  
ATOM 10707 H HD2  . LYS A 1 6   ? -0.830  14.418  -23.150 1.00 0.00 ? 381 LYS A HD2  7  
ATOM 10708 H HD3  . LYS A 1 6   ? -0.464  12.707  -23.385 1.00 0.00 ? 381 LYS A HD3  7  
ATOM 10709 H HE2  . LYS A 1 6   ? -0.432  13.323  -25.562 1.00 0.00 ? 381 LYS A HE2  7  
ATOM 10710 H HE3  . LYS A 1 6   ? -2.170  13.072  -25.416 1.00 0.00 ? 381 LYS A HE3  7  
ATOM 10711 H HZ1  . LYS A 1 6   ? -1.966  15.146  -26.413 1.00 0.00 ? 381 LYS A HZ1  7  
ATOM 10712 H HZ2  . LYS A 1 6   ? -2.239  15.527  -24.787 1.00 0.00 ? 381 LYS A HZ2  7  
ATOM 10713 H HZ3  . LYS A 1 6   ? -0.676  15.618  -25.425 1.00 0.00 ? 381 LYS A HZ3  7  
ATOM 10714 N N    . TYR A 1 7   ? -5.324  13.114  -20.040 1.00 0.00 ? 382 TYR A N    7  
ATOM 10715 C CA   . TYR A 1 7   ? -6.283  12.481  -19.142 1.00 0.00 ? 382 TYR A CA   7  
ATOM 10716 C C    . TYR A 1 7   ? -7.159  11.485  -19.897 1.00 0.00 ? 382 TYR A C    7  
ATOM 10717 O O    . TYR A 1 7   ? -7.703  11.802  -20.955 1.00 0.00 ? 382 TYR A O    7  
ATOM 10718 C CB   . TYR A 1 7   ? -7.157  13.544  -18.472 1.00 0.00 ? 382 TYR A CB   7  
ATOM 10719 C CG   . TYR A 1 7   ? -8.216  12.975  -17.554 1.00 0.00 ? 382 TYR A CG   7  
ATOM 10720 C CD1  . TYR A 1 7   ? -7.867  12.344  -16.367 1.00 0.00 ? 382 TYR A CD1  7  
ATOM 10721 C CD2  . TYR A 1 7   ? -9.564  13.069  -17.877 1.00 0.00 ? 382 TYR A CD2  7  
ATOM 10722 C CE1  . TYR A 1 7   ? -8.833  11.823  -15.527 1.00 0.00 ? 382 TYR A CE1  7  
ATOM 10723 C CE2  . TYR A 1 7   ? -10.535 12.551  -17.041 1.00 0.00 ? 382 TYR A CE2  7  
ATOM 10724 C CZ   . TYR A 1 7   ? -10.164 11.929  -15.869 1.00 0.00 ? 382 TYR A CZ   7  
ATOM 10725 O OH   . TYR A 1 7   ? -11.129 11.411  -15.034 1.00 0.00 ? 382 TYR A OH   7  
ATOM 10726 H H    . TYR A 1 7   ? -5.586  13.296  -20.967 1.00 0.00 ? 382 TYR A H    7  
ATOM 10727 H HA   . TYR A 1 7   ? -5.728  11.952  -18.382 1.00 0.00 ? 382 TYR A HA   7  
ATOM 10728 H HB2  . TYR A 1 7   ? -6.530  14.198  -17.885 1.00 0.00 ? 382 TYR A HB2  7  
ATOM 10729 H HB3  . TYR A 1 7   ? -7.655  14.123  -19.236 1.00 0.00 ? 382 TYR A HB3  7  
ATOM 10730 H HD1  . TYR A 1 7   ? -6.824  12.263  -16.103 1.00 0.00 ? 382 TYR A HD1  7  
ATOM 10731 H HD2  . TYR A 1 7   ? -9.852  13.557  -18.797 1.00 0.00 ? 382 TYR A HD2  7  
ATOM 10732 H HE1  . TYR A 1 7   ? -8.542  11.336  -14.608 1.00 0.00 ? 382 TYR A HE1  7  
ATOM 10733 H HE2  . TYR A 1 7   ? -11.578 12.633  -17.310 1.00 0.00 ? 382 TYR A HE2  7  
ATOM 10734 H HH   . TYR A 1 7   ? -11.131 11.897  -14.207 1.00 0.00 ? 382 TYR A HH   7  
ATOM 10735 N N    . ILE A 1 8   ? -7.292  10.280  -19.349 1.00 0.00 ? 383 ILE A N    7  
ATOM 10736 C CA   . ILE A 1 8   ? -8.106  9.243   -19.976 1.00 0.00 ? 383 ILE A CA   7  
ATOM 10737 C C    . ILE A 1 8   ? -9.124  8.656   -19.000 1.00 0.00 ? 383 ILE A C    7  
ATOM 10738 O O    . ILE A 1 8   ? -9.743  7.630   -19.282 1.00 0.00 ? 383 ILE A O    7  
ATOM 10739 C CB   . ILE A 1 8   ? -7.234  8.102   -20.536 1.00 0.00 ? 383 ILE A CB   7  
ATOM 10740 C CG1  . ILE A 1 8   ? -6.123  7.743   -19.547 1.00 0.00 ? 383 ILE A CG1  7  
ATOM 10741 C CG2  . ILE A 1 8   ? -6.652  8.499   -21.886 1.00 0.00 ? 383 ILE A CG2  7  
ATOM 10742 C CD1  . ILE A 1 8   ? -5.183  6.669   -20.050 1.00 0.00 ? 383 ILE A CD1  7  
ATOM 10743 H H    . ILE A 1 8   ? -6.836  10.085  -18.504 1.00 0.00 ? 383 ILE A H    7  
ATOM 10744 H HA   . ILE A 1 8   ? -8.636  9.694   -20.801 1.00 0.00 ? 383 ILE A HA   7  
ATOM 10745 H HB   . ILE A 1 8   ? -7.866  7.238   -20.687 1.00 0.00 ? 383 ILE A HB   7  
ATOM 10746 H HG12 . ILE A 1 8   ? -5.537  8.625   -19.339 1.00 0.00 ? 383 ILE A HG12 7  
ATOM 10747 H HG13 . ILE A 1 8   ? -6.570  7.391   -18.630 1.00 0.00 ? 383 ILE A HG13 7  
ATOM 10748 H HG21 . ILE A 1 8   ? -6.752  9.567   -22.021 1.00 0.00 ? 383 ILE A HG21 7  
ATOM 10749 H HG22 . ILE A 1 8   ? -5.608  8.227   -21.924 1.00 0.00 ? 383 ILE A HG22 7  
ATOM 10750 H HG23 . ILE A 1 8   ? -7.187  7.987   -22.672 1.00 0.00 ? 383 ILE A HG23 7  
ATOM 10751 H HD11 . ILE A 1 8   ? -5.688  5.713   -20.035 1.00 0.00 ? 383 ILE A HD11 7  
ATOM 10752 H HD12 . ILE A 1 8   ? -4.881  6.899   -21.061 1.00 0.00 ? 383 ILE A HD12 7  
ATOM 10753 H HD13 . ILE A 1 8   ? -4.312  6.625   -19.414 1.00 0.00 ? 383 ILE A HD13 7  
ATOM 10754 N N    . GLY A 1 9   ? -9.299  9.315   -17.855 1.00 0.00 ? 384 GLY A N    7  
ATOM 10755 C CA   . GLY A 1 9   ? -10.251 8.851   -16.858 1.00 0.00 ? 384 GLY A CA   7  
ATOM 10756 C C    . GLY A 1 9   ? -10.212 7.348   -16.641 1.00 0.00 ? 384 GLY A C    7  
ATOM 10757 O O    . GLY A 1 9   ? -11.196 6.654   -16.897 1.00 0.00 ? 384 GLY A O    7  
ATOM 10758 H H    . GLY A 1 9   ? -8.783  10.130  -17.688 1.00 0.00 ? 384 GLY A H    7  
ATOM 10759 H HA2  . GLY A 1 9   ? -10.034 9.340   -15.919 1.00 0.00 ? 384 GLY A HA2  7  
ATOM 10760 H HA3  . GLY A 1 9   ? -11.245 9.130   -17.173 1.00 0.00 ? 384 GLY A HA3  7  
ATOM 10761 N N    . ILE A 1 10  ? -9.079  6.844   -16.167 1.00 0.00 ? 385 ILE A N    7  
ATOM 10762 C CA   . ILE A 1 10  ? -8.929  5.416   -15.914 1.00 0.00 ? 385 ILE A CA   7  
ATOM 10763 C C    . ILE A 1 10  ? -7.978  5.160   -14.749 1.00 0.00 ? 385 ILE A C    7  
ATOM 10764 O O    . ILE A 1 10  ? -6.833  5.612   -14.756 1.00 0.00 ? 385 ILE A O    7  
ATOM 10765 C CB   . ILE A 1 10  ? -8.415  4.672   -17.165 1.00 0.00 ? 385 ILE A CB   7  
ATOM 10766 C CG1  . ILE A 1 10  ? -8.314  3.169   -16.892 1.00 0.00 ? 385 ILE A CG1  7  
ATOM 10767 C CG2  . ILE A 1 10  ? -7.069  5.228   -17.601 1.00 0.00 ? 385 ILE A CG2  7  
ATOM 10768 C CD1  . ILE A 1 10  ? -9.623  2.539   -16.474 1.00 0.00 ? 385 ILE A CD1  7  
ATOM 10769 H H    . ILE A 1 10  ? -8.328  7.446   -15.979 1.00 0.00 ? 385 ILE A H    7  
ATOM 10770 H HA   . ILE A 1 10  ? -9.902  5.020   -15.662 1.00 0.00 ? 385 ILE A HA   7  
ATOM 10771 H HB   . ILE A 1 10  ? -9.119  4.837   -17.966 1.00 0.00 ? 385 ILE A HB   7  
ATOM 10772 H HG12 . ILE A 1 10  ? -7.977  2.669   -17.788 1.00 0.00 ? 385 ILE A HG12 7  
ATOM 10773 H HG13 . ILE A 1 10  ? -7.595  3.001   -16.102 1.00 0.00 ? 385 ILE A HG13 7  
ATOM 10774 H HG21 . ILE A 1 10  ? -6.879  6.159   -17.087 1.00 0.00 ? 385 ILE A HG21 7  
ATOM 10775 H HG22 . ILE A 1 10  ? -6.290  4.519   -17.361 1.00 0.00 ? 385 ILE A HG22 7  
ATOM 10776 H HG23 . ILE A 1 10  ? -7.080  5.401   -18.667 1.00 0.00 ? 385 ILE A HG23 7  
ATOM 10777 H HD11 . ILE A 1 10  ? -9.549  2.200   -15.451 1.00 0.00 ? 385 ILE A HD11 7  
ATOM 10778 H HD12 . ILE A 1 10  ? -10.415 3.268   -16.553 1.00 0.00 ? 385 ILE A HD12 7  
ATOM 10779 H HD13 . ILE A 1 10  ? -9.840  1.700   -17.117 1.00 0.00 ? 385 ILE A HD13 7  
ATOM 10780 N N    . ARG A 1 11  ? -8.461  4.430   -13.749 1.00 0.00 ? 386 ARG A N    7  
ATOM 10781 C CA   . ARG A 1 11  ? -7.657  4.108   -12.577 1.00 0.00 ? 386 ARG A CA   7  
ATOM 10782 C C    . ARG A 1 11  ? -6.893  2.808   -12.793 1.00 0.00 ? 386 ARG A C    7  
ATOM 10783 O O    . ARG A 1 11  ? -7.491  1.759   -13.039 1.00 0.00 ? 386 ARG A O    7  
ATOM 10784 C CB   . ARG A 1 11  ? -8.544  3.993   -11.336 1.00 0.00 ? 386 ARG A CB   7  
ATOM 10785 C CG   . ARG A 1 11  ? -8.839  5.329   -10.672 1.00 0.00 ? 386 ARG A CG   7  
ATOM 10786 C CD   . ARG A 1 11  ? -10.193 5.320   -9.982  1.00 0.00 ? 386 ARG A CD   7  
ATOM 10787 N NE   . ARG A 1 11  ? -10.268 6.319   -8.916  1.00 0.00 ? 386 ARG A NE   7  
ATOM 10788 C CZ   . ARG A 1 11  ? -11.170 7.299   -8.869  1.00 0.00 ? 386 ARG A CZ   7  
ATOM 10789 N NH1  . ARG A 1 11  ? -12.089 7.424   -9.820  1.00 0.00 ? 386 ARG A NH1  7  
ATOM 10790 N NH2  . ARG A 1 11  ? -11.155 8.160   -7.860  1.00 0.00 ? 386 ARG A NH2  7  
ATOM 10791 H H    . ARG A 1 11  ? -9.382  4.096   -13.803 1.00 0.00 ? 386 ARG A H    7  
ATOM 10792 H HA   . ARG A 1 11  ? -6.947  4.909   -12.430 1.00 0.00 ? 386 ARG A HA   7  
ATOM 10793 H HB2  . ARG A 1 11  ? -9.483  3.541   -11.619 1.00 0.00 ? 386 ARG A HB2  7  
ATOM 10794 H HB3  . ARG A 1 11  ? -8.053  3.359   -10.614 1.00 0.00 ? 386 ARG A HB3  7  
ATOM 10795 H HG2  . ARG A 1 11  ? -8.074  5.533   -9.938  1.00 0.00 ? 386 ARG A HG2  7  
ATOM 10796 H HG3  . ARG A 1 11  ? -8.834  6.104   -11.426 1.00 0.00 ? 386 ARG A HG3  7  
ATOM 10797 H HD2  . ARG A 1 11  ? -10.956 5.525   -10.714 1.00 0.00 ? 386 ARG A HD2  7  
ATOM 10798 H HD3  . ARG A 1 11  ? -10.358 4.341   -9.557  1.00 0.00 ? 386 ARG A HD3  7  
ATOM 10799 H HE   . ARG A 1 11  ? -9.608  6.256   -8.194  1.00 0.00 ? 386 ARG A HE   7  
ATOM 10800 H HH11 . ARG A 1 11  ? -12.112 6.782   -10.583 1.00 0.00 ? 386 ARG A HH11 7  
ATOM 10801 H HH12 . ARG A 1 11  ? -12.758 8.165   -9.771  1.00 0.00 ? 386 ARG A HH12 7  
ATOM 10802 H HH21 . ARG A 1 11  ? -10.468 8.073   -7.139  1.00 0.00 ? 386 ARG A HH21 7  
ATOM 10803 H HH22 . ARG A 1 11  ? -11.830 8.897   -7.821  1.00 0.00 ? 386 ARG A HH22 7  
ATOM 10804 N N    . MET A 1 12  ? -5.571  2.882   -12.704 1.00 0.00 ? 387 MET A N    7  
ATOM 10805 C CA   . MET A 1 12  ? -4.726  1.709   -12.894 1.00 0.00 ? 387 MET A CA   7  
ATOM 10806 C C    . MET A 1 12  ? -3.744  1.549   -11.740 1.00 0.00 ? 387 MET A C    7  
ATOM 10807 O O    . MET A 1 12  ? -3.290  2.532   -11.156 1.00 0.00 ? 387 MET A O    7  
ATOM 10808 C CB   . MET A 1 12  ? -3.967  1.805   -14.221 1.00 0.00 ? 387 MET A CB   7  
ATOM 10809 C CG   . MET A 1 12  ? -3.370  3.180   -14.488 1.00 0.00 ? 387 MET A CG   7  
ATOM 10810 S SD   . MET A 1 12  ? -1.569  3.175   -14.459 1.00 0.00 ? 387 MET A SD   7  
ATOM 10811 C CE   . MET A 1 12  ? -1.229  4.920   -14.247 1.00 0.00 ? 387 MET A CE   7  
ATOM 10812 H H    . MET A 1 12  ? -5.153  3.746   -12.507 1.00 0.00 ? 387 MET A H    7  
ATOM 10813 H HA   . MET A 1 12  ? -5.370  0.842   -12.923 1.00 0.00 ? 387 MET A HA   7  
ATOM 10814 H HB2  . MET A 1 12  ? -3.164  1.082   -14.215 1.00 0.00 ? 387 MET A HB2  7  
ATOM 10815 H HB3  . MET A 1 12  ? -4.645  1.569   -15.027 1.00 0.00 ? 387 MET A HB3  7  
ATOM 10816 H HG2  . MET A 1 12  ? -3.698  3.515   -15.461 1.00 0.00 ? 387 MET A HG2  7  
ATOM 10817 H HG3  . MET A 1 12  ? -3.726  3.867   -13.736 1.00 0.00 ? 387 MET A HG3  7  
ATOM 10818 H HE1  . MET A 1 12  ? -1.108  5.384   -15.215 1.00 0.00 ? 387 MET A HE1  7  
ATOM 10819 H HE2  . MET A 1 12  ? -2.053  5.385   -13.725 1.00 0.00 ? 387 MET A HE2  7  
ATOM 10820 H HE3  . MET A 1 12  ? -0.323  5.044   -13.673 1.00 0.00 ? 387 MET A HE3  7  
ATOM 10821 N N    . MET A 1 13  ? -3.422  0.300   -11.418 1.00 0.00 ? 388 MET A N    7  
ATOM 10822 C CA   . MET A 1 13  ? -2.495  0.005   -10.332 1.00 0.00 ? 388 MET A CA   7  
ATOM 10823 C C    . MET A 1 13  ? -1.378  -0.919  -10.805 1.00 0.00 ? 388 MET A C    7  
ATOM 10824 O O    . MET A 1 13  ? -1.399  -1.410  -11.934 1.00 0.00 ? 388 MET A O    7  
ATOM 10825 C CB   . MET A 1 13  ? -3.239  -0.639  -9.159  1.00 0.00 ? 388 MET A CB   7  
ATOM 10826 C CG   . MET A 1 13  ? -4.247  -1.694  -9.584  1.00 0.00 ? 388 MET A CG   7  
ATOM 10827 S SD   . MET A 1 13  ? -5.414  -2.108  -8.273  1.00 0.00 ? 388 MET A SD   7  
ATOM 10828 C CE   . MET A 1 13  ? -4.304  -2.300  -6.880  1.00 0.00 ? 388 MET A CE   7  
ATOM 10829 H H    . MET A 1 13  ? -3.819  -0.441  -11.921 1.00 0.00 ? 388 MET A H    7  
ATOM 10830 H HA   . MET A 1 13  ? -2.060  0.936   -10.003 1.00 0.00 ? 388 MET A HA   7  
ATOM 10831 H HB2  . MET A 1 13  ? -2.518  -1.105  -8.504  1.00 0.00 ? 388 MET A HB2  7  
ATOM 10832 H HB3  . MET A 1 13  ? -3.763  0.131   -8.614  1.00 0.00 ? 388 MET A HB3  7  
ATOM 10833 H HG2  . MET A 1 13  ? -4.801  -1.322  -10.433 1.00 0.00 ? 388 MET A HG2  7  
ATOM 10834 H HG3  . MET A 1 13  ? -3.714  -2.590  -9.868  1.00 0.00 ? 388 MET A HG3  7  
ATOM 10835 H HE1  . MET A 1 13  ? -3.663  -3.154  -7.046  1.00 0.00 ? 388 MET A HE1  7  
ATOM 10836 H HE2  . MET A 1 13  ? -3.699  -1.411  -6.776  1.00 0.00 ? 388 MET A HE2  7  
ATOM 10837 H HE3  . MET A 1 13  ? -4.880  -2.452  -5.979  1.00 0.00 ? 388 MET A HE3  7  
ATOM 10838 N N    . SER A 1 14  ? -0.404  -1.155  -9.932  1.00 0.00 ? 389 SER A N    7  
ATOM 10839 C CA   . SER A 1 14  ? 0.722   -2.023  -10.258 1.00 0.00 ? 389 SER A CA   7  
ATOM 10840 C C    . SER A 1 14  ? 0.412   -3.471  -9.898  1.00 0.00 ? 389 SER A C    7  
ATOM 10841 O O    . SER A 1 14  ? 0.510   -3.867  -8.736  1.00 0.00 ? 389 SER A O    7  
ATOM 10842 C CB   . SER A 1 14  ? 1.979   -1.560  -9.519  1.00 0.00 ? 389 SER A CB   7  
ATOM 10843 O OG   . SER A 1 14  ? 1.735   -1.425  -8.130  1.00 0.00 ? 389 SER A OG   7  
ATOM 10844 H H    . SER A 1 14  ? -0.446  -0.737  -9.047  1.00 0.00 ? 389 SER A H    7  
ATOM 10845 H HA   . SER A 1 14  ? 0.894   -1.957  -11.321 1.00 0.00 ? 389 SER A HA   7  
ATOM 10846 H HB2  . SER A 1 14  ? 2.767   -2.285  -9.664  1.00 0.00 ? 389 SER A HB2  7  
ATOM 10847 H HB3  . SER A 1 14  ? 2.294   -0.604  -9.912  1.00 0.00 ? 389 SER A HB3  7  
ATOM 10848 H HG   . SER A 1 14  ? 2.544   -1.159  -7.687  1.00 0.00 ? 389 SER A HG   7  
ATOM 10849 N N    . LEU A 1 15  ? 0.036   -4.257  -10.901 1.00 0.00 ? 390 LEU A N    7  
ATOM 10850 C CA   . LEU A 1 15  ? -0.292  -5.663  -10.691 1.00 0.00 ? 390 LEU A CA   7  
ATOM 10851 C C    . LEU A 1 15  ? 0.891   -6.413  -10.086 1.00 0.00 ? 390 LEU A C    7  
ATOM 10852 O O    . LEU A 1 15  ? 1.715   -6.977  -10.805 1.00 0.00 ? 390 LEU A O    7  
ATOM 10853 C CB   . LEU A 1 15  ? -0.704  -6.317  -12.011 1.00 0.00 ? 390 LEU A CB   7  
ATOM 10854 C CG   . LEU A 1 15  ? -1.706  -7.465  -11.880 1.00 0.00 ? 390 LEU A CG   7  
ATOM 10855 C CD1  . LEU A 1 15  ? -2.956  -7.004  -11.141 1.00 0.00 ? 390 LEU A CD1  7  
ATOM 10856 C CD2  . LEU A 1 15  ? -2.066  -8.015  -13.252 1.00 0.00 ? 390 LEU A CD2  7  
ATOM 10857 H H    . LEU A 1 15  ? -0.025  -3.883  -11.806 1.00 0.00 ? 390 LEU A H    7  
ATOM 10858 H HA   . LEU A 1 15  ? -1.121  -5.710  -10.002 1.00 0.00 ? 390 LEU A HA   7  
ATOM 10859 H HB2  . LEU A 1 15  ? -1.138  -5.556  -12.644 1.00 0.00 ? 390 LEU A HB2  7  
ATOM 10860 H HB3  . LEU A 1 15  ? 0.183   -6.698  -12.493 1.00 0.00 ? 390 LEU A HB3  7  
ATOM 10861 H HG   . LEU A 1 15  ? -1.256  -8.262  -11.307 1.00 0.00 ? 390 LEU A HG   7  
ATOM 10862 H HD11 . LEU A 1 15  ? -2.878  -5.950  -10.922 1.00 0.00 ? 390 LEU A HD11 7  
ATOM 10863 H HD12 . LEU A 1 15  ? -3.826  -7.182  -11.755 1.00 0.00 ? 390 LEU A HD12 7  
ATOM 10864 H HD13 . LEU A 1 15  ? -3.051  -7.557  -10.217 1.00 0.00 ? 390 LEU A HD13 7  
ATOM 10865 H HD21 . LEU A 1 15  ? -2.737  -7.332  -13.750 1.00 0.00 ? 390 LEU A HD21 7  
ATOM 10866 H HD22 . LEU A 1 15  ? -1.169  -8.131  -13.840 1.00 0.00 ? 390 LEU A HD22 7  
ATOM 10867 H HD23 . LEU A 1 15  ? -2.549  -8.976  -13.140 1.00 0.00 ? 390 LEU A HD23 7  
ATOM 10868 N N    . THR A 1 16  ? 0.966   -6.417  -8.759  1.00 0.00 ? 391 THR A N    7  
ATOM 10869 C CA   . THR A 1 16  ? 2.046   -7.098  -8.056  1.00 0.00 ? 391 THR A CA   7  
ATOM 10870 C C    . THR A 1 16  ? 1.829   -8.609  -8.062  1.00 0.00 ? 391 THR A C    7  
ATOM 10871 O O    . THR A 1 16  ? 0.761   -9.090  -8.441  1.00 0.00 ? 391 THR A O    7  
ATOM 10872 C CB   . THR A 1 16  ? 2.146   -6.585  -6.617  1.00 0.00 ? 391 THR A CB   7  
ATOM 10873 O OG1  . THR A 1 16  ? 3.180   -7.254  -5.914  1.00 0.00 ? 391 THR A OG1  7  
ATOM 10874 C CG2  . THR A 1 16  ? 0.864   -6.755  -5.830  1.00 0.00 ? 391 THR A CG2  7  
ATOM 10875 H H    . THR A 1 16  ? 0.277   -5.950  -8.240  1.00 0.00 ? 391 THR A H    7  
ATOM 10876 H HA   . THR A 1 16  ? 2.968   -6.877  -8.572  1.00 0.00 ? 391 THR A HA   7  
ATOM 10877 H HB   . THR A 1 16  ? 2.381   -5.530  -6.640  1.00 0.00 ? 391 THR A HB   7  
ATOM 10878 H HG1  . THR A 1 16  ? 2.886   -8.133  -5.668  1.00 0.00 ? 391 THR A HG1  7  
ATOM 10879 H HG21 . THR A 1 16  ? 0.046   -6.942  -6.510  1.00 0.00 ? 391 THR A HG21 7  
ATOM 10880 H HG22 . THR A 1 16  ? 0.968   -7.589  -5.152  1.00 0.00 ? 391 THR A HG22 7  
ATOM 10881 H HG23 . THR A 1 16  ? 0.665   -5.854  -5.267  1.00 0.00 ? 391 THR A HG23 7  
ATOM 10882 N N    . SER A 1 17  ? 2.849   -9.352  -7.643  1.00 0.00 ? 392 SER A N    7  
ATOM 10883 C CA   . SER A 1 17  ? 2.770   -10.810 -7.604  1.00 0.00 ? 392 SER A CA   7  
ATOM 10884 C C    . SER A 1 17  ? 1.562   -11.274 -6.795  1.00 0.00 ? 392 SER A C    7  
ATOM 10885 O O    . SER A 1 17  ? 0.912   -12.259 -7.143  1.00 0.00 ? 392 SER A O    7  
ATOM 10886 C CB   . SER A 1 17  ? 4.052   -11.393 -7.005  1.00 0.00 ? 392 SER A CB   7  
ATOM 10887 O OG   . SER A 1 17  ? 4.033   -11.322 -5.589  1.00 0.00 ? 392 SER A OG   7  
ATOM 10888 H H    . SER A 1 17  ? 3.674   -8.910  -7.355  1.00 0.00 ? 392 SER A H    7  
ATOM 10889 H HA   . SER A 1 17  ? 2.665   -11.162 -8.619  1.00 0.00 ? 392 SER A HA   7  
ATOM 10890 H HB2  . SER A 1 17  ? 4.145   -12.428 -7.299  1.00 0.00 ? 392 SER A HB2  7  
ATOM 10891 H HB3  . SER A 1 17  ? 4.903   -10.838 -7.370  1.00 0.00 ? 392 SER A HB3  7  
ATOM 10892 H HG   . SER A 1 17  ? 3.736   -10.451 -5.317  1.00 0.00 ? 392 SER A HG   7  
ATOM 10893 N N    . SER A 1 18  ? 1.270   -10.559 -5.713  1.00 0.00 ? 393 SER A N    7  
ATOM 10894 C CA   . SER A 1 18  ? 0.141   -10.900 -4.855  1.00 0.00 ? 393 SER A CA   7  
ATOM 10895 C C    . SER A 1 18  ? -1.184  -10.628 -5.559  1.00 0.00 ? 393 SER A C    7  
ATOM 10896 O O    . SER A 1 18  ? -2.020  -11.520 -5.694  1.00 0.00 ? 393 SER A O    7  
ATOM 10897 C CB   . SER A 1 18  ? 0.210   -10.106 -3.549  1.00 0.00 ? 393 SER A CB   7  
ATOM 10898 O OG   . SER A 1 18  ? -0.385  -10.825 -2.482  1.00 0.00 ? 393 SER A OG   7  
ATOM 10899 H H    . SER A 1 18  ? 1.826   -9.785  -5.487  1.00 0.00 ? 393 SER A H    7  
ATOM 10900 H HA   . SER A 1 18  ? 0.205   -11.953 -4.628  1.00 0.00 ? 393 SER A HA   7  
ATOM 10901 H HB2  . SER A 1 18  ? 1.244   -9.912  -3.302  1.00 0.00 ? 393 SER A HB2  7  
ATOM 10902 H HB3  . SER A 1 18  ? -0.311  -9.168  -3.671  1.00 0.00 ? 393 SER A HB3  7  
ATOM 10903 H HG   . SER A 1 18  ? 0.084   -11.652 -2.352  1.00 0.00 ? 393 SER A HG   7  
ATOM 10904 N N    . LYS A 1 19  ? -1.369  -9.390  -6.005  1.00 0.00 ? 394 LYS A N    7  
ATOM 10905 C CA   . LYS A 1 19  ? -2.595  -9.002  -6.694  1.00 0.00 ? 394 LYS A CA   7  
ATOM 10906 C C    . LYS A 1 19  ? -2.765  -9.791  -7.989  1.00 0.00 ? 394 LYS A C    7  
ATOM 10907 O O    . LYS A 1 19  ? -3.875  -10.193 -8.340  1.00 0.00 ? 394 LYS A O    7  
ATOM 10908 C CB   . LYS A 1 19  ? -2.581  -7.502  -6.996  1.00 0.00 ? 394 LYS A CB   7  
ATOM 10909 C CG   . LYS A 1 19  ? -3.958  -6.858  -6.941  1.00 0.00 ? 394 LYS A CG   7  
ATOM 10910 C CD   . LYS A 1 19  ? -3.924  -5.527  -6.207  1.00 0.00 ? 394 LYS A CD   7  
ATOM 10911 C CE   . LYS A 1 19  ? -3.918  -5.723  -4.700  1.00 0.00 ? 394 LYS A CE   7  
ATOM 10912 N NZ   . LYS A 1 19  ? -5.235  -6.203  -4.197  1.00 0.00 ? 394 LYS A NZ   7  
ATOM 10913 H H    . LYS A 1 19  ? -0.666  -8.721  -5.866  1.00 0.00 ? 394 LYS A H    7  
ATOM 10914 H HA   . LYS A 1 19  ? -3.426  -9.221  -6.041  1.00 0.00 ? 394 LYS A HA   7  
ATOM 10915 H HB2  . LYS A 1 19  ? -1.946  -7.008  -6.276  1.00 0.00 ? 394 LYS A HB2  7  
ATOM 10916 H HB3  . LYS A 1 19  ? -2.175  -7.350  -7.985  1.00 0.00 ? 394 LYS A HB3  7  
ATOM 10917 H HG2  . LYS A 1 19  ? -4.306  -6.691  -7.950  1.00 0.00 ? 394 LYS A HG2  7  
ATOM 10918 H HG3  . LYS A 1 19  ? -4.636  -7.524  -6.430  1.00 0.00 ? 394 LYS A HG3  7  
ATOM 10919 H HD2  . LYS A 1 19  ? -3.031  -4.992  -6.493  1.00 0.00 ? 394 LYS A HD2  7  
ATOM 10920 H HD3  . LYS A 1 19  ? -4.794  -4.952  -6.483  1.00 0.00 ? 394 LYS A HD3  7  
ATOM 10921 H HE2  . LYS A 1 19  ? -3.160  -6.450  -4.447  1.00 0.00 ? 394 LYS A HE2  7  
ATOM 10922 H HE3  . LYS A 1 19  ? -3.684  -4.780  -4.228  1.00 0.00 ? 394 LYS A HE3  7  
ATOM 10923 H HZ1  . LYS A 1 19  ? -5.281  -6.103  -3.163  1.00 0.00 ? 394 LYS A HZ1  7  
ATOM 10924 H HZ2  . LYS A 1 19  ? -6.004  -5.647  -4.622  1.00 0.00 ? 394 LYS A HZ2  7  
ATOM 10925 H HZ3  . LYS A 1 19  ? -5.369  -7.204  -4.445  1.00 0.00 ? 394 LYS A HZ3  7  
ATOM 10926 N N    . ALA A 1 20  ? -1.660  -10.009 -8.693  1.00 0.00 ? 395 ALA A N    7  
ATOM 10927 C CA   . ALA A 1 20  ? -1.688  -10.749 -9.949  1.00 0.00 ? 395 ALA A CA   7  
ATOM 10928 C C    . ALA A 1 20  ? -2.228  -12.160 -9.744  1.00 0.00 ? 395 ALA A C    7  
ATOM 10929 O O    . ALA A 1 20  ? -3.107  -12.611 -10.479 1.00 0.00 ? 395 ALA A O    7  
ATOM 10930 C CB   . ALA A 1 20  ? -0.297  -10.799 -10.562 1.00 0.00 ? 395 ALA A CB   7  
ATOM 10931 H H    . ALA A 1 20  ? -0.806  -9.664  -8.361  1.00 0.00 ? 395 ALA A H    7  
ATOM 10932 H HA   . ALA A 1 20  ? -2.338  -10.222 -10.632 1.00 0.00 ? 395 ALA A HA   7  
ATOM 10933 H HB1  . ALA A 1 20  ? -0.120  -9.895  -11.126 1.00 0.00 ? 395 ALA A HB1  7  
ATOM 10934 H HB2  . ALA A 1 20  ? 0.440   -10.883 -9.777  1.00 0.00 ? 395 ALA A HB2  7  
ATOM 10935 H HB3  . ALA A 1 20  ? -0.222  -11.653 -11.219 1.00 0.00 ? 395 ALA A HB3  7  
ATOM 10936 N N    . LYS A 1 21  ? -1.698  -12.853 -8.742  1.00 0.00 ? 396 LYS A N    7  
ATOM 10937 C CA   . LYS A 1 21  ? -2.129  -14.215 -8.441  1.00 0.00 ? 396 LYS A CA   7  
ATOM 10938 C C    . LYS A 1 21  ? -3.507  -14.219 -7.785  1.00 0.00 ? 396 LYS A C    7  
ATOM 10939 O O    . LYS A 1 21  ? -4.259  -15.187 -7.904  1.00 0.00 ? 396 LYS A O    7  
ATOM 10940 C CB   . LYS A 1 21  ? -1.112  -14.902 -7.527  1.00 0.00 ? 396 LYS A CB   7  
ATOM 10941 C CG   . LYS A 1 21  ? -0.688  -16.278 -8.016  1.00 0.00 ? 396 LYS A CG   7  
ATOM 10942 C CD   . LYS A 1 21  ? -1.799  -17.303 -7.832  1.00 0.00 ? 396 LYS A CD   7  
ATOM 10943 C CE   . LYS A 1 21  ? -1.992  -18.155 -9.078  1.00 0.00 ? 396 LYS A CE   7  
ATOM 10944 N NZ   . LYS A 1 21  ? -1.782  -19.603 -8.801  1.00 0.00 ? 396 LYS A NZ   7  
ATOM 10945 H H    . LYS A 1 21  ? -1.001  -12.440 -8.191  1.00 0.00 ? 396 LYS A H    7  
ATOM 10946 H HA   . LYS A 1 21  ? -2.186  -14.756 -9.373  1.00 0.00 ? 396 LYS A HA   7  
ATOM 10947 H HB2  . LYS A 1 21  ? -0.231  -14.282 -7.459  1.00 0.00 ? 396 LYS A HB2  7  
ATOM 10948 H HB3  . LYS A 1 21  ? -1.542  -15.011 -6.543  1.00 0.00 ? 396 LYS A HB3  7  
ATOM 10949 H HG2  . LYS A 1 21  ? -0.440  -16.216 -9.066  1.00 0.00 ? 396 LYS A HG2  7  
ATOM 10950 H HG3  . LYS A 1 21  ? 0.179   -16.597 -7.458  1.00 0.00 ? 396 LYS A HG3  7  
ATOM 10951 H HD2  . LYS A 1 21  ? -1.545  -17.948 -7.004  1.00 0.00 ? 396 LYS A HD2  7  
ATOM 10952 H HD3  . LYS A 1 21  ? -2.721  -16.784 -7.616  1.00 0.00 ? 396 LYS A HD3  7  
ATOM 10953 H HE2  . LYS A 1 21  ? -2.998  -18.011 -9.445  1.00 0.00 ? 396 LYS A HE2  7  
ATOM 10954 H HE3  . LYS A 1 21  ? -1.287  -17.836 -9.832  1.00 0.00 ? 396 LYS A HE3  7  
ATOM 10955 H HZ1  . LYS A 1 21  ? -1.554  -20.106 -9.682  1.00 0.00 ? 396 LYS A HZ1  7  
ATOM 10956 H HZ2  . LYS A 1 21  ? -0.999  -19.729 -8.128  1.00 0.00 ? 396 LYS A HZ2  7  
ATOM 10957 H HZ3  . LYS A 1 21  ? -2.644  -20.018 -8.393  1.00 0.00 ? 396 LYS A HZ3  7  
ATOM 10958 N N    . GLU A 1 22  ? -3.832  -13.132 -7.091  1.00 0.00 ? 397 GLU A N    7  
ATOM 10959 C CA   . GLU A 1 22  ? -5.121  -13.011 -6.416  1.00 0.00 ? 397 GLU A CA   7  
ATOM 10960 C C    . GLU A 1 22  ? -6.273  -13.181 -7.401  1.00 0.00 ? 397 GLU A C    7  
ATOM 10961 O O    . GLU A 1 22  ? -7.235  -13.899 -7.129  1.00 0.00 ? 397 GLU A O    7  
ATOM 10962 C CB   . GLU A 1 22  ? -5.227  -11.655 -5.717  1.00 0.00 ? 397 GLU A CB   7  
ATOM 10963 C CG   . GLU A 1 22  ? -5.883  -11.726 -4.348  1.00 0.00 ? 397 GLU A CG   7  
ATOM 10964 C CD   . GLU A 1 22  ? -7.265  -12.346 -4.395  1.00 0.00 ? 397 GLU A CD   7  
ATOM 10965 O OE1  . GLU A 1 22  ? -8.227  -11.629 -4.744  1.00 0.00 ? 397 GLU A OE1  7  
ATOM 10966 O OE2  . GLU A 1 22  ? -7.387  -13.549 -4.085  1.00 0.00 ? 397 GLU A OE2  7  
ATOM 10967 H H    . GLU A 1 22  ? -3.192  -12.394 -7.031  1.00 0.00 ? 397 GLU A H    7  
ATOM 10968 H HA   . GLU A 1 22  ? -5.180  -13.793 -5.674  1.00 0.00 ? 397 GLU A HA   7  
ATOM 10969 H HB2  . GLU A 1 22  ? -4.236  -11.245 -5.596  1.00 0.00 ? 397 GLU A HB2  7  
ATOM 10970 H HB3  . GLU A 1 22  ? -5.809  -10.988 -6.336  1.00 0.00 ? 397 GLU A HB3  7  
ATOM 10971 H HG2  . GLU A 1 22  ? -5.261  -12.321 -3.695  1.00 0.00 ? 397 GLU A HG2  7  
ATOM 10972 H HG3  . GLU A 1 22  ? -5.967  -10.725 -3.951  1.00 0.00 ? 397 GLU A HG3  7  
ATOM 10973 N N    . LEU A 1 23  ? -6.169  -12.515 -8.546  1.00 0.00 ? 398 LEU A N    7  
ATOM 10974 C CA   . LEU A 1 23  ? -7.202  -12.593 -9.572  1.00 0.00 ? 398 LEU A CA   7  
ATOM 10975 C C    . LEU A 1 23  ? -7.266  -13.991 -10.176 1.00 0.00 ? 398 LEU A C    7  
ATOM 10976 O O    . LEU A 1 23  ? -8.329  -14.449 -10.594 1.00 0.00 ? 398 LEU A O    7  
ATOM 10977 C CB   . LEU A 1 23  ? -6.939  -11.562 -10.671 1.00 0.00 ? 398 LEU A CB   7  
ATOM 10978 C CG   . LEU A 1 23  ? -6.804  -10.118 -10.185 1.00 0.00 ? 398 LEU A CG   7  
ATOM 10979 C CD1  . LEU A 1 23  ? -6.099  -9.267  -11.229 1.00 0.00 ? 398 LEU A CD1  7  
ATOM 10980 C CD2  . LEU A 1 23  ? -8.170  -9.538  -9.855  1.00 0.00 ? 398 LEU A CD2  7  
ATOM 10981 H H    . LEU A 1 23  ? -5.378  -11.958 -8.705  1.00 0.00 ? 398 LEU A H    7  
ATOM 10982 H HA   . LEU A 1 23  ? -8.150  -12.372 -9.104  1.00 0.00 ? 398 LEU A HA   7  
ATOM 10983 H HB2  . LEU A 1 23  ? -6.027  -11.836 -11.181 1.00 0.00 ? 398 LEU A HB2  7  
ATOM 10984 H HB3  . LEU A 1 23  ? -7.754  -11.605 -11.378 1.00 0.00 ? 398 LEU A HB3  7  
ATOM 10985 H HG   . LEU A 1 23  ? -6.207  -10.103 -9.284  1.00 0.00 ? 398 LEU A HG   7  
ATOM 10986 H HD11 . LEU A 1 23  ? -6.584  -9.396  -12.186 1.00 0.00 ? 398 LEU A HD11 7  
ATOM 10987 H HD12 . LEU A 1 23  ? -6.147  -8.229  -10.939 1.00 0.00 ? 398 LEU A HD12 7  
ATOM 10988 H HD13 . LEU A 1 23  ? -5.066  -9.573  -11.305 1.00 0.00 ? 398 LEU A HD13 7  
ATOM 10989 H HD21 . LEU A 1 23  ? -8.157  -8.471  -10.018 1.00 0.00 ? 398 LEU A HD21 7  
ATOM 10990 H HD22 . LEU A 1 23  ? -8.917  -9.991  -10.492 1.00 0.00 ? 398 LEU A HD22 7  
ATOM 10991 H HD23 . LEU A 1 23  ? -8.408  -9.741  -8.821  1.00 0.00 ? 398 LEU A HD23 7  
ATOM 10992 N N    . LYS A 1 24  ? -6.121  -14.665 -10.218 1.00 0.00 ? 399 LYS A N    7  
ATOM 10993 C CA   . LYS A 1 24  ? -6.046  -16.011 -10.771 1.00 0.00 ? 399 LYS A CA   7  
ATOM 10994 C C    . LYS A 1 24  ? -6.560  -17.041 -9.771  1.00 0.00 ? 399 LYS A C    7  
ATOM 10995 O O    . LYS A 1 24  ? -7.106  -18.076 -10.155 1.00 0.00 ? 399 LYS A O    7  
ATOM 10996 C CB   . LYS A 1 24  ? -4.606  -16.341 -11.167 1.00 0.00 ? 399 LYS A CB   7  
ATOM 10997 C CG   . LYS A 1 24  ? -4.276  -15.988 -12.607 1.00 0.00 ? 399 LYS A CG   7  
ATOM 10998 C CD   . LYS A 1 24  ? -4.878  -16.991 -13.578 1.00 0.00 ? 399 LYS A CD   7  
ATOM 10999 C CE   . LYS A 1 24  ? -4.259  -18.371 -13.412 1.00 0.00 ? 399 LYS A CE   7  
ATOM 11000 N NZ   . LYS A 1 24  ? -3.778  -18.922 -14.710 1.00 0.00 ? 399 LYS A NZ   7  
ATOM 11001 H H    . LYS A 1 24  ? -5.307  -14.246 -9.869  1.00 0.00 ? 399 LYS A H    7  
ATOM 11002 H HA   . LYS A 1 24  ? -6.668  -16.042 -11.653 1.00 0.00 ? 399 LYS A HA   7  
ATOM 11003 H HB2  . LYS A 1 24  ? -3.933  -15.795 -10.522 1.00 0.00 ? 399 LYS A HB2  7  
ATOM 11004 H HB3  . LYS A 1 24  ? -4.440  -17.399 -11.031 1.00 0.00 ? 399 LYS A HB3  7  
ATOM 11005 H HG2  . LYS A 1 24  ? -4.671  -15.007 -12.827 1.00 0.00 ? 399 LYS A HG2  7  
ATOM 11006 H HG3  . LYS A 1 24  ? -3.203  -15.981 -12.729 1.00 0.00 ? 399 LYS A HG3  7  
ATOM 11007 H HD2  . LYS A 1 24  ? -5.940  -17.060 -13.396 1.00 0.00 ? 399 LYS A HD2  7  
ATOM 11008 H HD3  . LYS A 1 24  ? -4.706  -16.647 -14.588 1.00 0.00 ? 399 LYS A HD3  7  
ATOM 11009 H HE2  . LYS A 1 24  ? -3.424  -18.299 -12.731 1.00 0.00 ? 399 LYS A HE2  7  
ATOM 11010 H HE3  . LYS A 1 24  ? -5.003  -19.038 -13.001 1.00 0.00 ? 399 LYS A HE3  7  
ATOM 11011 H HZ1  . LYS A 1 24  ? -4.584  -19.118 -15.336 1.00 0.00 ? 399 LYS A HZ1  7  
ATOM 11012 H HZ2  . LYS A 1 24  ? -3.148  -18.239 -15.176 1.00 0.00 ? 399 LYS A HZ2  7  
ATOM 11013 H HZ3  . LYS A 1 24  ? -3.255  -19.807 -14.550 1.00 0.00 ? 399 LYS A HZ3  7  
ATOM 11014 N N    . ASP A 1 25  ? -6.383  -16.751 -8.486  1.00 0.00 ? 400 ASP A N    7  
ATOM 11015 C CA   . ASP A 1 25  ? -6.828  -17.653 -7.429  1.00 0.00 ? 400 ASP A CA   7  
ATOM 11016 C C    . ASP A 1 25  ? -8.332  -17.892 -7.517  1.00 0.00 ? 400 ASP A C    7  
ATOM 11017 O O    . ASP A 1 25  ? -8.790  -19.035 -7.514  1.00 0.00 ? 400 ASP A O    7  
ATOM 11018 C CB   . ASP A 1 25  ? -6.466  -17.080 -6.057  1.00 0.00 ? 400 ASP A CB   7  
ATOM 11019 C CG   . ASP A 1 25  ? -5.389  -17.888 -5.359  1.00 0.00 ? 400 ASP A CG   7  
ATOM 11020 O OD1  . ASP A 1 25  ? -4.197  -17.684 -5.672  1.00 0.00 ? 400 ASP A OD1  7  
ATOM 11021 O OD2  . ASP A 1 25  ? -5.738  -18.725 -4.499  1.00 0.00 ? 400 ASP A OD2  7  
ATOM 11022 H H    . ASP A 1 25  ? -5.940  -15.911 -8.243  1.00 0.00 ? 400 ASP A H    7  
ATOM 11023 H HA   . ASP A 1 25  ? -6.318  -18.594 -7.562  1.00 0.00 ? 400 ASP A HA   7  
ATOM 11024 H HB2  . ASP A 1 25  ? -6.108  -16.069 -6.177  1.00 0.00 ? 400 ASP A HB2  7  
ATOM 11025 H HB3  . ASP A 1 25  ? -7.347  -17.073 -5.431  1.00 0.00 ? 400 ASP A HB3  7  
ATOM 11026 N N    . ARG A 1 26  ? -9.096  -16.807 -7.597  1.00 0.00 ? 401 ARG A N    7  
ATOM 11027 C CA   . ARG A 1 26  ? -10.548 -16.900 -7.687  1.00 0.00 ? 401 ARG A CA   7  
ATOM 11028 C C    . ARG A 1 26  ? -10.983 -17.248 -9.107  1.00 0.00 ? 401 ARG A C    7  
ATOM 11029 O O    . ARG A 1 26  ? -11.491 -18.339 -9.361  1.00 0.00 ? 401 ARG A O    7  
ATOM 11030 C CB   . ARG A 1 26  ? -11.193 -15.581 -7.251  1.00 0.00 ? 401 ARG A CB   7  
ATOM 11031 C CG   . ARG A 1 26  ? -11.604 -15.561 -5.788  1.00 0.00 ? 401 ARG A CG   7  
ATOM 11032 C CD   . ARG A 1 26  ? -11.046 -14.345 -5.065  1.00 0.00 ? 401 ARG A CD   7  
ATOM 11033 N NE   . ARG A 1 26  ? -11.836 -13.998 -3.886  1.00 0.00 ? 401 ARG A NE   7  
ATOM 11034 C CZ   . ARG A 1 26  ? -11.770 -12.820 -3.269  1.00 0.00 ? 401 ARG A CZ   7  
ATOM 11035 N NH1  . ARG A 1 26  ? -10.952 -11.874 -3.716  1.00 0.00 ? 401 ARG A NH1  7  
ATOM 11036 N NH2  . ARG A 1 26  ? -12.523 -12.587 -2.203  1.00 0.00 ? 401 ARG A NH2  7  
ATOM 11037 H H    . ARG A 1 26  ? -8.672  -15.923 -7.596  1.00 0.00 ? 401 ARG A H    7  
ATOM 11038 H HA   . ARG A 1 26  ? -10.872 -17.685 -7.022  1.00 0.00 ? 401 ARG A HA   7  
ATOM 11039 H HB2  . ARG A 1 26  ? -10.489 -14.779 -7.419  1.00 0.00 ? 401 ARG A HB2  7  
ATOM 11040 H HB3  . ARG A 1 26  ? -12.072 -15.407 -7.853  1.00 0.00 ? 401 ARG A HB3  7  
ATOM 11041 H HG2  . ARG A 1 26  ? -12.682 -15.538 -5.727  1.00 0.00 ? 401 ARG A HG2  7  
ATOM 11042 H HG3  . ARG A 1 26  ? -11.233 -16.455 -5.307  1.00 0.00 ? 401 ARG A HG3  7  
ATOM 11043 H HD2  . ARG A 1 26  ? -10.033 -14.557 -4.758  1.00 0.00 ? 401 ARG A HD2  7  
ATOM 11044 H HD3  . ARG A 1 26  ? -11.046 -13.507 -5.747  1.00 0.00 ? 401 ARG A HD3  7  
ATOM 11045 H HE   . ARG A 1 26  ? -12.448 -14.679 -3.535  1.00 0.00 ? 401 ARG A HE   7  
ATOM 11046 H HH11 . ARG A 1 26  ? -10.381 -12.043 -4.519  1.00 0.00 ? 401 ARG A HH11 7  
ATOM 11047 H HH12 . ARG A 1 26  ? -10.907 -10.991 -3.248  1.00 0.00 ? 401 ARG A HH12 7  
ATOM 11048 H HH21 . ARG A 1 26  ? -13.141 -13.296 -1.863  1.00 0.00 ? 401 ARG A HH21 7  
ATOM 11049 H HH22 . ARG A 1 26  ? -12.474 -11.703 -1.739  1.00 0.00 ? 401 ARG A HH22 7  
ATOM 11050 N N    . HIS A 1 27  ? -10.778 -16.313 -10.029 1.00 0.00 ? 402 HIS A N    7  
ATOM 11051 C CA   . HIS A 1 27  ? -11.147 -16.522 -11.424 1.00 0.00 ? 402 HIS A CA   7  
ATOM 11052 C C    . HIS A 1 27  ? -10.018 -17.206 -12.186 1.00 0.00 ? 402 HIS A C    7  
ATOM 11053 O O    . HIS A 1 27  ? -9.172  -16.545 -12.788 1.00 0.00 ? 402 HIS A O    7  
ATOM 11054 C CB   . HIS A 1 27  ? -11.496 -15.186 -12.087 1.00 0.00 ? 402 HIS A CB   7  
ATOM 11055 C CG   . HIS A 1 27  ? -12.870 -15.154 -12.679 1.00 0.00 ? 402 HIS A CG   7  
ATOM 11056 N ND1  . HIS A 1 27  ? -13.181 -14.444 -13.820 1.00 0.00 ? 402 HIS A ND1  7  
ATOM 11057 C CD2  . HIS A 1 27  ? -14.020 -15.748 -12.283 1.00 0.00 ? 402 HIS A CD2  7  
ATOM 11058 C CE1  . HIS A 1 27  ? -14.463 -14.603 -14.099 1.00 0.00 ? 402 HIS A CE1  7  
ATOM 11059 N NE2  . HIS A 1 27  ? -14.993 -15.391 -13.183 1.00 0.00 ? 402 HIS A NE2  7  
ATOM 11060 H H    . HIS A 1 27  ? -10.367 -15.463 -9.765  1.00 0.00 ? 402 HIS A H    7  
ATOM 11061 H HA   . HIS A 1 27  ? -12.015 -17.161 -11.445 1.00 0.00 ? 402 HIS A HA   7  
ATOM 11062 H HB2  . HIS A 1 27  ? -11.434 -14.400 -11.349 1.00 0.00 ? 402 HIS A HB2  7  
ATOM 11063 H HB3  . HIS A 1 27  ? -10.787 -14.986 -12.877 1.00 0.00 ? 402 HIS A HB3  7  
ATOM 11064 H HD1  . HIS A 1 27  ? -12.556 -13.903 -14.345 1.00 0.00 ? 402 HIS A HD1  7  
ATOM 11065 H HD2  . HIS A 1 27  ? -14.149 -16.386 -11.419 1.00 0.00 ? 402 HIS A HD2  7  
ATOM 11066 H HE1  . HIS A 1 27  ? -14.986 -14.165 -14.936 1.00 0.00 ? 402 HIS A HE1  7  
ATOM 11067 H HE2  . HIS A 1 27  ? -15.947 -15.603 -13.105 1.00 0.00 ? 402 HIS A HE2  7  
ATOM 11068 N N    . ARG A 1 28  ? -10.011 -18.534 -12.157 1.00 0.00 ? 403 ARG A N    7  
ATOM 11069 C CA   . ARG A 1 28  ? -8.985  -19.306 -12.847 1.00 0.00 ? 403 ARG A CA   7  
ATOM 11070 C C    . ARG A 1 28  ? -9.278  -19.387 -14.342 1.00 0.00 ? 403 ARG A C    7  
ATOM 11071 O O    . ARG A 1 28  ? -9.476  -20.471 -14.892 1.00 0.00 ? 403 ARG A O    7  
ATOM 11072 C CB   . ARG A 1 28  ? -8.884  -20.713 -12.256 1.00 0.00 ? 403 ARG A CB   7  
ATOM 11073 C CG   . ARG A 1 28  ? -7.619  -21.447 -12.667 1.00 0.00 ? 403 ARG A CG   7  
ATOM 11074 C CD   . ARG A 1 28  ? -7.802  -22.954 -12.604 1.00 0.00 ? 403 ARG A CD   7  
ATOM 11075 N NE   . ARG A 1 28  ? -6.615  -23.669 -13.067 1.00 0.00 ? 403 ARG A NE   7  
ATOM 11076 C CZ   . ARG A 1 28  ? -6.540  -24.994 -13.170 1.00 0.00 ? 403 ARG A CZ   7  
ATOM 11077 N NH1  . ARG A 1 28  ? -7.580  -25.752 -12.843 1.00 0.00 ? 403 ARG A NH1  7  
ATOM 11078 N NH2  . ARG A 1 28  ? -5.423  -25.564 -13.600 1.00 0.00 ? 403 ARG A NH2  7  
ATOM 11079 H H    . ARG A 1 28  ? -10.712 -19.007 -11.662 1.00 0.00 ? 403 ARG A H    7  
ATOM 11080 H HA   . ARG A 1 28  ? -8.042  -18.799 -12.708 1.00 0.00 ? 403 ARG A HA   7  
ATOM 11081 H HB2  . ARG A 1 28  ? -8.901  -20.641 -11.179 1.00 0.00 ? 403 ARG A HB2  7  
ATOM 11082 H HB3  . ARG A 1 28  ? -9.734  -21.292 -12.584 1.00 0.00 ? 403 ARG A HB3  7  
ATOM 11083 H HG2  . ARG A 1 28  ? -7.367  -21.166 -13.679 1.00 0.00 ? 403 ARG A HG2  7  
ATOM 11084 H HG3  . ARG A 1 28  ? -6.817  -21.161 -12.001 1.00 0.00 ? 403 ARG A HG3  7  
ATOM 11085 H HD2  . ARG A 1 28  ? -8.004  -23.237 -11.581 1.00 0.00 ? 403 ARG A HD2  7  
ATOM 11086 H HD3  . ARG A 1 28  ? -8.642  -23.229 -13.225 1.00 0.00 ? 403 ARG A HD3  7  
ATOM 11087 H HE   . ARG A 1 28  ? -5.832  -23.134 -13.315 1.00 0.00 ? 403 ARG A HE   7  
ATOM 11088 H HH11 . ARG A 1 28  ? -8.426  -25.329 -12.517 1.00 0.00 ? 403 ARG A HH11 7  
ATOM 11089 H HH12 . ARG A 1 28  ? -7.517  -26.746 -12.923 1.00 0.00 ? 403 ARG A HH12 7  
ATOM 11090 H HH21 . ARG A 1 28  ? -4.637  -24.998 -13.847 1.00 0.00 ? 403 ARG A HH21 7  
ATOM 11091 H HH22 . ARG A 1 28  ? -5.366  -26.560 -13.677 1.00 0.00 ? 403 ARG A HH22 7  
ATOM 11092 N N    . ASP A 1 29  ? -9.303  -18.230 -14.992 1.00 0.00 ? 404 ASP A N    7  
ATOM 11093 C CA   . ASP A 1 29  ? -9.570  -18.159 -16.424 1.00 0.00 ? 404 ASP A CA   7  
ATOM 11094 C C    . ASP A 1 29  ? -8.883  -16.946 -17.048 1.00 0.00 ? 404 ASP A C    7  
ATOM 11095 O O    . ASP A 1 29  ? -9.273  -16.485 -18.121 1.00 0.00 ? 404 ASP A O    7  
ATOM 11096 C CB   . ASP A 1 29  ? -11.076 -18.094 -16.681 1.00 0.00 ? 404 ASP A CB   7  
ATOM 11097 C CG   . ASP A 1 29  ? -11.441 -18.511 -18.092 1.00 0.00 ? 404 ASP A CG   7  
ATOM 11098 O OD1  . ASP A 1 29  ? -10.760 -19.400 -18.643 1.00 0.00 ? 404 ASP A OD1  7  
ATOM 11099 O OD2  . ASP A 1 29  ? -12.410 -17.950 -18.646 1.00 0.00 ? 404 ASP A OD2  7  
ATOM 11100 H H    . ASP A 1 29  ? -9.137  -17.403 -14.496 1.00 0.00 ? 404 ASP A H    7  
ATOM 11101 H HA   . ASP A 1 29  ? -9.175  -19.054 -16.879 1.00 0.00 ? 404 ASP A HA   7  
ATOM 11102 H HB2  . ASP A 1 29  ? -11.582 -18.752 -15.989 1.00 0.00 ? 404 ASP A HB2  7  
ATOM 11103 H HB3  . ASP A 1 29  ? -11.419 -17.082 -16.524 1.00 0.00 ? 404 ASP A HB3  7  
ATOM 11104 N N    . PHE A 1 30  ? -7.859  -16.435 -16.372 1.00 0.00 ? 405 PHE A N    7  
ATOM 11105 C CA   . PHE A 1 30  ? -7.118  -15.278 -16.861 1.00 0.00 ? 405 PHE A CA   7  
ATOM 11106 C C    . PHE A 1 30  ? -5.926  -15.717 -17.709 1.00 0.00 ? 405 PHE A C    7  
ATOM 11107 O O    . PHE A 1 30  ? -5.465  -16.853 -17.603 1.00 0.00 ? 405 PHE A O    7  
ATOM 11108 C CB   . PHE A 1 30  ? -6.640  -14.421 -15.688 1.00 0.00 ? 405 PHE A CB   7  
ATOM 11109 C CG   . PHE A 1 30  ? -7.725  -13.584 -15.073 1.00 0.00 ? 405 PHE A CG   7  
ATOM 11110 C CD1  . PHE A 1 30  ? -8.489  -12.732 -15.855 1.00 0.00 ? 405 PHE A CD1  7  
ATOM 11111 C CD2  . PHE A 1 30  ? -7.981  -13.650 -13.713 1.00 0.00 ? 405 PHE A CD2  7  
ATOM 11112 C CE1  . PHE A 1 30  ? -9.489  -11.961 -15.291 1.00 0.00 ? 405 PHE A CE1  7  
ATOM 11113 C CE2  . PHE A 1 30  ? -8.979  -12.881 -13.143 1.00 0.00 ? 405 PHE A CE2  7  
ATOM 11114 C CZ   . PHE A 1 30  ? -9.733  -12.036 -13.934 1.00 0.00 ? 405 PHE A CZ   7  
ATOM 11115 H H    . PHE A 1 30  ? -7.593  -16.845 -15.523 1.00 0.00 ? 405 PHE A H    7  
ATOM 11116 H HA   . PHE A 1 30  ? -7.786  -14.693 -17.476 1.00 0.00 ? 405 PHE A HA   7  
ATOM 11117 H HB2  . PHE A 1 30  ? -6.243  -15.066 -14.919 1.00 0.00 ? 405 PHE A HB2  7  
ATOM 11118 H HB3  . PHE A 1 30  ? -5.860  -13.757 -16.031 1.00 0.00 ? 405 PHE A HB3  7  
ATOM 11119 H HD1  . PHE A 1 30  ? -8.300  -12.673 -16.917 1.00 0.00 ? 405 PHE A HD1  7  
ATOM 11120 H HD2  . PHE A 1 30  ? -7.392  -14.310 -13.094 1.00 0.00 ? 405 PHE A HD2  7  
ATOM 11121 H HE1  . PHE A 1 30  ? -10.076 -11.301 -15.911 1.00 0.00 ? 405 PHE A HE1  7  
ATOM 11122 H HE2  . PHE A 1 30  ? -9.168  -12.940 -12.082 1.00 0.00 ? 405 PHE A HE2  7  
ATOM 11123 H HZ   . PHE A 1 30  ? -10.513 -11.434 -13.491 1.00 0.00 ? 405 PHE A HZ   7  
ATOM 11124 N N    . PRO A 1 31  ? -5.407  -14.819 -18.563 1.00 0.00 ? 406 PRO A N    7  
ATOM 11125 C CA   . PRO A 1 31  ? -4.261  -15.120 -19.429 1.00 0.00 ? 406 PRO A CA   7  
ATOM 11126 C C    . PRO A 1 31  ? -3.034  -15.549 -18.632 1.00 0.00 ? 406 PRO A C    7  
ATOM 11127 O O    . PRO A 1 31  ? -3.039  -15.521 -17.400 1.00 0.00 ? 406 PRO A O    7  
ATOM 11128 C CB   . PRO A 1 31  ? -3.992  -13.798 -20.160 1.00 0.00 ? 406 PRO A CB   7  
ATOM 11129 C CG   . PRO A 1 31  ? -4.703  -12.756 -19.365 1.00 0.00 ? 406 PRO A CG   7  
ATOM 11130 C CD   . PRO A 1 31  ? -5.890  -13.442 -18.754 1.00 0.00 ? 406 PRO A CD   7  
ATOM 11131 H HA   . PRO A 1 31  ? -4.505  -15.889 -20.148 1.00 0.00 ? 406 PRO A HA   7  
ATOM 11132 H HB2  . PRO A 1 31  ? -2.928  -13.612 -20.190 1.00 0.00 ? 406 PRO A HB2  7  
ATOM 11133 H HB3  . PRO A 1 31  ? -4.379  -13.857 -21.166 1.00 0.00 ? 406 PRO A HB3  7  
ATOM 11134 H HG2  . PRO A 1 31  ? -4.052  -12.374 -18.593 1.00 0.00 ? 406 PRO A HG2  7  
ATOM 11135 H HG3  . PRO A 1 31  ? -5.027  -11.956 -20.014 1.00 0.00 ? 406 PRO A HG3  7  
ATOM 11136 H HD2  . PRO A 1 31  ? -6.146  -12.985 -17.810 1.00 0.00 ? 406 PRO A HD2  7  
ATOM 11137 H HD3  . PRO A 1 31  ? -6.732  -13.419 -19.430 1.00 0.00 ? 406 PRO A HD3  7  
ATOM 11138 N N    . ASP A 1 32  ? -1.983  -15.943 -19.342 1.00 0.00 ? 407 ASP A N    7  
ATOM 11139 C CA   . ASP A 1 32  ? -0.746  -16.378 -18.700 1.00 0.00 ? 407 ASP A CA   7  
ATOM 11140 C C    . ASP A 1 32  ? 0.242   -15.223 -18.583 1.00 0.00 ? 407 ASP A C    7  
ATOM 11141 O O    . ASP A 1 32  ? 1.426   -15.371 -18.885 1.00 0.00 ? 407 ASP A O    7  
ATOM 11142 C CB   . ASP A 1 32  ? -0.118  -17.529 -19.487 1.00 0.00 ? 407 ASP A CB   7  
ATOM 11143 C CG   . ASP A 1 32  ? 0.488   -18.585 -18.583 1.00 0.00 ? 407 ASP A CG   7  
ATOM 11144 O OD1  . ASP A 1 32  ? 1.040   -18.215 -17.525 1.00 0.00 ? 407 ASP A OD1  7  
ATOM 11145 O OD2  . ASP A 1 32  ? 0.410   -19.782 -18.932 1.00 0.00 ? 407 ASP A OD2  7  
ATOM 11146 H H    . ASP A 1 32  ? -2.038  -15.944 -20.319 1.00 0.00 ? 407 ASP A H    7  
ATOM 11147 H HA   . ASP A 1 32  ? -0.994  -16.726 -17.708 1.00 0.00 ? 407 ASP A HA   7  
ATOM 11148 H HB2  . ASP A 1 32  ? -0.876  -17.998 -20.098 1.00 0.00 ? 407 ASP A HB2  7  
ATOM 11149 H HB3  . ASP A 1 32  ? 0.661   -17.138 -20.125 1.00 0.00 ? 407 ASP A HB3  7  
ATOM 11150 N N    . VAL A 1 33  ? -0.251  -14.070 -18.142 1.00 0.00 ? 408 VAL A N    7  
ATOM 11151 C CA   . VAL A 1 33  ? 0.590   -12.889 -17.984 1.00 0.00 ? 408 VAL A CA   7  
ATOM 11152 C C    . VAL A 1 33  ? 0.531   -12.362 -16.555 1.00 0.00 ? 408 VAL A C    7  
ATOM 11153 O O    . VAL A 1 33  ? -0.493  -12.479 -15.881 1.00 0.00 ? 408 VAL A O    7  
ATOM 11154 C CB   . VAL A 1 33  ? 0.169   -11.766 -18.952 1.00 0.00 ? 408 VAL A CB   7  
ATOM 11155 C CG1  . VAL A 1 33  ? 0.477   -12.157 -20.390 1.00 0.00 ? 408 VAL A CG1  7  
ATOM 11156 C CG2  . VAL A 1 33  ? -1.307  -11.441 -18.783 1.00 0.00 ? 408 VAL A CG2  7  
ATOM 11157 H H    . VAL A 1 33  ? -1.203  -14.012 -17.917 1.00 0.00 ? 408 VAL A H    7  
ATOM 11158 H HA   . VAL A 1 33  ? 1.607   -13.171 -18.212 1.00 0.00 ? 408 VAL A HA   7  
ATOM 11159 H HB   . VAL A 1 33  ? 0.740   -10.880 -18.714 1.00 0.00 ? 408 VAL A HB   7  
ATOM 11160 H HG11 . VAL A 1 33  ? 0.174   -13.179 -20.558 1.00 0.00 ? 408 VAL A HG11 7  
ATOM 11161 H HG12 . VAL A 1 33  ? -0.062  -11.505 -21.062 1.00 0.00 ? 408 VAL A HG12 7  
ATOM 11162 H HG13 . VAL A 1 33  ? 1.537   -12.061 -20.570 1.00 0.00 ? 408 VAL A HG13 7  
ATOM 11163 H HG21 . VAL A 1 33  ? -1.896  -12.322 -18.995 1.00 0.00 ? 408 VAL A HG21 7  
ATOM 11164 H HG22 . VAL A 1 33  ? -1.492  -11.121 -17.768 1.00 0.00 ? 408 VAL A HG22 7  
ATOM 11165 H HG23 . VAL A 1 33  ? -1.582  -10.651 -19.466 1.00 0.00 ? 408 VAL A HG23 7  
ATOM 11166 N N    . ILE A 1 34  ? 1.634   -11.780 -16.098 1.00 0.00 ? 409 ILE A N    7  
ATOM 11167 C CA   . ILE A 1 34  ? 1.707   -11.233 -14.746 1.00 0.00 ? 409 ILE A CA   7  
ATOM 11168 C C    . ILE A 1 34  ? 2.135   -9.769  -14.763 1.00 0.00 ? 409 ILE A C    7  
ATOM 11169 O O    . ILE A 1 34  ? 1.604   -8.950  -14.014 1.00 0.00 ? 409 ILE A O    7  
ATOM 11170 C CB   . ILE A 1 34  ? 2.685   -12.035 -13.864 1.00 0.00 ? 409 ILE A CB   7  
ATOM 11171 C CG1  . ILE A 1 34  ? 4.085   -12.035 -14.480 1.00 0.00 ? 409 ILE A CG1  7  
ATOM 11172 C CG2  . ILE A 1 34  ? 2.183   -13.459 -13.676 1.00 0.00 ? 409 ILE A CG2  7  
ATOM 11173 C CD1  . ILE A 1 34  ? 4.973   -10.924 -13.961 1.00 0.00 ? 409 ILE A CD1  7  
ATOM 11174 H H    . ILE A 1 34  ? 2.417   -11.715 -16.682 1.00 0.00 ? 409 ILE A H    7  
ATOM 11175 H HA   . ILE A 1 34  ? 0.722   -11.303 -14.308 1.00 0.00 ? 409 ILE A HA   7  
ATOM 11176 H HB   . ILE A 1 34  ? 2.725   -11.564 -12.894 1.00 0.00 ? 409 ILE A HB   7  
ATOM 11177 H HG12 . ILE A 1 34  ? 4.570   -12.974 -14.257 1.00 0.00 ? 409 ILE A HG12 7  
ATOM 11178 H HG13 . ILE A 1 34  ? 4.004   -11.923 -15.550 1.00 0.00 ? 409 ILE A HG13 7  
ATOM 11179 H HG21 . ILE A 1 34  ? 1.184   -13.437 -13.267 1.00 0.00 ? 409 ILE A HG21 7  
ATOM 11180 H HG22 . ILE A 1 34  ? 2.170   -13.965 -14.630 1.00 0.00 ? 409 ILE A HG22 7  
ATOM 11181 H HG23 . ILE A 1 34  ? 2.838   -13.985 -12.998 1.00 0.00 ? 409 ILE A HG23 7  
ATOM 11182 H HD11 . ILE A 1 34  ? 5.513   -10.481 -14.786 1.00 0.00 ? 409 ILE A HD11 7  
ATOM 11183 H HD12 . ILE A 1 34  ? 4.365   -10.170 -13.485 1.00 0.00 ? 409 ILE A HD12 7  
ATOM 11184 H HD13 . ILE A 1 34  ? 5.675   -11.327 -13.247 1.00 0.00 ? 409 ILE A HD13 7  
ATOM 11185 N N    . SER A 1 35  ? 3.095   -9.446  -15.623 1.00 0.00 ? 410 SER A N    7  
ATOM 11186 C CA   . SER A 1 35  ? 3.591   -8.079  -15.736 1.00 0.00 ? 410 SER A CA   7  
ATOM 11187 C C    . SER A 1 35  ? 2.596   -7.200  -16.485 1.00 0.00 ? 410 SER A C    7  
ATOM 11188 O O    . SER A 1 35  ? 2.086   -7.582  -17.539 1.00 0.00 ? 410 SER A O    7  
ATOM 11189 C CB   . SER A 1 35  ? 4.943   -8.062  -16.452 1.00 0.00 ? 410 SER A CB   7  
ATOM 11190 O OG   . SER A 1 35  ? 5.069   -9.165  -17.332 1.00 0.00 ? 410 SER A OG   7  
ATOM 11191 H H    . SER A 1 35  ? 3.480   -10.141 -16.195 1.00 0.00 ? 410 SER A H    7  
ATOM 11192 H HA   . SER A 1 35  ? 3.717   -7.689  -14.738 1.00 0.00 ? 410 SER A HA   7  
ATOM 11193 H HB2  . SER A 1 35  ? 5.036   -7.150  -17.023 1.00 0.00 ? 410 SER A HB2  7  
ATOM 11194 H HB3  . SER A 1 35  ? 5.736   -8.109  -15.720 1.00 0.00 ? 410 SER A HB3  7  
ATOM 11195 H HG   . SER A 1 35  ? 5.810   -9.019  -17.926 1.00 0.00 ? 410 SER A HG   7  
ATOM 11196 N N    . GLY A 1 36  ? 2.323   -6.022  -15.935 1.00 0.00 ? 411 GLY A N    7  
ATOM 11197 C CA   . GLY A 1 36  ? 1.388   -5.107  -16.566 1.00 0.00 ? 411 GLY A CA   7  
ATOM 11198 C C    . GLY A 1 36  ? 0.595   -4.303  -15.555 1.00 0.00 ? 411 GLY A C    7  
ATOM 11199 O O    . GLY A 1 36  ? 0.806   -4.427  -14.349 1.00 0.00 ? 411 GLY A O    7  
ATOM 11200 H H    . GLY A 1 36  ? 2.759   -5.771  -15.094 1.00 0.00 ? 411 GLY A H    7  
ATOM 11201 H HA2  . GLY A 1 36  ? 1.940   -4.428  -17.199 1.00 0.00 ? 411 GLY A HA2  7  
ATOM 11202 H HA3  . GLY A 1 36  ? 0.702   -5.676  -17.176 1.00 0.00 ? 411 GLY A HA3  7  
ATOM 11203 N N    . ALA A 1 37  ? -0.321  -3.475  -16.048 1.00 0.00 ? 412 ALA A N    7  
ATOM 11204 C CA   . ALA A 1 37  ? -1.148  -2.647  -15.179 1.00 0.00 ? 412 ALA A CA   7  
ATOM 11205 C C    . ALA A 1 37  ? -2.577  -3.172  -15.118 1.00 0.00 ? 412 ALA A C    7  
ATOM 11206 O O    . ALA A 1 37  ? -3.126  -3.623  -16.123 1.00 0.00 ? 412 ALA A O    7  
ATOM 11207 C CB   . ALA A 1 37  ? -1.131  -1.202  -15.654 1.00 0.00 ? 412 ALA A CB   7  
ATOM 11208 H H    . ALA A 1 37  ? -0.442  -3.419  -17.019 1.00 0.00 ? 412 ALA A H    7  
ATOM 11209 H HA   . ALA A 1 37  ? -0.722  -2.678  -14.186 1.00 0.00 ? 412 ALA A HA   7  
ATOM 11210 H HB1  . ALA A 1 37  ? -0.266  -0.699  -15.248 1.00 0.00 ? 412 ALA A HB1  7  
ATOM 11211 H HB2  . ALA A 1 37  ? -1.087  -1.179  -16.733 1.00 0.00 ? 412 ALA A HB2  7  
ATOM 11212 H HB3  . ALA A 1 37  ? -2.028  -0.703  -15.320 1.00 0.00 ? 412 ALA A HB3  7  
ATOM 11213 N N    . TYR A 1 38  ? -3.175  -3.108  -13.934 1.00 0.00 ? 413 TYR A N    7  
ATOM 11214 C CA   . TYR A 1 38  ? -4.542  -3.577  -13.739 1.00 0.00 ? 413 TYR A CA   7  
ATOM 11215 C C    . TYR A 1 38  ? -5.535  -2.425  -13.871 1.00 0.00 ? 413 TYR A C    7  
ATOM 11216 O O    . TYR A 1 38  ? -5.300  -1.329  -13.365 1.00 0.00 ? 413 TYR A O    7  
ATOM 11217 C CB   . TYR A 1 38  ? -4.683  -4.235  -12.363 1.00 0.00 ? 413 TYR A CB   7  
ATOM 11218 C CG   . TYR A 1 38  ? -6.105  -4.615  -12.008 1.00 0.00 ? 413 TYR A CG   7  
ATOM 11219 C CD1  . TYR A 1 38  ? -6.626  -5.850  -12.376 1.00 0.00 ? 413 TYR A CD1  7  
ATOM 11220 C CD2  . TYR A 1 38  ? -6.924  -3.740  -11.306 1.00 0.00 ? 413 TYR A CD2  7  
ATOM 11221 C CE1  . TYR A 1 38  ? -7.923  -6.201  -12.055 1.00 0.00 ? 413 TYR A CE1  7  
ATOM 11222 C CE2  . TYR A 1 38  ? -8.222  -4.084  -10.980 1.00 0.00 ? 413 TYR A CE2  7  
ATOM 11223 C CZ   . TYR A 1 38  ? -8.717  -5.315  -11.357 1.00 0.00 ? 413 TYR A CZ   7  
ATOM 11224 O OH   . TYR A 1 38  ? -10.008 -5.661  -11.035 1.00 0.00 ? 413 TYR A OH   7  
ATOM 11225 H H    . TYR A 1 38  ? -2.684  -2.737  -13.170 1.00 0.00 ? 413 TYR A H    7  
ATOM 11226 H HA   . TYR A 1 38  ? -4.754  -4.309  -14.503 1.00 0.00 ? 413 TYR A HA   7  
ATOM 11227 H HB2  . TYR A 1 38  ? -4.087  -5.134  -12.341 1.00 0.00 ? 413 TYR A HB2  7  
ATOM 11228 H HB3  . TYR A 1 38  ? -4.324  -3.552  -11.607 1.00 0.00 ? 413 TYR A HB3  7  
ATOM 11229 H HD1  . TYR A 1 38  ? -6.002  -6.542  -12.923 1.00 0.00 ? 413 TYR A HD1  7  
ATOM 11230 H HD2  . TYR A 1 38  ? -6.534  -2.776  -11.012 1.00 0.00 ? 413 TYR A HD2  7  
ATOM 11231 H HE1  . TYR A 1 38  ? -8.311  -7.164  -12.350 1.00 0.00 ? 413 TYR A HE1  7  
ATOM 11232 H HE2  . TYR A 1 38  ? -8.843  -3.390  -10.434 1.00 0.00 ? 413 TYR A HE2  7  
ATOM 11233 H HH   . TYR A 1 38  ? -10.187 -5.419  -10.123 1.00 0.00 ? 413 TYR A HH   7  
ATOM 11234 N N    . ILE A 1 39  ? -6.648  -2.685  -14.552 1.00 0.00 ? 414 ILE A N    7  
ATOM 11235 C CA   . ILE A 1 39  ? -7.677  -1.671  -14.745 1.00 0.00 ? 414 ILE A CA   7  
ATOM 11236 C C    . ILE A 1 39  ? -8.657  -1.663  -13.578 1.00 0.00 ? 414 ILE A C    7  
ATOM 11237 O O    . ILE A 1 39  ? -9.358  -2.646  -13.337 1.00 0.00 ? 414 ILE A O    7  
ATOM 11238 C CB   . ILE A 1 39  ? -8.455  -1.897  -16.056 1.00 0.00 ? 414 ILE A CB   7  
ATOM 11239 C CG1  . ILE A 1 39  ? -7.486  -2.149  -17.212 1.00 0.00 ? 414 ILE A CG1  7  
ATOM 11240 C CG2  . ILE A 1 39  ? -9.346  -0.702  -16.355 1.00 0.00 ? 414 ILE A CG2  7  
ATOM 11241 C CD1  . ILE A 1 39  ? -8.176  -2.433  -18.527 1.00 0.00 ? 414 ILE A CD1  7  
ATOM 11242 H H    . ILE A 1 39  ? -6.780  -3.580  -14.929 1.00 0.00 ? 414 ILE A H    7  
ATOM 11243 H HA   . ILE A 1 39  ? -7.190  -0.708  -14.800 1.00 0.00 ? 414 ILE A HA   7  
ATOM 11244 H HB   . ILE A 1 39  ? -9.087  -2.764  -15.928 1.00 0.00 ? 414 ILE A HB   7  
ATOM 11245 H HG12 . ILE A 1 39  ? -6.861  -1.279  -17.346 1.00 0.00 ? 414 ILE A HG12 7  
ATOM 11246 H HG13 . ILE A 1 39  ? -6.863  -2.999  -16.972 1.00 0.00 ? 414 ILE A HG13 7  
ATOM 11247 H HG21 . ILE A 1 39  ? -8.805  0.210   -16.152 1.00 0.00 ? 414 ILE A HG21 7  
ATOM 11248 H HG22 . ILE A 1 39  ? -9.640  -0.723  -17.394 1.00 0.00 ? 414 ILE A HG22 7  
ATOM 11249 H HG23 . ILE A 1 39  ? -10.227 -0.744  -15.732 1.00 0.00 ? 414 ILE A HG23 7  
ATOM 11250 H HD11 . ILE A 1 39  ? -7.461  -2.834  -19.230 1.00 0.00 ? 414 ILE A HD11 7  
ATOM 11251 H HD12 . ILE A 1 39  ? -8.968  -3.151  -18.372 1.00 0.00 ? 414 ILE A HD12 7  
ATOM 11252 H HD13 . ILE A 1 39  ? -8.592  -1.517  -18.920 1.00 0.00 ? 414 ILE A HD13 7  
ATOM 11253 N N    . ILE A 1 40  ? -8.695  -0.551  -12.852 1.00 0.00 ? 415 ILE A N    7  
ATOM 11254 C CA   . ILE A 1 40  ? -9.584  -0.418  -11.704 1.00 0.00 ? 415 ILE A CA   7  
ATOM 11255 C C    . ILE A 1 40  ? -10.981 0.031   -12.128 1.00 0.00 ? 415 ILE A C    7  
ATOM 11256 O O    . ILE A 1 40  ? -11.957 -0.693  -11.935 1.00 0.00 ? 415 ILE A O    7  
ATOM 11257 C CB   . ILE A 1 40  ? -9.012  0.577   -10.671 1.00 0.00 ? 415 ILE A CB   7  
ATOM 11258 C CG1  . ILE A 1 40  ? -7.646  0.091   -10.179 1.00 0.00 ? 415 ILE A CG1  7  
ATOM 11259 C CG2  . ILE A 1 40  ? -9.972  0.753   -9.500  1.00 0.00 ? 415 ILE A CG2  7  
ATOM 11260 C CD1  . ILE A 1 40  ? -6.764  1.198   -9.644  1.00 0.00 ? 415 ILE A CD1  7  
ATOM 11261 H H    . ILE A 1 40  ? -8.108  0.196   -13.092 1.00 0.00 ? 415 ILE A H    7  
ATOM 11262 H HA   . ILE A 1 40  ? -9.659  -1.387  -11.231 1.00 0.00 ? 415 ILE A HA   7  
ATOM 11263 H HB   . ILE A 1 40  ? -8.893  1.534   -11.154 1.00 0.00 ? 415 ILE A HB   7  
ATOM 11264 H HG12 . ILE A 1 40  ? -7.791  -0.626  -9.386  1.00 0.00 ? 415 ILE A HG12 7  
ATOM 11265 H HG13 . ILE A 1 40  ? -7.124  -0.383  -10.997 1.00 0.00 ? 415 ILE A HG13 7  
ATOM 11266 H HG21 . ILE A 1 40  ? -10.756 0.013   -9.563  1.00 0.00 ? 415 ILE A HG21 7  
ATOM 11267 H HG22 . ILE A 1 40  ? -9.435  0.631   -8.572  1.00 0.00 ? 415 ILE A HG22 7  
ATOM 11268 H HG23 . ILE A 1 40  ? -10.406 1.741   -9.537  1.00 0.00 ? 415 ILE A HG23 7  
ATOM 11269 H HD11 . ILE A 1 40  ? -6.208  1.640   -10.458 1.00 0.00 ? 415 ILE A HD11 7  
ATOM 11270 H HD12 . ILE A 1 40  ? -7.377  1.954   -9.177  1.00 0.00 ? 415 ILE A HD12 7  
ATOM 11271 H HD13 . ILE A 1 40  ? -6.076  0.791   -8.918  1.00 0.00 ? 415 ILE A HD13 7  
ATOM 11272 N N    . GLU A 1 41  ? -11.073 1.227   -12.701 1.00 0.00 ? 416 GLU A N    7  
ATOM 11273 C CA   . GLU A 1 41  ? -12.358 1.759   -13.144 1.00 0.00 ? 416 GLU A CA   7  
ATOM 11274 C C    . GLU A 1 41  ? -12.176 2.771   -14.270 1.00 0.00 ? 416 GLU A C    7  
ATOM 11275 O O    . GLU A 1 41  ? -11.132 3.411   -14.384 1.00 0.00 ? 416 GLU A O    7  
ATOM 11276 C CB   . GLU A 1 41  ? -13.091 2.412   -11.972 1.00 0.00 ? 416 GLU A CB   7  
ATOM 11277 C CG   . GLU A 1 41  ? -12.317 3.550   -11.328 1.00 0.00 ? 416 GLU A CG   7  
ATOM 11278 C CD   . GLU A 1 41  ? -13.151 4.335   -10.335 1.00 0.00 ? 416 GLU A CD   7  
ATOM 11279 O OE1  . GLU A 1 41  ? -14.064 5.066   -10.773 1.00 0.00 ? 416 GLU A OE1  7  
ATOM 11280 O OE2  . GLU A 1 41  ? -12.892 4.216   -9.119  1.00 0.00 ? 416 GLU A OE2  7  
ATOM 11281 H H    . GLU A 1 41  ? -10.261 1.762   -12.827 1.00 0.00 ? 416 GLU A H    7  
ATOM 11282 H HA   . GLU A 1 41  ? -12.948 0.933   -13.509 1.00 0.00 ? 416 GLU A HA   7  
ATOM 11283 H HB2  . GLU A 1 41  ? -14.035 2.800   -12.324 1.00 0.00 ? 416 GLU A HB2  7  
ATOM 11284 H HB3  . GLU A 1 41  ? -13.279 1.662   -11.217 1.00 0.00 ? 416 GLU A HB3  7  
ATOM 11285 H HG2  . GLU A 1 41  ? -11.463 3.141   -10.813 1.00 0.00 ? 416 GLU A HG2  7  
ATOM 11286 H HG3  . GLU A 1 41  ? -11.981 4.223   -12.104 1.00 0.00 ? 416 GLU A HG3  7  
ATOM 11287 N N    . VAL A 1 42  ? -13.206 2.910   -15.102 1.00 0.00 ? 417 VAL A N    7  
ATOM 11288 C CA   . VAL A 1 42  ? -13.168 3.843   -16.222 1.00 0.00 ? 417 VAL A CA   7  
ATOM 11289 C C    . VAL A 1 42  ? -14.297 4.863   -16.122 1.00 0.00 ? 417 VAL A C    7  
ATOM 11290 O O    . VAL A 1 42  ? -15.413 4.531   -15.725 1.00 0.00 ? 417 VAL A O    7  
ATOM 11291 C CB   . VAL A 1 42  ? -13.279 3.107   -17.572 1.00 0.00 ? 417 VAL A CB   7  
ATOM 11292 C CG1  . VAL A 1 42  ? -13.042 4.070   -18.725 1.00 0.00 ? 417 VAL A CG1  7  
ATOM 11293 C CG2  . VAL A 1 42  ? -12.303 1.941   -17.633 1.00 0.00 ? 417 VAL A CG2  7  
ATOM 11294 H H    . VAL A 1 42  ? -14.012 2.371   -14.957 1.00 0.00 ? 417 VAL A H    7  
ATOM 11295 H HA   . VAL A 1 42  ? -12.221 4.362   -16.194 1.00 0.00 ? 417 VAL A HA   7  
ATOM 11296 H HB   . VAL A 1 42  ? -14.281 2.714   -17.662 1.00 0.00 ? 417 VAL A HB   7  
ATOM 11297 H HG11 . VAL A 1 42  ? -12.426 4.891   -18.388 1.00 0.00 ? 417 VAL A HG11 7  
ATOM 11298 H HG12 . VAL A 1 42  ? -12.542 3.551   -19.530 1.00 0.00 ? 417 VAL A HG12 7  
ATOM 11299 H HG13 . VAL A 1 42  ? -13.989 4.451   -19.077 1.00 0.00 ? 417 VAL A HG13 7  
ATOM 11300 H HG21 . VAL A 1 42  ? -11.457 2.211   -18.248 1.00 0.00 ? 417 VAL A HG21 7  
ATOM 11301 H HG22 . VAL A 1 42  ? -11.962 1.702   -16.637 1.00 0.00 ? 417 VAL A HG22 7  
ATOM 11302 H HG23 . VAL A 1 42  ? -12.798 1.080   -18.059 1.00 0.00 ? 417 VAL A HG23 7  
ATOM 11303 N N    . ILE A 1 43  ? -14.003 6.106   -16.490 1.00 0.00 ? 418 ILE A N    7  
ATOM 11304 C CA   . ILE A 1 43  ? -14.999 7.171   -16.444 1.00 0.00 ? 418 ILE A CA   7  
ATOM 11305 C C    . ILE A 1 43  ? -15.897 7.128   -17.682 1.00 0.00 ? 418 ILE A C    7  
ATOM 11306 O O    . ILE A 1 43  ? -15.435 6.820   -18.780 1.00 0.00 ? 418 ILE A O    7  
ATOM 11307 C CB   . ILE A 1 43  ? -14.334 8.559   -16.338 1.00 0.00 ? 418 ILE A CB   7  
ATOM 11308 C CG1  . ILE A 1 43  ? -13.220 8.536   -15.289 1.00 0.00 ? 418 ILE A CG1  7  
ATOM 11309 C CG2  . ILE A 1 43  ? -15.368 9.619   -15.993 1.00 0.00 ? 418 ILE A CG2  7  
ATOM 11310 C CD1  . ILE A 1 43  ? -13.718 8.295   -13.880 1.00 0.00 ? 418 ILE A CD1  7  
ATOM 11311 H H    . ILE A 1 43  ? -13.096 6.312   -16.802 1.00 0.00 ? 418 ILE A H    7  
ATOM 11312 H HA   . ILE A 1 43  ? -15.604 7.017   -15.564 1.00 0.00 ? 418 ILE A HA   7  
ATOM 11313 H HB   . ILE A 1 43  ? -13.910 8.805   -17.298 1.00 0.00 ? 418 ILE A HB   7  
ATOM 11314 H HG12 . ILE A 1 43  ? -12.523 7.749   -15.531 1.00 0.00 ? 418 ILE A HG12 7  
ATOM 11315 H HG13 . ILE A 1 43  ? -12.703 9.485   -15.302 1.00 0.00 ? 418 ILE A HG13 7  
ATOM 11316 H HG21 . ILE A 1 43  ? -16.147 9.620   -16.740 1.00 0.00 ? 418 ILE A HG21 7  
ATOM 11317 H HG22 . ILE A 1 43  ? -15.798 9.403   -15.026 1.00 0.00 ? 418 ILE A HG22 7  
ATOM 11318 H HG23 . ILE A 1 43  ? -14.893 10.589  -15.968 1.00 0.00 ? 418 ILE A HG23 7  
ATOM 11319 H HD11 . ILE A 1 43  ? -13.824 9.241   -13.369 1.00 0.00 ? 418 ILE A HD11 7  
ATOM 11320 H HD12 . ILE A 1 43  ? -14.675 7.796   -13.917 1.00 0.00 ? 418 ILE A HD12 7  
ATOM 11321 H HD13 . ILE A 1 43  ? -13.010 7.676   -13.349 1.00 0.00 ? 418 ILE A HD13 7  
ATOM 11322 N N    . PRO A 1 44  ? -17.204 7.417   -17.520 1.00 0.00 ? 419 PRO A N    7  
ATOM 11323 C CA   . PRO A 1 44  ? -18.169 7.392   -18.629 1.00 0.00 ? 419 PRO A CA   7  
ATOM 11324 C C    . PRO A 1 44  ? -17.985 8.535   -19.630 1.00 0.00 ? 419 PRO A C    7  
ATOM 11325 O O    . PRO A 1 44  ? -18.719 8.624   -20.613 1.00 0.00 ? 419 PRO A O    7  
ATOM 11326 C CB   . PRO A 1 44  ? -19.535 7.520   -17.933 1.00 0.00 ? 419 PRO A CB   7  
ATOM 11327 C CG   . PRO A 1 44  ? -19.269 7.329   -16.476 1.00 0.00 ? 419 PRO A CG   7  
ATOM 11328 C CD   . PRO A 1 44  ? -17.854 7.771   -16.251 1.00 0.00 ? 419 PRO A CD   7  
ATOM 11329 H HA   . PRO A 1 44  ? -18.128 6.451   -19.158 1.00 0.00 ? 419 PRO A HA   7  
ATOM 11330 H HB2  . PRO A 1 44  ? -19.949 8.498   -18.129 1.00 0.00 ? 419 PRO A HB2  7  
ATOM 11331 H HB3  . PRO A 1 44  ? -20.204 6.762   -18.312 1.00 0.00 ? 419 PRO A HB3  7  
ATOM 11332 H HG2  . PRO A 1 44  ? -19.947 7.936   -15.897 1.00 0.00 ? 419 PRO A HG2  7  
ATOM 11333 H HG3  . PRO A 1 44  ? -19.381 6.287   -16.217 1.00 0.00 ? 419 PRO A HG3  7  
ATOM 11334 H HD2  . PRO A 1 44  ? -17.813 8.836   -16.074 1.00 0.00 ? 419 PRO A HD2  7  
ATOM 11335 H HD3  . PRO A 1 44  ? -17.417 7.229   -15.426 1.00 0.00 ? 419 PRO A HD3  7  
ATOM 11336 N N    . ASP A 1 45  ? -17.013 9.409   -19.382 1.00 0.00 ? 420 ASP A N    7  
ATOM 11337 C CA   . ASP A 1 45  ? -16.762 10.537  -20.274 1.00 0.00 ? 420 ASP A CA   7  
ATOM 11338 C C    . ASP A 1 45  ? -15.283 10.636  -20.638 1.00 0.00 ? 420 ASP A C    7  
ATOM 11339 O O    . ASP A 1 45  ? -14.633 11.645  -20.368 1.00 0.00 ? 420 ASP A O    7  
ATOM 11340 C CB   . ASP A 1 45  ? -17.227 11.841  -19.620 1.00 0.00 ? 420 ASP A CB   7  
ATOM 11341 C CG   . ASP A 1 45  ? -18.665 12.178  -19.958 1.00 0.00 ? 420 ASP A CG   7  
ATOM 11342 O OD1  . ASP A 1 45  ? -19.050 12.022  -21.136 1.00 0.00 ? 420 ASP A OD1  7  
ATOM 11343 O OD2  . ASP A 1 45  ? -19.407 12.598  -19.046 1.00 0.00 ? 420 ASP A OD2  7  
ATOM 11344 H H    . ASP A 1 45  ? -16.457 9.299   -18.585 1.00 0.00 ? 420 ASP A H    7  
ATOM 11345 H HA   . ASP A 1 45  ? -17.333 10.378  -21.177 1.00 0.00 ? 420 ASP A HA   7  
ATOM 11346 H HB2  . ASP A 1 45  ? -17.141 11.748  -18.547 1.00 0.00 ? 420 ASP A HB2  7  
ATOM 11347 H HB3  . ASP A 1 45  ? -16.597 12.650  -19.958 1.00 0.00 ? 420 ASP A HB3  7  
ATOM 11348 N N    . THR A 1 46  ? -14.755 9.582   -21.252 1.00 0.00 ? 421 THR A N    7  
ATOM 11349 C CA   . THR A 1 46  ? -13.352 9.557   -21.650 1.00 0.00 ? 421 THR A CA   7  
ATOM 11350 C C    . THR A 1 46  ? -13.107 8.499   -22.724 1.00 0.00 ? 421 THR A C    7  
ATOM 11351 O O    . THR A 1 46  ? -13.881 7.552   -22.861 1.00 0.00 ? 421 THR A O    7  
ATOM 11352 C CB   . THR A 1 46  ? -12.466 9.289   -20.433 1.00 0.00 ? 421 THR A CB   7  
ATOM 11353 O OG1  . THR A 1 46  ? -11.168 8.897   -20.829 1.00 0.00 ? 421 THR A OG1  7  
ATOM 11354 C CG2  . THR A 1 46  ? -13.011 8.214   -19.524 1.00 0.00 ? 421 THR A CG2  7  
ATOM 11355 H H    . THR A 1 46  ? -15.321 8.804   -21.442 1.00 0.00 ? 421 THR A H    7  
ATOM 11356 H HA   . THR A 1 46  ? -13.107 10.527  -22.056 1.00 0.00 ? 421 THR A HA   7  
ATOM 11357 H HB   . THR A 1 46  ? -12.382 10.198  -19.855 1.00 0.00 ? 421 THR A HB   7  
ATOM 11358 H HG1  . THR A 1 46  ? -10.571 9.644   -20.744 1.00 0.00 ? 421 THR A HG1  7  
ATOM 11359 H HG21 . THR A 1 46  ? -14.021 8.465   -19.239 1.00 0.00 ? 421 THR A HG21 7  
ATOM 11360 H HG22 . THR A 1 46  ? -13.008 7.268   -20.045 1.00 0.00 ? 421 THR A HG22 7  
ATOM 11361 H HG23 . THR A 1 46  ? -12.394 8.141   -18.642 1.00 0.00 ? 421 THR A HG23 7  
ATOM 11362 N N    . PRO A 1 47  ? -12.022 8.647   -23.507 1.00 0.00 ? 422 PRO A N    7  
ATOM 11363 C CA   . PRO A 1 47  ? -11.683 7.701   -24.575 1.00 0.00 ? 422 PRO A CA   7  
ATOM 11364 C C    . PRO A 1 47  ? -11.455 6.286   -24.050 1.00 0.00 ? 422 PRO A C    7  
ATOM 11365 O O    . PRO A 1 47  ? -11.541 5.316   -24.801 1.00 0.00 ? 422 PRO A O    7  
ATOM 11366 C CB   . PRO A 1 47  ? -10.388 8.271   -25.167 1.00 0.00 ? 422 PRO A CB   7  
ATOM 11367 C CG   . PRO A 1 47  ? -10.387 9.705   -24.769 1.00 0.00 ? 422 PRO A CG   7  
ATOM 11368 C CD   . PRO A 1 47  ? -11.046 9.746   -23.422 1.00 0.00 ? 422 PRO A CD   7  
ATOM 11369 H HA   . PRO A 1 47  ? -12.448 7.677   -25.338 1.00 0.00 ? 422 PRO A HA   7  
ATOM 11370 H HB2  . PRO A 1 47  ? -9.540  7.746   -24.754 1.00 0.00 ? 422 PRO A HB2  7  
ATOM 11371 H HB3  . PRO A 1 47  ? -10.399 8.159   -26.241 1.00 0.00 ? 422 PRO A HB3  7  
ATOM 11372 H HG2  . PRO A 1 47  ? -9.372  10.069  -24.702 1.00 0.00 ? 422 PRO A HG2  7  
ATOM 11373 H HG3  . PRO A 1 47  ? -10.951 10.286  -25.482 1.00 0.00 ? 422 PRO A HG3  7  
ATOM 11374 H HD2  . PRO A 1 47  ? -10.322 9.562   -22.646 1.00 0.00 ? 422 PRO A HD2  7  
ATOM 11375 H HD3  . PRO A 1 47  ? -11.543 10.691  -23.264 1.00 0.00 ? 422 PRO A HD3  7  
ATOM 11376 N N    . ALA A 1 48  ? -11.168 6.174   -22.755 1.00 0.00 ? 423 ALA A N    7  
ATOM 11377 C CA   . ALA A 1 48  ? -10.937 4.873   -22.138 1.00 0.00 ? 423 ALA A CA   7  
ATOM 11378 C C    . ALA A 1 48  ? -12.146 3.960   -22.319 1.00 0.00 ? 423 ALA A C    7  
ATOM 11379 O O    . ALA A 1 48  ? -12.005 2.758   -22.544 1.00 0.00 ? 423 ALA A O    7  
ATOM 11380 C CB   . ALA A 1 48  ? -10.614 5.040   -20.660 1.00 0.00 ? 423 ALA A CB   7  
ATOM 11381 H H    . ALA A 1 48  ? -11.115 6.981   -22.203 1.00 0.00 ? 423 ALA A H    7  
ATOM 11382 H HA   . ALA A 1 48  ? -10.081 4.423   -22.621 1.00 0.00 ? 423 ALA A HA   7  
ATOM 11383 H HB1  . ALA A 1 48  ? -9.602  5.403   -20.551 1.00 0.00 ? 423 ALA A HB1  7  
ATOM 11384 H HB2  . ALA A 1 48  ? -11.299 5.748   -20.220 1.00 0.00 ? 423 ALA A HB2  7  
ATOM 11385 H HB3  . ALA A 1 48  ? -10.710 4.087   -20.162 1.00 0.00 ? 423 ALA A HB3  7  
ATOM 11386 N N    . GLU A 1 49  ? -13.335 4.545   -22.224 1.00 0.00 ? 424 GLU A N    7  
ATOM 11387 C CA   . GLU A 1 49  ? -14.573 3.792   -22.381 1.00 0.00 ? 424 GLU A CA   7  
ATOM 11388 C C    . GLU A 1 49  ? -14.944 3.666   -23.855 1.00 0.00 ? 424 GLU A C    7  
ATOM 11389 O O    . GLU A 1 49  ? -15.552 2.679   -24.270 1.00 0.00 ? 424 GLU A O    7  
ATOM 11390 C CB   . GLU A 1 49  ? -15.707 4.470   -21.611 1.00 0.00 ? 424 GLU A CB   7  
ATOM 11391 C CG   . GLU A 1 49  ? -17.022 3.710   -21.668 1.00 0.00 ? 424 GLU A CG   7  
ATOM 11392 C CD   . GLU A 1 49  ? -18.199 4.545   -21.204 1.00 0.00 ? 424 GLU A CD   7  
ATOM 11393 O OE1  . GLU A 1 49  ? -18.714 5.347   -22.012 1.00 0.00 ? 424 GLU A OE1  7  
ATOM 11394 O OE2  . GLU A 1 49  ? -18.606 4.398   -20.033 1.00 0.00 ? 424 GLU A OE2  7  
ATOM 11395 H H    . GLU A 1 49  ? -13.381 5.508   -22.047 1.00 0.00 ? 424 GLU A H    7  
ATOM 11396 H HA   . GLU A 1 49  ? -14.414 2.804   -21.976 1.00 0.00 ? 424 GLU A HA   7  
ATOM 11397 H HB2  . GLU A 1 49  ? -15.417 4.567   -20.574 1.00 0.00 ? 424 GLU A HB2  7  
ATOM 11398 H HB3  . GLU A 1 49  ? -15.868 5.455   -22.023 1.00 0.00 ? 424 GLU A HB3  7  
ATOM 11399 H HG2  . GLU A 1 49  ? -17.200 3.402   -22.687 1.00 0.00 ? 424 GLU A HG2  7  
ATOM 11400 H HG3  . GLU A 1 49  ? -16.946 2.837   -21.036 1.00 0.00 ? 424 GLU A HG3  7  
ATOM 11401 N N    . ALA A 1 50  ? -14.573 4.672   -24.640 1.00 0.00 ? 425 ALA A N    7  
ATOM 11402 C CA   . ALA A 1 50  ? -14.865 4.676   -26.068 1.00 0.00 ? 425 ALA A CA   7  
ATOM 11403 C C    . ALA A 1 50  ? -13.927 3.739   -26.821 1.00 0.00 ? 425 ALA A C    7  
ATOM 11404 O O    . ALA A 1 50  ? -14.304 3.151   -27.835 1.00 0.00 ? 425 ALA A O    7  
ATOM 11405 C CB   . ALA A 1 50  ? -14.761 6.089   -26.623 1.00 0.00 ? 425 ALA A CB   7  
ATOM 11406 H H    . ALA A 1 50  ? -14.090 5.430   -24.249 1.00 0.00 ? 425 ALA A H    7  
ATOM 11407 H HA   . ALA A 1 50  ? -15.882 4.336   -26.200 1.00 0.00 ? 425 ALA A HA   7  
ATOM 11408 H HB1  . ALA A 1 50  ? -15.709 6.591   -26.506 1.00 0.00 ? 425 ALA A HB1  7  
ATOM 11409 H HB2  . ALA A 1 50  ? -13.997 6.631   -26.085 1.00 0.00 ? 425 ALA A HB2  7  
ATOM 11410 H HB3  . ALA A 1 50  ? -14.503 6.046   -27.670 1.00 0.00 ? 425 ALA A HB3  7  
ATOM 11411 N N    . GLY A 1 51  ? -12.704 3.603   -26.318 1.00 0.00 ? 426 GLY A N    7  
ATOM 11412 C CA   . GLY A 1 51  ? -11.733 2.735   -26.954 1.00 0.00 ? 426 GLY A CA   7  
ATOM 11413 C C    . GLY A 1 51  ? -12.127 1.275   -26.871 1.00 0.00 ? 426 GLY A C    7  
ATOM 11414 O O    . GLY A 1 51  ? -11.881 0.503   -27.798 1.00 0.00 ? 426 GLY A O    7  
ATOM 11415 H H    . GLY A 1 51  ? -12.461 4.095   -25.506 1.00 0.00 ? 426 GLY A H    7  
ATOM 11416 H HA2  . GLY A 1 51  ? -11.642 3.014   -27.993 1.00 0.00 ? 426 GLY A HA2  7  
ATOM 11417 H HA3  . GLY A 1 51  ? -10.776 2.866   -26.471 1.00 0.00 ? 426 GLY A HA3  7  
ATOM 11418 N N    . GLY A 1 52  ? -12.745 0.895   -25.757 1.00 0.00 ? 427 GLY A N    7  
ATOM 11419 C CA   . GLY A 1 52  ? -13.170 -0.481  -25.576 1.00 0.00 ? 427 GLY A CA   7  
ATOM 11420 C C    . GLY A 1 52  ? -12.526 -1.143  -24.374 1.00 0.00 ? 427 GLY A C    7  
ATOM 11421 O O    . GLY A 1 52  ? -12.361 -2.362  -24.348 1.00 0.00 ? 427 GLY A O    7  
ATOM 11422 H H    . GLY A 1 52  ? -12.918 1.556   -25.055 1.00 0.00 ? 427 GLY A H    7  
ATOM 11423 H HA2  . GLY A 1 52  ? -14.242 -0.499  -25.450 1.00 0.00 ? 427 GLY A HA2  7  
ATOM 11424 H HA3  . GLY A 1 52  ? -12.914 -1.043  -26.463 1.00 0.00 ? 427 GLY A HA3  7  
ATOM 11425 N N    . LEU A 1 53  ? -12.163 -0.344  -23.374 1.00 0.00 ? 428 LEU A N    7  
ATOM 11426 C CA   . LEU A 1 53  ? -11.539 -0.875  -22.169 1.00 0.00 ? 428 LEU A CA   7  
ATOM 11427 C C    . LEU A 1 53  ? -12.586 -1.172  -21.103 1.00 0.00 ? 428 LEU A C    7  
ATOM 11428 O O    . LEU A 1 53  ? -13.787 -1.057  -21.349 1.00 0.00 ? 428 LEU A O    7  
ATOM 11429 C CB   . LEU A 1 53  ? -10.510 0.110   -21.612 1.00 0.00 ? 428 LEU A CB   7  
ATOM 11430 C CG   . LEU A 1 53  ? -9.808  0.990   -22.646 1.00 0.00 ? 428 LEU A CG   7  
ATOM 11431 C CD1  . LEU A 1 53  ? -9.191  2.202   -21.969 1.00 0.00 ? 428 LEU A CD1  7  
ATOM 11432 C CD2  . LEU A 1 53  ? -8.749  0.195   -23.393 1.00 0.00 ? 428 LEU A CD2  7  
ATOM 11433 H H    . LEU A 1 53  ? -12.320 0.621   -23.444 1.00 0.00 ? 428 LEU A H    7  
ATOM 11434 H HA   . LEU A 1 53  ? -11.038 -1.795  -22.433 1.00 0.00 ? 428 LEU A HA   7  
ATOM 11435 H HB2  . LEU A 1 53  ? -11.010 0.755   -20.904 1.00 0.00 ? 428 LEU A HB2  7  
ATOM 11436 H HB3  . LEU A 1 53  ? -9.757  -0.454  -21.086 1.00 0.00 ? 428 LEU A HB3  7  
ATOM 11437 H HG   . LEU A 1 53  ? -10.532 1.342   -23.365 1.00 0.00 ? 428 LEU A HG   7  
ATOM 11438 H HD11 . LEU A 1 53  ? -9.949  2.720   -21.401 1.00 0.00 ? 428 LEU A HD11 7  
ATOM 11439 H HD12 . LEU A 1 53  ? -8.402  1.880   -21.306 1.00 0.00 ? 428 LEU A HD12 7  
ATOM 11440 H HD13 . LEU A 1 53  ? -8.784  2.866   -22.718 1.00 0.00 ? 428 LEU A HD13 7  
ATOM 11441 H HD21 . LEU A 1 53  ? -8.194  0.855   -24.043 1.00 0.00 ? 428 LEU A HD21 7  
ATOM 11442 H HD22 . LEU A 1 53  ? -8.075  -0.261  -22.683 1.00 0.00 ? 428 LEU A HD22 7  
ATOM 11443 H HD23 . LEU A 1 53  ? -9.225  -0.574  -23.983 1.00 0.00 ? 428 LEU A HD23 7  
ATOM 11444 N N    . LYS A 1 54  ? -12.121 -1.550  -19.918 1.00 0.00 ? 429 LYS A N    7  
ATOM 11445 C CA   . LYS A 1 54  ? -13.014 -1.857  -18.809 1.00 0.00 ? 429 LYS A CA   7  
ATOM 11446 C C    . LYS A 1 54  ? -12.223 -2.261  -17.569 1.00 0.00 ? 429 LYS A C    7  
ATOM 11447 O O    . LYS A 1 54  ? -11.013 -2.473  -17.636 1.00 0.00 ? 429 LYS A O    7  
ATOM 11448 C CB   . LYS A 1 54  ? -13.983 -2.978  -19.194 1.00 0.00 ? 429 LYS A CB   7  
ATOM 11449 C CG   . LYS A 1 54  ? -15.359 -2.840  -18.560 1.00 0.00 ? 429 LYS A CG   7  
ATOM 11450 C CD   . LYS A 1 54  ? -15.534 -3.791  -17.386 1.00 0.00 ? 429 LYS A CD   7  
ATOM 11451 C CE   . LYS A 1 54  ? -16.798 -4.625  -17.526 1.00 0.00 ? 429 LYS A CE   7  
ATOM 11452 N NZ   . LYS A 1 54  ? -17.945 -4.024  -16.789 1.00 0.00 ? 429 LYS A NZ   7  
ATOM 11453 H H    . LYS A 1 54  ? -11.153 -1.618  -19.784 1.00 0.00 ? 429 LYS A H    7  
ATOM 11454 H HA   . LYS A 1 54  ? -13.579 -0.965  -18.586 1.00 0.00 ? 429 LYS A HA   7  
ATOM 11455 H HB2  . LYS A 1 54  ? -14.104 -2.980  -20.268 1.00 0.00 ? 429 LYS A HB2  7  
ATOM 11456 H HB3  . LYS A 1 54  ? -13.561 -3.924  -18.888 1.00 0.00 ? 429 LYS A HB3  7  
ATOM 11457 H HG2  . LYS A 1 54  ? -15.482 -1.826  -18.210 1.00 0.00 ? 429 LYS A HG2  7  
ATOM 11458 H HG3  . LYS A 1 54  ? -16.110 -3.058  -19.306 1.00 0.00 ? 429 LYS A HG3  7  
ATOM 11459 H HD2  . LYS A 1 54  ? -14.683 -4.455  -17.340 1.00 0.00 ? 429 LYS A HD2  7  
ATOM 11460 H HD3  . LYS A 1 54  ? -15.593 -3.215  -16.475 1.00 0.00 ? 429 LYS A HD3  7  
ATOM 11461 H HE2  . LYS A 1 54  ? -17.053 -4.697  -18.573 1.00 0.00 ? 429 LYS A HE2  7  
ATOM 11462 H HE3  . LYS A 1 54  ? -16.608 -5.614  -17.133 1.00 0.00 ? 429 LYS A HE3  7  
ATOM 11463 H HZ1  . LYS A 1 54  ? -17.764 -4.048  -15.765 1.00 0.00 ? 429 LYS A HZ1  7  
ATOM 11464 H HZ2  . LYS A 1 54  ? -18.080 -3.036  -17.083 1.00 0.00 ? 429 LYS A HZ2  7  
ATOM 11465 H HZ3  . LYS A 1 54  ? -18.816 -4.555  -16.987 1.00 0.00 ? 429 LYS A HZ3  7  
ATOM 11466 N N    . GLU A 1 55  ? -12.915 -2.364  -16.441 1.00 0.00 ? 430 GLU A N    7  
ATOM 11467 C CA   . GLU A 1 55  ? -12.277 -2.743  -15.185 1.00 0.00 ? 430 GLU A CA   7  
ATOM 11468 C C    . GLU A 1 55  ? -12.227 -4.261  -15.034 1.00 0.00 ? 430 GLU A C    7  
ATOM 11469 O O    . GLU A 1 55  ? -12.695 -4.811  -14.037 1.00 0.00 ? 430 GLU A O    7  
ATOM 11470 C CB   . GLU A 1 55  ? -13.026 -2.123  -14.003 1.00 0.00 ? 430 GLU A CB   7  
ATOM 11471 C CG   . GLU A 1 55  ? -14.517 -2.420  -14.006 1.00 0.00 ? 430 GLU A CG   7  
ATOM 11472 C CD   . GLU A 1 55  ? -15.348 -1.225  -14.431 1.00 0.00 ? 430 GLU A CD   7  
ATOM 11473 O OE1  . GLU A 1 55  ? -15.148 -0.130  -13.866 1.00 0.00 ? 430 GLU A OE1  7  
ATOM 11474 O OE2  . GLU A 1 55  ? -16.201 -1.385  -15.330 1.00 0.00 ? 430 GLU A OE2  7  
ATOM 11475 H H    . GLU A 1 55  ? -13.878 -2.182  -16.452 1.00 0.00 ? 430 GLU A H    7  
ATOM 11476 H HA   . GLU A 1 55  ? -11.267 -2.361  -15.199 1.00 0.00 ? 430 GLU A HA   7  
ATOM 11477 H HB2  . GLU A 1 55  ? -12.606 -2.507  -13.086 1.00 0.00 ? 430 GLU A HB2  7  
ATOM 11478 H HB3  . GLU A 1 55  ? -12.894 -1.052  -14.029 1.00 0.00 ? 430 GLU A HB3  7  
ATOM 11479 H HG2  . GLU A 1 55  ? -14.707 -3.233  -14.690 1.00 0.00 ? 430 GLU A HG2  7  
ATOM 11480 H HG3  . GLU A 1 55  ? -14.814 -2.711  -13.009 1.00 0.00 ? 430 GLU A HG3  7  
ATOM 11481 N N    . ASN A 1 56  ? -11.657 -4.933  -16.030 1.00 0.00 ? 431 ASN A N    7  
ATOM 11482 C CA   . ASN A 1 56  ? -11.549 -6.388  -16.004 1.00 0.00 ? 431 ASN A CA   7  
ATOM 11483 C C    . ASN A 1 56  ? -10.445 -6.877  -16.940 1.00 0.00 ? 431 ASN A C    7  
ATOM 11484 O O    . ASN A 1 56  ? -10.493 -8.004  -17.432 1.00 0.00 ? 431 ASN A O    7  
ATOM 11485 C CB   . ASN A 1 56  ? -12.884 -7.024  -16.394 1.00 0.00 ? 431 ASN A CB   7  
ATOM 11486 C CG   . ASN A 1 56  ? -13.309 -8.115  -15.431 1.00 0.00 ? 431 ASN A CG   7  
ATOM 11487 O OD1  . ASN A 1 56  ? -13.574 -9.247  -15.834 1.00 0.00 ? 431 ASN A OD1  7  
ATOM 11488 N ND2  . ASN A 1 56  ? -13.375 -7.778  -14.148 1.00 0.00 ? 431 ASN A ND2  7  
ATOM 11489 H H    . ASN A 1 56  ? -11.302 -4.440  -16.799 1.00 0.00 ? 431 ASN A H    7  
ATOM 11490 H HA   . ASN A 1 56  ? -11.303 -6.682  -14.994 1.00 0.00 ? 431 ASN A HA   7  
ATOM 11491 H HB2  . ASN A 1 56  ? -13.649 -6.262  -16.405 1.00 0.00 ? 431 ASN A HB2  7  
ATOM 11492 H HB3  . ASN A 1 56  ? -12.797 -7.454  -17.381 1.00 0.00 ? 431 ASN A HB3  7  
ATOM 11493 H HD21 . ASN A 1 56  ? -13.150 -6.858  -13.899 1.00 0.00 ? 431 ASN A HD21 7  
ATOM 11494 H HD22 . ASN A 1 56  ? -13.648 -8.464  -13.503 1.00 0.00 ? 431 ASN A HD22 7  
ATOM 11495 N N    . ASP A 1 57  ? -9.451  -6.027  -17.179 1.00 0.00 ? 432 ASP A N    7  
ATOM 11496 C CA   . ASP A 1 57  ? -8.339  -6.380  -18.054 1.00 0.00 ? 432 ASP A CA   7  
ATOM 11497 C C    . ASP A 1 57  ? -7.016  -5.887  -17.476 1.00 0.00 ? 432 ASP A C    7  
ATOM 11498 O O    . ASP A 1 57  ? -6.971  -5.371  -16.359 1.00 0.00 ? 432 ASP A O    7  
ATOM 11499 C CB   . ASP A 1 57  ? -8.549  -5.794  -19.452 1.00 0.00 ? 432 ASP A CB   7  
ATOM 11500 C CG   . ASP A 1 57  ? -9.965  -5.991  -19.958 1.00 0.00 ? 432 ASP A CG   7  
ATOM 11501 O OD1  . ASP A 1 57  ? -10.880 -5.317  -19.439 1.00 0.00 ? 432 ASP A OD1  7  
ATOM 11502 O OD2  . ASP A 1 57  ? -10.160 -6.819  -20.872 1.00 0.00 ? 432 ASP A OD2  7  
ATOM 11503 H H    . ASP A 1 57  ? -9.464  -5.142  -16.757 1.00 0.00 ? 432 ASP A H    7  
ATOM 11504 H HA   . ASP A 1 57  ? -8.304  -7.457  -18.127 1.00 0.00 ? 432 ASP A HA   7  
ATOM 11505 H HB2  . ASP A 1 57  ? -8.341  -4.735  -19.427 1.00 0.00 ? 432 ASP A HB2  7  
ATOM 11506 H HB3  . ASP A 1 57  ? -7.870  -6.274  -20.142 1.00 0.00 ? 432 ASP A HB3  7  
ATOM 11507 N N    . VAL A 1 58  ? -5.941  -6.051  -18.240 1.00 0.00 ? 433 VAL A N    7  
ATOM 11508 C CA   . VAL A 1 58  ? -4.620  -5.622  -17.797 1.00 0.00 ? 433 VAL A CA   7  
ATOM 11509 C C    . VAL A 1 58  ? -3.799  -5.067  -18.955 1.00 0.00 ? 433 VAL A C    7  
ATOM 11510 O O    . VAL A 1 58  ? -3.519  -5.772  -19.925 1.00 0.00 ? 433 VAL A O    7  
ATOM 11511 C CB   . VAL A 1 58  ? -3.844  -6.783  -17.146 1.00 0.00 ? 433 VAL A CB   7  
ATOM 11512 C CG1  . VAL A 1 58  ? -2.552  -6.279  -16.520 1.00 0.00 ? 433 VAL A CG1  7  
ATOM 11513 C CG2  . VAL A 1 58  ? -4.707  -7.489  -16.112 1.00 0.00 ? 433 VAL A CG2  7  
ATOM 11514 H H    . VAL A 1 58  ? -6.038  -6.470  -19.120 1.00 0.00 ? 433 VAL A H    7  
ATOM 11515 H HA   . VAL A 1 58  ? -4.751  -4.846  -17.058 1.00 0.00 ? 433 VAL A HA   7  
ATOM 11516 H HB   . VAL A 1 58  ? -3.589  -7.495  -17.917 1.00 0.00 ? 433 VAL A HB   7  
ATOM 11517 H HG11 . VAL A 1 58  ? -2.189  -5.429  -17.078 1.00 0.00 ? 433 VAL A HG11 7  
ATOM 11518 H HG12 . VAL A 1 58  ? -2.738  -5.986  -15.498 1.00 0.00 ? 433 VAL A H