data_2K2V
# 
_entry.id   2K2V 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2K2V         
RCSB  RCSB100606   
WWPDB D_1000100606 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 15402 BMRB 'Entry containing chemical shift assignments'                               
unspecified 2p0p  PDB  'Entry containing the coordinates of the calcium-free form of this protein' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2K2V 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2008-04-13 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hu, Y.'    1 
'Zhang, X.' 2 
'Jin, C.'   3 
# 
_citation.id                        primary 
_citation.title                     'Anabaena CcbP in the calcium-bound form' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hu, Y.'    1 
primary 'Zhang, X.' 2 
primary 'Xia, B.'   3 
primary 'Jin, C.'   4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Alr1010 protein' 14768.400 1 ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'     40.078    2 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        CcbP 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYV
EVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYV
EVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   SER n 
1 4   VAL n 
1 5   GLU n 
1 6   ARG n 
1 7   ASP n 
1 8   GLU n 
1 9   THR n 
1 10  ARG n 
1 11  GLU n 
1 12  HIS n 
1 13  ARG n 
1 14  ILE n 
1 15  GLU n 
1 16  THR n 
1 17  GLU n 
1 18  ILE n 
1 19  ILE n 
1 20  VAL n 
1 21  ASP n 
1 22  ALA n 
1 23  GLU n 
1 24  ASP n 
1 25  LYS n 
1 26  GLU n 
1 27  GLU n 
1 28  ARG n 
1 29  ALA n 
1 30  MET n 
1 31  GLY n 
1 32  TRP n 
1 33  TYR n 
1 34  TYR n 
1 35  TYR n 
1 36  LEU n 
1 37  ASP n 
1 38  ASP n 
1 39  THR n 
1 40  LEU n 
1 41  GLU n 
1 42  PHE n 
1 43  PRO n 
1 44  PHE n 
1 45  MET n 
1 46  GLY n 
1 47  LYS n 
1 48  TRP n 
1 49  LYS n 
1 50  LYS n 
1 51  LYS n 
1 52  SER n 
1 53  ARG n 
1 54  LYS n 
1 55  THR n 
1 56  SER n 
1 57  THR n 
1 58  ILE n 
1 59  GLU n 
1 60  GLU n 
1 61  LYS n 
1 62  THR n 
1 63  VAL n 
1 64  GLU n 
1 65  VAL n 
1 66  LEU n 
1 67  GLY n 
1 68  MET n 
1 69  ALA n 
1 70  PRO n 
1 71  ASP n 
1 72  ASP n 
1 73  GLU n 
1 74  CYS n 
1 75  LEU n 
1 76  LYS n 
1 77  ASP n 
1 78  MET n 
1 79  TYR n 
1 80  VAL n 
1 81  GLU n 
1 82  VAL n 
1 83  ALA n 
1 84  ASP n 
1 85  ILE n 
1 86  GLY n 
1 87  GLY n 
1 88  LYS n 
1 89  ASP n 
1 90  ASP n 
1 91  ASP n 
1 92  VAL n 
1 93  TYR n 
1 94  THR n 
1 95  ALA n 
1 96  LYS n 
1 97  LEU n 
1 98  SER n 
1 99  ASP n 
1 100 ILE n 
1 101 GLU n 
1 102 ALA n 
1 103 ILE n 
1 104 ASP n 
1 105 VAL n 
1 106 ASP n 
1 107 ASP n 
1 108 ASP n 
1 109 THR n 
1 110 GLN n 
1 111 GLU n 
1 112 ALA n 
1 113 ILE n 
1 114 ALA n 
1 115 ASP n 
1 116 TRP n 
1 117 LEU n 
1 118 TYR n 
1 119 TRP n 
1 120 LEU n 
1 121 ALA n 
1 122 ARG n 
1 123 GLY n 
1 124 TYR n 
1 125 LYS n 
1 126 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ccbP, alr1010' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'PCC 7120' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Anabaena sp. (strain PCC 7120)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     ? 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET15b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8YY42_ANASP 
_struct_ref.pdbx_db_accession          Q8YY42 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MASVERDETREHRIETEIIVDAEDKEERAMGWYYYLDDTLEFPFMGKWKKKSRKTSTIEEKTVEVLGMAPDDECLKDMYV
EVADIGGKDDDVYTAKLSDIEAIDVDDDTQEAIADWLYWLARGYKF
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2K2V 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 126 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q8YY42 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  126 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       126 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D 1H-13C NOESY' 
1 2 2 '3D 1H-15N NOESY' 
1 3 1 '3D HCCH-COSY'    
1 4 1 '3D HCCH-TOCSY'   
1 5 1 '3D HNCO'         
1 6 1 '3D HNCACB'       
1 7 1 '3D CBCA(CO)NH'   
1 8 1 '2D 1H-13C HSQC'  
1 9 2 '2D 1H-15N HSQC'  
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.32 
_pdbx_nmr_exptl_sample_conditions.pH                  7.4 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM [U-100% 13C; U-100% 15N] protein, 40 mM CALCIUM ION, 20 mM TRIS, 220 mM sodium chloride, 10 mM DTT, 90% H2O/10% D2O' 1 
'90% H2O/10% D2O' 
'1 mM [U-100% 15N] protein, 40 mM CALCIUM ION, 20 mM TRIS, 220 mM sodium chloride, 10 mM DTT, 90% H2O/10% D2O'             2 
'90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
500 Bruker Avance 1 'Bruker Avance' 
800 Bruker Avance 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2K2V 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2K2V 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2K2V 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                                  collection                  xwinnmr     3.5  1  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'               processing                  NMRPipe     2.1  2  
'Johnson, One Moon Scientific'                                    'data analysis'             NMRView     5    3  
'Johnson, One Moon Scientific'                                    'peak picking'              NMRView     5    4  
'Johnson, One Moon Scientific'                                    'chemical shift assignment' NMRView     5    5  
'Cornilescu, Delaglio and Bax'                                    'data analysis'             TALOS       ?    6  
'Guntert, Mumenthaler and Wuthrich'                               'structure solution'        CYANA       2.0  7  
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, Kollm' refinement                  AMBER       7.0  8  
'Duggan, Legge, Dyson, Wright'                                    'data analysis'             SANE        ?    9  
'Koradi, Billeter and Wuthrich'                                   'data analysis'             Molmol      2K.2 10 
'Laskowski and MacArthur'                                         'data analysis'             ProcheckNMR ?    11 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2K2V 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2K2V 
_struct.title                     'Anabaena CcbP in the calcium-bound form' 
_struct.pdbx_descriptor           'Alr1010 protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2K2V 
_struct_keywords.pdbx_keywords   'CALCIUM-BINDING PROTEIN' 
_struct_keywords.text            'calcium-binding, CALCIUM-BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 8   ? THR A 16  ? GLU A 8   THR A 16  1 ? 9  
HELX_P HELX_P2 2 ASP A 24  ? LEU A 40  ? ASP A 24  LEU A 40  1 ? 17 
HELX_P HELX_P3 3 PRO A 70  ? LEU A 75  ? PRO A 70  LEU A 75  1 ? 6  
HELX_P HELX_P4 4 ASP A 106 ? GLY A 123 ? ASP A 106 GLY A 123 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 21 O   ? ? ? 1_555 C CA . CA ? ? A ASP 21 A CA 128 1_555 ? ? ? ? ? ? ? 2.914 ? 
metalc2  metalc ? ? A GLU 23 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 23 A CA 128 1_555 ? ? ? ? ? ? ? 2.819 ? 
metalc3  metalc ? ? A ASP 24 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 24 A CA 128 1_555 ? ? ? ? ? ? ? 2.882 ? 
metalc4  metalc ? ? A GLU 27 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 27 A CA 128 1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc5  metalc ? ? A ASP 37 O   ? ? ? 1_555 B CA . CA ? ? A ASP 37 A CA 127 1_555 ? ? ? ? ? ? ? 2.829 ? 
metalc6  metalc ? ? A ASP 37 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 37 A CA 127 1_555 ? ? ? ? ? ? ? 2.920 ? 
metalc7  metalc ? ? A ASP 38 O   ? ? ? 1_555 B CA . CA ? ? A ASP 38 A CA 127 1_555 ? ? ? ? ? ? ? 2.893 ? 
metalc8  metalc ? ? A ASP 38 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 38 A CA 127 1_555 ? ? ? ? ? ? ? 2.911 ? 
metalc9  metalc ? ? A LEU 40 O   ? ? ? 1_555 B CA . CA ? ? A LEU 40 A CA 127 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc10 metalc ? ? A GLU 41 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 41 A CA 127 1_555 ? ? ? ? ? ? ? 2.805 ? 
metalc11 metalc ? ? A GLU 27 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 27 A CA 128 1_555 ? ? ? ? ? ? ? 2.802 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 1  -10.16 
2  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 2  -10.30 
3  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 3  -10.25 
4  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 4  -1.65  
5  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 5  -0.75  
6  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 6  -2.54  
7  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 7  -10.15 
8  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 8  1.62   
9  PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 9  -10.31 
10 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 10 -0.46  
11 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 11 -1.07  
12 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 12 0.66   
13 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 13 -0.37  
14 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 14 0.42   
15 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 15 0.69   
16 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 16 -6.49  
17 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 17 -0.99  
18 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 18 0.07   
19 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 19 -2.36  
20 PHE 42 A . ? PHE 42 A PRO 43 A ? PRO 43 A 20 -10.16 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 93  ? LYS A 96  ? TYR A 93  LYS A 96  
A 2 TYR A 79  ? ASP A 84  ? TYR A 79  ASP A 84  
A 3 ILE A 58  ? MET A 68  ? ILE A 58  MET A 68  
A 4 PHE A 44  ? LYS A 51  ? PHE A 44  LYS A 51  
A 5 ILE A 100 ? ILE A 103 ? ILE A 100 ILE A 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 93 ? O TYR A 93 N VAL A 82  ? N VAL A 82  
A 2 3 O ALA A 83 ? O ALA A 83 N GLU A 64  ? N GLU A 64  
A 3 4 O VAL A 65 ? O VAL A 65 N PHE A 44  ? N PHE A 44  
A 4 5 N MET A 45 ? N MET A 45 O ILE A 103 ? O ILE A 103 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CA A 127' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CA A 128' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 2 ASP A 37 ? ASP A 37 . ? 1_555 ? 
2 AC1 2 ASP A 38 ? ASP A 38 . ? 1_555 ? 
3 AC2 3 ASP A 21 ? ASP A 21 . ? 1_555 ? 
4 AC2 3 GLU A 23 ? GLU A 23 . ? 1_555 ? 
5 AC2 3 ASP A 24 ? ASP A 24 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2K2V 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A 1 1   ? 5.433   -14.485 -4.955  1.00 0.00 ? 1   MET A N    1  
ATOM   2     C  CA   . MET A 1 1   ? 6.616   -14.211 -4.105  1.00 0.00 ? 1   MET A CA   1  
ATOM   3     C  C    . MET A 1 1   ? 7.415   -13.032 -4.674  1.00 0.00 ? 1   MET A C    1  
ATOM   4     O  O    . MET A 1 1   ? 7.580   -12.924 -5.891  1.00 0.00 ? 1   MET A O    1  
ATOM   5     C  CB   . MET A 1 1   ? 7.496   -15.471 -3.943  1.00 0.00 ? 1   MET A CB   1  
ATOM   6     C  CG   . MET A 1 1   ? 8.705   -15.254 -3.020  1.00 0.00 ? 1   MET A CG   1  
ATOM   7     S  SD   . MET A 1 1   ? 8.308   -14.597 -1.373  1.00 0.00 ? 1   MET A SD   1  
ATOM   8     C  CE   . MET A 1 1   ? 9.987   -14.407 -0.715  1.00 0.00 ? 1   MET A CE   1  
ATOM   9     H  H1   . MET A 1 1   ? 4.942   -15.303 -4.632  1.00 0.00 ? 1   MET A H1   1  
ATOM   10    H  H2   . MET A 1 1   ? 4.803   -13.695 -4.913  1.00 0.00 ? 1   MET A H2   1  
ATOM   11    H  H3   . MET A 1 1   ? 5.722   -14.622 -5.912  1.00 0.00 ? 1   MET A H3   1  
ATOM   12    H  HA   . MET A 1 1   ? 6.248   -13.933 -3.115  1.00 0.00 ? 1   MET A HA   1  
ATOM   13    H  HB2  . MET A 1 1   ? 6.891   -16.276 -3.521  1.00 0.00 ? 1   MET A HB2  1  
ATOM   14    H  HB3  . MET A 1 1   ? 7.860   -15.796 -4.919  1.00 0.00 ? 1   MET A HB3  1  
ATOM   15    H  HG2  . MET A 1 1   ? 9.214   -16.210 -2.894  1.00 0.00 ? 1   MET A HG2  1  
ATOM   16    H  HG3  . MET A 1 1   ? 9.405   -14.574 -3.506  1.00 0.00 ? 1   MET A HG3  1  
ATOM   17    H  HE1  . MET A 1 1   ? 10.502  -15.368 -0.739  1.00 0.00 ? 1   MET A HE1  1  
ATOM   18    H  HE2  . MET A 1 1   ? 10.539  -13.684 -1.317  1.00 0.00 ? 1   MET A HE2  1  
ATOM   19    H  HE3  . MET A 1 1   ? 9.936   -14.055 0.315   1.00 0.00 ? 1   MET A HE3  1  
ATOM   20    N  N    . ALA A 1 2   ? 7.937   -12.161 -3.800  1.00 0.00 ? 2   ALA A N    1  
ATOM   21    C  CA   . ALA A 1 2   ? 8.891   -11.107 -4.136  1.00 0.00 ? 2   ALA A CA   1  
ATOM   22    C  C    . ALA A 1 2   ? 9.736   -10.816 -2.893  1.00 0.00 ? 2   ALA A C    1  
ATOM   23    O  O    . ALA A 1 2   ? 9.294   -11.079 -1.771  1.00 0.00 ? 2   ALA A O    1  
ATOM   24    C  CB   . ALA A 1 2   ? 8.145   -9.845  -4.596  1.00 0.00 ? 2   ALA A CB   1  
ATOM   25    H  H    . ALA A 1 2   ? 7.832   -12.326 -2.806  1.00 0.00 ? 2   ALA A H    1  
ATOM   26    H  HA   . ALA A 1 2   ? 9.547   -11.449 -4.939  1.00 0.00 ? 2   ALA A HA   1  
ATOM   27    H  HB1  . ALA A 1 2   ? 7.444   -9.515  -3.831  1.00 0.00 ? 2   ALA A HB1  1  
ATOM   28    H  HB2  . ALA A 1 2   ? 8.856   -9.043  -4.799  1.00 0.00 ? 2   ALA A HB2  1  
ATOM   29    H  HB3  . ALA A 1 2   ? 7.594   -10.057 -5.513  1.00 0.00 ? 2   ALA A HB3  1  
ATOM   30    N  N    . SER A 1 3   ? 10.917  -10.230 -3.074  1.00 0.00 ? 3   SER A N    1  
ATOM   31    C  CA   . SER A 1 3   ? 11.914  -10.010 -2.021  1.00 0.00 ? 3   SER A CA   1  
ATOM   32    C  C    . SER A 1 3   ? 11.736  -8.646  -1.330  1.00 0.00 ? 3   SER A C    1  
ATOM   33    O  O    . SER A 1 3   ? 12.699  -8.041  -0.854  1.00 0.00 ? 3   SER A O    1  
ATOM   34    C  CB   . SER A 1 3   ? 13.316  -10.170 -2.632  1.00 0.00 ? 3   SER A CB   1  
ATOM   35    O  OG   . SER A 1 3   ? 13.413  -11.380 -3.375  1.00 0.00 ? 3   SER A OG   1  
ATOM   36    H  H    . SER A 1 3   ? 11.214  -10.018 -4.015  1.00 0.00 ? 3   SER A H    1  
ATOM   37    H  HA   . SER A 1 3   ? 11.781  -10.776 -1.257  1.00 0.00 ? 3   SER A HA   1  
ATOM   38    H  HB2  . SER A 1 3   ? 13.520  -9.327  -3.294  1.00 0.00 ? 3   SER A HB2  1  
ATOM   39    H  HB3  . SER A 1 3   ? 14.060  -10.174 -1.833  1.00 0.00 ? 3   SER A HB3  1  
ATOM   40    H  HG   . SER A 1 3   ? 14.318  -11.439 -3.732  1.00 0.00 ? 3   SER A HG   1  
ATOM   41    N  N    . VAL A 1 4   ? 10.505  -8.135  -1.315  1.00 0.00 ? 4   VAL A N    1  
ATOM   42    C  CA   . VAL A 1 4   ? 10.088  -6.851  -0.760  1.00 0.00 ? 4   VAL A CA   1  
ATOM   43    C  C    . VAL A 1 4   ? 10.051  -6.900  0.779   1.00 0.00 ? 4   VAL A C    1  
ATOM   44    O  O    . VAL A 1 4   ? 9.003   -6.749  1.407   1.00 0.00 ? 4   VAL A O    1  
ATOM   45    C  CB   . VAL A 1 4   ? 8.756   -6.433  -1.421  1.00 0.00 ? 4   VAL A CB   1  
ATOM   46    C  CG1  . VAL A 1 4   ? 9.002   -6.004  -2.875  1.00 0.00 ? 4   VAL A CG1  1  
ATOM   47    C  CG2  . VAL A 1 4   ? 7.671   -7.528  -1.407  1.00 0.00 ? 4   VAL A CG2  1  
ATOM   48    H  H    . VAL A 1 4   ? 9.766   -8.701  -1.701  1.00 0.00 ? 4   VAL A H    1  
ATOM   49    H  HA   . VAL A 1 4   ? 10.840  -6.105  -1.027  1.00 0.00 ? 4   VAL A HA   1  
ATOM   50    H  HB   . VAL A 1 4   ? 8.374   -5.566  -0.894  1.00 0.00 ? 4   VAL A HB   1  
ATOM   51    H  HG11 . VAL A 1 4   ? 9.367   -6.841  -3.471  1.00 0.00 ? 4   VAL A HG11 1  
ATOM   52    H  HG12 . VAL A 1 4   ? 8.076   -5.629  -3.312  1.00 0.00 ? 4   VAL A HG12 1  
ATOM   53    H  HG13 . VAL A 1 4   ? 9.739   -5.200  -2.900  1.00 0.00 ? 4   VAL A HG13 1  
ATOM   54    H  HG21 . VAL A 1 4   ? 7.400   -7.780  -0.382  1.00 0.00 ? 4   VAL A HG21 1  
ATOM   55    H  HG22 . VAL A 1 4   ? 6.786   -7.160  -1.916  1.00 0.00 ? 4   VAL A HG22 1  
ATOM   56    H  HG23 . VAL A 1 4   ? 8.001   -8.428  -1.917  1.00 0.00 ? 4   VAL A HG23 1  
ATOM   57    N  N    . GLU A 1 5   ? 11.201  -7.170  1.395   1.00 0.00 ? 5   GLU A N    1  
ATOM   58    C  CA   . GLU A 1 5   ? 11.328  -7.463  2.813   1.00 0.00 ? 5   GLU A CA   1  
ATOM   59    C  C    . GLU A 1 5   ? 12.633  -6.844  3.324   1.00 0.00 ? 5   GLU A C    1  
ATOM   60    O  O    . GLU A 1 5   ? 13.719  -7.260  2.911   1.00 0.00 ? 5   GLU A O    1  
ATOM   61    C  CB   . GLU A 1 5   ? 11.310  -8.992  2.971   1.00 0.00 ? 5   GLU A CB   1  
ATOM   62    C  CG   . GLU A 1 5   ? 11.404  -9.455  4.428   1.00 0.00 ? 5   GLU A CG   1  
ATOM   63    C  CD   . GLU A 1 5   ? 11.400  -10.988 4.516   1.00 0.00 ? 5   GLU A CD   1  
ATOM   64    O  OE1  . GLU A 1 5   ? 10.339  -11.592 4.243   1.00 0.00 ? 5   GLU A OE1  1  
ATOM   65    O  OE2  . GLU A 1 5   ? 12.450  -11.589 4.835   1.00 0.00 ? 5   GLU A OE2  1  
ATOM   66    H  H    . GLU A 1 5   ? 12.035  -7.299  0.828   1.00 0.00 ? 5   GLU A H    1  
ATOM   67    H  HA   . GLU A 1 5   ? 10.481  -7.042  3.356   1.00 0.00 ? 5   GLU A HA   1  
ATOM   68    H  HB2  . GLU A 1 5   ? 10.379  -9.366  2.548   1.00 0.00 ? 5   GLU A HB2  1  
ATOM   69    H  HB3  . GLU A 1 5   ? 12.134  -9.429  2.405   1.00 0.00 ? 5   GLU A HB3  1  
ATOM   70    H  HG2  . GLU A 1 5   ? 12.323  -9.069  4.867   1.00 0.00 ? 5   GLU A HG2  1  
ATOM   71    H  HG3  . GLU A 1 5   ? 10.555  -9.054  4.984   1.00 0.00 ? 5   GLU A HG3  1  
ATOM   72    N  N    . ARG A 1 6   ? 12.539  -5.847  4.217   1.00 0.00 ? 6   ARG A N    1  
ATOM   73    C  CA   . ARG A 1 6   ? 13.722  -5.329  4.915   1.00 0.00 ? 6   ARG A CA   1  
ATOM   74    C  C    . ARG A 1 6   ? 14.276  -6.375  5.881   1.00 0.00 ? 6   ARG A C    1  
ATOM   75    O  O    . ARG A 1 6   ? 15.492  -6.534  5.978   1.00 0.00 ? 6   ARG A O    1  
ATOM   76    C  CB   . ARG A 1 6   ? 13.453  -3.957  5.573   1.00 0.00 ? 6   ARG A CB   1  
ATOM   77    C  CG   . ARG A 1 6   ? 12.332  -3.827  6.631   1.00 0.00 ? 6   ARG A CG   1  
ATOM   78    C  CD   . ARG A 1 6   ? 12.658  -4.252  8.075   1.00 0.00 ? 6   ARG A CD   1  
ATOM   79    N  NE   . ARG A 1 6   ? 13.857  -3.590  8.618   1.00 0.00 ? 6   ARG A NE   1  
ATOM   80    C  CZ   . ARG A 1 6   ? 14.446  -3.881  9.787   1.00 0.00 ? 6   ARG A CZ   1  
ATOM   81    N  NH1  . ARG A 1 6   ? 13.955  -4.822  10.592  1.00 0.00 ? 6   ARG A NH1  1  
ATOM   82    N  NH2  . ARG A 1 6   ? 15.539  -3.218  10.150  1.00 0.00 ? 6   ARG A NH2  1  
ATOM   83    H  H    . ARG A 1 6   ? 11.629  -5.492  4.472   1.00 0.00 ? 6   ARG A H    1  
ATOM   84    H  HA   . ARG A 1 6   ? 14.495  -5.165  4.162   1.00 0.00 ? 6   ARG A HA   1  
ATOM   85    H  HB2  . ARG A 1 6   ? 14.389  -3.592  5.995   1.00 0.00 ? 6   ARG A HB2  1  
ATOM   86    H  HB3  . ARG A 1 6   ? 13.200  -3.271  4.762   1.00 0.00 ? 6   ARG A HB3  1  
ATOM   87    H  HG2  . ARG A 1 6   ? 12.048  -2.775  6.670   1.00 0.00 ? 6   ARG A HG2  1  
ATOM   88    H  HG3  . ARG A 1 6   ? 11.455  -4.380  6.298   1.00 0.00 ? 6   ARG A HG3  1  
ATOM   89    H  HD2  . ARG A 1 6   ? 11.807  -3.991  8.705   1.00 0.00 ? 6   ARG A HD2  1  
ATOM   90    H  HD3  . ARG A 1 6   ? 12.788  -5.328  8.128   1.00 0.00 ? 6   ARG A HD3  1  
ATOM   91    H  HE   . ARG A 1 6   ? 14.244  -2.844  8.054   1.00 0.00 ? 6   ARG A HE   1  
ATOM   92    H  HH11 . ARG A 1 6   ? 13.110  -5.341  10.350  1.00 0.00 ? 6   ARG A HH11 1  
ATOM   93    H  HH12 . ARG A 1 6   ? 14.394  -5.054  11.470  1.00 0.00 ? 6   ARG A HH12 1  
ATOM   94    H  HH21 . ARG A 1 6   ? 15.938  -2.498  9.562   1.00 0.00 ? 6   ARG A HH21 1  
ATOM   95    H  HH22 . ARG A 1 6   ? 16.014  -3.403  11.023  1.00 0.00 ? 6   ARG A HH22 1  
ATOM   96    N  N    . ASP A 1 7   ? 13.385  -7.111  6.546   1.00 0.00 ? 7   ASP A N    1  
ATOM   97    C  CA   . ASP A 1 7   ? 13.639  -8.264  7.401   1.00 0.00 ? 7   ASP A CA   1  
ATOM   98    C  C    . ASP A 1 7   ? 12.264  -8.856  7.734   1.00 0.00 ? 7   ASP A C    1  
ATOM   99    O  O    . ASP A 1 7   ? 11.236  -8.211  7.501   1.00 0.00 ? 7   ASP A O    1  
ATOM   100   C  CB   . ASP A 1 7   ? 14.377  -7.861  8.693   1.00 0.00 ? 7   ASP A CB   1  
ATOM   101   C  CG   . ASP A 1 7   ? 14.782  -9.068  9.557   1.00 0.00 ? 7   ASP A CG   1  
ATOM   102   O  OD1  . ASP A 1 7   ? 15.020  -10.164 9.003   1.00 0.00 ? 7   ASP A OD1  1  
ATOM   103   O  OD2  . ASP A 1 7   ? 14.886  -8.914  10.794  1.00 0.00 ? 7   ASP A OD2  1  
ATOM   104   H  H    . ASP A 1 7   ? 12.398  -6.931  6.407   1.00 0.00 ? 7   ASP A H    1  
ATOM   105   H  HA   . ASP A 1 7   ? 14.236  -8.995  6.853   1.00 0.00 ? 7   ASP A HA   1  
ATOM   106   H  HB2  . ASP A 1 7   ? 15.283  -7.308  8.443   1.00 0.00 ? 7   ASP A HB2  1  
ATOM   107   H  HB3  . ASP A 1 7   ? 13.733  -7.202  9.271   1.00 0.00 ? 7   ASP A HB3  1  
ATOM   108   N  N    . GLU A 1 8   ? 12.219  -10.058 8.303   1.00 0.00 ? 8   GLU A N    1  
ATOM   109   C  CA   . GLU A 1 8   ? 10.994  -10.761 8.687   1.00 0.00 ? 8   GLU A CA   1  
ATOM   110   C  C    . GLU A 1 8   ? 10.203  -10.052 9.803   1.00 0.00 ? 8   GLU A C    1  
ATOM   111   O  O    . GLU A 1 8   ? 9.139   -10.531 10.196  1.00 0.00 ? 8   GLU A O    1  
ATOM   112   C  CB   . GLU A 1 8   ? 11.323  -12.222 9.049   1.00 0.00 ? 8   GLU A CB   1  
ATOM   113   C  CG   . GLU A 1 8   ? 12.225  -12.373 10.289  1.00 0.00 ? 8   GLU A CG   1  
ATOM   114   C  CD   . GLU A 1 8   ? 12.570  -13.835 10.649  1.00 0.00 ? 8   GLU A CD   1  
ATOM   115   O  OE1  . GLU A 1 8   ? 12.353  -14.769 9.842   1.00 0.00 ? 8   GLU A OE1  1  
ATOM   116   O  OE2  . GLU A 1 8   ? 13.121  -14.064 11.751  1.00 0.00 ? 8   GLU A OE2  1  
ATOM   117   H  H    . GLU A 1 8   ? 13.102  -10.512 8.517   1.00 0.00 ? 8   GLU A H    1  
ATOM   118   H  HA   . GLU A 1 8   ? 10.348  -10.780 7.808   1.00 0.00 ? 8   GLU A HA   1  
ATOM   119   H  HB2  . GLU A 1 8   ? 10.389  -12.759 9.223   1.00 0.00 ? 8   GLU A HB2  1  
ATOM   120   H  HB3  . GLU A 1 8   ? 11.820  -12.678 8.192   1.00 0.00 ? 8   GLU A HB3  1  
ATOM   121   H  HG2  . GLU A 1 8   ? 13.157  -11.837 10.114  1.00 0.00 ? 8   GLU A HG2  1  
ATOM   122   H  HG3  . GLU A 1 8   ? 11.732  -11.903 11.142  1.00 0.00 ? 8   GLU A HG3  1  
ATOM   123   N  N    . THR A 1 9   ? 10.679  -8.909  10.306  1.00 0.00 ? 9   THR A N    1  
ATOM   124   C  CA   . THR A 1 9   ? 9.960   -8.062  11.238  1.00 0.00 ? 9   THR A CA   1  
ATOM   125   C  C    . THR A 1 9   ? 8.569   -7.705  10.710  1.00 0.00 ? 9   THR A C    1  
ATOM   126   O  O    . THR A 1 9   ? 7.589   -7.779  11.454  1.00 0.00 ? 9   THR A O    1  
ATOM   127   C  CB   . THR A 1 9   ? 10.798  -6.792  11.465  1.00 0.00 ? 9   THR A CB   1  
ATOM   128   O  OG1  . THR A 1 9   ? 11.487  -6.371  10.290  1.00 0.00 ? 9   THR A OG1  1  
ATOM   129   C  CG2  . THR A 1 9   ? 11.853  -7.012  12.548  1.00 0.00 ? 9   THR A CG2  1  
ATOM   130   H  H    . THR A 1 9   ? 11.494  -8.477  9.884   1.00 0.00 ? 9   THR A H    1  
ATOM   131   H  HA   . THR A 1 9   ? 9.834   -8.594  12.182  1.00 0.00 ? 9   THR A HA   1  
ATOM   132   H  HB   . THR A 1 9   ? 10.125  -5.999  11.764  1.00 0.00 ? 9   THR A HB   1  
ATOM   133   H  HG1  . THR A 1 9   ? 10.845  -5.926  9.712   1.00 0.00 ? 9   THR A HG1  1  
ATOM   134   H  HG21 . THR A 1 9   ? 12.556  -7.784  12.236  1.00 0.00 ? 9   THR A HG21 1  
ATOM   135   H  HG22 . THR A 1 9   ? 12.390  -6.081  12.730  1.00 0.00 ? 9   THR A HG22 1  
ATOM   136   H  HG23 . THR A 1 9   ? 11.370  -7.319  13.477  1.00 0.00 ? 9   THR A HG23 1  
ATOM   137   N  N    . ARG A 1 10  ? 8.469   -7.352  9.420   1.00 0.00 ? 10  ARG A N    1  
ATOM   138   C  CA   . ARG A 1 10  ? 7.182   -7.001  8.815   1.00 0.00 ? 10  ARG A CA   1  
ATOM   139   C  C    . ARG A 1 10  ? 6.245   -8.201  8.854   1.00 0.00 ? 10  ARG A C    1  
ATOM   140   O  O    . ARG A 1 10  ? 5.110   -8.065  9.302   1.00 0.00 ? 10  ARG A O    1  
ATOM   141   C  CB   . ARG A 1 10  ? 7.343   -6.483  7.374   1.00 0.00 ? 10  ARG A CB   1  
ATOM   142   C  CG   . ARG A 1 10  ? 7.933   -5.066  7.325   1.00 0.00 ? 10  ARG A CG   1  
ATOM   143   C  CD   . ARG A 1 10  ? 7.918   -4.508  5.894   1.00 0.00 ? 10  ARG A CD   1  
ATOM   144   N  NE   . ARG A 1 10  ? 8.473   -3.141  5.844   1.00 0.00 ? 10  ARG A NE   1  
ATOM   145   C  CZ   . ARG A 1 10  ? 7.819   -1.998  6.100   1.00 0.00 ? 10  ARG A CZ   1  
ATOM   146   N  NH1  . ARG A 1 10  ? 6.506   -1.975  6.300   1.00 0.00 ? 10  ARG A NH1  1  
ATOM   147   N  NH2  . ARG A 1 10  ? 8.491   -0.855  6.149   1.00 0.00 ? 10  ARG A NH2  1  
ATOM   148   H  H    . ARG A 1 10  ? 9.303   -7.358  8.851   1.00 0.00 ? 10  ARG A H    1  
ATOM   149   H  HA   . ARG A 1 10  ? 6.718   -6.217  9.418   1.00 0.00 ? 10  ARG A HA   1  
ATOM   150   H  HB2  . ARG A 1 10  ? 7.970   -7.167  6.798   1.00 0.00 ? 10  ARG A HB2  1  
ATOM   151   H  HB3  . ARG A 1 10  ? 6.355   -6.455  6.910   1.00 0.00 ? 10  ARG A HB3  1  
ATOM   152   H  HG2  . ARG A 1 10  ? 7.340   -4.410  7.965   1.00 0.00 ? 10  ARG A HG2  1  
ATOM   153   H  HG3  . ARG A 1 10  ? 8.959   -5.085  7.695   1.00 0.00 ? 10  ARG A HG3  1  
ATOM   154   H  HD2  . ARG A 1 10  ? 8.517   -5.157  5.255   1.00 0.00 ? 10  ARG A HD2  1  
ATOM   155   H  HD3  . ARG A 1 10  ? 6.898   -4.514  5.511   1.00 0.00 ? 10  ARG A HD3  1  
ATOM   156   H  HE   . ARG A 1 10  ? 9.459   -3.087  5.625   1.00 0.00 ? 10  ARG A HE   1  
ATOM   157   H  HH11 . ARG A 1 10  ? 5.927   -2.814  6.168   1.00 0.00 ? 10  ARG A HH11 1  
ATOM   158   H  HH12 . ARG A 1 10  ? 6.029   -1.109  6.504   1.00 0.00 ? 10  ARG A HH12 1  
ATOM   159   H  HH21 . ARG A 1 10  ? 9.491   -0.814  6.017   1.00 0.00 ? 10  ARG A HH21 1  
ATOM   160   H  HH22 . ARG A 1 10  ? 8.014   0.030   6.370   1.00 0.00 ? 10  ARG A HH22 1  
ATOM   161   N  N    . GLU A 1 11  ? 6.722   -9.375  8.437   1.00 0.00 ? 11  GLU A N    1  
ATOM   162   C  CA   . GLU A 1 11  ? 5.914   -10.588 8.420   1.00 0.00 ? 11  GLU A CA   1  
ATOM   163   C  C    . GLU A 1 11  ? 5.426   -10.917 9.829   1.00 0.00 ? 11  GLU A C    1  
ATOM   164   O  O    . GLU A 1 11  ? 4.244   -11.207 10.007  1.00 0.00 ? 11  GLU A O    1  
ATOM   165   C  CB   . GLU A 1 11  ? 6.710   -11.767 7.835   1.00 0.00 ? 11  GLU A CB   1  
ATOM   166   C  CG   . GLU A 1 11  ? 7.061   -11.593 6.350   1.00 0.00 ? 11  GLU A CG   1  
ATOM   167   C  CD   . GLU A 1 11  ? 5.827   -11.422 5.445   1.00 0.00 ? 11  GLU A CD   1  
ATOM   168   O  OE1  . GLU A 1 11  ? 4.883   -12.239 5.521   1.00 0.00 ? 11  GLU A OE1  1  
ATOM   169   O  OE2  . GLU A 1 11  ? 5.828   -10.484 4.615   1.00 0.00 ? 11  GLU A OE2  1  
ATOM   170   H  H    . GLU A 1 11  ? 7.679   -9.439  8.128   1.00 0.00 ? 11  GLU A H    1  
ATOM   171   H  HA   . GLU A 1 11  ? 5.033   -10.412 7.802   1.00 0.00 ? 11  GLU A HA   1  
ATOM   172   H  HB2  . GLU A 1 11  ? 7.634   -11.895 8.399   1.00 0.00 ? 11  GLU A HB2  1  
ATOM   173   H  HB3  . GLU A 1 11  ? 6.125   -12.680 7.952   1.00 0.00 ? 11  GLU A HB3  1  
ATOM   174   H  HG2  . GLU A 1 11  ? 7.722   -10.730 6.241   1.00 0.00 ? 11  GLU A HG2  1  
ATOM   175   H  HG3  . GLU A 1 11  ? 7.619   -12.473 6.023   1.00 0.00 ? 11  GLU A HG3  1  
ATOM   176   N  N    . HIS A 1 12  ? 6.295   -10.824 10.839  1.00 0.00 ? 12  HIS A N    1  
ATOM   177   C  CA   . HIS A 1 12  ? 5.896   -11.109 12.208  1.00 0.00 ? 12  HIS A CA   1  
ATOM   178   C  C    . HIS A 1 12  ? 4.927   -10.061 12.752  1.00 0.00 ? 12  HIS A C    1  
ATOM   179   O  O    . HIS A 1 12  ? 4.013   -10.430 13.483  1.00 0.00 ? 12  HIS A O    1  
ATOM   180   C  CB   . HIS A 1 12  ? 7.118   -11.283 13.113  1.00 0.00 ? 12  HIS A CB   1  
ATOM   181   C  CG   . HIS A 1 12  ? 7.858   -12.569 12.834  1.00 0.00 ? 12  HIS A CG   1  
ATOM   182   N  ND1  . HIS A 1 12  ? 7.314   -13.837 12.770  1.00 0.00 ? 12  HIS A ND1  1  
ATOM   183   C  CD2  . HIS A 1 12  ? 9.199   -12.695 12.594  1.00 0.00 ? 12  HIS A CD2  1  
ATOM   184   C  CE1  . HIS A 1 12  ? 8.306   -14.699 12.497  1.00 0.00 ? 12  HIS A CE1  1  
ATOM   185   N  NE2  . HIS A 1 12  ? 9.481   -14.052 12.384  1.00 0.00 ? 12  HIS A NE2  1  
ATOM   186   H  H    . HIS A 1 12  ? 7.269   -10.601 10.651  1.00 0.00 ? 12  HIS A H    1  
ATOM   187   H  HA   . HIS A 1 12  ? 5.363   -12.058 12.205  1.00 0.00 ? 12  HIS A HA   1  
ATOM   188   H  HB2  . HIS A 1 12  ? 7.789   -10.430 12.993  1.00 0.00 ? 12  HIS A HB2  1  
ATOM   189   H  HB3  . HIS A 1 12  ? 6.784   -11.307 14.152  1.00 0.00 ? 12  HIS A HB3  1  
ATOM   190   H  HD1  . HIS A 1 12  ? 6.325   -14.097 12.883  1.00 0.00 ? 12  HIS A HD1  1  
ATOM   191   H  HD2  . HIS A 1 12  ? 9.913   -11.881 12.572  1.00 0.00 ? 12  HIS A HD2  1  
ATOM   192   H  HE1  . HIS A 1 12  ? 8.170   -15.769 12.384  1.00 0.00 ? 12  HIS A HE1  1  
ATOM   193   N  N    . ARG A 1 13  ? 5.052   -8.774  12.415  1.00 0.00 ? 13  ARG A N    1  
ATOM   194   C  CA   . ARG A 1 13  ? 4.091   -7.767  12.880  1.00 0.00 ? 13  ARG A CA   1  
ATOM   195   C  C    . ARG A 1 13  ? 2.739   -7.918  12.190  1.00 0.00 ? 13  ARG A C    1  
ATOM   196   O  O    . ARG A 1 13  ? 1.712   -7.704  12.832  1.00 0.00 ? 13  ARG A O    1  
ATOM   197   C  CB   . ARG A 1 13  ? 4.663   -6.349  12.707  1.00 0.00 ? 13  ARG A CB   1  
ATOM   198   C  CG   . ARG A 1 13  ? 5.776   -6.005  13.718  1.00 0.00 ? 13  ARG A CG   1  
ATOM   199   C  CD   . ARG A 1 13  ? 5.263   -5.509  15.083  1.00 0.00 ? 13  ARG A CD   1  
ATOM   200   N  NE   . ARG A 1 13  ? 4.529   -6.541  15.841  1.00 0.00 ? 13  ARG A NE   1  
ATOM   201   C  CZ   . ARG A 1 13  ? 3.395   -6.361  16.534  1.00 0.00 ? 13  ARG A CZ   1  
ATOM   202   N  NH1  . ARG A 1 13  ? 2.863   -5.159  16.719  1.00 0.00 ? 13  ARG A NH1  1  
ATOM   203   N  NH2  . ARG A 1 13  ? 2.754   -7.394  17.058  1.00 0.00 ? 13  ARG A NH2  1  
ATOM   204   H  H    . ARG A 1 13  ? 5.833   -8.479  11.836  1.00 0.00 ? 13  ARG A H    1  
ATOM   205   H  HA   . ARG A 1 13  ? 3.896   -7.949  13.933  1.00 0.00 ? 13  ARG A HA   1  
ATOM   206   H  HB2  . ARG A 1 13  ? 5.061   -6.255  11.695  1.00 0.00 ? 13  ARG A HB2  1  
ATOM   207   H  HB3  . ARG A 1 13  ? 3.858   -5.619  12.812  1.00 0.00 ? 13  ARG A HB3  1  
ATOM   208   H  HG2  . ARG A 1 13  ? 6.435   -6.862  13.862  1.00 0.00 ? 13  ARG A HG2  1  
ATOM   209   H  HG3  . ARG A 1 13  ? 6.376   -5.202  13.288  1.00 0.00 ? 13  ARG A HG3  1  
ATOM   210   H  HD2  . ARG A 1 13  ? 6.119   -5.188  15.679  1.00 0.00 ? 13  ARG A HD2  1  
ATOM   211   H  HD3  . ARG A 1 13  ? 4.628   -4.639  14.911  1.00 0.00 ? 13  ARG A HD3  1  
ATOM   212   H  HE   . ARG A 1 13  ? 4.928   -7.472  15.813  1.00 0.00 ? 13  ARG A HE   1  
ATOM   213   H  HH11 . ARG A 1 13  ? 3.305   -4.320  16.374  1.00 0.00 ? 13  ARG A HH11 1  
ATOM   214   H  HH12 . ARG A 1 13  ? 1.983   -5.090  17.238  1.00 0.00 ? 13  ARG A HH12 1  
ATOM   215   H  HH21 . ARG A 1 13  ? 3.034   -8.354  16.855  1.00 0.00 ? 13  ARG A HH21 1  
ATOM   216   H  HH22 . ARG A 1 13  ? 1.867   -7.228  17.540  1.00 0.00 ? 13  ARG A HH22 1  
ATOM   217   N  N    . ILE A 1 14  ? 2.716   -8.329  10.923  1.00 0.00 ? 14  ILE A N    1  
ATOM   218   C  CA   . ILE A 1 14  ? 1.486   -8.712  10.237  1.00 0.00 ? 14  ILE A CA   1  
ATOM   219   C  C    . ILE A 1 14  ? 0.866   -9.881  11.020  1.00 0.00 ? 14  ILE A C    1  
ATOM   220   O  O    . ILE A 1 14  ? -0.289  -9.809  11.445  1.00 0.00 ? 14  ILE A O    1  
ATOM   221   C  CB   . ILE A 1 14  ? 1.825   -9.032  8.756   1.00 0.00 ? 14  ILE A CB   1  
ATOM   222   C  CG1  . ILE A 1 14  ? 2.161   -7.735  7.984   1.00 0.00 ? 14  ILE A CG1  1  
ATOM   223   C  CG2  . ILE A 1 14  ? 0.701   -9.800  8.043   1.00 0.00 ? 14  ILE A CG2  1  
ATOM   224   C  CD1  . ILE A 1 14  ? 2.905   -7.979  6.663   1.00 0.00 ? 14  ILE A CD1  1  
ATOM   225   H  H    . ILE A 1 14  ? 3.593   -8.445  10.424  1.00 0.00 ? 14  ILE A H    1  
ATOM   226   H  HA   . ILE A 1 14  ? 0.789   -7.876  10.267  1.00 0.00 ? 14  ILE A HA   1  
ATOM   227   H  HB   . ILE A 1 14  ? 2.706   -9.671  8.739   1.00 0.00 ? 14  ILE A HB   1  
ATOM   228   H  HG12 . ILE A 1 14  ? 1.243   -7.189  7.777   1.00 0.00 ? 14  ILE A HG12 1  
ATOM   229   H  HG13 . ILE A 1 14  ? 2.790   -7.091  8.597   1.00 0.00 ? 14  ILE A HG13 1  
ATOM   230   H  HG21 . ILE A 1 14  ? 0.557   -10.765 8.527   1.00 0.00 ? 14  ILE A HG21 1  
ATOM   231   H  HG22 . ILE A 1 14  ? -0.227  -9.228  8.070   1.00 0.00 ? 14  ILE A HG22 1  
ATOM   232   H  HG23 . ILE A 1 14  ? 0.974   -9.999  7.008   1.00 0.00 ? 14  ILE A HG23 1  
ATOM   233   H  HD11 . ILE A 1 14  ? 3.800   -8.575  6.841   1.00 0.00 ? 14  ILE A HD11 1  
ATOM   234   H  HD12 . ILE A 1 14  ? 2.262   -8.492  5.949   1.00 0.00 ? 14  ILE A HD12 1  
ATOM   235   H  HD13 . ILE A 1 14  ? 3.204   -7.021  6.236   1.00 0.00 ? 14  ILE A HD13 1  
ATOM   236   N  N    . GLU A 1 15  ? 1.652   -10.931 11.259  1.00 0.00 ? 15  GLU A N    1  
ATOM   237   C  CA   . GLU A 1 15  ? 1.222   -12.175 11.884  1.00 0.00 ? 15  GLU A CA   1  
ATOM   238   C  C    . GLU A 1 15  ? 0.725   -11.976 13.319  1.00 0.00 ? 15  GLU A C    1  
ATOM   239   O  O    . GLU A 1 15  ? -0.249  -12.614 13.705  1.00 0.00 ? 15  GLU A O    1  
ATOM   240   C  CB   . GLU A 1 15  ? 2.425   -13.132 11.829  1.00 0.00 ? 15  GLU A CB   1  
ATOM   241   C  CG   . GLU A 1 15  ? 2.293   -14.452 12.598  1.00 0.00 ? 15  GLU A CG   1  
ATOM   242   C  CD   . GLU A 1 15  ? 3.582   -15.288 12.473  1.00 0.00 ? 15  GLU A CD   1  
ATOM   243   O  OE1  . GLU A 1 15  ? 4.662   -14.829 12.915  1.00 0.00 ? 15  GLU A OE1  1  
ATOM   244   O  OE2  . GLU A 1 15  ? 3.520   -16.422 11.943  1.00 0.00 ? 15  GLU A OE2  1  
ATOM   245   H  H    . GLU A 1 15  ? 2.599   -10.918 10.889  1.00 0.00 ? 15  GLU A H    1  
ATOM   246   H  HA   . GLU A 1 15  ? 0.397   -12.587 11.298  1.00 0.00 ? 15  GLU A HA   1  
ATOM   247   H  HB2  . GLU A 1 15  ? 2.634   -13.363 10.783  1.00 0.00 ? 15  GLU A HB2  1  
ATOM   248   H  HB3  . GLU A 1 15  ? 3.284   -12.608 12.236  1.00 0.00 ? 15  GLU A HB3  1  
ATOM   249   H  HG2  . GLU A 1 15  ? 2.112   -14.245 13.654  1.00 0.00 ? 15  GLU A HG2  1  
ATOM   250   H  HG3  . GLU A 1 15  ? 1.438   -15.007 12.205  1.00 0.00 ? 15  GLU A HG3  1  
ATOM   251   N  N    . THR A 1 16  ? 1.353   -11.105 14.110  1.00 0.00 ? 16  THR A N    1  
ATOM   252   C  CA   . THR A 1 16  ? 1.089   -11.006 15.548  1.00 0.00 ? 16  THR A CA   1  
ATOM   253   C  C    . THR A 1 16  ? 0.188   -9.810  15.888  1.00 0.00 ? 16  THR A C    1  
ATOM   254   O  O    . THR A 1 16  ? 0.019   -9.488  17.066  1.00 0.00 ? 16  THR A O    1  
ATOM   255   C  CB   . THR A 1 16  ? 2.413   -11.018 16.343  1.00 0.00 ? 16  THR A CB   1  
ATOM   256   O  OG1  . THR A 1 16  ? 3.275   -9.962  15.961  1.00 0.00 ? 16  THR A OG1  1  
ATOM   257   C  CG2  . THR A 1 16  ? 3.171   -12.342 16.186  1.00 0.00 ? 16  THR A CG2  1  
ATOM   258   H  H    . THR A 1 16  ? 2.171   -10.628 13.755  1.00 0.00 ? 16  THR A H    1  
ATOM   259   H  HA   . THR A 1 16  ? 0.534   -11.893 15.858  1.00 0.00 ? 16  THR A HA   1  
ATOM   260   H  HB   . THR A 1 16  ? 2.179   -10.899 17.401  1.00 0.00 ? 16  THR A HB   1  
ATOM   261   H  HG1  . THR A 1 16  ? 3.622   -10.178 15.072  1.00 0.00 ? 16  THR A HG1  1  
ATOM   262   H  HG21 . THR A 1 16  ? 2.538   -13.167 16.513  1.00 0.00 ? 16  THR A HG21 1  
ATOM   263   H  HG22 . THR A 1 16  ? 3.458   -12.505 15.148  1.00 0.00 ? 16  THR A HG22 1  
ATOM   264   H  HG23 . THR A 1 16  ? 4.067   -12.323 16.806  1.00 0.00 ? 16  THR A HG23 1  
ATOM   265   N  N    . GLU A 1 17  ? -0.400  -9.146  14.885  1.00 0.00 ? 17  GLU A N    1  
ATOM   266   C  CA   . GLU A 1 17  ? -1.258  -7.990  15.123  1.00 0.00 ? 17  GLU A CA   1  
ATOM   267   C  C    . GLU A 1 17  ? -2.386  -7.908  14.094  1.00 0.00 ? 17  GLU A C    1  
ATOM   268   O  O    . GLU A 1 17  ? -3.555  -7.877  14.477  1.00 0.00 ? 17  GLU A O    1  
ATOM   269   C  CB   . GLU A 1 17  ? -0.402  -6.706  15.119  1.00 0.00 ? 17  GLU A CB   1  
ATOM   270   C  CG   . GLU A 1 17  ? -0.937  -5.642  16.084  1.00 0.00 ? 17  GLU A CG   1  
ATOM   271   C  CD   . GLU A 1 17  ? -0.669  -6.007  17.556  1.00 0.00 ? 17  GLU A CD   1  
ATOM   272   O  OE1  . GLU A 1 17  ? 0.511   -5.961  17.975  1.00 0.00 ? 17  GLU A OE1  1  
ATOM   273   O  OE2  . GLU A 1 17  ? -1.628  -6.309  18.300  1.00 0.00 ? 17  GLU A OE2  1  
ATOM   274   H  H    . GLU A 1 17  ? -0.240  -9.455  13.944  1.00 0.00 ? 17  GLU A H    1  
ATOM   275   H  HA   . GLU A 1 17  ? -1.720  -8.101  16.105  1.00 0.00 ? 17  GLU A HA   1  
ATOM   276   H  HB2  . GLU A 1 17  ? 0.623   -6.939  15.402  1.00 0.00 ? 17  GLU A HB2  1  
ATOM   277   H  HB3  . GLU A 1 17  ? -0.370  -6.283  14.114  1.00 0.00 ? 17  GLU A HB3  1  
ATOM   278   H  HG2  . GLU A 1 17  ? -0.442  -4.694  15.863  1.00 0.00 ? 17  GLU A HG2  1  
ATOM   279   H  HG3  . GLU A 1 17  ? -2.005  -5.507  15.913  1.00 0.00 ? 17  GLU A HG3  1  
ATOM   280   N  N    . ILE A 1 18  ? -2.057  -7.909  12.799  1.00 0.00 ? 18  ILE A N    1  
ATOM   281   C  CA   . ILE A 1 18  ? -3.026  -7.617  11.745  1.00 0.00 ? 18  ILE A CA   1  
ATOM   282   C  C    . ILE A 1 18  ? -3.912  -8.844  11.488  1.00 0.00 ? 18  ILE A C    1  
ATOM   283   O  O    . ILE A 1 18  ? -5.127  -8.690  11.358  1.00 0.00 ? 18  ILE A O    1  
ATOM   284   C  CB   . ILE A 1 18  ? -2.309  -7.101  10.468  1.00 0.00 ? 18  ILE A CB   1  
ATOM   285   C  CG1  . ILE A 1 18  ? -1.383  -5.906  10.817  1.00 0.00 ? 18  ILE A CG1  1  
ATOM   286   C  CG2  . ILE A 1 18  ? -3.326  -6.681  9.390   1.00 0.00 ? 18  ILE A CG2  1  
ATOM   287   C  CD1  . ILE A 1 18  ? -0.723  -5.217  9.616   1.00 0.00 ? 18  ILE A CD1  1  
ATOM   288   H  H    . ILE A 1 18  ? -1.087  -8.027  12.530  1.00 0.00 ? 18  ILE A H    1  
ATOM   289   H  HA   . ILE A 1 18  ? -3.673  -6.815  12.102  1.00 0.00 ? 18  ILE A HA   1  
ATOM   290   H  HB   . ILE A 1 18  ? -1.699  -7.907  10.058  1.00 0.00 ? 18  ILE A HB   1  
ATOM   291   H  HG12 . ILE A 1 18  ? -1.954  -5.156  11.367  1.00 0.00 ? 18  ILE A HG12 1  
ATOM   292   H  HG13 . ILE A 1 18  ? -0.578  -6.254  11.465  1.00 0.00 ? 18  ILE A HG13 1  
ATOM   293   H  HG21 . ILE A 1 18  ? -4.040  -7.477  9.193   1.00 0.00 ? 18  ILE A HG21 1  
ATOM   294   H  HG22 . ILE A 1 18  ? -3.873  -5.799  9.718   1.00 0.00 ? 18  ILE A HG22 1  
ATOM   295   H  HG23 . ILE A 1 18  ? -2.816  -6.464  8.452   1.00 0.00 ? 18  ILE A HG23 1  
ATOM   296   H  HD11 . ILE A 1 18  ? -0.253  -5.961  8.975   1.00 0.00 ? 18  ILE A HD11 1  
ATOM   297   H  HD12 . ILE A 1 18  ? -1.464  -4.658  9.043   1.00 0.00 ? 18  ILE A HD12 1  
ATOM   298   H  HD13 . ILE A 1 18  ? 0.036   -4.520  9.972   1.00 0.00 ? 18  ILE A HD13 1  
ATOM   299   N  N    . ILE A 1 19  ? -3.336  -10.054 11.448  1.00 0.00 ? 19  ILE A N    1  
ATOM   300   C  CA   . ILE A 1 19  ? -4.042  -11.259 10.999  1.00 0.00 ? 19  ILE A CA   1  
ATOM   301   C  C    . ILE A 1 19  ? -3.907  -12.445 11.974  1.00 0.00 ? 19  ILE A C    1  
ATOM   302   O  O    . ILE A 1 19  ? -4.110  -13.588 11.576  1.00 0.00 ? 19  ILE A O    1  
ATOM   303   C  CB   . ILE A 1 19  ? -3.609  -11.601 9.562   1.00 0.00 ? 19  ILE A CB   1  
ATOM   304   C  CG1  . ILE A 1 19  ? -2.090  -11.836 9.518   1.00 0.00 ? 19  ILE A CG1  1  
ATOM   305   C  CG2  . ILE A 1 19  ? -4.048  -10.511 8.559   1.00 0.00 ? 19  ILE A CG2  1  
ATOM   306   C  CD1  . ILE A 1 19  ? -1.706  -12.641 8.293   1.00 0.00 ? 19  ILE A CD1  1  
ATOM   307   H  H    . ILE A 1 19  ? -2.321  -10.117 11.480  1.00 0.00 ? 19  ILE A H    1  
ATOM   308   H  HA   . ILE A 1 19  ? -5.102  -11.048 10.934  1.00 0.00 ? 19  ILE A HA   1  
ATOM   309   H  HB   . ILE A 1 19  ? -4.116  -12.522 9.272   1.00 0.00 ? 19  ILE A HB   1  
ATOM   310   H  HG12 . ILE A 1 19  ? -1.570  -10.881 9.499   1.00 0.00 ? 19  ILE A HG12 1  
ATOM   311   H  HG13 . ILE A 1 19  ? -1.767  -12.396 10.395  1.00 0.00 ? 19  ILE A HG13 1  
ATOM   312   H  HG21 . ILE A 1 19  ? -3.902  -10.856 7.536   1.00 0.00 ? 19  ILE A HG21 1  
ATOM   313   H  HG22 . ILE A 1 19  ? -5.106  -10.274 8.691   1.00 0.00 ? 19  ILE A HG22 1  
ATOM   314   H  HG23 . ILE A 1 19  ? -3.460  -9.606  8.695   1.00 0.00 ? 19  ILE A HG23 1  
ATOM   315   H  HD11 . ILE A 1 19  ? -1.940  -12.068 7.400   1.00 0.00 ? 19  ILE A HD11 1  
ATOM   316   H  HD12 . ILE A 1 19  ? -0.641  -12.854 8.339   1.00 0.00 ? 19  ILE A HD12 1  
ATOM   317   H  HD13 . ILE A 1 19  ? -2.273  -13.569 8.308   1.00 0.00 ? 19  ILE A HD13 1  
ATOM   318   N  N    . VAL A 1 20  ? -3.564  -12.199 13.242  1.00 0.00 ? 20  VAL A N    1  
ATOM   319   C  CA   . VAL A 1 20  ? -3.268  -13.239 14.236  1.00 0.00 ? 20  VAL A CA   1  
ATOM   320   C  C    . VAL A 1 20  ? -4.323  -14.356 14.333  1.00 0.00 ? 20  VAL A C    1  
ATOM   321   O  O    . VAL A 1 20  ? -3.957  -15.524 14.482  1.00 0.00 ? 20  VAL A O    1  
ATOM   322   C  CB   . VAL A 1 20  ? -2.968  -12.564 15.593  1.00 0.00 ? 20  VAL A CB   1  
ATOM   323   C  CG1  . VAL A 1 20  ? -4.210  -11.923 16.232  1.00 0.00 ? 20  VAL A CG1  1  
ATOM   324   C  CG2  . VAL A 1 20  ? -2.328  -13.541 16.586  1.00 0.00 ? 20  VAL A CG2  1  
ATOM   325   H  H    . VAL A 1 20  ? -3.339  -11.248 13.492  1.00 0.00 ? 20  VAL A H    1  
ATOM   326   H  HA   . VAL A 1 20  ? -2.353  -13.726 13.904  1.00 0.00 ? 20  VAL A HA   1  
ATOM   327   H  HB   . VAL A 1 20  ? -2.247  -11.766 15.414  1.00 0.00 ? 20  VAL A HB   1  
ATOM   328   H  HG11 . VAL A 1 20  ? -3.924  -11.396 17.143  1.00 0.00 ? 20  VAL A HG11 1  
ATOM   329   H  HG12 . VAL A 1 20  ? -4.663  -11.205 15.548  1.00 0.00 ? 20  VAL A HG12 1  
ATOM   330   H  HG13 . VAL A 1 20  ? -4.946  -12.691 16.485  1.00 0.00 ? 20  VAL A HG13 1  
ATOM   331   H  HG21 . VAL A 1 20  ? -2.049  -13.013 17.499  1.00 0.00 ? 20  VAL A HG21 1  
ATOM   332   H  HG22 . VAL A 1 20  ? -3.029  -14.340 16.835  1.00 0.00 ? 20  VAL A HG22 1  
ATOM   333   H  HG23 . VAL A 1 20  ? -1.430  -13.976 16.146  1.00 0.00 ? 20  VAL A HG23 1  
ATOM   334   N  N    . ASP A 1 21  ? -5.615  -14.028 14.212  1.00 0.00 ? 21  ASP A N    1  
ATOM   335   C  CA   . ASP A 1 21  ? -6.726  -14.989 14.327  1.00 0.00 ? 21  ASP A CA   1  
ATOM   336   C  C    . ASP A 1 21  ? -7.405  -15.233 12.961  1.00 0.00 ? 21  ASP A C    1  
ATOM   337   O  O    . ASP A 1 21  ? -8.385  -15.990 12.827  1.00 0.00 ? 21  ASP A O    1  
ATOM   338   C  CB   . ASP A 1 21  ? -7.722  -14.457 15.367  1.00 0.00 ? 21  ASP A CB   1  
ATOM   339   C  CG   . ASP A 1 21  ? -8.850  -15.456 15.677  1.00 0.00 ? 21  ASP A CG   1  
ATOM   340   O  OD1  . ASP A 1 21  ? -8.559  -16.596 16.104  1.00 0.00 ? 21  ASP A OD1  1  
ATOM   341   O  OD2  . ASP A 1 21  ? -10.041 -15.086 15.557  1.00 0.00 ? 21  ASP A OD2  1  
ATOM   342   H  H    . ASP A 1 21  ? -5.858  -13.055 14.087  1.00 0.00 ? 21  ASP A H    1  
ATOM   343   H  HA   . ASP A 1 21  ? -6.327  -15.928 14.706  1.00 0.00 ? 21  ASP A HA   1  
ATOM   344   H  HB2  . ASP A 1 21  ? -7.184  -14.242 16.293  1.00 0.00 ? 21  ASP A HB2  1  
ATOM   345   H  HB3  . ASP A 1 21  ? -8.146  -13.518 15.003  1.00 0.00 ? 21  ASP A HB3  1  
ATOM   346   N  N    . ALA A 1 22  ? -6.864  -14.560 11.936  1.00 0.00 ? 22  ALA A N    1  
ATOM   347   C  CA   . ALA A 1 22  ? -7.433  -14.447 10.615  1.00 0.00 ? 22  ALA A CA   1  
ATOM   348   C  C    . ALA A 1 22  ? -6.720  -15.375 9.644   1.00 0.00 ? 22  ALA A C    1  
ATOM   349   O  O    . ALA A 1 22  ? -5.501  -15.324 9.463   1.00 0.00 ? 22  ALA A O    1  
ATOM   350   C  CB   . ALA A 1 22  ? -7.340  -13.008 10.111  1.00 0.00 ? 22  ALA A CB   1  
ATOM   351   H  H    . ALA A 1 22  ? -5.955  -14.129 12.074  1.00 0.00 ? 22  ALA A H    1  
ATOM   352   H  HA   . ALA A 1 22  ? -8.485  -14.701 10.674  1.00 0.00 ? 22  ALA A HA   1  
ATOM   353   H  HB1  . ALA A 1 22  ? -7.880  -12.334 10.776  1.00 0.00 ? 22  ALA A HB1  1  
ATOM   354   H  HB2  . ALA A 1 22  ? -6.302  -12.705 10.034  1.00 0.00 ? 22  ALA A HB2  1  
ATOM   355   H  HB3  . ALA A 1 22  ? -7.783  -12.971 9.118   1.00 0.00 ? 22  ALA A HB3  1  
ATOM   356   N  N    . GLU A 1 23  ? -7.530  -16.152 8.947   1.00 0.00 ? 23  GLU A N    1  
ATOM   357   C  CA   . GLU A 1 23  ? -7.139  -17.000 7.822   1.00 0.00 ? 23  GLU A CA   1  
ATOM   358   C  C    . GLU A 1 23  ? -8.287  -17.323 6.873   1.00 0.00 ? 23  GLU A C    1  
ATOM   359   O  O    . GLU A 1 23  ? -8.055  -17.691 5.720   1.00 0.00 ? 23  GLU A O    1  
ATOM   360   C  CB   . GLU A 1 23  ? -6.424  -18.254 8.315   1.00 0.00 ? 23  GLU A CB   1  
ATOM   361   C  CG   . GLU A 1 23  ? -7.247  -19.479 8.730   1.00 0.00 ? 23  GLU A CG   1  
ATOM   362   C  CD   . GLU A 1 23  ? -7.952  -19.344 10.087  1.00 0.00 ? 23  GLU A CD   1  
ATOM   363   O  OE1  . GLU A 1 23  ? -7.474  -18.647 11.006  1.00 0.00 ? 23  GLU A OE1  1  
ATOM   364   O  OE2  . GLU A 1 23  ? -9.034  -19.939 10.281  1.00 0.00 ? 23  GLU A OE2  1  
ATOM   365   H  H    . GLU A 1 23  ? -8.498  -16.078 9.206   1.00 0.00 ? 23  GLU A H    1  
ATOM   366   H  HA   . GLU A 1 23  ? -6.410  -16.453 7.237   1.00 0.00 ? 23  GLU A HA   1  
ATOM   367   H  HB2  . GLU A 1 23  ? -5.784  -18.566 7.499   1.00 0.00 ? 23  GLU A HB2  1  
ATOM   368   H  HB3  . GLU A 1 23  ? -5.813  -17.949 9.152   1.00 0.00 ? 23  GLU A HB3  1  
ATOM   369   H  HG2  . GLU A 1 23  ? -7.971  -19.699 7.946   1.00 0.00 ? 23  GLU A HG2  1  
ATOM   370   H  HG3  . GLU A 1 23  ? -6.564  -20.328 8.790   1.00 0.00 ? 23  GLU A HG3  1  
ATOM   371   N  N    . ASP A 1 24  ? -9.521  -17.172 7.346   1.00 0.00 ? 24  ASP A N    1  
ATOM   372   C  CA   . ASP A 1 24  ? -10.703 -17.219 6.511   1.00 0.00 ? 24  ASP A CA   1  
ATOM   373   C  C    . ASP A 1 24  ? -10.639 -15.900 5.734   1.00 0.00 ? 24  ASP A C    1  
ATOM   374   O  O    . ASP A 1 24  ? -10.250 -14.868 6.294   1.00 0.00 ? 24  ASP A O    1  
ATOM   375   C  CB   . ASP A 1 24  ? -11.971 -17.333 7.375   1.00 0.00 ? 24  ASP A CB   1  
ATOM   376   C  CG   . ASP A 1 24  ? -12.002 -18.583 8.286   1.00 0.00 ? 24  ASP A CG   1  
ATOM   377   O  OD1  . ASP A 1 24  ? -12.339 -19.677 7.778   1.00 0.00 ? 24  ASP A OD1  1  
ATOM   378   O  OD2  . ASP A 1 24  ? -11.725 -18.485 9.512   1.00 0.00 ? 24  ASP A OD2  1  
ATOM   379   H  H    . ASP A 1 24  ? -9.647  -16.771 8.259   1.00 0.00 ? 24  ASP A H    1  
ATOM   380   H  HA   . ASP A 1 24  ? -10.650 -18.071 5.833   1.00 0.00 ? 24  ASP A HA   1  
ATOM   381   H  HB2  . ASP A 1 24  ? -12.065 -16.440 7.984   1.00 0.00 ? 24  ASP A HB2  1  
ATOM   382   H  HB3  . ASP A 1 24  ? -12.828 -17.354 6.698   1.00 0.00 ? 24  ASP A HB3  1  
ATOM   383   N  N    . LYS A 1 25  ? -10.977 -15.903 4.443   1.00 0.00 ? 25  LYS A N    1  
ATOM   384   C  CA   . LYS A 1 25  ? -10.719 -14.744 3.575   1.00 0.00 ? 25  LYS A CA   1  
ATOM   385   C  C    . LYS A 1 25  ? -11.361 -13.451 4.077   1.00 0.00 ? 25  LYS A C    1  
ATOM   386   O  O    . LYS A 1 25  ? -10.774 -12.380 3.926   1.00 0.00 ? 25  LYS A O    1  
ATOM   387   C  CB   . LYS A 1 25  ? -11.104 -15.052 2.122   1.00 0.00 ? 25  LYS A CB   1  
ATOM   388   C  CG   . LYS A 1 25  ? -12.612 -15.283 1.927   1.00 0.00 ? 25  LYS A CG   1  
ATOM   389   C  CD   . LYS A 1 25  ? -12.978 -15.644 0.481   1.00 0.00 ? 25  LYS A CD   1  
ATOM   390   C  CE   . LYS A 1 25  ? -12.349 -16.977 0.046   1.00 0.00 ? 25  LYS A CE   1  
ATOM   391   N  NZ   . LYS A 1 25  ? -12.741 -17.360 -1.334  1.00 0.00 ? 25  LYS A NZ   1  
ATOM   392   H  H    . LYS A 1 25  ? -11.328 -16.756 4.031   1.00 0.00 ? 25  LYS A H    1  
ATOM   393   H  HA   . LYS A 1 25  ? -9.642  -14.583 3.583   1.00 0.00 ? 25  LYS A HA   1  
ATOM   394   H  HB2  . LYS A 1 25  ? -10.793 -14.214 1.495   1.00 0.00 ? 25  LYS A HB2  1  
ATOM   395   H  HB3  . LYS A 1 25  ? -10.546 -15.933 1.806   1.00 0.00 ? 25  LYS A HB3  1  
ATOM   396   H  HG2  . LYS A 1 25  ? -12.949 -16.079 2.592   1.00 0.00 ? 25  LYS A HG2  1  
ATOM   397   H  HG3  . LYS A 1 25  ? -13.143 -14.370 2.193   1.00 0.00 ? 25  LYS A HG3  1  
ATOM   398   H  HD2  . LYS A 1 25  ? -14.064 -15.720 0.415   1.00 0.00 ? 25  LYS A HD2  1  
ATOM   399   H  HD3  . LYS A 1 25  ? -12.643 -14.843 -0.179  1.00 0.00 ? 25  LYS A HD3  1  
ATOM   400   H  HE2  . LYS A 1 25  ? -11.261 -16.888 0.104   1.00 0.00 ? 25  LYS A HE2  1  
ATOM   401   H  HE3  . LYS A 1 25  ? -12.661 -17.756 0.745   1.00 0.00 ? 25  LYS A HE3  1  
ATOM   402   H  HZ1  . LYS A 1 25  ? -13.741 -17.472 -1.413  1.00 0.00 ? 25  LYS A HZ1  1  
ATOM   403   H  HZ2  . LYS A 1 25  ? -12.447 -16.667 -2.006  1.00 0.00 ? 25  LYS A HZ2  1  
ATOM   404   H  HZ3  . LYS A 1 25  ? -12.316 -18.237 -1.595  1.00 0.00 ? 25  LYS A HZ3  1  
ATOM   405   N  N    . GLU A 1 26  ? -12.540 -13.547 4.696   1.00 0.00 ? 26  GLU A N    1  
ATOM   406   C  CA   . GLU A 1 26  ? -13.249 -12.388 5.216   1.00 0.00 ? 26  GLU A CA   1  
ATOM   407   C  C    . GLU A 1 26  ? -12.459 -11.797 6.382   1.00 0.00 ? 26  GLU A C    1  
ATOM   408   O  O    . GLU A 1 26  ? -12.324 -10.580 6.483   1.00 0.00 ? 26  GLU A O    1  
ATOM   409   C  CB   . GLU A 1 26  ? -14.666 -12.784 5.662   1.00 0.00 ? 26  GLU A CB   1  
ATOM   410   C  CG   . GLU A 1 26  ? -15.533 -13.280 4.495   1.00 0.00 ? 26  GLU A CG   1  
ATOM   411   C  CD   . GLU A 1 26  ? -16.966 -13.603 4.954   1.00 0.00 ? 26  GLU A CD   1  
ATOM   412   O  OE1  . GLU A 1 26  ? -17.218 -14.732 5.434   1.00 0.00 ? 26  GLU A OE1  1  
ATOM   413   O  OE2  . GLU A 1 26  ? -17.865 -12.741 4.821   1.00 0.00 ? 26  GLU A OE2  1  
ATOM   414   H  H    . GLU A 1 26  ? -12.950 -14.457 4.837   1.00 0.00 ? 26  GLU A H    1  
ATOM   415   H  HA   . GLU A 1 26  ? -13.320 -11.633 4.431   1.00 0.00 ? 26  GLU A HA   1  
ATOM   416   H  HB2  . GLU A 1 26  ? -14.601 -13.566 6.419   1.00 0.00 ? 26  GLU A HB2  1  
ATOM   417   H  HB3  . GLU A 1 26  ? -15.147 -11.913 6.109   1.00 0.00 ? 26  GLU A HB3  1  
ATOM   418   H  HG2  . GLU A 1 26  ? -15.558 -12.513 3.717   1.00 0.00 ? 26  GLU A HG2  1  
ATOM   419   H  HG3  . GLU A 1 26  ? -15.083 -14.176 4.062   1.00 0.00 ? 26  GLU A HG3  1  
ATOM   420   N  N    . GLU A 1 27  ? -11.883 -12.646 7.239   1.00 0.00 ? 27  GLU A N    1  
ATOM   421   C  CA   . GLU A 1 27  ? -11.097 -12.199 8.377   1.00 0.00 ? 27  GLU A CA   1  
ATOM   422   C  C    . GLU A 1 27  ? -9.798  -11.585 7.893   1.00 0.00 ? 27  GLU A C    1  
ATOM   423   O  O    . GLU A 1 27  ? -9.391  -10.551 8.413   1.00 0.00 ? 27  GLU A O    1  
ATOM   424   C  CB   . GLU A 1 27  ? -10.716 -13.367 9.281   1.00 0.00 ? 27  GLU A CB   1  
ATOM   425   C  CG   . GLU A 1 27  ? -11.884 -14.211 9.773   1.00 0.00 ? 27  GLU A CG   1  
ATOM   426   C  CD   . GLU A 1 27  ? -11.342 -15.427 10.522  1.00 0.00 ? 27  GLU A CD   1  
ATOM   427   O  OE1  . GLU A 1 27  ? -10.319 -16.027 10.101  1.00 0.00 ? 27  GLU A OE1  1  
ATOM   428   O  OE2  . GLU A 1 27  ? -11.917 -15.806 11.568  1.00 0.00 ? 27  GLU A OE2  1  
ATOM   429   H  H    . GLU A 1 27  ? -11.908 -13.645 7.067   1.00 0.00 ? 27  GLU A H    1  
ATOM   430   H  HA   . GLU A 1 27  ? -11.661 -11.467 8.953   1.00 0.00 ? 27  GLU A HA   1  
ATOM   431   H  HB2  . GLU A 1 27  ? -10.026 -14.006 8.732   1.00 0.00 ? 27  GLU A HB2  1  
ATOM   432   H  HB3  . GLU A 1 27  ? -10.195 -12.971 10.152  1.00 0.00 ? 27  GLU A HB3  1  
ATOM   433   H  HG2  . GLU A 1 27  ? -12.509 -13.605 10.432  1.00 0.00 ? 27  GLU A HG2  1  
ATOM   434   H  HG3  . GLU A 1 27  ? -12.490 -14.543 8.931   1.00 0.00 ? 27  GLU A HG3  1  
ATOM   435   N  N    . ARG A 1 28  ? -9.133  -12.217 6.915   1.00 0.00 ? 28  ARG A N    1  
ATOM   436   C  CA   . ARG A 1 28  ? -7.897  -11.668 6.357   1.00 0.00 ? 28  ARG A CA   1  
ATOM   437   C  C    . ARG A 1 28  ? -8.158  -10.256 5.841   1.00 0.00 ? 28  ARG A C    1  
ATOM   438   O  O    . ARG A 1 28  ? -7.432  -9.330  6.206   1.00 0.00 ? 28  ARG A O    1  
ATOM   439   C  CB   . ARG A 1 28  ? -7.371  -12.572 5.233   1.00 0.00 ? 28  ARG A CB   1  
ATOM   440   C  CG   . ARG A 1 28  ? -6.666  -13.840 5.740   1.00 0.00 ? 28  ARG A CG   1  
ATOM   441   C  CD   . ARG A 1 28  ? -5.180  -13.568 6.020   1.00 0.00 ? 28  ARG A CD   1  
ATOM   442   N  NE   . ARG A 1 28  ? -4.606  -14.588 6.908   1.00 0.00 ? 28  ARG A NE   1  
ATOM   443   C  CZ   . ARG A 1 28  ? -3.829  -15.632 6.599   1.00 0.00 ? 28  ARG A CZ   1  
ATOM   444   N  NH1  . ARG A 1 28  ? -3.451  -15.897 5.350   1.00 0.00 ? 28  ARG A NH1  1  
ATOM   445   N  NH2  . ARG A 1 28  ? -3.453  -16.427 7.594   1.00 0.00 ? 28  ARG A NH2  1  
ATOM   446   H  H    . ARG A 1 28  ? -9.503  -13.096 6.548   1.00 0.00 ? 28  ARG A H    1  
ATOM   447   H  HA   . ARG A 1 28  ? -7.151  -11.589 7.149   1.00 0.00 ? 28  ARG A HA   1  
ATOM   448   H  HB2  . ARG A 1 28  ? -8.198  -12.858 4.583   1.00 0.00 ? 28  ARG A HB2  1  
ATOM   449   H  HB3  . ARG A 1 28  ? -6.665  -11.995 4.640   1.00 0.00 ? 28  ARG A HB3  1  
ATOM   450   H  HG2  . ARG A 1 28  ? -7.165  -14.191 6.644   1.00 0.00 ? 28  ARG A HG2  1  
ATOM   451   H  HG3  . ARG A 1 28  ? -6.740  -14.622 4.983   1.00 0.00 ? 28  ARG A HG3  1  
ATOM   452   H  HD2  . ARG A 1 28  ? -4.629  -13.521 5.079   1.00 0.00 ? 28  ARG A HD2  1  
ATOM   453   H  HD3  . ARG A 1 28  ? -5.081  -12.603 6.516   1.00 0.00 ? 28  ARG A HD3  1  
ATOM   454   H  HE   . ARG A 1 28  ? -4.860  -14.493 7.891   1.00 0.00 ? 28  ARG A HE   1  
ATOM   455   H  HH11 . ARG A 1 28  ? -3.767  -15.347 4.553   1.00 0.00 ? 28  ARG A HH11 1  
ATOM   456   H  HH12 . ARG A 1 28  ? -2.869  -16.692 5.131   1.00 0.00 ? 28  ARG A HH12 1  
ATOM   457   H  HH21 . ARG A 1 28  ? -3.794  -16.251 8.537   1.00 0.00 ? 28  ARG A HH21 1  
ATOM   458   H  HH22 . ARG A 1 28  ? -2.853  -17.228 7.453   1.00 0.00 ? 28  ARG A HH22 1  
ATOM   459   N  N    . ALA A 1 29  ? -9.214  -10.088 5.044   1.00 0.00 ? 29  ALA A N    1  
ATOM   460   C  CA   . ALA A 1 29  ? -9.581  -8.803  4.484   1.00 0.00 ? 29  ALA A CA   1  
ATOM   461   C  C    . ALA A 1 29  ? -9.872  -7.791  5.598   1.00 0.00 ? 29  ALA A C    1  
ATOM   462   O  O    . ALA A 1 29  ? -9.324  -6.690  5.581   1.00 0.00 ? 29  ALA A O    1  
ATOM   463   C  CB   . ALA A 1 29  ? -10.780 -9.012  3.556   1.00 0.00 ? 29  ALA A CB   1  
ATOM   464   H  H    . ALA A 1 29  ? -9.776  -10.886 4.782   1.00 0.00 ? 29  ALA A H    1  
ATOM   465   H  HA   . ALA A 1 29  ? -8.743  -8.434  3.892   1.00 0.00 ? 29  ALA A HA   1  
ATOM   466   H  HB1  . ALA A 1 29  ? -10.547 -9.784  2.821   1.00 0.00 ? 29  ALA A HB1  1  
ATOM   467   H  HB2  . ALA A 1 29  ? -11.652 -9.328  4.128   1.00 0.00 ? 29  ALA A HB2  1  
ATOM   468   H  HB3  . ALA A 1 29  ? -11.000 -8.089  3.023   1.00 0.00 ? 29  ALA A HB3  1  
ATOM   469   N  N    . MET A 1 30  ? -10.686 -8.160  6.593   1.00 0.00 ? 30  MET A N    1  
ATOM   470   C  CA   . MET A 1 30  ? -11.035 -7.260  7.689   1.00 0.00 ? 30  MET A CA   1  
ATOM   471   C  C    . MET A 1 30  ? -9.830  -6.901  8.557   1.00 0.00 ? 30  MET A C    1  
ATOM   472   O  O    . MET A 1 30  ? -9.704  -5.740  8.940   1.00 0.00 ? 30  MET A O    1  
ATOM   473   C  CB   . MET A 1 30  ? -12.176 -7.840  8.531   1.00 0.00 ? 30  MET A CB   1  
ATOM   474   C  CG   . MET A 1 30  ? -13.525 -7.829  7.796   1.00 0.00 ? 30  MET A CG   1  
ATOM   475   S  SD   . MET A 1 30  ? -14.209 -6.200  7.360   1.00 0.00 ? 30  MET A SD   1  
ATOM   476   C  CE   . MET A 1 30  ? -13.524 -5.928  5.698   1.00 0.00 ? 30  MET A CE   1  
ATOM   477   H  H    . MET A 1 30  ? -11.111 -9.083  6.578   1.00 0.00 ? 30  MET A H    1  
ATOM   478   H  HA   . MET A 1 30  ? -11.381 -6.326  7.265   1.00 0.00 ? 30  MET A HA   1  
ATOM   479   H  HB2  . MET A 1 30  ? -11.930 -8.862  8.824   1.00 0.00 ? 30  MET A HB2  1  
ATOM   480   H  HB3  . MET A 1 30  ? -12.281 -7.246  9.438   1.00 0.00 ? 30  MET A HB3  1  
ATOM   481   H  HG2  . MET A 1 30  ? -13.451 -8.427  6.890   1.00 0.00 ? 30  MET A HG2  1  
ATOM   482   H  HG3  . MET A 1 30  ? -14.248 -8.321  8.447   1.00 0.00 ? 30  MET A HG3  1  
ATOM   483   H  HE1  . MET A 1 30  ? -14.118 -5.174  5.184   1.00 0.00 ? 30  MET A HE1  1  
ATOM   484   H  HE2  . MET A 1 30  ? -12.496 -5.576  5.749   1.00 0.00 ? 30  MET A HE2  1  
ATOM   485   H  HE3  . MET A 1 30  ? -13.550 -6.856  5.130   1.00 0.00 ? 30  MET A HE3  1  
ATOM   486   N  N    . GLY A 1 31  ? -8.924  -7.840  8.835   1.00 0.00 ? 31  GLY A N    1  
ATOM   487   C  CA   . GLY A 1 31  ? -7.730  -7.580  9.621   1.00 0.00 ? 31  GLY A CA   1  
ATOM   488   C  C    . GLY A 1 31  ? -6.887  -6.505  8.948   1.00 0.00 ? 31  GLY A C    1  
ATOM   489   O  O    . GLY A 1 31  ? -6.568  -5.489  9.571   1.00 0.00 ? 31  GLY A O    1  
ATOM   490   H  H    . GLY A 1 31  ? -9.061  -8.788  8.499   1.00 0.00 ? 31  GLY A H    1  
ATOM   491   H  HA2  . GLY A 1 31  ? -8.013  -7.253  10.622  1.00 0.00 ? 31  GLY A HA2  1  
ATOM   492   H  HA3  . GLY A 1 31  ? -7.149  -8.500  9.693   1.00 0.00 ? 31  GLY A HA3  1  
ATOM   493   N  N    . TRP A 1 32  ? -6.601  -6.682  7.653   1.00 0.00 ? 32  TRP A N    1  
ATOM   494   C  CA   . TRP A 1 32  ? -5.897  -5.674  6.877   1.00 0.00 ? 32  TRP A CA   1  
ATOM   495   C  C    . TRP A 1 32  ? -6.643  -4.340  6.912   1.00 0.00 ? 32  TRP A C    1  
ATOM   496   O  O    . TRP A 1 32  ? -6.032  -3.327  7.244   1.00 0.00 ? 32  TRP A O    1  
ATOM   497   C  CB   . TRP A 1 32  ? -5.668  -6.165  5.443   1.00 0.00 ? 32  TRP A CB   1  
ATOM   498   C  CG   . TRP A 1 32  ? -4.473  -7.055  5.309   1.00 0.00 ? 32  TRP A CG   1  
ATOM   499   C  CD1  . TRP A 1 32  ? -4.472  -8.391  5.115   1.00 0.00 ? 32  TRP A CD1  1  
ATOM   500   C  CD2  . TRP A 1 32  ? -3.071  -6.668  5.369   1.00 0.00 ? 32  TRP A CD2  1  
ATOM   501   N  NE1  . TRP A 1 32  ? -3.172  -8.852  5.057   1.00 0.00 ? 32  TRP A NE1  1  
ATOM   502   C  CE2  . TRP A 1 32  ? -2.262  -7.832  5.241   1.00 0.00 ? 32  TRP A CE2  1  
ATOM   503   C  CE3  . TRP A 1 32  ? -2.408  -5.434  5.503   1.00 0.00 ? 32  TRP A CE3  1  
ATOM   504   C  CZ2  . TRP A 1 32  ? -0.860  -7.772  5.285   1.00 0.00 ? 32  TRP A CZ2  1  
ATOM   505   C  CZ3  . TRP A 1 32  ? -1.004  -5.356  5.524   1.00 0.00 ? 32  TRP A CZ3  1  
ATOM   506   C  CH2  . TRP A 1 32  ? -0.231  -6.523  5.416   1.00 0.00 ? 32  TRP A CH2  1  
ATOM   507   H  H    . TRP A 1 32  ? -6.917  -7.520  7.177   1.00 0.00 ? 32  TRP A H    1  
ATOM   508   H  HA   . TRP A 1 32  ? -4.923  -5.514  7.341   1.00 0.00 ? 32  TRP A HA   1  
ATOM   509   H  HB2  . TRP A 1 32  ? -6.559  -6.672  5.070   1.00 0.00 ? 32  TRP A HB2  1  
ATOM   510   H  HB3  . TRP A 1 32  ? -5.494  -5.297  4.805   1.00 0.00 ? 32  TRP A HB3  1  
ATOM   511   H  HD1  . TRP A 1 32  ? -5.358  -8.998  5.014   1.00 0.00 ? 32  TRP A HD1  1  
ATOM   512   H  HE1  . TRP A 1 32  ? -2.934  -9.806  4.811   1.00 0.00 ? 32  TRP A HE1  1  
ATOM   513   H  HE3  . TRP A 1 32  ? -2.998  -4.537  5.565   1.00 0.00 ? 32  TRP A HE3  1  
ATOM   514   H  HZ2  . TRP A 1 32  ? -0.271  -8.671  5.199   1.00 0.00 ? 32  TRP A HZ2  1  
ATOM   515   H  HZ3  . TRP A 1 32  ? -0.515  -4.396  5.620   1.00 0.00 ? 32  TRP A HZ3  1  
ATOM   516   H  HH2  . TRP A 1 32  ? 0.848   -6.455  5.426   1.00 0.00 ? 32  TRP A HH2  1  
ATOM   517   N  N    . TYR A 1 33  ? -7.948  -4.342  6.633   1.00 0.00 ? 33  TYR A N    1  
ATOM   518   C  CA   . TYR A 1 33  ? -8.763  -3.134  6.558   1.00 0.00 ? 33  TYR A CA   1  
ATOM   519   C  C    . TYR A 1 33  ? -8.697  -2.325  7.857   1.00 0.00 ? 33  TYR A C    1  
ATOM   520   O  O    . TYR A 1 33  ? -8.453  -1.117  7.811   1.00 0.00 ? 33  TYR A O    1  
ATOM   521   C  CB   . TYR A 1 33  ? -10.203 -3.541  6.203   1.00 0.00 ? 33  TYR A CB   1  
ATOM   522   C  CG   . TYR A 1 33  ? -11.274 -2.487  6.409   1.00 0.00 ? 33  TYR A CG   1  
ATOM   523   C  CD1  . TYR A 1 33  ? -11.153 -1.214  5.826   1.00 0.00 ? 33  TYR A CD1  1  
ATOM   524   C  CD2  . TYR A 1 33  ? -12.400 -2.786  7.198   1.00 0.00 ? 33  TYR A CD2  1  
ATOM   525   C  CE1  . TYR A 1 33  ? -12.141 -0.238  6.042   1.00 0.00 ? 33  TYR A CE1  1  
ATOM   526   C  CE2  . TYR A 1 33  ? -13.383 -1.811  7.435   1.00 0.00 ? 33  TYR A CE2  1  
ATOM   527   C  CZ   . TYR A 1 33  ? -13.262 -0.529  6.851   1.00 0.00 ? 33  TYR A CZ   1  
ATOM   528   O  OH   . TYR A 1 33  ? -14.204 0.432   7.072   1.00 0.00 ? 33  TYR A OH   1  
ATOM   529   H  H    . TYR A 1 33  ? -8.403  -5.226  6.430   1.00 0.00 ? 33  TYR A H    1  
ATOM   530   H  HA   . TYR A 1 33  ? -8.375  -2.505  5.757   1.00 0.00 ? 33  TYR A HA   1  
ATOM   531   H  HB2  . TYR A 1 33  ? -10.229 -3.859  5.163   1.00 0.00 ? 33  TYR A HB2  1  
ATOM   532   H  HB3  . TYR A 1 33  ? -10.468 -4.403  6.809   1.00 0.00 ? 33  TYR A HB3  1  
ATOM   533   H  HD1  . TYR A 1 33  ? -10.297 -0.977  5.214   1.00 0.00 ? 33  TYR A HD1  1  
ATOM   534   H  HD2  . TYR A 1 33  ? -12.504 -3.764  7.645   1.00 0.00 ? 33  TYR A HD2  1  
ATOM   535   H  HE1  . TYR A 1 33  ? -12.036 0.737   5.592   1.00 0.00 ? 33  TYR A HE1  1  
ATOM   536   H  HE2  . TYR A 1 33  ? -14.220 -2.048  8.075   1.00 0.00 ? 33  TYR A HE2  1  
ATOM   537   H  HH   . TYR A 1 33  ? -14.922 0.142   7.656   1.00 0.00 ? 33  TYR A HH   1  
ATOM   538   N  N    . TYR A 1 34  ? -8.881  -2.971  9.012   1.00 0.00 ? 34  TYR A N    1  
ATOM   539   C  CA   . TYR A 1 34  ? -8.959  -2.284  10.292  1.00 0.00 ? 34  TYR A CA   1  
ATOM   540   C  C    . TYR A 1 34  ? -7.632  -1.600  10.622  1.00 0.00 ? 34  TYR A C    1  
ATOM   541   O  O    . TYR A 1 34  ? -7.623  -0.415  10.959  1.00 0.00 ? 34  TYR A O    1  
ATOM   542   C  CB   . TYR A 1 34  ? -9.333  -3.277  11.406  1.00 0.00 ? 34  TYR A CB   1  
ATOM   543   C  CG   . TYR A 1 34  ? -10.683 -3.983  11.327  1.00 0.00 ? 34  TYR A CG   1  
ATOM   544   C  CD1  . TYR A 1 34  ? -11.718 -3.555  10.465  1.00 0.00 ? 34  TYR A CD1  1  
ATOM   545   C  CD2  . TYR A 1 34  ? -10.900 -5.095  12.165  1.00 0.00 ? 34  TYR A CD2  1  
ATOM   546   C  CE1  . TYR A 1 34  ? -12.957 -4.223  10.458  1.00 0.00 ? 34  TYR A CE1  1  
ATOM   547   C  CE2  . TYR A 1 34  ? -12.132 -5.771  12.157  1.00 0.00 ? 34  TYR A CE2  1  
ATOM   548   C  CZ   . TYR A 1 34  ? -13.171 -5.334  11.306  1.00 0.00 ? 34  TYR A CZ   1  
ATOM   549   O  OH   . TYR A 1 34  ? -14.364 -5.994  11.309  1.00 0.00 ? 34  TYR A OH   1  
ATOM   550   H  H    . TYR A 1 34  ? -9.020  -3.975  9.013   1.00 0.00 ? 34  TYR A H    1  
ATOM   551   H  HA   . TYR A 1 34  ? -9.727  -1.513  10.233  1.00 0.00 ? 34  TYR A HA   1  
ATOM   552   H  HB2  . TYR A 1 34  ? -8.556  -4.043  11.455  1.00 0.00 ? 34  TYR A HB2  1  
ATOM   553   H  HB3  . TYR A 1 34  ? -9.307  -2.735  12.353  1.00 0.00 ? 34  TYR A HB3  1  
ATOM   554   H  HD1  . TYR A 1 34  ? -11.572 -2.723  9.789   1.00 0.00 ? 34  TYR A HD1  1  
ATOM   555   H  HD2  . TYR A 1 34  ? -10.111 -5.435  12.821  1.00 0.00 ? 34  TYR A HD2  1  
ATOM   556   H  HE1  . TYR A 1 34  ? -13.743 -3.884  9.798   1.00 0.00 ? 34  TYR A HE1  1  
ATOM   557   H  HE2  . TYR A 1 34  ? -12.283 -6.623  12.806  1.00 0.00 ? 34  TYR A HE2  1  
ATOM   558   H  HH   . TYR A 1 34  ? -15.014 -5.619  10.694  1.00 0.00 ? 34  TYR A HH   1  
ATOM   559   N  N    . TYR A 1 35  ? -6.510  -2.322  10.526  1.00 0.00 ? 35  TYR A N    1  
ATOM   560   C  CA   . TYR A 1 35  ? -5.218  -1.764  10.913  1.00 0.00 ? 35  TYR A CA   1  
ATOM   561   C  C    . TYR A 1 35  ? -4.712  -0.762  9.882   1.00 0.00 ? 35  TYR A C    1  
ATOM   562   O  O    . TYR A 1 35  ? -4.067  0.214   10.272  1.00 0.00 ? 35  TYR A O    1  
ATOM   563   C  CB   . TYR A 1 35  ? -4.192  -2.877  11.149  1.00 0.00 ? 35  TYR A CB   1  
ATOM   564   C  CG   . TYR A 1 35  ? -4.369  -3.551  12.496  1.00 0.00 ? 35  TYR A CG   1  
ATOM   565   C  CD1  . TYR A 1 35  ? -5.275  -4.617  12.644  1.00 0.00 ? 35  TYR A CD1  1  
ATOM   566   C  CD2  . TYR A 1 35  ? -3.672  -3.066  13.619  1.00 0.00 ? 35  TYR A CD2  1  
ATOM   567   C  CE1  . TYR A 1 35  ? -5.485  -5.205  13.903  1.00 0.00 ? 35  TYR A CE1  1  
ATOM   568   C  CE2  . TYR A 1 35  ? -3.879  -3.644  14.884  1.00 0.00 ? 35  TYR A CE2  1  
ATOM   569   C  CZ   . TYR A 1 35  ? -4.787  -4.718  15.033  1.00 0.00 ? 35  TYR A CZ   1  
ATOM   570   O  OH   . TYR A 1 35  ? -4.993  -5.258  16.268  1.00 0.00 ? 35  TYR A OH   1  
ATOM   571   H  H    . TYR A 1 35  ? -6.551  -3.282  10.202  1.00 0.00 ? 35  TYR A H    1  
ATOM   572   H  HA   . TYR A 1 35  ? -5.344  -1.214  11.851  1.00 0.00 ? 35  TYR A HA   1  
ATOM   573   H  HB2  . TYR A 1 35  ? -4.257  -3.612  10.346  1.00 0.00 ? 35  TYR A HB2  1  
ATOM   574   H  HB3  . TYR A 1 35  ? -3.190  -2.446  11.113  1.00 0.00 ? 35  TYR A HB3  1  
ATOM   575   H  HD1  . TYR A 1 35  ? -5.821  -4.978  11.788  1.00 0.00 ? 35  TYR A HD1  1  
ATOM   576   H  HD2  . TYR A 1 35  ? -2.986  -2.236  13.515  1.00 0.00 ? 35  TYR A HD2  1  
ATOM   577   H  HE1  . TYR A 1 35  ? -6.183  -6.026  13.999  1.00 0.00 ? 35  TYR A HE1  1  
ATOM   578   H  HE2  . TYR A 1 35  ? -3.346  -3.260  15.743  1.00 0.00 ? 35  TYR A HE2  1  
ATOM   579   H  HH   . TYR A 1 35  ? -5.629  -5.990  16.264  1.00 0.00 ? 35  TYR A HH   1  
ATOM   580   N  N    . LEU A 1 36  ? -5.009  -0.952  8.591   1.00 0.00 ? 36  LEU A N    1  
ATOM   581   C  CA   . LEU A 1 36  ? -4.658  0.032   7.580   1.00 0.00 ? 36  LEU A CA   1  
ATOM   582   C  C    . LEU A 1 36  ? -5.409  1.311   7.855   1.00 0.00 ? 36  LEU A C    1  
ATOM   583   O  O    . LEU A 1 36  ? -4.728  2.325   7.984   1.00 0.00 ? 36  LEU A O    1  
ATOM   584   C  CB   . LEU A 1 36  ? -4.912  -0.453  6.146   1.00 0.00 ? 36  LEU A CB   1  
ATOM   585   C  CG   . LEU A 1 36  ? -3.637  -0.994  5.475   1.00 0.00 ? 36  LEU A CG   1  
ATOM   586   C  CD1  . LEU A 1 36  ? -2.816  -1.959  6.340   1.00 0.00 ? 36  LEU A CD1  1  
ATOM   587   C  CD2  . LEU A 1 36  ? -4.028  -1.683  4.164   1.00 0.00 ? 36  LEU A CD2  1  
ATOM   588   H  H    . LEU A 1 36  ? -5.541  -1.757  8.301   1.00 0.00 ? 36  LEU A H    1  
ATOM   589   H  HA   . LEU A 1 36  ? -3.600  0.270   7.685   1.00 0.00 ? 36  LEU A HA   1  
ATOM   590   H  HB2  . LEU A 1 36  ? -5.712  -1.188  6.128   1.00 0.00 ? 36  LEU A HB2  1  
ATOM   591   H  HB3  . LEU A 1 36  ? -5.253  0.392   5.546   1.00 0.00 ? 36  LEU A HB3  1  
ATOM   592   H  HG   . LEU A 1 36  ? -2.997  -0.140  5.251   1.00 0.00 ? 36  LEU A HG   1  
ATOM   593   H  HD11 . LEU A 1 36  ? -2.346  -1.428  7.167   1.00 0.00 ? 36  LEU A HD11 1  
ATOM   594   H  HD12 . LEU A 1 36  ? -3.462  -2.736  6.746   1.00 0.00 ? 36  LEU A HD12 1  
ATOM   595   H  HD13 . LEU A 1 36  ? -2.020  -2.402  5.742   1.00 0.00 ? 36  LEU A HD13 1  
ATOM   596   H  HD21 . LEU A 1 36  ? -3.135  -1.935  3.594   1.00 0.00 ? 36  LEU A HD21 1  
ATOM   597   H  HD22 . LEU A 1 36  ? -4.593  -2.592  4.372   1.00 0.00 ? 36  LEU A HD22 1  
ATOM   598   H  HD23 . LEU A 1 36  ? -4.649  -1.015  3.568   1.00 0.00 ? 36  LEU A HD23 1  
ATOM   599   N  N    . ASP A 1 37  ? -6.742  1.293   8.029   1.00 0.00 ? 37  ASP A N    1  
ATOM   600   C  CA   . ASP A 1 37  ? -7.423  2.543   8.358   1.00 0.00 ? 37  ASP A CA   1  
ATOM   601   C  C    . ASP A 1 37  ? -6.794  3.116   9.580   1.00 0.00 ? 37  ASP A C    1  
ATOM   602   O  O    . ASP A 1 37  ? -6.493  4.311   9.567   1.00 0.00 ? 37  ASP A O    1  
ATOM   603   C  CB   . ASP A 1 37  ? -8.929  2.473   8.677   1.00 0.00 ? 37  ASP A CB   1  
ATOM   604   C  CG   . ASP A 1 37  ? -9.484  3.869   9.125   1.00 0.00 ? 37  ASP A CG   1  
ATOM   605   O  OD1  . ASP A 1 37  ? -9.131  4.435   10.203  1.00 0.00 ? 37  ASP A OD1  1  
ATOM   606   O  OD2  . ASP A 1 37  ? -10.317 4.419   8.372   1.00 0.00 ? 37  ASP A OD2  1  
ATOM   607   H  H    . ASP A 1 37  ? -7.268  0.421   7.995   1.00 0.00 ? 37  ASP A H    1  
ATOM   608   H  HA   . ASP A 1 37  ? -7.241  3.251   7.556   1.00 0.00 ? 37  ASP A HA   1  
ATOM   609   H  HB2  . ASP A 1 37  ? -9.462  2.125   7.791   1.00 0.00 ? 37  ASP A HB2  1  
ATOM   610   H  HB3  . ASP A 1 37  ? -9.103  1.742   9.470   1.00 0.00 ? 37  ASP A HB3  1  
ATOM   611   N  N    . ASP A 1 38  ? -6.577  2.313   10.632  1.00 0.00 ? 38  ASP A N    1  
ATOM   612   C  CA   . ASP A 1 38  ? -6.212  3.002   11.840  1.00 0.00 ? 38  ASP A CA   1  
ATOM   613   C  C    . ASP A 1 38  ? -4.874  3.722   11.723  1.00 0.00 ? 38  ASP A C    1  
ATOM   614   O  O    . ASP A 1 38  ? -4.757  4.849   12.208  1.00 0.00 ? 38  ASP A O    1  
ATOM   615   C  CB   . ASP A 1 38  ? -6.437  2.286   13.161  1.00 0.00 ? 38  ASP A CB   1  
ATOM   616   C  CG   . ASP A 1 38  ? -6.607  3.394   14.239  1.00 0.00 ? 38  ASP A CG   1  
ATOM   617   O  OD1  . ASP A 1 38  ? -7.098  4.515   13.913  1.00 0.00 ? 38  ASP A OD1  1  
ATOM   618   O  OD2  . ASP A 1 38  ? -6.262  3.144   15.415  1.00 0.00 ? 38  ASP A OD2  1  
ATOM   619   H  H    . ASP A 1 38  ? -6.804  1.321   10.629  1.00 0.00 ? 38  ASP A H    1  
ATOM   620   H  HA   . ASP A 1 38  ? -6.974  3.765   11.845  1.00 0.00 ? 38  ASP A HA   1  
ATOM   621   H  HB2  . ASP A 1 38  ? -7.349  1.688   13.107  1.00 0.00 ? 38  ASP A HB2  1  
ATOM   622   H  HB3  . ASP A 1 38  ? -5.592  1.626   13.377  1.00 0.00 ? 38  ASP A HB3  1  
ATOM   623   N  N    . THR A 1 39  ? -3.964  3.160   10.930  1.00 0.00 ? 39  THR A N    1  
ATOM   624   C  CA   . THR A 1 39  ? -2.642  3.715   10.716  1.00 0.00 ? 39  THR A CA   1  
ATOM   625   C  C    . THR A 1 39  ? -2.728  4.975   9.844   1.00 0.00 ? 39  THR A C    1  
ATOM   626   O  O    . THR A 1 39  ? -2.056  5.971   10.117  1.00 0.00 ? 39  THR A O    1  
ATOM   627   C  CB   . THR A 1 39  ? -1.776  2.627   10.060  1.00 0.00 ? 39  THR A CB   1  
ATOM   628   O  OG1  . THR A 1 39  ? -1.739  1.457   10.854  1.00 0.00 ? 39  THR A OG1  1  
ATOM   629   C  CG2  . THR A 1 39  ? -0.353  3.135   9.876   1.00 0.00 ? 39  THR A CG2  1  
ATOM   630   H  H    . THR A 1 39  ? -4.253  2.366   10.338  1.00 0.00 ? 39  THR A H    1  
ATOM   631   H  HA   . THR A 1 39  ? -2.210  3.986   11.680  1.00 0.00 ? 39  THR A HA   1  
ATOM   632   H  HB   . THR A 1 39  ? -2.187  2.373   9.082   1.00 0.00 ? 39  THR A HB   1  
ATOM   633   H  HG1  . THR A 1 39  ? -2.590  0.996   10.720  1.00 0.00 ? 39  THR A HG1  1  
ATOM   634   H  HG21 . THR A 1 39  ? 0.285   2.352   9.471   1.00 0.00 ? 39  THR A HG21 1  
ATOM   635   H  HG22 . THR A 1 39  ? -0.378  3.978   9.187   1.00 0.00 ? 39  THR A HG22 1  
ATOM   636   H  HG23 . THR A 1 39  ? 0.043   3.468   10.830  1.00 0.00 ? 39  THR A HG23 1  
ATOM   637   N  N    . LEU A 1 40  ? -3.545  4.927   8.792   1.00 0.00 ? 40  LEU A N    1  
ATOM   638   C  CA   . LEU A 1 40  ? -3.772  6.028   7.873   1.00 0.00 ? 40  LEU A CA   1  
ATOM   639   C  C    . LEU A 1 40  ? -4.523  7.140   8.620   1.00 0.00 ? 40  LEU A C    1  
ATOM   640   O  O    . LEU A 1 40  ? -5.476  6.886   9.371   1.00 0.00 ? 40  LEU A O    1  
ATOM   641   C  CB   . LEU A 1 40  ? -4.585  5.514   6.667   1.00 0.00 ? 40  LEU A CB   1  
ATOM   642   C  CG   . LEU A 1 40  ? -3.919  4.376   5.852   1.00 0.00 ? 40  LEU A CG   1  
ATOM   643   C  CD1  . LEU A 1 40  ? -4.931  3.623   4.980   1.00 0.00 ? 40  LEU A CD1  1  
ATOM   644   C  CD2  . LEU A 1 40  ? -2.806  4.857   4.928   1.00 0.00 ? 40  LEU A CD2  1  
ATOM   645   H  H    . LEU A 1 40  ? -4.089  4.093   8.633   1.00 0.00 ? 40  LEU A H    1  
ATOM   646   H  HA   . LEU A 1 40  ? -2.810  6.407   7.528   1.00 0.00 ? 40  LEU A HA   1  
ATOM   647   H  HB2  . LEU A 1 40  ? -5.533  5.145   7.058   1.00 0.00 ? 40  LEU A HB2  1  
ATOM   648   H  HB3  . LEU A 1 40  ? -4.804  6.351   6.002   1.00 0.00 ? 40  LEU A HB3  1  
ATOM   649   H  HG   . LEU A 1 40  ? -3.464  3.663   6.535   1.00 0.00 ? 40  LEU A HG   1  
ATOM   650   H  HD11 . LEU A 1 40  ? -4.463  2.735   4.556   1.00 0.00 ? 40  LEU A HD11 1  
ATOM   651   H  HD12 . LEU A 1 40  ? -5.783  3.306   5.580   1.00 0.00 ? 40  LEU A HD12 1  
ATOM   652   H  HD13 . LEU A 1 40  ? -5.270  4.262   4.169   1.00 0.00 ? 40  LEU A HD13 1  
ATOM   653   H  HD21 . LEU A 1 40  ? -1.981  5.236   5.523   1.00 0.00 ? 40  LEU A HD21 1  
ATOM   654   H  HD22 . LEU A 1 40  ? -2.439  4.015   4.344   1.00 0.00 ? 40  LEU A HD22 1  
ATOM   655   H  HD23 . LEU A 1 40  ? -3.171  5.629   4.251   1.00 0.00 ? 40  LEU A HD23 1  
ATOM   656   N  N    . GLU A 1 41  ? -4.128  8.388   8.380   1.00 0.00 ? 41  GLU A N    1  
ATOM   657   C  CA   . GLU A 1 41  ? -4.727  9.571   8.991   1.00 0.00 ? 41  GLU A CA   1  
ATOM   658   C  C    . GLU A 1 41  ? -5.278  10.459  7.874   1.00 0.00 ? 41  GLU A C    1  
ATOM   659   O  O    . GLU A 1 41  ? -4.774  11.545  7.581   1.00 0.00 ? 41  GLU A O    1  
ATOM   660   C  CB   . GLU A 1 41  ? -3.738  10.254  9.951   1.00 0.00 ? 41  GLU A CB   1  
ATOM   661   C  CG   . GLU A 1 41  ? -3.500  9.422   11.224  1.00 0.00 ? 41  GLU A CG   1  
ATOM   662   C  CD   . GLU A 1 41  ? -4.744  9.351   12.136  1.00 0.00 ? 41  GLU A CD   1  
ATOM   663   O  OE1  . GLU A 1 41  ? -4.908  10.236  13.007  1.00 0.00 ? 41  GLU A OE1  1  
ATOM   664   O  OE2  . GLU A 1 41  ? -5.567  8.412   12.003  1.00 0.00 ? 41  GLU A OE2  1  
ATOM   665   H  H    . GLU A 1 41  ? -3.283  8.537   7.834   1.00 0.00 ? 41  GLU A H    1  
ATOM   666   H  HA   . GLU A 1 41  ? -5.591  9.272   9.582   1.00 0.00 ? 41  GLU A HA   1  
ATOM   667   H  HB2  . GLU A 1 41  ? -2.786  10.407  9.440   1.00 0.00 ? 41  GLU A HB2  1  
ATOM   668   H  HB3  . GLU A 1 41  ? -4.131  11.228  10.245  1.00 0.00 ? 41  GLU A HB3  1  
ATOM   669   H  HG2  . GLU A 1 41  ? -3.184  8.416   10.944  1.00 0.00 ? 41  GLU A HG2  1  
ATOM   670   H  HG3  . GLU A 1 41  ? -2.676  9.875   11.778  1.00 0.00 ? 41  GLU A HG3  1  
ATOM   671   N  N    . PHE A 1 42  ? -6.313  9.928   7.218   1.00 0.00 ? 42  PHE A N    1  
ATOM   672   C  CA   . PHE A 1 42  ? -7.126  10.612  6.221   1.00 0.00 ? 42  PHE A CA   1  
ATOM   673   C  C    . PHE A 1 42  ? -7.733  11.923  6.770   1.00 0.00 ? 42  PHE A C    1  
ATOM   674   O  O    . PHE A 1 42  ? -7.906  12.047  7.989   1.00 0.00 ? 42  PHE A O    1  
ATOM   675   C  CB   . PHE A 1 42  ? -8.270  9.678   5.804   1.00 0.00 ? 42  PHE A CB   1  
ATOM   676   C  CG   . PHE A 1 42  ? -7.869  8.363   5.169   1.00 0.00 ? 42  PHE A CG   1  
ATOM   677   C  CD1  . PHE A 1 42  ? -7.656  8.296   3.779   1.00 0.00 ? 42  PHE A CD1  1  
ATOM   678   C  CD2  . PHE A 1 42  ? -7.826  7.184   5.941   1.00 0.00 ? 42  PHE A CD2  1  
ATOM   679   C  CE1  . PHE A 1 42  ? -7.449  7.051   3.160   1.00 0.00 ? 42  PHE A CE1  1  
ATOM   680   C  CE2  . PHE A 1 42  ? -7.622  5.945   5.316   1.00 0.00 ? 42  PHE A CE2  1  
ATOM   681   C  CZ   . PHE A 1 42  ? -7.444  5.876   3.925   1.00 0.00 ? 42  PHE A CZ   1  
ATOM   682   H  H    . PHE A 1 42  ? -6.619  9.007   7.494   1.00 0.00 ? 42  PHE A H    1  
ATOM   683   H  HA   . PHE A 1 42  ? -6.498  10.819  5.358   1.00 0.00 ? 42  PHE A HA   1  
ATOM   684   H  HB2  . PHE A 1 42  ? -8.890  9.472   6.678   1.00 0.00 ? 42  PHE A HB2  1  
ATOM   685   H  HB3  . PHE A 1 42  ? -8.907  10.203  5.095   1.00 0.00 ? 42  PHE A HB3  1  
ATOM   686   H  HD1  . PHE A 1 42  ? -7.685  9.194   3.178   1.00 0.00 ? 42  PHE A HD1  1  
ATOM   687   H  HD2  . PHE A 1 42  ? -7.972  7.211   7.013   1.00 0.00 ? 42  PHE A HD2  1  
ATOM   688   H  HE1  . PHE A 1 42  ? -7.290  6.991   2.096   1.00 0.00 ? 42  PHE A HE1  1  
ATOM   689   H  HE2  . PHE A 1 42  ? -7.606  5.043   5.910   1.00 0.00 ? 42  PHE A HE2  1  
ATOM   690   H  HZ   . PHE A 1 42  ? -7.295  4.923   3.440   1.00 0.00 ? 42  PHE A HZ   1  
ATOM   691   N  N    . PRO A 1 43  ? -8.156  12.863  5.902   1.00 0.00 ? 43  PRO A N    1  
ATOM   692   C  CA   . PRO A 1 43  ? -7.914  12.867  4.462   1.00 0.00 ? 43  PRO A CA   1  
ATOM   693   C  C    . PRO A 1 43  ? -6.436  13.149  4.174   1.00 0.00 ? 43  PRO A C    1  
ATOM   694   O  O    . PRO A 1 43  ? -5.746  13.782  4.978   1.00 0.00 ? 43  PRO A O    1  
ATOM   695   C  CB   . PRO A 1 43  ? -8.826  13.961  3.899   1.00 0.00 ? 43  PRO A CB   1  
ATOM   696   C  CG   . PRO A 1 43  ? -8.939  14.956  5.053   1.00 0.00 ? 43  PRO A CG   1  
ATOM   697   C  CD   . PRO A 1 43  ? -8.887  14.061  6.293   1.00 0.00 ? 43  PRO A CD   1  
ATOM   698   H  HA   . PRO A 1 43  ? -8.196  11.915  4.018   1.00 0.00 ? 43  PRO A HA   1  
ATOM   699   H  HB2  . PRO A 1 43  ? -8.413  14.424  3.001   1.00 0.00 ? 43  PRO A HB2  1  
ATOM   700   H  HB3  . PRO A 1 43  ? -9.809  13.538  3.687   1.00 0.00 ? 43  PRO A HB3  1  
ATOM   701   H  HG2  . PRO A 1 43  ? -8.078  15.625  5.048   1.00 0.00 ? 43  PRO A HG2  1  
ATOM   702   H  HG3  . PRO A 1 43  ? -9.867  15.527  5.006   1.00 0.00 ? 43  PRO A HG3  1  
ATOM   703   H  HD2  . PRO A 1 43  ? -8.387  14.579  7.112   1.00 0.00 ? 43  PRO A HD2  1  
ATOM   704   H  HD3  . PRO A 1 43  ? -9.899  13.782  6.589   1.00 0.00 ? 43  PRO A HD3  1  
ATOM   705   N  N    . PHE A 1 44  ? -5.952  12.695  3.018   1.00 0.00 ? 44  PHE A N    1  
ATOM   706   C  CA   . PHE A 1 44  ? -4.607  13.000  2.539   1.00 0.00 ? 44  PHE A CA   1  
ATOM   707   C  C    . PHE A 1 44  ? -4.632  13.105  1.014   1.00 0.00 ? 44  PHE A C    1  
ATOM   708   O  O    . PHE A 1 44  ? -5.583  12.653  0.384   1.00 0.00 ? 44  PHE A O    1  
ATOM   709   C  CB   . PHE A 1 44  ? -3.594  11.959  3.053   1.00 0.00 ? 44  PHE A CB   1  
ATOM   710   C  CG   . PHE A 1 44  ? -3.732  10.530  2.545   1.00 0.00 ? 44  PHE A CG   1  
ATOM   711   C  CD1  . PHE A 1 44  ? -3.170  10.179  1.306   1.00 0.00 ? 44  PHE A CD1  1  
ATOM   712   C  CD2  . PHE A 1 44  ? -4.327  9.526   3.334   1.00 0.00 ? 44  PHE A CD2  1  
ATOM   713   C  CE1  . PHE A 1 44  ? -3.227  8.861   0.829   1.00 0.00 ? 44  PHE A CE1  1  
ATOM   714   C  CE2  . PHE A 1 44  ? -4.367  8.197   2.870   1.00 0.00 ? 44  PHE A CE2  1  
ATOM   715   C  CZ   . PHE A 1 44  ? -3.832  7.865   1.613   1.00 0.00 ? 44  PHE A CZ   1  
ATOM   716   H  H    . PHE A 1 44  ? -6.577  12.224  2.365   1.00 0.00 ? 44  PHE A H    1  
ATOM   717   H  HA   . PHE A 1 44  ? -4.311  13.975  2.930   1.00 0.00 ? 44  PHE A HA   1  
ATOM   718   H  HB2  . PHE A 1 44  ? -2.601  12.313  2.776   1.00 0.00 ? 44  PHE A HB2  1  
ATOM   719   H  HB3  . PHE A 1 44  ? -3.628  11.949  4.143   1.00 0.00 ? 44  PHE A HB3  1  
ATOM   720   H  HD1  . PHE A 1 44  ? -2.670  10.926  0.722   1.00 0.00 ? 44  PHE A HD1  1  
ATOM   721   H  HD2  . PHE A 1 44  ? -4.729  9.763   4.308   1.00 0.00 ? 44  PHE A HD2  1  
ATOM   722   H  HE1  . PHE A 1 44  ? -2.779  8.621   -0.127  1.00 0.00 ? 44  PHE A HE1  1  
ATOM   723   H  HE2  . PHE A 1 44  ? -4.805  7.425   3.486   1.00 0.00 ? 44  PHE A HE2  1  
ATOM   724   H  HZ   . PHE A 1 44  ? -3.866  6.842   1.261   1.00 0.00 ? 44  PHE A HZ   1  
ATOM   725   N  N    . MET A 1 45  ? -3.616  13.712  0.405   1.00 0.00 ? 45  MET A N    1  
ATOM   726   C  CA   . MET A 1 45  ? -3.520  13.840  -1.048  1.00 0.00 ? 45  MET A CA   1  
ATOM   727   C  C    . MET A 1 45  ? -2.717  12.654  -1.583  1.00 0.00 ? 45  MET A C    1  
ATOM   728   O  O    . MET A 1 45  ? -1.736  12.260  -0.953  1.00 0.00 ? 45  MET A O    1  
ATOM   729   C  CB   . MET A 1 45  ? -2.808  15.166  -1.353  1.00 0.00 ? 45  MET A CB   1  
ATOM   730   C  CG   . MET A 1 45  ? -2.665  15.435  -2.850  1.00 0.00 ? 45  MET A CG   1  
ATOM   731   S  SD   . MET A 1 45  ? -1.644  16.882  -3.220  1.00 0.00 ? 45  MET A SD   1  
ATOM   732   C  CE   . MET A 1 45  ? -1.618  16.711  -5.017  1.00 0.00 ? 45  MET A CE   1  
ATOM   733   H  H    . MET A 1 45  ? -2.829  14.031  0.950   1.00 0.00 ? 45  MET A H    1  
ATOM   734   H  HA   . MET A 1 45  ? -4.518  13.843  -1.492  1.00 0.00 ? 45  MET A HA   1  
ATOM   735   H  HB2  . MET A 1 45  ? -3.370  15.987  -0.905  1.00 0.00 ? 45  MET A HB2  1  
ATOM   736   H  HB3  . MET A 1 45  ? -1.812  15.145  -0.907  1.00 0.00 ? 45  MET A HB3  1  
ATOM   737   H  HG2  . MET A 1 45  ? -2.199  14.575  -3.327  1.00 0.00 ? 45  MET A HG2  1  
ATOM   738   H  HG3  . MET A 1 45  ? -3.655  15.572  -3.284  1.00 0.00 ? 45  MET A HG3  1  
ATOM   739   H  HE1  . MET A 1 45  ? -1.301  15.700  -5.280  1.00 0.00 ? 45  MET A HE1  1  
ATOM   740   H  HE2  . MET A 1 45  ? -2.620  16.882  -5.408  1.00 0.00 ? 45  MET A HE2  1  
ATOM   741   H  HE3  . MET A 1 45  ? -0.929  17.436  -5.450  1.00 0.00 ? 45  MET A HE3  1  
ATOM   742   N  N    . GLY A 1 46  ? -3.055  12.109  -2.753  1.00 0.00 ? 46  GLY A N    1  
ATOM   743   C  CA   . GLY A 1 46  ? -2.270  11.053  -3.357  1.00 0.00 ? 46  GLY A CA   1  
ATOM   744   C  C    . GLY A 1 46  ? -2.349  11.089  -4.870  1.00 0.00 ? 46  GLY A C    1  
ATOM   745   O  O    . GLY A 1 46  ? -3.134  11.826  -5.468  1.00 0.00 ? 46  GLY A O    1  
ATOM   746   H  H    . GLY A 1 46  ? -3.833  12.470  -3.302  1.00 0.00 ? 46  GLY A H    1  
ATOM   747   H  HA2  . GLY A 1 46  ? -1.226  11.172  -3.077  1.00 0.00 ? 46  GLY A HA2  1  
ATOM   748   H  HA3  . GLY A 1 46  ? -2.622  10.082  -3.004  1.00 0.00 ? 46  GLY A HA3  1  
ATOM   749   N  N    . LYS A 1 47  ? -1.496  10.292  -5.496  1.00 0.00 ? 47  LYS A N    1  
ATOM   750   C  CA   . LYS A 1 47  ? -1.564  10.024  -6.918  1.00 0.00 ? 47  LYS A CA   1  
ATOM   751   C  C    . LYS A 1 47  ? -2.266  8.682   -7.086  1.00 0.00 ? 47  LYS A C    1  
ATOM   752   O  O    . LYS A 1 47  ? -1.823  7.680   -6.520  1.00 0.00 ? 47  LYS A O    1  
ATOM   753   C  CB   . LYS A 1 47  ? -0.142  9.989   -7.512  1.00 0.00 ? 47  LYS A CB   1  
ATOM   754   C  CG   . LYS A 1 47  ? -0.164  10.129  -9.039  1.00 0.00 ? 47  LYS A CG   1  
ATOM   755   C  CD   . LYS A 1 47  ? -0.475  11.557  -9.524  1.00 0.00 ? 47  LYS A CD   1  
ATOM   756   C  CE   . LYS A 1 47  ? 0.704   12.519  -9.322  1.00 0.00 ? 47  LYS A CE   1  
ATOM   757   N  NZ   . LYS A 1 47  ? 0.622   13.664  -10.256 1.00 0.00 ? 47  LYS A NZ   1  
ATOM   758   H  H    . LYS A 1 47  ? -0.870  9.728   -4.933  1.00 0.00 ? 47  LYS A H    1  
ATOM   759   H  HA   . LYS A 1 47  ? -2.157  10.806  -7.394  1.00 0.00 ? 47  LYS A HA   1  
ATOM   760   H  HB2  . LYS A 1 47  ? 0.469   10.785  -7.093  1.00 0.00 ? 47  LYS A HB2  1  
ATOM   761   H  HB3  . LYS A 1 47  ? 0.336   9.045   -7.246  1.00 0.00 ? 47  LYS A HB3  1  
ATOM   762   H  HG2  . LYS A 1 47  ? 0.807   9.828   -9.435  1.00 0.00 ? 47  LYS A HG2  1  
ATOM   763   H  HG3  . LYS A 1 47  ? -0.911  9.446   -9.445  1.00 0.00 ? 47  LYS A HG3  1  
ATOM   764   H  HD2  . LYS A 1 47  ? -0.720  11.511  -10.584 1.00 0.00 ? 47  LYS A HD2  1  
ATOM   765   H  HD3  . LYS A 1 47  ? -1.344  11.956  -9.006  1.00 0.00 ? 47  LYS A HD3  1  
ATOM   766   H  HE2  . LYS A 1 47  ? 0.710   12.873  -8.289  1.00 0.00 ? 47  LYS A HE2  1  
ATOM   767   H  HE3  . LYS A 1 47  ? 1.637   11.983  -9.510  1.00 0.00 ? 47  LYS A HE3  1  
ATOM   768   H  HZ1  . LYS A 1 47  ? 0.748   13.318  -11.210 1.00 0.00 ? 47  LYS A HZ1  1  
ATOM   769   H  HZ2  . LYS A 1 47  ? -0.280  14.129  -10.189 1.00 0.00 ? 47  LYS A HZ2  1  
ATOM   770   H  HZ3  . LYS A 1 47  ? 1.349   14.340  -10.074 1.00 0.00 ? 47  LYS A HZ3  1  
ATOM   771   N  N    . TRP A 1 48  ? -3.362  8.660   -7.838  1.00 0.00 ? 48  TRP A N    1  
ATOM   772   C  CA   . TRP A 1 48  ? -3.994  7.428   -8.270  1.00 0.00 ? 48  TRP A CA   1  
ATOM   773   C  C    . TRP A 1 48  ? -3.178  7.004   -9.487  1.00 0.00 ? 48  TRP A C    1  
ATOM   774   O  O    . TRP A 1 48  ? -3.326  7.561   -10.571 1.00 0.00 ? 48  TRP A O    1  
ATOM   775   C  CB   . TRP A 1 48  ? -5.480  7.653   -8.596  1.00 0.00 ? 48  TRP A CB   1  
ATOM   776   C  CG   . TRP A 1 48  ? -6.275  6.435   -8.974  1.00 0.00 ? 48  TRP A CG   1  
ATOM   777   C  CD1  . TRP A 1 48  ? -5.804  5.170   -9.068  1.00 0.00 ? 48  TRP A CD1  1  
ATOM   778   C  CD2  . TRP A 1 48  ? -7.700  6.336   -9.287  1.00 0.00 ? 48  TRP A CD2  1  
ATOM   779   N  NE1  . TRP A 1 48  ? -6.812  4.312   -9.440  1.00 0.00 ? 48  TRP A NE1  1  
ATOM   780   C  CE2  . TRP A 1 48  ? -8.011  4.974   -9.587  1.00 0.00 ? 48  TRP A CE2  1  
ATOM   781   C  CE3  . TRP A 1 48  ? -8.771  7.256   -9.323  1.00 0.00 ? 48  TRP A CE3  1  
ATOM   782   C  CZ2  . TRP A 1 48  ? -9.310  4.551   -9.911  1.00 0.00 ? 48  TRP A CZ2  1  
ATOM   783   C  CZ3  . TRP A 1 48  ? -10.082 6.842   -9.630  1.00 0.00 ? 48  TRP A CZ3  1  
ATOM   784   C  CH2  . TRP A 1 48  ? -10.352 5.494   -9.926  1.00 0.00 ? 48  TRP A CH2  1  
ATOM   785   H  H    . TRP A 1 48  ? -3.644  9.507   -8.318  1.00 0.00 ? 48  TRP A H    1  
ATOM   786   H  HA   . TRP A 1 48  ? -3.913  6.675   -7.485  1.00 0.00 ? 48  TRP A HA   1  
ATOM   787   H  HB2  . TRP A 1 48  ? -5.958  8.092   -7.722  1.00 0.00 ? 48  TRP A HB2  1  
ATOM   788   H  HB3  . TRP A 1 48  ? -5.563  8.378   -9.406  1.00 0.00 ? 48  TRP A HB3  1  
ATOM   789   H  HD1  . TRP A 1 48  ? -4.787  4.863   -8.882  1.00 0.00 ? 48  TRP A HD1  1  
ATOM   790   H  HE1  . TRP A 1 48  ? -6.656  3.321   -9.563  1.00 0.00 ? 48  TRP A HE1  1  
ATOM   791   H  HE3  . TRP A 1 48  ? -8.580  8.291   -9.082  1.00 0.00 ? 48  TRP A HE3  1  
ATOM   792   H  HZ2  . TRP A 1 48  ? -9.513  3.511   -10.120 1.00 0.00 ? 48  TRP A HZ2  1  
ATOM   793   H  HZ3  . TRP A 1 48  ? -10.892 7.560   -9.619  1.00 0.00 ? 48  TRP A HZ3  1  
ATOM   794   H  HH2  . TRP A 1 48  ? -11.363 5.179   -10.148 1.00 0.00 ? 48  TRP A HH2  1  
ATOM   795   N  N    . LYS A 1 49  ? -2.251  6.073   -9.302  1.00 0.00 ? 49  LYS A N    1  
ATOM   796   C  CA   . LYS A 1 49  ? -1.384  5.527   -10.337 1.00 0.00 ? 49  LYS A CA   1  
ATOM   797   C  C    . LYS A 1 49  ? -2.139  4.343   -10.947 1.00 0.00 ? 49  LYS A C    1  
ATOM   798   O  O    . LYS A 1 49  ? -1.807  3.184   -10.698 1.00 0.00 ? 49  LYS A O    1  
ATOM   799   C  CB   . LYS A 1 49  ? -0.044  5.135   -9.686  1.00 0.00 ? 49  LYS A CB   1  
ATOM   800   C  CG   . LYS A 1 49  ? 0.763   6.382   -9.274  1.00 0.00 ? 49  LYS A CG   1  
ATOM   801   C  CD   . LYS A 1 49  ? 2.026   6.050   -8.465  1.00 0.00 ? 49  LYS A CD   1  
ATOM   802   C  CE   . LYS A 1 49  ? 3.002   5.151   -9.236  1.00 0.00 ? 49  LYS A CE   1  
ATOM   803   N  NZ   . LYS A 1 49  ? 4.272   4.931   -8.498  1.00 0.00 ? 49  LYS A NZ   1  
ATOM   804   H  H    . LYS A 1 49  ? -2.249  5.560   -8.436  1.00 0.00 ? 49  LYS A H    1  
ATOM   805   H  HA   . LYS A 1 49  ? -1.201  6.271   -11.116 1.00 0.00 ? 49  LYS A HA   1  
ATOM   806   H  HB2  . LYS A 1 49  ? -0.234  4.515   -8.807  1.00 0.00 ? 49  LYS A HB2  1  
ATOM   807   H  HB3  . LYS A 1 49  ? 0.539   4.549   -10.394 1.00 0.00 ? 49  LYS A HB3  1  
ATOM   808   H  HG2  . LYS A 1 49  ? 1.041   6.943   -10.169 1.00 0.00 ? 49  LYS A HG2  1  
ATOM   809   H  HG3  . LYS A 1 49  ? 0.142   7.025   -8.651  1.00 0.00 ? 49  LYS A HG3  1  
ATOM   810   H  HD2  . LYS A 1 49  ? 2.521   6.988   -8.212  1.00 0.00 ? 49  LYS A HD2  1  
ATOM   811   H  HD3  . LYS A 1 49  ? 1.730   5.553   -7.541  1.00 0.00 ? 49  LYS A HD3  1  
ATOM   812   H  HE2  . LYS A 1 49  ? 2.518   4.188   -9.416  1.00 0.00 ? 49  LYS A HE2  1  
ATOM   813   H  HE3  . LYS A 1 49  ? 3.218   5.615   -10.200 1.00 0.00 ? 49  LYS A HE3  1  
ATOM   814   H  HZ1  . LYS A 1 49  ? 4.895   4.339   -9.030  1.00 0.00 ? 49  LYS A HZ1  1  
ATOM   815   H  HZ2  . LYS A 1 49  ? 4.756   5.801   -8.329  1.00 0.00 ? 49  LYS A HZ2  1  
ATOM   816   H  HZ3  . LYS A 1 49  ? 4.111   4.478   -7.610  1.00 0.00 ? 49  LYS A HZ3  1  
ATOM   817   N  N    . LYS A 1 50  ? -3.235  4.642   -11.647 1.00 0.00 ? 50  LYS A N    1  
ATOM   818   C  CA   . LYS A 1 50  ? -4.169  3.623   -12.111 1.00 0.00 ? 50  LYS A CA   1  
ATOM   819   C  C    . LYS A 1 50  ? -3.441  2.743   -13.120 1.00 0.00 ? 50  LYS A C    1  
ATOM   820   O  O    . LYS A 1 50  ? -2.807  3.283   -14.029 1.00 0.00 ? 50  LYS A O    1  
ATOM   821   C  CB   . LYS A 1 50  ? -5.412  4.297   -12.713 1.00 0.00 ? 50  LYS A CB   1  
ATOM   822   C  CG   . LYS A 1 50  ? -6.565  3.302   -12.905 1.00 0.00 ? 50  LYS A CG   1  
ATOM   823   C  CD   . LYS A 1 50  ? -7.812  4.005   -13.457 1.00 0.00 ? 50  LYS A CD   1  
ATOM   824   C  CE   . LYS A 1 50  ? -8.947  2.988   -13.645 1.00 0.00 ? 50  LYS A CE   1  
ATOM   825   N  NZ   . LYS A 1 50  ? -10.178 3.612   -14.190 1.00 0.00 ? 50  LYS A NZ   1  
ATOM   826   H  H    . LYS A 1 50  ? -3.428  5.642   -11.836 1.00 0.00 ? 50  LYS A H    1  
ATOM   827   H  HA   . LYS A 1 50  ? -4.464  3.016   -11.255 1.00 0.00 ? 50  LYS A HA   1  
ATOM   828   H  HB2  . LYS A 1 50  ? -5.747  5.092   -12.044 1.00 0.00 ? 50  LYS A HB2  1  
ATOM   829   H  HB3  . LYS A 1 50  ? -5.157  4.742   -13.675 1.00 0.00 ? 50  LYS A HB3  1  
ATOM   830   H  HG2  . LYS A 1 50  ? -6.260  2.522   -13.600 1.00 0.00 ? 50  LYS A HG2  1  
ATOM   831   H  HG3  . LYS A 1 50  ? -6.808  2.840   -11.947 1.00 0.00 ? 50  LYS A HG3  1  
ATOM   832   H  HD2  . LYS A 1 50  ? -8.127  4.782   -12.758 1.00 0.00 ? 50  LYS A HD2  1  
ATOM   833   H  HD3  . LYS A 1 50  ? -7.569  4.465   -14.417 1.00 0.00 ? 50  LYS A HD3  1  
ATOM   834   H  HE2  . LYS A 1 50  ? -8.605  2.203   -14.325 1.00 0.00 ? 50  LYS A HE2  1  
ATOM   835   H  HE3  . LYS A 1 50  ? -9.169  2.525   -12.681 1.00 0.00 ? 50  LYS A HE3  1  
ATOM   836   H  HZ1  . LYS A 1 50  ? -10.532 4.328   -13.575 1.00 0.00 ? 50  LYS A HZ1  1  
ATOM   837   H  HZ2  . LYS A 1 50  ? -10.010 4.025   -15.096 1.00 0.00 ? 50  LYS A HZ2  1  
ATOM   838   H  HZ3  . LYS A 1 50  ? -10.907 2.921   -14.304 1.00 0.00 ? 50  LYS A HZ3  1  
ATOM   839   N  N    . LYS A 1 51  ? -3.511  1.414   -13.007 1.00 0.00 ? 51  LYS A N    1  
ATOM   840   C  CA   . LYS A 1 51  ? -3.013  0.541   -14.072 1.00 0.00 ? 51  LYS A CA   1  
ATOM   841   C  C    . LYS A 1 51  ? -3.728  0.931   -15.369 1.00 0.00 ? 51  LYS A C    1  
ATOM   842   O  O    . LYS A 1 51  ? -4.951  1.095   -15.374 1.00 0.00 ? 51  LYS A O    1  
ATOM   843   C  CB   . LYS A 1 51  ? -3.227  -0.936  -13.710 1.00 0.00 ? 51  LYS A CB   1  
ATOM   844   C  CG   . LYS A 1 51  ? -2.512  -1.863  -14.710 1.00 0.00 ? 51  LYS A CG   1  
ATOM   845   C  CD   . LYS A 1 51  ? -2.657  -3.353  -14.364 1.00 0.00 ? 51  LYS A CD   1  
ATOM   846   C  CE   . LYS A 1 51  ? -4.104  -3.844  -14.528 1.00 0.00 ? 51  LYS A CE   1  
ATOM   847   N  NZ   . LYS A 1 51  ? -4.237  -5.299  -14.259 1.00 0.00 ? 51  LYS A NZ   1  
ATOM   848   H  H    . LYS A 1 51  ? -3.929  0.992   -12.180 1.00 0.00 ? 51  LYS A H    1  
ATOM   849   H  HA   . LYS A 1 51  ? -1.942  0.726   -14.182 1.00 0.00 ? 51  LYS A HA   1  
ATOM   850   H  HB2  . LYS A 1 51  ? -2.822  -1.119  -12.713 1.00 0.00 ? 51  LYS A HB2  1  
ATOM   851   H  HB3  . LYS A 1 51  ? -4.297  -1.151  -13.698 1.00 0.00 ? 51  LYS A HB3  1  
ATOM   852   H  HG2  . LYS A 1 51  ? -2.902  -1.697  -15.715 1.00 0.00 ? 51  LYS A HG2  1  
ATOM   853   H  HG3  . LYS A 1 51  ? -1.449  -1.615  -14.715 1.00 0.00 ? 51  LYS A HG3  1  
ATOM   854   H  HD2  . LYS A 1 51  ? -2.012  -3.923  -15.033 1.00 0.00 ? 51  LYS A HD2  1  
ATOM   855   H  HD3  . LYS A 1 51  ? -2.321  -3.518  -13.339 1.00 0.00 ? 51  LYS A HD3  1  
ATOM   856   H  HE2  . LYS A 1 51  ? -4.749  -3.290  -13.843 1.00 0.00 ? 51  LYS A HE2  1  
ATOM   857   H  HE3  . LYS A 1 51  ? -4.434  -3.633  -15.548 1.00 0.00 ? 51  LYS A HE3  1  
ATOM   858   H  HZ1  . LYS A 1 51  ? -3.677  -5.843  -14.898 1.00 0.00 ? 51  LYS A HZ1  1  
ATOM   859   H  HZ2  . LYS A 1 51  ? -3.955  -5.527  -13.318 1.00 0.00 ? 51  LYS A HZ2  1  
ATOM   860   H  HZ3  . LYS A 1 51  ? -5.196  -5.596  -14.370 1.00 0.00 ? 51  LYS A HZ3  1  
ATOM   861   N  N    . SER A 1 52  ? -2.969  1.122   -16.445 1.00 0.00 ? 52  SER A N    1  
ATOM   862   C  CA   . SER A 1 52  ? -3.489  1.583   -17.719 1.00 0.00 ? 52  SER A CA   1  
ATOM   863   C  C    . SER A 1 52  ? -4.501  0.584   -18.287 1.00 0.00 ? 52  SER A C    1  
ATOM   864   O  O    . SER A 1 52  ? -4.474  -0.615  -17.996 1.00 0.00 ? 52  SER A O    1  
ATOM   865   C  CB   . SER A 1 52  ? -2.320  1.804   -18.685 1.00 0.00 ? 52  SER A CB   1  
ATOM   866   O  OG   . SER A 1 52  ? -2.780  2.289   -19.934 1.00 0.00 ? 52  SER A OG   1  
ATOM   867   H  H    . SER A 1 52  ? -1.976  0.927   -16.386 1.00 0.00 ? 52  SER A H    1  
ATOM   868   H  HA   . SER A 1 52  ? -3.986  2.539   -17.554 1.00 0.00 ? 52  SER A HA   1  
ATOM   869   H  HB2  . SER A 1 52  ? -1.626  2.525   -18.252 1.00 0.00 ? 52  SER A HB2  1  
ATOM   870   H  HB3  . SER A 1 52  ? -1.794  0.865   -18.841 1.00 0.00 ? 52  SER A HB3  1  
ATOM   871   H  HG   . SER A 1 52  ? -2.018  2.653   -20.415 1.00 0.00 ? 52  SER A HG   1  
ATOM   872   N  N    . ARG A 1 53  ? -5.389  1.092   -19.146 1.00 0.00 ? 53  ARG A N    1  
ATOM   873   C  CA   . ARG A 1 53  ? -6.272  0.257   -19.952 1.00 0.00 ? 53  ARG A CA   1  
ATOM   874   C  C    . ARG A 1 53  ? -5.469  -0.431  -21.061 1.00 0.00 ? 53  ARG A C    1  
ATOM   875   O  O    . ARG A 1 53  ? -5.877  -1.499  -21.520 1.00 0.00 ? 53  ARG A O    1  
ATOM   876   C  CB   . ARG A 1 53  ? -7.407  1.135   -20.519 1.00 0.00 ? 53  ARG A CB   1  
ATOM   877   C  CG   . ARG A 1 53  ? -8.365  0.427   -21.495 1.00 0.00 ? 53  ARG A CG   1  
ATOM   878   C  CD   . ARG A 1 53  ? -9.031  -0.824  -20.901 1.00 0.00 ? 53  ARG A CD   1  
ATOM   879   N  NE   . ARG A 1 53  ? -9.829  -1.543  -21.909 1.00 0.00 ? 53  ARG A NE   1  
ATOM   880   C  CZ   . ARG A 1 53  ? -9.370  -2.444  -22.790 1.00 0.00 ? 53  ARG A CZ   1  
ATOM   881   N  NH1  . ARG A 1 53  ? -8.073  -2.745  -22.858 1.00 0.00 ? 53  ARG A NH1  1  
ATOM   882   N  NH2  . ARG A 1 53  ? -10.223 -3.046  -23.613 1.00 0.00 ? 53  ARG A NH2  1  
ATOM   883   H  H    . ARG A 1 53  ? -5.337  2.080   -19.361 1.00 0.00 ? 53  ARG A H    1  
ATOM   884   H  HA   . ARG A 1 53  ? -6.696  -0.515  -19.307 1.00 0.00 ? 53  ARG A HA   1  
ATOM   885   H  HB2  . ARG A 1 53  ? -7.991  1.528   -19.685 1.00 0.00 ? 53  ARG A HB2  1  
ATOM   886   H  HB3  . ARG A 1 53  ? -6.966  1.987   -21.042 1.00 0.00 ? 53  ARG A HB3  1  
ATOM   887   H  HG2  . ARG A 1 53  ? -9.146  1.132   -21.785 1.00 0.00 ? 53  ARG A HG2  1  
ATOM   888   H  HG3  . ARG A 1 53  ? -7.819  0.156   -22.399 1.00 0.00 ? 53  ARG A HG3  1  
ATOM   889   H  HD2  . ARG A 1 53  ? -8.280  -1.502  -20.498 1.00 0.00 ? 53  ARG A HD2  1  
ATOM   890   H  HD3  . ARG A 1 53  ? -9.682  -0.521  -20.081 1.00 0.00 ? 53  ARG A HD3  1  
ATOM   891   H  HE   . ARG A 1 53  ? -10.822 -1.340  -21.897 1.00 0.00 ? 53  ARG A HE   1  
ATOM   892   H  HH11 . ARG A 1 53  ? -7.390  -2.281  -22.260 1.00 0.00 ? 53  ARG A HH11 1  
ATOM   893   H  HH12 . ARG A 1 53  ? -7.716  -3.426  -23.512 1.00 0.00 ? 53  ARG A HH12 1  
ATOM   894   H  HH21 . ARG A 1 53  ? -11.213 -2.839  -23.585 1.00 0.00 ? 53  ARG A HH21 1  
ATOM   895   H  HH22 . ARG A 1 53  ? -9.921  -3.730  -24.293 1.00 0.00 ? 53  ARG A HH22 1  
ATOM   896   N  N    . LYS A 1 54  ? -4.366  0.170   -21.523 1.00 0.00 ? 54  LYS A N    1  
ATOM   897   C  CA   . LYS A 1 54  ? -3.624  -0.330  -22.678 1.00 0.00 ? 54  LYS A CA   1  
ATOM   898   C  C    . LYS A 1 54  ? -2.774  -1.542  -22.299 1.00 0.00 ? 54  LYS A C    1  
ATOM   899   O  O    . LYS A 1 54  ? -2.788  -2.538  -23.022 1.00 0.00 ? 54  LYS A O    1  
ATOM   900   C  CB   . LYS A 1 54  ? -2.751  0.807   -23.245 1.00 0.00 ? 54  LYS A CB   1  
ATOM   901   C  CG   . LYS A 1 54  ? -1.969  0.450   -24.521 1.00 0.00 ? 54  LYS A CG   1  
ATOM   902   C  CD   . LYS A 1 54  ? -2.875  0.065   -25.704 1.00 0.00 ? 54  LYS A CD   1  
ATOM   903   C  CE   . LYS A 1 54  ? -2.093  -0.078  -27.020 1.00 0.00 ? 54  LYS A CE   1  
ATOM   904   N  NZ   . LYS A 1 54  ? -1.151  -1.228  -27.020 1.00 0.00 ? 54  LYS A NZ   1  
ATOM   905   H  H    . LYS A 1 54  ? -4.046  1.028   -21.084 1.00 0.00 ? 54  LYS A H    1  
ATOM   906   H  HA   . LYS A 1 54  ? -4.347  -0.640  -23.434 1.00 0.00 ? 54  LYS A HA   1  
ATOM   907   H  HB2  . LYS A 1 54  ? -3.389  1.665   -23.463 1.00 0.00 ? 54  LYS A HB2  1  
ATOM   908   H  HB3  . LYS A 1 54  ? -2.031  1.114   -22.484 1.00 0.00 ? 54  LYS A HB3  1  
ATOM   909   H  HG2  . LYS A 1 54  ? -1.377  1.321   -24.805 1.00 0.00 ? 54  LYS A HG2  1  
ATOM   910   H  HG3  . LYS A 1 54  ? -1.281  -0.367  -24.307 1.00 0.00 ? 54  LYS A HG3  1  
ATOM   911   H  HD2  . LYS A 1 54  ? -3.397  -0.868  -25.491 1.00 0.00 ? 54  LYS A HD2  1  
ATOM   912   H  HD3  . LYS A 1 54  ? -3.622  0.850   -25.840 1.00 0.00 ? 54  LYS A HD3  1  
ATOM   913   H  HE2  . LYS A 1 54  ? -2.812  -0.208  -27.832 1.00 0.00 ? 54  LYS A HE2  1  
ATOM   914   H  HE3  . LYS A 1 54  ? -1.544  0.848   -27.208 1.00 0.00 ? 54  LYS A HE3  1  
ATOM   915   H  HZ1  . LYS A 1 54  ? -1.636  -2.099  -26.860 1.00 0.00 ? 54  LYS A HZ1  1  
ATOM   916   H  HZ2  . LYS A 1 54  ? -0.687  -1.302  -27.914 1.00 0.00 ? 54  LYS A HZ2  1  
ATOM   917   H  HZ3  . LYS A 1 54  ? -0.436  -1.121  -26.317 1.00 0.00 ? 54  LYS A HZ3  1  
ATOM   918   N  N    . THR A 1 55  ? -2.061  -1.468  -21.177 1.00 0.00 ? 55  THR A N    1  
ATOM   919   C  CA   . THR A 1 55  ? -1.036  -2.429  -20.776 1.00 0.00 ? 55  THR A CA   1  
ATOM   920   C  C    . THR A 1 55  ? -0.857  -2.354  -19.251 1.00 0.00 ? 55  THR A C    1  
ATOM   921   O  O    . THR A 1 55  ? -1.516  -1.556  -18.583 1.00 0.00 ? 55  THR A O    1  
ATOM   922   C  CB   . THR A 1 55  ? 0.292   -2.116  -21.529 1.00 0.00 ? 55  THR A CB   1  
ATOM   923   O  OG1  . THR A 1 55  ? 0.377   -0.777  -21.989 1.00 0.00 ? 55  THR A OG1  1  
ATOM   924   C  CG2  . THR A 1 55  ? 0.490   -3.019  -22.750 1.00 0.00 ? 55  THR A CG2  1  
ATOM   925   H  H    . THR A 1 55  ? -2.128  -0.640  -20.602 1.00 0.00 ? 55  THR A H    1  
ATOM   926   H  HA   . THR A 1 55  ? -1.366  -3.440  -21.022 1.00 0.00 ? 55  THR A HA   1  
ATOM   927   H  HB   . THR A 1 55  ? 1.137   -2.293  -20.863 1.00 0.00 ? 55  THR A HB   1  
ATOM   928   H  HG1  . THR A 1 55  ? 0.462   -0.195  -21.209 1.00 0.00 ? 55  THR A HG1  1  
ATOM   929   H  HG21 . THR A 1 55  ? 1.470   -2.830  -23.189 1.00 0.00 ? 55  THR A HG21 1  
ATOM   930   H  HG22 . THR A 1 55  ? 0.444   -4.066  -22.448 1.00 0.00 ? 55  THR A HG22 1  
ATOM   931   H  HG23 . THR A 1 55  ? -0.276  -2.828  -23.501 1.00 0.00 ? 55  THR A HG23 1  
ATOM   932   N  N    . SER A 1 56  ? 0.074   -3.132  -18.690 1.00 0.00 ? 56  SER A N    1  
ATOM   933   C  CA   . SER A 1 56  ? 0.521   -3.050  -17.296 1.00 0.00 ? 56  SER A CA   1  
ATOM   934   C  C    . SER A 1 56  ? 1.236   -1.721  -16.948 1.00 0.00 ? 56  SER A C    1  
ATOM   935   O  O    . SER A 1 56  ? 1.869   -1.613  -15.895 1.00 0.00 ? 56  SER A O    1  
ATOM   936   C  CB   . SER A 1 56  ? 1.441   -4.252  -17.018 1.00 0.00 ? 56  SER A CB   1  
ATOM   937   O  OG   . SER A 1 56  ? 0.907   -5.458  -17.554 1.00 0.00 ? 56  SER A OG   1  
ATOM   938   H  H    . SER A 1 56  ? 0.539   -3.834  -19.250 1.00 0.00 ? 56  SER A H    1  
ATOM   939   H  HA   . SER A 1 56  ? -0.359  -3.127  -16.657 1.00 0.00 ? 56  SER A HA   1  
ATOM   940   H  HB2  . SER A 1 56  ? 2.411   -4.067  -17.481 1.00 0.00 ? 56  SER A HB2  1  
ATOM   941   H  HB3  . SER A 1 56  ? 1.586   -4.359  -15.941 1.00 0.00 ? 56  SER A HB3  1  
ATOM   942   H  HG   . SER A 1 56  ? 0.126   -5.703  -17.028 1.00 0.00 ? 56  SER A HG   1  
ATOM   943   N  N    . THR A 1 57  ? 1.181   -0.726  -17.835 1.00 0.00 ? 57  THR A N    1  
ATOM   944   C  CA   . THR A 1 57  ? 1.660   0.634   -17.649 1.00 0.00 ? 57  THR A CA   1  
ATOM   945   C  C    . THR A 1 57  ? 0.746   1.380   -16.656 1.00 0.00 ? 57  THR A C    1  
ATOM   946   O  O    . THR A 1 57  ? -0.186  0.799   -16.090 1.00 0.00 ? 57  THR A O    1  
ATOM   947   C  CB   . THR A 1 57  ? 1.712   1.288   -19.048 1.00 0.00 ? 57  THR A CB   1  
ATOM   948   O  OG1  . THR A 1 57  ? 0.574   0.938   -19.824 1.00 0.00 ? 57  THR A OG1  1  
ATOM   949   C  CG2  . THR A 1 57  ? 2.937   0.805   -19.831 1.00 0.00 ? 57  THR A CG2  1  
ATOM   950   H  H    . THR A 1 57  ? 0.584   -0.829  -18.642 1.00 0.00 ? 57  THR A H    1  
ATOM   951   H  HA   . THR A 1 57  ? 2.666   0.612   -17.226 1.00 0.00 ? 57  THR A HA   1  
ATOM   952   H  HB   . THR A 1 57  ? 1.770   2.372   -18.947 1.00 0.00 ? 57  THR A HB   1  
ATOM   953   H  HG1  . THR A 1 57  ? 0.383   1.686   -20.413 1.00 0.00 ? 57  THR A HG1  1  
ATOM   954   H  HG21 . THR A 1 57  ? 2.960   1.289   -20.808 1.00 0.00 ? 57  THR A HG21 1  
ATOM   955   H  HG22 . THR A 1 57  ? 3.847   1.067   -19.291 1.00 0.00 ? 57  THR A HG22 1  
ATOM   956   H  HG23 . THR A 1 57  ? 2.899   -0.276  -19.969 1.00 0.00 ? 57  THR A HG23 1  
ATOM   957   N  N    . ILE A 1 58  ? 0.998   2.671   -16.423 1.00 0.00 ? 58  ILE A N    1  
ATOM   958   C  CA   . ILE A 1 58  ? 0.329   3.469   -15.398 1.00 0.00 ? 58  ILE A CA   1  
ATOM   959   C  C    . ILE A 1 58  ? -0.225  4.723   -16.076 1.00 0.00 ? 58  ILE A C    1  
ATOM   960   O  O    . ILE A 1 58  ? 0.471   5.385   -16.849 1.00 0.00 ? 58  ILE A O    1  
ATOM   961   C  CB   . ILE A 1 58  ? 1.336   3.783   -14.262 1.00 0.00 ? 58  ILE A CB   1  
ATOM   962   C  CG1  . ILE A 1 58  ? 1.789   2.507   -13.509 1.00 0.00 ? 58  ILE A CG1  1  
ATOM   963   C  CG2  . ILE A 1 58  ? 0.808   4.832   -13.268 1.00 0.00 ? 58  ILE A CG2  1  
ATOM   964   C  CD1  . ILE A 1 58  ? 0.738   1.847   -12.609 1.00 0.00 ? 58  ILE A CD1  1  
ATOM   965   H  H    . ILE A 1 58  ? 1.730   3.135   -16.943 1.00 0.00 ? 58  ILE A H    1  
ATOM   966   H  HA   . ILE A 1 58  ? -0.508  2.922   -14.966 1.00 0.00 ? 58  ILE A HA   1  
ATOM   967   H  HB   . ILE A 1 58  ? 2.224   4.211   -14.728 1.00 0.00 ? 58  ILE A HB   1  
ATOM   968   H  HG12 . ILE A 1 58  ? 2.124   1.760   -14.227 1.00 0.00 ? 58  ILE A HG12 1  
ATOM   969   H  HG13 . ILE A 1 58  ? 2.649   2.760   -12.887 1.00 0.00 ? 58  ILE A HG13 1  
ATOM   970   H  HG21 . ILE A 1 58  ? 0.693   5.798   -13.762 1.00 0.00 ? 58  ILE A HG21 1  
ATOM   971   H  HG22 . ILE A 1 58  ? -0.157  4.521   -12.873 1.00 0.00 ? 58  ILE A HG22 1  
ATOM   972   H  HG23 . ILE A 1 58  ? 1.520   4.961   -12.451 1.00 0.00 ? 58  ILE A HG23 1  
ATOM   973   H  HD11 . ILE A 1 58  ? 1.130   0.902   -12.232 1.00 0.00 ? 58  ILE A HD11 1  
ATOM   974   H  HD12 . ILE A 1 58  ? 0.518   2.490   -11.759 1.00 0.00 ? 58  ILE A HD12 1  
ATOM   975   H  HD13 . ILE A 1 58  ? -0.175  1.649   -13.166 1.00 0.00 ? 58  ILE A HD13 1  
ATOM   976   N  N    . GLU A 1 59  ? -1.471  5.053   -15.746 1.00 0.00 ? 59  GLU A N    1  
ATOM   977   C  CA   . GLU A 1 59  ? -2.162  6.279   -16.093 1.00 0.00 ? 59  GLU A CA   1  
ATOM   978   C  C    . GLU A 1 59  ? -2.380  6.968   -14.745 1.00 0.00 ? 59  GLU A C    1  
ATOM   979   O  O    . GLU A 1 59  ? -3.274  6.605   -13.975 1.00 0.00 ? 59  GLU A O    1  
ATOM   980   C  CB   . GLU A 1 59  ? -3.491  5.956   -16.805 1.00 0.00 ? 59  GLU A CB   1  
ATOM   981   C  CG   . GLU A 1 59  ? -3.316  5.444   -18.243 1.00 0.00 ? 59  GLU A CG   1  
ATOM   982   C  CD   . GLU A 1 59  ? -2.926  6.568   -19.222 1.00 0.00 ? 59  GLU A CD   1  
ATOM   983   O  OE1  . GLU A 1 59  ? -3.828  7.266   -19.741 1.00 0.00 ? 59  GLU A OE1  1  
ATOM   984   O  OE2  . GLU A 1 59  ? -1.722  6.760   -19.499 1.00 0.00 ? 59  GLU A OE2  1  
ATOM   985   H  H    . GLU A 1 59  ? -1.992  4.450   -15.113 1.00 0.00 ? 59  GLU A H    1  
ATOM   986   H  HA   . GLU A 1 59  ? -1.545  6.908   -16.736 1.00 0.00 ? 59  GLU A HA   1  
ATOM   987   H  HB2  . GLU A 1 59  ? -4.024  5.193   -16.233 1.00 0.00 ? 59  GLU A HB2  1  
ATOM   988   H  HB3  . GLU A 1 59  ? -4.113  6.851   -16.826 1.00 0.00 ? 59  GLU A HB3  1  
ATOM   989   H  HG2  . GLU A 1 59  ? -2.565  4.654   -18.261 1.00 0.00 ? 59  GLU A HG2  1  
ATOM   990   H  HG3  . GLU A 1 59  ? -4.260  4.997   -18.569 1.00 0.00 ? 59  GLU A HG3  1  
ATOM   991   N  N    . GLU A 1 60  ? -1.481  7.886   -14.392 1.00 0.00 ? 60  GLU A N    1  
ATOM   992   C  CA   . GLU A 1 60  ? -1.601  8.619   -13.141 1.00 0.00 ? 60  GLU A CA   1  
ATOM   993   C  C    . GLU A 1 60  ? -2.738  9.654   -13.217 1.00 0.00 ? 60  GLU A C    1  
ATOM   994   O  O    . GLU A 1 60  ? -3.056  10.170  -14.294 1.00 0.00 ? 60  GLU A O    1  
ATOM   995   C  CB   . GLU A 1 60  ? -0.255  9.210   -12.706 1.00 0.00 ? 60  GLU A CB   1  
ATOM   996   C  CG   . GLU A 1 60  ? 0.262   10.266  -13.675 1.00 0.00 ? 60  GLU A CG   1  
ATOM   997   C  CD   . GLU A 1 60  ? 1.435   11.080  -13.102 1.00 0.00 ? 60  GLU A CD   1  
ATOM   998   O  OE1  . GLU A 1 60  ? 2.602   10.641  -13.216 1.00 0.00 ? 60  GLU A OE1  1  
ATOM   999   O  OE2  . GLU A 1 60  ? 1.191   12.180  -12.554 1.00 0.00 ? 60  GLU A OE2  1  
ATOM   1000  H  H    . GLU A 1 60  ? -0.753  8.158   -15.037 1.00 0.00 ? 60  GLU A H    1  
ATOM   1001  H  HA   . GLU A 1 60  ? -1.855  7.906   -12.378 1.00 0.00 ? 60  GLU A HA   1  
ATOM   1002  H  HB2  . GLU A 1 60  ? -0.384  9.657   -11.728 1.00 0.00 ? 60  GLU A HB2  1  
ATOM   1003  H  HB3  . GLU A 1 60  ? 0.481   8.409   -12.616 1.00 0.00 ? 60  GLU A HB3  1  
ATOM   1004  H  HG2  . GLU A 1 60  ? 0.553   9.752   -14.590 1.00 0.00 ? 60  GLU A HG2  1  
ATOM   1005  H  HG3  . GLU A 1 60  ? -0.558  10.941  -13.901 1.00 0.00 ? 60  GLU A HG3  1  
ATOM   1006  N  N    . LYS A 1 61  ? -3.321  9.995   -12.065 1.00 0.00 ? 61  LYS A N    1  
ATOM   1007  C  CA   . LYS A 1 61  ? -4.273  11.088  -11.883 1.00 0.00 ? 61  LYS A CA   1  
ATOM   1008  C  C    . LYS A 1 61  ? -4.064  11.602  -10.461 1.00 0.00 ? 61  LYS A C    1  
ATOM   1009  O  O    . LYS A 1 61  ? -3.742  10.810  -9.574  1.00 0.00 ? 61  LYS A O    1  
ATOM   1010  C  CB   . LYS A 1 61  ? -5.698  10.549  -12.110 1.00 0.00 ? 61  LYS A CB   1  
ATOM   1011  C  CG   . LYS A 1 61  ? -6.785  11.630  -11.986 1.00 0.00 ? 61  LYS A CG   1  
ATOM   1012  C  CD   . LYS A 1 61  ? -8.137  11.177  -12.560 1.00 0.00 ? 61  LYS A CD   1  
ATOM   1013  C  CE   . LYS A 1 61  ? -8.713  9.946   -11.841 1.00 0.00 ? 61  LYS A CE   1  
ATOM   1014  N  NZ   . LYS A 1 61  ? -9.990  9.493   -12.452 1.00 0.00 ? 61  LYS A NZ   1  
ATOM   1015  H  H    . LYS A 1 61  ? -3.094  9.474   -11.203 1.00 0.00 ? 61  LYS A H    1  
ATOM   1016  H  HA   . LYS A 1 61  ? -4.058  11.882  -12.601 1.00 0.00 ? 61  LYS A HA   1  
ATOM   1017  H  HB2  . LYS A 1 61  ? -5.744  10.124  -13.114 1.00 0.00 ? 61  LYS A HB2  1  
ATOM   1018  H  HB3  . LYS A 1 61  ? -5.899  9.752   -11.392 1.00 0.00 ? 61  LYS A HB3  1  
ATOM   1019  H  HG2  . LYS A 1 61  ? -6.912  11.902  -10.937 1.00 0.00 ? 61  LYS A HG2  1  
ATOM   1020  H  HG3  . LYS A 1 61  ? -6.466  12.516  -12.537 1.00 0.00 ? 61  LYS A HG3  1  
ATOM   1021  H  HD2  . LYS A 1 61  ? -8.842  12.005  -12.474 1.00 0.00 ? 61  LYS A HD2  1  
ATOM   1022  H  HD3  . LYS A 1 61  ? -8.007  10.952  -13.621 1.00 0.00 ? 61  LYS A HD3  1  
ATOM   1023  H  HE2  . LYS A 1 61  ? -7.985  9.133   -11.890 1.00 0.00 ? 61  LYS A HE2  1  
ATOM   1024  H  HE3  . LYS A 1 61  ? -8.875  10.196  -10.790 1.00 0.00 ? 61  LYS A HE3  1  
ATOM   1025  H  HZ1  . LYS A 1 61  ? -10.340 8.668   -11.986 1.00 0.00 ? 61  LYS A HZ1  1  
ATOM   1026  H  HZ2  . LYS A 1 61  ? -10.702 10.207  -12.394 1.00 0.00 ? 61  LYS A HZ2  1  
ATOM   1027  H  HZ3  . LYS A 1 61  ? -9.865  9.257   -13.427 1.00 0.00 ? 61  LYS A HZ3  1  
ATOM   1028  N  N    . THR A 1 62  ? -4.213  12.900  -10.221 1.00 0.00 ? 62  THR A N    1  
ATOM   1029  C  CA   . THR A 1 62  ? -3.915  13.489  -8.919  1.00 0.00 ? 62  THR A CA   1  
ATOM   1030  C  C    . THR A 1 62  ? -5.234  13.607  -8.155  1.00 0.00 ? 62  THR A C    1  
ATOM   1031  O  O    . THR A 1 62  ? -6.207  14.161  -8.675  1.00 0.00 ? 62  THR A O    1  
ATOM   1032  C  CB   . THR A 1 62  ? -3.169  14.816  -9.124  1.00 0.00 ? 62  THR A CB   1  
ATOM   1033  O  OG1  . THR A 1 62  ? -2.109  14.632  -10.053 1.00 0.00 ? 62  THR A OG1  1  
ATOM   1034  C  CG2  . THR A 1 62  ? -2.537  15.297  -7.823  1.00 0.00 ? 62  THR A CG2  1  
ATOM   1035  H  H    . THR A 1 62  ? -4.541  13.517  -10.949 1.00 0.00 ? 62  THR A H    1  
ATOM   1036  H  HA   . THR A 1 62  ? -3.259  12.825  -8.358  1.00 0.00 ? 62  THR A HA   1  
ATOM   1037  H  HB   . THR A 1 62  ? -3.857  15.577  -9.493  1.00 0.00 ? 62  THR A HB   1  
ATOM   1038  H  HG1  . THR A 1 62  ? -2.477  14.742  -10.946 1.00 0.00 ? 62  THR A HG1  1  
ATOM   1039  H  HG21 . THR A 1 62  ? -1.828  14.556  -7.451  1.00 0.00 ? 62  THR A HG21 1  
ATOM   1040  H  HG22 . THR A 1 62  ? -2.017  16.239  -8.001  1.00 0.00 ? 62  THR A HG22 1  
ATOM   1041  H  HG23 . THR A 1 62  ? -3.316  15.458  -7.079  1.00 0.00 ? 62  THR A HG23 1  
ATOM   1042  N  N    . VAL A 1 63  ? -5.286  13.074  -6.932  1.00 0.00 ? 63  VAL A N    1  
ATOM   1043  C  CA   . VAL A 1 63  ? -6.528  12.912  -6.197  1.00 0.00 ? 63  VAL A CA   1  
ATOM   1044  C  C    . VAL A 1 63  ? -6.363  13.282  -4.725  1.00 0.00 ? 63  VAL A C    1  
ATOM   1045  O  O    . VAL A 1 63  ? -5.275  13.247  -4.150  1.00 0.00 ? 63  VAL A O    1  
ATOM   1046  C  CB   . VAL A 1 63  ? -7.044  11.456  -6.330  1.00 0.00 ? 63  VAL A CB   1  
ATOM   1047  C  CG1  . VAL A 1 63  ? -7.389  11.072  -7.778  1.00 0.00 ? 63  VAL A CG1  1  
ATOM   1048  C  CG2  . VAL A 1 63  ? -6.066  10.400  -5.791  1.00 0.00 ? 63  VAL A CG2  1  
ATOM   1049  H  H    . VAL A 1 63  ? -4.456  12.690  -6.493  1.00 0.00 ? 63  VAL A H    1  
ATOM   1050  H  HA   . VAL A 1 63  ? -7.282  13.569  -6.624  1.00 0.00 ? 63  VAL A HA   1  
ATOM   1051  H  HB   . VAL A 1 63  ? -7.961  11.376  -5.746  1.00 0.00 ? 63  VAL A HB   1  
ATOM   1052  H  HG11 . VAL A 1 63  ? -6.491  11.027  -8.394  1.00 0.00 ? 63  VAL A HG11 1  
ATOM   1053  H  HG12 . VAL A 1 63  ? -7.872  10.095  -7.786  1.00 0.00 ? 63  VAL A HG12 1  
ATOM   1054  H  HG13 . VAL A 1 63  ? -8.079  11.798  -8.200  1.00 0.00 ? 63  VAL A HG13 1  
ATOM   1055  H  HG21 . VAL A 1 63  ? -5.168  10.360  -6.405  1.00 0.00 ? 63  VAL A HG21 1  
ATOM   1056  H  HG22 . VAL A 1 63  ? -5.785  10.629  -4.764  1.00 0.00 ? 63  VAL A HG22 1  
ATOM   1057  H  HG23 . VAL A 1 63  ? -6.550  9.426   -5.801  1.00 0.00 ? 63  VAL A HG23 1  
ATOM   1058  N  N    . GLU A 1 64  ? -7.478  13.643  -4.114  1.00 0.00 ? 64  GLU A N    1  
ATOM   1059  C  CA   . GLU A 1 64  ? -7.615  13.805  -2.680  1.00 0.00 ? 64  GLU A CA   1  
ATOM   1060  C  C    . GLU A 1 64  ? -8.256  12.493  -2.224  1.00 0.00 ? 64  GLU A C    1  
ATOM   1061  O  O    . GLU A 1 64  ? -9.174  12.004  -2.881  1.00 0.00 ? 64  GLU A O    1  
ATOM   1062  C  CB   . GLU A 1 64  ? -8.479  15.039  -2.377  1.00 0.00 ? 64  GLU A CB   1  
ATOM   1063  C  CG   . GLU A 1 64  ? -8.626  15.265  -0.866  1.00 0.00 ? 64  GLU A CG   1  
ATOM   1064  C  CD   . GLU A 1 64  ? -9.314  16.608  -0.560  1.00 0.00 ? 64  GLU A CD   1  
ATOM   1065  O  OE1  . GLU A 1 64  ? -10.561 16.690  -0.615  1.00 0.00 ? 64  GLU A OE1  1  
ATOM   1066  O  OE2  . GLU A 1 64  ? -8.611  17.595  -0.245  1.00 0.00 ? 64  GLU A OE2  1  
ATOM   1067  H  H    . GLU A 1 64  ? -8.328  13.670  -4.668  1.00 0.00 ? 64  GLU A H    1  
ATOM   1068  H  HA   . GLU A 1 64  ? -6.637  13.927  -2.215  1.00 0.00 ? 64  GLU A HA   1  
ATOM   1069  H  HB2  . GLU A 1 64  ? -8.007  15.918  -2.822  1.00 0.00 ? 64  GLU A HB2  1  
ATOM   1070  H  HB3  . GLU A 1 64  ? -9.465  14.918  -2.826  1.00 0.00 ? 64  GLU A HB3  1  
ATOM   1071  H  HG2  . GLU A 1 64  ? -9.204  14.446  -0.432  1.00 0.00 ? 64  GLU A HG2  1  
ATOM   1072  H  HG3  . GLU A 1 64  ? -7.634  15.249  -0.408  1.00 0.00 ? 64  GLU A HG3  1  
ATOM   1073  N  N    . VAL A 1 65  ? -7.765  11.899  -1.143  1.00 0.00 ? 65  VAL A N    1  
ATOM   1074  C  CA   . VAL A 1 65  ? -8.150  10.575  -0.672  1.00 0.00 ? 65  VAL A CA   1  
ATOM   1075  C  C    . VAL A 1 65  ? -8.930  10.803  0.622   1.00 0.00 ? 65  VAL A C    1  
ATOM   1076  O  O    . VAL A 1 65  ? -8.373  11.267  1.621   1.00 0.00 ? 65  VAL A O    1  
ATOM   1077  C  CB   . VAL A 1 65  ? -6.905  9.674   -0.493  1.00 0.00 ? 65  VAL A CB   1  
ATOM   1078  C  CG1  . VAL A 1 65  ? -7.344  8.208   -0.401  1.00 0.00 ? 65  VAL A CG1  1  
ATOM   1079  C  CG2  . VAL A 1 65  ? -5.883  9.792   -1.642  1.00 0.00 ? 65  VAL A CG2  1  
ATOM   1080  H  H    . VAL A 1 65  ? -7.008  12.344  -0.637  1.00 0.00 ? 65  VAL A H    1  
ATOM   1081  H  HA   . VAL A 1 65  ? -8.804  10.109  -1.409  1.00 0.00 ? 65  VAL A HA   1  
ATOM   1082  H  HB   . VAL A 1 65  ? -6.396  9.941   0.434   1.00 0.00 ? 65  VAL A HB   1  
ATOM   1083  H  HG11 . VAL A 1 65  ? -7.745  7.871   -1.356  1.00 0.00 ? 65  VAL A HG11 1  
ATOM   1084  H  HG12 . VAL A 1 65  ? -6.492  7.583   -0.133  1.00 0.00 ? 65  VAL A HG12 1  
ATOM   1085  H  HG13 . VAL A 1 65  ? -8.121  8.100   0.355   1.00 0.00 ? 65  VAL A HG13 1  
ATOM   1086  H  HG21 . VAL A 1 65  ? -5.086  9.062   -1.506  1.00 0.00 ? 65  VAL A HG21 1  
ATOM   1087  H  HG22 . VAL A 1 65  ? -6.367  9.619   -2.601  1.00 0.00 ? 65  VAL A HG22 1  
ATOM   1088  H  HG23 . VAL A 1 65  ? -5.431  10.784  -1.643  1.00 0.00 ? 65  VAL A HG23 1  
ATOM   1089  N  N    . LEU A 1 66  ? -10.241 10.552  0.578   1.00 0.00 ? 66  LEU A N    1  
ATOM   1090  C  CA   . LEU A 1 66  ? -11.164 10.924  1.647   1.00 0.00 ? 66  LEU A CA   1  
ATOM   1091  C  C    . LEU A 1 66  ? -11.117 9.943   2.818   1.00 0.00 ? 66  LEU A C    1  
ATOM   1092  O  O    . LEU A 1 66  ? -11.322 10.356  3.960   1.00 0.00 ? 66  LEU A O    1  
ATOM   1093  C  CB   . LEU A 1 66  ? -12.615 10.991  1.122   1.00 0.00 ? 66  LEU A CB   1  
ATOM   1094  C  CG   . LEU A 1 66  ? -12.974 12.098  0.108   1.00 0.00 ? 66  LEU A CG   1  
ATOM   1095  C  CD1  . LEU A 1 66  ? -12.509 13.486  0.560   1.00 0.00 ? 66  LEU A CD1  1  
ATOM   1096  C  CD2  . LEU A 1 66  ? -12.457 11.815  -1.307  1.00 0.00 ? 66  LEU A CD2  1  
ATOM   1097  H  H    . LEU A 1 66  ? -10.638 10.161  -0.275  1.00 0.00 ? 66  LEU A H    1  
ATOM   1098  H  HA   . LEU A 1 66  ? -10.879 11.905  2.028   1.00 0.00 ? 66  LEU A HA   1  
ATOM   1099  H  HB2  . LEU A 1 66  ? -12.886 10.023  0.700   1.00 0.00 ? 66  LEU A HB2  1  
ATOM   1100  H  HB3  . LEU A 1 66  ? -13.262 11.142  1.988   1.00 0.00 ? 66  LEU A HB3  1  
ATOM   1101  H  HG   . LEU A 1 66  ? -14.063 12.123  0.044   1.00 0.00 ? 66  LEU A HG   1  
ATOM   1102  H  HD11 . LEU A 1 66  ? -11.421 13.551  0.547   1.00 0.00 ? 66  LEU A HD11 1  
ATOM   1103  H  HD12 . LEU A 1 66  ? -12.912 14.244  -0.112  1.00 0.00 ? 66  LEU A HD12 1  
ATOM   1104  H  HD13 . LEU A 1 66  ? -12.872 13.688  1.569   1.00 0.00 ? 66  LEU A HD13 1  
ATOM   1105  H  HD21 . LEU A 1 66  ? -12.745 10.810  -1.611  1.00 0.00 ? 66  LEU A HD21 1  
ATOM   1106  H  HD22 . LEU A 1 66  ? -12.903 12.526  -1.999  1.00 0.00 ? 66  LEU A HD22 1  
ATOM   1107  H  HD23 . LEU A 1 66  ? -11.375 11.920  -1.357  1.00 0.00 ? 66  LEU A HD23 1  
ATOM   1108  N  N    . GLY A 1 67  ? -10.885 8.657   2.554   1.00 0.00 ? 67  GLY A N    1  
ATOM   1109  C  CA   . GLY A 1 67  ? -10.990 7.595   3.536   1.00 0.00 ? 67  GLY A CA   1  
ATOM   1110  C  C    . GLY A 1 67  ? -10.968 6.257   2.815   1.00 0.00 ? 67  GLY A C    1  
ATOM   1111  O  O    . GLY A 1 67  ? -11.051 6.206   1.584   1.00 0.00 ? 67  GLY A O    1  
ATOM   1112  H  H    . GLY A 1 67  ? -10.749 8.351   1.598   1.00 0.00 ? 67  GLY A H    1  
ATOM   1113  H  HA2  . GLY A 1 67  ? -10.170 7.649   4.245   1.00 0.00 ? 67  GLY A HA2  1  
ATOM   1114  H  HA3  . GLY A 1 67  ? -11.929 7.689   4.082   1.00 0.00 ? 67  GLY A HA3  1  
ATOM   1115  N  N    . MET A 1 68  ? -10.857 5.169   3.570   1.00 0.00 ? 68  MET A N    1  
ATOM   1116  C  CA   . MET A 1 68  ? -11.056 3.832   3.016   1.00 0.00 ? 68  MET A CA   1  
ATOM   1117  C  C    . MET A 1 68  ? -12.522 3.691   2.601   1.00 0.00 ? 68  MET A C    1  
ATOM   1118  O  O    . MET A 1 68  ? -13.409 4.339   3.168   1.00 0.00 ? 68  MET A O    1  
ATOM   1119  C  CB   . MET A 1 68  ? -10.635 2.724   3.990   1.00 0.00 ? 68  MET A CB   1  
ATOM   1120  C  CG   . MET A 1 68  ? -9.121  2.760   4.222   1.00 0.00 ? 68  MET A CG   1  
ATOM   1121  S  SD   . MET A 1 68  ? -8.407  1.314   5.044   1.00 0.00 ? 68  MET A SD   1  
ATOM   1122  C  CE   . MET A 1 68  ? -8.324  0.152   3.659   1.00 0.00 ? 68  MET A CE   1  
ATOM   1123  H  H    . MET A 1 68  ? -10.807 5.286   4.568   1.00 0.00 ? 68  MET A H    1  
ATOM   1124  H  HA   . MET A 1 68  ? -10.443 3.728   2.127   1.00 0.00 ? 68  MET A HA   1  
ATOM   1125  H  HB2  . MET A 1 68  ? -11.159 2.837   4.939   1.00 0.00 ? 68  MET A HB2  1  
ATOM   1126  H  HB3  . MET A 1 68  ? -10.899 1.760   3.553   1.00 0.00 ? 68  MET A HB3  1  
ATOM   1127  H  HG2  . MET A 1 68  ? -8.614  2.885   3.265   1.00 0.00 ? 68  MET A HG2  1  
ATOM   1128  H  HG3  . MET A 1 68  ? -8.906  3.629   4.838   1.00 0.00 ? 68  MET A HG3  1  
ATOM   1129  H  HE1  . MET A 1 68  ? -7.691  0.559   2.871   1.00 0.00 ? 68  MET A HE1  1  
ATOM   1130  H  HE2  . MET A 1 68  ? -7.899  -0.785  4.016   1.00 0.00 ? 68  MET A HE2  1  
ATOM   1131  H  HE3  . MET A 1 68  ? -9.324  -0.033  3.265   1.00 0.00 ? 68  MET A HE3  1  
ATOM   1132  N  N    . ALA A 1 69  ? -12.771 2.836   1.609   1.00 0.00 ? 69  ALA A N    1  
ATOM   1133  C  CA   . ALA A 1 69  ? -14.120 2.448   1.220   1.00 0.00 ? 69  ALA A CA   1  
ATOM   1134  C  C    . ALA A 1 69  ? -14.831 1.735   2.392   1.00 0.00 ? 69  ALA A C    1  
ATOM   1135  O  O    . ALA A 1 69  ? -14.165 1.335   3.353   1.00 0.00 ? 69  ALA A O    1  
ATOM   1136  C  CB   . ALA A 1 69  ? -14.023 1.550   -0.017  1.00 0.00 ? 69  ALA A CB   1  
ATOM   1137  H  H    . ALA A 1 69  ? -11.995 2.310   1.221   1.00 0.00 ? 69  ALA A H    1  
ATOM   1138  H  HA   . ALA A 1 69  ? -14.672 3.350   0.958   1.00 0.00 ? 69  ALA A HA   1  
ATOM   1139  H  HB1  . ALA A 1 69  ? -13.580 0.595   0.266   1.00 0.00 ? 69  ALA A HB1  1  
ATOM   1140  H  HB2  . ALA A 1 69  ? -15.012 1.369   -0.432  1.00 0.00 ? 69  ALA A HB2  1  
ATOM   1141  H  HB3  . ALA A 1 69  ? -13.415 2.034   -0.782  1.00 0.00 ? 69  ALA A HB3  1  
ATOM   1142  N  N    . PRO A 1 70  ? -16.164 1.549   2.336   1.00 0.00 ? 70  PRO A N    1  
ATOM   1143  C  CA   . PRO A 1 70  ? -16.896 0.755   3.317   1.00 0.00 ? 70  PRO A CA   1  
ATOM   1144  C  C    . PRO A 1 70  ? -16.297 -0.640  3.515   1.00 0.00 ? 70  PRO A C    1  
ATOM   1145  O  O    . PRO A 1 70  ? -15.669 -1.199  2.611   1.00 0.00 ? 70  PRO A O    1  
ATOM   1146  C  CB   . PRO A 1 70  ? -18.332 0.665   2.788   1.00 0.00 ? 70  PRO A CB   1  
ATOM   1147  C  CG   . PRO A 1 70  ? -18.477 1.932   1.949   1.00 0.00 ? 70  PRO A CG   1  
ATOM   1148  C  CD   . PRO A 1 70  ? -17.083 2.094   1.347   1.00 0.00 ? 70  PRO A CD   1  
ATOM   1149  H  HA   . PRO A 1 70  ? -16.894 1.296   4.264   1.00 0.00 ? 70  PRO A HA   1  
ATOM   1150  H  HB2  . PRO A 1 70  ? -18.440 -0.207  2.140   1.00 0.00 ? 70  PRO A HB2  1  
ATOM   1151  H  HB3  . PRO A 1 70  ? -19.061 0.631   3.598   1.00 0.00 ? 70  PRO A HB3  1  
ATOM   1152  H  HG2  . PRO A 1 70  ? -19.241 1.825   1.178   1.00 0.00 ? 70  PRO A HG2  1  
ATOM   1153  H  HG3  . PRO A 1 70  ? -18.698 2.780   2.598   1.00 0.00 ? 70  PRO A HG3  1  
ATOM   1154  H  HD2  . PRO A 1 70  ? -17.021 1.511   0.429   1.00 0.00 ? 70  PRO A HD2  1  
ATOM   1155  H  HD3  . PRO A 1 70  ? -16.882 3.147   1.145   1.00 0.00 ? 70  PRO A HD3  1  
ATOM   1156  N  N    . ASP A 1 71  ? -16.577 -1.251  4.668   1.00 0.00 ? 71  ASP A N    1  
ATOM   1157  C  CA   . ASP A 1 71  ? -16.193 -2.634  4.955   1.00 0.00 ? 71  ASP A CA   1  
ATOM   1158  C  C    . ASP A 1 71  ? -16.773 -3.608  3.924   1.00 0.00 ? 71  ASP A C    1  
ATOM   1159  O  O    . ASP A 1 71  ? -16.146 -4.620  3.622   1.00 0.00 ? 71  ASP A O    1  
ATOM   1160  C  CB   . ASP A 1 71  ? -16.612 -3.044  6.375   1.00 0.00 ? 71  ASP A CB   1  
ATOM   1161  C  CG   . ASP A 1 71  ? -18.082 -3.492  6.473   1.00 0.00 ? 71  ASP A CG   1  
ATOM   1162  O  OD1  . ASP A 1 71  ? -18.980 -2.622  6.433   1.00 0.00 ? 71  ASP A OD1  1  
ATOM   1163  O  OD2  . ASP A 1 71  ? -18.344 -4.705  6.627   1.00 0.00 ? 71  ASP A OD2  1  
ATOM   1164  H  H    . ASP A 1 71  ? -17.104 -0.757  5.374   1.00 0.00 ? 71  ASP A H    1  
ATOM   1165  H  HA   . ASP A 1 71  ? -15.107 -2.686  4.905   1.00 0.00 ? 71  ASP A HA   1  
ATOM   1166  H  HB2  . ASP A 1 71  ? -15.971 -3.869  6.687   1.00 0.00 ? 71  ASP A HB2  1  
ATOM   1167  H  HB3  . ASP A 1 71  ? -16.431 -2.216  7.063   1.00 0.00 ? 71  ASP A HB3  1  
ATOM   1168  N  N    . ASP A 1 72  ? -17.928 -3.281  3.334   1.00 0.00 ? 72  ASP A N    1  
ATOM   1169  C  CA   . ASP A 1 72  ? -18.568 -4.094  2.301   1.00 0.00 ? 72  ASP A CA   1  
ATOM   1170  C  C    . ASP A 1 72  ? -17.714 -4.177  1.035   1.00 0.00 ? 72  ASP A C    1  
ATOM   1171  O  O    . ASP A 1 72  ? -17.727 -5.192  0.339   1.00 0.00 ? 72  ASP A O    1  
ATOM   1172  C  CB   . ASP A 1 72  ? -19.945 -3.519  1.958   1.00 0.00 ? 72  ASP A CB   1  
ATOM   1173  C  CG   . ASP A 1 72  ? -20.634 -4.350  0.861   1.00 0.00 ? 72  ASP A CG   1  
ATOM   1174  O  OD1  . ASP A 1 72  ? -21.133 -5.458  1.163   1.00 0.00 ? 72  ASP A OD1  1  
ATOM   1175  O  OD2  . ASP A 1 72  ? -20.717 -3.883  -0.297  1.00 0.00 ? 72  ASP A OD2  1  
ATOM   1176  H  H    . ASP A 1 72  ? -18.389 -2.433  3.625   1.00 0.00 ? 72  ASP A H    1  
ATOM   1177  H  HA   . ASP A 1 72  ? -18.702 -5.103  2.686   1.00 0.00 ? 72  ASP A HA   1  
ATOM   1178  H  HB2  . ASP A 1 72  ? -20.566 -3.514  2.856   1.00 0.00 ? 72  ASP A HB2  1  
ATOM   1179  H  HB3  . ASP A 1 72  ? -19.830 -2.486  1.622   1.00 0.00 ? 72  ASP A HB3  1  
ATOM   1180  N  N    . GLU A 1 73  ? -16.939 -3.131  0.744   1.00 0.00 ? 73  GLU A N    1  
ATOM   1181  C  CA   . GLU A 1 73  ? -15.953 -3.147  -0.328  1.00 0.00 ? 73  GLU A CA   1  
ATOM   1182  C  C    . GLU A 1 73  ? -14.684 -3.817  0.188   1.00 0.00 ? 73  GLU A C    1  
ATOM   1183  O  O    . GLU A 1 73  ? -14.157 -4.722  -0.462  1.00 0.00 ? 73  GLU A O    1  
ATOM   1184  C  CB   . GLU A 1 73  ? -15.673 -1.720  -0.828  1.00 0.00 ? 73  GLU A CB   1  
ATOM   1185  C  CG   . GLU A 1 73  ? -16.860 -1.086  -1.573  1.00 0.00 ? 73  GLU A CG   1  
ATOM   1186  C  CD   . GLU A 1 73  ? -17.101 -1.719  -2.957  1.00 0.00 ? 73  GLU A CD   1  
ATOM   1187  O  OE1  . GLU A 1 73  ? -17.634 -2.850  -3.032  1.00 0.00 ? 73  GLU A OE1  1  
ATOM   1188  O  OE2  . GLU A 1 73  ? -16.774 -1.080  -3.983  1.00 0.00 ? 73  GLU A OE2  1  
ATOM   1189  H  H    . GLU A 1 73  ? -16.895 -2.368  1.409   1.00 0.00 ? 73  GLU A H    1  
ATOM   1190  H  HA   . GLU A 1 73  ? -16.320 -3.739  -1.159  1.00 0.00 ? 73  GLU A HA   1  
ATOM   1191  H  HB2  . GLU A 1 73  ? -15.418 -1.088  0.021   1.00 0.00 ? 73  GLU A HB2  1  
ATOM   1192  H  HB3  . GLU A 1 73  ? -14.816 -1.737  -1.501  1.00 0.00 ? 73  GLU A HB3  1  
ATOM   1193  H  HG2  . GLU A 1 73  ? -17.764 -1.165  -0.965  1.00 0.00 ? 73  GLU A HG2  1  
ATOM   1194  H  HG3  . GLU A 1 73  ? -16.651 -0.022  -1.699  1.00 0.00 ? 73  GLU A HG3  1  
ATOM   1195  N  N    . CYS A 1 74  ? -14.230 -3.438  1.387   1.00 0.00 ? 74  CYS A N    1  
ATOM   1196  C  CA   . CYS A 1 74  ? -12.939 -3.854  1.922   1.00 0.00 ? 74  CYS A CA   1  
ATOM   1197  C  C    . CYS A 1 74  ? -12.859 -5.335  2.324   1.00 0.00 ? 74  CYS A C    1  
ATOM   1198  O  O    . CYS A 1 74  ? -11.846 -5.765  2.871   1.00 0.00 ? 74  CYS A O    1  
ATOM   1199  C  CB   . CYS A 1 74  ? -12.486 -2.917  3.045   1.00 0.00 ? 74  CYS A CB   1  
ATOM   1200  S  SG   . CYS A 1 74  ? -12.351 -1.222  2.404   1.00 0.00 ? 74  CYS A SG   1  
ATOM   1201  H  H    . CYS A 1 74  ? -14.755 -2.741  1.906   1.00 0.00 ? 74  CYS A H    1  
ATOM   1202  H  HA   . CYS A 1 74  ? -12.240 -3.735  1.109   1.00 0.00 ? 74  CYS A HA   1  
ATOM   1203  H  HB2  . CYS A 1 74  ? -13.181 -2.955  3.883   1.00 0.00 ? 74  CYS A HB2  1  
ATOM   1204  H  HB3  . CYS A 1 74  ? -11.503 -3.240  3.387   1.00 0.00 ? 74  CYS A HB3  1  
ATOM   1205  H  HG   . CYS A 1 74  ? -13.665 -0.944  2.454   1.00 0.00 ? 74  CYS A HG   1  
ATOM   1206  N  N    . LEU A 1 75  ? -13.908 -6.117  2.064   1.00 0.00 ? 75  LEU A N    1  
ATOM   1207  C  CA   . LEU A 1 75  ? -13.917 -7.574  2.182   1.00 0.00 ? 75  LEU A CA   1  
ATOM   1208  C  C    . LEU A 1 75  ? -13.245 -8.227  0.968   1.00 0.00 ? 75  LEU A C    1  
ATOM   1209  O  O    . LEU A 1 75  ? -12.803 -9.371  1.061   1.00 0.00 ? 75  LEU A O    1  
ATOM   1210  C  CB   . LEU A 1 75  ? -15.368 -8.081  2.293   1.00 0.00 ? 75  LEU A CB   1  
ATOM   1211  C  CG   . LEU A 1 75  ? -15.925 -8.032  3.727   1.00 0.00 ? 75  LEU A CG   1  
ATOM   1212  C  CD1  . LEU A 1 75  ? -17.452 -8.147  3.694   1.00 0.00 ? 75  LEU A CD1  1  
ATOM   1213  C  CD2  . LEU A 1 75  ? -15.349 -9.159  4.597   1.00 0.00 ? 75  LEU A CD2  1  
ATOM   1214  H  H    . LEU A 1 75  ? -14.687 -5.676  1.601   1.00 0.00 ? 75  LEU A H    1  
ATOM   1215  H  HA   . LEU A 1 75  ? -13.358 -7.865  3.070   1.00 0.00 ? 75  LEU A HA   1  
ATOM   1216  H  HB2  . LEU A 1 75  ? -15.998 -7.485  1.630   1.00 0.00 ? 75  LEU A HB2  1  
ATOM   1217  H  HB3  . LEU A 1 75  ? -15.419 -9.114  1.944   1.00 0.00 ? 75  LEU A HB3  1  
ATOM   1218  H  HG   . LEU A 1 75  ? -15.670 -7.081  4.185   1.00 0.00 ? 75  LEU A HG   1  
ATOM   1219  H  HD11 . LEU A 1 75  ? -17.752 -9.092  3.238   1.00 0.00 ? 75  LEU A HD11 1  
ATOM   1220  H  HD12 . LEU A 1 75  ? -17.849 -8.089  4.707   1.00 0.00 ? 75  LEU A HD12 1  
ATOM   1221  H  HD13 . LEU A 1 75  ? -17.862 -7.321  3.113   1.00 0.00 ? 75  LEU A HD13 1  
ATOM   1222  H  HD21 . LEU A 1 75  ? -15.626 -10.128 4.183   1.00 0.00 ? 75  LEU A HD21 1  
ATOM   1223  H  HD22 . LEU A 1 75  ? -14.264 -9.091  4.648   1.00 0.00 ? 75  LEU A HD22 1  
ATOM   1224  H  HD23 . LEU A 1 75  ? -15.744 -9.078  5.610   1.00 0.00 ? 75  LEU A HD23 1  
ATOM   1225  N  N    . LYS A 1 76  ? -13.186 -7.529  -0.172  1.00 0.00 ? 76  LYS A N    1  
ATOM   1226  C  CA   . LYS A 1 76  ? -12.713 -8.080  -1.438  1.00 0.00 ? 76  LYS A CA   1  
ATOM   1227  C  C    . LYS A 1 76  ? -11.276 -7.669  -1.725  1.00 0.00 ? 76  LYS A C    1  
ATOM   1228  O  O    . LYS A 1 76  ? -10.497 -8.497  -2.197  1.00 0.00 ? 76  LYS A O    1  
ATOM   1229  C  CB   . LYS A 1 76  ? -13.659 -7.654  -2.572  1.00 0.00 ? 76  LYS A CB   1  
ATOM   1230  C  CG   . LYS A 1 76  ? -15.061 -8.268  -2.393  1.00 0.00 ? 76  LYS A CG   1  
ATOM   1231  C  CD   . LYS A 1 76  ? -16.158 -7.342  -1.848  1.00 0.00 ? 76  LYS A CD   1  
ATOM   1232  C  CE   . LYS A 1 76  ? -16.474 -6.173  -2.791  1.00 0.00 ? 76  LYS A CE   1  
ATOM   1233  N  NZ   . LYS A 1 76  ? -17.767 -5.533  -2.453  1.00 0.00 ? 76  LYS A NZ   1  
ATOM   1234  H  H    . LYS A 1 76  ? -13.593 -6.606  -0.193  1.00 0.00 ? 76  LYS A H    1  
ATOM   1235  H  HA   . LYS A 1 76  ? -12.726 -9.167  -1.389  1.00 0.00 ? 76  LYS A HA   1  
ATOM   1236  H  HB2  . LYS A 1 76  ? -13.713 -6.567  -2.637  1.00 0.00 ? 76  LYS A HB2  1  
ATOM   1237  H  HB3  . LYS A 1 76  ? -13.244 -8.024  -3.511  1.00 0.00 ? 76  LYS A HB3  1  
ATOM   1238  H  HG2  . LYS A 1 76  ? -15.393 -8.657  -3.356  1.00 0.00 ? 76  LYS A HG2  1  
ATOM   1239  H  HG3  . LYS A 1 76  ? -14.979 -9.107  -1.703  1.00 0.00 ? 76  LYS A HG3  1  
ATOM   1240  H  HD2  . LYS A 1 76  ? -17.058 -7.945  -1.713  1.00 0.00 ? 76  LYS A HD2  1  
ATOM   1241  H  HD3  . LYS A 1 76  ? -15.863 -6.954  -0.873  1.00 0.00 ? 76  LYS A HD3  1  
ATOM   1242  H  HE2  . LYS A 1 76  ? -15.670 -5.438  -2.715  1.00 0.00 ? 76  LYS A HE2  1  
ATOM   1243  H  HE3  . LYS A 1 76  ? -16.511 -6.535  -3.821  1.00 0.00 ? 76  LYS A HE3  1  
ATOM   1244  H  HZ1  . LYS A 1 76  ? -17.823 -4.598  -2.865  1.00 0.00 ? 76  LYS A HZ1  1  
ATOM   1245  H  HZ2  . LYS A 1 76  ? -18.549 -6.079  -2.785  1.00 0.00 ? 76  LYS A HZ2  1  
ATOM   1246  H  HZ3  . LYS A 1 76  ? -17.859 -5.416  -1.447  1.00 0.00 ? 76  LYS A HZ3  1  
ATOM   1247  N  N    . ASP A 1 77  ? -10.910 -6.425  -1.422  1.00 0.00 ? 77  ASP A N    1  
ATOM   1248  C  CA   . ASP A 1 77  ? -9.561  -5.880  -1.598  1.00 0.00 ? 77  ASP A CA   1  
ATOM   1249  C  C    . ASP A 1 77  ? -9.494  -4.572  -0.807  1.00 0.00 ? 77  ASP A C    1  
ATOM   1250  O  O    . ASP A 1 77  ? -10.526 -4.122  -0.311  1.00 0.00 ? 77  ASP A O    1  
ATOM   1251  C  CB   . ASP A 1 77  ? -9.267  -5.621  -3.088  1.00 0.00 ? 77  ASP A CB   1  
ATOM   1252  C  CG   . ASP A 1 77  ? -7.782  -5.363  -3.381  1.00 0.00 ? 77  ASP A CG   1  
ATOM   1253  O  OD1  . ASP A 1 77  ? -6.930  -5.652  -2.512  1.00 0.00 ? 77  ASP A OD1  1  
ATOM   1254  O  OD2  . ASP A 1 77  ? -7.471  -4.915  -4.507  1.00 0.00 ? 77  ASP A OD2  1  
ATOM   1255  H  H    . ASP A 1 77  ? -11.576 -5.800  -0.977  1.00 0.00 ? 77  ASP A H    1  
ATOM   1256  H  HA   . ASP A 1 77  ? -8.833  -6.589  -1.202  1.00 0.00 ? 77  ASP A HA   1  
ATOM   1257  H  HB2  . ASP A 1 77  ? -9.582  -6.482  -3.679  1.00 0.00 ? 77  ASP A HB2  1  
ATOM   1258  H  HB3  . ASP A 1 77  ? -9.844  -4.759  -3.414  1.00 0.00 ? 77  ASP A HB3  1  
ATOM   1259  N  N    . MET A 1 78  ? -8.328  -3.944  -0.652  1.00 0.00 ? 78  MET A N    1  
ATOM   1260  C  CA   . MET A 1 78  ? -8.248  -2.637  0.000   1.00 0.00 ? 78  MET A CA   1  
ATOM   1261  C  C    . MET A 1 78  ? -8.621  -1.555  -1.017  1.00 0.00 ? 78  MET A C    1  
ATOM   1262  O  O    . MET A 1 78  ? -8.034  -1.493  -2.102  1.00 0.00 ? 78  MET A O    1  
ATOM   1263  C  CB   . MET A 1 78  ? -6.848  -2.393  0.575   1.00 0.00 ? 78  MET A CB   1  
ATOM   1264  C  CG   . MET A 1 78  ? -6.468  -3.382  1.684   1.00 0.00 ? 78  MET A CG   1  
ATOM   1265  S  SD   . MET A 1 78  ? -7.536  -3.419  3.152   1.00 0.00 ? 78  MET A SD   1  
ATOM   1266  C  CE   . MET A 1 78  ? -8.518  -4.905  2.803   1.00 0.00 ? 78  MET A CE   1  
ATOM   1267  H  H    . MET A 1 78  ? -7.503  -4.317  -1.112  1.00 0.00 ? 78  MET A H    1  
ATOM   1268  H  HA   . MET A 1 78  ? -8.963  -2.602  0.823   1.00 0.00 ? 78  MET A HA   1  
ATOM   1269  H  HB2  . MET A 1 78  ? -6.112  -2.467  -0.226  1.00 0.00 ? 78  MET A HB2  1  
ATOM   1270  H  HB3  . MET A 1 78  ? -6.808  -1.384  0.987   1.00 0.00 ? 78  MET A HB3  1  
ATOM   1271  H  HG2  . MET A 1 78  ? -6.444  -4.383  1.261   1.00 0.00 ? 78  MET A HG2  1  
ATOM   1272  H  HG3  . MET A 1 78  ? -5.457  -3.135  2.008   1.00 0.00 ? 78  MET A HG3  1  
ATOM   1273  H  HE1  . MET A 1 78  ? -9.106  -4.763  1.899   1.00 0.00 ? 78  MET A HE1  1  
ATOM   1274  H  HE2  . MET A 1 78  ? -7.858  -5.764  2.680   1.00 0.00 ? 78  MET A HE2  1  
ATOM   1275  H  HE3  . MET A 1 78  ? -9.199  -5.097  3.629   1.00 0.00 ? 78  MET A HE3  1  
ATOM   1276  N  N    . TYR A 1 79  ? -9.549  -0.665  -0.654  1.00 0.00 ? 79  TYR A N    1  
ATOM   1277  C  CA   . TYR A 1 79  ? -10.041 0.401   -1.522  1.00 0.00 ? 79  TYR A CA   1  
ATOM   1278  C  C    . TYR A 1 79  ? -10.184 1.698   -0.724  1.00 0.00 ? 79  TYR A C    1  
ATOM   1279  O  O    . TYR A 1 79  ? -10.316 1.674   0.502   1.00 0.00 ? 79  TYR A O    1  
ATOM   1280  C  CB   . TYR A 1 79  ? -11.407 0.038   -2.127  1.00 0.00 ? 79  TYR A CB   1  
ATOM   1281  C  CG   . TYR A 1 79  ? -11.534 -1.257  -2.907  1.00 0.00 ? 79  TYR A CG   1  
ATOM   1282  C  CD1  . TYR A 1 79  ? -11.208 -1.316  -4.277  1.00 0.00 ? 79  TYR A CD1  1  
ATOM   1283  C  CD2  . TYR A 1 79  ? -12.098 -2.381  -2.278  1.00 0.00 ? 79  TYR A CD2  1  
ATOM   1284  C  CE1  . TYR A 1 79  ? -11.452 -2.492  -5.014  1.00 0.00 ? 79  TYR A CE1  1  
ATOM   1285  C  CE2  . TYR A 1 79  ? -12.350 -3.552  -3.008  1.00 0.00 ? 79  TYR A CE2  1  
ATOM   1286  C  CZ   . TYR A 1 79  ? -12.032 -3.617  -4.380  1.00 0.00 ? 79  TYR A CZ   1  
ATOM   1287  O  OH   . TYR A 1 79  ? -12.279 -4.778  -5.053  1.00 0.00 ? 79  TYR A OH   1  
ATOM   1288  H  H    . TYR A 1 79  ? -9.958  -0.724  0.269   1.00 0.00 ? 79  TYR A H    1  
ATOM   1289  H  HA   . TYR A 1 79  ? -9.328  0.576   -2.325  1.00 0.00 ? 79  TYR A HA   1  
ATOM   1290  H  HB2  . TYR A 1 79  ? -12.127 -0.001  -1.314  1.00 0.00 ? 79  TYR A HB2  1  
ATOM   1291  H  HB3  . TYR A 1 79  ? -11.715 0.851   -2.782  1.00 0.00 ? 79  TYR A HB3  1  
ATOM   1292  H  HD1  . TYR A 1 79  ? -10.788 -0.451  -4.774  1.00 0.00 ? 79  TYR A HD1  1  
ATOM   1293  H  HD2  . TYR A 1 79  ? -12.343 -2.352  -1.226  1.00 0.00 ? 79  TYR A HD2  1  
ATOM   1294  H  HE1  . TYR A 1 79  ? -11.204 -2.523  -6.066  1.00 0.00 ? 79  TYR A HE1  1  
ATOM   1295  H  HE2  . TYR A 1 79  ? -12.777 -4.408  -2.512  1.00 0.00 ? 79  TYR A HE2  1  
ATOM   1296  H  HH   . TYR A 1 79  ? -12.005 -4.763  -5.982  1.00 0.00 ? 79  TYR A HH   1  
ATOM   1297  N  N    . VAL A 1 80  ? -10.197 2.826   -1.430  1.00 0.00 ? 80  VAL A N    1  
ATOM   1298  C  CA   . VAL A 1 80  ? -10.230 4.166   -0.866  1.00 0.00 ? 80  VAL A CA   1  
ATOM   1299  C  C    . VAL A 1 80  ? -11.132 5.033   -1.737  1.00 0.00 ? 80  VAL A C    1  
ATOM   1300  O  O    . VAL A 1 80  ? -11.139 4.900   -2.961  1.00 0.00 ? 80  VAL A O    1  
ATOM   1301  C  CB   . VAL A 1 80  ? -8.806  4.756   -0.754  1.00 0.00 ? 80  VAL A CB   1  
ATOM   1302  C  CG1  . VAL A 1 80  ? -8.054  4.207   0.465   1.00 0.00 ? 80  VAL A CG1  1  
ATOM   1303  C  CG2  . VAL A 1 80  ? -7.937  4.528   -2.003  1.00 0.00 ? 80  VAL A CG2  1  
ATOM   1304  H  H    . VAL A 1 80  ? -10.135 2.765   -2.443  1.00 0.00 ? 80  VAL A H    1  
ATOM   1305  H  HA   . VAL A 1 80  ? -10.674 4.128   0.124   1.00 0.00 ? 80  VAL A HA   1  
ATOM   1306  H  HB   . VAL A 1 80  ? -8.910  5.829   -0.604  1.00 0.00 ? 80  VAL A HB   1  
ATOM   1307  H  HG11 . VAL A 1 80  ? -8.594  4.480   1.368   1.00 0.00 ? 80  VAL A HG11 1  
ATOM   1308  H  HG12 . VAL A 1 80  ? -7.955  3.122   0.406   1.00 0.00 ? 80  VAL A HG12 1  
ATOM   1309  H  HG13 . VAL A 1 80  ? -7.063  4.657   0.520   1.00 0.00 ? 80  VAL A HG13 1  
ATOM   1310  H  HG21 . VAL A 1 80  ? -8.442  4.931   -2.880  1.00 0.00 ? 80  VAL A HG21 1  
ATOM   1311  H  HG22 . VAL A 1 80  ? -6.985  5.045   -1.883  1.00 0.00 ? 80  VAL A HG22 1  
ATOM   1312  H  HG23 . VAL A 1 80  ? -7.748  3.464   -2.156  1.00 0.00 ? 80  VAL A HG23 1  
ATOM   1313  N  N    . GLU A 1 81  ? -11.911 5.902   -1.104  1.00 0.00 ? 81  GLU A N    1  
ATOM   1314  C  CA   . GLU A 1 81  ? -12.696 6.916   -1.784  1.00 0.00 ? 81  GLU A CA   1  
ATOM   1315  C  C    . GLU A 1 81  ? -11.748 8.056   -2.148  1.00 0.00 ? 81  GLU A C    1  
ATOM   1316  O  O    . GLU A 1 81  ? -10.910 8.460   -1.334  1.00 0.00 ? 81  GLU A O    1  
ATOM   1317  C  CB   . GLU A 1 81  ? -13.833 7.415   -0.881  1.00 0.00 ? 81  GLU A CB   1  
ATOM   1318  C  CG   . GLU A 1 81  ? -14.880 6.322   -0.624  1.00 0.00 ? 81  GLU A CG   1  
ATOM   1319  C  CD   . GLU A 1 81  ? -16.090 6.872   0.152   1.00 0.00 ? 81  GLU A CD   1  
ATOM   1320  O  OE1  . GLU A 1 81  ? -16.026 6.984   1.397   1.00 0.00 ? 81  GLU A OE1  1  
ATOM   1321  O  OE2  . GLU A 1 81  ? -17.129 7.182   -0.475  1.00 0.00 ? 81  GLU A OE2  1  
ATOM   1322  H  H    . GLU A 1 81  ? -11.769 6.033   -0.109  1.00 0.00 ? 81  GLU A H    1  
ATOM   1323  H  HA   . GLU A 1 81  ? -13.126 6.492   -2.691  1.00 0.00 ? 81  GLU A HA   1  
ATOM   1324  H  HB2  . GLU A 1 81  ? -13.423 7.753   0.071   1.00 0.00 ? 81  GLU A HB2  1  
ATOM   1325  H  HB3  . GLU A 1 81  ? -14.321 8.258   -1.371  1.00 0.00 ? 81  GLU A HB3  1  
ATOM   1326  H  HG2  . GLU A 1 81  ? -15.213 5.917   -1.583  1.00 0.00 ? 81  GLU A HG2  1  
ATOM   1327  H  HG3  . GLU A 1 81  ? -14.423 5.506   -0.059  1.00 0.00 ? 81  GLU A HG3  1  
ATOM   1328  N  N    . VAL A 1 82  ? -11.886 8.588   -3.358  1.00 0.00 ? 82  VAL A N    1  
ATOM   1329  C  CA   . VAL A 1 82  ? -10.977 9.574   -3.925  1.00 0.00 ? 82  VAL A CA   1  
ATOM   1330  C  C    . VAL A 1 82  ? -11.775 10.630  -4.688  1.00 0.00 ? 82  VAL A C    1  
ATOM   1331  O  O    . VAL A 1 82  ? -12.823 10.319  -5.246  1.00 0.00 ? 82  VAL A O    1  
ATOM   1332  C  CB   . VAL A 1 82  ? -9.944  8.891   -4.849  1.00 0.00 ? 82  VAL A CB   1  
ATOM   1333  C  CG1  . VAL A 1 82  ? -8.874  8.146   -4.046  1.00 0.00 ? 82  VAL A CG1  1  
ATOM   1334  C  CG2  . VAL A 1 82  ? -10.561 7.922   -5.872  1.00 0.00 ? 82  VAL A CG2  1  
ATOM   1335  H  H    . VAL A 1 82  ? -12.637 8.260   -3.962  1.00 0.00 ? 82  VAL A H    1  
ATOM   1336  H  HA   . VAL A 1 82  ? -10.453 10.065  -3.110  1.00 0.00 ? 82  VAL A HA   1  
ATOM   1337  H  HB   . VAL A 1 82  ? -9.433  9.672   -5.410  1.00 0.00 ? 82  VAL A HB   1  
ATOM   1338  H  HG11 . VAL A 1 82  ? -8.377  8.856   -3.389  1.00 0.00 ? 82  VAL A HG11 1  
ATOM   1339  H  HG12 . VAL A 1 82  ? -9.321  7.348   -3.454  1.00 0.00 ? 82  VAL A HG12 1  
ATOM   1340  H  HG13 . VAL A 1 82  ? -8.136  7.719   -4.722  1.00 0.00 ? 82  VAL A HG13 1  
ATOM   1341  H  HG21 . VAL A 1 82  ? -11.003 7.060   -5.372  1.00 0.00 ? 82  VAL A HG21 1  
ATOM   1342  H  HG22 . VAL A 1 82  ? -11.323 8.437   -6.454  1.00 0.00 ? 82  VAL A HG22 1  
ATOM   1343  H  HG23 . VAL A 1 82  ? -9.786  7.575   -6.555  1.00 0.00 ? 82  VAL A HG23 1  
ATOM   1344  N  N    . ALA A 1 83  ? -11.268 11.857  -4.771  1.00 0.00 ? 83  ALA A N    1  
ATOM   1345  C  CA   . ALA A 1 83  ? -11.844 12.938  -5.557  1.00 0.00 ? 83  ALA A CA   1  
ATOM   1346  C  C    . ALA A 1 83  ? -10.743 13.490  -6.451  1.00 0.00 ? 83  ALA A C    1  
ATOM   1347  O  O    . ALA A 1 83  ? -9.627  13.724  -5.986  1.00 0.00 ? 83  ALA A O    1  
ATOM   1348  C  CB   . ALA A 1 83  ? -12.402 14.023  -4.632  1.00 0.00 ? 83  ALA A CB   1  
ATOM   1349  H  H    . ALA A 1 83  ? -10.396 12.058  -4.289  1.00 0.00 ? 83  ALA A H    1  
ATOM   1350  H  HA   . ALA A 1 83  ? -12.655 12.556  -6.179  1.00 0.00 ? 83  ALA A HA   1  
ATOM   1351  H  HB1  . ALA A 1 83  ? -12.771 14.856  -5.231  1.00 0.00 ? 83  ALA A HB1  1  
ATOM   1352  H  HB2  . ALA A 1 83  ? -13.227 13.619  -4.048  1.00 0.00 ? 83  ALA A HB2  1  
ATOM   1353  H  HB3  . ALA A 1 83  ? -11.621 14.384  -3.962  1.00 0.00 ? 83  ALA A HB3  1  
ATOM   1354  N  N    . ASP A 1 84  ? -11.040 13.667  -7.736  1.00 0.00 ? 84  ASP A N    1  
ATOM   1355  C  CA   . ASP A 1 84  ? -10.072 14.162  -8.711  1.00 0.00 ? 84  ASP A CA   1  
ATOM   1356  C  C    . ASP A 1 84  ? -9.772  15.637  -8.462  1.00 0.00 ? 84  ASP A C    1  
ATOM   1357  O  O    . ASP A 1 84  ? -10.678 16.468  -8.530  1.00 0.00 ? 84  ASP A O    1  
ATOM   1358  C  CB   . ASP A 1 84  ? -10.605 13.974  -10.137 1.00 0.00 ? 84  ASP A CB   1  
ATOM   1359  C  CG   . ASP A 1 84  ? -9.737  14.747  -11.131 1.00 0.00 ? 84  ASP A CG   1  
ATOM   1360  O  OD1  . ASP A 1 84  ? -8.514  14.503  -11.176 1.00 0.00 ? 84  ASP A OD1  1  
ATOM   1361  O  OD2  . ASP A 1 84  ? -10.286 15.632  -11.820 1.00 0.00 ? 84  ASP A OD2  1  
ATOM   1362  H  H    . ASP A 1 84  ? -11.989 13.503  -8.044  1.00 0.00 ? 84  ASP A H    1  
ATOM   1363  H  HA   . ASP A 1 84  ? -9.142  13.604  -8.608  1.00 0.00 ? 84  ASP A HA   1  
ATOM   1364  H  HB2  . ASP A 1 84  ? -10.608 12.914  -10.393 1.00 0.00 ? 84  ASP A HB2  1  
ATOM   1365  H  HB3  . ASP A 1 84  ? -11.628 14.350  -10.198 1.00 0.00 ? 84  ASP A HB3  1  
ATOM   1366  N  N    . ILE A 1 85  ? -8.505  15.966  -8.204  1.00 0.00 ? 85  ILE A N    1  
ATOM   1367  C  CA   . ILE A 1 85  ? -8.045  17.346  -8.057  1.00 0.00 ? 85  ILE A CA   1  
ATOM   1368  C  C    . ILE A 1 85  ? -7.748  17.929  -9.454  1.00 0.00 ? 85  ILE A C    1  
ATOM   1369  O  O    . ILE A 1 85  ? -7.818  19.144  -9.642  1.00 0.00 ? 85  ILE A O    1  
ATOM   1370  C  CB   . ILE A 1 85  ? -6.800  17.403  -7.129  1.00 0.00 ? 85  ILE A CB   1  
ATOM   1371  C  CG1  . ILE A 1 85  ? -7.034  16.702  -5.768  1.00 0.00 ? 85  ILE A CG1  1  
ATOM   1372  C  CG2  . ILE A 1 85  ? -6.374  18.855  -6.839  1.00 0.00 ? 85  ILE A CG2  1  
ATOM   1373  C  CD1  . ILE A 1 85  ? -5.765  16.576  -4.910  1.00 0.00 ? 85  ILE A CD1  1  
ATOM   1374  H  H    . ILE A 1 85  ? -7.796  15.239  -8.222  1.00 0.00 ? 85  ILE A H    1  
ATOM   1375  H  HA   . ILE A 1 85  ? -8.835  17.933  -7.594  1.00 0.00 ? 85  ILE A HA   1  
ATOM   1376  H  HB   . ILE A 1 85  ? -5.985  16.899  -7.644  1.00 0.00 ? 85  ILE A HB   1  
ATOM   1377  H  HG12 . ILE A 1 85  ? -7.795  17.241  -5.203  1.00 0.00 ? 85  ILE A HG12 1  
ATOM   1378  H  HG13 . ILE A 1 85  ? -7.407  15.696  -5.938  1.00 0.00 ? 85  ILE A HG13 1  
ATOM   1379  H  HG21 . ILE A 1 85  ? -5.439  18.877  -6.284  1.00 0.00 ? 85  ILE A HG21 1  
ATOM   1380  H  HG22 . ILE A 1 85  ? -6.199  19.405  -7.761  1.00 0.00 ? 85  ILE A HG22 1  
ATOM   1381  H  HG23 . ILE A 1 85  ? -7.148  19.355  -6.255  1.00 0.00 ? 85  ILE A HG23 1  
ATOM   1382  H  HD11 . ILE A 1 85  ? -5.414  17.551  -4.578  1.00 0.00 ? 85  ILE A HD11 1  
ATOM   1383  H  HD12 . ILE A 1 85  ? -5.981  15.992  -4.019  1.00 0.00 ? 85  ILE A HD12 1  
ATOM   1384  H  HD13 . ILE A 1 85  ? -4.983  16.075  -5.481  1.00 0.00 ? 85  ILE A HD13 1  
ATOM   1385  N  N    . GLY A 1 86  ? -7.422  17.081  -10.439 1.00 0.00 ? 86  GLY A N    1  
ATOM   1386  C  CA   . GLY A 1 86  ? -6.916  17.493  -11.741 1.00 0.00 ? 86  GLY A CA   1  
ATOM   1387  C  C    . GLY A 1 86  ? -7.898  18.359  -12.530 1.00 0.00 ? 86  GLY A C    1  
ATOM   1388  O  O    . GLY A 1 86  ? -7.460  19.261  -13.250 1.00 0.00 ? 86  GLY A O    1  
ATOM   1389  H  H    . GLY A 1 86  ? -7.516  16.080  -10.290 1.00 0.00 ? 86  GLY A H    1  
ATOM   1390  H  HA2  . GLY A 1 86  ? -5.985  18.043  -11.600 1.00 0.00 ? 86  GLY A HA2  1  
ATOM   1391  H  HA3  . GLY A 1 86  ? -6.705  16.596  -12.322 1.00 0.00 ? 86  GLY A HA3  1  
ATOM   1392  N  N    . GLY A 1 87  ? -9.206  18.124  -12.389 1.00 0.00 ? 87  GLY A N    1  
ATOM   1393  C  CA   . GLY A 1 87  ? -10.227 18.804  -13.169 1.00 0.00 ? 87  GLY A CA   1  
ATOM   1394  C  C    . GLY A 1 87  ? -11.575 18.910  -12.464 1.00 0.00 ? 87  GLY A C    1  
ATOM   1395  O  O    . GLY A 1 87  ? -12.145 20.003  -12.435 1.00 0.00 ? 87  GLY A O    1  
ATOM   1396  H  H    . GLY A 1 87  ? -9.499  17.304  -11.861 1.00 0.00 ? 87  GLY A H    1  
ATOM   1397  H  HA2  . GLY A 1 87  ? -9.889  19.805  -13.439 1.00 0.00 ? 87  GLY A HA2  1  
ATOM   1398  H  HA3  . GLY A 1 87  ? -10.376 18.224  -14.080 1.00 0.00 ? 87  GLY A HA3  1  
ATOM   1399  N  N    . LYS A 1 88  ? -12.105 17.812  -11.907 1.00 0.00 ? 88  LYS A N    1  
ATOM   1400  C  CA   . LYS A 1 88  ? -13.485 17.807  -11.412 1.00 0.00 ? 88  LYS A CA   1  
ATOM   1401  C  C    . LYS A 1 88  ? -13.599 18.639  -10.138 1.00 0.00 ? 88  LYS A C    1  
ATOM   1402  O  O    . LYS A 1 88  ? -14.402 19.569  -10.094 1.00 0.00 ? 88  LYS A O    1  
ATOM   1403  C  CB   . LYS A 1 88  ? -14.020 16.379  -11.199 1.00 0.00 ? 88  LYS A CB   1  
ATOM   1404  C  CG   . LYS A 1 88  ? -13.913 15.517  -12.469 1.00 0.00 ? 88  LYS A CG   1  
ATOM   1405  C  CD   . LYS A 1 88  ? -14.774 14.247  -12.405 1.00 0.00 ? 88  LYS A CD   1  
ATOM   1406  C  CE   . LYS A 1 88  ? -16.230 14.543  -12.796 1.00 0.00 ? 88  LYS A CE   1  
ATOM   1407  N  NZ   . LYS A 1 88  ? -17.064 13.319  -12.814 1.00 0.00 ? 88  LYS A NZ   1  
ATOM   1408  H  H    . LYS A 1 88  ? -11.574 16.940  -11.915 1.00 0.00 ? 88  LYS A H    1  
ATOM   1409  H  HA   . LYS A 1 88  ? -14.112 18.283  -12.169 1.00 0.00 ? 88  LYS A HA   1  
ATOM   1410  H  HB2  . LYS A 1 88  ? -13.474 15.892  -10.389 1.00 0.00 ? 88  LYS A HB2  1  
ATOM   1411  H  HB3  . LYS A 1 88  ? -15.067 16.456  -10.903 1.00 0.00 ? 88  LYS A HB3  1  
ATOM   1412  H  HG2  . LYS A 1 88  ? -14.205 16.103  -13.343 1.00 0.00 ? 88  LYS A HG2  1  
ATOM   1413  H  HG3  . LYS A 1 88  ? -12.873 15.218  -12.599 1.00 0.00 ? 88  LYS A HG3  1  
ATOM   1414  H  HD2  . LYS A 1 88  ? -14.364 13.521  -13.110 1.00 0.00 ? 88  LYS A HD2  1  
ATOM   1415  H  HD3  . LYS A 1 88  ? -14.729 13.823  -11.401 1.00 0.00 ? 88  LYS A HD3  1  
ATOM   1416  H  HE2  . LYS A 1 88  ? -16.656 15.267  -12.099 1.00 0.00 ? 88  LYS A HE2  1  
ATOM   1417  H  HE3  . LYS A 1 88  ? -16.233 14.990  -13.793 1.00 0.00 ? 88  LYS A HE3  1  
ATOM   1418  H  HZ1  . LYS A 1 88  ? -17.232 12.966  -11.870 1.00 0.00 ? 88  LYS A HZ1  1  
ATOM   1419  H  HZ2  . LYS A 1 88  ? -17.965 13.501  -13.232 1.00 0.00 ? 88  LYS A HZ2  1  
ATOM   1420  H  HZ3  . LYS A 1 88  ? -16.617 12.570  -13.328 1.00 0.00 ? 88  LYS A HZ3  1  
ATOM   1421  N  N    . ASP A 1 89  ? -12.785 18.315  -9.126  1.00 0.00 ? 89  ASP A N    1  
ATOM   1422  C  CA   . ASP A 1 89  ? -12.726 18.948  -7.801  1.00 0.00 ? 89  ASP A CA   1  
ATOM   1423  C  C    . ASP A 1 89  ? -14.096 19.094  -7.104  1.00 0.00 ? 89  ASP A C    1  
ATOM   1424  O  O    . ASP A 1 89  ? -14.273 19.928  -6.216  1.00 0.00 ? 89  ASP A O    1  
ATOM   1425  C  CB   . ASP A 1 89  ? -11.943 20.268  -7.905  1.00 0.00 ? 89  ASP A CB   1  
ATOM   1426  C  CG   . ASP A 1 89  ? -11.582 20.868  -6.533  1.00 0.00 ? 89  ASP A CG   1  
ATOM   1427  O  OD1  . ASP A 1 89  ? -11.012 20.152  -5.678  1.00 0.00 ? 89  ASP A OD1  1  
ATOM   1428  O  OD2  . ASP A 1 89  ? -11.803 22.083  -6.325  1.00 0.00 ? 89  ASP A OD2  1  
ATOM   1429  H  H    . ASP A 1 89  ? -12.129 17.552  -9.262  1.00 0.00 ? 89  ASP A H    1  
ATOM   1430  H  HA   . ASP A 1 89  ? -12.134 18.279  -7.175  1.00 0.00 ? 89  ASP A HA   1  
ATOM   1431  H  HB2  . ASP A 1 89  ? -11.018 20.084  -8.456  1.00 0.00 ? 89  ASP A HB2  1  
ATOM   1432  H  HB3  . ASP A 1 89  ? -12.537 20.981  -8.479  1.00 0.00 ? 89  ASP A HB3  1  
ATOM   1433  N  N    . ASP A 1 90  ? -15.090 18.295  -7.512  1.00 0.00 ? 90  ASP A N    1  
ATOM   1434  C  CA   . ASP A 1 90  ? -16.495 18.443  -7.104  1.00 0.00 ? 90  ASP A CA   1  
ATOM   1435  C  C    . ASP A 1 90  ? -17.262 17.111  -7.206  1.00 0.00 ? 90  ASP A C    1  
ATOM   1436  O  O    . ASP A 1 90  ? -18.492 17.080  -7.146  1.00 0.00 ? 90  ASP A O    1  
ATOM   1437  C  CB   . ASP A 1 90  ? -17.156 19.524  -7.979  1.00 0.00 ? 90  ASP A CB   1  
ATOM   1438  C  CG   . ASP A 1 90  ? -18.562 19.922  -7.494  1.00 0.00 ? 90  ASP A CG   1  
ATOM   1439  O  OD1  . ASP A 1 90  ? -18.727 20.274  -6.303  1.00 0.00 ? 90  ASP A OD1  1  
ATOM   1440  O  OD2  . ASP A 1 90  ? -19.504 19.958  -8.319  1.00 0.00 ? 90  ASP A OD2  1  
ATOM   1441  H  H    . ASP A 1 90  ? -14.896 17.650  -8.261  1.00 0.00 ? 90  ASP A H    1  
ATOM   1442  H  HA   . ASP A 1 90  ? -16.525 18.769  -6.063  1.00 0.00 ? 90  ASP A HA   1  
ATOM   1443  H  HB2  . ASP A 1 90  ? -16.530 20.419  -7.977  1.00 0.00 ? 90  ASP A HB2  1  
ATOM   1444  H  HB3  . ASP A 1 90  ? -17.205 19.159  -9.008  1.00 0.00 ? 90  ASP A HB3  1  
ATOM   1445  N  N    . ASP A 1 91  ? -16.551 15.994  -7.385  1.00 0.00 ? 91  ASP A N    1  
ATOM   1446  C  CA   . ASP A 1 91  ? -17.126 14.657  -7.548  1.00 0.00 ? 91  ASP A CA   1  
ATOM   1447  C  C    . ASP A 1 91  ? -16.160 13.626  -6.961  1.00 0.00 ? 91  ASP A C    1  
ATOM   1448  O  O    . ASP A 1 91  ? -14.975 13.928  -6.786  1.00 0.00 ? 91  ASP A O    1  
ATOM   1449  C  CB   . ASP A 1 91  ? -17.399 14.385  -9.033  1.00 0.00 ? 91  ASP A CB   1  
ATOM   1450  C  CG   . ASP A 1 91  ? -18.089 13.033  -9.272  1.00 0.00 ? 91  ASP A CG   1  
ATOM   1451  O  OD1  . ASP A 1 91  ? -18.934 12.614  -8.448  1.00 0.00 ? 91  ASP A OD1  1  
ATOM   1452  O  OD2  . ASP A 1 91  ? -17.801 12.412  -10.317 1.00 0.00 ? 91  ASP A OD2  1  
ATOM   1453  H  H    . ASP A 1 91  ? -15.543 16.027  -7.306  1.00 0.00 ? 91  ASP A H    1  
ATOM   1454  H  HA   . ASP A 1 91  ? -18.069 14.600  -7.002  1.00 0.00 ? 91  ASP A HA   1  
ATOM   1455  H  HB2  . ASP A 1 91  ? -18.040 15.176  -9.430  1.00 0.00 ? 91  ASP A HB2  1  
ATOM   1456  H  HB3  . ASP A 1 91  ? -16.452 14.416  -9.576  1.00 0.00 ? 91  ASP A HB3  1  
ATOM   1457  N  N    . VAL A 1 92  ? -16.648 12.422  -6.654  1.00 0.00 ? 92  VAL A N    1  
ATOM   1458  C  CA   . VAL A 1 92  ? -15.922 11.411  -5.892  1.00 0.00 ? 92  VAL A CA   1  
ATOM   1459  C  C    . VAL A 1 92  ? -16.098 10.045  -6.579  1.00 0.00 ? 92  VAL A C    1  
ATOM   1460  O  O    . VAL A 1 92  ? -17.135 9.762   -7.185  1.00 0.00 ? 92  VAL A O    1  
ATOM   1461  C  CB   . VAL A 1 92  ? -16.428 11.404  -4.424  1.00 0.00 ? 92  VAL A CB   1  
ATOM   1462  C  CG1  . VAL A 1 92  ? -15.535 10.584  -3.480  1.00 0.00 ? 92  VAL A CG1  1  
ATOM   1463  C  CG2  . VAL A 1 92  ? -16.550 12.812  -3.807  1.00 0.00 ? 92  VAL A CG2  1  
ATOM   1464  H  H    . VAL A 1 92  ? -17.594 12.184  -6.928  1.00 0.00 ? 92  VAL A H    1  
ATOM   1465  H  HA   . VAL A 1 92  ? -14.865 11.669  -5.884  1.00 0.00 ? 92  VAL A HA   1  
ATOM   1466  H  HB   . VAL A 1 92  ? -17.419 10.956  -4.418  1.00 0.00 ? 92  VAL A HB   1  
ATOM   1467  H  HG11 . VAL A 1 92  ? -14.538 11.019  -3.436  1.00 0.00 ? 92  VAL A HG11 1  
ATOM   1468  H  HG12 . VAL A 1 92  ? -15.960 10.575  -2.476  1.00 0.00 ? 92  VAL A HG12 1  
ATOM   1469  H  HG13 . VAL A 1 92  ? -15.466 9.551   -3.818  1.00 0.00 ? 92  VAL A HG13 1  
ATOM   1470  H  HG21 . VAL A 1 92  ? -17.326 13.386  -4.314  1.00 0.00 ? 92  VAL A HG21 1  
ATOM   1471  H  HG22 . VAL A 1 92  ? -16.832 12.740  -2.756  1.00 0.00 ? 92  VAL A HG22 1  
ATOM   1472  H  HG23 . VAL A 1 92  ? -15.600 13.341  -3.887  1.00 0.00 ? 92  VAL A HG23 1  
ATOM   1473  N  N    . TYR A 1 93  ? -15.074 9.205   -6.451  1.00 0.00 ? 93  TYR A N    1  
ATOM   1474  C  CA   . TYR A 1 93  ? -14.948 7.860   -6.995  1.00 0.00 ? 93  TYR A CA   1  
ATOM   1475  C  C    . TYR A 1 93  ? -14.315 6.958   -5.920  1.00 0.00 ? 93  TYR A C    1  
ATOM   1476  O  O    . TYR A 1 93  ? -14.059 7.394   -4.795  1.00 0.00 ? 93  TYR A O    1  
ATOM   1477  C  CB   . TYR A 1 93  ? -14.063 7.903   -8.259  1.00 0.00 ? 93  TYR A CB   1  
ATOM   1478  C  CG   . TYR A 1 93  ? -14.617 8.670   -9.445  1.00 0.00 ? 93  TYR A CG   1  
ATOM   1479  C  CD1  . TYR A 1 93  ? -15.590 8.074   -10.270 1.00 0.00 ? 93  TYR A CD1  1  
ATOM   1480  C  CD2  . TYR A 1 93  ? -14.104 9.941   -9.773  1.00 0.00 ? 93  TYR A CD2  1  
ATOM   1481  C  CE1  . TYR A 1 93  ? -16.040 8.733   -11.428 1.00 0.00 ? 93  TYR A CE1  1  
ATOM   1482  C  CE2  . TYR A 1 93  ? -14.548 10.604  -10.932 1.00 0.00 ? 93  TYR A CE2  1  
ATOM   1483  C  CZ   . TYR A 1 93  ? -15.514 10.000  -11.769 1.00 0.00 ? 93  TYR A CZ   1  
ATOM   1484  O  OH   . TYR A 1 93  ? -15.912 10.631  -12.913 1.00 0.00 ? 93  TYR A OH   1  
ATOM   1485  H  H    . TYR A 1 93  ? -14.280 9.540   -5.928  1.00 0.00 ? 93  TYR A H    1  
ATOM   1486  H  HA   . TYR A 1 93  ? -15.931 7.465   -7.256  1.00 0.00 ? 93  TYR A HA   1  
ATOM   1487  H  HB2  . TYR A 1 93  ? -13.091 8.320   -7.990  1.00 0.00 ? 93  TYR A HB2  1  
ATOM   1488  H  HB3  . TYR A 1 93  ? -13.880 6.885   -8.603  1.00 0.00 ? 93  TYR A HB3  1  
ATOM   1489  H  HD1  . TYR A 1 93  ? -15.981 7.094   -10.029 1.00 0.00 ? 93  TYR A HD1  1  
ATOM   1490  H  HD2  . TYR A 1 93  ? -13.351 10.402  -9.148  1.00 0.00 ? 93  TYR A HD2  1  
ATOM   1491  H  HE1  . TYR A 1 93  ? -16.779 8.257   -12.060 1.00 0.00 ? 93  TYR A HE1  1  
ATOM   1492  H  HE2  . TYR A 1 93  ? -14.131 11.566  -11.189 1.00 0.00 ? 93  TYR A HE2  1  
ATOM   1493  H  HH   . TYR A 1 93  ? -16.529 10.097  -13.440 1.00 0.00 ? 93  TYR A HH   1  
ATOM   1494  N  N    . THR A 1 94  ? -14.017 5.715   -6.291  1.00 0.00 ? 94  THR A N    1  
ATOM   1495  C  CA   . THR A 1 94  ? -13.316 4.747   -5.455  1.00 0.00 ? 94  THR A CA   1  
ATOM   1496  C  C    . THR A 1 94  ? -12.168 4.163   -6.284  1.00 0.00 ? 94  THR A C    1  
ATOM   1497  O  O    . THR A 1 94  ? -12.312 3.953   -7.492  1.00 0.00 ? 94  THR A O    1  
ATOM   1498  C  CB   . THR A 1 94  ? -14.298 3.674   -4.936  1.00 0.00 ? 94  THR A CB   1  
ATOM   1499  O  OG1  . THR A 1 94  ? -15.539 4.252   -4.557  1.00 0.00 ? 94  THR A OG1  1  
ATOM   1500  C  CG2  . THR A 1 94  ? -13.736 2.941   -3.713  1.00 0.00 ? 94  THR A CG2  1  
ATOM   1501  H  H    . THR A 1 94  ? -14.215 5.464   -7.255  1.00 0.00 ? 94  THR A H    1  
ATOM   1502  H  HA   . THR A 1 94  ? -12.885 5.255   -4.593  1.00 0.00 ? 94  THR A HA   1  
ATOM   1503  H  HB   . THR A 1 94  ? -14.478 2.949   -5.732  1.00 0.00 ? 94  THR A HB   1  
ATOM   1504  H  HG1  . THR A 1 94  ? -16.202 3.545   -4.523  1.00 0.00 ? 94  THR A HG1  1  
ATOM   1505  H  HG21 . THR A 1 94  ? -14.428 2.159   -3.397  1.00 0.00 ? 94  THR A HG21 1  
ATOM   1506  H  HG22 . THR A 1 94  ? -12.785 2.477   -3.969  1.00 0.00 ? 94  THR A HG22 1  
ATOM   1507  H  HG23 . THR A 1 94  ? -13.584 3.641   -2.890  1.00 0.00 ? 94  THR A HG23 1  
ATOM   1508  N  N    . ALA A 1 95  ? -11.036 3.907   -5.629  1.00 0.00 ? 95  ALA A N    1  
ATOM   1509  C  CA   . ALA A 1 95  ? -9.817  3.374   -6.216  1.00 0.00 ? 95  ALA A CA   1  
ATOM   1510  C  C    . ALA A 1 95  ? -9.309  2.244   -5.326  1.00 0.00 ? 95  ALA A C    1  
ATOM   1511  O  O    . ALA A 1 95  ? -9.623  2.196   -4.135  1.00 0.00 ? 95  ALA A O    1  
ATOM   1512  C  CB   . ALA A 1 95  ? -8.773  4.495   -6.303  1.00 0.00 ? 95  ALA A CB   1  
ATOM   1513  H  H    . ALA A 1 95  ? -11.000 4.106   -4.633  1.00 0.00 ? 95  ALA A H    1  
ATOM   1514  H  HA   . ALA A 1 95  ? -10.017 2.988   -7.217  1.00 0.00 ? 95  ALA A HA   1  
ATOM   1515  H  HB1  . ALA A 1 95  ? -7.842  4.106   -6.715  1.00 0.00 ? 95  ALA A HB1  1  
ATOM   1516  H  HB2  . ALA A 1 95  ? -9.143  5.291   -6.947  1.00 0.00 ? 95  ALA A HB2  1  
ATOM   1517  H  HB3  . ALA A 1 95  ? -8.574  4.902   -5.311  1.00 0.00 ? 95  ALA A HB3  1  
ATOM   1518  N  N    . LYS A 1 96  ? -8.504  1.338   -5.881  1.00 0.00 ? 96  LYS A N    1  
ATOM   1519  C  CA   . LYS A 1 96  ? -7.792  0.353   -5.086  1.00 0.00 ? 96  LYS A CA   1  
ATOM   1520  C  C    . LYS A 1 96  ? -6.687  1.095   -4.354  1.00 0.00 ? 96  LYS A C    1  
ATOM   1521  O  O    . LYS A 1 96  ? -5.984  1.904   -4.963  1.00 0.00 ? 96  LYS A O    1  
ATOM   1522  C  CB   . LYS A 1 96  ? -7.176  -0.714  -6.002  1.00 0.00 ? 96  LYS A CB   1  
ATOM   1523  C  CG   . LYS A 1 96  ? -8.223  -1.623  -6.666  1.00 0.00 ? 96  LYS A CG   1  
ATOM   1524  C  CD   . LYS A 1 96  ? -7.585  -2.445  -7.795  1.00 0.00 ? 96  LYS A CD   1  
ATOM   1525  C  CE   . LYS A 1 96  ? -7.462  -1.614  -9.085  1.00 0.00 ? 96  LYS A CE   1  
ATOM   1526  N  NZ   . LYS A 1 96  ? -6.341  -2.062  -9.943  1.00 0.00 ? 96  LYS A NZ   1  
ATOM   1527  H  H    . LYS A 1 96  ? -8.199  1.477   -6.830  1.00 0.00 ? 96  LYS A H    1  
ATOM   1528  H  HA   . LYS A 1 96  ? -8.467  -0.119  -4.370  1.00 0.00 ? 96  LYS A HA   1  
ATOM   1529  H  HB2  . LYS A 1 96  ? -6.571  -0.220  -6.763  1.00 0.00 ? 96  LYS A HB2  1  
ATOM   1530  H  HB3  . LYS A 1 96  ? -6.516  -1.344  -5.405  1.00 0.00 ? 96  LYS A HB3  1  
ATOM   1531  H  HG2  . LYS A 1 96  ? -8.617  -2.301  -5.909  1.00 0.00 ? 96  LYS A HG2  1  
ATOM   1532  H  HG3  . LYS A 1 96  ? -9.049  -1.036  -7.068  1.00 0.00 ? 96  LYS A HG3  1  
ATOM   1533  H  HD2  . LYS A 1 96  ? -6.604  -2.791  -7.466  1.00 0.00 ? 96  LYS A HD2  1  
ATOM   1534  H  HD3  . LYS A 1 96  ? -8.209  -3.315  -7.999  1.00 0.00 ? 96  LYS A HD3  1  
ATOM   1535  H  HE2  . LYS A 1 96  ? -8.405  -1.680  -9.634  1.00 0.00 ? 96  LYS A HE2  1  
ATOM   1536  H  HE3  . LYS A 1 96  ? -7.298  -0.567  -8.824  1.00 0.00 ? 96  LYS A HE3  1  
ATOM   1537  H  HZ1  . LYS A 1 96  ? -6.362  -1.583  -10.832 1.00 0.00 ? 96  LYS A HZ1  1  
ATOM   1538  H  HZ2  . LYS A 1 96  ? -5.455  -1.806  -9.501  1.00 0.00 ? 96  LYS A HZ2  1  
ATOM   1539  H  HZ3  . LYS A 1 96  ? -6.366  -3.056  -10.111 1.00 0.00 ? 96  LYS A HZ3  1  
ATOM   1540  N  N    . LEU A 1 97  ? -6.466  0.769   -3.083  1.00 0.00 ? 97  LEU A N    1  
ATOM   1541  C  CA   . LEU A 1 97  ? -5.285  1.246   -2.362  1.00 0.00 ? 97  LEU A CA   1  
ATOM   1542  C  C    . LEU A 1 97  ? -4.023  0.751   -3.089  1.00 0.00 ? 97  LEU A C    1  
ATOM   1543  O  O    . LEU A 1 97  ? -3.004  1.434   -3.104  1.00 0.00 ? 97  LEU A O    1  
ATOM   1544  C  CB   . LEU A 1 97  ? -5.321  0.752   -0.907  1.00 0.00 ? 97  LEU A CB   1  
ATOM   1545  C  CG   . LEU A 1 97  ? -4.164  1.283   -0.032  1.00 0.00 ? 97  LEU A CG   1  
ATOM   1546  C  CD1  . LEU A 1 97  ? -4.198  2.810   0.119   1.00 0.00 ? 97  LEU A CD1  1  
ATOM   1547  C  CD2  . LEU A 1 97  ? -4.250  0.641   1.355   1.00 0.00 ? 97  LEU A CD2  1  
ATOM   1548  H  H    . LEU A 1 97  ? -7.063  0.076   -2.651  1.00 0.00 ? 97  LEU A H    1  
ATOM   1549  H  HA   . LEU A 1 97  ? -5.299  2.336   -2.377  1.00 0.00 ? 97  LEU A HA   1  
ATOM   1550  H  HB2  . LEU A 1 97  ? -6.270  1.049   -0.455  1.00 0.00 ? 97  LEU A HB2  1  
ATOM   1551  H  HB3  . LEU A 1 97  ? -5.274  -0.337  -0.918  1.00 0.00 ? 97  LEU A HB3  1  
ATOM   1552  H  HG   . LEU A 1 97  ? -3.209  0.993   -0.469  1.00 0.00 ? 97  LEU A HG   1  
ATOM   1553  H  HD11 . LEU A 1 97  ? -5.172  3.133   0.483   1.00 0.00 ? 97  LEU A HD11 1  
ATOM   1554  H  HD12 . LEU A 1 97  ? -3.437  3.128   0.830   1.00 0.00 ? 97  LEU A HD12 1  
ATOM   1555  H  HD13 . LEU A 1 97  ? -3.988  3.291   -0.836  1.00 0.00 ? 97  LEU A HD13 1  
ATOM   1556  H  HD21 . LEU A 1 97  ? -3.415  0.976   1.972   1.00 0.00 ? 97  LEU A HD21 1  
ATOM   1557  H  HD22 . LEU A 1 97  ? -5.187  0.911   1.843   1.00 0.00 ? 97  LEU A HD22 1  
ATOM   1558  H  HD23 . LEU A 1 97  ? -4.190  -0.444  1.259   1.00 0.00 ? 97  LEU A HD23 1  
ATOM   1559  N  N    . SER A 1 98  ? -4.125  -0.403  -3.755  1.00 0.00 ? 98  SER A N    1  
ATOM   1560  C  CA   . SER A 1 98  ? -3.089  -1.008  -4.584  1.00 0.00 ? 98  SER A CA   1  
ATOM   1561  C  C    . SER A 1 98  ? -2.671  -0.133  -5.779  1.00 0.00 ? 98  SER A C    1  
ATOM   1562  O  O    . SER A 1 98  ? -1.617  -0.374  -6.369  1.00 0.00 ? 98  SER A O    1  
ATOM   1563  C  CB   . SER A 1 98  ? -3.627  -2.357  -5.076  1.00 0.00 ? 98  SER A CB   1  
ATOM   1564  O  OG   . SER A 1 98  ? -4.187  -3.071  -3.985  1.00 0.00 ? 98  SER A OG   1  
ATOM   1565  H  H    . SER A 1 98  ? -4.989  -0.931  -3.685  1.00 0.00 ? 98  SER A H    1  
ATOM   1566  H  HA   . SER A 1 98  ? -2.210  -1.185  -3.963  1.00 0.00 ? 98  SER A HA   1  
ATOM   1567  H  HB2  . SER A 1 98  ? -4.398  -2.187  -5.828  1.00 0.00 ? 98  SER A HB2  1  
ATOM   1568  H  HB3  . SER A 1 98  ? -2.826  -2.935  -5.532  1.00 0.00 ? 98  SER A HB3  1  
ATOM   1569  H  HG   . SER A 1 98  ? -4.558  -3.905  -4.320  1.00 0.00 ? 98  SER A HG   1  
ATOM   1570  N  N    . ASP A 1 99  ? -3.460  0.889   -6.123  1.00 0.00 ? 99  ASP A N    1  
ATOM   1571  C  CA   . ASP A 1 99  ? -3.221  1.778   -7.259  1.00 0.00 ? 99  ASP A CA   1  
ATOM   1572  C  C    . ASP A 1 99  ? -3.006  3.208   -6.745  1.00 0.00 ? 99  ASP A C    1  
ATOM   1573  O  O    . ASP A 1 99  ? -2.995  4.146   -7.533  1.00 0.00 ? 99  ASP A O    1  
ATOM   1574  C  CB   . ASP A 1 99  ? -4.387  1.698   -8.269  1.00 0.00 ? 99  ASP A CB   1  
ATOM   1575  C  CG   . ASP A 1 99  ? -4.361  0.464   -9.185  1.00 0.00 ? 99  ASP A CG   1  
ATOM   1576  O  OD1  . ASP A 1 99  ? -4.301  -0.682  -8.685  1.00 0.00 ? 99  ASP A OD1  1  
ATOM   1577  O  OD2  . ASP A 1 99  ? -4.511  0.632   -10.417 1.00 0.00 ? 99  ASP A OD2  1  
ATOM   1578  H  H    . ASP A 1 99  ? -4.291  1.077   -5.577  1.00 0.00 ? 99  ASP A H    1  
ATOM   1579  H  HA   . ASP A 1 99  ? -2.310  1.481   -7.779  1.00 0.00 ? 99  ASP A HA   1  
ATOM   1580  H  HB2  . ASP A 1 99  ? -5.338  1.736   -7.734  1.00 0.00 ? 99  ASP A HB2  1  
ATOM   1581  H  HB3  . ASP A 1 99  ? -4.349  2.572   -8.917  1.00 0.00 ? 99  ASP A HB3  1  
ATOM   1582  N  N    . ILE A 1 100 ? -2.826  3.412   -5.437  1.00 0.00 ? 100 ILE A N    1  
ATOM   1583  C  CA   . ILE A 1 100 ? -2.640  4.725   -4.826  1.00 0.00 ? 100 ILE A CA   1  
ATOM   1584  C  C    . ILE A 1 100 ? -1.245  4.792   -4.221  1.00 0.00 ? 100 ILE A C    1  
ATOM   1585  O  O    . ILE A 1 100 ? -0.698  3.810   -3.714  1.00 0.00 ? 100 ILE A O    1  
ATOM   1586  C  CB   . ILE A 1 100 ? -3.776  4.997   -3.805  1.00 0.00 ? 100 ILE A CB   1  
ATOM   1587  C  CG1  . ILE A 1 100 ? -5.021  5.495   -4.568  1.00 0.00 ? 100 ILE A CG1  1  
ATOM   1588  C  CG2  . ILE A 1 100 ? -3.428  5.942   -2.633  1.00 0.00 ? 100 ILE A CG2  1  
ATOM   1589  C  CD1  . ILE A 1 100 ? -5.125  7.004   -4.791  1.00 0.00 ? 100 ILE A CD1  1  
ATOM   1590  H  H    . ILE A 1 100 ? -2.805  2.611   -4.815  1.00 0.00 ? 100 ILE A H    1  
ATOM   1591  H  HA   . ILE A 1 100 ? -2.693  5.493   -5.597  1.00 0.00 ? 100 ILE A HA   1  
ATOM   1592  H  HB   . ILE A 1 100 ? -4.036  4.040   -3.350  1.00 0.00 ? 100 ILE A HB   1  
ATOM   1593  H  HG12 . ILE A 1 100 ? -5.036  5.026   -5.548  1.00 0.00 ? 100 ILE A HG12 1  
ATOM   1594  H  HG13 . ILE A 1 100 ? -5.909  5.190   -4.023  1.00 0.00 ? 100 ILE A HG13 1  
ATOM   1595  H  HG21 . ILE A 1 100 ? -2.658  5.492   -2.005  1.00 0.00 ? 100 ILE A HG21 1  
ATOM   1596  H  HG22 . ILE A 1 100 ? -3.068  6.909   -2.995  1.00 0.00 ? 100 ILE A HG22 1  
ATOM   1597  H  HG23 . ILE A 1 100 ? -4.311  6.102   -2.014  1.00 0.00 ? 100 ILE A HG23 1  
ATOM   1598  H  HD11 . ILE A 1 100 ? -4.197  7.390   -5.207  1.00 0.00 ? 100 ILE A HD11 1  
ATOM   1599  H  HD12 . ILE A 1 100 ? -5.941  7.189   -5.487  1.00 0.00 ? 100 ILE A HD12 1  
ATOM   1600  H  HD13 . ILE A 1 100 ? -5.347  7.506   -3.849  1.00 0.00 ? 100 ILE A HD13 1  
ATOM   1601  N  N    . GLU A 1 101 ? -0.702  6.001   -4.259  1.00 0.00 ? 101 GLU A N    1  
ATOM   1602  C  CA   . GLU A 1 101 ? 0.513   6.390   -3.566  1.00 0.00 ? 101 GLU A CA   1  
ATOM   1603  C  C    . GLU A 1 101 ? 0.223   7.757   -2.946  1.00 0.00 ? 101 GLU A C    1  
ATOM   1604  O  O    . GLU A 1 101 ? -0.393  8.604   -3.595  1.00 0.00 ? 101 GLU A O    1  
ATOM   1605  C  CB   . GLU A 1 101 ? 1.689   6.406   -4.557  1.00 0.00 ? 101 GLU A CB   1  
ATOM   1606  C  CG   . GLU A 1 101 ? 3.010   6.897   -3.942  1.00 0.00 ? 101 GLU A CG   1  
ATOM   1607  C  CD   . GLU A 1 101 ? 3.479   6.056   -2.739  1.00 0.00 ? 101 GLU A CD   1  
ATOM   1608  O  OE1  . GLU A 1 101 ? 2.852   6.141   -1.658  1.00 0.00 ? 101 GLU A OE1  1  
ATOM   1609  O  OE2  . GLU A 1 101 ? 4.493   5.333   -2.870  1.00 0.00 ? 101 GLU A OE2  1  
ATOM   1610  H  H    . GLU A 1 101 ? -1.214  6.736   -4.742  1.00 0.00 ? 101 GLU A H    1  
ATOM   1611  H  HA   . GLU A 1 101 ? 0.716   5.668   -2.774  1.00 0.00 ? 101 GLU A HA   1  
ATOM   1612  H  HB2  . GLU A 1 101 ? 1.839   5.396   -4.944  1.00 0.00 ? 101 GLU A HB2  1  
ATOM   1613  H  HB3  . GLU A 1 101 ? 1.438   7.050   -5.403  1.00 0.00 ? 101 GLU A HB3  1  
ATOM   1614  H  HG2  . GLU A 1 101 ? 3.773   6.877   -4.723  1.00 0.00 ? 101 GLU A HG2  1  
ATOM   1615  H  HG3  . GLU A 1 101 ? 2.896   7.938   -3.638  1.00 0.00 ? 101 GLU A HG3  1  
ATOM   1616  N  N    . ALA A 1 102 ? 0.602   7.975   -1.687  1.00 0.00 ? 102 ALA A N    1  
ATOM   1617  C  CA   . ALA A 1 102 ? 0.350   9.249   -1.023  1.00 0.00 ? 102 ALA A CA   1  
ATOM   1618  C  C    . ALA A 1 102 ? 1.369   10.298  -1.463  1.00 0.00 ? 102 ALA A C    1  
ATOM   1619  O  O    . ALA A 1 102 ? 2.482   9.986   -1.892  1.00 0.00 ? 102 ALA A O    1  
ATOM   1620  C  CB   . ALA A 1 102 ? 0.398   9.104   0.498   1.00 0.00 ? 102 ALA A CB   1  
ATOM   1621  H  H    . ALA A 1 102 ? 1.240   7.320   -1.248  1.00 0.00 ? 102 ALA A H    1  
ATOM   1622  H  HA   . ALA A 1 102 ? -0.648  9.598   -1.294  1.00 0.00 ? 102 ALA A HA   1  
ATOM   1623  H  HB1  . ALA A 1 102 ? -0.476  8.570   0.856   1.00 0.00 ? 102 ALA A HB1  1  
ATOM   1624  H  HB2  . ALA A 1 102 ? 1.311   8.594   0.806   1.00 0.00 ? 102 ALA A HB2  1  
ATOM   1625  H  HB3  . ALA A 1 102 ? 0.367   10.094  0.948   1.00 0.00 ? 102 ALA A HB3  1  
ATOM   1626  N  N    . ILE A 1 103 ? 0.989   11.559  -1.275  1.00 0.00 ? 103 ILE A N    1  
ATOM   1627  C  CA   . ILE A 1 103 ? 1.818   12.727  -1.524  1.00 0.00 ? 103 ILE A CA   1  
ATOM   1628  C  C    . ILE A 1 103 ? 1.840   13.543  -0.228  1.00 0.00 ? 103 ILE A C    1  
ATOM   1629  O  O    . ILE A 1 103 ? 0.791   13.839  0.346   1.00 0.00 ? 103 ILE A O    1  
ATOM   1630  C  CB   . ILE A 1 103 ? 1.247   13.528  -2.721  1.00 0.00 ? 103 ILE A CB   1  
ATOM   1631  C  CG1  . ILE A 1 103 ? 1.208   12.693  -4.026  1.00 0.00 ? 103 ILE A CG1  1  
ATOM   1632  C  CG2  . ILE A 1 103 ? 2.062   14.812  -2.961  1.00 0.00 ? 103 ILE A CG2  1  
ATOM   1633  C  CD1  . ILE A 1 103 ? 0.322   13.317  -5.110  1.00 0.00 ? 103 ILE A CD1  1  
ATOM   1634  H  H    . ILE A 1 103 ? 0.014   11.744  -1.027  1.00 0.00 ? 103 ILE A H    1  
ATOM   1635  H  HA   . ILE A 1 103 ? 2.833   12.414  -1.761  1.00 0.00 ? 103 ILE A HA   1  
ATOM   1636  H  HB   . ILE A 1 103 ? 0.228   13.816  -2.466  1.00 0.00 ? 103 ILE A HB   1  
ATOM   1637  H  HG12 . ILE A 1 103 ? 2.220   12.567  -4.415  1.00 0.00 ? 103 ILE A HG12 1  
ATOM   1638  H  HG13 . ILE A 1 103 ? 0.810   11.700  -3.830  1.00 0.00 ? 103 ILE A HG13 1  
ATOM   1639  H  HG21 . ILE A 1 103 ? 3.089   14.558  -3.226  1.00 0.00 ? 103 ILE A HG21 1  
ATOM   1640  H  HG22 . ILE A 1 103 ? 1.618   15.398  -3.764  1.00 0.00 ? 103 ILE A HG22 1  
ATOM   1641  H  HG23 . ILE A 1 103 ? 2.069   15.434  -2.066  1.00 0.00 ? 103 ILE A HG23 1  
ATOM   1642  H  HD11 . ILE A 1 103 ? 0.753   14.247  -5.478  1.00 0.00 ? 103 ILE A HD11 1  
ATOM   1643  H  HD12 . ILE A 1 103 ? 0.230   12.624  -5.941  1.00 0.00 ? 103 ILE A HD12 1  
ATOM   1644  H  HD13 . ILE A 1 103 ? -0.674  13.502  -4.711  1.00 0.00 ? 103 ILE A HD13 1  
ATOM   1645  N  N    . ASP A 1 104 ? 3.050   13.930  0.192   1.00 0.00 ? 104 ASP A N    1  
ATOM   1646  C  CA   . ASP A 1 104 ? 3.324   14.839  1.311   1.00 0.00 ? 104 ASP A CA   1  
ATOM   1647  C  C    . ASP A 1 104 ? 2.557   14.478  2.596   1.00 0.00 ? 104 ASP A C    1  
ATOM   1648  O  O    . ASP A 1 104 ? 2.033   15.346  3.299   1.00 0.00 ? 104 ASP A O    1  
ATOM   1649  C  CB   . ASP A 1 104 ? 3.129   16.296  0.856   1.00 0.00 ? 104 ASP A CB   1  
ATOM   1650  C  CG   . ASP A 1 104 ? 3.612   17.318  1.904   1.00 0.00 ? 104 ASP A CG   1  
ATOM   1651  O  OD1  . ASP A 1 104 ? 4.727   17.160  2.452   1.00 0.00 ? 104 ASP A OD1  1  
ATOM   1652  O  OD2  . ASP A 1 104 ? 2.908   18.327  2.140   1.00 0.00 ? 104 ASP A OD2  1  
ATOM   1653  H  H    . ASP A 1 104 ? 3.851   13.632  -0.341  1.00 0.00 ? 104 ASP A H    1  
ATOM   1654  H  HA   . ASP A 1 104 ? 4.383   14.724  1.536   1.00 0.00 ? 104 ASP A HA   1  
ATOM   1655  H  HB2  . ASP A 1 104 ? 3.690   16.453  -0.067  1.00 0.00 ? 104 ASP A HB2  1  
ATOM   1656  H  HB3  . ASP A 1 104 ? 2.072   16.458  0.635   1.00 0.00 ? 104 ASP A HB3  1  
ATOM   1657  N  N    . VAL A 1 105 ? 2.451   13.176  2.887   1.00 0.00 ? 105 VAL A N    1  
ATOM   1658  C  CA   . VAL A 1 105 ? 1.709   12.666  4.043   1.00 0.00 ? 105 VAL A CA   1  
ATOM   1659  C  C    . VAL A 1 105 ? 2.659   12.358  5.214   1.00 0.00 ? 105 VAL A C    1  
ATOM   1660  O  O    . VAL A 1 105 ? 3.884   12.427  5.063   1.00 0.00 ? 105 VAL A O    1  
ATOM   1661  C  CB   . VAL A 1 105 ? 0.820   11.485  3.597   1.00 0.00 ? 105 VAL A CB   1  
ATOM   1662  C  CG1  . VAL A 1 105 ? 1.550   10.136  3.506   1.00 0.00 ? 105 VAL A CG1  1  
ATOM   1663  C  CG2  . VAL A 1 105 ? -0.441  11.392  4.457   1.00 0.00 ? 105 VAL A CG2  1  
ATOM   1664  H  H    . VAL A 1 105 ? 2.914   12.503  2.288   1.00 0.00 ? 105 VAL A H    1  
ATOM   1665  H  HA   . VAL A 1 105 ? 1.039   13.457  4.380   1.00 0.00 ? 105 VAL A HA   1  
ATOM   1666  H  HB   . VAL A 1 105 ? 0.450   11.700  2.602   1.00 0.00 ? 105 VAL A HB   1  
ATOM   1667  H  HG11 . VAL A 1 105 ? 0.859   9.357   3.188   1.00 0.00 ? 105 VAL A HG11 1  
ATOM   1668  H  HG12 . VAL A 1 105 ? 2.376   10.195  2.794   1.00 0.00 ? 105 VAL A HG12 1  
ATOM   1669  H  HG13 . VAL A 1 105 ? 1.944   9.852   4.474   1.00 0.00 ? 105 VAL A HG13 1  
ATOM   1670  H  HG21 . VAL A 1 105 ? -0.923  12.369  4.523   1.00 0.00 ? 105 VAL A HG21 1  
ATOM   1671  H  HG22 . VAL A 1 105 ? -1.134  10.709  3.972   1.00 0.00 ? 105 VAL A HG22 1  
ATOM   1672  H  HG23 . VAL A 1 105 ? -0.218  11.043  5.461   1.00 0.00 ? 105 VAL A HG23 1  
ATOM   1673  N  N    . ASP A 1 106 ? 2.103   12.044  6.390   1.00 0.00 ? 106 ASP A N    1  
ATOM   1674  C  CA   . ASP A 1 106 ? 2.894   11.689  7.567   1.00 0.00 ? 106 ASP A CA   1  
ATOM   1675  C  C    . ASP A 1 106 ? 3.445   10.272  7.426   1.00 0.00 ? 106 ASP A C    1  
ATOM   1676  O  O    . ASP A 1 106 ? 2.955   9.454   6.644   1.00 0.00 ? 106 ASP A O    1  
ATOM   1677  C  CB   . ASP A 1 106 ? 2.066   11.781  8.855   1.00 0.00 ? 106 ASP A CB   1  
ATOM   1678  C  CG   . ASP A 1 106 ? 2.904   11.732  10.147  1.00 0.00 ? 106 ASP A CG   1  
ATOM   1679  O  OD1  . ASP A 1 106 ? 4.104   12.088  10.125  1.00 0.00 ? 106 ASP A OD1  1  
ATOM   1680  O  OD2  . ASP A 1 106 ? 2.358   11.335  11.199  1.00 0.00 ? 106 ASP A OD2  1  
ATOM   1681  H  H    . ASP A 1 106 ? 1.103   11.914  6.448   1.00 0.00 ? 106 ASP A H    1  
ATOM   1682  H  HA   . ASP A 1 106 ? 3.726   12.390  7.644   1.00 0.00 ? 106 ASP A HA   1  
ATOM   1683  H  HB2  . ASP A 1 106 ? 1.497   12.709  8.847   1.00 0.00 ? 106 ASP A HB2  1  
ATOM   1684  H  HB3  . ASP A 1 106 ? 1.388   10.932  8.862   1.00 0.00 ? 106 ASP A HB3  1  
ATOM   1685  N  N    . ASP A 1 107 ? 4.446   9.979   8.241   1.00 0.00 ? 107 ASP A N    1  
ATOM   1686  C  CA   . ASP A 1 107 ? 5.262   8.774   8.147   1.00 0.00 ? 107 ASP A CA   1  
ATOM   1687  C  C    . ASP A 1 107 ? 4.416   7.513   8.292   1.00 0.00 ? 107 ASP A C    1  
ATOM   1688  O  O    . ASP A 1 107 ? 4.583   6.571   7.522   1.00 0.00 ? 107 ASP A O    1  
ATOM   1689  C  CB   . ASP A 1 107 ? 6.356   8.800   9.217   1.00 0.00 ? 107 ASP A CB   1  
ATOM   1690  C  CG   . ASP A 1 107 ? 7.201   7.516   9.177   1.00 0.00 ? 107 ASP A CG   1  
ATOM   1691  O  OD1  . ASP A 1 107 ? 8.043   7.374   8.262   1.00 0.00 ? 107 ASP A OD1  1  
ATOM   1692  O  OD2  . ASP A 1 107 ? 7.071   6.674   10.093  1.00 0.00 ? 107 ASP A OD2  1  
ATOM   1693  H  H    . ASP A 1 107 ? 4.643   10.667  8.963   1.00 0.00 ? 107 ASP A H    1  
ATOM   1694  H  HA   . ASP A 1 107 ? 5.743   8.750   7.168   1.00 0.00 ? 107 ASP A HA   1  
ATOM   1695  H  HB2  . ASP A 1 107 ? 6.998   9.668   9.050   1.00 0.00 ? 107 ASP A HB2  1  
ATOM   1696  H  HB3  . ASP A 1 107 ? 5.895   8.910   10.201  1.00 0.00 ? 107 ASP A HB3  1  
ATOM   1697  N  N    . ASP A 1 108 ? 3.471   7.504   9.236   1.00 0.00 ? 108 ASP A N    1  
ATOM   1698  C  CA   . ASP A 1 108 ? 2.679   6.316   9.538   1.00 0.00 ? 108 ASP A CA   1  
ATOM   1699  C  C    . ASP A 1 108 ? 1.718   6.013   8.383   1.00 0.00 ? 108 ASP A C    1  
ATOM   1700  O  O    . ASP A 1 108 ? 1.591   4.862   7.965   1.00 0.00 ? 108 ASP A O    1  
ATOM   1701  C  CB   . ASP A 1 108 ? 1.921   6.522   10.864  1.00 0.00 ? 108 ASP A CB   1  
ATOM   1702  C  CG   . ASP A 1 108 ? 1.792   5.256   11.731  1.00 0.00 ? 108 ASP A CG   1  
ATOM   1703  O  OD1  . ASP A 1 108 ? 2.618   4.323   11.621  1.00 0.00 ? 108 ASP A OD1  1  
ATOM   1704  O  OD2  . ASP A 1 108 ? 0.895   5.231   12.604  1.00 0.00 ? 108 ASP A OD2  1  
ATOM   1705  H  H    . ASP A 1 108 ? 3.350   8.314   9.824   1.00 0.00 ? 108 ASP A H    1  
ATOM   1706  H  HA   . ASP A 1 108 ? 3.370   5.479   9.644   1.00 0.00 ? 108 ASP A HA   1  
ATOM   1707  H  HB2  . ASP A 1 108 ? 2.443   7.271   11.463  1.00 0.00 ? 108 ASP A HB2  1  
ATOM   1708  H  HB3  . ASP A 1 108 ? 0.923   6.908   10.646  1.00 0.00 ? 108 ASP A HB3  1  
ATOM   1709  N  N    . THR A 1 109 ? 1.099   7.054   7.809   1.00 0.00 ? 109 THR A N    1  
ATOM   1710  C  CA   . THR A 1 109 ? 0.228   6.919   6.644   1.00 0.00 ? 109 THR A CA   1  
ATOM   1711  C  C    . THR A 1 109 ? 1.046   6.375   5.471   1.00 0.00 ? 109 THR A C    1  
ATOM   1712  O  O    . THR A 1 109 ? 0.639   5.402   4.831   1.00 0.00 ? 109 THR A O    1  
ATOM   1713  C  CB   . THR A 1 109 ? -0.465  8.268   6.340   1.00 0.00 ? 109 THR A CB   1  
ATOM   1714  O  OG1  . THR A 1 109 ? -1.203  8.690   7.478   1.00 0.00 ? 109 THR A OG1  1  
ATOM   1715  C  CG2  . THR A 1 109 ? -1.492  8.190   5.211   1.00 0.00 ? 109 THR A CG2  1  
ATOM   1716  H  H    . THR A 1 109 ? 1.334   7.990   8.109   1.00 0.00 ? 109 THR A H    1  
ATOM   1717  H  HA   . THR A 1 109 ? -0.541  6.183   6.865   1.00 0.00 ? 109 THR A HA   1  
ATOM   1718  H  HB   . THR A 1 109 ? 0.276   9.030   6.069   1.00 0.00 ? 109 THR A HB   1  
ATOM   1719  H  HG1  . THR A 1 109 ? -0.590  8.942   8.184   1.00 0.00 ? 109 THR A HG1  1  
ATOM   1720  H  HG21 . THR A 1 109 ? -0.999  7.988   4.257   1.00 0.00 ? 109 THR A HG21 1  
ATOM   1721  H  HG22 . THR A 1 109 ? -2.229  7.426   5.424   1.00 0.00 ? 109 THR A HG22 1  
ATOM   1722  H  HG23 . THR A 1 109 ? -2.025  9.135   5.142   1.00 0.00 ? 109 THR A HG23 1  
ATOM   1723  N  N    . GLN A 1 110 ? 2.227   6.945   5.221   1.00 0.00 ? 110 GLN A N    1  
ATOM   1724  C  CA   . GLN A 1 110 ? 3.063   6.517   4.118   1.00 0.00 ? 110 GLN A CA   1  
ATOM   1725  C  C    . GLN A 1 110 ? 3.539   5.071   4.305   1.00 0.00 ? 110 GLN A C    1  
ATOM   1726  O  O    . GLN A 1 110 ? 3.604   4.329   3.323   1.00 0.00 ? 110 GLN A O    1  
ATOM   1727  C  CB   . GLN A 1 110 ? 4.228   7.502   3.963   1.00 0.00 ? 110 GLN A CB   1  
ATOM   1728  C  CG   . GLN A 1 110 ? 5.094   7.219   2.734   1.00 0.00 ? 110 GLN A CG   1  
ATOM   1729  C  CD   . GLN A 1 110 ? 4.326   7.249   1.411   1.00 0.00 ? 110 GLN A CD   1  
ATOM   1730  O  OE1  . GLN A 1 110 ? 4.185   8.297   0.788   1.00 0.00 ? 110 GLN A OE1  1  
ATOM   1731  N  NE2  . GLN A 1 110 ? 3.830   6.108   0.956   1.00 0.00 ? 110 GLN A NE2  1  
ATOM   1732  H  H    . GLN A 1 110 ? 2.555   7.713   5.801   1.00 0.00 ? 110 GLN A H    1  
ATOM   1733  H  HA   . GLN A 1 110 ? 2.452   6.557   3.218   1.00 0.00 ? 110 GLN A HA   1  
ATOM   1734  H  HB2  . GLN A 1 110 ? 3.836   8.514   3.876   1.00 0.00 ? 110 GLN A HB2  1  
ATOM   1735  H  HB3  . GLN A 1 110 ? 4.858   7.459   4.852   1.00 0.00 ? 110 GLN A HB3  1  
ATOM   1736  H  HG2  . GLN A 1 110 ? 5.867   7.985   2.698   1.00 0.00 ? 110 GLN A HG2  1  
ATOM   1737  H  HG3  . GLN A 1 110 ? 5.571   6.248   2.854   1.00 0.00 ? 110 GLN A HG3  1  
ATOM   1738  H  HE21 . GLN A 1 110 ? 3.915   5.256   1.502   1.00 0.00 ? 110 GLN A HE21 1  
ATOM   1739  H  HE22 . GLN A 1 110 ? 3.404   6.085   0.021   1.00 0.00 ? 110 GLN A HE22 1  
ATOM   1740  N  N    . GLU A 1 111 ? 3.848   4.654   5.535   1.00 0.00 ? 111 GLU A N    1  
ATOM   1741  C  CA   . GLU A 1 111 ? 4.302   3.300   5.823   1.00 0.00 ? 111 GLU A CA   1  
ATOM   1742  C  C    . GLU A 1 111 ? 3.205   2.279   5.568   1.00 0.00 ? 111 GLU A C    1  
ATOM   1743  O  O    . GLU A 1 111 ? 3.497   1.236   4.991   1.00 0.00 ? 111 GLU A O    1  
ATOM   1744  C  CB   . GLU A 1 111 ? 4.795   3.181   7.274   1.00 0.00 ? 111 GLU A CB   1  
ATOM   1745  C  CG   . GLU A 1 111 ? 6.252   3.628   7.421   1.00 0.00 ? 111 GLU A CG   1  
ATOM   1746  C  CD   . GLU A 1 111 ? 7.239   2.720   6.659   1.00 0.00 ? 111 GLU A CD   1  
ATOM   1747  O  OE1  . GLU A 1 111 ? 7.171   1.477   6.798   1.00 0.00 ? 111 GLU A OE1  1  
ATOM   1748  O  OE2  . GLU A 1 111 ? 8.103   3.246   5.921   1.00 0.00 ? 111 GLU A OE2  1  
ATOM   1749  H  H    . GLU A 1 111 ? 3.829   5.318   6.305   1.00 0.00 ? 111 GLU A H    1  
ATOM   1750  H  HA   . GLU A 1 111 ? 5.114   3.059   5.140   1.00 0.00 ? 111 GLU A HA   1  
ATOM   1751  H  HB2  . GLU A 1 111 ? 4.162   3.780   7.929   1.00 0.00 ? 111 GLU A HB2  1  
ATOM   1752  H  HB3  . GLU A 1 111 ? 4.716   2.144   7.604   1.00 0.00 ? 111 GLU A HB3  1  
ATOM   1753  H  HG2  . GLU A 1 111 ? 6.335   4.653   7.058   1.00 0.00 ? 111 GLU A HG2  1  
ATOM   1754  H  HG3  . GLU A 1 111 ? 6.506   3.619   8.481   1.00 0.00 ? 111 GLU A HG3  1  
ATOM   1755  N  N    . ALA A 1 112 ? 1.954   2.564   5.939   1.00 0.00 ? 112 ALA A N    1  
ATOM   1756  C  CA   . ALA A 1 112 ? 0.845   1.656   5.659   1.00 0.00 ? 112 ALA A CA   1  
ATOM   1757  C  C    . ALA A 1 112 ? 0.706   1.421   4.153   1.00 0.00 ? 112 ALA A C    1  
ATOM   1758  O  O    . ALA A 1 112 ? 0.479   0.293   3.714   1.00 0.00 ? 112 ALA A O    1  
ATOM   1759  C  CB   . ALA A 1 112 ? -0.452  2.236   6.222   1.00 0.00 ? 112 ALA A CB   1  
ATOM   1760  H  H    . ALA A 1 112 ? 1.759   3.454   6.390   1.00 0.00 ? 112 ALA A H    1  
ATOM   1761  H  HA   . ALA A 1 112 ? 1.043   0.698   6.143   1.00 0.00 ? 112 ALA A HA   1  
ATOM   1762  H  HB1  . ALA A 1 112 ? -1.290  1.590   5.956   1.00 0.00 ? 112 ALA A HB1  1  
ATOM   1763  H  HB2  . ALA A 1 112 ? -0.380  2.296   7.302   1.00 0.00 ? 112 ALA A HB2  1  
ATOM   1764  H  HB3  . ALA A 1 112 ? -0.617  3.231   5.816   1.00 0.00 ? 112 ALA A HB3  1  
ATOM   1765  N  N    . ILE A 1 113 ? 0.856   2.485   3.363   1.00 0.00 ? 113 ILE A N    1  
ATOM   1766  C  CA   . ILE A 1 113 ? 0.735   2.427   1.913   1.00 0.00 ? 113 ILE A CA   1  
ATOM   1767  C  C    . ILE A 1 113 ? 1.901   1.616   1.345   1.00 0.00 ? 113 ILE A C    1  
ATOM   1768  O  O    . ILE A 1 113 ? 1.674   0.673   0.591   1.00 0.00 ? 113 ILE A O    1  
ATOM   1769  C  CB   . ILE A 1 113 ? 0.678   3.864   1.361   1.00 0.00 ? 113 ILE A CB   1  
ATOM   1770  C  CG1  . ILE A 1 113 ? -0.603  4.566   1.859   1.00 0.00 ? 113 ILE A CG1  1  
ATOM   1771  C  CG2  . ILE A 1 113 ? 0.749   3.894   -0.173  1.00 0.00 ? 113 ILE A CG2  1  
ATOM   1772  C  CD1  . ILE A 1 113 ? -0.485  6.084   1.808   1.00 0.00 ? 113 ILE A CD1  1  
ATOM   1773  H  H    . ILE A 1 113 ? 1.037   3.386   3.790   1.00 0.00 ? 113 ILE A H    1  
ATOM   1774  H  HA   . ILE A 1 113 ? -0.194  1.919   1.655   1.00 0.00 ? 113 ILE A HA   1  
ATOM   1775  H  HB   . ILE A 1 113 ? 1.541   4.404   1.743   1.00 0.00 ? 113 ILE A HB   1  
ATOM   1776  H  HG12 . ILE A 1 113 ? -1.460  4.246   1.268   1.00 0.00 ? 113 ILE A HG12 1  
ATOM   1777  H  HG13 . ILE A 1 113 ? -0.797  4.305   2.895   1.00 0.00 ? 113 ILE A HG13 1  
ATOM   1778  H  HG21 . ILE A 1 113 ? 1.718   3.514   -0.500  1.00 0.00 ? 113 ILE A HG21 1  
ATOM   1779  H  HG22 . ILE A 1 113 ? -0.045  3.284   -0.604  1.00 0.00 ? 113 ILE A HG22 1  
ATOM   1780  H  HG23 . ILE A 1 113 ? 0.655   4.915   -0.535  1.00 0.00 ? 113 ILE A HG23 1  
ATOM   1781  H  HD11 . ILE A 1 113 ? 0.428   6.407   2.312   1.00 0.00 ? 113 ILE A HD11 1  
ATOM   1782  H  HD12 . ILE A 1 113 ? -0.471  6.402   0.769   1.00 0.00 ? 113 ILE A HD12 1  
ATOM   1783  H  HD13 . ILE A 1 113 ? -1.339  6.526   2.321   1.00 0.00 ? 113 ILE A HD13 1  
ATOM   1784  N  N    . ALA A 1 114 ? 3.138   1.948   1.725   1.00 0.00 ? 114 ALA A N    1  
ATOM   1785  C  CA   . ALA A 1 114 ? 4.323   1.236   1.267   1.00 0.00 ? 114 ALA A CA   1  
ATOM   1786  C  C    . ALA A 1 114 ? 4.233   -0.250  1.628   1.00 0.00 ? 114 ALA A C    1  
ATOM   1787  O  O    . ALA A 1 114 ? 4.508   -1.107  0.793   1.00 0.00 ? 114 ALA A O    1  
ATOM   1788  C  CB   . ALA A 1 114 ? 5.575   1.872   1.881   1.00 0.00 ? 114 ALA A CB   1  
ATOM   1789  H  H    . ALA A 1 114 ? 3.263   2.712   2.363   1.00 0.00 ? 114 ALA A H    1  
ATOM   1790  H  HA   . ALA A 1 114 ? 4.384   1.325   0.182   1.00 0.00 ? 114 ALA A HA   1  
ATOM   1791  H  HB1  . ALA A 1 114 ? 6.459   1.353   1.511   1.00 0.00 ? 114 ALA A HB1  1  
ATOM   1792  H  HB2  . ALA A 1 114 ? 5.637   2.923   1.597   1.00 0.00 ? 114 ALA A HB2  1  
ATOM   1793  H  HB3  . ALA A 1 114 ? 5.544   1.791   2.968   1.00 0.00 ? 114 ALA A HB3  1  
ATOM   1794  N  N    . ASP A 1 115 ? 3.793   -0.558  2.849   1.00 0.00 ? 115 ASP A N    1  
ATOM   1795  C  CA   . ASP A 1 115 ? 3.649   -1.929  3.328   1.00 0.00 ? 115 ASP A CA   1  
ATOM   1796  C  C    . ASP A 1 115 ? 2.607   -2.697  2.516   1.00 0.00 ? 115 ASP A C    1  
ATOM   1797  O  O    . ASP A 1 115 ? 2.820   -3.859  2.166   1.00 0.00 ? 115 ASP A O    1  
ATOM   1798  C  CB   . ASP A 1 115 ? 3.280   -1.940  4.812   1.00 0.00 ? 115 ASP A CB   1  
ATOM   1799  C  CG   . ASP A 1 115 ? 3.368   -3.361  5.376   1.00 0.00 ? 115 ASP A CG   1  
ATOM   1800  O  OD1  . ASP A 1 115 ? 4.503   -3.793  5.686   1.00 0.00 ? 115 ASP A OD1  1  
ATOM   1801  O  OD2  . ASP A 1 115 ? 2.315   -4.008  5.556   1.00 0.00 ? 115 ASP A OD2  1  
ATOM   1802  H  H    . ASP A 1 115 ? 3.570   0.200   3.493   1.00 0.00 ? 115 ASP A H    1  
ATOM   1803  H  HA   . ASP A 1 115 ? 4.605   -2.431  3.221   1.00 0.00 ? 115 ASP A HA   1  
ATOM   1804  H  HB2  . ASP A 1 115 ? 3.976   -1.304  5.360   1.00 0.00 ? 115 ASP A HB2  1  
ATOM   1805  H  HB3  . ASP A 1 115 ? 2.275   -1.536  4.948   1.00 0.00 ? 115 ASP A HB3  1  
ATOM   1806  N  N    . TRP A 1 116 ? 1.508   -2.032  2.150   1.00 0.00 ? 116 TRP A N    1  
ATOM   1807  C  CA   . TRP A 1 116 ? 0.494   -2.618  1.288   1.00 0.00 ? 116 TRP A CA   1  
ATOM   1808  C  C    . TRP A 1 116 ? 1.046   -2.851  -0.122  1.00 0.00 ? 116 TRP A C    1  
ATOM   1809  O  O    . TRP A 1 116 ? 0.764   -3.883  -0.728  1.00 0.00 ? 116 TRP A O    1  
ATOM   1810  C  CB   . TRP A 1 116 ? -0.764  -1.741  1.241   1.00 0.00 ? 116 TRP A CB   1  
ATOM   1811  C  CG   . TRP A 1 116 ? -1.865  -2.371  0.450   1.00 0.00 ? 116 TRP A CG   1  
ATOM   1812  C  CD1  . TRP A 1 116 ? -2.257  -2.012  -0.794  1.00 0.00 ? 116 TRP A CD1  1  
ATOM   1813  C  CD2  . TRP A 1 116 ? -2.638  -3.564  0.782   1.00 0.00 ? 116 TRP A CD2  1  
ATOM   1814  N  NE1  . TRP A 1 116 ? -3.196  -2.906  -1.263  1.00 0.00 ? 116 TRP A NE1  1  
ATOM   1815  C  CE2  . TRP A 1 116 ? -3.473  -3.882  -0.329  1.00 0.00 ? 116 TRP A CE2  1  
ATOM   1816  C  CE3  . TRP A 1 116 ? -2.691  -4.431  1.896   1.00 0.00 ? 116 TRP A CE3  1  
ATOM   1817  C  CZ2  . TRP A 1 116 ? -4.322  -4.996  -0.324  1.00 0.00 ? 116 TRP A CZ2  1  
ATOM   1818  C  CZ3  . TRP A 1 116 ? -3.540  -5.554  1.904   1.00 0.00 ? 116 TRP A CZ3  1  
ATOM   1819  C  CH2  . TRP A 1 116 ? -4.356  -5.839  0.797   1.00 0.00 ? 116 TRP A CH2  1  
ATOM   1820  H  H    . TRP A 1 116 ? 1.405   -1.059  2.419   1.00 0.00 ? 116 TRP A H    1  
ATOM   1821  H  HA   . TRP A 1 116 ? 0.217   -3.586  1.707   1.00 0.00 ? 116 TRP A HA   1  
ATOM   1822  H  HB2  . TRP A 1 116 ? -1.121  -1.579  2.258   1.00 0.00 ? 116 TRP A HB2  1  
ATOM   1823  H  HB3  . TRP A 1 116 ? -0.521  -0.771  0.808   1.00 0.00 ? 116 TRP A HB3  1  
ATOM   1824  H  HD1  . TRP A 1 116 ? -1.846  -1.189  -1.363  1.00 0.00 ? 116 TRP A HD1  1  
ATOM   1825  H  HE1  . TRP A 1 116 ? -3.544  -2.898  -2.225  1.00 0.00 ? 116 TRP A HE1  1  
ATOM   1826  H  HE3  . TRP A 1 116 ? -2.063  -4.236  2.752   1.00 0.00 ? 116 TRP A HE3  1  
ATOM   1827  H  HZ2  . TRP A 1 116 ? -4.952  -5.195  -1.171  1.00 0.00 ? 116 TRP A HZ2  1  
ATOM   1828  H  HZ3  . TRP A 1 116 ? -3.553  -6.213  2.759   1.00 0.00 ? 116 TRP A HZ3  1  
ATOM   1829  H  HH2  . TRP A 1 116 ? -5.006  -6.703  0.808   1.00 0.00 ? 116 TRP A HH2  1  
ATOM   1830  N  N    . LEU A 1 117 ? 1.855   -1.929  -0.649  1.00 0.00 ? 117 LEU A N    1  
ATOM   1831  C  CA   . LEU A 1 117 ? 2.486   -2.092  -1.954  1.00 0.00 ? 117 LEU A CA   1  
ATOM   1832  C  C    . LEU A 1 117 ? 3.496   -3.245  -1.930  1.00 0.00 ? 117 LEU A C    1  
ATOM   1833  O  O    . LEU A 1 117 ? 3.633   -3.942  -2.936  1.00 0.00 ? 117 LEU A O    1  
ATOM   1834  C  CB   . LEU A 1 117 ? 3.133   -0.774  -2.418  1.00 0.00 ? 117 LEU A CB   1  
ATOM   1835  C  CG   . LEU A 1 117 ? 2.114   0.336   -2.759  1.00 0.00 ? 117 LEU A CG   1  
ATOM   1836  C  CD1  . LEU A 1 117 ? 2.840   1.672   -2.943  1.00 0.00 ? 117 LEU A CD1  1  
ATOM   1837  C  CD2  . LEU A 1 117 ? 1.301   0.021   -4.022  1.00 0.00 ? 117 LEU A CD2  1  
ATOM   1838  H  H    . LEU A 1 117 ? 2.053   -1.086  -0.120  1.00 0.00 ? 117 LEU A H    1  
ATOM   1839  H  HA   . LEU A 1 117 ? 1.710   -2.363  -2.668  1.00 0.00 ? 117 LEU A HA   1  
ATOM   1840  H  HB2  . LEU A 1 117 ? 3.806   -0.422  -1.637  1.00 0.00 ? 117 LEU A HB2  1  
ATOM   1841  H  HB3  . LEU A 1 117 ? 3.738   -0.976  -3.304  1.00 0.00 ? 117 LEU A HB3  1  
ATOM   1842  H  HG   . LEU A 1 117 ? 1.411   0.452   -1.937  1.00 0.00 ? 117 LEU A HG   1  
ATOM   1843  H  HD11 . LEU A 1 117 ? 3.365   1.933   -2.023  1.00 0.00 ? 117 LEU A HD11 1  
ATOM   1844  H  HD12 . LEU A 1 117 ? 3.557   1.606   -3.761  1.00 0.00 ? 117 LEU A HD12 1  
ATOM   1845  H  HD13 . LEU A 1 117 ? 2.117   2.460   -3.158  1.00 0.00 ? 117 LEU A HD13 1  
ATOM   1846  H  HD21 . LEU A 1 117 ? 0.643   0.860   -4.256  1.00 0.00 ? 117 LEU A HD21 1  
ATOM   1847  H  HD22 . LEU A 1 117 ? 1.965   -0.158  -4.868  1.00 0.00 ? 117 LEU A HD22 1  
ATOM   1848  H  HD23 . LEU A 1 117 ? 0.676   -0.855  -3.860  1.00 0.00 ? 117 LEU A HD23 1  
ATOM   1849  N  N    . TYR A 1 118 ? 4.162   -3.507  -0.799  1.00 0.00 ? 118 TYR A N    1  
ATOM   1850  C  CA   . TYR A 1 118 ? 4.987   -4.703  -0.655  1.00 0.00 ? 118 TYR A CA   1  
ATOM   1851  C  C    . TYR A 1 118 ? 4.100   -5.947  -0.698  1.00 0.00 ? 118 TYR A C    1  
ATOM   1852  O  O    . TYR A 1 118 ? 4.382   -6.849  -1.476  1.00 0.00 ? 118 TYR A O    1  
ATOM   1853  C  CB   . TYR A 1 118 ? 5.836   -4.672  0.627   1.00 0.00 ? 118 TYR A CB   1  
ATOM   1854  C  CG   . TYR A 1 118 ? 6.735   -3.458  0.813   1.00 0.00 ? 118 TYR A CG   1  
ATOM   1855  C  CD1  . TYR A 1 118 ? 7.361   -2.831  -0.286  1.00 0.00 ? 118 TYR A CD1  1  
ATOM   1856  C  CD2  . TYR A 1 118 ? 6.932   -2.941  2.108   1.00 0.00 ? 118 TYR A CD2  1  
ATOM   1857  C  CE1  . TYR A 1 118 ? 8.137   -1.675  -0.096  1.00 0.00 ? 118 TYR A CE1  1  
ATOM   1858  C  CE2  . TYR A 1 118 ? 7.675   -1.765  2.302   1.00 0.00 ? 118 TYR A CE2  1  
ATOM   1859  C  CZ   . TYR A 1 118 ? 8.287   -1.127  1.198   1.00 0.00 ? 118 TYR A CZ   1  
ATOM   1860  O  OH   . TYR A 1 118 ? 9.027   0.006   1.367   1.00 0.00 ? 118 TYR A OH   1  
ATOM   1861  H  H    . TYR A 1 118 ? 4.086   -2.870  -0.013  1.00 0.00 ? 118 TYR A H    1  
ATOM   1862  H  HA   . TYR A 1 118 ? 5.662   -4.756  -1.509  1.00 0.00 ? 118 TYR A HA   1  
ATOM   1863  H  HB2  . TYR A 1 118 ? 5.169   -4.744  1.485   1.00 0.00 ? 118 TYR A HB2  1  
ATOM   1864  H  HB3  . TYR A 1 118 ? 6.464   -5.562  0.640   1.00 0.00 ? 118 TYR A HB3  1  
ATOM   1865  H  HD1  . TYR A 1 118 ? 7.241   -3.220  -1.286  1.00 0.00 ? 118 TYR A HD1  1  
ATOM   1866  H  HD2  . TYR A 1 118 ? 6.488   -3.435  2.961   1.00 0.00 ? 118 TYR A HD2  1  
ATOM   1867  H  HE1  . TYR A 1 118 ? 8.603   -1.199  -0.947  1.00 0.00 ? 118 TYR A HE1  1  
ATOM   1868  H  HE2  . TYR A 1 118 ? 7.760   -1.350  3.295   1.00 0.00 ? 118 TYR A HE2  1  
ATOM   1869  H  HH   . TYR A 1 118 ? 9.085   0.297   2.290   1.00 0.00 ? 118 TYR A HH   1  
ATOM   1870  N  N    . TRP A 1 119 ? 3.002   -5.997  0.060   1.00 0.00 ? 119 TRP A N    1  
ATOM   1871  C  CA   . TRP A 1 119 ? 2.059   -7.118  0.026   1.00 0.00 ? 119 TRP A CA   1  
ATOM   1872  C  C    . TRP A 1 119 ? 1.520   -7.367  -1.393  1.00 0.00 ? 119 TRP A C    1  
ATOM   1873  O  O    . TRP A 1 119 ? 1.430   -8.518  -1.835  1.00 0.00 ? 119 TRP A O    1  
ATOM   1874  C  CB   . TRP A 1 119 ? 0.941   -6.839  1.042   1.00 0.00 ? 119 TRP A CB   1  
ATOM   1875  C  CG   . TRP A 1 119 ? -0.328  -7.613  0.873   1.00 0.00 ? 119 TRP A CG   1  
ATOM   1876  C  CD1  . TRP A 1 119 ? -1.302  -7.309  -0.013  1.00 0.00 ? 119 TRP A CD1  1  
ATOM   1877  C  CD2  . TRP A 1 119 ? -0.814  -8.780  1.606   1.00 0.00 ? 119 TRP A CD2  1  
ATOM   1878  N  NE1  . TRP A 1 119 ? -2.334  -8.209  0.104   1.00 0.00 ? 119 TRP A NE1  1  
ATOM   1879  C  CE2  . TRP A 1 119 ? -2.114  -9.103  1.119   1.00 0.00 ? 119 TRP A CE2  1  
ATOM   1880  C  CE3  . TRP A 1 119 ? -0.305  -9.594  2.639   1.00 0.00 ? 119 TRP A CE3  1  
ATOM   1881  C  CZ2  . TRP A 1 119 ? -2.882  -10.147 1.643   1.00 0.00 ? 119 TRP A CZ2  1  
ATOM   1882  C  CZ3  . TRP A 1 119 ? -1.085  -10.621 3.208   1.00 0.00 ? 119 TRP A CZ3  1  
ATOM   1883  C  CH2  . TRP A 1 119 ? -2.381  -10.885 2.725   1.00 0.00 ? 119 TRP A CH2  1  
ATOM   1884  H  H    . TRP A 1 119 ? 2.805   -5.224  0.689   1.00 0.00 ? 119 TRP A H    1  
ATOM   1885  H  HA   . TRP A 1 119 ? 2.580   -8.024  0.334   1.00 0.00 ? 119 TRP A HA   1  
ATOM   1886  H  HB2  . TRP A 1 119 ? 1.335   -7.026  2.042   1.00 0.00 ? 119 TRP A HB2  1  
ATOM   1887  H  HB3  . TRP A 1 119 ? 0.676   -5.785  0.997   1.00 0.00 ? 119 TRP A HB3  1  
ATOM   1888  H  HD1  . TRP A 1 119 ? -1.284  -6.478  -0.707  1.00 0.00 ? 119 TRP A HD1  1  
ATOM   1889  H  HE1  . TRP A 1 119 ? -3.149  -8.199  -0.499  1.00 0.00 ? 119 TRP A HE1  1  
ATOM   1890  H  HE3  . TRP A 1 119 ? 0.684   -9.397  3.027   1.00 0.00 ? 119 TRP A HE3  1  
ATOM   1891  H  HZ2  . TRP A 1 119 ? -3.856  -10.350 1.229   1.00 0.00 ? 119 TRP A HZ2  1  
ATOM   1892  H  HZ3  . TRP A 1 119 ? -0.684  -11.202 4.028   1.00 0.00 ? 119 TRP A HZ3  1  
ATOM   1893  H  HH2  . TRP A 1 119 ? -2.984  -11.662 3.175   1.00 0.00 ? 119 TRP A HH2  1  
ATOM   1894  N  N    . LEU A 1 120 ? 1.209   -6.299  -2.131  1.00 0.00 ? 120 LEU A N    1  
ATOM   1895  C  CA   . LEU A 1 120 ? 0.765   -6.360  -3.517  1.00 0.00 ? 120 LEU A CA   1  
ATOM   1896  C  C    . LEU A 1 120 ? 1.829   -7.035  -4.380  1.00 0.00 ? 120 LEU A C    1  
ATOM   1897  O  O    . LEU A 1 120 ? 1.525   -8.007  -5.071  1.00 0.00 ? 120 LEU A O    1  
ATOM   1898  C  CB   . LEU A 1 120 ? 0.459   -4.925  -3.979  1.00 0.00 ? 120 LEU A CB   1  
ATOM   1899  C  CG   . LEU A 1 120 ? 0.093   -4.742  -5.463  1.00 0.00 ? 120 LEU A CG   1  
ATOM   1900  C  CD1  . LEU A 1 120 ? -1.241  -5.402  -5.819  1.00 0.00 ? 120 LEU A CD1  1  
ATOM   1901  C  CD2  . LEU A 1 120 ? 0.019   -3.239  -5.747  1.00 0.00 ? 120 LEU A CD2  1  
ATOM   1902  H  H    . LEU A 1 120 ? 1.245   -5.371  -1.708  1.00 0.00 ? 120 LEU A H    1  
ATOM   1903  H  HA   . LEU A 1 120 ? -0.144  -6.954  -3.561  1.00 0.00 ? 120 LEU A HA   1  
ATOM   1904  H  HB2  . LEU A 1 120 ? -0.351  -4.528  -3.364  1.00 0.00 ? 120 LEU A HB2  1  
ATOM   1905  H  HB3  . LEU A 1 120 ? 1.339   -4.317  -3.789  1.00 0.00 ? 120 LEU A HB3  1  
ATOM   1906  H  HG   . LEU A 1 120 ? 0.875   -5.165  -6.095  1.00 0.00 ? 120 LEU A HG   1  
ATOM   1907  H  HD11 . LEU A 1 120 ? -1.124  -6.484  -5.808  1.00 0.00 ? 120 LEU A HD11 1  
ATOM   1908  H  HD12 . LEU A 1 120 ? -2.016  -5.100  -5.110  1.00 0.00 ? 120 LEU A HD12 1  
ATOM   1909  H  HD13 . LEU A 1 120 ? -1.547  -5.111  -6.824  1.00 0.00 ? 120 LEU A HD13 1  
ATOM   1910  H  HD21 . LEU A 1 120 ? -0.316  -3.062  -6.769  1.00 0.00 ? 120 LEU A HD21 1  
ATOM   1911  H  HD22 . LEU A 1 120 ? -0.669  -2.760  -5.051  1.00 0.00 ? 120 LEU A HD22 1  
ATOM   1912  H  HD23 . LEU A 1 120 ? 1.006   -2.793  -5.626  1.00 0.00 ? 120 LEU A HD23 1  
ATOM   1913  N  N    . ALA A 1 121 ? 3.079   -6.565  -4.303  1.00 0.00 ? 121 ALA A N    1  
ATOM   1914  C  CA   . ALA A 1 121 ? 4.190   -7.151  -5.044  1.00 0.00 ? 121 ALA A CA   1  
ATOM   1915  C  C    . ALA A 1 121 ? 4.483   -8.590  -4.598  1.00 0.00 ? 121 ALA A C    1  
ATOM   1916  O  O    . ALA A 1 121 ? 4.883   -9.416  -5.419  1.00 0.00 ? 121 ALA A O    1  
ATOM   1917  C  CB   . ALA A 1 121 ? 5.433   -6.269  -4.876  1.00 0.00 ? 121 ALA A CB   1  
ATOM   1918  H  H    . ALA A 1 121 ? 3.275   -5.762  -3.709  1.00 0.00 ? 121 ALA A H    1  
ATOM   1919  H  HA   . ALA A 1 121 ? 3.921   -7.172  -6.101  1.00 0.00 ? 121 ALA A HA   1  
ATOM   1920  H  HB1  . ALA A 1 121 ? 6.266   -6.702  -5.431  1.00 0.00 ? 121 ALA A HB1  1  
ATOM   1921  H  HB2  . ALA A 1 121 ? 5.232   -5.269  -5.260  1.00 0.00 ? 121 ALA A HB2  1  
ATOM   1922  H  HB3  . ALA A 1 121 ? 5.703   -6.202  -3.823  1.00 0.00 ? 121 ALA A HB3  1  
ATOM   1923  N  N    . ARG A 1 122 ? 4.277   -8.908  -3.314  1.00 0.00 ? 122 ARG A N    1  
ATOM   1924  C  CA   . ARG A 1 122 ? 4.517   -10.235 -2.748  1.00 0.00 ? 122 ARG A CA   1  
ATOM   1925  C  C    . ARG A 1 122 ? 3.596   -11.269 -3.391  1.00 0.00 ? 122 ARG A C    1  
ATOM   1926  O  O    . ARG A 1 122 ? 4.008   -12.420 -3.534  1.00 0.00 ? 122 ARG A O    1  
ATOM   1927  C  CB   . ARG A 1 122 ? 4.322   -10.198 -1.215  1.00 0.00 ? 122 ARG A CB   1  
ATOM   1928  C  CG   . ARG A 1 122 ? 4.925   -11.411 -0.487  1.00 0.00 ? 122 ARG A CG   1  
ATOM   1929  C  CD   . ARG A 1 122 ? 6.442   -11.279 -0.279  1.00 0.00 ? 122 ARG A CD   1  
ATOM   1930  N  NE   . ARG A 1 122 ? 6.769   -10.797 1.075   1.00 0.00 ? 122 ARG A NE   1  
ATOM   1931  C  CZ   . ARG A 1 122 ? 7.942   -10.983 1.692   1.00 0.00 ? 122 ARG A CZ   1  
ATOM   1932  N  NH1  . ARG A 1 122 ? 9.025   -11.369 1.024   1.00 0.00 ? 122 ARG A NH1  1  
ATOM   1933  N  NH2  . ARG A 1 122 ? 8.023   -10.796 2.999   1.00 0.00 ? 122 ARG A NH2  1  
ATOM   1934  H  H    . ARG A 1 122 ? 3.970   -8.171  -2.684  1.00 0.00 ? 122 ARG A H    1  
ATOM   1935  H  HA   . ARG A 1 122 ? 5.545   -10.511 -2.978  1.00 0.00 ? 122 ARG A HA   1  
ATOM   1936  H  HB2  . ARG A 1 122 ? 4.775   -9.296  -0.802  1.00 0.00 ? 122 ARG A HB2  1  
ATOM   1937  H  HB3  . ARG A 1 122 ? 3.255   -10.166 -0.997  1.00 0.00 ? 122 ARG A HB3  1  
ATOM   1938  H  HG2  . ARG A 1 122 ? 4.435   -11.522 0.482   1.00 0.00 ? 122 ARG A HG2  1  
ATOM   1939  H  HG3  . ARG A 1 122 ? 4.720   -12.320 -1.052  1.00 0.00 ? 122 ARG A HG3  1  
ATOM   1940  H  HD2  . ARG A 1 122 ? 6.886   -12.266 -0.403  1.00 0.00 ? 122 ARG A HD2  1  
ATOM   1941  H  HD3  . ARG A 1 122 ? 6.869   -10.605 -1.022  1.00 0.00 ? 122 ARG A HD3  1  
ATOM   1942  H  HE   . ARG A 1 122 ? 5.996   -10.432 1.618   1.00 0.00 ? 122 ARG A HE   1  
ATOM   1943  H  HH11 . ARG A 1 122 ? 9.020   -11.415 0.004   1.00 0.00 ? 122 ARG A HH11 1  
ATOM   1944  H  HH12 . ARG A 1 122 ? 9.893   -11.561 1.502   1.00 0.00 ? 122 ARG A HH12 1  
ATOM   1945  H  HH21 . ARG A 1 122 ? 7.196   -10.535 3.547   1.00 0.00 ? 122 ARG A HH21 1  
ATOM   1946  H  HH22 . ARG A 1 122 ? 8.874   -11.041 3.516   1.00 0.00 ? 122 ARG A HH22 1  
ATOM   1947  N  N    . GLY A 1 123 ? 2.386   -10.873 -3.797  1.00 0.00 ? 123 GLY A N    1  
ATOM   1948  C  CA   . GLY A 1 123 ? 1.416   -11.774 -4.404  1.00 0.00 ? 123 GLY A CA   1  
ATOM   1949  C  C    . GLY A 1 123 ? 0.335   -12.227 -3.420  1.00 0.00 ? 123 GLY A C    1  
ATOM   1950  O  O    . GLY A 1 123 ? -0.228  -13.304 -3.625  1.00 0.00 ? 123 GLY A O    1  
ATOM   1951  H  H    . GLY A 1 123 ? 2.145   -9.893  -3.755  1.00 0.00 ? 123 GLY A H    1  
ATOM   1952  H  HA2  . GLY A 1 123 ? 0.931   -11.244 -5.224  1.00 0.00 ? 123 GLY A HA2  1  
ATOM   1953  H  HA3  . GLY A 1 123 ? 1.918   -12.650 -4.817  1.00 0.00 ? 123 GLY A HA3  1  
ATOM   1954  N  N    . TYR A 1 124 ? 0.031   -11.406 -2.398  1.00 0.00 ? 124 TYR A N    1  
ATOM   1955  C  CA   . TYR A 1 124 ? -1.021  -11.579 -1.392  1.00 0.00 ? 124 TYR A CA   1  
ATOM   1956  C  C    . TYR A 1 124 ? -0.900  -12.864 -0.549  1.00 0.00 ? 124 TYR A C    1  
ATOM   1957  O  O    . TYR A 1 124 ? -0.090  -13.752 -0.824  1.00 0.00 ? 124 TYR A O    1  
ATOM   1958  C  CB   . TYR A 1 124 ? -2.392  -11.471 -2.084  1.00 0.00 ? 124 TYR A CB   1  
ATOM   1959  C  CG   . TYR A 1 124 ? -2.938  -10.079 -2.340  1.00 0.00 ? 124 TYR A CG   1  
ATOM   1960  C  CD1  . TYR A 1 124 ? -2.218  -9.169  -3.136  1.00 0.00 ? 124 TYR A CD1  1  
ATOM   1961  C  CD2  . TYR A 1 124 ? -4.205  -9.712  -1.839  1.00 0.00 ? 124 TYR A CD2  1  
ATOM   1962  C  CE1  . TYR A 1 124 ? -2.771  -7.919  -3.446  1.00 0.00 ? 124 TYR A CE1  1  
ATOM   1963  C  CE2  . TYR A 1 124 ? -4.755  -8.452  -2.137  1.00 0.00 ? 124 TYR A CE2  1  
ATOM   1964  C  CZ   . TYR A 1 124 ? -4.048  -7.556  -2.972  1.00 0.00 ? 124 TYR A CZ   1  
ATOM   1965  O  OH   . TYR A 1 124 ? -4.564  -6.359  -3.357  1.00 0.00 ? 124 TYR A OH   1  
ATOM   1966  H  H    . TYR A 1 124 ? 0.491   -10.514 -2.361  1.00 0.00 ? 124 TYR A H    1  
ATOM   1967  H  HA   . TYR A 1 124 ? -0.939  -10.743 -0.698  1.00 0.00 ? 124 TYR A HA   1  
ATOM   1968  H  HB2  . TYR A 1 124 ? -2.316  -11.964 -3.048  1.00 0.00 ? 124 TYR A HB2  1  
ATOM   1969  H  HB3  . TYR A 1 124 ? -3.125  -12.019 -1.500  1.00 0.00 ? 124 TYR A HB3  1  
ATOM   1970  H  HD1  . TYR A 1 124 ? -1.249  -9.426  -3.535  1.00 0.00 ? 124 TYR A HD1  1  
ATOM   1971  H  HD2  . TYR A 1 124 ? -4.776  -10.407 -1.237  1.00 0.00 ? 124 TYR A HD2  1  
ATOM   1972  H  HE1  . TYR A 1 124 ? -2.222  -7.239  -4.068  1.00 0.00 ? 124 TYR A HE1  1  
ATOM   1973  H  HE2  . TYR A 1 124 ? -5.729  -8.197  -1.746  1.00 0.00 ? 124 TYR A HE2  1  
ATOM   1974  H  HH   . TYR A 1 124 ? -5.458  -6.168  -2.992  1.00 0.00 ? 124 TYR A HH   1  
ATOM   1975  N  N    . LYS A 1 125 ? -1.730  -12.957 0.500   1.00 0.00 ? 125 LYS A N    1  
ATOM   1976  C  CA   . LYS A 1 125 ? -1.915  -14.154 1.348   1.00 0.00 ? 125 LYS A CA   1  
ATOM   1977  C  C    . LYS A 1 125 ? -3.400  -14.391 1.655   1.00 0.00 ? 125 LYS A C    1  
ATOM   1978  O  O    . LYS A 1 125 ? -3.735  -15.129 2.585   1.00 0.00 ? 125 LYS A O    1  
ATOM   1979  C  CB   . LYS A 1 125 ? -1.097  -14.093 2.658   1.00 0.00 ? 125 LYS A CB   1  
ATOM   1980  C  CG   . LYS A 1 125 ? 0.383   -13.738 2.487   1.00 0.00 ? 125 LYS A CG   1  
ATOM   1981  C  CD   . LYS A 1 125 ? 1.216   -14.930 1.994   1.00 0.00 ? 125 LYS A CD   1  
ATOM   1982  C  CE   . LYS A 1 125 ? 2.675   -14.508 1.778   1.00 0.00 ? 125 LYS A CE   1  
ATOM   1983  N  NZ   . LYS A 1 125 ? 3.530   -15.649 1.362   1.00 0.00 ? 125 LYS A NZ   1  
ATOM   1984  H  H    . LYS A 1 125 ? -2.298  -12.142 0.712   1.00 0.00 ? 125 LYS A H    1  
ATOM   1985  H  HA   . LYS A 1 125 ? -1.574  -15.021 0.778   1.00 0.00 ? 125 LYS A HA   1  
ATOM   1986  H  HB2  . LYS A 1 125 ? -1.548  -13.366 3.327   1.00 0.00 ? 125 LYS A HB2  1  
ATOM   1987  H  HB3  . LYS A 1 125 ? -1.164  -15.057 3.165   1.00 0.00 ? 125 LYS A HB3  1  
ATOM   1988  H  HG2  . LYS A 1 125 ? 0.463   -12.898 1.798   1.00 0.00 ? 125 LYS A HG2  1  
ATOM   1989  H  HG3  . LYS A 1 125 ? 0.769   -13.419 3.455   1.00 0.00 ? 125 LYS A HG3  1  
ATOM   1990  H  HD2  . LYS A 1 125 ? 1.174   -15.724 2.743   1.00 0.00 ? 125 LYS A HD2  1  
ATOM   1991  H  HD3  . LYS A 1 125 ? 0.805   -15.310 1.059   1.00 0.00 ? 125 LYS A HD3  1  
ATOM   1992  H  HE2  . LYS A 1 125 ? 2.704   -13.729 1.014   1.00 0.00 ? 125 LYS A HE2  1  
ATOM   1993  H  HE3  . LYS A 1 125 ? 3.060   -14.086 2.710   1.00 0.00 ? 125 LYS A HE3  1  
ATOM   1994  H  HZ1  . LYS A 1 125 ? 3.531   -16.378 2.061   1.00 0.00 ? 125 LYS A HZ1  1  
ATOM   1995  H  HZ2  . LYS A 1 125 ? 3.210   -16.049 0.492   1.00 0.00 ? 125 LYS A HZ2  1  
ATOM   1996  H  HZ3  . LYS A 1 125 ? 4.487   -15.354 1.234   1.00 0.00 ? 125 LYS A HZ3  1  
ATOM   1997  N  N    . PHE A 1 126 ? -4.290  -13.719 0.928   1.00 0.00 ? 126 PHE A N    1  
ATOM   1998  C  CA   . PHE A 1 126 ? -5.727  -13.986 0.924   1.00 0.00 ? 126 PHE A CA   1  
ATOM   1999  C  C    . PHE A 1 126 ? -6.259  -13.763 -0.490  1.00 0.00 ? 126 PHE A C    1  
ATOM   2000  O  O    . PHE A 1 126 ? -7.252  -14.421 -0.863  1.00 0.00 ? 126 PHE A O    1  
ATOM   2001  C  CB   . PHE A 1 126 ? -6.490  -13.184 1.993   1.00 0.00 ? 126 PHE A CB   1  
ATOM   2002  C  CG   . PHE A 1 126 ? -6.887  -11.744 1.690   1.00 0.00 ? 126 PHE A CG   1  
ATOM   2003  C  CD1  . PHE A 1 126 ? -8.025  -11.473 0.904   1.00 0.00 ? 126 PHE A CD1  1  
ATOM   2004  C  CD2  . PHE A 1 126 ? -6.193  -10.669 2.280   1.00 0.00 ? 126 PHE A CD2  1  
ATOM   2005  C  CE1  . PHE A 1 126 ? -8.439  -10.147 0.681   1.00 0.00 ? 126 PHE A CE1  1  
ATOM   2006  C  CE2  . PHE A 1 126 ? -6.605  -9.342  2.058   1.00 0.00 ? 126 PHE A CE2  1  
ATOM   2007  C  CZ   . PHE A 1 126 ? -7.725  -9.079  1.252   1.00 0.00 ? 126 PHE A CZ   1  
ATOM   2008  O  OXT  . PHE A 1 126 ? -5.645  -12.976 -1.240  1.00 0.00 ? 126 PHE A OXT  1  
ATOM   2009  H  H    . PHE A 1 126 ? -3.942  -13.099 0.210   1.00 0.00 ? 126 PHE A H    1  
ATOM   2010  H  HA   . PHE A 1 126 ? -5.857  -15.043 1.165   1.00 0.00 ? 126 PHE A HA   1  
ATOM   2011  H  HB2  . PHE A 1 126 ? -7.412  -13.729 2.201   1.00 0.00 ? 126 PHE A HB2  1  
ATOM   2012  H  HB3  . PHE A 1 126 ? -5.900  -13.212 2.906   1.00 0.00 ? 126 PHE A HB3  1  
ATOM   2013  H  HD1  . PHE A 1 126 ? -8.592  -12.286 0.474   1.00 0.00 ? 126 PHE A HD1  1  
ATOM   2014  H  HD2  . PHE A 1 126 ? -5.339  -10.855 2.912   1.00 0.00 ? 126 PHE A HD2  1  
ATOM   2015  H  HE1  . PHE A 1 126 ? -9.314  -9.950  0.077   1.00 0.00 ? 126 PHE A HE1  1  
ATOM   2016  H  HE2  . PHE A 1 126 ? -6.062  -8.525  2.514   1.00 0.00 ? 126 PHE A HE2  1  
ATOM   2017  H  HZ   . PHE A 1 126 ? -8.046  -8.060  1.082   1.00 0.00 ? 126 PHE A HZ   1  
HETATM 2018  CA CA   . CA  B 2 .   ? -7.228  6.199   11.542  1.00 0.00 ? 127 CA  A CA   1  
HETATM 2019  CA CA   . CA  C 2 .   ? -10.267 -18.037 11.957  1.00 0.00 ? 128 CA  A CA   1  
ATOM   2020  N  N    . MET A 1 1   ? 7.634   -18.003 -3.443  1.00 0.00 ? 1   MET A N    2  
ATOM   2021  C  CA   . MET A 1 1   ? 8.663   -17.470 -2.516  1.00 0.00 ? 1   MET A CA   2  
ATOM   2022  C  C    . MET A 1 1   ? 8.876   -15.976 -2.779  1.00 0.00 ? 1   MET A C    2  
ATOM   2023  O  O    . MET A 1 1   ? 8.898   -15.540 -3.935  1.00 0.00 ? 1   MET A O    2  
ATOM   2024  C  CB   . MET A 1 1   ? 10.007  -18.222 -2.623  1.00 0.00 ? 1   MET A CB   2  
ATOM   2025  C  CG   . MET A 1 1   ? 9.945   -19.665 -2.101  1.00 0.00 ? 1   MET A CG   2  
ATOM   2026  S  SD   . MET A 1 1   ? 11.542  -20.530 -2.136  1.00 0.00 ? 1   MET A SD   2  
ATOM   2027  C  CE   . MET A 1 1   ? 11.036  -22.130 -1.446  1.00 0.00 ? 1   MET A CE   2  
ATOM   2028  H  H1   . MET A 1 1   ? 7.452   -18.977 -3.262  1.00 0.00 ? 1   MET A H1   2  
ATOM   2029  H  H2   . MET A 1 1   ? 6.775   -17.488 -3.333  1.00 0.00 ? 1   MET A H2   2  
ATOM   2030  H  H3   . MET A 1 1   ? 7.944   -17.893 -4.396  1.00 0.00 ? 1   MET A H3   2  
ATOM   2031  H  HA   . MET A 1 1   ? 8.293   -17.582 -1.495  1.00 0.00 ? 1   MET A HA   2  
ATOM   2032  H  HB2  . MET A 1 1   ? 10.348  -18.230 -3.661  1.00 0.00 ? 1   MET A HB2  2  
ATOM   2033  H  HB3  . MET A 1 1   ? 10.752  -17.688 -2.031  1.00 0.00 ? 1   MET A HB3  2  
ATOM   2034  H  HG2  . MET A 1 1   ? 9.588   -19.650 -1.070  1.00 0.00 ? 1   MET A HG2  2  
ATOM   2035  H  HG3  . MET A 1 1   ? 9.238   -20.237 -2.702  1.00 0.00 ? 1   MET A HG3  2  
ATOM   2036  H  HE1  . MET A 1 1   ? 11.900  -22.794 -1.393  1.00 0.00 ? 1   MET A HE1  2  
ATOM   2037  H  HE2  . MET A 1 1   ? 10.631  -21.988 -0.444  1.00 0.00 ? 1   MET A HE2  2  
ATOM   2038  H  HE3  . MET A 1 1   ? 10.276  -22.583 -2.083  1.00 0.00 ? 1   MET A HE3  2  
ATOM   2039  N  N    . ALA A 1 2   ? 9.045   -15.183 -1.715  1.00 0.00 ? 2   ALA A N    2  
ATOM   2040  C  CA   . ALA A 1 2   ? 9.347   -13.756 -1.771  1.00 0.00 ? 2   ALA A CA   2  
ATOM   2041  C  C    . ALA A 1 2   ? 10.198  -13.389 -0.549  1.00 0.00 ? 2   ALA A C    2  
ATOM   2042  O  O    . ALA A 1 2   ? 10.128  -14.071 0.478   1.00 0.00 ? 2   ALA A O    2  
ATOM   2043  C  CB   . ALA A 1 2   ? 8.038   -12.952 -1.775  1.00 0.00 ? 2   ALA A CB   2  
ATOM   2044  H  H    . ALA A 1 2   ? 9.067   -15.587 -0.786  1.00 0.00 ? 2   ALA A H    2  
ATOM   2045  H  HA   . ALA A 1 2   ? 9.905   -13.532 -2.681  1.00 0.00 ? 2   ALA A HA   2  
ATOM   2046  H  HB1  . ALA A 1 2   ? 7.470   -13.157 -0.866  1.00 0.00 ? 2   ALA A HB1  2  
ATOM   2047  H  HB2  . ALA A 1 2   ? 8.259   -11.886 -1.825  1.00 0.00 ? 2   ALA A HB2  2  
ATOM   2048  H  HB3  . ALA A 1 2   ? 7.437   -13.224 -2.644  1.00 0.00 ? 2   ALA A HB3  2  
ATOM   2049  N  N    . SER A 1 3   ? 10.955  -12.293 -0.651  1.00 0.00 ? 3   SER A N    2  
ATOM   2050  C  CA   . SER A 1 3   ? 11.919  -11.854 0.365   1.00 0.00 ? 3   SER A CA   2  
ATOM   2051  C  C    . SER A 1 3   ? 11.854  -10.332 0.570   1.00 0.00 ? 3   SER A C    2  
ATOM   2052  O  O    . SER A 1 3   ? 12.836  -9.697  0.957   1.00 0.00 ? 3   SER A O    2  
ATOM   2053  C  CB   . SER A 1 3   ? 13.328  -12.328 -0.037  1.00 0.00 ? 3   SER A CB   2  
ATOM   2054  O  OG   . SER A 1 3   ? 13.356  -13.719 -0.335  1.00 0.00 ? 3   SER A OG   2  
ATOM   2055  H  H    . SER A 1 3   ? 10.981  -11.804 -1.536  1.00 0.00 ? 3   SER A H    2  
ATOM   2056  H  HA   . SER A 1 3   ? 11.654  -12.304 1.321   1.00 0.00 ? 3   SER A HA   2  
ATOM   2057  H  HB2  . SER A 1 3   ? 13.656  -11.771 -0.917  1.00 0.00 ? 3   SER A HB2  2  
ATOM   2058  H  HB3  . SER A 1 3   ? 14.022  -12.123 0.781   1.00 0.00 ? 3   SER A HB3  2  
ATOM   2059  H  HG   . SER A 1 3   ? 14.269  -13.954 -0.576  1.00 0.00 ? 3   SER A HG   2  
ATOM   2060  N  N    . VAL A 1 4   ? 10.695  -9.732  0.278   1.00 0.00 ? 4   VAL A N    2  
ATOM   2061  C  CA   . VAL A 1 4   ? 10.478  -8.290  0.308   1.00 0.00 ? 4   VAL A CA   2  
ATOM   2062  C  C    . VAL A 1 4   ? 10.430  -7.728  1.742   1.00 0.00 ? 4   VAL A C    2  
ATOM   2063  O  O    . VAL A 1 4   ? 10.510  -6.513  1.923   1.00 0.00 ? 4   VAL A O    2  
ATOM   2064  C  CB   . VAL A 1 4   ? 9.178   -7.978  -0.462  1.00 0.00 ? 4   VAL A CB   2  
ATOM   2065  C  CG1  . VAL A 1 4   ? 9.207   -8.502  -1.908  1.00 0.00 ? 4   VAL A CG1  2  
ATOM   2066  C  CG2  . VAL A 1 4   ? 7.928   -8.496  0.251   1.00 0.00 ? 4   VAL A CG2  2  
ATOM   2067  H  H    . VAL A 1 4   ? 9.913   -10.295 -0.020  1.00 0.00 ? 4   VAL A H    2  
ATOM   2068  H  HA   . VAL A 1 4   ? 11.308  -7.808  -0.212  1.00 0.00 ? 4   VAL A HA   2  
ATOM   2069  H  HB   . VAL A 1 4   ? 9.065   -6.909  -0.525  1.00 0.00 ? 4   VAL A HB   2  
ATOM   2070  H  HG11 . VAL A 1 4   ? 8.331   -8.136  -2.446  1.00 0.00 ? 4   VAL A HG11 2  
ATOM   2071  H  HG12 . VAL A 1 4   ? 10.100  -8.134  -2.414  1.00 0.00 ? 4   VAL A HG12 2  
ATOM   2072  H  HG13 . VAL A 1 4   ? 9.202   -9.590  -1.936  1.00 0.00 ? 4   VAL A HG13 2  
ATOM   2073  H  HG21 . VAL A 1 4   ? 7.834   -8.044  1.239   1.00 0.00 ? 4   VAL A HG21 2  
ATOM   2074  H  HG22 . VAL A 1 4   ? 7.061   -8.192  -0.327  1.00 0.00 ? 4   VAL A HG22 2  
ATOM   2075  H  HG23 . VAL A 1 4   ? 7.961   -9.580  0.351   1.00 0.00 ? 4   VAL A HG23 2  
ATOM   2076  N  N    . GLU A 1 5   ? 10.248  -8.596  2.747   1.00 0.00 ? 5   GLU A N    2  
ATOM   2077  C  CA   . GLU A 1 5   ? 10.037  -8.221  4.143   1.00 0.00 ? 5   GLU A CA   2  
ATOM   2078  C  C    . GLU A 1 5   ? 11.171  -7.321  4.658   1.00 0.00 ? 5   GLU A C    2  
ATOM   2079  O  O    . GLU A 1 5   ? 12.353  -7.573  4.402   1.00 0.00 ? 5   GLU A O    2  
ATOM   2080  C  CB   . GLU A 1 5   ? 9.837   -9.482  5.009   1.00 0.00 ? 5   GLU A CB   2  
ATOM   2081  C  CG   . GLU A 1 5   ? 11.027  -10.458 5.005   1.00 0.00 ? 5   GLU A CG   2  
ATOM   2082  C  CD   . GLU A 1 5   ? 10.707  -11.762 5.756   1.00 0.00 ? 5   GLU A CD   2  
ATOM   2083  O  OE1  . GLU A 1 5   ? 9.975   -12.618 5.209   1.00 0.00 ? 5   GLU A OE1  2  
ATOM   2084  O  OE2  . GLU A 1 5   ? 11.231  -11.962 6.874   1.00 0.00 ? 5   GLU A OE2  2  
ATOM   2085  H  H    . GLU A 1 5   ? 10.222  -9.580  2.531   1.00 0.00 ? 5   GLU A H    2  
ATOM   2086  H  HA   . GLU A 1 5   ? 9.107   -7.651  4.183   1.00 0.00 ? 5   GLU A HA   2  
ATOM   2087  H  HB2  . GLU A 1 5   ? 9.638   -9.176  6.037   1.00 0.00 ? 5   GLU A HB2  2  
ATOM   2088  H  HB3  . GLU A 1 5   ? 8.954   -10.006 4.639   1.00 0.00 ? 5   GLU A HB3  2  
ATOM   2089  H  HG2  . GLU A 1 5   ? 11.298  -10.705 3.976   1.00 0.00 ? 5   GLU A HG2  2  
ATOM   2090  H  HG3  . GLU A 1 5   ? 11.887  -9.975  5.471   1.00 0.00 ? 5   GLU A HG3  2  
ATOM   2091  N  N    . ARG A 1 6   ? 10.803  -6.257  5.382   1.00 0.00 ? 6   ARG A N    2  
ATOM   2092  C  CA   . ARG A 1 6   ? 11.765  -5.294  5.921   1.00 0.00 ? 6   ARG A CA   2  
ATOM   2093  C  C    . ARG A 1 6   ? 12.667  -5.944  6.974   1.00 0.00 ? 6   ARG A C    2  
ATOM   2094  O  O    . ARG A 1 6   ? 13.864  -5.660  7.014   1.00 0.00 ? 6   ARG A O    2  
ATOM   2095  C  CB   . ARG A 1 6   ? 11.024  -4.049  6.458   1.00 0.00 ? 6   ARG A CB   2  
ATOM   2096  C  CG   . ARG A 1 6   ? 10.214  -4.305  7.744   1.00 0.00 ? 6   ARG A CG   2  
ATOM   2097  C  CD   . ARG A 1 6   ? 9.140   -3.247  8.022   1.00 0.00 ? 6   ARG A CD   2  
ATOM   2098  N  NE   . ARG A 1 6   ? 9.698   -1.888  8.135   1.00 0.00 ? 6   ARG A NE   2  
ATOM   2099  C  CZ   . ARG A 1 6   ? 9.184   -0.765  7.609   1.00 0.00 ? 6   ARG A CZ   2  
ATOM   2100  N  NH1  . ARG A 1 6   ? 8.167   -0.788  6.752   1.00 0.00 ? 6   ARG A NH1  2  
ATOM   2101  N  NH2  . ARG A 1 6   ? 9.699   0.407   7.960   1.00 0.00 ? 6   ARG A NH2  2  
ATOM   2102  H  H    . ARG A 1 6   ? 9.819   -6.077  5.524   1.00 0.00 ? 6   ARG A H    2  
ATOM   2103  H  HA   . ARG A 1 6   ? 12.403  -4.970  5.096   1.00 0.00 ? 6   ARG A HA   2  
ATOM   2104  H  HB2  . ARG A 1 6   ? 11.756  -3.266  6.659   1.00 0.00 ? 6   ARG A HB2  2  
ATOM   2105  H  HB3  . ARG A 1 6   ? 10.354  -3.683  5.678   1.00 0.00 ? 6   ARG A HB3  2  
ATOM   2106  H  HG2  . ARG A 1 6   ? 9.709   -5.265  7.658   1.00 0.00 ? 6   ARG A HG2  2  
ATOM   2107  H  HG3  . ARG A 1 6   ? 10.894  -4.352  8.596   1.00 0.00 ? 6   ARG A HG3  2  
ATOM   2108  H  HD2  . ARG A 1 6   ? 8.394   -3.295  7.232   1.00 0.00 ? 6   ARG A HD2  2  
ATOM   2109  H  HD3  . ARG A 1 6   ? 8.650   -3.496  8.967   1.00 0.00 ? 6   ARG A HD3  2  
ATOM   2110  H  HE   . ARG A 1 6   ? 10.494  -1.802  8.755   1.00 0.00 ? 6   ARG A HE   2  
ATOM   2111  H  HH11 . ARG A 1 6   ? 7.797   -1.658  6.381   1.00 0.00 ? 6   ARG A HH11 2  
ATOM   2112  H  HH12 . ARG A 1 6   ? 7.748   0.091   6.423   1.00 0.00 ? 6   ARG A HH12 2  
ATOM   2113  H  HH21 . ARG A 1 6   ? 10.473  0.473   8.606   1.00 0.00 ? 6   ARG A HH21 2  
ATOM   2114  H  HH22 . ARG A 1 6   ? 9.291   1.290   7.629   1.00 0.00 ? 6   ARG A HH22 2  
ATOM   2115  N  N    . ASP A 1 7   ? 12.094  -6.808  7.816   1.00 0.00 ? 7   ASP A N    2  
ATOM   2116  C  CA   . ASP A 1 7   ? 12.724  -7.492  8.942   1.00 0.00 ? 7   ASP A CA   2  
ATOM   2117  C  C    . ASP A 1 7   ? 11.698  -8.504  9.460   1.00 0.00 ? 7   ASP A C    2  
ATOM   2118  O  O    . ASP A 1 7   ? 10.494  -8.293  9.280   1.00 0.00 ? 7   ASP A O    2  
ATOM   2119  C  CB   . ASP A 1 7   ? 13.049  -6.482  10.057  1.00 0.00 ? 7   ASP A CB   2  
ATOM   2120  C  CG   . ASP A 1 7   ? 13.769  -7.144  11.239  1.00 0.00 ? 7   ASP A CG   2  
ATOM   2121  O  OD1  . ASP A 1 7   ? 15.017  -7.238  11.216  1.00 0.00 ? 7   ASP A OD1  2  
ATOM   2122  O  OD2  . ASP A 1 7   ? 13.083  -7.536  12.208  1.00 0.00 ? 7   ASP A OD2  2  
ATOM   2123  H  H    . ASP A 1 7   ? 11.112  -7.023  7.706   1.00 0.00 ? 7   ASP A H    2  
ATOM   2124  H  HA   . ASP A 1 7   ? 13.634  -7.998  8.619   1.00 0.00 ? 7   ASP A HA   2  
ATOM   2125  H  HB2  . ASP A 1 7   ? 13.682  -5.687  9.661   1.00 0.00 ? 7   ASP A HB2  2  
ATOM   2126  H  HB3  . ASP A 1 7   ? 12.123  -6.020  10.405  1.00 0.00 ? 7   ASP A HB3  2  
ATOM   2127  N  N    . GLU A 1 8   ? 12.138  -9.568  10.132  1.00 0.00 ? 8   GLU A N    2  
ATOM   2128  C  CA   . GLU A 1 8   ? 11.273  -10.582 10.737  1.00 0.00 ? 8   GLU A CA   2  
ATOM   2129  C  C    . GLU A 1 8   ? 10.248  -9.977  11.712  1.00 0.00 ? 8   GLU A C    2  
ATOM   2130  O  O    . GLU A 1 8   ? 9.171   -10.544 11.904  1.00 0.00 ? 8   GLU A O    2  
ATOM   2131  C  CB   . GLU A 1 8   ? 12.107  -11.652 11.467  1.00 0.00 ? 8   GLU A CB   2  
ATOM   2132  C  CG   . GLU A 1 8   ? 13.126  -12.398 10.587  1.00 0.00 ? 8   GLU A CG   2  
ATOM   2133  C  CD   . GLU A 1 8   ? 14.521  -11.741 10.587  1.00 0.00 ? 8   GLU A CD   2  
ATOM   2134  O  OE1  . GLU A 1 8   ? 14.711  -10.693 9.930   1.00 0.00 ? 8   GLU A OE1  2  
ATOM   2135  O  OE2  . GLU A 1 8   ? 15.447  -12.282 11.236  1.00 0.00 ? 8   GLU A OE2  2  
ATOM   2136  H  H    . GLU A 1 8   ? 13.142  -9.726  10.193  1.00 0.00 ? 8   GLU A H    2  
ATOM   2137  H  HA   . GLU A 1 8   ? 10.718  -11.070 9.934   1.00 0.00 ? 8   GLU A HA   2  
ATOM   2138  H  HB2  . GLU A 1 8   ? 12.623  -11.200 12.316  1.00 0.00 ? 8   GLU A HB2  2  
ATOM   2139  H  HB3  . GLU A 1 8   ? 11.412  -12.393 11.863  1.00 0.00 ? 8   GLU A HB3  2  
ATOM   2140  H  HG2  . GLU A 1 8   ? 13.219  -13.415 10.973  1.00 0.00 ? 8   GLU A HG2  2  
ATOM   2141  H  HG3  . GLU A 1 8   ? 12.745  -12.478 9.567   1.00 0.00 ? 8   GLU A HG3  2  
ATOM   2142  N  N    . THR A 1 9   ? 10.541  -8.807  12.290  1.00 0.00 ? 9   THR A N    2  
ATOM   2143  C  CA   . THR A 1 9   ? 9.607   -8.022  13.089  1.00 0.00 ? 9   THR A CA   2  
ATOM   2144  C  C    . THR A 1 9   ? 8.279   -7.812  12.351  1.00 0.00 ? 9   THR A C    2  
ATOM   2145  O  O    . THR A 1 9   ? 7.216   -7.873  12.974  1.00 0.00 ? 9   THR A O    2  
ATOM   2146  C  CB   . THR A 1 9   ? 10.275  -6.678  13.433  1.00 0.00 ? 9   THR A CB   2  
ATOM   2147  O  OG1  . THR A 1 9   ? 11.480  -6.897  14.137  1.00 0.00 ? 9   THR A OG1  2  
ATOM   2148  C  CG2  . THR A 1 9   ? 9.388   -5.733  14.252  1.00 0.00 ? 9   THR A CG2  2  
ATOM   2149  H  H    . THR A 1 9   ? 11.465  -8.391  12.116  1.00 0.00 ? 9   THR A H    2  
ATOM   2150  H  HA   . THR A 1 9   ? 9.402   -8.555  14.014  1.00 0.00 ? 9   THR A HA   2  
ATOM   2151  H  HB   . THR A 1 9   ? 10.523  -6.178  12.500  1.00 0.00 ? 9   THR A HB   2  
ATOM   2152  H  HG1  . THR A 1 9   ? 12.137  -7.174  13.454  1.00 0.00 ? 9   THR A HG1  2  
ATOM   2153  H  HG21 . THR A 1 9   ? 9.005   -6.242  15.137  1.00 0.00 ? 9   THR A HG21 2  
ATOM   2154  H  HG22 . THR A 1 9   ? 9.961   -4.855  14.552  1.00 0.00 ? 9   THR A HG22 2  
ATOM   2155  H  HG23 . THR A 1 9   ? 8.552   -5.393  13.637  1.00 0.00 ? 9   THR A HG23 2  
ATOM   2156  N  N    . ARG A 1 10  ? 8.303   -7.582  11.032  1.00 0.00 ? 10  ARG A N    2  
ATOM   2157  C  CA   . ARG A 1 10  ? 7.072   -7.340  10.293  1.00 0.00 ? 10  ARG A CA   2  
ATOM   2158  C  C    . ARG A 1 10  ? 6.245   -8.615  10.238  1.00 0.00 ? 10  ARG A C    2  
ATOM   2159  O  O    . ARG A 1 10  ? 5.047   -8.553  10.493  1.00 0.00 ? 10  ARG A O    2  
ATOM   2160  C  CB   . ARG A 1 10  ? 7.388   -6.794  8.891   1.00 0.00 ? 10  ARG A CB   2  
ATOM   2161  C  CG   . ARG A 1 10  ? 6.133   -6.357  8.118   1.00 0.00 ? 10  ARG A CG   2  
ATOM   2162  C  CD   . ARG A 1 10  ? 5.469   -5.117  8.732   1.00 0.00 ? 10  ARG A CD   2  
ATOM   2163  N  NE   . ARG A 1 10  ? 4.142   -4.885  8.151   1.00 0.00 ? 10  ARG A NE   2  
ATOM   2164  C  CZ   . ARG A 1 10  ? 2.955   -4.895  8.762   1.00 0.00 ? 10  ARG A CZ   2  
ATOM   2165  N  NH1  . ARG A 1 10  ? 2.853   -5.205  10.056  1.00 0.00 ? 10  ARG A NH1  2  
ATOM   2166  N  NH2  . ARG A 1 10  ? 1.874   -4.584  8.059   1.00 0.00 ? 10  ARG A NH2  2  
ATOM   2167  H  H    . ARG A 1 10  ? 9.177   -7.639  10.519  1.00 0.00 ? 10  ARG A H    2  
ATOM   2168  H  HA   . ARG A 1 10  ? 6.504   -6.602  10.858  1.00 0.00 ? 10  ARG A HA   2  
ATOM   2169  H  HB2  . ARG A 1 10  ? 8.048   -5.935  8.994   1.00 0.00 ? 10  ARG A HB2  2  
ATOM   2170  H  HB3  . ARG A 1 10  ? 7.907   -7.561  8.312   1.00 0.00 ? 10  ARG A HB3  2  
ATOM   2171  H  HG2  . ARG A 1 10  ? 6.413   -6.128  7.089   1.00 0.00 ? 10  ARG A HG2  2  
ATOM   2172  H  HG3  . ARG A 1 10  ? 5.421   -7.180  8.096   1.00 0.00 ? 10  ARG A HG3  2  
ATOM   2173  H  HD2  . ARG A 1 10  ? 5.391   -5.216  9.811   1.00 0.00 ? 10  ARG A HD2  2  
ATOM   2174  H  HD3  . ARG A 1 10  ? 6.094   -4.250  8.512   1.00 0.00 ? 10  ARG A HD3  2  
ATOM   2175  H  HE   . ARG A 1 10  ? 4.164   -4.620  7.162   1.00 0.00 ? 10  ARG A HE   2  
ATOM   2176  H  HH11 . ARG A 1 10  ? 3.675   -5.474  10.575  1.00 0.00 ? 10  ARG A HH11 2  
ATOM   2177  H  HH12 . ARG A 1 10  ? 1.976   -5.167  10.553  1.00 0.00 ? 10  ARG A HH12 2  
ATOM   2178  H  HH21 . ARG A 1 10  ? 1.975   -4.319  7.067   1.00 0.00 ? 10  ARG A HH21 2  
ATOM   2179  H  HH22 . ARG A 1 10  ? 0.945   -4.585  8.445   1.00 0.00 ? 10  ARG A HH22 2  
ATOM   2180  N  N    . GLU A 1 11  ? 6.871   -9.758  9.963   1.00 0.00 ? 11  GLU A N    2  
ATOM   2181  C  CA   . GLU A 1 11  ? 6.191   -11.048 9.933   1.00 0.00 ? 11  GLU A CA   2  
ATOM   2182  C  C    . GLU A 1 11  ? 5.565   -11.335 11.299  1.00 0.00 ? 11  GLU A C    2  
ATOM   2183  O  O    . GLU A 1 11  ? 4.412   -11.763 11.369  1.00 0.00 ? 11  GLU A O    2  
ATOM   2184  C  CB   . GLU A 1 11  ? 7.169   -12.172 9.551   1.00 0.00 ? 11  GLU A CB   2  
ATOM   2185  C  CG   . GLU A 1 11  ? 7.897   -11.950 8.219   1.00 0.00 ? 11  GLU A CG   2  
ATOM   2186  C  CD   . GLU A 1 11  ? 6.921   -11.798 7.045   1.00 0.00 ? 11  GLU A CD   2  
ATOM   2187  O  OE1  . GLU A 1 11  ? 6.369   -12.815 6.568   1.00 0.00 ? 11  GLU A OE1  2  
ATOM   2188  O  OE2  . GLU A 1 11  ? 6.693   -10.659 6.584   1.00 0.00 ? 11  GLU A OE2  2  
ATOM   2189  H  H    . GLU A 1 11  ? 7.861   -9.743  9.774   1.00 0.00 ? 11  GLU A H    2  
ATOM   2190  H  HA   . GLU A 1 11  ? 5.392   -11.003 9.192   1.00 0.00 ? 11  GLU A HA   2  
ATOM   2191  H  HB2  . GLU A 1 11  ? 7.919   -12.282 10.334  1.00 0.00 ? 11  GLU A HB2  2  
ATOM   2192  H  HB3  . GLU A 1 11  ? 6.613   -13.109 9.492   1.00 0.00 ? 11  GLU A HB3  2  
ATOM   2193  H  HG2  . GLU A 1 11  ? 8.532   -11.065 8.294   1.00 0.00 ? 11  GLU A HG2  2  
ATOM   2194  H  HG3  . GLU A 1 11  ? 8.547   -12.808 8.039   1.00 0.00 ? 11  GLU A HG3  2  
ATOM   2195  N  N    . HIS A 1 12  ? 6.302   -11.049 12.380  1.00 0.00 ? 12  HIS A N    2  
ATOM   2196  C  CA   . HIS A 1 12  ? 5.801   -11.204 13.737  1.00 0.00 ? 12  HIS A CA   2  
ATOM   2197  C  C    . HIS A 1 12  ? 4.556   -10.343 13.931  1.00 0.00 ? 12  HIS A C    2  
ATOM   2198  O  O    . HIS A 1 12  ? 3.536   -10.874 14.360  1.00 0.00 ? 12  HIS A O    2  
ATOM   2199  C  CB   . HIS A 1 12  ? 6.894   -10.860 14.760  1.00 0.00 ? 12  HIS A CB   2  
ATOM   2200  C  CG   . HIS A 1 12  ? 6.530   -11.103 16.211  1.00 0.00 ? 12  HIS A CG   2  
ATOM   2201  N  ND1  . HIS A 1 12  ? 5.286   -11.012 16.810  1.00 0.00 ? 12  HIS A ND1  2  
ATOM   2202  C  CD2  . HIS A 1 12  ? 7.425   -11.395 17.208  1.00 0.00 ? 12  HIS A CD2  2  
ATOM   2203  C  CE1  . HIS A 1 12  ? 5.437   -11.239 18.124  1.00 0.00 ? 12  HIS A CE1  2  
ATOM   2204  N  NE2  . HIS A 1 12  ? 6.726   -11.484 18.420  1.00 0.00 ? 12  HIS A NE2  2  
ATOM   2205  H  H    . HIS A 1 12  ? 7.256   -10.718 12.256  1.00 0.00 ? 12  HIS A H    2  
ATOM   2206  H  HA   . HIS A 1 12  ? 5.520   -12.249 13.876  1.00 0.00 ? 12  HIS A HA   2  
ATOM   2207  H  HB2  . HIS A 1 12  ? 7.778   -11.457 14.530  1.00 0.00 ? 12  HIS A HB2  2  
ATOM   2208  H  HB3  . HIS A 1 12  ? 7.171   -9.812  14.656  1.00 0.00 ? 12  HIS A HB3  2  
ATOM   2209  H  HD1  . HIS A 1 12  ? 4.385   -10.809 16.364  1.00 0.00 ? 12  HIS A HD1  2  
ATOM   2210  H  HD2  . HIS A 1 12  ? 8.494   -11.513 17.079  1.00 0.00 ? 12  HIS A HD2  2  
ATOM   2211  H  HE1  . HIS A 1 12  ? 4.625   -11.220 18.842  1.00 0.00 ? 12  HIS A HE1  2  
ATOM   2212  N  N    . ARG A 1 13  ? 4.602   -9.039  13.631  1.00 0.00 ? 13  ARG A N    2  
ATOM   2213  C  CA   . ARG A 1 13  ? 3.447   -8.176  13.884  1.00 0.00 ? 13  ARG A CA   2  
ATOM   2214  C  C    . ARG A 1 13  ? 2.285   -8.498  12.954  1.00 0.00 ? 13  ARG A C    2  
ATOM   2215  O  O    . ARG A 1 13  ? 1.147   -8.382  13.389  1.00 0.00 ? 13  ARG A O    2  
ATOM   2216  C  CB   . ARG A 1 13  ? 3.807   -6.686  13.824  1.00 0.00 ? 13  ARG A CB   2  
ATOM   2217  C  CG   . ARG A 1 13  ? 4.722   -6.266  14.988  1.00 0.00 ? 13  ARG A CG   2  
ATOM   2218  C  CD   . ARG A 1 13  ? 4.720   -4.750  15.227  1.00 0.00 ? 13  ARG A CD   2  
ATOM   2219  N  NE   . ARG A 1 13  ? 5.122   -3.986  14.032  1.00 0.00 ? 13  ARG A NE   2  
ATOM   2220  C  CZ   . ARG A 1 13  ? 4.315   -3.304  13.205  1.00 0.00 ? 13  ARG A CZ   2  
ATOM   2221  N  NH1  . ARG A 1 13  ? 2.999   -3.252  13.386  1.00 0.00 ? 13  ARG A NH1  2  
ATOM   2222  N  NH2  . ARG A 1 13  ? 4.840   -2.674  12.159  1.00 0.00 ? 13  ARG A NH2  2  
ATOM   2223  H  H    . ARG A 1 13  ? 5.459   -8.627  13.268  1.00 0.00 ? 13  ARG A H    2  
ATOM   2224  H  HA   . ARG A 1 13  ? 3.089   -8.393  14.893  1.00 0.00 ? 13  ARG A HA   2  
ATOM   2225  H  HB2  . ARG A 1 13  ? 4.286   -6.457  12.871  1.00 0.00 ? 13  ARG A HB2  2  
ATOM   2226  H  HB3  . ARG A 1 13  ? 2.879   -6.117  13.893  1.00 0.00 ? 13  ARG A HB3  2  
ATOM   2227  H  HG2  . ARG A 1 13  ? 4.379   -6.745  15.906  1.00 0.00 ? 13  ARG A HG2  2  
ATOM   2228  H  HG3  . ARG A 1 13  ? 5.740   -6.600  14.791  1.00 0.00 ? 13  ARG A HG3  2  
ATOM   2229  H  HD2  . ARG A 1 13  ? 3.733   -4.441  15.565  1.00 0.00 ? 13  ARG A HD2  2  
ATOM   2230  H  HD3  . ARG A 1 13  ? 5.421   -4.528  16.033  1.00 0.00 ? 13  ARG A HD3  2  
ATOM   2231  H  HE   . ARG A 1 13  ? 6.118   -3.970  13.854  1.00 0.00 ? 13  ARG A HE   2  
ATOM   2232  H  HH11 . ARG A 1 13  ? 2.532   -3.675  14.201  1.00 0.00 ? 13  ARG A HH11 2  
ATOM   2233  H  HH12 . ARG A 1 13  ? 2.404   -2.730  12.749  1.00 0.00 ? 13  ARG A HH12 2  
ATOM   2234  H  HH21 . ARG A 1 13  ? 5.839   -2.657  12.001  1.00 0.00 ? 13  ARG A HH21 2  
ATOM   2235  H  HH22 . ARG A 1 13  ? 4.268   -2.125  11.532  1.00 0.00 ? 13  ARG A HH22 2  
ATOM   2236  N  N    . ILE A 1 14  ? 2.518   -8.928  11.712  1.00 0.00 ? 14  ILE A N    2  
ATOM   2237  C  CA   . ILE A 1 14  ? 1.443   -9.425  10.856  1.00 0.00 ? 14  ILE A CA   2  
ATOM   2238  C  C    . ILE A 1 14  ? 0.713   -10.528 11.633  1.00 0.00 ? 14  ILE A C    2  
ATOM   2239  O  O    . ILE A 1 14  ? -0.496  -10.430 11.859  1.00 0.00 ? 14  ILE A O    2  
ATOM   2240  C  CB   . ILE A 1 14  ? 2.019   -9.868  9.485   1.00 0.00 ? 14  ILE A CB   2  
ATOM   2241  C  CG1  . ILE A 1 14  ? 2.377   -8.625  8.639   1.00 0.00 ? 14  ILE A CG1  2  
ATOM   2242  C  CG2  . ILE A 1 14  ? 1.050   -10.769 8.698   1.00 0.00 ? 14  ILE A CG2  2  
ATOM   2243  C  CD1  . ILE A 1 14  ? 3.265   -8.929  7.424   1.00 0.00 ? 14  ILE A CD1  2  
ATOM   2244  H  H    . ILE A 1 14  ? 3.469   -8.982  11.368  1.00 0.00 ? 14  ILE A H    2  
ATOM   2245  H  HA   . ILE A 1 14  ? 0.731   -8.618  10.689  1.00 0.00 ? 14  ILE A HA   2  
ATOM   2246  H  HB   . ILE A 1 14  ? 2.928   -10.442 9.663   1.00 0.00 ? 14  ILE A HB   2  
ATOM   2247  H  HG12 . ILE A 1 14  ? 1.462   -8.146  8.294   1.00 0.00 ? 14  ILE A HG12 2  
ATOM   2248  H  HG13 . ILE A 1 14  ? 2.908   -7.904  9.257   1.00 0.00 ? 14  ILE A HG13 2  
ATOM   2249  H  HG21 . ILE A 1 14  ? 1.493   -11.070 7.750   1.00 0.00 ? 14  ILE A HG21 2  
ATOM   2250  H  HG22 . ILE A 1 14  ? 0.849   -11.680 9.260   1.00 0.00 ? 14  ILE A HG22 2  
ATOM   2251  H  HG23 . ILE A 1 14  ? 0.115   -10.242 8.508   1.00 0.00 ? 14  ILE A HG23 2  
ATOM   2252  H  HD11 . ILE A 1 14  ? 3.516   -7.995  6.922   1.00 0.00 ? 14  ILE A HD11 2  
ATOM   2253  H  HD12 . ILE A 1 14  ? 4.185   -9.415  7.751   1.00 0.00 ? 14  ILE A HD12 2  
ATOM   2254  H  HD13 . ILE A 1 14  ? 2.746   -9.568  6.713   1.00 0.00 ? 14  ILE A HD13 2  
ATOM   2255  N  N    . GLU A 1 15  ? 1.454   -11.528 12.110  1.00 0.00 ? 15  GLU A N    2  
ATOM   2256  C  CA   . GLU A 1 15  ? 0.885   -12.669 12.804  1.00 0.00 ? 15  GLU A CA   2  
ATOM   2257  C  C    . GLU A 1 15  ? 0.182   -12.266 14.106  1.00 0.00 ? 15  GLU A C    2  
ATOM   2258  O  O    . GLU A 1 15  ? -0.933  -12.724 14.333  1.00 0.00 ? 15  GLU A O    2  
ATOM   2259  C  CB   . GLU A 1 15  ? 1.997   -13.702 13.049  1.00 0.00 ? 15  GLU A CB   2  
ATOM   2260  C  CG   . GLU A 1 15  ? 1.512   -14.976 13.755  1.00 0.00 ? 15  GLU A CG   2  
ATOM   2261  C  CD   . GLU A 1 15  ? 0.444   -15.769 12.973  1.00 0.00 ? 15  GLU A CD   2  
ATOM   2262  O  OE1  . GLU A 1 15  ? 0.527   -15.868 11.728  1.00 0.00 ? 15  GLU A OE1  2  
ATOM   2263  O  OE2  . GLU A 1 15  ? -0.460  -16.352 13.611  1.00 0.00 ? 15  GLU A OE2  2  
ATOM   2264  H  H    . GLU A 1 15  ? 2.450   -11.532 11.928  1.00 0.00 ? 15  GLU A H    2  
ATOM   2265  H  HA   . GLU A 1 15  ? 0.133   -13.116 12.149  1.00 0.00 ? 15  GLU A HA   2  
ATOM   2266  H  HB2  . GLU A 1 15  ? 2.452   -13.972 12.095  1.00 0.00 ? 15  GLU A HB2  2  
ATOM   2267  H  HB3  . GLU A 1 15  ? 2.773   -13.253 13.667  1.00 0.00 ? 15  GLU A HB3  2  
ATOM   2268  H  HG2  . GLU A 1 15  ? 2.376   -15.622 13.919  1.00 0.00 ? 15  GLU A HG2  2  
ATOM   2269  H  HG3  . GLU A 1 15  ? 1.123   -14.696 14.736  1.00 0.00 ? 15  GLU A HG3  2  
ATOM   2270  N  N    . THR A 1 16  ? 0.774   -11.415 14.950  1.00 0.00 ? 16  THR A N    2  
ATOM   2271  C  CA   . THR A 1 16  ? 0.254   -11.181 16.299  1.00 0.00 ? 16  THR A CA   2  
ATOM   2272  C  C    . THR A 1 16  ? -0.637  -9.935  16.423  1.00 0.00 ? 16  THR A C    2  
ATOM   2273  O  O    . THR A 1 16  ? -1.295  -9.770  17.453  1.00 0.00 ? 16  THR A O    2  
ATOM   2274  C  CB   . THR A 1 16  ? 1.423   -11.184 17.304  1.00 0.00 ? 16  THR A CB   2  
ATOM   2275  O  OG1  . THR A 1 16  ? 2.427   -10.244 16.959  1.00 0.00 ? 16  THR A OG1  2  
ATOM   2276  C  CG2  . THR A 1 16  ? 2.091   -12.565 17.361  1.00 0.00 ? 16  THR A CG2  2  
ATOM   2277  H  H    . THR A 1 16  ? 1.722   -11.090 14.756  1.00 0.00 ? 16  THR A H    2  
ATOM   2278  H  HA   . THR A 1 16  ? -0.383  -12.025 16.568  1.00 0.00 ? 16  THR A HA   2  
ATOM   2279  H  HB   . THR A 1 16  ? 1.040   -10.952 18.298  1.00 0.00 ? 16  THR A HB   2  
ATOM   2280  H  HG1  . THR A 1 16  ? 2.136   -9.370  17.261  1.00 0.00 ? 16  THR A HG1  2  
ATOM   2281  H  HG21 . THR A 1 16  ? 2.603   -12.783 16.422  1.00 0.00 ? 16  THR A HG21 2  
ATOM   2282  H  HG22 . THR A 1 16  ? 2.813   -12.587 18.176  1.00 0.00 ? 16  THR A HG22 2  
ATOM   2283  H  HG23 . THR A 1 16  ? 1.339   -13.332 17.547  1.00 0.00 ? 16  THR A HG23 2  
ATOM   2284  N  N    . GLU A 1 17  ? -0.697  -9.071  15.403  1.00 0.00 ? 17  GLU A N    2  
ATOM   2285  C  CA   . GLU A 1 17  ? -1.339  -7.757  15.494  1.00 0.00 ? 17  GLU A CA   2  
ATOM   2286  C  C    . GLU A 1 17  ? -2.318  -7.508  14.334  1.00 0.00 ? 17  GLU A C    2  
ATOM   2287  O  O    . GLU A 1 17  ? -3.148  -6.604  14.444  1.00 0.00 ? 17  GLU A O    2  
ATOM   2288  C  CB   . GLU A 1 17  ? -0.240  -6.674  15.584  1.00 0.00 ? 17  GLU A CB   2  
ATOM   2289  C  CG   . GLU A 1 17  ? -0.709  -5.305  16.089  1.00 0.00 ? 17  GLU A CG   2  
ATOM   2290  C  CD   . GLU A 1 17  ? 0.485   -4.357  16.319  1.00 0.00 ? 17  GLU A CD   2  
ATOM   2291  O  OE1  . GLU A 1 17  ? 1.237   -4.068  15.360  1.00 0.00 ? 17  GLU A OE1  2  
ATOM   2292  O  OE2  . GLU A 1 17  ? 0.668   -3.883  17.465  1.00 0.00 ? 17  GLU A OE2  2  
ATOM   2293  H  H    . GLU A 1 17  ? -0.100  -9.232  14.605  1.00 0.00 ? 17  GLU A H    2  
ATOM   2294  H  HA   . GLU A 1 17  ? -1.919  -7.711  16.417  1.00 0.00 ? 17  GLU A HA   2  
ATOM   2295  H  HB2  . GLU A 1 17  ? 0.540   -7.029  16.260  1.00 0.00 ? 17  GLU A HB2  2  
ATOM   2296  H  HB3  . GLU A 1 17  ? 0.199   -6.523  14.601  1.00 0.00 ? 17  GLU A HB3  2  
ATOM   2297  H  HG2  . GLU A 1 17  ? -1.382  -4.854  15.357  1.00 0.00 ? 17  GLU A HG2  2  
ATOM   2298  H  HG3  . GLU A 1 17  ? -1.260  -5.442  17.022  1.00 0.00 ? 17  GLU A HG3  2  
ATOM   2299  N  N    . ILE A 1 18  ? -2.286  -8.310  13.256  1.00 0.00 ? 18  ILE A N    2  
ATOM   2300  C  CA   . ILE A 1 18  ? -3.137  -8.090  12.079  1.00 0.00 ? 18  ILE A CA   2  
ATOM   2301  C  C    . ILE A 1 18  ? -4.016  -9.314  11.805  1.00 0.00 ? 18  ILE A C    2  
ATOM   2302  O  O    . ILE A 1 18  ? -5.224  -9.149  11.631  1.00 0.00 ? 18  ILE A O    2  
ATOM   2303  C  CB   . ILE A 1 18  ? -2.293  -7.676  10.844  1.00 0.00 ? 18  ILE A CB   2  
ATOM   2304  C  CG1  . ILE A 1 18  ? -1.330  -6.518  11.196  1.00 0.00 ? 18  ILE A CG1  2  
ATOM   2305  C  CG2  . ILE A 1 18  ? -3.206  -7.260  9.674   1.00 0.00 ? 18  ILE A CG2  2  
ATOM   2306  C  CD1  . ILE A 1 18  ? -0.542  -5.953  10.012  1.00 0.00 ? 18  ILE A CD1  2  
ATOM   2307  H  H    . ILE A 1 18  ? -1.577  -9.031  13.194  1.00 0.00 ? 18  ILE A H    2  
ATOM   2308  H  HA   . ILE A 1 18  ? -3.815  -7.261  12.283  1.00 0.00 ? 18  ILE A HA   2  
ATOM   2309  H  HB   . ILE A 1 18  ? -1.702  -8.532  10.518  1.00 0.00 ? 18  ILE A HB   2  
ATOM   2310  H  HG12 . ILE A 1 18  ? -1.900  -5.708  11.650  1.00 0.00 ? 18  ILE A HG12 2  
ATOM   2311  H  HG13 . ILE A 1 18  ? -0.601  -6.864  11.928  1.00 0.00 ? 18  ILE A HG13 2  
ATOM   2312  H  HG21 . ILE A 1 18  ? -2.627  -7.166  8.755   1.00 0.00 ? 18  ILE A HG21 2  
ATOM   2313  H  HG22 . ILE A 1 18  ? -3.977  -8.004  9.492   1.00 0.00 ? 18  ILE A HG22 2  
ATOM   2314  H  HG23 . ILE A 1 18  ? -3.687  -6.310  9.900   1.00 0.00 ? 18  ILE A HG23 2  
ATOM   2315  H  HD11 . ILE A 1 18  ? -1.209  -5.470  9.299   1.00 0.00 ? 18  ILE A HD11 2  
ATOM   2316  H  HD12 . ILE A 1 18  ? 0.153   -5.206  10.388  1.00 0.00 ? 18  ILE A HD12 2  
ATOM   2317  H  HD13 . ILE A 1 18  ? 0.008   -6.750  9.514   1.00 0.00 ? 18  ILE A HD13 2  
ATOM   2318  N  N    . ILE A 1 19  ? -3.458  -10.531 11.807  1.00 0.00 ? 19  ILE A N    2  
ATOM   2319  C  CA   . ILE A 1 19  ? -4.165  -11.725 11.335  1.00 0.00 ? 19  ILE A CA   2  
ATOM   2320  C  C    . ILE A 1 19  ? -4.146  -12.890 12.345  1.00 0.00 ? 19  ILE A C    2  
ATOM   2321  O  O    . ILE A 1 19  ? -4.277  -14.046 11.953  1.00 0.00 ? 19  ILE A O    2  
ATOM   2322  C  CB   . ILE A 1 19  ? -3.636  -12.108 9.939   1.00 0.00 ? 19  ILE A CB   2  
ATOM   2323  C  CG1  . ILE A 1 19  ? -2.123  -12.375 10.006  1.00 0.00 ? 19  ILE A CG1  2  
ATOM   2324  C  CG2  . ILE A 1 19  ? -3.968  -11.040 8.873   1.00 0.00 ? 19  ILE A CG2  2  
ATOM   2325  C  CD1  . ILE A 1 19  ? -1.698  -13.388 8.961   1.00 0.00 ? 19  ILE A CD1  2  
ATOM   2326  H  H    . ILE A 1 19  ? -2.446  -10.618 11.886  1.00 0.00 ? 19  ILE A H    2  
ATOM   2327  H  HA   . ILE A 1 19  ? -5.211  -11.484 11.193  1.00 0.00 ? 19  ILE A HA   2  
ATOM   2328  H  HB   . ILE A 1 19  ? -4.143  -13.023 9.633   1.00 0.00 ? 19  ILE A HB   2  
ATOM   2329  H  HG12 . ILE A 1 19  ? -1.578  -11.448 9.844   1.00 0.00 ? 19  ILE A HG12 2  
ATOM   2330  H  HG13 . ILE A 1 19  ? -1.854  -12.775 10.984  1.00 0.00 ? 19  ILE A HG13 2  
ATOM   2331  H  HG21 . ILE A 1 19  ? -3.377  -10.137 9.023   1.00 0.00 ? 19  ILE A HG21 2  
ATOM   2332  H  HG22 . ILE A 1 19  ? -3.751  -11.428 7.878   1.00 0.00 ? 19  ILE A HG22 2  
ATOM   2333  H  HG23 . ILE A 1 19  ? -5.027  -10.776 8.915   1.00 0.00 ? 19  ILE A HG23 2  
ATOM   2334  H  HD11 . ILE A 1 19  ? -1.880  -12.980 7.969   1.00 0.00 ? 19  ILE A HD11 2  
ATOM   2335  H  HD12 . ILE A 1 19  ? -0.640  -13.600 9.100   1.00 0.00 ? 19  ILE A HD12 2  
ATOM   2336  H  HD13 . ILE A 1 19  ? -2.280  -14.297 9.107   1.00 0.00 ? 19  ILE A HD13 2  
ATOM   2337  N  N    . VAL A 1 20  ? -3.993  -12.611 13.641  1.00 0.00 ? 20  VAL A N    2  
ATOM   2338  C  CA   . VAL A 1 20  ? -3.858  -13.626 14.696  1.00 0.00 ? 20  VAL A CA   2  
ATOM   2339  C  C    . VAL A 1 20  ? -4.927  -14.733 14.660  1.00 0.00 ? 20  VAL A C    2  
ATOM   2340  O  O    . VAL A 1 20  ? -4.611  -15.894 14.928  1.00 0.00 ? 20  VAL A O    2  
ATOM   2341  C  CB   . VAL A 1 20  ? -3.768  -12.919 16.066  1.00 0.00 ? 20  VAL A CB   2  
ATOM   2342  C  CG1  . VAL A 1 20  ? -5.105  -12.300 16.506  1.00 0.00 ? 20  VAL A CG1  2  
ATOM   2343  C  CG2  . VAL A 1 20  ? -3.256  -13.862 17.161  1.00 0.00 ? 20  VAL A CG2  2  
ATOM   2344  H  H    . VAL A 1 20  ? -3.783  -11.658 13.893  1.00 0.00 ? 20  VAL A H    2  
ATOM   2345  H  HA   . VAL A 1 20  ? -2.905  -14.124 14.519  1.00 0.00 ? 20  VAL A HA   2  
ATOM   2346  H  HB   . VAL A 1 20  ? -3.047  -12.106 15.975  1.00 0.00 ? 20  VAL A HB   2  
ATOM   2347  H  HG11 . VAL A 1 20  ? -5.850  -13.083 16.668  1.00 0.00 ? 20  VAL A HG11 2  
ATOM   2348  H  HG12 . VAL A 1 20  ? -4.966  -11.749 17.437  1.00 0.00 ? 20  VAL A HG12 2  
ATOM   2349  H  HG13 . VAL A 1 20  ? -5.471  -11.609 15.747  1.00 0.00 ? 20  VAL A HG13 2  
ATOM   2350  H  HG21 . VAL A 1 20  ? -3.122  -13.311 18.092  1.00 0.00 ? 20  VAL A HG21 2  
ATOM   2351  H  HG22 . VAL A 1 20  ? -3.967  -14.674 17.323  1.00 0.00 ? 20  VAL A HG22 2  
ATOM   2352  H  HG23 . VAL A 1 20  ? -2.294  -14.282 16.862  1.00 0.00 ? 20  VAL A HG23 2  
ATOM   2353  N  N    . ASP A 1 21  ? -6.173  -14.399 14.304  1.00 0.00 ? 21  ASP A N    2  
ATOM   2354  C  CA   . ASP A 1 21  ? -7.302  -15.342 14.264  1.00 0.00 ? 21  ASP A CA   2  
ATOM   2355  C  C    . ASP A 1 21  ? -7.782  -15.576 12.815  1.00 0.00 ? 21  ASP A C    2  
ATOM   2356  O  O    . ASP A 1 21  ? -8.759  -16.301 12.549  1.00 0.00 ? 21  ASP A O    2  
ATOM   2357  C  CB   . ASP A 1 21  ? -8.428  -14.790 15.152  1.00 0.00 ? 21  ASP A CB   2  
ATOM   2358  C  CG   . ASP A 1 21  ? -9.607  -15.767 15.299  1.00 0.00 ? 21  ASP A CG   2  
ATOM   2359  O  OD1  . ASP A 1 21  ? -9.400  -16.911 15.764  1.00 0.00 ? 21  ASP A OD1  2  
ATOM   2360  O  OD2  . ASP A 1 21  ? -10.762 -15.373 15.019  1.00 0.00 ? 21  ASP A OD2  2  
ATOM   2361  H  H    . ASP A 1 21  ? -6.374  -13.431 14.097  1.00 0.00 ? 21  ASP A H    2  
ATOM   2362  H  HA   . ASP A 1 21  ? -6.976  -16.285 14.697  1.00 0.00 ? 21  ASP A HA   2  
ATOM   2363  H  HB2  . ASP A 1 21  ? -8.023  -14.580 16.144  1.00 0.00 ? 21  ASP A HB2  2  
ATOM   2364  H  HB3  . ASP A 1 21  ? -8.778  -13.845 14.730  1.00 0.00 ? 21  ASP A HB3  2  
ATOM   2365  N  N    . ALA A 1 22  ? -7.079  -14.937 11.870  1.00 0.00 ? 22  ALA A N    2  
ATOM   2366  C  CA   . ALA A 1 22  ? -7.461  -14.826 10.481  1.00 0.00 ? 22  ALA A CA   2  
ATOM   2367  C  C    . ALA A 1 22  ? -6.579  -15.693 9.589   1.00 0.00 ? 22  ALA A C    2  
ATOM   2368  O  O    . ALA A 1 22  ? -5.353  -15.583 9.575   1.00 0.00 ? 22  ALA A O    2  
ATOM   2369  C  CB   . ALA A 1 22  ? -7.390  -13.369 10.030  1.00 0.00 ? 22  ALA A CB   2  
ATOM   2370  H  H    . ALA A 1 22  ? -6.180  -14.541 12.127  1.00 0.00 ? 22  ALA A H    2  
ATOM   2371  H  HA   . ALA A 1 22  ? -8.497  -15.132 10.387  1.00 0.00 ? 22  ALA A HA   2  
ATOM   2372  H  HB1  . ALA A 1 22  ? -6.375  -13.001 10.115  1.00 0.00 ? 22  ALA A HB1  2  
ATOM   2373  H  HB2  . ALA A 1 22  ? -7.684  -13.322 8.986   1.00 0.00 ? 22  ALA A HB2  2  
ATOM   2374  H  HB3  . ALA A 1 22  ? -8.061  -12.750 10.627  1.00 0.00 ? 22  ALA A HB3  2  
ATOM   2375  N  N    . GLU A 1 23  ? -7.246  -16.490 8.766   1.00 0.00 ? 23  GLU A N    2  
ATOM   2376  C  CA   . GLU A 1 23  ? -6.651  -17.254 7.673   1.00 0.00 ? 23  GLU A CA   2  
ATOM   2377  C  C    . GLU A 1 23  ? -7.630  -17.319 6.499   1.00 0.00 ? 23  GLU A C    2  
ATOM   2378  O  O    . GLU A 1 23  ? -7.203  -17.388 5.345   1.00 0.00 ? 23  GLU A O    2  
ATOM   2379  C  CB   . GLU A 1 23  ? -6.297  -18.709 8.044   1.00 0.00 ? 23  GLU A CB   2  
ATOM   2380  C  CG   . GLU A 1 23  ? -5.700  -19.009 9.428   1.00 0.00 ? 23  GLU A CG   2  
ATOM   2381  C  CD   . GLU A 1 23  ? -6.800  -19.157 10.490  1.00 0.00 ? 23  GLU A CD   2  
ATOM   2382  O  OE1  . GLU A 1 23  ? -7.657  -20.064 10.388  1.00 0.00 ? 23  GLU A OE1  2  
ATOM   2383  O  OE2  . GLU A 1 23  ? -6.902  -18.338 11.423  1.00 0.00 ? 23  GLU A OE2  2  
ATOM   2384  H  H    . GLU A 1 23  ? -8.253  -16.431 8.827   1.00 0.00 ? 23  GLU A H    2  
ATOM   2385  H  HA   . GLU A 1 23  ? -5.741  -16.748 7.352   1.00 0.00 ? 23  GLU A HA   2  
ATOM   2386  H  HB2  . GLU A 1 23  ? -7.197  -19.312 7.929   1.00 0.00 ? 23  GLU A HB2  2  
ATOM   2387  H  HB3  . GLU A 1 23  ? -5.587  -19.062 7.295   1.00 0.00 ? 23  GLU A HB3  2  
ATOM   2388  H  HG2  . GLU A 1 23  ? -5.158  -19.955 9.368   1.00 0.00 ? 23  GLU A HG2  2  
ATOM   2389  H  HG3  . GLU A 1 23  ? -4.980  -18.238 9.705   1.00 0.00 ? 23  GLU A HG3  2  
ATOM   2390  N  N    . ASP A 1 24  ? -8.938  -17.320 6.778   1.00 0.00 ? 24  ASP A N    2  
ATOM   2391  C  CA   . ASP A 1 24  ? -9.975  -17.447 5.782   1.00 0.00 ? 24  ASP A CA   2  
ATOM   2392  C  C    . ASP A 1 24  ? -9.983  -16.103 5.050   1.00 0.00 ? 24  ASP A C    2  
ATOM   2393  O  O    . ASP A 1 24  ? -9.745  -15.062 5.671   1.00 0.00 ? 24  ASP A O    2  
ATOM   2394  C  CB   . ASP A 1 24  ? -11.299 -17.785 6.492   1.00 0.00 ? 24  ASP A CB   2  
ATOM   2395  C  CG   . ASP A 1 24  ? -11.234 -19.094 7.321   1.00 0.00 ? 24  ASP A CG   2  
ATOM   2396  O  OD1  . ASP A 1 24  ? -10.890 -19.076 8.535   1.00 0.00 ? 24  ASP A OD1  2  
ATOM   2397  O  OD2  . ASP A 1 24  ? -11.543 -20.167 6.752   1.00 0.00 ? 24  ASP A OD2  2  
ATOM   2398  H  H    . ASP A 1 24  ? -9.290  -17.109 7.700   1.00 0.00 ? 24  ASP A H    2  
ATOM   2399  H  HA   . ASP A 1 24  ? -9.722  -18.253 5.093   1.00 0.00 ? 24  ASP A HA   2  
ATOM   2400  H  HB2  . ASP A 1 24  ? -11.577 -16.960 7.143   1.00 0.00 ? 24  ASP A HB2  2  
ATOM   2401  H  HB3  . ASP A 1 24  ? -12.078 -17.873 5.731   1.00 0.00 ? 24  ASP A HB3  2  
ATOM   2402  N  N    . LYS A 1 25  ? -10.220 -16.103 3.734   1.00 0.00 ? 25  LYS A N    2  
ATOM   2403  C  CA   . LYS A 1 25  ? -10.020 -14.906 2.905   1.00 0.00 ? 25  LYS A CA   2  
ATOM   2404  C  C    . LYS A 1 25  ? -10.733 -13.660 3.434   1.00 0.00 ? 25  LYS A C    2  
ATOM   2405  O  O    . LYS A 1 25  ? -10.163 -12.571 3.400   1.00 0.00 ? 25  LYS A O    2  
ATOM   2406  C  CB   . LYS A 1 25  ? -10.326 -15.178 1.415   1.00 0.00 ? 25  LYS A CB   2  
ATOM   2407  C  CG   . LYS A 1 25  ? -11.808 -15.239 0.990   1.00 0.00 ? 25  LYS A CG   2  
ATOM   2408  C  CD   . LYS A 1 25  ? -12.618 -16.445 1.500   1.00 0.00 ? 25  LYS A CD   2  
ATOM   2409  C  CE   . LYS A 1 25  ? -12.139 -17.804 0.957   1.00 0.00 ? 25  LYS A CE   2  
ATOM   2410  N  NZ   . LYS A 1 25  ? -12.386 -17.966 -0.500  1.00 0.00 ? 25  LYS A NZ   2  
ATOM   2411  H  H    . LYS A 1 25  ? -10.393 -16.986 3.278   1.00 0.00 ? 25  LYS A H    2  
ATOM   2412  H  HA   . LYS A 1 25  ? -8.954  -14.685 2.966   1.00 0.00 ? 25  LYS A HA   2  
ATOM   2413  H  HB2  . LYS A 1 25  ? -9.876  -14.365 0.846   1.00 0.00 ? 25  LYS A HB2  2  
ATOM   2414  H  HB3  . LYS A 1 25  ? -9.817  -16.091 1.103   1.00 0.00 ? 25  LYS A HB3  2  
ATOM   2415  H  HG2  . LYS A 1 25  ? -12.305 -14.325 1.315   1.00 0.00 ? 25  LYS A HG2  2  
ATOM   2416  H  HG3  . LYS A 1 25  ? -11.844 -15.237 -0.099  1.00 0.00 ? 25  LYS A HG3  2  
ATOM   2417  H  HD2  . LYS A 1 25  ? -12.586 -16.466 2.589   1.00 0.00 ? 25  LYS A HD2  2  
ATOM   2418  H  HD3  . LYS A 1 25  ? -13.664 -16.303 1.221   1.00 0.00 ? 25  LYS A HD3  2  
ATOM   2419  H  HE2  . LYS A 1 25  ? -11.074 -17.925 1.163   1.00 0.00 ? 25  LYS A HE2  2  
ATOM   2420  H  HE3  . LYS A 1 25  ? -12.672 -18.593 1.493   1.00 0.00 ? 25  LYS A HE3  2  
ATOM   2421  H  HZ1  . LYS A 1 25  ? -11.884 -17.280 -1.043  1.00 0.00 ? 25  LYS A HZ1  2  
ATOM   2422  H  HZ2  . LYS A 1 25  ? -12.084 -18.879 -0.811  1.00 0.00 ? 25  LYS A HZ2  2  
ATOM   2423  H  HZ3  . LYS A 1 25  ? -13.369 -17.887 -0.716  1.00 0.00 ? 25  LYS A HZ3  2  
ATOM   2424  N  N    . GLU A 1 26  ? -11.950 -13.824 3.957   1.00 0.00 ? 26  GLU A N    2  
ATOM   2425  C  CA   . GLU A 1 26  ? -12.735 -12.718 4.487   1.00 0.00 ? 26  GLU A CA   2  
ATOM   2426  C  C    . GLU A 1 26  ? -12.063 -12.162 5.743   1.00 0.00 ? 26  GLU A C    2  
ATOM   2427  O  O    . GLU A 1 26  ? -11.976 -10.946 5.915   1.00 0.00 ? 26  GLU A O    2  
ATOM   2428  C  CB   . GLU A 1 26  ? -14.162 -13.196 4.807   1.00 0.00 ? 26  GLU A CB   2  
ATOM   2429  C  CG   . GLU A 1 26  ? -14.941 -13.602 3.546   1.00 0.00 ? 26  GLU A CG   2  
ATOM   2430  C  CD   . GLU A 1 26  ? -16.381 -14.026 3.885   1.00 0.00 ? 26  GLU A CD   2  
ATOM   2431  O  OE1  . GLU A 1 26  ? -16.607 -15.204 4.245   1.00 0.00 ? 26  GLU A OE1  2  
ATOM   2432  O  OE2  . GLU A 1 26  ? -17.309 -13.192 3.774   1.00 0.00 ? 26  GLU A OE2  2  
ATOM   2433  H  H    . GLU A 1 26  ? -12.326 -14.754 4.035   1.00 0.00 ? 26  GLU A H    2  
ATOM   2434  H  HA   . GLU A 1 26  ? -12.783 -11.923 3.741   1.00 0.00 ? 26  GLU A HA   2  
ATOM   2435  H  HB2  . GLU A 1 26  ? -14.114 -14.046 5.490   1.00 0.00 ? 26  GLU A HB2  2  
ATOM   2436  H  HB3  . GLU A 1 26  ? -14.700 -12.390 5.305   1.00 0.00 ? 26  GLU A HB3  2  
ATOM   2437  H  HG2  . GLU A 1 26  ? -14.956 -12.761 2.850   1.00 0.00 ? 26  GLU A HG2  2  
ATOM   2438  H  HG3  . GLU A 1 26  ? -14.428 -14.431 3.053   1.00 0.00 ? 26  GLU A HG3  2  
ATOM   2439  N  N    . GLU A 1 27  ? -11.550 -13.036 6.612   1.00 0.00 ? 27  GLU A N    2  
ATOM   2440  C  CA   . GLU A 1 27  ? -10.928 -12.632 7.863   1.00 0.00 ? 27  GLU A CA   2  
ATOM   2441  C  C    . GLU A 1 27  ? -9.615  -11.924 7.579   1.00 0.00 ? 27  GLU A C    2  
ATOM   2442  O  O    . GLU A 1 27  ? -9.350  -10.884 8.176   1.00 0.00 ? 27  GLU A O    2  
ATOM   2443  C  CB   . GLU A 1 27  ? -10.601 -13.848 8.729   1.00 0.00 ? 27  GLU A CB   2  
ATOM   2444  C  CG   . GLU A 1 27  ? -11.777 -14.770 9.036   1.00 0.00 ? 27  GLU A CG   2  
ATOM   2445  C  CD   . GLU A 1 27  ? -11.284 -16.012 9.782   1.00 0.00 ? 27  GLU A CD   2  
ATOM   2446  O  OE1  . GLU A 1 27  ? -10.156 -16.500 9.513   1.00 0.00 ? 27  GLU A OE1  2  
ATOM   2447  O  OE2  . GLU A 1 27  ? -12.015 -16.523 10.661  1.00 0.00 ? 27  GLU A OE2  2  
ATOM   2448  H  H    . GLU A 1 27  ? -11.514 -14.024 6.393   1.00 0.00 ? 27  GLU A H    2  
ATOM   2449  H  HA   . GLU A 1 27  ? -11.595 -11.964 8.408   1.00 0.00 ? 27  GLU A HA   2  
ATOM   2450  H  HB2  . GLU A 1 27  ? -9.828  -14.425 8.222   1.00 0.00 ? 27  GLU A HB2  2  
ATOM   2451  H  HB3  . GLU A 1 27  ? -10.198 -13.494 9.677   1.00 0.00 ? 27  GLU A HB3  2  
ATOM   2452  H  HG2  . GLU A 1 27  ? -12.504 -14.228 9.643   1.00 0.00 ? 27  GLU A HG2  2  
ATOM   2453  H  HG3  . GLU A 1 27  ? -12.261 -15.081 8.111   1.00 0.00 ? 27  GLU A HG3  2  
ATOM   2454  N  N    . ARG A 1 28  ? -8.782  -12.476 6.683   1.00 0.00 ? 28  ARG A N    2  
ATOM   2455  C  CA   . ARG A 1 28  ? -7.516  -11.838 6.340   1.00 0.00 ? 28  ARG A CA   2  
ATOM   2456  C  C    . ARG A 1 28  ? -7.791  -10.454 5.763   1.00 0.00 ? 28  ARG A C    2  
ATOM   2457  O  O    . ARG A 1 28  ? -7.160  -9.495  6.206   1.00 0.00 ? 28  ARG A O    2  
ATOM   2458  C  CB   . ARG A 1 28  ? -6.706  -12.709 5.371   1.00 0.00 ? 28  ARG A CB   2  
ATOM   2459  C  CG   . ARG A 1 28  ? -5.964  -13.858 6.072   1.00 0.00 ? 28  ARG A CG   2  
ATOM   2460  C  CD   . ARG A 1 28  ? -5.165  -14.680 5.047   1.00 0.00 ? 28  ARG A CD   2  
ATOM   2461  N  NE   . ARG A 1 28  ? -4.042  -15.414 5.667   1.00 0.00 ? 28  ARG A NE   2  
ATOM   2462  C  CZ   . ARG A 1 28  ? -3.673  -16.683 5.429   1.00 0.00 ? 28  ARG A CZ   2  
ATOM   2463  N  NH1  . ARG A 1 28  ? -4.470  -17.519 4.770   1.00 0.00 ? 28  ARG A NH1  2  
ATOM   2464  N  NH2  . ARG A 1 28  ? -2.495  -17.114 5.866   1.00 0.00 ? 28  ARG A NH2  2  
ATOM   2465  H  H    . ARG A 1 28  ? -9.038  -13.350 6.226   1.00 0.00 ? 28  ARG A H    2  
ATOM   2466  H  HA   . ARG A 1 28  ? -6.939  -11.689 7.254   1.00 0.00 ? 28  ARG A HA   2  
ATOM   2467  H  HB2  . ARG A 1 28  ? -7.365  -13.108 4.600   1.00 0.00 ? 28  ARG A HB2  2  
ATOM   2468  H  HB3  . ARG A 1 28  ? -5.957  -12.072 4.902   1.00 0.00 ? 28  ARG A HB3  2  
ATOM   2469  H  HG2  . ARG A 1 28  ? -5.283  -13.433 6.810   1.00 0.00 ? 28  ARG A HG2  2  
ATOM   2470  H  HG3  . ARG A 1 28  ? -6.679  -14.504 6.581   1.00 0.00 ? 28  ARG A HG3  2  
ATOM   2471  H  HD2  . ARG A 1 28  ? -5.844  -15.352 4.522   1.00 0.00 ? 28  ARG A HD2  2  
ATOM   2472  H  HD3  . ARG A 1 28  ? -4.738  -14.001 4.308   1.00 0.00 ? 28  ARG A HD3  2  
ATOM   2473  H  HE   . ARG A 1 28  ? -3.424  -14.844 6.232   1.00 0.00 ? 28  ARG A HE   2  
ATOM   2474  H  HH11 . ARG A 1 28  ? -5.450  -17.281 4.616   1.00 0.00 ? 28  ARG A HH11 2  
ATOM   2475  H  HH12 . ARG A 1 28  ? -4.197  -18.467 4.556   1.00 0.00 ? 28  ARG A HH12 2  
ATOM   2476  H  HH21 . ARG A 1 28  ? -1.863  -16.508 6.372   1.00 0.00 ? 28  ARG A HH21 2  
ATOM   2477  H  HH22 . ARG A 1 28  ? -2.187  -18.067 5.725   1.00 0.00 ? 28  ARG A HH22 2  
ATOM   2478  N  N    . ALA A 1 29  ? -8.756  -10.332 4.847   1.00 0.00 ? 29  ALA A N    2  
ATOM   2479  C  CA   . ALA A 1 29  ? -9.121  -9.050  4.271   1.00 0.00 ? 29  ALA A CA   2  
ATOM   2480  C  C    . ALA A 1 29  ? -9.510  -8.060  5.376   1.00 0.00 ? 29  ALA A C    2  
ATOM   2481  O  O    . ALA A 1 29  ? -8.997  -6.943  5.392   1.00 0.00 ? 29  ALA A O    2  
ATOM   2482  C  CB   . ALA A 1 29  ? -10.244 -9.259  3.249   1.00 0.00 ? 29  ALA A CB   2  
ATOM   2483  H  H    . ALA A 1 29  ? -9.258  -11.148 4.525   1.00 0.00 ? 29  ALA A H    2  
ATOM   2484  H  HA   . ALA A 1 29  ? -8.248  -8.654  3.750   1.00 0.00 ? 29  ALA A HA   2  
ATOM   2485  H  HB1  . ALA A 1 29  ? -10.440 -8.331  2.716   1.00 0.00 ? 29  ALA A HB1  2  
ATOM   2486  H  HB2  . ALA A 1 29  ? -9.948  -10.013 2.520   1.00 0.00 ? 29  ALA A HB2  2  
ATOM   2487  H  HB3  . ALA A 1 29  ? -11.153 -9.592  3.749   1.00 0.00 ? 29  ALA A HB3  2  
ATOM   2488  N  N    . MET A 1 30  ? -10.350 -8.469  6.334   1.00 0.00 ? 30  MET A N    2  
ATOM   2489  C  CA   . MET A 1 30  ? -10.748 -7.611  7.450   1.00 0.00 ? 30  MET A CA   2  
ATOM   2490  C  C    . MET A 1 30  ? -9.582  -7.254  8.370   1.00 0.00 ? 30  MET A C    2  
ATOM   2491  O  O    . MET A 1 30  ? -9.443  -6.087  8.729   1.00 0.00 ? 30  MET A O    2  
ATOM   2492  C  CB   . MET A 1 30  ? -11.899 -8.242  8.240   1.00 0.00 ? 30  MET A CB   2  
ATOM   2493  C  CG   . MET A 1 30  ? -13.221 -8.245  7.461   1.00 0.00 ? 30  MET A CG   2  
ATOM   2494  S  SD   . MET A 1 30  ? -13.920 -6.621  7.033   1.00 0.00 ? 30  MET A SD   2  
ATOM   2495  C  CE   . MET A 1 30  ? -13.142 -6.277  5.427   1.00 0.00 ? 30  MET A CE   2  
ATOM   2496  H  H    . MET A 1 30  ? -10.745 -9.403  6.286   1.00 0.00 ? 30  MET A H    2  
ATOM   2497  H  HA   . MET A 1 30  ? -11.098 -6.669  7.051   1.00 0.00 ? 30  MET A HA   2  
ATOM   2498  H  HB2  . MET A 1 30  ? -11.639 -9.265  8.514   1.00 0.00 ? 30  MET A HB2  2  
ATOM   2499  H  HB3  . MET A 1 30  ? -12.048 -7.674  9.157   1.00 0.00 ? 30  MET A HB3  2  
ATOM   2500  H  HG2  . MET A 1 30  ? -13.102 -8.824  6.548   1.00 0.00 ? 30  MET A HG2  2  
ATOM   2501  H  HG3  . MET A 1 30  ? -13.956 -8.763  8.078   1.00 0.00 ? 30  MET A HG3  2  
ATOM   2502  H  HE1  . MET A 1 30  ? -12.140 -5.873  5.548   1.00 0.00 ? 30  MET A HE1  2  
ATOM   2503  H  HE2  . MET A 1 30  ? -13.084 -7.190  4.838   1.00 0.00 ? 30  MET A HE2  2  
ATOM   2504  H  HE3  . MET A 1 30  ? -13.737 -5.538  4.894   1.00 0.00 ? 30  MET A HE3  2  
ATOM   2505  N  N    . GLY A 1 31  ? -8.728  -8.213  8.731   1.00 0.00 ? 31  GLY A N    2  
ATOM   2506  C  CA   . GLY A 1 31  ? -7.591  -7.967  9.605   1.00 0.00 ? 31  GLY A CA   2  
ATOM   2507  C  C    . GLY A 1 31  ? -6.677  -6.906  9.001   1.00 0.00 ? 31  GLY A C    2  
ATOM   2508  O  O    . GLY A 1 31  ? -6.344  -5.918  9.663   1.00 0.00 ? 31  GLY A O    2  
ATOM   2509  H  H    . GLY A 1 31  ? -8.877  -9.162  8.404   1.00 0.00 ? 31  GLY A H    2  
ATOM   2510  H  HA2  . GLY A 1 31  ? -7.946  -7.634  10.581  1.00 0.00 ? 31  GLY A HA2  2  
ATOM   2511  H  HA3  . GLY A 1 31  ? -7.033  -8.896  9.723   1.00 0.00 ? 31  GLY A HA3  2  
ATOM   2512  N  N    . TRP A 1 32  ? -6.333  -7.072  7.720   1.00 0.00 ? 32  TRP A N    2  
ATOM   2513  C  CA   . TRP A 1 32  ? -5.527  -6.101  7.001   1.00 0.00 ? 32  TRP A CA   2  
ATOM   2514  C  C    . TRP A 1 32  ? -6.242  -4.751  6.914   1.00 0.00 ? 32  TRP A C    2  
ATOM   2515  O  O    . TRP A 1 32  ? -5.620  -3.733  7.207   1.00 0.00 ? 32  TRP A O    2  
ATOM   2516  C  CB   . TRP A 1 32  ? -5.145  -6.640  5.617   1.00 0.00 ? 32  TRP A CB   2  
ATOM   2517  C  CG   . TRP A 1 32  ? -3.955  -7.550  5.651   1.00 0.00 ? 32  TRP A CG   2  
ATOM   2518  C  CD1  . TRP A 1 32  ? -3.971  -8.897  5.731   1.00 0.00 ? 32  TRP A CD1  2  
ATOM   2519  C  CD2  . TRP A 1 32  ? -2.545  -7.177  5.668   1.00 0.00 ? 32  TRP A CD2  2  
ATOM   2520  N  NE1  . TRP A 1 32  ? -2.682  -9.386  5.761   1.00 0.00 ? 32  TRP A NE1  2  
ATOM   2521  C  CE2  . TRP A 1 32  ? -1.758  -8.361  5.790   1.00 0.00 ? 32  TRP A CE2  2  
ATOM   2522  C  CE3  . TRP A 1 32  ? -1.857  -5.948  5.609   1.00 0.00 ? 32  TRP A CE3  2  
ATOM   2523  C  CZ2  . TRP A 1 32  ? -0.358  -8.315  5.888   1.00 0.00 ? 32  TRP A CZ2  2  
ATOM   2524  C  CZ3  . TRP A 1 32  ? -0.454  -5.894  5.681   1.00 0.00 ? 32  TRP A CZ3  2  
ATOM   2525  C  CH2  . TRP A 1 32  ? 0.296   -7.074  5.827   1.00 0.00 ? 32  TRP A CH2  2  
ATOM   2526  H  H    . TRP A 1 32  ? -6.664  -7.887  7.212   1.00 0.00 ? 32  TRP A H    2  
ATOM   2527  H  HA   . TRP A 1 32  ? -4.606  -5.962  7.569   1.00 0.00 ? 32  TRP A HA   2  
ATOM   2528  H  HB2  . TRP A 1 32  ? -5.996  -7.149  5.160   1.00 0.00 ? 32  TRP A HB2  2  
ATOM   2529  H  HB3  . TRP A 1 32  ? -4.889  -5.795  4.975   1.00 0.00 ? 32  TRP A HB3  2  
ATOM   2530  H  HD1  . TRP A 1 32  ? -4.863  -9.502  5.749   1.00 0.00 ? 32  TRP A HD1  2  
ATOM   2531  H  HE1  . TRP A 1 32  ? -2.471  -10.376 5.724   1.00 0.00 ? 32  TRP A HE1  2  
ATOM   2532  H  HE3  . TRP A 1 32  ? -2.423  -5.038  5.496   1.00 0.00 ? 32  TRP A HE3  2  
ATOM   2533  H  HZ2  . TRP A 1 32  ? 0.213   -9.226  5.984   1.00 0.00 ? 32  TRP A HZ2  2  
ATOM   2534  H  HZ3  . TRP A 1 32  ? 0.048   -4.940  5.617   1.00 0.00 ? 32  TRP A HZ3  2  
ATOM   2535  H  HH2  . TRP A 1 32  ? 1.375   -7.026  5.877   1.00 0.00 ? 32  TRP A HH2  2  
ATOM   2536  N  N    . TYR A 1 33  ? -7.534  -4.730  6.570   1.00 0.00 ? 33  TYR A N    2  
ATOM   2537  C  CA   . TYR A 1 33  ? -8.334  -3.515  6.434   1.00 0.00 ? 33  TYR A CA   2  
ATOM   2538  C  C    . TYR A 1 33  ? -8.311  -2.684  7.716   1.00 0.00 ? 33  TYR A C    2  
ATOM   2539  O  O    . TYR A 1 33  ? -8.061  -1.478  7.649   1.00 0.00 ? 33  TYR A O    2  
ATOM   2540  C  CB   . TYR A 1 33  ? -9.768  -3.914  6.040   1.00 0.00 ? 33  TYR A CB   2  
ATOM   2541  C  CG   . TYR A 1 33  ? -10.875 -2.904  6.288   1.00 0.00 ? 33  TYR A CG   2  
ATOM   2542  C  CD1  . TYR A 1 33  ? -10.802 -1.605  5.754   1.00 0.00 ? 33  TYR A CD1  2  
ATOM   2543  C  CD2  . TYR A 1 33  ? -12.008 -3.285  7.033   1.00 0.00 ? 33  TYR A CD2  2  
ATOM   2544  C  CE1  . TYR A 1 33  ? -11.854 -0.696  5.964   1.00 0.00 ? 33  TYR A CE1  2  
ATOM   2545  C  CE2  . TYR A 1 33  ? -13.057 -2.377  7.255   1.00 0.00 ? 33  TYR A CE2  2  
ATOM   2546  C  CZ   . TYR A 1 33  ? -12.987 -1.074  6.716   1.00 0.00 ? 33  TYR A CZ   2  
ATOM   2547  O  OH   . TYR A 1 33  ? -13.993 -0.177  6.920   1.00 0.00 ? 33  TYR A OH   2  
ATOM   2548  H  H    . TYR A 1 33  ? -8.002  -5.608  6.373   1.00 0.00 ? 33  TYR A H    2  
ATOM   2549  H  HA   . TYR A 1 33  ? -7.911  -2.908  5.633   1.00 0.00 ? 33  TYR A HA   2  
ATOM   2550  H  HB2  . TYR A 1 33  ? -9.773  -4.177  4.985   1.00 0.00 ? 33  TYR A HB2  2  
ATOM   2551  H  HB3  . TYR A 1 33  ? -10.029 -4.813  6.588   1.00 0.00 ? 33  TYR A HB3  2  
ATOM   2552  H  HD1  . TYR A 1 33  ? -9.946  -1.304  5.170   1.00 0.00 ? 33  TYR A HD1  2  
ATOM   2553  H  HD2  . TYR A 1 33  ? -12.075 -4.281  7.448   1.00 0.00 ? 33  TYR A HD2  2  
ATOM   2554  H  HE1  . TYR A 1 33  ? -11.803 0.291   5.538   1.00 0.00 ? 33  TYR A HE1  2  
ATOM   2555  H  HE2  . TYR A 1 33  ? -13.912 -2.681  7.841   1.00 0.00 ? 33  TYR A HE2  2  
ATOM   2556  H  HH   . TYR A 1 33  ? -14.715 -0.523  7.467   1.00 0.00 ? 33  TYR A HH   2  
ATOM   2557  N  N    . TYR A 1 34  ? -8.533  -3.311  8.874   1.00 0.00 ? 34  TYR A N    2  
ATOM   2558  C  CA   . TYR A 1 34  ? -8.597  -2.605  10.145  1.00 0.00 ? 34  TYR A CA   2  
ATOM   2559  C  C    . TYR A 1 34  ? -7.249  -1.947  10.455  1.00 0.00 ? 34  TYR A C    2  
ATOM   2560  O  O    . TYR A 1 34  ? -7.208  -0.769  10.810  1.00 0.00 ? 34  TYR A O    2  
ATOM   2561  C  CB   . TYR A 1 34  ? -8.985  -3.575  11.275  1.00 0.00 ? 34  TYR A CB   2  
ATOM   2562  C  CG   . TYR A 1 34  ? -10.309 -4.327  11.175  1.00 0.00 ? 34  TYR A CG   2  
ATOM   2563  C  CD1  . TYR A 1 34  ? -11.364 -3.913  10.331  1.00 0.00 ? 34  TYR A CD1  2  
ATOM   2564  C  CD2  . TYR A 1 34  ? -10.481 -5.472  11.980  1.00 0.00 ? 34  TYR A CD2  2  
ATOM   2565  C  CE1  . TYR A 1 34  ? -12.576 -4.628  10.309  1.00 0.00 ? 34  TYR A CE1  2  
ATOM   2566  C  CE2  . TYR A 1 34  ? -11.688 -6.193  11.960  1.00 0.00 ? 34  TYR A CE2  2  
ATOM   2567  C  CZ   . TYR A 1 34  ? -12.746 -5.769  11.125  1.00 0.00 ? 34  TYR A CZ   2  
ATOM   2568  O  OH   . TYR A 1 34  ? -13.928 -6.448  11.097  1.00 0.00 ? 34  TYR A OH   2  
ATOM   2569  H  H    . TYR A 1 34  ? -8.693  -4.313  8.887   1.00 0.00 ? 34  TYR A H    2  
ATOM   2570  H  HA   . TYR A 1 34  ? -9.352  -1.822  10.076  1.00 0.00 ? 34  TYR A HA   2  
ATOM   2571  H  HB2  . TYR A 1 34  ? -8.188  -4.315  11.371  1.00 0.00 ? 34  TYR A HB2  2  
ATOM   2572  H  HB3  . TYR A 1 34  ? -9.004  -3.006  12.206  1.00 0.00 ? 34  TYR A HB3  2  
ATOM   2573  H  HD1  . TYR A 1 34  ? -11.257 -3.057  9.679   1.00 0.00 ? 34  TYR A HD1  2  
ATOM   2574  H  HD2  . TYR A 1 34  ? -9.677  -5.803  12.623  1.00 0.00 ? 34  TYR A HD2  2  
ATOM   2575  H  HE1  . TYR A 1 34  ? -13.380 -4.306  9.663   1.00 0.00 ? 34  TYR A HE1  2  
ATOM   2576  H  HE2  . TYR A 1 34  ? -11.798 -7.067  12.588  1.00 0.00 ? 34  TYR A HE2  2  
ATOM   2577  H  HH   . TYR A 1 34  ? -13.951 -7.208  11.700  1.00 0.00 ? 34  TYR A HH   2  
ATOM   2578  N  N    . TYR A 1 35  ? -6.145  -2.686  10.304  1.00 0.00 ? 35  TYR A N    2  
ATOM   2579  C  CA   . TYR A 1 35  ? -4.810  -2.178  10.602  1.00 0.00 ? 35  TYR A CA   2  
ATOM   2580  C  C    . TYR A 1 35  ? -4.394  -1.096  9.601   1.00 0.00 ? 35  TYR A C    2  
ATOM   2581  O  O    . TYR A 1 35  ? -3.808  -0.090  10.007  1.00 0.00 ? 35  TYR A O    2  
ATOM   2582  C  CB   . TYR A 1 35  ? -3.822  -3.353  10.588  1.00 0.00 ? 35  TYR A CB   2  
ATOM   2583  C  CG   . TYR A 1 35  ? -2.367  -2.957  10.768  1.00 0.00 ? 35  TYR A CG   2  
ATOM   2584  C  CD1  . TYR A 1 35  ? -1.799  -2.879  12.054  1.00 0.00 ? 35  TYR A CD1  2  
ATOM   2585  C  CD2  . TYR A 1 35  ? -1.579  -2.669  9.638   1.00 0.00 ? 35  TYR A CD2  2  
ATOM   2586  C  CE1  . TYR A 1 35  ? -0.447  -2.521  12.209  1.00 0.00 ? 35  TYR A CE1  2  
ATOM   2587  C  CE2  . TYR A 1 35  ? -0.236  -2.286  9.783   1.00 0.00 ? 35  TYR A CE2  2  
ATOM   2588  C  CZ   . TYR A 1 35  ? 0.338   -2.213  11.073  1.00 0.00 ? 35  TYR A CZ   2  
ATOM   2589  O  OH   . TYR A 1 35  ? 1.650   -1.872  11.224  1.00 0.00 ? 35  TYR A OH   2  
ATOM   2590  H  H    . TYR A 1 35  ? -6.229  -3.643  9.981   1.00 0.00 ? 35  TYR A H    2  
ATOM   2591  H  HA   . TYR A 1 35  ? -4.818  -1.721  11.598  1.00 0.00 ? 35  TYR A HA   2  
ATOM   2592  H  HB2  . TYR A 1 35  ? -4.098  -4.054  11.377  1.00 0.00 ? 35  TYR A HB2  2  
ATOM   2593  H  HB3  . TYR A 1 35  ? -3.917  -3.880  9.637   1.00 0.00 ? 35  TYR A HB3  2  
ATOM   2594  H  HD1  . TYR A 1 35  ? -2.398  -3.102  12.927  1.00 0.00 ? 35  TYR A HD1  2  
ATOM   2595  H  HD2  . TYR A 1 35  ? -2.012  -2.739  8.653   1.00 0.00 ? 35  TYR A HD2  2  
ATOM   2596  H  HE1  . TYR A 1 35  ? -0.018  -2.471  13.199  1.00 0.00 ? 35  TYR A HE1  2  
ATOM   2597  H  HE2  . TYR A 1 35  ? 0.350   -2.047  8.906   1.00 0.00 ? 35  TYR A HE2  2  
ATOM   2598  H  HH   . TYR A 1 35  ? 2.063   -1.604  10.387  1.00 0.00 ? 35  TYR A HH   2  
ATOM   2599  N  N    . LEU A 1 36  ? -4.694  -1.273  8.307   1.00 0.00 ? 36  LEU A N    2  
ATOM   2600  C  CA   . LEU A 1 36  ? -4.349  -0.300  7.285   1.00 0.00 ? 36  LEU A CA   2  
ATOM   2601  C  C    . LEU A 1 36  ? -5.097  0.987   7.546   1.00 0.00 ? 36  LEU A C    2  
ATOM   2602  O  O    . LEU A 1 36  ? -4.421  2.008   7.640   1.00 0.00 ? 36  LEU A O    2  
ATOM   2603  C  CB   . LEU A 1 36  ? -4.634  -0.818  5.866   1.00 0.00 ? 36  LEU A CB   2  
ATOM   2604  C  CG   . LEU A 1 36  ? -3.362  -1.256  5.119   1.00 0.00 ? 36  LEU A CG   2  
ATOM   2605  C  CD1  . LEU A 1 36  ? -2.463  -2.217  5.904   1.00 0.00 ? 36  LEU A CD1  2  
ATOM   2606  C  CD2  . LEU A 1 36  ? -3.786  -1.937  3.815   1.00 0.00 ? 36  LEU A CD2  2  
ATOM   2607  H  H    . LEU A 1 36  ? -5.188  -2.094  8.003   1.00 0.00 ? 36  LEU A H    2  
ATOM   2608  H  HA   . LEU A 1 36  ? -3.287  -0.069  7.374   1.00 0.00 ? 36  LEU A HA   2  
ATOM   2609  H  HB2  . LEU A 1 36  ? -5.360  -1.628  5.897   1.00 0.00 ? 36  LEU A HB2  2  
ATOM   2610  H  HB3  . LEU A 1 36  ? -5.088  -0.014  5.282   1.00 0.00 ? 36  LEU A HB3  2  
ATOM   2611  H  HG   . LEU A 1 36  ? -2.772  -0.362  4.900   1.00 0.00 ? 36  LEU A HG   2  
ATOM   2612  H  HD11 . LEU A 1 36  ? -3.064  -3.013  6.344   1.00 0.00 ? 36  LEU A HD11 2  
ATOM   2613  H  HD12 . LEU A 1 36  ? -1.707  -2.645  5.245   1.00 0.00 ? 36  LEU A HD12 2  
ATOM   2614  H  HD13 . LEU A 1 36  ? -1.942  -1.672  6.689   1.00 0.00 ? 36  LEU A HD13 2  
ATOM   2615  H  HD21 . LEU A 1 36  ? -2.917  -2.115  3.186   1.00 0.00 ? 36  LEU A HD21 2  
ATOM   2616  H  HD22 . LEU A 1 36  ? -4.271  -2.890  4.032   1.00 0.00 ? 36  LEU A HD22 2  
ATOM   2617  H  HD23 . LEU A 1 36  ? -4.489  -1.305  3.276   1.00 0.00 ? 36  LEU A HD23 2  
ATOM   2618  N  N    . ASP A 1 37  ? -6.430  0.963   7.734   1.00 0.00 ? 37  ASP A N    2  
ATOM   2619  C  CA   . ASP A 1 37  ? -7.114  2.204   8.092   1.00 0.00 ? 37  ASP A CA   2  
ATOM   2620  C  C    . ASP A 1 37  ? -6.469  2.765   9.313   1.00 0.00 ? 37  ASP A C    2  
ATOM   2621  O  O    . ASP A 1 37  ? -6.185  3.965   9.319   1.00 0.00 ? 37  ASP A O    2  
ATOM   2622  C  CB   . ASP A 1 37  ? -8.611  2.115   8.447   1.00 0.00 ? 37  ASP A CB   2  
ATOM   2623  C  CG   . ASP A 1 37  ? -9.170  3.502   8.917   1.00 0.00 ? 37  ASP A CG   2  
ATOM   2624  O  OD1  . ASP A 1 37  ? -8.814  4.048   10.004  1.00 0.00 ? 37  ASP A OD1  2  
ATOM   2625  O  OD2  . ASP A 1 37  ? -10.002 4.060   8.169   1.00 0.00 ? 37  ASP A OD2  2  
ATOM   2626  H  H    . ASP A 1 37  ? -6.948  0.087   7.722   1.00 0.00 ? 37  ASP A H    2  
ATOM   2627  H  HA   . ASP A 1 37  ? -6.959  2.925   7.295   1.00 0.00 ? 37  ASP A HA   2  
ATOM   2628  H  HB2  . ASP A 1 37  ? -9.162  1.766   7.573   1.00 0.00 ? 37  ASP A HB2  2  
ATOM   2629  H  HB3  . ASP A 1 37  ? -8.757  1.379   9.240   1.00 0.00 ? 37  ASP A HB3  2  
ATOM   2630  N  N    . ASP A 1 38  ? -6.229  1.948   10.348  1.00 0.00 ? 38  ASP A N    2  
ATOM   2631  C  CA   . ASP A 1 38  ? -5.849  2.613   11.563  1.00 0.00 ? 38  ASP A CA   2  
ATOM   2632  C  C    . ASP A 1 38  ? -4.526  3.359   11.438  1.00 0.00 ? 38  ASP A C    2  
ATOM   2633  O  O    . ASP A 1 38  ? -4.411  4.470   11.959  1.00 0.00 ? 38  ASP A O    2  
ATOM   2634  C  CB   . ASP A 1 38  ? -6.027  1.853   12.866  1.00 0.00 ? 38  ASP A CB   2  
ATOM   2635  C  CG   . ASP A 1 38  ? -6.178  2.931   13.977  1.00 0.00 ? 38  ASP A CG   2  
ATOM   2636  O  OD1  . ASP A 1 38  ? -6.699  4.051   13.695  1.00 0.00 ? 38  ASP A OD1  2  
ATOM   2637  O  OD2  . ASP A 1 38  ? -5.788  2.659   15.135  1.00 0.00 ? 38  ASP A OD2  2  
ATOM   2638  H  H    . ASP A 1 38  ? -6.456  0.956   10.340  1.00 0.00 ? 38  ASP A H    2  
ATOM   2639  H  HA   . ASP A 1 38  ? -6.627  3.358   11.605  1.00 0.00 ? 38  ASP A HA   2  
ATOM   2640  H  HB2  . ASP A 1 38  ? -6.935  1.249   12.821  1.00 0.00 ? 38  ASP A HB2  2  
ATOM   2641  H  HB3  . ASP A 1 38  ? -5.173  1.189   13.034  1.00 0.00 ? 38  ASP A HB3  2  
ATOM   2642  N  N    . THR A 1 39  ? -3.630  2.842   10.602  1.00 0.00 ? 39  THR A N    2  
ATOM   2643  C  CA   . THR A 1 39  ? -2.320  3.417   10.385  1.00 0.00 ? 39  THR A CA   2  
ATOM   2644  C  C    . THR A 1 39  ? -2.430  4.681   9.518   1.00 0.00 ? 39  THR A C    2  
ATOM   2645  O  O    . THR A 1 39  ? -1.764  5.681   9.789   1.00 0.00 ? 39  THR A O    2  
ATOM   2646  C  CB   . THR A 1 39  ? -1.448  2.330   9.737   1.00 0.00 ? 39  THR A CB   2  
ATOM   2647  O  OG1  . THR A 1 39  ? -1.413  1.162   10.535  1.00 0.00 ? 39  THR A OG1  2  
ATOM   2648  C  CG2  . THR A 1 39  ? -0.025  2.838   9.549   1.00 0.00 ? 39  THR A CG2  2  
ATOM   2649  H  H    . THR A 1 39  ? -3.919  2.065   9.990   1.00 0.00 ? 39  THR A H    2  
ATOM   2650  H  HA   . THR A 1 39  ? -1.889  3.693   11.349  1.00 0.00 ? 39  THR A HA   2  
ATOM   2651  H  HB   . THR A 1 39  ? -1.861  2.070   8.761   1.00 0.00 ? 39  THR A HB   2  
ATOM   2652  H  HG1  . THR A 1 39  ? -2.268  0.706   10.417  1.00 0.00 ? 39  THR A HG1  2  
ATOM   2653  H  HG21 . THR A 1 39  ? 0.391   3.170   10.499  1.00 0.00 ? 39  THR A HG21 2  
ATOM   2654  H  HG22 . THR A 1 39  ? 0.600   2.056   9.120   1.00 0.00 ? 39  THR A HG22 2  
ATOM   2655  H  HG23 . THR A 1 39  ? -0.071  3.678   8.858   1.00 0.00 ? 39  THR A HG23 2  
ATOM   2656  N  N    . LEU A 1 40  ? -3.273  4.646   8.484   1.00 0.00 ? 40  LEU A N    2  
ATOM   2657  C  CA   . LEU A 1 40  ? -3.551  5.767   7.600   1.00 0.00 ? 40  LEU A CA   2  
ATOM   2658  C  C    . LEU A 1 40  ? -4.292  6.849   8.402   1.00 0.00 ? 40  LEU A C    2  
ATOM   2659  O  O    . LEU A 1 40  ? -5.219  6.561   9.174   1.00 0.00 ? 40  LEU A O    2  
ATOM   2660  C  CB   . LEU A 1 40  ? -4.405  5.264   6.416   1.00 0.00 ? 40  LEU A CB   2  
ATOM   2661  C  CG   . LEU A 1 40  ? -3.739  4.172   5.540   1.00 0.00 ? 40  LEU A CG   2  
ATOM   2662  C  CD1  . LEU A 1 40  ? -4.758  3.386   4.707   1.00 0.00 ? 40  LEU A CD1  2  
ATOM   2663  C  CD2  . LEU A 1 40  ? -2.712  4.729   4.558   1.00 0.00 ? 40  LEU A CD2  2  
ATOM   2664  H  H    . LEU A 1 40  ? -3.813  3.812   8.323   1.00 0.00 ? 40  LEU A H    2  
ATOM   2665  H  HA   . LEU A 1 40  ? -2.612  6.169   7.220   1.00 0.00 ? 40  LEU A HA   2  
ATOM   2666  H  HB2  . LEU A 1 40  ? -5.322  4.853   6.838   1.00 0.00 ? 40  LEU A HB2  2  
ATOM   2667  H  HB3  . LEU A 1 40  ? -4.679  6.112   5.787   1.00 0.00 ? 40  LEU A HB3  2  
ATOM   2668  H  HG   . LEU A 1 40  ? -3.218  3.467   6.186   1.00 0.00 ? 40  LEU A HG   2  
ATOM   2669  H  HD11 . LEU A 1 40  ? -5.585  3.052   5.332   1.00 0.00 ? 40  LEU A HD11 2  
ATOM   2670  H  HD12 . LEU A 1 40  ? -5.138  4.006   3.898   1.00 0.00 ? 40  LEU A HD12 2  
ATOM   2671  H  HD13 . LEU A 1 40  ? -4.280  2.506   4.275   1.00 0.00 ? 40  LEU A HD13 2  
ATOM   2672  H  HD21 . LEU A 1 40  ? -2.336  3.919   3.937   1.00 0.00 ? 40  LEU A HD21 2  
ATOM   2673  H  HD22 . LEU A 1 40  ? -3.162  5.488   3.918   1.00 0.00 ? 40  LEU A HD22 2  
ATOM   2674  H  HD23 . LEU A 1 40  ? -1.876  5.151   5.104   1.00 0.00 ? 40  LEU A HD23 2  
ATOM   2675  N  N    . GLU A 1 41  ? -3.923  8.111   8.188   1.00 0.00 ? 41  GLU A N    2  
ATOM   2676  C  CA   . GLU A 1 41  ? -4.517  9.270   8.850   1.00 0.00 ? 41  GLU A CA   2  
ATOM   2677  C  C    . GLU A 1 41  ? -5.101  10.190  7.775   1.00 0.00 ? 41  GLU A C    2  
ATOM   2678  O  O    . GLU A 1 41  ? -4.631  11.301  7.523   1.00 0.00 ? 41  GLU A O    2  
ATOM   2679  C  CB   . GLU A 1 41  ? -3.510  9.931   9.807   1.00 0.00 ? 41  GLU A CB   2  
ATOM   2680  C  CG   . GLU A 1 41  ? -3.231  9.062   11.046  1.00 0.00 ? 41  GLU A CG   2  
ATOM   2681  C  CD   . GLU A 1 41  ? -4.450  8.954   11.987  1.00 0.00 ? 41  GLU A CD   2  
ATOM   2682  O  OE1  . GLU A 1 41  ? -4.598  9.810   12.889  1.00 0.00 ? 41  GLU A OE1  2  
ATOM   2683  O  OE2  . GLU A 1 41  ? -5.269  8.013   11.847  1.00 0.00 ? 41  GLU A OE2  2  
ATOM   2684  H  H    . GLU A 1 41  ? -3.097  8.291   7.623   1.00 0.00 ? 41  GLU A H    2  
ATOM   2685  H  HA   . GLU A 1 41  ? -5.365  8.945   9.451   1.00 0.00 ? 41  GLU A HA   2  
ATOM   2686  H  HB2  . GLU A 1 41  ? -2.573  10.112  9.278   1.00 0.00 ? 41  GLU A HB2  2  
ATOM   2687  H  HB3  . GLU A 1 41  ? -3.904  10.891  10.143  1.00 0.00 ? 41  GLU A HB3  2  
ATOM   2688  H  HG2  . GLU A 1 41  ? -2.916  8.068   10.727  1.00 0.00 ? 41  GLU A HG2  2  
ATOM   2689  H  HG3  . GLU A 1 41  ? -2.396  9.505   11.593  1.00 0.00 ? 41  GLU A HG3  2  
ATOM   2690  N  N    . PHE A 1 42  ? -6.126  9.657   7.106   1.00 0.00 ? 42  PHE A N    2  
ATOM   2691  C  CA   . PHE A 1 42  ? -6.958  10.343  6.125   1.00 0.00 ? 42  PHE A CA   2  
ATOM   2692  C  C    . PHE A 1 42  ? -7.596  11.631  6.696   1.00 0.00 ? 42  PHE A C    2  
ATOM   2693  O  O    . PHE A 1 42  ? -7.759  11.735  7.917   1.00 0.00 ? 42  PHE A O    2  
ATOM   2694  C  CB   . PHE A 1 42  ? -8.086  9.390   5.707   1.00 0.00 ? 42  PHE A CB   2  
ATOM   2695  C  CG   . PHE A 1 42  ? -7.689  8.034   5.157   1.00 0.00 ? 42  PHE A CG   2  
ATOM   2696  C  CD1  . PHE A 1 42  ? -7.474  7.881   3.773   1.00 0.00 ? 42  PHE A CD1  2  
ATOM   2697  C  CD2  . PHE A 1 42  ? -7.694  6.897   5.993   1.00 0.00 ? 42  PHE A CD2  2  
ATOM   2698  C  CE1  . PHE A 1 42  ? -7.325  6.594   3.225   1.00 0.00 ? 42  PHE A CE1  2  
ATOM   2699  C  CE2  . PHE A 1 42  ? -7.569  5.616   5.434   1.00 0.00 ? 42  PHE A CE2  2  
ATOM   2700  C  CZ   . PHE A 1 42  ? -7.398  5.464   4.050   1.00 0.00 ? 42  PHE A CZ   2  
ATOM   2701  H  H    . PHE A 1 42  ? -6.401  8.717   7.348   1.00 0.00 ? 42  PHE A H    2  
ATOM   2702  H  HA   . PHE A 1 42  ? -6.343  10.579  5.261   1.00 0.00 ? 42  PHE A HA   2  
ATOM   2703  H  HB2  . PHE A 1 42  ? -8.742  9.233   6.565   1.00 0.00 ? 42  PHE A HB2  2  
ATOM   2704  H  HB3  . PHE A 1 42  ? -8.690  9.885   4.950   1.00 0.00 ? 42  PHE A HB3  2  
ATOM   2705  H  HD1  . PHE A 1 42  ? -7.465  8.745   3.123   1.00 0.00 ? 42  PHE A HD1  2  
ATOM   2706  H  HD2  . PHE A 1 42  ? -7.830  6.985   7.062   1.00 0.00 ? 42  PHE A HD2  2  
ATOM   2707  H  HE1  . PHE A 1 42  ? -7.174  6.463   2.167   1.00 0.00 ? 42  PHE A HE1  2  
ATOM   2708  H  HE2  . PHE A 1 42  ? -7.612  4.747   6.073   1.00 0.00 ? 42  PHE A HE2  2  
ATOM   2709  H  HZ   . PHE A 1 42  ? -7.317  4.479   3.616   1.00 0.00 ? 42  PHE A HZ   2  
ATOM   2710  N  N    . PRO A 1 43  ? -8.058  12.569  5.844   1.00 0.00 ? 43  PRO A N    2  
ATOM   2711  C  CA   . PRO A 1 43  ? -7.837  12.604  4.401   1.00 0.00 ? 43  PRO A CA   2  
ATOM   2712  C  C    . PRO A 1 43  ? -6.381  12.973  4.096   1.00 0.00 ? 43  PRO A C    2  
ATOM   2713  O  O    . PRO A 1 43  ? -5.702  13.596  4.918   1.00 0.00 ? 43  PRO A O    2  
ATOM   2714  C  CB   . PRO A 1 43  ? -8.814  13.656  3.863   1.00 0.00 ? 43  PRO A CB   2  
ATOM   2715  C  CG   . PRO A 1 43  ? -8.951  14.633  5.030   1.00 0.00 ? 43  PRO A CG   2  
ATOM   2716  C  CD   . PRO A 1 43  ? -8.831  13.732  6.260   1.00 0.00 ? 43  PRO A CD   2  
ATOM   2717  H  HA   . PRO A 1 43  ? -8.071  11.645  3.946   1.00 0.00 ? 43  PRO A HA   2  
ATOM   2718  H  HB2  . PRO A 1 43  ? -8.445  14.144  2.960   1.00 0.00 ? 43  PRO A HB2  2  
ATOM   2719  H  HB3  . PRO A 1 43  ? -9.780  13.187  3.665   1.00 0.00 ? 43  PRO A HB3  2  
ATOM   2720  H  HG2  . PRO A 1 43  ? -8.123  15.343  5.014   1.00 0.00 ? 43  PRO A HG2  2  
ATOM   2721  H  HG3  . PRO A 1 43  ? -9.906  15.160  5.006   1.00 0.00 ? 43  PRO A HG3  2  
ATOM   2722  H  HD2  . PRO A 1 43  ? -8.336  14.265  7.072   1.00 0.00 ? 43  PRO A HD2  2  
ATOM   2723  H  HD3  . PRO A 1 43  ? -9.823  13.406  6.576   1.00 0.00 ? 43  PRO A HD3  2  
ATOM   2724  N  N    . PHE A 1 44  ? -5.901  12.600  2.911   1.00 0.00 ? 44  PHE A N    2  
ATOM   2725  C  CA   . PHE A 1 44  ? -4.571  12.964  2.434   1.00 0.00 ? 44  PHE A CA   2  
ATOM   2726  C  C    . PHE A 1 44  ? -4.591  13.099  0.912   1.00 0.00 ? 44  PHE A C    2  
ATOM   2727  O  O    . PHE A 1 44  ? -5.495  12.591  0.256   1.00 0.00 ? 44  PHE A O    2  
ATOM   2728  C  CB   . PHE A 1 44  ? -3.527  11.940  2.909   1.00 0.00 ? 44  PHE A CB   2  
ATOM   2729  C  CG   . PHE A 1 44  ? -3.647  10.525  2.364   1.00 0.00 ? 44  PHE A CG   2  
ATOM   2730  C  CD1  . PHE A 1 44  ? -3.074  10.213  1.119   1.00 0.00 ? 44  PHE A CD1  2  
ATOM   2731  C  CD2  . PHE A 1 44  ? -4.250  9.499   3.117   1.00 0.00 ? 44  PHE A CD2  2  
ATOM   2732  C  CE1  . PHE A 1 44  ? -3.127  8.909   0.606   1.00 0.00 ? 44  PHE A CE1  2  
ATOM   2733  C  CE2  . PHE A 1 44  ? -4.284  8.184   2.618   1.00 0.00 ? 44  PHE A CE2  2  
ATOM   2734  C  CZ   . PHE A 1 44  ? -3.732  7.888   1.358   1.00 0.00 ? 44  PHE A CZ   2  
ATOM   2735  H  H    . PHE A 1 44  ? -6.514  12.122  2.252   1.00 0.00 ? 44  PHE A H    2  
ATOM   2736  H  HA   . PHE A 1 44  ? -4.305  13.937  2.851   1.00 0.00 ? 44  PHE A HA   2  
ATOM   2737  H  HB2  . PHE A 1 44  ? -2.550  12.326  2.620   1.00 0.00 ? 44  PHE A HB2  2  
ATOM   2738  H  HB3  . PHE A 1 44  ? -3.541  11.901  4.000   1.00 0.00 ? 44  PHE A HB3  2  
ATOM   2739  H  HD1  . PHE A 1 44  ? -2.572  10.979  0.558   1.00 0.00 ? 44  PHE A HD1  2  
ATOM   2740  H  HD2  . PHE A 1 44  ? -4.657  9.707   4.095   1.00 0.00 ? 44  PHE A HD2  2  
ATOM   2741  H  HE1  . PHE A 1 44  ? -2.683  8.700   -0.358  1.00 0.00 ? 44  PHE A HE1  2  
ATOM   2742  H  HE2  . PHE A 1 44  ? -4.724  7.396   3.210   1.00 0.00 ? 44  PHE A HE2  2  
ATOM   2743  H  HZ   . PHE A 1 44  ? -3.762  6.877   0.977   1.00 0.00 ? 44  PHE A HZ   2  
ATOM   2744  N  N    . MET A 1 45  ? -3.611  13.785  0.329   1.00 0.00 ? 45  MET A N    2  
ATOM   2745  C  CA   . MET A 1 45  ? -3.529  13.967  -1.117  1.00 0.00 ? 45  MET A CA   2  
ATOM   2746  C  C    . MET A 1 45  ? -2.751  12.796  -1.720  1.00 0.00 ? 45  MET A C    2  
ATOM   2747  O  O    . MET A 1 45  ? -1.742  12.381  -1.147  1.00 0.00 ? 45  MET A O    2  
ATOM   2748  C  CB   . MET A 1 45  ? -2.809  15.295  -1.378  1.00 0.00 ? 45  MET A CB   2  
ATOM   2749  C  CG   . MET A 1 45  ? -2.787  15.654  -2.860  1.00 0.00 ? 45  MET A CG   2  
ATOM   2750  S  SD   . MET A 1 45  ? -1.728  17.068  -3.238  1.00 0.00 ? 45  MET A SD   2  
ATOM   2751  C  CE   . MET A 1 45  ? -1.918  16.996  -5.029  1.00 0.00 ? 45  MET A CE   2  
ATOM   2752  H  H    . MET A 1 45  ? -2.848  14.138  0.889   1.00 0.00 ? 45  MET A H    2  
ATOM   2753  H  HA   . MET A 1 45  ? -4.534  14.001  -1.543  1.00 0.00 ? 45  MET A HA   2  
ATOM   2754  H  HB2  . MET A 1 45  ? -3.315  16.096  -0.837  1.00 0.00 ? 45  MET A HB2  2  
ATOM   2755  H  HB3  . MET A 1 45  ? -1.782  15.225  -1.014  1.00 0.00 ? 45  MET A HB3  2  
ATOM   2756  H  HG2  . MET A 1 45  ? -2.415  14.805  -3.430  1.00 0.00 ? 45  MET A HG2  2  
ATOM   2757  H  HG3  . MET A 1 45  ? -3.805  15.868  -3.191  1.00 0.00 ? 45  MET A HG3  2  
ATOM   2758  H  HE1  . MET A 1 45  ? -2.957  17.207  -5.284  1.00 0.00 ? 45  MET A HE1  2  
ATOM   2759  H  HE2  . MET A 1 45  ? -1.265  17.725  -5.507  1.00 0.00 ? 45  MET A HE2  2  
ATOM   2760  H  HE3  . MET A 1 45  ? -1.672  15.990  -5.375  1.00 0.00 ? 45  MET A HE3  2  
ATOM   2761  N  N    . GLY A 1 46  ? -3.140  12.292  -2.894  1.00 0.00 ? 46  GLY A N    2  
ATOM   2762  C  CA   . GLY A 1 46  ? -2.365  11.282  -3.587  1.00 0.00 ? 46  GLY A CA   2  
ATOM   2763  C  C    . GLY A 1 46  ? -2.529  11.380  -5.092  1.00 0.00 ? 46  GLY A C    2  
ATOM   2764  O  O    . GLY A 1 46  ? -3.372  12.113  -5.611  1.00 0.00 ? 46  GLY A O    2  
ATOM   2765  H  H    . GLY A 1 46  ? -3.944  12.664  -3.390  1.00 0.00 ? 46  GLY A H    2  
ATOM   2766  H  HA2  . GLY A 1 46  ? -1.310  11.405  -3.352  1.00 0.00 ? 46  GLY A HA2  2  
ATOM   2767  H  HA3  . GLY A 1 46  ? -2.682  10.293  -3.258  1.00 0.00 ? 46  GLY A HA3  2  
ATOM   2768  N  N    . LYS A 1 47  ? -1.692  10.636  -5.803  1.00 0.00 ? 47  LYS A N    2  
ATOM   2769  C  CA   . LYS A 1 47  ? -1.835  10.427  -7.234  1.00 0.00 ? 47  LYS A CA   2  
ATOM   2770  C  C    . LYS A 1 47  ? -2.441  9.040   -7.415  1.00 0.00 ? 47  LYS A C    2  
ATOM   2771  O  O    . LYS A 1 47  ? -1.917  8.060   -6.880  1.00 0.00 ? 47  LYS A O    2  
ATOM   2772  C  CB   . LYS A 1 47  ? -0.457  10.522  -7.920  1.00 0.00 ? 47  LYS A CB   2  
ATOM   2773  C  CG   . LYS A 1 47  ? -0.555  10.767  -9.434  1.00 0.00 ? 47  LYS A CG   2  
ATOM   2774  C  CD   . LYS A 1 47  ? -0.964  12.204  -9.810  1.00 0.00 ? 47  LYS A CD   2  
ATOM   2775  C  CE   . LYS A 1 47  ? 0.137   13.236  -9.519  1.00 0.00 ? 47  LYS A CE   2  
ATOM   2776  N  NZ   . LYS A 1 47  ? -0.177  14.564  -10.106 1.00 0.00 ? 47  LYS A NZ   2  
ATOM   2777  H  H    . LYS A 1 47  ? -1.024  10.069  -5.301  1.00 0.00 ? 47  LYS A H    2  
ATOM   2778  H  HA   . LYS A 1 47  ? -2.520  11.181  -7.631  1.00 0.00 ? 47  LYS A HA   2  
ATOM   2779  H  HB2  . LYS A 1 47  ? 0.133   11.319  -7.474  1.00 0.00 ? 47  LYS A HB2  2  
ATOM   2780  H  HB3  . LYS A 1 47  ? 0.089   9.592   -7.751  1.00 0.00 ? 47  LYS A HB3  2  
ATOM   2781  H  HG2  . LYS A 1 47  ? 0.417   10.554  -9.880  1.00 0.00 ? 47  LYS A HG2  2  
ATOM   2782  H  HG3  . LYS A 1 47  ? -1.275  10.068  -9.862  1.00 0.00 ? 47  LYS A HG3  2  
ATOM   2783  H  HD2  . LYS A 1 47  ? -1.197  12.230  -10.873 1.00 0.00 ? 47  LYS A HD2  2  
ATOM   2784  H  HD3  . LYS A 1 47  ? -1.860  12.482  -9.262  1.00 0.00 ? 47  LYS A HD3  2  
ATOM   2785  H  HE2  . LYS A 1 47  ? 0.257   13.332  -8.437  1.00 0.00 ? 47  LYS A HE2  2  
ATOM   2786  H  HE3  . LYS A 1 47  ? 1.083   12.875  -9.932  1.00 0.00 ? 47  LYS A HE3  2  
ATOM   2787  H  HZ1  . LYS A 1 47  ? 0.500   15.256  -9.817  1.00 0.00 ? 47  LYS A HZ1  2  
ATOM   2788  H  HZ2  . LYS A 1 47  ? -0.161  14.532  -11.115 1.00 0.00 ? 47  LYS A HZ2  2  
ATOM   2789  H  HZ3  . LYS A 1 47  ? -1.099  14.893  -9.831  1.00 0.00 ? 47  LYS A HZ3  2  
ATOM   2790  N  N    . TRP A 1 48  ? -3.546  8.950   -8.145  1.00 0.00 ? 48  TRP A N    2  
ATOM   2791  C  CA   . TRP A 1 48  ? -4.097  7.683   -8.583  1.00 0.00 ? 48  TRP A CA   2  
ATOM   2792  C  C    . TRP A 1 48  ? -3.309  7.306   -9.836  1.00 0.00 ? 48  TRP A C    2  
ATOM   2793  O  O    . TRP A 1 48  ? -3.441  7.961   -10.873 1.00 0.00 ? 48  TRP A O    2  
ATOM   2794  C  CB   . TRP A 1 48  ? -5.607  7.820   -8.851  1.00 0.00 ? 48  TRP A CB   2  
ATOM   2795  C  CG   . TRP A 1 48  ? -6.357  6.563   -9.197  1.00 0.00 ? 48  TRP A CG   2  
ATOM   2796  C  CD1  . TRP A 1 48  ? -5.831  5.325   -9.330  1.00 0.00 ? 48  TRP A CD1  2  
ATOM   2797  C  CD2  . TRP A 1 48  ? -7.789  6.389   -9.437  1.00 0.00 ? 48  TRP A CD2  2  
ATOM   2798  N  NE1  . TRP A 1 48  ? -6.809  4.415   -9.653  1.00 0.00 ? 48  TRP A NE1  2  
ATOM   2799  C  CE2  . TRP A 1 48  ? -8.049  5.009   -9.708  1.00 0.00 ? 48  TRP A CE2  2  
ATOM   2800  C  CE3  . TRP A 1 48  ? -8.900  7.260   -9.436  1.00 0.00 ? 48  TRP A CE3  2  
ATOM   2801  C  CZ2  . TRP A 1 48  ? -9.342  4.520   -9.946  1.00 0.00 ? 48  TRP A CZ2  2  
ATOM   2802  C  CZ3  . TRP A 1 48  ? -10.202 6.780   -9.681  1.00 0.00 ? 48  TRP A CZ3  2  
ATOM   2803  C  CH2  . TRP A 1 48  ? -10.426 5.414   -9.926  1.00 0.00 ? 48  TRP A CH2  2  
ATOM   2804  H  H    . TRP A 1 48  ? -3.935  9.791   -8.558  1.00 0.00 ? 48  TRP A H    2  
ATOM   2805  H  HA   . TRP A 1 48  ? -3.947  6.928   -7.809  1.00 0.00 ? 48  TRP A HA   2  
ATOM   2806  H  HB2  . TRP A 1 48  ? -6.073  8.236   -7.957  1.00 0.00 ? 48  TRP A HB2  2  
ATOM   2807  H  HB3  . TRP A 1 48  ? -5.760  8.538   -9.658  1.00 0.00 ? 48  TRP A HB3  2  
ATOM   2808  H  HD1  . TRP A 1 48  ? -4.793  5.065   -9.199  1.00 0.00 ? 48  TRP A HD1  2  
ATOM   2809  H  HE1  . TRP A 1 48  ? -6.591  3.424   -9.809  1.00 0.00 ? 48  TRP A HE1  2  
ATOM   2810  H  HE3  . TRP A 1 48  ? -8.745  8.308   -9.228  1.00 0.00 ? 48  TRP A HE3  2  
ATOM   2811  H  HZ2  . TRP A 1 48  ? -9.505  3.467   -10.132 1.00 0.00 ? 48  TRP A HZ2  2  
ATOM   2812  H  HZ3  . TRP A 1 48  ? -11.037 7.465   -9.668  1.00 0.00 ? 48  TRP A HZ3  2  
ATOM   2813  H  HH2  . TRP A 1 48  ? -11.431 5.050   -10.095 1.00 0.00 ? 48  TRP A HH2  2  
ATOM   2814  N  N    . LYS A 1 49  ? -2.463  6.279   -9.740  1.00 0.00 ? 49  LYS A N    2  
ATOM   2815  C  CA   . LYS A 1 49  ? -1.795  5.651   -10.879 1.00 0.00 ? 49  LYS A CA   2  
ATOM   2816  C  C    . LYS A 1 49  ? -2.792  4.708   -11.566 1.00 0.00 ? 49  LYS A C    2  
ATOM   2817  O  O    . LYS A 1 49  ? -2.670  3.484   -11.489 1.00 0.00 ? 49  LYS A O    2  
ATOM   2818  C  CB   . LYS A 1 49  ? -0.515  4.941   -10.394 1.00 0.00 ? 49  LYS A CB   2  
ATOM   2819  C  CG   . LYS A 1 49  ? 0.640   5.944   -10.281 1.00 0.00 ? 49  LYS A CG   2  
ATOM   2820  C  CD   . LYS A 1 49  ? 1.914   5.297   -9.726  1.00 0.00 ? 49  LYS A CD   2  
ATOM   2821  C  CE   . LYS A 1 49  ? 3.109   6.209   -10.033 1.00 0.00 ? 49  LYS A CE   2  
ATOM   2822  N  NZ   . LYS A 1 49  ? 4.358   5.743   -9.385  1.00 0.00 ? 49  LYS A NZ   2  
ATOM   2823  H  H    . LYS A 1 49  ? -2.396  5.783   -8.862  1.00 0.00 ? 49  LYS A H    2  
ATOM   2824  H  HA   . LYS A 1 49  ? -1.519  6.419   -11.603 1.00 0.00 ? 49  LYS A HA   2  
ATOM   2825  H  HB2  . LYS A 1 49  ? -0.693  4.455   -9.434  1.00 0.00 ? 49  LYS A HB2  2  
ATOM   2826  H  HB3  . LYS A 1 49  ? -0.223  4.178   -11.114 1.00 0.00 ? 49  LYS A HB3  2  
ATOM   2827  H  HG2  . LYS A 1 49  ? 0.847   6.328   -11.279 1.00 0.00 ? 49  LYS A HG2  2  
ATOM   2828  H  HG3  . LYS A 1 49  ? 0.352   6.776   -9.636  1.00 0.00 ? 49  LYS A HG3  2  
ATOM   2829  H  HD2  . LYS A 1 49  ? 1.806   5.157   -8.649  1.00 0.00 ? 49  LYS A HD2  2  
ATOM   2830  H  HD3  . LYS A 1 49  ? 2.074   4.327   -10.202 1.00 0.00 ? 49  LYS A HD3  2  
ATOM   2831  H  HE2  . LYS A 1 49  ? 3.244   6.240   -11.117 1.00 0.00 ? 49  LYS A HE2  2  
ATOM   2832  H  HE3  . LYS A 1 49  ? 2.882   7.221   -9.688  1.00 0.00 ? 49  LYS A HE3  2  
ATOM   2833  H  HZ1  . LYS A 1 49  ? 4.559   4.781   -9.609  1.00 0.00 ? 49  LYS A HZ1  2  
ATOM   2834  H  HZ2  . LYS A 1 49  ? 5.143   6.303   -9.683  1.00 0.00 ? 49  LYS A HZ2  2  
ATOM   2835  H  HZ3  . LYS A 1 49  ? 4.293   5.840   -8.370  1.00 0.00 ? 49  LYS A HZ3  2  
ATOM   2836  N  N    . LYS A 1 50  ? -3.843  5.275   -12.157 1.00 0.00 ? 50  LYS A N    2  
ATOM   2837  C  CA   . LYS A 1 50  ? -4.935  4.524   -12.765 1.00 0.00 ? 50  LYS A CA   2  
ATOM   2838  C  C    . LYS A 1 50  ? -4.414  3.804   -14.011 1.00 0.00 ? 50  LYS A C    2  
ATOM   2839  O  O    . LYS A 1 50  ? -3.798  4.430   -14.870 1.00 0.00 ? 50  LYS A O    2  
ATOM   2840  C  CB   . LYS A 1 50  ? -6.083  5.502   -13.069 1.00 0.00 ? 50  LYS A CB   2  
ATOM   2841  C  CG   . LYS A 1 50  ? -7.415  4.783   -13.328 1.00 0.00 ? 50  LYS A CG   2  
ATOM   2842  C  CD   . LYS A 1 50  ? -8.579  5.788   -13.360 1.00 0.00 ? 50  LYS A CD   2  
ATOM   2843  C  CE   . LYS A 1 50  ? -9.957  5.106   -13.352 1.00 0.00 ? 50  LYS A CE   2  
ATOM   2844  N  NZ   . LYS A 1 50  ? -10.300 4.454   -14.639 1.00 0.00 ? 50  LYS A NZ   2  
ATOM   2845  H  H    . LYS A 1 50  ? -3.834  6.283   -12.275 1.00 0.00 ? 50  LYS A H    2  
ATOM   2846  H  HA   . LYS A 1 50  ? -5.276  3.787   -12.035 1.00 0.00 ? 50  LYS A HA   2  
ATOM   2847  H  HB2  . LYS A 1 50  ? -6.212  6.156   -12.205 1.00 0.00 ? 50  LYS A HB2  2  
ATOM   2848  H  HB3  . LYS A 1 50  ? -5.826  6.124   -13.929 1.00 0.00 ? 50  LYS A HB3  2  
ATOM   2849  H  HG2  . LYS A 1 50  ? -7.357  4.252   -14.276 1.00 0.00 ? 50  LYS A HG2  2  
ATOM   2850  H  HG3  . LYS A 1 50  ? -7.593  4.062   -12.529 1.00 0.00 ? 50  LYS A HG3  2  
ATOM   2851  H  HD2  . LYS A 1 50  ? -8.523  6.412   -12.466 1.00 0.00 ? 50  LYS A HD2  2  
ATOM   2852  H  HD3  . LYS A 1 50  ? -8.485  6.440   -14.230 1.00 0.00 ? 50  LYS A HD3  2  
ATOM   2853  H  HE2  . LYS A 1 50  ? -9.978  4.368   -12.547 1.00 0.00 ? 50  LYS A HE2  2  
ATOM   2854  H  HE3  . LYS A 1 50  ? -10.712 5.863   -13.126 1.00 0.00 ? 50  LYS A HE3  2  
ATOM   2855  H  HZ1  . LYS A 1 50  ? -11.205 4.008   -14.581 1.00 0.00 ? 50  LYS A HZ1  2  
ATOM   2856  H  HZ2  . LYS A 1 50  ? -10.341 5.126   -15.391 1.00 0.00 ? 50  LYS A HZ2  2  
ATOM   2857  H  HZ3  . LYS A 1 50  ? -9.625  3.735   -14.888 1.00 0.00 ? 50  LYS A HZ3  2  
ATOM   2858  N  N    . LYS A 1 51  ? -4.657  2.497   -14.138 1.00 0.00 ? 51  LYS A N    2  
ATOM   2859  C  CA   . LYS A 1 51  ? -4.113  1.681   -15.237 1.00 0.00 ? 51  LYS A CA   2  
ATOM   2860  C  C    . LYS A 1 51  ? -4.950  1.716   -16.524 1.00 0.00 ? 51  LYS A C    2  
ATOM   2861  O  O    . LYS A 1 51  ? -4.700  0.933   -17.438 1.00 0.00 ? 51  LYS A O    2  
ATOM   2862  C  CB   . LYS A 1 51  ? -3.878  0.246   -14.737 1.00 0.00 ? 51  LYS A CB   2  
ATOM   2863  C  CG   . LYS A 1 51  ? -5.183  -0.547  -14.536 1.00 0.00 ? 51  LYS A CG   2  
ATOM   2864  C  CD   . LYS A 1 51  ? -5.033  -1.669  -13.500 1.00 0.00 ? 51  LYS A CD   2  
ATOM   2865  C  CE   . LYS A 1 51  ? -4.953  -1.042  -12.102 1.00 0.00 ? 51  LYS A CE   2  
ATOM   2866  N  NZ   . LYS A 1 51  ? -4.682  -2.017  -11.024 1.00 0.00 ? 51  LYS A NZ   2  
ATOM   2867  H  H    . LYS A 1 51  ? -5.111  2.009   -13.379 1.00 0.00 ? 51  LYS A H    2  
ATOM   2868  H  HA   . LYS A 1 51  ? -3.135  2.083   -15.498 1.00 0.00 ? 51  LYS A HA   2  
ATOM   2869  H  HB2  . LYS A 1 51  ? -3.257  -0.288  -15.457 1.00 0.00 ? 51  LYS A HB2  2  
ATOM   2870  H  HB3  . LYS A 1 51  ? -3.309  0.301   -13.809 1.00 0.00 ? 51  LYS A HB3  2  
ATOM   2871  H  HG2  . LYS A 1 51  ? -5.982  0.124   -14.217 1.00 0.00 ? 51  LYS A HG2  2  
ATOM   2872  H  HG3  . LYS A 1 51  ? -5.473  -0.981  -15.493 1.00 0.00 ? 51  LYS A HG3  2  
ATOM   2873  H  HD2  . LYS A 1 51  ? -5.905  -2.324  -13.554 1.00 0.00 ? 51  LYS A HD2  2  
ATOM   2874  H  HD3  . LYS A 1 51  ? -4.135  -2.250  -13.715 1.00 0.00 ? 51  LYS A HD3  2  
ATOM   2875  H  HE2  . LYS A 1 51  ? -4.160  -0.293  -12.085 1.00 0.00 ? 51  LYS A HE2  2  
ATOM   2876  H  HE3  . LYS A 1 51  ? -5.891  -0.525  -11.889 1.00 0.00 ? 51  LYS A HE3  2  
ATOM   2877  H  HZ1  . LYS A 1 51  ? -5.433  -2.682  -10.919 1.00 0.00 ? 51  LYS A HZ1  2  
ATOM   2878  H  HZ2  . LYS A 1 51  ? -3.816  -2.511  -11.176 1.00 0.00 ? 51  LYS A HZ2  2  
ATOM   2879  H  HZ3  . LYS A 1 51  ? -4.590  -1.477  -10.161 1.00 0.00 ? 51  LYS A HZ3  2  
ATOM   2880  N  N    . SER A 1 52  ? -5.978  2.560   -16.608 1.00 0.00 ? 52  SER A N    2  
ATOM   2881  C  CA   . SER A 1 52  ? -6.958  2.521   -17.694 1.00 0.00 ? 52  SER A CA   2  
ATOM   2882  C  C    . SER A 1 52  ? -6.520  3.292   -18.955 1.00 0.00 ? 52  SER A C    2  
ATOM   2883  O  O    . SER A 1 52  ? -7.362  3.618   -19.798 1.00 0.00 ? 52  SER A O    2  
ATOM   2884  C  CB   . SER A 1 52  ? -8.294  3.045   -17.167 1.00 0.00 ? 52  SER A CB   2  
ATOM   2885  O  OG   . SER A 1 52  ? -8.563  2.558   -15.857 1.00 0.00 ? 52  SER A OG   2  
ATOM   2886  H  H    . SER A 1 52  ? -6.199  3.153   -15.825 1.00 0.00 ? 52  SER A H    2  
ATOM   2887  H  HA   . SER A 1 52  ? -7.101  1.479   -17.985 1.00 0.00 ? 52  SER A HA   2  
ATOM   2888  H  HB2  . SER A 1 52  ? -8.257  4.134   -17.138 1.00 0.00 ? 52  SER A HB2  2  
ATOM   2889  H  HB3  . SER A 1 52  ? -9.084  2.731   -17.848 1.00 0.00 ? 52  SER A HB3  2  
ATOM   2890  H  HG   . SER A 1 52  ? -8.656  1.591   -15.910 1.00 0.00 ? 52  SER A HG   2  
ATOM   2891  N  N    . ARG A 1 53  ? -5.233  3.634   -19.089 1.00 0.00 ? 53  ARG A N    2  
ATOM   2892  C  CA   . ARG A 1 53  ? -4.677  4.243   -20.303 1.00 0.00 ? 53  ARG A CA   2  
ATOM   2893  C  C    . ARG A 1 53  ? -4.638  3.191   -21.430 1.00 0.00 ? 53  ARG A C    2  
ATOM   2894  O  O    . ARG A 1 53  ? -5.145  2.079   -21.257 1.00 0.00 ? 53  ARG A O    2  
ATOM   2895  C  CB   . ARG A 1 53  ? -3.291  4.799   -19.941 1.00 0.00 ? 53  ARG A CB   2  
ATOM   2896  C  CG   . ARG A 1 53  ? -2.764  5.964   -20.793 1.00 0.00 ? 53  ARG A CG   2  
ATOM   2897  C  CD   . ARG A 1 53  ? -1.411  6.384   -20.210 1.00 0.00 ? 53  ARG A CD   2  
ATOM   2898  N  NE   . ARG A 1 53  ? -0.787  7.502   -20.931 1.00 0.00 ? 53  ARG A NE   2  
ATOM   2899  C  CZ   . ARG A 1 53  ? 0.335   8.120   -20.535 1.00 0.00 ? 53  ARG A CZ   2  
ATOM   2900  N  NH1  . ARG A 1 53  ? 0.956   7.747   -19.416 1.00 0.00 ? 53  ARG A NH1  2  
ATOM   2901  N  NH2  . ARG A 1 53  ? 0.832   9.115   -21.263 1.00 0.00 ? 53  ARG A NH2  2  
ATOM   2902  H  H    . ARG A 1 53  ? -4.568  3.290   -18.406 1.00 0.00 ? 53  ARG A H    2  
ATOM   2903  H  HA   . ARG A 1 53  ? -5.326  5.065   -20.610 1.00 0.00 ? 53  ARG A HA   2  
ATOM   2904  H  HB2  . ARG A 1 53  ? -3.318  5.138   -18.906 1.00 0.00 ? 53  ARG A HB2  2  
ATOM   2905  H  HB3  . ARG A 1 53  ? -2.582  3.984   -19.990 1.00 0.00 ? 53  ARG A HB3  2  
ATOM   2906  H  HG2  . ARG A 1 53  ? -2.628  5.655   -21.828 1.00 0.00 ? 53  ARG A HG2  2  
ATOM   2907  H  HG3  . ARG A 1 53  ? -3.462  6.801   -20.746 1.00 0.00 ? 53  ARG A HG3  2  
ATOM   2908  H  HD2  . ARG A 1 53  ? -1.568  6.690   -19.178 1.00 0.00 ? 53  ARG A HD2  2  
ATOM   2909  H  HD3  . ARG A 1 53  ? -0.733  5.528   -20.228 1.00 0.00 ? 53  ARG A HD3  2  
ATOM   2910  H  HE   . ARG A 1 53  ? -1.247  7.807   -21.780 1.00 0.00 ? 53  ARG A HE   2  
ATOM   2911  H  HH11 . ARG A 1 53  ? 0.585   6.994   -18.835 1.00 0.00 ? 53  ARG A HH11 2  
ATOM   2912  H  HH12 . ARG A 1 53  ? 1.806   8.192   -19.100 1.00 0.00 ? 53  ARG A HH12 2  
ATOM   2913  H  HH21 . ARG A 1 53  ? 0.380   9.419   -22.115 1.00 0.00 ? 53  ARG A HH21 2  
ATOM   2914  H  HH22 . ARG A 1 53  ? 1.675   9.605   -20.997 1.00 0.00 ? 53  ARG A HH22 2  
ATOM   2915  N  N    . LYS A 1 54  ? -4.048  3.529   -22.586 1.00 0.00 ? 54  LYS A N    2  
ATOM   2916  C  CA   . LYS A 1 54  ? -3.913  2.619   -23.731 1.00 0.00 ? 54  LYS A CA   2  
ATOM   2917  C  C    . LYS A 1 54  ? -3.393  1.255   -23.275 1.00 0.00 ? 54  LYS A C    2  
ATOM   2918  O  O    . LYS A 1 54  ? -2.501  1.189   -22.423 1.00 0.00 ? 54  LYS A O    2  
ATOM   2919  C  CB   . LYS A 1 54  ? -3.056  3.248   -24.849 1.00 0.00 ? 54  LYS A CB   2  
ATOM   2920  C  CG   . LYS A 1 54  ? -1.596  3.548   -24.453 1.00 0.00 ? 54  LYS A CG   2  
ATOM   2921  C  CD   . LYS A 1 54  ? -0.763  4.123   -25.609 1.00 0.00 ? 54  LYS A CD   2  
ATOM   2922  C  CE   . LYS A 1 54  ? -1.255  5.508   -26.058 1.00 0.00 ? 54  LYS A CE   2  
ATOM   2923  N  NZ   . LYS A 1 54  ? -0.412  6.078   -27.139 1.00 0.00 ? 54  LYS A NZ   2  
ATOM   2924  H  H    . LYS A 1 54  ? -3.646  4.448   -22.673 1.00 0.00 ? 54  LYS A H    2  
ATOM   2925  H  HA   . LYS A 1 54  ? -4.917  2.472   -24.133 1.00 0.00 ? 54  LYS A HA   2  
ATOM   2926  H  HB2  . LYS A 1 54  ? -3.052  2.566   -25.701 1.00 0.00 ? 54  LYS A HB2  2  
ATOM   2927  H  HB3  . LYS A 1 54  ? -3.540  4.172   -25.167 1.00 0.00 ? 54  LYS A HB3  2  
ATOM   2928  H  HG2  . LYS A 1 54  ? -1.576  4.251   -23.620 1.00 0.00 ? 54  LYS A HG2  2  
ATOM   2929  H  HG3  . LYS A 1 54  ? -1.116  2.623   -24.131 1.00 0.00 ? 54  LYS A HG3  2  
ATOM   2930  H  HD2  . LYS A 1 54  ? 0.272   4.206   -25.271 1.00 0.00 ? 54  LYS A HD2  2  
ATOM   2931  H  HD3  . LYS A 1 54  ? -0.794  3.429   -26.451 1.00 0.00 ? 54  LYS A HD3  2  
ATOM   2932  H  HE2  . LYS A 1 54  ? -2.285  5.423   -26.413 1.00 0.00 ? 54  LYS A HE2  2  
ATOM   2933  H  HE3  . LYS A 1 54  ? -1.247  6.181   -25.198 1.00 0.00 ? 54  LYS A HE3  2  
ATOM   2934  H  HZ1  . LYS A 1 54  ? -0.755  6.986   -27.418 1.00 0.00 ? 54  LYS A HZ1  2  
ATOM   2935  H  HZ2  . LYS A 1 54  ? 0.544   6.195   -26.837 1.00 0.00 ? 54  LYS A HZ2  2  
ATOM   2936  H  HZ3  . LYS A 1 54  ? -0.415  5.488   -27.957 1.00 0.00 ? 54  LYS A HZ3  2  
ATOM   2937  N  N    . THR A 1 55  ? -3.916  0.181   -23.867 1.00 0.00 ? 55  THR A N    2  
ATOM   2938  C  CA   . THR A 1 55  ? -3.713  -1.190  -23.407 1.00 0.00 ? 55  THR A CA   2  
ATOM   2939  C  C    . THR A 1 55  ? -4.114  -1.264  -21.918 1.00 0.00 ? 55  THR A C    2  
ATOM   2940  O  O    . THR A 1 55  ? -5.314  -1.305  -21.633 1.00 0.00 ? 55  THR A O    2  
ATOM   2941  C  CB   . THR A 1 55  ? -2.297  -1.684  -23.779 1.00 0.00 ? 55  THR A CB   2  
ATOM   2942  O  OG1  . THR A 1 55  ? -2.027  -1.417  -25.145 1.00 0.00 ? 55  THR A OG1  2  
ATOM   2943  C  CG2  . THR A 1 55  ? -2.134  -3.193  -23.566 1.00 0.00 ? 55  THR A CG2  2  
ATOM   2944  H  H    . THR A 1 55  ? -4.614  0.315   -24.582 1.00 0.00 ? 55  THR A H    2  
ATOM   2945  H  HA   . THR A 1 55  ? -4.420  -1.819  -23.951 1.00 0.00 ? 55  THR A HA   2  
ATOM   2946  H  HB   . THR A 1 55  ? -1.556  -1.160  -23.173 1.00 0.00 ? 55  THR A HB   2  
ATOM   2947  H  HG1  . THR A 1 55  ? -2.079  -0.457  -25.274 1.00 0.00 ? 55  THR A HG1  2  
ATOM   2948  H  HG21 . THR A 1 55  ? -2.290  -3.445  -22.517 1.00 0.00 ? 55  THR A HG21 2  
ATOM   2949  H  HG22 . THR A 1 55  ? -2.858  -3.740  -24.172 1.00 0.00 ? 55  THR A HG22 2  
ATOM   2950  H  HG23 . THR A 1 55  ? -1.126  -3.498  -23.847 1.00 0.00 ? 55  THR A HG23 2  
ATOM   2951  N  N    . SER A 1 56  ? -3.153  -1.207  -20.988 1.00 0.00 ? 56  SER A N    2  
ATOM   2952  C  CA   . SER A 1 56  ? -3.375  -1.132  -19.544 1.00 0.00 ? 56  SER A CA   2  
ATOM   2953  C  C    . SER A 1 56  ? -2.266  -0.274  -18.898 1.00 0.00 ? 56  SER A C    2  
ATOM   2954  O  O    . SER A 1 56  ? -1.817  -0.561  -17.784 1.00 0.00 ? 56  SER A O    2  
ATOM   2955  C  CB   . SER A 1 56  ? -3.401  -2.553  -18.944 1.00 0.00 ? 56  SER A CB   2  
ATOM   2956  O  OG   . SER A 1 56  ? -4.303  -3.422  -19.617 1.00 0.00 ? 56  SER A OG   2  
ATOM   2957  H  H    . SER A 1 56  ? -2.193  -1.132  -21.290 1.00 0.00 ? 56  SER A H    2  
ATOM   2958  H  HA   . SER A 1 56  ? -4.335  -0.642  -19.354 1.00 0.00 ? 56  SER A HA   2  
ATOM   2959  H  HB2  . SER A 1 56  ? -2.397  -2.980  -19.001 1.00 0.00 ? 56  SER A HB2  2  
ATOM   2960  H  HB3  . SER A 1 56  ? -3.687  -2.486  -17.893 1.00 0.00 ? 56  SER A HB3  2  
ATOM   2961  H  HG   . SER A 1 56  ? -4.263  -4.290  -19.180 1.00 0.00 ? 56  SER A HG   2  
ATOM   2962  N  N    . THR A 1 57  ? -1.731  0.710   -19.631 1.00 0.00 ? 57  THR A N    2  
ATOM   2963  C  CA   . THR A 1 57  ? -0.617  1.528   -19.156 1.00 0.00 ? 57  THR A CA   2  
ATOM   2964  C  C    . THR A 1 57  ? -1.091  2.495   -18.054 1.00 0.00 ? 57  THR A C    2  
ATOM   2965  O  O    . THR A 1 57  ? -2.290  2.727   -17.871 1.00 0.00 ? 57  THR A O    2  
ATOM   2966  C  CB   . THR A 1 57  ? 0.097   2.216   -20.342 1.00 0.00 ? 57  THR A CB   2  
ATOM   2967  O  OG1  . THR A 1 57  ? -0.782  2.888   -21.220 1.00 0.00 ? 57  THR A OG1  2  
ATOM   2968  C  CG2  . THR A 1 57  ? 0.888   1.205   -21.180 1.00 0.00 ? 57  THR A CG2  2  
ATOM   2969  H  H    . THR A 1 57  ? -2.149  0.954   -20.520 1.00 0.00 ? 57  THR A H    2  
ATOM   2970  H  HA   . THR A 1 57  ? 0.109   0.859   -18.690 1.00 0.00 ? 57  THR A HA   2  
ATOM   2971  H  HB   . THR A 1 57  ? 0.804   2.944   -19.944 1.00 0.00 ? 57  THR A HB   2  
ATOM   2972  H  HG1  . THR A 1 57  ? -1.311  2.229   -21.706 1.00 0.00 ? 57  THR A HG1  2  
ATOM   2973  H  HG21 . THR A 1 57  ? 1.629   0.707   -20.554 1.00 0.00 ? 57  THR A HG21 2  
ATOM   2974  H  HG22 . THR A 1 57  ? 0.223   0.457   -21.611 1.00 0.00 ? 57  THR A HG22 2  
ATOM   2975  H  HG23 . THR A 1 57  ? 1.409   1.726   -21.985 1.00 0.00 ? 57  THR A HG23 2  
ATOM   2976  N  N    . ILE A 1 58  ? -0.150  3.038   -17.278 1.00 0.00 ? 58  ILE A N    2  
ATOM   2977  C  CA   . ILE A 1 58  ? -0.462  3.902   -16.144 1.00 0.00 ? 58  ILE A CA   2  
ATOM   2978  C  C    . ILE A 1 58  ? -0.712  5.323   -16.654 1.00 0.00 ? 58  ILE A C    2  
ATOM   2979  O  O    . ILE A 1 58  ? 0.020   5.839   -17.503 1.00 0.00 ? 58  ILE A O    2  
ATOM   2980  C  CB   . ILE A 1 58  ? 0.681   3.831   -15.101 1.00 0.00 ? 58  ILE A CB   2  
ATOM   2981  C  CG1  . ILE A 1 58  ? 0.870   2.399   -14.540 1.00 0.00 ? 58  ILE A CG1  2  
ATOM   2982  C  CG2  . ILE A 1 58  ? 0.500   4.829   -13.940 1.00 0.00 ? 58  ILE A CG2  2  
ATOM   2983  C  CD1  . ILE A 1 58  ? -0.292  1.845   -13.703 1.00 0.00 ? 58  ILE A CD1  2  
ATOM   2984  H  H    . ILE A 1 58  ? 0.824   2.850   -17.464 1.00 0.00 ? 58  ILE A H    2  
ATOM   2985  H  HA   . ILE A 1 58  ? -1.375  3.547   -15.670 1.00 0.00 ? 58  ILE A HA   2  
ATOM   2986  H  HB   . ILE A 1 58  ? 1.606   4.103   -15.611 1.00 0.00 ? 58  ILE A HB   2  
ATOM   2987  H  HG12 . ILE A 1 58  ? 1.041   1.708   -15.365 1.00 0.00 ? 58  ILE A HG12 2  
ATOM   2988  H  HG13 . ILE A 1 58  ? 1.767   2.386   -13.920 1.00 0.00 ? 58  ILE A HG13 2  
ATOM   2989  H  HG21 . ILE A 1 58  ? -0.484  4.713   -13.489 1.00 0.00 ? 58  ILE A HG21 2  
ATOM   2990  H  HG22 . ILE A 1 58  ? 1.272   4.675   -13.183 1.00 0.00 ? 58  ILE A HG22 2  
ATOM   2991  H  HG23 . ILE A 1 58  ? 0.596   5.852   -14.306 1.00 0.00 ? 58  ILE A HG23 2  
ATOM   2992  H  HD11 . ILE A 1 58  ? -0.443  2.452   -12.812 1.00 0.00 ? 58  ILE A HD11 2  
ATOM   2993  H  HD12 . ILE A 1 58  ? -1.207  1.820   -14.290 1.00 0.00 ? 58  ILE A HD12 2  
ATOM   2994  H  HD13 . ILE A 1 58  ? -0.053  0.828   -13.390 1.00 0.00 ? 58  ILE A HD13 2  
ATOM   2995  N  N    . GLU A 1 59  ? -1.727  5.957   -16.081 1.00 0.00 ? 59  GLU A N    2  
ATOM   2996  C  CA   . GLU A 1 59  ? -2.062  7.365   -16.196 1.00 0.00 ? 59  GLU A CA   2  
ATOM   2997  C  C    . GLU A 1 59  ? -2.075  7.875   -14.752 1.00 0.00 ? 59  GLU A C    2  
ATOM   2998  O  O    . GLU A 1 59  ? -2.347  7.113   -13.821 1.00 0.00 ? 59  GLU A O    2  
ATOM   2999  C  CB   . GLU A 1 59  ? -3.430  7.522   -16.885 1.00 0.00 ? 59  GLU A CB   2  
ATOM   3000  C  CG   . GLU A 1 59  ? -3.864  8.986   -17.039 1.00 0.00 ? 59  GLU A CG   2  
ATOM   3001  C  CD   . GLU A 1 59  ? -5.152  9.109   -17.874 1.00 0.00 ? 59  GLU A CD   2  
ATOM   3002  O  OE1  . GLU A 1 59  ? -6.262  8.951   -17.318 1.00 0.00 ? 59  GLU A OE1  2  
ATOM   3003  O  OE2  . GLU A 1 59  ? -5.066  9.394   -19.090 1.00 0.00 ? 59  GLU A OE2  2  
ATOM   3004  H  H    . GLU A 1 59  ? -2.278  5.450   -15.392 1.00 0.00 ? 59  GLU A H    2  
ATOM   3005  H  HA   . GLU A 1 59  ? -1.296  7.888   -16.770 1.00 0.00 ? 59  GLU A HA   2  
ATOM   3006  H  HB2  . GLU A 1 59  ? -3.371  7.086   -17.878 1.00 0.00 ? 59  GLU A HB2  2  
ATOM   3007  H  HB3  . GLU A 1 59  ? -4.189  6.982   -16.317 1.00 0.00 ? 59  GLU A HB3  2  
ATOM   3008  H  HG2  . GLU A 1 59  ? -4.033  9.422   -16.052 1.00 0.00 ? 59  GLU A HG2  2  
ATOM   3009  H  HG3  . GLU A 1 59  ? -3.058  9.544   -17.520 1.00 0.00 ? 59  GLU A HG3  2  
ATOM   3010  N  N    . GLU A 1 60  ? -1.763  9.151   -14.545 1.00 0.00 ? 60  GLU A N    2  
ATOM   3011  C  CA   . GLU A 1 60  ? -1.554  9.717   -13.222 1.00 0.00 ? 60  GLU A CA   2  
ATOM   3012  C  C    . GLU A 1 60  ? -2.558  10.846  -13.032 1.00 0.00 ? 60  GLU A C    2  
ATOM   3013  O  O    . GLU A 1 60  ? -2.479  11.870  -13.718 1.00 0.00 ? 60  GLU A O    2  
ATOM   3014  C  CB   . GLU A 1 60  ? -0.096  10.188  -13.103 1.00 0.00 ? 60  GLU A CB   2  
ATOM   3015  C  CG   . GLU A 1 60  ? 0.836   8.986   -12.935 1.00 0.00 ? 60  GLU A CG   2  
ATOM   3016  C  CD   . GLU A 1 60  ? 2.309   9.415   -12.819 1.00 0.00 ? 60  GLU A CD   2  
ATOM   3017  O  OE1  . GLU A 1 60  ? 2.970   9.626   -13.861 1.00 0.00 ? 60  GLU A OE1  2  
ATOM   3018  O  OE2  . GLU A 1 60  ? 2.825   9.528   -11.685 1.00 0.00 ? 60  GLU A OE2  2  
ATOM   3019  H  H    . GLU A 1 60  ? -1.579  9.757   -15.330 1.00 0.00 ? 60  GLU A H    2  
ATOM   3020  H  HA   . GLU A 1 60  ? -1.731  8.964   -12.452 1.00 0.00 ? 60  GLU A HA   2  
ATOM   3021  H  HB2  . GLU A 1 60  ? 0.187   10.756  -13.991 1.00 0.00 ? 60  GLU A HB2  2  
ATOM   3022  H  HB3  . GLU A 1 60  ? 0.012   10.832  -12.235 1.00 0.00 ? 60  GLU A HB3  2  
ATOM   3023  H  HG2  . GLU A 1 60  ? 0.529   8.450   -12.035 1.00 0.00 ? 60  GLU A HG2  2  
ATOM   3024  H  HG3  . GLU A 1 60  ? 0.716   8.315   -13.788 1.00 0.00 ? 60  GLU A HG3  2  
ATOM   3025  N  N    . LYS A 1 61  ? -3.507  10.657  -12.109 1.00 0.00 ? 61  LYS A N    2  
ATOM   3026  C  CA   . LYS A 1 61  ? -4.575  11.621  -11.850 1.00 0.00 ? 61  LYS A CA   2  
ATOM   3027  C  C    . LYS A 1 61  ? -4.513  12.047  -10.394 1.00 0.00 ? 61  LYS A C    2  
ATOM   3028  O  O    . LYS A 1 61  ? -4.509  11.202  -9.502  1.00 0.00 ? 61  LYS A O    2  
ATOM   3029  C  CB   . LYS A 1 61  ? -5.940  11.003  -12.191 1.00 0.00 ? 61  LYS A CB   2  
ATOM   3030  C  CG   . LYS A 1 61  ? -7.019  12.096  -12.239 1.00 0.00 ? 61  LYS A CG   2  
ATOM   3031  C  CD   . LYS A 1 61  ? -8.387  11.567  -12.679 1.00 0.00 ? 61  LYS A CD   2  
ATOM   3032  C  CE   . LYS A 1 61  ? -9.011  10.617  -11.645 1.00 0.00 ? 61  LYS A CE   2  
ATOM   3033  N  NZ   . LYS A 1 61  ? -10.469 10.475  -11.872 1.00 0.00 ? 61  LYS A NZ   2  
ATOM   3034  H  H    . LYS A 1 61  ? -3.551  9.757   -11.616 1.00 0.00 ? 61  LYS A H    2  
ATOM   3035  H  HA   . LYS A 1 61  ? -4.428  12.496  -12.486 1.00 0.00 ? 61  LYS A HA   2  
ATOM   3036  H  HB2  . LYS A 1 61  ? -5.883  10.521  -13.168 1.00 0.00 ? 61  LYS A HB2  2  
ATOM   3037  H  HB3  . LYS A 1 61  ? -6.202  10.256  -11.438 1.00 0.00 ? 61  LYS A HB3  2  
ATOM   3038  H  HG2  . LYS A 1 61  ? -7.120  12.563  -11.259 1.00 0.00 ? 61  LYS A HG2  2  
ATOM   3039  H  HG3  . LYS A 1 61  ? -6.710  12.863  -12.951 1.00 0.00 ? 61  LYS A HG3  2  
ATOM   3040  H  HD2  . LYS A 1 61  ? -9.038  12.431  -12.808 1.00 0.00 ? 61  LYS A HD2  2  
ATOM   3041  H  HD3  . LYS A 1 61  ? -8.297  11.062  -13.642 1.00 0.00 ? 61  LYS A HD3  2  
ATOM   3042  H  HE2  . LYS A 1 61  ? -8.516  9.642   -11.695 1.00 0.00 ? 61  LYS A HE2  2  
ATOM   3043  H  HE3  . LYS A 1 61  ? -8.848  11.035  -10.649 1.00 0.00 ? 61  LYS A HE3  2  
ATOM   3044  H  HZ1  . LYS A 1 61  ? -10.896 9.877   -11.179 1.00 0.00 ? 61  LYS A HZ1  2  
ATOM   3045  H  HZ2  . LYS A 1 61  ? -10.903 11.401  -11.801 1.00 0.00 ? 61  LYS A HZ2  2  
ATOM   3046  H  HZ3  . LYS A 1 61  ? -10.667 10.102  -12.789 1.00 0.00 ? 61  LYS A HZ3  2  
ATOM   3047  N  N    . THR A 1 62  ? -4.425  13.344  -10.144 1.00 0.00 ? 62  THR A N    2  
ATOM   3048  C  CA   . THR A 1 62  ? -4.353  13.888  -8.800  1.00 0.00 ? 62  THR A CA   2  
ATOM   3049  C  C    . THR A 1 62  ? -5.709  13.725  -8.107  1.00 0.00 ? 62  THR A C    2  
ATOM   3050  O  O    . THR A 1 62  ? -6.741  14.082  -8.682  1.00 0.00 ? 62  THR A O    2  
ATOM   3051  C  CB   . THR A 1 62  ? -3.925  15.356  -8.916  1.00 0.00 ? 62  THR A CB   2  
ATOM   3052  O  OG1  . THR A 1 62  ? -2.884  15.483  -9.875  1.00 0.00 ? 62  THR A OG1  2  
ATOM   3053  C  CG2  . THR A 1 62  ? -3.377  15.852  -7.591  1.00 0.00 ? 62  THR A CG2  2  
ATOM   3054  H  H    . THR A 1 62  ? -4.340  14.006  -10.901 1.00 0.00 ? 62  THR A H    2  
ATOM   3055  H  HA   . THR A 1 62  ? -3.602  13.339  -8.232  1.00 0.00 ? 62  THR A HA   2  
ATOM   3056  H  HB   . THR A 1 62  ? -4.775  15.966  -9.221  1.00 0.00 ? 62  THR A HB   2  
ATOM   3057  H  HG1  . THR A 1 62  ? -2.921  16.385  -10.237 1.00 0.00 ? 62  THR A HG1  2  
ATOM   3058  H  HG21 . THR A 1 62  ? -3.087  16.898  -7.690  1.00 0.00 ? 62  THR A HG21 2  
ATOM   3059  H  HG22 . THR A 1 62  ? -4.139  15.761  -6.818  1.00 0.00 ? 62  THR A HG22 2  
ATOM   3060  H  HG23 . THR A 1 62  ? -2.510  15.251  -7.313  1.00 0.00 ? 62  THR A HG23 2  
ATOM   3061  N  N    . VAL A 1 63  ? -5.719  13.218  -6.873  1.00 0.00 ? 63  VAL A N    2  
ATOM   3062  C  CA   . VAL A 1 63  ? -6.927  12.993  -6.094  1.00 0.00 ? 63  VAL A CA   2  
ATOM   3063  C  C    . VAL A 1 63  ? -6.656  13.323  -4.617  1.00 0.00 ? 63  VAL A C    2  
ATOM   3064  O  O    . VAL A 1 63  ? -5.519  13.339  -4.146  1.00 0.00 ? 63  VAL A O    2  
ATOM   3065  C  CB   . VAL A 1 63  ? -7.453  11.546  -6.255  1.00 0.00 ? 63  VAL A CB   2  
ATOM   3066  C  CG1  . VAL A 1 63  ? -7.814  11.185  -7.707  1.00 0.00 ? 63  VAL A CG1  2  
ATOM   3067  C  CG2  . VAL A 1 63  ? -6.475  10.477  -5.737  1.00 0.00 ? 63  VAL A CG2  2  
ATOM   3068  H  H    . VAL A 1 63  ? -4.868  12.908  -6.434  1.00 0.00 ? 63  VAL A H    2  
ATOM   3069  H  HA   . VAL A 1 63  ? -7.709  13.652  -6.461  1.00 0.00 ? 63  VAL A HA   2  
ATOM   3070  H  HB   . VAL A 1 63  ? -8.374  11.480  -5.666  1.00 0.00 ? 63  VAL A HB   2  
ATOM   3071  H  HG11 . VAL A 1 63  ? -6.918  11.103  -8.325  1.00 0.00 ? 63  VAL A HG11 2  
ATOM   3072  H  HG12 . VAL A 1 63  ? -8.342  10.232  -7.725  1.00 0.00 ? 63  VAL A HG12 2  
ATOM   3073  H  HG13 . VAL A 1 63  ? -8.462  11.948  -8.129  1.00 0.00 ? 63  VAL A HG13 2  
ATOM   3074  H  HG21 . VAL A 1 63  ? -6.929  9.491   -5.831  1.00 0.00 ? 63  VAL A HG21 2  
ATOM   3075  H  HG22 . VAL A 1 63  ? -5.548  10.497  -6.311  1.00 0.00 ? 63  VAL A HG22 2  
ATOM   3076  H  HG23 . VAL A 1 63  ? -6.248  10.650  -4.685  1.00 0.00 ? 63  VAL A HG23 2  
ATOM   3077  N  N    . GLU A 1 64  ? -7.724  13.574  -3.876  1.00 0.00 ? 64  GLU A N    2  
ATOM   3078  C  CA   . GLU A 1 64  ? -7.734  13.686  -2.426  1.00 0.00 ? 64  GLU A CA   2  
ATOM   3079  C  C    . GLU A 1 64  ? -8.328  12.367  -1.927  1.00 0.00 ? 64  GLU A C    2  
ATOM   3080  O  O    . GLU A 1 64  ? -9.475  12.049  -2.228  1.00 0.00 ? 64  GLU A O    2  
ATOM   3081  C  CB   . GLU A 1 64  ? -8.546  14.917  -1.989  1.00 0.00 ? 64  GLU A CB   2  
ATOM   3082  C  CG   . GLU A 1 64  ? -8.434  15.138  -0.474  1.00 0.00 ? 64  GLU A CG   2  
ATOM   3083  C  CD   . GLU A 1 64  ? -9.122  16.445  -0.040  1.00 0.00 ? 64  GLU A CD   2  
ATOM   3084  O  OE1  . GLU A 1 64  ? -10.356 16.455  0.169   1.00 0.00 ? 64  GLU A OE1  2  
ATOM   3085  O  OE2  . GLU A 1 64  ? -8.429  17.477  0.114   1.00 0.00 ? 64  GLU A OE2  2  
ATOM   3086  H  H    . GLU A 1 64  ? -8.615  13.608  -4.358  1.00 0.00 ? 64  GLU A H    2  
ATOM   3087  H  HA   . GLU A 1 64  ? -6.714  13.794  -2.056  1.00 0.00 ? 64  GLU A HA   2  
ATOM   3088  H  HB2  . GLU A 1 64  ? -8.173  15.806  -2.502  1.00 0.00 ? 64  GLU A HB2  2  
ATOM   3089  H  HB3  . GLU A 1 64  ? -9.592  14.791  -2.266  1.00 0.00 ? 64  GLU A HB3  2  
ATOM   3090  H  HG2  . GLU A 1 64  ? -8.879  14.292  0.052   1.00 0.00 ? 64  GLU A HG2  2  
ATOM   3091  H  HG3  . GLU A 1 64  ? -7.376  15.176  -0.201  1.00 0.00 ? 64  GLU A HG3  2  
ATOM   3092  N  N    . VAL A 1 65  ? -7.534  11.555  -1.242  1.00 0.00 ? 65  VAL A N    2  
ATOM   3093  C  CA   . VAL A 1 65  ? -7.938  10.277  -0.672  1.00 0.00 ? 65  VAL A CA   2  
ATOM   3094  C  C    . VAL A 1 65  ? -8.688  10.597  0.620   1.00 0.00 ? 65  VAL A C    2  
ATOM   3095  O  O    . VAL A 1 65  ? -8.173  11.298  1.494   1.00 0.00 ? 65  VAL A O    2  
ATOM   3096  C  CB   . VAL A 1 65  ? -6.697  9.386   -0.450  1.00 0.00 ? 65  VAL A CB   2  
ATOM   3097  C  CG1  . VAL A 1 65  ? -7.124  7.943   -0.160  1.00 0.00 ? 65  VAL A CG1  2  
ATOM   3098  C  CG2  . VAL A 1 65  ? -5.769  9.370   -1.679  1.00 0.00 ? 65  VAL A CG2  2  
ATOM   3099  H  H    . VAL A 1 65  ? -6.631  11.905  -0.945  1.00 0.00 ? 65  VAL A H    2  
ATOM   3100  H  HA   . VAL A 1 65  ? -8.627  9.786   -1.361  1.00 0.00 ? 65  VAL A HA   2  
ATOM   3101  H  HB   . VAL A 1 65  ? -6.132  9.762   0.404   1.00 0.00 ? 65  VAL A HB   2  
ATOM   3102  H  HG11 . VAL A 1 65  ? -6.257  7.359   0.149   1.00 0.00 ? 65  VAL A HG11 2  
ATOM   3103  H  HG12 . VAL A 1 65  ? -7.869  7.926   0.634   1.00 0.00 ? 65  VAL A HG12 2  
ATOM   3104  H  HG13 . VAL A 1 65  ? -7.549  7.485   -1.050  1.00 0.00 ? 65  VAL A HG13 2  
ATOM   3105  H  HG21 . VAL A 1 65  ? -5.276  10.336  -1.795  1.00 0.00 ? 65  VAL A HG21 2  
ATOM   3106  H  HG22 . VAL A 1 65  ? -4.995  8.614   -1.553  1.00 0.00 ? 65  VAL A HG22 2  
ATOM   3107  H  HG23 . VAL A 1 65  ? -6.345  9.149   -2.577  1.00 0.00 ? 65  VAL A HG23 2  
ATOM   3108  N  N    . LEU A 1 66  ? -9.912  10.085  0.732   1.00 0.00 ? 66  LEU A N    2  
ATOM   3109  C  CA   . LEU A 1 66  ? -10.857 10.483  1.771   1.00 0.00 ? 66  LEU A CA   2  
ATOM   3110  C  C    . LEU A 1 66  ? -10.905 9.518   2.949   1.00 0.00 ? 66  LEU A C    2  
ATOM   3111  O  O    . LEU A 1 66  ? -11.216 9.934   4.066   1.00 0.00 ? 66  LEU A O    2  
ATOM   3112  C  CB   . LEU A 1 66  ? -12.261 10.579  1.145   1.00 0.00 ? 66  LEU A CB   2  
ATOM   3113  C  CG   . LEU A 1 66  ? -12.326 11.370  -0.176  1.00 0.00 ? 66  LEU A CG   2  
ATOM   3114  C  CD1  . LEU A 1 66  ? -13.755 11.357  -0.710  1.00 0.00 ? 66  LEU A CD1  2  
ATOM   3115  C  CD2  . LEU A 1 66  ? -11.802 12.802  -0.028  1.00 0.00 ? 66  LEU A CD2  2  
ATOM   3116  H  H    . LEU A 1 66  ? -10.292 9.541   -0.054  1.00 0.00 ? 66  LEU A H    2  
ATOM   3117  H  HA   . LEU A 1 66  ? -10.583 11.468  2.146   1.00 0.00 ? 66  LEU A HA   2  
ATOM   3118  H  HB2  . LEU A 1 66  ? -12.623 9.567   0.955   1.00 0.00 ? 66  LEU A HB2  2  
ATOM   3119  H  HB3  . LEU A 1 66  ? -12.932 11.038  1.873   1.00 0.00 ? 66  LEU A HB3  2  
ATOM   3120  H  HG   . LEU A 1 66  ? -11.715 10.869  -0.924  1.00 0.00 ? 66  LEU A HG   2  
ATOM   3121  H  HD11 . LEU A 1 66  ? -13.786 11.885  -1.659  1.00 0.00 ? 66  LEU A HD11 2  
ATOM   3122  H  HD12 . LEU A 1 66  ? -14.062 10.325  -0.884  1.00 0.00 ? 66  LEU A HD12 2  
ATOM   3123  H  HD13 . LEU A 1 66  ? -14.435 11.831  -0.002  1.00 0.00 ? 66  LEU A HD13 2  
ATOM   3124  H  HD21 . LEU A 1 66  ? -11.884 13.317  -0.982  1.00 0.00 ? 66  LEU A HD21 2  
ATOM   3125  H  HD22 . LEU A 1 66  ? -12.364 13.340  0.735   1.00 0.00 ? 66  LEU A HD22 2  
ATOM   3126  H  HD23 . LEU A 1 66  ? -10.744 12.782  0.239   1.00 0.00 ? 66  LEU A HD23 2  
ATOM   3127  N  N    . GLY A 1 67  ? -10.630 8.239   2.706   1.00 0.00 ? 67  GLY A N    2  
ATOM   3128  C  CA   . GLY A 1 67  ? -10.798 7.175   3.674   1.00 0.00 ? 67  GLY A CA   2  
ATOM   3129  C  C    . GLY A 1 67  ? -10.797 5.850   2.934   1.00 0.00 ? 67  GLY A C    2  
ATOM   3130  O  O    . GLY A 1 67  ? -10.898 5.820   1.703   1.00 0.00 ? 67  GLY A O    2  
ATOM   3131  H  H    . GLY A 1 67  ? -10.419 7.943   1.760   1.00 0.00 ? 67  GLY A H    2  
ATOM   3132  H  HA2  . GLY A 1 67  ? -9.998  7.195   4.407   1.00 0.00 ? 67  GLY A HA2  2  
ATOM   3133  H  HA3  . GLY A 1 67  ? -11.751 7.290   4.193   1.00 0.00 ? 67  GLY A HA3  2  
ATOM   3134  N  N    . MET A 1 68  ? -10.688 4.751   3.675   1.00 0.00 ? 68  MET A N    2  
ATOM   3135  C  CA   . MET A 1 68  ? -10.907 3.429   3.103   1.00 0.00 ? 68  MET A CA   2  
ATOM   3136  C  C    . MET A 1 68  ? -12.368 3.348   2.648   1.00 0.00 ? 68  MET A C    2  
ATOM   3137  O  O    . MET A 1 68  ? -13.250 4.002   3.217   1.00 0.00 ? 68  MET A O    2  
ATOM   3138  C  CB   . MET A 1 68  ? -10.606 2.308   4.111   1.00 0.00 ? 68  MET A CB   2  
ATOM   3139  C  CG   . MET A 1 68  ? -9.137  2.193   4.539   1.00 0.00 ? 68  MET A CG   2  
ATOM   3140  S  SD   . MET A 1 68  ? -7.947  1.696   3.259   1.00 0.00 ? 68  MET A SD   2  
ATOM   3141  C  CE   . MET A 1 68  ? -8.269  -0.086  3.170   1.00 0.00 ? 68  MET A CE   2  
ATOM   3142  H  H    . MET A 1 68  ? -10.613 4.849   4.673   1.00 0.00 ? 68  MET A H    2  
ATOM   3143  H  HA   . MET A 1 68  ? -10.267 3.311   2.231   1.00 0.00 ? 68  MET A HA   2  
ATOM   3144  H  HB2  . MET A 1 68  ? -11.214 2.473   5.002   1.00 0.00 ? 68  MET A HB2  2  
ATOM   3145  H  HB3  . MET A 1 68  ? -10.906 1.358   3.669   1.00 0.00 ? 68  MET A HB3  2  
ATOM   3146  H  HG2  . MET A 1 68  ? -8.824  3.151   4.947   1.00 0.00 ? 68  MET A HG2  2  
ATOM   3147  H  HG3  . MET A 1 68  ? -9.076  1.461   5.344   1.00 0.00 ? 68  MET A HG3  2  
ATOM   3148  H  HE1  . MET A 1 68  ? -7.633  -0.530  2.406   1.00 0.00 ? 68  MET A HE1  2  
ATOM   3149  H  HE2  . MET A 1 68  ? -8.041  -0.552  4.130   1.00 0.00 ? 68  MET A HE2  2  
ATOM   3150  H  HE3  . MET A 1 68  ? -9.313  -0.264  2.912   1.00 0.00 ? 68  MET A HE3  2  
ATOM   3151  N  N    . ALA A 1 69  ? -12.623 2.530   1.629   1.00 0.00 ? 69  ALA A N    2  
ATOM   3152  C  CA   . ALA A 1 69  ? -13.974 2.175   1.214   1.00 0.00 ? 69  ALA A CA   2  
ATOM   3153  C  C    . ALA A 1 69  ? -14.698 1.412   2.346   1.00 0.00 ? 69  ALA A C    2  
ATOM   3154  O  O    . ALA A 1 69  ? -14.048 0.999   3.312   1.00 0.00 ? 69  ALA A O    2  
ATOM   3155  C  CB   . ALA A 1 69  ? -13.868 1.339   -0.062  1.00 0.00 ? 69  ALA A CB   2  
ATOM   3156  H  H    . ALA A 1 69  ? -11.852 1.997   1.241   1.00 0.00 ? 69  ALA A H    2  
ATOM   3157  H  HA   . ALA A 1 69  ? -14.522 3.090   0.994   1.00 0.00 ? 69  ALA A HA   2  
ATOM   3158  H  HB1  . ALA A 1 69  ? -13.274 1.877   -0.800  1.00 0.00 ? 69  ALA A HB1  2  
ATOM   3159  H  HB2  . ALA A 1 69  ? -13.402 0.383   0.174   1.00 0.00 ? 69  ALA A HB2  2  
ATOM   3160  H  HB3  . ALA A 1 69  ? -14.852 1.155   -0.487  1.00 0.00 ? 69  ALA A HB3  2  
ATOM   3161  N  N    . PRO A 1 70  ? -16.025 1.199   2.250   1.00 0.00 ? 70  PRO A N    2  
ATOM   3162  C  CA   . PRO A 1 70  ? -16.755 0.343   3.178   1.00 0.00 ? 70  PRO A CA   2  
ATOM   3163  C  C    . PRO A 1 70  ? -16.115 -1.041  3.329   1.00 0.00 ? 70  PRO A C    2  
ATOM   3164  O  O    . PRO A 1 70  ? -15.467 -1.551  2.408   1.00 0.00 ? 70  PRO A O    2  
ATOM   3165  C  CB   . PRO A 1 70  ? -18.176 0.239   2.614   1.00 0.00 ? 70  PRO A CB   2  
ATOM   3166  C  CG   . PRO A 1 70  ? -18.338 1.542   1.836   1.00 0.00 ? 70  PRO A CG   2  
ATOM   3167  C  CD   . PRO A 1 70  ? -16.939 1.767   1.269   1.00 0.00 ? 70  PRO A CD   2  
ATOM   3168  H  HA   . PRO A 1 70  ? -16.787 0.842   4.147   1.00 0.00 ? 70  PRO A HA   2  
ATOM   3169  H  HB2  . PRO A 1 70  ? -18.245 -0.604  1.923   1.00 0.00 ? 70  PRO A HB2  2  
ATOM   3170  H  HB3  . PRO A 1 70  ? -18.919 0.145   3.407   1.00 0.00 ? 70  PRO A HB3  2  
ATOM   3171  H  HG2  . PRO A 1 70  ? -19.086 1.455   1.048   1.00 0.00 ? 70  PRO A HG2  2  
ATOM   3172  H  HG3  . PRO A 1 70  ? -18.592 2.352   2.523   1.00 0.00 ? 70  PRO A HG3  2  
ATOM   3173  H  HD2  . PRO A 1 70  ? -16.849 1.227   0.328   1.00 0.00 ? 70  PRO A HD2  2  
ATOM   3174  H  HD3  . PRO A 1 70  ? -16.759 2.832   1.119   1.00 0.00 ? 70  PRO A HD3  2  
ATOM   3175  N  N    . ASP A 1 71  ? -16.371 -1.689  4.466   1.00 0.00 ? 71  ASP A N    2  
ATOM   3176  C  CA   . ASP A 1 71  ? -15.916 -3.047  4.739   1.00 0.00 ? 71  ASP A CA   2  
ATOM   3177  C  C    . ASP A 1 71  ? -16.367 -4.044  3.670   1.00 0.00 ? 71  ASP A C    2  
ATOM   3178  O  O    . ASP A 1 71  ? -15.634 -4.987  3.391   1.00 0.00 ? 71  ASP A O    2  
ATOM   3179  C  CB   . ASP A 1 71  ? -16.368 -3.516  6.128   1.00 0.00 ? 71  ASP A CB   2  
ATOM   3180  C  CG   . ASP A 1 71  ? -17.812 -4.050  6.153   1.00 0.00 ? 71  ASP A CG   2  
ATOM   3181  O  OD1  . ASP A 1 71  ? -18.758 -3.233  6.093   1.00 0.00 ? 71  ASP A OD1  2  
ATOM   3182  O  OD2  . ASP A 1 71  ? -18.010 -5.279  6.274   1.00 0.00 ? 71  ASP A OD2  2  
ATOM   3183  H  H    . ASP A 1 71  ? -16.871 -1.216  5.205   1.00 0.00 ? 71  ASP A H    2  
ATOM   3184  H  HA   . ASP A 1 71  ? -14.828 -3.023  4.740   1.00 0.00 ? 71  ASP A HA   2  
ATOM   3185  H  HB2  . ASP A 1 71  ? -15.692 -4.311  6.440   1.00 0.00 ? 71  ASP A HB2  2  
ATOM   3186  H  HB3  . ASP A 1 71  ? -16.260 -2.696  6.839   1.00 0.00 ? 71  ASP A HB3  2  
ATOM   3187  N  N    . ASP A 1 72  ? -17.517 -3.825  3.021   1.00 0.00 ? 72  ASP A N    2  
ATOM   3188  C  CA   . ASP A 1 72  ? -17.987 -4.719  1.961   1.00 0.00 ? 72  ASP A CA   2  
ATOM   3189  C  C    . ASP A 1 72  ? -17.016 -4.736  0.783   1.00 0.00 ? 72  ASP A C    2  
ATOM   3190  O  O    . ASP A 1 72  ? -16.783 -5.782  0.178   1.00 0.00 ? 72  ASP A O    2  
ATOM   3191  C  CB   . ASP A 1 72  ? -19.383 -4.325  1.469   1.00 0.00 ? 72  ASP A CB   2  
ATOM   3192  C  CG   . ASP A 1 72  ? -19.893 -5.345  0.434   1.00 0.00 ? 72  ASP A CG   2  
ATOM   3193  O  OD1  . ASP A 1 72  ? -20.453 -6.387  0.843   1.00 0.00 ? 72  ASP A OD1  2  
ATOM   3194  O  OD2  . ASP A 1 72  ? -19.752 -5.111  -0.788  1.00 0.00 ? 72  ASP A OD2  2  
ATOM   3195  H  H    . ASP A 1 72  ? -18.089 -3.037  3.284   1.00 0.00 ? 72  ASP A H    2  
ATOM   3196  H  HA   . ASP A 1 72  ? -18.045 -5.725  2.367   1.00 0.00 ? 72  ASP A HA   2  
ATOM   3197  H  HB2  . ASP A 1 72  ? -20.068 -4.292  2.319   1.00 0.00 ? 72  ASP A HB2  2  
ATOM   3198  H  HB3  . ASP A 1 72  ? -19.347 -3.327  1.025   1.00 0.00 ? 72  ASP A HB3  2  
ATOM   3199  N  N    . GLU A 1 73  ? -16.410 -3.591  0.473   1.00 0.00 ? 73  GLU A N    2  
ATOM   3200  C  CA   . GLU A 1 73  ? -15.394 -3.491  -0.570  1.00 0.00 ? 73  GLU A CA   2  
ATOM   3201  C  C    . GLU A 1 73  ? -14.073 -4.018  -0.023  1.00 0.00 ? 73  GLU A C    2  
ATOM   3202  O  O    . GLU A 1 73  ? -13.382 -4.775  -0.706  1.00 0.00 ? 73  GLU A O    2  
ATOM   3203  C  CB   . GLU A 1 73  ? -15.249 -2.037  -1.052  1.00 0.00 ? 73  GLU A CB   2  
ATOM   3204  C  CG   . GLU A 1 73  ? -16.485 -1.503  -1.793  1.00 0.00 ? 73  GLU A CG   2  
ATOM   3205  C  CD   . GLU A 1 73  ? -16.688 -2.164  -3.170  1.00 0.00 ? 73  GLU A CD   2  
ATOM   3206  O  OE1  . GLU A 1 73  ? -17.081 -3.351  -3.229  1.00 0.00 ? 73  GLU A OE1  2  
ATOM   3207  O  OE2  . GLU A 1 73  ? -16.481 -1.488  -4.204  1.00 0.00 ? 73  GLU A OE2  2  
ATOM   3208  H  H    . GLU A 1 73  ? -16.516 -2.811  1.113   1.00 0.00 ? 73  GLU A H    2  
ATOM   3209  H  HA   . GLU A 1 73  ? -15.668 -4.119  -1.414  1.00 0.00 ? 73  GLU A HA   2  
ATOM   3210  H  HB2  . GLU A 1 73  ? -15.056 -1.397  -0.192  1.00 0.00 ? 73  GLU A HB2  2  
ATOM   3211  H  HB3  . GLU A 1 73  ? -14.390 -1.967  -1.720  1.00 0.00 ? 73  GLU A HB3  2  
ATOM   3212  H  HG2  . GLU A 1 73  ? -17.376 -1.648  -1.179  1.00 0.00 ? 73  GLU A HG2  2  
ATOM   3213  H  HG3  . GLU A 1 73  ? -16.358 -0.427  -1.926  1.00 0.00 ? 73  GLU A HG3  2  
ATOM   3214  N  N    . CYS A 1 74  ? -13.753 -3.695  1.233   1.00 0.00 ? 74  CYS A N    2  
ATOM   3215  C  CA   . CYS A 1 74  ? -12.496 -4.094  1.849   1.00 0.00 ? 74  CYS A CA   2  
ATOM   3216  C  C    . CYS A 1 74  ? -12.401 -5.590  2.173   1.00 0.00 ? 74  CYS A C    2  
ATOM   3217  O  O    . CYS A 1 74  ? -11.378 -6.040  2.684   1.00 0.00 ? 74  CYS A O    2  
ATOM   3218  C  CB   . CYS A 1 74  ? -12.164 -3.192  3.037   1.00 0.00 ? 74  CYS A CB   2  
ATOM   3219  S  SG   . CYS A 1 74  ? -12.088 -1.468  2.466   1.00 0.00 ? 74  CYS A SG   2  
ATOM   3220  H  H    . CYS A 1 74  ? -14.380 -3.097  1.761   1.00 0.00 ? 74  CYS A H    2  
ATOM   3221  H  HA   . CYS A 1 74  ? -11.739 -3.920  1.103   1.00 0.00 ? 74  CYS A HA   2  
ATOM   3222  H  HB2  . CYS A 1 74  ? -12.905 -3.305  3.827   1.00 0.00 ? 74  CYS A HB2  2  
ATOM   3223  H  HB3  . CYS A 1 74  ? -11.188 -3.480  3.422   1.00 0.00 ? 74  CYS A HB3  2  
ATOM   3224  H  HG   . CYS A 1 74  ? -13.416 -1.270  2.410   1.00 0.00 ? 74  CYS A HG   2  
ATOM   3225  N  N    . LEU A 1 75  ? -13.445 -6.364  1.871   1.00 0.00 ? 75  LEU A N    2  
ATOM   3226  C  CA   . LEU A 1 75  ? -13.450 -7.827  1.904   1.00 0.00 ? 75  LEU A CA   2  
ATOM   3227  C  C    . LEU A 1 75  ? -12.853 -8.394  0.613   1.00 0.00 ? 75  LEU A C    2  
ATOM   3228  O  O    . LEU A 1 75  ? -12.451 -9.557  0.583   1.00 0.00 ? 75  LEU A O    2  
ATOM   3229  C  CB   . LEU A 1 75  ? -14.896 -8.348  2.025   1.00 0.00 ? 75  LEU A CB   2  
ATOM   3230  C  CG   . LEU A 1 75  ? -15.442 -8.389  3.461   1.00 0.00 ? 75  LEU A CG   2  
ATOM   3231  C  CD1  . LEU A 1 75  ? -16.959 -8.588  3.426   1.00 0.00 ? 75  LEU A CD1  2  
ATOM   3232  C  CD2  . LEU A 1 75  ? -14.808 -9.528  4.268   1.00 0.00 ? 75  LEU A CD2  2  
ATOM   3233  H  H    . LEU A 1 75  ? -14.242 -5.896  1.468   1.00 0.00 ? 75  LEU A H    2  
ATOM   3234  H  HA   . LEU A 1 75  ? -12.852 -8.177  2.742   1.00 0.00 ? 75  LEU A HA   2  
ATOM   3235  H  HB2  . LEU A 1 75  ? -15.540 -7.727  1.403   1.00 0.00 ? 75  LEU A HB2  2  
ATOM   3236  H  HB3  . LEU A 1 75  ? -14.948 -9.361  1.621   1.00 0.00 ? 75  LEU A HB3  2  
ATOM   3237  H  HG   . LEU A 1 75  ? -15.234 -7.448  3.961   1.00 0.00 ? 75  LEU A HG   2  
ATOM   3238  H  HD11 . LEU A 1 75  ? -17.359 -8.570  4.440   1.00 0.00 ? 75  LEU A HD11 2  
ATOM   3239  H  HD12 . LEU A 1 75  ? -17.413 -7.778  2.858   1.00 0.00 ? 75  LEU A HD12 2  
ATOM   3240  H  HD13 . LEU A 1 75  ? -17.207 -9.539  2.952   1.00 0.00 ? 75  LEU A HD13 2  
ATOM   3241  H  HD21 . LEU A 1 75  ? -15.033 -10.484 3.798   1.00 0.00 ? 75  LEU A HD21 2  
ATOM   3242  H  HD22 . LEU A 1 75  ? -13.729 -9.404  4.324   1.00 0.00 ? 75  LEU A HD22 2  
ATOM   3243  H  HD23 . LEU A 1 75  ? -15.206 -9.526  5.283   1.00 0.00 ? 75  LEU A HD23 2  
ATOM   3244  N  N    . LYS A 1 76  ? -12.831 -7.600  -0.461  1.00 0.00 ? 76  LYS A N    2  
ATOM   3245  C  CA   . LYS A 1 76  ? -12.495 -8.051  -1.807  1.00 0.00 ? 76  LYS A CA   2  
ATOM   3246  C  C    . LYS A 1 76  ? -11.050 -7.679  -2.114  1.00 0.00 ? 76  LYS A C    2  
ATOM   3247  O  O    . LYS A 1 76  ? -10.298 -8.509  -2.624  1.00 0.00 ? 76  LYS A O    2  
ATOM   3248  C  CB   . LYS A 1 76  ? -13.444 -7.415  -2.845  1.00 0.00 ? 76  LYS A CB   2  
ATOM   3249  C  CG   . LYS A 1 76  ? -14.943 -7.571  -2.527  1.00 0.00 ? 76  LYS A CG   2  
ATOM   3250  C  CD   . LYS A 1 76  ? -15.808 -7.045  -3.687  1.00 0.00 ? 76  LYS A CD   2  
ATOM   3251  C  CE   . LYS A 1 76  ? -17.310 -7.024  -3.356  1.00 0.00 ? 76  LYS A CE   2  
ATOM   3252  N  NZ   . LYS A 1 76  ? -17.663 -5.919  -2.437  1.00 0.00 ? 76  LYS A NZ   2  
ATOM   3253  H  H    . LYS A 1 76  ? -13.087 -6.627  -0.342  1.00 0.00 ? 76  LYS A H    2  
ATOM   3254  H  HA   . LYS A 1 76  ? -12.598 -9.137  -1.862  1.00 0.00 ? 76  LYS A HA   2  
ATOM   3255  H  HB2  . LYS A 1 76  ? -13.223 -6.351  -2.927  1.00 0.00 ? 76  LYS A HB2  2  
ATOM   3256  H  HB3  . LYS A 1 76  ? -13.237 -7.874  -3.814  1.00 0.00 ? 76  LYS A HB3  2  
ATOM   3257  H  HG2  . LYS A 1 76  ? -15.172 -8.624  -2.356  1.00 0.00 ? 76  LYS A HG2  2  
ATOM   3258  H  HG3  . LYS A 1 76  ? -15.175 -7.008  -1.623  1.00 0.00 ? 76  LYS A HG3  2  
ATOM   3259  H  HD2  . LYS A 1 76  ? -15.486 -6.039  -3.964  1.00 0.00 ? 76  LYS A HD2  2  
ATOM   3260  H  HD3  . LYS A 1 76  ? -15.656 -7.696  -4.550  1.00 0.00 ? 76  LYS A HD3  2  
ATOM   3261  H  HE2  . LYS A 1 76  ? -17.869 -6.895  -4.285  1.00 0.00 ? 76  LYS A HE2  2  
ATOM   3262  H  HE3  . LYS A 1 76  ? -17.597 -7.980  -2.916  1.00 0.00 ? 76  LYS A HE3  2  
ATOM   3263  H  HZ1  . LYS A 1 76  ? -17.442 -5.008  -2.841  1.00 0.00 ? 76  LYS A HZ1  2  
ATOM   3264  H  HZ2  . LYS A 1 76  ? -18.651 -5.898  -2.192  1.00 0.00 ? 76  LYS A HZ2  2  
ATOM   3265  H  HZ3  . LYS A 1 76  ? -17.172 -6.002  -1.553  1.00 0.00 ? 76  LYS A HZ3  2  
ATOM   3266  N  N    . ASP A 1 77  ? -10.658 -6.448  -1.784  1.00 0.00 ? 77  ASP A N    2  
ATOM   3267  C  CA   . ASP A 1 77  ? -9.309  -5.903  -1.958  1.00 0.00 ? 77  ASP A CA   2  
ATOM   3268  C  C    . ASP A 1 77  ? -9.220  -4.648  -1.084  1.00 0.00 ? 77  ASP A C    2  
ATOM   3269  O  O    . ASP A 1 77  ? -10.245 -4.192  -0.581  1.00 0.00 ? 77  ASP A O    2  
ATOM   3270  C  CB   . ASP A 1 77  ? -9.057  -5.552  -3.438  1.00 0.00 ? 77  ASP A CB   2  
ATOM   3271  C  CG   . ASP A 1 77  ? -7.584  -5.254  -3.775  1.00 0.00 ? 77  ASP A CG   2  
ATOM   3272  O  OD1  . ASP A 1 77  ? -6.702  -5.399  -2.901  1.00 0.00 ? 77  ASP A OD1  2  
ATOM   3273  O  OD2  . ASP A 1 77  ? -7.311  -4.908  -4.947  1.00 0.00 ? 77  ASP A OD2  2  
ATOM   3274  H  H    . ASP A 1 77  ? -11.318 -5.824  -1.322  1.00 0.00 ? 77  ASP A H    2  
ATOM   3275  H  HA   . ASP A 1 77  ? -8.574  -6.639  -1.629  1.00 0.00 ? 77  ASP A HA   2  
ATOM   3276  H  HB2  . ASP A 1 77  ? -9.381  -6.387  -4.061  1.00 0.00 ? 77  ASP A HB2  2  
ATOM   3277  H  HB3  . ASP A 1 77  ? -9.666  -4.687  -3.703  1.00 0.00 ? 77  ASP A HB3  2  
ATOM   3278  N  N    . MET A 1 78  ? -8.043  -4.063  -0.879  1.00 0.00 ? 78  MET A N    2  
ATOM   3279  C  CA   . MET A 1 78  ? -7.933  -2.796  -0.162  1.00 0.00 ? 78  MET A CA   2  
ATOM   3280  C  C    . MET A 1 78  ? -8.371  -1.673  -1.105  1.00 0.00 ? 78  MET A C    2  
ATOM   3281  O  O    . MET A 1 78  ? -7.766  -1.482  -2.163  1.00 0.00 ? 78  MET A O    2  
ATOM   3282  C  CB   . MET A 1 78  ? -6.498  -2.583  0.339   1.00 0.00 ? 78  MET A CB   2  
ATOM   3283  C  CG   . MET A 1 78  ? -6.080  -3.604  1.405   1.00 0.00 ? 78  MET A CG   2  
ATOM   3284  S  SD   . MET A 1 78  ? -7.087  -3.661  2.918   1.00 0.00 ? 78  MET A SD   2  
ATOM   3285  C  CE   . MET A 1 78  ? -8.126  -5.107  2.560   1.00 0.00 ? 78  MET A CE   2  
ATOM   3286  H  H    . MET A 1 78  ? -7.227  -4.433  -1.364  1.00 0.00 ? 78  MET A H    2  
ATOM   3287  H  HA   . MET A 1 78  ? -8.603  -2.809  0.699   1.00 0.00 ? 78  MET A HA   2  
ATOM   3288  H  HB2  . MET A 1 78  ? -5.807  -2.644  -0.502  1.00 0.00 ? 78  MET A HB2  2  
ATOM   3289  H  HB3  . MET A 1 78  ? -6.418  -1.584  0.770   1.00 0.00 ? 78  MET A HB3  2  
ATOM   3290  H  HG2  . MET A 1 78  ? -6.068  -4.597  0.957   1.00 0.00 ? 78  MET A HG2  2  
ATOM   3291  H  HG3  . MET A 1 78  ? -5.057  -3.369  1.696   1.00 0.00 ? 78  MET A HG3  2  
ATOM   3292  H  HE1  . MET A 1 78  ? -7.495  -5.971  2.354   1.00 0.00 ? 78  MET A HE1  2  
ATOM   3293  H  HE2  . MET A 1 78  ? -8.755  -5.330  3.418   1.00 0.00 ? 78  MET A HE2  2  
ATOM   3294  H  HE3  . MET A 1 78  ? -8.765  -4.910  1.701   1.00 0.00 ? 78  MET A HE3  2  
ATOM   3295  N  N    . TYR A 1 79  ? -9.394  -0.906  -0.717  1.00 0.00 ? 79  TYR A N    2  
ATOM   3296  C  CA   . TYR A 1 79  ? -9.982  0.160   -1.523  1.00 0.00 ? 79  TYR A CA   2  
ATOM   3297  C  C    . TYR A 1 79  ? -10.079 1.437   -0.694  1.00 0.00 ? 79  TYR A C    2  
ATOM   3298  O  O    . TYR A 1 79  ? -10.192 1.385   0.532   1.00 0.00 ? 79  TYR A O    2  
ATOM   3299  C  CB   . TYR A 1 79  ? -11.403 -0.231  -1.966  1.00 0.00 ? 79  TYR A CB   2  
ATOM   3300  C  CG   . TYR A 1 79  ? -11.546 -1.161  -3.150  1.00 0.00 ? 79  TYR A CG   2  
ATOM   3301  C  CD1  . TYR A 1 79  ? -11.567 -0.631  -4.453  1.00 0.00 ? 79  TYR A CD1  2  
ATOM   3302  C  CD2  . TYR A 1 79  ? -11.805 -2.527  -2.945  1.00 0.00 ? 79  TYR A CD2  2  
ATOM   3303  C  CE1  . TYR A 1 79  ? -11.848 -1.463  -5.549  1.00 0.00 ? 79  TYR A CE1  2  
ATOM   3304  C  CE2  . TYR A 1 79  ? -12.066 -3.371  -4.036  1.00 0.00 ? 79  TYR A CE2  2  
ATOM   3305  C  CZ   . TYR A 1 79  ? -12.088 -2.841  -5.346  1.00 0.00 ? 79  TYR A CZ   2  
ATOM   3306  O  OH   . TYR A 1 79  ? -12.331 -3.641  -6.422  1.00 0.00 ? 79  TYR A OH   2  
ATOM   3307  H  H    . TYR A 1 79  ? -9.830  -1.063  0.180   1.00 0.00 ? 79  TYR A H    2  
ATOM   3308  H  HA   . TYR A 1 79  ? -9.361  0.369   -2.393  1.00 0.00 ? 79  TYR A HA   2  
ATOM   3309  H  HB2  . TYR A 1 79  ? -11.923 -0.671  -1.115  1.00 0.00 ? 79  TYR A HB2  2  
ATOM   3310  H  HB3  . TYR A 1 79  ? -11.941 0.679   -2.230  1.00 0.00 ? 79  TYR A HB3  2  
ATOM   3311  H  HD1  . TYR A 1 79  ? -11.401 0.424   -4.615  1.00 0.00 ? 79  TYR A HD1  2  
ATOM   3312  H  HD2  . TYR A 1 79  ? -11.831 -2.930  -1.943  1.00 0.00 ? 79  TYR A HD2  2  
ATOM   3313  H  HE1  . TYR A 1 79  ? -11.888 -1.041  -6.544  1.00 0.00 ? 79  TYR A HE1  2  
ATOM   3314  H  HE2  . TYR A 1 79  ? -12.255 -4.419  -3.860  1.00 0.00 ? 79  TYR A HE2  2  
ATOM   3315  H  HH   . TYR A 1 79  ? -12.530 -4.560  -6.180  1.00 0.00 ? 79  TYR A HH   2  
ATOM   3316  N  N    . VAL A 1 80  ? -10.115 2.575   -1.381  1.00 0.00 ? 80  VAL A N    2  
ATOM   3317  C  CA   . VAL A 1 80  ? -10.161 3.906   -0.801  1.00 0.00 ? 80  VAL A CA   2  
ATOM   3318  C  C    . VAL A 1 80  ? -11.109 4.757   -1.635  1.00 0.00 ? 80  VAL A C    2  
ATOM   3319  O  O    . VAL A 1 80  ? -11.132 4.642   -2.861  1.00 0.00 ? 80  VAL A O    2  
ATOM   3320  C  CB   . VAL A 1 80  ? -8.747  4.525   -0.739  1.00 0.00 ? 80  VAL A CB   2  
ATOM   3321  C  CG1  . VAL A 1 80  ? -7.945  3.977   0.444   1.00 0.00 ? 80  VAL A CG1  2  
ATOM   3322  C  CG2  . VAL A 1 80  ? -7.916  4.316   -2.018  1.00 0.00 ? 80  VAL A CG2  2  
ATOM   3323  H  H    . VAL A 1 80  ? -10.034 2.527   -2.393  1.00 0.00 ? 80  VAL A H    2  
ATOM   3324  H  HA   . VAL A 1 80  ? -10.564 3.846   0.206   1.00 0.00 ? 80  VAL A HA   2  
ATOM   3325  H  HB   . VAL A 1 80  ? -8.865  5.595   -0.577  1.00 0.00 ? 80  VAL A HB   2  
ATOM   3326  H  HG11 . VAL A 1 80  ? -7.799  2.901   0.344   1.00 0.00 ? 80  VAL A HG11 2  
ATOM   3327  H  HG12 . VAL A 1 80  ? -6.977  4.474   0.492   1.00 0.00 ? 80  VAL A HG12 2  
ATOM   3328  H  HG13 . VAL A 1 80  ? -8.477  4.188   1.369   1.00 0.00 ? 80  VAL A HG13 2  
ATOM   3329  H  HG21 . VAL A 1 80  ? -8.450  4.721   -2.876  1.00 0.00 ? 80  VAL A HG21 2  
ATOM   3330  H  HG22 . VAL A 1 80  ? -6.963  4.836   -1.925  1.00 0.00 ? 80  VAL A HG22 2  
ATOM   3331  H  HG23 . VAL A 1 80  ? -7.727  3.254   -2.187  1.00 0.00 ? 80  VAL A HG23 2  
ATOM   3332  N  N    . GLU A 1 81  ? -11.901 5.597   -0.975  1.00 0.00 ? 81  GLU A N    2  
ATOM   3333  C  CA   . GLU A 1 81  ? -12.701 6.617   -1.633  1.00 0.00 ? 81  GLU A CA   2  
ATOM   3334  C  C    . GLU A 1 81  ? -11.770 7.786   -1.938  1.00 0.00 ? 81  GLU A C    2  
ATOM   3335  O  O    . GLU A 1 81  ? -10.933 8.146   -1.102  1.00 0.00 ? 81  GLU A O    2  
ATOM   3336  C  CB   . GLU A 1 81  ? -13.850 7.074   -0.722  1.00 0.00 ? 81  GLU A CB   2  
ATOM   3337  C  CG   . GLU A 1 81  ? -14.876 5.958   -0.485  1.00 0.00 ? 81  GLU A CG   2  
ATOM   3338  C  CD   . GLU A 1 81  ? -16.097 6.472   0.299   1.00 0.00 ? 81  GLU A CD   2  
ATOM   3339  O  OE1  . GLU A 1 81  ? -16.054 6.515   1.549   1.00 0.00 ? 81  GLU A OE1  2  
ATOM   3340  O  OE2  . GLU A 1 81  ? -17.122 6.825   -0.328  1.00 0.00 ? 81  GLU A OE2  2  
ATOM   3341  H  H    . GLU A 1 81  ? -11.738 5.721   0.019   1.00 0.00 ? 81  GLU A H    2  
ATOM   3342  H  HA   . GLU A 1 81  ? -13.115 6.220   -2.560  1.00 0.00 ? 81  GLU A HA   2  
ATOM   3343  H  HB2  . GLU A 1 81  ? -13.448 7.411   0.236   1.00 0.00 ? 81  GLU A HB2  2  
ATOM   3344  H  HB3  . GLU A 1 81  ? -14.355 7.914   -1.200  1.00 0.00 ? 81  GLU A HB3  2  
ATOM   3345  H  HG2  . GLU A 1 81  ? -15.200 5.561   -1.450  1.00 0.00 ? 81  GLU A HG2  2  
ATOM   3346  H  HG3  . GLU A 1 81  ? -14.402 5.144   0.067   1.00 0.00 ? 81  GLU A HG3  2  
ATOM   3347  N  N    . VAL A 1 82  ? -11.911 8.391   -3.114  1.00 0.00 ? 82  VAL A N    2  
ATOM   3348  C  CA   . VAL A 1 82  ? -11.023 9.454   -3.568  1.00 0.00 ? 82  VAL A CA   2  
ATOM   3349  C  C    . VAL A 1 82  ? -11.843 10.514  -4.297  1.00 0.00 ? 82  VAL A C    2  
ATOM   3350  O  O    . VAL A 1 82  ? -12.749 10.174  -5.054  1.00 0.00 ? 82  VAL A O    2  
ATOM   3351  C  CB   . VAL A 1 82  ? -9.879  8.878   -4.446  1.00 0.00 ? 82  VAL A CB   2  
ATOM   3352  C  CG1  . VAL A 1 82  ? -9.073  7.773   -3.747  1.00 0.00 ? 82  VAL A CG1  2  
ATOM   3353  C  CG2  . VAL A 1 82  ? -10.337 8.310   -5.800  1.00 0.00 ? 82  VAL A CG2  2  
ATOM   3354  H  H    . VAL A 1 82  ? -12.636 8.074   -3.755  1.00 0.00 ? 82  VAL A H    2  
ATOM   3355  H  HA   . VAL A 1 82  ? -10.594 9.937   -2.689  1.00 0.00 ? 82  VAL A HA   2  
ATOM   3356  H  HB   . VAL A 1 82  ? -9.190  9.695   -4.644  1.00 0.00 ? 82  VAL A HB   2  
ATOM   3357  H  HG11 . VAL A 1 82  ? -8.185  7.533   -4.331  1.00 0.00 ? 82  VAL A HG11 2  
ATOM   3358  H  HG12 . VAL A 1 82  ? -8.763  8.119   -2.768  1.00 0.00 ? 82  VAL A HG12 2  
ATOM   3359  H  HG13 . VAL A 1 82  ? -9.673  6.870   -3.635  1.00 0.00 ? 82  VAL A HG13 2  
ATOM   3360  H  HG21 . VAL A 1 82  ? -11.067 7.515   -5.651  1.00 0.00 ? 82  VAL A HG21 2  
ATOM   3361  H  HG22 . VAL A 1 82  ? -10.778 9.101   -6.406  1.00 0.00 ? 82  VAL A HG22 2  
ATOM   3362  H  HG23 . VAL A 1 82  ? -9.482  7.907   -6.345  1.00 0.00 ? 82  VAL A HG23 2  
ATOM   3363  N  N    . ALA A 1 83  ? -11.531 11.790  -4.089  1.00 0.00 ? 83  ALA A N    2  
ATOM   3364  C  CA   . ALA A 1 83  ? -12.187 12.912  -4.739  1.00 0.00 ? 83  ALA A CA   2  
ATOM   3365  C  C    . ALA A 1 83  ? -11.196 13.460  -5.745  1.00 0.00 ? 83  ALA A C    2  
ATOM   3366  O  O    . ALA A 1 83  ? -10.004 13.550  -5.464  1.00 0.00 ? 83  ALA A O    2  
ATOM   3367  C  CB   . ALA A 1 83  ? -12.580 13.992  -3.728  1.00 0.00 ? 83  ALA A CB   2  
ATOM   3368  H  H    . ALA A 1 83  ? -10.669 11.996  -3.589  1.00 0.00 ? 83  ALA A H    2  
ATOM   3369  H  HA   . ALA A 1 83  ? -13.083 12.577  -5.257  1.00 0.00 ? 83  ALA A HA   2  
ATOM   3370  H  HB1  . ALA A 1 83  ? -13.319 13.603  -3.031  1.00 0.00 ? 83  ALA A HB1  2  
ATOM   3371  H  HB2  . ALA A 1 83  ? -11.700 14.333  -3.183  1.00 0.00 ? 83  ALA A HB2  2  
ATOM   3372  H  HB3  . ALA A 1 83  ? -13.015 14.839  -4.259  1.00 0.00 ? 83  ALA A HB3  2  
ATOM   3373  N  N    . ASP A 1 84  ? -11.666 13.789  -6.934  1.00 0.00 ? 84  ASP A N    2  
ATOM   3374  C  CA   . ASP A 1 84  ? -10.786 14.194  -8.018  1.00 0.00 ? 84  ASP A CA   2  
ATOM   3375  C  C    . ASP A 1 84  ? -10.268 15.615  -7.773  1.00 0.00 ? 84  ASP A C    2  
ATOM   3376  O  O    . ASP A 1 84  ? -11.016 16.466  -7.280  1.00 0.00 ? 84  ASP A O    2  
ATOM   3377  C  CB   . ASP A 1 84  ? -11.593 14.105  -9.316  1.00 0.00 ? 84  ASP A CB   2  
ATOM   3378  C  CG   . ASP A 1 84  ? -10.719 13.862  -10.542 1.00 0.00 ? 84  ASP A CG   2  
ATOM   3379  O  OD1  . ASP A 1 84  ? -9.603  14.415  -10.620 1.00 0.00 ? 84  ASP A OD1  2  
ATOM   3380  O  OD2  . ASP A 1 84  ? -11.169 13.103  -11.429 1.00 0.00 ? 84  ASP A OD2  2  
ATOM   3381  H  H    . ASP A 1 84  ? -12.668 13.769  -7.101  1.00 0.00 ? 84  ASP A H    2  
ATOM   3382  H  HA   . ASP A 1 84  ? -9.930  13.513  -8.062  1.00 0.00 ? 84  ASP A HA   2  
ATOM   3383  H  HB2  . ASP A 1 84  ? -12.295 13.275  -9.233  1.00 0.00 ? 84  ASP A HB2  2  
ATOM   3384  H  HB3  . ASP A 1 84  ? -12.175 15.016  -9.444  1.00 0.00 ? 84  ASP A HB3  2  
ATOM   3385  N  N    . ILE A 1 85  ? -9.002  15.868  -8.114  1.00 0.00 ? 85  ILE A N    2  
ATOM   3386  C  CA   . ILE A 1 85  ? -8.413  17.209  -8.151  1.00 0.00 ? 85  ILE A CA   2  
ATOM   3387  C  C    . ILE A 1 85  ? -7.759  17.477  -9.526  1.00 0.00 ? 85  ILE A C    2  
ATOM   3388  O  O    . ILE A 1 85  ? -7.555  18.638  -9.887  1.00 0.00 ? 85  ILE A O    2  
ATOM   3389  C  CB   . ILE A 1 85  ? -7.372  17.428  -7.016  1.00 0.00 ? 85  ILE A CB   2  
ATOM   3390  C  CG1  . ILE A 1 85  ? -7.637  16.690  -5.684  1.00 0.00 ? 85  ILE A CG1  2  
ATOM   3391  C  CG2  . ILE A 1 85  ? -7.256  18.929  -6.694  1.00 0.00 ? 85  ILE A CG2  2  
ATOM   3392  C  CD1  . ILE A 1 85  ? -6.482  16.858  -4.684  1.00 0.00 ? 85  ILE A CD1  2  
ATOM   3393  H  H    . ILE A 1 85  ? -8.425  15.093  -8.425  1.00 0.00 ? 85  ILE A H    2  
ATOM   3394  H  HA   . ILE A 1 85  ? -9.212  17.935  -8.012  1.00 0.00 ? 85  ILE A HA   2  
ATOM   3395  H  HB   . ILE A 1 85  ? -6.409  17.077  -7.393  1.00 0.00 ? 85  ILE A HB   2  
ATOM   3396  H  HG12 . ILE A 1 85  ? -8.566  17.042  -5.232  1.00 0.00 ? 85  ILE A HG12 2  
ATOM   3397  H  HG13 . ILE A 1 85  ? -7.743  15.633  -5.881  1.00 0.00 ? 85  ILE A HG13 2  
ATOM   3398  H  HG21 . ILE A 1 85  ? -6.390  19.117  -6.060  1.00 0.00 ? 85  ILE A HG21 2  
ATOM   3399  H  HG22 . ILE A 1 85  ? -7.128  19.512  -7.603  1.00 0.00 ? 85  ILE A HG22 2  
ATOM   3400  H  HG23 . ILE A 1 85  ? -8.156  19.258  -6.172  1.00 0.00 ? 85  ILE A HG23 2  
ATOM   3401  H  HD11 . ILE A 1 85  ? -5.526  16.744  -5.193  1.00 0.00 ? 85  ILE A HD11 2  
ATOM   3402  H  HD12 . ILE A 1 85  ? -6.531  17.840  -4.214  1.00 0.00 ? 85  ILE A HD12 2  
ATOM   3403  H  HD13 . ILE A 1 85  ? -6.542  16.103  -3.908  1.00 0.00 ? 85  ILE A HD13 2  
ATOM   3404  N  N    . GLY A 1 86  ? -7.416  16.441  -10.304 1.00 0.00 ? 86  GLY A N    2  
ATOM   3405  C  CA   . GLY A 1 86  ? -6.597  16.582  -11.507 1.00 0.00 ? 86  GLY A CA   2  
ATOM   3406  C  C    . GLY A 1 86  ? -7.380  16.435  -12.811 1.00 0.00 ? 86  GLY A C    2  
ATOM   3407  O  O    . GLY A 1 86  ? -7.015  17.059  -13.810 1.00 0.00 ? 86  GLY A O    2  
ATOM   3408  H  H    . GLY A 1 86  ? -7.691  15.503  -10.030 1.00 0.00 ? 86  GLY A H    2  
ATOM   3409  H  HA2  . GLY A 1 86  ? -6.086  17.546  -11.499 1.00 0.00 ? 86  GLY A HA2  2  
ATOM   3410  H  HA3  . GLY A 1 86  ? -5.836  15.803  -11.483 1.00 0.00 ? 86  GLY A HA3  2  
ATOM   3411  N  N    . GLY A 1 87  ? -8.456  15.649  -12.810 1.00 0.00 ? 87  GLY A N    2  
ATOM   3412  C  CA   . GLY A 1 87  ? -9.309  15.401  -13.967 1.00 0.00 ? 87  GLY A CA   2  
ATOM   3413  C  C    . GLY A 1 87  ? -10.664 16.092  -13.828 1.00 0.00 ? 87  GLY A C    2  
ATOM   3414  O  O    . GLY A 1 87  ? -11.240 16.532  -14.826 1.00 0.00 ? 87  GLY A O    2  
ATOM   3415  H  H    . GLY A 1 87  ? -8.721  15.184  -11.943 1.00 0.00 ? 87  GLY A H    2  
ATOM   3416  H  HA2  . GLY A 1 87  ? -8.821  15.729  -14.884 1.00 0.00 ? 87  GLY A HA2  2  
ATOM   3417  H  HA3  . GLY A 1 87  ? -9.485  14.329  -14.020 1.00 0.00 ? 87  GLY A HA3  2  
ATOM   3418  N  N    . LYS A 1 88  ? -11.141 16.242  -12.593 1.00 0.00 ? 88  LYS A N    2  
ATOM   3419  C  CA   . LYS A 1 88  ? -12.330 16.993  -12.198 1.00 0.00 ? 88  LYS A CA   2  
ATOM   3420  C  C    . LYS A 1 88  ? -12.007 17.647  -10.850 1.00 0.00 ? 88  LYS A C    2  
ATOM   3421  O  O    . LYS A 1 88  ? -10.898 17.490  -10.339 1.00 0.00 ? 88  LYS A O    2  
ATOM   3422  C  CB   . LYS A 1 88  ? -13.562 16.066  -12.091 1.00 0.00 ? 88  LYS A CB   2  
ATOM   3423  C  CG   . LYS A 1 88  ? -13.957 15.338  -13.387 1.00 0.00 ? 88  LYS A CG   2  
ATOM   3424  C  CD   . LYS A 1 88  ? -15.229 14.517  -13.137 1.00 0.00 ? 88  LYS A CD   2  
ATOM   3425  C  CE   . LYS A 1 88  ? -15.625 13.652  -14.338 1.00 0.00 ? 88  LYS A CE   2  
ATOM   3426  N  NZ   . LYS A 1 88  ? -16.847 12.861  -14.048 1.00 0.00 ? 88  LYS A NZ   2  
ATOM   3427  H  H    . LYS A 1 88  ? -10.569 15.902  -11.824 1.00 0.00 ? 88  LYS A H    2  
ATOM   3428  H  HA   . LYS A 1 88  ? -12.530 17.777  -12.932 1.00 0.00 ? 88  LYS A HA   2  
ATOM   3429  H  HB2  . LYS A 1 88  ? -13.376 15.318  -11.321 1.00 0.00 ? 88  LYS A HB2  2  
ATOM   3430  H  HB3  . LYS A 1 88  ? -14.417 16.664  -11.773 1.00 0.00 ? 88  LYS A HB3  2  
ATOM   3431  H  HG2  . LYS A 1 88  ? -14.140 16.065  -14.179 1.00 0.00 ? 88  LYS A HG2  2  
ATOM   3432  H  HG3  . LYS A 1 88  ? -13.154 14.664  -13.691 1.00 0.00 ? 88  LYS A HG3  2  
ATOM   3433  H  HD2  . LYS A 1 88  ? -15.045 13.856  -12.293 1.00 0.00 ? 88  LYS A HD2  2  
ATOM   3434  H  HD3  . LYS A 1 88  ? -16.049 15.193  -12.889 1.00 0.00 ? 88  LYS A HD3  2  
ATOM   3435  H  HE2  . LYS A 1 88  ? -15.794 14.290  -15.209 1.00 0.00 ? 88  LYS A HE2  2  
ATOM   3436  H  HE3  . LYS A 1 88  ? -14.802 12.972  -14.567 1.00 0.00 ? 88  LYS A HE3  2  
ATOM   3437  H  HZ1  . LYS A 1 88  ? -16.983 12.140  -14.741 1.00 0.00 ? 88  LYS A HZ1  2  
ATOM   3438  H  HZ2  . LYS A 1 88  ? -16.792 12.420  -13.127 1.00 0.00 ? 88  LYS A HZ2  2  
ATOM   3439  H  HZ3  . LYS A 1 88  ? -17.666 13.449  -14.049 1.00 0.00 ? 88  LYS A HZ3  2  
ATOM   3440  N  N    . ASP A 1 89  ? -12.970 18.358  -10.262 1.00 0.00 ? 89  ASP A N    2  
ATOM   3441  C  CA   . ASP A 1 89  ? -12.809 19.038  -8.970  1.00 0.00 ? 89  ASP A CA   2  
ATOM   3442  C  C    . ASP A 1 89  ? -14.093 18.948  -8.124  1.00 0.00 ? 89  ASP A C    2  
ATOM   3443  O  O    . ASP A 1 89  ? -14.230 19.631  -7.109  1.00 0.00 ? 89  ASP A O    2  
ATOM   3444  C  CB   . ASP A 1 89  ? -12.397 20.497  -9.236  1.00 0.00 ? 89  ASP A CB   2  
ATOM   3445  C  CG   . ASP A 1 89  ? -12.039 21.274  -7.956  1.00 0.00 ? 89  ASP A CG   2  
ATOM   3446  O  OD1  . ASP A 1 89  ? -11.146 20.834  -7.197  1.00 0.00 ? 89  ASP A OD1  2  
ATOM   3447  O  OD2  . ASP A 1 89  ? -12.597 22.375  -7.739  1.00 0.00 ? 89  ASP A OD2  2  
ATOM   3448  H  H    . ASP A 1 89  ? -13.832 18.515  -10.763 1.00 0.00 ? 89  ASP A H    2  
ATOM   3449  H  HA   . ASP A 1 89  ? -12.008 18.557  -8.409  1.00 0.00 ? 89  ASP A HA   2  
ATOM   3450  H  HB2  . ASP A 1 89  ? -11.527 20.502  -9.896  1.00 0.00 ? 89  ASP A HB2  2  
ATOM   3451  H  HB3  . ASP A 1 89  ? -13.211 21.000  -9.762  1.00 0.00 ? 89  ASP A HB3  2  
ATOM   3452  N  N    . ASP A 1 90  ? -15.060 18.119  -8.540  1.00 0.00 ? 90  ASP A N    2  
ATOM   3453  C  CA   . ASP A 1 90  ? -16.417 18.086  -7.972  1.00 0.00 ? 90  ASP A CA   2  
ATOM   3454  C  C    . ASP A 1 90  ? -17.044 16.685  -8.068  1.00 0.00 ? 90  ASP A C    2  
ATOM   3455  O  O    . ASP A 1 90  ? -18.265 16.527  -8.117  1.00 0.00 ? 90  ASP A O    2  
ATOM   3456  C  CB   . ASP A 1 90  ? -17.265 19.125  -8.720  1.00 0.00 ? 90  ASP A CB   2  
ATOM   3457  C  CG   . ASP A 1 90  ? -18.647 19.362  -8.080  1.00 0.00 ? 90  ASP A CG   2  
ATOM   3458  O  OD1  . ASP A 1 90  ? -18.731 19.568  -6.848  1.00 0.00 ? 90  ASP A OD1  2  
ATOM   3459  O  OD2  . ASP A 1 90  ? -19.658 19.416  -8.818  1.00 0.00 ? 90  ASP A OD2  2  
ATOM   3460  H  H    . ASP A 1 90  ? -14.891 17.537  -9.346  1.00 0.00 ? 90  ASP A H    2  
ATOM   3461  H  HA   . ASP A 1 90  ? -16.369 18.363  -6.918  1.00 0.00 ? 90  ASP A HA   2  
ATOM   3462  H  HB2  . ASP A 1 90  ? -16.726 20.073  -8.741  1.00 0.00 ? 90  ASP A HB2  2  
ATOM   3463  H  HB3  . ASP A 1 90  ? -17.377 18.778  -9.750  1.00 0.00 ? 90  ASP A HB3  2  
ATOM   3464  N  N    . ASP A 1 91  ? -16.208 15.648  -8.145  1.00 0.00 ? 91  ASP A N    2  
ATOM   3465  C  CA   . ASP A 1 91  ? -16.629 14.258  -8.334  1.00 0.00 ? 91  ASP A CA   2  
ATOM   3466  C  C    . ASP A 1 91  ? -15.749 13.330  -7.496  1.00 0.00 ? 91  ASP A C    2  
ATOM   3467  O  O    . ASP A 1 91  ? -14.628 13.697  -7.126  1.00 0.00 ? 91  ASP A O    2  
ATOM   3468  C  CB   . ASP A 1 91  ? -16.548 13.898  -9.825  1.00 0.00 ? 91  ASP A CB   2  
ATOM   3469  C  CG   . ASP A 1 91  ? -17.277 12.595  -10.203 1.00 0.00 ? 91  ASP A CG   2  
ATOM   3470  O  OD1  . ASP A 1 91  ? -18.071 12.062  -9.395  1.00 0.00 ? 91  ASP A OD1  2  
ATOM   3471  O  OD2  . ASP A 1 91  ? -17.098 12.143  -11.357 1.00 0.00 ? 91  ASP A OD2  2  
ATOM   3472  H  H    . ASP A 1 91  ? -15.220 15.812  -8.022  1.00 0.00 ? 91  ASP A H    2  
ATOM   3473  H  HA   . ASP A 1 91  ? -17.663 14.148  -8.005  1.00 0.00 ? 91  ASP A HA   2  
ATOM   3474  H  HB2  . ASP A 1 91  ? -16.989 14.710  -10.407 1.00 0.00 ? 91  ASP A HB2  2  
ATOM   3475  H  HB3  . ASP A 1 91  ? -15.495 13.819  -10.097 1.00 0.00 ? 91  ASP A HB3  2  
ATOM   3476  N  N    . VAL A 1 92  ? -16.255 12.136  -7.187  1.00 0.00 ? 92  VAL A N    2  
ATOM   3477  C  CA   . VAL A 1 92  ? -15.661 11.193  -6.244  1.00 0.00 ? 92  VAL A CA   2  
ATOM   3478  C  C    . VAL A 1 92  ? -15.772 9.787   -6.846  1.00 0.00 ? 92  VAL A C    2  
ATOM   3479  O  O    . VAL A 1 92  ? -16.723 9.468   -7.566  1.00 0.00 ? 92  VAL A O    2  
ATOM   3480  C  CB   . VAL A 1 92  ? -16.342 11.288  -4.853  1.00 0.00 ? 92  VAL A CB   2  
ATOM   3481  C  CG1  . VAL A 1 92  ? -15.587 10.529  -3.748  1.00 0.00 ? 92  VAL A CG1  2  
ATOM   3482  C  CG2  . VAL A 1 92  ? -16.511 12.738  -4.360  1.00 0.00 ? 92  VAL A CG2  2  
ATOM   3483  H  H    . VAL A 1 92  ? -17.106 11.833  -7.646  1.00 0.00 ? 92  VAL A H    2  
ATOM   3484  H  HA   . VAL A 1 92  ? -14.611 11.437  -6.128  1.00 0.00 ? 92  VAL A HA   2  
ATOM   3485  H  HB   . VAL A 1 92  ? -17.326 10.838  -4.935  1.00 0.00 ? 92  VAL A HB   2  
ATOM   3486  H  HG11 . VAL A 1 92  ? -15.463 9.479   -4.007  1.00 0.00 ? 92  VAL A HG11 2  
ATOM   3487  H  HG12 . VAL A 1 92  ? -14.608 10.975  -3.588  1.00 0.00 ? 92  VAL A HG12 2  
ATOM   3488  H  HG13 . VAL A 1 92  ? -16.147 10.575  -2.813  1.00 0.00 ? 92  VAL A HG13 2  
ATOM   3489  H  HG21 . VAL A 1 92  ? -17.202 13.282  -5.004  1.00 0.00 ? 92  VAL A HG21 2  
ATOM   3490  H  HG22 . VAL A 1 92  ? -16.925 12.746  -3.351  1.00 0.00 ? 92  VAL A HG22 2  
ATOM   3491  H  HG23 . VAL A 1 92  ? -15.547 13.247  -4.353  1.00 0.00 ? 92  VAL A HG23 2  
ATOM   3492  N  N    . TYR A 1 93  ? -14.783 8.957   -6.531  1.00 0.00 ? 93  TYR A N    2  
ATOM   3493  C  CA   . TYR A 1 93  ? -14.570 7.621   -7.058  1.00 0.00 ? 93  TYR A CA   2  
ATOM   3494  C  C    . TYR A 1 93  ? -14.097 6.711   -5.917  1.00 0.00 ? 93  TYR A C    2  
ATOM   3495  O  O    . TYR A 1 93  ? -13.904 7.150   -4.780  1.00 0.00 ? 93  TYR A O    2  
ATOM   3496  C  CB   . TYR A 1 93  ? -13.494 7.680   -8.161  1.00 0.00 ? 93  TYR A CB   2  
ATOM   3497  C  CG   . TYR A 1 93  ? -13.785 8.567   -9.360  1.00 0.00 ? 93  TYR A CG   2  
ATOM   3498  C  CD1  . TYR A 1 93  ? -13.398 9.923   -9.350  1.00 0.00 ? 93  TYR A CD1  2  
ATOM   3499  C  CD2  . TYR A 1 93  ? -14.373 8.016   -10.515 1.00 0.00 ? 93  TYR A CD2  2  
ATOM   3500  C  CE1  . TYR A 1 93  ? -13.589 10.720  -10.493 1.00 0.00 ? 93  TYR A CE1  2  
ATOM   3501  C  CE2  . TYR A 1 93  ? -14.557 8.807   -11.664 1.00 0.00 ? 93  TYR A CE2  2  
ATOM   3502  C  CZ   . TYR A 1 93  ? -14.154 10.161  -11.661 1.00 0.00 ? 93  TYR A CZ   2  
ATOM   3503  O  OH   . TYR A 1 93  ? -14.267 10.905  -12.796 1.00 0.00 ? 93  TYR A OH   2  
ATOM   3504  H  H    . TYR A 1 93  ? -14.066 9.315   -5.919  1.00 0.00 ? 93  TYR A H    2  
ATOM   3505  H  HA   . TYR A 1 93  ? -15.497 7.226   -7.475  1.00 0.00 ? 93  TYR A HA   2  
ATOM   3506  H  HB2  . TYR A 1 93  ? -12.558 8.012   -7.711  1.00 0.00 ? 93  TYR A HB2  2  
ATOM   3507  H  HB3  . TYR A 1 93  ? -13.318 6.671   -8.535  1.00 0.00 ? 93  TYR A HB3  2  
ATOM   3508  H  HD1  . TYR A 1 93  ? -12.945 10.353  -8.466  1.00 0.00 ? 93  TYR A HD1  2  
ATOM   3509  H  HD2  . TYR A 1 93  ? -14.666 6.975   -10.534 1.00 0.00 ? 93  TYR A HD2  2  
ATOM   3510  H  HE1  . TYR A 1 93  ? -13.293 11.758  -10.479 1.00 0.00 ? 93  TYR A HE1  2  
ATOM   3511  H  HE2  . TYR A 1 93  ? -14.989 8.371   -12.555 1.00 0.00 ? 93  TYR A HE2  2  
ATOM   3512  H  HH   . TYR A 1 93  ? -13.894 11.792  -12.699 1.00 0.00 ? 93  TYR A HH   2  
ATOM   3513  N  N    . THR A 1 94  ? -13.847 5.452   -6.258  1.00 0.00 ? 94  THR A N    2  
ATOM   3514  C  CA   . THR A 1 94  ? -13.191 4.483   -5.394  1.00 0.00 ? 94  THR A CA   2  
ATOM   3515  C  C    . THR A 1 94  ? -12.041 3.890   -6.212  1.00 0.00 ? 94  THR A C    2  
ATOM   3516  O  O    . THR A 1 94  ? -12.207 3.603   -7.402  1.00 0.00 ? 94  THR A O    2  
ATOM   3517  C  CB   . THR A 1 94  ? -14.191 3.423   -4.887  1.00 0.00 ? 94  THR A CB   2  
ATOM   3518  O  OG1  . THR A 1 94  ? -15.447 4.001   -4.567  1.00 0.00 ? 94  THR A OG1  2  
ATOM   3519  C  CG2  . THR A 1 94  ? -13.680 2.725   -3.624  1.00 0.00 ? 94  THR A CG2  2  
ATOM   3520  H  H    . THR A 1 94  ? -13.992 5.205   -7.234  1.00 0.00 ? 94  THR A H    2  
ATOM   3521  H  HA   . THR A 1 94  ? -12.772 4.999   -4.533  1.00 0.00 ? 94  THR A HA   2  
ATOM   3522  H  HB   . THR A 1 94  ? -14.341 2.673   -5.664  1.00 0.00 ? 94  THR A HB   2  
ATOM   3523  H  HG1  . THR A 1 94  ? -15.821 4.362   -5.385  1.00 0.00 ? 94  THR A HG1  2  
ATOM   3524  H  HG21 . THR A 1 94  ? -14.364 1.923   -3.343  1.00 0.00 ? 94  THR A HG21 2  
ATOM   3525  H  HG22 . THR A 1 94  ? -12.696 2.298   -3.810  1.00 0.00 ? 94  THR A HG22 2  
ATOM   3526  H  HG23 . THR A 1 94  ? -13.607 3.440   -2.803  1.00 0.00 ? 94  THR A HG23 2  
ATOM   3527  N  N    . ALA A 1 95  ? -10.880 3.733   -5.581  1.00 0.00 ? 95  ALA A N    2  
ATOM   3528  C  CA   . ALA A 1 95  ? -9.654  3.241   -6.191  1.00 0.00 ? 95  ALA A CA   2  
ATOM   3529  C  C    . ALA A 1 95  ? -9.088  2.148   -5.291  1.00 0.00 ? 95  ALA A C    2  
ATOM   3530  O  O    . ALA A 1 95  ? -9.410  2.092   -4.102  1.00 0.00 ? 95  ALA A O    2  
ATOM   3531  C  CB   . ALA A 1 95  ? -8.659  4.402   -6.334  1.00 0.00 ? 95  ALA A CB   2  
ATOM   3532  H  H    . ALA A 1 95  ? -10.829 3.959   -4.591  1.00 0.00 ? 95  ALA A H    2  
ATOM   3533  H  HA   . ALA A 1 95  ? -9.863  2.825   -7.178  1.00 0.00 ? 95  ALA A HA   2  
ATOM   3534  H  HB1  . ALA A 1 95  ? -9.093  5.187   -6.954  1.00 0.00 ? 95  ALA A HB1  2  
ATOM   3535  H  HB2  . ALA A 1 95  ? -8.418  4.813   -5.353  1.00 0.00 ? 95  ALA A HB2  2  
ATOM   3536  H  HB3  . ALA A 1 95  ? -7.739  4.047   -6.801  1.00 0.00 ? 95  ALA A HB3  2  
ATOM   3537  N  N    . LYS A 1 96  ? -8.236  1.277   -5.835  1.00 0.00 ? 96  LYS A N    2  
ATOM   3538  C  CA   . LYS A 1 96  ? -7.486  0.344   -5.007  1.00 0.00 ? 96  LYS A CA   2  
ATOM   3539  C  C    . LYS A 1 96  ? -6.474  1.180   -4.231  1.00 0.00 ? 96  LYS A C    2  
ATOM   3540  O  O    . LYS A 1 96  ? -5.880  2.101   -4.791  1.00 0.00 ? 96  LYS A O    2  
ATOM   3541  C  CB   . LYS A 1 96  ? -6.731  -0.726  -5.832  1.00 0.00 ? 96  LYS A CB   2  
ATOM   3542  C  CG   . LYS A 1 96  ? -7.347  -1.163  -7.170  1.00 0.00 ? 96  LYS A CG   2  
ATOM   3543  C  CD   . LYS A 1 96  ? -8.644  -1.962  -7.016  1.00 0.00 ? 96  LYS A CD   2  
ATOM   3544  C  CE   . LYS A 1 96  ? -9.280  -2.133  -8.402  1.00 0.00 ? 96  LYS A CE   2  
ATOM   3545  N  NZ   . LYS A 1 96  ? -10.285 -3.225  -8.450  1.00 0.00 ? 96  LYS A NZ   2  
ATOM   3546  H  H    . LYS A 1 96  ? -7.934  1.418   -6.784  1.00 0.00 ? 96  LYS A H    2  
ATOM   3547  H  HA   . LYS A 1 96  ? -8.177  -0.152  -4.322  1.00 0.00 ? 96  LYS A HA   2  
ATOM   3548  H  HB2  . LYS A 1 96  ? -5.737  -0.351  -6.065  1.00 0.00 ? 96  LYS A HB2  2  
ATOM   3549  H  HB3  . LYS A 1 96  ? -6.586  -1.606  -5.204  1.00 0.00 ? 96  LYS A HB3  2  
ATOM   3550  H  HG2  . LYS A 1 96  ? -7.522  -0.286  -7.795  1.00 0.00 ? 96  LYS A HG2  2  
ATOM   3551  H  HG3  . LYS A 1 96  ? -6.621  -1.790  -7.689  1.00 0.00 ? 96  LYS A HG3  2  
ATOM   3552  H  HD2  . LYS A 1 96  ? -8.411  -2.933  -6.580  1.00 0.00 ? 96  LYS A HD2  2  
ATOM   3553  H  HD3  . LYS A 1 96  ? -9.328  -1.428  -6.359  1.00 0.00 ? 96  LYS A HD3  2  
ATOM   3554  H  HE2  . LYS A 1 96  ? -9.738  -1.181  -8.686  1.00 0.00 ? 96  LYS A HE2  2  
ATOM   3555  H  HE3  . LYS A 1 96  ? -8.490  -2.351  -9.124  1.00 0.00 ? 96  LYS A HE3  2  
ATOM   3556  H  HZ1  . LYS A 1 96  ? -9.852  -4.123  -8.286  1.00 0.00 ? 96  LYS A HZ1  2  
ATOM   3557  H  HZ2  . LYS A 1 96  ? -11.016 -3.105  -7.758  1.00 0.00 ? 96  LYS A HZ2  2  
ATOM   3558  H  HZ3  . LYS A 1 96  ? -10.724 -3.266  -9.358  1.00 0.00 ? 96  LYS A HZ3  2  
ATOM   3559  N  N    . LEU A 1 97  ? -6.199  0.820   -2.984  1.00 0.00 ? 97  LEU A N    2  
ATOM   3560  C  CA   . LEU A 1 97  ? -5.072  1.395   -2.247  1.00 0.00 ? 97  LEU A CA   2  
ATOM   3561  C  C    . LEU A 1 97  ? -3.778  1.072   -3.017  1.00 0.00 ? 97  LEU A C    2  
ATOM   3562  O  O    . LEU A 1 97  ? -2.848  1.872   -3.048  1.00 0.00 ? 97  LEU A O    2  
ATOM   3563  C  CB   . LEU A 1 97  ? -5.027  0.818   -0.822  1.00 0.00 ? 97  LEU A CB   2  
ATOM   3564  C  CG   . LEU A 1 97  ? -3.919  1.427   0.065   1.00 0.00 ? 97  LEU A CG   2  
ATOM   3565  C  CD1  . LEU A 1 97  ? -4.160  2.915   0.349   1.00 0.00 ? 97  LEU A CD1  2  
ATOM   3566  C  CD2  . LEU A 1 97  ? -3.865  0.675   1.396   1.00 0.00 ? 97  LEU A CD2  2  
ATOM   3567  H  H    . LEU A 1 97  ? -6.743  0.078   -2.573  1.00 0.00 ? 97  LEU A H    2  
ATOM   3568  H  HA   . LEU A 1 97  ? -5.202  2.477   -2.204  1.00 0.00 ? 97  LEU A HA   2  
ATOM   3569  H  HB2  . LEU A 1 97  ? -5.994  0.981   -0.342  1.00 0.00 ? 97  LEU A HB2  2  
ATOM   3570  H  HB3  . LEU A 1 97  ? -4.862  -0.259  -0.895  1.00 0.00 ? 97  LEU A HB3  2  
ATOM   3571  H  HG   . LEU A 1 97  ? -2.950  1.310   -0.419  1.00 0.00 ? 97  LEU A HG   2  
ATOM   3572  H  HD11 . LEU A 1 97  ? -4.071  3.498   -0.567  1.00 0.00 ? 97  LEU A HD11 2  
ATOM   3573  H  HD12 . LEU A 1 97  ? -5.150  3.055   0.779   1.00 0.00 ? 97  LEU A HD12 2  
ATOM   3574  H  HD13 . LEU A 1 97  ? -3.422  3.281   1.061   1.00 0.00 ? 97  LEU A HD13 2  
ATOM   3575  H  HD21 . LEU A 1 97  ? -4.813  0.779   1.928   1.00 0.00 ? 97  LEU A HD21 2  
ATOM   3576  H  HD22 . LEU A 1 97  ? -3.668  -0.381  1.209   1.00 0.00 ? 97  LEU A HD22 2  
ATOM   3577  H  HD23 . LEU A 1 97  ? -3.059  1.070   2.016   1.00 0.00 ? 97  LEU A HD23 2  
ATOM   3578  N  N    . SER A 1 98  ? -3.759  -0.076  -3.703  1.00 0.00 ? 98  SER A N    2  
ATOM   3579  C  CA   . SER A 1 98  ? -2.691  -0.538  -4.583  1.00 0.00 ? 98  SER A CA   2  
ATOM   3580  C  C    . SER A 1 98  ? -2.437  0.422   -5.755  1.00 0.00 ? 98  SER A C    2  
ATOM   3581  O  O    . SER A 1 98  ? -1.329  0.487   -6.285  1.00 0.00 ? 98  SER A O    2  
ATOM   3582  C  CB   . SER A 1 98  ? -3.119  -1.903  -5.143  1.00 0.00 ? 98  SER A CB   2  
ATOM   3583  O  OG   . SER A 1 98  ? -3.837  -2.652  -4.172  1.00 0.00 ? 98  SER A OG   2  
ATOM   3584  H  H    . SER A 1 98  ? -4.553  -0.700  -3.627  1.00 0.00 ? 98  SER A H    2  
ATOM   3585  H  HA   . SER A 1 98  ? -1.775  -0.654  -4.003  1.00 0.00 ? 98  SER A HA   2  
ATOM   3586  H  HB2  . SER A 1 98  ? -3.772  -1.749  -6.004  1.00 0.00 ? 98  SER A HB2  2  
ATOM   3587  H  HB3  . SER A 1 98  ? -2.242  -2.452  -5.476  1.00 0.00 ? 98  SER A HB3  2  
ATOM   3588  H  HG   . SER A 1 98  ? -4.198  -3.443  -4.605  1.00 0.00 ? 98  SER A HG   2  
ATOM   3589  N  N    . ASP A 1 99  ? -3.475  1.151   -6.170  1.00 0.00 ? 99  ASP A N    2  
ATOM   3590  C  CA   . ASP A 1 99  ? -3.485  2.031   -7.334  1.00 0.00 ? 99  ASP A CA   2  
ATOM   3591  C  C    . ASP A 1 99  ? -3.076  3.454   -6.953  1.00 0.00 ? 99  ASP A C    2  
ATOM   3592  O  O    . ASP A 1 99  ? -2.993  4.332   -7.809  1.00 0.00 ? 99  ASP A O    2  
ATOM   3593  C  CB   . ASP A 1 99  ? -4.904  2.035   -7.937  1.00 0.00 ? 99  ASP A CB   2  
ATOM   3594  C  CG   . ASP A 1 99  ? -4.995  1.319   -9.282  1.00 0.00 ? 99  ASP A CG   2  
ATOM   3595  O  OD1  . ASP A 1 99  ? -4.501  0.172   -9.372  1.00 0.00 ? 99  ASP A OD1  2  
ATOM   3596  O  OD2  . ASP A 1 99  ? -5.636  1.869   -10.207 1.00 0.00 ? 99  ASP A OD2  2  
ATOM   3597  H  H    . ASP A 1 99  ? -4.340  1.108   -5.648  1.00 0.00 ? 99  ASP A H    2  
ATOM   3598  H  HA   . ASP A 1 99  ? -2.770  1.667   -8.068  1.00 0.00 ? 99  ASP A HA   2  
ATOM   3599  H  HB2  . ASP A 1 99  ? -5.611  1.563   -7.261  1.00 0.00 ? 99  ASP A HB2  2  
ATOM   3600  H  HB3  . ASP A 1 99  ? -5.248  3.058   -8.047  1.00 0.00 ? 99  ASP A HB3  2  
ATOM   3601  N  N    . ILE A 1 100 ? -2.837  3.698   -5.669  1.00 0.00 ? 100 ILE A N    2  
ATOM   3602  C  CA   . ILE A 1 100 ? -2.644  5.018   -5.097  1.00 0.00 ? 100 ILE A CA   2  
ATOM   3603  C  C    . ILE A 1 100 ? -1.207  5.143   -4.626  1.00 0.00 ? 100 ILE A C    2  
ATOM   3604  O  O    . ILE A 1 100 ? -0.570  4.190   -4.171  1.00 0.00 ? 100 ILE A O    2  
ATOM   3605  C  CB   . ILE A 1 100 ? -3.692  5.245   -3.978  1.00 0.00 ? 100 ILE A CB   2  
ATOM   3606  C  CG1  . ILE A 1 100 ? -5.025  5.638   -4.639  1.00 0.00 ? 100 ILE A CG1  2  
ATOM   3607  C  CG2  . ILE A 1 100 ? -3.307  6.243   -2.866  1.00 0.00 ? 100 ILE A CG2  2  
ATOM   3608  C  CD1  . ILE A 1 100 ? -5.209  7.108   -4.998  1.00 0.00 ? 100 ILE A CD1  2  
ATOM   3609  H  H    . ILE A 1 100 ? -2.852  2.917   -5.032  1.00 0.00 ? 100 ILE A H    2  
ATOM   3610  H  HA   . ILE A 1 100 ? -2.800  5.767   -5.876  1.00 0.00 ? 100 ILE A HA   2  
ATOM   3611  H  HB   . ILE A 1 100 ? -3.851  4.289   -3.478  1.00 0.00 ? 100 ILE A HB   2  
ATOM   3612  H  HG12 . ILE A 1 100 ? -5.119  5.080   -5.564  1.00 0.00 ? 100 ILE A HG12 2  
ATOM   3613  H  HG13 . ILE A 1 100 ? -5.834  5.370   -3.969  1.00 0.00 ? 100 ILE A HG13 2  
ATOM   3614  H  HG21 . ILE A 1 100 ? -4.142  6.359   -2.175  1.00 0.00 ? 100 ILE A HG21 2  
ATOM   3615  H  HG22 . ILE A 1 100 ? -2.455  5.861   -2.301  1.00 0.00 ? 100 ILE A HG22 2  
ATOM   3616  H  HG23 . ILE A 1 100 ? -3.048  7.216   -3.286  1.00 0.00 ? 100 ILE A HG23 2  
ATOM   3617  H  HD11 . ILE A 1 100 ? -5.327  7.691   -4.088  1.00 0.00 ? 100 ILE A HD11 2  
ATOM   3618  H  HD12 . ILE A 1 100 ? -4.355  7.468   -5.565  1.00 0.00 ? 100 ILE A HD12 2  
ATOM   3619  H  HD13 . ILE A 1 100 ? -6.115  7.197   -5.596  1.00 0.00 ? 100 ILE A HD13 2  
ATOM   3620  N  N    . GLU A 1 101 ? -0.736  6.377   -4.715  1.00 0.00 ? 101 GLU A N    2  
ATOM   3621  C  CA   . GLU A 1 101 ? 0.548   6.813   -4.196  1.00 0.00 ? 101 GLU A CA   2  
ATOM   3622  C  C    . GLU A 1 101 ? 0.287   8.117   -3.445  1.00 0.00 ? 101 GLU A C    2  
ATOM   3623  O  O    . GLU A 1 101 ? -0.217  9.072   -4.036  1.00 0.00 ? 101 GLU A O    2  
ATOM   3624  C  CB   . GLU A 1 101 ? 1.532   6.970   -5.368  1.00 0.00 ? 101 GLU A CB   2  
ATOM   3625  C  CG   . GLU A 1 101 ? 2.953   7.275   -4.881  1.00 0.00 ? 101 GLU A CG   2  
ATOM   3626  C  CD   . GLU A 1 101 ? 3.940   7.371   -6.056  1.00 0.00 ? 101 GLU A CD   2  
ATOM   3627  O  OE1  . GLU A 1 101 ? 4.245   6.331   -6.683  1.00 0.00 ? 101 GLU A OE1  2  
ATOM   3628  O  OE2  . GLU A 1 101 ? 4.433   8.483   -6.354  1.00 0.00 ? 101 GLU A OE2  2  
ATOM   3629  H  H    . GLU A 1 101 ? -1.323  7.065   -5.171  1.00 0.00 ? 101 GLU A H    2  
ATOM   3630  H  HA   . GLU A 1 101 ? 0.940   6.063   -3.507  1.00 0.00 ? 101 GLU A HA   2  
ATOM   3631  H  HB2  . GLU A 1 101 ? 1.549   6.039   -5.938  1.00 0.00 ? 101 GLU A HB2  2  
ATOM   3632  H  HB3  . GLU A 1 101 ? 1.195   7.767   -6.033  1.00 0.00 ? 101 GLU A HB3  2  
ATOM   3633  H  HG2  . GLU A 1 101 ? 2.948   8.214   -4.325  1.00 0.00 ? 101 GLU A HG2  2  
ATOM   3634  H  HG3  . GLU A 1 101 ? 3.276   6.483   -4.203  1.00 0.00 ? 101 GLU A HG3  2  
ATOM   3635  N  N    . ALA A 1 102 ? 0.557   8.159   -2.138  1.00 0.00 ? 102 ALA A N    2  
ATOM   3636  C  CA   . ALA A 1 102 ? 0.321   9.365   -1.352  1.00 0.00 ? 102 ALA A CA   2  
ATOM   3637  C  C    . ALA A 1 102 ? 1.383   10.413  -1.670  1.00 0.00 ? 102 ALA A C    2  
ATOM   3638  O  O    . ALA A 1 102 ? 2.531   10.082  -1.979  1.00 0.00 ? 102 ALA A O    2  
ATOM   3639  C  CB   . ALA A 1 102 ? 0.349   9.061   0.144   1.00 0.00 ? 102 ALA A CB   2  
ATOM   3640  H  H    . ALA A 1 102 ? 1.042   7.380   -1.698  1.00 0.00 ? 102 ALA A H    2  
ATOM   3641  H  HA   . ALA A 1 102 ? -0.662  9.767   -1.601  1.00 0.00 ? 102 ALA A HA   2  
ATOM   3642  H  HB1  . ALA A 1 102 ? 0.205   9.990   0.693   1.00 0.00 ? 102 ALA A HB1  2  
ATOM   3643  H  HB2  . ALA A 1 102 ? -0.467  8.399   0.409   1.00 0.00 ? 102 ALA A HB2  2  
ATOM   3644  H  HB3  . ALA A 1 102 ? 1.303   8.614   0.427   1.00 0.00 ? 102 ALA A HB3  2  
ATOM   3645  N  N    . ILE A 1 103 ? 1.002   11.677  -1.515  1.00 0.00 ? 103 ILE A N    2  
ATOM   3646  C  CA   . ILE A 1 103 ? 1.861   12.829  -1.747  1.00 0.00 ? 103 ILE A CA   2  
ATOM   3647  C  C    . ILE A 1 103 ? 1.977   13.591  -0.426  1.00 0.00 ? 103 ILE A C    2  
ATOM   3648  O  O    . ILE A 1 103 ? 0.967   13.933  0.192   1.00 0.00 ? 103 ILE A O    2  
ATOM   3649  C  CB   . ILE A 1 103 ? 1.273   13.704  -2.881  1.00 0.00 ? 103 ILE A CB   2  
ATOM   3650  C  CG1  . ILE A 1 103 ? 1.127   12.933  -4.217  1.00 0.00 ? 103 ILE A CG1  2  
ATOM   3651  C  CG2  . ILE A 1 103 ? 2.148   14.949  -3.110  1.00 0.00 ? 103 ILE A CG2  2  
ATOM   3652  C  CD1  . ILE A 1 103 ? 0.200   13.644  -5.211  1.00 0.00 ? 103 ILE A CD1  2  
ATOM   3653  H  H    . ILE A 1 103 ? 0.017   11.873  -1.327  1.00 0.00 ? 103 ILE A H    2  
ATOM   3654  H  HA   . ILE A 1 103 ? 2.852   12.494  -2.045  1.00 0.00 ? 103 ILE A HA   2  
ATOM   3655  H  HB   . ILE A 1 103 ? 0.284   14.034  -2.563  1.00 0.00 ? 103 ILE A HB   2  
ATOM   3656  H  HG12 . ILE A 1 103 ? 2.108   12.795  -4.673  1.00 0.00 ? 103 ILE A HG12 2  
ATOM   3657  H  HG13 . ILE A 1 103 ? 0.710   11.944  -4.043  1.00 0.00 ? 103 ILE A HG13 2  
ATOM   3658  H  HG21 . ILE A 1 103 ? 3.143   14.648  -3.440  1.00 0.00 ? 103 ILE A HG21 2  
ATOM   3659  H  HG22 . ILE A 1 103 ? 1.698   15.594  -3.864  1.00 0.00 ? 103 ILE A HG22 2  
ATOM   3660  H  HG23 . ILE A 1 103 ? 2.239   15.529  -2.191  1.00 0.00 ? 103 ILE A HG23 2  
ATOM   3661  H  HD11 . ILE A 1 103 ? 0.634   14.585  -5.545  1.00 0.00 ? 103 ILE A HD11 2  
ATOM   3662  H  HD12 . ILE A 1 103 ? 0.048   13.007  -6.078  1.00 0.00 ? 103 ILE A HD12 2  
ATOM   3663  H  HD13 . ILE A 1 103 ? -0.768  13.828  -4.747  1.00 0.00 ? 103 ILE A HD13 2  
ATOM   3664  N  N    . ASP A 1 104 ? 3.224   13.886  -0.039  1.00 0.00 ? 104 ASP A N    2  
ATOM   3665  C  CA   . ASP A 1 104 ? 3.597   14.734  1.099   1.00 0.00 ? 104 ASP A CA   2  
ATOM   3666  C  C    . ASP A 1 104 ? 2.845   14.379  2.395   1.00 0.00 ? 104 ASP A C    2  
ATOM   3667  O  O    . ASP A 1 104 ? 2.413   15.254  3.150   1.00 0.00 ? 104 ASP A O    2  
ATOM   3668  C  CB   . ASP A 1 104 ? 3.486   16.216  0.701   1.00 0.00 ? 104 ASP A CB   2  
ATOM   3669  C  CG   . ASP A 1 104 ? 4.074   17.165  1.763   1.00 0.00 ? 104 ASP A CG   2  
ATOM   3670  O  OD1  . ASP A 1 104 ? 5.193   16.914  2.265   1.00 0.00 ? 104 ASP A OD1  2  
ATOM   3671  O  OD2  . ASP A 1 104 ? 3.449   18.210  2.058   1.00 0.00 ? 104 ASP A OD2  2  
ATOM   3672  H  H    . ASP A 1 104 ? 3.988   13.543  -0.603  1.00 0.00 ? 104 ASP A H    2  
ATOM   3673  H  HA   . ASP A 1 104 ? 4.652   14.539  1.281   1.00 0.00 ? 104 ASP A HA   2  
ATOM   3674  H  HB2  . ASP A 1 104 ? 4.024   16.368  -0.237  1.00 0.00 ? 104 ASP A HB2  2  
ATOM   3675  H  HB3  . ASP A 1 104 ? 2.435   16.455  0.525   1.00 0.00 ? 104 ASP A HB3  2  
ATOM   3676  N  N    . VAL A 1 105 ? 2.634   13.080  2.630   1.00 0.00 ? 105 VAL A N    2  
ATOM   3677  C  CA   . VAL A 1 105 ? 1.828   12.588  3.747   1.00 0.00 ? 105 VAL A CA   2  
ATOM   3678  C  C    . VAL A 1 105 ? 2.708   12.282  4.972   1.00 0.00 ? 105 VAL A C    2  
ATOM   3679  O  O    . VAL A 1 105 ? 3.940   12.352  4.900   1.00 0.00 ? 105 VAL A O    2  
ATOM   3680  C  CB   . VAL A 1 105 ? 0.952   11.416  3.255   1.00 0.00 ? 105 VAL A CB   2  
ATOM   3681  C  CG1  . VAL A 1 105 ? 1.678   10.064  3.173   1.00 0.00 ? 105 VAL A CG1  2  
ATOM   3682  C  CG2  . VAL A 1 105 ? -0.336  11.315  4.073   1.00 0.00 ? 105 VAL A CG2  2  
ATOM   3683  H  H    . VAL A 1 105 ? 3.044   12.390  2.006   1.00 0.00 ? 105 VAL A H    2  
ATOM   3684  H  HA   . VAL A 1 105 ? 1.149   13.391  4.035   1.00 0.00 ? 105 VAL A HA   2  
ATOM   3685  H  HB   . VAL A 1 105 ? 0.620   11.650  2.249   1.00 0.00 ? 105 VAL A HB   2  
ATOM   3686  H  HG11 . VAL A 1 105 ? 2.508   10.123  2.468   1.00 0.00 ? 105 VAL A HG11 2  
ATOM   3687  H  HG12 . VAL A 1 105 ? 2.061   9.778   4.147   1.00 0.00 ? 105 VAL A HG12 2  
ATOM   3688  H  HG13 . VAL A 1 105 ? 0.988   9.288   2.844   1.00 0.00 ? 105 VAL A HG13 2  
ATOM   3689  H  HG21 . VAL A 1 105 ? -1.016  10.642  3.556   1.00 0.00 ? 105 VAL A HG21 2  
ATOM   3690  H  HG22 . VAL A 1 105 ? -0.149  10.946  5.077   1.00 0.00 ? 105 VAL A HG22 2  
ATOM   3691  H  HG23 . VAL A 1 105 ? -0.810  12.294  4.144   1.00 0.00 ? 105 VAL A HG23 2  
ATOM   3692  N  N    . ASP A 1 106 ? 2.076   11.971  6.109   1.00 0.00 ? 106 ASP A N    2  
ATOM   3693  C  CA   . ASP A 1 106 ? 2.769   11.609  7.342   1.00 0.00 ? 106 ASP A CA   2  
ATOM   3694  C  C    . ASP A 1 106 ? 3.429   10.233  7.214   1.00 0.00 ? 106 ASP A C    2  
ATOM   3695  O  O    . ASP A 1 106 ? 3.028   9.404   6.394   1.00 0.00 ? 106 ASP A O    2  
ATOM   3696  C  CB   . ASP A 1 106 ? 1.824   11.668  8.558   1.00 0.00 ? 106 ASP A CB   2  
ATOM   3697  C  CG   . ASP A 1 106 ? 1.531   10.291  9.177   1.00 0.00 ? 106 ASP A CG   2  
ATOM   3698  O  OD1  . ASP A 1 106 ? 0.662   9.570   8.641   1.00 0.00 ? 106 ASP A OD1  2  
ATOM   3699  O  OD2  . ASP A 1 106 ? 2.189   9.936   10.180  1.00 0.00 ? 106 ASP A OD2  2  
ATOM   3700  H  H    . ASP A 1 106 ? 1.074   11.844  6.096   1.00 0.00 ? 106 ASP A H    2  
ATOM   3701  H  HA   . ASP A 1 106 ? 3.554   12.349  7.500   1.00 0.00 ? 106 ASP A HA   2  
ATOM   3702  H  HB2  . ASP A 1 106 ? 2.308   12.288  9.314   1.00 0.00 ? 106 ASP A HB2  2  
ATOM   3703  H  HB3  . ASP A 1 106 ? 0.887   12.157  8.285   1.00 0.00 ? 106 ASP A HB3  2  
ATOM   3704  N  N    . ASP A 1 107 ? 4.432   9.989   8.057   1.00 0.00 ? 107 ASP A N    2  
ATOM   3705  C  CA   . ASP A 1 107 ? 5.239   8.779   8.015   1.00 0.00 ? 107 ASP A CA   2  
ATOM   3706  C  C    . ASP A 1 107 ? 4.408   7.503   8.153   1.00 0.00 ? 107 ASP A C    2  
ATOM   3707  O  O    . ASP A 1 107 ? 4.670   6.542   7.435   1.00 0.00 ? 107 ASP A O    2  
ATOM   3708  C  CB   . ASP A 1 107 ? 6.308   8.830   9.109   1.00 0.00 ? 107 ASP A CB   2  
ATOM   3709  C  CG   . ASP A 1 107 ? 7.174   7.560   9.104   1.00 0.00 ? 107 ASP A CG   2  
ATOM   3710  O  OD1  . ASP A 1 107 ? 8.038   7.420   8.209   1.00 0.00 ? 107 ASP A OD1  2  
ATOM   3711  O  OD2  . ASP A 1 107 ? 7.041   6.731   10.033  1.00 0.00 ? 107 ASP A OD2  2  
ATOM   3712  H  H    . ASP A 1 107 ? 4.681   10.688  8.742   1.00 0.00 ? 107 ASP A H    2  
ATOM   3713  H  HA   . ASP A 1 107 ? 5.741   8.754   7.049   1.00 0.00 ? 107 ASP A HA   2  
ATOM   3714  H  HB2  . ASP A 1 107 ? 6.943   9.705   8.950   1.00 0.00 ? 107 ASP A HB2  2  
ATOM   3715  H  HB3  . ASP A 1 107 ? 5.821   8.941   10.081  1.00 0.00 ? 107 ASP A HB3  2  
ATOM   3716  N  N    . ASP A 1 108 ? 3.392   7.477   9.024   1.00 0.00 ? 108 ASP A N    2  
ATOM   3717  C  CA   . ASP A 1 108 ? 2.591   6.271   9.235   1.00 0.00 ? 108 ASP A CA   2  
ATOM   3718  C  C    . ASP A 1 108 ? 1.732   5.988   8.004   1.00 0.00 ? 108 ASP A C    2  
ATOM   3719  O  O    . ASP A 1 108 ? 1.695   4.852   7.531   1.00 0.00 ? 108 ASP A O    2  
ATOM   3720  C  CB   . ASP A 1 108 ? 1.703   6.374   10.486  1.00 0.00 ? 108 ASP A CB   2  
ATOM   3721  C  CG   . ASP A 1 108 ? 2.460   6.026   11.776  1.00 0.00 ? 108 ASP A CG   2  
ATOM   3722  O  OD1  . ASP A 1 108 ? 2.827   4.844   11.966  1.00 0.00 ? 108 ASP A OD1  2  
ATOM   3723  O  OD2  . ASP A 1 108 ? 2.669   6.918   12.629  1.00 0.00 ? 108 ASP A OD2  2  
ATOM   3724  H  H    . ASP A 1 108 ? 3.116   8.330   9.508   1.00 0.00 ? 108 ASP A H    2  
ATOM   3725  H  HA   . ASP A 1 108 ? 3.264   5.423   9.369   1.00 0.00 ? 108 ASP A HA   2  
ATOM   3726  H  HB2  . ASP A 1 108 ? 1.258   7.367   10.549  1.00 0.00 ? 108 ASP A HB2  2  
ATOM   3727  H  HB3  . ASP A 1 108 ? 0.883   5.661   10.386  1.00 0.00 ? 108 ASP A HB3  2  
ATOM   3728  N  N    . THR A 1 109 ? 1.079   7.008   7.443   1.00 0.00 ? 109 THR A N    2  
ATOM   3729  C  CA   . THR A 1 109 ? 0.285   6.862   6.232   1.00 0.00 ? 109 THR A CA   2  
ATOM   3730  C  C    . THR A 1 109 ? 1.173   6.367   5.084   1.00 0.00 ? 109 THR A C    2  
ATOM   3731  O  O    . THR A 1 109 ? 0.795   5.427   4.379   1.00 0.00 ? 109 THR A O    2  
ATOM   3732  C  CB   . THR A 1 109 ? -0.429  8.194   5.929   1.00 0.00 ? 109 THR A CB   2  
ATOM   3733  O  OG1  . THR A 1 109 ? -1.154  8.625   7.065   1.00 0.00 ? 109 THR A OG1  2  
ATOM   3734  C  CG2  . THR A 1 109 ? -1.454  8.088   4.800   1.00 0.00 ? 109 THR A CG2  2  
ATOM   3735  H  H    . THR A 1 109 ? 1.130   7.939   7.858   1.00 0.00 ? 109 THR A H    2  
ATOM   3736  H  HA   . THR A 1 109 ? -0.467  6.099   6.413   1.00 0.00 ? 109 THR A HA   2  
ATOM   3737  H  HB   . THR A 1 109 ? 0.309   8.955   5.658   1.00 0.00 ? 109 THR A HB   2  
ATOM   3738  H  HG1  . THR A 1 109 ? -0.488  8.980   7.704   1.00 0.00 ? 109 THR A HG1  2  
ATOM   3739  H  HG21 . THR A 1 109 ? -1.957  9.045   4.681   1.00 0.00 ? 109 THR A HG21 2  
ATOM   3740  H  HG22 . THR A 1 109 ? -0.964  7.825   3.861   1.00 0.00 ? 109 THR A HG22 2  
ATOM   3741  H  HG23 . THR A 1 109 ? -2.213  7.352   5.046   1.00 0.00 ? 109 THR A HG23 2  
ATOM   3742  N  N    . GLN A 1 110 ? 2.376   6.933   4.931   1.00 0.00 ? 110 GLN A N    2  
ATOM   3743  C  CA   . GLN A 1 110 ? 3.312   6.504   3.903   1.00 0.00 ? 110 GLN A CA   2  
ATOM   3744  C  C    . GLN A 1 110 ? 3.693   5.034   4.128   1.00 0.00 ? 110 GLN A C    2  
ATOM   3745  O  O    . GLN A 1 110 ? 3.655   4.245   3.185   1.00 0.00 ? 110 GLN A O    2  
ATOM   3746  C  CB   . GLN A 1 110 ? 4.537   7.439   3.895   1.00 0.00 ? 110 GLN A CB   2  
ATOM   3747  C  CG   . GLN A 1 110 ? 5.232   7.522   2.527   1.00 0.00 ? 110 GLN A CG   2  
ATOM   3748  C  CD   . GLN A 1 110 ? 5.825   6.192   2.055   1.00 0.00 ? 110 GLN A CD   2  
ATOM   3749  O  OE1  . GLN A 1 110 ? 6.724   5.636   2.679   1.00 0.00 ? 110 GLN A OE1  2  
ATOM   3750  N  NE2  . GLN A 1 110 ? 5.336   5.653   0.948   1.00 0.00 ? 110 GLN A NE2  2  
ATOM   3751  H  H    . GLN A 1 110 ? 2.660   7.681   5.559   1.00 0.00 ? 110 GLN A H    2  
ATOM   3752  H  HA   . GLN A 1 110 ? 2.800   6.587   2.943   1.00 0.00 ? 110 GLN A HA   2  
ATOM   3753  H  HB2  . GLN A 1 110 ? 4.214   8.450   4.143   1.00 0.00 ? 110 GLN A HB2  2  
ATOM   3754  H  HB3  . GLN A 1 110 ? 5.253   7.123   4.655   1.00 0.00 ? 110 GLN A HB3  2  
ATOM   3755  H  HG2  . GLN A 1 110 ? 4.513   7.891   1.793   1.00 0.00 ? 110 GLN A HG2  2  
ATOM   3756  H  HG3  . GLN A 1 110 ? 6.037   8.256   2.588   1.00 0.00 ? 110 GLN A HG3  2  
ATOM   3757  H  HE21 . GLN A 1 110 ? 4.593   6.112   0.442   1.00 0.00 ? 110 GLN A HE21 2  
ATOM   3758  H  HE22 . GLN A 1 110 ? 5.658   4.746   0.649   1.00 0.00 ? 110 GLN A HE22 2  
ATOM   3759  N  N    . GLU A 1 111 ? 4.012   4.645   5.365   1.00 0.00 ? 111 GLU A N    2  
ATOM   3760  C  CA   . GLU A 1 111 ? 4.426   3.285   5.688   1.00 0.00 ? 111 GLU A CA   2  
ATOM   3761  C  C    . GLU A 1 111 ? 3.330   2.277   5.378   1.00 0.00 ? 111 GLU A C    2  
ATOM   3762  O  O    . GLU A 1 111 ? 3.634   1.240   4.801   1.00 0.00 ? 111 GLU A O    2  
ATOM   3763  C  CB   . GLU A 1 111 ? 4.848   3.175   7.160   1.00 0.00 ? 111 GLU A CB   2  
ATOM   3764  C  CG   . GLU A 1 111 ? 6.277   3.685   7.380   1.00 0.00 ? 111 GLU A CG   2  
ATOM   3765  C  CD   . GLU A 1 111 ? 7.381   2.694   6.955   1.00 0.00 ? 111 GLU A CD   2  
ATOM   3766  O  OE1  . GLU A 1 111 ? 7.127   1.718   6.215   1.00 0.00 ? 111 GLU A OE1  2  
ATOM   3767  O  OE2  . GLU A 1 111 ? 8.543   2.863   7.391   1.00 0.00 ? 111 GLU A OE2  2  
ATOM   3768  H  H    . GLU A 1 111 ? 4.028   5.330   6.117   1.00 0.00 ? 111 GLU A H    2  
ATOM   3769  H  HA   . GLU A 1 111 ? 5.273   3.031   5.055   1.00 0.00 ? 111 GLU A HA   2  
ATOM   3770  H  HB2  . GLU A 1 111 ? 4.160   3.753   7.777   1.00 0.00 ? 111 GLU A HB2  2  
ATOM   3771  H  HB3  . GLU A 1 111 ? 4.790   2.137   7.492   1.00 0.00 ? 111 GLU A HB3  2  
ATOM   3772  H  HG2  . GLU A 1 111 ? 6.403   4.621   6.836   1.00 0.00 ? 111 GLU A HG2  2  
ATOM   3773  H  HG3  . GLU A 1 111 ? 6.384   3.893   8.445   1.00 0.00 ? 111 GLU A HG3  2  
ATOM   3774  N  N    . ALA A 1 112 ? 2.065   2.569   5.693   1.00 0.00 ? 112 ALA A N    2  
ATOM   3775  C  CA   . ALA A 1 112 ? 0.959   1.677   5.365   1.00 0.00 ? 112 ALA A CA   2  
ATOM   3776  C  C    . ALA A 1 112 ? 0.882   1.423   3.859   1.00 0.00 ? 112 ALA A C    2  
ATOM   3777  O  O    . ALA A 1 112 ? 0.636   0.294   3.437   1.00 0.00 ? 112 ALA A O    2  
ATOM   3778  C  CB   . ALA A 1 112 ? -0.354  2.285   5.854   1.00 0.00 ? 112 ALA A CB   2  
ATOM   3779  H  H    . ALA A 1 112 ? 1.857   3.454   6.146   1.00 0.00 ? 112 ALA A H    2  
ATOM   3780  H  HA   . ALA A 1 112 ? 1.115   0.722   5.871   1.00 0.00 ? 112 ALA A HA   2  
ATOM   3781  H  HB1  . ALA A 1 112 ? -1.190  1.657   5.546   1.00 0.00 ? 112 ALA A HB1  2  
ATOM   3782  H  HB2  . ALA A 1 112 ? -0.342  2.354   6.935   1.00 0.00 ? 112 ALA A HB2  2  
ATOM   3783  H  HB3  . ALA A 1 112 ? -0.470  3.281   5.432   1.00 0.00 ? 112 ALA A HB3  2  
ATOM   3784  N  N    . ILE A 1 113 ? 1.089   2.461   3.048   1.00 0.00 ? 113 ILE A N    2  
ATOM   3785  C  CA   . ILE A 1 113 ? 1.000   2.362   1.597   1.00 0.00 ? 113 ILE A CA   2  
ATOM   3786  C  C    . ILE A 1 113 ? 2.197   1.573   1.068   1.00 0.00 ? 113 ILE A C    2  
ATOM   3787  O  O    . ILE A 1 113 ? 2.006   0.616   0.321   1.00 0.00 ? 113 ILE A O    2  
ATOM   3788  C  CB   . ILE A 1 113 ? 0.890   3.782   1.011   1.00 0.00 ? 113 ILE A CB   2  
ATOM   3789  C  CG1  . ILE A 1 113 ? -0.478  4.371   1.415   1.00 0.00 ? 113 ILE A CG1  2  
ATOM   3790  C  CG2  . ILE A 1 113 ? 1.061   3.812   -0.518  1.00 0.00 ? 113 ILE A CG2  2  
ATOM   3791  C  CD1  . ILE A 1 113 ? -0.492  5.892   1.371   1.00 0.00 ? 113 ILE A CD1  2  
ATOM   3792  H  H    . ILE A 1 113 ? 1.297   3.366   3.455   1.00 0.00 ? 113 ILE A H    2  
ATOM   3793  H  HA   . ILE A 1 113 ? 0.095   1.813   1.336   1.00 0.00 ? 113 ILE A HA   2  
ATOM   3794  H  HB   . ILE A 1 113 ? 1.682   4.391   1.446   1.00 0.00 ? 113 ILE A HB   2  
ATOM   3795  H  HG12 . ILE A 1 113 ? -1.257  3.979   0.761   1.00 0.00 ? 113 ILE A HG12 2  
ATOM   3796  H  HG13 . ILE A 1 113 ? -0.723  4.089   2.435   1.00 0.00 ? 113 ILE A HG13 2  
ATOM   3797  H  HG21 . ILE A 1 113 ? 0.338   3.147   -0.993  1.00 0.00 ? 113 ILE A HG21 2  
ATOM   3798  H  HG22 . ILE A 1 113 ? 0.919   4.823   -0.898  1.00 0.00 ? 113 ILE A HG22 2  
ATOM   3799  H  HG23 . ILE A 1 113 ? 2.071   3.495   -0.780  1.00 0.00 ? 113 ILE A HG23 2  
ATOM   3800  H  HD11 . ILE A 1 113 ? -1.405  6.255   1.843   1.00 0.00 ? 113 ILE A HD11 2  
ATOM   3801  H  HD12 . ILE A 1 113 ? 0.363   6.280   1.925   1.00 0.00 ? 113 ILE A HD12 2  
ATOM   3802  H  HD13 . ILE A 1 113 ? -0.453  6.218   0.335   1.00 0.00 ? 113 ILE A HD13 2  
ATOM   3803  N  N    . ALA A 1 114 ? 3.419   1.931   1.471   1.00 0.00 ? 114 ALA A N    2  
ATOM   3804  C  CA   . ALA A 1 114 ? 4.626   1.217   1.063   1.00 0.00 ? 114 ALA A CA   2  
ATOM   3805  C  C    . ALA A 1 114 ? 4.544   -0.263  1.455   1.00 0.00 ? 114 ALA A C    2  
ATOM   3806  O  O    . ALA A 1 114 ? 4.852   -1.143  0.650   1.00 0.00 ? 114 ALA A O    2  
ATOM   3807  C  CB   . ALA A 1 114 ? 5.853   1.870   1.708   1.00 0.00 ? 114 ALA A CB   2  
ATOM   3808  H  H    . ALA A 1 114 ? 3.511   2.702   2.109   1.00 0.00 ? 114 ALA A H    2  
ATOM   3809  H  HA   . ALA A 1 114 ? 4.720   1.284   -0.022  1.00 0.00 ? 114 ALA A HA   2  
ATOM   3810  H  HB1  . ALA A 1 114 ? 5.771   1.837   2.795   1.00 0.00 ? 114 ALA A HB1  2  
ATOM   3811  H  HB2  . ALA A 1 114 ? 6.752   1.331   1.404   1.00 0.00 ? 114 ALA A HB2  2  
ATOM   3812  H  HB3  . ALA A 1 114 ? 5.938   2.906   1.385   1.00 0.00 ? 114 ALA A HB3  2  
ATOM   3813  N  N    . ASP A 1 115 ? 4.096   -0.530  2.680   1.00 0.00 ? 115 ASP A N    2  
ATOM   3814  C  CA   . ASP A 1 115 ? 3.952   -1.876  3.218   1.00 0.00 ? 115 ASP A CA   2  
ATOM   3815  C  C    . ASP A 1 115 ? 2.903   -2.669  2.454   1.00 0.00 ? 115 ASP A C    2  
ATOM   3816  O  O    . ASP A 1 115 ? 3.156   -3.815  2.080   1.00 0.00 ? 115 ASP A O    2  
ATOM   3817  C  CB   . ASP A 1 115 ? 3.595   -1.820  4.702   1.00 0.00 ? 115 ASP A CB   2  
ATOM   3818  C  CG   . ASP A 1 115 ? 3.437   -3.221  5.288   1.00 0.00 ? 115 ASP A CG   2  
ATOM   3819  O  OD1  . ASP A 1 115 ? 4.462   -3.839  5.648   1.00 0.00 ? 115 ASP A OD1  2  
ATOM   3820  O  OD2  . ASP A 1 115 ? 2.289   -3.666  5.497   1.00 0.00 ? 115 ASP A OD2  2  
ATOM   3821  H  H    . ASP A 1 115 ? 3.873   0.247   3.297   1.00 0.00 ? 115 ASP A H    2  
ATOM   3822  H  HA   . ASP A 1 115 ? 4.898   -2.391  3.113   1.00 0.00 ? 115 ASP A HA   2  
ATOM   3823  H  HB2  . ASP A 1 115 ? 4.388   -1.299  5.242   1.00 0.00 ? 115 ASP A HB2  2  
ATOM   3824  H  HB3  . ASP A 1 115 ? 2.663   -1.266  4.834   1.00 0.00 ? 115 ASP A HB3  2  
ATOM   3825  N  N    . TRP A 1 116 ? 1.758   -2.049  2.148   1.00 0.00 ? 116 TRP A N    2  
ATOM   3826  C  CA   . TRP A 1 116 ? 0.747   -2.668  1.312   1.00 0.00 ? 116 TRP A CA   2  
ATOM   3827  C  C    . TRP A 1 116 ? 1.319   -2.982  -0.071  1.00 0.00 ? 116 TRP A C    2  
ATOM   3828  O  O    . TRP A 1 116 ? 1.052   -4.055  -0.599  1.00 0.00 ? 116 TRP A O    2  
ATOM   3829  C  CB   . TRP A 1 116 ? -0.495  -1.774  1.201   1.00 0.00 ? 116 TRP A CB   2  
ATOM   3830  C  CG   . TRP A 1 116 ? -1.558  -2.353  0.319   1.00 0.00 ? 116 TRP A CG   2  
ATOM   3831  C  CD1  . TRP A 1 116 ? -1.928  -1.871  -0.889  1.00 0.00 ? 116 TRP A CD1  2  
ATOM   3832  C  CD2  . TRP A 1 116 ? -2.302  -3.599  0.495   1.00 0.00 ? 116 TRP A CD2  2  
ATOM   3833  N  NE1  . TRP A 1 116 ? -2.826  -2.735  -1.478  1.00 0.00 ? 116 TRP A NE1  2  
ATOM   3834  C  CE2  . TRP A 1 116 ? -3.057  -3.843  -0.691  1.00 0.00 ? 116 TRP A CE2  2  
ATOM   3835  C  CE3  . TRP A 1 116 ? -2.386  -4.569  1.518   1.00 0.00 ? 116 TRP A CE3  2  
ATOM   3836  C  CZ2  . TRP A 1 116 ? -3.811  -5.011  -0.872  1.00 0.00 ? 116 TRP A CZ2  2  
ATOM   3837  C  CZ3  . TRP A 1 116 ? -3.168  -5.730  1.360   1.00 0.00 ? 116 TRP A CZ3  2  
ATOM   3838  C  CH2  . TRP A 1 116 ? -3.860  -5.964  0.158   1.00 0.00 ? 116 TRP A CH2  2  
ATOM   3839  H  H    . TRP A 1 116 ? 1.603   -1.090  2.441   1.00 0.00 ? 116 TRP A H    2  
ATOM   3840  H  HA   . TRP A 1 116 ? 0.453   -3.608  1.778   1.00 0.00 ? 116 TRP A HA   2  
ATOM   3841  H  HB2  . TRP A 1 116 ? -0.912  -1.625  2.197   1.00 0.00 ? 116 TRP A HB2  2  
ATOM   3842  H  HB3  . TRP A 1 116 ? -0.206  -0.799  0.808   1.00 0.00 ? 116 TRP A HB3  2  
ATOM   3843  H  HD1  . TRP A 1 116 ? -1.531  -0.976  -1.352  1.00 0.00 ? 116 TRP A HD1  2  
ATOM   3844  H  HE1  . TRP A 1 116 ? -3.191  -2.604  -2.422  1.00 0.00 ? 116 TRP A HE1  2  
ATOM   3845  H  HE3  . TRP A 1 116 ? -1.836  -4.422  2.436   1.00 0.00 ? 116 TRP A HE3  2  
ATOM   3846  H  HZ2  . TRP A 1 116 ? -4.348  -5.176  -1.794  1.00 0.00 ? 116 TRP A HZ2  2  
ATOM   3847  H  HZ3  . TRP A 1 116 ? -3.216  -6.455  2.161   1.00 0.00 ? 116 TRP A HZ3  2  
ATOM   3848  H  HH2  . TRP A 1 116 ? -4.439  -6.869  0.027   1.00 0.00 ? 116 TRP A HH2  2  
ATOM   3849  N  N    . LEU A 1 117 ? 2.122   -2.087  -0.655  1.00 0.00 ? 117 LEU A N    2  
ATOM   3850  C  CA   . LEU A 1 117 ? 2.651   -2.270  -2.001  1.00 0.00 ? 117 LEU A CA   2  
ATOM   3851  C  C    . LEU A 1 117 ? 3.631   -3.441  -2.058  1.00 0.00 ? 117 LEU A C    2  
ATOM   3852  O  O    . LEU A 1 117 ? 3.531   -4.242  -2.989  1.00 0.00 ? 117 LEU A O    2  
ATOM   3853  C  CB   . LEU A 1 117 ? 3.297   -0.971  -2.514  1.00 0.00 ? 117 LEU A CB   2  
ATOM   3854  C  CG   . LEU A 1 117 ? 2.265   0.104   -2.916  1.00 0.00 ? 117 LEU A CG   2  
ATOM   3855  C  CD1  . LEU A 1 117 ? 2.956   1.465   -3.045  1.00 0.00 ? 117 LEU A CD1  2  
ATOM   3856  C  CD2  . LEU A 1 117 ? 1.560   -0.236  -4.235  1.00 0.00 ? 117 LEU A CD2  2  
ATOM   3857  H  H    . LEU A 1 117 ? 2.344   -1.231  -0.164  1.00 0.00 ? 117 LEU A H    2  
ATOM   3858  H  HA   . LEU A 1 117 ? 1.817   -2.526  -2.654  1.00 0.00 ? 117 LEU A HA   2  
ATOM   3859  H  HB2  . LEU A 1 117 ? 3.956   -0.578  -1.741  1.00 0.00 ? 117 LEU A HB2  2  
ATOM   3860  H  HB3  . LEU A 1 117 ? 3.916   -1.203  -3.384  1.00 0.00 ? 117 LEU A HB3  2  
ATOM   3861  H  HG   . LEU A 1 117 ? 1.503   0.187   -2.143  1.00 0.00 ? 117 LEU A HG   2  
ATOM   3862  H  HD11 . LEU A 1 117 ? 2.223   2.229   -3.308  1.00 0.00 ? 117 LEU A HD11 2  
ATOM   3863  H  HD12 . LEU A 1 117 ? 3.406   1.735   -2.089  1.00 0.00 ? 117 LEU A HD12 2  
ATOM   3864  H  HD13 . LEU A 1 117 ? 3.732   1.427   -3.811  1.00 0.00 ? 117 LEU A HD13 2  
ATOM   3865  H  HD21 . LEU A 1 117 ? 0.987   -1.157  -4.135  1.00 0.00 ? 117 LEU A HD21 2  
ATOM   3866  H  HD22 . LEU A 1 117 ? 0.868   0.565   -4.497  1.00 0.00 ? 117 LEU A HD22 2  
ATOM   3867  H  HD23 . LEU A 1 117 ? 2.290   -0.353  -5.037  1.00 0.00 ? 117 LEU A HD23 2  
ATOM   3868  N  N    . TYR A 1 118 ? 4.545   -3.605  -1.091  1.00 0.00 ? 118 TYR A N    2  
ATOM   3869  C  CA   . TYR A 1 118 ? 5.408   -4.786  -1.118  1.00 0.00 ? 118 TYR A CA   2  
ATOM   3870  C  C    . TYR A 1 118 ? 4.640   -6.052  -0.722  1.00 0.00 ? 118 TYR A C    2  
ATOM   3871  O  O    . TYR A 1 118 ? 4.904   -7.113  -1.286  1.00 0.00 ? 118 TYR A O    2  
ATOM   3872  C  CB   . TYR A 1 118 ? 6.756   -4.597  -0.398  1.00 0.00 ? 118 TYR A CB   2  
ATOM   3873  C  CG   . TYR A 1 118 ? 6.796   -4.202  1.071   1.00 0.00 ? 118 TYR A CG   2  
ATOM   3874  C  CD1  . TYR A 1 118 ? 6.319   -5.076  2.068   1.00 0.00 ? 118 TYR A CD1  2  
ATOM   3875  C  CD2  . TYR A 1 118 ? 7.427   -2.998  1.449   1.00 0.00 ? 118 TYR A CD2  2  
ATOM   3876  C  CE1  . TYR A 1 118 ? 6.412   -4.717  3.425   1.00 0.00 ? 118 TYR A CE1  2  
ATOM   3877  C  CE2  . TYR A 1 118 ? 7.549   -2.646  2.805   1.00 0.00 ? 118 TYR A CE2  2  
ATOM   3878  C  CZ   . TYR A 1 118 ? 7.017   -3.495  3.800   1.00 0.00 ? 118 TYR A CZ   2  
ATOM   3879  O  OH   . TYR A 1 118 ? 6.987   -3.087  5.098   1.00 0.00 ? 118 TYR A OH   2  
ATOM   3880  H  H    . TYR A 1 118 ? 4.623   -2.935  -0.330  1.00 0.00 ? 118 TYR A H    2  
ATOM   3881  H  HA   . TYR A 1 118 ? 5.688   -4.941  -2.162  1.00 0.00 ? 118 TYR A HA   2  
ATOM   3882  H  HB2  . TYR A 1 118 ? 7.304   -5.530  -0.499  1.00 0.00 ? 118 TYR A HB2  2  
ATOM   3883  H  HB3  . TYR A 1 118 ? 7.318   -3.854  -0.966  1.00 0.00 ? 118 TYR A HB3  2  
ATOM   3884  H  HD1  . TYR A 1 118 ? 5.871   -6.021  1.803   1.00 0.00 ? 118 TYR A HD1  2  
ATOM   3885  H  HD2  . TYR A 1 118 ? 7.817   -2.328  0.694   1.00 0.00 ? 118 TYR A HD2  2  
ATOM   3886  H  HE1  . TYR A 1 118 ? 5.998   -5.370  4.182   1.00 0.00 ? 118 TYR A HE1  2  
ATOM   3887  H  HE2  . TYR A 1 118 ? 7.999   -1.703  3.080   1.00 0.00 ? 118 TYR A HE2  2  
ATOM   3888  H  HH   . TYR A 1 118 ? 6.235   -3.524  5.545   1.00 0.00 ? 118 TYR A HH   2  
ATOM   3889  N  N    . TRP A 1 119 ? 3.635   -5.972  0.157   1.00 0.00 ? 119 TRP A N    2  
ATOM   3890  C  CA   . TRP A 1 119 ? 2.770   -7.109  0.448   1.00 0.00 ? 119 TRP A CA   2  
ATOM   3891  C  C    . TRP A 1 119 ? 2.017   -7.545  -0.817  1.00 0.00 ? 119 TRP A C    2  
ATOM   3892  O  O    . TRP A 1 119 ? 1.916   -8.740  -1.093  1.00 0.00 ? 119 TRP A O    2  
ATOM   3893  C  CB   . TRP A 1 119 ? 1.826   -6.742  1.597   1.00 0.00 ? 119 TRP A CB   2  
ATOM   3894  C  CG   . TRP A 1 119 ? 0.744   -7.731  1.886   1.00 0.00 ? 119 TRP A CG   2  
ATOM   3895  C  CD1  . TRP A 1 119 ? -0.498  -7.672  1.365   1.00 0.00 ? 119 TRP A CD1  2  
ATOM   3896  C  CD2  . TRP A 1 119 ? 0.780   -8.946  2.696   1.00 0.00 ? 119 TRP A CD2  2  
ATOM   3897  N  NE1  . TRP A 1 119 ? -1.257  -8.718  1.843   1.00 0.00 ? 119 TRP A NE1  2  
ATOM   3898  C  CE2  . TRP A 1 119 ? -0.514  -9.551  2.658   1.00 0.00 ? 119 TRP A CE2  2  
ATOM   3899  C  CE3  . TRP A 1 119 ? 1.779   -9.613  3.439   1.00 0.00 ? 119 TRP A CE3  2  
ATOM   3900  C  CZ2  . TRP A 1 119 ? -0.797  -10.756 3.323   1.00 0.00 ? 119 TRP A CZ2  2  
ATOM   3901  C  CZ3  . TRP A 1 119 ? 1.509   -10.827 4.100   1.00 0.00 ? 119 TRP A CZ3  2  
ATOM   3902  C  CH2  . TRP A 1 119 ? 0.224   -11.398 4.045   1.00 0.00 ? 119 TRP A CH2  2  
ATOM   3903  H  H    . TRP A 1 119 ? 3.407   -5.088  0.601   1.00 0.00 ? 119 TRP A H    2  
ATOM   3904  H  HA   . TRP A 1 119 ? 3.392   -7.942  0.769   1.00 0.00 ? 119 TRP A HA   2  
ATOM   3905  H  HB2  . TRP A 1 119 ? 2.416   -6.604  2.504   1.00 0.00 ? 119 TRP A HB2  2  
ATOM   3906  H  HB3  . TRP A 1 119 ? 1.347   -5.791  1.371   1.00 0.00 ? 119 TRP A HB3  2  
ATOM   3907  H  HD1  . TRP A 1 119 ? -0.836  -6.909  0.673   1.00 0.00 ? 119 TRP A HD1  2  
ATOM   3908  H  HE1  . TRP A 1 119 ? -2.216  -8.868  1.552   1.00 0.00 ? 119 TRP A HE1  2  
ATOM   3909  H  HE3  . TRP A 1 119 ? 2.768   -9.183  3.499   1.00 0.00 ? 119 TRP A HE3  2  
ATOM   3910  H  HZ2  . TRP A 1 119 ? -1.785  -11.191 3.272   1.00 0.00 ? 119 TRP A HZ2  2  
ATOM   3911  H  HZ3  . TRP A 1 119 ? 2.293   -11.321 4.659   1.00 0.00 ? 119 TRP A HZ3  2  
ATOM   3912  H  HH2  . TRP A 1 119 ? 0.022   -12.329 4.558   1.00 0.00 ? 119 TRP A HH2  2  
ATOM   3913  N  N    . LEU A 1 120 ? 1.564   -6.586  -1.630  1.00 0.00 ? 120 LEU A N    2  
ATOM   3914  C  CA   . LEU A 1 120 ? 0.932   -6.843  -2.916  1.00 0.00 ? 120 LEU A CA   2  
ATOM   3915  C  C    . LEU A 1 120 ? 1.891   -7.637  -3.809  1.00 0.00 ? 120 LEU A C    2  
ATOM   3916  O  O    . LEU A 1 120 ? 1.492   -8.633  -4.412  1.00 0.00 ? 120 LEU A O    2  
ATOM   3917  C  CB   . LEU A 1 120 ? 0.553   -5.512  -3.593  1.00 0.00 ? 120 LEU A CB   2  
ATOM   3918  C  CG   . LEU A 1 120 ? -0.523  -5.668  -4.681  1.00 0.00 ? 120 LEU A CG   2  
ATOM   3919  C  CD1  . LEU A 1 120 ? -1.919  -5.598  -4.053  1.00 0.00 ? 120 LEU A CD1  2  
ATOM   3920  C  CD2  . LEU A 1 120 ? -0.379  -4.547  -5.717  1.00 0.00 ? 120 LEU A CD2  2  
ATOM   3921  H  H    . LEU A 1 120 ? 1.635   -5.623  -1.320  1.00 0.00 ? 120 LEU A H    2  
ATOM   3922  H  HA   . LEU A 1 120 ? 0.031   -7.425  -2.726  1.00 0.00 ? 120 LEU A HA   2  
ATOM   3923  H  HB2  . LEU A 1 120 ? 0.189   -4.802  -2.851  1.00 0.00 ? 120 LEU A HB2  2  
ATOM   3924  H  HB3  . LEU A 1 120 ? 1.447   -5.085  -4.045  1.00 0.00 ? 120 LEU A HB3  2  
ATOM   3925  H  HG   . LEU A 1 120 ? -0.404  -6.625  -5.190  1.00 0.00 ? 120 LEU A HG   2  
ATOM   3926  H  HD11 . LEU A 1 120 ? -2.679  -5.791  -4.809  1.00 0.00 ? 120 LEU A HD11 2  
ATOM   3927  H  HD12 . LEU A 1 120 ? -2.013  -6.331  -3.253  1.00 0.00 ? 120 LEU A HD12 2  
ATOM   3928  H  HD13 . LEU A 1 120 ? -2.085  -4.610  -3.626  1.00 0.00 ? 120 LEU A HD13 2  
ATOM   3929  H  HD21 . LEU A 1 120 ? -1.198  -4.591  -6.435  1.00 0.00 ? 120 LEU A HD21 2  
ATOM   3930  H  HD22 . LEU A 1 120 ? -0.380  -3.576  -5.222  1.00 0.00 ? 120 LEU A HD22 2  
ATOM   3931  H  HD23 . LEU A 1 120 ? 0.562   -4.665  -6.256  1.00 0.00 ? 120 LEU A HD23 2  
ATOM   3932  N  N    . ALA A 1 121 ? 3.166   -7.224  -3.855  1.00 0.00 ? 121 ALA A N    2  
ATOM   3933  C  CA   . ALA A 1 121 ? 4.198   -7.859  -4.669  1.00 0.00 ? 121 ALA A CA   2  
ATOM   3934  C  C    . ALA A 1 121 ? 4.463   -9.317  -4.265  1.00 0.00 ? 121 ALA A C    2  
ATOM   3935  O  O    . ALA A 1 121 ? 4.854   -10.117 -5.116  1.00 0.00 ? 121 ALA A O    2  
ATOM   3936  C  CB   . ALA A 1 121 ? 5.495   -7.040  -4.607  1.00 0.00 ? 121 ALA A CB   2  
ATOM   3937  H  H    . ALA A 1 121 ? 3.428   -6.402  -3.325  1.00 0.00 ? 121 ALA A H    2  
ATOM   3938  H  HA   . ALA A 1 121 ? 3.848   -7.856  -5.703  1.00 0.00 ? 121 ALA A HA   2  
ATOM   3939  H  HB1  . ALA A 1 121 ? 6.214   -7.448  -5.318  1.00 0.00 ? 121 ALA A HB1  2  
ATOM   3940  H  HB2  . ALA A 1 121 ? 5.295   -6.000  -4.866  1.00 0.00 ? 121 ALA A HB2  2  
ATOM   3941  H  HB3  . ALA A 1 121 ? 5.933   -7.089  -3.609  1.00 0.00 ? 121 ALA A HB3  2  
ATOM   3942  N  N    . ARG A 1 122 ? 4.234   -9.691  -2.997  1.00 0.00 ? 122 ARG A N    2  
ATOM   3943  C  CA   . ARG A 1 122 ? 4.359   -11.088 -2.547  1.00 0.00 ? 122 ARG A CA   2  
ATOM   3944  C  C    . ARG A 1 122 ? 3.325   -12.004 -3.212  1.00 0.00 ? 122 ARG A C    2  
ATOM   3945  O  O    . ARG A 1 122 ? 3.497   -13.222 -3.175  1.00 0.00 ? 122 ARG A O    2  
ATOM   3946  C  CB   . ARG A 1 122 ? 4.216   -11.201 -1.016  1.00 0.00 ? 122 ARG A CB   2  
ATOM   3947  C  CG   . ARG A 1 122 ? 5.301   -10.448 -0.254  1.00 0.00 ? 122 ARG A CG   2  
ATOM   3948  C  CD   . ARG A 1 122 ? 5.000   -10.307 1.241   1.00 0.00 ? 122 ARG A CD   2  
ATOM   3949  N  NE   . ARG A 1 122 ? 5.226   -11.551 2.000   1.00 0.00 ? 122 ARG A NE   2  
ATOM   3950  C  CZ   . ARG A 1 122 ? 5.553   -11.616 3.300   1.00 0.00 ? 122 ARG A CZ   2  
ATOM   3951  N  NH1  . ARG A 1 122 ? 5.731   -10.511 4.019   1.00 0.00 ? 122 ARG A NH1  2  
ATOM   3952  N  NH2  . ARG A 1 122 ? 5.704   -12.793 3.891   1.00 0.00 ? 122 ARG A NH2  2  
ATOM   3953  H  H    . ARG A 1 122 ? 3.966   -8.978  -2.322  1.00 0.00 ? 122 ARG A H    2  
ATOM   3954  H  HA   . ARG A 1 122 ? 5.352   -11.447 -2.824  1.00 0.00 ? 122 ARG A HA   2  
ATOM   3955  H  HB2  . ARG A 1 122 ? 3.247   -10.814 -0.716  1.00 0.00 ? 122 ARG A HB2  2  
ATOM   3956  H  HB3  . ARG A 1 122 ? 4.279   -12.248 -0.727  1.00 0.00 ? 122 ARG A HB3  2  
ATOM   3957  H  HG2  . ARG A 1 122 ? 6.262   -10.940 -0.400  1.00 0.00 ? 122 ARG A HG2  2  
ATOM   3958  H  HG3  . ARG A 1 122 ? 5.358   -9.448  -0.664  1.00 0.00 ? 122 ARG A HG3  2  
ATOM   3959  H  HD2  . ARG A 1 122 ? 5.647   -9.522  1.630   1.00 0.00 ? 122 ARG A HD2  2  
ATOM   3960  H  HD3  . ARG A 1 122 ? 3.963   -9.996  1.370   1.00 0.00 ? 122 ARG A HD3  2  
ATOM   3961  H  HE   . ARG A 1 122 ? 5.094   -12.415 1.489   1.00 0.00 ? 122 ARG A HE   2  
ATOM   3962  H  HH11 . ARG A 1 122 ? 5.629   -9.597  3.613   1.00 0.00 ? 122 ARG A HH11 2  
ATOM   3963  H  HH12 . ARG A 1 122 ? 6.033   -10.564 5.002   1.00 0.00 ? 122 ARG A HH12 2  
ATOM   3964  H  HH21 . ARG A 1 122 ? 5.583   -13.663 3.392   1.00 0.00 ? 122 ARG A HH21 2  
ATOM   3965  H  HH22 . ARG A 1 122 ? 5.945   -12.846 4.889   1.00 0.00 ? 122 ARG A HH22 2  
ATOM   3966  N  N    . GLY A 1 123 ? 2.231   -11.458 -3.754  1.00 0.00 ? 123 GLY A N    2  
ATOM   3967  C  CA   . GLY A 1 123 ? 1.098   -12.233 -4.256  1.00 0.00 ? 123 GLY A CA   2  
ATOM   3968  C  C    . GLY A 1 123 ? 0.071   -12.544 -3.158  1.00 0.00 ? 123 GLY A C    2  
ATOM   3969  O  O    . GLY A 1 123 ? -1.077  -12.851 -3.484  1.00 0.00 ? 123 GLY A O    2  
ATOM   3970  H  H    . GLY A 1 123 ? 2.142   -10.450 -3.790  1.00 0.00 ? 123 GLY A H    2  
ATOM   3971  H  HA2  . GLY A 1 123 ? 0.610   -11.659 -5.044  1.00 0.00 ? 123 GLY A HA2  2  
ATOM   3972  H  HA3  . GLY A 1 123 ? 1.455   -13.171 -4.683  1.00 0.00 ? 123 GLY A HA3  2  
ATOM   3973  N  N    . TYR A 1 124 ? 0.463   -12.390 -1.883  1.00 0.00 ? 124 TYR A N    2  
ATOM   3974  C  CA   . TYR A 1 124 ? -0.337  -12.562 -0.670  1.00 0.00 ? 124 TYR A CA   2  
ATOM   3975  C  C    . TYR A 1 124 ? -1.269  -13.791 -0.704  1.00 0.00 ? 124 TYR A C    2  
ATOM   3976  O  O    . TYR A 1 124 ? -0.908  -14.806 -1.309  1.00 0.00 ? 124 TYR A O    2  
ATOM   3977  C  CB   . TYR A 1 124 ? -0.938  -11.217 -0.211  1.00 0.00 ? 124 TYR A CB   2  
ATOM   3978  C  CG   . TYR A 1 124 ? -1.880  -10.454 -1.132  1.00 0.00 ? 124 TYR A CG   2  
ATOM   3979  C  CD1  . TYR A 1 124 ? -1.377  -9.810  -2.280  1.00 0.00 ? 124 TYR A CD1  2  
ATOM   3980  C  CD2  . TYR A 1 124 ? -3.235  -10.281 -0.782  1.00 0.00 ? 124 TYR A CD2  2  
ATOM   3981  C  CE1  . TYR A 1 124 ? -2.232  -9.086  -3.127  1.00 0.00 ? 124 TYR A CE1  2  
ATOM   3982  C  CE2  . TYR A 1 124 ? -4.087  -9.515  -1.597  1.00 0.00 ? 124 TYR A CE2  2  
ATOM   3983  C  CZ   . TYR A 1 124 ? -3.598  -8.939  -2.790  1.00 0.00 ? 124 TYR A CZ   2  
ATOM   3984  O  OH   . TYR A 1 124 ? -4.447  -8.246  -3.600  1.00 0.00 ? 124 TYR A OH   2  
ATOM   3985  H  H    . TYR A 1 124 ? 1.423   -12.126 -1.729  1.00 0.00 ? 124 TYR A H    2  
ATOM   3986  H  HA   . TYR A 1 124 ? 0.382   -12.808 0.113   1.00 0.00 ? 124 TYR A HA   2  
ATOM   3987  H  HB2  . TYR A 1 124 ? -1.444  -11.384 0.738   1.00 0.00 ? 124 TYR A HB2  2  
ATOM   3988  H  HB3  . TYR A 1 124 ? -0.099  -10.553 0.003   1.00 0.00 ? 124 TYR A HB3  2  
ATOM   3989  H  HD1  . TYR A 1 124 ? -0.325  -9.870  -2.519  1.00 0.00 ? 124 TYR A HD1  2  
ATOM   3990  H  HD2  . TYR A 1 124 ? -3.635  -10.720 0.120   1.00 0.00 ? 124 TYR A HD2  2  
ATOM   3991  H  HE1  . TYR A 1 124 ? -1.831  -8.630  -4.021  1.00 0.00 ? 124 TYR A HE1  2  
ATOM   3992  H  HE2  . TYR A 1 124 ? -5.122  -9.374  -1.313  1.00 0.00 ? 124 TYR A HE2  2  
ATOM   3993  H  HH   . TYR A 1 124 ? -4.024  -7.903  -4.401  1.00 0.00 ? 124 TYR A HH   2  
ATOM   3994  N  N    . LYS A 1 125 ? -2.394  -13.772 0.029   1.00 0.00 ? 125 LYS A N    2  
ATOM   3995  C  CA   . LYS A 1 125 ? -3.234  -14.956 0.248   1.00 0.00 ? 125 LYS A CA   2  
ATOM   3996  C  C    . LYS A 1 125 ? -4.706  -14.702 -0.073  1.00 0.00 ? 125 LYS A C    2  
ATOM   3997  O  O    . LYS A 1 125 ? -5.260  -15.440 -0.891  1.00 0.00 ? 125 LYS A O    2  
ATOM   3998  C  CB   . LYS A 1 125 ? -3.076  -15.453 1.701   1.00 0.00 ? 125 LYS A CB   2  
ATOM   3999  C  CG   . LYS A 1 125 ? -1.667  -15.956 2.059   1.00 0.00 ? 125 LYS A CG   2  
ATOM   4000  C  CD   . LYS A 1 125 ? -1.292  -17.256 1.325   1.00 0.00 ? 125 LYS A CD   2  
ATOM   4001  C  CE   . LYS A 1 125 ? 0.052   -17.837 1.791   1.00 0.00 ? 125 LYS A CE   2  
ATOM   4002  N  NZ   . LYS A 1 125 ? 1.218   -17.011 1.384   1.00 0.00 ? 125 LYS A NZ   2  
ATOM   4003  H  H    . LYS A 1 125 ? -2.632  -12.925 0.519   1.00 0.00 ? 125 LYS A H    2  
ATOM   4004  H  HA   . LYS A 1 125 ? -2.914  -15.754 -0.422  1.00 0.00 ? 125 LYS A HA   2  
ATOM   4005  H  HB2  . LYS A 1 125 ? -3.330  -14.641 2.383   1.00 0.00 ? 125 LYS A HB2  2  
ATOM   4006  H  HB3  . LYS A 1 125 ? -3.788  -16.262 1.877   1.00 0.00 ? 125 LYS A HB3  2  
ATOM   4007  H  HG2  . LYS A 1 125 ? -0.940  -15.174 1.836   1.00 0.00 ? 125 LYS A HG2  2  
ATOM   4008  H  HG3  . LYS A 1 125 ? -1.639  -16.145 3.133   1.00 0.00 ? 125 LYS A HG3  2  
ATOM   4009  H  HD2  . LYS A 1 125 ? -2.065  -18.000 1.523   1.00 0.00 ? 125 LYS A HD2  2  
ATOM   4010  H  HD3  . LYS A 1 125 ? -1.257  -17.088 0.248   1.00 0.00 ? 125 LYS A HD3  2  
ATOM   4011  H  HE2  . LYS A 1 125 ? 0.035   -17.945 2.878   1.00 0.00 ? 125 LYS A HE2  2  
ATOM   4012  H  HE3  . LYS A 1 125 ? 0.158   -18.835 1.360   1.00 0.00 ? 125 LYS A HE3  2  
ATOM   4013  H  HZ1  . LYS A 1 125 ? 1.252   -16.897 0.381   1.00 0.00 ? 125 LYS A HZ1  2  
ATOM   4014  H  HZ2  . LYS A 1 125 ? 1.197   -16.100 1.815   1.00 0.00 ? 125 LYS A HZ2  2  
ATOM   4015  H  HZ3  . LYS A 1 125 ? 2.079   -17.459 1.666   1.00 0.00 ? 125 LYS A HZ3  2  
ATOM   4016  N  N    . PHE A 1 126 ? -5.351  -13.718 0.569   1.00 0.00 ? 126 PHE A N    2  
ATOM   4017  C  CA   . PHE A 1 126 ? -6.768  -13.456 0.311   1.00 0.00 ? 126 PHE A CA   2  
ATOM   4018  C  C    . PHE A 1 126 ? -6.973  -12.941 -1.117  1.00 0.00 ? 126 PHE A C    2  
ATOM   4019  O  O    . PHE A 1 126 ? -8.054  -13.200 -1.685  1.00 0.00 ? 126 PHE A O    2  
ATOM   4020  C  CB   . PHE A 1 126 ? -7.397  -12.540 1.368   1.00 0.00 ? 126 PHE A CB   2  
ATOM   4021  C  CG   . PHE A 1 126 ? -6.835  -11.140 1.510   1.00 0.00 ? 126 PHE A CG   2  
ATOM   4022  C  CD1  . PHE A 1 126 ? -5.713  -10.914 2.327   1.00 0.00 ? 126 PHE A CD1  2  
ATOM   4023  C  CD2  . PHE A 1 126 ? -7.489  -10.047 0.909   1.00 0.00 ? 126 PHE A CD2  2  
ATOM   4024  C  CE1  . PHE A 1 126 ? -5.262  -9.606  2.562   1.00 0.00 ? 126 PHE A CE1  2  
ATOM   4025  C  CE2  . PHE A 1 126 ? -7.033  -8.737  1.141   1.00 0.00 ? 126 PHE A CE2  2  
ATOM   4026  C  CZ   . PHE A 1 126 ? -5.923  -8.514  1.974   1.00 0.00 ? 126 PHE A CZ   2  
ATOM   4027  O  OXT  . PHE A 1 126 ? -6.062  -12.300 -1.680  1.00 0.00 ? 126 PHE A OXT  2  
ATOM   4028  H  H    . PHE A 1 126 ? -4.856  -13.109 1.204   1.00 0.00 ? 126 PHE A H    2  
ATOM   4029  H  HA   . PHE A 1 126 ? -7.286  -14.414 0.384   1.00 0.00 ? 126 PHE A HA   2  
ATOM   4030  H  HB2  . PHE A 1 126 ? -8.460  -12.456 1.143   1.00 0.00 ? 126 PHE A HB2  2  
ATOM   4031  H  HB3  . PHE A 1 126 ? -7.323  -13.040 2.332   1.00 0.00 ? 126 PHE A HB3  2  
ATOM   4032  H  HD1  . PHE A 1 126 ? -5.207  -11.742 2.800   1.00 0.00 ? 126 PHE A HD1  2  
ATOM   4033  H  HD2  . PHE A 1 126 ? -8.360  -10.209 0.289   1.00 0.00 ? 126 PHE A HD2  2  
ATOM   4034  H  HE1  . PHE A 1 126 ? -4.420  -9.445  3.215   1.00 0.00 ? 126 PHE A HE1  2  
ATOM   4035  H  HE2  . PHE A 1 126 ? -7.552  -7.901  0.694   1.00 0.00 ? 126 PHE A HE2  2  
ATOM   4036  H  HZ   . PHE A 1 126 ? -5.583  -7.507  2.171   1.00 0.00 ? 126 PHE A HZ   2  
HETATM 4037  CA CA   . CA  B 2 .   ? -6.911  5.791   11.363  1.00 0.00 ? 127 CA  A CA   2  
HETATM 4038  CA CA   . CA  C 2 .   ? -9.923  -18.604 11.214  1.00 0.00 ? 128 CA  A CA   2  
ATOM   4039  N  N    . MET A 1 1   ? 7.646   -17.403 -2.424  1.00 0.00 ? 1   MET A N    3  
ATOM   4040  C  CA   . MET A 1 1   ? 8.716   -16.744 -1.636  1.00 0.00 ? 1   MET A CA   3  
ATOM   4041  C  C    . MET A 1 1   ? 8.923   -15.312 -2.137  1.00 0.00 ? 1   MET A C    3  
ATOM   4042  O  O    . MET A 1 1   ? 8.936   -15.069 -3.348  1.00 0.00 ? 1   MET A O    3  
ATOM   4043  C  CB   . MET A 1 1   ? 10.051  -17.519 -1.683  1.00 0.00 ? 1   MET A CB   3  
ATOM   4044  C  CG   . MET A 1 1   ? 10.008  -18.876 -0.964  1.00 0.00 ? 1   MET A CG   3  
ATOM   4045  S  SD   . MET A 1 1   ? 9.572   -18.799 0.798   1.00 0.00 ? 1   MET A SD   3  
ATOM   4046  C  CE   . MET A 1 1   ? 9.701   -20.559 1.219   1.00 0.00 ? 1   MET A CE   3  
ATOM   4047  H  H1   . MET A 1 1   ? 7.914   -17.446 -3.395  1.00 0.00 ? 1   MET A H1   3  
ATOM   4048  H  H2   . MET A 1 1   ? 7.469   -18.335 -2.085  1.00 0.00 ? 1   MET A H2   3  
ATOM   4049  H  H3   . MET A 1 1   ? 6.794   -16.868 -2.358  1.00 0.00 ? 1   MET A H3   3  
ATOM   4050  H  HA   . MET A 1 1   ? 8.392   -16.693 -0.594  1.00 0.00 ? 1   MET A HA   3  
ATOM   4051  H  HB2  . MET A 1 1   ? 10.351  -17.678 -2.720  1.00 0.00 ? 1   MET A HB2  3  
ATOM   4052  H  HB3  . MET A 1 1   ? 10.824  -16.916 -1.203  1.00 0.00 ? 1   MET A HB3  3  
ATOM   4053  H  HG2  . MET A 1 1   ? 9.302   -19.533 -1.472  1.00 0.00 ? 1   MET A HG2  3  
ATOM   4054  H  HG3  . MET A 1 1   ? 10.996  -19.331 -1.048  1.00 0.00 ? 1   MET A HG3  3  
ATOM   4055  H  HE1  . MET A 1 1   ? 9.000   -21.136 0.614   1.00 0.00 ? 1   MET A HE1  3  
ATOM   4056  H  HE2  . MET A 1 1   ? 10.716  -20.910 1.028   1.00 0.00 ? 1   MET A HE2  3  
ATOM   4057  H  HE3  . MET A 1 1   ? 9.465   -20.701 2.274   1.00 0.00 ? 1   MET A HE3  3  
ATOM   4058  N  N    . ALA A 1 2   ? 9.098   -14.357 -1.216  1.00 0.00 ? 2   ALA A N    3  
ATOM   4059  C  CA   . ALA A 1 2   ? 9.402   -12.959 -1.508  1.00 0.00 ? 2   ALA A CA   3  
ATOM   4060  C  C    . ALA A 1 2   ? 10.255  -12.397 -0.365  1.00 0.00 ? 2   ALA A C    3  
ATOM   4061  O  O    . ALA A 1 2   ? 10.184  -12.904 0.759   1.00 0.00 ? 2   ALA A O    3  
ATOM   4062  C  CB   . ALA A 1 2   ? 8.096   -12.163 -1.643  1.00 0.00 ? 2   ALA A CB   3  
ATOM   4063  H  H    . ALA A 1 2   ? 9.130   -14.604 -0.234  1.00 0.00 ? 2   ALA A H    3  
ATOM   4064  H  HA   . ALA A 1 2   ? 9.964   -12.893 -2.442  1.00 0.00 ? 2   ALA A HA   3  
ATOM   4065  H  HB1  . ALA A 1 2   ? 8.323   -11.123 -1.877  1.00 0.00 ? 2   ALA A HB1  3  
ATOM   4066  H  HB2  . ALA A 1 2   ? 7.489   -12.577 -2.449  1.00 0.00 ? 2   ALA A HB2  3  
ATOM   4067  H  HB3  . ALA A 1 2   ? 7.534   -12.206 -0.709  1.00 0.00 ? 2   ALA A HB3  3  
ATOM   4068  N  N    . SER A 1 3   ? 11.017  -11.338 -0.651  1.00 0.00 ? 3   SER A N    3  
ATOM   4069  C  CA   . SER A 1 3   ? 12.002  -10.763 0.271   1.00 0.00 ? 3   SER A CA   3  
ATOM   4070  C  C    . SER A 1 3   ? 12.001  -9.225  0.209   1.00 0.00 ? 3   SER A C    3  
ATOM   4071  O  O    . SER A 1 3   ? 13.024  -8.578  0.443   1.00 0.00 ? 3   SER A O    3  
ATOM   4072  C  CB   . SER A 1 3   ? 13.392  -11.349 -0.040  1.00 0.00 ? 3   SER A CB   3  
ATOM   4073  O  OG   . SER A 1 3   ? 13.373  -12.770 -0.112  1.00 0.00 ? 3   SER A OG   3  
ATOM   4074  H  H    . SER A 1 3   ? 11.037  -10.996 -1.601  1.00 0.00 ? 3   SER A H    3  
ATOM   4075  H  HA   . SER A 1 3   ? 11.725  -11.034 1.287   1.00 0.00 ? 3   SER A HA   3  
ATOM   4076  H  HB2  . SER A 1 3   ? 13.739  -10.953 -0.996  1.00 0.00 ? 3   SER A HB2  3  
ATOM   4077  H  HB3  . SER A 1 3   ? 14.091  -11.039 0.737   1.00 0.00 ? 3   SER A HB3  3  
ATOM   4078  H  HG   . SER A 1 3   ? 14.279  -13.071 -0.303  1.00 0.00 ? 3   SER A HG   3  
ATOM   4079  N  N    . VAL A 1 4   ? 10.869  -8.633  -0.182  1.00 0.00 ? 4   VAL A N    3  
ATOM   4080  C  CA   . VAL A 1 4   ? 10.719  -7.202  -0.422  1.00 0.00 ? 4   VAL A CA   3  
ATOM   4081  C  C    . VAL A 1 4   ? 10.855  -6.372  0.865   1.00 0.00 ? 4   VAL A C    3  
ATOM   4082  O  O    . VAL A 1 4   ? 11.185  -5.186  0.806   1.00 0.00 ? 4   VAL A O    3  
ATOM   4083  C  CB   . VAL A 1 4   ? 9.351   -6.956  -1.091  1.00 0.00 ? 4   VAL A CB   3  
ATOM   4084  C  CG1  . VAL A 1 4   ? 9.184   -7.755  -2.395  1.00 0.00 ? 4   VAL A CG1  3  
ATOM   4085  C  CG2  . VAL A 1 4   ? 8.172   -7.253  -0.152  1.00 0.00 ? 4   VAL A CG2  3  
ATOM   4086  H  H    . VAL A 1 4   ? 10.049  -9.201  -0.325  1.00 0.00 ? 4   VAL A H    3  
ATOM   4087  H  HA   . VAL A 1 4   ? 11.506  -6.888  -1.108  1.00 0.00 ? 4   VAL A HA   3  
ATOM   4088  H  HB   . VAL A 1 4   ? 9.294   -5.909  -1.354  1.00 0.00 ? 4   VAL A HB   3  
ATOM   4089  H  HG11 . VAL A 1 4   ? 9.119   -8.824  -2.199  1.00 0.00 ? 4   VAL A HG11 3  
ATOM   4090  H  HG12 . VAL A 1 4   ? 8.272   -7.438  -2.903  1.00 0.00 ? 4   VAL A HG12 3  
ATOM   4091  H  HG13 . VAL A 1 4   ? 10.031  -7.561  -3.056  1.00 0.00 ? 4   VAL A HG13 3  
ATOM   4092  H  HG21 . VAL A 1 4   ? 7.246   -7.160  -0.710  1.00 0.00 ? 4   VAL A HG21 3  
ATOM   4093  H  HG22 . VAL A 1 4   ? 8.249   -8.254  0.266   1.00 0.00 ? 4   VAL A HG22 3  
ATOM   4094  H  HG23 . VAL A 1 4   ? 8.141   -6.527  0.662   1.00 0.00 ? 4   VAL A HG23 3  
ATOM   4095  N  N    . GLU A 1 5   ? 10.549  -6.976  2.016   1.00 0.00 ? 5   GLU A N    3  
ATOM   4096  C  CA   . GLU A 1 5   ? 10.427  -6.301  3.298   1.00 0.00 ? 5   GLU A CA   3  
ATOM   4097  C  C    . GLU A 1 5   ? 11.777  -5.791  3.821   1.00 0.00 ? 5   GLU A C    3  
ATOM   4098  O  O    . GLU A 1 5   ? 12.847  -6.237  3.394   1.00 0.00 ? 5   GLU A O    3  
ATOM   4099  C  CB   . GLU A 1 5   ? 9.727   -7.222  4.314   1.00 0.00 ? 5   GLU A CB   3  
ATOM   4100  C  CG   . GLU A 1 5   ? 10.523  -8.455  4.781   1.00 0.00 ? 5   GLU A CG   3  
ATOM   4101  C  CD   . GLU A 1 5   ? 10.813  -9.493  3.682   1.00 0.00 ? 5   GLU A CD   3  
ATOM   4102  O  OE1  . GLU A 1 5   ? 9.986   -9.647  2.750   1.00 0.00 ? 5   GLU A OE1  3  
ATOM   4103  O  OE2  . GLU A 1 5   ? 11.861  -10.171 3.764   1.00 0.00 ? 5   GLU A OE2  3  
ATOM   4104  H  H    . GLU A 1 5   ? 10.316  -7.965  1.998   1.00 0.00 ? 5   GLU A H    3  
ATOM   4105  H  HA   . GLU A 1 5   ? 9.780   -5.435  3.144   1.00 0.00 ? 5   GLU A HA   3  
ATOM   4106  H  HB2  . GLU A 1 5   ? 9.509   -6.621  5.195   1.00 0.00 ? 5   GLU A HB2  3  
ATOM   4107  H  HB3  . GLU A 1 5   ? 8.769   -7.547  3.904   1.00 0.00 ? 5   GLU A HB3  3  
ATOM   4108  H  HG2  . GLU A 1 5   ? 11.462  -8.119  5.225   1.00 0.00 ? 5   GLU A HG2  3  
ATOM   4109  H  HG3  . GLU A 1 5   ? 9.947   -8.945  5.568   1.00 0.00 ? 5   GLU A HG3  3  
ATOM   4110  N  N    . ARG A 1 6   ? 11.712  -4.865  4.784   1.00 0.00 ? 6   ARG A N    3  
ATOM   4111  C  CA   . ARG A 1 6   ? 12.886  -4.256  5.408   1.00 0.00 ? 6   ARG A CA   3  
ATOM   4112  C  C    . ARG A 1 6   ? 13.722  -5.303  6.137   1.00 0.00 ? 6   ARG A C    3  
ATOM   4113  O  O    . ARG A 1 6   ? 14.948  -5.304  6.020   1.00 0.00 ? 6   ARG A O    3  
ATOM   4114  C  CB   . ARG A 1 6   ? 12.437  -3.165  6.398   1.00 0.00 ? 6   ARG A CB   3  
ATOM   4115  C  CG   . ARG A 1 6   ? 11.795  -1.971  5.679   1.00 0.00 ? 6   ARG A CG   3  
ATOM   4116  C  CD   . ARG A 1 6   ? 11.200  -0.954  6.658   1.00 0.00 ? 6   ARG A CD   3  
ATOM   4117  N  NE   . ARG A 1 6   ? 10.728  0.224   5.906   1.00 0.00 ? 6   ARG A NE   3  
ATOM   4118  C  CZ   . ARG A 1 6   ? 9.780   1.096   6.268   1.00 0.00 ? 6   ARG A CZ   3  
ATOM   4119  N  NH1  . ARG A 1 6   ? 9.162   1.003   7.439   1.00 0.00 ? 6   ARG A NH1  3  
ATOM   4120  N  NH2  . ARG A 1 6   ? 9.455   2.081   5.440   1.00 0.00 ? 6   ARG A NH2  3  
ATOM   4121  H  H    . ARG A 1 6   ? 10.802  -4.553  5.095   1.00 0.00 ? 6   ARG A H    3  
ATOM   4122  H  HA   . ARG A 1 6   ? 13.508  -3.805  4.632   1.00 0.00 ? 6   ARG A HA   3  
ATOM   4123  H  HB2  . ARG A 1 6   ? 11.727  -3.588  7.112   1.00 0.00 ? 6   ARG A HB2  3  
ATOM   4124  H  HB3  . ARG A 1 6   ? 13.306  -2.809  6.954   1.00 0.00 ? 6   ARG A HB3  3  
ATOM   4125  H  HG2  . ARG A 1 6   ? 12.559  -1.484  5.070   1.00 0.00 ? 6   ARG A HG2  3  
ATOM   4126  H  HG3  . ARG A 1 6   ? 10.996  -2.316  5.022   1.00 0.00 ? 6   ARG A HG3  3  
ATOM   4127  H  HD2  . ARG A 1 6   ? 10.378  -1.423  7.206   1.00 0.00 ? 6   ARG A HD2  3  
ATOM   4128  H  HD3  . ARG A 1 6   ? 11.962  -0.647  7.377   1.00 0.00 ? 6   ARG A HD3  3  
ATOM   4129  H  HE   . ARG A 1 6   ? 11.181  0.365   5.012   1.00 0.00 ? 6   ARG A HE   3  
ATOM   4130  H  HH11 . ARG A 1 6   ? 9.392   0.275   8.097   1.00 0.00 ? 6   ARG A HH11 3  
ATOM   4131  H  HH12 . ARG A 1 6   ? 8.453   1.698   7.705   1.00 0.00 ? 6   ARG A HH12 3  
ATOM   4132  H  HH21 . ARG A 1 6   ? 9.906   2.192   4.543   1.00 0.00 ? 6   ARG A HH21 3  
ATOM   4133  H  HH22 . ARG A 1 6   ? 8.725   2.762   5.682   1.00 0.00 ? 6   ARG A HH22 3  
ATOM   4134  N  N    . ASP A 1 7   ? 13.060  -6.166  6.906   1.00 0.00 ? 7   ASP A N    3  
ATOM   4135  C  CA   . ASP A 1 7   ? 13.655  -7.114  7.840   1.00 0.00 ? 7   ASP A CA   3  
ATOM   4136  C  C    . ASP A 1 7   ? 12.538  -8.060  8.291   1.00 0.00 ? 7   ASP A C    3  
ATOM   4137  O  O    . ASP A 1 7   ? 11.357  -7.728  8.129   1.00 0.00 ? 7   ASP A O    3  
ATOM   4138  C  CB   . ASP A 1 7   ? 14.221  -6.333  9.041   1.00 0.00 ? 7   ASP A CB   3  
ATOM   4139  C  CG   . ASP A 1 7   ? 14.764  -7.255  10.137  1.00 0.00 ? 7   ASP A CG   3  
ATOM   4140  O  OD1  . ASP A 1 7   ? 15.857  -7.836  9.957   1.00 0.00 ? 7   ASP A OD1  3  
ATOM   4141  O  OD2  . ASP A 1 7   ? 14.074  -7.400  11.169  1.00 0.00 ? 7   ASP A OD2  3  
ATOM   4142  H  H    . ASP A 1 7   ? 12.048  -6.148  6.916   1.00 0.00 ? 7   ASP A H    3  
ATOM   4143  H  HA   . ASP A 1 7   ? 14.453  -7.678  7.355   1.00 0.00 ? 7   ASP A HA   3  
ATOM   4144  H  HB2  . ASP A 1 7   ? 15.024  -5.676  8.704   1.00 0.00 ? 7   ASP A HB2  3  
ATOM   4145  H  HB3  . ASP A 1 7   ? 13.434  -5.701  9.457   1.00 0.00 ? 7   ASP A HB3  3  
ATOM   4146  N  N    . GLU A 1 8   ? 12.876  -9.201  8.901   1.00 0.00 ? 8   GLU A N    3  
ATOM   4147  C  CA   . GLU A 1 8   ? 11.907  -10.123 9.503   1.00 0.00 ? 8   GLU A CA   3  
ATOM   4148  C  C    . GLU A 1 8   ? 10.965  -9.432  10.503  1.00 0.00 ? 8   GLU A C    3  
ATOM   4149  O  O    . GLU A 1 8   ? 9.873   -9.937  10.747  1.00 0.00 ? 8   GLU A O    3  
ATOM   4150  C  CB   . GLU A 1 8   ? 12.616  -11.343 10.118  1.00 0.00 ? 8   GLU A CB   3  
ATOM   4151  C  CG   . GLU A 1 8   ? 13.515  -11.012 11.319  1.00 0.00 ? 8   GLU A CG   3  
ATOM   4152  C  CD   . GLU A 1 8   ? 14.161  -12.281 11.904  1.00 0.00 ? 8   GLU A CD   3  
ATOM   4153  O  OE1  . GLU A 1 8   ? 15.254  -12.684 11.444  1.00 0.00 ? 8   GLU A OE1  3  
ATOM   4154  O  OE2  . GLU A 1 8   ? 13.593  -12.883 12.843  1.00 0.00 ? 8   GLU A OE2  3  
ATOM   4155  H  H    . GLU A 1 8   ? 13.855  -9.428  9.016   1.00 0.00 ? 8   GLU A H    3  
ATOM   4156  H  HA   . GLU A 1 8   ? 11.280  -10.495 8.691   1.00 0.00 ? 8   GLU A HA   3  
ATOM   4157  H  HB2  . GLU A 1 8   ? 11.856  -12.057 10.438  1.00 0.00 ? 8   GLU A HB2  3  
ATOM   4158  H  HB3  . GLU A 1 8   ? 13.220  -11.821 9.346   1.00 0.00 ? 8   GLU A HB3  3  
ATOM   4159  H  HG2  . GLU A 1 8   ? 14.297  -10.320 11.003  1.00 0.00 ? 8   GLU A HG2  3  
ATOM   4160  H  HG3  . GLU A 1 8   ? 12.922  -10.519 12.092  1.00 0.00 ? 8   GLU A HG3  3  
ATOM   4161  N  N    . THR A 1 9   ? 11.347  -8.264  11.033  1.00 0.00 ? 9   THR A N    3  
ATOM   4162  C  CA   . THR A 1 9   ? 10.505  -7.361  11.813  1.00 0.00 ? 9   THR A CA   3  
ATOM   4163  C  C    . THR A 1 9   ? 9.116   -7.212  11.176  1.00 0.00 ? 9   THR A C    3  
ATOM   4164  O  O    . THR A 1 9   ? 8.107   -7.252  11.883  1.00 0.00 ? 9   THR A O    3  
ATOM   4165  C  CB   . THR A 1 9   ? 11.249  -6.010  11.888  1.00 0.00 ? 9   THR A CB   3  
ATOM   4166  O  OG1  . THR A 1 9   ? 12.399  -6.140  12.697  1.00 0.00 ? 9   THR A OG1  3  
ATOM   4167  C  CG2  . THR A 1 9   ? 10.422  -4.818  12.388  1.00 0.00 ? 9   THR A CG2  3  
ATOM   4168  H  H    . THR A 1 9   ? 12.310  -7.964  10.879  1.00 0.00 ? 9   THR A H    3  
ATOM   4169  H  HA   . THR A 1 9   ? 10.383  -7.757  12.818  1.00 0.00 ? 9   THR A HA   3  
ATOM   4170  H  HB   . THR A 1 9   ? 11.581  -5.761  10.882  1.00 0.00 ? 9   THR A HB   3  
ATOM   4171  H  HG1  . THR A 1 9   ? 13.058  -6.648  12.167  1.00 0.00 ? 9   THR A HG1  3  
ATOM   4172  H  HG21 . THR A 1 9   ? 9.951   -5.053  13.343  1.00 0.00 ? 9   THR A HG21 3  
ATOM   4173  H  HG22 . THR A 1 9   ? 11.065  -3.943  12.496  1.00 0.00 ? 9   THR A HG22 3  
ATOM   4174  H  HG23 . THR A 1 9   ? 9.658   -4.564  11.650  1.00 0.00 ? 9   THR A HG23 3  
ATOM   4175  N  N    . ARG A 1 10  ? 9.043   -7.066  9.847   1.00 0.00 ? 10  ARG A N    3  
ATOM   4176  C  CA   . ARG A 1 10  ? 7.767   -6.886  9.162   1.00 0.00 ? 10  ARG A CA   3  
ATOM   4177  C  C    . ARG A 1 10  ? 6.926   -8.147  9.286   1.00 0.00 ? 10  ARG A C    3  
ATOM   4178  O  O    . ARG A 1 10  ? 5.754   -8.042  9.642   1.00 0.00 ? 10  ARG A O    3  
ATOM   4179  C  CB   . ARG A 1 10  ? 8.030   -6.505  7.693   1.00 0.00 ? 10  ARG A CB   3  
ATOM   4180  C  CG   . ARG A 1 10  ? 6.787   -6.379  6.791   1.00 0.00 ? 10  ARG A CG   3  
ATOM   4181  C  CD   . ARG A 1 10  ? 5.820   -5.238  7.143   1.00 0.00 ? 10  ARG A CD   3  
ATOM   4182  N  NE   . ARG A 1 10  ? 5.059   -5.459  8.386   1.00 0.00 ? 10  ARG A NE   3  
ATOM   4183  C  CZ   . ARG A 1 10  ? 4.254   -4.554  8.961   1.00 0.00 ? 10  ARG A CZ   3  
ATOM   4184  N  NH1  . ARG A 1 10  ? 4.017   -3.384  8.385   1.00 0.00 ? 10  ARG A NH1  3  
ATOM   4185  N  NH2  . ARG A 1 10  ? 3.684   -4.824  10.131  1.00 0.00 ? 10  ARG A NH2  3  
ATOM   4186  H  H    . ARG A 1 10  ? 9.887   -7.127  9.290   1.00 0.00 ? 10  ARG A H    3  
ATOM   4187  H  HA   . ARG A 1 10  ? 7.233   -6.077  9.663   1.00 0.00 ? 10  ARG A HA   3  
ATOM   4188  H  HB2  . ARG A 1 10  ? 8.575   -5.560  7.666   1.00 0.00 ? 10  ARG A HB2  3  
ATOM   4189  H  HB3  . ARG A 1 10  ? 8.674   -7.270  7.256   1.00 0.00 ? 10  ARG A HB3  3  
ATOM   4190  H  HG2  . ARG A 1 10  ? 7.139   -6.196  5.775   1.00 0.00 ? 10  ARG A HG2  3  
ATOM   4191  H  HG3  . ARG A 1 10  ? 6.249   -7.325  6.769   1.00 0.00 ? 10  ARG A HG3  3  
ATOM   4192  H  HD2  . ARG A 1 10  ? 6.387   -4.309  7.222   1.00 0.00 ? 10  ARG A HD2  3  
ATOM   4193  H  HD3  . ARG A 1 10  ? 5.107   -5.139  6.323   1.00 0.00 ? 10  ARG A HD3  3  
ATOM   4194  H  HE   . ARG A 1 10  ? 5.161   -6.373  8.817   1.00 0.00 ? 10  ARG A HE   3  
ATOM   4195  H  HH11 . ARG A 1 10  ? 4.383   -3.197  7.442   1.00 0.00 ? 10  ARG A HH11 3  
ATOM   4196  H  HH12 . ARG A 1 10  ? 3.386   -2.701  8.792   1.00 0.00 ? 10  ARG A HH12 3  
ATOM   4197  H  HH21 . ARG A 1 10  ? 3.821   -5.711  10.587  1.00 0.00 ? 10  ARG A HH21 3  
ATOM   4198  H  HH22 . ARG A 1 10  ? 3.083   -4.146  10.583  1.00 0.00 ? 10  ARG A HH22 3  
ATOM   4199  N  N    . GLU A 1 11  ? 7.503   -9.310  8.993   1.00 0.00 ? 11  GLU A N    3  
ATOM   4200  C  CA   . GLU A 1 11  ? 6.790   -10.585 9.016   1.00 0.00 ? 11  GLU A CA   3  
ATOM   4201  C  C    . GLU A 1 11  ? 6.346   -10.915 10.443  1.00 0.00 ? 11  GLU A C    3  
ATOM   4202  O  O    . GLU A 1 11  ? 5.219   -11.366 10.654  1.00 0.00 ? 11  GLU A O    3  
ATOM   4203  C  CB   . GLU A 1 11  ? 7.678   -11.708 8.454   1.00 0.00 ? 11  GLU A CB   3  
ATOM   4204  C  CG   . GLU A 1 11  ? 8.146   -11.428 7.018   1.00 0.00 ? 11  GLU A CG   3  
ATOM   4205  C  CD   . GLU A 1 11  ? 8.832   -12.652 6.387   1.00 0.00 ? 11  GLU A CD   3  
ATOM   4206  O  OE1  . GLU A 1 11  ? 9.899   -13.087 6.875   1.00 0.00 ? 11  GLU A OE1  3  
ATOM   4207  O  OE2  . GLU A 1 11  ? 8.314   -13.167 5.369   1.00 0.00 ? 11  GLU A OE2  3  
ATOM   4208  H  H    . GLU A 1 11  ? 8.471   -9.316  8.716   1.00 0.00 ? 11  GLU A H    3  
ATOM   4209  H  HA   . GLU A 1 11  ? 5.900   -10.504 8.393   1.00 0.00 ? 11  GLU A HA   3  
ATOM   4210  H  HB2  . GLU A 1 11  ? 8.550   -11.838 9.095   1.00 0.00 ? 11  GLU A HB2  3  
ATOM   4211  H  HB3  . GLU A 1 11  ? 7.103   -12.635 8.459   1.00 0.00 ? 11  GLU A HB3  3  
ATOM   4212  H  HG2  . GLU A 1 11  ? 7.281   -11.145 6.414   1.00 0.00 ? 11  GLU A HG2  3  
ATOM   4213  H  HG3  . GLU A 1 11  ? 8.843   -10.588 7.021   1.00 0.00 ? 11  GLU A HG3  3  
ATOM   4214  N  N    . HIS A 1 12  ? 7.208   -10.635 11.424  1.00 0.00 ? 12  HIS A N    3  
ATOM   4215  C  CA   . HIS A 1 12  ? 6.907   -10.803 12.835  1.00 0.00 ? 12  HIS A CA   3  
ATOM   4216  C  C    . HIS A 1 12  ? 5.690   -9.955  13.202  1.00 0.00 ? 12  HIS A C    3  
ATOM   4217  O  O    . HIS A 1 12  ? 4.709   -10.493 13.704  1.00 0.00 ? 12  HIS A O    3  
ATOM   4218  C  CB   . HIS A 1 12  ? 8.144   -10.431 13.667  1.00 0.00 ? 12  HIS A CB   3  
ATOM   4219  C  CG   . HIS A 1 12  ? 7.933   -10.560 15.155  1.00 0.00 ? 12  HIS A CG   3  
ATOM   4220  N  ND1  . HIS A 1 12  ? 7.996   -11.721 15.895  1.00 0.00 ? 12  HIS A ND1  3  
ATOM   4221  C  CD2  . HIS A 1 12  ? 7.660   -9.540  16.029  1.00 0.00 ? 12  HIS A CD2  3  
ATOM   4222  C  CE1  . HIS A 1 12  ? 7.773   -11.407 17.182  1.00 0.00 ? 12  HIS A CE1  3  
ATOM   4223  N  NE2  . HIS A 1 12  ? 7.564   -10.083 17.318  1.00 0.00 ? 12  HIS A NE2  3  
ATOM   4224  H  H    . HIS A 1 12  ? 8.127   -10.281 11.179  1.00 0.00 ? 12  HIS A H    3  
ATOM   4225  H  HA   . HIS A 1 12  ? 6.667   -11.851 13.017  1.00 0.00 ? 12  HIS A HA   3  
ATOM   4226  H  HB2  . HIS A 1 12  ? 8.972   -11.079 13.377  1.00 0.00 ? 12  HIS A HB2  3  
ATOM   4227  H  HB3  . HIS A 1 12  ? 8.435   -9.404  13.447  1.00 0.00 ? 12  HIS A HB3  3  
ATOM   4228  H  HD1  . HIS A 1 12  ? 8.193   -12.653 15.544  1.00 0.00 ? 12  HIS A HD1  3  
ATOM   4229  H  HD2  . HIS A 1 12  ? 7.550   -8.495  15.767  1.00 0.00 ? 12  HIS A HD2  3  
ATOM   4230  H  HE1  . HIS A 1 12  ? 7.769   -12.123 17.996  1.00 0.00 ? 12  HIS A HE1  3  
ATOM   4231  N  N    . ARG A 1 13  ? 5.716   -8.649  12.904  1.00 0.00 ? 13  ARG A N    3  
ATOM   4232  C  CA   . ARG A 1 13  ? 4.623   -7.741  13.259  1.00 0.00 ? 13  ARG A CA   3  
ATOM   4233  C  C    . ARG A 1 13  ? 3.328   -8.094  12.527  1.00 0.00 ? 13  ARG A C    3  
ATOM   4234  O  O    . ARG A 1 13  ? 2.250   -7.928  13.096  1.00 0.00 ? 13  ARG A O    3  
ATOM   4235  C  CB   . ARG A 1 13  ? 5.039   -6.289  13.006  1.00 0.00 ? 13  ARG A CB   3  
ATOM   4236  C  CG   . ARG A 1 13  ? 6.046   -5.821  14.068  1.00 0.00 ? 13  ARG A CG   3  
ATOM   4237  C  CD   . ARG A 1 13  ? 6.619   -4.448  13.719  1.00 0.00 ? 13  ARG A CD   3  
ATOM   4238  N  NE   . ARG A 1 13  ? 5.601   -3.380  13.780  1.00 0.00 ? 13  ARG A NE   3  
ATOM   4239  C  CZ   . ARG A 1 13  ? 5.668   -2.192  13.163  1.00 0.00 ? 13  ARG A CZ   3  
ATOM   4240  N  NH1  . ARG A 1 13  ? 6.712   -1.880  12.397  1.00 0.00 ? 13  ARG A NH1  3  
ATOM   4241  N  NH2  . ARG A 1 13  ? 4.682   -1.315  13.318  1.00 0.00 ? 13  ARG A NH2  3  
ATOM   4242  H  H    . ARG A 1 13  ? 6.543   -8.256  12.460  1.00 0.00 ? 13  ARG A H    3  
ATOM   4243  H  HA   . ARG A 1 13  ? 4.431   -7.842  14.328  1.00 0.00 ? 13  ARG A HA   3  
ATOM   4244  H  HB2  . ARG A 1 13  ? 5.477   -6.202  12.010  1.00 0.00 ? 13  ARG A HB2  3  
ATOM   4245  H  HB3  . ARG A 1 13  ? 4.154   -5.652  13.062  1.00 0.00 ? 13  ARG A HB3  3  
ATOM   4246  H  HG2  . ARG A 1 13  ? 5.564   -5.782  15.046  1.00 0.00 ? 13  ARG A HG2  3  
ATOM   4247  H  HG3  . ARG A 1 13  ? 6.876   -6.526  14.127  1.00 0.00 ? 13  ARG A HG3  3  
ATOM   4248  H  HD2  . ARG A 1 13  ? 7.413   -4.222  14.430  1.00 0.00 ? 13  ARG A HD2  3  
ATOM   4249  H  HD3  . ARG A 1 13  ? 7.044   -4.512  12.719  1.00 0.00 ? 13  ARG A HD3  3  
ATOM   4250  H  HE   . ARG A 1 13  ? 4.809   -3.566  14.382  1.00 0.00 ? 13  ARG A HE   3  
ATOM   4251  H  HH11 . ARG A 1 13  ? 7.481   -2.523  12.290  1.00 0.00 ? 13  ARG A HH11 3  
ATOM   4252  H  HH12 . ARG A 1 13  ? 6.784   -0.989  11.925  1.00 0.00 ? 13  ARG A HH12 3  
ATOM   4253  H  HH21 . ARG A 1 13  ? 3.887   -1.517  13.909  1.00 0.00 ? 13  ARG A HH21 3  
ATOM   4254  H  HH22 . ARG A 1 13  ? 4.703   -0.403  12.882  1.00 0.00 ? 13  ARG A HH22 3  
ATOM   4255  N  N    . ILE A 1 14  ? 3.411   -8.566  11.276  1.00 0.00 ? 14  ILE A N    3  
ATOM   4256  C  CA   . ILE A 1 14  ? 2.247   -9.084  10.555  1.00 0.00 ? 14  ILE A CA   3  
ATOM   4257  C  C    . ILE A 1 14  ? 1.617   -10.191 11.408  1.00 0.00 ? 14  ILE A C    3  
ATOM   4258  O  O    . ILE A 1 14  ? 0.441   -10.101 11.764  1.00 0.00 ? 14  ILE A O    3  
ATOM   4259  C  CB   . ILE A 1 14  ? 2.656   -9.532  9.123   1.00 0.00 ? 14  ILE A CB   3  
ATOM   4260  C  CG1  . ILE A 1 14  ? 2.877   -8.302  8.219   1.00 0.00 ? 14  ILE A CG1  3  
ATOM   4261  C  CG2  . ILE A 1 14  ? 1.623   -10.453 8.453   1.00 0.00 ? 14  ILE A CG2  3  
ATOM   4262  C  CD1  . ILE A 1 14  ? 3.681   -8.597  6.945   1.00 0.00 ? 14  ILE A CD1  3  
ATOM   4263  H  H    . ILE A 1 14  ? 4.316   -8.633  10.827  1.00 0.00 ? 14  ILE A H    3  
ATOM   4264  H  HA   . ILE A 1 14  ? 1.511   -8.288  10.470  1.00 0.00 ? 14  ILE A HA   3  
ATOM   4265  H  HB   . ILE A 1 14  ? 3.591   -10.084 9.190   1.00 0.00 ? 14  ILE A HB   3  
ATOM   4266  H  HG12 . ILE A 1 14  ? 1.912   -7.892  7.930   1.00 0.00 ? 14  ILE A HG12 3  
ATOM   4267  H  HG13 . ILE A 1 14  ? 3.402   -7.533  8.777   1.00 0.00 ? 14  ILE A HG13 3  
ATOM   4268  H  HG21 . ILE A 1 14  ? 0.658   -9.950  8.380   1.00 0.00 ? 14  ILE A HG21 3  
ATOM   4269  H  HG22 . ILE A 1 14  ? 1.949   -10.739 7.454   1.00 0.00 ? 14  ILE A HG22 3  
ATOM   4270  H  HG23 . ILE A 1 14  ? 1.522   -11.371 9.027   1.00 0.00 ? 14  ILE A HG23 3  
ATOM   4271  H  HD11 . ILE A 1 14  ? 4.639   -9.043  7.203   1.00 0.00 ? 14  ILE A HD11 3  
ATOM   4272  H  HD12 . ILE A 1 14  ? 3.135   -9.273  6.291   1.00 0.00 ? 14  ILE A HD12 3  
ATOM   4273  H  HD13 . ILE A 1 14  ? 3.856   -7.666  6.407   1.00 0.00 ? 14  ILE A HD13 3  
ATOM   4274  N  N    . GLU A 1 15  ? 2.403   -11.204 11.773  1.00 0.00 ? 15  GLU A N    3  
ATOM   4275  C  CA   . GLU A 1 15  ? 1.909   -12.369 12.489  1.00 0.00 ? 15  GLU A CA   3  
ATOM   4276  C  C    . GLU A 1 15  ? 1.379   -12.010 13.882  1.00 0.00 ? 15  GLU A C    3  
ATOM   4277  O  O    . GLU A 1 15  ? 0.315   -12.496 14.257  1.00 0.00 ? 15  GLU A O    3  
ATOM   4278  C  CB   . GLU A 1 15  ? 3.035   -13.416 12.553  1.00 0.00 ? 15  GLU A CB   3  
ATOM   4279  C  CG   . GLU A 1 15  ? 2.643   -14.671 13.343  1.00 0.00 ? 15  GLU A CG   3  
ATOM   4280  C  CD   . GLU A 1 15  ? 3.719   -15.766 13.232  1.00 0.00 ? 15  GLU A CD   3  
ATOM   4281  O  OE1  . GLU A 1 15  ? 3.645   -16.608 12.308  1.00 0.00 ? 15  GLU A OE1  3  
ATOM   4282  O  OE2  . GLU A 1 15  ? 4.639   -15.813 14.079  1.00 0.00 ? 15  GLU A OE2  3  
ATOM   4283  H  H    . GLU A 1 15  ? 3.366   -11.212 11.463  1.00 0.00 ? 15  GLU A H    3  
ATOM   4284  H  HA   . GLU A 1 15  ? 1.073   -12.786 11.920  1.00 0.00 ? 15  GLU A HA   3  
ATOM   4285  H  HB2  . GLU A 1 15  ? 3.293   -13.705 11.533  1.00 0.00 ? 15  GLU A HB2  3  
ATOM   4286  H  HB3  . GLU A 1 15  ? 3.918   -12.976 13.017  1.00 0.00 ? 15  GLU A HB3  3  
ATOM   4287  H  HG2  . GLU A 1 15  ? 2.508   -14.402 14.394  1.00 0.00 ? 15  GLU A HG2  3  
ATOM   4288  H  HG3  . GLU A 1 15  ? 1.691   -15.050 12.964  1.00 0.00 ? 15  GLU A HG3  3  
ATOM   4289  N  N    . THR A 1 16  ? 2.075   -11.177 14.658  1.00 0.00 ? 16  THR A N    3  
ATOM   4290  C  CA   . THR A 1 16  ? 1.735   -10.971 16.064  1.00 0.00 ? 16  THR A CA   3  
ATOM   4291  C  C    . THR A 1 16  ? 0.600   -9.959  16.272  1.00 0.00 ? 16  THR A C    3  
ATOM   4292  O  O    . THR A 1 16  ? 0.094   -9.852  17.392  1.00 0.00 ? 16  THR A O    3  
ATOM   4293  C  CB   . THR A 1 16  ? 2.998   -10.589 16.860  1.00 0.00 ? 16  THR A CB   3  
ATOM   4294  O  OG1  . THR A 1 16  ? 3.631   -9.450  16.305  1.00 0.00 ? 16  THR A OG1  3  
ATOM   4295  C  CG2  . THR A 1 16  ? 3.994   -11.757 16.896  1.00 0.00 ? 16  THR A CG2  3  
ATOM   4296  H  H    . THR A 1 16  ? 2.961   -10.794 14.334  1.00 0.00 ? 16  THR A H    3  
ATOM   4297  H  HA   . THR A 1 16  ? 1.377   -11.921 16.463  1.00 0.00 ? 16  THR A HA   3  
ATOM   4298  H  HB   . THR A 1 16  ? 2.706   -10.363 17.886  1.00 0.00 ? 16  THR A HB   3  
ATOM   4299  H  HG1  . THR A 1 16  ? 4.288   -9.135  16.943  1.00 0.00 ? 16  THR A HG1  3  
ATOM   4300  H  HG21 . THR A 1 16  ? 4.356   -11.991 15.895  1.00 0.00 ? 16  THR A HG21 3  
ATOM   4301  H  HG22 . THR A 1 16  ? 4.839   -11.497 17.532  1.00 0.00 ? 16  THR A HG22 3  
ATOM   4302  H  HG23 . THR A 1 16  ? 3.509   -12.641 17.310  1.00 0.00 ? 16  THR A HG23 3  
ATOM   4303  N  N    . GLU A 1 17  ? 0.174   -9.228  15.232  1.00 0.00 ? 17  GLU A N    3  
ATOM   4304  C  CA   . GLU A 1 17  ? -0.780  -8.134  15.392  1.00 0.00 ? 17  GLU A CA   3  
ATOM   4305  C  C    . GLU A 1 17  ? -1.790  -8.086  14.246  1.00 0.00 ? 17  GLU A C    3  
ATOM   4306  O  O    . GLU A 1 17  ? -2.994  -8.093  14.506  1.00 0.00 ? 17  GLU A O    3  
ATOM   4307  C  CB   . GLU A 1 17  ? -0.001  -6.809  15.519  1.00 0.00 ? 17  GLU A CB   3  
ATOM   4308  C  CG   . GLU A 1 17  ? -0.873  -5.607  15.908  1.00 0.00 ? 17  GLU A CG   3  
ATOM   4309  C  CD   . GLU A 1 17  ? -1.426  -5.717  17.342  1.00 0.00 ? 17  GLU A CD   3  
ATOM   4310  O  OE1  . GLU A 1 17  ? -0.699  -5.387  18.307  1.00 0.00 ? 17  GLU A OE1  3  
ATOM   4311  O  OE2  . GLU A 1 17  ? -2.601  -6.108  17.520  1.00 0.00 ? 17  GLU A OE2  3  
ATOM   4312  H  H    . GLU A 1 17  ? 0.618   -9.361  14.342  1.00 0.00 ? 17  GLU A H    3  
ATOM   4313  H  HA   . GLU A 1 17  ? -1.343  -8.286  16.314  1.00 0.00 ? 17  GLU A HA   3  
ATOM   4314  H  HB2  . GLU A 1 17  ? 0.784   -6.924  16.268  1.00 0.00 ? 17  GLU A HB2  3  
ATOM   4315  H  HB3  . GLU A 1 17  ? 0.481   -6.586  14.566  1.00 0.00 ? 17  GLU A HB3  3  
ATOM   4316  H  HG2  . GLU A 1 17  ? -0.264  -4.704  15.830  1.00 0.00 ? 17  GLU A HG2  3  
ATOM   4317  H  HG3  . GLU A 1 17  ? -1.692  -5.502  15.193  1.00 0.00 ? 17  GLU A HG3  3  
ATOM   4318  N  N    . ILE A 1 18  ? -1.333  -8.052  12.991  1.00 0.00 ? 18  ILE A N    3  
ATOM   4319  C  CA   . ILE A 1 18  ? -2.221  -7.788  11.857  1.00 0.00 ? 18  ILE A CA   3  
ATOM   4320  C  C    . ILE A 1 18  ? -3.127  -9.002  11.614  1.00 0.00 ? 18  ILE A C    3  
ATOM   4321  O  O    . ILE A 1 18  ? -4.329  -8.826  11.415  1.00 0.00 ? 18  ILE A O    3  
ATOM   4322  C  CB   . ILE A 1 18  ? -1.418  -7.375  10.596  1.00 0.00 ? 18  ILE A CB   3  
ATOM   4323  C  CG1  . ILE A 1 18  ? -0.473  -6.192  10.925  1.00 0.00 ? 18  ILE A CG1  3  
ATOM   4324  C  CG2  . ILE A 1 18  ? -2.363  -6.975  9.446   1.00 0.00 ? 18  ILE A CG2  3  
ATOM   4325  C  CD1  . ILE A 1 18  ? 0.340   -5.670  9.737   1.00 0.00 ? 18  ILE A CD1  3  
ATOM   4326  H  H    . ILE A 1 18  ? -0.339  -8.133  12.813  1.00 0.00 ? 18  ILE A H    3  
ATOM   4327  H  HA   . ILE A 1 18  ? -2.862  -6.947  12.127  1.00 0.00 ? 18  ILE A HA   3  
ATOM   4328  H  HB   . ILE A 1 18  ? -0.822  -8.226  10.265  1.00 0.00 ? 18  ILE A HB   3  
ATOM   4329  H  HG12 . ILE A 1 18  ? -1.061  -5.368  11.329  1.00 0.00 ? 18  ILE A HG12 3  
ATOM   4330  H  HG13 . ILE A 1 18  ? 0.242   -6.496  11.689  1.00 0.00 ? 18  ILE A HG13 3  
ATOM   4331  H  HG21 . ILE A 1 18  ? -1.804  -6.863  8.518   1.00 0.00 ? 18  ILE A HG21 3  
ATOM   4332  H  HG22 . ILE A 1 18  ? -3.119  -7.737  9.273   1.00 0.00 ? 18  ILE A HG22 3  
ATOM   4333  H  HG23 . ILE A 1 18  ? -2.864  -6.037  9.684   1.00 0.00 ? 18  ILE A HG23 3  
ATOM   4334  H  HD11 . ILE A 1 18  ? 0.936   -6.470  9.311   1.00 0.00 ? 18  ILE A HD11 3  
ATOM   4335  H  HD12 . ILE A 1 18  ? -0.311  -5.259  8.968   1.00 0.00 ? 18  ILE A HD12 3  
ATOM   4336  H  HD13 . ILE A 1 18  ? 1.001   -4.880  10.086  1.00 0.00 ? 18  ILE A HD13 3  
ATOM   4337  N  N    . ILE A 1 19  ? -2.583  -10.225 11.662  1.00 0.00 ? 19  ILE A N    3  
ATOM   4338  C  CA   . ILE A 1 19  ? -3.293  -11.432 11.237  1.00 0.00 ? 19  ILE A CA   3  
ATOM   4339  C  C    . ILE A 1 19  ? -3.214  -12.567 12.277  1.00 0.00 ? 19  ILE A C    3  
ATOM   4340  O  O    . ILE A 1 19  ? -3.363  -13.735 11.927  1.00 0.00 ? 19  ILE A O    3  
ATOM   4341  C  CB   . ILE A 1 19  ? -2.795  -11.842 9.838   1.00 0.00 ? 19  ILE A CB   3  
ATOM   4342  C  CG1  . ILE A 1 19  ? -1.284  -12.116 9.890   1.00 0.00 ? 19  ILE A CG1  3  
ATOM   4343  C  CG2  . ILE A 1 19  ? -3.148  -10.789 8.762   1.00 0.00 ? 19  ILE A CG2  3  
ATOM   4344  C  CD1  . ILE A 1 19  ? -0.864  -13.054 8.777   1.00 0.00 ? 19  ILE A CD1  3  
ATOM   4345  H  H    . ILE A 1 19  ? -1.573  -10.311 11.757  1.00 0.00 ? 19  ILE A H    3  
ATOM   4346  H  HA   . ILE A 1 19  ? -4.346  -11.209 11.118  1.00 0.00 ? 19  ILE A HA   3  
ATOM   4347  H  HB   . ILE A 1 19  ? -3.307  -12.764 9.563   1.00 0.00 ? 19  ILE A HB   3  
ATOM   4348  H  HG12 . ILE A 1 19  ? -0.740  -11.180 9.800   1.00 0.00 ? 19  ILE A HG12 3  
ATOM   4349  H  HG13 . ILE A 1 19  ? -1.012  -12.588 10.834  1.00 0.00 ? 19  ILE A HG13 3  
ATOM   4350  H  HG21 . ILE A 1 19  ? -4.199  -10.503 8.833   1.00 0.00 ? 19  ILE A HG21 3  
ATOM   4351  H  HG22 . ILE A 1 19  ? -2.539  -9.892  8.874   1.00 0.00 ? 19  ILE A HG22 3  
ATOM   4352  H  HG23 . ILE A 1 19  ? -2.972  -11.196 7.766   1.00 0.00 ? 19  ILE A HG23 3  
ATOM   4353  H  HD11 . ILE A 1 19  ? 0.187   -13.296 8.914   1.00 0.00 ? 19  ILE A HD11 3  
ATOM   4354  H  HD12 . ILE A 1 19  ? -1.464  -13.958 8.853   1.00 0.00 ? 19  ILE A HD12 3  
ATOM   4355  H  HD13 . ILE A 1 19  ? -1.028  -12.568 7.818   1.00 0.00 ? 19  ILE A HD13 3  
ATOM   4356  N  N    . VAL A 1 20  ? -2.969  -12.249 13.551  1.00 0.00 ? 20  VAL A N    3  
ATOM   4357  C  CA   . VAL A 1 20  ? -2.728  -13.226 14.620  1.00 0.00 ? 20  VAL A CA   3  
ATOM   4358  C  C    . VAL A 1 20  ? -3.779  -14.348 14.711  1.00 0.00 ? 20  VAL A C    3  
ATOM   4359  O  O    . VAL A 1 20  ? -3.419  -15.497 14.973  1.00 0.00 ? 20  VAL A O    3  
ATOM   4360  C  CB   . VAL A 1 20  ? -2.535  -12.468 15.952  1.00 0.00 ? 20  VAL A CB   3  
ATOM   4361  C  CG1  . VAL A 1 20  ? -3.834  -11.830 16.473  1.00 0.00 ? 20  VAL A CG1  3  
ATOM   4362  C  CG2  . VAL A 1 20  ? -1.934  -13.368 17.039  1.00 0.00 ? 20  VAL A CG2  3  
ATOM   4363  H  H    . VAL A 1 20  ? -2.782  -11.281 13.767  1.00 0.00 ? 20  VAL A H    3  
ATOM   4364  H  HA   . VAL A 1 20  ? -1.783  -13.713 14.380  1.00 0.00 ? 20  VAL A HA   3  
ATOM   4365  H  HB   . VAL A 1 20  ? -1.827  -11.659 15.772  1.00 0.00 ? 20  VAL A HB   3  
ATOM   4366  H  HG11 . VAL A 1 20  ? -3.622  -11.246 17.369  1.00 0.00 ? 20  VAL A HG11 3  
ATOM   4367  H  HG12 . VAL A 1 20  ? -4.259  -11.166 15.721  1.00 0.00 ? 20  VAL A HG12 3  
ATOM   4368  H  HG13 . VAL A 1 20  ? -4.563  -12.605 16.722  1.00 0.00 ? 20  VAL A HG13 3  
ATOM   4369  H  HG21 . VAL A 1 20  ? -2.628  -14.173 17.288  1.00 0.00 ? 20  VAL A HG21 3  
ATOM   4370  H  HG22 . VAL A 1 20  ? -0.999  -13.799 16.681  1.00 0.00 ? 20  VAL A HG22 3  
ATOM   4371  H  HG23 . VAL A 1 20  ? -1.729  -12.781 17.934  1.00 0.00 ? 20  VAL A HG23 3  
ATOM   4372  N  N    . ASP A 1 21  ? -5.058  -14.043 14.464  1.00 0.00 ? 21  ASP A N    3  
ATOM   4373  C  CA   . ASP A 1 21  ? -6.174  -14.999 14.561  1.00 0.00 ? 21  ASP A CA   3  
ATOM   4374  C  C    . ASP A 1 21  ? -6.765  -15.307 13.167  1.00 0.00 ? 21  ASP A C    3  
ATOM   4375  O  O    . ASP A 1 21  ? -7.801  -15.982 13.014  1.00 0.00 ? 21  ASP A O    3  
ATOM   4376  C  CB   . ASP A 1 21  ? -7.229  -14.419 15.515  1.00 0.00 ? 21  ASP A CB   3  
ATOM   4377  C  CG   . ASP A 1 21  ? -8.369  -15.407 15.820  1.00 0.00 ? 21  ASP A CG   3  
ATOM   4378  O  OD1  . ASP A 1 21  ? -8.095  -16.532 16.296  1.00 0.00 ? 21  ASP A OD1  3  
ATOM   4379  O  OD2  . ASP A 1 21  ? -9.555  -15.038 15.654  1.00 0.00 ? 21  ASP A OD2  3  
ATOM   4380  H  H    . ASP A 1 21  ? -5.292  -13.085 14.244  1.00 0.00 ? 21  ASP A H    3  
ATOM   4381  H  HA   . ASP A 1 21  ? -5.797  -15.918 15.007  1.00 0.00 ? 21  ASP A HA   3  
ATOM   4382  H  HB2  . ASP A 1 21  ? -6.743  -14.150 16.456  1.00 0.00 ? 21  ASP A HB2  3  
ATOM   4383  H  HB3  . ASP A 1 21  ? -7.636  -13.504 15.077  1.00 0.00 ? 21  ASP A HB3  3  
ATOM   4384  N  N    . ALA A 1 22  ? -6.089  -14.779 12.138  1.00 0.00 ? 22  ALA A N    3  
ATOM   4385  C  CA   . ALA A 1 22  ? -6.552  -14.737 10.773  1.00 0.00 ? 22  ALA A CA   3  
ATOM   4386  C  C    . ALA A 1 22  ? -5.760  -15.696 9.887   1.00 0.00 ? 22  ALA A C    3  
ATOM   4387  O  O    . ALA A 1 22  ? -4.537  -15.607 9.749   1.00 0.00 ? 22  ALA A O    3  
ATOM   4388  C  CB   . ALA A 1 22  ? -6.471  -13.307 10.248  1.00 0.00 ? 22  ALA A CB   3  
ATOM   4389  H  H    . ALA A 1 22  ? -5.168  -14.392 12.315  1.00 0.00 ? 22  ALA A H    3  
ATOM   4390  H  HA   . ALA A 1 22  ? -7.601  -15.007 10.764  1.00 0.00 ? 22  ALA A HA   3  
ATOM   4391  H  HB1  . ALA A 1 22  ? -5.439  -12.979 10.216  1.00 0.00 ? 22  ALA A HB1  3  
ATOM   4392  H  HB2  . ALA A 1 22  ? -6.872  -13.295 9.240   1.00 0.00 ? 22  ALA A HB2  3  
ATOM   4393  H  HB3  . ALA A 1 22  ? -7.056  -12.635 10.878  1.00 0.00 ? 22  ALA A HB3  3  
ATOM   4394  N  N    . GLU A 1 23  ? -6.505  -16.548 9.198   1.00 0.00 ? 23  GLU A N    3  
ATOM   4395  C  CA   . GLU A 1 23  ? -6.019  -17.455 8.155   1.00 0.00 ? 23  GLU A CA   3  
ATOM   4396  C  C    . GLU A 1 23  ? -7.049  -17.578 7.032   1.00 0.00 ? 23  GLU A C    3  
ATOM   4397  O  O    . GLU A 1 23  ? -6.681  -17.848 5.889   1.00 0.00 ? 23  GLU A O    3  
ATOM   4398  C  CB   . GLU A 1 23  ? -5.724  -18.882 8.658   1.00 0.00 ? 23  GLU A CB   3  
ATOM   4399  C  CG   . GLU A 1 23  ? -5.075  -19.068 10.039  1.00 0.00 ? 23  GLU A CG   3  
ATOM   4400  C  CD   . GLU A 1 23  ? -6.133  -19.084 11.152  1.00 0.00 ? 23  GLU A CD   3  
ATOM   4401  O  OE1  . GLU A 1 23  ? -7.042  -19.946 11.150  1.00 0.00 ? 23  GLU A OE1  3  
ATOM   4402  O  OE2  . GLU A 1 23  ? -6.152  -18.197 12.026  1.00 0.00 ? 23  GLU A OE2  3  
ATOM   4403  H  H    . GLU A 1 23  ? -7.503  -16.434 9.318   1.00 0.00 ? 23  GLU A H    3  
ATOM   4404  H  HA   . GLU A 1 23  ? -5.102  -17.055 7.735   1.00 0.00 ? 23  GLU A HA   3  
ATOM   4405  H  HB2  . GLU A 1 23  ? -6.658  -19.441 8.643   1.00 0.00 ? 23  GLU A HB2  3  
ATOM   4406  H  HB3  . GLU A 1 23  ? -5.068  -19.347 7.922   1.00 0.00 ? 23  GLU A HB3  3  
ATOM   4407  H  HG2  . GLU A 1 23  ? -4.559  -20.030 10.048  1.00 0.00 ? 23  GLU A HG2  3  
ATOM   4408  H  HG3  . GLU A 1 23  ? -4.328  -18.292 10.212  1.00 0.00 ? 23  GLU A HG3  3  
ATOM   4409  N  N    . ASP A 1 24  ? -8.338  -17.416 7.348   1.00 0.00 ? 24  ASP A N    3  
ATOM   4410  C  CA   . ASP A 1 24  ? -9.420  -17.490 6.400   1.00 0.00 ? 24  ASP A CA   3  
ATOM   4411  C  C    . ASP A 1 24  ? -9.352  -16.162 5.639   1.00 0.00 ? 24  ASP A C    3  
ATOM   4412  O  O    . ASP A 1 24  ? -9.018  -15.128 6.230   1.00 0.00 ? 24  ASP A O    3  
ATOM   4413  C  CB   . ASP A 1 24  ? -10.731 -17.709 7.181   1.00 0.00 ? 24  ASP A CB   3  
ATOM   4414  C  CG   . ASP A 1 24  ? -10.707 -18.962 8.099   1.00 0.00 ? 24  ASP A CG   3  
ATOM   4415  O  OD1  . ASP A 1 24  ? -11.094 -20.051 7.615   1.00 0.00 ? 24  ASP A OD1  3  
ATOM   4416  O  OD2  . ASP A 1 24  ? -10.325 -18.883 9.300   1.00 0.00 ? 24  ASP A OD2  3  
ATOM   4417  H  H    . ASP A 1 24  ? -8.630  -17.061 8.249   1.00 0.00 ? 24  ASP A H    3  
ATOM   4418  H  HA   . ASP A 1 24  ? -9.262  -18.330 5.722   1.00 0.00 ? 24  ASP A HA   3  
ATOM   4419  H  HB2  . ASP A 1 24  ? -10.936 -16.829 7.783   1.00 0.00 ? 24  ASP A HB2  3  
ATOM   4420  H  HB3  . ASP A 1 24  ? -11.543 -17.800 6.456   1.00 0.00 ? 24  ASP A HB3  3  
ATOM   4421  N  N    . LYS A 1 25  ? -9.637  -16.163 4.332   1.00 0.00 ? 25  LYS A N    3  
ATOM   4422  C  CA   . LYS A 1 25  ? -9.381  -14.995 3.469   1.00 0.00 ? 25  LYS A CA   3  
ATOM   4423  C  C    . LYS A 1 25  ? -10.022 -13.737 4.004   1.00 0.00 ? 25  LYS A C    3  
ATOM   4424  O  O    . LYS A 1 25  ? -9.426  -12.663 3.959   1.00 0.00 ? 25  LYS A O    3  
ATOM   4425  C  CB   . LYS A 1 25  ? -9.927  -15.204 2.044   1.00 0.00 ? 25  LYS A CB   3  
ATOM   4426  C  CG   . LYS A 1 25  ? -9.442  -16.475 1.356   1.00 0.00 ? 25  LYS A CG   3  
ATOM   4427  C  CD   . LYS A 1 25  ? -7.916  -16.478 1.175   1.00 0.00 ? 25  LYS A CD   3  
ATOM   4428  C  CE   . LYS A 1 25  ? -7.384  -17.825 0.686   1.00 0.00 ? 25  LYS A CE   3  
ATOM   4429  N  NZ   . LYS A 1 25  ? -5.904  -17.812 0.645   1.00 0.00 ? 25  LYS A NZ   3  
ATOM   4430  H  H    . LYS A 1 25  ? -9.942  -17.025 3.902   1.00 0.00 ? 25  LYS A H    3  
ATOM   4431  H  HA   . LYS A 1 25  ? -8.307  -14.815 3.436   1.00 0.00 ? 25  LYS A HA   3  
ATOM   4432  H  HB2  . LYS A 1 25  ? -11.017 -15.242 2.080   1.00 0.00 ? 25  LYS A HB2  3  
ATOM   4433  H  HB3  . LYS A 1 25  ? -9.648  -14.344 1.432   1.00 0.00 ? 25  LYS A HB3  3  
ATOM   4434  H  HG2  . LYS A 1 25  ? -9.765  -17.323 1.955   1.00 0.00 ? 25  LYS A HG2  3  
ATOM   4435  H  HG3  . LYS A 1 25  ? -9.934  -16.526 0.387   1.00 0.00 ? 25  LYS A HG3  3  
ATOM   4436  H  HD2  . LYS A 1 25  ? -7.640  -15.697 0.465   1.00 0.00 ? 25  LYS A HD2  3  
ATOM   4437  H  HD3  . LYS A 1 25  ? -7.439  -16.269 2.131   1.00 0.00 ? 25  LYS A HD3  3  
ATOM   4438  H  HE2  . LYS A 1 25  ? -7.717  -18.602 1.377   1.00 0.00 ? 25  LYS A HE2  3  
ATOM   4439  H  HE3  . LYS A 1 25  ? -7.786  -18.041 -0.306  1.00 0.00 ? 25  LYS A HE3  3  
ATOM   4440  H  HZ1  . LYS A 1 25  ? -5.524  -17.468 1.530   1.00 0.00 ? 25  LYS A HZ1  3  
ATOM   4441  H  HZ2  . LYS A 1 25  ? -5.523  -18.723 0.443   1.00 0.00 ? 25  LYS A HZ2  3  
ATOM   4442  H  HZ3  . LYS A 1 25  ? -5.559  -17.145 -0.039  1.00 0.00 ? 25  LYS A HZ3  3  
ATOM   4443  N  N    . GLU A 1 26  ? -11.247 -13.891 4.494   1.00 0.00 ? 26  GLU A N    3  
ATOM   4444  C  CA   . GLU A 1 26  ? -12.048 -12.766 4.902   1.00 0.00 ? 26  GLU A CA   3  
ATOM   4445  C  C    . GLU A 1 26  ? -11.427 -12.150 6.161   1.00 0.00 ? 26  GLU A C    3  
ATOM   4446  O  O    . GLU A 1 26  ? -11.403 -10.929 6.305   1.00 0.00 ? 26  GLU A O    3  
ATOM   4447  C  CB   . GLU A 1 26  ? -13.500 -13.215 5.127   1.00 0.00 ? 26  GLU A CB   3  
ATOM   4448  C  CG   . GLU A 1 26  ? -14.128 -13.782 3.841   1.00 0.00 ? 26  GLU A CG   3  
ATOM   4449  C  CD   . GLU A 1 26  ? -15.586 -14.219 4.072   1.00 0.00 ? 26  GLU A CD   3  
ATOM   4450  O  OE1  . GLU A 1 26  ? -15.824 -15.392 4.440   1.00 0.00 ? 26  GLU A OE1  3  
ATOM   4451  O  OE2  . GLU A 1 26  ? -16.513 -13.403 3.870   1.00 0.00 ? 26  GLU A OE2  3  
ATOM   4452  H  H    . GLU A 1 26  ? -11.615 -14.821 4.615   1.00 0.00 ? 26  GLU A H    3  
ATOM   4453  H  HA   . GLU A 1 26  ? -12.011 -12.053 4.078   1.00 0.00 ? 26  GLU A HA   3  
ATOM   4454  H  HB2  . GLU A 1 26  ? -13.526 -13.977 5.908   1.00 0.00 ? 26  GLU A HB2  3  
ATOM   4455  H  HB3  . GLU A 1 26  ? -14.086 -12.359 5.460   1.00 0.00 ? 26  GLU A HB3  3  
ATOM   4456  H  HG2  . GLU A 1 26  ? -14.089 -13.019 3.061   1.00 0.00 ? 26  GLU A HG2  3  
ATOM   4457  H  HG3  . GLU A 1 26  ? -13.545 -14.640 3.488   1.00 0.00 ? 26  GLU A HG3  3  
ATOM   4458  N  N    . GLU A 1 27  ? -10.863 -12.980 7.049   1.00 0.00 ? 27  GLU A N    3  
ATOM   4459  C  CA   . GLU A 1 27  ? -10.205 -12.516 8.261   1.00 0.00 ? 27  GLU A CA   3  
ATOM   4460  C  C    . GLU A 1 27  ? -8.910  -11.811 7.902   1.00 0.00 ? 27  GLU A C    3  
ATOM   4461  O  O    . GLU A 1 27  ? -8.670  -10.716 8.399   1.00 0.00 ? 27  GLU A O    3  
ATOM   4462  C  CB   . GLU A 1 27  ? -9.825  -13.681 9.175   1.00 0.00 ? 27  GLU A CB   3  
ATOM   4463  C  CG   . GLU A 1 27  ? -10.971 -14.594 9.591   1.00 0.00 ? 27  GLU A CG   3  
ATOM   4464  C  CD   . GLU A 1 27  ? -10.417 -15.798 10.354  1.00 0.00 ? 27  GLU A CD   3  
ATOM   4465  O  OE1  . GLU A 1 27  ? -9.329  -16.323 10.002  1.00 0.00 ? 27  GLU A OE1  3  
ATOM   4466  O  OE2  . GLU A 1 27  ? -11.047 -16.249 11.337  1.00 0.00 ? 27  GLU A OE2  3  
ATOM   4467  H  H    . GLU A 1 27  ? -10.789 -13.971 6.856   1.00 0.00 ? 27  GLU A H    3  
ATOM   4468  H  HA   . GLU A 1 27  ? -10.861 -11.832 8.798   1.00 0.00 ? 27  GLU A HA   3  
ATOM   4469  H  HB2  . GLU A 1 27  ? -9.072  -14.280 8.665   1.00 0.00 ? 27  GLU A HB2  3  
ATOM   4470  H  HB3  . GLU A 1 27  ? -9.374  -13.273 10.080  1.00 0.00 ? 27  GLU A HB3  3  
ATOM   4471  H  HG2  . GLU A 1 27  ? -11.664 -14.033 10.220  1.00 0.00 ? 27  GLU A HG2  3  
ATOM   4472  H  HG3  . GLU A 1 27  ? -11.505 -14.945 8.710   1.00 0.00 ? 27  GLU A HG3  3  
ATOM   4473  N  N    . ARG A 1 28  ? -8.057  -12.425 7.067   1.00 0.00 ? 28  ARG A N    3  
ATOM   4474  C  CA   . ARG A 1 28  ? -6.777  -11.800 6.723   1.00 0.00 ? 28  ARG A CA   3  
ATOM   4475  C  C    . ARG A 1 28  ? -7.009  -10.469 6.022   1.00 0.00 ? 28  ARG A C    3  
ATOM   4476  O  O    . ARG A 1 28  ? -6.349  -9.492  6.379   1.00 0.00 ? 28  ARG A O    3  
ATOM   4477  C  CB   . ARG A 1 28  ? -5.886  -12.742 5.897   1.00 0.00 ? 28  ARG A CB   3  
ATOM   4478  C  CG   . ARG A 1 28  ? -5.229  -13.785 6.809   1.00 0.00 ? 28  ARG A CG   3  
ATOM   4479  C  CD   . ARG A 1 28  ? -4.120  -14.592 6.125   1.00 0.00 ? 28  ARG A CD   3  
ATOM   4480  N  NE   . ARG A 1 28  ? -3.375  -15.362 7.133   1.00 0.00 ? 28  ARG A NE   3  
ATOM   4481  C  CZ   . ARG A 1 28  ? -2.410  -16.261 6.915   1.00 0.00 ? 28  ARG A CZ   3  
ATOM   4482  N  NH1  . ARG A 1 28  ? -1.979  -16.536 5.688   1.00 0.00 ? 28  ARG A NH1  3  
ATOM   4483  N  NH2  . ARG A 1 28  ? -1.891  -16.894 7.962   1.00 0.00 ? 28  ARG A NH2  3  
ATOM   4484  H  H    . ARG A 1 28  ? -8.289  -13.342 6.693   1.00 0.00 ? 28  ARG A H    3  
ATOM   4485  H  HA   . ARG A 1 28  ? -6.259  -11.555 7.652   1.00 0.00 ? 28  ARG A HA   3  
ATOM   4486  H  HB2  . ARG A 1 28  ? -6.481  -13.235 5.130   1.00 0.00 ? 28  ARG A HB2  3  
ATOM   4487  H  HB3  . ARG A 1 28  ? -5.101  -12.153 5.421   1.00 0.00 ? 28  ARG A HB3  3  
ATOM   4488  H  HG2  . ARG A 1 28  ? -4.786  -13.265 7.659   1.00 0.00 ? 28  ARG A HG2  3  
ATOM   4489  H  HG3  . ARG A 1 28  ? -5.993  -14.469 7.177   1.00 0.00 ? 28  ARG A HG3  3  
ATOM   4490  H  HD2  . ARG A 1 28  ? -4.566  -15.269 5.394   1.00 0.00 ? 28  ARG A HD2  3  
ATOM   4491  H  HD3  . ARG A 1 28  ? -3.432  -13.914 5.618   1.00 0.00 ? 28  ARG A HD3  3  
ATOM   4492  H  HE   . ARG A 1 28  ? -3.671  -15.218 8.099   1.00 0.00 ? 28  ARG A HE   3  
ATOM   4493  H  HH11 . ARG A 1 28  ? -2.383  -16.086 4.856   1.00 0.00 ? 28  ARG A HH11 3  
ATOM   4494  H  HH12 . ARG A 1 28  ? -1.248  -17.211 5.516   1.00 0.00 ? 28  ARG A HH12 3  
ATOM   4495  H  HH21 . ARG A 1 28  ? -2.223  -16.708 8.901   1.00 0.00 ? 28  ARG A HH21 3  
ATOM   4496  H  HH22 . ARG A 1 28  ? -1.157  -17.584 7.863   1.00 0.00 ? 28  ARG A HH22 3  
ATOM   4497  N  N    . ALA A 1 29  ? -7.973  -10.399 5.102   1.00 0.00 ? 29  ALA A N    3  
ATOM   4498  C  CA   . ALA A 1 29  ? -8.335  -9.154  4.451   1.00 0.00 ? 29  ALA A CA   3  
ATOM   4499  C  C    . ALA A 1 29  ? -8.723  -8.097  5.486   1.00 0.00 ? 29  ALA A C    3  
ATOM   4500  O  O    . ALA A 1 29  ? -8.245  -6.968  5.407   1.00 0.00 ? 29  ALA A O    3  
ATOM   4501  C  CB   . ALA A 1 29  ? -9.478  -9.406  3.467   1.00 0.00 ? 29  ALA A CB   3  
ATOM   4502  H  H    . ALA A 1 29  ? -8.479  -11.230 4.833   1.00 0.00 ? 29  ALA A H    3  
ATOM   4503  H  HA   . ALA A 1 29  ? -7.469  -8.789  3.900   1.00 0.00 ? 29  ALA A HA   3  
ATOM   4504  H  HB1  . ALA A 1 29  ? -9.703  -8.478  2.943   1.00 0.00 ? 29  ALA A HB1  3  
ATOM   4505  H  HB2  . ALA A 1 29  ? -9.182  -10.164 2.742   1.00 0.00 ? 29  ALA A HB2  3  
ATOM   4506  H  HB3  . ALA A 1 29  ? -10.364 -9.754  3.999   1.00 0.00 ? 29  ALA A HB3  3  
ATOM   4507  N  N    . MET A 1 30  ? -9.554  -8.452  6.470   1.00 0.00 ? 30  MET A N    3  
ATOM   4508  C  CA   . MET A 1 30  ? -9.990  -7.512  7.495   1.00 0.00 ? 30  MET A CA   3  
ATOM   4509  C  C    . MET A 1 30  ? -8.867  -7.127  8.458   1.00 0.00 ? 30  MET A C    3  
ATOM   4510  O  O    . MET A 1 30  ? -8.769  -5.959  8.830   1.00 0.00 ? 30  MET A O    3  
ATOM   4511  C  CB   . MET A 1 30  ? -11.212 -8.070  8.234   1.00 0.00 ? 30  MET A CB   3  
ATOM   4512  C  CG   . MET A 1 30  ? -12.469 -8.010  7.355   1.00 0.00 ? 30  MET A CG   3  
ATOM   4513  S  SD   . MET A 1 30  ? -12.944 -6.332  6.856   1.00 0.00 ? 30  MET A SD   3  
ATOM   4514  C  CE   . MET A 1 30  ? -12.326 -6.243  5.149   1.00 0.00 ? 30  MET A CE   3  
ATOM   4515  H  H    . MET A 1 30  ? -9.934  -9.393  6.492   1.00 0.00 ? 30  MET A H    3  
ATOM   4516  H  HA   . MET A 1 30  ? -10.285 -6.592  6.999   1.00 0.00 ? 30  MET A HA   3  
ATOM   4517  H  HB2  . MET A 1 30  ? -11.025 -9.099  8.544   1.00 0.00 ? 30  MET A HB2  3  
ATOM   4518  H  HB3  . MET A 1 30  ? -11.391 -7.472  9.128   1.00 0.00 ? 30  MET A HB3  3  
ATOM   4519  H  HG2  . MET A 1 30  ? -12.328 -8.617  6.462   1.00 0.00 ? 30  MET A HG2  3  
ATOM   4520  H  HG3  . MET A 1 30  ? -13.294 -8.440  7.924   1.00 0.00 ? 30  MET A HG3  3  
ATOM   4521  H  HE1  . MET A 1 30  ? -12.951 -6.851  4.497   1.00 0.00 ? 30  MET A HE1  3  
ATOM   4522  H  HE2  . MET A 1 30  ? -12.364 -5.210  4.803   1.00 0.00 ? 30  MET A HE2  3  
ATOM   4523  H  HE3  . MET A 1 30  ? -11.298 -6.599  5.087   1.00 0.00 ? 30  MET A HE3  3  
ATOM   4524  N  N    . GLY A 1 31  ? -7.992  -8.060  8.832   1.00 0.00 ? 31  GLY A N    3  
ATOM   4525  C  CA   . GLY A 1 31  ? -6.844  -7.779  9.677   1.00 0.00 ? 31  GLY A CA   3  
ATOM   4526  C  C    . GLY A 1 31  ? -5.965  -6.717  9.026   1.00 0.00 ? 31  GLY A C    3  
ATOM   4527  O  O    . GLY A 1 31  ? -5.645  -5.703  9.654   1.00 0.00 ? 31  GLY A O    3  
ATOM   4528  H  H    . GLY A 1 31  ? -8.120  -9.017  8.521   1.00 0.00 ? 31  GLY A H    3  
ATOM   4529  H  HA2  . GLY A 1 31  ? -7.180  -7.432  10.655  1.00 0.00 ? 31  GLY A HA2  3  
ATOM   4530  H  HA3  . GLY A 1 31  ? -6.269  -8.696  9.796   1.00 0.00 ? 31  GLY A HA3  3  
ATOM   4531  N  N    . TRP A 1 32  ? -5.654  -6.906  7.738   1.00 0.00 ? 32  TRP A N    3  
ATOM   4532  C  CA   . TRP A 1 32  ? -4.941  -5.908  6.961   1.00 0.00 ? 32  TRP A CA   3  
ATOM   4533  C  C    . TRP A 1 32  ? -5.731  -4.598  6.901   1.00 0.00 ? 32  TRP A C    3  
ATOM   4534  O  O    . TRP A 1 32  ? -5.160  -3.548  7.189   1.00 0.00 ? 32  TRP A O    3  
ATOM   4535  C  CB   . TRP A 1 32  ? -4.628  -6.440  5.556   1.00 0.00 ? 32  TRP A CB   3  
ATOM   4536  C  CG   . TRP A 1 32  ? -3.389  -7.276  5.503   1.00 0.00 ? 32  TRP A CG   3  
ATOM   4537  C  CD1  . TRP A 1 32  ? -3.325  -8.623  5.431   1.00 0.00 ? 32  TRP A CD1  3  
ATOM   4538  C  CD2  . TRP A 1 32  ? -2.006  -6.819  5.560   1.00 0.00 ? 32  TRP A CD2  3  
ATOM   4539  N  NE1  . TRP A 1 32  ? -2.007  -9.032  5.440   1.00 0.00 ? 32  TRP A NE1  3  
ATOM   4540  C  CE2  . TRP A 1 32  ? -1.147  -7.957  5.540   1.00 0.00 ? 32  TRP A CE2  3  
ATOM   4541  C  CE3  . TRP A 1 32  ? -1.396  -5.550  5.642   1.00 0.00 ? 32  TRP A CE3  3  
ATOM   4542  C  CZ2  . TRP A 1 32  ? 0.248   -7.835  5.610   1.00 0.00 ? 32  TRP A CZ2  3  
ATOM   4543  C  CZ3  . TRP A 1 32  ? 0.003   -5.416  5.697   1.00 0.00 ? 32  TRP A CZ3  3  
ATOM   4544  C  CH2  . TRP A 1 32  ? 0.825   -6.556  5.679   1.00 0.00 ? 32  TRP A CH2  3  
ATOM   4545  H  H    . TRP A 1 32  ? -5.960  -7.749  7.264   1.00 0.00 ? 32  TRP A H    3  
ATOM   4546  H  HA   . TRP A 1 32  ? -3.994  -5.723  7.470   1.00 0.00 ? 32  TRP A HA   3  
ATOM   4547  H  HB2  . TRP A 1 32  ? -5.477  -7.002  5.166   1.00 0.00 ? 32  TRP A HB2  3  
ATOM   4548  H  HB3  . TRP A 1 32  ? -4.468  -5.588  4.893   1.00 0.00 ? 32  TRP A HB3  3  
ATOM   4549  H  HD1  . TRP A 1 32  ? -4.183  -9.278  5.384   1.00 0.00 ? 32  TRP A HD1  3  
ATOM   4550  H  HE1  . TRP A 1 32  ? -1.729  -10.003 5.367   1.00 0.00 ? 32  TRP A HE1  3  
ATOM   4551  H  HE3  . TRP A 1 32  ? -2.016  -4.669  5.657   1.00 0.00 ? 32  TRP A HE3  3  
ATOM   4552  H  HZ2  . TRP A 1 32  ? 0.872   -8.715  5.595   1.00 0.00 ? 32  TRP A HZ2  3  
ATOM   4553  H  HZ3  . TRP A 1 32  ? 0.449   -4.433  5.753   1.00 0.00 ? 32  TRP A HZ3  3  
ATOM   4554  H  HH2  . TRP A 1 32  ? 1.900   -6.444  5.714   1.00 0.00 ? 32  TRP A HH2  3  
ATOM   4555  N  N    . TYR A 1 33  ? -7.027  -4.651  6.574   1.00 0.00 ? 33  TYR A N    3  
ATOM   4556  C  CA   . TYR A 1 33  ? -7.876  -3.477  6.388   1.00 0.00 ? 33  TYR A CA   3  
ATOM   4557  C  C    . TYR A 1 33  ? -7.847  -2.565  7.611   1.00 0.00 ? 33  TYR A C    3  
ATOM   4558  O  O    . TYR A 1 33  ? -7.623  -1.363  7.466   1.00 0.00 ? 33  TYR A O    3  
ATOM   4559  C  CB   . TYR A 1 33  ? -9.317  -3.922  6.085   1.00 0.00 ? 33  TYR A CB   3  
ATOM   4560  C  CG   . TYR A 1 33  ? -10.341 -2.814  5.911   1.00 0.00 ? 33  TYR A CG   3  
ATOM   4561  C  CD1  . TYR A 1 33  ? -10.902 -2.183  7.038   1.00 0.00 ? 33  TYR A CD1  3  
ATOM   4562  C  CD2  . TYR A 1 33  ? -10.782 -2.452  4.626   1.00 0.00 ? 33  TYR A CD2  3  
ATOM   4563  C  CE1  . TYR A 1 33  ? -11.871 -1.178  6.890   1.00 0.00 ? 33  TYR A CE1  3  
ATOM   4564  C  CE2  . TYR A 1 33  ? -11.798 -1.492  4.471   1.00 0.00 ? 33  TYR A CE2  3  
ATOM   4565  C  CZ   . TYR A 1 33  ? -12.346 -0.844  5.601   1.00 0.00 ? 33  TYR A CZ   3  
ATOM   4566  O  OH   . TYR A 1 33  ? -13.326 0.088   5.446   1.00 0.00 ? 33  TYR A OH   3  
ATOM   4567  H  H    . TYR A 1 33  ? -7.440  -5.556  6.370   1.00 0.00 ? 33  TYR A H    3  
ATOM   4568  H  HA   . TYR A 1 33  ? -7.501  -2.912  5.534   1.00 0.00 ? 33  TYR A HA   3  
ATOM   4569  H  HB2  . TYR A 1 33  ? -9.313  -4.537  5.186   1.00 0.00 ? 33  TYR A HB2  3  
ATOM   4570  H  HB3  . TYR A 1 33  ? -9.666  -4.545  6.903   1.00 0.00 ? 33  TYR A HB3  3  
ATOM   4571  H  HD1  . TYR A 1 33  ? -10.594 -2.470  8.030   1.00 0.00 ? 33  TYR A HD1  3  
ATOM   4572  H  HD2  . TYR A 1 33  ? -10.352 -2.927  3.758   1.00 0.00 ? 33  TYR A HD2  3  
ATOM   4573  H  HE1  . TYR A 1 33  ? -12.251 -0.680  7.770   1.00 0.00 ? 33  TYR A HE1  3  
ATOM   4574  H  HE2  . TYR A 1 33  ? -12.163 -1.247  3.486   1.00 0.00 ? 33  TYR A HE2  3  
ATOM   4575  H  HH   . TYR A 1 33  ? -13.570 0.211   4.510   1.00 0.00 ? 33  TYR A HH   3  
ATOM   4576  N  N    . TYR A 1 34  ? -8.079  -3.106  8.811   1.00 0.00 ? 34  TYR A N    3  
ATOM   4577  C  CA   . TYR A 1 34  ? -8.239  -2.270  9.993   1.00 0.00 ? 34  TYR A CA   3  
ATOM   4578  C  C    . TYR A 1 34  ? -6.893  -1.756  10.501  1.00 0.00 ? 34  TYR A C    3  
ATOM   4579  O  O    . TYR A 1 34  ? -6.844  -0.640  11.012  1.00 0.00 ? 34  TYR A O    3  
ATOM   4580  C  CB   . TYR A 1 34  ? -9.034  -3.005  11.079  1.00 0.00 ? 34  TYR A CB   3  
ATOM   4581  C  CG   . TYR A 1 34  ? -10.506 -3.188  10.735  1.00 0.00 ? 34  TYR A CG   3  
ATOM   4582  C  CD1  . TYR A 1 34  ? -11.351 -2.063  10.625  1.00 0.00 ? 34  TYR A CD1  3  
ATOM   4583  C  CD2  . TYR A 1 34  ? -11.033 -4.473  10.506  1.00 0.00 ? 34  TYR A CD2  3  
ATOM   4584  C  CE1  . TYR A 1 34  ? -12.709 -2.220  10.292  1.00 0.00 ? 34  TYR A CE1  3  
ATOM   4585  C  CE2  . TYR A 1 34  ? -12.388 -4.639  10.166  1.00 0.00 ? 34  TYR A CE2  3  
ATOM   4586  C  CZ   . TYR A 1 34  ? -13.234 -3.512  10.056  1.00 0.00 ? 34  TYR A CZ   3  
ATOM   4587  O  OH   . TYR A 1 34  ? -14.547 -3.682  9.731   1.00 0.00 ? 34  TYR A OH   3  
ATOM   4588  H  H    . TYR A 1 34  ? -8.219  -4.107  8.903   1.00 0.00 ? 34  TYR A H    3  
ATOM   4589  H  HA   . TYR A 1 34  ? -8.818  -1.391  9.705   1.00 0.00 ? 34  TYR A HA   3  
ATOM   4590  H  HB2  . TYR A 1 34  ? -8.569  -3.973  11.275  1.00 0.00 ? 34  TYR A HB2  3  
ATOM   4591  H  HB3  . TYR A 1 34  ? -8.979  -2.423  12.001  1.00 0.00 ? 34  TYR A HB3  3  
ATOM   4592  H  HD1  . TYR A 1 34  ? -10.960 -1.067  10.777  1.00 0.00 ? 34  TYR A HD1  3  
ATOM   4593  H  HD2  . TYR A 1 34  ? -10.393 -5.341  10.580  1.00 0.00 ? 34  TYR A HD2  3  
ATOM   4594  H  HE1  . TYR A 1 34  ? -13.342 -1.347  10.211  1.00 0.00 ? 34  TYR A HE1  3  
ATOM   4595  H  HE2  . TYR A 1 34  ? -12.781 -5.629  9.986   1.00 0.00 ? 34  TYR A HE2  3  
ATOM   4596  H  HH   . TYR A 1 34  ? -15.045 -2.851  9.696   1.00 0.00 ? 34  TYR A HH   3  
ATOM   4597  N  N    . TYR A 1 35  ? -5.795  -2.498  10.321  1.00 0.00 ? 35  TYR A N    3  
ATOM   4598  C  CA   . TYR A 1 35  ? -4.457  -1.970  10.589  1.00 0.00 ? 35  TYR A CA   3  
ATOM   4599  C  C    . TYR A 1 35  ? -4.124  -0.842  9.608   1.00 0.00 ? 35  TYR A C    3  
ATOM   4600  O  O    . TYR A 1 35  ? -3.567  0.179   10.022  1.00 0.00 ? 35  TYR A O    3  
ATOM   4601  C  CB   . TYR A 1 35  ? -3.440  -3.118  10.478  1.00 0.00 ? 35  TYR A CB   3  
ATOM   4602  C  CG   . TYR A 1 35  ? -1.982  -2.701  10.366  1.00 0.00 ? 35  TYR A CG   3  
ATOM   4603  C  CD1  . TYR A 1 35  ? -1.249  -2.335  11.512  1.00 0.00 ? 35  TYR A CD1  3  
ATOM   4604  C  CD2  . TYR A 1 35  ? -1.349  -2.709  9.108   1.00 0.00 ? 35  TYR A CD2  3  
ATOM   4605  C  CE1  . TYR A 1 35  ? 0.115   -2.003  11.404  1.00 0.00 ? 35  TYR A CE1  3  
ATOM   4606  C  CE2  . TYR A 1 35  ? 0.013   -2.377  8.991   1.00 0.00 ? 35  TYR A CE2  3  
ATOM   4607  C  CZ   . TYR A 1 35  ? 0.757   -2.035  10.142  1.00 0.00 ? 35  TYR A CZ   3  
ATOM   4608  O  OH   . TYR A 1 35  ? 2.093   -1.777  10.029  1.00 0.00 ? 35  TYR A OH   3  
ATOM   4609  H  H    . TYR A 1 35  ? -5.871  -3.418  9.899   1.00 0.00 ? 35  TYR A H    3  
ATOM   4610  H  HA   . TYR A 1 35  ? -4.435  -1.541  11.599  1.00 0.00 ? 35  TYR A HA   3  
ATOM   4611  H  HB2  . TYR A 1 35  ? -3.555  -3.773  11.343  1.00 0.00 ? 35  TYR A HB2  3  
ATOM   4612  H  HB3  . TYR A 1 35  ? -3.683  -3.709  9.594   1.00 0.00 ? 35  TYR A HB3  3  
ATOM   4613  H  HD1  . TYR A 1 35  ? -1.727  -2.324  12.482  1.00 0.00 ? 35  TYR A HD1  3  
ATOM   4614  H  HD2  . TYR A 1 35  ? -1.902  -3.001  8.226   1.00 0.00 ? 35  TYR A HD2  3  
ATOM   4615  H  HE1  . TYR A 1 35  ? 0.670   -1.740  12.294  1.00 0.00 ? 35  TYR A HE1  3  
ATOM   4616  H  HE2  . TYR A 1 35  ? 0.494   -2.410  8.023   1.00 0.00 ? 35  TYR A HE2  3  
ATOM   4617  H  HH   . TYR A 1 35  ? 2.490   -1.464  10.857  1.00 0.00 ? 35  TYR A HH   3  
ATOM   4618  N  N    . LEU A 1 36  ? -4.485  -0.994  8.328   1.00 0.00 ? 36  LEU A N    3  
ATOM   4619  C  CA   . LEU A 1 36  ? -4.269  0.028   7.321   1.00 0.00 ? 36  LEU A CA   3  
ATOM   4620  C  C    . LEU A 1 36  ? -5.063  1.262   7.684   1.00 0.00 ? 36  LEU A C    3  
ATOM   4621  O  O    . LEU A 1 36  ? -4.426  2.301   7.845   1.00 0.00 ? 36  LEU A O    3  
ATOM   4622  C  CB   . LEU A 1 36  ? -4.640  -0.464  5.913   1.00 0.00 ? 36  LEU A CB   3  
ATOM   4623  C  CG   . LEU A 1 36  ? -3.410  -0.765  5.041   1.00 0.00 ? 36  LEU A CG   3  
ATOM   4624  C  CD1  . LEU A 1 36  ? -2.422  -1.753  5.669   1.00 0.00 ? 36  LEU A CD1  3  
ATOM   4625  C  CD2  . LEU A 1 36  ? -3.913  -1.350  3.718   1.00 0.00 ? 36  LEU A CD2  3  
ATOM   4626  H  H    . LEU A 1 36  ? -4.941  -1.837  8.026   1.00 0.00 ? 36  LEU A H    3  
ATOM   4627  H  HA   . LEU A 1 36  ? -3.216  0.310   7.336   1.00 0.00 ? 36  LEU A HA   3  
ATOM   4628  H  HB2  . LEU A 1 36  ? -5.285  -1.339  5.973   1.00 0.00 ? 36  LEU A HB2  3  
ATOM   4629  H  HB3  . LEU A 1 36  ? -5.212  0.316   5.407   1.00 0.00 ? 36  LEU A HB3  3  
ATOM   4630  H  HG   . LEU A 1 36  ? -2.880  0.173   4.859   1.00 0.00 ? 36  LEU A HG   3  
ATOM   4631  H  HD11 . LEU A 1 36  ? -1.658  -2.031  4.942   1.00 0.00 ? 36  LEU A HD11 3  
ATOM   4632  H  HD12 . LEU A 1 36  ? -1.923  -1.295  6.522   1.00 0.00 ? 36  LEU A HD12 3  
ATOM   4633  H  HD13 . LEU A 1 36  ? -2.955  -2.643  5.998   1.00 0.00 ? 36  LEU A HD13 3  
ATOM   4634  H  HD21 . LEU A 1 36  ? -4.324  -2.347  3.882   1.00 0.00 ? 36  LEU A HD21 3  
ATOM   4635  H  HD22 . LEU A 1 36  ? -4.697  -0.716  3.308   1.00 0.00 ? 36  LEU A HD22 3  
ATOM   4636  H  HD23 . LEU A 1 36  ? -3.097  -1.412  3.002   1.00 0.00 ? 36  LEU A HD23 3  
ATOM   4637  N  N    . ASP A 1 37  ? -6.392  1.173   7.880   1.00 0.00 ? 37  ASP A N    3  
ATOM   4638  C  CA   . ASP A 1 37  ? -7.138  2.359   8.291   1.00 0.00 ? 37  ASP A CA   3  
ATOM   4639  C  C    . ASP A 1 37  ? -6.510  2.917   9.521   1.00 0.00 ? 37  ASP A C    3  
ATOM   4640  O  O    . ASP A 1 37  ? -6.318  4.132   9.564   1.00 0.00 ? 37  ASP A O    3  
ATOM   4641  C  CB   . ASP A 1 37  ? -8.625  2.173   8.654   1.00 0.00 ? 37  ASP A CB   3  
ATOM   4642  C  CG   . ASP A 1 37  ? -9.258  3.501   9.196   1.00 0.00 ? 37  ASP A CG   3  
ATOM   4643  O  OD1  . ASP A 1 37  ? -8.921  4.018   10.303  1.00 0.00 ? 37  ASP A OD1  3  
ATOM   4644  O  OD2  . ASP A 1 37  ? -10.135 4.042   8.488   1.00 0.00 ? 37  ASP A OD2  3  
ATOM   4645  H  H    . ASP A 1 37  ? -6.871  0.271   7.821   1.00 0.00 ? 37  ASP A H    3  
ATOM   4646  H  HA   . ASP A 1 37  ? -7.037  3.114   7.518   1.00 0.00 ? 37  ASP A HA   3  
ATOM   4647  H  HB2  . ASP A 1 37  ? -9.161  1.838   7.765   1.00 0.00 ? 37  ASP A HB2  3  
ATOM   4648  H  HB3  . ASP A 1 37  ? -8.721  1.394   9.413   1.00 0.00 ? 37  ASP A HB3  3  
ATOM   4649  N  N    . ASP A 1 38  ? -6.179  2.091   10.522  1.00 0.00 ? 38  ASP A N    3  
ATOM   4650  C  CA   . ASP A 1 38  ? -5.824  2.745   11.750  1.00 0.00 ? 38  ASP A CA   3  
ATOM   4651  C  C    . ASP A 1 38  ? -4.559  3.585   11.622  1.00 0.00 ? 38  ASP A C    3  
ATOM   4652  O  O    . ASP A 1 38  ? -4.510  4.688   12.171  1.00 0.00 ? 38  ASP A O    3  
ATOM   4653  C  CB   . ASP A 1 38  ? -5.912  1.931   13.029  1.00 0.00 ? 38  ASP A CB   3  
ATOM   4654  C  CG   . ASP A 1 38  ? -6.096  2.964   14.178  1.00 0.00 ? 38  ASP A CG   3  
ATOM   4655  O  OD1  . ASP A 1 38  ? -6.703  4.053   13.947  1.00 0.00 ? 38  ASP A OD1  3  
ATOM   4656  O  OD2  . ASP A 1 38  ? -5.648  2.687   15.312  1.00 0.00 ? 38  ASP A OD2  3  
ATOM   4657  H  H    . ASP A 1 38  ? -6.306  1.082   10.491  1.00 0.00 ? 38  ASP A H    3  
ATOM   4658  H  HA   . ASP A 1 38  ? -6.653  3.428   11.834  1.00 0.00 ? 38  ASP A HA   3  
ATOM   4659  H  HB2  . ASP A 1 38  ? -6.783  1.275   12.991  1.00 0.00 ? 38  ASP A HB2  3  
ATOM   4660  H  HB3  . ASP A 1 38  ? -5.015  1.311   13.144  1.00 0.00 ? 38  ASP A HB3  3  
ATOM   4661  N  N    . THR A 1 39  ? -3.646  3.152   10.758  1.00 0.00 ? 39  THR A N    3  
ATOM   4662  C  CA   . THR A 1 39  ? -2.397  3.841   10.515  1.00 0.00 ? 39  THR A CA   3  
ATOM   4663  C  C    . THR A 1 39  ? -2.644  5.097   9.661   1.00 0.00 ? 39  THR A C    3  
ATOM   4664  O  O    . THR A 1 39  ? -2.084  6.157   9.940   1.00 0.00 ? 39  THR A O    3  
ATOM   4665  C  CB   . THR A 1 39  ? -1.448  2.838   9.842   1.00 0.00 ? 39  THR A CB   3  
ATOM   4666  O  OG1  . THR A 1 39  ? -1.311  1.660   10.616  1.00 0.00 ? 39  THR A OG1  3  
ATOM   4667  C  CG2  . THR A 1 39  ? -0.074  3.465   9.654   1.00 0.00 ? 39  THR A CG2  3  
ATOM   4668  H  H    . THR A 1 39  ? -3.898  2.378   10.126  1.00 0.00 ? 39  THR A H    3  
ATOM   4669  H  HA   . THR A 1 39  ? -1.971  4.149   11.471  1.00 0.00 ? 39  THR A HA   3  
ATOM   4670  H  HB   . THR A 1 39  ? -1.849  2.562   8.866   1.00 0.00 ? 39  THR A HB   3  
ATOM   4671  H  HG1  . THR A 1 39  ? -2.117  1.128   10.475  1.00 0.00 ? 39  THR A HG1  3  
ATOM   4672  H  HG21 . THR A 1 39  ? -0.197  4.307   8.977   1.00 0.00 ? 39  THR A HG21 3  
ATOM   4673  H  HG22 . THR A 1 39  ? 0.320   3.820   10.606  1.00 0.00 ? 39  THR A HG22 3  
ATOM   4674  H  HG23 . THR A 1 39  ? 0.613   2.747   9.209   1.00 0.00 ? 39  THR A HG23 3  
ATOM   4675  N  N    . LEU A 1 40  ? -3.489  4.988   8.634   1.00 0.00 ? 40  LEU A N    3  
ATOM   4676  C  CA   . LEU A 1 40  ? -3.900  6.086   7.770   1.00 0.00 ? 40  LEU A CA   3  
ATOM   4677  C  C    . LEU A 1 40  ? -4.706  7.105   8.596   1.00 0.00 ? 40  LEU A C    3  
ATOM   4678  O  O    . LEU A 1 40  ? -5.537  6.743   9.441   1.00 0.00 ? 40  LEU A O    3  
ATOM   4679  C  CB   . LEU A 1 40  ? -4.745  5.521   6.605   1.00 0.00 ? 40  LEU A CB   3  
ATOM   4680  C  CG   . LEU A 1 40  ? -4.022  4.486   5.705   1.00 0.00 ? 40  LEU A CG   3  
ATOM   4681  C  CD1  . LEU A 1 40  ? -4.999  3.620   4.902   1.00 0.00 ? 40  LEU A CD1  3  
ATOM   4682  C  CD2  . LEU A 1 40  ? -3.069  5.117   4.695   1.00 0.00 ? 40  LEU A CD2  3  
ATOM   4683  H  H    . LEU A 1 40  ? -3.926  4.099   8.455   1.00 0.00 ? 40  LEU A H    3  
ATOM   4684  H  HA   . LEU A 1 40  ? -3.014  6.572   7.362   1.00 0.00 ? 40  LEU A HA   3  
ATOM   4685  H  HB2  . LEU A 1 40  ? -5.621  5.045   7.045   1.00 0.00 ? 40  LEU A HB2  3  
ATOM   4686  H  HB3  . LEU A 1 40  ? -5.098  6.348   5.986   1.00 0.00 ? 40  LEU A HB3  3  
ATOM   4687  H  HG   . LEU A 1 40  ? -3.423  3.825   6.328   1.00 0.00 ? 40  LEU A HG   3  
ATOM   4688  H  HD11 . LEU A 1 40  ? -4.461  2.802   4.424   1.00 0.00 ? 40  LEU A HD11 3  
ATOM   4689  H  HD12 . LEU A 1 40  ? -5.754  3.192   5.558   1.00 0.00 ? 40  LEU A HD12 3  
ATOM   4690  H  HD13 . LEU A 1 40  ? -5.481  4.218   4.133   1.00 0.00 ? 40  LEU A HD13 3  
ATOM   4691  H  HD21 . LEU A 1 40  ? -3.592  5.834   4.064   1.00 0.00 ? 40  LEU A HD21 3  
ATOM   4692  H  HD22 . LEU A 1 40  ? -2.256  5.607   5.218   1.00 0.00 ? 40  LEU A HD22 3  
ATOM   4693  H  HD23 . LEU A 1 40  ? -2.644  4.336   4.068   1.00 0.00 ? 40  LEU A HD23 3  
ATOM   4694  N  N    . GLU A 1 41  ? -4.512  8.391   8.316   1.00 0.00 ? 41  GLU A N    3  
ATOM   4695  C  CA   . GLU A 1 41  ? -5.220  9.495   8.959   1.00 0.00 ? 41  GLU A CA   3  
ATOM   4696  C  C    . GLU A 1 41  ? -5.932  10.300  7.869   1.00 0.00 ? 41  GLU A C    3  
ATOM   4697  O  O    . GLU A 1 41  ? -5.568  11.429  7.534   1.00 0.00 ? 41  GLU A O    3  
ATOM   4698  C  CB   . GLU A 1 41  ? -4.273  10.303  9.862   1.00 0.00 ? 41  GLU A CB   3  
ATOM   4699  C  CG   . GLU A 1 41  ? -3.851  9.513   11.114  1.00 0.00 ? 41  GLU A CG   3  
ATOM   4700  C  CD   . GLU A 1 41  ? -5.014  9.297   12.106  1.00 0.00 ? 41  GLU A CD   3  
ATOM   4701  O  OE1  . GLU A 1 41  ? -5.245  10.173  12.970  1.00 0.00 ? 41  GLU A OE1  3  
ATOM   4702  O  OE2  . GLU A 1 41  ? -5.705  8.250   12.046  1.00 0.00 ? 41  GLU A OE2  3  
ATOM   4703  H  H    . GLU A 1 41  ? -3.742  8.650   7.704   1.00 0.00 ? 41  GLU A H    3  
ATOM   4704  H  HA   . GLU A 1 41  ? -6.008  9.095   9.597   1.00 0.00 ? 41  GLU A HA   3  
ATOM   4705  H  HB2  . GLU A 1 41  ? -3.382  10.579  9.296   1.00 0.00 ? 41  GLU A HB2  3  
ATOM   4706  H  HB3  . GLU A 1 41  ? -4.771  11.219  10.183  1.00 0.00 ? 41  GLU A HB3  3  
ATOM   4707  H  HG2  . GLU A 1 41  ? -3.431  8.553   10.810  1.00 0.00 ? 41  GLU A HG2  3  
ATOM   4708  H  HG3  . GLU A 1 41  ? -3.054  10.068  11.614  1.00 0.00 ? 41  GLU A HG3  3  
ATOM   4709  N  N    . PHE A 1 42  ? -6.937  9.646   7.279   1.00 0.00 ? 42  PHE A N    3  
ATOM   4710  C  CA   . PHE A 1 42  ? -7.849  10.195  6.283   1.00 0.00 ? 42  PHE A CA   3  
ATOM   4711  C  C    . PHE A 1 42  ? -8.572  11.467  6.776   1.00 0.00 ? 42  PHE A C    3  
ATOM   4712  O  O    . PHE A 1 42  ? -8.695  11.660  7.991   1.00 0.00 ? 42  PHE A O    3  
ATOM   4713  C  CB   . PHE A 1 42  ? -8.907  9.131   5.968   1.00 0.00 ? 42  PHE A CB   3  
ATOM   4714  C  CG   . PHE A 1 42  ? -8.406  7.866   5.306   1.00 0.00 ? 42  PHE A CG   3  
ATOM   4715  C  CD1  . PHE A 1 42  ? -8.254  7.865   3.912   1.00 0.00 ? 42  PHE A CD1  3  
ATOM   4716  C  CD2  . PHE A 1 42  ? -8.216  6.674   6.033   1.00 0.00 ? 42  PHE A CD2  3  
ATOM   4717  C  CE1  . PHE A 1 42  ? -7.979  6.670   3.226   1.00 0.00 ? 42  PHE A CE1  3  
ATOM   4718  C  CE2  . PHE A 1 42  ? -7.937  5.480   5.346   1.00 0.00 ? 42  PHE A CE2  3  
ATOM   4719  C  CZ   . PHE A 1 42  ? -7.835  5.474   3.945   1.00 0.00 ? 42  PHE A CZ   3  
ATOM   4720  H  H    . PHE A 1 42  ? -7.126  8.705   7.589   1.00 0.00 ? 42  PHE A H    3  
ATOM   4721  H  HA   . PHE A 1 42  ? -7.277  10.415  5.384   1.00 0.00 ? 42  PHE A HA   3  
ATOM   4722  H  HB2  . PHE A 1 42  ? -9.439  8.872   6.885   1.00 0.00 ? 42  PHE A HB2  3  
ATOM   4723  H  HB3  . PHE A 1 42  ? -9.640  9.572   5.292   1.00 0.00 ? 42  PHE A HB3  3  
ATOM   4724  H  HD1  . PHE A 1 42  ? -8.401  8.785   3.372   1.00 0.00 ? 42  PHE A HD1  3  
ATOM   4725  H  HD2  . PHE A 1 42  ? -8.306  6.653   7.111   1.00 0.00 ? 42  PHE A HD2  3  
ATOM   4726  H  HE1  . PHE A 1 42  ? -7.891  6.663   2.149   1.00 0.00 ? 42  PHE A HE1  3  
ATOM   4727  H  HE2  . PHE A 1 42  ? -7.813  4.561   5.898   1.00 0.00 ? 42  PHE A HE2  3  
ATOM   4728  H  HZ   . PHE A 1 42  ? -7.640  4.552   3.417   1.00 0.00 ? 42  PHE A HZ   3  
ATOM   4729  N  N    . PRO A 1 43  ? -9.146  12.288  5.871   1.00 0.00 ? 43  PRO A N    3  
ATOM   4730  C  CA   . PRO A 1 43  ? -8.991  12.226  4.415   1.00 0.00 ? 43  PRO A CA   3  
ATOM   4731  C  C    . PRO A 1 43  ? -7.570  12.644  4.018   1.00 0.00 ? 43  PRO A C    3  
ATOM   4732  O  O    . PRO A 1 43  ? -6.918  13.369  4.776   1.00 0.00 ? 43  PRO A O    3  
ATOM   4733  C  CB   . PRO A 1 43  ? -10.038 13.201  3.864   1.00 0.00 ? 43  PRO A CB   3  
ATOM   4734  C  CG   . PRO A 1 43  ? -10.170 14.250  4.966   1.00 0.00 ? 43  PRO A CG   3  
ATOM   4735  C  CD   . PRO A 1 43  ? -9.969  13.433  6.241   1.00 0.00 ? 43  PRO A CD   3  
ATOM   4736  H  HA   . PRO A 1 43  ? -9.199  11.229  4.032   1.00 0.00 ? 43  PRO A HA   3  
ATOM   4737  H  HB2  . PRO A 1 43  ? -9.735  13.645  2.915   1.00 0.00 ? 43  PRO A HB2  3  
ATOM   4738  H  HB3  . PRO A 1 43  ? -10.989 12.681  3.751   1.00 0.00 ? 43  PRO A HB3  3  
ATOM   4739  H  HG2  . PRO A 1 43  ? -9.373  14.988  4.871   1.00 0.00 ? 43  PRO A HG2  3  
ATOM   4740  H  HG3  . PRO A 1 43  ? -11.146 14.736  4.947   1.00 0.00 ? 43  PRO A HG3  3  
ATOM   4741  H  HD2  . PRO A 1 43  ? -9.481  14.041  7.004   1.00 0.00 ? 43  PRO A HD2  3  
ATOM   4742  H  HD3  . PRO A 1 43  ? -10.932 13.076  6.607   1.00 0.00 ? 43  PRO A HD3  3  
ATOM   4743  N  N    . PHE A 1 44  ? -7.081  12.222  2.845   1.00 0.00 ? 44  PHE A N    3  
ATOM   4744  C  CA   . PHE A 1 44  ? -5.787  12.724  2.359   1.00 0.00 ? 44  PHE A CA   3  
ATOM   4745  C  C    . PHE A 1 44  ? -5.779  12.905  0.843   1.00 0.00 ? 44  PHE A C    3  
ATOM   4746  O  O    . PHE A 1 44  ? -6.588  12.309  0.145   1.00 0.00 ? 44  PHE A O    3  
ATOM   4747  C  CB   . PHE A 1 44  ? -4.632  11.840  2.864   1.00 0.00 ? 44  PHE A CB   3  
ATOM   4748  C  CG   . PHE A 1 44  ? -4.546  10.425  2.318   1.00 0.00 ? 44  PHE A CG   3  
ATOM   4749  C  CD1  . PHE A 1 44  ? -3.873  10.194  1.106   1.00 0.00 ? 44  PHE A CD1  3  
ATOM   4750  C  CD2  . PHE A 1 44  ? -5.061  9.329   3.038   1.00 0.00 ? 44  PHE A CD2  3  
ATOM   4751  C  CE1  . PHE A 1 44  ? -3.744  8.898   0.587   1.00 0.00 ? 44  PHE A CE1  3  
ATOM   4752  C  CE2  . PHE A 1 44  ? -4.913  8.024   2.534   1.00 0.00 ? 44  PHE A CE2  3  
ATOM   4753  C  CZ   . PHE A 1 44  ? -4.264  7.806   1.304   1.00 0.00 ? 44  PHE A CZ   3  
ATOM   4754  H  H    . PHE A 1 44  ? -7.648  11.629  2.223   1.00 0.00 ? 44  PHE A H    3  
ATOM   4755  H  HA   . PHE A 1 44  ? -5.630  13.718  2.781   1.00 0.00 ? 44  PHE A HA   3  
ATOM   4756  H  HB2  . PHE A 1 44  ? -3.706  12.353  2.605   1.00 0.00 ? 44  PHE A HB2  3  
ATOM   4757  H  HB3  . PHE A 1 44  ? -4.671  11.795  3.953   1.00 0.00 ? 44  PHE A HB3  3  
ATOM   4758  H  HD1  . PHE A 1 44  ? -3.438  11.019  0.576   1.00 0.00 ? 44  PHE A HD1  3  
ATOM   4759  H  HD2  . PHE A 1 44  ? -5.554  9.482   3.988   1.00 0.00 ? 44  PHE A HD2  3  
ATOM   4760  H  HE1  . PHE A 1 44  ? -3.224  8.755   -0.352  1.00 0.00 ? 44  PHE A HE1  3  
ATOM   4761  H  HE2  . PHE A 1 44  ? -5.302  7.186   3.092   1.00 0.00 ? 44  PHE A HE2  3  
ATOM   4762  H  HZ   . PHE A 1 44  ? -4.157  6.802   0.916   1.00 0.00 ? 44  PHE A HZ   3  
ATOM   4763  N  N    . MET A 1 45  ? -4.890  13.743  0.310   1.00 0.00 ? 45  MET A N    3  
ATOM   4764  C  CA   . MET A 1 45  ? -4.775  13.944  -1.133  1.00 0.00 ? 45  MET A CA   3  
ATOM   4765  C  C    . MET A 1 45  ? -3.847  12.873  -1.703  1.00 0.00 ? 45  MET A C    3  
ATOM   4766  O  O    . MET A 1 45  ? -2.831  12.558  -1.083  1.00 0.00 ? 45  MET A O    3  
ATOM   4767  C  CB   . MET A 1 45  ? -4.206  15.349  -1.387  1.00 0.00 ? 45  MET A CB   3  
ATOM   4768  C  CG   . MET A 1 45  ? -4.072  15.661  -2.879  1.00 0.00 ? 45  MET A CG   3  
ATOM   4769  S  SD   . MET A 1 45  ? -3.301  17.258  -3.233  1.00 0.00 ? 45  MET A SD   3  
ATOM   4770  C  CE   . MET A 1 45  ? -3.305  17.144  -5.038  1.00 0.00 ? 45  MET A CE   3  
ATOM   4771  H  H    . MET A 1 45  ? -4.198  14.181  0.901   1.00 0.00 ? 45  MET A H    3  
ATOM   4772  H  HA   . MET A 1 45  ? -5.763  13.853  -1.590  1.00 0.00 ? 45  MET A HA   3  
ATOM   4773  H  HB2  . MET A 1 45  ? -4.866  16.090  -0.934  1.00 0.00 ? 45  MET A HB2  3  
ATOM   4774  H  HB3  . MET A 1 45  ? -3.222  15.429  -0.922  1.00 0.00 ? 45  MET A HB3  3  
ATOM   4775  H  HG2  . MET A 1 45  ? -3.460  14.894  -3.351  1.00 0.00 ? 45  MET A HG2  3  
ATOM   4776  H  HG3  . MET A 1 45  ? -5.061  15.633  -3.333  1.00 0.00 ? 45  MET A HG3  3  
ATOM   4777  H  HE1  . MET A 1 45  ? -4.332  17.170  -5.399  1.00 0.00 ? 45  MET A HE1  3  
ATOM   4778  H  HE2  . MET A 1 45  ? -2.750  17.980  -5.465  1.00 0.00 ? 45  MET A HE2  3  
ATOM   4779  H  HE3  . MET A 1 45  ? -2.848  16.204  -5.348  1.00 0.00 ? 45  MET A HE3  3  
ATOM   4780  N  N    . GLY A 1 46  ? -4.120  12.358  -2.901  1.00 0.00 ? 46  GLY A N    3  
ATOM   4781  C  CA   . GLY A 1 46  ? -3.227  11.419  -3.553  1.00 0.00 ? 46  GLY A CA   3  
ATOM   4782  C  C    . GLY A 1 46  ? -3.363  11.454  -5.065  1.00 0.00 ? 46  GLY A C    3  
ATOM   4783  O  O    . GLY A 1 46  ? -4.285  12.056  -5.619  1.00 0.00 ? 46  GLY A O    3  
ATOM   4784  H  H    . GLY A 1 46  ? -4.939  12.660  -3.426  1.00 0.00 ? 46  GLY A H    3  
ATOM   4785  H  HA2  . GLY A 1 46  ? -2.198  11.660  -3.299  1.00 0.00 ? 46  GLY A HA2  3  
ATOM   4786  H  HA3  . GLY A 1 46  ? -3.445  10.409  -3.203  1.00 0.00 ? 46  GLY A HA3  3  
ATOM   4787  N  N    . LYS A 1 47  ? -2.412  10.817  -5.740  1.00 0.00 ? 47  LYS A N    3  
ATOM   4788  C  CA   . LYS A 1 47  ? -2.513  10.562  -7.168  1.00 0.00 ? 47  LYS A CA   3  
ATOM   4789  C  C    . LYS A 1 47  ? -3.044  9.142   -7.313  1.00 0.00 ? 47  LYS A C    3  
ATOM   4790  O  O    . LYS A 1 47  ? -2.475  8.206   -6.745  1.00 0.00 ? 47  LYS A O    3  
ATOM   4791  C  CB   . LYS A 1 47  ? -1.138  10.701  -7.854  1.00 0.00 ? 47  LYS A CB   3  
ATOM   4792  C  CG   . LYS A 1 47  ? -1.270  10.860  -9.381  1.00 0.00 ? 47  LYS A CG   3  
ATOM   4793  C  CD   . LYS A 1 47  ? -1.688  12.283  -9.800  1.00 0.00 ? 47  LYS A CD   3  
ATOM   4794  C  CE   . LYS A 1 47  ? -0.540  13.303  -9.732  1.00 0.00 ? 47  LYS A CE   3  
ATOM   4795  N  NZ   . LYS A 1 47  ? 0.353   13.245  -10.917 1.00 0.00 ? 47  LYS A NZ   3  
ATOM   4796  H  H    . LYS A 1 47  ? -1.712  10.315  -5.213  1.00 0.00 ? 47  LYS A H    3  
ATOM   4797  H  HA   . LYS A 1 47  ? -3.228  11.267  -7.599  1.00 0.00 ? 47  LYS A HA   3  
ATOM   4798  H  HB2  . LYS A 1 47  ? -0.599  11.556  -7.453  1.00 0.00 ? 47  LYS A HB2  3  
ATOM   4799  H  HB3  . LYS A 1 47  ? -0.538  9.816   -7.638  1.00 0.00 ? 47  LYS A HB3  3  
ATOM   4800  H  HG2  . LYS A 1 47  ? -0.315  10.615  -9.843  1.00 0.00 ? 47  LYS A HG2  3  
ATOM   4801  H  HG3  . LYS A 1 47  ? -2.008  10.149  -9.754  1.00 0.00 ? 47  LYS A HG3  3  
ATOM   4802  H  HD2  . LYS A 1 47  ? -2.098  12.264  -10.809 1.00 0.00 ? 47  LYS A HD2  3  
ATOM   4803  H  HD3  . LYS A 1 47  ? -2.480  12.630  -9.140  1.00 0.00 ? 47  LYS A HD3  3  
ATOM   4804  H  HE2  . LYS A 1 47  ? -0.977  14.304  -9.672  1.00 0.00 ? 47  LYS A HE2  3  
ATOM   4805  H  HE3  . LYS A 1 47  ? 0.038   13.133  -8.822  1.00 0.00 ? 47  LYS A HE3  3  
ATOM   4806  H  HZ1  . LYS A 1 47  ? 0.686   12.298  -11.113 1.00 0.00 ? 47  LYS A HZ1  3  
ATOM   4807  H  HZ2  . LYS A 1 47  ? -0.122  13.573  -11.744 1.00 0.00 ? 47  LYS A HZ2  3  
ATOM   4808  H  HZ3  . LYS A 1 47  ? 1.163   13.833  -10.783 1.00 0.00 ? 47  LYS A HZ3  3  
ATOM   4809  N  N    . TRP A 1 48  ? -4.135  8.977   -8.051  1.00 0.00 ? 48  TRP A N    3  
ATOM   4810  C  CA   . TRP A 1 48  ? -4.614  7.673   -8.462  1.00 0.00 ? 48  TRP A CA   3  
ATOM   4811  C  C    . TRP A 1 48  ? -3.768  7.336   -9.685  1.00 0.00 ? 48  TRP A C    3  
ATOM   4812  O  O    . TRP A 1 48  ? -3.951  7.926   -10.750 1.00 0.00 ? 48  TRP A O    3  
ATOM   4813  C  CB   . TRP A 1 48  ? -6.118  7.738   -8.767  1.00 0.00 ? 48  TRP A CB   3  
ATOM   4814  C  CG   . TRP A 1 48  ? -6.801  6.450   -9.121  1.00 0.00 ? 48  TRP A CG   3  
ATOM   4815  C  CD1  . TRP A 1 48  ? -6.232  5.224   -9.200  1.00 0.00 ? 48  TRP A CD1  3  
ATOM   4816  C  CD2  . TRP A 1 48  ? -8.213  6.241   -9.433  1.00 0.00 ? 48  TRP A CD2  3  
ATOM   4817  N  NE1  . TRP A 1 48  ? -7.171  4.290   -9.579  1.00 0.00 ? 48  TRP A NE1  3  
ATOM   4818  C  CE2  . TRP A 1 48  ? -8.413  4.864   -9.753  1.00 0.00 ? 48  TRP A CE2  3  
ATOM   4819  C  CE3  . TRP A 1 48  ? -9.350  7.078   -9.459  1.00 0.00 ? 48  TRP A CE3  3  
ATOM   4820  C  CZ2  . TRP A 1 48  ? -9.669  4.357   -10.122 1.00 0.00 ? 48  TRP A CZ2  3  
ATOM   4821  C  CZ3  . TRP A 1 48  ? -10.623 6.570   -9.784  1.00 0.00 ? 48  TRP A CZ3  3  
ATOM   4822  C  CH2  . TRP A 1 48  ? -10.781 5.216   -10.128 1.00 0.00 ? 48  TRP A CH2  3  
ATOM   4823  H  H    . TRP A 1 48  ? -4.514  9.779   -8.543  1.00 0.00 ? 48  TRP A H    3  
ATOM   4824  H  HA   . TRP A 1 48  ? -4.439  6.942   -7.671  1.00 0.00 ? 48  TRP A HA   3  
ATOM   4825  H  HB2  . TRP A 1 48  ? -6.628  8.144   -7.894  1.00 0.00 ? 48  TRP A HB2  3  
ATOM   4826  H  HB3  . TRP A 1 48  ? -6.282  8.440   -9.584  1.00 0.00 ? 48  TRP A HB3  3  
ATOM   4827  H  HD1  . TRP A 1 48  ? -5.194  4.997   -9.005  1.00 0.00 ? 48  TRP A HD1  3  
ATOM   4828  H  HE1  . TRP A 1 48  ? -6.942  3.312   -9.701  1.00 0.00 ? 48  TRP A HE1  3  
ATOM   4829  H  HE3  . TRP A 1 48  ? -9.242  8.119   -9.195  1.00 0.00 ? 48  TRP A HE3  3  
ATOM   4830  H  HZ2  . TRP A 1 48  ? -9.784  3.316   -10.387 1.00 0.00 ? 48  TRP A HZ2  3  
ATOM   4831  H  HZ3  . TRP A 1 48  ? -11.487 7.223   -9.760  1.00 0.00 ? 48  TRP A HZ3  3  
ATOM   4832  H  HH2  . TRP A 1 48  ? -11.761 4.829   -10.378 1.00 0.00 ? 48  TRP A HH2  3  
ATOM   4833  N  N    . LYS A 1 49  ? -2.800  6.438   -9.524  1.00 0.00 ? 49  LYS A N    3  
ATOM   4834  C  CA   . LYS A 1 49  ? -1.870  5.992   -10.554 1.00 0.00 ? 49  LYS A CA   3  
ATOM   4835  C  C    . LYS A 1 49  ? -2.428  4.682   -11.114 1.00 0.00 ? 49  LYS A C    3  
ATOM   4836  O  O    . LYS A 1 49  ? -1.841  3.614   -10.935 1.00 0.00 ? 49  LYS A O    3  
ATOM   4837  C  CB   . LYS A 1 49  ? -0.475  5.821   -9.921  1.00 0.00 ? 49  LYS A CB   3  
ATOM   4838  C  CG   . LYS A 1 49  ? 0.146   7.162   -9.496  1.00 0.00 ? 49  LYS A CG   3  
ATOM   4839  C  CD   . LYS A 1 49  ? 1.467   6.997   -8.732  1.00 0.00 ? 49  LYS A CD   3  
ATOM   4840  C  CE   . LYS A 1 49  ? 2.551   6.296   -9.563  1.00 0.00 ? 49  LYS A CE   3  
ATOM   4841  N  NZ   . LYS A 1 49  ? 3.857   6.244   -8.858  1.00 0.00 ? 49  LYS A NZ   3  
ATOM   4842  H  H    . LYS A 1 49  ? -2.747  5.917   -8.669  1.00 0.00 ? 49  LYS A H    3  
ATOM   4843  H  HA   . LYS A 1 49  ? -1.817  6.726   -11.361 1.00 0.00 ? 49  LYS A HA   3  
ATOM   4844  H  HB2  . LYS A 1 49  ? -0.556  5.167   -9.051  1.00 0.00 ? 49  LYS A HB2  3  
ATOM   4845  H  HB3  . LYS A 1 49  ? 0.182   5.343   -10.645 1.00 0.00 ? 49  LYS A HB3  3  
ATOM   4846  H  HG2  . LYS A 1 49  ? 0.322   7.774   -10.380 1.00 0.00 ? 49  LYS A HG2  3  
ATOM   4847  H  HG3  . LYS A 1 49  ? -0.550  7.694   -8.847  1.00 0.00 ? 49  LYS A HG3  3  
ATOM   4848  H  HD2  . LYS A 1 49  ? 1.817   7.990   -8.450  1.00 0.00 ? 49  LYS A HD2  3  
ATOM   4849  H  HD3  . LYS A 1 49  ? 1.277   6.419   -7.827  1.00 0.00 ? 49  LYS A HD3  3  
ATOM   4850  H  HE2  . LYS A 1 49  ? 2.218   5.280   -9.782  1.00 0.00 ? 49  LYS A HE2  3  
ATOM   4851  H  HE3  . LYS A 1 49  ? 2.669   6.833   -10.507 1.00 0.00 ? 49  LYS A HE3  3  
ATOM   4852  H  HZ1  . LYS A 1 49  ? 3.790   5.732   -7.990  1.00 0.00 ? 49  LYS A HZ1  3  
ATOM   4853  H  HZ2  . LYS A 1 49  ? 4.552   5.781   -9.428  1.00 0.00 ? 49  LYS A HZ2  3  
ATOM   4854  H  HZ3  . LYS A 1 49  ? 4.205   7.170   -8.655  1.00 0.00 ? 49  LYS A HZ3  3  
ATOM   4855  N  N    . LYS A 1 50  ? -3.622  4.763   -11.703 1.00 0.00 ? 50  LYS A N    3  
ATOM   4856  C  CA   . LYS A 1 50  ? -4.387  3.613   -12.175 1.00 0.00 ? 50  LYS A CA   3  
ATOM   4857  C  C    . LYS A 1 50  ? -3.532  2.780   -13.129 1.00 0.00 ? 50  LYS A C    3  
ATOM   4858  O  O    . LYS A 1 50  ? -3.259  3.228   -14.240 1.00 0.00 ? 50  LYS A O    3  
ATOM   4859  C  CB   . LYS A 1 50  ? -5.702  4.086   -12.815 1.00 0.00 ? 50  LYS A CB   3  
ATOM   4860  C  CG   . LYS A 1 50  ? -6.595  2.896   -13.213 1.00 0.00 ? 50  LYS A CG   3  
ATOM   4861  C  CD   . LYS A 1 50  ? -8.056  3.295   -13.481 1.00 0.00 ? 50  LYS A CD   3  
ATOM   4862  C  CE   . LYS A 1 50  ? -8.229  4.436   -14.496 1.00 0.00 ? 50  LYS A CE   3  
ATOM   4863  N  NZ   . LYS A 1 50  ? -7.847  4.049   -15.876 1.00 0.00 ? 50  LYS A NZ   3  
ATOM   4864  H  H    . LYS A 1 50  ? -4.009  5.709   -11.821 1.00 0.00 ? 50  LYS A H    3  
ATOM   4865  H  HA   . LYS A 1 50  ? -4.631  3.007   -11.307 1.00 0.00 ? 50  LYS A HA   3  
ATOM   4866  H  HB2  . LYS A 1 50  ? -6.236  4.709   -12.098 1.00 0.00 ? 50  LYS A HB2  3  
ATOM   4867  H  HB3  . LYS A 1 50  ? -5.482  4.692   -13.695 1.00 0.00 ? 50  LYS A HB3  3  
ATOM   4868  H  HG2  . LYS A 1 50  ? -6.182  2.419   -14.101 1.00 0.00 ? 50  LYS A HG2  3  
ATOM   4869  H  HG3  . LYS A 1 50  ? -6.595  2.163   -12.404 1.00 0.00 ? 50  LYS A HG3  3  
ATOM   4870  H  HD2  . LYS A 1 50  ? -8.613  2.418   -13.815 1.00 0.00 ? 50  LYS A HD2  3  
ATOM   4871  H  HD3  . LYS A 1 50  ? -8.495  3.619   -12.539 1.00 0.00 ? 50  LYS A HD3  3  
ATOM   4872  H  HE2  . LYS A 1 50  ? -9.275  4.750   -14.484 1.00 0.00 ? 50  LYS A HE2  3  
ATOM   4873  H  HE3  . LYS A 1 50  ? -7.625  5.286   -14.172 1.00 0.00 ? 50  LYS A HE3  3  
ATOM   4874  H  HZ1  . LYS A 1 50  ? -8.556  3.475   -16.309 1.00 0.00 ? 50  LYS A HZ1  3  
ATOM   4875  H  HZ2  . LYS A 1 50  ? -7.715  4.884   -16.455 1.00 0.00 ? 50  LYS A HZ2  3  
ATOM   4876  H  HZ3  . LYS A 1 50  ? -6.967  3.561   -15.897 1.00 0.00 ? 50  LYS A HZ3  3  
ATOM   4877  N  N    . LYS A 1 51  ? -3.117  1.574   -12.730 1.00 0.00 ? 51  LYS A N    3  
ATOM   4878  C  CA   . LYS A 1 51  ? -2.351  0.674   -13.591 1.00 0.00 ? 51  LYS A CA   3  
ATOM   4879  C  C    . LYS A 1 51  ? -3.252  -0.073  -14.573 1.00 0.00 ? 51  LYS A C    3  
ATOM   4880  O  O    . LYS A 1 51  ? -2.752  -0.729  -15.478 1.00 0.00 ? 51  LYS A O    3  
ATOM   4881  C  CB   . LYS A 1 51  ? -1.470  -0.273  -12.754 1.00 0.00 ? 51  LYS A CB   3  
ATOM   4882  C  CG   . LYS A 1 51  ? -2.218  -1.442  -12.092 1.00 0.00 ? 51  LYS A CG   3  
ATOM   4883  C  CD   . LYS A 1 51  ? -1.272  -2.362  -11.300 1.00 0.00 ? 51  LYS A CD   3  
ATOM   4884  C  CE   . LYS A 1 51  ? -0.733  -1.739  -10.000 1.00 0.00 ? 51  LYS A CE   3  
ATOM   4885  N  NZ   . LYS A 1 51  ? -1.704  -1.817  -8.881  1.00 0.00 ? 51  LYS A NZ   3  
ATOM   4886  H  H    . LYS A 1 51  ? -3.386  1.228   -11.811 1.00 0.00 ? 51  LYS A H    3  
ATOM   4887  H  HA   . LYS A 1 51  ? -1.676  1.279   -14.191 1.00 0.00 ? 51  LYS A HA   3  
ATOM   4888  H  HB2  . LYS A 1 51  ? -0.708  -0.690  -13.416 1.00 0.00 ? 51  LYS A HB2  3  
ATOM   4889  H  HB3  . LYS A 1 51  ? -0.959  0.310   -11.988 1.00 0.00 ? 51  LYS A HB3  3  
ATOM   4890  H  HG2  . LYS A 1 51  ? -2.995  -1.057  -11.438 1.00 0.00 ? 51  LYS A HG2  3  
ATOM   4891  H  HG3  . LYS A 1 51  ? -2.690  -2.038  -12.872 1.00 0.00 ? 51  LYS A HG3  3  
ATOM   4892  H  HD2  . LYS A 1 51  ? -1.790  -3.294  -11.068 1.00 0.00 ? 51  LYS A HD2  3  
ATOM   4893  H  HD3  . LYS A 1 51  ? -0.424  -2.616  -11.939 1.00 0.00 ? 51  LYS A HD3  3  
ATOM   4894  H  HE2  . LYS A 1 51  ? 0.173   -2.278  -9.712  1.00 0.00 ? 51  LYS A HE2  3  
ATOM   4895  H  HE3  . LYS A 1 51  ? -0.455  -0.699  -10.182 1.00 0.00 ? 51  LYS A HE3  3  
ATOM   4896  H  HZ1  . LYS A 1 51  ? -1.352  -1.347  -8.051  1.00 0.00 ? 51  LYS A HZ1  3  
ATOM   4897  H  HZ2  . LYS A 1 51  ? -2.583  -1.343  -9.091  1.00 0.00 ? 51  LYS A HZ2  3  
ATOM   4898  H  HZ3  . LYS A 1 51  ? -1.913  -2.773  -8.639  1.00 0.00 ? 51  LYS A HZ3  3  
ATOM   4899  N  N    . SER A 1 52  ? -4.574  -0.019  -14.398 1.00 0.00 ? 52  SER A N    3  
ATOM   4900  C  CA   . SER A 1 52  ? -5.518  -0.782  -15.202 1.00 0.00 ? 52  SER A CA   3  
ATOM   4901  C  C    . SER A 1 52  ? -5.592  -0.330  -16.674 1.00 0.00 ? 52  SER A C    3  
ATOM   4902  O  O    . SER A 1 52  ? -6.231  -1.008  -17.481 1.00 0.00 ? 52  SER A O    3  
ATOM   4903  C  CB   . SER A 1 52  ? -6.905  -0.679  -14.558 1.00 0.00 ? 52  SER A CB   3  
ATOM   4904  O  OG   . SER A 1 52  ? -6.846  -0.662  -13.134 1.00 0.00 ? 52  SER A OG   3  
ATOM   4905  H  H    . SER A 1 52  ? -4.953  0.422   -13.571 1.00 0.00 ? 52  SER A H    3  
ATOM   4906  H  HA   . SER A 1 52  ? -5.209  -1.828  -15.182 1.00 0.00 ? 52  SER A HA   3  
ATOM   4907  H  HB2  . SER A 1 52  ? -7.379  0.243   -14.894 1.00 0.00 ? 52  SER A HB2  3  
ATOM   4908  H  HB3  . SER A 1 52  ? -7.507  -1.523  -14.894 1.00 0.00 ? 52  SER A HB3  3  
ATOM   4909  H  HG   . SER A 1 52  ? -7.764  -0.563  -12.825 1.00 0.00 ? 52  SER A HG   3  
ATOM   4910  N  N    . ARG A 1 53  ? -5.015  0.827   -17.034 1.00 0.00 ? 53  ARG A N    3  
ATOM   4911  C  CA   . ARG A 1 53  ? -5.096  1.369   -18.393 1.00 0.00 ? 53  ARG A CA   3  
ATOM   4912  C  C    . ARG A 1 53  ? -4.311  0.461   -19.346 1.00 0.00 ? 53  ARG A C    3  
ATOM   4913  O  O    . ARG A 1 53  ? -3.213  0.010   -19.013 1.00 0.00 ? 53  ARG A O    3  
ATOM   4914  C  CB   . ARG A 1 53  ? -4.607  2.834   -18.369 1.00 0.00 ? 53  ARG A CB   3  
ATOM   4915  C  CG   . ARG A 1 53  ? -4.593  3.571   -19.723 1.00 0.00 ? 53  ARG A CG   3  
ATOM   4916  C  CD   . ARG A 1 53  ? -3.253  3.392   -20.444 1.00 0.00 ? 53  ARG A CD   3  
ATOM   4917  N  NE   . ARG A 1 53  ? -3.179  4.128   -21.714 1.00 0.00 ? 53  ARG A NE   3  
ATOM   4918  C  CZ   . ARG A 1 53  ? -2.168  4.030   -22.590 1.00 0.00 ? 53  ARG A CZ   3  
ATOM   4919  N  NH1  . ARG A 1 53  ? -1.150  3.197   -22.368 1.00 0.00 ? 53  ARG A NH1  3  
ATOM   4920  N  NH2  . ARG A 1 53  ? -2.183  4.770   -23.694 1.00 0.00 ? 53  ARG A NH2  3  
ATOM   4921  H  H    . ARG A 1 53  ? -4.409  1.298   -16.377 1.00 0.00 ? 53  ARG A H    3  
ATOM   4922  H  HA   . ARG A 1 53  ? -6.145  1.361   -18.695 1.00 0.00 ? 53  ARG A HA   3  
ATOM   4923  H  HB2  . ARG A 1 53  ? -5.276  3.388   -17.710 1.00 0.00 ? 53  ARG A HB2  3  
ATOM   4924  H  HB3  . ARG A 1 53  ? -3.613  2.885   -17.926 1.00 0.00 ? 53  ARG A HB3  3  
ATOM   4925  H  HG2  . ARG A 1 53  ? -5.414  3.221   -20.350 1.00 0.00 ? 53  ARG A HG2  3  
ATOM   4926  H  HG3  . ARG A 1 53  ? -4.736  4.635   -19.537 1.00 0.00 ? 53  ARG A HG3  3  
ATOM   4927  H  HD2  . ARG A 1 53  ? -2.448  3.735   -19.792 1.00 0.00 ? 53  ARG A HD2  3  
ATOM   4928  H  HD3  . ARG A 1 53  ? -3.109  2.338   -20.657 1.00 0.00 ? 53  ARG A HD3  3  
ATOM   4929  H  HE   . ARG A 1 53  ? -3.941  4.766   -21.910 1.00 0.00 ? 53  ARG A HE   3  
ATOM   4930  H  HH11 . ARG A 1 53  ? -1.121  2.613   -21.530 1.00 0.00 ? 53  ARG A HH11 3  
ATOM   4931  H  HH12 . ARG A 1 53  ? -0.364  3.134   -22.998 1.00 0.00 ? 53  ARG A HH12 3  
ATOM   4932  H  HH21 . ARG A 1 53  ? -2.942  5.410   -23.886 1.00 0.00 ? 53  ARG A HH21 3  
ATOM   4933  H  HH22 . ARG A 1 53  ? -1.438  4.734   -24.376 1.00 0.00 ? 53  ARG A HH22 3  
ATOM   4934  N  N    . LYS A 1 54  ? -4.838  0.271   -20.563 1.00 0.00 ? 54  LYS A N    3  
ATOM   4935  C  CA   . LYS A 1 54  ? -4.307  -0.648  -21.575 1.00 0.00 ? 54  LYS A CA   3  
ATOM   4936  C  C    . LYS A 1 54  ? -3.975  -1.997  -20.917 1.00 0.00 ? 54  LYS A C    3  
ATOM   4937  O  O    . LYS A 1 54  ? -4.823  -2.539  -20.206 1.00 0.00 ? 54  LYS A O    3  
ATOM   4938  C  CB   . LYS A 1 54  ? -3.171  0.035   -22.370 1.00 0.00 ? 54  LYS A CB   3  
ATOM   4939  C  CG   . LYS A 1 54  ? -2.919  -0.614  -23.742 1.00 0.00 ? 54  LYS A CG   3  
ATOM   4940  C  CD   . LYS A 1 54  ? -1.761  0.076   -24.475 1.00 0.00 ? 54  LYS A CD   3  
ATOM   4941  C  CE   . LYS A 1 54  ? -1.525  -0.601  -25.833 1.00 0.00 ? 54  LYS A CE   3  
ATOM   4942  N  NZ   . LYS A 1 54  ? -0.412  0.023   -26.590 1.00 0.00 ? 54  LYS A NZ   3  
ATOM   4943  H  H    . LYS A 1 54  ? -5.739  0.682   -20.760 1.00 0.00 ? 54  LYS A H    3  
ATOM   4944  H  HA   . LYS A 1 54  ? -5.117  -0.841  -22.281 1.00 0.00 ? 54  LYS A HA   3  
ATOM   4945  H  HB2  . LYS A 1 54  ? -3.448  1.074   -22.551 1.00 0.00 ? 54  LYS A HB2  3  
ATOM   4946  H  HB3  . LYS A 1 54  ? -2.253  0.026   -21.781 1.00 0.00 ? 54  LYS A HB3  3  
ATOM   4947  H  HG2  . LYS A 1 54  ? -2.679  -1.669  -23.623 1.00 0.00 ? 54  LYS A HG2  3  
ATOM   4948  H  HG3  . LYS A 1 54  ? -3.825  -0.531  -24.345 1.00 0.00 ? 54  LYS A HG3  3  
ATOM   4949  H  HD2  . LYS A 1 54  ? -2.008  1.129   -24.628 1.00 0.00 ? 54  LYS A HD2  3  
ATOM   4950  H  HD3  . LYS A 1 54  ? -0.857  0.004   -23.867 1.00 0.00 ? 54  LYS A HD3  3  
ATOM   4951  H  HE2  . LYS A 1 54  ? -1.301  -1.658  -25.665 1.00 0.00 ? 54  LYS A HE2  3  
ATOM   4952  H  HE3  . LYS A 1 54  ? -2.444  -0.541  -26.421 1.00 0.00 ? 54  LYS A HE3  3  
ATOM   4953  H  HZ1  . LYS A 1 54  ? -0.279  -0.444  -27.476 1.00 0.00 ? 54  LYS A HZ1  3  
ATOM   4954  H  HZ2  . LYS A 1 54  ? -0.600  0.995   -26.788 1.00 0.00 ? 54  LYS A HZ2  3  
ATOM   4955  H  HZ3  . LYS A 1 54  ? 0.459   -0.036  -26.084 1.00 0.00 ? 54  LYS A HZ3  3  
ATOM   4956  N  N    . THR A 1 55  ? -2.800  -2.567  -21.175 1.00 0.00 ? 55  THR A N    3  
ATOM   4957  C  CA   . THR A 1 55  ? -2.361  -3.839  -20.623 1.00 0.00 ? 55  THR A CA   3  
ATOM   4958  C  C    . THR A 1 55  ? -2.183  -3.708  -19.106 1.00 0.00 ? 55  THR A C    3  
ATOM   4959  O  O    . THR A 1 55  ? -2.861  -4.396  -18.337 1.00 0.00 ? 55  THR A O    3  
ATOM   4960  C  CB   . THR A 1 55  ? -1.050  -4.235  -21.334 1.00 0.00 ? 55  THR A CB   3  
ATOM   4961  O  OG1  . THR A 1 55  ? -0.227  -3.088  -21.510 1.00 0.00 ? 55  THR A OG1  3  
ATOM   4962  C  CG2  . THR A 1 55  ? -1.336  -4.820  -22.721 1.00 0.00 ? 55  THR A CG2  3  
ATOM   4963  H  H    . THR A 1 55  ? -2.107  -2.081  -21.727 1.00 0.00 ? 55  THR A H    3  
ATOM   4964  H  HA   . THR A 1 55  ? -3.119  -4.600  -20.816 1.00 0.00 ? 55  THR A HA   3  
ATOM   4965  H  HB   . THR A 1 55  ? -0.525  -4.981  -20.736 1.00 0.00 ? 55  THR A HB   3  
ATOM   4966  H  HG1  . THR A 1 55  ? 0.662   -3.390  -21.756 1.00 0.00 ? 55  THR A HG1  3  
ATOM   4967  H  HG21 . THR A 1 55  ? -1.848  -4.090  -23.348 1.00 0.00 ? 55  THR A HG21 3  
ATOM   4968  H  HG22 . THR A 1 55  ? -0.399  -5.110  -23.198 1.00 0.00 ? 55  THR A HG22 3  
ATOM   4969  H  HG23 . THR A 1 55  ? -1.963  -5.707  -22.623 1.00 0.00 ? 55  THR A HG23 3  
ATOM   4970  N  N    . SER A 1 56  ? -1.298  -2.804  -18.682 1.00 0.00 ? 56  SER A N    3  
ATOM   4971  C  CA   . SER A 1 56  ? -0.930  -2.598  -17.283 1.00 0.00 ? 56  SER A CA   3  
ATOM   4972  C  C    . SER A 1 56  ? -0.228  -1.239  -17.074 1.00 0.00 ? 56  SER A C    3  
ATOM   4973  O  O    . SER A 1 56  ? 0.454   -1.033  -16.065 1.00 0.00 ? 56  SER A O    3  
ATOM   4974  C  CB   . SER A 1 56  ? -0.055  -3.781  -16.821 1.00 0.00 ? 56  SER A CB   3  
ATOM   4975  O  OG   . SER A 1 56  ? 0.963   -4.098  -17.763 1.00 0.00 ? 56  SER A OG   3  
ATOM   4976  H  H    . SER A 1 56  ? -0.725  -2.346  -19.379 1.00 0.00 ? 56  SER A H    3  
ATOM   4977  H  HA   . SER A 1 56  ? -1.847  -2.598  -16.690 1.00 0.00 ? 56  SER A HA   3  
ATOM   4978  H  HB2  . SER A 1 56  ? 0.394   -3.555  -15.852 1.00 0.00 ? 56  SER A HB2  3  
ATOM   4979  H  HB3  . SER A 1 56  ? -0.691  -4.657  -16.694 1.00 0.00 ? 56  SER A HB3  3  
ATOM   4980  H  HG   . SER A 1 56  ? 1.468   -4.854  -17.415 1.00 0.00 ? 56  SER A HG   3  
ATOM   4981  N  N    . THR A 1 57  ? -0.321  -0.326  -18.046 1.00 0.00 ? 57  THR A N    3  
ATOM   4982  C  CA   . THR A 1 57  ? 0.371   0.959   -18.004 1.00 0.00 ? 57  THR A CA   3  
ATOM   4983  C  C    . THR A 1 57  ? -0.290  1.884   -16.971 1.00 0.00 ? 57  THR A C    3  
ATOM   4984  O  O    . THR A 1 57  ? -1.511  1.870   -16.807 1.00 0.00 ? 57  THR A O    3  
ATOM   4985  C  CB   . THR A 1 57  ? 0.380   1.586   -19.409 1.00 0.00 ? 57  THR A CB   3  
ATOM   4986  O  OG1  . THR A 1 57  ? -0.883  1.473   -20.040 1.00 0.00 ? 57  THR A OG1  3  
ATOM   4987  C  CG2  . THR A 1 57  ? 1.384   0.891   -20.332 1.00 0.00 ? 57  THR A CG2  3  
ATOM   4988  H  H    . THR A 1 57  ? -0.975  -0.475  -18.803 1.00 0.00 ? 57  THR A H    3  
ATOM   4989  H  HA   . THR A 1 57  ? 1.404   0.786   -17.697 1.00 0.00 ? 57  THR A HA   3  
ATOM   4990  H  HB   . THR A 1 57  ? 0.650   2.639   -19.329 1.00 0.00 ? 57  THR A HB   3  
ATOM   4991  H  HG1  . THR A 1 57  ? -1.551  1.333   -19.346 1.00 0.00 ? 57  THR A HG1  3  
ATOM   4992  H  HG21 . THR A 1 57  ? 1.383   1.380   -21.306 1.00 0.00 ? 57  THR A HG21 3  
ATOM   4993  H  HG22 . THR A 1 57  ? 2.386   0.962   -19.907 1.00 0.00 ? 57  THR A HG22 3  
ATOM   4994  H  HG23 . THR A 1 57  ? 1.121   -0.159  -20.458 1.00 0.00 ? 57  THR A HG23 3  
ATOM   4995  N  N    . ILE A 1 58  ? 0.511   2.706   -16.287 1.00 0.00 ? 58  ILE A N    3  
ATOM   4996  C  CA   . ILE A 1 58  ? 0.005   3.715   -15.362 1.00 0.00 ? 58  ILE A CA   3  
ATOM   4997  C  C    . ILE A 1 58  ? -0.706  4.812   -16.167 1.00 0.00 ? 58  ILE A C    3  
ATOM   4998  O  O    . ILE A 1 58  ? -0.250  5.218   -17.239 1.00 0.00 ? 58  ILE A O    3  
ATOM   4999  C  CB   . ILE A 1 58  ? 1.159   4.286   -14.496 1.00 0.00 ? 58  ILE A CB   3  
ATOM   5000  C  CG1  . ILE A 1 58  ? 1.941   3.193   -13.726 1.00 0.00 ? 58  ILE A CG1  3  
ATOM   5001  C  CG2  . ILE A 1 58  ? 0.666   5.357   -13.502 1.00 0.00 ? 58  ILE A CG2  3  
ATOM   5002  C  CD1  . ILE A 1 58  ? 1.141   2.444   -12.653 1.00 0.00 ? 58  ILE A CD1  3  
ATOM   5003  H  H    . ILE A 1 58  ? 1.504   2.698   -16.470 1.00 0.00 ? 58  ILE A H    3  
ATOM   5004  H  HA   . ILE A 1 58  ? -0.718  3.247   -14.698 1.00 0.00 ? 58  ILE A HA   3  
ATOM   5005  H  HB   . ILE A 1 58  ? 1.866   4.770   -15.170 1.00 0.00 ? 58  ILE A HB   3  
ATOM   5006  H  HG12 . ILE A 1 58  ? 2.327   2.459   -14.433 1.00 0.00 ? 58  ILE A HG12 3  
ATOM   5007  H  HG13 . ILE A 1 58  ? 2.804   3.655   -13.245 1.00 0.00 ? 58  ILE A HG13 3  
ATOM   5008  H  HG21 . ILE A 1 58  ? -0.181  4.981   -12.931 1.00 0.00 ? 58  ILE A HG21 3  
ATOM   5009  H  HG22 . ILE A 1 58  ? 1.465   5.641   -12.813 1.00 0.00 ? 58  ILE A HG22 3  
ATOM   5010  H  HG23 . ILE A 1 58  ? 0.356   6.253   -14.039 1.00 0.00 ? 58  ILE A HG23 3  
ATOM   5011  H  HD11 . ILE A 1 58  ? 0.258   1.994   -13.097 1.00 0.00 ? 58  ILE A HD11 3  
ATOM   5012  H  HD12 . ILE A 1 58  ? 1.762   1.656   -12.226 1.00 0.00 ? 58  ILE A HD12 3  
ATOM   5013  H  HD13 . ILE A 1 58  ? 0.844   3.123   -11.854 1.00 0.00 ? 58  ILE A HD13 3  
ATOM   5014  N  N    . GLU A 1 59  ? -1.794  5.324   -15.603 1.00 0.00 ? 59  GLU A N    3  
ATOM   5015  C  CA   . GLU A 1 59  ? -2.531  6.504   -16.018 1.00 0.00 ? 59  GLU A CA   3  
ATOM   5016  C  C    . GLU A 1 59  ? -2.756  7.264   -14.707 1.00 0.00 ? 59  GLU A C    3  
ATOM   5017  O  O    . GLU A 1 59  ? -2.916  6.637   -13.657 1.00 0.00 ? 59  GLU A O    3  
ATOM   5018  C  CB   . GLU A 1 59  ? -3.841  6.082   -16.704 1.00 0.00 ? 59  GLU A CB   3  
ATOM   5019  C  CG   . GLU A 1 59  ? -4.725  7.279   -17.084 1.00 0.00 ? 59  GLU A CG   3  
ATOM   5020  C  CD   . GLU A 1 59  ? -5.963  6.850   -17.890 1.00 0.00 ? 59  GLU A CD   3  
ATOM   5021  O  OE1  . GLU A 1 59  ? -6.817  6.113   -17.347 1.00 0.00 ? 59  GLU A OE1  3  
ATOM   5022  O  OE2  . GLU A 1 59  ? -6.104  7.273   -19.061 1.00 0.00 ? 59  GLU A OE2  3  
ATOM   5023  H  H    . GLU A 1 59  ? -2.153  4.897   -14.754 1.00 0.00 ? 59  GLU A H    3  
ATOM   5024  H  HA   . GLU A 1 59  ? -1.930  7.105   -16.703 1.00 0.00 ? 59  GLU A HA   3  
ATOM   5025  H  HB2  . GLU A 1 59  ? -3.588  5.533   -17.611 1.00 0.00 ? 59  GLU A HB2  3  
ATOM   5026  H  HB3  . GLU A 1 59  ? -4.400  5.421   -16.041 1.00 0.00 ? 59  GLU A HB3  3  
ATOM   5027  H  HG2  . GLU A 1 59  ? -5.057  7.785   -16.176 1.00 0.00 ? 59  GLU A HG2  3  
ATOM   5028  H  HG3  . GLU A 1 59  ? -4.130  7.985   -17.666 1.00 0.00 ? 59  GLU A HG3  3  
ATOM   5029  N  N    . GLU A 1 60  ? -2.745  8.595   -14.733 1.00 0.00 ? 60  GLU A N    3  
ATOM   5030  C  CA   . GLU A 1 60  ? -2.724  9.393   -13.512 1.00 0.00 ? 60  GLU A CA   3  
ATOM   5031  C  C    . GLU A 1 60  ? -3.927  10.329  -13.456 1.00 0.00 ? 60  GLU A C    3  
ATOM   5032  O  O    . GLU A 1 60  ? -4.229  11.022  -14.432 1.00 0.00 ? 60  GLU A O    3  
ATOM   5033  C  CB   . GLU A 1 60  ? -1.416  10.196  -13.435 1.00 0.00 ? 60  GLU A CB   3  
ATOM   5034  C  CG   . GLU A 1 60  ? -0.183  9.306   -13.233 1.00 0.00 ? 60  GLU A CG   3  
ATOM   5035  C  CD   . GLU A 1 60  ? 1.096   10.142  -13.061 1.00 0.00 ? 60  GLU A CD   3  
ATOM   5036  O  OE1  . GLU A 1 60  ? 1.206   10.885  -12.059 1.00 0.00 ? 60  GLU A OE1  3  
ATOM   5037  O  OE2  . GLU A 1 60  ? 2.001   10.062  -13.924 1.00 0.00 ? 60  GLU A OE2  3  
ATOM   5038  H  H    . GLU A 1 60  ? -2.684  9.091   -15.611 1.00 0.00 ? 60  GLU A H    3  
ATOM   5039  H  HA   . GLU A 1 60  ? -2.753  8.743   -12.641 1.00 0.00 ? 60  GLU A HA   3  
ATOM   5040  H  HB2  . GLU A 1 60  ? -1.291  10.784  -14.346 1.00 0.00 ? 60  GLU A HB2  3  
ATOM   5041  H  HB3  . GLU A 1 60  ? -1.487  10.882  -12.592 1.00 0.00 ? 60  GLU A HB3  3  
ATOM   5042  H  HG2  . GLU A 1 60  ? -0.335  8.688   -12.347 1.00 0.00 ? 60  GLU A HG2  3  
ATOM   5043  H  HG3  . GLU A 1 60  ? -0.075  8.642   -14.093 1.00 0.00 ? 60  GLU A HG3  3  
ATOM   5044  N  N    . LYS A 1 61  ? -4.576  10.384  -12.290 1.00 0.00 ? 61  LYS A N    3  
ATOM   5045  C  CA   . LYS A 1 61  ? -5.608  11.365  -11.953 1.00 0.00 ? 61  LYS A CA   3  
ATOM   5046  C  C    . LYS A 1 61  ? -5.288  11.876  -10.553 1.00 0.00 ? 61  LYS A C    3  
ATOM   5047  O  O    . LYS A 1 61  ? -4.737  11.128  -9.744  1.00 0.00 ? 61  LYS A O    3  
ATOM   5048  C  CB   . LYS A 1 61  ? -7.008  10.727  -11.987 1.00 0.00 ? 61  LYS A CB   3  
ATOM   5049  C  CG   . LYS A 1 61  ? -7.442  10.323  -13.406 1.00 0.00 ? 61  LYS A CG   3  
ATOM   5050  C  CD   . LYS A 1 61  ? -8.893  9.820   -13.462 1.00 0.00 ? 61  LYS A CD   3  
ATOM   5051  C  CE   . LYS A 1 61  ? -9.078  8.493   -12.708 1.00 0.00 ? 61  LYS A CE   3  
ATOM   5052  N  NZ   . LYS A 1 61  ? -10.466 7.975   -12.825 1.00 0.00 ? 61  LYS A NZ   3  
ATOM   5053  H  H    . LYS A 1 61  ? -4.325  9.720   -11.529 1.00 0.00 ? 61  LYS A H    3  
ATOM   5054  H  HA   . LYS A 1 61  ? -5.570  12.200  -12.655 1.00 0.00 ? 61  LYS A HA   3  
ATOM   5055  H  HB2  . LYS A 1 61  ? -7.018  9.852   -11.336 1.00 0.00 ? 61  LYS A HB2  3  
ATOM   5056  H  HB3  . LYS A 1 61  ? -7.727  11.450  -11.597 1.00 0.00 ? 61  LYS A HB3  3  
ATOM   5057  H  HG2  . LYS A 1 61  ? -7.358  11.195  -14.057 1.00 0.00 ? 61  LYS A HG2  3  
ATOM   5058  H  HG3  . LYS A 1 61  ? -6.781  9.544   -13.787 1.00 0.00 ? 61  LYS A HG3  3  
ATOM   5059  H  HD2  . LYS A 1 61  ? -9.551  10.581  -13.037 1.00 0.00 ? 61  LYS A HD2  3  
ATOM   5060  H  HD3  . LYS A 1 61  ? -9.162  9.677   -14.510 1.00 0.00 ? 61  LYS A HD3  3  
ATOM   5061  H  HE2  . LYS A 1 61  ? -8.377  7.759   -13.113 1.00 0.00 ? 61  LYS A HE2  3  
ATOM   5062  H  HE3  . LYS A 1 61  ? -8.835  8.646   -11.654 1.00 0.00 ? 61  LYS A HE3  3  
ATOM   5063  H  HZ1  . LYS A 1 61  ? -10.711 7.794   -13.788 1.00 0.00 ? 61  LYS A HZ1  3  
ATOM   5064  H  HZ2  . LYS A 1 61  ? -10.568 7.110   -12.311 1.00 0.00 ? 61  LYS A HZ2  3  
ATOM   5065  H  HZ3  . LYS A 1 61  ? -11.135 8.634   -12.453 1.00 0.00 ? 61  LYS A HZ3  3  
ATOM   5066  N  N    . THR A 1 62  ? -5.632  13.121  -10.245 1.00 0.00 ? 62  THR A N    3  
ATOM   5067  C  CA   . THR A 1 62  ? -5.318  13.727  -8.956  1.00 0.00 ? 62  THR A CA   3  
ATOM   5068  C  C    . THR A 1 62  ? -6.618  13.745  -8.156  1.00 0.00 ? 62  THR A C    3  
ATOM   5069  O  O    . THR A 1 62  ? -7.637  14.246  -8.638  1.00 0.00 ? 62  THR A O    3  
ATOM   5070  C  CB   . THR A 1 62  ? -4.690  15.110  -9.188  1.00 0.00 ? 62  THR A CB   3  
ATOM   5071  O  OG1  . THR A 1 62  ? -3.632  15.014  -10.129 1.00 0.00 ? 62  THR A OG1  3  
ATOM   5072  C  CG2  . THR A 1 62  ? -4.092  15.671  -7.901  1.00 0.00 ? 62  THR A CG2  3  
ATOM   5073  H  H    . THR A 1 62  ? -6.161  13.675  -10.902 1.00 0.00 ? 62  THR A H    3  
ATOM   5074  H  HA   . THR A 1 62  ? -4.593  13.114  -8.421  1.00 0.00 ? 62  THR A HA   3  
ATOM   5075  H  HB   . THR A 1 62  ? -5.445  15.801  -9.565  1.00 0.00 ? 62  THR A HB   3  
ATOM   5076  H  HG1  . THR A 1 62  ? -4.020  14.902  -11.010 1.00 0.00 ? 62  THR A HG1  3  
ATOM   5077  H  HG21 . THR A 1 62  ? -4.879  15.791  -7.160  1.00 0.00 ? 62  THR A HG21 3  
ATOM   5078  H  HG22 . THR A 1 62  ? -3.328  14.996  -7.513  1.00 0.00 ? 62  THR A HG22 3  
ATOM   5079  H  HG23 . THR A 1 62  ? -3.646  16.647  -8.100  1.00 0.00 ? 62  THR A HG23 3  
ATOM   5080  N  N    . VAL A 1 63  ? -6.605  13.176  -6.949  1.00 0.00 ? 63  VAL A N    3  
ATOM   5081  C  CA   . VAL A 1 63  ? -7.817  12.922  -6.189  1.00 0.00 ? 63  VAL A CA   3  
ATOM   5082  C  C    . VAL A 1 63  ? -7.625  13.265  -4.712  1.00 0.00 ? 63  VAL A C    3  
ATOM   5083  O  O    . VAL A 1 63  ? -6.516  13.270  -4.177  1.00 0.00 ? 63  VAL A O    3  
ATOM   5084  C  CB   . VAL A 1 63  ? -8.262  11.449  -6.371  1.00 0.00 ? 63  VAL A CB   3  
ATOM   5085  C  CG1  . VAL A 1 63  ? -8.585  11.090  -7.832  1.00 0.00 ? 63  VAL A CG1  3  
ATOM   5086  C  CG2  . VAL A 1 63  ? -7.234  10.424  -5.864  1.00 0.00 ? 63  VAL A CG2  3  
ATOM   5087  H  H    . VAL A 1 63  ? -5.735  12.842  -6.543  1.00 0.00 ? 63  VAL A H    3  
ATOM   5088  H  HA   . VAL A 1 63  ? -8.618  13.553  -6.571  1.00 0.00 ? 63  VAL A HA   3  
ATOM   5089  H  HB   . VAL A 1 63  ? -9.180  11.315  -5.799  1.00 0.00 ? 63  VAL A HB   3  
ATOM   5090  H  HG11 . VAL A 1 63  ? -7.680  11.084  -8.441  1.00 0.00 ? 63  VAL A HG11 3  
ATOM   5091  H  HG12 . VAL A 1 63  ? -9.043  10.103  -7.871  1.00 0.00 ? 63  VAL A HG12 3  
ATOM   5092  H  HG13 . VAL A 1 63  ? -9.287  11.808  -8.247  1.00 0.00 ? 63  VAL A HG13 3  
ATOM   5093  H  HG21 . VAL A 1 63  ? -6.327  10.459  -6.468  1.00 0.00 ? 63  VAL A HG21 3  
ATOM   5094  H  HG22 . VAL A 1 63  ? -6.973  10.628  -4.826  1.00 0.00 ? 63  VAL A HG22 3  
ATOM   5095  H  HG23 . VAL A 1 63  ? -7.660  9.423   -5.921  1.00 0.00 ? 63  VAL A HG23 3  
ATOM   5096  N  N    . GLU A 1 64  ? -8.735  13.550  -4.049  1.00 0.00 ? 64  GLU A N    3  
ATOM   5097  C  CA   . GLU A 1 64  ? -8.826  13.683  -2.607  1.00 0.00 ? 64  GLU A CA   3  
ATOM   5098  C  C    . GLU A 1 64  ? -9.511  12.399  -2.149  1.00 0.00 ? 64  GLU A C    3  
ATOM   5099  O  O    . GLU A 1 64  ? -10.556 12.039  -2.691  1.00 0.00 ? 64  GLU A O    3  
ATOM   5100  C  CB   . GLU A 1 64  ? -9.625  14.944  -2.237  1.00 0.00 ? 64  GLU A CB   3  
ATOM   5101  C  CG   . GLU A 1 64  ? -9.677  15.133  -0.715  1.00 0.00 ? 64  GLU A CG   3  
ATOM   5102  C  CD   . GLU A 1 64  ? -10.347 16.465  -0.332  1.00 0.00 ? 64  GLU A CD   3  
ATOM   5103  O  OE1  . GLU A 1 64  ? -11.586 16.504  -0.163  1.00 0.00 ? 64  GLU A OE1  3  
ATOM   5104  O  OE2  . GLU A 1 64  ? -9.636  17.484  -0.174  1.00 0.00 ? 64  GLU A OE2  3  
ATOM   5105  H  H    . GLU A 1 64  ? -9.604  13.555  -4.571  1.00 0.00 ? 64  GLU A H    3  
ATOM   5106  H  HA   . GLU A 1 64  ? -7.832  13.750  -2.168  1.00 0.00 ? 64  GLU A HA   3  
ATOM   5107  H  HB2  . GLU A 1 64  ? -9.148  15.817  -2.686  1.00 0.00 ? 64  GLU A HB2  3  
ATOM   5108  H  HB3  . GLU A 1 64  ? -10.638 14.871  -2.634  1.00 0.00 ? 64  GLU A HB3  3  
ATOM   5109  H  HG2  . GLU A 1 64  ? -10.225 14.303  -0.264  1.00 0.00 ? 64  GLU A HG2  3  
ATOM   5110  H  HG3  . GLU A 1 64  ? -8.658  15.110  -0.320  1.00 0.00 ? 64  GLU A HG3  3  
ATOM   5111  N  N    . VAL A 1 65  ? -8.920  11.678  -1.203  1.00 0.00 ? 65  VAL A N    3  
ATOM   5112  C  CA   . VAL A 1 65  ? -9.413  10.386  -0.753  1.00 0.00 ? 65  VAL A CA   3  
ATOM   5113  C  C    . VAL A 1 65  ? -10.123 10.576  0.583   1.00 0.00 ? 65  VAL A C    3  
ATOM   5114  O  O    . VAL A 1 65  ? -9.579  11.193  1.501   1.00 0.00 ? 65  VAL A O    3  
ATOM   5115  C  CB   . VAL A 1 65  ? -8.311  9.304   -0.751  1.00 0.00 ? 65  VAL A CB   3  
ATOM   5116  C  CG1  . VAL A 1 65  ? -7.329  9.423   -1.930  1.00 0.00 ? 65  VAL A CG1  3  
ATOM   5117  C  CG2  . VAL A 1 65  ? -7.542  9.112   0.547   1.00 0.00 ? 65  VAL A CG2  3  
ATOM   5118  H  H    . VAL A 1 65  ? -8.056  12.011  -0.790  1.00 0.00 ? 65  VAL A H    3  
ATOM   5119  H  HA   . VAL A 1 65  ? -10.152 10.043  -1.472  1.00 0.00 ? 65  VAL A HA   3  
ATOM   5120  H  HB   . VAL A 1 65  ? -8.842  8.371   -0.848  1.00 0.00 ? 65  VAL A HB   3  
ATOM   5121  H  HG11 . VAL A 1 65  ? -7.878  9.544   -2.863  1.00 0.00 ? 65  VAL A HG11 3  
ATOM   5122  H  HG12 . VAL A 1 65  ? -6.668  10.280  -1.790  1.00 0.00 ? 65  VAL A HG12 3  
ATOM   5123  H  HG13 . VAL A 1 65  ? -6.722  8.520   -1.993  1.00 0.00 ? 65  VAL A HG13 3  
ATOM   5124  H  HG21 . VAL A 1 65  ? -6.821  8.305   0.429   1.00 0.00 ? 65  VAL A HG21 3  
ATOM   5125  H  HG22 . VAL A 1 65  ? -7.027  10.019  0.843   1.00 0.00 ? 65  VAL A HG22 3  
ATOM   5126  H  HG23 . VAL A 1 65  ? -8.259  8.820   1.306   1.00 0.00 ? 65  VAL A HG23 3  
ATOM   5127  N  N    . LEU A 1 66  ? -11.353 10.074  0.681   1.00 0.00 ? 66  LEU A N    3  
ATOM   5128  C  CA   . LEU A 1 66  ? -12.239 10.355  1.803   1.00 0.00 ? 66  LEU A CA   3  
ATOM   5129  C  C    . LEU A 1 66  ? -12.062 9.336   2.931   1.00 0.00 ? 66  LEU A C    3  
ATOM   5130  O  O    . LEU A 1 66  ? -12.418 9.633   4.073   1.00 0.00 ? 66  LEU A O    3  
ATOM   5131  C  CB   . LEU A 1 66  ? -13.713 10.351  1.345   1.00 0.00 ? 66  LEU A CB   3  
ATOM   5132  C  CG   . LEU A 1 66  ? -14.163 11.428  0.333   1.00 0.00 ? 66  LEU A CG   3  
ATOM   5133  C  CD1  . LEU A 1 66  ? -13.711 12.839  0.730   1.00 0.00 ? 66  LEU A CD1  3  
ATOM   5134  C  CD2  . LEU A 1 66  ? -13.724 11.135  -1.107  1.00 0.00 ? 66  LEU A CD2  3  
ATOM   5135  H  H    . LEU A 1 66  ? -11.748 9.577   -0.121  1.00 0.00 ? 66  LEU A H    3  
ATOM   5136  H  HA   . LEU A 1 66  ? -12.002 11.340  2.204   1.00 0.00 ? 66  LEU A HA   3  
ATOM   5137  H  HB2  . LEU A 1 66  ? -13.961 9.366   0.946   1.00 0.00 ? 66  LEU A HB2  3  
ATOM   5138  H  HB3  . LEU A 1 66  ? -14.327 10.486  2.237   1.00 0.00 ? 66  LEU A HB3  3  
ATOM   5139  H  HG   . LEU A 1 66  ? -15.254 11.422  0.334   1.00 0.00 ? 66  LEU A HG   3  
ATOM   5140  H  HD11 . LEU A 1 66  ? -14.020 13.051  1.754   1.00 0.00 ? 66  LEU A HD11 3  
ATOM   5141  H  HD12 . LEU A 1 66  ? -12.627 12.932  0.652   1.00 0.00 ? 66  LEU A HD12 3  
ATOM   5142  H  HD13 . LEU A 1 66  ? -14.174 13.571  0.068   1.00 0.00 ? 66  LEU A HD13 3  
ATOM   5143  H  HD21 . LEU A 1 66  ? -13.985 10.111  -1.374  1.00 0.00 ? 66  LEU A HD21 3  
ATOM   5144  H  HD22 . LEU A 1 66  ? -14.243 11.812  -1.785  1.00 0.00 ? 66  LEU A HD22 3  
ATOM   5145  H  HD23 . LEU A 1 66  ? -12.654 11.286  -1.230  1.00 0.00 ? 66  LEU A HD23 3  
ATOM   5146  N  N    . GLY A 1 67  ? -11.544 8.142   2.634   1.00 0.00 ? 67  GLY A N    3  
ATOM   5147  C  CA   . GLY A 1 67  ? -11.523 7.023   3.556   1.00 0.00 ? 67  GLY A CA   3  
ATOM   5148  C  C    . GLY A 1 67  ? -11.366 5.728   2.773   1.00 0.00 ? 67  GLY A C    3  
ATOM   5149  O  O    . GLY A 1 67  ? -11.387 5.725   1.538   1.00 0.00 ? 67  GLY A O    3  
ATOM   5150  H  H    . GLY A 1 67  ? -11.243 7.937   1.688   1.00 0.00 ? 67  GLY A H    3  
ATOM   5151  H  HA2  . GLY A 1 67  ? -10.711 7.130   4.268   1.00 0.00 ? 67  GLY A HA2  3  
ATOM   5152  H  HA3  . GLY A 1 67  ? -12.462 6.984   4.109   1.00 0.00 ? 67  GLY A HA3  3  
ATOM   5153  N  N    . MET A 1 68  ? -11.219 4.622   3.496   1.00 0.00 ? 68  MET A N    3  
ATOM   5154  C  CA   . MET A 1 68  ? -11.284 3.285   2.912   1.00 0.00 ? 68  MET A CA   3  
ATOM   5155  C  C    . MET A 1 68  ? -12.689 3.066   2.344   1.00 0.00 ? 68  MET A C    3  
ATOM   5156  O  O    . MET A 1 68  ? -13.671 3.612   2.859   1.00 0.00 ? 68  MET A O    3  
ATOM   5157  C  CB   . MET A 1 68  ? -10.993 2.199   3.963   1.00 0.00 ? 68  MET A CB   3  
ATOM   5158  C  CG   . MET A 1 68  ? -9.566  2.206   4.522   1.00 0.00 ? 68  MET A CG   3  
ATOM   5159  S  SD   . MET A 1 68  ? -8.245  1.727   3.371   1.00 0.00 ? 68  MET A SD   3  
ATOM   5160  C  CE   . MET A 1 68  ? -8.500  -0.068  3.313   1.00 0.00 ? 68  MET A CE   3  
ATOM   5161  H  H    . MET A 1 68  ? -11.215 4.717   4.496   1.00 0.00 ? 68  MET A H    3  
ATOM   5162  H  HA   . MET A 1 68  ? -10.565 3.215   2.098   1.00 0.00 ? 68  MET A HA   3  
ATOM   5163  H  HB2  . MET A 1 68  ? -11.688 2.324   4.794   1.00 0.00 ? 68  MET A HB2  3  
ATOM   5164  H  HB3  . MET A 1 68  ? -11.182 1.222   3.518   1.00 0.00 ? 68  MET A HB3  3  
ATOM   5165  H  HG2  . MET A 1 68  ? -9.353  3.204   4.898   1.00 0.00 ? 68  MET A HG2  3  
ATOM   5166  H  HG3  . MET A 1 68  ? -9.531  1.525   5.373   1.00 0.00 ? 68  MET A HG3  3  
ATOM   5167  H  HE1  . MET A 1 68  ? -9.473  -0.292  2.876   1.00 0.00 ? 68  MET A HE1  3  
ATOM   5168  H  HE2  . MET A 1 68  ? -7.721  -0.523  2.702   1.00 0.00 ? 68  MET A HE2  3  
ATOM   5169  H  HE3  . MET A 1 68  ? -8.449  -0.485  4.320   1.00 0.00 ? 68  MET A HE3  3  
ATOM   5170  N  N    . ALA A 1 69  ? -12.787 2.249   1.295   1.00 0.00 ? 69  ALA A N    3  
ATOM   5171  C  CA   . ALA A 1 69  ? -14.070 1.774   0.794   1.00 0.00 ? 69  ALA A CA   3  
ATOM   5172  C  C    . ALA A 1 69  ? -14.670 0.792   1.822   1.00 0.00 ? 69  ALA A C    3  
ATOM   5173  O  O    . ALA A 1 69  ? -13.977 0.403   2.771   1.00 0.00 ? 69  ALA A O    3  
ATOM   5174  C  CB   . ALA A 1 69  ? -13.869 1.127   -0.579  1.00 0.00 ? 69  ALA A CB   3  
ATOM   5175  H  H    . ALA A 1 69  ? -11.949 1.783   0.962   1.00 0.00 ? 69  ALA A H    3  
ATOM   5176  H  HA   . ALA A 1 69  ? -14.738 2.626   0.685   1.00 0.00 ? 69  ALA A HA   3  
ATOM   5177  H  HB1  . ALA A 1 69  ? -14.821 1.046   -1.102  1.00 0.00 ? 69  ALA A HB1  3  
ATOM   5178  H  HB2  . ALA A 1 69  ? -13.197 1.733   -1.185  1.00 0.00 ? 69  ALA A HB2  3  
ATOM   5179  H  HB3  . ALA A 1 69  ? -13.460 0.130   -0.449  1.00 0.00 ? 69  ALA A HB3  3  
ATOM   5180  N  N    . PRO A 1 70  ? -15.943 0.385   1.677   1.00 0.00 ? 70  PRO A N    3  
ATOM   5181  C  CA   . PRO A 1 70  ? -16.575 -0.526  2.614   1.00 0.00 ? 70  PRO A CA   3  
ATOM   5182  C  C    . PRO A 1 70  ? -15.801 -1.828  2.823   1.00 0.00 ? 70  PRO A C    3  
ATOM   5183  O  O    . PRO A 1 70  ? -15.306 -2.462  1.885   1.00 0.00 ? 70  PRO A O    3  
ATOM   5184  C  CB   . PRO A 1 70  ? -17.973 -0.804  2.062   1.00 0.00 ? 70  PRO A CB   3  
ATOM   5185  C  CG   . PRO A 1 70  ? -18.282 0.454   1.254   1.00 0.00 ? 70  PRO A CG   3  
ATOM   5186  C  CD   . PRO A 1 70  ? -16.914 0.838   0.691   1.00 0.00 ? 70  PRO A CD   3  
ATOM   5187  H  HA   . PRO A 1 70  ? -16.673 0.000   3.566   1.00 0.00 ? 70  PRO A HA   3  
ATOM   5188  H  HB2  . PRO A 1 70  ? -17.951 -1.667  1.395   1.00 0.00 ? 70  PRO A HB2  3  
ATOM   5189  H  HB3  . PRO A 1 70  ? -18.689 -0.962  2.870   1.00 0.00 ? 70  PRO A HB3  3  
ATOM   5190  H  HG2  . PRO A 1 70  ? -19.007 0.262   0.463   1.00 0.00 ? 70  PRO A HG2  3  
ATOM   5191  H  HG3  . PRO A 1 70  ? -18.638 1.241   1.921   1.00 0.00 ? 70  PRO A HG3  3  
ATOM   5192  H  HD2  . PRO A 1 70  ? -16.750 0.308   -0.247  1.00 0.00 ? 70  PRO A HD2  3  
ATOM   5193  H  HD3  . PRO A 1 70  ? -16.863 1.916   0.534   1.00 0.00 ? 70  PRO A HD3  3  
ATOM   5194  N  N    . ASP A 1 71  ? -15.806 -2.278  4.074   1.00 0.00 ? 71  ASP A N    3  
ATOM   5195  C  CA   . ASP A 1 71  ? -15.333 -3.595  4.491   1.00 0.00 ? 71  ASP A CA   3  
ATOM   5196  C  C    . ASP A 1 71  ? -16.092 -4.723  3.777   1.00 0.00 ? 71  ASP A C    3  
ATOM   5197  O  O    . ASP A 1 71  ? -15.586 -5.837  3.675   1.00 0.00 ? 71  ASP A O    3  
ATOM   5198  C  CB   . ASP A 1 71  ? -15.495 -3.749  6.010   1.00 0.00 ? 71  ASP A CB   3  
ATOM   5199  C  CG   . ASP A 1 71  ? -16.950 -4.002  6.442   1.00 0.00 ? 71  ASP A CG   3  
ATOM   5200  O  OD1  . ASP A 1 71  ? -17.747 -3.038  6.469   1.00 0.00 ? 71  ASP A OD1  3  
ATOM   5201  O  OD2  . ASP A 1 71  ? -17.301 -5.155  6.782   1.00 0.00 ? 71  ASP A OD2  3  
ATOM   5202  H  H    . ASP A 1 71  ? -16.214 -1.691  4.787   1.00 0.00 ? 71  ASP A H    3  
ATOM   5203  H  HA   . ASP A 1 71  ? -14.274 -3.669  4.246   1.00 0.00 ? 71  ASP A HA   3  
ATOM   5204  H  HB2  . ASP A 1 71  ? -14.896 -4.598  6.321   1.00 0.00 ? 71  ASP A HB2  3  
ATOM   5205  H  HB3  . ASP A 1 71  ? -15.097 -2.865  6.514   1.00 0.00 ? 71  ASP A HB3  3  
ATOM   5206  N  N    . ASP A 1 72  ? -17.285 -4.426  3.251   1.00 0.00 ? 72  ASP A N    3  
ATOM   5207  C  CA   . ASP A 1 72  ? -18.129 -5.351  2.497   1.00 0.00 ? 72  ASP A CA   3  
ATOM   5208  C  C    . ASP A 1 72  ? -17.510 -5.751  1.151   1.00 0.00 ? 72  ASP A C    3  
ATOM   5209  O  O    . ASP A 1 72  ? -17.879 -6.787  0.597   1.00 0.00 ? 72  ASP A O    3  
ATOM   5210  C  CB   . ASP A 1 72  ? -19.501 -4.703  2.267   1.00 0.00 ? 72  ASP A CB   3  
ATOM   5211  C  CG   . ASP A 1 72  ? -20.461 -5.639  1.512   1.00 0.00 ? 72  ASP A CG   3  
ATOM   5212  O  OD1  . ASP A 1 72  ? -20.898 -6.660  2.090   1.00 0.00 ? 72  ASP A OD1  3  
ATOM   5213  O  OD2  . ASP A 1 72  ? -20.835 -5.327  0.358   1.00 0.00 ? 72  ASP A OD2  3  
ATOM   5214  H  H    . ASP A 1 72  ? -17.626 -3.485  3.372   1.00 0.00 ? 72  ASP A H    3  
ATOM   5215  H  HA   . ASP A 1 72  ? -18.270 -6.253  3.092   1.00 0.00 ? 72  ASP A HA   3  
ATOM   5216  H  HB2  . ASP A 1 72  ? -19.939 -4.443  3.233   1.00 0.00 ? 72  ASP A HB2  3  
ATOM   5217  H  HB3  . ASP A 1 72  ? -19.367 -3.778  1.701   1.00 0.00 ? 72  ASP A HB3  3  
ATOM   5218  N  N    . GLU A 1 73  ? -16.556 -4.968  0.630   1.00 0.00 ? 73  GLU A N    3  
ATOM   5219  C  CA   . GLU A 1 73  ? -15.933 -5.213  -0.673  1.00 0.00 ? 73  GLU A CA   3  
ATOM   5220  C  C    . GLU A 1 73  ? -14.404 -5.265  -0.601  1.00 0.00 ? 73  GLU A C    3  
ATOM   5221  O  O    . GLU A 1 73  ? -13.779 -5.858  -1.481  1.00 0.00 ? 73  GLU A O    3  
ATOM   5222  C  CB   . GLU A 1 73  ? -16.442 -4.204  -1.717  1.00 0.00 ? 73  GLU A CB   3  
ATOM   5223  C  CG   . GLU A 1 73  ? -16.084 -2.737  -1.432  1.00 0.00 ? 73  GLU A CG   3  
ATOM   5224  C  CD   . GLU A 1 73  ? -16.593 -1.825  -2.563  1.00 0.00 ? 73  GLU A CD   3  
ATOM   5225  O  OE1  . GLU A 1 73  ? -15.852 -1.599  -3.547  1.00 0.00 ? 73  GLU A OE1  3  
ATOM   5226  O  OE2  . GLU A 1 73  ? -17.742 -1.335  -2.488  1.00 0.00 ? 73  GLU A OE2  3  
ATOM   5227  H  H    . GLU A 1 73  ? -16.285 -4.130  1.134   1.00 0.00 ? 73  GLU A H    3  
ATOM   5228  H  HA   . GLU A 1 73  ? -16.245 -6.197  -1.025  1.00 0.00 ? 73  GLU A HA   3  
ATOM   5229  H  HB2  . GLU A 1 73  ? -16.031 -4.480  -2.688  1.00 0.00 ? 73  GLU A HB2  3  
ATOM   5230  H  HB3  . GLU A 1 73  ? -17.528 -4.291  -1.782  1.00 0.00 ? 73  GLU A HB3  3  
ATOM   5231  H  HG2  . GLU A 1 73  ? -16.537 -2.431  -0.488  1.00 0.00 ? 73  GLU A HG2  3  
ATOM   5232  H  HG3  . GLU A 1 73  ? -15.001 -2.636  -1.336  1.00 0.00 ? 73  GLU A HG3  3  
ATOM   5233  N  N    . CYS A 1 74  ? -13.784 -4.743  0.464   1.00 0.00 ? 74  CYS A N    3  
ATOM   5234  C  CA   . CYS A 1 74  ? -12.337 -4.828  0.670   1.00 0.00 ? 74  CYS A CA   3  
ATOM   5235  C  C    . CYS A 1 74  ? -11.912 -6.210  1.204   1.00 0.00 ? 74  CYS A C    3  
ATOM   5236  O  O    . CYS A 1 74  ? -11.134 -6.303  2.153   1.00 0.00 ? 74  CYS A O    3  
ATOM   5237  C  CB   . CYS A 1 74  ? -11.865 -3.692  1.580   1.00 0.00 ? 74  CYS A CB   3  
ATOM   5238  S  SG   . CYS A 1 74  ? -12.262 -2.086  0.839   1.00 0.00 ? 74  CYS A SG   3  
ATOM   5239  H  H    . CYS A 1 74  ? -14.335 -4.262  1.166   1.00 0.00 ? 74  CYS A H    3  
ATOM   5240  H  HA   . CYS A 1 74  ? -11.853 -4.699  -0.298  1.00 0.00 ? 74  CYS A HA   3  
ATOM   5241  H  HB2  . CYS A 1 74  ? -12.335 -3.782  2.560   1.00 0.00 ? 74  CYS A HB2  3  
ATOM   5242  H  HB3  . CYS A 1 74  ? -10.783 -3.773  1.693   1.00 0.00 ? 74  CYS A HB3  3  
ATOM   5243  H  HG   . CYS A 1 74  ? -13.588 -2.163  1.044   1.00 0.00 ? 74  CYS A HG   3  
ATOM   5244  N  N    . LEU A 1 75  ? -12.457 -7.289  0.633   1.00 0.00 ? 75  LEU A N    3  
ATOM   5245  C  CA   . LEU A 1 75  ? -12.233 -8.670  1.072   1.00 0.00 ? 75  LEU A CA   3  
ATOM   5246  C  C    . LEU A 1 75  ? -11.284 -9.425  0.131   1.00 0.00 ? 75  LEU A C    3  
ATOM   5247  O  O    . LEU A 1 75  ? -10.941 -10.574 0.409   1.00 0.00 ? 75  LEU A O    3  
ATOM   5248  C  CB   . LEU A 1 75  ? -13.586 -9.399  1.195   1.00 0.00 ? 75  LEU A CB   3  
ATOM   5249  C  CG   . LEU A 1 75  ? -14.454 -8.877  2.357   1.00 0.00 ? 75  LEU A CG   3  
ATOM   5250  C  CD1  . LEU A 1 75  ? -15.895 -9.367  2.196   1.00 0.00 ? 75  LEU A CD1  3  
ATOM   5251  C  CD2  . LEU A 1 75  ? -13.924 -9.327  3.726   1.00 0.00 ? 75  LEU A CD2  3  
ATOM   5252  H  H    . LEU A 1 75  ? -13.096 -7.137  -0.140  1.00 0.00 ? 75  LEU A H    3  
ATOM   5253  H  HA   . LEU A 1 75  ? -11.765 -8.654  2.054   1.00 0.00 ? 75  LEU A HA   3  
ATOM   5254  H  HB2  . LEU A 1 75  ? -14.124 -9.284  0.252   1.00 0.00 ? 75  LEU A HB2  3  
ATOM   5255  H  HB3  . LEU A 1 75  ? -13.412 -10.466 1.347   1.00 0.00 ? 75  LEU A HB3  3  
ATOM   5256  H  HG   . LEU A 1 75  ? -14.466 -7.789  2.324   1.00 0.00 ? 75  LEU A HG   3  
ATOM   5257  H  HD11 . LEU A 1 75  ? -16.294 -9.018  1.243   1.00 0.00 ? 75  LEU A HD11 3  
ATOM   5258  H  HD12 . LEU A 1 75  ? -15.932 -10.456 2.225   1.00 0.00 ? 75  LEU A HD12 3  
ATOM   5259  H  HD13 . LEU A 1 75  ? -16.512 -8.959  2.997   1.00 0.00 ? 75  LEU A HD13 3  
ATOM   5260  H  HD21 . LEU A 1 75  ? -13.981 -10.411 3.815   1.00 0.00 ? 75  LEU A HD21 3  
ATOM   5261  H  HD22 . LEU A 1 75  ? -12.891 -9.014  3.863   1.00 0.00 ? 75  LEU A HD22 3  
ATOM   5262  H  HD23 . LEU A 1 75  ? -14.523 -8.869  4.515   1.00 0.00 ? 75  LEU A HD23 3  
ATOM   5263  N  N    . LYS A 1 76  ? -10.853 -8.800  -0.974  1.00 0.00 ? 76  LYS A N    3  
ATOM   5264  C  CA   . LYS A 1 76  ? -10.005 -9.422  -2.000  1.00 0.00 ? 76  LYS A CA   3  
ATOM   5265  C  C    . LYS A 1 76  ? -8.827  -8.528  -2.396  1.00 0.00 ? 76  LYS A C    3  
ATOM   5266  O  O    . LYS A 1 76  ? -7.821  -9.036  -2.888  1.00 0.00 ? 76  LYS A O    3  
ATOM   5267  C  CB   . LYS A 1 76  ? -10.844 -9.764  -3.245  1.00 0.00 ? 76  LYS A CB   3  
ATOM   5268  C  CG   . LYS A 1 76  ? -11.959 -10.785 -2.961  1.00 0.00 ? 76  LYS A CG   3  
ATOM   5269  C  CD   . LYS A 1 76  ? -12.709 -11.153 -4.251  1.00 0.00 ? 76  LYS A CD   3  
ATOM   5270  C  CE   . LYS A 1 76  ? -13.880 -12.116 -3.998  1.00 0.00 ? 76  LYS A CE   3  
ATOM   5271  N  NZ   . LYS A 1 76  ? -13.441 -13.473 -3.581  1.00 0.00 ? 76  LYS A NZ   3  
ATOM   5272  H  H    . LYS A 1 76  ? -11.190 -7.866  -1.146  1.00 0.00 ? 76  LYS A H    3  
ATOM   5273  H  HA   . LYS A 1 76  ? -9.588  -10.350 -1.609  1.00 0.00 ? 76  LYS A HA   3  
ATOM   5274  H  HB2  . LYS A 1 76  ? -11.285 -8.849  -3.645  1.00 0.00 ? 76  LYS A HB2  3  
ATOM   5275  H  HB3  . LYS A 1 76  ? -10.180 -10.181 -4.005  1.00 0.00 ? 76  LYS A HB3  3  
ATOM   5276  H  HG2  . LYS A 1 76  ? -11.515 -11.681 -2.527  1.00 0.00 ? 76  LYS A HG2  3  
ATOM   5277  H  HG3  . LYS A 1 76  ? -12.669 -10.360 -2.251  1.00 0.00 ? 76  LYS A HG3  3  
ATOM   5278  H  HD2  . LYS A 1 76  ? -13.114 -10.239 -4.690  1.00 0.00 ? 76  LYS A HD2  3  
ATOM   5279  H  HD3  . LYS A 1 76  ? -12.017 -11.595 -4.969  1.00 0.00 ? 76  LYS A HD3  3  
ATOM   5280  H  HE2  . LYS A 1 76  ? -14.534 -11.687 -3.235  1.00 0.00 ? 76  LYS A HE2  3  
ATOM   5281  H  HE3  . LYS A 1 76  ? -14.459 -12.200 -4.922  1.00 0.00 ? 76  LYS A HE3  3  
ATOM   5282  H  HZ1  . LYS A 1 76  ? -14.240 -14.078 -3.453  1.00 0.00 ? 76  LYS A HZ1  3  
ATOM   5283  H  HZ2  . LYS A 1 76  ? -12.851 -13.898 -4.280  1.00 0.00 ? 76  LYS A HZ2  3  
ATOM   5284  H  HZ3  . LYS A 1 76  ? -12.937 -13.447 -2.708  1.00 0.00 ? 76  LYS A HZ3  3  
ATOM   5285  N  N    . ASP A 1 77  ? -8.938  -7.219  -2.176  1.00 0.00 ? 77  ASP A N    3  
ATOM   5286  C  CA   . ASP A 1 77  ? -7.922  -6.196  -2.410  1.00 0.00 ? 77  ASP A CA   3  
ATOM   5287  C  C    . ASP A 1 77  ? -8.346  -4.993  -1.555  1.00 0.00 ? 77  ASP A C    3  
ATOM   5288  O  O    . ASP A 1 77  ? -9.477  -4.974  -1.052  1.00 0.00 ? 77  ASP A O    3  
ATOM   5289  C  CB   . ASP A 1 77  ? -7.870  -5.839  -3.907  1.00 0.00 ? 77  ASP A CB   3  
ATOM   5290  C  CG   . ASP A 1 77  ? -6.710  -4.912  -4.312  1.00 0.00 ? 77  ASP A CG   3  
ATOM   5291  O  OD1  . ASP A 1 77  ? -5.774  -4.689  -3.512  1.00 0.00 ? 77  ASP A OD1  3  
ATOM   5292  O  OD2  . ASP A 1 77  ? -6.714  -4.444  -5.472  1.00 0.00 ? 77  ASP A OD2  3  
ATOM   5293  H  H    . ASP A 1 77  ? -9.764  -6.857  -1.722  1.00 0.00 ? 77  ASP A H    3  
ATOM   5294  H  HA   . ASP A 1 77  ? -6.945  -6.558  -2.088  1.00 0.00 ? 77  ASP A HA   3  
ATOM   5295  H  HB2  . ASP A 1 77  ? -7.773  -6.762  -4.482  1.00 0.00 ? 77  ASP A HB2  3  
ATOM   5296  H  HB3  . ASP A 1 77  ? -8.815  -5.376  -4.188  1.00 0.00 ? 77  ASP A HB3  3  
ATOM   5297  N  N    . MET A 1 78  ? -7.472  -4.010  -1.352  1.00 0.00 ? 78  MET A N    3  
ATOM   5298  C  CA   . MET A 1 78  ? -7.785  -2.814  -0.568  1.00 0.00 ? 78  MET A CA   3  
ATOM   5299  C  C    . MET A 1 78  ? -8.252  -1.694  -1.499  1.00 0.00 ? 78  MET A C    3  
ATOM   5300  O  O    . MET A 1 78  ? -7.702  -1.515  -2.589  1.00 0.00 ? 78  MET A O    3  
ATOM   5301  C  CB   . MET A 1 78  ? -6.553  -2.373  0.235   1.00 0.00 ? 78  MET A CB   3  
ATOM   5302  C  CG   . MET A 1 78  ? -6.188  -3.346  1.363   1.00 0.00 ? 78  MET A CG   3  
ATOM   5303  S  SD   . MET A 1 78  ? -7.395  -3.483  2.713   1.00 0.00 ? 78  MET A SD   3  
ATOM   5304  C  CE   . MET A 1 78  ? -8.102  -5.113  2.348   1.00 0.00 ? 78  MET A CE   3  
ATOM   5305  H  H    . MET A 1 78  ? -6.585  -4.050  -1.853  1.00 0.00 ? 78  MET A H    3  
ATOM   5306  H  HA   . MET A 1 78  ? -8.590  -3.037  0.133   1.00 0.00 ? 78  MET A HA   3  
ATOM   5307  H  HB2  . MET A 1 78  ? -5.703  -2.280  -0.441  1.00 0.00 ? 78  MET A HB2  3  
ATOM   5308  H  HB3  . MET A 1 78  ? -6.745  -1.395  0.676   1.00 0.00 ? 78  MET A HB3  3  
ATOM   5309  H  HG2  . MET A 1 78  ? -6.021  -4.336  0.940   1.00 0.00 ? 78  MET A HG2  3  
ATOM   5310  H  HG3  . MET A 1 78  ? -5.244  -3.013  1.792   1.00 0.00 ? 78  MET A HG3  3  
ATOM   5311  H  HE1  . MET A 1 78  ? -8.586  -5.095  1.373   1.00 0.00 ? 78  MET A HE1  3  
ATOM   5312  H  HE2  . MET A 1 78  ? -7.314  -5.866  2.351   1.00 0.00 ? 78  MET A HE2  3  
ATOM   5313  H  HE3  . MET A 1 78  ? -8.841  -5.371  3.105   1.00 0.00 ? 78  MET A HE3  3  
ATOM   5314  N  N    . TYR A 1 79  ? -9.226  -0.892  -1.055  1.00 0.00 ? 79  TYR A N    3  
ATOM   5315  C  CA   . TYR A 1 79  ? -9.852  0.159   -1.856  1.00 0.00 ? 79  TYR A CA   3  
ATOM   5316  C  C    . TYR A 1 79  ? -10.150 1.382   -0.984  1.00 0.00 ? 79  TYR A C    3  
ATOM   5317  O  O    . TYR A 1 79  ? -10.268 1.272   0.238   1.00 0.00 ? 79  TYR A O    3  
ATOM   5318  C  CB   . TYR A 1 79  ? -11.159 -0.349  -2.489  1.00 0.00 ? 79  TYR A CB   3  
ATOM   5319  C  CG   . TYR A 1 79  ? -11.076 -1.562  -3.398  1.00 0.00 ? 79  TYR A CG   3  
ATOM   5320  C  CD1  . TYR A 1 79  ? -11.199 -2.853  -2.851  1.00 0.00 ? 79  TYR A CD1  3  
ATOM   5321  C  CD2  . TYR A 1 79  ? -10.975 -1.403  -4.794  1.00 0.00 ? 79  TYR A CD2  3  
ATOM   5322  C  CE1  . TYR A 1 79  ? -11.217 -3.983  -3.684  1.00 0.00 ? 79  TYR A CE1  3  
ATOM   5323  C  CE2  . TYR A 1 79  ? -10.995 -2.530  -5.636  1.00 0.00 ? 79  TYR A CE2  3  
ATOM   5324  C  CZ   . TYR A 1 79  ? -11.112 -3.828  -5.085  1.00 0.00 ? 79  TYR A CZ   3  
ATOM   5325  O  OH   . TYR A 1 79  ? -11.132 -4.914  -5.908  1.00 0.00 ? 79  TYR A OH   3  
ATOM   5326  H  H    . TYR A 1 79  ? -9.602  -1.028  -0.126  1.00 0.00 ? 79  TYR A H    3  
ATOM   5327  H  HA   . TYR A 1 79  ? -9.173  0.470   -2.646  1.00 0.00 ? 79  TYR A HA   3  
ATOM   5328  H  HB2  . TYR A 1 79  ? -11.846 -0.597  -1.686  1.00 0.00 ? 79  TYR A HB2  3  
ATOM   5329  H  HB3  . TYR A 1 79  ? -11.610 0.467   -3.052  1.00 0.00 ? 79  TYR A HB3  3  
ATOM   5330  H  HD1  . TYR A 1 79  ? -11.291 -2.981  -1.782  1.00 0.00 ? 79  TYR A HD1  3  
ATOM   5331  H  HD2  . TYR A 1 79  ? -10.902 -0.414  -5.225  1.00 0.00 ? 79  TYR A HD2  3  
ATOM   5332  H  HE1  . TYR A 1 79  ? -11.318 -4.965  -3.242  1.00 0.00 ? 79  TYR A HE1  3  
ATOM   5333  H  HE2  . TYR A 1 79  ? -10.927 -2.402  -6.707  1.00 0.00 ? 79  TYR A HE2  3  
ATOM   5334  H  HH   . TYR A 1 79  ? -11.213 -5.757  -5.434  1.00 0.00 ? 79  TYR A HH   3  
ATOM   5335  N  N    . VAL A 1 80  ? -10.306 2.540   -1.625  1.00 0.00 ? 80  VAL A N    3  
ATOM   5336  C  CA   . VAL A 1 80  ? -10.507 3.840   -0.997  1.00 0.00 ? 80  VAL A CA   3  
ATOM   5337  C  C    . VAL A 1 80  ? -11.556 4.603   -1.803  1.00 0.00 ? 80  VAL A C    3  
ATOM   5338  O  O    . VAL A 1 80  ? -11.613 4.477   -3.028  1.00 0.00 ? 80  VAL A O    3  
ATOM   5339  C  CB   . VAL A 1 80  ? -9.175  4.623   -0.902  1.00 0.00 ? 80  VAL A CB   3  
ATOM   5340  C  CG1  . VAL A 1 80  ? -8.320  4.129   0.272   1.00 0.00 ? 80  VAL A CG1  3  
ATOM   5341  C  CG2  . VAL A 1 80  ? -8.322  4.557   -2.182  1.00 0.00 ? 80  VAL A CG2  3  
ATOM   5342  H  H    . VAL A 1 80  ? -10.230 2.536   -2.638  1.00 0.00 ? 80  VAL A H    3  
ATOM   5343  H  HA   . VAL A 1 80  ? -10.898 3.702   0.007   1.00 0.00 ? 80  VAL A HA   3  
ATOM   5344  H  HB   . VAL A 1 80  ? -9.410  5.671   -0.709  1.00 0.00 ? 80  VAL A HB   3  
ATOM   5345  H  HG11 . VAL A 1 80  ? -8.068  3.076   0.149   1.00 0.00 ? 80  VAL A HG11 3  
ATOM   5346  H  HG12 . VAL A 1 80  ? -7.405  4.717   0.334   1.00 0.00 ? 80  VAL A HG12 3  
ATOM   5347  H  HG13 . VAL A 1 80  ? -8.869  4.261   1.202   1.00 0.00 ? 80  VAL A HG13 3  
ATOM   5348  H  HG21 . VAL A 1 80  ? -7.452  5.205   -2.077  1.00 0.00 ? 80  VAL A HG21 3  
ATOM   5349  H  HG22 . VAL A 1 80  ? -7.986  3.537   -2.374  1.00 0.00 ? 80  VAL A HG22 3  
ATOM   5350  H  HG23 . VAL A 1 80  ? -8.910  4.902   -3.031  1.00 0.00 ? 80  VAL A HG23 3  
ATOM   5351  N  N    . GLU A 1 81  ? -12.395 5.377   -1.120  1.00 0.00 ? 81  GLU A N    3  
ATOM   5352  C  CA   . GLU A 1 81  ? -13.315 6.310   -1.760  1.00 0.00 ? 81  GLU A CA   3  
ATOM   5353  C  C    . GLU A 1 81  ? -12.523 7.565   -2.122  1.00 0.00 ? 81  GLU A C    3  
ATOM   5354  O  O    . GLU A 1 81  ? -11.735 8.047   -1.302  1.00 0.00 ? 81  GLU A O    3  
ATOM   5355  C  CB   . GLU A 1 81  ? -14.472 6.674   -0.819  1.00 0.00 ? 81  GLU A CB   3  
ATOM   5356  C  CG   . GLU A 1 81  ? -15.379 5.474   -0.524  1.00 0.00 ? 81  GLU A CG   3  
ATOM   5357  C  CD   . GLU A 1 81  ? -16.634 5.895   0.262   1.00 0.00 ? 81  GLU A CD   3  
ATOM   5358  O  OE1  . GLU A 1 81  ? -16.550 6.109   1.493   1.00 0.00 ? 81  GLU A OE1  3  
ATOM   5359  O  OE2  . GLU A 1 81  ? -17.726 6.002   -0.341  1.00 0.00 ? 81  GLU A OE2  3  
ATOM   5360  H  H    . GLU A 1 81  ? -12.227 5.497   -0.125  1.00 0.00 ? 81  GLU A H    3  
ATOM   5361  H  HA   . GLU A 1 81  ? -13.720 5.855   -2.664  1.00 0.00 ? 81  GLU A HA   3  
ATOM   5362  H  HB2  . GLU A 1 81  ? -14.072 7.063   0.118   1.00 0.00 ? 81  GLU A HB2  3  
ATOM   5363  H  HB3  . GLU A 1 81  ? -15.069 7.454   -1.292  1.00 0.00 ? 81  GLU A HB3  3  
ATOM   5364  H  HG2  . GLU A 1 81  ? -15.675 5.010   -1.468  1.00 0.00 ? 81  GLU A HG2  3  
ATOM   5365  H  HG3  . GLU A 1 81  ? -14.819 4.736   0.051   1.00 0.00 ? 81  GLU A HG3  3  
ATOM   5366  N  N    . VAL A 1 82  ? -12.730 8.112   -3.320  1.00 0.00 ? 82  VAL A N    3  
ATOM   5367  C  CA   . VAL A 1 82  ? -11.931 9.219   -3.838  1.00 0.00 ? 82  VAL A CA   3  
ATOM   5368  C  C    . VAL A 1 82  ? -12.822 10.186  -4.616  1.00 0.00 ? 82  VAL A C    3  
ATOM   5369  O  O    . VAL A 1 82  ? -13.796 9.763   -5.234  1.00 0.00 ? 82  VAL A O    3  
ATOM   5370  C  CB   . VAL A 1 82  ? -10.750 8.697   -4.696  1.00 0.00 ? 82  VAL A CB   3  
ATOM   5371  C  CG1  . VAL A 1 82  ? -9.890  7.645   -3.980  1.00 0.00 ? 82  VAL A CG1  3  
ATOM   5372  C  CG2  . VAL A 1 82  ? -11.164 8.105   -6.053  1.00 0.00 ? 82  VAL A CG2  3  
ATOM   5373  H  H    . VAL A 1 82  ? -13.444 7.723   -3.930  1.00 0.00 ? 82  VAL A H    3  
ATOM   5374  H  HA   . VAL A 1 82  ? -11.520 9.764   -2.993  1.00 0.00 ? 82  VAL A HA   3  
ATOM   5375  H  HB   . VAL A 1 82  ? -10.105 9.549   -4.892  1.00 0.00 ? 82  VAL A HB   3  
ATOM   5376  H  HG11 . VAL A 1 82  ? -10.425 6.698   -3.913  1.00 0.00 ? 82  VAL A HG11 3  
ATOM   5377  H  HG12 . VAL A 1 82  ? -8.962  7.489   -4.530  1.00 0.00 ? 82  VAL A HG12 3  
ATOM   5378  H  HG13 . VAL A 1 82  ? -9.650  7.984   -2.977  1.00 0.00 ? 82  VAL A HG13 3  
ATOM   5379  H  HG21 . VAL A 1 82  ? -11.642 8.870   -6.665  1.00 0.00 ? 82  VAL A HG21 3  
ATOM   5380  H  HG22 . VAL A 1 82  ? -10.282 7.756   -6.588  1.00 0.00 ? 82  VAL A HG22 3  
ATOM   5381  H  HG23 . VAL A 1 82  ? -11.852 7.271   -5.910  1.00 0.00 ? 82  VAL A HG23 3  
ATOM   5382  N  N    . ALA A 1 83  ? -12.478 11.470  -4.639  1.00 0.00 ? 83  ALA A N    3  
ATOM   5383  C  CA   . ALA A 1 83  ? -13.165 12.503  -5.397  1.00 0.00 ? 83  ALA A CA   3  
ATOM   5384  C  C    . ALA A 1 83  ? -12.118 13.193  -6.262  1.00 0.00 ? 83  ALA A C    3  
ATOM   5385  O  O    . ALA A 1 83  ? -11.008 13.475  -5.805  1.00 0.00 ? 83  ALA A O    3  
ATOM   5386  C  CB   . ALA A 1 83  ? -13.848 13.490  -4.446  1.00 0.00 ? 83  ALA A CB   3  
ATOM   5387  H  H    . ALA A 1 83  ? -11.653 11.766  -4.125  1.00 0.00 ? 83  ALA A H    3  
ATOM   5388  H  HA   . ALA A 1 83  ? -13.928 12.056  -6.037  1.00 0.00 ? 83  ALA A HA   3  
ATOM   5389  H  HB1  . ALA A 1 83  ? -14.620 12.976  -3.874  1.00 0.00 ? 83  ALA A HB1  3  
ATOM   5390  H  HB2  . ALA A 1 83  ? -13.114 13.923  -3.766  1.00 0.00 ? 83  ALA A HB2  3  
ATOM   5391  H  HB3  . ALA A 1 83  ? -14.314 14.288  -5.026  1.00 0.00 ? 83  ALA A HB3  3  
ATOM   5392  N  N    . ASP A 1 84  ? -12.456 13.422  -7.527  1.00 0.00 ? 84  ASP A N    3  
ATOM   5393  C  CA   . ASP A 1 84  ? -11.540 14.007  -8.503  1.00 0.00 ? 84  ASP A CA   3  
ATOM   5394  C  C    . ASP A 1 84  ? -11.293 15.482  -8.197  1.00 0.00 ? 84  ASP A C    3  
ATOM   5395  O  O    . ASP A 1 84  ? -12.241 16.262  -8.121  1.00 0.00 ? 84  ASP A O    3  
ATOM   5396  C  CB   . ASP A 1 84  ? -12.133 13.869  -9.906  1.00 0.00 ? 84  ASP A CB   3  
ATOM   5397  C  CG   . ASP A 1 84  ? -11.324 14.671  -10.930 1.00 0.00 ? 84  ASP A CG   3  
ATOM   5398  O  OD1  . ASP A 1 84  ? -10.086 14.512  -10.982 1.00 0.00 ? 84  ASP A OD1  3  
ATOM   5399  O  OD2  . ASP A 1 84  ? -11.935 15.488  -11.650 1.00 0.00 ? 84  ASP A OD2  3  
ATOM   5400  H  H    . ASP A 1 84  ? -13.401 13.209  -7.820  1.00 0.00 ? 84  ASP A H    3  
ATOM   5401  H  HA   . ASP A 1 84  ? -10.584 13.483  -8.464  1.00 0.00 ? 84  ASP A HA   3  
ATOM   5402  H  HB2  . ASP A 1 84  ? -12.161 12.818  -10.195 1.00 0.00 ? 84  ASP A HB2  3  
ATOM   5403  H  HB3  . ASP A 1 84  ? -13.153 14.255  -9.885  1.00 0.00 ? 84  ASP A HB3  3  
ATOM   5404  N  N    . ILE A 1 85  ? -10.028 15.880  -8.053  1.00 0.00 ? 85  ILE A N    3  
ATOM   5405  C  CA   . ILE A 1 85  ? -9.655  17.277  -7.835  1.00 0.00 ? 85  ILE A CA   3  
ATOM   5406  C  C    . ILE A 1 85  ? -9.628  18.019  -9.187  1.00 0.00 ? 85  ILE A C    3  
ATOM   5407  O  O    . ILE A 1 85  ? -9.784  19.242  -9.213  1.00 0.00 ? 85  ILE A O    3  
ATOM   5408  C  CB   . ILE A 1 85  ? -8.319  17.347  -7.048  1.00 0.00 ? 85  ILE A CB   3  
ATOM   5409  C  CG1  . ILE A 1 85  ? -8.462  16.662  -5.666  1.00 0.00 ? 85  ILE A CG1  3  
ATOM   5410  C  CG2  . ILE A 1 85  ? -7.844  18.791  -6.808  1.00 0.00 ? 85  ILE A CG2  3  
ATOM   5411  C  CD1  . ILE A 1 85  ? -7.149  16.547  -4.879  1.00 0.00 ? 85  ILE A CD1  3  
ATOM   5412  H  H    . ILE A 1 85  ? -9.277  15.209  -8.191  1.00 0.00 ? 85  ILE A H    3  
ATOM   5413  H  HA   . ILE A 1 85  ? -10.418 17.744  -7.215  1.00 0.00 ? 85  ILE A HA   3  
ATOM   5414  H  HB   . ILE A 1 85  ? -7.559  16.828  -7.629  1.00 0.00 ? 85  ILE A HB   3  
ATOM   5415  H  HG12 . ILE A 1 85  ? -9.186  17.209  -5.061  1.00 0.00 ? 85  ILE A HG12 3  
ATOM   5416  H  HG13 . ILE A 1 85  ? -8.849  15.656  -5.800  1.00 0.00 ? 85  ILE A HG13 3  
ATOM   5417  H  HG21 . ILE A 1 85  ? -8.561  19.309  -6.169  1.00 0.00 ? 85  ILE A HG21 3  
ATOM   5418  H  HG22 . ILE A 1 85  ? -6.868  18.797  -6.329  1.00 0.00 ? 85  ILE A HG22 3  
ATOM   5419  H  HG23 . ILE A 1 85  ? -7.733  19.325  -7.749  1.00 0.00 ? 85  ILE A HG23 3  
ATOM   5420  H  HD11 . ILE A 1 85  ? -6.778  17.527  -4.583  1.00 0.00 ? 85  ILE A HD11 3  
ATOM   5421  H  HD12 . ILE A 1 85  ? -7.315  15.978  -3.969  1.00 0.00 ? 85  ILE A HD12 3  
ATOM   5422  H  HD13 . ILE A 1 85  ? -6.404  16.030  -5.481  1.00 0.00 ? 85  ILE A HD13 3  
ATOM   5423  N  N    . GLY A 1 86  ? -9.467  17.307  -10.313 1.00 0.00 ? 86  GLY A N    3  
ATOM   5424  C  CA   . GLY A 1 86  ? -9.364  17.894  -11.645 1.00 0.00 ? 86  GLY A CA   3  
ATOM   5425  C  C    . GLY A 1 86  ? -10.582 18.748  -12.006 1.00 0.00 ? 86  GLY A C    3  
ATOM   5426  O  O    . GLY A 1 86  ? -10.419 19.859  -12.518 1.00 0.00 ? 86  GLY A O    3  
ATOM   5427  H  H    . GLY A 1 86  ? -9.437  16.292  -10.263 1.00 0.00 ? 86  GLY A H    3  
ATOM   5428  H  HA2  . GLY A 1 86  ? -8.463  18.505  -11.697 1.00 0.00 ? 86  GLY A HA2  3  
ATOM   5429  H  HA3  . GLY A 1 86  ? -9.280  17.085  -12.371 1.00 0.00 ? 86  GLY A HA3  3  
ATOM   5430  N  N    . GLY A 1 87  ? -11.790 18.271  -11.697 1.00 0.00 ? 87  GLY A N    3  
ATOM   5431  C  CA   . GLY A 1 87  ? -13.020 19.027  -11.895 1.00 0.00 ? 87  GLY A CA   3  
ATOM   5432  C  C    . GLY A 1 87  ? -14.284 18.316  -11.415 1.00 0.00 ? 87  GLY A C    3  
ATOM   5433  O  O    . GLY A 1 87  ? -15.229 18.991  -11.006 1.00 0.00 ? 87  GLY A O    3  
ATOM   5434  H  H    . GLY A 1 87  ? -11.858 17.311  -11.366 1.00 0.00 ? 87  GLY A H    3  
ATOM   5435  H  HA2  . GLY A 1 87  ? -12.934 19.978  -11.371 1.00 0.00 ? 87  GLY A HA2  3  
ATOM   5436  H  HA3  . GLY A 1 87  ? -13.129 19.221  -12.961 1.00 0.00 ? 87  GLY A HA3  3  
ATOM   5437  N  N    . LYS A 1 88  ? -14.327 16.978  -11.405 1.00 0.00 ? 88  LYS A N    3  
ATOM   5438  C  CA   . LYS A 1 88  ? -15.517 16.208  -11.020 1.00 0.00 ? 88  LYS A CA   3  
ATOM   5439  C  C    . LYS A 1 88  ? -15.616 16.053  -9.493  1.00 0.00 ? 88  LYS A C    3  
ATOM   5440  O  O    . LYS A 1 88  ? -16.072 15.025  -8.998  1.00 0.00 ? 88  LYS A O    3  
ATOM   5441  C  CB   . LYS A 1 88  ? -15.554 14.855  -11.764 1.00 0.00 ? 88  LYS A CB   3  
ATOM   5442  C  CG   . LYS A 1 88  ? -15.446 14.938  -13.298 1.00 0.00 ? 88  LYS A CG   3  
ATOM   5443  C  CD   . LYS A 1 88  ? -16.573 15.761  -13.947 1.00 0.00 ? 88  LYS A CD   3  
ATOM   5444  C  CE   . LYS A 1 88  ? -16.470 15.789  -15.480 1.00 0.00 ? 88  LYS A CE   3  
ATOM   5445  N  NZ   . LYS A 1 88  ? -16.744 14.472  -16.109 1.00 0.00 ? 88  LYS A NZ   3  
ATOM   5446  H  H    . LYS A 1 88  ? -13.496 16.450  -11.672 1.00 0.00 ? 88  LYS A H    3  
ATOM   5447  H  HA   . LYS A 1 88  ? -16.397 16.777  -11.323 1.00 0.00 ? 88  LYS A HA   3  
ATOM   5448  H  HB2  . LYS A 1 88  ? -14.746 14.222  -11.406 1.00 0.00 ? 88  LYS A HB2  3  
ATOM   5449  H  HB3  . LYS A 1 88  ? -16.493 14.357  -11.520 1.00 0.00 ? 88  LYS A HB3  3  
ATOM   5450  H  HG2  . LYS A 1 88  ? -14.483 15.369  -13.573 1.00 0.00 ? 88  LYS A HG2  3  
ATOM   5451  H  HG3  . LYS A 1 88  ? -15.480 13.920  -13.686 1.00 0.00 ? 88  LYS A HG3  3  
ATOM   5452  H  HD2  . LYS A 1 88  ? -17.543 15.359  -13.650 1.00 0.00 ? 88  LYS A HD2  3  
ATOM   5453  H  HD3  . LYS A 1 88  ? -16.509 16.791  -13.594 1.00 0.00 ? 88  LYS A HD3  3  
ATOM   5454  H  HE2  . LYS A 1 88  ? -17.191 16.519  -15.858 1.00 0.00 ? 88  LYS A HE2  3  
ATOM   5455  H  HE3  . LYS A 1 88  ? -15.472 16.133  -15.761 1.00 0.00 ? 88  LYS A HE3  3  
ATOM   5456  H  HZ1  . LYS A 1 88  ? -16.076 13.775  -15.817 1.00 0.00 ? 88  LYS A HZ1  3  
ATOM   5457  H  HZ2  . LYS A 1 88  ? -17.671 14.143  -15.882 1.00 0.00 ? 88  LYS A HZ2  3  
ATOM   5458  H  HZ3  . LYS A 1 88  ? -16.688 14.542  -17.115 1.00 0.00 ? 88  LYS A HZ3  3  
ATOM   5459  N  N    . ASP A 1 89  ? -15.197 17.073  -8.741  1.00 0.00 ? 89  ASP A N    3  
ATOM   5460  C  CA   . ASP A 1 89  ? -15.240 17.115  -7.275  1.00 0.00 ? 89  ASP A CA   3  
ATOM   5461  C  C    . ASP A 1 89  ? -16.674 17.003  -6.740  1.00 0.00 ? 89  ASP A C    3  
ATOM   5462  O  O    . ASP A 1 89  ? -16.890 16.588  -5.602  1.00 0.00 ? 89  ASP A O    3  
ATOM   5463  C  CB   . ASP A 1 89  ? -14.609 18.427  -6.793  1.00 0.00 ? 89  ASP A CB   3  
ATOM   5464  C  CG   . ASP A 1 89  ? -14.674 18.568  -5.263  1.00 0.00 ? 89  ASP A CG   3  
ATOM   5465  O  OD1  . ASP A 1 89  ? -13.934 17.854  -4.551  1.00 0.00 ? 89  ASP A OD1  3  
ATOM   5466  O  OD2  . ASP A 1 89  ? -15.430 19.435  -4.767  1.00 0.00 ? 89  ASP A OD2  3  
ATOM   5467  H  H    . ASP A 1 89  ? -14.857 17.898  -9.214  1.00 0.00 ? 89  ASP A H    3  
ATOM   5468  H  HA   . ASP A 1 89  ? -14.654 16.284  -6.882  1.00 0.00 ? 89  ASP A HA   3  
ATOM   5469  H  HB2  . ASP A 1 89  ? -13.567 18.470  -7.118  1.00 0.00 ? 89  ASP A HB2  3  
ATOM   5470  H  HB3  . ASP A 1 89  ? -15.134 19.264  -7.260  1.00 0.00 ? 89  ASP A HB3  3  
ATOM   5471  N  N    . ASP A 1 90  ? -17.659 17.350  -7.575  1.00 0.00 ? 90  ASP A N    3  
ATOM   5472  C  CA   . ASP A 1 90  ? -19.090 17.237  -7.289  1.00 0.00 ? 90  ASP A CA   3  
ATOM   5473  C  C    . ASP A 1 90  ? -19.554 15.782  -7.094  1.00 0.00 ? 90  ASP A C    3  
ATOM   5474  O  O    . ASP A 1 90  ? -20.667 15.551  -6.620  1.00 0.00 ? 90  ASP A O    3  
ATOM   5475  C  CB   . ASP A 1 90  ? -19.872 17.896  -8.435  1.00 0.00 ? 90  ASP A CB   3  
ATOM   5476  C  CG   . ASP A 1 90  ? -21.389 17.916  -8.181  1.00 0.00 ? 90  ASP A CG   3  
ATOM   5477  O  OD1  . ASP A 1 90  ? -21.841 18.604  -7.237  1.00 0.00 ? 90  ASP A OD1  3  
ATOM   5478  O  OD2  . ASP A 1 90  ? -22.148 17.299  -8.963  1.00 0.00 ? 90  ASP A OD2  3  
ATOM   5479  H  H    . ASP A 1 90  ? -17.403 17.701  -8.485  1.00 0.00 ? 90  ASP A H    3  
ATOM   5480  H  HA   . ASP A 1 90  ? -19.300 17.789  -6.371  1.00 0.00 ? 90  ASP A HA   3  
ATOM   5481  H  HB2  . ASP A 1 90  ? -19.521 18.923  -8.560  1.00 0.00 ? 90  ASP A HB2  3  
ATOM   5482  H  HB3  . ASP A 1 90  ? -19.659 17.358  -9.362  1.00 0.00 ? 90  ASP A HB3  3  
ATOM   5483  N  N    . ASP A 1 91  ? -18.719 14.791  -7.427  1.00 0.00 ? 91  ASP A N    3  
ATOM   5484  C  CA   . ASP A 1 91  ? -19.038 13.367  -7.345  1.00 0.00 ? 91  ASP A CA   3  
ATOM   5485  C  C    . ASP A 1 91  ? -17.847 12.594  -6.762  1.00 0.00 ? 91  ASP A C    3  
ATOM   5486  O  O    . ASP A 1 91  ? -16.745 13.130  -6.623  1.00 0.00 ? 91  ASP A O    3  
ATOM   5487  C  CB   . ASP A 1 91  ? -19.432 12.850  -8.740  1.00 0.00 ? 91  ASP A CB   3  
ATOM   5488  C  CG   . ASP A 1 91  ? -20.034 11.431  -8.724  1.00 0.00 ? 91  ASP A CG   3  
ATOM   5489  O  OD1  . ASP A 1 91  ? -20.597 11.010  -7.689  1.00 0.00 ? 91  ASP A OD1  3  
ATOM   5490  O  OD2  . ASP A 1 91  ? -19.989 10.749  -9.773  1.00 0.00 ? 91  ASP A OD2  3  
ATOM   5491  H  H    . ASP A 1 91  ? -17.774 15.012  -7.727  1.00 0.00 ? 91  ASP A H    3  
ATOM   5492  H  HA   . ASP A 1 91  ? -19.890 13.228  -6.678  1.00 0.00 ? 91  ASP A HA   3  
ATOM   5493  H  HB2  . ASP A 1 91  ? -20.174 13.527  -9.169  1.00 0.00 ? 91  ASP A HB2  3  
ATOM   5494  H  HB3  . ASP A 1 91  ? -18.549 12.870  -9.384  1.00 0.00 ? 91  ASP A HB3  3  
ATOM   5495  N  N    . VAL A 1 92  ? -18.070 11.333  -6.399  1.00 0.00 ? 92  VAL A N    3  
ATOM   5496  C  CA   . VAL A 1 92  ? -17.117 10.474  -5.716  1.00 0.00 ? 92  VAL A CA   3  
ATOM   5497  C  C    . VAL A 1 92  ? -17.109 9.102   -6.400  1.00 0.00 ? 92  VAL A C    3  
ATOM   5498  O  O    . VAL A 1 92  ? -18.075 8.691   -7.050  1.00 0.00 ? 92  VAL A O    3  
ATOM   5499  C  CB   . VAL A 1 92  ? -17.491 10.439  -4.216  1.00 0.00 ? 92  VAL A CB   3  
ATOM   5500  C  CG1  . VAL A 1 92  ? -18.844 9.763   -3.934  1.00 0.00 ? 92  VAL A CG1  3  
ATOM   5501  C  CG2  . VAL A 1 92  ? -16.416 9.817   -3.315  1.00 0.00 ? 92  VAL A CG2  3  
ATOM   5502  H  H    . VAL A 1 92  ? -18.989 10.938  -6.555  1.00 0.00 ? 92  VAL A H    3  
ATOM   5503  H  HA   . VAL A 1 92  ? -16.120 10.915  -5.818  1.00 0.00 ? 92  VAL A HA   3  
ATOM   5504  H  HB   . VAL A 1 92  ? -17.582 11.475  -3.905  1.00 0.00 ? 92  VAL A HB   3  
ATOM   5505  H  HG11 . VAL A 1 92  ? -18.802 8.705   -4.194  1.00 0.00 ? 92  VAL A HG11 3  
ATOM   5506  H  HG12 . VAL A 1 92  ? -19.088 9.856   -2.876  1.00 0.00 ? 92  VAL A HG12 3  
ATOM   5507  H  HG13 . VAL A 1 92  ? -19.637 10.243  -4.509  1.00 0.00 ? 92  VAL A HG13 3  
ATOM   5508  H  HG21 . VAL A 1 92  ? -15.483 10.361  -3.439  1.00 0.00 ? 92  VAL A HG21 3  
ATOM   5509  H  HG22 . VAL A 1 92  ? -16.718 9.898   -2.270  1.00 0.00 ? 92  VAL A HG22 3  
ATOM   5510  H  HG23 . VAL A 1 92  ? -16.265 8.765   -3.557  1.00 0.00 ? 92  VAL A HG23 3  
ATOM   5511  N  N    . TYR A 1 93  ? -15.989 8.411   -6.241  1.00 0.00 ? 93  TYR A N    3  
ATOM   5512  C  CA   . TYR A 1 93  ? -15.613 7.193   -6.930  1.00 0.00 ? 93  TYR A CA   3  
ATOM   5513  C  C    . TYR A 1 93  ? -14.900 6.279   -5.929  1.00 0.00 ? 93  TYR A C    3  
ATOM   5514  O  O    . TYR A 1 93  ? -14.718 6.637   -4.761  1.00 0.00 ? 93  TYR A O    3  
ATOM   5515  C  CB   . TYR A 1 93  ? -14.679 7.561   -8.103  1.00 0.00 ? 93  TYR A CB   3  
ATOM   5516  C  CG   . TYR A 1 93  ? -15.212 8.635   -9.040  1.00 0.00 ? 93  TYR A CG   3  
ATOM   5517  C  CD1  . TYR A 1 93  ? -16.045 8.280   -10.117 1.00 0.00 ? 93  TYR A CD1  3  
ATOM   5518  C  CD2  . TYR A 1 93  ? -14.895 9.992   -8.817  1.00 0.00 ? 93  TYR A CD2  3  
ATOM   5519  C  CE1  . TYR A 1 93  ? -16.564 9.271   -10.969 1.00 0.00 ? 93  TYR A CE1  3  
ATOM   5520  C  CE2  . TYR A 1 93  ? -15.419 10.990  -9.658  1.00 0.00 ? 93  TYR A CE2  3  
ATOM   5521  C  CZ   . TYR A 1 93  ? -16.255 10.633  -10.741 1.00 0.00 ? 93  TYR A CZ   3  
ATOM   5522  O  OH   . TYR A 1 93  ? -16.751 11.602  -11.560 1.00 0.00 ? 93  TYR A OH   3  
ATOM   5523  H  H    . TYR A 1 93  ? -15.264 8.844   -5.689  1.00 0.00 ? 93  TYR A H    3  
ATOM   5524  H  HA   . TYR A 1 93  ? -16.500 6.689   -7.316  1.00 0.00 ? 93  TYR A HA   3  
ATOM   5525  H  HB2  . TYR A 1 93  ? -13.726 7.903   -7.696  1.00 0.00 ? 93  TYR A HB2  3  
ATOM   5526  H  HB3  . TYR A 1 93  ? -14.473 6.664   -8.688  1.00 0.00 ? 93  TYR A HB3  3  
ATOM   5527  H  HD1  . TYR A 1 93  ? -16.296 7.242   -10.291 1.00 0.00 ? 93  TYR A HD1  3  
ATOM   5528  H  HD2  . TYR A 1 93  ? -14.261 10.269  -7.986  1.00 0.00 ? 93  TYR A HD2  3  
ATOM   5529  H  HE1  . TYR A 1 93  ? -17.203 8.984   -11.793 1.00 0.00 ? 93  TYR A HE1  3  
ATOM   5530  H  HE2  . TYR A 1 93  ? -15.188 12.031  -9.475  1.00 0.00 ? 93  TYR A HE2  3  
ATOM   5531  H  HH   . TYR A 1 93  ? -17.317 11.255  -12.266 1.00 0.00 ? 93  TYR A HH   3  
ATOM   5532  N  N    . THR A 1 94  ? -14.445 5.125   -6.405  1.00 0.00 ? 94  THR A N    3  
ATOM   5533  C  CA   . THR A 1 94  ? -13.658 4.179   -5.629  1.00 0.00 ? 94  THR A CA   3  
ATOM   5534  C  C    . THR A 1 94  ? -12.428 3.827   -6.463  1.00 0.00 ? 94  THR A C    3  
ATOM   5535  O  O    . THR A 1 94  ? -12.532 3.623   -7.676  1.00 0.00 ? 94  THR A O    3  
ATOM   5536  C  CB   . THR A 1 94  ? -14.510 2.948   -5.256  1.00 0.00 ? 94  THR A CB   3  
ATOM   5537  O  OG1  . THR A 1 94  ? -15.807 3.335   -4.825  1.00 0.00 ? 94  THR A OG1  3  
ATOM   5538  C  CG2  . THR A 1 94  ? -13.854 2.148   -4.127  1.00 0.00 ? 94  THR A CG2  3  
ATOM   5539  H  H    . THR A 1 94  ? -14.589 4.931   -7.388  1.00 0.00 ? 94  THR A H    3  
ATOM   5540  H  HA   . THR A 1 94  ? -13.323 4.653   -4.707  1.00 0.00 ? 94  THR A HA   3  
ATOM   5541  H  HB   . THR A 1 94  ? -14.608 2.306   -6.131  1.00 0.00 ? 94  THR A HB   3  
ATOM   5542  H  HG1  . THR A 1 94  ? -16.385 2.558   -4.877  1.00 0.00 ? 94  THR A HG1  3  
ATOM   5543  H  HG21 . THR A 1 94  ? -13.747 2.776   -3.242  1.00 0.00 ? 94  THR A HG21 3  
ATOM   5544  H  HG22 . THR A 1 94  ? -14.464 1.278   -3.884  1.00 0.00 ? 94  THR A HG22 3  
ATOM   5545  H  HG23 . THR A 1 94  ? -12.871 1.804   -4.446  1.00 0.00 ? 94  THR A HG23 3  
ATOM   5546  N  N    . ALA A 1 95  ? -11.273 3.756   -5.805  1.00 0.00 ? 95  ALA A N    3  
ATOM   5547  C  CA   . ALA A 1 95  ? -9.995  3.400   -6.395  1.00 0.00 ? 95  ALA A CA   3  
ATOM   5548  C  C    . ALA A 1 95  ? -9.396  2.274   -5.560  1.00 0.00 ? 95  ALA A C    3  
ATOM   5549  O  O    . ALA A 1 95  ? -9.696  2.150   -4.371  1.00 0.00 ? 95  ALA A O    3  
ATOM   5550  C  CB   . ALA A 1 95  ? -9.075  4.627   -6.394  1.00 0.00 ? 95  ALA A CB   3  
ATOM   5551  H  H    . ALA A 1 95  ? -11.276 3.927   -4.803  1.00 0.00 ? 95  ALA A H    3  
ATOM   5552  H  HA   . ALA A 1 95  ? -10.134 3.057   -7.421  1.00 0.00 ? 95  ALA A HA   3  
ATOM   5553  H  HB1  . ALA A 1 95  ? -8.925  4.984   -5.376  1.00 0.00 ? 95  ALA A HB1  3  
ATOM   5554  H  HB2  . ALA A 1 95  ? -8.106  4.365   -6.818  1.00 0.00 ? 95  ALA A HB2  3  
ATOM   5555  H  HB3  . ALA A 1 95  ? -9.523  5.422   -6.990  1.00 0.00 ? 95  ALA A HB3  3  
ATOM   5556  N  N    . LYS A 1 96  ? -8.534  1.455   -6.160  1.00 0.00 ? 96  LYS A N    3  
ATOM   5557  C  CA   . LYS A 1 96  ? -7.749  0.497   -5.406  1.00 0.00 ? 96  LYS A CA   3  
ATOM   5558  C  C    . LYS A 1 96  ? -6.738  1.315   -4.616  1.00 0.00 ? 96  LYS A C    3  
ATOM   5559  O  O    . LYS A 1 96  ? -6.069  2.176   -5.191  1.00 0.00 ? 96  LYS A O    3  
ATOM   5560  C  CB   . LYS A 1 96  ? -7.029  -0.465  -6.363  1.00 0.00 ? 96  LYS A CB   3  
ATOM   5561  C  CG   . LYS A 1 96  ? -7.976  -1.423  -7.105  1.00 0.00 ? 96  LYS A CG   3  
ATOM   5562  C  CD   . LYS A 1 96  ? -7.251  -2.135  -8.258  1.00 0.00 ? 96  LYS A CD   3  
ATOM   5563  C  CE   . LYS A 1 96  ? -7.231  -1.272  -9.532  1.00 0.00 ? 96  LYS A CE   3  
ATOM   5564  N  NZ   . LYS A 1 96  ? -6.143  -1.660  -10.460 1.00 0.00 ? 96  LYS A NZ   3  
ATOM   5565  H  H    . LYS A 1 96  ? -8.241  1.658   -7.100  1.00 0.00 ? 96  LYS A H    3  
ATOM   5566  H  HA   . LYS A 1 96  ? -8.391  -0.071  -4.730  1.00 0.00 ? 96  LYS A HA   3  
ATOM   5567  H  HB2  . LYS A 1 96  ? -6.455  0.111   -7.085  1.00 0.00 ? 96  LYS A HB2  3  
ATOM   5568  H  HB3  . LYS A 1 96  ? -6.331  -1.067  -5.783  1.00 0.00 ? 96  LYS A HB3  3  
ATOM   5569  H  HG2  . LYS A 1 96  ? -8.326  -2.169  -6.393  1.00 0.00 ? 96  LYS A HG2  3  
ATOM   5570  H  HG3  . LYS A 1 96  ? -8.841  -0.887  -7.497  1.00 0.00 ? 96  LYS A HG3  3  
ATOM   5571  H  HD2  . LYS A 1 96  ? -6.234  -2.371  -7.942  1.00 0.00 ? 96  LYS A HD2  3  
ATOM   5572  H  HD3  . LYS A 1 96  ? -7.770  -3.068  -8.479  1.00 0.00 ? 96  LYS A HD3  3  
ATOM   5573  H  HE2  . LYS A 1 96  ? -8.198  -1.361  -10.033 1.00 0.00 ? 96  LYS A HE2  3  
ATOM   5574  H  HE3  . LYS A 1 96  ? -7.088  -0.226  -9.255  1.00 0.00 ? 96  LYS A HE3  3  
ATOM   5575  H  HZ1  . LYS A 1 96  ? -6.152  -2.647  -10.666 1.00 0.00 ? 96  LYS A HZ1  3  
ATOM   5576  H  HZ2  . LYS A 1 96  ? -6.215  -1.145  -11.334 1.00 0.00 ? 96  LYS A HZ2  3  
ATOM   5577  H  HZ3  . LYS A 1 96  ? -5.249  -1.387  -10.050 1.00 0.00 ? 96  LYS A HZ3  3  
ATOM   5578  N  N    . LEU A 1 97  ? -6.569  1.024   -3.327  1.00 0.00 ? 97  LEU A N    3  
ATOM   5579  C  CA   . LEU A 1 97  ? -5.456  1.593   -2.559  1.00 0.00 ? 97  LEU A CA   3  
ATOM   5580  C  C    . LEU A 1 97  ? -4.142  1.158   -3.227  1.00 0.00 ? 97  LEU A C    3  
ATOM   5581  O  O    . LEU A 1 97  ? -3.158  1.891   -3.244  1.00 0.00 ? 97  LEU A O    3  
ATOM   5582  C  CB   . LEU A 1 97  ? -5.512  1.101   -1.103  1.00 0.00 ? 97  LEU A CB   3  
ATOM   5583  C  CG   . LEU A 1 97  ? -4.364  1.635   -0.219  1.00 0.00 ? 97  LEU A CG   3  
ATOM   5584  C  CD1  . LEU A 1 97  ? -4.401  3.161   -0.070  1.00 0.00 ? 97  LEU A CD1  3  
ATOM   5585  C  CD2  . LEU A 1 97  ? -4.453  0.990   1.163   1.00 0.00 ? 97  LEU A CD2  3  
ATOM   5586  H  H    . LEU A 1 97  ? -7.095  0.251   -2.934  1.00 0.00 ? 97  LEU A H    3  
ATOM   5587  H  HA   . LEU A 1 97  ? -5.535  2.679   -2.582  1.00 0.00 ? 97  LEU A HA   3  
ATOM   5588  H  HB2  . LEU A 1 97  ? -6.468  1.391   -0.665  1.00 0.00 ? 97  LEU A HB2  3  
ATOM   5589  H  HB3  . LEU A 1 97  ? -5.459  0.012   -1.112  1.00 0.00 ? 97  LEU A HB3  3  
ATOM   5590  H  HG   . LEU A 1 97  ? -3.404  1.348   -0.647  1.00 0.00 ? 97  LEU A HG   3  
ATOM   5591  H  HD11 . LEU A 1 97  ? -4.203  3.641   -1.028  1.00 0.00 ? 97  LEU A HD11 3  
ATOM   5592  H  HD12 . LEU A 1 97  ? -5.372  3.479   0.306   1.00 0.00 ? 97  LEU A HD12 3  
ATOM   5593  H  HD13 . LEU A 1 97  ? -3.632  3.478   0.633   1.00 0.00 ? 97  LEU A HD13 3  
ATOM   5594  H  HD21 . LEU A 1 97  ? -5.399  1.245   1.644   1.00 0.00 ? 97  LEU A HD21 3  
ATOM   5595  H  HD22 . LEU A 1 97  ? -4.378  -0.093  1.059   1.00 0.00 ? 97  LEU A HD22 3  
ATOM   5596  H  HD23 . LEU A 1 97  ? -3.627  1.331   1.788   1.00 0.00 ? 97  LEU A HD23 3  
ATOM   5597  N  N    . SER A 1 98  ? -4.179  -0.021  -3.844  1.00 0.00 ? 98  SER A N    3  
ATOM   5598  C  CA   . SER A 1 98  ? -3.118  -0.664  -4.598  1.00 0.00 ? 98  SER A CA   3  
ATOM   5599  C  C    . SER A 1 98  ? -2.749  0.094   -5.887  1.00 0.00 ? 98  SER A C    3  
ATOM   5600  O  O    . SER A 1 98  ? -1.783  -0.280  -6.554  1.00 0.00 ? 98  SER A O    3  
ATOM   5601  C  CB   . SER A 1 98  ? -3.611  -2.095  -4.875  1.00 0.00 ? 98  SER A CB   3  
ATOM   5602  O  OG   . SER A 1 98  ? -4.155  -2.617  -3.669  1.00 0.00 ? 98  SER A OG   3  
ATOM   5603  H  H    . SER A 1 98  ? -5.035  -0.561  -3.779  1.00 0.00 ? 98  SER A H    3  
ATOM   5604  H  HA   . SER A 1 98  ? -2.229  -0.715  -3.968  1.00 0.00 ? 98  SER A HA   3  
ATOM   5605  H  HB2  . SER A 1 98  ? -4.381  -2.080  -5.644  1.00 0.00 ? 98  SER A HB2  3  
ATOM   5606  H  HB3  . SER A 1 98  ? -2.786  -2.713  -5.219  1.00 0.00 ? 98  SER A HB3  3  
ATOM   5607  H  HG   . SER A 1 98  ? -4.696  -3.423  -3.843  1.00 0.00 ? 98  SER A HG   3  
ATOM   5608  N  N    . ASP A 1 99  ? -3.482  1.163   -6.228  1.00 0.00 ? 99  ASP A N    3  
ATOM   5609  C  CA   . ASP A 1 99  ? -3.260  2.023   -7.391  1.00 0.00 ? 99  ASP A CA   3  
ATOM   5610  C  C    . ASP A 1 99  ? -3.161  3.488   -6.934  1.00 0.00 ? 99  ASP A C    3  
ATOM   5611  O  O    . ASP A 1 99  ? -3.210  4.394   -7.760  1.00 0.00 ? 99  ASP A O    3  
ATOM   5612  C  CB   . ASP A 1 99  ? -4.409  1.863   -8.411  1.00 0.00 ? 99  ASP A CB   3  
ATOM   5613  C  CG   . ASP A 1 99  ? -4.330  0.627   -9.305  1.00 0.00 ? 99  ASP A CG   3  
ATOM   5614  O  OD1  . ASP A 1 99  ? -4.101  -0.506  -8.829  1.00 0.00 ? 99  ASP A OD1  3  
ATOM   5615  O  OD2  . ASP A 1 99  ? -4.580  0.759   -10.520 1.00 0.00 ? 99  ASP A OD2  3  
ATOM   5616  H  H    . ASP A 1 99  ? -4.263  1.423   -5.639  1.00 0.00 ? 99  ASP A H    3  
ATOM   5617  H  HA   . ASP A 1 99  ? -2.321  1.759   -7.877  1.00 0.00 ? 99  ASP A HA   3  
ATOM   5618  H  HB2  . ASP A 1 99  ? -5.366  1.882   -7.892  1.00 0.00 ? 99  ASP A HB2  3  
ATOM   5619  H  HB3  . ASP A 1 99  ? -4.403  2.721   -9.082  1.00 0.00 ? 99  ASP A HB3  3  
ATOM   5620  N  N    . ILE A 1 100 ? -3.035  3.760   -5.633  1.00 0.00 ? 100 ILE A N    3  
ATOM   5621  C  CA   . ILE A 1 100 ? -2.992  5.109   -5.073  1.00 0.00 ? 100 ILE A CA   3  
ATOM   5622  C  C    . ILE A 1 100 ? -1.613  5.332   -4.469  1.00 0.00 ? 100 ILE A C    3  
ATOM   5623  O  O    . ILE A 1 100 ? -0.974  4.418   -3.942  1.00 0.00 ? 100 ILE A O    3  
ATOM   5624  C  CB   . ILE A 1 100 ? -4.160  5.288   -4.065  1.00 0.00 ? 100 ILE A CB   3  
ATOM   5625  C  CG1  . ILE A 1 100 ? -5.439  5.692   -4.831  1.00 0.00 ? 100 ILE A CG1  3  
ATOM   5626  C  CG2  . ILE A 1 100 ? -3.895  6.236   -2.875  1.00 0.00 ? 100 ILE A CG2  3  
ATOM   5627  C  CD1  . ILE A 1 100 ? -5.666  7.195   -5.030  1.00 0.00 ? 100 ILE A CD1  3  
ATOM   5628  H  H    . ILE A 1 100 ? -2.925  2.997   -4.981  1.00 0.00 ? 100 ILE A H    3  
ATOM   5629  H  HA   . ILE A 1 100 ? -3.115  5.843   -5.869  1.00 0.00 ? 100 ILE A HA   3  
ATOM   5630  H  HB   . ILE A 1 100 ? -4.352  4.312   -3.621  1.00 0.00 ? 100 ILE A HB   3  
ATOM   5631  H  HG12 . ILE A 1 100 ? -5.409  5.232   -5.817  1.00 0.00 ? 100 ILE A HG12 3  
ATOM   5632  H  HG13 . ILE A 1 100 ? -6.300  5.297   -4.298  1.00 0.00 ? 100 ILE A HG13 3  
ATOM   5633  H  HG21 . ILE A 1 100 ? -3.608  7.231   -3.221  1.00 0.00 ? 100 ILE A HG21 3  
ATOM   5634  H  HG22 . ILE A 1 100 ? -4.793  6.317   -2.261  1.00 0.00 ? 100 ILE A HG22 3  
ATOM   5635  H  HG23 . ILE A 1 100 ? -3.097  5.835   -2.249  1.00 0.00 ? 100 ILE A HG23 3  
ATOM   5636  H  HD11 . ILE A 1 100 ? -4.782  7.658   -5.462  1.00 0.00 ? 100 ILE A HD11 3  
ATOM   5637  H  HD12 . ILE A 1 100 ? -6.515  7.335   -5.697  1.00 0.00 ? 100 ILE A HD12 3  
ATOM   5638  H  HD13 . ILE A 1 100 ? -5.896  7.673   -4.079  1.00 0.00 ? 100 ILE A HD13 3  
ATOM   5639  N  N    . GLU A 1 101 ? -1.186  6.586   -4.528  1.00 0.00 ? 101 GLU A N    3  
ATOM   5640  C  CA   . GLU A 1 101 ? -0.011  7.088   -3.838  1.00 0.00 ? 101 GLU A CA   3  
ATOM   5641  C  C    . GLU A 1 101 ? -0.411  8.425   -3.219  1.00 0.00 ? 101 GLU A C    3  
ATOM   5642  O  O    . GLU A 1 101 ? -1.103  9.218   -3.861  1.00 0.00 ? 101 GLU A O    3  
ATOM   5643  C  CB   . GLU A 1 101 ? 1.158   7.213   -4.829  1.00 0.00 ? 101 GLU A CB   3  
ATOM   5644  C  CG   . GLU A 1 101 ? 2.444   7.766   -4.194  1.00 0.00 ? 101 GLU A CG   3  
ATOM   5645  C  CD   . GLU A 1 101 ? 2.949   6.926   -3.004  1.00 0.00 ? 101 GLU A CD   3  
ATOM   5646  O  OE1  . GLU A 1 101 ? 2.361   7.024   -1.902  1.00 0.00 ? 101 GLU A OE1  3  
ATOM   5647  O  OE2  . GLU A 1 101 ? 3.947   6.188   -3.169  1.00 0.00 ? 101 GLU A OE2  3  
ATOM   5648  H  H    . GLU A 1 101 ? -1.757  7.265   -5.020  1.00 0.00 ? 101 GLU A H    3  
ATOM   5649  H  HA   . GLU A 1 101 ? 0.259   6.389   -3.046  1.00 0.00 ? 101 GLU A HA   3  
ATOM   5650  H  HB2  . GLU A 1 101 ? 1.370   6.231   -5.253  1.00 0.00 ? 101 GLU A HB2  3  
ATOM   5651  H  HB3  . GLU A 1 101 ? 0.859   7.874   -5.647  1.00 0.00 ? 101 GLU A HB3  3  
ATOM   5652  H  HG2  . GLU A 1 101 ? 3.214   7.806   -4.967  1.00 0.00 ? 101 GLU A HG2  3  
ATOM   5653  H  HG3  . GLU A 1 101 ? 2.269   8.791   -3.867  1.00 0.00 ? 101 GLU A HG3  3  
ATOM   5654  N  N    . ALA A 1 102 ? -0.033  8.667   -1.965  1.00 0.00 ? 102 ALA A N    3  
ATOM   5655  C  CA   . ALA A 1 102 ? -0.394  9.899   -1.281  1.00 0.00 ? 102 ALA A CA   3  
ATOM   5656  C  C    . ALA A 1 102 ? 0.478   11.061  -1.750  1.00 0.00 ? 102 ALA A C    3  
ATOM   5657  O  O    . ALA A 1 102 ? 1.606   10.882  -2.216  1.00 0.00 ? 102 ALA A O    3  
ATOM   5658  C  CB   . ALA A 1 102 ? -0.250  9.747   0.232   1.00 0.00 ? 102 ALA A CB   3  
ATOM   5659  H  H    . ALA A 1 102 ? 0.652   8.059   -1.534  1.00 0.00 ? 102 ALA A H    3  
ATOM   5660  H  HA   . ALA A 1 102 ? -1.437  10.135  -1.498  1.00 0.00 ? 102 ALA A HA   3  
ATOM   5661  H  HB1  . ALA A 1 102 ? -0.415  10.716  0.696   1.00 0.00 ? 102 ALA A HB1  3  
ATOM   5662  H  HB2  . ALA A 1 102 ? -1.007  9.076   0.623   1.00 0.00 ? 102 ALA A HB2  3  
ATOM   5663  H  HB3  . ALA A 1 102 ? 0.747   9.385   0.486   1.00 0.00 ? 102 ALA A HB3  3  
ATOM   5664  N  N    . ILE A 1 103 ? -0.040  12.267  -1.536  1.00 0.00 ? 103 ILE A N    3  
ATOM   5665  C  CA   . ILE A 1 103 ? 0.649   13.525  -1.781  1.00 0.00 ? 103 ILE A CA   3  
ATOM   5666  C  C    . ILE A 1 103 ? 0.620   14.320  -0.473  1.00 0.00 ? 103 ILE A C    3  
ATOM   5667  O  O    . ILE A 1 103 ? -0.438  14.496  0.133   1.00 0.00 ? 103 ILE A O    3  
ATOM   5668  C  CB   . ILE A 1 103 ? -0.032  14.276  -2.953  1.00 0.00 ? 103 ILE A CB   3  
ATOM   5669  C  CG1  . ILE A 1 103 ? 0.019   13.470  -4.275  1.00 0.00 ? 103 ILE A CG1  3  
ATOM   5670  C  CG2  . ILE A 1 103 ? 0.611   15.658  -3.172  1.00 0.00 ? 103 ILE A CG2  3  
ATOM   5671  C  CD1  . ILE A 1 103 ? -0.942  14.002  -5.346  1.00 0.00 ? 103 ILE A CD1  3  
ATOM   5672  H  H    . ILE A 1 103 ? -1.023  12.331  -1.260  1.00 0.00 ? 103 ILE A H    3  
ATOM   5673  H  HA   . ILE A 1 103 ? 1.687   13.329  -2.043  1.00 0.00 ? 103 ILE A HA   3  
ATOM   5674  H  HB   . ILE A 1 103 ? -1.076  14.428  -2.682  1.00 0.00 ? 103 ILE A HB   3  
ATOM   5675  H  HG12 . ILE A 1 103 ? 1.036   13.475  -4.670  1.00 0.00 ? 103 ILE A HG12 3  
ATOM   5676  H  HG13 . ILE A 1 103 ? -0.254  12.432  -4.097  1.00 0.00 ? 103 ILE A HG13 3  
ATOM   5677  H  HG21 . ILE A 1 103 ? 0.547   16.258  -2.264  1.00 0.00 ? 103 ILE A HG21 3  
ATOM   5678  H  HG22 . ILE A 1 103 ? 1.659   15.542  -3.449  1.00 0.00 ? 103 ILE A HG22 3  
ATOM   5679  H  HG23 . ILE A 1 103 ? 0.088   16.200  -3.958  1.00 0.00 ? 103 ILE A HG23 3  
ATOM   5680  H  HD11 . ILE A 1 103 ? -1.954  14.042  -4.946  1.00 0.00 ? 103 ILE A HD11 3  
ATOM   5681  H  HD12 . ILE A 1 103 ? -0.637  14.991  -5.685  1.00 0.00 ? 103 ILE A HD12 3  
ATOM   5682  H  HD13 . ILE A 1 103 ? -0.937  13.328  -6.198  1.00 0.00 ? 103 ILE A HD13 3  
ATOM   5683  N  N    . ASP A 1 104 ? 1.796   14.826  -0.080  1.00 0.00 ? 104 ASP A N    3  
ATOM   5684  C  CA   . ASP A 1 104 ? 2.009   15.749  1.041   1.00 0.00 ? 104 ASP A CA   3  
ATOM   5685  C  C    . ASP A 1 104 ? 1.314   15.302  2.340   1.00 0.00 ? 104 ASP A C    3  
ATOM   5686  O  O    . ASP A 1 104 ? 0.703   16.102  3.053   1.00 0.00 ? 104 ASP A O    3  
ATOM   5687  C  CB   . ASP A 1 104 ? 1.658   17.182  0.608   1.00 0.00 ? 104 ASP A CB   3  
ATOM   5688  C  CG   . ASP A 1 104 ? 2.059   18.237  1.657   1.00 0.00 ? 104 ASP A CG   3  
ATOM   5689  O  OD1  . ASP A 1 104 ? 3.194   18.184  2.184   1.00 0.00 ? 104 ASP A OD1  3  
ATOM   5690  O  OD2  . ASP A 1 104 ? 1.266   19.171  1.917   1.00 0.00 ? 104 ASP A OD2  3  
ATOM   5691  H  H    . ASP A 1 104 ? 2.609   14.613  -0.636  1.00 0.00 ? 104 ASP A H    3  
ATOM   5692  H  HA   . ASP A 1 104 ? 3.079   15.737  1.240   1.00 0.00 ? 104 ASP A HA   3  
ATOM   5693  H  HB2  . ASP A 1 104 ? 2.180   17.403  -0.325  1.00 0.00 ? 104 ASP A HB2  3  
ATOM   5694  H  HB3  . ASP A 1 104 ? 0.585   17.238  0.413   1.00 0.00 ? 104 ASP A HB3  3  
ATOM   5695  N  N    . VAL A 1 105 ? 1.367   13.997  2.628   1.00 0.00 ? 105 VAL A N    3  
ATOM   5696  C  CA   . VAL A 1 105 ? 0.669   13.394  3.765   1.00 0.00 ? 105 VAL A CA   3  
ATOM   5697  C  C    . VAL A 1 105 ? 1.619   13.176  4.955   1.00 0.00 ? 105 VAL A C    3  
ATOM   5698  O  O    . VAL A 1 105 ? 2.833   13.377  4.842   1.00 0.00 ? 105 VAL A O    3  
ATOM   5699  C  CB   . VAL A 1 105 ? -0.077  12.129  3.287   1.00 0.00 ? 105 VAL A CB   3  
ATOM   5700  C  CG1  . VAL A 1 105 ? 0.794   10.866  3.216   1.00 0.00 ? 105 VAL A CG1  3  
ATOM   5701  C  CG2  . VAL A 1 105 ? -1.343  11.891  4.110   1.00 0.00 ? 105 VAL A CG2  3  
ATOM   5702  H  H    . VAL A 1 105 ? 1.896   13.382  2.017   1.00 0.00 ? 105 VAL A H    3  
ATOM   5703  H  HA   . VAL A 1 105 ? -0.092  14.102  4.096   1.00 0.00 ? 105 VAL A HA   3  
ATOM   5704  H  HB   . VAL A 1 105 ? -0.439  12.316  2.282   1.00 0.00 ? 105 VAL A HB   3  
ATOM   5705  H  HG11 . VAL A 1 105 ? 1.198   10.628  4.193   1.00 0.00 ? 105 VAL A HG11 3  
ATOM   5706  H  HG12 . VAL A 1 105 ? 0.198   10.015  2.894   1.00 0.00 ? 105 VAL A HG12 3  
ATOM   5707  H  HG13 . VAL A 1 105 ? 1.623   11.010  2.520   1.00 0.00 ? 105 VAL A HG13 3  
ATOM   5708  H  HG21 . VAL A 1 105 ? -1.111  11.584  5.126   1.00 0.00 ? 105 VAL A HG21 3  
ATOM   5709  H  HG22 . VAL A 1 105 ? -1.943  12.801  4.145   1.00 0.00 ? 105 VAL A HG22 3  
ATOM   5710  H  HG23 . VAL A 1 105 ? -1.928  11.118  3.618   1.00 0.00 ? 105 VAL A HG23 3  
ATOM   5711  N  N    . ASP A 1 106 ? 1.064   12.788  6.109   1.00 0.00 ? 106 ASP A N    3  
ATOM   5712  C  CA   . ASP A 1 106 ? 1.829   12.488  7.317   1.00 0.00 ? 106 ASP A CA   3  
ATOM   5713  C  C    . ASP A 1 106 ? 2.594   11.169  7.170   1.00 0.00 ? 106 ASP A C    3  
ATOM   5714  O  O    . ASP A 1 106 ? 2.240   10.306  6.362   1.00 0.00 ? 106 ASP A O    3  
ATOM   5715  C  CB   . ASP A 1 106 ? 0.925   12.477  8.565   1.00 0.00 ? 106 ASP A CB   3  
ATOM   5716  C  CG   . ASP A 1 106 ? 0.752   11.082  9.188   1.00 0.00 ? 106 ASP A CG   3  
ATOM   5717  O  OD1  . ASP A 1 106 ? -0.075  10.299  8.675   1.00 0.00 ? 106 ASP A OD1  3  
ATOM   5718  O  OD2  . ASP A 1 106 ? 1.462   10.777  10.173  1.00 0.00 ? 106 ASP A OD2  3  
ATOM   5719  H  H    . ASP A 1 106 ? 0.080   12.560  6.127   1.00 0.00 ? 106 ASP A H    3  
ATOM   5720  H  HA   . ASP A 1 106 ? 2.557   13.290  7.448   1.00 0.00 ? 106 ASP A HA   3  
ATOM   5721  H  HB2  . ASP A 1 106 ? 1.389   13.129  9.306   1.00 0.00 ? 106 ASP A HB2  3  
ATOM   5722  H  HB3  . ASP A 1 106 ? -0.053  12.898  8.327   1.00 0.00 ? 106 ASP A HB3  3  
ATOM   5723  N  N    . ASP A 1 107 ? 3.636   11.008  7.984   1.00 0.00 ? 107 ASP A N    3  
ATOM   5724  C  CA   . ASP A 1 107 ? 4.531   9.863   7.921   1.00 0.00 ? 107 ASP A CA   3  
ATOM   5725  C  C    . ASP A 1 107 ? 3.801   8.529   8.088   1.00 0.00 ? 107 ASP A C    3  
ATOM   5726  O  O    . ASP A 1 107 ? 4.100   7.594   7.351   1.00 0.00 ? 107 ASP A O    3  
ATOM   5727  C  CB   . ASP A 1 107 ? 5.627   9.999   8.982   1.00 0.00 ? 107 ASP A CB   3  
ATOM   5728  C  CG   . ASP A 1 107 ? 6.586   8.797   8.949   1.00 0.00 ? 107 ASP A CG   3  
ATOM   5729  O  OD1  . ASP A 1 107 ? 7.416   8.710   8.016   1.00 0.00 ? 107 ASP A OD1  3  
ATOM   5730  O  OD2  . ASP A 1 107 ? 6.558   7.972   9.890   1.00 0.00 ? 107 ASP A OD2  3  
ATOM   5731  H  H    . ASP A 1 107 ? 3.848   11.727  8.662   1.00 0.00 ? 107 ASP A H    3  
ATOM   5732  H  HA   . ASP A 1 107 ? 5.004   9.870   6.941   1.00 0.00 ? 107 ASP A HA   3  
ATOM   5733  H  HB2  . ASP A 1 107 ? 6.189   10.918  8.801   1.00 0.00 ? 107 ASP A HB2  3  
ATOM   5734  H  HB3  . ASP A 1 107 ? 5.164   10.076  9.968   1.00 0.00 ? 107 ASP A HB3  3  
ATOM   5735  N  N    . ASP A 1 108 ? 2.829   8.425   9.001   1.00 0.00 ? 108 ASP A N    3  
ATOM   5736  C  CA   . ASP A 1 108 ? 2.137   7.159   9.245   1.00 0.00 ? 108 ASP A CA   3  
ATOM   5737  C  C    . ASP A 1 108 ? 1.259   6.800   8.048   1.00 0.00 ? 108 ASP A C    3  
ATOM   5738  O  O    . ASP A 1 108 ? 1.297   5.661   7.580   1.00 0.00 ? 108 ASP A O    3  
ATOM   5739  C  CB   . ASP A 1 108 ? 1.293   7.195   10.529  1.00 0.00 ? 108 ASP A CB   3  
ATOM   5740  C  CG   . ASP A 1 108 ? 2.130   6.943   11.792  1.00 0.00 ? 108 ASP A CG   3  
ATOM   5741  O  OD1  . ASP A 1 108 ? 2.622   5.807   11.980  1.00 0.00 ? 108 ASP A OD1  3  
ATOM   5742  O  OD2  . ASP A 1 108 ? 2.279   7.864   12.627  1.00 0.00 ? 108 ASP A OD2  3  
ATOM   5743  H  H    . ASP A 1 108 ? 2.507   9.253   9.498   1.00 0.00 ? 108 ASP A H    3  
ATOM   5744  H  HA   . ASP A 1 108 ? 2.883   6.371   9.357   1.00 0.00 ? 108 ASP A HA   3  
ATOM   5745  H  HB2  . ASP A 1 108 ? 0.755   8.141   10.598  1.00 0.00 ? 108 ASP A HB2  3  
ATOM   5746  H  HB3  . ASP A 1 108 ? 0.546   6.403   10.471  1.00 0.00 ? 108 ASP A HB3  3  
ATOM   5747  N  N    . THR A 1 109 ? 0.508   7.760   7.504   1.00 0.00 ? 109 THR A N    3  
ATOM   5748  C  CA   . THR A 1 109 ? -0.310  7.535   6.322   1.00 0.00 ? 109 THR A CA   3  
ATOM   5749  C  C    . THR A 1 109 ? 0.578   7.069   5.164   1.00 0.00 ? 109 THR A C    3  
ATOM   5750  O  O    . THR A 1 109 ? 0.276   6.059   4.523   1.00 0.00 ? 109 THR A O    3  
ATOM   5751  C  CB   . THR A 1 109 ? -1.121  8.809   6.007   1.00 0.00 ? 109 THR A CB   3  
ATOM   5752  O  OG1  . THR A 1 109 ? -1.853  9.203   7.150   1.00 0.00 ? 109 THR A OG1  3  
ATOM   5753  C  CG2  . THR A 1 109 ? -2.152  8.610   4.897   1.00 0.00 ? 109 THR A CG2  3  
ATOM   5754  H  H    . THR A 1 109 ? 0.499   8.697   7.908   1.00 0.00 ? 109 THR A H    3  
ATOM   5755  H  HA   . THR A 1 109 ? -1.001  6.728   6.543   1.00 0.00 ? 109 THR A HA   3  
ATOM   5756  H  HB   . THR A 1 109 ? -0.447  9.619   5.710   1.00 0.00 ? 109 THR A HB   3  
ATOM   5757  H  HG1  . THR A 1 109 ? -1.203  9.615   7.771   1.00 0.00 ? 109 THR A HG1  3  
ATOM   5758  H  HG21 . THR A 1 109 ? -2.811  7.782   5.136   1.00 0.00 ? 109 THR A HG21 3  
ATOM   5759  H  HG22 . THR A 1 109 ? -2.768  9.503   4.811   1.00 0.00 ? 109 THR A HG22 3  
ATOM   5760  H  HG23 . THR A 1 109 ? -1.653  8.433   3.943   1.00 0.00 ? 109 THR A HG23 3  
ATOM   5761  N  N    . GLN A 1 110 ? 1.709   7.742   4.933   1.00 0.00 ? 110 GLN A N    3  
ATOM   5762  C  CA   . GLN A 1 110 ? 2.608   7.375   3.857   1.00 0.00 ? 110 GLN A CA   3  
ATOM   5763  C  C    . GLN A 1 110 ? 3.215   5.983   4.082   1.00 0.00 ? 110 GLN A C    3  
ATOM   5764  O  O    . GLN A 1 110 ? 3.365   5.231   3.115   1.00 0.00 ? 110 GLN A O    3  
ATOM   5765  C  CB   . GLN A 1 110 ? 3.678   8.463   3.706   1.00 0.00 ? 110 GLN A CB   3  
ATOM   5766  C  CG   . GLN A 1 110 ? 4.575   8.259   2.482   1.00 0.00 ? 110 GLN A CG   3  
ATOM   5767  C  CD   . GLN A 1 110 ? 3.815   8.228   1.154   1.00 0.00 ? 110 GLN A CD   3  
ATOM   5768  O  OE1  . GLN A 1 110 ? 3.597   9.263   0.530   1.00 0.00 ? 110 GLN A OE1  3  
ATOM   5769  N  NE2  . GLN A 1 110 ? 3.411   7.053   0.695   1.00 0.00 ? 110 GLN A NE2  3  
ATOM   5770  H  H    . GLN A 1 110 ? 1.954   8.539   5.515   1.00 0.00 ? 110 GLN A H    3  
ATOM   5771  H  HA   . GLN A 1 110 ? 2.014   7.341   2.945   1.00 0.00 ? 110 GLN A HA   3  
ATOM   5772  H  HB2  . GLN A 1 110 ? 3.195   9.434   3.613   1.00 0.00 ? 110 GLN A HB2  3  
ATOM   5773  H  HB3  . GLN A 1 110 ? 4.302   8.481   4.600   1.00 0.00 ? 110 GLN A HB3  3  
ATOM   5774  H  HG2  . GLN A 1 110 ? 5.280   9.087   2.455   1.00 0.00 ? 110 GLN A HG2  3  
ATOM   5775  H  HG3  . GLN A 1 110 ? 5.133   7.332   2.603   1.00 0.00 ? 110 GLN A HG3  3  
ATOM   5776  H  HE21 . GLN A 1 110 ? 3.568   6.209   1.235   1.00 0.00 ? 110 GLN A HE21 3  
ATOM   5777  H  HE22 . GLN A 1 110 ? 2.974   7.002   -0.234  1.00 0.00 ? 110 GLN A HE22 3  
ATOM   5778  N  N    . GLU A 1 111 ? 3.537   5.626   5.328   1.00 0.00 ? 111 GLU A N    3  
ATOM   5779  C  CA   . GLU A 1 111 ? 4.094   4.325   5.677   1.00 0.00 ? 111 GLU A CA   3  
ATOM   5780  C  C    . GLU A 1 111 ? 3.114   3.207   5.349   1.00 0.00 ? 111 GLU A C    3  
ATOM   5781  O  O    . GLU A 1 111 ? 3.524   2.225   4.738   1.00 0.00 ? 111 GLU A O    3  
ATOM   5782  C  CB   . GLU A 1 111 ? 4.469   4.269   7.169   1.00 0.00 ? 111 GLU A CB   3  
ATOM   5783  C  CG   . GLU A 1 111 ? 5.851   4.861   7.460   1.00 0.00 ? 111 GLU A CG   3  
ATOM   5784  C  CD   . GLU A 1 111 ? 6.973   3.886   7.080   1.00 0.00 ? 111 GLU A CD   3  
ATOM   5785  O  OE1  . GLU A 1 111 ? 7.345   3.024   7.907   1.00 0.00 ? 111 GLU A OE1  3  
ATOM   5786  O  OE2  . GLU A 1 111 ? 7.502   3.964   5.950   1.00 0.00 ? 111 GLU A OE2  3  
ATOM   5787  H  H    . GLU A 1 111 ? 3.426   6.299   6.082   1.00 0.00 ? 111 GLU A H    3  
ATOM   5788  H  HA   . GLU A 1 111 ? 4.984   4.155   5.075   1.00 0.00 ? 111 GLU A HA   3  
ATOM   5789  H  HB2  . GLU A 1 111 ? 3.722   4.803   7.754   1.00 0.00 ? 111 GLU A HB2  3  
ATOM   5790  H  HB3  . GLU A 1 111 ? 4.464   3.232   7.508   1.00 0.00 ? 111 GLU A HB3  3  
ATOM   5791  H  HG2  . GLU A 1 111 ? 5.972   5.799   6.917   1.00 0.00 ? 111 GLU A HG2  3  
ATOM   5792  H  HG3  . GLU A 1 111 ? 5.912   5.077   8.528   1.00 0.00 ? 111 GLU A HG3  3  
ATOM   5793  N  N    . ALA A 1 112 ? 1.833   3.346   5.703   1.00 0.00 ? 112 ALA A N    3  
ATOM   5794  C  CA   . ALA A 1 112 ? 0.835   2.320   5.428   1.00 0.00 ? 112 ALA A CA   3  
ATOM   5795  C  C    . ALA A 1 112 ? 0.713   2.067   3.926   1.00 0.00 ? 112 ALA A C    3  
ATOM   5796  O  O    . ALA A 1 112 ? 0.577   0.922   3.501   1.00 0.00 ? 112 ALA A O    3  
ATOM   5797  C  CB   . ALA A 1 112 ? -0.513  2.760   5.992   1.00 0.00 ? 112 ALA A CB   3  
ATOM   5798  H  H    . ALA A 1 112 ? 1.529   4.202   6.156   1.00 0.00 ? 112 ALA A H    3  
ATOM   5799  H  HA   . ALA A 1 112 ? 1.139   1.392   5.915   1.00 0.00 ? 112 ALA A HA   3  
ATOM   5800  H  HB1  . ALA A 1 112 ? -0.440  2.844   7.070   1.00 0.00 ? 112 ALA A HB1  3  
ATOM   5801  H  HB2  . ALA A 1 112 ? -0.784  3.728   5.575   1.00 0.00 ? 112 ALA A HB2  3  
ATOM   5802  H  HB3  . ALA A 1 112 ? -1.278  2.025   5.741   1.00 0.00 ? 112 ALA A HB3  3  
ATOM   5803  N  N    . ILE A 1 113 ? 0.768   3.134   3.127   1.00 0.00 ? 113 ILE A N    3  
ATOM   5804  C  CA   . ILE A 1 113 ? 0.651   3.048   1.679   1.00 0.00 ? 113 ILE A CA   3  
ATOM   5805  C  C    . ILE A 1 113 ? 1.875   2.321   1.121   1.00 0.00 ? 113 ILE A C    3  
ATOM   5806  O  O    . ILE A 1 113 ? 1.724   1.326   0.414   1.00 0.00 ? 113 ILE A O    3  
ATOM   5807  C  CB   . ILE A 1 113 ? 0.483   4.469   1.109   1.00 0.00 ? 113 ILE A CB   3  
ATOM   5808  C  CG1  . ILE A 1 113 ? -0.858  5.064   1.584   1.00 0.00 ? 113 ILE A CG1  3  
ATOM   5809  C  CG2  . ILE A 1 113 ? 0.571   4.487   -0.423  1.00 0.00 ? 113 ILE A CG2  3  
ATOM   5810  C  CD1  . ILE A 1 113 ? -0.868  6.585   1.516   1.00 0.00 ? 113 ILE A CD1  3  
ATOM   5811  H  H    . ILE A 1 113 ? 0.872   4.050   3.545   1.00 0.00 ? 113 ILE A H    3  
ATOM   5812  H  HA   . ILE A 1 113 ? -0.237  2.466   1.429   1.00 0.00 ? 113 ILE A HA   3  
ATOM   5813  H  HB   . ILE A 1 113 ? 1.294   5.082   1.496   1.00 0.00 ? 113 ILE A HB   3  
ATOM   5814  H  HG12 . ILE A 1 113 ? -1.679  4.665   0.989   1.00 0.00 ? 113 ILE A HG12 3  
ATOM   5815  H  HG13 . ILE A 1 113 ? -1.039  4.799   2.621   1.00 0.00 ? 113 ILE A HG13 3  
ATOM   5816  H  HG21 . ILE A 1 113 ? 0.375   5.488   -0.802  1.00 0.00 ? 113 ILE A HG21 3  
ATOM   5817  H  HG22 . ILE A 1 113 ? 1.580   4.207   -0.729  1.00 0.00 ? 113 ILE A HG22 3  
ATOM   5818  H  HG23 . ILE A 1 113 ? -0.148  3.791   -0.855  1.00 0.00 ? 113 ILE A HG23 3  
ATOM   5819  H  HD11 . ILE A 1 113 ? -0.925  6.896   0.475   1.00 0.00 ? 113 ILE A HD11 3  
ATOM   5820  H  HD12 . ILE A 1 113 ? -1.731  6.958   2.066   1.00 0.00 ? 113 ILE A HD12 3  
ATOM   5821  H  HD13 . ILE A 1 113 ? 0.034   6.989   1.978   1.00 0.00 ? 113 ILE A HD13 3  
ATOM   5822  N  N    . ALA A 1 114 ? 3.081   2.786   1.458   1.00 0.00 ? 114 ALA A N    3  
ATOM   5823  C  CA   . ALA A 1 114 ? 4.323   2.183   0.988   1.00 0.00 ? 114 ALA A CA   3  
ATOM   5824  C  C    . ALA A 1 114 ? 4.397   0.705   1.390   1.00 0.00 ? 114 ALA A C    3  
ATOM   5825  O  O    . ALA A 1 114 ? 4.763   -0.147  0.580   1.00 0.00 ? 114 ALA A O    3  
ATOM   5826  C  CB   . ALA A 1 114 ? 5.507   2.964   1.568   1.00 0.00 ? 114 ALA A CB   3  
ATOM   5827  H  H    . ALA A 1 114 ? 3.144   3.566   2.085   1.00 0.00 ? 114 ALA A H    3  
ATOM   5828  H  HA   . ALA A 1 114 ? 4.353   2.250   -0.101  1.00 0.00 ? 114 ALA A HA   3  
ATOM   5829  H  HB1  . ALA A 1 114 ? 5.469   4.001   1.232   1.00 0.00 ? 114 ALA A HB1  3  
ATOM   5830  H  HB2  . ALA A 1 114 ? 5.475   2.939   2.659   1.00 0.00 ? 114 ALA A HB2  3  
ATOM   5831  H  HB3  . ALA A 1 114 ? 6.440   2.513   1.228   1.00 0.00 ? 114 ALA A HB3  3  
ATOM   5832  N  N    . ASP A 1 115 ? 4.013   0.407   2.631   1.00 0.00 ? 115 ASP A N    3  
ATOM   5833  C  CA   . ASP A 1 115 ? 4.021   -0.941  3.180   1.00 0.00 ? 115 ASP A CA   3  
ATOM   5834  C  C    . ASP A 1 115 ? 3.038   -1.846  2.446   1.00 0.00 ? 115 ASP A C    3  
ATOM   5835  O  O    . ASP A 1 115 ? 3.398   -2.957  2.053   1.00 0.00 ? 115 ASP A O    3  
ATOM   5836  C  CB   . ASP A 1 115 ? 3.705   -0.895  4.675   1.00 0.00 ? 115 ASP A CB   3  
ATOM   5837  C  CG   . ASP A 1 115 ? 3.746   -2.290  5.301   1.00 0.00 ? 115 ASP A CG   3  
ATOM   5838  O  OD1  . ASP A 1 115 ? 2.696   -2.964  5.351   1.00 0.00 ? 115 ASP A OD1  3  
ATOM   5839  O  OD2  . ASP A 1 115 ? 4.816   -2.671  5.830   1.00 0.00 ? 115 ASP A OD2  3  
ATOM   5840  H  H    . ASP A 1 115 ? 3.730   1.164   3.249   1.00 0.00 ? 115 ASP A H    3  
ATOM   5841  H  HA   . ASP A 1 115 ? 5.015   -1.354  3.054   1.00 0.00 ? 115 ASP A HA   3  
ATOM   5842  H  HB2  . ASP A 1 115 ? 4.442   -0.262  5.174   1.00 0.00 ? 115 ASP A HB2  3  
ATOM   5843  H  HB3  . ASP A 1 115 ? 2.718   -0.454  4.828   1.00 0.00 ? 115 ASP A HB3  3  
ATOM   5844  N  N    . TRP A 1 116 ? 1.823   -1.351  2.180   1.00 0.00 ? 116 TRP A N    3  
ATOM   5845  C  CA   . TRP A 1 116 ? 0.844   -2.091  1.407   1.00 0.00 ? 116 TRP A CA   3  
ATOM   5846  C  C    . TRP A 1 116 ? 1.357   -2.333  -0.013  1.00 0.00 ? 116 TRP A C    3  
ATOM   5847  O  O    . TRP A 1 116 ? 1.143   -3.413  -0.555  1.00 0.00 ? 116 TRP A O    3  
ATOM   5848  C  CB   . TRP A 1 116 ? -0.499  -1.350  1.390   1.00 0.00 ? 116 TRP A CB   3  
ATOM   5849  C  CG   . TRP A 1 116 ? -1.556  -2.052  0.593   1.00 0.00 ? 116 TRP A CG   3  
ATOM   5850  C  CD1  . TRP A 1 116 ? -2.029  -1.653  -0.609  1.00 0.00 ? 116 TRP A CD1  3  
ATOM   5851  C  CD2  . TRP A 1 116 ? -2.203  -3.336  0.867   1.00 0.00 ? 116 TRP A CD2  3  
ATOM   5852  N  NE1  . TRP A 1 116 ? -2.899  -2.601  -1.103  1.00 0.00 ? 116 TRP A NE1  3  
ATOM   5853  C  CE2  . TRP A 1 116 ? -3.013  -3.681  -0.256  1.00 0.00 ? 116 TRP A CE2  3  
ATOM   5854  C  CE3  . TRP A 1 116 ? -2.164  -4.261  1.934   1.00 0.00 ? 116 TRP A CE3  3  
ATOM   5855  C  CZ2  . TRP A 1 116 ? -3.711  -4.896  -0.336  1.00 0.00 ? 116 TRP A CZ2  3  
ATOM   5856  C  CZ3  . TRP A 1 116 ? -2.885  -5.470  1.878   1.00 0.00 ? 116 TRP A CZ3  3  
ATOM   5857  C  CH2  . TRP A 1 116 ? -3.646  -5.796  0.740   1.00 0.00 ? 116 TRP A CH2  3  
ATOM   5858  H  H    . TRP A 1 116 ? 1.583   -0.406  2.464   1.00 0.00 ? 116 TRP A H    3  
ATOM   5859  H  HA   . TRP A 1 116 ? 0.694   -3.059  1.885   1.00 0.00 ? 116 TRP A HA   3  
ATOM   5860  H  HB2  . TRP A 1 116 ? -0.852  -1.245  2.415   1.00 0.00 ? 116 TRP A HB2  3  
ATOM   5861  H  HB3  . TRP A 1 116 ? -0.354  -0.351  0.978   1.00 0.00 ? 116 TRP A HB3  3  
ATOM   5862  H  HD1  . TRP A 1 116 ? -1.729  -0.753  -1.131  1.00 0.00 ? 116 TRP A HD1  3  
ATOM   5863  H  HE1  . TRP A 1 116 ? -3.338  -2.532  -2.023  1.00 0.00 ? 116 TRP A HE1  3  
ATOM   5864  H  HE3  . TRP A 1 116 ? -1.565  -4.040  2.805   1.00 0.00 ? 116 TRP A HE3  3  
ATOM   5865  H  HZ2  . TRP A 1 116 ? -4.300  -5.130  -1.212  1.00 0.00 ? 116 TRP A HZ2  3  
ATOM   5866  H  HZ3  . TRP A 1 116 ? -2.835  -6.162  2.708   1.00 0.00 ? 116 TRP A HZ3  3  
ATOM   5867  H  HH2  . TRP A 1 116 ? -4.183  -6.733  0.695   1.00 0.00 ? 116 TRP A HH2  3  
ATOM   5868  N  N    . LEU A 1 117 ? 2.052   -1.366  -0.621  1.00 0.00 ? 117 LEU A N    3  
ATOM   5869  C  CA   . LEU A 1 117 ? 2.515   -1.487  -1.996  1.00 0.00 ? 117 LEU A CA   3  
ATOM   5870  C  C    . LEU A 1 117 ? 3.611   -2.545  -2.128  1.00 0.00 ? 117 LEU A C    3  
ATOM   5871  O  O    . LEU A 1 117 ? 3.549   -3.328  -3.076  1.00 0.00 ? 117 LEU A O    3  
ATOM   5872  C  CB   . LEU A 1 117 ? 2.972   -0.124  -2.541  1.00 0.00 ? 117 LEU A CB   3  
ATOM   5873  C  CG   . LEU A 1 117 ? 1.797   0.831   -2.848  1.00 0.00 ? 117 LEU A CG   3  
ATOM   5874  C  CD1  . LEU A 1 117 ? 2.330   2.250   -3.055  1.00 0.00 ? 117 LEU A CD1  3  
ATOM   5875  C  CD2  . LEU A 1 117 ? 0.993   0.400   -4.083  1.00 0.00 ? 117 LEU A CD2  3  
ATOM   5876  H  H    . LEU A 1 117 ? 2.220   -0.497  -0.130  1.00 0.00 ? 117 LEU A H    3  
ATOM   5877  H  HA   . LEU A 1 117 ? 1.677   -1.835  -2.598  1.00 0.00 ? 117 LEU A HA   3  
ATOM   5878  H  HB2  . LEU A 1 117 ? 3.642   0.336   -1.815  1.00 0.00 ? 117 LEU A HB2  3  
ATOM   5879  H  HB3  . LEU A 1 117 ? 3.540   -0.282  -3.460  1.00 0.00 ? 117 LEU A HB3  3  
ATOM   5880  H  HG   . LEU A 1 117 ? 1.113   0.851   -2.001  1.00 0.00 ? 117 LEU A HG   3  
ATOM   5881  H  HD11 . LEU A 1 117 ? 2.850   2.574   -2.153  1.00 0.00 ? 117 LEU A HD11 3  
ATOM   5882  H  HD12 . LEU A 1 117 ? 3.018   2.279   -3.899  1.00 0.00 ? 117 LEU A HD12 3  
ATOM   5883  H  HD13 . LEU A 1 117 ? 1.500   2.934   -3.238  1.00 0.00 ? 117 LEU A HD13 3  
ATOM   5884  H  HD21 . LEU A 1 117 ? 1.645   0.332   -4.955  1.00 0.00 ? 117 LEU A HD21 3  
ATOM   5885  H  HD22 . LEU A 1 117 ? 0.520   -0.565  -3.912  1.00 0.00 ? 117 LEU A HD22 3  
ATOM   5886  H  HD23 . LEU A 1 117 ? 0.206   1.129   -4.282  1.00 0.00 ? 117 LEU A HD23 3  
ATOM   5887  N  N    . TYR A 1 118 ? 4.582   -2.641  -1.205  1.00 0.00 ? 118 TYR A N    3  
ATOM   5888  C  CA   . TYR A 1 118 ? 5.534   -3.752  -1.290  1.00 0.00 ? 118 TYR A CA   3  
ATOM   5889  C  C    . TYR A 1 118 ? 4.878   -5.077  -0.892  1.00 0.00 ? 118 TYR A C    3  
ATOM   5890  O  O    . TYR A 1 118 ? 5.181   -6.100  -1.507  1.00 0.00 ? 118 TYR A O    3  
ATOM   5891  C  CB   . TYR A 1 118 ? 6.891   -3.482  -0.615  1.00 0.00 ? 118 TYR A CB   3  
ATOM   5892  C  CG   . TYR A 1 118 ? 6.952   -3.104  0.856   1.00 0.00 ? 118 TYR A CG   3  
ATOM   5893  C  CD1  . TYR A 1 118 ? 6.526   -3.999  1.858   1.00 0.00 ? 118 TYR A CD1  3  
ATOM   5894  C  CD2  . TYR A 1 118 ? 7.548   -1.882  1.229   1.00 0.00 ? 118 TYR A CD2  3  
ATOM   5895  C  CE1  . TYR A 1 118 ? 6.626   -3.645  3.214   1.00 0.00 ? 118 TYR A CE1  3  
ATOM   5896  C  CE2  . TYR A 1 118 ? 7.691   -1.539  2.584   1.00 0.00 ? 118 TYR A CE2  3  
ATOM   5897  C  CZ   . TYR A 1 118 ? 7.207   -2.410  3.584   1.00 0.00 ? 118 TYR A CZ   3  
ATOM   5898  O  OH   . TYR A 1 118 ? 7.229   -2.011  4.884   1.00 0.00 ? 118 TYR A OH   3  
ATOM   5899  H  H    . TYR A 1 118 ? 4.629   -1.989  -0.429  1.00 0.00 ? 118 TYR A H    3  
ATOM   5900  H  HA   . TYR A 1 118 ? 5.784   -3.864  -2.346  1.00 0.00 ? 118 TYR A HA   3  
ATOM   5901  H  HB2  . TYR A 1 118 ? 7.505   -4.372  -0.749  1.00 0.00 ? 118 TYR A HB2  3  
ATOM   5902  H  HB3  . TYR A 1 118 ? 7.378   -2.693  -1.190  1.00 0.00 ? 118 TYR A HB3  3  
ATOM   5903  H  HD1  . TYR A 1 118 ? 6.111   -4.961  1.597   1.00 0.00 ? 118 TYR A HD1  3  
ATOM   5904  H  HD2  . TYR A 1 118 ? 7.900   -1.194  0.472   1.00 0.00 ? 118 TYR A HD2  3  
ATOM   5905  H  HE1  . TYR A 1 118 ? 6.250   -4.322  3.967   1.00 0.00 ? 118 TYR A HE1  3  
ATOM   5906  H  HE2  . TYR A 1 118 ? 8.125   -0.587  2.855   1.00 0.00 ? 118 TYR A HE2  3  
ATOM   5907  H  HH   . TYR A 1 118 ? 6.504   -2.432  5.390   1.00 0.00 ? 118 TYR A HH   3  
ATOM   5908  N  N    . TRP A 1 119 ? 3.918   -5.092  0.040   1.00 0.00 ? 119 TRP A N    3  
ATOM   5909  C  CA   . TRP A 1 119 ? 3.142   -6.297  0.317   1.00 0.00 ? 119 TRP A CA   3  
ATOM   5910  C  C    . TRP A 1 119 ? 2.408   -6.760  -0.951  1.00 0.00 ? 119 TRP A C    3  
ATOM   5911  O  O    . TRP A 1 119 ? 2.384   -7.955  -1.244  1.00 0.00 ? 119 TRP A O    3  
ATOM   5912  C  CB   . TRP A 1 119 ? 2.188   -6.048  1.490   1.00 0.00 ? 119 TRP A CB   3  
ATOM   5913  C  CG   . TRP A 1 119 ? 1.166   -7.117  1.703   1.00 0.00 ? 119 TRP A CG   3  
ATOM   5914  C  CD1  . TRP A 1 119 ? -0.076  -7.100  1.176   1.00 0.00 ? 119 TRP A CD1  3  
ATOM   5915  C  CD2  . TRP A 1 119 ? 1.278   -8.389  2.414   1.00 0.00 ? 119 TRP A CD2  3  
ATOM   5916  N  NE1  . TRP A 1 119 ? -0.756  -8.239  1.544   1.00 0.00 ? 119 TRP A NE1  3  
ATOM   5917  C  CE2  . TRP A 1 119 ? 0.032   -9.079  2.303   1.00 0.00 ? 119 TRP A CE2  3  
ATOM   5918  C  CE3  . TRP A 1 119 ? 2.310   -9.039  3.128   1.00 0.00 ? 119 TRP A CE3  3  
ATOM   5919  C  CZ2  . TRP A 1 119 ? -0.179  -10.343 2.878   1.00 0.00 ? 119 TRP A CZ2  3  
ATOM   5920  C  CZ3  . TRP A 1 119 ? 2.112   -10.312 3.699   1.00 0.00 ? 119 TRP A CZ3  3  
ATOM   5921  C  CH2  . TRP A 1 119 ? 0.870   -10.962 3.578   1.00 0.00 ? 119 TRP A CH2  3  
ATOM   5922  H  H    . TRP A 1 119 ? 3.663   -4.241  0.534   1.00 0.00 ? 119 TRP A H    3  
ATOM   5923  H  HA   . TRP A 1 119 ? 3.830   -7.090  0.608   1.00 0.00 ? 119 TRP A HA   3  
ATOM   5924  H  HB2  . TRP A 1 119 ? 2.774   -5.939  2.403   1.00 0.00 ? 119 TRP A HB2  3  
ATOM   5925  H  HB3  . TRP A 1 119 ? 1.658   -5.113  1.327   1.00 0.00 ? 119 TRP A HB3  3  
ATOM   5926  H  HD1  . TRP A 1 119 ? -0.467  -6.308  0.546   1.00 0.00 ? 119 TRP A HD1  3  
ATOM   5927  H  HE1  . TRP A 1 119 ? -1.695  -8.438  1.220   1.00 0.00 ? 119 TRP A HE1  3  
ATOM   5928  H  HE3  . TRP A 1 119 ? 3.262   -8.543  3.246   1.00 0.00 ? 119 TRP A HE3  3  
ATOM   5929  H  HZ2  . TRP A 1 119 ? -1.134  -10.838 2.775   1.00 0.00 ? 119 TRP A HZ2  3  
ATOM   5930  H  HZ3  . TRP A 1 119 ? 2.914   -10.787 4.249   1.00 0.00 ? 119 TRP A HZ3  3  
ATOM   5931  H  HH2  . TRP A 1 119 ? 0.723   -11.937 4.024   1.00 0.00 ? 119 TRP A HH2  3  
ATOM   5932  N  N    . LEU A 1 120 ? 1.888   -5.823  -1.752  1.00 0.00 ? 120 LEU A N    3  
ATOM   5933  C  CA   . LEU A 1 120 ? 1.278   -6.116  -3.041  1.00 0.00 ? 120 LEU A CA   3  
ATOM   5934  C  C    . LEU A 1 120 ? 2.288   -6.834  -3.940  1.00 0.00 ? 120 LEU A C    3  
ATOM   5935  O  O    . LEU A 1 120 ? 1.978   -7.873  -4.524  1.00 0.00 ? 120 LEU A O    3  
ATOM   5936  C  CB   . LEU A 1 120 ? 0.804   -4.817  -3.723  1.00 0.00 ? 120 LEU A CB   3  
ATOM   5937  C  CG   . LEU A 1 120 ? -0.425  -5.058  -4.610  1.00 0.00 ? 120 LEU A CG   3  
ATOM   5938  C  CD1  . LEU A 1 120 ? -1.692  -4.910  -3.761  1.00 0.00 ? 120 LEU A CD1  3  
ATOM   5939  C  CD2  . LEU A 1 120 ? -0.459  -4.059  -5.772  1.00 0.00 ? 120 LEU A CD2  3  
ATOM   5940  H  H    . LEU A 1 120 ? 1.886   -4.860  -1.435  1.00 0.00 ? 120 LEU A H    3  
ATOM   5941  H  HA   . LEU A 1 120 ? 0.421   -6.762  -2.852  1.00 0.00 ? 120 LEU A HA   3  
ATOM   5942  H  HB2  . LEU A 1 120 ? 0.560   -4.059  -2.979  1.00 0.00 ? 120 LEU A HB2  3  
ATOM   5943  H  HB3  . LEU A 1 120 ? 1.614   -4.418  -4.335  1.00 0.00 ? 120 LEU A HB3  3  
ATOM   5944  H  HG   . LEU A 1 120 ? -0.387  -6.064  -5.029  1.00 0.00 ? 120 LEU A HG   3  
ATOM   5945  H  HD11 . LEU A 1 120 ? -1.641  -5.552  -2.883  1.00 0.00 ? 120 LEU A HD11 3  
ATOM   5946  H  HD12 . LEU A 1 120 ? -1.783  -3.884  -3.410  1.00 0.00 ? 120 LEU A HD12 3  
ATOM   5947  H  HD13 . LEU A 1 120 ? -2.573  -5.168  -4.348  1.00 0.00 ? 120 LEU A HD13 3  
ATOM   5948  H  HD21 . LEU A 1 120 ? 0.419   -4.202  -6.403  1.00 0.00 ? 120 LEU A HD21 3  
ATOM   5949  H  HD22 . LEU A 1 120 ? -1.349  -4.231  -6.377  1.00 0.00 ? 120 LEU A HD22 3  
ATOM   5950  H  HD23 . LEU A 1 120 ? -0.460  -3.036  -5.393  1.00 0.00 ? 120 LEU A HD23 3  
ATOM   5951  N  N    . ALA A 1 121 ? 3.512   -6.296  -4.010  1.00 0.00 ? 121 ALA A N    3  
ATOM   5952  C  CA   . ALA A 1 121 ? 4.595   -6.820  -4.833  1.00 0.00 ? 121 ALA A CA   3  
ATOM   5953  C  C    . ALA A 1 121 ? 5.049   -8.224  -4.409  1.00 0.00 ? 121 ALA A C    3  
ATOM   5954  O  O    . ALA A 1 121 ? 5.643   -8.930  -5.227  1.00 0.00 ? 121 ALA A O    3  
ATOM   5955  C  CB   . ALA A 1 121 ? 5.780   -5.847  -4.812  1.00 0.00 ? 121 ALA A CB   3  
ATOM   5956  H  H    . ALA A 1 121 ? 3.697   -5.453  -3.481  1.00 0.00 ? 121 ALA A H    3  
ATOM   5957  H  HA   . ALA A 1 121 ? 4.227   -6.882  -5.858  1.00 0.00 ? 121 ALA A HA   3  
ATOM   5958  H  HB1  . ALA A 1 121 ? 5.448   -4.845  -5.087  1.00 0.00 ? 121 ALA A HB1  3  
ATOM   5959  H  HB2  . ALA A 1 121 ? 6.229   -5.826  -3.820  1.00 0.00 ? 121 ALA A HB2  3  
ATOM   5960  H  HB3  . ALA A 1 121 ? 6.533   -6.179  -5.527  1.00 0.00 ? 121 ALA A HB3  3  
ATOM   5961  N  N    . ARG A 1 122 ? 4.761   -8.667  -3.175  1.00 0.00 ? 122 ARG A N    3  
ATOM   5962  C  CA   . ARG A 1 122 ? 5.007   -10.061 -2.775  1.00 0.00 ? 122 ARG A CA   3  
ATOM   5963  C  C    . ARG A 1 122 ? 4.181   -11.060 -3.594  1.00 0.00 ? 122 ARG A C    3  
ATOM   5964  O  O    . ARG A 1 122 ? 4.502   -12.249 -3.572  1.00 0.00 ? 122 ARG A O    3  
ATOM   5965  C  CB   . ARG A 1 122 ? 4.724   -10.304 -1.282  1.00 0.00 ? 122 ARG A CB   3  
ATOM   5966  C  CG   . ARG A 1 122 ? 5.616   -9.492  -0.343  1.00 0.00 ? 122 ARG A CG   3  
ATOM   5967  C  CD   . ARG A 1 122 ? 5.398   -9.881  1.128   1.00 0.00 ? 122 ARG A CD   3  
ATOM   5968  N  NE   . ARG A 1 122 ? 6.657   -10.292 1.780   1.00 0.00 ? 122 ARG A NE   3  
ATOM   5969  C  CZ   . ARG A 1 122 ? 6.808   -11.264 2.690   1.00 0.00 ? 122 ARG A CZ   3  
ATOM   5970  N  NH1  . ARG A 1 122 ? 5.781   -12.008 3.094   1.00 0.00 ? 122 ARG A NH1  3  
ATOM   5971  N  NH2  . ARG A 1 122 ? 8.006   -11.488 3.202   1.00 0.00 ? 122 ARG A NH2  3  
ATOM   5972  H  H    . ARG A 1 122 ? 4.331   -8.025  -2.514  1.00 0.00 ? 122 ARG A H    3  
ATOM   5973  H  HA   . ARG A 1 122 ? 6.061   -10.280 -2.959  1.00 0.00 ? 122 ARG A HA   3  
ATOM   5974  H  HB2  . ARG A 1 122 ? 3.679   -10.097 -1.064  1.00 0.00 ? 122 ARG A HB2  3  
ATOM   5975  H  HB3  . ARG A 1 122 ? 4.909   -11.358 -1.072  1.00 0.00 ? 122 ARG A HB3  3  
ATOM   5976  H  HG2  . ARG A 1 122 ? 6.653   -9.663  -0.628  1.00 0.00 ? 122 ARG A HG2  3  
ATOM   5977  H  HG3  . ARG A 1 122 ? 5.385   -8.437  -0.461  1.00 0.00 ? 122 ARG A HG3  3  
ATOM   5978  H  HD2  . ARG A 1 122 ? 4.998   -9.018  1.661   1.00 0.00 ? 122 ARG A HD2  3  
ATOM   5979  H  HD3  . ARG A 1 122 ? 4.662   -10.683 1.187   1.00 0.00 ? 122 ARG A HD3  3  
ATOM   5980  H  HE   . ARG A 1 122 ? 7.477   -9.755  1.530   1.00 0.00 ? 122 ARG A HE   3  
ATOM   5981  H  HH11 . ARG A 1 122 ? 4.857   -11.865 2.716   1.00 0.00 ? 122 ARG A HH11 3  
ATOM   5982  H  HH12 . ARG A 1 122 ? 5.900   -12.740 3.781   1.00 0.00 ? 122 ARG A HH12 3  
ATOM   5983  H  HH21 . ARG A 1 122 ? 8.806   -10.901 2.939   1.00 0.00 ? 122 ARG A HH21 3  
ATOM   5984  H  HH22 . ARG A 1 122 ? 8.155   -12.201 3.923   1.00 0.00 ? 122 ARG A HH22 3  
ATOM   5985  N  N    . GLY A 1 123 ? 3.120   -10.625 -4.286  1.00 0.00 ? 123 GLY A N    3  
ATOM   5986  C  CA   . GLY A 1 123 ? 2.170   -11.541 -4.906  1.00 0.00 ? 123 GLY A CA   3  
ATOM   5987  C  C    . GLY A 1 123 ? 1.376   -12.268 -3.821  1.00 0.00 ? 123 GLY A C    3  
ATOM   5988  O  O    . GLY A 1 123 ? 1.238   -13.493 -3.872  1.00 0.00 ? 123 GLY A O    3  
ATOM   5989  H  H    . GLY A 1 123 ? 2.900   -9.638  -4.315  1.00 0.00 ? 123 GLY A H    3  
ATOM   5990  H  HA2  . GLY A 1 123 ? 1.481   -10.971 -5.530  1.00 0.00 ? 123 GLY A HA2  3  
ATOM   5991  H  HA3  . GLY A 1 123 ? 2.699   -12.265 -5.527  1.00 0.00 ? 123 GLY A HA3  3  
ATOM   5992  N  N    . TYR A 1 124 ? 0.939   -11.517 -2.802  1.00 0.00 ? 124 TYR A N    3  
ATOM   5993  C  CA   . TYR A 1 124 ? 0.190   -12.010 -1.649  1.00 0.00 ? 124 TYR A CA   3  
ATOM   5994  C  C    . TYR A 1 124 ? -1.089  -12.756 -2.060  1.00 0.00 ? 124 TYR A C    3  
ATOM   5995  O  O    . TYR A 1 124 ? -1.636  -12.540 -3.147  1.00 0.00 ? 124 TYR A O    3  
ATOM   5996  C  CB   . TYR A 1 124 ? -0.142  -10.841 -0.706  1.00 0.00 ? 124 TYR A CB   3  
ATOM   5997  C  CG   . TYR A 1 124 ? -1.282  -9.948  -1.175  1.00 0.00 ? 124 TYR A CG   3  
ATOM   5998  C  CD1  . TYR A 1 124 ? -1.096  -9.071  -2.261  1.00 0.00 ? 124 TYR A CD1  3  
ATOM   5999  C  CD2  . TYR A 1 124 ? -2.545  -10.024 -0.552  1.00 0.00 ? 124 TYR A CD2  3  
ATOM   6000  C  CE1  . TYR A 1 124 ? -2.165  -8.297  -2.742  1.00 0.00 ? 124 TYR A CE1  3  
ATOM   6001  C  CE2  . TYR A 1 124 ? -3.611  -9.235  -1.016  1.00 0.00 ? 124 TYR A CE2  3  
ATOM   6002  C  CZ   . TYR A 1 124 ? -3.430  -8.369  -2.115  1.00 0.00 ? 124 TYR A CZ   3  
ATOM   6003  O  OH   . TYR A 1 124 ? -4.481  -7.624  -2.559  1.00 0.00 ? 124 TYR A OH   3  
ATOM   6004  H  H    . TYR A 1 124 ? 1.118   -10.526 -2.835  1.00 0.00 ? 124 TYR A H    3  
ATOM   6005  H  HA   . TYR A 1 124 ? 0.842   -12.703 -1.113  1.00 0.00 ? 124 TYR A HA   3  
ATOM   6006  H  HB2  . TYR A 1 124 ? -0.411  -11.266 0.261   1.00 0.00 ? 124 TYR A HB2  3  
ATOM   6007  H  HB3  . TYR A 1 124 ? 0.750   -10.234 -0.548  1.00 0.00 ? 124 TYR A HB3  3  
ATOM   6008  H  HD1  . TYR A 1 124 ? -0.133  -8.998  -2.744  1.00 0.00 ? 124 TYR A HD1  3  
ATOM   6009  H  HD2  . TYR A 1 124 ? -2.710  -10.693 0.281   1.00 0.00 ? 124 TYR A HD2  3  
ATOM   6010  H  HE1  . TYR A 1 124 ? -2.013  -7.658  -3.598  1.00 0.00 ? 124 TYR A HE1  3  
ATOM   6011  H  HE2  . TYR A 1 124 ? -4.578  -9.299  -0.542  1.00 0.00 ? 124 TYR A HE2  3  
ATOM   6012  H  HH   . TYR A 1 124 ? -4.260  -7.035  -3.294  1.00 0.00 ? 124 TYR A HH   3  
ATOM   6013  N  N    . LYS A 1 125 ? -1.576  -13.628 -1.165  1.00 0.00 ? 125 LYS A N    3  
ATOM   6014  C  CA   . LYS A 1 125 ? -2.681  -14.562 -1.437  1.00 0.00 ? 125 LYS A CA   3  
ATOM   6015  C  C    . LYS A 1 125 ? -3.609  -14.725 -0.228  1.00 0.00 ? 125 LYS A C    3  
ATOM   6016  O  O    . LYS A 1 125 ? -4.473  -15.603 -0.259  1.00 0.00 ? 125 LYS A O    3  
ATOM   6017  C  CB   . LYS A 1 125 ? -2.119  -15.935 -1.872  1.00 0.00 ? 125 LYS A CB   3  
ATOM   6018  C  CG   . LYS A 1 125 ? -1.164  -15.830 -3.068  1.00 0.00 ? 125 LYS A CG   3  
ATOM   6019  C  CD   . LYS A 1 125 ? -0.680  -17.193 -3.575  1.00 0.00 ? 125 LYS A CD   3  
ATOM   6020  C  CE   . LYS A 1 125 ? 0.212   -17.046 -4.820  1.00 0.00 ? 125 LYS A CE   3  
ATOM   6021  N  NZ   . LYS A 1 125 ? 1.459   -16.279 -4.562  1.00 0.00 ? 125 LYS A NZ   3  
ATOM   6022  H  H    . LYS A 1 125 ? -1.092  -13.735 -0.284  1.00 0.00 ? 125 LYS A H    3  
ATOM   6023  H  HA   . LYS A 1 125 ? -3.286  -14.162 -2.253  1.00 0.00 ? 125 LYS A HA   3  
ATOM   6024  H  HB2  . LYS A 1 125 ? -1.591  -16.392 -1.033  1.00 0.00 ? 125 LYS A HB2  3  
ATOM   6025  H  HB3  . LYS A 1 125 ? -2.950  -16.585 -2.150  1.00 0.00 ? 125 LYS A HB3  3  
ATOM   6026  H  HG2  . LYS A 1 125 ? -1.670  -15.303 -3.878  1.00 0.00 ? 125 LYS A HG2  3  
ATOM   6027  H  HG3  . LYS A 1 125 ? -0.294  -15.258 -2.753  1.00 0.00 ? 125 LYS A HG3  3  
ATOM   6028  H  HD2  . LYS A 1 125 ? -0.131  -17.707 -2.785  1.00 0.00 ? 125 LYS A HD2  3  
ATOM   6029  H  HD3  . LYS A 1 125 ? -1.546  -17.801 -3.842  1.00 0.00 ? 125 LYS A HD3  3  
ATOM   6030  H  HE2  . LYS A 1 125 ? 0.473   -18.045 -5.176  1.00 0.00 ? 125 LYS A HE2  3  
ATOM   6031  H  HE3  . LYS A 1 125 ? -0.363  -16.552 -5.606  1.00 0.00 ? 125 LYS A HE3  3  
ATOM   6032  H  HZ1  . LYS A 1 125 ? 2.025   -16.238 -5.398  1.00 0.00 ? 125 LYS A HZ1  3  
ATOM   6033  H  HZ2  . LYS A 1 125 ? 1.259   -15.321 -4.284  1.00 0.00 ? 125 LYS A HZ2  3  
ATOM   6034  H  HZ3  . LYS A 1 125 ? 2.013   -16.714 -3.840  1.00 0.00 ? 125 LYS A HZ3  3  
ATOM   6035  N  N    . PHE A 1 126 ? -3.445  -13.884 0.802   1.00 0.00 ? 126 PHE A N    3  
ATOM   6036  C  CA   . PHE A 1 126 ? -4.068  -14.000 2.119   1.00 0.00 ? 126 PHE A CA   3  
ATOM   6037  C  C    . PHE A 1 126 ? -3.869  -15.414 2.672   1.00 0.00 ? 126 PHE A C    3  
ATOM   6038  O  O    . PHE A 1 126 ? -4.787  -16.260 2.626   1.00 0.00 ? 126 PHE A O    3  
ATOM   6039  C  CB   . PHE A 1 126 ? -5.531  -13.518 2.103   1.00 0.00 ? 126 PHE A CB   3  
ATOM   6040  C  CG   . PHE A 1 126 ? -5.761  -12.029 1.875   1.00 0.00 ? 126 PHE A CG   3  
ATOM   6041  C  CD1  . PHE A 1 126 ? -4.980  -11.057 2.537   1.00 0.00 ? 126 PHE A CD1  3  
ATOM   6042  C  CD2  . PHE A 1 126 ? -6.809  -11.609 1.031   1.00 0.00 ? 126 PHE A CD2  3  
ATOM   6043  C  CE1  . PHE A 1 126 ? -5.242  -9.686  2.351   1.00 0.00 ? 126 PHE A CE1  3  
ATOM   6044  C  CE2  . PHE A 1 126 ? -7.070  -10.239 0.847   1.00 0.00 ? 126 PHE A CE2  3  
ATOM   6045  C  CZ   . PHE A 1 126 ? -6.289  -9.276  1.508   1.00 0.00 ? 126 PHE A CZ   3  
ATOM   6046  O  OXT  . PHE A 1 126 ? -2.758  -15.656 3.186   1.00 0.00 ? 126 PHE A OXT  3  
ATOM   6047  H  H    . PHE A 1 126 ? -2.728  -13.185 0.709   1.00 0.00 ? 126 PHE A H    3  
ATOM   6048  H  HA   . PHE A 1 126 ? -3.517  -13.345 2.791   1.00 0.00 ? 126 PHE A HA   3  
ATOM   6049  H  HB2  . PHE A 1 126 ? -6.070  -14.081 1.342   1.00 0.00 ? 126 PHE A HB2  3  
ATOM   6050  H  HB3  . PHE A 1 126 ? -5.981  -13.778 3.058   1.00 0.00 ? 126 PHE A HB3  3  
ATOM   6051  H  HD1  . PHE A 1 126 ? -4.176  -11.351 3.194   1.00 0.00 ? 126 PHE A HD1  3  
ATOM   6052  H  HD2  . PHE A 1 126 ? -7.427  -12.340 0.529   1.00 0.00 ? 126 PHE A HD2  3  
ATOM   6053  H  HE1  . PHE A 1 126 ? -4.640  -8.947  2.861   1.00 0.00 ? 126 PHE A HE1  3  
ATOM   6054  H  HE2  . PHE A 1 126 ? -7.882  -9.928  0.206   1.00 0.00 ? 126 PHE A HE2  3  
ATOM   6055  H  HZ   . PHE A 1 126 ? -6.493  -8.223  1.368   1.00 0.00 ? 126 PHE A HZ   3  
HETATM 6056  CA CA   . CA  B 2 .   ? -7.108  5.847   11.675  1.00 0.00 ? 127 CA  A CA   3  
HETATM 6057  CA CA   . CA  C 2 .   ? -9.191  -18.282 11.894  1.00 0.00 ? 128 CA  A CA   3  
ATOM   6058  N  N    . MET A 1 1   ? 11.194  -15.119 -4.279  1.00 0.00 ? 1   MET A N    4  
ATOM   6059  C  CA   . MET A 1 1   ? 11.907  -13.825 -4.406  1.00 0.00 ? 1   MET A CA   4  
ATOM   6060  C  C    . MET A 1 1   ? 10.912  -12.711 -4.749  1.00 0.00 ? 1   MET A C    4  
ATOM   6061  O  O    . MET A 1 1   ? 10.229  -12.788 -5.773  1.00 0.00 ? 1   MET A O    4  
ATOM   6062  C  CB   . MET A 1 1   ? 13.041  -13.917 -5.450  1.00 0.00 ? 1   MET A CB   4  
ATOM   6063  C  CG   . MET A 1 1   ? 13.876  -12.633 -5.559  1.00 0.00 ? 1   MET A CG   4  
ATOM   6064  S  SD   . MET A 1 1   ? 14.676  -12.110 -4.017  1.00 0.00 ? 1   MET A SD   4  
ATOM   6065  C  CE   . MET A 1 1   ? 15.622  -10.692 -4.634  1.00 0.00 ? 1   MET A CE   4  
ATOM   6066  H  H1   . MET A 1 1   ? 11.838  -15.857 -4.040  1.00 0.00 ? 1   MET A H1   4  
ATOM   6067  H  H2   . MET A 1 1   ? 10.490  -15.060 -3.561  1.00 0.00 ? 1   MET A H2   4  
ATOM   6068  H  H3   . MET A 1 1   ? 10.741  -15.347 -5.151  1.00 0.00 ? 1   MET A H3   4  
ATOM   6069  H  HA   . MET A 1 1   ? 12.363  -13.595 -3.441  1.00 0.00 ? 1   MET A HA   4  
ATOM   6070  H  HB2  . MET A 1 1   ? 13.714  -14.732 -5.177  1.00 0.00 ? 1   MET A HB2  4  
ATOM   6071  H  HB3  . MET A 1 1   ? 12.622  -14.141 -6.433  1.00 0.00 ? 1   MET A HB3  4  
ATOM   6072  H  HG2  . MET A 1 1   ? 14.653  -12.800 -6.305  1.00 0.00 ? 1   MET A HG2  4  
ATOM   6073  H  HG3  . MET A 1 1   ? 13.244  -11.820 -5.919  1.00 0.00 ? 1   MET A HG3  4  
ATOM   6074  H  HE1  . MET A 1 1   ? 16.148  -10.217 -3.806  1.00 0.00 ? 1   MET A HE1  4  
ATOM   6075  H  HE2  . MET A 1 1   ? 16.348  -11.029 -5.374  1.00 0.00 ? 1   MET A HE2  4  
ATOM   6076  H  HE3  . MET A 1 1   ? 14.947  -9.971  -5.094  1.00 0.00 ? 1   MET A HE3  4  
ATOM   6077  N  N    . ALA A 1 2   ? 10.839  -11.665 -3.916  1.00 0.00 ? 2   ALA A N    4  
ATOM   6078  C  CA   . ALA A 1 2   ? 9.988   -10.490 -4.119  1.00 0.00 ? 2   ALA A CA   4  
ATOM   6079  C  C    . ALA A 1 2   ? 10.774  -9.181  -3.937  1.00 0.00 ? 2   ALA A C    4  
ATOM   6080  O  O    . ALA A 1 2   ? 10.172  -8.106  -3.935  1.00 0.00 ? 2   ALA A O    4  
ATOM   6081  C  CB   . ALA A 1 2   ? 8.776   -10.569 -3.182  1.00 0.00 ? 2   ALA A CB   4  
ATOM   6082  H  H    . ALA A 1 2   ? 11.383  -11.685 -3.050  1.00 0.00 ? 2   ALA A H    4  
ATOM   6083  H  HA   . ALA A 1 2   ? 9.614   -10.489 -5.140  1.00 0.00 ? 2   ALA A HA   4  
ATOM   6084  H  HB1  . ALA A 1 2   ? 8.129   -9.703  -3.334  1.00 0.00 ? 2   ALA A HB1  4  
ATOM   6085  H  HB2  . ALA A 1 2   ? 8.200   -11.471 -3.387  1.00 0.00 ? 2   ALA A HB2  4  
ATOM   6086  H  HB3  . ALA A 1 2   ? 9.111   -10.580 -2.147  1.00 0.00 ? 2   ALA A HB3  4  
ATOM   6087  N  N    . SER A 1 3   ? 12.100  -9.260  -3.777  1.00 0.00 ? 3   SER A N    4  
ATOM   6088  C  CA   . SER A 1 3   ? 12.978  -8.135  -3.460  1.00 0.00 ? 3   SER A CA   4  
ATOM   6089  C  C    . SER A 1 3   ? 12.560  -7.430  -2.156  1.00 0.00 ? 3   SER A C    4  
ATOM   6090  O  O    . SER A 1 3   ? 12.828  -6.241  -1.974  1.00 0.00 ? 3   SER A O    4  
ATOM   6091  C  CB   . SER A 1 3   ? 13.099  -7.190  -4.669  1.00 0.00 ? 3   SER A CB   4  
ATOM   6092  O  OG   . SER A 1 3   ? 13.398  -7.910  -5.859  1.00 0.00 ? 3   SER A OG   4  
ATOM   6093  H  H    . SER A 1 3   ? 12.521  -10.175 -3.697  1.00 0.00 ? 3   SER A H    4  
ATOM   6094  H  HA   . SER A 1 3   ? 13.966  -8.555  -3.275  1.00 0.00 ? 3   SER A HA   4  
ATOM   6095  H  HB2  . SER A 1 3   ? 12.164  -6.645  -4.804  1.00 0.00 ? 3   SER A HB2  4  
ATOM   6096  H  HB3  . SER A 1 3   ? 13.893  -6.466  -4.477  1.00 0.00 ? 3   SER A HB3  4  
ATOM   6097  H  HG   . SER A 1 3   ? 13.458  -7.269  -6.588  1.00 0.00 ? 3   SER A HG   4  
ATOM   6098  N  N    . VAL A 1 4   ? 11.900  -8.157  -1.245  1.00 0.00 ? 4   VAL A N    4  
ATOM   6099  C  CA   . VAL A 1 4   ? 11.440  -7.640  0.045   1.00 0.00 ? 4   VAL A CA   4  
ATOM   6100  C  C    . VAL A 1 4   ? 11.538  -8.746  1.118   1.00 0.00 ? 4   VAL A C    4  
ATOM   6101  O  O    . VAL A 1 4   ? 10.875  -8.708  2.150   1.00 0.00 ? 4   VAL A O    4  
ATOM   6102  C  CB   . VAL A 1 4   ? 10.065  -6.947  -0.161  1.00 0.00 ? 4   VAL A CB   4  
ATOM   6103  C  CG1  . VAL A 1 4   ? 8.905   -7.907  -0.457  1.00 0.00 ? 4   VAL A CG1  4  
ATOM   6104  C  CG2  . VAL A 1 4   ? 9.682   -6.007  0.985   1.00 0.00 ? 4   VAL A CG2  4  
ATOM   6105  H  H    . VAL A 1 4   ? 11.725  -9.139  -1.449  1.00 0.00 ? 4   VAL A H    4  
ATOM   6106  H  HA   . VAL A 1 4   ? 12.148  -6.868  0.349   1.00 0.00 ? 4   VAL A HA   4  
ATOM   6107  H  HB   . VAL A 1 4   ? 10.165  -6.304  -1.037  1.00 0.00 ? 4   VAL A HB   4  
ATOM   6108  H  HG11 . VAL A 1 4   ? 9.127   -8.473  -1.357  1.00 0.00 ? 4   VAL A HG11 4  
ATOM   6109  H  HG12 . VAL A 1 4   ? 8.750   -8.588  0.378   1.00 0.00 ? 4   VAL A HG12 4  
ATOM   6110  H  HG13 . VAL A 1 4   ? 7.989   -7.340  -0.628  1.00 0.00 ? 4   VAL A HG13 4  
ATOM   6111  H  HG21 . VAL A 1 4   ? 9.296   -6.580  1.825   1.00 0.00 ? 4   VAL A HG21 4  
ATOM   6112  H  HG22 . VAL A 1 4   ? 10.546  -5.423  1.302   1.00 0.00 ? 4   VAL A HG22 4  
ATOM   6113  H  HG23 . VAL A 1 4   ? 8.911   -5.319  0.641   1.00 0.00 ? 4   VAL A HG23 4  
ATOM   6114  N  N    . GLU A 1 5   ? 12.387  -9.750  0.876   1.00 0.00 ? 5   GLU A N    4  
ATOM   6115  C  CA   . GLU A 1 5   ? 12.695  -10.881 1.752   1.00 0.00 ? 5   GLU A CA   4  
ATOM   6116  C  C    . GLU A 1 5   ? 13.063  -10.431 3.176   1.00 0.00 ? 5   GLU A C    4  
ATOM   6117  O  O    . GLU A 1 5   ? 12.677  -11.084 4.146   1.00 0.00 ? 5   GLU A O    4  
ATOM   6118  C  CB   . GLU A 1 5   ? 13.847  -11.679 1.106   1.00 0.00 ? 5   GLU A CB   4  
ATOM   6119  C  CG   . GLU A 1 5   ? 13.431  -12.688 0.015   1.00 0.00 ? 5   GLU A CG   4  
ATOM   6120  C  CD   . GLU A 1 5   ? 12.484  -12.162 -1.073  1.00 0.00 ? 5   GLU A CD   4  
ATOM   6121  O  OE1  . GLU A 1 5   ? 12.624  -11.026 -1.571  1.00 0.00 ? 5   GLU A OE1  4  
ATOM   6122  O  OE2  . GLU A 1 5   ? 11.512  -12.876 -1.405  1.00 0.00 ? 5   GLU A OE2  4  
ATOM   6123  H  H    . GLU A 1 5   ? 12.847  -9.769  -0.031  1.00 0.00 ? 5   GLU A H    4  
ATOM   6124  H  HA   . GLU A 1 5   ? 11.821  -11.527 1.837   1.00 0.00 ? 5   GLU A HA   4  
ATOM   6125  H  HB2  . GLU A 1 5   ? 14.577  -10.983 0.688   1.00 0.00 ? 5   GLU A HB2  4  
ATOM   6126  H  HB3  . GLU A 1 5   ? 14.357  -12.247 1.885   1.00 0.00 ? 5   GLU A HB3  4  
ATOM   6127  H  HG2  . GLU A 1 5   ? 14.333  -13.070 -0.465  1.00 0.00 ? 5   GLU A HG2  4  
ATOM   6128  H  HG3  . GLU A 1 5   ? 12.944  -13.529 0.512   1.00 0.00 ? 5   GLU A HG3  4  
ATOM   6129  N  N    . ARG A 1 6   ? 13.764  -9.297  3.320   1.00 0.00 ? 6   ARG A N    4  
ATOM   6130  C  CA   . ARG A 1 6   ? 14.134  -8.713  4.599   1.00 0.00 ? 6   ARG A CA   4  
ATOM   6131  C  C    . ARG A 1 6   ? 12.934  -8.407  5.497   1.00 0.00 ? 6   ARG A C    4  
ATOM   6132  O  O    . ARG A 1 6   ? 13.114  -8.329  6.709   1.00 0.00 ? 6   ARG A O    4  
ATOM   6133  C  CB   . ARG A 1 6   ? 14.965  -7.442  4.311   1.00 0.00 ? 6   ARG A CB   4  
ATOM   6134  C  CG   . ARG A 1 6   ? 15.474  -6.695  5.553   1.00 0.00 ? 6   ARG A CG   4  
ATOM   6135  C  CD   . ARG A 1 6   ? 16.266  -7.629  6.473   1.00 0.00 ? 6   ARG A CD   4  
ATOM   6136  N  NE   . ARG A 1 6   ? 16.641  -6.973  7.741   1.00 0.00 ? 6   ARG A NE   4  
ATOM   6137  C  CZ   . ARG A 1 6   ? 15.840  -6.793  8.804   1.00 0.00 ? 6   ARG A CZ   4  
ATOM   6138  N  NH1  . ARG A 1 6   ? 14.580  -7.215  8.782   1.00 0.00 ? 6   ARG A NH1  4  
ATOM   6139  N  NH2  . ARG A 1 6   ? 16.307  -6.183  9.888   1.00 0.00 ? 6   ARG A NH2  4  
ATOM   6140  H  H    . ARG A 1 6   ? 14.138  -8.835  2.508   1.00 0.00 ? 6   ARG A H    4  
ATOM   6141  H  HA   . ARG A 1 6   ? 14.750  -9.454  5.107   1.00 0.00 ? 6   ARG A HA   4  
ATOM   6142  H  HB2  . ARG A 1 6   ? 15.831  -7.721  3.707   1.00 0.00 ? 6   ARG A HB2  4  
ATOM   6143  H  HB3  . ARG A 1 6   ? 14.360  -6.747  3.727   1.00 0.00 ? 6   ARG A HB3  4  
ATOM   6144  H  HG2  . ARG A 1 6   ? 16.119  -5.876  5.234   1.00 0.00 ? 6   ARG A HG2  4  
ATOM   6145  H  HG3  . ARG A 1 6   ? 14.629  -6.265  6.091   1.00 0.00 ? 6   ARG A HG3  4  
ATOM   6146  H  HD2  . ARG A 1 6   ? 15.675  -8.517  6.689   1.00 0.00 ? 6   ARG A HD2  4  
ATOM   6147  H  HD3  . ARG A 1 6   ? 17.155  -7.957  5.933   1.00 0.00 ? 6   ARG A HD3  4  
ATOM   6148  H  HE   . ARG A 1 6   ? 17.598  -6.642  7.790   1.00 0.00 ? 6   ARG A HE   4  
ATOM   6149  H  HH11 . ARG A 1 6   ? 14.190  -7.665  7.956   1.00 0.00 ? 6   ARG A HH11 4  
ATOM   6150  H  HH12 . ARG A 1 6   ? 13.907  -7.062  9.530   1.00 0.00 ? 6   ARG A HH12 4  
ATOM   6151  H  HH21 . ARG A 1 6   ? 17.261  -5.850  9.932   1.00 0.00 ? 6   ARG A HH21 4  
ATOM   6152  H  HH22 . ARG A 1 6   ? 15.732  -6.026  10.704  1.00 0.00 ? 6   ARG A HH22 4  
ATOM   6153  N  N    . ASP A 1 7   ? 11.733  -8.223  4.954   1.00 0.00 ? 7   ASP A N    4  
ATOM   6154  C  CA   . ASP A 1 7   ? 10.569  -7.725  5.692   1.00 0.00 ? 7   ASP A CA   4  
ATOM   6155  C  C    . ASP A 1 7   ? 10.005  -8.731  6.709   1.00 0.00 ? 7   ASP A C    4  
ATOM   6156  O  O    . ASP A 1 7   ? 9.001   -8.458  7.364   1.00 0.00 ? 7   ASP A O    4  
ATOM   6157  C  CB   . ASP A 1 7   ? 9.502   -7.299  4.680   1.00 0.00 ? 7   ASP A CB   4  
ATOM   6158  C  CG   . ASP A 1 7   ? 8.378   -6.459  5.304   1.00 0.00 ? 7   ASP A CG   4  
ATOM   6159  O  OD1  . ASP A 1 7   ? 8.685   -5.379  5.858   1.00 0.00 ? 7   ASP A OD1  4  
ATOM   6160  O  OD2  . ASP A 1 7   ? 7.192   -6.828  5.149   1.00 0.00 ? 7   ASP A OD2  4  
ATOM   6161  H  H    . ASP A 1 7   ? 11.613  -8.369  3.957   1.00 0.00 ? 7   ASP A H    4  
ATOM   6162  H  HA   . ASP A 1 7   ? 10.883  -6.839  6.245   1.00 0.00 ? 7   ASP A HA   4  
ATOM   6163  H  HB2  . ASP A 1 7   ? 9.990   -6.689  3.919   1.00 0.00 ? 7   ASP A HB2  4  
ATOM   6164  H  HB3  . ASP A 1 7   ? 9.090   -8.188  4.198   1.00 0.00 ? 7   ASP A HB3  4  
ATOM   6165  N  N    . GLU A 1 8   ? 10.634  -9.899  6.868   1.00 0.00 ? 8   GLU A N    4  
ATOM   6166  C  CA   . GLU A 1 8   ? 10.187  -10.966 7.758   1.00 0.00 ? 8   GLU A CA   4  
ATOM   6167  C  C    . GLU A 1 8   ? 9.984   -10.520 9.214   1.00 0.00 ? 8   GLU A C    4  
ATOM   6168  O  O    . GLU A 1 8   ? 9.140   -11.082 9.913   1.00 0.00 ? 8   GLU A O    4  
ATOM   6169  C  CB   . GLU A 1 8   ? 11.132  -12.176 7.656   1.00 0.00 ? 8   GLU A CB   4  
ATOM   6170  C  CG   . GLU A 1 8   ? 12.567  -11.897 8.133   1.00 0.00 ? 8   GLU A CG   4  
ATOM   6171  C  CD   . GLU A 1 8   ? 13.436  -13.166 8.076   1.00 0.00 ? 8   GLU A CD   4  
ATOM   6172  O  OE1  . GLU A 1 8   ? 13.406  -13.972 9.035   1.00 0.00 ? 8   GLU A OE1  4  
ATOM   6173  O  OE2  . GLU A 1 8   ? 14.176  -13.366 7.086   1.00 0.00 ? 8   GLU A OE2  4  
ATOM   6174  H  H    . GLU A 1 8   ? 11.458  -10.076 6.311   1.00 0.00 ? 8   GLU A H    4  
ATOM   6175  H  HA   . GLU A 1 8   ? 9.213   -11.276 7.389   1.00 0.00 ? 8   GLU A HA   4  
ATOM   6176  H  HB2  . GLU A 1 8   ? 10.714  -12.988 8.252   1.00 0.00 ? 8   GLU A HB2  4  
ATOM   6177  H  HB3  . GLU A 1 8   ? 11.167  -12.508 6.617   1.00 0.00 ? 8   GLU A HB3  4  
ATOM   6178  H  HG2  . GLU A 1 8   ? 13.012  -11.118 7.509   1.00 0.00 ? 8   GLU A HG2  4  
ATOM   6179  H  HG3  . GLU A 1 8   ? 12.545  -11.527 9.160   1.00 0.00 ? 8   GLU A HG3  4  
ATOM   6180  N  N    . THR A 1 9   ? 10.697  -9.488  9.672   1.00 0.00 ? 9   THR A N    4  
ATOM   6181  C  CA   . THR A 1 9   ? 10.496  -8.874  10.975  1.00 0.00 ? 9   THR A CA   4  
ATOM   6182  C  C    . THR A 1 9   ? 9.081   -8.307  11.118  1.00 0.00 ? 9   THR A C    4  
ATOM   6183  O  O    . THR A 1 9   ? 8.440   -8.484  12.161  1.00 0.00 ? 9   THR A O    4  
ATOM   6184  C  CB   . THR A 1 9   ? 11.557  -7.771  11.144  1.00 0.00 ? 9   THR A CB   4  
ATOM   6185  O  OG1  . THR A 1 9   ? 11.958  -7.191  9.910   1.00 0.00 ? 9   THR A OG1  4  
ATOM   6186  C  CG2  . THR A 1 9   ? 12.833  -8.326  11.781  1.00 0.00 ? 9   THR A CG2  4  
ATOM   6187  H  H    . THR A 1 9   ? 11.381  -9.039  9.077   1.00 0.00 ? 9   THR A H    4  
ATOM   6188  H  HA   . THR A 1 9   ? 10.614  -9.627  11.756  1.00 0.00 ? 9   THR A HA   4  
ATOM   6189  H  HB   . THR A 1 9   ? 11.134  -6.992  11.766  1.00 0.00 ? 9   THR A HB   4  
ATOM   6190  H  HG1  . THR A 1 9   ? 11.378  -6.433  9.722   1.00 0.00 ? 9   THR A HG1  4  
ATOM   6191  H  HG21 . THR A 1 9   ? 13.268  -9.095  11.141  1.00 0.00 ? 9   THR A HG21 4  
ATOM   6192  H  HG22 . THR A 1 9   ? 13.554  -7.521  11.921  1.00 0.00 ? 9   THR A HG22 4  
ATOM   6193  H  HG23 . THR A 1 9   ? 12.605  -8.760  12.755  1.00 0.00 ? 9   THR A HG23 4  
ATOM   6194  N  N    . ARG A 1 10  ? 8.580   -7.650  10.071  1.00 0.00 ? 10  ARG A N    4  
ATOM   6195  C  CA   . ARG A 1 10  ? 7.194   -7.199  10.049  1.00 0.00 ? 10  ARG A CA   4  
ATOM   6196  C  C    . ARG A 1 10  ? 6.270   -8.378  9.829   1.00 0.00 ? 10  ARG A C    4  
ATOM   6197  O  O    . ARG A 1 10  ? 5.239   -8.406  10.485  1.00 0.00 ? 10  ARG A O    4  
ATOM   6198  C  CB   . ARG A 1 10  ? 6.927   -6.122  8.990   1.00 0.00 ? 10  ARG A CB   4  
ATOM   6199  C  CG   . ARG A 1 10  ? 7.444   -4.745  9.433   1.00 0.00 ? 10  ARG A CG   4  
ATOM   6200  C  CD   . ARG A 1 10  ? 6.942   -3.609  8.526   1.00 0.00 ? 10  ARG A CD   4  
ATOM   6201  N  NE   . ARG A 1 10  ? 5.473   -3.472  8.505   1.00 0.00 ? 10  ARG A NE   4  
ATOM   6202  C  CZ   . ARG A 1 10  ? 4.683   -2.980  9.466   1.00 0.00 ? 10  ARG A CZ   4  
ATOM   6203  N  NH1  . ARG A 1 10  ? 5.187   -2.557  10.624  1.00 0.00 ? 10  ARG A NH1  4  
ATOM   6204  N  NH2  . ARG A 1 10  ? 3.375   -2.903  9.260   1.00 0.00 ? 10  ARG A NH2  4  
ATOM   6205  H  H    . ARG A 1 10  ? 9.102   -7.682  9.211   1.00 0.00 ? 10  ARG A H    4  
ATOM   6206  H  HA   . ARG A 1 10  ? 6.948   -6.784  11.028  1.00 0.00 ? 10  ARG A HA   4  
ATOM   6207  H  HB2  . ARG A 1 10  ? 7.377   -6.406  8.041   1.00 0.00 ? 10  ARG A HB2  4  
ATOM   6208  H  HB3  . ARG A 1 10  ? 5.848   -6.057  8.847   1.00 0.00 ? 10  ARG A HB3  4  
ATOM   6209  H  HG2  . ARG A 1 10  ? 7.124   -4.551  10.457  1.00 0.00 ? 10  ARG A HG2  4  
ATOM   6210  H  HG3  . ARG A 1 10  ? 8.535   -4.755  9.415   1.00 0.00 ? 10  ARG A HG3  4  
ATOM   6211  H  HD2  . ARG A 1 10  ? 7.388   -2.668  8.848   1.00 0.00 ? 10  ARG A HD2  4  
ATOM   6212  H  HD3  . ARG A 1 10  ? 7.272   -3.808  7.508   1.00 0.00 ? 10  ARG A HD3  4  
ATOM   6213  H  HE   . ARG A 1 10  ? 5.040   -3.725  7.611   1.00 0.00 ? 10  ARG A HE   4  
ATOM   6214  H  HH11 . ARG A 1 10  ? 6.182   -2.580  10.792  1.00 0.00 ? 10  ARG A HH11 4  
ATOM   6215  H  HH12 . ARG A 1 10  ? 4.602   -2.180  11.356  1.00 0.00 ? 10  ARG A HH12 4  
ATOM   6216  H  HH21 . ARG A 1 10  ? 2.966   -3.171  8.356   1.00 0.00 ? 10  ARG A HH21 4  
ATOM   6217  H  HH22 . ARG A 1 10  ? 2.750   -2.487  9.946   1.00 0.00 ? 10  ARG A HH22 4  
ATOM   6218  N  N    . GLU A 1 11  ? 6.604   -9.354  8.980   1.00 0.00 ? 11  GLU A N    4  
ATOM   6219  C  CA   . GLU A 1 11  ? 5.715   -10.497 8.757   1.00 0.00 ? 11  GLU A CA   4  
ATOM   6220  C  C    . GLU A 1 11  ? 5.420   -11.217 10.078  1.00 0.00 ? 11  GLU A C    4  
ATOM   6221  O  O    . GLU A 1 11  ? 4.262   -11.538 10.346  1.00 0.00 ? 11  GLU A O    4  
ATOM   6222  C  CB   . GLU A 1 11  ? 6.275   -11.488 7.728   1.00 0.00 ? 11  GLU A CB   4  
ATOM   6223  C  CG   . GLU A 1 11  ? 6.391   -10.896 6.317   1.00 0.00 ? 11  GLU A CG   4  
ATOM   6224  C  CD   . GLU A 1 11  ? 6.796   -11.976 5.297   1.00 0.00 ? 11  GLU A CD   4  
ATOM   6225  O  OE1  . GLU A 1 11  ? 5.906   -12.694 4.787   1.00 0.00 ? 11  GLU A OE1  4  
ATOM   6226  O  OE2  . GLU A 1 11  ? 8.002   -12.113 4.998   1.00 0.00 ? 11  GLU A OE2  4  
ATOM   6227  H  H    . GLU A 1 11  ? 7.446   -9.259  8.412   1.00 0.00 ? 11  GLU A H    4  
ATOM   6228  H  HA   . GLU A 1 11  ? 4.767   -10.115 8.375   1.00 0.00 ? 11  GLU A HA   4  
ATOM   6229  H  HB2  . GLU A 1 11  ? 7.246   -11.852 8.059   1.00 0.00 ? 11  GLU A HB2  4  
ATOM   6230  H  HB3  . GLU A 1 11  ? 5.599   -12.342 7.683   1.00 0.00 ? 11  GLU A HB3  4  
ATOM   6231  H  HG2  . GLU A 1 11  ? 5.427   -10.467 6.031   1.00 0.00 ? 11  GLU A HG2  4  
ATOM   6232  H  HG3  . GLU A 1 11  ? 7.128   -10.093 6.319   1.00 0.00 ? 11  GLU A HG3  4  
ATOM   6233  N  N    . HIS A 1 12  ? 6.434   -11.408 10.932  1.00 0.00 ? 12  HIS A N    4  
ATOM   6234  C  CA   . HIS A 1 12  ? 6.244   -11.968 12.265  1.00 0.00 ? 12  HIS A CA   4  
ATOM   6235  C  C    . HIS A 1 12  ? 5.302   -11.082 13.077  1.00 0.00 ? 12  HIS A C    4  
ATOM   6236  O  O    . HIS A 1 12  ? 4.343   -11.592 13.651  1.00 0.00 ? 12  HIS A O    4  
ATOM   6237  C  CB   . HIS A 1 12  ? 7.598   -12.119 12.978  1.00 0.00 ? 12  HIS A CB   4  
ATOM   6238  C  CG   . HIS A 1 12  ? 7.549   -12.696 14.383  1.00 0.00 ? 12  HIS A CG   4  
ATOM   6239  N  ND1  . HIS A 1 12  ? 6.506   -12.660 15.294  1.00 0.00 ? 12  HIS A ND1  4  
ATOM   6240  C  CD2  . HIS A 1 12  ? 8.600   -13.307 15.016  1.00 0.00 ? 12  HIS A CD2  4  
ATOM   6241  C  CE1  . HIS A 1 12  ? 6.926   -13.228 16.435  1.00 0.00 ? 12  HIS A CE1  4  
ATOM   6242  N  NE2  . HIS A 1 12  ? 8.200   -13.645 16.317  1.00 0.00 ? 12  HIS A NE2  4  
ATOM   6243  H  H    . HIS A 1 12  ? 7.376   -11.154 10.648  1.00 0.00 ? 12  HIS A H    4  
ATOM   6244  H  HA   . HIS A 1 12  ? 5.792   -12.956 12.166  1.00 0.00 ? 12  HIS A HA   4  
ATOM   6245  H  HB2  . HIS A 1 12  ? 8.233   -12.766 12.370  1.00 0.00 ? 12  HIS A HB2  4  
ATOM   6246  H  HB3  . HIS A 1 12  ? 8.084   -11.143 13.033  1.00 0.00 ? 12  HIS A HB3  4  
ATOM   6247  H  HD1  . HIS A 1 12  ? 5.567   -12.276 15.152  1.00 0.00 ? 12  HIS A HD1  4  
ATOM   6248  H  HD2  . HIS A 1 12  ? 9.580   -13.476 14.587  1.00 0.00 ? 12  HIS A HD2  4  
ATOM   6249  H  HE1  . HIS A 1 12  ? 6.318   -13.327 17.327  1.00 0.00 ? 12  HIS A HE1  4  
ATOM   6250  N  N    . ARG A 1 13  ? 5.573   -9.776  13.162  1.00 0.00 ? 13  ARG A N    4  
ATOM   6251  C  CA   . ARG A 1 13  ? 4.793   -8.874  14.014  1.00 0.00 ? 13  ARG A CA   4  
ATOM   6252  C  C    . ARG A 1 13  ? 3.336   -8.825  13.559  1.00 0.00 ? 13  ARG A C    4  
ATOM   6253  O  O    . ARG A 1 13  ? 2.434   -8.889  14.389  1.00 0.00 ? 13  ARG A O    4  
ATOM   6254  C  CB   . ARG A 1 13  ? 5.436   -7.481  14.015  1.00 0.00 ? 13  ARG A CB   4  
ATOM   6255  C  CG   . ARG A 1 13  ? 6.757   -7.494  14.801  1.00 0.00 ? 13  ARG A CG   4  
ATOM   6256  C  CD   . ARG A 1 13  ? 7.569   -6.224  14.527  1.00 0.00 ? 13  ARG A CD   4  
ATOM   6257  N  NE   . ARG A 1 13  ? 8.748   -6.115  15.406  1.00 0.00 ? 13  ARG A NE   4  
ATOM   6258  C  CZ   . ARG A 1 13  ? 9.844   -6.887  15.395  1.00 0.00 ? 13  ARG A CZ   4  
ATOM   6259  N  NH1  . ARG A 1 13  ? 9.976   -7.883  14.519  1.00 0.00 ? 13  ARG A NH1  4  
ATOM   6260  N  NH2  . ARG A 1 13  ? 10.813  -6.659  16.275  1.00 0.00 ? 13  ARG A NH2  4  
ATOM   6261  H  H    . ARG A 1 13  ? 6.367   -9.399  12.655  1.00 0.00 ? 13  ARG A H    4  
ATOM   6262  H  HA   . ARG A 1 13  ? 4.800   -9.262  15.034  1.00 0.00 ? 13  ARG A HA   4  
ATOM   6263  H  HB2  . ARG A 1 13  ? 5.611   -7.161  12.987  1.00 0.00 ? 13  ARG A HB2  4  
ATOM   6264  H  HB3  . ARG A 1 13  ? 4.757   -6.769  14.486  1.00 0.00 ? 13  ARG A HB3  4  
ATOM   6265  H  HG2  . ARG A 1 13  ? 6.535   -7.564  15.867  1.00 0.00 ? 13  ARG A HG2  4  
ATOM   6266  H  HG3  . ARG A 1 13  ? 7.353   -8.362  14.516  1.00 0.00 ? 13  ARG A HG3  4  
ATOM   6267  H  HD2  . ARG A 1 13  ? 7.885   -6.212  13.483  1.00 0.00 ? 13  ARG A HD2  4  
ATOM   6268  H  HD3  . ARG A 1 13  ? 6.928   -5.360  14.700  1.00 0.00 ? 13  ARG A HD3  4  
ATOM   6269  H  HE   . ARG A 1 13  ? 8.699   -5.366  16.087  1.00 0.00 ? 13  ARG A HE   4  
ATOM   6270  H  HH11 . ARG A 1 13  ? 9.247   -8.070  13.833  1.00 0.00 ? 13  ARG A HH11 4  
ATOM   6271  H  HH12 . ARG A 1 13  ? 10.764  -8.514  14.552  1.00 0.00 ? 13  ARG A HH12 4  
ATOM   6272  H  HH21 . ARG A 1 13  ? 10.738  -5.912  16.953  1.00 0.00 ? 13  ARG A HH21 4  
ATOM   6273  H  HH22 . ARG A 1 13  ? 11.657  -7.213  16.304  1.00 0.00 ? 13  ARG A HH22 4  
ATOM   6274  N  N    . ILE A 1 14  ? 3.105   -8.755  12.249  1.00 0.00 ? 14  ILE A N    4  
ATOM   6275  C  CA   . ILE A 1 14  ? 1.788   -8.816  11.637  1.00 0.00 ? 14  ILE A CA   4  
ATOM   6276  C  C    . ILE A 1 14  ? 1.114   -10.116 12.087  1.00 0.00 ? 14  ILE A C    4  
ATOM   6277  O  O    . ILE A 1 14  ? 0.000   -10.077 12.612  1.00 0.00 ? 14  ILE A O    4  
ATOM   6278  C  CB   . ILE A 1 14  ? 1.948   -8.683  10.099  1.00 0.00 ? 14  ILE A CB   4  
ATOM   6279  C  CG1  . ILE A 1 14  ? 2.350   -7.237  9.707   1.00 0.00 ? 14  ILE A CG1  4  
ATOM   6280  C  CG2  . ILE A 1 14  ? 0.676   -9.108  9.347   1.00 0.00 ? 14  ILE A CG2  4  
ATOM   6281  C  CD1  . ILE A 1 14  ? 2.997   -7.123  8.320   1.00 0.00 ? 14  ILE A CD1  4  
ATOM   6282  H  H    . ILE A 1 14  ? 3.900   -8.710  11.623  1.00 0.00 ? 14  ILE A H    4  
ATOM   6283  H  HA   . ILE A 1 14  ? 1.192   -7.983  12.007  1.00 0.00 ? 14  ILE A HA   4  
ATOM   6284  H  HB   . ILE A 1 14  ? 2.746   -9.357  9.784   1.00 0.00 ? 14  ILE A HB   4  
ATOM   6285  H  HG12 . ILE A 1 14  ? 1.469   -6.596  9.728   1.00 0.00 ? 14  ILE A HG12 4  
ATOM   6286  H  HG13 . ILE A 1 14  ? 3.063   -6.840  10.430  1.00 0.00 ? 14  ILE A HG13 4  
ATOM   6287  H  HG21 . ILE A 1 14  ? 0.489   -10.168 9.522   1.00 0.00 ? 14  ILE A HG21 4  
ATOM   6288  H  HG22 . ILE A 1 14  ? -0.180  -8.524  9.687   1.00 0.00 ? 14  ILE A HG22 4  
ATOM   6289  H  HG23 . ILE A 1 14  ? 0.801   -8.970  8.275   1.00 0.00 ? 14  ILE A HG23 4  
ATOM   6290  H  HD11 . ILE A 1 14  ? 3.295   -6.088  8.141   1.00 0.00 ? 14  ILE A HD11 4  
ATOM   6291  H  HD12 . ILE A 1 14  ? 3.884   -7.753  8.264   1.00 0.00 ? 14  ILE A HD12 4  
ATOM   6292  H  HD13 . ILE A 1 14  ? 2.298   -7.430  7.547   1.00 0.00 ? 14  ILE A HD13 4  
ATOM   6293  N  N    . GLU A 1 15  ? 1.789   -11.256 11.920  1.00 0.00 ? 15  GLU A N    4  
ATOM   6294  C  CA   . GLU A 1 15  ? 1.239   -12.560 12.251  1.00 0.00 ? 15  GLU A CA   4  
ATOM   6295  C  C    . GLU A 1 15  ? 0.814   -12.638 13.720  1.00 0.00 ? 15  GLU A C    4  
ATOM   6296  O  O    . GLU A 1 15  ? -0.303  -13.072 13.990  1.00 0.00 ? 15  GLU A O    4  
ATOM   6297  C  CB   . GLU A 1 15  ? 2.239   -13.663 11.867  1.00 0.00 ? 15  GLU A CB   4  
ATOM   6298  C  CG   . GLU A 1 15  ? 1.694   -15.067 12.158  1.00 0.00 ? 15  GLU A CG   4  
ATOM   6299  C  CD   . GLU A 1 15  ? 2.643   -16.160 11.635  1.00 0.00 ? 15  GLU A CD   4  
ATOM   6300  O  OE1  . GLU A 1 15  ? 3.548   -16.597 12.382  1.00 0.00 ? 15  GLU A OE1  4  
ATOM   6301  O  OE2  . GLU A 1 15  ? 2.479   -16.614 10.480  1.00 0.00 ? 15  GLU A OE2  4  
ATOM   6302  H  H    . GLU A 1 15  ? 2.705   -11.234 11.480  1.00 0.00 ? 15  GLU A H    4  
ATOM   6303  H  HA   . GLU A 1 15  ? 0.348   -12.698 11.644  1.00 0.00 ? 15  GLU A HA   4  
ATOM   6304  H  HB2  . GLU A 1 15  ? 2.448   -13.585 10.800  1.00 0.00 ? 15  GLU A HB2  4  
ATOM   6305  H  HB3  . GLU A 1 15  ? 3.171   -13.530 12.415  1.00 0.00 ? 15  GLU A HB3  4  
ATOM   6306  H  HG2  . GLU A 1 15  ? 1.565   -15.183 13.237  1.00 0.00 ? 15  GLU A HG2  4  
ATOM   6307  H  HG3  . GLU A 1 15  ? 0.714   -15.173 11.687  1.00 0.00 ? 15  GLU A HG3  4  
ATOM   6308  N  N    . THR A 1 16  ? 1.656   -12.214 14.665  1.00 0.00 ? 16  THR A N    4  
ATOM   6309  C  CA   . THR A 1 16  ? 1.381   -12.418 16.084  1.00 0.00 ? 16  THR A CA   4  
ATOM   6310  C  C    . THR A 1 16  ? 0.486   -11.321 16.688  1.00 0.00 ? 16  THR A C    4  
ATOM   6311  O  O    . THR A 1 16  ? -0.171  -11.580 17.698  1.00 0.00 ? 16  THR A O    4  
ATOM   6312  C  CB   . THR A 1 16  ? 2.706   -12.627 16.847  1.00 0.00 ? 16  THR A CB   4  
ATOM   6313  O  OG1  . THR A 1 16  ? 3.700   -11.678 16.500  1.00 0.00 ? 16  THR A OG1  4  
ATOM   6314  C  CG2  . THR A 1 16  ? 3.287   -14.009 16.519  1.00 0.00 ? 16  THR A CG2  4  
ATOM   6315  H  H    . THR A 1 16  ? 2.586   -11.881 14.410  1.00 0.00 ? 16  THR A H    4  
ATOM   6316  H  HA   . THR A 1 16  ? 0.813   -13.345 16.182  1.00 0.00 ? 16  THR A HA   4  
ATOM   6317  H  HB   . THR A 1 16  ? 2.515   -12.583 17.920  1.00 0.00 ? 16  THR A HB   4  
ATOM   6318  H  HG1  . THR A 1 16  ? 3.514   -10.861 16.986  1.00 0.00 ? 16  THR A HG1  4  
ATOM   6319  H  HG21 . THR A 1 16  ? 2.551   -14.783 16.740  1.00 0.00 ? 16  THR A HG21 4  
ATOM   6320  H  HG22 . THR A 1 16  ? 3.564   -14.067 15.466  1.00 0.00 ? 16  THR A HG22 4  
ATOM   6321  H  HG23 . THR A 1 16  ? 4.167   -14.191 17.135  1.00 0.00 ? 16  THR A HG23 4  
ATOM   6322  N  N    . GLU A 1 17  ? 0.411   -10.130 16.077  1.00 0.00 ? 17  GLU A N    4  
ATOM   6323  C  CA   . GLU A 1 17  ? -0.248  -8.974  16.697  1.00 0.00 ? 17  GLU A CA   4  
ATOM   6324  C  C    . GLU A 1 17  ? -1.448  -8.445  15.900  1.00 0.00 ? 17  GLU A C    4  
ATOM   6325  O  O    . GLU A 1 17  ? -2.247  -7.697  16.468  1.00 0.00 ? 17  GLU A O    4  
ATOM   6326  C  CB   . GLU A 1 17  ? 0.762   -7.837  16.950  1.00 0.00 ? 17  GLU A CB   4  
ATOM   6327  C  CG   . GLU A 1 17  ? 2.004   -8.234  17.768  1.00 0.00 ? 17  GLU A CG   4  
ATOM   6328  C  CD   . GLU A 1 17  ? 1.671   -8.806  19.160  1.00 0.00 ? 17  GLU A CD   4  
ATOM   6329  O  OE1  . GLU A 1 17  ? 0.890   -8.184  19.917  1.00 0.00 ? 17  GLU A OE1  4  
ATOM   6330  O  OE2  . GLU A 1 17  ? 2.232   -9.861  19.534  1.00 0.00 ? 17  GLU A OE2  4  
ATOM   6331  H  H    . GLU A 1 17  ? 1.066   -9.966  15.337  1.00 0.00 ? 17  GLU A H    4  
ATOM   6332  H  HA   . GLU A 1 17  ? -0.639  -9.269  17.671  1.00 0.00 ? 17  GLU A HA   4  
ATOM   6333  H  HB2  . GLU A 1 17  ? 1.090   -7.430  15.994  1.00 0.00 ? 17  GLU A HB2  4  
ATOM   6334  H  HB3  . GLU A 1 17  ? 0.253   -7.030  17.477  1.00 0.00 ? 17  GLU A HB3  4  
ATOM   6335  H  HG2  . GLU A 1 17  ? 2.591   -8.959  17.201  1.00 0.00 ? 17  GLU A HG2  4  
ATOM   6336  H  HG3  . GLU A 1 17  ? 2.628   -7.347  17.893  1.00 0.00 ? 17  GLU A HG3  4  
ATOM   6337  N  N    . ILE A 1 18  ? -1.610  -8.810  14.619  1.00 0.00 ? 18  ILE A N    4  
ATOM   6338  C  CA   . ILE A 1 18  ? -2.602  -8.184  13.733  1.00 0.00 ? 18  ILE A CA   4  
ATOM   6339  C  C    . ILE A 1 18  ? -3.555  -9.235  13.149  1.00 0.00 ? 18  ILE A C    4  
ATOM   6340  O  O    . ILE A 1 18  ? -4.762  -8.991  13.109  1.00 0.00 ? 18  ILE A O    4  
ATOM   6341  C  CB   . ILE A 1 18  ? -1.902  -7.317  12.649  1.00 0.00 ? 18  ILE A CB   4  
ATOM   6342  C  CG1  . ILE A 1 18  ? -0.878  -6.345  13.295  1.00 0.00 ? 18  ILE A CG1  4  
ATOM   6343  C  CG2  . ILE A 1 18  ? -2.944  -6.536  11.823  1.00 0.00 ? 18  ILE A CG2  4  
ATOM   6344  C  CD1  . ILE A 1 18  ? -0.181  -5.390  12.321  1.00 0.00 ? 18  ILE A CD1  4  
ATOM   6345  H  H    . ILE A 1 18  ? -0.919  -9.419  14.191  1.00 0.00 ? 18  ILE A H    4  
ATOM   6346  H  HA   . ILE A 1 18  ? -3.218  -7.505  14.322  1.00 0.00 ? 18  ILE A HA   4  
ATOM   6347  H  HB   . ILE A 1 18  ? -1.366  -7.975  11.965  1.00 0.00 ? 18  ILE A HB   4  
ATOM   6348  H  HG12 . ILE A 1 18  ? -1.378  -5.751  14.061  1.00 0.00 ? 18  ILE A HG12 4  
ATOM   6349  H  HG13 . ILE A 1 18  ? -0.091  -6.924  13.777  1.00 0.00 ? 18  ILE A HG13 4  
ATOM   6350  H  HG21 . ILE A 1 18  ? -2.463  -5.996  11.008  1.00 0.00 ? 18  ILE A HG21 4  
ATOM   6351  H  HG22 . ILE A 1 18  ? -3.667  -7.215  11.372  1.00 0.00 ? 18  ILE A HG22 4  
ATOM   6352  H  HG23 . ILE A 1 18  ? -3.474  -5.830  12.462  1.00 0.00 ? 18  ILE A HG23 4  
ATOM   6353  H  HD11 . ILE A 1 18  ? 0.632   -4.877  12.835  1.00 0.00 ? 18  ILE A HD11 4  
ATOM   6354  H  HD12 . ILE A 1 18  ? 0.221   -5.947  11.479  1.00 0.00 ? 18  ILE A HD12 4  
ATOM   6355  H  HD13 . ILE A 1 18  ? -0.886  -4.646  11.959  1.00 0.00 ? 18  ILE A HD13 4  
ATOM   6356  N  N    . ILE A 1 19  ? -3.057  -10.413 12.753  1.00 0.00 ? 19  ILE A N    4  
ATOM   6357  C  CA   . ILE A 1 19  ? -3.857  -11.440 12.071  1.00 0.00 ? 19  ILE A CA   4  
ATOM   6358  C  C    . ILE A 1 19  ? -3.824  -12.794 12.806  1.00 0.00 ? 19  ILE A C    4  
ATOM   6359  O  O    . ILE A 1 19  ? -4.156  -13.816 12.216  1.00 0.00 ? 19  ILE A O    4  
ATOM   6360  C  CB   . ILE A 1 19  ? -3.458  -11.530 10.587  1.00 0.00 ? 19  ILE A CB   4  
ATOM   6361  C  CG1  . ILE A 1 19  ? -1.972  -11.889 10.464  1.00 0.00 ? 19  ILE A CG1  4  
ATOM   6362  C  CG2  . ILE A 1 19  ? -3.828  -10.234 9.836   1.00 0.00 ? 19  ILE A CG2  4  
ATOM   6363  C  CD1  . ILE A 1 19  ? -1.595  -12.210 9.033   1.00 0.00 ? 19  ILE A CD1  4  
ATOM   6364  H  H    . ILE A 1 19  ? -2.049  -10.541 12.741  1.00 0.00 ? 19  ILE A H    4  
ATOM   6365  H  HA   . ILE A 1 19  ? -4.896  -11.135 12.047  1.00 0.00 ? 19  ILE A HA   4  
ATOM   6366  H  HB   . ILE A 1 19  ? -4.037  -12.333 10.132  1.00 0.00 ? 19  ILE A HB   4  
ATOM   6367  H  HG12 . ILE A 1 19  ? -1.360  -11.058 10.798  1.00 0.00 ? 19  ILE A HG12 4  
ATOM   6368  H  HG13 . ILE A 1 19  ? -1.759  -12.767 11.073  1.00 0.00 ? 19  ILE A HG13 4  
ATOM   6369  H  HG21 . ILE A 1 19  ? -3.184  -9.411  10.147  1.00 0.00 ? 19  ILE A HG21 4  
ATOM   6370  H  HG22 . ILE A 1 19  ? -3.729  -10.376 8.760   1.00 0.00 ? 19  ILE A HG22 4  
ATOM   6371  H  HG23 . ILE A 1 19  ? -4.868  -9.976  10.035  1.00 0.00 ? 19  ILE A HG23 4  
ATOM   6372  H  HD11 . ILE A 1 19  ? -0.567  -12.564 9.014   1.00 0.00 ? 19  ILE A HD11 4  
ATOM   6373  H  HD12 . ILE A 1 19  ? -2.269  -12.980 8.673   1.00 0.00 ? 19  ILE A HD12 4  
ATOM   6374  H  HD13 . ILE A 1 19  ? -1.691  -11.310 8.432   1.00 0.00 ? 19  ILE A HD13 4  
ATOM   6375  N  N    . VAL A 1 20  ? -3.422  -12.825 14.078  1.00 0.00 ? 20  VAL A N    4  
ATOM   6376  C  CA   . VAL A 1 20  ? -3.177  -14.062 14.830  1.00 0.00 ? 20  VAL A CA   4  
ATOM   6377  C  C    . VAL A 1 20  ? -4.369  -15.039 14.830  1.00 0.00 ? 20  VAL A C    4  
ATOM   6378  O  O    . VAL A 1 20  ? -4.167  -16.248 14.702  1.00 0.00 ? 20  VAL A O    4  
ATOM   6379  C  CB   . VAL A 1 20  ? -2.673  -13.697 16.245  1.00 0.00 ? 20  VAL A CB   4  
ATOM   6380  C  CG1  . VAL A 1 20  ? -3.744  -13.036 17.129  1.00 0.00 ? 20  VAL A CG1  4  
ATOM   6381  C  CG2  . VAL A 1 20  ? -2.079  -14.910 16.972  1.00 0.00 ? 20  VAL A CG2  4  
ATOM   6382  H  H    . VAL A 1 20  ? -3.082  -11.966 14.480  1.00 0.00 ? 20  VAL A H    4  
ATOM   6383  H  HA   . VAL A 1 20  ? -2.357  -14.569 14.319  1.00 0.00 ? 20  VAL A HA   4  
ATOM   6384  H  HB   . VAL A 1 20  ? -1.869  -12.973 16.128  1.00 0.00 ? 20  VAL A HB   4  
ATOM   6385  H  HG11 . VAL A 1 20  ? -4.549  -13.741 17.346  1.00 0.00 ? 20  VAL A HG11 4  
ATOM   6386  H  HG12 . VAL A 1 20  ? -3.294  -12.718 18.070  1.00 0.00 ? 20  VAL A HG12 4  
ATOM   6387  H  HG13 . VAL A 1 20  ? -4.157  -12.157 16.635  1.00 0.00 ? 20  VAL A HG13 4  
ATOM   6388  H  HG21 . VAL A 1 20  ? -2.852  -15.656 17.161  1.00 0.00 ? 20  VAL A HG21 4  
ATOM   6389  H  HG22 . VAL A 1 20  ? -1.292  -15.355 16.360  1.00 0.00 ? 20  VAL A HG22 4  
ATOM   6390  H  HG23 . VAL A 1 20  ? -1.645  -14.595 17.921  1.00 0.00 ? 20  VAL A HG23 4  
ATOM   6391  N  N    . ASP A 1 21  ? -5.606  -14.536 14.938  1.00 0.00 ? 21  ASP A N    4  
ATOM   6392  C  CA   . ASP A 1 21  ? -6.829  -15.357 14.976  1.00 0.00 ? 21  ASP A CA   4  
ATOM   6393  C  C    . ASP A 1 21  ? -7.486  -15.474 13.584  1.00 0.00 ? 21  ASP A C    4  
ATOM   6394  O  O    . ASP A 1 21  ? -8.459  -16.221 13.372  1.00 0.00 ? 21  ASP A O    4  
ATOM   6395  C  CB   . ASP A 1 21  ? -7.800  -14.732 15.987  1.00 0.00 ? 21  ASP A CB   4  
ATOM   6396  C  CG   . ASP A 1 21  ? -9.071  -15.576 16.186  1.00 0.00 ? 21  ASP A CG   4  
ATOM   6397  O  OD1  . ASP A 1 21  ? -8.968  -16.741 16.631  1.00 0.00 ? 21  ASP A OD1  4  
ATOM   6398  O  OD2  . ASP A 1 21  ? -10.187 -15.056 15.958  1.00 0.00 ? 21  ASP A OD2  4  
ATOM   6399  H  H    . ASP A 1 21  ? -5.714  -13.537 15.039  1.00 0.00 ? 21  ASP A H    4  
ATOM   6400  H  HA   . ASP A 1 21  ? -6.570  -16.355 15.331  1.00 0.00 ? 21  ASP A HA   4  
ATOM   6401  H  HB2  . ASP A 1 21  ? -7.292  -14.631 16.948  1.00 0.00 ? 21  ASP A HB2  4  
ATOM   6402  H  HB3  . ASP A 1 21  ? -8.070  -13.730 15.646  1.00 0.00 ? 21  ASP A HB3  4  
ATOM   6403  N  N    . ALA A 1 22  ? -6.939  -14.706 12.633  1.00 0.00 ? 22  ALA A N    4  
ATOM   6404  C  CA   . ALA A 1 22  ? -7.424  -14.588 11.281  1.00 0.00 ? 22  ALA A CA   4  
ATOM   6405  C  C    . ALA A 1 22  ? -6.694  -15.587 10.395  1.00 0.00 ? 22  ALA A C    4  
ATOM   6406  O  O    . ALA A 1 22  ? -5.466  -15.678 10.398  1.00 0.00 ? 22  ALA A O    4  
ATOM   6407  C  CB   . ALA A 1 22  ? -7.207  -13.169 10.746  1.00 0.00 ? 22  ALA A CB   4  
ATOM   6408  H  H    . ALA A 1 22  ? -6.041  -14.279 12.823  1.00 0.00 ? 22  ALA A H    4  
ATOM   6409  H  HA   . ALA A 1 22  ? -8.490  -14.785 11.277  1.00 0.00 ? 22  ALA A HA   4  
ATOM   6410  H  HB1  . ALA A 1 22  ? -7.557  -13.131 9.717   1.00 0.00 ? 22  ALA A HB1  4  
ATOM   6411  H  HB2  . ALA A 1 22  ? -7.765  -12.446 11.342  1.00 0.00 ? 22  ALA A HB2  4  
ATOM   6412  H  HB3  . ALA A 1 22  ? -6.152  -12.911 10.757  1.00 0.00 ? 22  ALA A HB3  4  
ATOM   6413  N  N    . GLU A 1 23  ? -7.464  -16.271 9.568   1.00 0.00 ? 23  GLU A N    4  
ATOM   6414  C  CA   . GLU A 1 23  ? -6.998  -17.128 8.475   1.00 0.00 ? 23  GLU A CA   4  
ATOM   6415  C  C    . GLU A 1 23  ? -8.067  -17.396 7.419   1.00 0.00 ? 23  GLU A C    4  
ATOM   6416  O  O    . GLU A 1 23  ? -7.748  -17.744 6.281   1.00 0.00 ? 23  GLU A O    4  
ATOM   6417  C  CB   . GLU A 1 23  ? -6.392  -18.426 9.013   1.00 0.00 ? 23  GLU A CB   4  
ATOM   6418  C  CG   . GLU A 1 23  ? -7.293  -19.648 9.246   1.00 0.00 ? 23  GLU A CG   4  
ATOM   6419  C  CD   . GLU A 1 23  ? -8.179  -19.559 10.495  1.00 0.00 ? 23  GLU A CD   4  
ATOM   6420  O  OE1  . GLU A 1 23  ? -7.920  -18.757 11.418  1.00 0.00 ? 23  GLU A OE1  4  
ATOM   6421  O  OE2  . GLU A 1 23  ? -9.186  -20.292 10.602  1.00 0.00 ? 23  GLU A OE2  4  
ATOM   6422  H  H    . GLU A 1 23  ? -8.448  -16.151 9.730   1.00 0.00 ? 23  GLU A H    4  
ATOM   6423  H  HA   . GLU A 1 23  ? -6.190  -16.607 7.972   1.00 0.00 ? 23  GLU A HA   4  
ATOM   6424  H  HB2  . GLU A 1 23  ? -5.642  -18.723 8.289   1.00 0.00 ? 23  GLU A HB2  4  
ATOM   6425  H  HB3  . GLU A 1 23  ? -5.902  -18.182 9.944   1.00 0.00 ? 23  GLU A HB3  4  
ATOM   6426  H  HG2  . GLU A 1 23  ? -7.903  -19.818 8.359   1.00 0.00 ? 23  GLU A HG2  4  
ATOM   6427  H  HG3  . GLU A 1 23  ? -6.641  -20.515 9.361   1.00 0.00 ? 23  GLU A HG3  4  
ATOM   6428  N  N    . ASP A 1 24  ? -9.333  -17.219 7.790   1.00 0.00 ? 24  ASP A N    4  
ATOM   6429  C  CA   . ASP A 1 24  ? -10.453 -17.221 6.870   1.00 0.00 ? 24  ASP A CA   4  
ATOM   6430  C  C    . ASP A 1 24  ? -10.308 -15.920 6.072   1.00 0.00 ? 24  ASP A C    4  
ATOM   6431  O  O    . ASP A 1 24  ? -9.865  -14.906 6.624   1.00 0.00 ? 24  ASP A O    4  
ATOM   6432  C  CB   . ASP A 1 24  ? -11.772 -17.275 7.665   1.00 0.00 ? 24  ASP A CB   4  
ATOM   6433  C  CG   . ASP A 1 24  ? -11.919 -18.535 8.548   1.00 0.00 ? 24  ASP A CG   4  
ATOM   6434  O  OD1  . ASP A 1 24  ? -12.309 -19.595 8.006   1.00 0.00 ? 24  ASP A OD1  4  
ATOM   6435  O  OD2  . ASP A 1 24  ? -11.678 -18.477 9.783   1.00 0.00 ? 24  ASP A OD2  4  
ATOM   6436  H  H    . ASP A 1 24  ? -9.522  -16.849 8.704   1.00 0.00 ? 24  ASP A H    4  
ATOM   6437  H  HA   . ASP A 1 24  ? -10.392 -18.087 6.210   1.00 0.00 ? 24  ASP A HA   4  
ATOM   6438  H  HB2  . ASP A 1 24  ? -11.845 -16.388 8.288   1.00 0.00 ? 24  ASP A HB2  4  
ATOM   6439  H  HB3  . ASP A 1 24  ? -12.603 -17.236 6.957   1.00 0.00 ? 24  ASP A HB3  4  
ATOM   6440  N  N    . LYS A 1 25  ? -10.654 -15.921 4.778   1.00 0.00 ? 25  LYS A N    4  
ATOM   6441  C  CA   . LYS A 1 25  ? -10.349 -14.794 3.878   1.00 0.00 ? 25  LYS A CA   4  
ATOM   6442  C  C    . LYS A 1 25  ? -10.890 -13.483 4.418   1.00 0.00 ? 25  LYS A C    4  
ATOM   6443  O  O    . LYS A 1 25  ? -10.235 -12.446 4.319   1.00 0.00 ? 25  LYS A O    4  
ATOM   6444  C  CB   . LYS A 1 25  ? -10.967 -14.986 2.480   1.00 0.00 ? 25  LYS A CB   4  
ATOM   6445  C  CG   . LYS A 1 25  ? -10.777 -16.355 1.842   1.00 0.00 ? 25  LYS A CG   4  
ATOM   6446  C  CD   . LYS A 1 25  ? -9.298  -16.686 1.601   1.00 0.00 ? 25  LYS A CD   4  
ATOM   6447  C  CE   . LYS A 1 25  ? -9.123  -18.102 1.038   1.00 0.00 ? 25  LYS A CE   4  
ATOM   6448  N  NZ   . LYS A 1 25  ? -9.620  -18.246 -0.355  1.00 0.00 ? 25  LYS A NZ   4  
ATOM   6449  H  H    . LYS A 1 25  ? -11.033 -16.767 4.374   1.00 0.00 ? 25  LYS A H    4  
ATOM   6450  H  HA   . LYS A 1 25  ? -9.265  -14.702 3.791   1.00 0.00 ? 25  LYS A HA   4  
ATOM   6451  H  HB2  . LYS A 1 25  ? -12.043 -14.816 2.540   1.00 0.00 ? 25  LYS A HB2  4  
ATOM   6452  H  HB3  . LYS A 1 25  ? -10.550 -14.235 1.809   1.00 0.00 ? 25  LYS A HB3  4  
ATOM   6453  H  HG2  . LYS A 1 25  ? -11.238 -17.101 2.488   1.00 0.00 ? 25  LYS A HG2  4  
ATOM   6454  H  HG3  . LYS A 1 25  ? -11.315 -16.341 0.896   1.00 0.00 ? 25  LYS A HG3  4  
ATOM   6455  H  HD2  . LYS A 1 25  ? -8.864  -15.955 0.918   1.00 0.00 ? 25  LYS A HD2  4  
ATOM   6456  H  HD3  . LYS A 1 25  ? -8.760  -16.632 2.549   1.00 0.00 ? 25  LYS A HD3  4  
ATOM   6457  H  HE2  . LYS A 1 25  ? -8.061  -18.350 1.068   1.00 0.00 ? 25  LYS A HE2  4  
ATOM   6458  H  HE3  . LYS A 1 25  ? -9.654  -18.795 1.694   1.00 0.00 ? 25  LYS A HE3  4  
ATOM   6459  H  HZ1  . LYS A 1 25  ? -10.610 -18.062 -0.417  1.00 0.00 ? 25  LYS A HZ1  4  
ATOM   6460  H  HZ2  . LYS A 1 25  ? -9.138  -17.622 -0.985  1.00 0.00 ? 25  LYS A HZ2  4  
ATOM   6461  H  HZ3  . LYS A 1 25  ? -9.468  -19.188 -0.688  1.00 0.00 ? 25  LYS A HZ3  4  
ATOM   6462  N  N    . GLU A 1 26  ? -12.097 -13.554 4.976   1.00 0.00 ? 26  GLU A N    4  
ATOM   6463  C  CA   . GLU A 1 26  ? -12.810 -12.388 5.441   1.00 0.00 ? 26  GLU A CA   4  
ATOM   6464  C  C    . GLU A 1 26  ? -12.060 -11.798 6.636   1.00 0.00 ? 26  GLU A C    4  
ATOM   6465  O  O    . GLU A 1 26  ? -11.917 -10.583 6.740   1.00 0.00 ? 26  GLU A O    4  
ATOM   6466  C  CB   . GLU A 1 26  ? -14.249 -12.770 5.824   1.00 0.00 ? 26  GLU A CB   4  
ATOM   6467  C  CG   . GLU A 1 26  ? -15.071 -13.263 4.623   1.00 0.00 ? 26  GLU A CG   4  
ATOM   6468  C  CD   . GLU A 1 26  ? -16.476 -13.723 5.053   1.00 0.00 ? 26  GLU A CD   4  
ATOM   6469  O  OE1  . GLU A 1 26  ? -17.377 -12.874 5.235   1.00 0.00 ? 26  GLU A OE1  4  
ATOM   6470  O  OE2  . GLU A 1 26  ? -16.700 -14.946 5.200   1.00 0.00 ? 26  GLU A OE2  4  
ATOM   6471  H  H    . GLU A 1 26  ? -12.503 -14.462 5.138   1.00 0.00 ? 26  GLU A H    4  
ATOM   6472  H  HA   . GLU A 1 26  ? -12.826 -11.673 4.618   1.00 0.00 ? 26  GLU A HA   4  
ATOM   6473  H  HB2  . GLU A 1 26  ? -14.221 -13.553 6.584   1.00 0.00 ? 26  GLU A HB2  4  
ATOM   6474  H  HB3  . GLU A 1 26  ? -14.743 -11.897 6.251   1.00 0.00 ? 26  GLU A HB3  4  
ATOM   6475  H  HG2  . GLU A 1 26  ? -15.152 -12.457 3.891   1.00 0.00 ? 26  GLU A HG2  4  
ATOM   6476  H  HG3  . GLU A 1 26  ? -14.552 -14.096 4.140   1.00 0.00 ? 26  GLU A HG3  4  
ATOM   6477  N  N    . GLU A 1 27  ? -11.528 -12.649 7.522   1.00 0.00 ? 27  GLU A N    4  
ATOM   6478  C  CA   . GLU A 1 27  ? -10.807 -12.213 8.706   1.00 0.00 ? 27  GLU A CA   4  
ATOM   6479  C  C    . GLU A 1 27  ? -9.460  -11.632 8.313   1.00 0.00 ? 27  GLU A C    4  
ATOM   6480  O  O    . GLU A 1 27  ? -9.079  -10.590 8.836   1.00 0.00 ? 27  GLU A O    4  
ATOM   6481  C  CB   . GLU A 1 27  ? -10.527 -13.390 9.636   1.00 0.00 ? 27  GLU A CB   4  
ATOM   6482  C  CG   . GLU A 1 27  ? -11.763 -14.156 10.097  1.00 0.00 ? 27  GLU A CG   4  
ATOM   6483  C  CD   . GLU A 1 27  ? -11.334 -15.391 10.891  1.00 0.00 ? 27  GLU A CD   4  
ATOM   6484  O  OE1  . GLU A 1 27  ? -10.315 -16.041 10.545  1.00 0.00 ? 27  GLU A OE1  4  
ATOM   6485  O  OE2  . GLU A 1 27  ? -12.005 -15.736 11.891  1.00 0.00 ? 27  GLU A OE2  4  
ATOM   6486  H  H    . GLU A 1 27  ? -11.554 -13.649 7.363   1.00 0.00 ? 27  GLU A H    4  
ATOM   6487  H  HA   . GLU A 1 27  ? -11.390 -11.465 9.240   1.00 0.00 ? 27  GLU A HA   4  
ATOM   6488  H  HB2  . GLU A 1 27  ? -9.855  -14.076 9.121   1.00 0.00 ? 27  GLU A HB2  4  
ATOM   6489  H  HB3  . GLU A 1 27  ? -10.019 -13.012 10.523  1.00 0.00 ? 27  GLU A HB3  4  
ATOM   6490  H  HG2  . GLU A 1 27  ? -12.375 -13.499 10.719  1.00 0.00 ? 27  GLU A HG2  4  
ATOM   6491  H  HG3  . GLU A 1 27  ? -12.356 -14.468 9.238   1.00 0.00 ? 27  GLU A HG3  4  
ATOM   6492  N  N    . ARG A 1 28  ? -8.727  -12.293 7.406   1.00 0.00 ? 28  ARG A N    4  
ATOM   6493  C  CA   . ARG A 1 28  ? -7.442  -11.772 6.936   1.00 0.00 ? 28  ARG A CA   4  
ATOM   6494  C  C    . ARG A 1 28  ? -7.641  -10.387 6.339   1.00 0.00 ? 28  ARG A C    4  
ATOM   6495  O  O    . ARG A 1 28  ? -6.930  -9.458  6.726   1.00 0.00 ? 28  ARG A O    4  
ATOM   6496  C  CB   . ARG A 1 28  ? -6.811  -12.726 5.908   1.00 0.00 ? 28  ARG A CB   4  
ATOM   6497  C  CG   . ARG A 1 28  ? -6.155  -13.952 6.556   1.00 0.00 ? 28  ARG A CG   4  
ATOM   6498  C  CD   . ARG A 1 28  ? -4.800  -13.594 7.186   1.00 0.00 ? 28  ARG A CD   4  
ATOM   6499  N  NE   . ARG A 1 28  ? -4.330  -14.656 8.087   1.00 0.00 ? 28  ARG A NE   4  
ATOM   6500  C  CZ   . ARG A 1 28  ? -3.445  -15.627 7.844   1.00 0.00 ? 28  ARG A CZ   4  
ATOM   6501  N  NH1  . ARG A 1 28  ? -2.823  -15.719 6.673   1.00 0.00 ? 28  ARG A NH1  4  
ATOM   6502  N  NH2  . ARG A 1 28  ? -3.213  -16.508 8.808   1.00 0.00 ? 28  ARG A NH2  4  
ATOM   6503  H  H    . ARG A 1 28  ? -9.074  -13.177 7.037   1.00 0.00 ? 28  ARG A H    4  
ATOM   6504  H  HA   . ARG A 1 28  ? -6.779  -11.648 7.794   1.00 0.00 ? 28  ARG A HA   4  
ATOM   6505  H  HB2  . ARG A 1 28  ? -7.576  -13.058 5.203   1.00 0.00 ? 28  ARG A HB2  4  
ATOM   6506  H  HB3  . ARG A 1 28  ? -6.052  -12.182 5.347   1.00 0.00 ? 28  ARG A HB3  4  
ATOM   6507  H  HG2  . ARG A 1 28  ? -6.826  -14.356 7.314   1.00 0.00 ? 28  ARG A HG2  4  
ATOM   6508  H  HG3  . ARG A 1 28  ? -5.997  -14.718 5.796   1.00 0.00 ? 28  ARG A HG3  4  
ATOM   6509  H  HD2  . ARG A 1 28  ? -4.070  -13.400 6.400   1.00 0.00 ? 28  ARG A HD2  4  
ATOM   6510  H  HD3  . ARG A 1 28  ? -4.900  -12.682 7.774   1.00 0.00 ? 28  ARG A HD3  4  
ATOM   6511  H  HE   . ARG A 1 28  ? -4.746  -14.655 9.017   1.00 0.00 ? 28  ARG A HE   4  
ATOM   6512  H  HH11 . ARG A 1 28  ? -3.018  -15.055 5.940   1.00 0.00 ? 28  ARG A HH11 4  
ATOM   6513  H  HH12 . ARG A 1 28  ? -2.148  -16.447 6.481   1.00 0.00 ? 28  ARG A HH12 4  
ATOM   6514  H  HH21 . ARG A 1 28  ? -3.739  -16.442 9.679   1.00 0.00 ? 28  ARG A HH21 4  
ATOM   6515  H  HH22 . ARG A 1 28  ? -2.551  -17.266 8.709   1.00 0.00 ? 28  ARG A HH22 4  
ATOM   6516  N  N    . ALA A 1 29  ? -8.630  -10.236 5.455   1.00 0.00 ? 29  ALA A N    4  
ATOM   6517  C  CA   . ALA A 1 29  ? -8.956  -8.950  4.871   1.00 0.00 ? 29  ALA A CA   4  
ATOM   6518  C  C    . ALA A 1 29  ? -9.276  -7.923  5.961   1.00 0.00 ? 29  ALA A C    4  
ATOM   6519  O  O    . ALA A 1 29  ? -8.763  -6.807  5.913   1.00 0.00 ? 29  ALA A O    4  
ATOM   6520  C  CB   . ALA A 1 29  ? -10.129 -9.126  3.908   1.00 0.00 ? 29  ALA A CB   4  
ATOM   6521  H  H    . ALA A 1 29  ? -9.176  -11.038 5.161   1.00 0.00 ? 29  ALA A H    4  
ATOM   6522  H  HA   . ALA A 1 29  ? -8.091  -8.597  4.306   1.00 0.00 ? 29  ALA A HA   4  
ATOM   6523  H  HB1  . ALA A 1 29  ? -10.364 -8.167  3.453   1.00 0.00 ? 29  ALA A HB1  4  
ATOM   6524  H  HB2  . ALA A 1 29  ? -9.861  -9.838  3.127   1.00 0.00 ? 29  ALA A HB2  4  
ATOM   6525  H  HB3  . ALA A 1 29  ? -11.003 -9.501  4.444   1.00 0.00 ? 29  ALA A HB3  4  
ATOM   6526  N  N    . MET A 1 30  ? -10.089 -8.285  6.958   1.00 0.00 ? 30  MET A N    4  
ATOM   6527  C  CA   . MET A 1 30  ? -10.483 -7.360  8.014   1.00 0.00 ? 30  MET A CA   4  
ATOM   6528  C  C    . MET A 1 30  ? -9.328  -6.988  8.944   1.00 0.00 ? 30  MET A C    4  
ATOM   6529  O  O    . MET A 1 30  ? -9.221  -5.821  9.312   1.00 0.00 ? 30  MET A O    4  
ATOM   6530  C  CB   . MET A 1 30  ? -11.690 -7.900  8.788   1.00 0.00 ? 30  MET A CB   4  
ATOM   6531  C  CG   . MET A 1 30  ? -12.987 -7.769  7.975   1.00 0.00 ? 30  MET A CG   4  
ATOM   6532  S  SD   . MET A 1 30  ? -13.446 -6.067  7.535   1.00 0.00 ? 30  MET A SD   4  
ATOM   6533  C  CE   . MET A 1 30  ? -12.862 -5.949  5.817   1.00 0.00 ? 30  MET A CE   4  
ATOM   6534  H  H    . MET A 1 30  ? -10.489 -9.219  6.969   1.00 0.00 ? 30  MET A H    4  
ATOM   6535  H  HA   . MET A 1 30  ? -10.785 -6.433  7.543   1.00 0.00 ? 30  MET A HA   4  
ATOM   6536  H  HB2  . MET A 1 30  ? -11.524 -8.944  9.058   1.00 0.00 ? 30  MET A HB2  4  
ATOM   6537  H  HB3  . MET A 1 30  ? -11.807 -7.326  9.706   1.00 0.00 ? 30  MET A HB3  4  
ATOM   6538  H  HG2  . MET A 1 30  ? -12.912 -8.357  7.063   1.00 0.00 ? 30  MET A HG2  4  
ATOM   6539  H  HG3  . MET A 1 30  ? -13.796 -8.190  8.574   1.00 0.00 ? 30  MET A HG3  4  
ATOM   6540  H  HE1  . MET A 1 30  ? -13.501 -6.549  5.173   1.00 0.00 ? 30  MET A HE1  4  
ATOM   6541  H  HE2  . MET A 1 30  ? -12.911 -4.911  5.488   1.00 0.00 ? 30  MET A HE2  4  
ATOM   6542  H  HE3  . MET A 1 30  ? -11.836 -6.304  5.724   1.00 0.00 ? 30  MET A HE3  4  
ATOM   6543  N  N    . GLY A 1 31  ? -8.435  -7.919  9.288   1.00 0.00 ? 31  GLY A N    4  
ATOM   6544  C  CA   . GLY A 1 31  ? -7.274  -7.631  10.121  1.00 0.00 ? 31  GLY A CA   4  
ATOM   6545  C  C    . GLY A 1 31  ? -6.398  -6.574  9.453   1.00 0.00 ? 31  GLY A C    4  
ATOM   6546  O  O    . GLY A 1 31  ? -6.052  -5.568  10.078  1.00 0.00 ? 31  GLY A O    4  
ATOM   6547  H  H    . GLY A 1 31  ? -8.566  -8.876  8.974   1.00 0.00 ? 31  GLY A H    4  
ATOM   6548  H  HA2  . GLY A 1 31  ? -7.607  -7.267  11.094  1.00 0.00 ? 31  GLY A HA2  4  
ATOM   6549  H  HA3  . GLY A 1 31  ? -6.698  -8.546  10.261  1.00 0.00 ? 31  GLY A HA3  4  
ATOM   6550  N  N    . TRP A 1 32  ? -6.112  -6.759  8.158   1.00 0.00 ? 32  TRP A N    4  
ATOM   6551  C  CA   . TRP A 1 32  ? -5.419  -5.748  7.368   1.00 0.00 ? 32  TRP A CA   4  
ATOM   6552  C  C    . TRP A 1 32  ? -6.210  -4.440  7.321   1.00 0.00 ? 32  TRP A C    4  
ATOM   6553  O  O    . TRP A 1 32  ? -5.630  -3.386  7.567   1.00 0.00 ? 32  TRP A O    4  
ATOM   6554  C  CB   . TRP A 1 32  ? -5.129  -6.269  5.955   1.00 0.00 ? 32  TRP A CB   4  
ATOM   6555  C  CG   . TRP A 1 32  ? -3.893  -7.107  5.865   1.00 0.00 ? 32  TRP A CG   4  
ATOM   6556  C  CD1  . TRP A 1 32  ? -3.835  -8.455  5.836   1.00 0.00 ? 32  TRP A CD1  4  
ATOM   6557  C  CD2  . TRP A 1 32  ? -2.508  -6.653  5.812   1.00 0.00 ? 32  TRP A CD2  4  
ATOM   6558  N  NE1  . TRP A 1 32  ? -2.518  -8.867  5.784   1.00 0.00 ? 32  TRP A NE1  4  
ATOM   6559  C  CE2  . TRP A 1 32  ? -1.651  -7.793  5.796   1.00 0.00 ? 32  TRP A CE2  4  
ATOM   6560  C  CE3  . TRP A 1 32  ? -1.893  -5.385  5.780   1.00 0.00 ? 32  TRP A CE3  4  
ATOM   6561  C  CZ2  . TRP A 1 32  ? -0.253  -7.671  5.783   1.00 0.00 ? 32  TRP A CZ2  4  
ATOM   6562  C  CZ3  . TRP A 1 32  ? -0.494  -5.251  5.739   1.00 0.00 ? 32  TRP A CZ3  4  
ATOM   6563  C  CH2  . TRP A 1 32  ? 0.326   -6.391  5.742   1.00 0.00 ? 32  TRP A CH2  4  
ATOM   6564  H  H    . TRP A 1 32  ? -6.432  -7.599  7.690   1.00 0.00 ? 32  TRP A H    4  
ATOM   6565  H  HA   . TRP A 1 32  ? -4.466  -5.531  7.853   1.00 0.00 ? 32  TRP A HA   4  
ATOM   6566  H  HB2  . TRP A 1 32  ? -5.987  -6.828  5.578   1.00 0.00 ? 32  TRP A HB2  4  
ATOM   6567  H  HB3  . TRP A 1 32  ? -4.984  -5.413  5.294   1.00 0.00 ? 32  TRP A HB3  4  
ATOM   6568  H  HD1  . TRP A 1 32  ? -4.697  -9.107  5.854   1.00 0.00 ? 32  TRP A HD1  4  
ATOM   6569  H  HE1  . TRP A 1 32  ? -2.248  -9.838  5.694   1.00 0.00 ? 32  TRP A HE1  4  
ATOM   6570  H  HE3  . TRP A 1 32  ? -2.516  -4.507  5.772   1.00 0.00 ? 32  TRP A HE3  4  
ATOM   6571  H  HZ2  . TRP A 1 32  ? 0.370   -8.552  5.786   1.00 0.00 ? 32  TRP A HZ2  4  
ATOM   6572  H  HZ3  . TRP A 1 32  ? -0.045  -4.266  5.709   1.00 0.00 ? 32  TRP A HZ3  4  
ATOM   6573  H  HH2  . TRP A 1 32  ? 1.402   -6.280  5.707   1.00 0.00 ? 32  TRP A HH2  4  
ATOM   6574  N  N    . TYR A 1 33  ? -7.514  -4.490  7.043   1.00 0.00 ? 33  TYR A N    4  
ATOM   6575  C  CA   . TYR A 1 33  ? -8.343  -3.308  6.852   1.00 0.00 ? 33  TYR A CA   4  
ATOM   6576  C  C    . TYR A 1 33  ? -8.355  -2.430  8.104   1.00 0.00 ? 33  TYR A C    4  
ATOM   6577  O  O    . TYR A 1 33  ? -8.165  -1.217  8.001   1.00 0.00 ? 33  TYR A O    4  
ATOM   6578  C  CB   . TYR A 1 33  ? -9.761  -3.757  6.475   1.00 0.00 ? 33  TYR A CB   4  
ATOM   6579  C  CG   . TYR A 1 33  ? -10.789 -2.650  6.431   1.00 0.00 ? 33  TYR A CG   4  
ATOM   6580  C  CD1  . TYR A 1 33  ? -10.687 -1.633  5.471   1.00 0.00 ? 33  TYR A CD1  4  
ATOM   6581  C  CD2  . TYR A 1 33  ? -11.839 -2.630  7.364   1.00 0.00 ? 33  TYR A CD2  4  
ATOM   6582  C  CE1  . TYR A 1 33  ? -11.637 -0.600  5.437   1.00 0.00 ? 33  TYR A CE1  4  
ATOM   6583  C  CE2  . TYR A 1 33  ? -12.773 -1.582  7.361   1.00 0.00 ? 33  TYR A CE2  4  
ATOM   6584  C  CZ   . TYR A 1 33  ? -12.695 -0.573  6.373   1.00 0.00 ? 33  TYR A CZ   4  
ATOM   6585  O  OH   . TYR A 1 33  ? -13.646 0.400   6.312   1.00 0.00 ? 33  TYR A OH   4  
ATOM   6586  H  H    . TYR A 1 33  ? -7.954  -5.389  6.890   1.00 0.00 ? 33  TYR A H    4  
ATOM   6587  H  HA   . TYR A 1 33  ? -7.931  -2.722  6.031   1.00 0.00 ? 33  TYR A HA   4  
ATOM   6588  H  HB2  . TYR A 1 33  ? -9.739  -4.244  5.502   1.00 0.00 ? 33  TYR A HB2  4  
ATOM   6589  H  HB3  . TYR A 1 33  ? -10.091 -4.488  7.205   1.00 0.00 ? 33  TYR A HB3  4  
ATOM   6590  H  HD1  . TYR A 1 33  ? -9.888  -1.652  4.746   1.00 0.00 ? 33  TYR A HD1  4  
ATOM   6591  H  HD2  . TYR A 1 33  ? -11.934 -3.428  8.084   1.00 0.00 ? 33  TYR A HD2  4  
ATOM   6592  H  HE1  . TYR A 1 33  ? -11.547 0.170   4.691   1.00 0.00 ? 33  TYR A HE1  4  
ATOM   6593  H  HE2  . TYR A 1 33  ? -13.554 -1.564  8.106   1.00 0.00 ? 33  TYR A HE2  4  
ATOM   6594  H  HH   . TYR A 1 33  ? -13.586 0.919   5.494   1.00 0.00 ? 33  TYR A HH   4  
ATOM   6595  N  N    . TYR A 1 34  ? -8.543  -3.027  9.284   1.00 0.00 ? 34  TYR A N    4  
ATOM   6596  C  CA   . TYR A 1 34  ? -8.627  -2.285  10.534  1.00 0.00 ? 34  TYR A CA   4  
ATOM   6597  C  C    . TYR A 1 34  ? -7.291  -1.614  10.847  1.00 0.00 ? 34  TYR A C    4  
ATOM   6598  O  O    . TYR A 1 34  ? -7.268  -0.446  11.233  1.00 0.00 ? 34  TYR A O    4  
ATOM   6599  C  CB   . TYR A 1 34  ? -9.028  -3.228  11.680  1.00 0.00 ? 34  TYR A CB   4  
ATOM   6600  C  CG   . TYR A 1 34  ? -10.361 -3.959  11.566  1.00 0.00 ? 34  TYR A CG   4  
ATOM   6601  C  CD1  . TYR A 1 34  ? -11.407 -3.493  10.740  1.00 0.00 ? 34  TYR A CD1  4  
ATOM   6602  C  CD2  . TYR A 1 34  ? -10.554 -5.127  12.330  1.00 0.00 ? 34  TYR A CD2  4  
ATOM   6603  C  CE1  . TYR A 1 34  ? -12.637 -4.176  10.698  1.00 0.00 ? 34  TYR A CE1  4  
ATOM   6604  C  CE2  . TYR A 1 34  ? -11.779 -5.817  12.292  1.00 0.00 ? 34  TYR A CE2  4  
ATOM   6605  C  CZ   . TYR A 1 34  ? -12.831 -5.339  11.477  1.00 0.00 ? 34  TYR A CZ   4  
ATOM   6606  O  OH   . TYR A 1 34  ? -14.028 -5.989  11.432  1.00 0.00 ? 34  TYR A OH   4  
ATOM   6607  H  H    . TYR A 1 34  ? -8.642  -4.035  9.333   1.00 0.00 ? 34  TYR A H    4  
ATOM   6608  H  HA   . TYR A 1 34  ? -9.380  -1.503  10.433  1.00 0.00 ? 34  TYR A HA   4  
ATOM   6609  H  HB2  . TYR A 1 34  ? -8.240  -3.975  11.795  1.00 0.00 ? 34  TYR A HB2  4  
ATOM   6610  H  HB3  . TYR A 1 34  ? -9.053  -2.642  12.600  1.00 0.00 ? 34  TYR A HB3  4  
ATOM   6611  H  HD1  . TYR A 1 34  ? -11.272 -2.621  10.116  1.00 0.00 ? 34  TYR A HD1  4  
ATOM   6612  H  HD2  . TYR A 1 34  ? -9.752  -5.502  12.950  1.00 0.00 ? 34  TYR A HD2  4  
ATOM   6613  H  HE1  . TYR A 1 34  ? -13.434 -3.813  10.064  1.00 0.00 ? 34  TYR A HE1  4  
ATOM   6614  H  HE2  . TYR A 1 34  ? -11.907 -6.710  12.889  1.00 0.00 ? 34  TYR A HE2  4  
ATOM   6615  H  HH   . TYR A 1 34  ? -14.067 -6.769  12.009  1.00 0.00 ? 34  TYR A HH   4  
ATOM   6616  N  N    . TYR A 1 35  ? -6.177  -2.330  10.668  1.00 0.00 ? 35  TYR A N    4  
ATOM   6617  C  CA   . TYR A 1 35  ? -4.850  -1.788  10.927  1.00 0.00 ? 35  TYR A CA   4  
ATOM   6618  C  C    . TYR A 1 35  ? -4.498  -0.694  9.919   1.00 0.00 ? 35  TYR A C    4  
ATOM   6619  O  O    . TYR A 1 35  ? -3.930  0.328   10.311  1.00 0.00 ? 35  TYR A O    4  
ATOM   6620  C  CB   . TYR A 1 35  ? -3.838  -2.940  10.868  1.00 0.00 ? 35  TYR A CB   4  
ATOM   6621  C  CG   . TYR A 1 35  ? -2.381  -2.521  10.932  1.00 0.00 ? 35  TYR A CG   4  
ATOM   6622  C  CD1  . TYR A 1 35  ? -1.857  -1.966  12.115  1.00 0.00 ? 35  TYR A CD1  4  
ATOM   6623  C  CD2  . TYR A 1 35  ? -1.545  -2.705  9.813   1.00 0.00 ? 35  TYR A CD2  4  
ATOM   6624  C  CE1  . TYR A 1 35  ? -0.499  -1.605  12.187  1.00 0.00 ? 35  TYR A CE1  4  
ATOM   6625  C  CE2  . TYR A 1 35  ? -0.187  -2.347  9.876   1.00 0.00 ? 35  TYR A CE2  4  
ATOM   6626  C  CZ   . TYR A 1 35  ? 0.343   -1.800  11.067  1.00 0.00 ? 35  TYR A CZ   4  
ATOM   6627  O  OH   . TYR A 1 35  ? 1.669   -1.482  11.131  1.00 0.00 ? 35  TYR A OH   4  
ATOM   6628  H  H    . TYR A 1 35  ? -6.245  -3.285  10.333  1.00 0.00 ? 35  TYR A H    4  
ATOM   6629  H  HA   . TYR A 1 35  ? -4.840  -1.332  11.923  1.00 0.00 ? 35  TYR A HA   4  
ATOM   6630  H  HB2  . TYR A 1 35  ? -4.039  -3.617  11.699  1.00 0.00 ? 35  TYR A HB2  4  
ATOM   6631  H  HB3  . TYR A 1 35  ? -3.998  -3.501  9.946   1.00 0.00 ? 35  TYR A HB3  4  
ATOM   6632  H  HD1  . TYR A 1 35  ? -2.493  -1.822  12.978  1.00 0.00 ? 35  TYR A HD1  4  
ATOM   6633  H  HD2  . TYR A 1 35  ? -1.939  -3.132  8.900   1.00 0.00 ? 35  TYR A HD2  4  
ATOM   6634  H  HE1  . TYR A 1 35  ? -0.107  -1.186  13.103  1.00 0.00 ? 35  TYR A HE1  4  
ATOM   6635  H  HE2  . TYR A 1 35  ? 0.445   -2.497  9.012   1.00 0.00 ? 35  TYR A HE2  4  
ATOM   6636  H  HH   . TYR A 1 35  ? 1.920   -1.080  11.979  1.00 0.00 ? 35  TYR A HH   4  
ATOM   6637  N  N    . LEU A 1 36  ? -4.846  -0.868  8.639   1.00 0.00 ? 36  LEU A N    4  
ATOM   6638  C  CA   . LEU A 1 36  ? -4.582  0.130   7.618   1.00 0.00 ? 36  LEU A CA   4  
ATOM   6639  C  C    . LEU A 1 36  ? -5.375  1.379   7.919   1.00 0.00 ? 36  LEU A C    4  
ATOM   6640  O  O    . LEU A 1 36  ? -4.734  2.423   8.010   1.00 0.00 ? 36  LEU A O    4  
ATOM   6641  C  CB   . LEU A 1 36  ? -4.881  -0.388  6.205   1.00 0.00 ? 36  LEU A CB   4  
ATOM   6642  C  CG   . LEU A 1 36  ? -3.605  -0.795  5.448   1.00 0.00 ? 36  LEU A CG   4  
ATOM   6643  C  CD1  . LEU A 1 36  ? -2.696  -1.759  6.221   1.00 0.00 ? 36  LEU A CD1  4  
ATOM   6644  C  CD2  . LEU A 1 36  ? -4.026  -1.452  4.132   1.00 0.00 ? 36  LEU A CD2  4  
ATOM   6645  H  H    . LEU A 1 36  ? -5.319  -1.706  8.350   1.00 0.00 ? 36  LEU A H    4  
ATOM   6646  H  HA   . LEU A 1 36  ? -3.529  0.409   7.676   1.00 0.00 ? 36  LEU A HA   4  
ATOM   6647  H  HB2  . LEU A 1 36  ? -5.589  -1.215  6.246   1.00 0.00 ? 36  LEU A HB2  4  
ATOM   6648  H  HB3  . LEU A 1 36  ? -5.354  0.411   5.631   1.00 0.00 ? 36  LEU A HB3  4  
ATOM   6649  H  HG   . LEU A 1 36  ? -3.028  0.109   5.238   1.00 0.00 ? 36  LEU A HG   4  
ATOM   6650  H  HD11 . LEU A 1 36  ? -3.283  -2.593  6.600   1.00 0.00 ? 36  LEU A HD11 4  
ATOM   6651  H  HD12 . LEU A 1 36  ? -1.903  -2.126  5.569   1.00 0.00 ? 36  LEU A HD12 4  
ATOM   6652  H  HD13 . LEU A 1 36  ? -2.226  -1.248  7.061   1.00 0.00 ? 36  LEU A HD13 4  
ATOM   6653  H  HD21 . LEU A 1 36  ? -3.155  -1.622  3.503   1.00 0.00 ? 36  LEU A HD21 4  
ATOM   6654  H  HD22 . LEU A 1 36  ? -4.512  -2.407  4.334   1.00 0.00 ? 36  LEU A HD22 4  
ATOM   6655  H  HD23 . LEU A 1 36  ? -4.725  -0.809  3.599   1.00 0.00 ? 36  LEU A HD23 4  
ATOM   6656  N  N    . ASP A 1 37  ? -6.697  1.297   8.156   1.00 0.00 ? 37  ASP A N    4  
ATOM   6657  C  CA   . ASP A 1 37  ? -7.436  2.485   8.582   1.00 0.00 ? 37  ASP A CA   4  
ATOM   6658  C  C    . ASP A 1 37  ? -6.738  3.076   9.756   1.00 0.00 ? 37  ASP A C    4  
ATOM   6659  O  O    . ASP A 1 37  ? -6.477  4.281   9.728   1.00 0.00 ? 37  ASP A O    4  
ATOM   6660  C  CB   . ASP A 1 37  ? -8.894  2.257   9.037   1.00 0.00 ? 37  ASP A CB   4  
ATOM   6661  C  CG   . ASP A 1 37  ? -9.589  3.493   9.717   1.00 0.00 ? 37  ASP A CG   4  
ATOM   6662  O  OD1  . ASP A 1 37  ? -9.034  4.237   10.580  1.00 0.00 ? 37  ASP A OD1  4  
ATOM   6663  O  OD2  . ASP A 1 37  ? -10.786 3.690   9.413   1.00 0.00 ? 37  ASP A OD2  4  
ATOM   6664  H  H    . ASP A 1 37  ? -7.183  0.399   8.111   1.00 0.00 ? 37  ASP A H    4  
ATOM   6665  H  HA   . ASP A 1 37  ? -7.397  3.220   7.785   1.00 0.00 ? 37  ASP A HA   4  
ATOM   6666  H  HB2  . ASP A 1 37  ? -9.472  1.951   8.162   1.00 0.00 ? 37  ASP A HB2  4  
ATOM   6667  H  HB3  . ASP A 1 37  ? -8.917  1.424   9.742   1.00 0.00 ? 37  ASP A HB3  4  
ATOM   6668  N  N    . ASP A 1 38  ? -6.411  2.279   10.782  1.00 0.00 ? 38  ASP A N    4  
ATOM   6669  C  CA   . ASP A 1 38  ? -5.990  2.963   11.969  1.00 0.00 ? 38  ASP A CA   4  
ATOM   6670  C  C    . ASP A 1 38  ? -4.696  3.745   11.785  1.00 0.00 ? 38  ASP A C    4  
ATOM   6671  O  O    . ASP A 1 38  ? -4.588  4.857   12.306  1.00 0.00 ? 38  ASP A O    4  
ATOM   6672  C  CB   . ASP A 1 38  ? -6.091  2.210   13.284  1.00 0.00 ? 38  ASP A CB   4  
ATOM   6673  C  CG   . ASP A 1 38  ? -6.230  3.293   14.393  1.00 0.00 ? 38  ASP A CG   4  
ATOM   6674  O  OD1  . ASP A 1 38  ? -6.791  4.397   14.123  1.00 0.00 ? 38  ASP A OD1  4  
ATOM   6675  O  OD2  . ASP A 1 38  ? -5.791  3.040   15.537  1.00 0.00 ? 38  ASP A OD2  4  
ATOM   6676  H  H    . ASP A 1 38  ? -6.574  1.275   10.788  1.00 0.00 ? 38  ASP A H    4  
ATOM   6677  H  HA   . ASP A 1 38  ? -6.784  3.687   12.041  1.00 0.00 ? 38  ASP A HA   4  
ATOM   6678  H  HB2  . ASP A 1 38  ? -6.982  1.578   13.280  1.00 0.00 ? 38  ASP A HB2  4  
ATOM   6679  H  HB3  . ASP A 1 38  ? -5.212  1.570   13.420  1.00 0.00 ? 38  ASP A HB3  4  
ATOM   6680  N  N    . THR A 1 39  ? -3.825  3.252   10.912  1.00 0.00 ? 39  THR A N    4  
ATOM   6681  C  CA   . THR A 1 39  ? -2.532  3.855   10.666  1.00 0.00 ? 39  THR A CA   4  
ATOM   6682  C  C    . THR A 1 39  ? -2.702  5.100   9.781   1.00 0.00 ? 39  THR A C    4  
ATOM   6683  O  O    . THR A 1 39  ? -2.114  6.147   10.055  1.00 0.00 ? 39  THR A O    4  
ATOM   6684  C  CB   . THR A 1 39  ? -1.640  2.787   10.017  1.00 0.00 ? 39  THR A CB   4  
ATOM   6685  O  OG1  . THR A 1 39  ? -1.599  1.606   10.796  1.00 0.00 ? 39  THR A OG1  4  
ATOM   6686  C  CG2  . THR A 1 39  ? -0.216  3.310   9.890   1.00 0.00 ? 39  THR A CG2  4  
ATOM   6687  H  H    . THR A 1 39  ? -4.138  2.508   10.277  1.00 0.00 ? 39  THR A H    4  
ATOM   6688  H  HA   . THR A 1 39  ? -2.092  4.158   11.618  1.00 0.00 ? 39  THR A HA   4  
ATOM   6689  H  HB   . THR A 1 39  ? -2.036  2.543   9.031   1.00 0.00 ? 39  THR A HB   4  
ATOM   6690  H  HG1  . THR A 1 39  ? -2.454  1.150   10.678  1.00 0.00 ? 39  THR A HG1  4  
ATOM   6691  H  HG21 . THR A 1 39  ? 0.228   3.413   10.876  1.00 0.00 ? 39  THR A HG21 4  
ATOM   6692  H  HG22 . THR A 1 39  ? 0.384   2.628   9.290   1.00 0.00 ? 39  THR A HG22 4  
ATOM   6693  H  HG23 . THR A 1 39  ? -0.249  4.288   9.410   1.00 0.00 ? 39  THR A HG23 4  
ATOM   6694  N  N    . LEU A 1 40  ? -3.518  4.994   8.731   1.00 0.00 ? 40  LEU A N    4  
ATOM   6695  C  CA   . LEU A 1 40  ? -3.897  6.106   7.868   1.00 0.00 ? 40  LEU A CA   4  
ATOM   6696  C  C    . LEU A 1 40  ? -4.643  7.173   8.690   1.00 0.00 ? 40  LEU A C    4  
ATOM   6697  O  O    . LEU A 1 40  ? -5.456  6.865   9.575   1.00 0.00 ? 40  LEU A O    4  
ATOM   6698  C  CB   . LEU A 1 40  ? -4.797  5.613   6.716   1.00 0.00 ? 40  LEU A CB   4  
ATOM   6699  C  CG   . LEU A 1 40  ? -4.201  4.526   5.791   1.00 0.00 ? 40  LEU A CG   4  
ATOM   6700  C  CD1  . LEU A 1 40  ? -5.325  3.837   5.008   1.00 0.00 ? 40  LEU A CD1  4  
ATOM   6701  C  CD2  . LEU A 1 40  ? -3.175  5.035   4.780   1.00 0.00 ? 40  LEU A CD2  4  
ATOM   6702  H  H    . LEU A 1 40  ? -3.953  4.104   8.546   1.00 0.00 ? 40  LEU A H    4  
ATOM   6703  H  HA   . LEU A 1 40  ? -2.993  6.535   7.439   1.00 0.00 ? 40  LEU A HA   4  
ATOM   6704  H  HB2  . LEU A 1 40  ? -5.709  5.219   7.169   1.00 0.00 ? 40  LEU A HB2  4  
ATOM   6705  H  HB3  . LEU A 1 40  ? -5.078  6.472   6.106   1.00 0.00 ? 40  LEU A HB3  4  
ATOM   6706  H  HG   . LEU A 1 40  ? -3.687  3.786   6.399   1.00 0.00 ? 40  LEU A HG   4  
ATOM   6707  H  HD11 . LEU A 1 40  ? -5.834  4.551   4.361   1.00 0.00 ? 40  LEU A HD11 4  
ATOM   6708  H  HD12 . LEU A 1 40  ? -4.918  3.027   4.402   1.00 0.00 ? 40  LEU A HD12 4  
ATOM   6709  H  HD13 . LEU A 1 40  ? -6.043  3.410   5.706   1.00 0.00 ? 40  LEU A HD13 4  
ATOM   6710  H  HD21 . LEU A 1 40  ? -3.608  5.804   4.143   1.00 0.00 ? 40  LEU A HD21 4  
ATOM   6711  H  HD22 . LEU A 1 40  ? -2.307  5.425   5.304   1.00 0.00 ? 40  LEU A HD22 4  
ATOM   6712  H  HD23 . LEU A 1 40  ? -2.843  4.208   4.153   1.00 0.00 ? 40  LEU A HD23 4  
ATOM   6713  N  N    . GLU A 1 41  ? -4.437  8.438   8.327   1.00 0.00 ? 41  GLU A N    4  
ATOM   6714  C  CA   . GLU A 1 41  ? -5.124  9.603   8.882   1.00 0.00 ? 41  GLU A CA   4  
ATOM   6715  C  C    . GLU A 1 41  ? -5.715  10.418  7.720   1.00 0.00 ? 41  GLU A C    4  
ATOM   6716  O  O    . GLU A 1 41  ? -5.477  11.618  7.570   1.00 0.00 ? 41  GLU A O    4  
ATOM   6717  C  CB   . GLU A 1 41  ? -4.172  10.396  9.799   1.00 0.00 ? 41  GLU A CB   4  
ATOM   6718  C  CG   . GLU A 1 41  ? -3.824  9.639   11.092  1.00 0.00 ? 41  GLU A CG   4  
ATOM   6719  C  CD   . GLU A 1 41  ? -5.021  9.541   12.062  1.00 0.00 ? 41  GLU A CD   4  
ATOM   6720  O  OE1  . GLU A 1 41  ? -5.237  10.484  12.857  1.00 0.00 ? 41  GLU A OE1  4  
ATOM   6721  O  OE2  . GLU A 1 41  ? -5.751  8.520   12.057  1.00 0.00 ? 41  GLU A OE2  4  
ATOM   6722  H  H    . GLU A 1 41  ? -3.656  8.640   7.709   1.00 0.00 ? 41  GLU A H    4  
ATOM   6723  H  HA   . GLU A 1 41  ? -5.969  9.268   9.484   1.00 0.00 ? 41  GLU A HA   4  
ATOM   6724  H  HB2  . GLU A 1 41  ? -3.251  10.612  9.256   1.00 0.00 ? 41  GLU A HB2  4  
ATOM   6725  H  HB3  . GLU A 1 41  ? -4.635  11.344  10.074  1.00 0.00 ? 41  GLU A HB3  4  
ATOM   6726  H  HG2  . GLU A 1 41  ? -3.455  8.644   10.840  1.00 0.00 ? 41  GLU A HG2  4  
ATOM   6727  H  HG3  . GLU A 1 41  ? -3.008  10.170  11.587  1.00 0.00 ? 41  GLU A HG3  4  
ATOM   6728  N  N    . PHE A 1 42  ? -6.464  9.720   6.858   1.00 0.00 ? 42  PHE A N    4  
ATOM   6729  C  CA   . PHE A 1 42  ? -7.277  10.301  5.791   1.00 0.00 ? 42  PHE A CA   4  
ATOM   6730  C  C    . PHE A 1 42  ? -8.320  11.299  6.350   1.00 0.00 ? 42  PHE A C    4  
ATOM   6731  O  O    . PHE A 1 42  ? -8.629  11.232  7.546   1.00 0.00 ? 42  PHE A O    4  
ATOM   6732  C  CB   . PHE A 1 42  ? -7.910  9.145   4.994   1.00 0.00 ? 42  PHE A CB   4  
ATOM   6733  C  CG   . PHE A 1 42  ? -8.751  8.156   5.787   1.00 0.00 ? 42  PHE A CG   4  
ATOM   6734  C  CD1  . PHE A 1 42  ? -10.020 8.529   6.275   1.00 0.00 ? 42  PHE A CD1  4  
ATOM   6735  C  CD2  . PHE A 1 42  ? -8.316  6.823   5.940   1.00 0.00 ? 42  PHE A CD2  4  
ATOM   6736  C  CE1  . PHE A 1 42  ? -10.841 7.583   6.912   1.00 0.00 ? 42  PHE A CE1  4  
ATOM   6737  C  CE2  . PHE A 1 42  ? -9.135  5.879   6.583   1.00 0.00 ? 42  PHE A CE2  4  
ATOM   6738  C  CZ   . PHE A 1 42  ? -10.400 6.258   7.063   1.00 0.00 ? 42  PHE A CZ   4  
ATOM   6739  H  H    . PHE A 1 42  ? -6.607  8.740   7.052   1.00 0.00 ? 42  PHE A H    4  
ATOM   6740  H  HA   . PHE A 1 42  ? -6.611  10.847  5.130   1.00 0.00 ? 42  PHE A HA   4  
ATOM   6741  H  HB2  . PHE A 1 42  ? -8.534  9.545   4.200   1.00 0.00 ? 42  PHE A HB2  4  
ATOM   6742  H  HB3  . PHE A 1 42  ? -7.106  8.600   4.499   1.00 0.00 ? 42  PHE A HB3  4  
ATOM   6743  H  HD1  . PHE A 1 42  ? -10.391 9.534   6.131   1.00 0.00 ? 42  PHE A HD1  4  
ATOM   6744  H  HD2  . PHE A 1 42  ? -7.360  6.512   5.543   1.00 0.00 ? 42  PHE A HD2  4  
ATOM   6745  H  HE1  . PHE A 1 42  ? -11.818 7.873   7.275   1.00 0.00 ? 42  PHE A HE1  4  
ATOM   6746  H  HE2  . PHE A 1 42  ? -8.798  4.859   6.700   1.00 0.00 ? 42  PHE A HE2  4  
ATOM   6747  H  HZ   . PHE A 1 42  ? -11.039 5.531   7.544   1.00 0.00 ? 42  PHE A HZ   4  
ATOM   6748  N  N    . PRO A 1 43  ? -8.917  12.194  5.531   1.00 0.00 ? 43  PRO A N    4  
ATOM   6749  C  CA   . PRO A 1 43  ? -8.687  12.397  4.097   1.00 0.00 ? 43  PRO A CA   4  
ATOM   6750  C  C    . PRO A 1 43  ? -7.273  12.913  3.808   1.00 0.00 ? 43  PRO A C    4  
ATOM   6751  O  O    . PRO A 1 43  ? -6.673  13.582  4.653   1.00 0.00 ? 43  PRO A O    4  
ATOM   6752  C  CB   . PRO A 1 43  ? -9.750  13.414  3.655   1.00 0.00 ? 43  PRO A CB   4  
ATOM   6753  C  CG   . PRO A 1 43  ? -10.039 14.214  4.920   1.00 0.00 ? 43  PRO A CG   4  
ATOM   6754  C  CD   . PRO A 1 43  ? -9.897  13.160  6.015   1.00 0.00 ? 43  PRO A CD   4  
ATOM   6755  H  HA   . PRO A 1 43  ? -8.849  11.474  3.547   1.00 0.00 ? 43  PRO A HA   4  
ATOM   6756  H  HB2  . PRO A 1 43  ? -9.405  14.053  2.840   1.00 0.00 ? 43  PRO A HB2  4  
ATOM   6757  H  HB3  . PRO A 1 43  ? -10.656 12.888  3.356   1.00 0.00 ? 43  PRO A HB3  4  
ATOM   6758  H  HG2  . PRO A 1 43  ? -9.281  14.987  5.051   1.00 0.00 ? 43  PRO A HG2  4  
ATOM   6759  H  HG3  . PRO A 1 43  ? -11.038 14.650  4.906   1.00 0.00 ? 43  PRO A HG3  4  
ATOM   6760  H  HD2  . PRO A 1 43  ? -9.569  13.627  6.944   1.00 0.00 ? 43  PRO A HD2  4  
ATOM   6761  H  HD3  . PRO A 1 43  ? -10.851 12.654  6.167   1.00 0.00 ? 43  PRO A HD3  4  
ATOM   6762  N  N    . PHE A 1 44  ? -6.738  12.609  2.621   1.00 0.00 ? 44  PHE A N    4  
ATOM   6763  C  CA   . PHE A 1 44  ? -5.433  13.106  2.184   1.00 0.00 ? 44  PHE A CA   4  
ATOM   6764  C  C    . PHE A 1 44  ? -5.414  13.241  0.661   1.00 0.00 ? 44  PHE A C    4  
ATOM   6765  O  O    . PHE A 1 44  ? -6.246  12.652  -0.023  1.00 0.00 ? 44  PHE A O    4  
ATOM   6766  C  CB   . PHE A 1 44  ? -4.296  12.199  2.701   1.00 0.00 ? 44  PHE A CB   4  
ATOM   6767  C  CG   . PHE A 1 44  ? -4.283  10.748  2.236   1.00 0.00 ? 44  PHE A CG   4  
ATOM   6768  C  CD1  . PHE A 1 44  ? -3.838  10.428  0.943   1.00 0.00 ? 44  PHE A CD1  4  
ATOM   6769  C  CD2  . PHE A 1 44  ? -4.635  9.703   3.111   1.00 0.00 ? 44  PHE A CD2  4  
ATOM   6770  C  CE1  . PHE A 1 44  ? -3.757  9.097   0.511   1.00 0.00 ? 44  PHE A CE1  4  
ATOM   6771  C  CE2  . PHE A 1 44  ? -4.564  8.364   2.684   1.00 0.00 ? 44  PHE A CE2  4  
ATOM   6772  C  CZ   . PHE A 1 44  ? -4.120  8.057   1.384   1.00 0.00 ? 44  PHE A CZ   4  
ATOM   6773  H  H    . PHE A 1 44  ? -7.280  12.080  1.938   1.00 0.00 ? 44  PHE A H    4  
ATOM   6774  H  HA   . PHE A 1 44  ? -5.284  14.102  2.604   1.00 0.00 ? 44  PHE A HA   4  
ATOM   6775  H  HB2  . PHE A 1 44  ? -3.351  12.651  2.399   1.00 0.00 ? 44  PHE A HB2  4  
ATOM   6776  H  HB3  . PHE A 1 44  ? -4.313  12.216  3.792   1.00 0.00 ? 44  PHE A HB3  4  
ATOM   6777  H  HD1  . PHE A 1 44  ? -3.541  11.210  0.274   1.00 0.00 ? 44  PHE A HD1  4  
ATOM   6778  H  HD2  . PHE A 1 44  ? -4.934  9.921   4.124   1.00 0.00 ? 44  PHE A HD2  4  
ATOM   6779  H  HE1  . PHE A 1 44  ? -3.393  8.886   -0.486  1.00 0.00 ? 44  PHE A HE1  4  
ATOM   6780  H  HE2  . PHE A 1 44  ? -4.845  7.570   3.359   1.00 0.00 ? 44  PHE A HE2  4  
ATOM   6781  H  HZ   . PHE A 1 44  ? -4.058  7.027   1.060   1.00 0.00 ? 44  PHE A HZ   4  
ATOM   6782  N  N    . MET A 1 45  ? -4.473  14.004  0.107   1.00 0.00 ? 45  MET A N    4  
ATOM   6783  C  CA   . MET A 1 45  ? -4.319  14.132  -1.341  1.00 0.00 ? 45  MET A CA   4  
ATOM   6784  C  C    . MET A 1 45  ? -3.424  12.997  -1.838  1.00 0.00 ? 45  MET A C    4  
ATOM   6785  O  O    . MET A 1 45  ? -2.434  12.675  -1.180  1.00 0.00 ? 45  MET A O    4  
ATOM   6786  C  CB   . MET A 1 45  ? -3.682  15.497  -1.639  1.00 0.00 ? 45  MET A CB   4  
ATOM   6787  C  CG   . MET A 1 45  ? -3.497  15.745  -3.136  1.00 0.00 ? 45  MET A CG   4  
ATOM   6788  S  SD   . MET A 1 45  ? -2.588  17.262  -3.517  1.00 0.00 ? 45  MET A SD   4  
ATOM   6789  C  CE   . MET A 1 45  ? -2.549  17.081  -5.315  1.00 0.00 ? 45  MET A CE   4  
ATOM   6790  H  H    . MET A 1 45  ? -3.767  14.427  0.692   1.00 0.00 ? 45  MET A H    4  
ATOM   6791  H  HA   . MET A 1 45  ? -5.298  14.060  -1.820  1.00 0.00 ? 45  MET A HA   4  
ATOM   6792  H  HB2  . MET A 1 45  ? -4.316  16.286  -1.231  1.00 0.00 ? 45  MET A HB2  4  
ATOM   6793  H  HB3  . MET A 1 45  ? -2.706  15.551  -1.153  1.00 0.00 ? 45  MET A HB3  4  
ATOM   6794  H  HG2  . MET A 1 45  ? -2.942  14.917  -3.572  1.00 0.00 ? 45  MET A HG2  4  
ATOM   6795  H  HG3  . MET A 1 45  ? -4.477  15.785  -3.611  1.00 0.00 ? 45  MET A HG3  4  
ATOM   6796  H  HE1  . MET A 1 45  ? -1.922  17.858  -5.753  1.00 0.00 ? 45  MET A HE1  4  
ATOM   6797  H  HE2  . MET A 1 45  ? -2.153  16.098  -5.576  1.00 0.00 ? 45  MET A HE2  4  
ATOM   6798  H  HE3  . MET A 1 45  ? -3.562  17.171  -5.705  1.00 0.00 ? 45  MET A HE3  4  
ATOM   6799  N  N    . GLY A 1 46  ? -3.699  12.423  -3.010  1.00 0.00 ? 46  GLY A N    4  
ATOM   6800  C  CA   . GLY A 1 46  ? -2.831  11.424  -3.600  1.00 0.00 ? 46  GLY A CA   4  
ATOM   6801  C  C    . GLY A 1 46  ? -2.918  11.442  -5.114  1.00 0.00 ? 46  GLY A C    4  
ATOM   6802  O  O    . GLY A 1 46  ? -3.771  12.100  -5.711  1.00 0.00 ? 46  GLY A O    4  
ATOM   6803  H  H    . GLY A 1 46  ? -4.483  12.735  -3.579  1.00 0.00 ? 46  GLY A H    4  
ATOM   6804  H  HA2  . GLY A 1 46  ? -1.801  11.621  -3.316  1.00 0.00 ? 46  GLY A HA2  4  
ATOM   6805  H  HA3  . GLY A 1 46  ? -3.113  10.434  -3.239  1.00 0.00 ? 46  GLY A HA3  4  
ATOM   6806  N  N    . LYS A 1 47  ? -2.000  10.721  -5.743  1.00 0.00 ? 47  LYS A N    4  
ATOM   6807  C  CA   . LYS A 1 47  ? -2.064  10.443  -7.165  1.00 0.00 ? 47  LYS A CA   4  
ATOM   6808  C  C    . LYS A 1 47  ? -2.662  9.051   -7.302  1.00 0.00 ? 47  LYS A C    4  
ATOM   6809  O  O    . LYS A 1 47  ? -2.157  8.096   -6.705  1.00 0.00 ? 47  LYS A O    4  
ATOM   6810  C  CB   . LYS A 1 47  ? -0.656  10.497  -7.789  1.00 0.00 ? 47  LYS A CB   4  
ATOM   6811  C  CG   . LYS A 1 47  ? -0.702  10.658  -9.317  1.00 0.00 ? 47  LYS A CG   4  
ATOM   6812  C  CD   . LYS A 1 47  ? -1.095  12.078  -9.773  1.00 0.00 ? 47  LYS A CD   4  
ATOM   6813  C  CE   . LYS A 1 47  ? -0.087  13.194  -9.447  1.00 0.00 ? 47  LYS A CE   4  
ATOM   6814  N  NZ   . LYS A 1 47  ? 1.273   12.924  -9.977  1.00 0.00 ? 47  LYS A NZ   4  
ATOM   6815  H  H    . LYS A 1 47  ? -1.345  10.195  -5.186  1.00 0.00 ? 47  LYS A H    4  
ATOM   6816  H  HA   . LYS A 1 47  ? -2.724  11.174  -7.639  1.00 0.00 ? 47  LYS A HA   4  
ATOM   6817  H  HB2  . LYS A 1 47  ? -0.085  11.319  -7.362  1.00 0.00 ? 47  LYS A HB2  4  
ATOM   6818  H  HB3  . LYS A 1 47  ? -0.120  9.577   -7.547  1.00 0.00 ? 47  LYS A HB3  4  
ATOM   6819  H  HG2  . LYS A 1 47  ? 0.275   10.405  -9.726  1.00 0.00 ? 47  LYS A HG2  4  
ATOM   6820  H  HG3  . LYS A 1 47  ? -1.417  9.945   -9.731  1.00 0.00 ? 47  LYS A HG3  4  
ATOM   6821  H  HD2  . LYS A 1 47  ? -1.248  12.070  -10.849 1.00 0.00 ? 47  LYS A HD2  4  
ATOM   6822  H  HD3  . LYS A 1 47  ? -2.050  12.348  -9.325  1.00 0.00 ? 47  LYS A HD3  4  
ATOM   6823  H  HE2  . LYS A 1 47  ? -0.465  14.118  -9.892  1.00 0.00 ? 47  LYS A HE2  4  
ATOM   6824  H  HE3  . LYS A 1 47  ? -0.039  13.343  -8.366  1.00 0.00 ? 47  LYS A HE3  4  
ATOM   6825  H  HZ1  . LYS A 1 47  ? 1.765   12.252  -9.408  1.00 0.00 ? 47  LYS A HZ1  4  
ATOM   6826  H  HZ2  . LYS A 1 47  ? 1.237   12.539  -10.924 1.00 0.00 ? 47  LYS A HZ2  4  
ATOM   6827  H  HZ3  . LYS A 1 47  ? 1.826   13.769  -10.001 1.00 0.00 ? 47  LYS A HZ3  4  
ATOM   6828  N  N    . TRP A 1 48  ? -3.743  8.928   -8.060  1.00 0.00 ? 48  TRP A N    4  
ATOM   6829  C  CA   . TRP A 1 48  ? -4.266  7.641   -8.460  1.00 0.00 ? 48  TRP A CA   4  
ATOM   6830  C  C    . TRP A 1 48  ? -3.396  7.256   -9.652  1.00 0.00 ? 48  TRP A C    4  
ATOM   6831  O  O    . TRP A 1 48  ? -3.481  7.876   -10.713 1.00 0.00 ? 48  TRP A O    4  
ATOM   6832  C  CB   . TRP A 1 48  ? -5.756  7.761   -8.819  1.00 0.00 ? 48  TRP A CB   4  
ATOM   6833  C  CG   . TRP A 1 48  ? -6.474  6.485   -9.144  1.00 0.00 ? 48  TRP A CG   4  
ATOM   6834  C  CD1  . TRP A 1 48  ? -5.922  5.256   -9.177  1.00 0.00 ? 48  TRP A CD1  4  
ATOM   6835  C  CD2  . TRP A 1 48  ? -7.883  6.276   -9.470  1.00 0.00 ? 48  TRP A CD2  4  
ATOM   6836  N  NE1  . TRP A 1 48  ? -6.869  4.308   -9.463  1.00 0.00 ? 48  TRP A NE1  4  
ATOM   6837  C  CE2  . TRP A 1 48  ? -8.108  4.877   -9.663  1.00 0.00 ? 48  TRP A CE2  4  
ATOM   6838  C  CE3  . TRP A 1 48  ? -9.000  7.130   -9.606  1.00 0.00 ? 48  TRP A CE3  4  
ATOM   6839  C  CZ2  . TRP A 1 48  ? -9.377  4.357   -9.963  1.00 0.00 ? 48  TRP A CZ2  4  
ATOM   6840  C  CZ3  . TRP A 1 48  ? -10.275 6.620   -9.915  1.00 0.00 ? 48  TRP A CZ3  4  
ATOM   6841  C  CH2  . TRP A 1 48  ? -10.466 5.237   -10.089 1.00 0.00 ? 48  TRP A CH2  4  
ATOM   6842  H  H    . TRP A 1 48  ? -4.105  9.741   -8.547  1.00 0.00 ? 48  TRP A H    4  
ATOM   6843  H  HA   . TRP A 1 48  ? -4.147  6.917   -7.653  1.00 0.00 ? 48  TRP A HA   4  
ATOM   6844  H  HB2  . TRP A 1 48  ? -6.276  8.220   -7.979  1.00 0.00 ? 48  TRP A HB2  4  
ATOM   6845  H  HB3  . TRP A 1 48  ? -5.857  8.431   -9.667  1.00 0.00 ? 48  TRP A HB3  4  
ATOM   6846  H  HD1  . TRP A 1 48  ? -4.888  5.030   -8.986  1.00 0.00 ? 48  TRP A HD1  4  
ATOM   6847  H  HE1  . TRP A 1 48  ? -6.629  3.309   -9.456  1.00 0.00 ? 48  TRP A HE1  4  
ATOM   6848  H  HE3  . TRP A 1 48  ? -8.870  8.190   -9.458  1.00 0.00 ? 48  TRP A HE3  4  
ATOM   6849  H  HZ2  . TRP A 1 48  ? -9.521  3.294   -10.083 1.00 0.00 ? 48  TRP A HZ2  4  
ATOM   6850  H  HZ3  . TRP A 1 48  ? -11.116 7.294   -10.008 1.00 0.00 ? 48  TRP A HZ3  4  
ATOM   6851  H  HH2  . TRP A 1 48  ? -11.452 4.849   -10.307 1.00 0.00 ? 48  TRP A HH2  4  
ATOM   6852  N  N    . LYS A 1 49  ? -2.505  6.283   -9.476  1.00 0.00 ? 49  LYS A N    4  
ATOM   6853  C  CA   . LYS A 1 49  ? -1.641  5.758   -10.527 1.00 0.00 ? 49  LYS A CA   4  
ATOM   6854  C  C    . LYS A 1 49  ? -2.370  4.549   -11.110 1.00 0.00 ? 49  LYS A C    4  
ATOM   6855  O  O    . LYS A 1 49  ? -1.984  3.400   -10.894 1.00 0.00 ? 49  LYS A O    4  
ATOM   6856  C  CB   . LYS A 1 49  ? -0.259  5.447   -9.924  1.00 0.00 ? 49  LYS A CB   4  
ATOM   6857  C  CG   . LYS A 1 49  ? 0.533   6.753   -9.721  1.00 0.00 ? 49  LYS A CG   4  
ATOM   6858  C  CD   . LYS A 1 49  ? 1.800   6.603   -8.869  1.00 0.00 ? 49  LYS A CD   4  
ATOM   6859  C  CE   . LYS A 1 49  ? 2.765   5.531   -9.396  1.00 0.00 ? 49  LYS A CE   4  
ATOM   6860  N  NZ   . LYS A 1 49  ? 4.084   5.597   -8.721  1.00 0.00 ? 49  LYS A NZ   4  
ATOM   6861  H  H    . LYS A 1 49  ? -2.485  5.769   -8.616  1.00 0.00 ? 49  LYS A H    4  
ATOM   6862  H  HA   . LYS A 1 49  ? -1.522  6.495   -11.324 1.00 0.00 ? 49  LYS A HA   4  
ATOM   6863  H  HB2  . LYS A 1 49  ? -0.383  4.929   -8.971  1.00 0.00 ? 49  LYS A HB2  4  
ATOM   6864  H  HB3  . LYS A 1 49  ? 0.295   4.796   -10.599 1.00 0.00 ? 49  LYS A HB3  4  
ATOM   6865  H  HG2  . LYS A 1 49  ? 0.810   7.147   -10.699 1.00 0.00 ? 49  LYS A HG2  4  
ATOM   6866  H  HG3  . LYS A 1 49  ? -0.104  7.491   -9.231  1.00 0.00 ? 49  LYS A HG3  4  
ATOM   6867  H  HD2  . LYS A 1 49  ? 2.306   7.570   -8.850  1.00 0.00 ? 49  LYS A HD2  4  
ATOM   6868  H  HD3  . LYS A 1 49  ? 1.509   6.349   -7.850  1.00 0.00 ? 49  LYS A HD3  4  
ATOM   6869  H  HE2  . LYS A 1 49  ? 2.318   4.549   -9.225  1.00 0.00 ? 49  LYS A HE2  4  
ATOM   6870  H  HE3  . LYS A 1 49  ? 2.901   5.666   -10.471 1.00 0.00 ? 49  LYS A HE3  4  
ATOM   6871  H  HZ1  . LYS A 1 49  ? 4.645   4.788   -8.942  1.00 0.00 ? 49  LYS A HZ1  4  
ATOM   6872  H  HZ2  . LYS A 1 49  ? 4.598   6.415   -9.010  1.00 0.00 ? 49  LYS A HZ2  4  
ATOM   6873  H  HZ3  . LYS A 1 49  ? 3.983   5.649   -7.705  1.00 0.00 ? 49  LYS A HZ3  4  
ATOM   6874  N  N    . LYS A 1 50  ? -3.503  4.823   -11.758 1.00 0.00 ? 50  LYS A N    4  
ATOM   6875  C  CA   . LYS A 1 50  ? -4.415  3.796   -12.245 1.00 0.00 ? 50  LYS A CA   4  
ATOM   6876  C  C    . LYS A 1 50  ? -3.704  3.032   -13.353 1.00 0.00 ? 50  LYS A C    4  
ATOM   6877  O  O    . LYS A 1 50  ? -2.977  3.649   -14.131 1.00 0.00 ? 50  LYS A O    4  
ATOM   6878  C  CB   . LYS A 1 50  ? -5.693  4.476   -12.765 1.00 0.00 ? 50  LYS A CB   4  
ATOM   6879  C  CG   . LYS A 1 50  ? -6.855  3.489   -12.948 1.00 0.00 ? 50  LYS A CG   4  
ATOM   6880  C  CD   . LYS A 1 50  ? -8.101  4.219   -13.468 1.00 0.00 ? 50  LYS A CD   4  
ATOM   6881  C  CE   . LYS A 1 50  ? -9.258  3.229   -13.659 1.00 0.00 ? 50  LYS A CE   4  
ATOM   6882  N  NZ   . LYS A 1 50  ? -10.483 3.887   -14.179 1.00 0.00 ? 50  LYS A NZ   4  
ATOM   6883  H  H    . LYS A 1 50  ? -3.682  5.805   -12.002 1.00 0.00 ? 50  LYS A H    4  
ATOM   6884  H  HA   . LYS A 1 50  ? -4.660  3.125   -11.421 1.00 0.00 ? 50  LYS A HA   4  
ATOM   6885  H  HB2  . LYS A 1 50  ? -6.005  5.244   -12.056 1.00 0.00 ? 50  LYS A HB2  4  
ATOM   6886  H  HB3  . LYS A 1 50  ? -5.481  4.963   -13.718 1.00 0.00 ? 50  LYS A HB3  4  
ATOM   6887  H  HG2  . LYS A 1 50  ? -6.573  2.716   -13.660 1.00 0.00 ? 50  LYS A HG2  4  
ATOM   6888  H  HG3  . LYS A 1 50  ? -7.084  3.017   -11.993 1.00 0.00 ? 50  LYS A HG3  4  
ATOM   6889  H  HD2  . LYS A 1 50  ? -8.390  4.989   -12.750 1.00 0.00 ? 50  LYS A HD2  4  
ATOM   6890  H  HD3  . LYS A 1 50  ? -7.864  4.693   -14.422 1.00 0.00 ? 50  LYS A HD3  4  
ATOM   6891  H  HE2  . LYS A 1 50  ? -8.940  2.449   -14.355 1.00 0.00 ? 50  LYS A HE2  4  
ATOM   6892  H  HE3  . LYS A 1 50  ? -9.479  2.756   -12.699 1.00 0.00 ? 50  LYS A HE3  4  
ATOM   6893  H  HZ1  . LYS A 1 50  ? -10.317 4.311   -15.080 1.00 0.00 ? 50  LYS A HZ1  4  
ATOM   6894  H  HZ2  . LYS A 1 50  ? -11.227 3.213   -14.295 1.00 0.00 ? 50  LYS A HZ2  4  
ATOM   6895  H  HZ3  . LYS A 1 50  ? -10.814 4.601   -13.547 1.00 0.00 ? 50  LYS A HZ3  4  
ATOM   6896  N  N    . LYS A 1 51  ? -3.886  1.713   -13.472 1.00 0.00 ? 51  LYS A N    4  
ATOM   6897  C  CA   . LYS A 1 51  ? -3.398  1.014   -14.663 1.00 0.00 ? 51  LYS A CA   4  
ATOM   6898  C  C    . LYS A 1 51  ? -4.083  1.648   -15.880 1.00 0.00 ? 51  LYS A C    4  
ATOM   6899  O  O    . LYS A 1 51  ? -5.270  1.980   -15.810 1.00 0.00 ? 51  LYS A O    4  
ATOM   6900  C  CB   . LYS A 1 51  ? -3.689  -0.493  -14.575 1.00 0.00 ? 51  LYS A CB   4  
ATOM   6901  C  CG   . LYS A 1 51  ? -2.863  -1.271  -15.614 1.00 0.00 ? 51  LYS A CG   4  
ATOM   6902  C  CD   . LYS A 1 51  ? -3.264  -2.749  -15.726 1.00 0.00 ? 51  LYS A CD   4  
ATOM   6903  C  CE   . LYS A 1 51  ? -4.664  -2.993  -16.317 1.00 0.00 ? 51  LYS A CE   4  
ATOM   6904  N  NZ   . LYS A 1 51  ? -4.830  -2.434  -17.683 1.00 0.00 ? 51  LYS A NZ   4  
ATOM   6905  H  H    . LYS A 1 51  ? -4.345  1.183   -12.748 1.00 0.00 ? 51  LYS A H    4  
ATOM   6906  H  HA   . LYS A 1 51  ? -2.318  1.170   -14.732 1.00 0.00 ? 51  LYS A HA   4  
ATOM   6907  H  HB2  . LYS A 1 51  ? -3.423  -0.860  -13.582 1.00 0.00 ? 51  LYS A HB2  4  
ATOM   6908  H  HB3  . LYS A 1 51  ? -4.755  -0.660  -14.734 1.00 0.00 ? 51  LYS A HB3  4  
ATOM   6909  H  HG2  . LYS A 1 51  ? -2.956  -0.808  -16.594 1.00 0.00 ? 51  LYS A HG2  4  
ATOM   6910  H  HG3  . LYS A 1 51  ? -1.812  -1.220  -15.325 1.00 0.00 ? 51  LYS A HG3  4  
ATOM   6911  H  HD2  . LYS A 1 51  ? -2.530  -3.262  -16.349 1.00 0.00 ? 51  LYS A HD2  4  
ATOM   6912  H  HD3  . LYS A 1 51  ? -3.219  -3.202  -14.734 1.00 0.00 ? 51  LYS A HD3  4  
ATOM   6913  H  HE2  . LYS A 1 51  ? -4.825  -4.073  -16.355 1.00 0.00 ? 51  LYS A HE2  4  
ATOM   6914  H  HE3  . LYS A 1 51  ? -5.421  -2.571  -15.651 1.00 0.00 ? 51  LYS A HE3  4  
ATOM   6915  H  HZ1  . LYS A 1 51  ? -4.014  -2.609  -18.260 1.00 0.00 ? 51  LYS A HZ1  4  
ATOM   6916  H  HZ2  . LYS A 1 51  ? -5.642  -2.829  -18.136 1.00 0.00 ? 51  LYS A HZ2  4  
ATOM   6917  H  HZ3  . LYS A 1 51  ? -4.949  -1.424  -17.671 1.00 0.00 ? 51  LYS A HZ3  4  
ATOM   6918  N  N    . SER A 1 52  ? -3.363  1.803   -16.987 1.00 0.00 ? 52  SER A N    4  
ATOM   6919  C  CA   . SER A 1 52  ? -3.914  2.295   -18.238 1.00 0.00 ? 52  SER A CA   4  
ATOM   6920  C  C    . SER A 1 52  ? -5.114  1.456   -18.681 1.00 0.00 ? 52  SER A C    4  
ATOM   6921  O  O    . SER A 1 52  ? -5.203  0.259   -18.391 1.00 0.00 ? 52  SER A O    4  
ATOM   6922  C  CB   . SER A 1 52  ? -2.821  2.275   -19.301 1.00 0.00 ? 52  SER A CB   4  
ATOM   6923  O  OG   . SER A 1 52  ? -1.761  3.123   -18.923 1.00 0.00 ? 52  SER A OG   4  
ATOM   6924  H  H    . SER A 1 52  ? -2.383  1.540   -16.988 1.00 0.00 ? 52  SER A H    4  
ATOM   6925  H  HA   . SER A 1 52  ? -4.243  3.323   -18.088 1.00 0.00 ? 52  SER A HA   4  
ATOM   6926  H  HB2  . SER A 1 52  ? -2.445  1.256   -19.406 1.00 0.00 ? 52  SER A HB2  4  
ATOM   6927  H  HB3  . SER A 1 52  ? -3.225  2.609   -20.257 1.00 0.00 ? 52  SER A HB3  4  
ATOM   6928  H  HG   . SER A 1 52  ? -1.011  2.878   -19.495 1.00 0.00 ? 52  SER A HG   4  
ATOM   6929  N  N    . ARG A 1 53  ? -6.031  2.090   -19.417 1.00 0.00 ? 53  ARG A N    4  
ATOM   6930  C  CA   . ARG A 1 53  ? -7.323  1.509   -19.782 1.00 0.00 ? 53  ARG A CA   4  
ATOM   6931  C  C    . ARG A 1 53  ? -7.187  0.232   -20.619 1.00 0.00 ? 53  ARG A C    4  
ATOM   6932  O  O    . ARG A 1 53  ? -8.041  -0.648  -20.510 1.00 0.00 ? 53  ARG A O    4  
ATOM   6933  C  CB   . ARG A 1 53  ? -8.146  2.594   -20.503 1.00 0.00 ? 53  ARG A CB   4  
ATOM   6934  C  CG   . ARG A 1 53  ? -9.616  2.193   -20.713 1.00 0.00 ? 53  ARG A CG   4  
ATOM   6935  C  CD   . ARG A 1 53  ? -10.444 3.322   -21.344 1.00 0.00 ? 53  ARG A CD   4  
ATOM   6936  N  NE   . ARG A 1 53  ? -9.993  3.662   -22.708 1.00 0.00 ? 53  ARG A NE   4  
ATOM   6937  C  CZ   . ARG A 1 53  ? -10.332 3.031   -23.841 1.00 0.00 ? 53  ARG A CZ   4  
ATOM   6938  N  NH1  . ARG A 1 53  ? -11.133 1.967   -23.817 1.00 0.00 ? 53  ARG A NH1  4  
ATOM   6939  N  NH2  . ARG A 1 53  ? -9.861  3.470   -25.004 1.00 0.00 ? 53  ARG A NH2  4  
ATOM   6940  H  H    . ARG A 1 53  ? -5.884  3.067   -19.635 1.00 0.00 ? 53  ARG A H    4  
ATOM   6941  H  HA   . ARG A 1 53  ? -7.835  1.242   -18.855 1.00 0.00 ? 53  ARG A HA   4  
ATOM   6942  H  HB2  . ARG A 1 53  ? -8.119  3.510   -19.904 1.00 0.00 ? 53  ARG A HB2  4  
ATOM   6943  H  HB3  . ARG A 1 53  ? -7.685  2.808   -21.469 1.00 0.00 ? 53  ARG A HB3  4  
ATOM   6944  H  HG2  . ARG A 1 53  ? -9.673  1.313   -21.354 1.00 0.00 ? 53  ARG A HG2  4  
ATOM   6945  H  HG3  . ARG A 1 53  ? -10.055 1.944   -19.746 1.00 0.00 ? 53  ARG A HG3  4  
ATOM   6946  H  HD2  . ARG A 1 53  ? -11.494 3.025   -21.369 1.00 0.00 ? 53  ARG A HD2  4  
ATOM   6947  H  HD3  . ARG A 1 53  ? -10.369 4.209   -20.715 1.00 0.00 ? 53  ARG A HD3  4  
ATOM   6948  H  HE   . ARG A 1 53  ? -9.396  4.478   -22.771 1.00 0.00 ? 53  ARG A HE   4  
ATOM   6949  H  HH11 . ARG A 1 53  ? -11.512 1.629   -22.945 1.00 0.00 ? 53  ARG A HH11 4  
ATOM   6950  H  HH12 . ARG A 1 53  ? -11.404 1.477   -24.658 1.00 0.00 ? 53  ARG A HH12 4  
ATOM   6951  H  HH21 . ARG A 1 53  ? -9.265  4.286   -25.052 1.00 0.00 ? 53  ARG A HH21 4  
ATOM   6952  H  HH22 . ARG A 1 53  ? -10.109 3.034   -25.881 1.00 0.00 ? 53  ARG A HH22 4  
ATOM   6953  N  N    . LYS A 1 54  ? -6.133  0.113   -21.438 1.00 0.00 ? 54  LYS A N    4  
ATOM   6954  C  CA   . LYS A 1 54  ? -5.991  -0.964  -22.427 1.00 0.00 ? 54  LYS A CA   4  
ATOM   6955  C  C    . LYS A 1 54  ? -4.574  -1.550  -22.491 1.00 0.00 ? 54  LYS A C    4  
ATOM   6956  O  O    . LYS A 1 54  ? -4.282  -2.325  -23.403 1.00 0.00 ? 54  LYS A O    4  
ATOM   6957  C  CB   . LYS A 1 54  ? -6.492  -0.464  -23.800 1.00 0.00 ? 54  LYS A CB   4  
ATOM   6958  C  CG   . LYS A 1 54  ? -5.684  0.717   -24.368 1.00 0.00 ? 54  LYS A CG   4  
ATOM   6959  C  CD   . LYS A 1 54  ? -6.176  1.103   -25.769 1.00 0.00 ? 54  LYS A CD   4  
ATOM   6960  C  CE   . LYS A 1 54  ? -5.330  2.259   -26.322 1.00 0.00 ? 54  LYS A CE   4  
ATOM   6961  N  NZ   . LYS A 1 54  ? -5.727  2.640   -27.701 1.00 0.00 ? 54  LYS A NZ   4  
ATOM   6962  H  H    . LYS A 1 54  ? -5.471  0.875   -21.480 1.00 0.00 ? 54  LYS A H    4  
ATOM   6963  H  HA   . LYS A 1 54  ? -6.641  -1.789  -22.128 1.00 0.00 ? 54  LYS A HA   4  
ATOM   6964  H  HB2  . LYS A 1 54  ? -6.457  -1.292  -24.509 1.00 0.00 ? 54  LYS A HB2  4  
ATOM   6965  H  HB3  . LYS A 1 54  ? -7.536  -0.160  -23.703 1.00 0.00 ? 54  LYS A HB3  4  
ATOM   6966  H  HG2  . LYS A 1 54  ? -5.783  1.580   -23.708 1.00 0.00 ? 54  LYS A HG2  4  
ATOM   6967  H  HG3  . LYS A 1 54  ? -4.631  0.442   -24.430 1.00 0.00 ? 54  LYS A HG3  4  
ATOM   6968  H  HD2  . LYS A 1 54  ? -6.088  0.238   -26.430 1.00 0.00 ? 54  LYS A HD2  4  
ATOM   6969  H  HD3  . LYS A 1 54  ? -7.223  1.406   -25.714 1.00 0.00 ? 54  LYS A HD3  4  
ATOM   6970  H  HE2  . LYS A 1 54  ? -5.435  3.121   -25.659 1.00 0.00 ? 54  LYS A HE2  4  
ATOM   6971  H  HE3  . LYS A 1 54  ? -4.279  1.958   -26.318 1.00 0.00 ? 54  LYS A HE3  4  
ATOM   6972  H  HZ1  . LYS A 1 54  ? -5.154  3.400   -28.038 1.00 0.00 ? 54  LYS A HZ1  4  
ATOM   6973  H  HZ2  . LYS A 1 54  ? -5.613  1.868   -28.341 1.00 0.00 ? 54  LYS A HZ2  4  
ATOM   6974  H  HZ3  . LYS A 1 54  ? -6.688  2.943   -27.738 1.00 0.00 ? 54  LYS A HZ3  4  
ATOM   6975  N  N    . THR A 1 55  ? -3.696  -1.204  -21.550 1.00 0.00 ? 55  THR A N    4  
ATOM   6976  C  CA   . THR A 1 55  ? -2.285  -1.592  -21.543 1.00 0.00 ? 55  THR A CA   4  
ATOM   6977  C  C    . THR A 1 55  ? -1.836  -1.822  -20.094 1.00 0.00 ? 55  THR A C    4  
ATOM   6978  O  O    . THR A 1 55  ? -2.580  -1.526  -19.154 1.00 0.00 ? 55  THR A O    4  
ATOM   6979  C  CB   . THR A 1 55  ? -1.440  -0.505  -22.253 1.00 0.00 ? 55  THR A CB   4  
ATOM   6980  O  OG1  . THR A 1 55  ? -1.896  0.795   -21.932 1.00 0.00 ? 55  THR A OG1  4  
ATOM   6981  C  CG2  . THR A 1 55  ? -1.472  -0.635  -23.779 1.00 0.00 ? 55  THR A CG2  4  
ATOM   6982  H  H    . THR A 1 55  ? -3.986  -0.615  -20.784 1.00 0.00 ? 55  THR A H    4  
ATOM   6983  H  HA   . THR A 1 55  ? -2.162  -2.537  -22.075 1.00 0.00 ? 55  THR A HA   4  
ATOM   6984  H  HB   . THR A 1 55  ? -0.400  -0.599  -21.938 1.00 0.00 ? 55  THR A HB   4  
ATOM   6985  H  HG1  . THR A 1 55  ? -1.198  1.218   -21.399 1.00 0.00 ? 55  THR A HG1  4  
ATOM   6986  H  HG21 . THR A 1 55  ? -0.789  0.093   -24.219 1.00 0.00 ? 55  THR A HG21 4  
ATOM   6987  H  HG22 . THR A 1 55  ? -1.149  -1.635  -24.071 1.00 0.00 ? 55  THR A HG22 4  
ATOM   6988  H  HG23 . THR A 1 55  ? -2.475  -0.454  -24.160 1.00 0.00 ? 55  THR A HG23 4  
ATOM   6989  N  N    . SER A 1 56  ? -0.628  -2.353  -19.899 1.00 0.00 ? 56  SER A N    4  
ATOM   6990  C  CA   . SER A 1 56  ? -0.043  -2.601  -18.580 1.00 0.00 ? 56  SER A CA   4  
ATOM   6991  C  C    . SER A 1 56  ? 0.615   -1.344  -17.974 1.00 0.00 ? 56  SER A C    4  
ATOM   6992  O  O    . SER A 1 56  ? 1.187   -1.416  -16.884 1.00 0.00 ? 56  SER A O    4  
ATOM   6993  C  CB   . SER A 1 56  ? 0.984   -3.737  -18.703 1.00 0.00 ? 56  SER A CB   4  
ATOM   6994  O  OG   . SER A 1 56  ? 0.434   -4.851  -19.397 1.00 0.00 ? 56  SER A OG   4  
ATOM   6995  H  H    . SER A 1 56  ? -0.083  -2.661  -20.693 1.00 0.00 ? 56  SER A H    4  
ATOM   6996  H  HA   . SER A 1 56  ? -0.834  -2.924  -17.904 1.00 0.00 ? 56  SER A HA   4  
ATOM   6997  H  HB2  . SER A 1 56  ? 1.858   -3.374  -19.247 1.00 0.00 ? 56  SER A HB2  4  
ATOM   6998  H  HB3  . SER A 1 56  ? 1.298   -4.049  -17.706 1.00 0.00 ? 56  SER A HB3  4  
ATOM   6999  H  HG   . SER A 1 56  ? 1.117   -5.544  -19.438 1.00 0.00 ? 56  SER A HG   4  
ATOM   7000  N  N    . THR A 1 57  ? 0.588   -0.214  -18.685 1.00 0.00 ? 57  THR A N    4  
ATOM   7001  C  CA   . THR A 1 57  ? 1.163   1.061   -18.275 1.00 0.00 ? 57  THR A CA   4  
ATOM   7002  C  C    . THR A 1 57  ? 0.320   1.718   -17.161 1.00 0.00 ? 57  THR A C    4  
ATOM   7003  O  O    . THR A 1 57  ? -0.614  1.110   -16.627 1.00 0.00 ? 57  THR A O    4  
ATOM   7004  C  CB   . THR A 1 57  ? 1.342   1.921   -19.547 1.00 0.00 ? 57  THR A CB   4  
ATOM   7005  O  OG1  . THR A 1 57  ? 0.203   1.848   -20.394 1.00 0.00 ? 57  THR A OG1  4  
ATOM   7006  C  CG2  . THR A 1 57  ? 2.536   1.425   -20.368 1.00 0.00 ? 57  THR A CG2  4  
ATOM   7007  H  H    . THR A 1 57  ? 0.090   -0.187  -19.561 1.00 0.00 ? 57  THR A H    4  
ATOM   7008  H  HA   . THR A 1 57  ? 2.151   0.877   -17.851 1.00 0.00 ? 57  THR A HA   4  
ATOM   7009  H  HB   . THR A 1 57  ? 1.524   2.959   -19.268 1.00 0.00 ? 57  THR A HB   4  
ATOM   7010  H  HG1  . THR A 1 57  ? 0.359   2.461   -21.134 1.00 0.00 ? 57  THR A HG1  4  
ATOM   7011  H  HG21 . THR A 1 57  ? 2.370   0.401   -20.704 1.00 0.00 ? 57  THR A HG21 4  
ATOM   7012  H  HG22 . THR A 1 57  ? 2.675   2.068   -21.238 1.00 0.00 ? 57  THR A HG22 4  
ATOM   7013  H  HG23 . THR A 1 57  ? 3.442   1.463   -19.763 1.00 0.00 ? 57  THR A HG23 4  
ATOM   7014  N  N    . ILE A 1 58  ? 0.655   2.956   -16.785 1.00 0.00 ? 58  ILE A N    4  
ATOM   7015  C  CA   . ILE A 1 58  ? 0.003   3.715   -15.721 1.00 0.00 ? 58  ILE A CA   4  
ATOM   7016  C  C    . ILE A 1 58  ? -0.552  4.998   -16.349 1.00 0.00 ? 58  ILE A C    4  
ATOM   7017  O  O    . ILE A 1 58  ? 0.064   5.595   -17.237 1.00 0.00 ? 58  ILE A O    4  
ATOM   7018  C  CB   . ILE A 1 58  ? 1.028   3.974   -14.588 1.00 0.00 ? 58  ILE A CB   4  
ATOM   7019  C  CG1  . ILE A 1 58  ? 1.480   2.662   -13.899 1.00 0.00 ? 58  ILE A CG1  4  
ATOM   7020  C  CG2  . ILE A 1 58  ? 0.529   4.984   -13.539 1.00 0.00 ? 58  ILE A CG2  4  
ATOM   7021  C  CD1  . ILE A 1 58  ? 0.432   1.969   -13.018 1.00 0.00 ? 58  ILE A CD1  4  
ATOM   7022  H  H    . ILE A 1 58  ? 1.366   3.450   -17.305 1.00 0.00 ? 58  ILE A H    4  
ATOM   7023  H  HA   . ILE A 1 58  ? -0.835  3.160   -15.303 1.00 0.00 ? 58  ILE A HA   4  
ATOM   7024  H  HB   . ILE A 1 58  ? 1.912   4.414   -15.049 1.00 0.00 ? 58  ILE A HB   4  
ATOM   7025  H  HG12 . ILE A 1 58  ? 1.801   1.947   -14.655 1.00 0.00 ? 58  ILE A HG12 4  
ATOM   7026  H  HG13 . ILE A 1 58  ? 2.347   2.881   -13.276 1.00 0.00 ? 58  ILE A HG13 4  
ATOM   7027  H  HG21 . ILE A 1 58  ? 0.416   5.971   -13.988 1.00 0.00 ? 58  ILE A HG21 4  
ATOM   7028  H  HG22 . ILE A 1 58  ? -0.431  4.665   -13.137 1.00 0.00 ? 58  ILE A HG22 4  
ATOM   7029  H  HG23 . ILE A 1 58  ? 1.258   5.067   -12.733 1.00 0.00 ? 58  ILE A HG23 4  
ATOM   7030  H  HD11 . ILE A 1 58  ? 0.209   2.585   -12.149 1.00 0.00 ? 58  ILE A HD11 4  
ATOM   7031  H  HD12 . ILE A 1 58  ? -0.480  1.783   -13.581 1.00 0.00 ? 58  ILE A HD12 4  
ATOM   7032  H  HD13 . ILE A 1 58  ? 0.830   1.016   -12.671 1.00 0.00 ? 58  ILE A HD13 4  
ATOM   7033  N  N    . GLU A 1 59  ? -1.705  5.429   -15.846 1.00 0.00 ? 59  GLU A N    4  
ATOM   7034  C  CA   . GLU A 1 59  ? -2.474  6.576   -16.275 1.00 0.00 ? 59  GLU A CA   4  
ATOM   7035  C  C    . GLU A 1 59  ? -2.815  7.318   -14.978 1.00 0.00 ? 59  GLU A C    4  
ATOM   7036  O  O    . GLU A 1 59  ? -3.507  6.795   -14.101 1.00 0.00 ? 59  GLU A O    4  
ATOM   7037  C  CB   . GLU A 1 59  ? -3.705  6.069   -17.048 1.00 0.00 ? 59  GLU A CB   4  
ATOM   7038  C  CG   . GLU A 1 59  ? -4.625  7.174   -17.583 1.00 0.00 ? 59  GLU A CG   4  
ATOM   7039  C  CD   . GLU A 1 59  ? -3.941  8.038   -18.658 1.00 0.00 ? 59  GLU A CD   4  
ATOM   7040  O  OE1  . GLU A 1 59  ? -3.224  9.002   -18.307 1.00 0.00 ? 59  GLU A OE1  4  
ATOM   7041  O  OE2  . GLU A 1 59  ? -4.131  7.775   -19.868 1.00 0.00 ? 59  GLU A OE2  4  
ATOM   7042  H  H    . GLU A 1 59  ? -2.154  4.886   -15.113 1.00 0.00 ? 59  GLU A H    4  
ATOM   7043  H  HA   . GLU A 1 59  ? -1.871  7.208   -16.928 1.00 0.00 ? 59  GLU A HA   4  
ATOM   7044  H  HB2  . GLU A 1 59  ? -3.364  5.473   -17.896 1.00 0.00 ? 59  GLU A HB2  4  
ATOM   7045  H  HB3  . GLU A 1 59  ? -4.292  5.417   -16.398 1.00 0.00 ? 59  GLU A HB3  4  
ATOM   7046  H  HG2  . GLU A 1 59  ? -5.512  6.695   -18.012 1.00 0.00 ? 59  GLU A HG2  4  
ATOM   7047  H  HG3  . GLU A 1 59  ? -4.955  7.801   -16.753 1.00 0.00 ? 59  GLU A HG3  4  
ATOM   7048  N  N    . GLU A 1 60  ? -2.220  8.494   -14.801 1.00 0.00 ? 60  GLU A N    4  
ATOM   7049  C  CA   . GLU A 1 60  ? -2.299  9.251   -13.559 1.00 0.00 ? 60  GLU A CA   4  
ATOM   7050  C  C    . GLU A 1 60  ? -3.600  10.059  -13.491 1.00 0.00 ? 60  GLU A C    4  
ATOM   7051  O  O    . GLU A 1 60  ? -4.091  10.550  -14.514 1.00 0.00 ? 60  GLU A O    4  
ATOM   7052  C  CB   . GLU A 1 60  ? -1.102  10.210  -13.483 1.00 0.00 ? 60  GLU A CB   4  
ATOM   7053  C  CG   . GLU A 1 60  ? 0.206   9.499   -13.112 1.00 0.00 ? 60  GLU A CG   4  
ATOM   7054  C  CD   . GLU A 1 60  ? 1.391   10.480  -13.105 1.00 0.00 ? 60  GLU A CD   4  
ATOM   7055  O  OE1  . GLU A 1 60  ? 1.397   11.424  -12.283 1.00 0.00 ? 60  GLU A OE1  4  
ATOM   7056  O  OE2  . GLU A 1 60  ? 2.332   10.308  -13.915 1.00 0.00 ? 60  GLU A OE2  4  
ATOM   7057  H  H    . GLU A 1 60  ? -1.691  8.900   -15.558 1.00 0.00 ? 60  GLU A H    4  
ATOM   7058  H  HA   . GLU A 1 60  ? -2.259  8.564   -12.713 1.00 0.00 ? 60  GLU A HA   4  
ATOM   7059  H  HB2  . GLU A 1 60  ? -0.981  10.721  -14.440 1.00 0.00 ? 60  GLU A HB2  4  
ATOM   7060  H  HB3  . GLU A 1 60  ? -1.308  10.962  -12.726 1.00 0.00 ? 60  GLU A HB3  4  
ATOM   7061  H  HG2  . GLU A 1 60  ? 0.097   9.054   -12.121 1.00 0.00 ? 60  GLU A HG2  4  
ATOM   7062  H  HG3  . GLU A 1 60  ? 0.395   8.694   -13.825 1.00 0.00 ? 60  GLU A HG3  4  
ATOM   7063  N  N    . LYS A 1 61  ? -4.119  10.267  -12.276 1.00 0.00 ? 61  LYS A N    4  
ATOM   7064  C  CA   . LYS A 1 61  ? -5.215  11.192  -11.993 1.00 0.00 ? 61  LYS A CA   4  
ATOM   7065  C  C    . LYS A 1 61  ? -4.926  11.779  -10.614 1.00 0.00 ? 61  LYS A C    4  
ATOM   7066  O  O    . LYS A 1 61  ? -4.633  11.026  -9.686  1.00 0.00 ? 61  LYS A O    4  
ATOM   7067  C  CB   . LYS A 1 61  ? -6.554  10.435  -12.031 1.00 0.00 ? 61  LYS A CB   4  
ATOM   7068  C  CG   . LYS A 1 61  ? -7.772  11.371  -11.979 1.00 0.00 ? 61  LYS A CG   4  
ATOM   7069  C  CD   . LYS A 1 61  ? -9.097  10.618  -11.765 1.00 0.00 ? 61  LYS A CD   4  
ATOM   7070  C  CE   . LYS A 1 61  ? -9.355  9.445   -12.729 1.00 0.00 ? 61  LYS A CE   4  
ATOM   7071  N  NZ   . LYS A 1 61  ? -9.524  9.878   -14.141 1.00 0.00 ? 61  LYS A NZ   4  
ATOM   7072  H  H    . LYS A 1 61  ? -3.726  9.769   -11.457 1.00 0.00 ? 61  LYS A H    4  
ATOM   7073  H  HA   . LYS A 1 61  ? -5.222  11.985  -12.743 1.00 0.00 ? 61  LYS A HA   4  
ATOM   7074  H  HB2  . LYS A 1 61  ? -6.599  9.852   -12.952 1.00 0.00 ? 61  LYS A HB2  4  
ATOM   7075  H  HB3  . LYS A 1 61  ? -6.602  9.746   -11.191 1.00 0.00 ? 61  LYS A HB3  4  
ATOM   7076  H  HG2  . LYS A 1 61  ? -7.652  12.074  -11.154 1.00 0.00 ? 61  LYS A HG2  4  
ATOM   7077  H  HG3  . LYS A 1 61  ? -7.821  11.944  -12.906 1.00 0.00 ? 61  LYS A HG3  4  
ATOM   7078  H  HD2  . LYS A 1 61  ? -9.101  10.223  -10.748 1.00 0.00 ? 61  LYS A HD2  4  
ATOM   7079  H  HD3  . LYS A 1 61  ? -9.921  11.330  -11.836 1.00 0.00 ? 61  LYS A HD3  4  
ATOM   7080  H  HE2  . LYS A 1 61  ? -8.530  8.730   -12.650 1.00 0.00 ? 61  LYS A HE2  4  
ATOM   7081  H  HE3  . LYS A 1 61  ? -10.261 8.929   -12.402 1.00 0.00 ? 61  LYS A HE3  4  
ATOM   7082  H  HZ1  . LYS A 1 61  ? -10.301 10.516  -14.239 1.00 0.00 ? 61  LYS A HZ1  4  
ATOM   7083  H  HZ2  . LYS A 1 61  ? -8.696  10.332  -14.498 1.00 0.00 ? 61  LYS A HZ2  4  
ATOM   7084  H  HZ3  . LYS A 1 61  ? -9.712  9.084   -14.737 1.00 0.00 ? 61  LYS A HZ3  4  
ATOM   7085  N  N    . THR A 1 62  ? -4.958  13.097  -10.461 1.00 0.00 ? 62  THR A N    4  
ATOM   7086  C  CA   . THR A 1 62  ? -4.698  13.743  -9.179  1.00 0.00 ? 62  THR A CA   4  
ATOM   7087  C  C    . THR A 1 62  ? -6.011  13.756  -8.395  1.00 0.00 ? 62  THR A C    4  
ATOM   7088  O  O    . THR A 1 62  ? -7.027  14.236  -8.909  1.00 0.00 ? 62  THR A O    4  
ATOM   7089  C  CB   . THR A 1 62  ? -4.128  15.146  -9.438  1.00 0.00 ? 62  THR A CB   4  
ATOM   7090  O  OG1  . THR A 1 62  ? -3.093  15.064  -10.406 1.00 0.00 ? 62  THR A OG1  4  
ATOM   7091  C  CG2  . THR A 1 62  ? -3.532  15.744  -8.167  1.00 0.00 ? 62  THR A CG2  4  
ATOM   7092  H  H    . THR A 1 62  ? -5.164  13.697  -11.245 1.00 0.00 ? 62  THR A H    4  
ATOM   7093  H  HA   . THR A 1 62  ? -3.963  13.165  -8.621  1.00 0.00 ? 62  THR A HA   4  
ATOM   7094  H  HB   . THR A 1 62  ? -4.920  15.798  -9.808  1.00 0.00 ? 62  THR A HB   4  
ATOM   7095  H  HG1  . THR A 1 62  ? -2.936  15.953  -10.760 1.00 0.00 ? 62  THR A HG1  4  
ATOM   7096  H  HG21 . THR A 1 62  ? -3.146  16.743  -8.375  1.00 0.00 ? 62  THR A HG21 4  
ATOM   7097  H  HG22 . THR A 1 62  ? -4.307  15.821  -7.406  1.00 0.00 ? 62  THR A HG22 4  
ATOM   7098  H  HG23 . THR A 1 62  ? -2.724  15.112  -7.796  1.00 0.00 ? 62  THR A HG23 4  
ATOM   7099  N  N    . VAL A 1 63  ? -6.018  13.229  -7.168  1.00 0.00 ? 63  VAL A N    4  
ATOM   7100  C  CA   . VAL A 1 63  ? -7.248  12.993  -6.427  1.00 0.00 ? 63  VAL A CA   4  
ATOM   7101  C  C    . VAL A 1 63  ? -7.091  13.372  -4.954  1.00 0.00 ? 63  VAL A C    4  
ATOM   7102  O  O    . VAL A 1 63  ? -5.993  13.411  -4.399  1.00 0.00 ? 63  VAL A O    4  
ATOM   7103  C  CB   . VAL A 1 63  ? -7.703  11.520  -6.573  1.00 0.00 ? 63  VAL A CB   4  
ATOM   7104  C  CG1  . VAL A 1 63  ? -7.998  11.113  -8.024  1.00 0.00 ? 63  VAL A CG1  4  
ATOM   7105  C  CG2  . VAL A 1 63  ? -6.707  10.502  -5.996  1.00 0.00 ? 63  VAL A CG2  4  
ATOM   7106  H  H    . VAL A 1 63  ? -5.167  12.889  -6.737  1.00 0.00 ? 63  VAL A H    4  
ATOM   7107  H  HA   . VAL A 1 63  ? -8.033  13.619  -6.844  1.00 0.00 ? 63  VAL A HA   4  
ATOM   7108  H  HB   . VAL A 1 63  ? -8.638  11.419  -6.022  1.00 0.00 ? 63  VAL A HB   4  
ATOM   7109  H  HG11 . VAL A 1 63  ? -7.080  11.077  -8.609  1.00 0.00 ? 63  VAL A HG11 4  
ATOM   7110  H  HG12 . VAL A 1 63  ? -8.463  10.127  -8.038  1.00 0.00 ? 63  VAL A HG12 4  
ATOM   7111  H  HG13 . VAL A 1 63  ? -8.684  11.823  -8.478  1.00 0.00 ? 63  VAL A HG13 4  
ATOM   7112  H  HG21 . VAL A 1 63  ? -6.495  10.724  -4.950  1.00 0.00 ? 63  VAL A HG21 4  
ATOM   7113  H  HG22 . VAL A 1 63  ? -7.138  9.504   -6.051  1.00 0.00 ? 63  VAL A HG22 4  
ATOM   7114  H  HG23 . VAL A 1 63  ? -5.774  10.519  -6.560  1.00 0.00 ? 63  VAL A HG23 4  
ATOM   7115  N  N    . GLU A 1 64  ? -8.219  13.637  -4.313  1.00 0.00 ? 64  GLU A N    4  
ATOM   7116  C  CA   . GLU A 1 64  ? -8.334  13.795  -2.873  1.00 0.00 ? 64  GLU A CA   4  
ATOM   7117  C  C    . GLU A 1 64  ? -9.023  12.522  -2.393  1.00 0.00 ? 64  GLU A C    4  
ATOM   7118  O  O    . GLU A 1 64  ? -10.133 12.229  -2.838  1.00 0.00 ? 64  GLU A O    4  
ATOM   7119  C  CB   . GLU A 1 64  ? -9.130  15.066  -2.532  1.00 0.00 ? 64  GLU A CB   4  
ATOM   7120  C  CG   . GLU A 1 64  ? -9.216  15.273  -1.014  1.00 0.00 ? 64  GLU A CG   4  
ATOM   7121  C  CD   . GLU A 1 64  ? -9.854  16.628  -0.662  1.00 0.00 ? 64  GLU A CD   4  
ATOM   7122  O  OE1  . GLU A 1 64  ? -11.101 16.735  -0.632  1.00 0.00 ? 64  GLU A OE1  4  
ATOM   7123  O  OE2  . GLU A 1 64  ? -9.113  17.601  -0.394  1.00 0.00 ? 64  GLU A OE2  4  
ATOM   7124  H  H    . GLU A 1 64  ? -9.075  13.642  -4.862  1.00 0.00 ? 64  GLU A H    4  
ATOM   7125  H  HA   . GLU A 1 64  ? -7.346  13.869  -2.420  1.00 0.00 ? 64  GLU A HA   4  
ATOM   7126  H  HB2  . GLU A 1 64  ? -8.634  15.930  -2.976  1.00 0.00 ? 64  GLU A HB2  4  
ATOM   7127  H  HB3  . GLU A 1 64  ? -10.135 15.000  -2.952  1.00 0.00 ? 64  GLU A HB3  4  
ATOM   7128  H  HG2  . GLU A 1 64  ? -9.801  14.464  -0.569  1.00 0.00 ? 64  GLU A HG2  4  
ATOM   7129  H  HG3  . GLU A 1 64  ? -8.209  15.223  -0.592  1.00 0.00 ? 64  GLU A HG3  4  
ATOM   7130  N  N    . VAL A 1 65  ? -8.364  11.727  -1.554  1.00 0.00 ? 65  VAL A N    4  
ATOM   7131  C  CA   . VAL A 1 65  ? -8.973  10.545  -0.961  1.00 0.00 ? 65  VAL A CA   4  
ATOM   7132  C  C    . VAL A 1 65  ? -9.825  11.016  0.211   1.00 0.00 ? 65  VAL A C    4  
ATOM   7133  O  O    . VAL A 1 65  ? -9.373  11.829  1.021   1.00 0.00 ? 65  VAL A O    4  
ATOM   7134  C  CB   . VAL A 1 65  ? -7.952  9.444   -0.580  1.00 0.00 ? 65  VAL A CB   4  
ATOM   7135  C  CG1  . VAL A 1 65  ? -6.781  9.347   -1.575  1.00 0.00 ? 65  VAL A CG1  4  
ATOM   7136  C  CG2  . VAL A 1 65  ? -7.404  9.481   0.850   1.00 0.00 ? 65  VAL A CG2  4  
ATOM   7137  H  H    . VAL A 1 65  ? -7.491  12.050  -1.154  1.00 0.00 ? 65  VAL A H    4  
ATOM   7138  H  HA   . VAL A 1 65  ? -9.630  10.107  -1.707  1.00 0.00 ? 65  VAL A HA   4  
ATOM   7139  H  HB   . VAL A 1 65  ? -8.501  8.510   -0.632  1.00 0.00 ? 65  VAL A HB   4  
ATOM   7140  H  HG11 . VAL A 1 65  ? -7.155  9.329   -2.598  1.00 0.00 ? 65  VAL A HG11 4  
ATOM   7141  H  HG12 . VAL A 1 65  ? -6.109  10.198  -1.456  1.00 0.00 ? 65  VAL A HG12 4  
ATOM   7142  H  HG13 . VAL A 1 65  ? -6.219  8.430   -1.392  1.00 0.00 ? 65  VAL A HG13 4  
ATOM   7143  H  HG21 . VAL A 1 65  ? -6.767  8.614   1.009   1.00 0.00 ? 65  VAL A HG21 4  
ATOM   7144  H  HG22 . VAL A 1 65  ? -6.825  10.385  1.008   1.00 0.00 ? 65  VAL A HG22 4  
ATOM   7145  H  HG23 . VAL A 1 65  ? -8.219  9.423   1.573   1.00 0.00 ? 65  VAL A HG23 4  
ATOM   7146  N  N    . LEU A 1 66  ? -11.048 10.501  0.314   1.00 0.00 ? 66  LEU A N    4  
ATOM   7147  C  CA   . LEU A 1 66  ? -11.964 10.852  1.389   1.00 0.00 ? 66  LEU A CA   4  
ATOM   7148  C  C    . LEU A 1 66  ? -11.794 9.888   2.563   1.00 0.00 ? 66  LEU A C    4  
ATOM   7149  O  O    . LEU A 1 66  ? -12.047 10.268  3.706   1.00 0.00 ? 66  LEU A O    4  
ATOM   7150  C  CB   . LEU A 1 66  ? -13.422 10.866  0.895   1.00 0.00 ? 66  LEU A CB   4  
ATOM   7151  C  CG   . LEU A 1 66  ? -13.760 11.880  -0.223  1.00 0.00 ? 66  LEU A CG   4  
ATOM   7152  C  CD1  . LEU A 1 66  ? -13.088 13.247  -0.025  1.00 0.00 ? 66  LEU A CD1  4  
ATOM   7153  C  CD2  . LEU A 1 66  ? -13.420 11.351  -1.621  1.00 0.00 ? 66  LEU A CD2  4  
ATOM   7154  H  H    . LEU A 1 66  ? -11.385 9.858   -0.415  1.00 0.00 ? 66  LEU A H    4  
ATOM   7155  H  HA   . LEU A 1 66  ? -11.723 11.850  1.748   1.00 0.00 ? 66  LEU A HA   4  
ATOM   7156  H  HB2  . LEU A 1 66  ? -13.709 9.863   0.577   1.00 0.00 ? 66  LEU A HB2  4  
ATOM   7157  H  HB3  . LEU A 1 66  ? -14.047 11.116  1.754   1.00 0.00 ? 66  LEU A HB3  4  
ATOM   7158  H  HG   . LEU A 1 66  ? -14.839 12.032  -0.197  1.00 0.00 ? 66  LEU A HG   4  
ATOM   7159  H  HD11 . LEU A 1 66  ? -13.479 13.957  -0.753  1.00 0.00 ? 66  LEU A HD11 4  
ATOM   7160  H  HD12 . LEU A 1 66  ? -13.297 13.621  0.978   1.00 0.00 ? 66  LEU A HD12 4  
ATOM   7161  H  HD13 . LEU A 1 66  ? -12.006 13.170  -0.159  1.00 0.00 ? 66  LEU A HD13 4  
ATOM   7162  H  HD21 . LEU A 1 66  ? -13.832 10.351  -1.754  1.00 0.00 ? 66  LEU A HD21 4  
ATOM   7163  H  HD22 . LEU A 1 66  ? -13.859 12.008  -2.369  1.00 0.00 ? 66  LEU A HD22 4  
ATOM   7164  H  HD23 . LEU A 1 66  ? -12.343 11.326  -1.776  1.00 0.00 ? 66  LEU A HD23 4  
ATOM   7165  N  N    . GLY A 1 67  ? -11.338 8.662   2.298   1.00 0.00 ? 67  GLY A N    4  
ATOM   7166  C  CA   . GLY A 1 67  ? -11.082 7.646   3.291   1.00 0.00 ? 67  GLY A CA   4  
ATOM   7167  C  C    . GLY A 1 67  ? -11.080 6.284   2.626   1.00 0.00 ? 67  GLY A C    4  
ATOM   7168  O  O    . GLY A 1 67  ? -11.309 6.170   1.419   1.00 0.00 ? 67  GLY A O    4  
ATOM   7169  H  H    . GLY A 1 67  ? -11.166 8.374   1.348   1.00 0.00 ? 67  GLY A H    4  
ATOM   7170  H  HA2  . GLY A 1 67  ? -10.099 7.819   3.712   1.00 0.00 ? 67  GLY A HA2  4  
ATOM   7171  H  HA3  . GLY A 1 67  ? -11.838 7.673   4.077   1.00 0.00 ? 67  GLY A HA3  4  
ATOM   7172  N  N    . MET A 1 68  ? -10.802 5.248   3.409   1.00 0.00 ? 68  MET A N    4  
ATOM   7173  C  CA   . MET A 1 68  ? -10.982 3.877   2.947   1.00 0.00 ? 68  MET A CA   4  
ATOM   7174  C  C    . MET A 1 68  ? -12.462 3.636   2.639   1.00 0.00 ? 68  MET A C    4  
ATOM   7175  O  O    . MET A 1 68  ? -13.345 4.240   3.258   1.00 0.00 ? 68  MET A O    4  
ATOM   7176  C  CB   . MET A 1 68  ? -10.446 2.849   3.948   1.00 0.00 ? 68  MET A CB   4  
ATOM   7177  C  CG   . MET A 1 68  ? -8.923  2.924   4.093   1.00 0.00 ? 68  MET A CG   4  
ATOM   7178  S  SD   . MET A 1 68  ? -8.220  1.601   5.115   1.00 0.00 ? 68  MET A SD   4  
ATOM   7179  C  CE   . MET A 1 68  ? -8.079  0.266   3.897   1.00 0.00 ? 68  MET A CE   4  
ATOM   7180  H  H    . MET A 1 68  ? -10.641 5.423   4.388   1.00 0.00 ? 68  MET A H    4  
ATOM   7181  H  HA   . MET A 1 68  ? -10.426 3.748   2.025   1.00 0.00 ? 68  MET A HA   4  
ATOM   7182  H  HB2  . MET A 1 68  ? -10.922 2.987   4.920   1.00 0.00 ? 68  MET A HB2  4  
ATOM   7183  H  HB3  . MET A 1 68  ? -10.698 1.859   3.570   1.00 0.00 ? 68  MET A HB3  4  
ATOM   7184  H  HG2  . MET A 1 68  ? -8.463  2.880   3.105   1.00 0.00 ? 68  MET A HG2  4  
ATOM   7185  H  HG3  . MET A 1 68  ? -8.661  3.881   4.543   1.00 0.00 ? 68  MET A HG3  4  
ATOM   7186  H  HE1  . MET A 1 68  ? -9.050  0.074   3.442   1.00 0.00 ? 68  MET A HE1  4  
ATOM   7187  H  HE2  . MET A 1 68  ? -7.366  0.549   3.122   1.00 0.00 ? 68  MET A HE2  4  
ATOM   7188  H  HE3  . MET A 1 68  ? -7.728  -0.638  4.398   1.00 0.00 ? 68  MET A HE3  4  
ATOM   7189  N  N    . ALA A 1 69  ? -12.721 2.745   1.682   1.00 0.00 ? 69  ALA A N    4  
ATOM   7190  C  CA   . ALA A 1 69  ? -14.066 2.276   1.376   1.00 0.00 ? 69  ALA A CA   4  
ATOM   7191  C  C    . ALA A 1 69  ? -14.664 1.533   2.594   1.00 0.00 ? 69  ALA A C    4  
ATOM   7192  O  O    . ALA A 1 69  ? -13.922 1.181   3.520   1.00 0.00 ? 69  ALA A O    4  
ATOM   7193  C  CB   . ALA A 1 69  ? -13.999 1.389   0.125   1.00 0.00 ? 69  ALA A CB   4  
ATOM   7194  H  H    . ALA A 1 69  ? -11.941 2.257   1.256   1.00 0.00 ? 69  ALA A H    4  
ATOM   7195  H  HA   . ALA A 1 69  ? -14.683 3.146   1.153   1.00 0.00 ? 69  ALA A HA   4  
ATOM   7196  H  HB1  . ALA A 1 69  ? -15.000 1.113   -0.200  1.00 0.00 ? 69  ALA A HB1  4  
ATOM   7197  H  HB2  . ALA A 1 69  ? -13.511 1.927   -0.688  1.00 0.00 ? 69  ALA A HB2  4  
ATOM   7198  H  HB3  . ALA A 1 69  ? -13.445 0.480   0.347   1.00 0.00 ? 69  ALA A HB3  4  
ATOM   7199  N  N    . PRO A 1 70  ? -15.989 1.285   2.620   1.00 0.00 ? 70  PRO A N    4  
ATOM   7200  C  CA   . PRO A 1 70  ? -16.629 0.458   3.637   1.00 0.00 ? 70  PRO A CA   4  
ATOM   7201  C  C    . PRO A 1 70  ? -15.965 -0.913  3.792   1.00 0.00 ? 70  PRO A C    4  
ATOM   7202  O  O    . PRO A 1 70  ? -15.408 -1.464  2.837   1.00 0.00 ? 70  PRO A O    4  
ATOM   7203  C  CB   . PRO A 1 70  ? -18.089 0.311   3.197   1.00 0.00 ? 70  PRO A CB   4  
ATOM   7204  C  CG   . PRO A 1 70  ? -18.336 1.578   2.382   1.00 0.00 ? 70  PRO A CG   4  
ATOM   7205  C  CD   . PRO A 1 70  ? -16.990 1.802   1.698   1.00 0.00 ? 70  PRO A CD   4  
ATOM   7206  H  HA   . PRO A 1 70  ? -16.590 0.996   4.585   1.00 0.00 ? 70  PRO A HA   4  
ATOM   7207  H  HB2  . PRO A 1 70  ? -18.202 -0.560  2.549   1.00 0.00 ? 70  PRO A HB2  4  
ATOM   7208  H  HB3  . PRO A 1 70  ? -18.764 0.241   4.051   1.00 0.00 ? 70  PRO A HB3  4  
ATOM   7209  H  HG2  . PRO A 1 70  ? -19.142 1.447   1.660   1.00 0.00 ? 70  PRO A HG2  4  
ATOM   7210  H  HG3  . PRO A 1 70  ? -18.550 2.411   3.054   1.00 0.00 ? 70  PRO A HG3  4  
ATOM   7211  H  HD2  . PRO A 1 70  ? -16.959 1.230   0.772   1.00 0.00 ? 70  PRO A HD2  4  
ATOM   7212  H  HD3  . PRO A 1 70  ? -16.844 2.864   1.497   1.00 0.00 ? 70  PRO A HD3  4  
ATOM   7213  N  N    . ASP A 1 71  ? -16.105 -1.501  4.981   1.00 0.00 ? 71  ASP A N    4  
ATOM   7214  C  CA   . ASP A 1 71  ? -15.559 -2.817  5.310   1.00 0.00 ? 71  ASP A CA   4  
ATOM   7215  C  C    . ASP A 1 71  ? -16.075 -3.898  4.358   1.00 0.00 ? 71  ASP A C    4  
ATOM   7216  O  O    . ASP A 1 71  ? -15.315 -4.778  3.960   1.00 0.00 ? 71  ASP A O    4  
ATOM   7217  C  CB   . ASP A 1 71  ? -15.874 -3.188  6.768   1.00 0.00 ? 71  ASP A CB   4  
ATOM   7218  C  CG   . ASP A 1 71  ? -17.299 -3.732  6.977   1.00 0.00 ? 71  ASP A CG   4  
ATOM   7219  O  OD1  . ASP A 1 71  ? -18.258 -2.928  6.958   1.00 0.00 ? 71  ASP A OD1  4  
ATOM   7220  O  OD2  . ASP A 1 71  ? -17.466 -4.952  7.195   1.00 0.00 ? 71  ASP A OD2  4  
ATOM   7221  H  H    . ASP A 1 71  ? -16.589 -1.006  5.715   1.00 0.00 ? 71  ASP A H    4  
ATOM   7222  H  HA   . ASP A 1 71  ? -14.476 -2.758  5.207   1.00 0.00 ? 71  ASP A HA   4  
ATOM   7223  H  HB2  . ASP A 1 71  ? -15.162 -3.950  7.076   1.00 0.00 ? 71  ASP A HB2  4  
ATOM   7224  H  HB3  . ASP A 1 71  ? -15.714 -2.319  7.409   1.00 0.00 ? 71  ASP A HB3  4  
ATOM   7225  N  N    . ASP A 1 72  ? -17.337 -3.791  3.929   1.00 0.00 ? 72  ASP A N    4  
ATOM   7226  C  CA   . ASP A 1 72  ? -17.971 -4.738  3.013   1.00 0.00 ? 72  ASP A CA   4  
ATOM   7227  C  C    . ASP A 1 72  ? -17.291 -4.752  1.642   1.00 0.00 ? 72  ASP A C    4  
ATOM   7228  O  O    . ASP A 1 72  ? -17.278 -5.779  0.963   1.00 0.00 ? 72  ASP A O    4  
ATOM   7229  C  CB   . ASP A 1 72  ? -19.453 -4.380  2.850   1.00 0.00 ? 72  ASP A CB   4  
ATOM   7230  C  CG   . ASP A 1 72  ? -20.159 -5.332  1.869   1.00 0.00 ? 72  ASP A CG   4  
ATOM   7231  O  OD1  . ASP A 1 72  ? -20.398 -6.507  2.227   1.00 0.00 ? 72  ASP A OD1  4  
ATOM   7232  O  OD2  . ASP A 1 72  ? -20.529 -4.896  0.756   1.00 0.00 ? 72  ASP A OD2  4  
ATOM   7233  H  H    . ASP A 1 72  ? -17.904 -3.040  4.296   1.00 0.00 ? 72  ASP A H    4  
ATOM   7234  H  HA   . ASP A 1 72  ? -17.901 -5.737  3.441   1.00 0.00 ? 72  ASP A HA   4  
ATOM   7235  H  HB2  . ASP A 1 72  ? -19.943 -4.433  3.825   1.00 0.00 ? 72  ASP A HB2  4  
ATOM   7236  H  HB3  . ASP A 1 72  ? -19.534 -3.352  2.490   1.00 0.00 ? 72  ASP A HB3  4  
ATOM   7237  N  N    . GLU A 1 73  ? -16.685 -3.630  1.248   1.00 0.00 ? 73  GLU A N    4  
ATOM   7238  C  CA   . GLU A 1 73  ? -15.957 -3.503  -0.009  1.00 0.00 ? 73  GLU A CA   4  
ATOM   7239  C  C    . GLU A 1 73  ? -14.468 -3.807  0.187   1.00 0.00 ? 73  GLU A C    4  
ATOM   7240  O  O    . GLU A 1 73  ? -13.779 -4.078  -0.793  1.00 0.00 ? 73  GLU A O    4  
ATOM   7241  C  CB   . GLU A 1 73  ? -16.164 -2.100  -0.608  1.00 0.00 ? 73  GLU A CB   4  
ATOM   7242  C  CG   . GLU A 1 73  ? -17.620 -1.889  -1.052  1.00 0.00 ? 73  GLU A CG   4  
ATOM   7243  C  CD   . GLU A 1 73  ? -17.802 -0.603  -1.880  1.00 0.00 ? 73  GLU A CD   4  
ATOM   7244  O  OE1  . GLU A 1 73  ? -17.349 -0.556  -3.047  1.00 0.00 ? 73  GLU A OE1  4  
ATOM   7245  O  OE2  . GLU A 1 73  ? -18.445 0.354   -1.394  1.00 0.00 ? 73  GLU A OE2  4  
ATOM   7246  H  H    . GLU A 1 73  ? -16.632 -2.850  1.894   1.00 0.00 ? 73  GLU A H    4  
ATOM   7247  H  HA   . GLU A 1 73  ? -16.347 -4.231  -0.723  1.00 0.00 ? 73  GLU A HA   4  
ATOM   7248  H  HB2  . GLU A 1 73  ? -15.887 -1.336  0.119   1.00 0.00 ? 73  GLU A HB2  4  
ATOM   7249  H  HB3  . GLU A 1 73  ? -15.515 -1.997  -1.478  1.00 0.00 ? 73  GLU A HB3  4  
ATOM   7250  H  HG2  . GLU A 1 73  ? -17.934 -2.742  -1.658  1.00 0.00 ? 73  GLU A HG2  4  
ATOM   7251  H  HG3  . GLU A 1 73  ? -18.263 -1.853  -0.169  1.00 0.00 ? 73  GLU A HG3  4  
ATOM   7252  N  N    . CYS A 1 74  ? -13.970 -3.840  1.430   1.00 0.00 ? 74  CYS A N    4  
ATOM   7253  C  CA   . CYS A 1 74  ? -12.559 -4.064  1.737   1.00 0.00 ? 74  CYS A CA   4  
ATOM   7254  C  C    . CYS A 1 74  ? -12.323 -5.511  2.182   1.00 0.00 ? 74  CYS A C    4  
ATOM   7255  O  O    . CYS A 1 74  ? -11.322 -5.829  2.820   1.00 0.00 ? 74  CYS A O    4  
ATOM   7256  C  CB   . CYS A 1 74  ? -12.067 -3.053  2.775   1.00 0.00 ? 74  CYS A CB   4  
ATOM   7257  S  SG   . CYS A 1 74  ? -12.184 -1.380  2.085   1.00 0.00 ? 74  CYS A SG   4  
ATOM   7258  H  H    . CYS A 1 74  ? -14.611 -3.803  2.215   1.00 0.00 ? 74  CYS A H    4  
ATOM   7259  H  HA   . CYS A 1 74  ? -11.987 -3.902  0.829   1.00 0.00 ? 74  CYS A HA   4  
ATOM   7260  H  HB2  . CYS A 1 74  ? -12.659 -3.128  3.687   1.00 0.00 ? 74  CYS A HB2  4  
ATOM   7261  H  HB3  . CYS A 1 74  ? -11.024 -3.270  3.010   1.00 0.00 ? 74  CYS A HB3  4  
ATOM   7262  H  HG   . CYS A 1 74  ? -13.521 -1.294  2.204   1.00 0.00 ? 74  CYS A HG   4  
ATOM   7263  N  N    . LEU A 1 75  ? -13.277 -6.392  1.876   1.00 0.00 ? 75  LEU A N    4  
ATOM   7264  C  CA   . LEU A 1 75  ? -13.345 -7.764  2.335   1.00 0.00 ? 75  LEU A CA   4  
ATOM   7265  C  C    . LEU A 1 75  ? -12.512 -8.710  1.460   1.00 0.00 ? 75  LEU A C    4  
ATOM   7266  O  O    . LEU A 1 75  ? -12.426 -9.900  1.758   1.00 0.00 ? 75  LEU A O    4  
ATOM   7267  C  CB   . LEU A 1 75  ? -14.837 -8.138  2.324   1.00 0.00 ? 75  LEU A CB   4  
ATOM   7268  C  CG   . LEU A 1 75  ? -15.223 -9.277  3.274   1.00 0.00 ? 75  LEU A CG   4  
ATOM   7269  C  CD1  . LEU A 1 75  ? -14.954 -8.912  4.738   1.00 0.00 ? 75  LEU A CD1  4  
ATOM   7270  C  CD2  . LEU A 1 75  ? -16.714 -9.568  3.086   1.00 0.00 ? 75  LEU A CD2  4  
ATOM   7271  H  H    . LEU A 1 75  ? -14.084 -6.063  1.373   1.00 0.00 ? 75  LEU A H    4  
ATOM   7272  H  HA   . LEU A 1 75  ? -12.952 -7.796  3.349   1.00 0.00 ? 75  LEU A HA   4  
ATOM   7273  H  HB2  . LEU A 1 75  ? -15.426 -7.265  2.611   1.00 0.00 ? 75  LEU A HB2  4  
ATOM   7274  H  HB3  . LEU A 1 75  ? -15.119 -8.406  1.304   1.00 0.00 ? 75  LEU A HB3  4  
ATOM   7275  H  HG   . LEU A 1 75  ? -14.658 -10.165 3.018   1.00 0.00 ? 75  LEU A HG   4  
ATOM   7276  H  HD11 . LEU A 1 75  ? -15.365 -7.923  4.954   1.00 0.00 ? 75  LEU A HD11 4  
ATOM   7277  H  HD12 . LEU A 1 75  ? -15.411 -9.647  5.400   1.00 0.00 ? 75  LEU A HD12 4  
ATOM   7278  H  HD13 . LEU A 1 75  ? -13.882 -8.906  4.930   1.00 0.00 ? 75  LEU A HD13 4  
ATOM   7279  H  HD21 . LEU A 1 75  ? -17.019 -10.388 3.734   1.00 0.00 ? 75  LEU A HD21 4  
ATOM   7280  H  HD22 . LEU A 1 75  ? -17.299 -8.678  3.323   1.00 0.00 ? 75  LEU A HD22 4  
ATOM   7281  H  HD23 . LEU A 1 75  ? -16.904 -9.850  2.050   1.00 0.00 ? 75  LEU A HD23 4  
ATOM   7282  N  N    . LYS A 1 76  ? -11.914 -8.196  0.376   1.00 0.00 ? 76  LYS A N    4  
ATOM   7283  C  CA   . LYS A 1 76  ? -11.139 -8.978  -0.590  1.00 0.00 ? 76  LYS A CA   4  
ATOM   7284  C  C    . LYS A 1 76  ? -9.830  -8.289  -0.980  1.00 0.00 ? 76  LYS A C    4  
ATOM   7285  O  O    . LYS A 1 76  ? -8.865  -8.974  -1.316  1.00 0.00 ? 76  LYS A O    4  
ATOM   7286  C  CB   . LYS A 1 76  ? -11.979 -9.248  -1.853  1.00 0.00 ? 76  LYS A CB   4  
ATOM   7287  C  CG   . LYS A 1 76  ? -13.265 -10.041 -1.570  1.00 0.00 ? 76  LYS A CG   4  
ATOM   7288  C  CD   . LYS A 1 76  ? -14.012 -10.368 -2.869  1.00 0.00 ? 76  LYS A CD   4  
ATOM   7289  C  CE   . LYS A 1 76  ? -15.298 -11.146 -2.555  1.00 0.00 ? 76  LYS A CE   4  
ATOM   7290  N  NZ   . LYS A 1 76  ? -16.061 -11.489 -3.781  1.00 0.00 ? 76  LYS A NZ   4  
ATOM   7291  H  H    . LYS A 1 76  ? -12.055 -7.217  0.183   1.00 0.00 ? 76  LYS A H    4  
ATOM   7292  H  HA   . LYS A 1 76  ? -10.885 -9.934  -0.139  1.00 0.00 ? 76  LYS A HA   4  
ATOM   7293  H  HB2  . LYS A 1 76  ? -12.239 -8.297  -2.323  1.00 0.00 ? 76  LYS A HB2  4  
ATOM   7294  H  HB3  . LYS A 1 76  ? -11.368 -9.817  -2.556  1.00 0.00 ? 76  LYS A HB3  4  
ATOM   7295  H  HG2  . LYS A 1 76  ? -13.008 -10.970 -1.059  1.00 0.00 ? 76  LYS A HG2  4  
ATOM   7296  H  HG3  . LYS A 1 76  ? -13.920 -9.451  -0.927  1.00 0.00 ? 76  LYS A HG3  4  
ATOM   7297  H  HD2  . LYS A 1 76  ? -14.263 -9.438  -3.383  1.00 0.00 ? 76  LYS A HD2  4  
ATOM   7298  H  HD3  . LYS A 1 76  ? -13.368 -10.970 -3.513  1.00 0.00 ? 76  LYS A HD3  4  
ATOM   7299  H  HE2  . LYS A 1 76  ? -15.034 -12.062 -2.022  1.00 0.00 ? 76  LYS A HE2  4  
ATOM   7300  H  HE3  . LYS A 1 76  ? -15.924 -10.540 -1.895  1.00 0.00 ? 76  LYS A HE3  4  
ATOM   7301  H  HZ1  . LYS A 1 76  ? -15.516 -12.069 -4.401  1.00 0.00 ? 76  LYS A HZ1  4  
ATOM   7302  H  HZ2  . LYS A 1 76  ? -16.900 -11.999 -3.547  1.00 0.00 ? 76  LYS A HZ2  4  
ATOM   7303  H  HZ3  . LYS A 1 76  ? -16.340 -10.661 -4.285  1.00 0.00 ? 76  LYS A HZ3  4  
ATOM   7304  N  N    . ASP A 1 77  ? -9.787  -6.957  -0.941  1.00 0.00 ? 77  ASP A N    4  
ATOM   7305  C  CA   . ASP A 1 77  ? -8.641  -6.122  -1.312  1.00 0.00 ? 77  ASP A CA   4  
ATOM   7306  C  C    . ASP A 1 77  ? -8.881  -4.745  -0.674  1.00 0.00 ? 77  ASP A C    4  
ATOM   7307  O  O    . ASP A 1 77  ? -9.988  -4.497  -0.192  1.00 0.00 ? 77  ASP A O    4  
ATOM   7308  C  CB   . ASP A 1 77  ? -8.542  -6.036  -2.846  1.00 0.00 ? 77  ASP A CB   4  
ATOM   7309  C  CG   . ASP A 1 77  ? -7.314  -5.270  -3.367  1.00 0.00 ? 77  ASP A CG   4  
ATOM   7310  O  OD1  . ASP A 1 77  ? -6.342  -5.071  -2.607  1.00 0.00 ? 77  ASP A OD1  4  
ATOM   7311  O  OD2  . ASP A 1 77  ? -7.310  -4.914  -4.567  1.00 0.00 ? 77  ASP A OD2  4  
ATOM   7312  H  H    . ASP A 1 77  ? -10.579 -6.435  -0.592  1.00 0.00 ? 77  ASP A H    4  
ATOM   7313  H  HA   . ASP A 1 77  ? -7.722  -6.554  -0.915  1.00 0.00 ? 77  ASP A HA   4  
ATOM   7314  H  HB2  . ASP A 1 77  ? -8.500  -7.048  -3.251  1.00 0.00 ? 77  ASP A HB2  4  
ATOM   7315  H  HB3  . ASP A 1 77  ? -9.448  -5.569  -3.228  1.00 0.00 ? 77  ASP A HB3  4  
ATOM   7316  N  N    . MET A 1 78  ? -7.883  -3.865  -0.614  1.00 0.00 ? 78  MET A N    4  
ATOM   7317  C  CA   . MET A 1 78  ? -7.975  -2.584  0.087   1.00 0.00 ? 78  MET A CA   4  
ATOM   7318  C  C    . MET A 1 78  ? -8.358  -1.484  -0.905  1.00 0.00 ? 78  MET A C    4  
ATOM   7319  O  O    . MET A 1 78  ? -7.713  -1.337  -1.948  1.00 0.00 ? 78  MET A O    4  
ATOM   7320  C  CB   . MET A 1 78  ? -6.632  -2.252  0.755   1.00 0.00 ? 78  MET A CB   4  
ATOM   7321  C  CG   . MET A 1 78  ? -6.212  -3.262  1.830   1.00 0.00 ? 78  MET A CG   4  
ATOM   7322  S  SD   . MET A 1 78  ? -7.274  -3.370  3.300   1.00 0.00 ? 78  MET A SD   4  
ATOM   7323  C  CE   . MET A 1 78  ? -8.190  -4.887  2.917   1.00 0.00 ? 78  MET A CE   4  
ATOM   7324  H  H    . MET A 1 78  ? -7.025  -4.076  -1.118  1.00 0.00 ? 78  MET A H    4  
ATOM   7325  H  HA   . MET A 1 78  ? -8.740  -2.645  0.862   1.00 0.00 ? 78  MET A HA   4  
ATOM   7326  H  HB2  . MET A 1 78  ? -5.853  -2.217  -0.008  1.00 0.00 ? 78  MET A HB2  4  
ATOM   7327  H  HB3  . MET A 1 78  ? -6.698  -1.265  1.216   1.00 0.00 ? 78  MET A HB3  4  
ATOM   7328  H  HG2  . MET A 1 78  ? -6.134  -4.251  1.380   1.00 0.00 ? 78  MET A HG2  4  
ATOM   7329  H  HG3  . MET A 1 78  ? -5.212  -2.985  2.161   1.00 0.00 ? 78  MET A HG3  4  
ATOM   7330  H  HE1  . MET A 1 78  ? -8.862  -4.708  2.080   1.00 0.00 ? 78  MET A HE1  4  
ATOM   7331  H  HE2  . MET A 1 78  ? -7.495  -5.688  2.666   1.00 0.00 ? 78  MET A HE2  4  
ATOM   7332  H  HE3  . MET A 1 78  ? -8.780  -5.193  3.779   1.00 0.00 ? 78  MET A HE3  4  
ATOM   7333  N  N    . TYR A 1 79  ? -9.356  -0.666  -0.559  1.00 0.00 ? 79  TYR A N    4  
ATOM   7334  C  CA   . TYR A 1 79  ? -9.906  0.360   -1.443  1.00 0.00 ? 79  TYR A CA   4  
ATOM   7335  C  C    . TYR A 1 79  ? -10.120 1.667   -0.686  1.00 0.00 ? 79  TYR A C    4  
ATOM   7336  O  O    . TYR A 1 79  ? -10.255 1.678   0.539   1.00 0.00 ? 79  TYR A O    4  
ATOM   7337  C  CB   . TYR A 1 79  ? -11.241 -0.103  -2.044  1.00 0.00 ? 79  TYR A CB   4  
ATOM   7338  C  CG   . TYR A 1 79  ? -11.196 -1.350  -2.905  1.00 0.00 ? 79  TYR A CG   4  
ATOM   7339  C  CD1  . TYR A 1 79  ? -10.986 -1.259  -4.295  1.00 0.00 ? 79  TYR A CD1  4  
ATOM   7340  C  CD2  . TYR A 1 79  ? -11.439 -2.603  -2.318  1.00 0.00 ? 79  TYR A CD2  4  
ATOM   7341  C  CE1  . TYR A 1 79  ? -11.026 -2.419  -5.093  1.00 0.00 ? 79  TYR A CE1  4  
ATOM   7342  C  CE2  . TYR A 1 79  ? -11.483 -3.763  -3.106  1.00 0.00 ? 79  TYR A CE2  4  
ATOM   7343  C  CZ   . TYR A 1 79  ? -11.275 -3.679  -4.501  1.00 0.00 ? 79  TYR A CZ   4  
ATOM   7344  O  OH   . TYR A 1 79  ? -11.324 -4.800  -5.276  1.00 0.00 ? 79  TYR A OH   4  
ATOM   7345  H  H    . TYR A 1 79  ? -9.805  -0.778  0.340   1.00 0.00 ? 79  TYR A H    4  
ATOM   7346  H  HA   . TYR A 1 79  ? -9.206  0.560   -2.251  1.00 0.00 ? 79  TYR A HA   4  
ATOM   7347  H  HB2  . TYR A 1 79  ? -11.945 -0.276  -1.231  1.00 0.00 ? 79  TYR A HB2  4  
ATOM   7348  H  HB3  . TYR A 1 79  ? -11.649 0.707   -2.647  1.00 0.00 ? 79  TYR A HB3  4  
ATOM   7349  H  HD1  . TYR A 1 79  ? -10.809 -0.296  -4.755  1.00 0.00 ? 79  TYR A HD1  4  
ATOM   7350  H  HD2  . TYR A 1 79  ? -11.611 -2.679  -1.254  1.00 0.00 ? 79  TYR A HD2  4  
ATOM   7351  H  HE1  . TYR A 1 79  ? -10.874 -2.343  -6.161  1.00 0.00 ? 79  TYR A HE1  4  
ATOM   7352  H  HE2  . TYR A 1 79  ? -11.689 -4.712  -2.631  1.00 0.00 ? 79  TYR A HE2  4  
ATOM   7353  H  HH   . TYR A 1 79  ? -11.496 -5.611  -4.769  1.00 0.00 ? 79  TYR A HH   4  
ATOM   7354  N  N    . VAL A 1 80  ? -10.187 2.764   -1.436  1.00 0.00 ? 80  VAL A N    4  
ATOM   7355  C  CA   . VAL A 1 80  ? -10.319 4.122   -0.935  1.00 0.00 ? 80  VAL A CA   4  
ATOM   7356  C  C    . VAL A 1 80  ? -11.282 4.867   -1.853  1.00 0.00 ? 80  VAL A C    4  
ATOM   7357  O  O    . VAL A 1 80  ? -11.270 4.669   -3.067  1.00 0.00 ? 80  VAL A O    4  
ATOM   7358  C  CB   . VAL A 1 80  ? -8.940  4.819   -0.848  1.00 0.00 ? 80  VAL A CB   4  
ATOM   7359  C  CG1  . VAL A 1 80  ? -8.154  4.394   0.400   1.00 0.00 ? 80  VAL A CG1  4  
ATOM   7360  C  CG2  . VAL A 1 80  ? -8.047  4.573   -2.075  1.00 0.00 ? 80  VAL A CG2  4  
ATOM   7361  H  H    . VAL A 1 80  ? -10.111 2.664   -2.445  1.00 0.00 ? 80  VAL A H    4  
ATOM   7362  H  HA   . VAL A 1 80  ? -10.767 4.098   0.053   1.00 0.00 ? 80  VAL A HA   4  
ATOM   7363  H  HB   . VAL A 1 80  ? -9.114  5.891   -0.765  1.00 0.00 ? 80  VAL A HB   4  
ATOM   7364  H  HG11 . VAL A 1 80  ? -8.687  4.725   1.288   1.00 0.00 ? 80  VAL A HG11 4  
ATOM   7365  H  HG12 . VAL A 1 80  ? -8.020  3.312   0.427   1.00 0.00 ? 80  VAL A HG12 4  
ATOM   7366  H  HG13 . VAL A 1 80  ? -7.176  4.877   0.404   1.00 0.00 ? 80  VAL A HG13 4  
ATOM   7367  H  HG21 . VAL A 1 80  ? -8.579  4.872   -2.976  1.00 0.00 ? 80  VAL A HG21 4  
ATOM   7368  H  HG22 . VAL A 1 80  ? -7.140  5.171   -1.991  1.00 0.00 ? 80  VAL A HG22 4  
ATOM   7369  H  HG23 . VAL A 1 80  ? -7.772  3.519   -2.153  1.00 0.00 ? 80  VAL A HG23 4  
ATOM   7370  N  N    . GLU A 1 81  ? -12.133 5.703   -1.270  1.00 0.00 ? 81  GLU A N    4  
ATOM   7371  C  CA   . GLU A 1 81  ? -13.004 6.607   -2.007  1.00 0.00 ? 81  GLU A CA   4  
ATOM   7372  C  C    . GLU A 1 81  ? -12.170 7.838   -2.347  1.00 0.00 ? 81  GLU A C    4  
ATOM   7373  O  O    . GLU A 1 81  ? -11.450 8.345   -1.481  1.00 0.00 ? 81  GLU A O    4  
ATOM   7374  C  CB   . GLU A 1 81  ? -14.218 6.997   -1.153  1.00 0.00 ? 81  GLU A CB   4  
ATOM   7375  C  CG   . GLU A 1 81  ? -15.144 5.801   -0.892  1.00 0.00 ? 81  GLU A CG   4  
ATOM   7376  C  CD   . GLU A 1 81  ? -16.410 6.227   -0.128  1.00 0.00 ? 81  GLU A CD   4  
ATOM   7377  O  OE1  . GLU A 1 81  ? -16.394 6.255   1.123   1.00 0.00 ? 81  GLU A OE1  4  
ATOM   7378  O  OE2  . GLU A 1 81  ? -17.443 6.523   -0.772  1.00 0.00 ? 81  GLU A OE2  4  
ATOM   7379  H  H    . GLU A 1 81  ? -12.003 5.897   -0.283  1.00 0.00 ? 81  GLU A H    4  
ATOM   7380  H  HA   . GLU A 1 81  ? -13.347 6.124   -2.922  1.00 0.00 ? 81  GLU A HA   4  
ATOM   7381  H  HB2  . GLU A 1 81  ? -13.880 7.411   -0.201  1.00 0.00 ? 81  GLU A HB2  4  
ATOM   7382  H  HB3  . GLU A 1 81  ? -14.782 7.766   -1.683  1.00 0.00 ? 81  GLU A HB3  4  
ATOM   7383  H  HG2  . GLU A 1 81  ? -15.424 5.353   -1.848  1.00 0.00 ? 81  GLU A HG2  4  
ATOM   7384  H  HG3  . GLU A 1 81  ? -14.606 5.044   -0.315  1.00 0.00 ? 81  GLU A HG3  4  
ATOM   7385  N  N    . VAL A 1 82  ? -12.254 8.326   -3.584  1.00 0.00 ? 82  VAL A N    4  
ATOM   7386  C  CA   . VAL A 1 82  ? -11.401 9.406   -4.074  1.00 0.00 ? 82  VAL A CA   4  
ATOM   7387  C  C    . VAL A 1 82  ? -12.221 10.361  -4.944  1.00 0.00 ? 82  VAL A C    4  
ATOM   7388  O  O    . VAL A 1 82  ? -13.144 9.924   -5.624  1.00 0.00 ? 82  VAL A O    4  
ATOM   7389  C  CB   . VAL A 1 82  ? -10.165 8.832   -4.812  1.00 0.00 ? 82  VAL A CB   4  
ATOM   7390  C  CG1  . VAL A 1 82  ? -9.384  7.808   -3.972  1.00 0.00 ? 82  VAL A CG1  4  
ATOM   7391  C  CG2  . VAL A 1 82  ? -10.484 8.171   -6.162  1.00 0.00 ? 82  VAL A CG2  4  
ATOM   7392  H  H    . VAL A 1 82  ? -12.904 7.907   -4.244  1.00 0.00 ? 82  VAL A H    4  
ATOM   7393  H  HA   . VAL A 1 82  ? -11.045 9.976   -3.222  1.00 0.00 ? 82  VAL A HA   4  
ATOM   7394  H  HB   . VAL A 1 82  ? -9.493  9.665   -5.000  1.00 0.00 ? 82  VAL A HB   4  
ATOM   7395  H  HG11 . VAL A 1 82  ? -9.944  6.877   -3.886  1.00 0.00 ? 82  VAL A HG11 4  
ATOM   7396  H  HG12 . VAL A 1 82  ? -8.426  7.596   -4.445  1.00 0.00 ? 82  VAL A HG12 4  
ATOM   7397  H  HG13 . VAL A 1 82  ? -9.201  8.203   -2.976  1.00 0.00 ? 82  VAL A HG13 4  
ATOM   7398  H  HG21 . VAL A 1 82  ? -11.188 7.350   -6.028  1.00 0.00 ? 82  VAL A HG21 4  
ATOM   7399  H  HG22 . VAL A 1 82  ? -10.908 8.905   -6.847  1.00 0.00 ? 82  VAL A HG22 4  
ATOM   7400  H  HG23 . VAL A 1 82  ? -9.568  7.785   -6.612  1.00 0.00 ? 82  VAL A HG23 4  
ATOM   7401  N  N    . ALA A 1 83  ? -11.884 11.649  -4.961  1.00 0.00 ? 83  ALA A N    4  
ATOM   7402  C  CA   . ALA A 1 83  ? -12.539 12.668  -5.772  1.00 0.00 ? 83  ALA A CA   4  
ATOM   7403  C  C    . ALA A 1 83  ? -11.480 13.311  -6.656  1.00 0.00 ? 83  ALA A C    4  
ATOM   7404  O  O    . ALA A 1 83  ? -10.370 13.582  -6.199  1.00 0.00 ? 83  ALA A O    4  
ATOM   7405  C  CB   . ALA A 1 83  ? -13.208 13.710  -4.871  1.00 0.00 ? 83  ALA A CB   4  
ATOM   7406  H  H    . ALA A 1 83  ? -11.110 11.962  -4.382  1.00 0.00 ? 83  ALA A H    4  
ATOM   7407  H  HA   . ALA A 1 83  ? -13.304 12.213  -6.403  1.00 0.00 ? 83  ALA A HA   4  
ATOM   7408  H  HB1  . ALA A 1 83  ? -13.634 14.502  -5.488  1.00 0.00 ? 83  ALA A HB1  4  
ATOM   7409  H  HB2  . ALA A 1 83  ? -14.009 13.245  -4.300  1.00 0.00 ? 83  ALA A HB2  4  
ATOM   7410  H  HB3  . ALA A 1 83  ? -12.475 14.144  -4.190  1.00 0.00 ? 83  ALA A HB3  4  
ATOM   7411  N  N    . ASP A 1 84  ? -11.809 13.527  -7.927  1.00 0.00 ? 84  ASP A N    4  
ATOM   7412  C  CA   . ASP A 1 84  ? -10.871 14.055  -8.911  1.00 0.00 ? 84  ASP A CA   4  
ATOM   7413  C  C    . ASP A 1 84  ? -10.618 15.539  -8.670  1.00 0.00 ? 84  ASP A C    4  
ATOM   7414  O  O    . ASP A 1 84  ? -11.547 16.341  -8.758  1.00 0.00 ? 84  ASP A O    4  
ATOM   7415  C  CB   . ASP A 1 84  ? -11.428 13.847  -10.325 1.00 0.00 ? 84  ASP A CB   4  
ATOM   7416  C  CG   . ASP A 1 84  ? -10.612 14.636  -11.349 1.00 0.00 ? 84  ASP A CG   4  
ATOM   7417  O  OD1  . ASP A 1 84  ? -9.387  14.413  -11.438 1.00 0.00 ? 84  ASP A OD1  4  
ATOM   7418  O  OD2  . ASP A 1 84  ? -11.205 15.501  -12.028 1.00 0.00 ? 84  ASP A OD2  4  
ATOM   7419  H  H    . ASP A 1 84  ? -12.758 13.351  -8.224  1.00 0.00 ? 84  ASP A H    4  
ATOM   7420  H  HA   . ASP A 1 84  ? -9.921  13.528  -8.813  1.00 0.00 ? 84  ASP A HA   4  
ATOM   7421  H  HB2  . ASP A 1 84  ? -11.411 12.787  -10.574 1.00 0.00 ? 84  ASP A HB2  4  
ATOM   7422  H  HB3  . ASP A 1 84  ? -12.463 14.195  -10.364 1.00 0.00 ? 84  ASP A HB3  4  
ATOM   7423  N  N    . ILE A 1 85  ? -9.366  15.910  -8.398  1.00 0.00 ? 85  ILE A N    4  
ATOM   7424  C  CA   . ILE A 1 85  ? -8.947  17.306  -8.285  1.00 0.00 ? 85  ILE A CA   4  
ATOM   7425  C  C    . ILE A 1 85  ? -8.654  17.856  -9.695  1.00 0.00 ? 85  ILE A C    4  
ATOM   7426  O  O    . ILE A 1 85  ? -8.761  19.062  -9.920  1.00 0.00 ? 85  ILE A O    4  
ATOM   7427  C  CB   . ILE A 1 85  ? -7.708  17.425  -7.357  1.00 0.00 ? 85  ILE A CB   4  
ATOM   7428  C  CG1  . ILE A 1 85  ? -7.910  16.742  -5.982  1.00 0.00 ? 85  ILE A CG1  4  
ATOM   7429  C  CG2  . ILE A 1 85  ? -7.335  18.897  -7.096  1.00 0.00 ? 85  ILE A CG2  4  
ATOM   7430  C  CD1  . ILE A 1 85  ? -6.624  16.672  -5.144  1.00 0.00 ? 85  ILE A CD1  4  
ATOM   7431  H  H    . ILE A 1 85  ? -8.635  15.205  -8.400  1.00 0.00 ? 85  ILE A H    4  
ATOM   7432  H  HA   . ILE A 1 85  ? -9.756  17.883  -7.842  1.00 0.00 ? 85  ILE A HA   4  
ATOM   7433  H  HB   . ILE A 1 85  ? -6.874  16.942  -7.864  1.00 0.00 ? 85  ILE A HB   4  
ATOM   7434  H  HG12 . ILE A 1 85  ? -8.679  17.270  -5.417  1.00 0.00 ? 85  ILE A HG12 4  
ATOM   7435  H  HG13 . ILE A 1 85  ? -8.256  15.723  -6.129  1.00 0.00 ? 85  ILE A HG13 4  
ATOM   7436  H  HG21 . ILE A 1 85  ? -6.403  18.963  -6.540  1.00 0.00 ? 85  ILE A HG21 4  
ATOM   7437  H  HG22 . ILE A 1 85  ? -7.180  19.434  -8.028  1.00 0.00 ? 85  ILE A HG22 4  
ATOM   7438  H  HG23 . ILE A 1 85  ? -8.129  19.379  -6.523  1.00 0.00 ? 85  ILE A HG23 4  
ATOM   7439  H  HD11 . ILE A 1 85  ? -5.832  16.202  -5.725  1.00 0.00 ? 85  ILE A HD11 4  
ATOM   7440  H  HD12 . ILE A 1 85  ? -6.309  17.662  -4.820  1.00 0.00 ? 85  ILE A HD12 4  
ATOM   7441  H  HD13 . ILE A 1 85  ? -6.797  16.080  -4.250  1.00 0.00 ? 85  ILE A HD13 4  
ATOM   7442  N  N    . GLY A 1 86  ? -8.287  16.989  -10.648 1.00 0.00 ? 86  GLY A N    4  
ATOM   7443  C  CA   . GLY A 1 86  ? -7.777  17.372  -11.957 1.00 0.00 ? 86  GLY A CA   4  
ATOM   7444  C  C    . GLY A 1 86  ? -8.758  18.210  -12.777 1.00 0.00 ? 86  GLY A C    4  
ATOM   7445  O  O    . GLY A 1 86  ? -8.317  19.090  -13.521 1.00 0.00 ? 86  GLY A O    4  
ATOM   7446  H  H    . GLY A 1 86  ? -8.344  15.991  -10.464 1.00 0.00 ? 86  GLY A H    4  
ATOM   7447  H  HA2  . GLY A 1 86  ? -6.851  17.932  -11.823 1.00 0.00 ? 86  GLY A HA2  4  
ATOM   7448  H  HA3  . GLY A 1 86  ? -7.554  16.462  -12.514 1.00 0.00 ? 86  GLY A HA3  4  
ATOM   7449  N  N    . GLY A 1 87  ? -10.067 17.978  -12.637 1.00 0.00 ? 87  GLY A N    4  
ATOM   7450  C  CA   . GLY A 1 87  ? -11.079 18.630  -13.452 1.00 0.00 ? 87  GLY A CA   4  
ATOM   7451  C  C    . GLY A 1 87  ? -12.429 18.784  -12.762 1.00 0.00 ? 87  GLY A C    4  
ATOM   7452  O  O    . GLY A 1 87  ? -12.976 19.890  -12.750 1.00 0.00 ? 87  GLY A O    4  
ATOM   7453  H  H    . GLY A 1 87  ? -10.365 17.175  -12.087 1.00 0.00 ? 87  GLY A H    4  
ATOM   7454  H  HA2  . GLY A 1 87  ? -10.732 19.610  -13.778 1.00 0.00 ? 87  GLY A HA2  4  
ATOM   7455  H  HA3  . GLY A 1 87  ? -11.236 17.998  -14.327 1.00 0.00 ? 87  GLY A HA3  4  
ATOM   7456  N  N    . LYS A 1 88  ? -12.981 17.706  -12.196 1.00 0.00 ? 88  LYS A N    4  
ATOM   7457  C  CA   . LYS A 1 88  ? -14.364 17.721  -11.718 1.00 0.00 ? 88  LYS A CA   4  
ATOM   7458  C  C    . LYS A 1 88  ? -14.494 18.469  -10.397 1.00 0.00 ? 88  LYS A C    4  
ATOM   7459  O  O    . LYS A 1 88  ? -15.289 19.404  -10.314 1.00 0.00 ? 88  LYS A O    4  
ATOM   7460  C  CB   . LYS A 1 88  ? -14.924 16.293  -11.615 1.00 0.00 ? 88  LYS A CB   4  
ATOM   7461  C  CG   . LYS A 1 88  ? -14.997 15.629  -13.000 1.00 0.00 ? 88  LYS A CG   4  
ATOM   7462  C  CD   . LYS A 1 88  ? -15.744 14.291  -12.942 1.00 0.00 ? 88  LYS A CD   4  
ATOM   7463  C  CE   . LYS A 1 88  ? -15.874 13.649  -14.331 1.00 0.00 ? 88  LYS A CE   4  
ATOM   7464  N  NZ   . LYS A 1 88  ? -14.588 13.106  -14.834 1.00 0.00 ? 88  LYS A NZ   4  
ATOM   7465  H  H    . LYS A 1 88  ? -12.460 16.829  -12.182 1.00 0.00 ? 88  LYS A H    4  
ATOM   7466  H  HA   . LYS A 1 88  ? -14.969 18.261  -12.450 1.00 0.00 ? 88  LYS A HA   4  
ATOM   7467  H  HB2  . LYS A 1 88  ? -14.304 15.693  -10.948 1.00 0.00 ? 88  LYS A HB2  4  
ATOM   7468  H  HB3  . LYS A 1 88  ? -15.931 16.348  -11.197 1.00 0.00 ? 88  LYS A HB3  4  
ATOM   7469  H  HG2  . LYS A 1 88  ? -15.524 16.294  -13.687 1.00 0.00 ? 88  LYS A HG2  4  
ATOM   7470  H  HG3  . LYS A 1 88  ? -13.987 15.465  -13.375 1.00 0.00 ? 88  LYS A HG3  4  
ATOM   7471  H  HD2  . LYS A 1 88  ? -15.231 13.610  -12.261 1.00 0.00 ? 88  LYS A HD2  4  
ATOM   7472  H  HD3  . LYS A 1 88  ? -16.749 14.473  -12.559 1.00 0.00 ? 88  LYS A HD3  4  
ATOM   7473  H  HE2  . LYS A 1 88  ? -16.598 12.834  -14.263 1.00 0.00 ? 88  LYS A HE2  4  
ATOM   7474  H  HE3  . LYS A 1 88  ? -16.267 14.390  -15.030 1.00 0.00 ? 88  LYS A HE3  4  
ATOM   7475  H  HZ1  . LYS A 1 88  ? -14.255 12.373  -14.218 1.00 0.00 ? 88  LYS A HZ1  4  
ATOM   7476  H  HZ2  . LYS A 1 88  ? -14.711 12.702  -15.752 1.00 0.00 ? 88  LYS A HZ2  4  
ATOM   7477  H  HZ3  . LYS A 1 88  ? -13.882 13.824  -14.907 1.00 0.00 ? 88  LYS A HZ3  4  
ATOM   7478  N  N    . ASP A 1 89  ? -13.730 18.059  -9.379  1.00 0.00 ? 89  ASP A N    4  
ATOM   7479  C  CA   . ASP A 1 89  ? -13.835 18.511  -7.983  1.00 0.00 ? 89  ASP A CA   4  
ATOM   7480  C  C    . ASP A 1 89  ? -15.281 18.476  -7.444  1.00 0.00 ? 89  ASP A C    4  
ATOM   7481  O  O    . ASP A 1 89  ? -15.653 19.233  -6.546  1.00 0.00 ? 89  ASP A O    4  
ATOM   7482  C  CB   . ASP A 1 89  ? -13.152 19.878  -7.834  1.00 0.00 ? 89  ASP A CB   4  
ATOM   7483  C  CG   . ASP A 1 89  ? -12.996 20.318  -6.366  1.00 0.00 ? 89  ASP A CG   4  
ATOM   7484  O  OD1  . ASP A 1 89  ? -12.509 19.523  -5.531  1.00 0.00 ? 89  ASP A OD1  4  
ATOM   7485  O  OD2  . ASP A 1 89  ? -13.298 21.493  -6.050  1.00 0.00 ? 89  ASP A OD2  4  
ATOM   7486  H  H    . ASP A 1 89  ? -13.046 17.326  -9.544  1.00 0.00 ? 89  ASP A H    4  
ATOM   7487  H  HA   . ASP A 1 89  ? -13.263 17.801  -7.386  1.00 0.00 ? 89  ASP A HA   4  
ATOM   7488  H  HB2  . ASP A 1 89  ? -12.161 19.824  -8.290  1.00 0.00 ? 89  ASP A HB2  4  
ATOM   7489  H  HB3  . ASP A 1 89  ? -13.737 20.615  -8.384  1.00 0.00 ? 89  ASP A HB3  4  
ATOM   7490  N  N    . ASP A 1 90  ? -16.121 17.608  -8.019  1.00 0.00 ? 90  ASP A N    4  
ATOM   7491  C  CA   . ASP A 1 90  ? -17.573 17.574  -7.795  1.00 0.00 ? 90  ASP A CA   4  
ATOM   7492  C  C    . ASP A 1 90  ? -18.159 16.168  -8.028  1.00 0.00 ? 90  ASP A C    4  
ATOM   7493  O  O    . ASP A 1 90  ? -19.375 15.995  -8.117  1.00 0.00 ? 90  ASP A O    4  
ATOM   7494  C  CB   . ASP A 1 90  ? -18.240 18.608  -8.721  1.00 0.00 ? 90  ASP A CB   4  
ATOM   7495  C  CG   . ASP A 1 90  ? -19.735 18.819  -8.419  1.00 0.00 ? 90  ASP A CG   4  
ATOM   7496  O  OD1  . ASP A 1 90  ? -20.094 19.106  -7.254  1.00 0.00 ? 90  ASP A OD1  4  
ATOM   7497  O  OD2  . ASP A 1 90  ? -20.560 18.773  -9.361  1.00 0.00 ? 90  ASP A OD2  4  
ATOM   7498  H  H    . ASP A 1 90  ? -15.755 17.040  -8.766  1.00 0.00 ? 90  ASP A H    4  
ATOM   7499  H  HA   . ASP A 1 90  ? -17.773 17.853  -6.760  1.00 0.00 ? 90  ASP A HA   4  
ATOM   7500  H  HB2  . ASP A 1 90  ? -17.733 19.568  -8.607  1.00 0.00 ? 90  ASP A HB2  4  
ATOM   7501  H  HB3  . ASP A 1 90  ? -18.109 18.286  -9.757  1.00 0.00 ? 90  ASP A HB3  4  
ATOM   7502  N  N    . ASP A 1 91  ? -17.306 15.144  -8.139  1.00 0.00 ? 91  ASP A N    4  
ATOM   7503  C  CA   . ASP A 1 91  ? -17.708 13.749  -8.334  1.00 0.00 ? 91  ASP A CA   4  
ATOM   7504  C  C    . ASP A 1 91  ? -16.699 12.843  -7.628  1.00 0.00 ? 91  ASP A C    4  
ATOM   7505  O  O    . ASP A 1 91  ? -15.574 13.274  -7.354  1.00 0.00 ? 91  ASP A O    4  
ATOM   7506  C  CB   . ASP A 1 91  ? -17.792 13.416  -9.831  1.00 0.00 ? 91  ASP A CB   4  
ATOM   7507  C  CG   . ASP A 1 91  ? -18.373 12.015  -10.100 1.00 0.00 ? 91  ASP A CG   4  
ATOM   7508  O  OD1  . ASP A 1 91  ? -19.210 11.531  -9.305  1.00 0.00 ? 91  ASP A OD1  4  
ATOM   7509  O  OD2  . ASP A 1 91  ? -18.021 11.409  -11.136 1.00 0.00 ? 91  ASP A OD2  4  
ATOM   7510  H  H    . ASP A 1 91  ? -16.324 15.290  -7.945  1.00 0.00 ? 91  ASP A H    4  
ATOM   7511  H  HA   . ASP A 1 91  ? -18.690 13.592  -7.885  1.00 0.00 ? 91  ASP A HA   4  
ATOM   7512  H  HB2  . ASP A 1 91  ? -18.427 14.155  -10.325 1.00 0.00 ? 91  ASP A HB2  4  
ATOM   7513  H  HB3  . ASP A 1 91  ? -16.790 13.490  -10.259 1.00 0.00 ? 91  ASP A HB3  4  
ATOM   7514  N  N    . VAL A 1 92  ? -17.089 11.603  -7.326  1.00 0.00 ? 92  VAL A N    4  
ATOM   7515  C  CA   . VAL A 1 92  ? -16.338 10.691  -6.471  1.00 0.00 ? 92  VAL A CA   4  
ATOM   7516  C  C    . VAL A 1 92  ? -16.298 9.309   -7.142  1.00 0.00 ? 92  VAL A C    4  
ATOM   7517  O  O    . VAL A 1 92  ? -17.212 8.918   -7.874  1.00 0.00 ? 92  VAL A O    4  
ATOM   7518  C  CB   . VAL A 1 92  ? -16.964 10.652  -5.052  1.00 0.00 ? 92  VAL A CB   4  
ATOM   7519  C  CG1  . VAL A 1 92  ? -16.063 9.945   -4.026  1.00 0.00 ? 92  VAL A CG1  4  
ATOM   7520  C  CG2  . VAL A 1 92  ? -17.275 12.052  -4.486  1.00 0.00 ? 92  VAL A CG2  4  
ATOM   7521  H  H    . VAL A 1 92  ? -17.973 11.259  -7.680  1.00 0.00 ? 92  VAL A H    4  
ATOM   7522  H  HA   . VAL A 1 92  ? -15.320 11.059  -6.373  1.00 0.00 ? 92  VAL A HA   4  
ATOM   7523  H  HB   . VAL A 1 92  ? -17.898 10.100  -5.112  1.00 0.00 ? 92  VAL A HB   4  
ATOM   7524  H  HG11 . VAL A 1 92  ? -16.539 9.947   -3.045  1.00 0.00 ? 92  VAL A HG11 4  
ATOM   7525  H  HG12 . VAL A 1 92  ? -15.899 8.907   -4.310  1.00 0.00 ? 92  VAL A HG12 4  
ATOM   7526  H  HG13 . VAL A 1 92  ? -15.104 10.458  -3.955  1.00 0.00 ? 92  VAL A HG13 4  
ATOM   7527  H  HG21 . VAL A 1 92  ? -16.378 12.671  -4.500  1.00 0.00 ? 92  VAL A HG21 4  
ATOM   7528  H  HG22 . VAL A 1 92  ? -18.056 12.535  -5.073  1.00 0.00 ? 92  VAL A HG22 4  
ATOM   7529  H  HG23 . VAL A 1 92  ? -17.638 11.971  -3.461  1.00 0.00 ? 92  VAL A HG23 4  
ATOM   7530  N  N    . TYR A 1 93  ? -15.221 8.584   -6.863  1.00 0.00 ? 93  TYR A N    4  
ATOM   7531  C  CA   . TYR A 1 93  ? -14.842 7.297   -7.418  1.00 0.00 ? 93  TYR A CA   4  
ATOM   7532  C  C    . TYR A 1 93  ? -14.315 6.415   -6.278  1.00 0.00 ? 93  TYR A C    4  
ATOM   7533  O  O    . TYR A 1 93  ? -14.198 6.857   -5.132  1.00 0.00 ? 93  TYR A O    4  
ATOM   7534  C  CB   . TYR A 1 93  ? -13.729 7.509   -8.464  1.00 0.00 ? 93  TYR A CB   4  
ATOM   7535  C  CG   . TYR A 1 93  ? -14.072 8.400   -9.644  1.00 0.00 ? 93  TYR A CG   4  
ATOM   7536  C  CD1  . TYR A 1 93  ? -14.709 7.847   -10.771 1.00 0.00 ? 93  TYR A CD1  4  
ATOM   7537  C  CD2  . TYR A 1 93  ? -13.699 9.759   -9.644  1.00 0.00 ? 93  TYR A CD2  4  
ATOM   7538  C  CE1  . TYR A 1 93  ? -14.958 8.642   -11.903 1.00 0.00 ? 93  TYR A CE1  4  
ATOM   7539  C  CE2  . TYR A 1 93  ? -13.947 10.561  -10.773 1.00 0.00 ? 93  TYR A CE2  4  
ATOM   7540  C  CZ   . TYR A 1 93  ? -14.570 10.001  -11.913 1.00 0.00 ? 93  TYR A CZ   4  
ATOM   7541  O  OH   . TYR A 1 93  ? -14.770 10.764  -13.025 1.00 0.00 ? 93  TYR A OH   4  
ATOM   7542  H  H    . TYR A 1 93  ? -14.541 9.011   -6.255  1.00 0.00 ? 93  TYR A H    4  
ATOM   7543  H  HA   . TYR A 1 93  ? -15.701 6.816   -7.887  1.00 0.00 ? 93  TYR A HA   4  
ATOM   7544  H  HB2  . TYR A 1 93  ? -12.855 7.924   -7.960  1.00 0.00 ? 93  TYR A HB2  4  
ATOM   7545  H  HB3  . TYR A 1 93  ? -13.429 6.539   -8.861  1.00 0.00 ? 93  TYR A HB3  4  
ATOM   7546  H  HD1  . TYR A 1 93  ? -14.993 6.803   -10.779 1.00 0.00 ? 93  TYR A HD1  4  
ATOM   7547  H  HD2  . TYR A 1 93  ? -13.207 10.187  -8.780  1.00 0.00 ? 93  TYR A HD2  4  
ATOM   7548  H  HE1  . TYR A 1 93  ? -15.436 8.201   -12.768 1.00 0.00 ? 93  TYR A HE1  4  
ATOM   7549  H  HE2  . TYR A 1 93  ? -13.651 11.600  -10.774 1.00 0.00 ? 93  TYR A HE2  4  
ATOM   7550  H  HH   . TYR A 1 93  ? -15.218 10.270  -13.731 1.00 0.00 ? 93  TYR A HH   4  
ATOM   7551  N  N    . THR A 1 94  ? -13.923 5.190   -6.617  1.00 0.00 ? 94  THR A N    4  
ATOM   7552  C  CA   . THR A 1 94  ? -13.206 4.289   -5.725  1.00 0.00 ? 94  THR A CA   4  
ATOM   7553  C  C    . THR A 1 94  ? -11.949 3.827   -6.464  1.00 0.00 ? 94  THR A C    4  
ATOM   7554  O  O    . THR A 1 94  ? -12.002 3.514   -7.656  1.00 0.00 ? 94  THR A O    4  
ATOM   7555  C  CB   . THR A 1 94  ? -14.116 3.123   -5.289  1.00 0.00 ? 94  THR A CB   4  
ATOM   7556  O  OG1  . THR A 1 94  ? -15.402 3.588   -4.914  1.00 0.00 ? 94  THR A OG1  4  
ATOM   7557  C  CG2  . THR A 1 94  ? -13.535 2.360   -4.094  1.00 0.00 ? 94  THR A CG2  4  
ATOM   7558  H  H    . THR A 1 94  ? -14.004 4.927   -7.595  1.00 0.00 ? 94  THR A H    4  
ATOM   7559  H  HA   . THR A 1 94  ? -12.899 4.830   -4.831  1.00 0.00 ? 94  THR A HA   4  
ATOM   7560  H  HB   . THR A 1 94  ? -14.227 2.428   -6.122  1.00 0.00 ? 94  THR A HB   4  
ATOM   7561  H  HG1  . THR A 1 94  ? -15.813 3.978   -5.701  1.00 0.00 ? 94  THR A HG1  4  
ATOM   7562  H  HG21 . THR A 1 94  ? -14.193 1.533   -3.828  1.00 0.00 ? 94  THR A HG21 4  
ATOM   7563  H  HG22 . THR A 1 94  ? -12.559 1.955   -4.360  1.00 0.00 ? 94  THR A HG22 4  
ATOM   7564  H  HG23 . THR A 1 94  ? -13.428 3.025   -3.236  1.00 0.00 ? 94  THR A HG23 4  
ATOM   7565  N  N    . ALA A 1 95  ? -10.829 3.792   -5.746  1.00 0.00 ? 95  ALA A N    4  
ATOM   7566  C  CA   . ALA A 1 95  ? -9.524  3.356   -6.217  1.00 0.00 ? 95  ALA A CA   4  
ATOM   7567  C  C    . ALA A 1 95  ? -9.022  2.276   -5.258  1.00 0.00 ? 95  ALA A C    4  
ATOM   7568  O  O    . ALA A 1 95  ? -9.581  2.094   -4.171  1.00 0.00 ? 95  ALA A O    4  
ATOM   7569  C  CB   . ALA A 1 95  ? -8.577  4.560   -6.266  1.00 0.00 ? 95  ALA A CB   4  
ATOM   7570  H  H    . ALA A 1 95  ? -10.886 4.021   -4.757  1.00 0.00 ? 95  ALA A H    4  
ATOM   7571  H  HA   . ALA A 1 95  ? -9.608  2.932   -7.218  1.00 0.00 ? 95  ALA A HA   4  
ATOM   7572  H  HB1  . ALA A 1 95  ? -8.976  5.316   -6.941  1.00 0.00 ? 95  ALA A HB1  4  
ATOM   7573  H  HB2  . ALA A 1 95  ? -8.468  4.993   -5.273  1.00 0.00 ? 95  ALA A HB2  4  
ATOM   7574  H  HB3  . ALA A 1 95  ? -7.596  4.246   -6.624  1.00 0.00 ? 95  ALA A HB3  4  
ATOM   7575  N  N    . LYS A 1 96  ? -7.975  1.551   -5.642  1.00 0.00 ? 96  LYS A N    4  
ATOM   7576  C  CA   . LYS A 1 96  ? -7.350  0.591   -4.747  1.00 0.00 ? 96  LYS A CA   4  
ATOM   7577  C  C    . LYS A 1 96  ? -6.303  1.357   -3.960  1.00 0.00 ? 96  LYS A C    4  
ATOM   7578  O  O    . LYS A 1 96  ? -5.629  2.227   -4.510  1.00 0.00 ? 96  LYS A O    4  
ATOM   7579  C  CB   . LYS A 1 96  ? -6.667  -0.548  -5.523  1.00 0.00 ? 96  LYS A CB   4  
ATOM   7580  C  CG   . LYS A 1 96  ? -7.612  -1.447  -6.341  1.00 0.00 ? 96  LYS A CG   4  
ATOM   7581  C  CD   . LYS A 1 96  ? -7.430  -1.345  -7.866  1.00 0.00 ? 96  LYS A CD   4  
ATOM   7582  C  CE   . LYS A 1 96  ? -8.192  -0.157  -8.466  1.00 0.00 ? 96  LYS A CE   4  
ATOM   7583  N  NZ   . LYS A 1 96  ? -7.882  0.039   -9.902  1.00 0.00 ? 96  LYS A NZ   4  
ATOM   7584  H  H    . LYS A 1 96  ? -7.416  1.892   -6.430  1.00 0.00 ? 96  LYS A H    4  
ATOM   7585  H  HA   . LYS A 1 96  ? -8.091  0.161   -4.073  1.00 0.00 ? 96  LYS A HA   4  
ATOM   7586  H  HB2  . LYS A 1 96  ? -5.881  -0.144  -6.162  1.00 0.00 ? 96  LYS A HB2  4  
ATOM   7587  H  HB3  . LYS A 1 96  ? -6.178  -1.186  -4.786  1.00 0.00 ? 96  LYS A HB3  4  
ATOM   7588  H  HG2  . LYS A 1 96  ? -7.402  -2.479  -6.062  1.00 0.00 ? 96  LYS A HG2  4  
ATOM   7589  H  HG3  . LYS A 1 96  ? -8.649  -1.245  -6.079  1.00 0.00 ? 96  LYS A HG3  4  
ATOM   7590  H  HD2  . LYS A 1 96  ? -6.367  -1.275  -8.104  1.00 0.00 ? 96  LYS A HD2  4  
ATOM   7591  H  HD3  . LYS A 1 96  ? -7.817  -2.262  -8.315  1.00 0.00 ? 96  LYS A HD3  4  
ATOM   7592  H  HE2  . LYS A 1 96  ? -9.264  -0.330  -8.338  1.00 0.00 ? 96  LYS A HE2  4  
ATOM   7593  H  HE3  . LYS A 1 96  ? -7.919  0.751   -7.927  1.00 0.00 ? 96  LYS A HE3  4  
ATOM   7594  H  HZ1  . LYS A 1 96  ? -8.564  0.642   -10.336 1.00 0.00 ? 96  LYS A HZ1  4  
ATOM   7595  H  HZ2  . LYS A 1 96  ? -6.974  0.500   -9.991  1.00 0.00 ? 96  LYS A HZ2  4  
ATOM   7596  H  HZ3  . LYS A 1 96  ? -7.870  -0.835  -10.408 1.00 0.00 ? 96  LYS A HZ3  4  
ATOM   7597  N  N    . LEU A 1 97  ? -6.091  1.007   -2.693  1.00 0.00 ? 97  LEU A N    4  
ATOM   7598  C  CA   . LEU A 1 97  ? -4.931  1.538   -1.975  1.00 0.00 ? 97  LEU A CA   4  
ATOM   7599  C  C    . LEU A 1 97  ? -3.663  1.092   -2.730  1.00 0.00 ? 97  LEU A C    4  
ATOM   7600  O  O    . LEU A 1 97  ? -2.684  1.828   -2.809  1.00 0.00 ? 97  LEU A O    4  
ATOM   7601  C  CB   . LEU A 1 97  ? -4.923  1.056   -0.515  1.00 0.00 ? 97  LEU A CB   4  
ATOM   7602  C  CG   . LEU A 1 97  ? -3.879  1.791   0.354   1.00 0.00 ? 97  LEU A CG   4  
ATOM   7603  C  CD1  . LEU A 1 97  ? -4.232  3.274   0.538   1.00 0.00 ? 97  LEU A CD1  4  
ATOM   7604  C  CD2  . LEU A 1 97  ? -3.805  1.131   1.732   1.00 0.00 ? 97  LEU A CD2  4  
ATOM   7605  H  H    . LEU A 1 97  ? -6.655  0.278   -2.278  1.00 0.00 ? 97  LEU A H    4  
ATOM   7606  H  HA   . LEU A 1 97  ? -4.993  2.626   -1.999  1.00 0.00 ? 97  LEU A HA   4  
ATOM   7607  H  HB2  . LEU A 1 97  ? -5.913  1.208   -0.081  1.00 0.00 ? 97  LEU A HB2  4  
ATOM   7608  H  HB3  . LEU A 1 97  ? -4.708  -0.014  -0.506  1.00 0.00 ? 97  LEU A HB3  4  
ATOM   7609  H  HG   . LEU A 1 97  ? -2.894  1.713   -0.105  1.00 0.00 ? 97  LEU A HG   4  
ATOM   7610  H  HD11 . LEU A 1 97  ? -5.263  3.377   0.878   1.00 0.00 ? 97  LEU A HD11 4  
ATOM   7611  H  HD12 . LEU A 1 97  ? -3.579  3.725   1.284   1.00 0.00 ? 97  LEU A HD12 4  
ATOM   7612  H  HD13 . LEU A 1 97  ? -4.102  3.817   -0.398  1.00 0.00 ? 97  LEU A HD13 4  
ATOM   7613  H  HD21 . LEU A 1 97  ? -4.768  1.207   2.238   1.00 0.00 ? 97  LEU A HD21 4  
ATOM   7614  H  HD22 . LEU A 1 97  ? -3.537  0.080   1.617   1.00 0.00 ? 97  LEU A HD22 4  
ATOM   7615  H  HD23 . LEU A 1 97  ? -3.039  1.615   2.338   1.00 0.00 ? 97  LEU A HD23 4  
ATOM   7616  N  N    . SER A 1 98  ? -3.732  -0.088  -3.353  1.00 0.00 ? 98  SER A N    4  
ATOM   7617  C  CA   . SER A 1 98  ? -2.724  -0.701  -4.204  1.00 0.00 ? 98  SER A CA   4  
ATOM   7618  C  C    . SER A 1 98  ? -2.358  0.119   -5.453  1.00 0.00 ? 98  SER A C    4  
ATOM   7619  O  O    . SER A 1 98  ? -1.285  -0.110  -6.013  1.00 0.00 ? 98  SER A O    4  
ATOM   7620  C  CB   . SER A 1 98  ? -3.268  -2.071  -4.638  1.00 0.00 ? 98  SER A CB   4  
ATOM   7621  O  OG   . SER A 1 98  ? -3.973  -2.691  -3.570  1.00 0.00 ? 98  SER A OG   4  
ATOM   7622  H  H    . SER A 1 98  ? -4.550  -0.665  -3.193  1.00 0.00 ? 98  SER A H    4  
ATOM   7623  H  HA   . SER A 1 98  ? -1.821  -0.853  -3.611  1.00 0.00 ? 98  SER A HA   4  
ATOM   7624  H  HB2  . SER A 1 98  ? -3.954  -1.934  -5.475  1.00 0.00 ? 98  SER A HB2  4  
ATOM   7625  H  HB3  . SER A 1 98  ? -2.445  -2.704  -4.966  1.00 0.00 ? 98  SER A HB3  4  
ATOM   7626  H  HG   . SER A 1 98  ? -4.417  -3.485  -3.912  1.00 0.00 ? 98  SER A HG   4  
ATOM   7627  N  N    . ASP A 1 99  ? -3.209  1.052   -5.904  1.00 0.00 ? 99  ASP A N    4  
ATOM   7628  C  CA   . ASP A 1 99  ? -2.963  1.883   -7.092  1.00 0.00 ? 99  ASP A CA   4  
ATOM   7629  C  C    . ASP A 1 99  ? -3.104  3.375   -6.777  1.00 0.00 ? 99  ASP A C    4  
ATOM   7630  O  O    . ASP A 1 99  ? -3.147  4.213   -7.676  1.00 0.00 ? 99  ASP A O    4  
ATOM   7631  C  CB   . ASP A 1 99  ? -3.751  1.396   -8.327  1.00 0.00 ? 99  ASP A CB   4  
ATOM   7632  C  CG   . ASP A 1 99  ? -5.217  1.812   -8.481  1.00 0.00 ? 99  ASP A CG   4  
ATOM   7633  O  OD1  . ASP A 1 99  ? -5.911  2.142   -7.502  1.00 0.00 ? 99  ASP A OD1  4  
ATOM   7634  O  OD2  . ASP A 1 99  ? -5.725  1.724   -9.625  1.00 0.00 ? 99  ASP A OD2  4  
ATOM   7635  H  H    . ASP A 1 99  ? -4.066  1.238   -5.400  1.00 0.00 ? 99  ASP A H    4  
ATOM   7636  H  HA   . ASP A 1 99  ? -1.914  1.757   -7.357  1.00 0.00 ? 99  ASP A HA   4  
ATOM   7637  H  HB2  . ASP A 1 99  ? -3.237  1.780   -9.205  1.00 0.00 ? 99  ASP A HB2  4  
ATOM   7638  H  HB3  . ASP A 1 99  ? -3.697  0.309   -8.366  1.00 0.00 ? 99  ASP A HB3  4  
ATOM   7639  N  N    . ILE A 1 100 ? -3.060  3.715   -5.489  1.00 0.00 ? 100 ILE A N    4  
ATOM   7640  C  CA   . ILE A 1 100 ? -2.964  5.073   -4.973  1.00 0.00 ? 100 ILE A CA   4  
ATOM   7641  C  C    . ILE A 1 100 ? -1.565  5.250   -4.396  1.00 0.00 ? 100 ILE A C    4  
ATOM   7642  O  O    . ILE A 1 100 ? -0.942  4.314   -3.890  1.00 0.00 ? 100 ILE A O    4  
ATOM   7643  C  CB   . ILE A 1 100 ? -4.098  5.310   -3.943  1.00 0.00 ? 100 ILE A CB   4  
ATOM   7644  C  CG1  . ILE A 1 100 ? -5.366  5.712   -4.720  1.00 0.00 ? 100 ILE A CG1  4  
ATOM   7645  C  CG2  . ILE A 1 100 ? -3.796  6.302   -2.800  1.00 0.00 ? 100 ILE A CG2  4  
ATOM   7646  C  CD1  . ILE A 1 100 ? -5.540  7.202   -5.008  1.00 0.00 ? 100 ILE A CD1  4  
ATOM   7647  H  H    . ILE A 1 100 ? -2.965  2.974   -4.812  1.00 0.00 ? 100 ILE A H    4  
ATOM   7648  H  HA   . ILE A 1 100 ? -3.077  5.783   -5.793  1.00 0.00 ? 100 ILE A HA   4  
ATOM   7649  H  HB   . ILE A 1 100 ? -4.301  4.355   -3.456  1.00 0.00 ? 100 ILE A HB   4  
ATOM   7650  H  HG12 . ILE A 1 100 ? -5.358  5.201   -5.679  1.00 0.00 ? 100 ILE A HG12 4  
ATOM   7651  H  HG13 . ILE A 1 100 ? -6.235  5.387   -4.158  1.00 0.00 ? 100 ILE A HG13 4  
ATOM   7652  H  HG21 . ILE A 1 100 ? -4.683  6.426   -2.178  1.00 0.00 ? 100 ILE A HG21 4  
ATOM   7653  H  HG22 . ILE A 1 100 ? -2.997  5.912   -2.168  1.00 0.00 ? 100 ILE A HG22 4  
ATOM   7654  H  HG23 . ILE A 1 100 ? -3.496  7.277   -3.190  1.00 0.00 ? 100 ILE A HG23 4  
ATOM   7655  H  HD11 . ILE A 1 100 ? -4.633  7.609   -5.449  1.00 0.00 ? 100 ILE A HD11 4  
ATOM   7656  H  HD12 . ILE A 1 100 ? -6.370  7.318   -5.701  1.00 0.00 ? 100 ILE A HD12 4  
ATOM   7657  H  HD13 . ILE A 1 100 ? -5.773  7.731   -4.085  1.00 0.00 ? 100 ILE A HD13 4  
ATOM   7658  N  N    . GLU A 1 101 ? -1.099  6.489   -4.453  1.00 0.00 ? 101 GLU A N    4  
ATOM   7659  C  CA   . GLU A 1 101 ? 0.144   6.929   -3.840  1.00 0.00 ? 101 GLU A CA   4  
ATOM   7660  C  C    . GLU A 1 101 ? -0.146  8.287   -3.205  1.00 0.00 ? 101 GLU A C    4  
ATOM   7661  O  O    . GLU A 1 101 ? -0.567  9.213   -3.898  1.00 0.00 ? 101 GLU A O    4  
ATOM   7662  C  CB   . GLU A 1 101 ? 1.238   6.983   -4.917  1.00 0.00 ? 101 GLU A CB   4  
ATOM   7663  C  CG   . GLU A 1 101 ? 2.624   7.260   -4.322  1.00 0.00 ? 101 GLU A CG   4  
ATOM   7664  C  CD   . GLU A 1 101 ? 3.711   7.263   -5.411  1.00 0.00 ? 101 GLU A CD   4  
ATOM   7665  O  OE1  . GLU A 1 101 ? 3.967   6.200   -6.022  1.00 0.00 ? 101 GLU A OE1  4  
ATOM   7666  O  OE2  . GLU A 1 101 ? 4.328   8.324   -5.658  1.00 0.00 ? 101 GLU A OE2  4  
ATOM   7667  H  H    . GLU A 1 101 ? -1.643  7.177   -4.954  1.00 0.00 ? 101 GLU A H    4  
ATOM   7668  H  HA   . GLU A 1 101 ? 0.443   6.217   -3.069  1.00 0.00 ? 101 GLU A HA   4  
ATOM   7669  H  HB2  . GLU A 1 101 ? 1.268   6.019   -5.426  1.00 0.00 ? 101 GLU A HB2  4  
ATOM   7670  H  HB3  . GLU A 1 101 ? 0.997   7.752   -5.653  1.00 0.00 ? 101 GLU A HB3  4  
ATOM   7671  H  HG2  . GLU A 1 101 ? 2.608   8.225   -3.811  1.00 0.00 ? 101 GLU A HG2  4  
ATOM   7672  H  HG3  . GLU A 1 101 ? 2.856   6.491   -3.583  1.00 0.00 ? 101 GLU A HG3  4  
ATOM   7673  N  N    . ALA A 1 102 ? 0.002   8.404   -1.884  1.00 0.00 ? 102 ALA A N    4  
ATOM   7674  C  CA   . ALA A 1 102 ? -0.306  9.647   -1.189  1.00 0.00 ? 102 ALA A CA   4  
ATOM   7675  C  C    . ALA A 1 102 ? 0.728   10.721  -1.528  1.00 0.00 ? 102 ALA A C    4  
ATOM   7676  O  O    . ALA A 1 102 ? 1.886   10.424  -1.835  1.00 0.00 ? 102 ALA A O    4  
ATOM   7677  C  CB   . ALA A 1 102 ? -0.343  9.421   0.322   1.00 0.00 ? 102 ALA A CB   4  
ATOM   7678  H  H    . ALA A 1 102 ? 0.376   7.631   -1.345  1.00 0.00 ? 102 ALA A H    4  
ATOM   7679  H  HA   . ALA A 1 102 ? -1.292  9.993   -1.505  1.00 0.00 ? 102 ALA A HA   4  
ATOM   7680  H  HB1  . ALA A 1 102 ? 0.630   9.076   0.674   1.00 0.00 ? 102 ALA A HB1  4  
ATOM   7681  H  HB2  . ALA A 1 102 ? -0.599  10.357  0.815   1.00 0.00 ? 102 ALA A HB2  4  
ATOM   7682  H  HB3  . ALA A 1 102 ? -1.109  8.695   0.578   1.00 0.00 ? 102 ALA A HB3  4  
ATOM   7683  N  N    . ILE A 1 103 ? 0.307   11.977  -1.405  1.00 0.00 ? 103 ILE A N    4  
ATOM   7684  C  CA   . ILE A 1 103 ? 1.128   13.157  -1.645  1.00 0.00 ? 103 ILE A CA   4  
ATOM   7685  C  C    . ILE A 1 103 ? 1.163   13.958  -0.341  1.00 0.00 ? 103 ILE A C    4  
ATOM   7686  O  O    . ILE A 1 103 ? 0.118   14.249  0.245   1.00 0.00 ? 103 ILE A O    4  
ATOM   7687  C  CB   . ILE A 1 103 ? 0.549   13.973  -2.828  1.00 0.00 ? 103 ILE A CB   4  
ATOM   7688  C  CG1  . ILE A 1 103 ? 0.583   13.172  -4.153  1.00 0.00 ? 103 ILE A CG1  4  
ATOM   7689  C  CG2  . ILE A 1 103 ? 1.314   15.297  -3.015  1.00 0.00 ? 103 ILE A CG2  4  
ATOM   7690  C  CD1  . ILE A 1 103 ? -0.290  13.793  -5.251  1.00 0.00 ? 103 ILE A CD1  4  
ATOM   7691  H  H    . ILE A 1 103 ? -0.680  12.140  -1.205  1.00 0.00 ? 103 ILE A H    4  
ATOM   7692  H  HA   . ILE A 1 103 ? 2.142   12.855  -1.902  1.00 0.00 ? 103 ILE A HA   4  
ATOM   7693  H  HB   . ILE A 1 103 ? -0.487  14.212  -2.591  1.00 0.00 ? 103 ILE A HB   4  
ATOM   7694  H  HG12 . ILE A 1 103 ? 1.611   13.096  -4.511  1.00 0.00 ? 103 ILE A HG12 4  
ATOM   7695  H  HG13 . ILE A 1 103 ? 0.223   12.159  -3.990  1.00 0.00 ? 103 ILE A HG13 4  
ATOM   7696  H  HG21 . ILE A 1 103 ? 0.867   15.885  -3.816  1.00 0.00 ? 103 ILE A HG21 4  
ATOM   7697  H  HG22 . ILE A 1 103 ? 1.269   15.899  -2.107  1.00 0.00 ? 103 ILE A HG22 4  
ATOM   7698  H  HG23 . ILE A 1 103 ? 2.358   15.095  -3.256  1.00 0.00 ? 103 ILE A HG23 4  
ATOM   7699  H  HD11 . ILE A 1 103 ? -0.316  13.125  -6.107  1.00 0.00 ? 103 ILE A HD11 4  
ATOM   7700  H  HD12 . ILE A 1 103 ? -1.307  13.926  -4.886  1.00 0.00 ? 103 ILE A HD12 4  
ATOM   7701  H  HD13 . ILE A 1 103 ? 0.114   14.751  -5.574  1.00 0.00 ? 103 ILE A HD13 4  
ATOM   7702  N  N    . ASP A 1 104 ? 2.378   14.342  0.070   1.00 0.00 ? 104 ASP A N    4  
ATOM   7703  C  CA   . ASP A 1 104 ? 2.668   15.232  1.202   1.00 0.00 ? 104 ASP A CA   4  
ATOM   7704  C  C    . ASP A 1 104 ? 1.905   14.853  2.484   1.00 0.00 ? 104 ASP A C    4  
ATOM   7705  O  O    . ASP A 1 104 ? 1.410   15.711  3.219   1.00 0.00 ? 104 ASP A O    4  
ATOM   7706  C  CB   . ASP A 1 104 ? 2.478   16.697  0.772   1.00 0.00 ? 104 ASP A CB   4  
ATOM   7707  C  CG   . ASP A 1 104 ? 2.976   17.698  1.832   1.00 0.00 ? 104 ASP A CG   4  
ATOM   7708  O  OD1  . ASP A 1 104 ? 4.097   17.529  2.365   1.00 0.00 ? 104 ASP A OD1  4  
ATOM   7709  O  OD2  . ASP A 1 104 ? 2.278   18.705  2.094   1.00 0.00 ? 104 ASP A OD2  4  
ATOM   7710  H  H    . ASP A 1 104 ? 3.172   14.051  -0.477  1.00 0.00 ? 104 ASP A H    4  
ATOM   7711  H  HA   . ASP A 1 104 ? 3.728   15.105  1.418   1.00 0.00 ? 104 ASP A HA   4  
ATOM   7712  H  HB2  . ASP A 1 104 ? 3.032   16.867  -0.153  1.00 0.00 ? 104 ASP A HB2  4  
ATOM   7713  H  HB3  . ASP A 1 104 ? 1.420   16.870  0.562   1.00 0.00 ? 104 ASP A HB3  4  
ATOM   7714  N  N    . VAL A 1 105 ? 1.759   13.547  2.731   1.00 0.00 ? 105 VAL A N    4  
ATOM   7715  C  CA   . VAL A 1 105 ? 0.965   13.023  3.840   1.00 0.00 ? 105 VAL A CA   4  
ATOM   7716  C  C    . VAL A 1 105 ? 1.847   12.802  5.080   1.00 0.00 ? 105 VAL A C    4  
ATOM   7717  O  O    . VAL A 1 105 ? 3.074   12.939  5.014   1.00 0.00 ? 105 VAL A O    4  
ATOM   7718  C  CB   . VAL A 1 105 ? 0.183   11.783  3.354   1.00 0.00 ? 105 VAL A CB   4  
ATOM   7719  C  CG1  . VAL A 1 105 ? 0.996   10.480  3.328   1.00 0.00 ? 105 VAL A CG1  4  
ATOM   7720  C  CG2  . VAL A 1 105 ? -1.134  11.626  4.115   1.00 0.00 ? 105 VAL A CG2  4  
ATOM   7721  H  H    . VAL A 1 105 ? 2.213   12.877  2.122   1.00 0.00 ? 105 VAL A H    4  
ATOM   7722  H  HA   . VAL A 1 105 ? 0.228   13.784  4.102   1.00 0.00 ? 105 VAL A HA   4  
ATOM   7723  H  HB   . VAL A 1 105 ? -0.121  11.967  2.332   1.00 0.00 ? 105 VAL A HB   4  
ATOM   7724  H  HG11 . VAL A 1 105 ? 1.852   10.576  2.658   1.00 0.00 ? 105 VAL A HG11 4  
ATOM   7725  H  HG12 . VAL A 1 105 ? 1.356   10.236  4.321   1.00 0.00 ? 105 VAL A HG12 4  
ATOM   7726  H  HG13 . VAL A 1 105 ? 0.371   9.655   2.990   1.00 0.00 ? 105 VAL A HG13 4  
ATOM   7727  H  HG21 . VAL A 1 105 ? -0.969  11.299  5.138   1.00 0.00 ? 105 VAL A HG21 4  
ATOM   7728  H  HG22 . VAL A 1 105 ? -1.673  12.575  4.125   1.00 0.00 ? 105 VAL A HG22 4  
ATOM   7729  H  HG23 . VAL A 1 105 ? -1.750  10.901  3.587   1.00 0.00 ? 105 VAL A HG23 4  
ATOM   7730  N  N    . ASP A 1 106 ? 1.226   12.485  6.221   1.00 0.00 ? 106 ASP A N    4  
ATOM   7731  C  CA   . ASP A 1 106 ? 1.945   12.184  7.456   1.00 0.00 ? 106 ASP A CA   4  
ATOM   7732  C  C    . ASP A 1 106 ? 2.697   10.858  7.331   1.00 0.00 ? 106 ASP A C    4  
ATOM   7733  O  O    . ASP A 1 106 ? 2.330   9.982   6.542   1.00 0.00 ? 106 ASP A O    4  
ATOM   7734  C  CB   . ASP A 1 106 ? 1.009   12.195  8.679   1.00 0.00 ? 106 ASP A CB   4  
ATOM   7735  C  CG   . ASP A 1 106 ? 0.859   10.824  9.357   1.00 0.00 ? 106 ASP A CG   4  
ATOM   7736  O  OD1  . ASP A 1 106 ? 0.035   10.014  8.882   1.00 0.00 ? 106 ASP A OD1  4  
ATOM   7737  O  OD2  . ASP A 1 106 ? 1.579   10.560  10.346  1.00 0.00 ? 106 ASP A OD2  4  
ATOM   7738  H  H    . ASP A 1 106 ? 0.234   12.302  6.213   1.00 0.00 ? 106 ASP A H    4  
ATOM   7739  H  HA   . ASP A 1 106 ? 2.680   12.977  7.602   1.00 0.00 ? 106 ASP A HA   4  
ATOM   7740  H  HB2  . ASP A 1 106 ? 1.436   12.890  9.403   1.00 0.00 ? 106 ASP A HB2  4  
ATOM   7741  H  HB3  . ASP A 1 106 ? 0.026   12.575  8.397   1.00 0.00 ? 106 ASP A HB3  4  
ATOM   7742  N  N    . ASP A 1 107 ? 3.747   10.710  8.137   1.00 0.00 ? 107 ASP A N    4  
ATOM   7743  C  CA   . ASP A 1 107 ? 4.630   9.557   8.081   1.00 0.00 ? 107 ASP A CA   4  
ATOM   7744  C  C    . ASP A 1 107 ? 3.881   8.239   8.282   1.00 0.00 ? 107 ASP A C    4  
ATOM   7745  O  O    . ASP A 1 107 ? 4.169   7.274   7.580   1.00 0.00 ? 107 ASP A O    4  
ATOM   7746  C  CB   . ASP A 1 107 ? 5.742   9.697   9.123   1.00 0.00 ? 107 ASP A CB   4  
ATOM   7747  C  CG   . ASP A 1 107 ? 6.682   8.481   9.103   1.00 0.00 ? 107 ASP A CG   4  
ATOM   7748  O  OD1  . ASP A 1 107 ? 7.497   8.360   8.161   1.00 0.00 ? 107 ASP A OD1  4  
ATOM   7749  O  OD2  . ASP A 1 107 ? 6.658   7.680   10.065  1.00 0.00 ? 107 ASP A OD2  4  
ATOM   7750  H  H    . ASP A 1 107 ? 3.973   11.441  8.797   1.00 0.00 ? 107 ASP A H    4  
ATOM   7751  H  HA   . ASP A 1 107 ? 5.083   9.543   7.093   1.00 0.00 ? 107 ASP A HA   4  
ATOM   7752  H  HB2  . ASP A 1 107 ? 6.314   10.605  8.917   1.00 0.00 ? 107 ASP A HB2  4  
ATOM   7753  H  HB3  . ASP A 1 107 ? 5.293   9.801   10.114  1.00 0.00 ? 107 ASP A HB3  4  
ATOM   7754  N  N    . ASP A 1 108 ? 2.900   8.184   9.188   1.00 0.00 ? 108 ASP A N    4  
ATOM   7755  C  CA   . ASP A 1 108 ? 2.208   6.935   9.498   1.00 0.00 ? 108 ASP A CA   4  
ATOM   7756  C  C    . ASP A 1 108 ? 1.316   6.524   8.324   1.00 0.00 ? 108 ASP A C    4  
ATOM   7757  O  O    . ASP A 1 108 ? 1.345   5.368   7.901   1.00 0.00 ? 108 ASP A O    4  
ATOM   7758  C  CB   . ASP A 1 108 ? 1.397   7.072   10.799  1.00 0.00 ? 108 ASP A CB   4  
ATOM   7759  C  CG   . ASP A 1 108 ? 1.368   5.796   11.658  1.00 0.00 ? 108 ASP A CG   4  
ATOM   7760  O  OD1  . ASP A 1 108 ? 2.347   5.016   11.657  1.00 0.00 ? 108 ASP A OD1  4  
ATOM   7761  O  OD2  . ASP A 1 108 ? 0.398   5.619   12.429  1.00 0.00 ? 108 ASP A OD2  4  
ATOM   7762  H  H    . ASP A 1 108 ? 2.591   9.031   9.659   1.00 0.00 ? 108 ASP A H    4  
ATOM   7763  H  HA   . ASP A 1 108 ? 2.970   6.168   9.635   1.00 0.00 ? 108 ASP A HA   4  
ATOM   7764  H  HB2  . ASP A 1 108 ? 1.829   7.866   11.411  1.00 0.00 ? 108 ASP A HB2  4  
ATOM   7765  H  HB3  . ASP A 1 108 ? 0.374   7.352   10.548  1.00 0.00 ? 108 ASP A HB3  4  
ATOM   7766  N  N    . THR A 1 109 ? 0.587   7.477   7.733   1.00 0.00 ? 109 THR A N    4  
ATOM   7767  C  CA   . THR A 1 109 ? -0.201  7.257   6.527   1.00 0.00 ? 109 THR A CA   4  
ATOM   7768  C  C    . THR A 1 109 ? 0.699   6.721   5.411   1.00 0.00 ? 109 THR A C    4  
ATOM   7769  O  O    . THR A 1 109 ? 0.370   5.708   4.790   1.00 0.00 ? 109 THR A O    4  
ATOM   7770  C  CB   . THR A 1 109 ? -0.941  8.559   6.142   1.00 0.00 ? 109 THR A CB   4  
ATOM   7771  O  OG1  . THR A 1 109 ? -1.698  9.027   7.241   1.00 0.00 ? 109 THR A OG1  4  
ATOM   7772  C  CG2  . THR A 1 109 ? -1.950  8.354   5.013   1.00 0.00 ? 109 THR A CG2  4  
ATOM   7773  H  H    . THR A 1 109 ? 0.591   8.421   8.119   1.00 0.00 ? 109 THR A H    4  
ATOM   7774  H  HA   . THR A 1 109 ? -0.936  6.486   6.737   1.00 0.00 ? 109 THR A HA   4  
ATOM   7775  H  HB   . THR A 1 109 ? -0.233  9.335   5.829   1.00 0.00 ? 109 THR A HB   4  
ATOM   7776  H  HG1  . THR A 1 109 ? -1.055  9.396   7.895   1.00 0.00 ? 109 THR A HG1  4  
ATOM   7777  H  HG21 . THR A 1 109 ? -2.485  9.281   4.833   1.00 0.00 ? 109 THR A HG21 4  
ATOM   7778  H  HG22 . THR A 1 109 ? -1.445  8.052   4.094   1.00 0.00 ? 109 THR A HG22 4  
ATOM   7779  H  HG23 . THR A 1 109 ? -2.687  7.613   5.301   1.00 0.00 ? 109 THR A HG23 4  
ATOM   7780  N  N    . GLN A 1 110 ? 1.859   7.343   5.188   1.00 0.00 ? 110 GLN A N    4  
ATOM   7781  C  CA   . GLN A 1 110 ? 2.765   6.911   4.141   1.00 0.00 ? 110 GLN A CA   4  
ATOM   7782  C  C    . GLN A 1 110 ? 3.344   5.519   4.435   1.00 0.00 ? 110 GLN A C    4  
ATOM   7783  O  O    . GLN A 1 110 ? 3.527   4.734   3.501   1.00 0.00 ? 110 GLN A O    4  
ATOM   7784  C  CB   . GLN A 1 110 ? 3.842   7.984   3.942   1.00 0.00 ? 110 GLN A CB   4  
ATOM   7785  C  CG   . GLN A 1 110 ? 4.757   7.717   2.744   1.00 0.00 ? 110 GLN A CG   4  
ATOM   7786  C  CD   . GLN A 1 110 ? 4.017   7.517   1.419   1.00 0.00 ? 110 GLN A CD   4  
ATOM   7787  O  OE1  . GLN A 1 110 ? 3.728   8.468   0.699   1.00 0.00 ? 110 GLN A OE1  4  
ATOM   7788  N  NE2  . GLN A 1 110 ? 3.698   6.280   1.068   1.00 0.00 ? 110 GLN A NE2  4  
ATOM   7789  H  H    . GLN A 1 110 ? 2.120   8.149   5.751   1.00 0.00 ? 110 GLN A H    4  
ATOM   7790  H  HA   . GLN A 1 110 ? 2.182   6.840   3.225   1.00 0.00 ? 110 GLN A HA   4  
ATOM   7791  H  HB2  . GLN A 1 110 ? 3.359   8.948   3.787   1.00 0.00 ? 110 GLN A HB2  4  
ATOM   7792  H  HB3  . GLN A 1 110 ? 4.453   8.055   4.843   1.00 0.00 ? 110 GLN A HB3  4  
ATOM   7793  H  HG2  . GLN A 1 110 ? 5.420   8.574   2.642   1.00 0.00 ? 110 GLN A HG2  4  
ATOM   7794  H  HG3  . GLN A 1 110 ? 5.359   6.835   2.956   1.00 0.00 ? 110 GLN A HG3  4  
ATOM   7795  H  HE21 . GLN A 1 110 ? 3.891   5.509   1.706   1.00 0.00 ? 110 GLN A HE21 4  
ATOM   7796  H  HE22 . GLN A 1 110 ? 3.256   6.104   0.180   1.00 0.00 ? 110 GLN A HE22 4  
ATOM   7797  N  N    . GLU A 1 111 ? 3.604   5.183   5.700   1.00 0.00 ? 111 GLU A N    4  
ATOM   7798  C  CA   . GLU A 1 111 ? 4.103   3.867   6.080   1.00 0.00 ? 111 GLU A CA   4  
ATOM   7799  C  C    . GLU A 1 111 ? 3.052   2.787   5.839   1.00 0.00 ? 111 GLU A C    4  
ATOM   7800  O  O    . GLU A 1 111 ? 3.412   1.717   5.355   1.00 0.00 ? 111 GLU A O    4  
ATOM   7801  C  CB   . GLU A 1 111 ? 4.559   3.854   7.548   1.00 0.00 ? 111 GLU A CB   4  
ATOM   7802  C  CG   . GLU A 1 111 ? 5.934   4.506   7.742   1.00 0.00 ? 111 GLU A CG   4  
ATOM   7803  C  CD   . GLU A 1 111 ? 7.082   3.630   7.207   1.00 0.00 ? 111 GLU A CD   4  
ATOM   7804  O  OE1  . GLU A 1 111 ? 7.546   2.720   7.930   1.00 0.00 ? 111 GLU A OE1  4  
ATOM   7805  O  OE2  . GLU A 1 111 ? 7.548   3.855   6.067   1.00 0.00 ? 111 GLU A OE2  4  
ATOM   7806  H  H    . GLU A 1 111 ? 3.484   5.874   6.436   1.00 0.00 ? 111 GLU A H    4  
ATOM   7807  H  HA   . GLU A 1 111 ? 4.951   3.626   5.442   1.00 0.00 ? 111 GLU A HA   4  
ATOM   7808  H  HB2  . GLU A 1 111 ? 3.825   4.376   8.161   1.00 0.00 ? 111 GLU A HB2  4  
ATOM   7809  H  HB3  . GLU A 1 111 ? 4.614   2.824   7.902   1.00 0.00 ? 111 GLU A HB3  4  
ATOM   7810  H  HG2  . GLU A 1 111 ? 5.950   5.475   7.244   1.00 0.00 ? 111 GLU A HG2  4  
ATOM   7811  H  HG3  . GLU A 1 111 ? 6.080   4.678   8.810   1.00 0.00 ? 111 GLU A HG3  4  
ATOM   7812  N  N    . ALA A 1 112 ? 1.768   3.051   6.107   1.00 0.00 ? 112 ALA A N    4  
ATOM   7813  C  CA   . ALA A 1 112 ? 0.699   2.097   5.821   1.00 0.00 ? 112 ALA A CA   4  
ATOM   7814  C  C    . ALA A 1 112 ? 0.665   1.759   4.329   1.00 0.00 ? 112 ALA A C    4  
ATOM   7815  O  O    . ALA A 1 112 ? 0.521   0.599   3.950   1.00 0.00 ? 112 ALA A O    4  
ATOM   7816  C  CB   . ALA A 1 112 ? -0.648  2.693   6.234   1.00 0.00 ? 112 ALA A CB   4  
ATOM   7817  H  H    . ALA A 1 112 ? 1.521   3.942   6.526   1.00 0.00 ? 112 ALA A H    4  
ATOM   7818  H  HA   . ALA A 1 112 ? 0.878   1.184   6.390   1.00 0.00 ? 112 ALA A HA   4  
ATOM   7819  H  HB1  . ALA A 1 112 ? -0.611  3.018   7.266   1.00 0.00 ? 112 ALA A HB1  4  
ATOM   7820  H  HB2  . ALA A 1 112 ? -0.876  3.552   5.608   1.00 0.00 ? 112 ALA A HB2  4  
ATOM   7821  H  HB3  . ALA A 1 112 ? -1.432  1.945   6.115   1.00 0.00 ? 112 ALA A HB3  4  
ATOM   7822  N  N    . ILE A 1 113 ? 0.806   2.786   3.490   1.00 0.00 ? 113 ILE A N    4  
ATOM   7823  C  CA   . ILE A 1 113 ? 0.775   2.658   2.041   1.00 0.00 ? 113 ILE A CA   4  
ATOM   7824  C  C    . ILE A 1 113 ? 1.988   1.841   1.585   1.00 0.00 ? 113 ILE A C    4  
ATOM   7825  O  O    . ILE A 1 113 ? 1.827   0.868   0.849   1.00 0.00 ? 113 ILE A O    4  
ATOM   7826  C  CB   . ILE A 1 113 ? 0.716   4.075   1.433   1.00 0.00 ? 113 ILE A CB   4  
ATOM   7827  C  CG1  . ILE A 1 113 ? -0.659  4.710   1.739   1.00 0.00 ? 113 ILE A CG1  4  
ATOM   7828  C  CG2  . ILE A 1 113 ? 0.993   4.080   -0.080  1.00 0.00 ? 113 ILE A CG2  4  
ATOM   7829  C  CD1  . ILE A 1 113 ? -0.628  6.237   1.695   1.00 0.00 ? 113 ILE A CD1  4  
ATOM   7830  H  H    . ILE A 1 113 ? 0.932   3.708   3.886   1.00 0.00 ? 113 ILE A H    4  
ATOM   7831  H  HA   . ILE A 1 113 ? -0.126  2.117   1.752   1.00 0.00 ? 113 ILE A HA   4  
ATOM   7832  H  HB   . ILE A 1 113 ? 1.486   4.676   1.911   1.00 0.00 ? 113 ILE A HB   4  
ATOM   7833  H  HG12 . ILE A 1 113 ? -1.395  4.344   1.024   1.00 0.00 ? 113 ILE A HG12 4  
ATOM   7834  H  HG13 . ILE A 1 113 ? -0.993  4.430   2.735   1.00 0.00 ? 113 ILE A HG13 4  
ATOM   7835  H  HG21 . ILE A 1 113 ? 0.897   5.087   -0.484  1.00 0.00 ? 113 ILE A HG21 4  
ATOM   7836  H  HG22 . ILE A 1 113 ? 2.011   3.737   -0.268  1.00 0.00 ? 113 ILE A HG22 4  
ATOM   7837  H  HG23 . ILE A 1 113 ? 0.291   3.421   -0.594  1.00 0.00 ? 113 ILE A HG23 4  
ATOM   7838  H  HD11 . ILE A 1 113 ? -1.594  6.623   2.021   1.00 0.00 ? 113 ILE A HD11 4  
ATOM   7839  H  HD12 . ILE A 1 113 ? 0.138   6.620   2.369   1.00 0.00 ? 113 ILE A HD12 4  
ATOM   7840  H  HD13 . ILE A 1 113 ? -0.418  6.567   0.680   1.00 0.00 ? 113 ILE A HD13 4  
ATOM   7841  N  N    . ALA A 1 114 ? 3.191   2.204   2.039   1.00 0.00 ? 114 ALA A N    4  
ATOM   7842  C  CA   . ALA A 1 114 ? 4.413   1.495   1.684   1.00 0.00 ? 114 ALA A CA   4  
ATOM   7843  C  C    . ALA A 1 114 ? 4.335   0.029   2.123   1.00 0.00 ? 114 ALA A C    4  
ATOM   7844  O  O    . ALA A 1 114 ? 4.630   -0.866  1.336   1.00 0.00 ? 114 ALA A O    4  
ATOM   7845  C  CB   . ALA A 1 114 ? 5.615   2.199   2.321   1.00 0.00 ? 114 ALA A CB   4  
ATOM   7846  H  H    . ALA A 1 114 ? 3.262   2.980   2.664   1.00 0.00 ? 114 ALA A H    4  
ATOM   7847  H  HA   . ALA A 1 114 ? 4.529   1.525   0.599   1.00 0.00 ? 114 ALA A HA   4  
ATOM   7848  H  HB1  . ALA A 1 114 ? 5.665   3.234   1.982   1.00 0.00 ? 114 ALA A HB1  4  
ATOM   7849  H  HB2  . ALA A 1 114 ? 5.535   2.176   3.408   1.00 0.00 ? 114 ALA A HB2  4  
ATOM   7850  H  HB3  . ALA A 1 114 ? 6.529   1.686   2.022   1.00 0.00 ? 114 ALA A HB3  4  
ATOM   7851  N  N    . ASP A 1 115 ? 3.888   -0.223  3.354   1.00 0.00 ? 115 ASP A N    4  
ATOM   7852  C  CA   . ASP A 1 115 ? 3.768   -1.570  3.907   1.00 0.00 ? 115 ASP A CA   4  
ATOM   7853  C  C    . ASP A 1 115 ? 2.757   -2.410  3.130   1.00 0.00 ? 115 ASP A C    4  
ATOM   7854  O  O    . ASP A 1 115 ? 2.998   -3.587  2.855   1.00 0.00 ? 115 ASP A O    4  
ATOM   7855  C  CB   . ASP A 1 115 ? 3.367   -1.495  5.381   1.00 0.00 ? 115 ASP A CB   4  
ATOM   7856  C  CG   . ASP A 1 115 ? 3.299   -2.885  6.020   1.00 0.00 ? 115 ASP A CG   4  
ATOM   7857  O  OD1  . ASP A 1 115 ? 4.298   -3.632  5.966   1.00 0.00 ? 115 ASP A OD1  4  
ATOM   7858  O  OD2  . ASP A 1 115 ? 2.303   -3.172  6.719   1.00 0.00 ? 115 ASP A OD2  4  
ATOM   7859  H  H    . ASP A 1 115 ? 3.657   0.556   3.963   1.00 0.00 ? 115 ASP A H    4  
ATOM   7860  H  HA   . ASP A 1 115 ? 4.735   -2.058  3.847   1.00 0.00 ? 115 ASP A HA   4  
ATOM   7861  H  HB2  . ASP A 1 115 ? 4.106   -0.899  5.921   1.00 0.00 ? 115 ASP A HB2  4  
ATOM   7862  H  HB3  . ASP A 1 115 ? 2.398   -0.999  5.467   1.00 0.00 ? 115 ASP A HB3  4  
ATOM   7863  N  N    . TRP A 1 116 ? 1.648   -1.795  2.714   1.00 0.00 ? 116 TRP A N    4  
ATOM   7864  C  CA   . TRP A 1 116 ? 0.666   -2.454  1.871   1.00 0.00 ? 116 TRP A CA   4  
ATOM   7865  C  C    . TRP A 1 116 ? 1.282   -2.813  0.517   1.00 0.00 ? 116 TRP A C    4  
ATOM   7866  O  O    . TRP A 1 116 ? 1.068   -3.919  0.027   1.00 0.00 ? 116 TRP A O    4  
ATOM   7867  C  CB   . TRP A 1 116 ? -0.582  -1.579  1.698   1.00 0.00 ? 116 TRP A CB   4  
ATOM   7868  C  CG   . TRP A 1 116 ? -1.641  -2.229  0.863   1.00 0.00 ? 116 TRP A CG   4  
ATOM   7869  C  CD1  . TRP A 1 116 ? -2.027  -1.838  -0.372  1.00 0.00 ? 116 TRP A CD1  4  
ATOM   7870  C  CD2  . TRP A 1 116 ? -2.372  -3.465  1.135   1.00 0.00 ? 116 TRP A CD2  4  
ATOM   7871  N  NE1  . TRP A 1 116 ? -2.926  -2.749  -0.887  1.00 0.00 ? 116 TRP A NE1  4  
ATOM   7872  C  CE2  . TRP A 1 116 ? -3.140  -3.799  -0.020  1.00 0.00 ? 116 TRP A CE2  4  
ATOM   7873  C  CE3  . TRP A 1 116 ? -2.432  -4.360  2.226   1.00 0.00 ? 116 TRP A CE3  4  
ATOM   7874  C  CZ2  . TRP A 1 116 ? -3.888  -4.982  -0.103  1.00 0.00 ? 116 TRP A CZ2  4  
ATOM   7875  C  CZ3  . TRP A 1 116 ? -3.207  -5.533  2.164   1.00 0.00 ? 116 TRP A CZ3  4  
ATOM   7876  C  CH2  . TRP A 1 116 ? -3.921  -5.855  0.997   1.00 0.00 ? 116 TRP A CH2  4  
ATOM   7877  H  H    . TRP A 1 116 ? 1.506   -0.818  2.946   1.00 0.00 ? 116 TRP A H    4  
ATOM   7878  H  HA   . TRP A 1 116 ? 0.369   -3.382  2.361   1.00 0.00 ? 116 TRP A HA   4  
ATOM   7879  H  HB2  . TRP A 1 116 ? -1.000  -1.366  2.681   1.00 0.00 ? 116 TRP A HB2  4  
ATOM   7880  H  HB3  . TRP A 1 116 ? -0.302  -0.631  1.238   1.00 0.00 ? 116 TRP A HB3  4  
ATOM   7881  H  HD1  . TRP A 1 116 ? -1.646  -0.974  -0.902  1.00 0.00 ? 116 TRP A HD1  4  
ATOM   7882  H  HE1  . TRP A 1 116 ? -3.310  -2.682  -1.830  1.00 0.00 ? 116 TRP A HE1  4  
ATOM   7883  H  HE3  . TRP A 1 116 ? -1.866  -4.145  3.120   1.00 0.00 ? 116 TRP A HE3  4  
ATOM   7884  H  HZ2  . TRP A 1 116 ? -4.434  -5.218  -1.003  1.00 0.00 ? 116 TRP A HZ2  4  
ATOM   7885  H  HZ3  . TRP A 1 116 ? -3.233  -6.207  3.010   1.00 0.00 ? 116 TRP A HZ3  4  
ATOM   7886  H  HH2  . TRP A 1 116 ? -4.497  -6.769  0.949   1.00 0.00 ? 116 TRP A HH2  4  
ATOM   7887  N  N    . LEU A 1 117 ? 2.079   -1.921  -0.079  1.00 0.00 ? 117 LEU A N    4  
ATOM   7888  C  CA   . LEU A 1 117 ? 2.732   -2.177  -1.360  1.00 0.00 ? 117 LEU A CA   4  
ATOM   7889  C  C    . LEU A 1 117 ? 3.776   -3.293  -1.235  1.00 0.00 ? 117 LEU A C    4  
ATOM   7890  O  O    . LEU A 1 117 ? 3.893   -4.109  -2.150  1.00 0.00 ? 117 LEU A O    4  
ATOM   7891  C  CB   . LEU A 1 117 ? 3.351   -0.883  -1.918  1.00 0.00 ? 117 LEU A CB   4  
ATOM   7892  C  CG   . LEU A 1 117 ? 2.301   0.144   -2.395  1.00 0.00 ? 117 LEU A CG   4  
ATOM   7893  C  CD1  . LEU A 1 117 ? 2.958   1.516   -2.585  1.00 0.00 ? 117 LEU A CD1  4  
ATOM   7894  C  CD2  . LEU A 1 117 ? 1.625   -0.285  -3.704  1.00 0.00 ? 117 LEU A CD2  4  
ATOM   7895  H  H    . LEU A 1 117 ? 2.265   -1.046  0.388   1.00 0.00 ? 117 LEU A H    4  
ATOM   7896  H  HA   . LEU A 1 117 ? 1.975   -2.528  -2.060  1.00 0.00 ? 117 LEU A HA   4  
ATOM   7897  H  HB2  . LEU A 1 117 ? 3.976   -0.434  -1.146  1.00 0.00 ? 117 LEU A HB2  4  
ATOM   7898  H  HB3  . LEU A 1 117 ? 4.002   -1.135  -2.757  1.00 0.00 ? 117 LEU A HB3  4  
ATOM   7899  H  HG   . LEU A 1 117 ? 1.524   0.251   -1.640  1.00 0.00 ? 117 LEU A HG   4  
ATOM   7900  H  HD11 . LEU A 1 117 ? 3.380   1.852   -1.637  1.00 0.00 ? 117 LEU A HD11 4  
ATOM   7901  H  HD12 . LEU A 1 117 ? 3.751   1.457   -3.332  1.00 0.00 ? 117 LEU A HD12 4  
ATOM   7902  H  HD13 . LEU A 1 117 ? 2.212   2.244   -2.904  1.00 0.00 ? 117 LEU A HD13 4  
ATOM   7903  H  HD21 . LEU A 1 117 ? 1.071   -1.211  -3.558  1.00 0.00 ? 117 LEU A HD21 4  
ATOM   7904  H  HD22 . LEU A 1 117 ? 0.919   0.483   -4.023  1.00 0.00 ? 117 LEU A HD22 4  
ATOM   7905  H  HD23 . LEU A 1 117 ? 2.370   -0.432  -4.486  1.00 0.00 ? 117 LEU A HD23 4  
ATOM   7906  N  N    . TYR A 1 118 ? 4.495   -3.388  -0.109  1.00 0.00 ? 118 TYR A N    4  
ATOM   7907  C  CA   . TYR A 1 118 ? 5.411   -4.501  0.139   1.00 0.00 ? 118 TYR A CA   4  
ATOM   7908  C  C    . TYR A 1 118 ? 4.637   -5.819  0.152   1.00 0.00 ? 118 TYR A C    4  
ATOM   7909  O  O    . TYR A 1 118 ? 5.036   -6.777  -0.508  1.00 0.00 ? 118 TYR A O    4  
ATOM   7910  C  CB   . TYR A 1 118 ? 6.153   -4.341  1.478   1.00 0.00 ? 118 TYR A CB   4  
ATOM   7911  C  CG   . TYR A 1 118 ? 6.956   -3.069  1.700   1.00 0.00 ? 118 TYR A CG   4  
ATOM   7912  C  CD1  . TYR A 1 118 ? 7.548   -2.364  0.630   1.00 0.00 ? 118 TYR A CD1  4  
ATOM   7913  C  CD2  . TYR A 1 118 ? 7.103   -2.586  3.015   1.00 0.00 ? 118 TYR A CD2  4  
ATOM   7914  C  CE1  . TYR A 1 118 ? 8.248   -1.168  0.871   1.00 0.00 ? 118 TYR A CE1  4  
ATOM   7915  C  CE2  . TYR A 1 118 ? 7.777   -1.379  3.260   1.00 0.00 ? 118 TYR A CE2  4  
ATOM   7916  C  CZ   . TYR A 1 118 ? 8.360   -0.666  2.189   1.00 0.00 ? 118 TYR A CZ   4  
ATOM   7917  O  OH   . TYR A 1 118 ? 9.031   0.494   2.440   1.00 0.00 ? 118 TYR A OH   4  
ATOM   7918  H  H    . TYR A 1 118 ? 4.410   -2.664  0.599   1.00 0.00 ? 118 TYR A H    4  
ATOM   7919  H  HA   . TYR A 1 118 ? 6.141   -4.544  -0.669  1.00 0.00 ? 118 TYR A HA   4  
ATOM   7920  H  HB2  . TYR A 1 118 ? 5.422   -4.419  2.283   1.00 0.00 ? 118 TYR A HB2  4  
ATOM   7921  H  HB3  . TYR A 1 118 ? 6.827   -5.190  1.593   1.00 0.00 ? 118 TYR A HB3  4  
ATOM   7922  H  HD1  . TYR A 1 118 ? 7.459   -2.725  -0.384  1.00 0.00 ? 118 TYR A HD1  4  
ATOM   7923  H  HD2  . TYR A 1 118 ? 6.676   -3.135  3.844   1.00 0.00 ? 118 TYR A HD2  4  
ATOM   7924  H  HE1  . TYR A 1 118 ? 8.686   -0.632  0.041   1.00 0.00 ? 118 TYR A HE1  4  
ATOM   7925  H  HE2  . TYR A 1 118 ? 7.838   -0.999  4.270   1.00 0.00 ? 118 TYR A HE2  4  
ATOM   7926  H  HH   . TYR A 1 118 ? 9.407   0.902   1.643   1.00 0.00 ? 118 TYR A HH   4  
ATOM   7927  N  N    . TRP A 1 119 ? 3.512   -5.866  0.868   1.00 0.00 ? 119 TRP A N    4  
ATOM   7928  C  CA   . TRP A 1 119 ? 2.669   -7.044  0.975   1.00 0.00 ? 119 TRP A CA   4  
ATOM   7929  C  C    . TRP A 1 119 ? 2.080   -7.405  -0.388  1.00 0.00 ? 119 TRP A C    4  
ATOM   7930  O  O    . TRP A 1 119 ? 2.039   -8.581  -0.754  1.00 0.00 ? 119 TRP A O    4  
ATOM   7931  C  CB   . TRP A 1 119 ? 1.595   -6.735  2.016   1.00 0.00 ? 119 TRP A CB   4  
ATOM   7932  C  CG   . TRP A 1 119 ? 0.495   -7.730  2.155   1.00 0.00 ? 119 TRP A CG   4  
ATOM   7933  C  CD1  . TRP A 1 119 ? -0.727  -7.620  1.591   1.00 0.00 ? 119 TRP A CD1  4  
ATOM   7934  C  CD2  . TRP A 1 119 ? 0.490   -8.993  2.884   1.00 0.00 ? 119 TRP A CD2  4  
ATOM   7935  N  NE1  . TRP A 1 119 ? -1.526  -8.661  2.017   1.00 0.00 ? 119 TRP A NE1  4  
ATOM   7936  C  CE2  . TRP A 1 119 ? -0.817  -9.555  2.795   1.00 0.00 ? 119 TRP A CE2  4  
ATOM   7937  C  CE3  . TRP A 1 119 ? 1.462   -9.725  3.602   1.00 0.00 ? 119 TRP A CE3  4  
ATOM   7938  C  CZ2  . TRP A 1 119 ? -1.142  -10.780 3.397   1.00 0.00 ? 119 TRP A CZ2  4  
ATOM   7939  C  CZ3  . TRP A 1 119 ? 1.141   -10.952 4.215   1.00 0.00 ? 119 TRP A CZ3  4  
ATOM   7940  C  CH2  . TRP A 1 119 ? -0.159  -11.480 4.115   1.00 0.00 ? 119 TRP A CH2  4  
ATOM   7941  H  H    . TRP A 1 119 ? 3.186   -5.030  1.340   1.00 0.00 ? 119 TRP A H    4  
ATOM   7942  H  HA   . TRP A 1 119 ? 3.266   -7.886  1.324   1.00 0.00 ? 119 TRP A HA   4  
ATOM   7943  H  HB2  . TRP A 1 119 ? 2.086   -6.637  2.984   1.00 0.00 ? 119 TRP A HB2  4  
ATOM   7944  H  HB3  . TRP A 1 119 ? 1.141   -5.774  1.783   1.00 0.00 ? 119 TRP A HB3  4  
ATOM   7945  H  HD1  . TRP A 1 119 ? -1.031  -6.812  0.932   1.00 0.00 ? 119 TRP A HD1  4  
ATOM   7946  H  HE1  . TRP A 1 119 ? -2.501  -8.785  1.721   1.00 0.00 ? 119 TRP A HE1  4  
ATOM   7947  H  HE3  . TRP A 1 119 ? 2.465   -9.331  3.687   1.00 0.00 ? 119 TRP A HE3  4  
ATOM   7948  H  HZ2  . TRP A 1 119 ? -2.138  -11.180 3.299   1.00 0.00 ? 119 TRP A HZ2  4  
ATOM   7949  H  HZ3  . TRP A 1 119 ? 1.901   -11.494 4.764   1.00 0.00 ? 119 TRP A HZ3  4  
ATOM   7950  H  HH2  . TRP A 1 119 ? -0.397  -12.426 4.584   1.00 0.00 ? 119 TRP A HH2  4  
ATOM   7951  N  N    . LEU A 1 120 ? 1.703   -6.397  -1.178  1.00 0.00 ? 120 LEU A N    4  
ATOM   7952  C  CA   . LEU A 1 120 ? 1.189   -6.585  -2.523  1.00 0.00 ? 120 LEU A CA   4  
ATOM   7953  C  C    . LEU A 1 120 ? 2.198   -7.379  -3.366  1.00 0.00 ? 120 LEU A C    4  
ATOM   7954  O  O    . LEU A 1 120 ? 1.825   -8.317  -4.070  1.00 0.00 ? 120 LEU A O    4  
ATOM   7955  C  CB   . LEU A 1 120 ? 0.931   -5.211  -3.172  1.00 0.00 ? 120 LEU A CB   4  
ATOM   7956  C  CG   . LEU A 1 120 ? -0.175  -5.263  -4.236  1.00 0.00 ? 120 LEU A CG   4  
ATOM   7957  C  CD1  . LEU A 1 120 ? -1.538  -5.115  -3.553  1.00 0.00 ? 120 LEU A CD1  4  
ATOM   7958  C  CD2  . LEU A 1 120 ? 0.006   -4.131  -5.254  1.00 0.00 ? 120 LEU A CD2  4  
ATOM   7959  H  H    . LEU A 1 120 ? 1.701   -5.450  -0.808  1.00 0.00 ? 120 LEU A H    4  
ATOM   7960  H  HA   . LEU A 1 120 ? 0.250   -7.134  -2.416  1.00 0.00 ? 120 LEU A HA   4  
ATOM   7961  H  HB2  . LEU A 1 120 ? 0.646   -4.482  -2.416  1.00 0.00 ? 120 LEU A HB2  4  
ATOM   7962  H  HB3  . LEU A 1 120 ? 1.856   -4.857  -3.630  1.00 0.00 ? 120 LEU A HB3  4  
ATOM   7963  H  HG   . LEU A 1 120 ? -0.134  -6.213  -4.768  1.00 0.00 ? 120 LEU A HG   4  
ATOM   7964  H  HD11 . LEU A 1 120 ? -1.669  -5.892  -2.800  1.00 0.00 ? 120 LEU A HD11 4  
ATOM   7965  H  HD12 . LEU A 1 120 ? -1.610  -4.147  -3.058  1.00 0.00 ? 120 LEU A HD12 4  
ATOM   7966  H  HD13 . LEU A 1 120 ? -2.335  -5.196  -4.290  1.00 0.00 ? 120 LEU A HD13 4  
ATOM   7967  H  HD21 . LEU A 1 120 ? 0.964   -4.244  -5.763  1.00 0.00 ? 120 LEU A HD21 4  
ATOM   7968  H  HD22 . LEU A 1 120 ? -0.786  -4.176  -6.001  1.00 0.00 ? 120 LEU A HD22 4  
ATOM   7969  H  HD23 . LEU A 1 120 ? -0.020  -3.162  -4.755  1.00 0.00 ? 120 LEU A HD23 4  
ATOM   7970  N  N    . ALA A 1 121 ? 3.485   -7.017  -3.271  1.00 0.00 ? 121 ALA A N    4  
ATOM   7971  C  CA   . ALA A 1 121 ? 4.570   -7.677  -3.992  1.00 0.00 ? 121 ALA A CA   4  
ATOM   7972  C  C    . ALA A 1 121 ? 4.961   -9.025  -3.369  1.00 0.00 ? 121 ALA A C    4  
ATOM   7973  O  O    . ALA A 1 121 ? 5.466   -9.898  -4.075  1.00 0.00 ? 121 ALA A O    4  
ATOM   7974  C  CB   . ALA A 1 121 ? 5.788   -6.746  -4.023  1.00 0.00 ? 121 ALA A CB   4  
ATOM   7975  H  H    . ALA A 1 121 ? 3.727   -6.232  -2.678  1.00 0.00 ? 121 ALA A H    4  
ATOM   7976  H  HA   . ALA A 1 121 ? 4.244   -7.857  -5.018  1.00 0.00 ? 121 ALA A HA   4  
ATOM   7977  H  HB1  . ALA A 1 121 ? 6.147   -6.560  -3.010  1.00 0.00 ? 121 ALA A HB1  4  
ATOM   7978  H  HB2  . ALA A 1 121 ? 6.588   -7.211  -4.601  1.00 0.00 ? 121 ALA A HB2  4  
ATOM   7979  H  HB3  . ALA A 1 121 ? 5.520   -5.798  -4.491  1.00 0.00 ? 121 ALA A HB3  4  
ATOM   7980  N  N    . ARG A 1 122 ? 4.748   -9.205  -2.059  1.00 0.00 ? 122 ARG A N    4  
ATOM   7981  C  CA   . ARG A 1 122 ? 5.169   -10.387 -1.298  1.00 0.00 ? 122 ARG A CA   4  
ATOM   7982  C  C    . ARG A 1 122 ? 4.534   -11.679 -1.824  1.00 0.00 ? 122 ARG A C    4  
ATOM   7983  O  O    . ARG A 1 122 ? 5.124   -12.746 -1.648  1.00 0.00 ? 122 ARG A O    4  
ATOM   7984  C  CB   . ARG A 1 122 ? 4.834   -10.147 0.192   1.00 0.00 ? 122 ARG A CB   4  
ATOM   7985  C  CG   . ARG A 1 122 ? 5.309   -11.187 1.220   1.00 0.00 ? 122 ARG A CG   4  
ATOM   7986  C  CD   . ARG A 1 122 ? 6.828   -11.387 1.246   1.00 0.00 ? 122 ARG A CD   4  
ATOM   7987  N  NE   . ARG A 1 122 ? 7.267   -12.319 0.199   1.00 0.00 ? 122 ARG A NE   4  
ATOM   7988  C  CZ   . ARG A 1 122 ? 8.527   -12.502 -0.195  1.00 0.00 ? 122 ARG A CZ   4  
ATOM   7989  N  NH1  . ARG A 1 122 ? 9.521   -11.788 0.319   1.00 0.00 ? 122 ARG A NH1  4  
ATOM   7990  N  NH2  . ARG A 1 122 ? 8.821   -13.388 -1.134  1.00 0.00 ? 122 ARG A NH2  4  
ATOM   7991  H  H    . ARG A 1 122 ? 4.372   -8.422  -1.533  1.00 0.00 ? 122 ARG A H    4  
ATOM   7992  H  HA   . ARG A 1 122 ? 6.251   -10.473 -1.418  1.00 0.00 ? 122 ARG A HA   4  
ATOM   7993  H  HB2  . ARG A 1 122 ? 5.257   -9.187  0.489   1.00 0.00 ? 122 ARG A HB2  4  
ATOM   7994  H  HB3  . ARG A 1 122 ? 3.753   -10.079 0.296   1.00 0.00 ? 122 ARG A HB3  4  
ATOM   7995  H  HG2  . ARG A 1 122 ? 5.003   -10.832 2.205   1.00 0.00 ? 122 ARG A HG2  4  
ATOM   7996  H  HG3  . ARG A 1 122 ? 4.810   -12.142 1.050   1.00 0.00 ? 122 ARG A HG3  4  
ATOM   7997  H  HD2  . ARG A 1 122 ? 7.325   -10.422 1.126   1.00 0.00 ? 122 ARG A HD2  4  
ATOM   7998  H  HD3  . ARG A 1 122 ? 7.109   -11.805 2.213   1.00 0.00 ? 122 ARG A HD3  4  
ATOM   7999  H  HE   . ARG A 1 122 ? 6.527   -12.832 -0.277  1.00 0.00 ? 122 ARG A HE   4  
ATOM   8000  H  HH11 . ARG A 1 122 ? 9.366   -11.122 1.063   1.00 0.00 ? 122 ARG A HH11 4  
ATOM   8001  H  HH12 . ARG A 1 122 ? 10.448  -11.916 -0.077  1.00 0.00 ? 122 ARG A HH12 4  
ATOM   8002  H  HH21 . ARG A 1 122 ? 8.116   -13.976 -1.558  1.00 0.00 ? 122 ARG A HH21 4  
ATOM   8003  H  HH22 . ARG A 1 122 ? 9.802   -13.491 -1.409  1.00 0.00 ? 122 ARG A HH22 4  
ATOM   8004  N  N    . GLY A 1 123 ? 3.360   -11.590 -2.452  1.00 0.00 ? 123 GLY A N    4  
ATOM   8005  C  CA   . GLY A 1 123 ? 2.634   -12.744 -2.986  1.00 0.00 ? 123 GLY A CA   4  
ATOM   8006  C  C    . GLY A 1 123 ? 1.365   -13.026 -2.181  1.00 0.00 ? 123 GLY A C    4  
ATOM   8007  O  O    . GLY A 1 123 ? 0.994   -14.185 -1.990  1.00 0.00 ? 123 GLY A O    4  
ATOM   8008  H  H    . GLY A 1 123 ? 2.918   -10.678 -2.502  1.00 0.00 ? 123 GLY A H    4  
ATOM   8009  H  HA2  . GLY A 1 123 ? 2.350   -12.525 -4.016  1.00 0.00 ? 123 GLY A HA2  4  
ATOM   8010  H  HA3  . GLY A 1 123 ? 3.267   -13.632 -2.986  1.00 0.00 ? 123 GLY A HA3  4  
ATOM   8011  N  N    . TYR A 1 124 ? 0.745   -11.968 -1.651  1.00 0.00 ? 124 TYR A N    4  
ATOM   8012  C  CA   . TYR A 1 124 ? -0.478  -12.001 -0.860  1.00 0.00 ? 124 TYR A CA   4  
ATOM   8013  C  C    . TYR A 1 124 ? -1.682  -12.636 -1.576  1.00 0.00 ? 124 TYR A C    4  
ATOM   8014  O  O    . TYR A 1 124 ? -1.667  -12.856 -2.791  1.00 0.00 ? 124 TYR A O    4  
ATOM   8015  C  CB   . TYR A 1 124 ? -0.826  -10.567 -0.447  1.00 0.00 ? 124 TYR A CB   4  
ATOM   8016  C  CG   . TYR A 1 124 ? -1.499  -9.697  -1.505  1.00 0.00 ? 124 TYR A CG   4  
ATOM   8017  C  CD1  . TYR A 1 124 ? -0.962  -9.535  -2.798  1.00 0.00 ? 124 TYR A CD1  4  
ATOM   8018  C  CD2  . TYR A 1 124 ? -2.711  -9.059  -1.190  1.00 0.00 ? 124 TYR A CD2  4  
ATOM   8019  C  CE1  . TYR A 1 124 ? -1.664  -8.811  -3.777  1.00 0.00 ? 124 TYR A CE1  4  
ATOM   8020  C  CE2  . TYR A 1 124 ? -3.414  -8.323  -2.150  1.00 0.00 ? 124 TYR A CE2  4  
ATOM   8021  C  CZ   . TYR A 1 124 ? -2.917  -8.230  -3.469  1.00 0.00 ? 124 TYR A CZ   4  
ATOM   8022  O  OH   . TYR A 1 124 ? -3.642  -7.580  -4.423  1.00 0.00 ? 124 TYR A OH   4  
ATOM   8023  H  H    . TYR A 1 124 ? 1.138   -11.054 -1.810  1.00 0.00 ? 124 TYR A H    4  
ATOM   8024  H  HA   . TYR A 1 124 ? -0.269  -12.575 0.045   1.00 0.00 ? 124 TYR A HA   4  
ATOM   8025  H  HB2  . TYR A 1 124 ? -1.518  -10.666 0.386   1.00 0.00 ? 124 TYR A HB2  4  
ATOM   8026  H  HB3  . TYR A 1 124 ? 0.063   -10.065 -0.070  1.00 0.00 ? 124 TYR A HB3  4  
ATOM   8027  H  HD1  . TYR A 1 124 ? -0.013  -9.971  -3.064  1.00 0.00 ? 124 TYR A HD1  4  
ATOM   8028  H  HD2  . TYR A 1 124 ? -3.122  -9.135  -0.201  1.00 0.00 ? 124 TYR A HD2  4  
ATOM   8029  H  HE1  . TYR A 1 124 ? -1.231  -8.705  -4.761  1.00 0.00 ? 124 TYR A HE1  4  
ATOM   8030  H  HE2  . TYR A 1 124 ? -4.332  -7.839  -1.858  1.00 0.00 ? 124 TYR A HE2  4  
ATOM   8031  H  HH   . TYR A 1 124 ? -3.225  -7.591  -5.298  1.00 0.00 ? 124 TYR A HH   4  
ATOM   8032  N  N    . LYS A 1 125 ? -2.761  -12.857 -0.810  1.00 0.00 ? 125 LYS A N    4  
ATOM   8033  C  CA   . LYS A 1 125 ? -4.044  -13.376 -1.300  1.00 0.00 ? 125 LYS A CA   4  
ATOM   8034  C  C    . LYS A 1 125 ? -5.246  -12.595 -0.746  1.00 0.00 ? 125 LYS A C    4  
ATOM   8035  O  O    . LYS A 1 125 ? -6.370  -12.818 -1.201  1.00 0.00 ? 125 LYS A O    4  
ATOM   8036  C  CB   . LYS A 1 125 ? -4.183  -14.864 -0.923  1.00 0.00 ? 125 LYS A CB   4  
ATOM   8037  C  CG   . LYS A 1 125 ? -3.043  -15.737 -1.466  1.00 0.00 ? 125 LYS A CG   4  
ATOM   8038  C  CD   . LYS A 1 125 ? -3.279  -17.221 -1.156  1.00 0.00 ? 125 LYS A CD   4  
ATOM   8039  C  CE   . LYS A 1 125 ? -2.114  -18.059 -1.703  1.00 0.00 ? 125 LYS A CE   4  
ATOM   8040  N  NZ   . LYS A 1 125 ? -2.289  -19.509 -1.435  1.00 0.00 ? 125 LYS A NZ   4  
ATOM   8041  H  H    . LYS A 1 125 ? -2.686  -12.680 0.182   1.00 0.00 ? 125 LYS A H    4  
ATOM   8042  H  HA   . LYS A 1 125 ? -4.071  -13.289 -2.387  1.00 0.00 ? 125 LYS A HA   4  
ATOM   8043  H  HB2  . LYS A 1 125 ? -4.213  -14.956 0.164   1.00 0.00 ? 125 LYS A HB2  4  
ATOM   8044  H  HB3  . LYS A 1 125 ? -5.127  -15.238 -1.322  1.00 0.00 ? 125 LYS A HB3  4  
ATOM   8045  H  HG2  . LYS A 1 125 ? -2.972  -15.599 -2.546  1.00 0.00 ? 125 LYS A HG2  4  
ATOM   8046  H  HG3  . LYS A 1 125 ? -2.105  -15.426 -1.004  1.00 0.00 ? 125 LYS A HG3  4  
ATOM   8047  H  HD2  . LYS A 1 125 ? -3.352  -17.356 -0.076  1.00 0.00 ? 125 LYS A HD2  4  
ATOM   8048  H  HD3  . LYS A 1 125 ? -4.212  -17.542 -1.622  1.00 0.00 ? 125 LYS A HD3  4  
ATOM   8049  H  HE2  . LYS A 1 125 ? -2.039  -17.896 -2.781  1.00 0.00 ? 125 LYS A HE2  4  
ATOM   8050  H  HE3  . LYS A 1 125 ? -1.186  -17.714 -1.243  1.00 0.00 ? 125 LYS A HE3  4  
ATOM   8051  H  HZ1  . LYS A 1 125 ? -3.128  -19.864 -1.868  1.00 0.00 ? 125 LYS A HZ1  4  
ATOM   8052  H  HZ2  . LYS A 1 125 ? -1.511  -20.035 -1.805  1.00 0.00 ? 125 LYS A HZ2  4  
ATOM   8053  H  HZ3  . LYS A 1 125 ? -2.338  -19.696 -0.445  1.00 0.00 ? 125 LYS A HZ3  4  
ATOM   8054  N  N    . PHE A 1 126 ? -5.038  -11.714 0.234   1.00 0.00 ? 126 PHE A N    4  
ATOM   8055  C  CA   . PHE A 1 126 ? -6.066  -11.007 0.993   1.00 0.00 ? 126 PHE A CA   4  
ATOM   8056  C  C    . PHE A 1 126 ? -5.413  -9.776  1.627   1.00 0.00 ? 126 PHE A C    4  
ATOM   8057  O  O    . PHE A 1 126 ? -4.172  -9.785  1.799   1.00 0.00 ? 126 PHE A O    4  
ATOM   8058  C  CB   . PHE A 1 126 ? -6.698  -11.923 2.068   1.00 0.00 ? 126 PHE A CB   4  
ATOM   8059  C  CG   . PHE A 1 126 ? -5.834  -13.074 2.569   1.00 0.00 ? 126 PHE A CG   4  
ATOM   8060  C  CD1  . PHE A 1 126 ? -4.589  -12.825 3.176   1.00 0.00 ? 126 PHE A CD1  4  
ATOM   8061  C  CD2  . PHE A 1 126 ? -6.256  -14.404 2.383   1.00 0.00 ? 126 PHE A CD2  4  
ATOM   8062  C  CE1  . PHE A 1 126 ? -3.754  -13.891 3.555   1.00 0.00 ? 126 PHE A CE1  4  
ATOM   8063  C  CE2  . PHE A 1 126 ? -5.435  -15.473 2.784   1.00 0.00 ? 126 PHE A CE2  4  
ATOM   8064  C  CZ   . PHE A 1 126 ? -4.177  -15.218 3.358   1.00 0.00 ? 126 PHE A CZ   4  
ATOM   8065  O  OXT  . PHE A 1 126 ? -6.148  -8.812  1.923   1.00 0.00 ? 126 PHE A OXT  4  
ATOM   8066  H  H    . PHE A 1 126 ? -4.098  -11.507 0.537   1.00 0.00 ? 126 PHE A H    4  
ATOM   8067  H  HA   . PHE A 1 126 ? -6.848  -10.670 0.311   1.00 0.00 ? 126 PHE A HA   4  
ATOM   8068  H  HB2  . PHE A 1 126 ? -7.008  -11.318 2.921   1.00 0.00 ? 126 PHE A HB2  4  
ATOM   8069  H  HB3  . PHE A 1 126 ? -7.610  -12.340 1.640   1.00 0.00 ? 126 PHE A HB3  4  
ATOM   8070  H  HD1  . PHE A 1 126 ? -4.267  -11.807 3.335   1.00 0.00 ? 126 PHE A HD1  4  
ATOM   8071  H  HD2  . PHE A 1 126 ? -7.207  -14.606 1.914   1.00 0.00 ? 126 PHE A HD2  4  
ATOM   8072  H  HE1  . PHE A 1 126 ? -2.782  -13.687 3.981   1.00 0.00 ? 126 PHE A HE1  4  
ATOM   8073  H  HE2  . PHE A 1 126 ? -5.763  -16.492 2.631   1.00 0.00 ? 126 PHE A HE2  4  
ATOM   8074  H  HZ   . PHE A 1 126 ? -3.536  -16.044 3.637   1.00 0.00 ? 126 PHE A HZ   4  
HETATM 8075  CA CA   . CA  B 2 .   ? -7.143  6.105   11.781  1.00 0.00 ? 127 CA  A CA   4  
HETATM 8076  CA CA   . CA  C 2 .   ? -10.407 -18.117 12.334  1.00 0.00 ? 128 CA  A CA   4  
ATOM   8077  N  N    . MET A 1 1   ? 9.895   -15.615 -4.364  1.00 0.00 ? 1   MET A N    5  
ATOM   8078  C  CA   . MET A 1 1   ? 9.058   -14.461 -3.947  1.00 0.00 ? 1   MET A CA   5  
ATOM   8079  C  C    . MET A 1 1   ? 9.835   -13.152 -4.131  1.00 0.00 ? 1   MET A C    5  
ATOM   8080  O  O    . MET A 1 1   ? 11.068  -13.144 -4.083  1.00 0.00 ? 1   MET A O    5  
ATOM   8081  C  CB   . MET A 1 1   ? 8.564   -14.582 -2.487  1.00 0.00 ? 1   MET A CB   5  
ATOM   8082  C  CG   . MET A 1 1   ? 7.503   -15.673 -2.285  1.00 0.00 ? 1   MET A CG   5  
ATOM   8083  S  SD   . MET A 1 1   ? 6.809   -15.711 -0.607  1.00 0.00 ? 1   MET A SD   5  
ATOM   8084  C  CE   . MET A 1 1   ? 5.625   -17.072 -0.797  1.00 0.00 ? 1   MET A CE   5  
ATOM   8085  H  H1   . MET A 1 1   ? 9.387   -16.481 -4.282  1.00 0.00 ? 1   MET A H1   5  
ATOM   8086  H  H2   . MET A 1 1   ? 10.182  -15.498 -5.323  1.00 0.00 ? 1   MET A H2   5  
ATOM   8087  H  H3   . MET A 1 1   ? 10.726  -15.659 -3.795  1.00 0.00 ? 1   MET A H3   5  
ATOM   8088  H  HA   . MET A 1 1   ? 8.184   -14.422 -4.600  1.00 0.00 ? 1   MET A HA   5  
ATOM   8089  H  HB2  . MET A 1 1   ? 9.408   -14.771 -1.821  1.00 0.00 ? 1   MET A HB2  5  
ATOM   8090  H  HB3  . MET A 1 1   ? 8.113   -13.633 -2.190  1.00 0.00 ? 1   MET A HB3  5  
ATOM   8091  H  HG2  . MET A 1 1   ? 6.685   -15.504 -2.986  1.00 0.00 ? 1   MET A HG2  5  
ATOM   8092  H  HG3  . MET A 1 1   ? 7.942   -16.648 -2.495  1.00 0.00 ? 1   MET A HG3  5  
ATOM   8093  H  HE1  . MET A 1 1   ? 4.898   -16.822 -1.570  1.00 0.00 ? 1   MET A HE1  5  
ATOM   8094  H  HE2  . MET A 1 1   ? 6.153   -17.983 -1.079  1.00 0.00 ? 1   MET A HE2  5  
ATOM   8095  H  HE3  . MET A 1 1   ? 5.103   -17.236 0.146   1.00 0.00 ? 1   MET A HE3  5  
ATOM   8096  N  N    . ALA A 1 2   ? 9.120   -12.028 -4.303  1.00 0.00 ? 2   ALA A N    5  
ATOM   8097  C  CA   . ALA A 1 2   ? 9.709   -10.707 -4.553  1.00 0.00 ? 2   ALA A CA   5  
ATOM   8098  C  C    . ALA A 1 2   ? 10.713  -10.267 -3.478  1.00 0.00 ? 2   ALA A C    5  
ATOM   8099  O  O    . ALA A 1 2   ? 11.607  -9.476  -3.781  1.00 0.00 ? 2   ALA A O    5  
ATOM   8100  C  CB   . ALA A 1 2   ? 8.595   -9.660  -4.700  1.00 0.00 ? 2   ALA A CB   5  
ATOM   8101  H  H    . ALA A 1 2   ? 8.112   -12.095 -4.354  1.00 0.00 ? 2   ALA A H    5  
ATOM   8102  H  HA   . ALA A 1 2   ? 10.249  -10.752 -5.498  1.00 0.00 ? 2   ALA A HA   5  
ATOM   8103  H  HB1  . ALA A 1 2   ? 9.033   -8.697  -4.967  1.00 0.00 ? 2   ALA A HB1  5  
ATOM   8104  H  HB2  . ALA A 1 2   ? 7.902   -9.956  -5.489  1.00 0.00 ? 2   ALA A HB2  5  
ATOM   8105  H  HB3  . ALA A 1 2   ? 8.052   -9.546  -3.762  1.00 0.00 ? 2   ALA A HB3  5  
ATOM   8106  N  N    . SER A 1 3   ? 10.577  -10.771 -2.242  1.00 0.00 ? 3   SER A N    5  
ATOM   8107  C  CA   . SER A 1 3   ? 11.438  -10.438 -1.102  1.00 0.00 ? 3   SER A CA   5  
ATOM   8108  C  C    . SER A 1 3   ? 11.533  -8.914  -0.870  1.00 0.00 ? 3   SER A C    5  
ATOM   8109  O  O    . SER A 1 3   ? 12.564  -8.388  -0.445  1.00 0.00 ? 3   SER A O    5  
ATOM   8110  C  CB   . SER A 1 3   ? 12.800  -11.131 -1.273  1.00 0.00 ? 3   SER A CB   5  
ATOM   8111  O  OG   . SER A 1 3   ? 12.639  -12.511 -1.581  1.00 0.00 ? 3   SER A OG   5  
ATOM   8112  H  H    . SER A 1 3   ? 9.828   -11.421 -2.063  1.00 0.00 ? 3   SER A H    5  
ATOM   8113  H  HA   . SER A 1 3   ? 10.967  -10.861 -0.216  1.00 0.00 ? 3   SER A HA   5  
ATOM   8114  H  HB2  . SER A 1 3   ? 13.357  -10.648 -2.077  1.00 0.00 ? 3   SER A HB2  5  
ATOM   8115  H  HB3  . SER A 1 3   ? 13.369  -11.032 -0.348  1.00 0.00 ? 3   SER A HB3  5  
ATOM   8116  H  HG   . SER A 1 3   ? 12.195  -12.574 -2.444  1.00 0.00 ? 3   SER A HG   5  
ATOM   8117  N  N    . VAL A 1 4   ? 10.465  -8.198  -1.233  1.00 0.00 ? 4   VAL A N    5  
ATOM   8118  C  CA   . VAL A 1 4   ? 10.392  -6.742  -1.294  1.00 0.00 ? 4   VAL A CA   5  
ATOM   8119  C  C    . VAL A 1 4   ? 10.252  -6.107  0.104   1.00 0.00 ? 4   VAL A C    5  
ATOM   8120  O  O    . VAL A 1 4   ? 10.551  -4.923  0.268   1.00 0.00 ? 4   VAL A O    5  
ATOM   8121  C  CB   . VAL A 1 4   ? 9.266   -6.374  -2.291  1.00 0.00 ? 4   VAL A CB   5  
ATOM   8122  C  CG1  . VAL A 1 4   ? 7.902   -6.970  -1.907  1.00 0.00 ? 4   VAL A CG1  5  
ATOM   8123  C  CG2  . VAL A 1 4   ? 9.117   -4.867  -2.530  1.00 0.00 ? 4   VAL A CG2  5  
ATOM   8124  H  H    . VAL A 1 4   ? 9.666   -8.704  -1.581  1.00 0.00 ? 4   VAL A H    5  
ATOM   8125  H  HA   . VAL A 1 4   ? 11.333  -6.385  -1.716  1.00 0.00 ? 4   VAL A HA   5  
ATOM   8126  H  HB   . VAL A 1 4   ? 9.540   -6.811  -3.252  1.00 0.00 ? 4   VAL A HB   5  
ATOM   8127  H  HG11 . VAL A 1 4   ? 7.165   -6.707  -2.664  1.00 0.00 ? 4   VAL A HG11 5  
ATOM   8128  H  HG12 . VAL A 1 4   ? 7.941   -8.057  -1.854  1.00 0.00 ? 4   VAL A HG12 5  
ATOM   8129  H  HG13 . VAL A 1 4   ? 7.577   -6.585  -0.943  1.00 0.00 ? 4   VAL A HG13 5  
ATOM   8130  H  HG21 . VAL A 1 4   ? 10.081  -4.441  -2.810  1.00 0.00 ? 4   VAL A HG21 5  
ATOM   8131  H  HG22 . VAL A 1 4   ? 8.409   -4.689  -3.340  1.00 0.00 ? 4   VAL A HG22 5  
ATOM   8132  H  HG23 . VAL A 1 4   ? 8.755   -4.373  -1.629  1.00 0.00 ? 4   VAL A HG23 5  
ATOM   8133  N  N    . GLU A 1 5   ? 9.830   -6.870  1.121   1.00 0.00 ? 5   GLU A N    5  
ATOM   8134  C  CA   . GLU A 1 5   ? 9.794   -6.412  2.509   1.00 0.00 ? 5   GLU A CA   5  
ATOM   8135  C  C    . GLU A 1 5   ? 11.197  -6.009  3.001   1.00 0.00 ? 5   GLU A C    5  
ATOM   8136  O  O    . GLU A 1 5   ? 12.210  -6.499  2.491   1.00 0.00 ? 5   GLU A O    5  
ATOM   8137  C  CB   . GLU A 1 5   ? 9.141   -7.471  3.421   1.00 0.00 ? 5   GLU A CB   5  
ATOM   8138  C  CG   . GLU A 1 5   ? 9.953   -8.759  3.665   1.00 0.00 ? 5   GLU A CG   5  
ATOM   8139  C  CD   . GLU A 1 5   ? 10.169  -9.632  2.415   1.00 0.00 ? 5   GLU A CD   5  
ATOM   8140  O  OE1  . GLU A 1 5   ? 9.295   -9.640  1.513   1.00 0.00 ? 5   GLU A OE1  5  
ATOM   8141  O  OE2  . GLU A 1 5   ? 11.201  -10.337 2.352   1.00 0.00 ? 5   GLU A OE2  5  
ATOM   8142  H  H    . GLU A 1 5   ? 9.617   -7.850  0.951   1.00 0.00 ? 5   GLU A H    5  
ATOM   8143  H  HA   . GLU A 1 5   ? 9.161   -5.523  2.535   1.00 0.00 ? 5   GLU A HA   5  
ATOM   8144  H  HB2  . GLU A 1 5   ? 8.970   -7.006  4.391   1.00 0.00 ? 5   GLU A HB2  5  
ATOM   8145  H  HB3  . GLU A 1 5   ? 8.162   -7.732  3.018   1.00 0.00 ? 5   GLU A HB3  5  
ATOM   8146  H  HG2  . GLU A 1 5   ? 10.917  -8.493  4.104   1.00 0.00 ? 5   GLU A HG2  5  
ATOM   8147  H  HG3  . GLU A 1 5   ? 9.422   -9.357  4.406   1.00 0.00 ? 5   GLU A HG3  5  
ATOM   8148  N  N    . ARG A 1 6   ? 11.263  -5.127  4.009   1.00 0.00 ? 6   ARG A N    5  
ATOM   8149  C  CA   . ARG A 1 6   ? 12.518  -4.615  4.550   1.00 0.00 ? 6   ARG A CA   5  
ATOM   8150  C  C    . ARG A 1 6   ? 13.349  -5.758  5.135   1.00 0.00 ? 6   ARG A C    5  
ATOM   8151  O  O    . ARG A 1 6   ? 14.534  -5.871  4.827   1.00 0.00 ? 6   ARG A O    5  
ATOM   8152  C  CB   . ARG A 1 6   ? 12.178  -3.497  5.559   1.00 0.00 ? 6   ARG A CB   5  
ATOM   8153  C  CG   . ARG A 1 6   ? 13.365  -2.957  6.372   1.00 0.00 ? 6   ARG A CG   5  
ATOM   8154  C  CD   . ARG A 1 6   ? 13.476  -3.657  7.733   1.00 0.00 ? 6   ARG A CD   5  
ATOM   8155  N  NE   . ARG A 1 6   ? 14.680  -3.224  8.462   1.00 0.00 ? 6   ARG A NE   5  
ATOM   8156  C  CZ   . ARG A 1 6   ? 15.192  -3.789  9.564   1.00 0.00 ? 6   ARG A CZ   5  
ATOM   8157  N  NH1  . ARG A 1 6   ? 14.590  -4.811  10.169  1.00 0.00 ? 6   ARG A NH1  5  
ATOM   8158  N  NH2  . ARG A 1 6   ? 16.330  -3.319  10.066  1.00 0.00 ? 6   ARG A NH2  5  
ATOM   8159  H  H    . ARG A 1 6   ? 10.415  -4.777  4.429   1.00 0.00 ? 6   ARG A H    5  
ATOM   8160  H  HA   . ARG A 1 6   ? 13.092  -4.175  3.731   1.00 0.00 ? 6   ARG A HA   5  
ATOM   8161  H  HB2  . ARG A 1 6   ? 11.757  -2.664  4.993   1.00 0.00 ? 6   ARG A HB2  5  
ATOM   8162  H  HB3  . ARG A 1 6   ? 11.405  -3.844  6.247   1.00 0.00 ? 6   ARG A HB3  5  
ATOM   8163  H  HG2  . ARG A 1 6   ? 14.290  -3.077  5.805   1.00 0.00 ? 6   ARG A HG2  5  
ATOM   8164  H  HG3  . ARG A 1 6   ? 13.209  -1.892  6.550   1.00 0.00 ? 6   ARG A HG3  5  
ATOM   8165  H  HD2  . ARG A 1 6   ? 12.585  -3.428  8.320   1.00 0.00 ? 6   ARG A HD2  5  
ATOM   8166  H  HD3  . ARG A 1 6   ? 13.511  -4.730  7.575   1.00 0.00 ? 6   ARG A HD3  5  
ATOM   8167  H  HE   . ARG A 1 6   ? 15.167  -2.432  8.061   1.00 0.00 ? 6   ARG A HE   5  
ATOM   8168  H  HH11 . ARG A 1 6   ? 13.692  -5.175  9.851   1.00 0.00 ? 6   ARG A HH11 5  
ATOM   8169  H  HH12 . ARG A 1 6   ? 14.990  -5.258  10.980  1.00 0.00 ? 6   ARG A HH12 5  
ATOM   8170  H  HH21 . ARG A 1 6   ? 16.816  -2.546  9.630   1.00 0.00 ? 6   ARG A HH21 5  
ATOM   8171  H  HH22 . ARG A 1 6   ? 16.754  -3.709  10.896  1.00 0.00 ? 6   ARG A HH22 5  
ATOM   8172  N  N    . ASP A 1 7   ? 12.725  -6.598  5.962   1.00 0.00 ? 7   ASP A N    5  
ATOM   8173  C  CA   . ASP A 1 7   ? 13.291  -7.786  6.594   1.00 0.00 ? 7   ASP A CA   5  
ATOM   8174  C  C    . ASP A 1 7   ? 12.118  -8.529  7.244   1.00 0.00 ? 7   ASP A C    5  
ATOM   8175  O  O    . ASP A 1 7   ? 10.997  -8.010  7.280   1.00 0.00 ? 7   ASP A O    5  
ATOM   8176  C  CB   . ASP A 1 7   ? 14.348  -7.399  7.653   1.00 0.00 ? 7   ASP A CB   5  
ATOM   8177  C  CG   . ASP A 1 7   ? 15.042  -8.602  8.315   1.00 0.00 ? 7   ASP A CG   5  
ATOM   8178  O  OD1  . ASP A 1 7   ? 15.209  -9.653  7.658   1.00 0.00 ? 7   ASP A OD1  5  
ATOM   8179  O  OD2  . ASP A 1 7   ? 15.425  -8.498  9.501   1.00 0.00 ? 7   ASP A OD2  5  
ATOM   8180  H  H    . ASP A 1 7   ? 11.737  -6.471  6.144   1.00 0.00 ? 7   ASP A H    5  
ATOM   8181  H  HA   . ASP A 1 7   ? 13.753  -8.420  5.836   1.00 0.00 ? 7   ASP A HA   5  
ATOM   8182  H  HB2  . ASP A 1 7   ? 15.119  -6.781  7.192   1.00 0.00 ? 7   ASP A HB2  5  
ATOM   8183  H  HB3  . ASP A 1 7   ? 13.862  -6.804  8.421   1.00 0.00 ? 7   ASP A HB3  5  
ATOM   8184  N  N    . GLU A 1 8   ? 12.362  -9.714  7.803   1.00 0.00 ? 8   GLU A N    5  
ATOM   8185  C  CA   . GLU A 1 8   ? 11.380  -10.533 8.511   1.00 0.00 ? 8   GLU A CA   5  
ATOM   8186  C  C    . GLU A 1 8   ? 10.723  -9.812  9.698   1.00 0.00 ? 8   GLU A C    5  
ATOM   8187  O  O    . GLU A 1 8   ? 9.719   -10.302 10.212  1.00 0.00 ? 8   GLU A O    5  
ATOM   8188  C  CB   . GLU A 1 8   ? 12.027  -11.850 8.971   1.00 0.00 ? 8   GLU A CB   5  
ATOM   8189  C  CG   . GLU A 1 8   ? 12.446  -12.741 7.792   1.00 0.00 ? 8   GLU A CG   5  
ATOM   8190  C  CD   . GLU A 1 8   ? 13.012  -14.088 8.277   1.00 0.00 ? 8   GLU A CD   5  
ATOM   8191  O  OE1  . GLU A 1 8   ? 14.232  -14.187 8.541   1.00 0.00 ? 8   GLU A OE1  5  
ATOM   8192  O  OE2  . GLU A 1 8   ? 12.246  -15.074 8.380   1.00 0.00 ? 8   GLU A OE2  5  
ATOM   8193  H  H    . GLU A 1 8   ? 13.311  -10.080 7.743   1.00 0.00 ? 8   GLU A H    5  
ATOM   8194  H  HA   . GLU A 1 8   ? 10.584  -10.774 7.808   1.00 0.00 ? 8   GLU A HA   5  
ATOM   8195  H  HB2  . GLU A 1 8   ? 12.898  -11.629 9.589   1.00 0.00 ? 8   GLU A HB2  5  
ATOM   8196  H  HB3  . GLU A 1 8   ? 11.308  -12.403 9.576   1.00 0.00 ? 8   GLU A HB3  5  
ATOM   8197  H  HG2  . GLU A 1 8   ? 11.577  -12.916 7.155   1.00 0.00 ? 8   GLU A HG2  5  
ATOM   8198  H  HG3  . GLU A 1 8   ? 13.199  -12.224 7.193   1.00 0.00 ? 8   GLU A HG3  5  
ATOM   8199  N  N    . THR A 1 9   ? 11.225  -8.652  10.132  1.00 0.00 ? 9   THR A N    5  
ATOM   8200  C  CA   . THR A 1 9   ? 10.556  -7.794  11.096  1.00 0.00 ? 9   THR A CA   5  
ATOM   8201  C  C    . THR A 1 9   ? 9.132   -7.463  10.637  1.00 0.00 ? 9   THR A C    5  
ATOM   8202  O  O    . THR A 1 9   ? 8.184   -7.523  11.422  1.00 0.00 ? 9   THR A O    5  
ATOM   8203  C  CB   . THR A 1 9   ? 11.391  -6.510  11.235  1.00 0.00 ? 9   THR A CB   5  
ATOM   8204  O  OG1  . THR A 1 9   ? 11.974  -6.096  10.001  1.00 0.00 ? 9   THR A OG1  5  
ATOM   8205  C  CG2  . THR A 1 9   ? 12.531  -6.704  12.236  1.00 0.00 ? 9   THR A CG2  5  
ATOM   8206  H  H    . THR A 1 9   ? 11.998  -8.218  9.642   1.00 0.00 ? 9   THR A H    5  
ATOM   8207  H  HA   . THR A 1 9   ? 10.493  -8.305  12.058  1.00 0.00 ? 9   THR A HA   5  
ATOM   8208  H  HB   . THR A 1 9   ? 10.732  -5.724  11.578  1.00 0.00 ? 9   THR A HB   5  
ATOM   8209  H  HG1  . THR A 1 9   ? 11.321  -5.555  9.528   1.00 0.00 ? 9   THR A HG1  5  
ATOM   8210  H  HG21 . THR A 1 9   ? 13.047  -5.756  12.386  1.00 0.00 ? 9   THR A HG21 5  
ATOM   8211  H  HG22 . THR A 1 9   ? 12.129  -7.032  13.195  1.00 0.00 ? 9   THR A HG22 5  
ATOM   8212  H  HG23 . THR A 1 9   ? 13.233  -7.451  11.865  1.00 0.00 ? 9   THR A HG23 5  
ATOM   8213  N  N    . ARG A 1 10  ? 8.976   -7.162  9.344   1.00 0.00 ? 10  ARG A N    5  
ATOM   8214  C  CA   . ARG A 1 10  ? 7.676   -6.884  8.738   1.00 0.00 ? 10  ARG A CA   5  
ATOM   8215  C  C    . ARG A 1 10  ? 6.767   -8.098  8.897   1.00 0.00 ? 10  ARG A C    5  
ATOM   8216  O  O    . ARG A 1 10  ? 5.617   -7.943  9.296   1.00 0.00 ? 10  ARG A O    5  
ATOM   8217  C  CB   . ARG A 1 10  ? 7.859   -6.512  7.253   1.00 0.00 ? 10  ARG A CB   5  
ATOM   8218  C  CG   . ARG A 1 10  ? 8.581   -5.166  7.044   1.00 0.00 ? 10  ARG A CG   5  
ATOM   8219  C  CD   . ARG A 1 10  ? 7.636   -3.976  7.252   1.00 0.00 ? 10  ARG A CD   5  
ATOM   8220  N  NE   . ARG A 1 10  ? 8.348   -2.684  7.294   1.00 0.00 ? 10  ARG A NE   5  
ATOM   8221  C  CZ   . ARG A 1 10  ? 7.769   -1.479  7.173   1.00 0.00 ? 10  ARG A CZ   5  
ATOM   8222  N  NH1  . ARG A 1 10  ? 6.478   -1.362  6.886   1.00 0.00 ? 10  ARG A NH1  5  
ATOM   8223  N  NH2  . ARG A 1 10  ? 8.482   -0.373  7.340   1.00 0.00 ? 10  ARG A NH2  5  
ATOM   8224  H  H    . ARG A 1 10  ? 9.792   -7.186  8.746   1.00 0.00 ? 10  ARG A H    5  
ATOM   8225  H  HA   . ARG A 1 10  ? 7.209   -6.055  9.270   1.00 0.00 ? 10  ARG A HA   5  
ATOM   8226  H  HB2  . ARG A 1 10  ? 8.431   -7.300  6.762   1.00 0.00 ? 10  ARG A HB2  5  
ATOM   8227  H  HB3  . ARG A 1 10  ? 6.881   -6.469  6.769   1.00 0.00 ? 10  ARG A HB3  5  
ATOM   8228  H  HG2  . ARG A 1 10  ? 9.431   -5.090  7.722   1.00 0.00 ? 10  ARG A HG2  5  
ATOM   8229  H  HG3  . ARG A 1 10  ? 8.956   -5.125  6.022   1.00 0.00 ? 10  ARG A HG3  5  
ATOM   8230  H  HD2  . ARG A 1 10  ? 6.929   -3.973  6.425   1.00 0.00 ? 10  ARG A HD2  5  
ATOM   8231  H  HD3  . ARG A 1 10  ? 7.086   -4.099  8.186   1.00 0.00 ? 10  ARG A HD3  5  
ATOM   8232  H  HE   . ARG A 1 10  ? 9.333   -2.727  7.520   1.00 0.00 ? 10  ARG A HE   5  
ATOM   8233  H  HH11 . ARG A 1 10  ? 5.895   -2.191  6.714   1.00 0.00 ? 10  ARG A HH11 5  
ATOM   8234  H  HH12 . ARG A 1 10  ? 6.044   -0.452  6.811   1.00 0.00 ? 10  ARG A HH12 5  
ATOM   8235  H  HH21 . ARG A 1 10  ? 9.466   -0.397  7.564   1.00 0.00 ? 10  ARG A HH21 5  
ATOM   8236  H  HH22 . ARG A 1 10  ? 8.029   0.550   7.292   1.00 0.00 ? 10  ARG A HH22 5  
ATOM   8237  N  N    . GLU A 1 11  ? 7.282   -9.304  8.654   1.00 0.00 ? 11  GLU A N    5  
ATOM   8238  C  CA   . GLU A 1 11  ? 6.491   -10.524 8.770   1.00 0.00 ? 11  GLU A CA   5  
ATOM   8239  C  C    . GLU A 1 11  ? 6.052   -10.753 10.216  1.00 0.00 ? 11  GLU A C    5  
ATOM   8240  O  O    . GLU A 1 11  ? 4.905   -11.135 10.446  1.00 0.00 ? 11  GLU A O    5  
ATOM   8241  C  CB   . GLU A 1 11  ? 7.264   -11.742 8.237   1.00 0.00 ? 11  GLU A CB   5  
ATOM   8242  C  CG   . GLU A 1 11  ? 7.764   -11.564 6.797   1.00 0.00 ? 11  GLU A CG   5  
ATOM   8243  C  CD   . GLU A 1 11  ? 6.670   -11.058 5.848   1.00 0.00 ? 11  GLU A CD   5  
ATOM   8244  O  OE1  . GLU A 1 11  ? 5.671   -11.771 5.608   1.00 0.00 ? 11  GLU A OE1  5  
ATOM   8245  O  OE2  . GLU A 1 11  ? 6.822   -9.949  5.295   1.00 0.00 ? 11  GLU A OE2  5  
ATOM   8246  H  H    . GLU A 1 11  ? 8.237   -9.379  8.346   1.00 0.00 ? 11  GLU A H    5  
ATOM   8247  H  HA   . GLU A 1 11  ? 5.587   -10.401 8.174   1.00 0.00 ? 11  GLU A HA   5  
ATOM   8248  H  HB2  . GLU A 1 11  ? 8.119   -11.947 8.880   1.00 0.00 ? 11  GLU A HB2  5  
ATOM   8249  H  HB3  . GLU A 1 11  ? 6.604   -12.609 8.271   1.00 0.00 ? 11  GLU A HB3  5  
ATOM   8250  H  HG2  . GLU A 1 11  ? 8.595   -10.856 6.797   1.00 0.00 ? 11  GLU A HG2  5  
ATOM   8251  H  HG3  . GLU A 1 11  ? 8.148   -12.519 6.436   1.00 0.00 ? 11  GLU A HG3  5  
ATOM   8252  N  N    . HIS A 1 12  ? 6.922   -10.472 11.193  1.00 0.00 ? 12  HIS A N    5  
ATOM   8253  C  CA   . HIS A 1 12  ? 6.561   -10.576 12.603  1.00 0.00 ? 12  HIS A CA   5  
ATOM   8254  C  C    . HIS A 1 12  ? 5.452   -9.579  12.947  1.00 0.00 ? 12  HIS A C    5  
ATOM   8255  O  O    . HIS A 1 12  ? 4.495   -9.957  13.623  1.00 0.00 ? 12  HIS A O    5  
ATOM   8256  C  CB   . HIS A 1 12  ? 7.784   -10.375 13.510  1.00 0.00 ? 12  HIS A CB   5  
ATOM   8257  C  CG   . HIS A 1 12  ? 8.732   -11.551 13.516  1.00 0.00 ? 12  HIS A CG   5  
ATOM   8258  N  ND1  . HIS A 1 12  ? 9.605   -11.908 12.513  1.00 0.00 ? 12  HIS A ND1  5  
ATOM   8259  C  CD2  . HIS A 1 12  ? 8.884   -12.469 14.522  1.00 0.00 ? 12  HIS A CD2  5  
ATOM   8260  C  CE1  . HIS A 1 12  ? 10.266  -13.010 12.902  1.00 0.00 ? 12  HIS A CE1  5  
ATOM   8261  N  NE2  . HIS A 1 12  ? 9.862   -13.395 14.128  1.00 0.00 ? 12  HIS A NE2  5  
ATOM   8262  H  H    . HIS A 1 12  ? 7.855   -10.159 10.952  1.00 0.00 ? 12  HIS A H    5  
ATOM   8263  H  HA   . HIS A 1 12  ? 6.167   -11.578 12.784  1.00 0.00 ? 12  HIS A HA   5  
ATOM   8264  H  HB2  . HIS A 1 12  ? 8.324   -9.475  13.216  1.00 0.00 ? 12  HIS A HB2  5  
ATOM   8265  H  HB3  . HIS A 1 12  ? 7.431   -10.225 14.532  1.00 0.00 ? 12  HIS A HB3  5  
ATOM   8266  H  HD1  . HIS A 1 12  ? 9.723   -11.424 11.623  1.00 0.00 ? 12  HIS A HD1  5  
ATOM   8267  H  HD2  . HIS A 1 12  ? 8.340   -12.474 15.459  1.00 0.00 ? 12  HIS A HD2  5  
ATOM   8268  H  HE1  . HIS A 1 12  ? 11.018  -13.516 12.306  1.00 0.00 ? 12  HIS A HE1  5  
ATOM   8269  N  N    . ARG A 1 13  ? 5.529   -8.328  12.476  1.00 0.00 ? 13  ARG A N    5  
ATOM   8270  C  CA   . ARG A 1 13  ? 4.479   -7.336  12.724  1.00 0.00 ? 13  ARG A CA   5  
ATOM   8271  C  C    . ARG A 1 13  ? 3.162   -7.770  12.084  1.00 0.00 ? 13  ARG A C    5  
ATOM   8272  O  O    . ARG A 1 13  ? 2.123   -7.690  12.736  1.00 0.00 ? 13  ARG A O    5  
ATOM   8273  C  CB   . ARG A 1 13  ? 4.906   -5.951  12.202  1.00 0.00 ? 13  ARG A CB   5  
ATOM   8274  C  CG   . ARG A 1 13  ? 6.045   -5.300  13.005  1.00 0.00 ? 13  ARG A CG   5  
ATOM   8275  C  CD   . ARG A 1 13  ? 5.592   -4.849  14.399  1.00 0.00 ? 13  ARG A CD   5  
ATOM   8276  N  NE   . ARG A 1 13  ? 6.686   -4.208  15.146  1.00 0.00 ? 13  ARG A NE   5  
ATOM   8277  C  CZ   . ARG A 1 13  ? 6.572   -3.661  16.364  1.00 0.00 ? 13  ARG A CZ   5  
ATOM   8278  N  NH1  . ARG A 1 13  ? 5.403   -3.650  16.998  1.00 0.00 ? 13  ARG A NH1  5  
ATOM   8279  N  NH2  . ARG A 1 13  ? 7.639   -3.122  16.945  1.00 0.00 ? 13  ARG A NH2  5  
ATOM   8280  H  H    . ARG A 1 13  ? 6.339   -8.052  11.924  1.00 0.00 ? 13  ARG A H    5  
ATOM   8281  H  HA   . ARG A 1 13  ? 4.301   -7.279  13.799  1.00 0.00 ? 13  ARG A HA   5  
ATOM   8282  H  HB2  . ARG A 1 13  ? 5.221   -6.044  11.162  1.00 0.00 ? 13  ARG A HB2  5  
ATOM   8283  H  HB3  . ARG A 1 13  ? 4.043   -5.283  12.224  1.00 0.00 ? 13  ARG A HB3  5  
ATOM   8284  H  HG2  . ARG A 1 13  ? 6.875   -5.998  13.103  1.00 0.00 ? 13  ARG A HG2  5  
ATOM   8285  H  HG3  . ARG A 1 13  ? 6.395   -4.426  12.454  1.00 0.00 ? 13  ARG A HG3  5  
ATOM   8286  H  HD2  . ARG A 1 13  ? 4.772   -4.139  14.288  1.00 0.00 ? 13  ARG A HD2  5  
ATOM   8287  H  HD3  . ARG A 1 13  ? 5.240   -5.711  14.966  1.00 0.00 ? 13  ARG A HD3  5  
ATOM   8288  H  HE   . ARG A 1 13  ? 7.589   -4.199  14.690  1.00 0.00 ? 13  ARG A HE   5  
ATOM   8289  H  HH11 . ARG A 1 13  ? 4.561   -4.052  16.562  1.00 0.00 ? 13  ARG A HH11 5  
ATOM   8290  H  HH12 . ARG A 1 13  ? 5.290   -3.244  17.915  1.00 0.00 ? 13  ARG A HH12 5  
ATOM   8291  H  HH21 . ARG A 1 13  ? 8.540   -3.115  16.486  1.00 0.00 ? 13  ARG A HH21 5  
ATOM   8292  H  HH22 . ARG A 1 13  ? 7.594   -2.700  17.862  1.00 0.00 ? 13  ARG A HH22 5  
ATOM   8293  N  N    . ILE A 1 14  ? 3.200   -8.256  10.841  1.00 0.00 ? 14  ILE A N    5  
ATOM   8294  C  CA   . ILE A 1 14  ? 2.024   -8.766  10.141  1.00 0.00 ? 14  ILE A CA   5  
ATOM   8295  C  C    . ILE A 1 14  ? 1.387   -9.866  10.998  1.00 0.00 ? 14  ILE A C    5  
ATOM   8296  O  O    . ILE A 1 14  ? 0.202   -9.789  11.332  1.00 0.00 ? 14  ILE A O    5  
ATOM   8297  C  CB   . ILE A 1 14  ? 2.432   -9.223  8.715   1.00 0.00 ? 14  ILE A CB   5  
ATOM   8298  C  CG1  . ILE A 1 14  ? 2.739   -7.996  7.825   1.00 0.00 ? 14  ILE A CG1  5  
ATOM   8299  C  CG2  . ILE A 1 14  ? 1.353   -10.094 8.047   1.00 0.00 ? 14  ILE A CG2  5  
ATOM   8300  C  CD1  . ILE A 1 14  ? 3.527   -8.327  6.551   1.00 0.00 ? 14  ILE A CD1  5  
ATOM   8301  H  H    . ILE A 1 14  ? 4.087   -8.278  10.349  1.00 0.00 ? 14  ILE A H    5  
ATOM   8302  H  HA   . ILE A 1 14  ? 1.301   -7.960  10.049  1.00 0.00 ? 14  ILE A HA   5  
ATOM   8303  H  HB   . ILE A 1 14  ? 3.336   -9.827  8.794   1.00 0.00 ? 14  ILE A HB   5  
ATOM   8304  H  HG12 . ILE A 1 14  ? 1.804   -7.517  7.542   1.00 0.00 ? 14  ILE A HG12 5  
ATOM   8305  H  HG13 . ILE A 1 14  ? 3.317   -7.264  8.387   1.00 0.00 ? 14  ILE A HG13 5  
ATOM   8306  H  HG21 . ILE A 1 14  ? 1.223   -11.015 8.615   1.00 0.00 ? 14  ILE A HG21 5  
ATOM   8307  H  HG22 . ILE A 1 14  ? 0.406   -9.555  8.001   1.00 0.00 ? 14  ILE A HG22 5  
ATOM   8308  H  HG23 . ILE A 1 14  ? 1.654   -10.377 7.040   1.00 0.00 ? 14  ILE A HG23 5  
ATOM   8309  H  HD11 . ILE A 1 14  ? 4.451   -8.843  6.809   1.00 0.00 ? 14  ILE A HD11 5  
ATOM   8310  H  HD12 . ILE A 1 14  ? 2.937   -8.952  5.881   1.00 0.00 ? 14  ILE A HD12 5  
ATOM   8311  H  HD13 . ILE A 1 14  ? 3.776   -7.401  6.032   1.00 0.00 ? 14  ILE A HD13 5  
ATOM   8312  N  N    . GLU A 1 15  ? 2.177   -10.864 11.392  1.00 0.00 ? 15  GLU A N    5  
ATOM   8313  C  CA   . GLU A 1 15  ? 1.686   -12.013 12.132  1.00 0.00 ? 15  GLU A CA   5  
ATOM   8314  C  C    . GLU A 1 15  ? 1.101   -11.596 13.486  1.00 0.00 ? 15  GLU A C    5  
ATOM   8315  O  O    . GLU A 1 15  ? 0.018   -12.051 13.841  1.00 0.00 ? 15  GLU A O    5  
ATOM   8316  C  CB   . GLU A 1 15  ? 2.837   -13.021 12.291  1.00 0.00 ? 15  GLU A CB   5  
ATOM   8317  C  CG   . GLU A 1 15  ? 2.418   -14.274 13.070  1.00 0.00 ? 15  GLU A CG   5  
ATOM   8318  C  CD   . GLU A 1 15  ? 3.540   -15.328 13.087  1.00 0.00 ? 15  GLU A CD   5  
ATOM   8319  O  OE1  . GLU A 1 15  ? 4.379   -15.317 14.016  1.00 0.00 ? 15  GLU A OE1  5  
ATOM   8320  O  OE2  . GLU A 1 15  ? 3.580   -16.196 12.185  1.00 0.00 ? 15  GLU A OE2  5  
ATOM   8321  H  H    . GLU A 1 15  ? 3.142   -10.879 11.082  1.00 0.00 ? 15  GLU A H    5  
ATOM   8322  H  HA   . GLU A 1 15  ? 0.892   -12.478 11.545  1.00 0.00 ? 15  GLU A HA   5  
ATOM   8323  H  HB2  . GLU A 1 15  ? 3.173   -13.321 11.297  1.00 0.00 ? 15  GLU A HB2  5  
ATOM   8324  H  HB3  . GLU A 1 15  ? 3.671   -12.546 12.808  1.00 0.00 ? 15  GLU A HB3  5  
ATOM   8325  H  HG2  . GLU A 1 15  ? 2.172   -13.989 14.096  1.00 0.00 ? 15  GLU A HG2  5  
ATOM   8326  H  HG3  . GLU A 1 15  ? 1.521   -14.696 12.611  1.00 0.00 ? 15  GLU A HG3  5  
ATOM   8327  N  N    . THR A 1 16  ? 1.786   -10.733 14.238  1.00 0.00 ? 16  THR A N    5  
ATOM   8328  C  CA   . THR A 1 16  ? 1.414   -10.453 15.623  1.00 0.00 ? 16  THR A CA   5  
ATOM   8329  C  C    . THR A 1 16  ? 0.341   -9.363  15.759  1.00 0.00 ? 16  THR A C    5  
ATOM   8330  O  O    . THR A 1 16  ? -0.349  -9.339  16.781  1.00 0.00 ? 16  THR A O    5  
ATOM   8331  C  CB   . THR A 1 16  ? 2.669   -10.129 16.460  1.00 0.00 ? 16  THR A CB   5  
ATOM   8332  O  OG1  . THR A 1 16  ? 3.443   -9.090  15.894  1.00 0.00 ? 16  THR A OG1  5  
ATOM   8333  C  CG2  . THR A 1 16  ? 3.568   -11.360 16.633  1.00 0.00 ? 16  THR A CG2  5  
ATOM   8334  H  H    . THR A 1 16  ? 2.671   -10.373 13.899  1.00 0.00 ? 16  THR A H    5  
ATOM   8335  H  HA   . THR A 1 16  ? 0.980   -11.362 16.043  1.00 0.00 ? 16  THR A HA   5  
ATOM   8336  H  HB   . THR A 1 16  ? 2.346   -9.811  17.452  1.00 0.00 ? 16  THR A HB   5  
ATOM   8337  H  HG1  . THR A 1 16  ? 3.853   -9.433  15.078  1.00 0.00 ? 16  THR A HG1  5  
ATOM   8338  H  HG21 . THR A 1 16  ? 3.006   -12.156 17.124  1.00 0.00 ? 16  THR A HG21 5  
ATOM   8339  H  HG22 . THR A 1 16  ? 3.923   -11.722 15.668  1.00 0.00 ? 16  THR A HG22 5  
ATOM   8340  H  HG23 . THR A 1 16  ? 4.424   -11.105 17.258  1.00 0.00 ? 16  THR A HG23 5  
ATOM   8341  N  N    . GLU A 1 17  ? 0.158   -8.490  14.758  1.00 0.00 ? 17  GLU A N    5  
ATOM   8342  C  CA   . GLU A 1 17  ? -0.685  -7.298  14.902  1.00 0.00 ? 17  GLU A CA   5  
ATOM   8343  C  C    . GLU A 1 17  ? -1.696  -7.113  13.764  1.00 0.00 ? 17  GLU A C    5  
ATOM   8344  O  O    . GLU A 1 17  ? -2.559  -6.240  13.884  1.00 0.00 ? 17  GLU A O    5  
ATOM   8345  C  CB   . GLU A 1 17  ? 0.189   -6.037  15.068  1.00 0.00 ? 17  GLU A CB   5  
ATOM   8346  C  CG   . GLU A 1 17  ? 1.041   -6.062  16.345  1.00 0.00 ? 17  GLU A CG   5  
ATOM   8347  C  CD   . GLU A 1 17  ? 1.769   -4.726  16.568  1.00 0.00 ? 17  GLU A CD   5  
ATOM   8348  O  OE1  . GLU A 1 17  ? 1.176   -3.799  17.168  1.00 0.00 ? 17  GLU A OE1  5  
ATOM   8349  O  OE2  . GLU A 1 17  ? 2.951   -4.603  16.177  1.00 0.00 ? 17  GLU A OE2  5  
ATOM   8350  H  H    . GLU A 1 17  ? 0.780   -8.531  13.968  1.00 0.00 ? 17  GLU A H    5  
ATOM   8351  H  HA   . GLU A 1 17  ? -1.280  -7.392  15.811  1.00 0.00 ? 17  GLU A HA   5  
ATOM   8352  H  HB2  . GLU A 1 17  ? 0.837   -5.916  14.200  1.00 0.00 ? 17  GLU A HB2  5  
ATOM   8353  H  HB3  . GLU A 1 17  ? -0.464  -5.166  15.121  1.00 0.00 ? 17  GLU A HB3  5  
ATOM   8354  H  HG2  . GLU A 1 17  ? 0.394   -6.269  17.201  1.00 0.00 ? 17  GLU A HG2  5  
ATOM   8355  H  HG3  . GLU A 1 17  ? 1.775   -6.866  16.279  1.00 0.00 ? 17  GLU A HG3  5  
ATOM   8356  N  N    . ILE A 1 18  ? -1.655  -7.922  12.695  1.00 0.00 ? 18  ILE A N    5  
ATOM   8357  C  CA   . ILE A 1 18  ? -2.540  -7.740  11.540  1.00 0.00 ? 18  ILE A CA   5  
ATOM   8358  C  C    . ILE A 1 18  ? -3.388  -8.996  11.317  1.00 0.00 ? 18  ILE A C    5  
ATOM   8359  O  O    . ILE A 1 18  ? -4.595  -8.866  11.119  1.00 0.00 ? 18  ILE A O    5  
ATOM   8360  C  CB   . ILE A 1 18  ? -1.744  -7.308  10.278  1.00 0.00 ? 18  ILE A CB   5  
ATOM   8361  C  CG1  . ILE A 1 18  ? -0.762  -6.153  10.602  1.00 0.00 ? 18  ILE A CG1  5  
ATOM   8362  C  CG2  . ILE A 1 18  ? -2.712  -6.890  9.158   1.00 0.00 ? 18  ILE A CG2  5  
ATOM   8363  C  CD1  . ILE A 1 18  ? -0.063  -5.525  9.390   1.00 0.00 ? 18  ILE A CD1  5  
ATOM   8364  H  H    . ILE A 1 18  ? -0.921  -8.618  12.621  1.00 0.00 ? 18  ILE A H    5  
ATOM   8365  H  HA   . ILE A 1 18  ? -3.239  -6.931  11.754  1.00 0.00 ? 18  ILE A HA   5  
ATOM   8366  H  HB   . ILE A 1 18  ? -1.168  -8.157  9.912   1.00 0.00 ? 18  ILE A HB   5  
ATOM   8367  H  HG12 . ILE A 1 18  ? -1.298  -5.369  11.132  1.00 0.00 ? 18  ILE A HG12 5  
ATOM   8368  H  HG13 . ILE A 1 18  ? 0.016   -6.524  11.268  1.00 0.00 ? 18  ILE A HG13 5  
ATOM   8369  H  HG21 . ILE A 1 18  ? -3.241  -5.982  9.444   1.00 0.00 ? 18  ILE A HG21 5  
ATOM   8370  H  HG22 . ILE A 1 18  ? -2.168  -6.716  8.230   1.00 0.00 ? 18  ILE A HG22 5  
ATOM   8371  H  HG23 . ILE A 1 18  ? -3.443  -7.672  8.963   1.00 0.00 ? 18  ILE A HG23 5  
ATOM   8372  H  HD11 . ILE A 1 18  ? 0.740   -4.873  9.734   1.00 0.00 ? 18  ILE A HD11 5  
ATOM   8373  H  HD12 . ILE A 1 18  ? 0.354   -6.304  8.757   1.00 0.00 ? 18  ILE A HD12 5  
ATOM   8374  H  HD13 . ILE A 1 18  ? -0.770  -4.931  8.811   1.00 0.00 ? 18  ILE A HD13 5  
ATOM   8375  N  N    . ILE A 1 19  ? -2.810  -10.203 11.398  1.00 0.00 ? 19  ILE A N    5  
ATOM   8376  C  CA   . ILE A 1 19  ? -3.494  -11.434 10.986  1.00 0.00 ? 19  ILE A CA   5  
ATOM   8377  C  C    . ILE A 1 19  ? -3.368  -12.580 12.012  1.00 0.00 ? 19  ILE A C    5  
ATOM   8378  O  O    . ILE A 1 19  ? -3.469  -13.747 11.643  1.00 0.00 ? 19  ILE A O    5  
ATOM   8379  C  CB   . ILE A 1 19  ? -3.018  -11.829 9.576   1.00 0.00 ? 19  ILE A CB   5  
ATOM   8380  C  CG1  . ILE A 1 19  ? -1.493  -12.022 9.587   1.00 0.00 ? 19  ILE A CG1  5  
ATOM   8381  C  CG2  . ILE A 1 19  ? -3.454  -10.807 8.503   1.00 0.00 ? 19  ILE A CG2  5  
ATOM   8382  C  CD1  . ILE A 1 19  ? -1.060  -12.969 8.486   1.00 0.00 ? 19  ILE A CD1  5  
ATOM   8383  H  H    . ILE A 1 19  ? -1.797  -10.261 11.479  1.00 0.00 ? 19  ILE A H    5  
ATOM   8384  H  HA   . ILE A 1 19  ? -4.554  -11.239 10.893  1.00 0.00 ? 19  ILE A HA   5  
ATOM   8385  H  HB   . ILE A 1 19  ? -3.494  -12.776 9.320   1.00 0.00 ? 19  ILE A HB   5  
ATOM   8386  H  HG12 . ILE A 1 19  ? -0.999  -11.062 9.455   1.00 0.00 ? 19  ILE A HG12 5  
ATOM   8387  H  HG13 . ILE A 1 19  ? -1.173  -12.451 10.537  1.00 0.00 ? 19  ILE A HG13 5  
ATOM   8388  H  HG21 . ILE A 1 19  ? -4.521  -10.591 8.594   1.00 0.00 ? 19  ILE A HG21 5  
ATOM   8389  H  HG22 . ILE A 1 19  ? -2.899  -9.876  8.604   1.00 0.00 ? 19  ILE A HG22 5  
ATOM   8390  H  HG23 . ILE A 1 19  ? -3.270  -11.209 7.507   1.00 0.00 ? 19  ILE A HG23 5  
ATOM   8391  H  HD11 . ILE A 1 19  ? 0.012   -13.131 8.573   1.00 0.00 ? 19  ILE A HD11 5  
ATOM   8392  H  HD12 . ILE A 1 19  ? -1.590  -13.909 8.621   1.00 0.00 ? 19  ILE A HD12 5  
ATOM   8393  H  HD13 . ILE A 1 19  ? -1.304  -12.533 7.520   1.00 0.00 ? 19  ILE A HD13 5  
ATOM   8394  N  N    . VAL A 1 20  ? -3.139  -12.273 13.292  1.00 0.00 ? 20  VAL A N    5  
ATOM   8395  C  CA   . VAL A 1 20  ? -2.814  -13.258 14.333  1.00 0.00 ? 20  VAL A CA   5  
ATOM   8396  C  C    . VAL A 1 20  ? -3.761  -14.471 14.392  1.00 0.00 ? 20  VAL A C    5  
ATOM   8397  O  O    . VAL A 1 20  ? -3.296  -15.595 14.593  1.00 0.00 ? 20  VAL A O    5  
ATOM   8398  C  CB   . VAL A 1 20  ? -2.681  -12.534 15.692  1.00 0.00 ? 20  VAL A CB   5  
ATOM   8399  C  CG1  . VAL A 1 20  ? -4.028  -12.033 16.239  1.00 0.00 ? 20  VAL A CG1  5  
ATOM   8400  C  CG2  . VAL A 1 20  ? -2.004  -13.424 16.742  1.00 0.00 ? 20  VAL A CG2  5  
ATOM   8401  H  H    . VAL A 1 20  ? -2.994  -11.301 13.521  1.00 0.00 ? 20  VAL A H    5  
ATOM   8402  H  HA   . VAL A 1 20  ? -1.833  -13.655 14.075  1.00 0.00 ? 20  VAL A HA   5  
ATOM   8403  H  HB   . VAL A 1 20  ? -2.044  -11.662 15.546  1.00 0.00 ? 20  VAL A HB   5  
ATOM   8404  H  HG11 . VAL A 1 20  ? -4.517  -11.387 15.510  1.00 0.00 ? 20  VAL A HG11 5  
ATOM   8405  H  HG12 . VAL A 1 20  ? -4.682  -12.877 16.468  1.00 0.00 ? 20  VAL A HG12 5  
ATOM   8406  H  HG13 . VAL A 1 20  ? -3.862  -11.459 17.151  1.00 0.00 ? 20  VAL A HG13 5  
ATOM   8407  H  HG21 . VAL A 1 20  ? -2.627  -14.296 16.955  1.00 0.00 ? 20  VAL A HG21 5  
ATOM   8408  H  HG22 . VAL A 1 20  ? -1.035  -13.758 16.370  1.00 0.00 ? 20  VAL A HG22 5  
ATOM   8409  H  HG23 . VAL A 1 20  ? -1.850  -12.860 17.662  1.00 0.00 ? 20  VAL A HG23 5  
ATOM   8410  N  N    . ASP A 1 21  ? -5.067  -14.267 14.185  1.00 0.00 ? 21  ASP A N    5  
ATOM   8411  C  CA   . ASP A 1 21  ? -6.094  -15.319 14.257  1.00 0.00 ? 21  ASP A CA   5  
ATOM   8412  C  C    . ASP A 1 21  ? -6.740  -15.558 12.874  1.00 0.00 ? 21  ASP A C    5  
ATOM   8413  O  O    . ASP A 1 21  ? -7.709  -16.325 12.712  1.00 0.00 ? 21  ASP A O    5  
ATOM   8414  C  CB   . ASP A 1 21  ? -7.133  -14.916 15.315  1.00 0.00 ? 21  ASP A CB   5  
ATOM   8415  C  CG   . ASP A 1 21  ? -8.168  -16.022 15.586  1.00 0.00 ? 21  ASP A CG   5  
ATOM   8416  O  OD1  . ASP A 1 21  ? -7.775  -17.153 15.952  1.00 0.00 ? 21  ASP A OD1  5  
ATOM   8417  O  OD2  . ASP A 1 21  ? -9.387  -15.750 15.496  1.00 0.00 ? 21  ASP A OD2  5  
ATOM   8418  H  H    . ASP A 1 21  ? -5.387  -13.323 14.018  1.00 0.00 ? 21  ASP A H    5  
ATOM   8419  H  HA   . ASP A 1 21  ? -5.617  -16.235 14.600  1.00 0.00 ? 21  ASP A HA   5  
ATOM   8420  H  HB2  . ASP A 1 21  ? -6.614  -14.690 16.250  1.00 0.00 ? 21  ASP A HB2  5  
ATOM   8421  H  HB3  . ASP A 1 21  ? -7.637  -14.005 14.986  1.00 0.00 ? 21  ASP A HB3  5  
ATOM   8422  N  N    . ALA A 1 22  ? -6.183  -14.870 11.869  1.00 0.00 ? 22  ALA A N    5  
ATOM   8423  C  CA   . ALA A 1 22  ? -6.725  -14.747 10.538  1.00 0.00 ? 22  ALA A CA   5  
ATOM   8424  C  C    . ALA A 1 22  ? -5.928  -15.583 9.547   1.00 0.00 ? 22  ALA A C    5  
ATOM   8425  O  O    . ALA A 1 22  ? -4.723  -15.409 9.348   1.00 0.00 ? 22  ALA A O    5  
ATOM   8426  C  CB   . ALA A 1 22  ? -6.741  -13.286 10.102  1.00 0.00 ? 22  ALA A CB   5  
ATOM   8427  H  H    . ALA A 1 22  ? -5.286  -14.422 12.035  1.00 0.00 ? 22  ALA A H    5  
ATOM   8428  H  HA   . ALA A 1 22  ? -7.758  -15.080 10.558  1.00 0.00 ? 22  ALA A HA   5  
ATOM   8429  H  HB1  . ALA A 1 22  ? -7.182  -13.245 9.111   1.00 0.00 ? 22  ALA A HB1  5  
ATOM   8430  H  HB2  . ALA A 1 22  ? -7.335  -12.687 10.792  1.00 0.00 ? 22  ALA A HB2  5  
ATOM   8431  H  HB3  . ALA A 1 22  ? -5.728  -12.902 10.045  1.00 0.00 ? 22  ALA A HB3  5  
ATOM   8432  N  N    . GLU A 1 23  ? -6.663  -16.442 8.864   1.00 0.00 ? 23  GLU A N    5  
ATOM   8433  C  CA   . GLU A 1 23  ? -6.166  -17.324 7.808   1.00 0.00 ? 23  GLU A CA   5  
ATOM   8434  C  C    . GLU A 1 23  ? -7.233  -17.723 6.800   1.00 0.00 ? 23  GLU A C    5  
ATOM   8435  O  O    . GLU A 1 23  ? -6.912  -18.137 5.685   1.00 0.00 ? 23  GLU A O    5  
ATOM   8436  C  CB   . GLU A 1 23  ? -5.430  -18.527 8.400   1.00 0.00 ? 23  GLU A CB   5  
ATOM   8437  C  CG   . GLU A 1 23  ? -6.208  -19.815 8.709   1.00 0.00 ? 23  GLU A CG   5  
ATOM   8438  C  CD   . GLU A 1 23  ? -7.102  -19.738 9.953   1.00 0.00 ? 23  GLU A CD   5  
ATOM   8439  O  OE1  . GLU A 1 23  ? -6.931  -18.856 10.820  1.00 0.00 ? 23  GLU A OE1  5  
ATOM   8440  O  OE2  . GLU A 1 23  ? -8.027  -20.564 10.109  1.00 0.00 ? 23  GLU A OE2  5  
ATOM   8441  H  H    . GLU A 1 23  ? -7.641  -16.432 9.107   1.00 0.00 ? 23  GLU A H    5  
ATOM   8442  H  HA   . GLU A 1 23  ? -5.427  -16.772 7.247   1.00 0.00 ? 23  GLU A HA   5  
ATOM   8443  H  HB2  . GLU A 1 23  ? -4.665  -18.788 7.678   1.00 0.00 ? 23  GLU A HB2  5  
ATOM   8444  H  HB3  . GLU A 1 23  ? -4.952  -18.183 9.308   1.00 0.00 ? 23  GLU A HB3  5  
ATOM   8445  H  HG2  . GLU A 1 23  ? -6.798  -20.095 7.836   1.00 0.00 ? 23  GLU A HG2  5  
ATOM   8446  H  HG3  . GLU A 1 23  ? -5.476  -20.607 8.872   1.00 0.00 ? 23  GLU A HG3  5  
ATOM   8447  N  N    . ASP A 1 24  ? -8.498  -17.598 7.187   1.00 0.00 ? 24  ASP A N    5  
ATOM   8448  C  CA   . ASP A 1 24  ? -9.613  -17.708 6.273   1.00 0.00 ? 24  ASP A CA   5  
ATOM   8449  C  C    . ASP A 1 24  ? -9.545  -16.389 5.495   1.00 0.00 ? 24  ASP A C    5  
ATOM   8450  O  O    . ASP A 1 24  ? -9.258  -15.335 6.076   1.00 0.00 ? 24  ASP A O    5  
ATOM   8451  C  CB   . ASP A 1 24  ? -10.933 -17.885 7.037   1.00 0.00 ? 24  ASP A CB   5  
ATOM   8452  C  CG   . ASP A 1 24  ? -10.959 -19.122 7.966   1.00 0.00 ? 24  ASP A CG   5  
ATOM   8453  O  OD1  . ASP A 1 24  ? -11.265 -20.230 7.466   1.00 0.00 ? 24  ASP A OD1  5  
ATOM   8454  O  OD2  . ASP A 1 24  ? -10.705 -19.005 9.195   1.00 0.00 ? 24  ASP A OD2  5  
ATOM   8455  H  H    . ASP A 1 24  ? -8.694  -17.149 8.065   1.00 0.00 ? 24  ASP A H    5  
ATOM   8456  H  HA   . ASP A 1 24  ? -9.468  -18.559 5.607   1.00 0.00 ? 24  ASP A HA   5  
ATOM   8457  H  HB2  . ASP A 1 24  ? -11.127 -16.992 7.620   1.00 0.00 ? 24  ASP A HB2  5  
ATOM   8458  H  HB3  . ASP A 1 24  ? -11.726 -17.965 6.290   1.00 0.00 ? 24  ASP A HB3  5  
ATOM   8459  N  N    . LYS A 1 25  ? -9.773  -16.418 4.182   1.00 0.00 ? 25  LYS A N    5  
ATOM   8460  C  CA   . LYS A 1 25  ? -9.498  -15.265 3.320   1.00 0.00 ? 25  LYS A CA   5  
ATOM   8461  C  C    . LYS A 1 25  ? -10.209 -13.981 3.746   1.00 0.00 ? 25  LYS A C    5  
ATOM   8462  O  O    . LYS A 1 25  ? -9.631  -12.898 3.642   1.00 0.00 ? 25  LYS A O    5  
ATOM   8463  C  CB   . LYS A 1 25  ? -9.801  -15.651 1.867   1.00 0.00 ? 25  LYS A CB   5  
ATOM   8464  C  CG   . LYS A 1 25  ? -11.307 -15.815 1.588   1.00 0.00 ? 25  LYS A CG   5  
ATOM   8465  C  CD   . LYS A 1 25  ? -11.618 -16.761 0.419   1.00 0.00 ? 25  LYS A CD   5  
ATOM   8466  C  CE   . LYS A 1 25  ? -10.727 -16.484 -0.798  1.00 0.00 ? 25  LYS A CE   5  
ATOM   8467  N  NZ   . LYS A 1 25  ? -11.071 -17.342 -1.959  1.00 0.00 ? 25  LYS A NZ   5  
ATOM   8468  H  H    . LYS A 1 25  ? -10.043 -17.287 3.741   1.00 0.00 ? 25  LYS A H    5  
ATOM   8469  H  HA   . LYS A 1 25  ? -8.427  -15.071 3.391   1.00 0.00 ? 25  LYS A HA   5  
ATOM   8470  H  HB2  . LYS A 1 25  ? -9.398  -14.880 1.207   1.00 0.00 ? 25  LYS A HB2  5  
ATOM   8471  H  HB3  . LYS A 1 25  ? -9.280  -16.586 1.652   1.00 0.00 ? 25  LYS A HB3  5  
ATOM   8472  H  HG2  . LYS A 1 25  ? -11.806 -16.210 2.473   1.00 0.00 ? 25  LYS A HG2  5  
ATOM   8473  H  HG3  . LYS A 1 25  ? -11.727 -14.829 1.383   1.00 0.00 ? 25  LYS A HG3  5  
ATOM   8474  H  HD2  . LYS A 1 25  ? -11.455 -17.788 0.751   1.00 0.00 ? 25  LYS A HD2  5  
ATOM   8475  H  HD3  . LYS A 1 25  ? -12.669 -16.646 0.148   1.00 0.00 ? 25  LYS A HD3  5  
ATOM   8476  H  HE2  . LYS A 1 25  ? -10.824 -15.431 -1.072  1.00 0.00 ? 25  LYS A HE2  5  
ATOM   8477  H  HE3  . LYS A 1 25  ? -9.692  -16.668 -0.497  1.00 0.00 ? 25  LYS A HE3  5  
ATOM   8478  H  HZ1  . LYS A 1 25  ? -10.462 -17.145 -2.741  1.00 0.00 ? 25  LYS A HZ1  5  
ATOM   8479  H  HZ2  . LYS A 1 25  ? -10.972 -18.321 -1.736  1.00 0.00 ? 25  LYS A HZ2  5  
ATOM   8480  H  HZ3  . LYS A 1 25  ? -12.019 -17.182 -2.266  1.00 0.00 ? 25  LYS A HZ3  5  
ATOM   8481  N  N    . GLU A 1 26  ? -11.439 -14.101 4.248   1.00 0.00 ? 26  GLU A N    5  
ATOM   8482  C  CA   . GLU A 1 26  ? -12.231 -12.956 4.672   1.00 0.00 ? 26  GLU A CA   5  
ATOM   8483  C  C    . GLU A 1 26  ? -11.601 -12.345 5.922   1.00 0.00 ? 26  GLU A C    5  
ATOM   8484  O  O    . GLU A 1 26  ? -11.544 -11.123 6.046   1.00 0.00 ? 26  GLU A O    5  
ATOM   8485  C  CB   . GLU A 1 26  ? -13.682 -13.382 4.948   1.00 0.00 ? 26  GLU A CB   5  
ATOM   8486  C  CG   . GLU A 1 26  ? -14.395 -13.896 3.687   1.00 0.00 ? 26  GLU A CG   5  
ATOM   8487  C  CD   . GLU A 1 26  ? -15.862 -14.259 3.977   1.00 0.00 ? 26  GLU A CD   5  
ATOM   8488  O  OE1  . GLU A 1 26  ? -16.135 -15.385 4.454   1.00 0.00 ? 26  GLU A OE1  5  
ATOM   8489  O  OE2  . GLU A 1 26  ? -16.765 -13.433 3.711   1.00 0.00 ? 26  GLU A OE2  5  
ATOM   8490  H  H    . GLU A 1 26  ? -11.823 -15.021 4.389   1.00 0.00 ? 26  GLU A H    5  
ATOM   8491  H  HA   . GLU A 1 26  ? -12.225 -12.204 3.880   1.00 0.00 ? 26  GLU A HA   5  
ATOM   8492  H  HB2  . GLU A 1 26  ? -13.690 -14.163 5.710   1.00 0.00 ? 26  GLU A HB2  5  
ATOM   8493  H  HB3  . GLU A 1 26  ? -14.231 -12.522 5.332   1.00 0.00 ? 26  GLU A HB3  5  
ATOM   8494  H  HG2  . GLU A 1 26  ? -14.348 -13.128 2.913   1.00 0.00 ? 26  GLU A HG2  5  
ATOM   8495  H  HG3  . GLU A 1 26  ? -13.875 -14.779 3.309   1.00 0.00 ? 26  GLU A HG3  5  
ATOM   8496  N  N    . GLU A 1 27  ? -11.080 -13.177 6.831   1.00 0.00 ? 27  GLU A N    5  
ATOM   8497  C  CA   . GLU A 1 27  ? -10.445 -12.695 8.046   1.00 0.00 ? 27  GLU A CA   5  
ATOM   8498  C  C    . GLU A 1 27  ? -9.161  -11.975 7.694   1.00 0.00 ? 27  GLU A C    5  
ATOM   8499  O  O    . GLU A 1 27  ? -8.910  -10.908 8.243   1.00 0.00 ? 27  GLU A O    5  
ATOM   8500  C  CB   . GLU A 1 27  ? -10.050 -13.837 8.976   1.00 0.00 ? 27  GLU A CB   5  
ATOM   8501  C  CG   . GLU A 1 27  ? -11.190 -14.756 9.389   1.00 0.00 ? 27  GLU A CG   5  
ATOM   8502  C  CD   . GLU A 1 27  ? -10.619 -15.924 10.192  1.00 0.00 ? 27  GLU A CD   5  
ATOM   8503  O  OE1  . GLU A 1 27  ? -9.527  -16.449 9.856   1.00 0.00 ? 27  GLU A OE1  5  
ATOM   8504  O  OE2  . GLU A 1 27  ? -11.240 -16.337 11.199  1.00 0.00 ? 27  GLU A OE2  5  
ATOM   8505  H  H    . GLU A 1 27  ? -11.020 -14.171 6.646   1.00 0.00 ? 27  GLU A H    5  
ATOM   8506  H  HA   . GLU A 1 27  ? -11.117 -12.015 8.569   1.00 0.00 ? 27  GLU A HA   5  
ATOM   8507  H  HB2  . GLU A 1 27  ? -9.281  -14.428 8.481   1.00 0.00 ? 27  GLU A HB2  5  
ATOM   8508  H  HB3  . GLU A 1 27  ? -9.618  -13.409 9.881   1.00 0.00 ? 27  GLU A HB3  5  
ATOM   8509  H  HG2  . GLU A 1 27  ? -11.902 -14.192 9.993   1.00 0.00 ? 27  GLU A HG2  5  
ATOM   8510  H  HG3  . GLU A 1 27  ? -11.702 -15.132 8.506   1.00 0.00 ? 27  GLU A HG3  5  
ATOM   8511  N  N    . ARG A 1 28  ? -8.331  -12.546 6.807   1.00 0.00 ? 28  ARG A N    5  
ATOM   8512  C  CA   . ARG A 1 28  ? -7.082  -11.869 6.453   1.00 0.00 ? 28  ARG A CA   5  
ATOM   8513  C  C    . ARG A 1 28  ? -7.379  -10.526 5.802   1.00 0.00 ? 28  ARG A C    5  
ATOM   8514  O  O    . ARG A 1 28  ? -6.763  -9.535  6.195   1.00 0.00 ? 28  ARG A O    5  
ATOM   8515  C  CB   . ARG A 1 28  ? -6.164  -12.751 5.595   1.00 0.00 ? 28  ARG A CB   5  
ATOM   8516  C  CG   . ARG A 1 28  ? -5.444  -13.763 6.494   1.00 0.00 ? 28  ARG A CG   5  
ATOM   8517  C  CD   . ARG A 1 28  ? -4.355  -14.552 5.764   1.00 0.00 ? 28  ARG A CD   5  
ATOM   8518  N  NE   . ARG A 1 28  ? -3.523  -15.287 6.730   1.00 0.00 ? 28  ARG A NE   5  
ATOM   8519  C  CZ   . ARG A 1 28  ? -2.574  -16.185 6.444   1.00 0.00 ? 28  ARG A CZ   5  
ATOM   8520  N  NH1  . ARG A 1 28  ? -2.282  -16.506 5.186   1.00 0.00 ? 28  ARG A NH1  5  
ATOM   8521  N  NH2  . ARG A 1 28  ? -1.927  -16.770 7.446   1.00 0.00 ? 28  ARG A NH2  5  
ATOM   8522  H  H    . ARG A 1 28  ? -8.571  -13.447 6.390   1.00 0.00 ? 28  ARG A H    5  
ATOM   8523  H  HA   . ARG A 1 28  ? -6.559  -11.629 7.380   1.00 0.00 ? 28  ARG A HA   5  
ATOM   8524  H  HB2  . ARG A 1 28  ? -6.742  -13.266 4.828   1.00 0.00 ? 28  ARG A HB2  5  
ATOM   8525  H  HB3  . ARG A 1 28  ? -5.414  -12.118 5.118   1.00 0.00 ? 28  ARG A HB3  5  
ATOM   8526  H  HG2  . ARG A 1 28  ? -4.978  -13.225 7.320   1.00 0.00 ? 28  ARG A HG2  5  
ATOM   8527  H  HG3  . ARG A 1 28  ? -6.179  -14.458 6.899   1.00 0.00 ? 28  ARG A HG3  5  
ATOM   8528  H  HD2  . ARG A 1 28  ? -4.830  -15.254 5.080   1.00 0.00 ? 28  ARG A HD2  5  
ATOM   8529  H  HD3  . ARG A 1 28  ? -3.720  -13.867 5.200   1.00 0.00 ? 28  ARG A HD3  5  
ATOM   8530  H  HE   . ARG A 1 28  ? -3.746  -15.123 7.713   1.00 0.00 ? 28  ARG A HE   5  
ATOM   8531  H  HH11 . ARG A 1 28  ? -2.812  -16.123 4.391   1.00 0.00 ? 28  ARG A HH11 5  
ATOM   8532  H  HH12 . ARG A 1 28  ? -1.564  -17.177 4.959   1.00 0.00 ? 28  ARG A HH12 5  
ATOM   8533  H  HH21 . ARG A 1 28  ? -2.150  -16.555 8.409   1.00 0.00 ? 28  ARG A HH21 5  
ATOM   8534  H  HH22 . ARG A 1 28  ? -1.199  -17.454 7.287   1.00 0.00 ? 28  ARG A HH22 5  
ATOM   8535  N  N    . ALA A 1 29  ? -8.350  -10.459 4.889   1.00 0.00 ? 29  ALA A N    5  
ATOM   8536  C  CA   . ALA A 1 29  ? -8.746  -9.203  4.276   1.00 0.00 ? 29  ALA A CA   5  
ATOM   8537  C  C    . ALA A 1 29  ? -9.171  -8.186  5.343   1.00 0.00 ? 29  ALA A C    5  
ATOM   8538  O  O    . ALA A 1 29  ? -8.709  -7.046  5.320   1.00 0.00 ? 29  ALA A O    5  
ATOM   8539  C  CB   . ALA A 1 29  ? -9.865  -9.470  3.269   1.00 0.00 ? 29  ALA A CB   5  
ATOM   8540  H  H    . ALA A 1 29  ? -8.826  -11.296 4.588   1.00 0.00 ? 29  ALA A H    5  
ATOM   8541  H  HA   . ALA A 1 29  ? -7.887  -8.798  3.741   1.00 0.00 ? 29  ALA A HA   5  
ATOM   8542  H  HB1  . ALA A 1 29  ? -10.760 -9.819  3.784   1.00 0.00 ? 29  ALA A HB1  5  
ATOM   8543  H  HB2  . ALA A 1 29  ? -10.079 -8.551  2.727   1.00 0.00 ? 29  ALA A HB2  5  
ATOM   8544  H  HB3  . ALA A 1 29  ? -9.548  -10.235 2.559   1.00 0.00 ? 29  ALA A HB3  5  
ATOM   8545  N  N    . MET A 1 30  ? -10.003 -8.596  6.306   1.00 0.00 ? 30  MET A N    5  
ATOM   8546  C  CA   . MET A 1 30  ? -10.451 -7.719  7.382   1.00 0.00 ? 30  MET A CA   5  
ATOM   8547  C  C    . MET A 1 30  ? -9.315  -7.315  8.321   1.00 0.00 ? 30  MET A C    5  
ATOM   8548  O  O    . MET A 1 30  ? -9.248  -6.151  8.702   1.00 0.00 ? 30  MET A O    5  
ATOM   8549  C  CB   . MET A 1 30  ? -11.614 -8.358  8.148   1.00 0.00 ? 30  MET A CB   5  
ATOM   8550  C  CG   . MET A 1 30  ? -12.906 -8.407  7.318   1.00 0.00 ? 30  MET A CG   5  
ATOM   8551  S  SD   . MET A 1 30  ? -13.606 -6.803  6.825   1.00 0.00 ? 30  MET A SD   5  
ATOM   8552  C  CE   . MET A 1 30  ? -12.863 -6.545  5.185   1.00 0.00 ? 30  MET A CE   5  
ATOM   8553  H  H    . MET A 1 30  ? -10.373 -9.542  6.277   1.00 0.00 ? 30  MET A H    5  
ATOM   8554  H  HA   . MET A 1 30  ? -10.813 -6.796  6.946   1.00 0.00 ? 30  MET A HA   5  
ATOM   8555  H  HB2  . MET A 1 30  ? -11.341 -9.368  8.455   1.00 0.00 ? 30  MET A HB2  5  
ATOM   8556  H  HB3  . MET A 1 30  ? -11.808 -7.773  9.045   1.00 0.00 ? 30  MET A HB3  5  
ATOM   8557  H  HG2  . MET A 1 30  ? -12.747 -9.005  6.423   1.00 0.00 ? 30  MET A HG2  5  
ATOM   8558  H  HG3  . MET A 1 30  ? -13.656 -8.920  7.921   1.00 0.00 ? 30  MET A HG3  5  
ATOM   8559  H  HE1  . MET A 1 30  ? -13.372 -5.722  4.685   1.00 0.00 ? 30  MET A HE1  5  
ATOM   8560  H  HE2  . MET A 1 30  ? -11.807 -6.297  5.261   1.00 0.00 ? 30  MET A HE2  5  
ATOM   8561  H  HE3  . MET A 1 30  ? -12.966 -7.446  4.585   1.00 0.00 ? 30  MET A HE3  5  
ATOM   8562  N  N    . GLY A 1 31  ? -8.396  -8.219  8.661   1.00 0.00 ? 31  GLY A N    5  
ATOM   8563  C  CA   . GLY A 1 31  ? -7.267  -7.920  9.527   1.00 0.00 ? 31  GLY A CA   5  
ATOM   8564  C  C    . GLY A 1 31  ? -6.393  -6.836  8.905   1.00 0.00 ? 31  GLY A C    5  
ATOM   8565  O  O    . GLY A 1 31  ? -6.082  -5.837  9.560   1.00 0.00 ? 31  GLY A O    5  
ATOM   8566  H  H    . GLY A 1 31  ? -8.483  -9.170  8.318   1.00 0.00 ? 31  GLY A H    5  
ATOM   8567  H  HA2  . GLY A 1 31  ? -7.629  -7.587  10.500  1.00 0.00 ? 31  GLY A HA2  5  
ATOM   8568  H  HA3  . GLY A 1 31  ? -6.678  -8.827  9.653   1.00 0.00 ? 31  GLY A HA3  5  
ATOM   8569  N  N    . TRP A 1 32  ? -6.074  -6.991  7.614   1.00 0.00 ? 32  TRP A N    5  
ATOM   8570  C  CA   . TRP A 1 32  ? -5.369  -5.971  6.855   1.00 0.00 ? 32  TRP A CA   5  
ATOM   8571  C  C    . TRP A 1 32  ? -6.158  -4.662  6.849   1.00 0.00 ? 32  TRP A C    5  
ATOM   8572  O  O    . TRP A 1 32  ? -5.596  -3.626  7.195   1.00 0.00 ? 32  TRP A O    5  
ATOM   8573  C  CB   . TRP A 1 32  ? -5.071  -6.468  5.434   1.00 0.00 ? 32  TRP A CB   5  
ATOM   8574  C  CG   . TRP A 1 32  ? -3.833  -7.305  5.342   1.00 0.00 ? 32  TRP A CG   5  
ATOM   8575  C  CD1  . TRP A 1 32  ? -3.766  -8.652  5.267   1.00 0.00 ? 32  TRP A CD1  5  
ATOM   8576  C  CD2  . TRP A 1 32  ? -2.450  -6.847  5.340   1.00 0.00 ? 32  TRP A CD2  5  
ATOM   8577  N  NE1  . TRP A 1 32  ? -2.447  -9.056  5.238   1.00 0.00 ? 32  TRP A NE1  5  
ATOM   8578  C  CE2  . TRP A 1 32  ? -1.587  -7.980  5.303   1.00 0.00 ? 32  TRP A CE2  5  
ATOM   8579  C  CE3  . TRP A 1 32  ? -1.844  -5.576  5.368   1.00 0.00 ? 32  TRP A CE3  5  
ATOM   8580  C  CZ2  . TRP A 1 32  ? -0.190  -7.852  5.319   1.00 0.00 ? 32  TRP A CZ2  5  
ATOM   8581  C  CZ3  . TRP A 1 32  ? -0.446  -5.434  5.357   1.00 0.00 ? 32  TRP A CZ3  5  
ATOM   8582  C  CH2  . TRP A 1 32  ? 0.382   -6.569  5.333   1.00 0.00 ? 32  TRP A CH2  5  
ATOM   8583  H  H    . TRP A 1 32  ? -6.378  -7.821  7.119   1.00 0.00 ? 32  TRP A H    5  
ATOM   8584  H  HA   . TRP A 1 32  ? -4.417  -5.781  7.351   1.00 0.00 ? 32  TRP A HA   5  
ATOM   8585  H  HB2  . TRP A 1 32  ? -5.926  -7.019  5.039   1.00 0.00 ? 32  TRP A HB2  5  
ATOM   8586  H  HB3  . TRP A 1 32  ? -4.920  -5.600  4.790   1.00 0.00 ? 32  TRP A HB3  5  
ATOM   8587  H  HD1  . TRP A 1 32  ? -4.619  -9.311  5.241   1.00 0.00 ? 32  TRP A HD1  5  
ATOM   8588  H  HE1  . TRP A 1 32  ? -2.167  -10.021 5.110   1.00 0.00 ? 32  TRP A HE1  5  
ATOM   8589  H  HE3  . TRP A 1 32  ? -2.471  -4.701  5.380   1.00 0.00 ? 32  TRP A HE3  5  
ATOM   8590  H  HZ2  . TRP A 1 32  ? 0.439   -8.729  5.301   1.00 0.00 ? 32  TRP A HZ2  5  
ATOM   8591  H  HZ3  . TRP A 1 32  ? -0.006  -4.447  5.369   1.00 0.00 ? 32  TRP A HZ3  5  
ATOM   8592  H  HH2  . TRP A 1 32  ? 1.456   -6.452  5.323   1.00 0.00 ? 32  TRP A HH2  5  
ATOM   8593  N  N    . TYR A 1 33  ? -7.448  -4.702  6.509   1.00 0.00 ? 33  TYR A N    5  
ATOM   8594  C  CA   . TYR A 1 33  ? -8.295  -3.519  6.397   1.00 0.00 ? 33  TYR A CA   5  
ATOM   8595  C  C    . TYR A 1 33  ? -8.335  -2.728  7.708   1.00 0.00 ? 33  TYR A C    5  
ATOM   8596  O  O    . TYR A 1 33  ? -8.140  -1.511  7.690   1.00 0.00 ? 33  TYR A O    5  
ATOM   8597  C  CB   . TYR A 1 33  ? -9.695  -3.965  5.946   1.00 0.00 ? 33  TYR A CB   5  
ATOM   8598  C  CG   . TYR A 1 33  ? -10.818 -2.958  6.113   1.00 0.00 ? 33  TYR A CG   5  
ATOM   8599  C  CD1  . TYR A 1 33  ? -10.721 -1.669  5.560   1.00 0.00 ? 33  TYR A CD1  5  
ATOM   8600  C  CD2  . TYR A 1 33  ? -11.967 -3.319  6.840   1.00 0.00 ? 33  TYR A CD2  5  
ATOM   8601  C  CE1  . TYR A 1 33  ? -11.760 -0.739  5.746   1.00 0.00 ? 33  TYR A CE1  5  
ATOM   8602  C  CE2  . TYR A 1 33  ? -13.000 -2.391  7.048   1.00 0.00 ? 33  TYR A CE2  5  
ATOM   8603  C  CZ   . TYR A 1 33  ? -12.904 -1.093  6.497   1.00 0.00 ? 33  TYR A CZ   5  
ATOM   8604  O  OH   . TYR A 1 33  ? -13.892 -0.175  6.699   1.00 0.00 ? 33  TYR A OH   5  
ATOM   8605  H  H    . TYR A 1 33  ? -7.869  -5.597  6.280   1.00 0.00 ? 33  TYR A H    5  
ATOM   8606  H  HA   . TYR A 1 33  ? -7.877  -2.866  5.630   1.00 0.00 ? 33  TYR A HA   5  
ATOM   8607  H  HB2  . TYR A 1 33  ? -9.648  -4.259  4.900   1.00 0.00 ? 33  TYR A HB2  5  
ATOM   8608  H  HB3  . TYR A 1 33  ? -9.963  -4.852  6.514   1.00 0.00 ? 33  TYR A HB3  5  
ATOM   8609  H  HD1  . TYR A 1 33  ? -9.841  -1.383  5.005   1.00 0.00 ? 33  TYR A HD1  5  
ATOM   8610  H  HD2  . TYR A 1 33  ? -12.051 -4.310  7.265   1.00 0.00 ? 33  TYR A HD2  5  
ATOM   8611  H  HE1  . TYR A 1 33  ? -11.676 0.253   5.331   1.00 0.00 ? 33  TYR A HE1  5  
ATOM   8612  H  HE2  . TYR A 1 33  ? -13.855 -2.675  7.643   1.00 0.00 ? 33  TYR A HE2  5  
ATOM   8613  H  HH   . TYR A 1 33  ? -14.622 -0.508  7.243   1.00 0.00 ? 33  TYR A HH   5  
ATOM   8614  N  N    . TYR A 1 34  ? -8.546  -3.397  8.845   1.00 0.00 ? 34  TYR A N    5  
ATOM   8615  C  CA   . TYR A 1 34  ? -8.678  -2.733  10.133  1.00 0.00 ? 34  TYR A CA   5  
ATOM   8616  C  C    . TYR A 1 34  ? -7.359  -2.064  10.527  1.00 0.00 ? 34  TYR A C    5  
ATOM   8617  O  O    . TYR A 1 34  ? -7.362  -0.913  10.964  1.00 0.00 ? 34  TYR A O    5  
ATOM   8618  C  CB   . TYR A 1 34  ? -9.095  -3.745  11.214  1.00 0.00 ? 34  TYR A CB   5  
ATOM   8619  C  CG   . TYR A 1 34  ? -10.420 -4.485  11.051  1.00 0.00 ? 34  TYR A CG   5  
ATOM   8620  C  CD1  . TYR A 1 34  ? -11.426 -4.063  10.153  1.00 0.00 ? 34  TYR A CD1  5  
ATOM   8621  C  CD2  . TYR A 1 34  ? -10.642 -5.628  11.846  1.00 0.00 ? 34  TYR A CD2  5  
ATOM   8622  C  CE1  . TYR A 1 34  ? -12.642 -4.768  10.067  1.00 0.00 ? 34  TYR A CE1  5  
ATOM   8623  C  CE2  . TYR A 1 34  ? -11.850 -6.340  11.760  1.00 0.00 ? 34  TYR A CE2  5  
ATOM   8624  C  CZ   . TYR A 1 34  ? -12.860 -5.910  10.871  1.00 0.00 ? 34  TYR A CZ   5  
ATOM   8625  O  OH   . TYR A 1 34  ? -14.030 -6.605  10.797  1.00 0.00 ? 34  TYR A OH   5  
ATOM   8626  H  H    . TYR A 1 34  ? -8.633  -4.407  8.834   1.00 0.00 ? 34  TYR A H    5  
ATOM   8627  H  HA   . TYR A 1 34  ? -9.442  -1.959  10.057  1.00 0.00 ? 34  TYR A HA   5  
ATOM   8628  H  HB2  . TYR A 1 34  ? -8.303  -4.492  11.300  1.00 0.00 ? 34  TYR A HB2  5  
ATOM   8629  H  HB3  . TYR A 1 34  ? -9.136  -3.213  12.165  1.00 0.00 ? 34  TYR A HB3  5  
ATOM   8630  H  HD1  . TYR A 1 34  ? -11.275 -3.207  9.509   1.00 0.00 ? 34  TYR A HD1  5  
ATOM   8631  H  HD2  . TYR A 1 34  ? -9.875  -5.965  12.530  1.00 0.00 ? 34  TYR A HD2  5  
ATOM   8632  H  HE1  . TYR A 1 34  ? -13.405 -4.434  9.379   1.00 0.00 ? 34  TYR A HE1  5  
ATOM   8633  H  HE2  . TYR A 1 34  ? -12.005 -7.215  12.376  1.00 0.00 ? 34  TYR A HE2  5  
ATOM   8634  H  HH   . TYR A 1 34  ? -14.662 -6.232  10.162  1.00 0.00 ? 34  TYR A HH   5  
ATOM   8635  N  N    . TYR A 1 35  ? -6.229  -2.762  10.371  1.00 0.00 ? 35  TYR A N    5  
ATOM   8636  C  CA   . TYR A 1 35  ? -4.929  -2.223  10.749  1.00 0.00 ? 35  TYR A CA   5  
ATOM   8637  C  C    . TYR A 1 35  ? -4.513  -1.092  9.808   1.00 0.00 ? 35  TYR A C    5  
ATOM   8638  O  O    . TYR A 1 35  ? -3.946  -0.098  10.270  1.00 0.00 ? 35  TYR A O    5  
ATOM   8639  C  CB   . TYR A 1 35  ? -3.898  -3.356  10.722  1.00 0.00 ? 35  TYR A CB   5  
ATOM   8640  C  CG   . TYR A 1 35  ? -2.517  -2.945  11.194  1.00 0.00 ? 35  TYR A CG   5  
ATOM   8641  C  CD1  . TYR A 1 35  ? -2.180  -3.044  12.557  1.00 0.00 ? 35  TYR A CD1  5  
ATOM   8642  C  CD2  . TYR A 1 35  ? -1.564  -2.478  10.268  1.00 0.00 ? 35  TYR A CD2  5  
ATOM   8643  C  CE1  . TYR A 1 35  ? -0.894  -2.685  12.996  1.00 0.00 ? 35  TYR A CE1  5  
ATOM   8644  C  CE2  . TYR A 1 35  ? -0.276  -2.114  10.699  1.00 0.00 ? 35  TYR A CE2  5  
ATOM   8645  C  CZ   . TYR A 1 35  ? 0.066   -2.218  12.068  1.00 0.00 ? 35  TYR A CZ   5  
ATOM   8646  O  OH   . TYR A 1 35  ? 1.312   -1.877  12.504  1.00 0.00 ? 35  TYR A OH   5  
ATOM   8647  H  H    . TYR A 1 35  ? -6.262  -3.702  9.993   1.00 0.00 ? 35  TYR A H    5  
ATOM   8648  H  HA   . TYR A 1 35  ? -4.997  -1.810  11.762  1.00 0.00 ? 35  TYR A HA   5  
ATOM   8649  H  HB2  . TYR A 1 35  ? -4.252  -4.173  11.354  1.00 0.00 ? 35  TYR A HB2  5  
ATOM   8650  H  HB3  . TYR A 1 35  ? -3.823  -3.737  9.703   1.00 0.00 ? 35  TYR A HB3  5  
ATOM   8651  H  HD1  . TYR A 1 35  ? -2.905  -3.411  13.272  1.00 0.00 ? 35  TYR A HD1  5  
ATOM   8652  H  HD2  . TYR A 1 35  ? -1.815  -2.402  9.219   1.00 0.00 ? 35  TYR A HD2  5  
ATOM   8653  H  HE1  . TYR A 1 35  ? -0.642  -2.771  14.043  1.00 0.00 ? 35  TYR A HE1  5  
ATOM   8654  H  HE2  . TYR A 1 35  ? 0.443   -1.756  9.976   1.00 0.00 ? 35  TYR A HE2  5  
ATOM   8655  H  HH   . TYR A 1 35  ? 1.895   -1.564  11.795  1.00 0.00 ? 35  TYR A HH   5  
ATOM   8656  N  N    . LEU A 1 36  ? -4.803  -1.207  8.506   1.00 0.00 ? 36  LEU A N    5  
ATOM   8657  C  CA   . LEU A 1 36  ? -4.515  -0.154  7.548   1.00 0.00 ? 36  LEU A CA   5  
ATOM   8658  C  C    . LEU A 1 36  ? -5.300  1.078   7.926   1.00 0.00 ? 36  LEU A C    5  
ATOM   8659  O  O    . LEU A 1 36  ? -4.657  2.109   8.098   1.00 0.00 ? 36  LEU A O    5  
ATOM   8660  C  CB   . LEU A 1 36  ? -4.828  -0.565  6.102   1.00 0.00 ? 36  LEU A CB   5  
ATOM   8661  C  CG   . LEU A 1 36  ? -3.565  -0.920  5.299   1.00 0.00 ? 36  LEU A CG   5  
ATOM   8662  C  CD1  . LEU A 1 36  ? -2.678  -1.975  5.969   1.00 0.00 ? 36  LEU A CD1  5  
ATOM   8663  C  CD2  . LEU A 1 36  ? -4.006  -1.422  3.922   1.00 0.00 ? 36  LEU A CD2  5  
ATOM   8664  H  H    . LEU A 1 36  ? -5.276  -2.025  8.161   1.00 0.00 ? 36  LEU A H    5  
ATOM   8665  H  HA   . LEU A 1 36  ? -3.458  0.105   7.625   1.00 0.00 ? 36  LEU A HA   5  
ATOM   8666  H  HB2  . LEU A 1 36  ? -5.543  -1.386  6.084   1.00 0.00 ? 36  LEU A HB2  5  
ATOM   8667  H  HB3  . LEU A 1 36  ? -5.301  0.277   5.594   1.00 0.00 ? 36  LEU A HB3  5  
ATOM   8668  H  HG   . LEU A 1 36  ? -2.971  -0.012  5.181   1.00 0.00 ? 36  LEU A HG   5  
ATOM   8669  H  HD11 . LEU A 1 36  ? -3.282  -2.833  6.258   1.00 0.00 ? 36  LEU A HD11 5  
ATOM   8670  H  HD12 . LEU A 1 36  ? -1.891  -2.289  5.283   1.00 0.00 ? 36  LEU A HD12 5  
ATOM   8671  H  HD13 . LEU A 1 36  ? -2.203  -1.563  6.858   1.00 0.00 ? 36  LEU A HD13 5  
ATOM   8672  H  HD21 . LEU A 1 36  ? -4.674  -0.696  3.460   1.00 0.00 ? 36  LEU A HD21 5  
ATOM   8673  H  HD22 . LEU A 1 36  ? -3.141  -1.560  3.278   1.00 0.00 ? 36  LEU A HD22 5  
ATOM   8674  H  HD23 . LEU A 1 36  ? -4.533  -2.371  4.024   1.00 0.00 ? 36  LEU A HD23 5  
ATOM   8675  N  N    . ASP A 1 37  ? -6.625  0.982   8.136   1.00 0.00 ? 37  ASP A N    5  
ATOM   8676  C  CA   . ASP A 1 37  ? -7.384  2.144   8.596   1.00 0.00 ? 37  ASP A CA   5  
ATOM   8677  C  C    . ASP A 1 37  ? -6.711  2.684   9.807   1.00 0.00 ? 37  ASP A C    5  
ATOM   8678  O  O    . ASP A 1 37  ? -6.456  3.890   9.840   1.00 0.00 ? 37  ASP A O    5  
ATOM   8679  C  CB   . ASP A 1 37  ? -8.849  1.884   9.012   1.00 0.00 ? 37  ASP A CB   5  
ATOM   8680  C  CG   . ASP A 1 37  ? -9.569  3.070   9.754   1.00 0.00 ? 37  ASP A CG   5  
ATOM   8681  O  OD1  . ASP A 1 37  ? -9.024  3.797   10.638  1.00 0.00 ? 37  ASP A OD1  5  
ATOM   8682  O  OD2  . ASP A 1 37  ? -10.776 3.240   9.476   1.00 0.00 ? 37  ASP A OD2  5  
ATOM   8683  H  H    . ASP A 1 37  ? -7.095  0.082   8.055   1.00 0.00 ? 37  ASP A H    5  
ATOM   8684  H  HA   . ASP A 1 37  ? -7.338  2.914   7.834   1.00 0.00 ? 37  ASP A HA   5  
ATOM   8685  H  HB2  . ASP A 1 37  ? -9.409  1.629   8.110   1.00 0.00 ? 37  ASP A HB2  5  
ATOM   8686  H  HB3  . ASP A 1 37  ? -8.880  1.010   9.664   1.00 0.00 ? 37  ASP A HB3  5  
ATOM   8687  N  N    . ASP A 1 38  ? -6.400  1.839   10.798  1.00 0.00 ? 38  ASP A N    5  
ATOM   8688  C  CA   . ASP A 1 38  ? -6.001  2.469   12.024  1.00 0.00 ? 38  ASP A CA   5  
ATOM   8689  C  C    . ASP A 1 38  ? -4.707  3.261   11.897  1.00 0.00 ? 38  ASP A C    5  
ATOM   8690  O  O    . ASP A 1 38  ? -4.613  4.350   12.466  1.00 0.00 ? 38  ASP A O    5  
ATOM   8691  C  CB   . ASP A 1 38  ? -6.126  1.657   13.302  1.00 0.00 ? 38  ASP A CB   5  
ATOM   8692  C  CG   . ASP A 1 38  ? -6.295  2.686   14.456  1.00 0.00 ? 38  ASP A CG   5  
ATOM   8693  O  OD1  . ASP A 1 38  ? -6.851  3.801   14.226  1.00 0.00 ? 38  ASP A OD1  5  
ATOM   8694  O  OD2  . ASP A 1 38  ? -5.885  2.379   15.598  1.00 0.00 ? 38  ASP A OD2  5  
ATOM   8695  H  H    . ASP A 1 38  ? -6.551  0.834   10.747  1.00 0.00 ? 38  ASP A H    5  
ATOM   8696  H  HA   . ASP A 1 38  ? -6.799  3.188   12.114  1.00 0.00 ? 38  ASP A HA   5  
ATOM   8697  H  HB2  . ASP A 1 38  ? -7.011  1.019   13.249  1.00 0.00 ? 38  ASP A HB2  5  
ATOM   8698  H  HB3  . ASP A 1 38  ? -5.245  1.020   13.429  1.00 0.00 ? 38  ASP A HB3  5  
ATOM   8699  N  N    . THR A 1 39  ? -3.821  2.810   11.015  1.00 0.00 ? 39  THR A N    5  
ATOM   8700  C  CA   . THR A 1 39  ? -2.533  3.433   10.797  1.00 0.00 ? 39  THR A CA   5  
ATOM   8701  C  C    . THR A 1 39  ? -2.711  4.718   9.973   1.00 0.00 ? 39  THR A C    5  
ATOM   8702  O  O    . THR A 1 39  ? -2.137  5.758   10.298  1.00 0.00 ? 39  THR A O    5  
ATOM   8703  C  CB   . THR A 1 39  ? -1.634  2.408   10.091  1.00 0.00 ? 39  THR A CB   5  
ATOM   8704  O  OG1  . THR A 1 39  ? -1.595  1.181   10.797  1.00 0.00 ? 39  THR A OG1  5  
ATOM   8705  C  CG2  . THR A 1 39  ? -0.211  2.943   10.000  1.00 0.00 ? 39  THR A CG2  5  
ATOM   8706  H  H    . THR A 1 39  ? -4.128  2.095   10.340  1.00 0.00 ? 39  THR A H    5  
ATOM   8707  H  HA   . THR A 1 39  ? -2.094  3.692   11.762  1.00 0.00 ? 39  THR A HA   5  
ATOM   8708  H  HB   . THR A 1 39  ? -2.021  2.222   9.088   1.00 0.00 ? 39  THR A HB   5  
ATOM   8709  H  HG1  . THR A 1 39  ? -2.452  0.734   10.659  1.00 0.00 ? 39  THR A HG1  5  
ATOM   8710  H  HG21 . THR A 1 39  ? 0.228   2.997   10.993  1.00 0.00 ? 39  THR A HG21 5  
ATOM   8711  H  HG22 . THR A 1 39  ? 0.395   2.296   9.369   1.00 0.00 ? 39  THR A HG22 5  
ATOM   8712  H  HG23 . THR A 1 39  ? -0.243  3.945   9.572   1.00 0.00 ? 39  THR A HG23 5  
ATOM   8713  N  N    . LEU A 1 40  ? -3.519  4.652   8.913   1.00 0.00 ? 40  LEU A N    5  
ATOM   8714  C  CA   . LEU A 1 40  ? -3.895  5.797   8.095   1.00 0.00 ? 40  LEU A CA   5  
ATOM   8715  C  C    . LEU A 1 40  ? -4.636  6.831   8.956   1.00 0.00 ? 40  LEU A C    5  
ATOM   8716  O  O    . LEU A 1 40  ? -5.467  6.492   9.812   1.00 0.00 ? 40  LEU A O    5  
ATOM   8717  C  CB   . LEU A 1 40  ? -4.805  5.353   6.929   1.00 0.00 ? 40  LEU A CB   5  
ATOM   8718  C  CG   . LEU A 1 40  ? -4.218  4.307   5.954   1.00 0.00 ? 40  LEU A CG   5  
ATOM   8719  C  CD1  . LEU A 1 40  ? -5.348  3.651   5.151   1.00 0.00 ? 40  LEU A CD1  5  
ATOM   8720  C  CD2  . LEU A 1 40  ? -3.202  4.865   4.959   1.00 0.00 ? 40  LEU A CD2  5  
ATOM   8721  H  H    . LEU A 1 40  ? -3.940  3.767   8.681   1.00 0.00 ? 40  LEU A H    5  
ATOM   8722  H  HA   . LEU A 1 40  ? -2.989  6.239   7.685   1.00 0.00 ? 40  LEU A HA   5  
ATOM   8723  H  HB2  . LEU A 1 40  ? -5.714  4.940   7.371   1.00 0.00 ? 40  LEU A HB2  5  
ATOM   8724  H  HB3  . LEU A 1 40  ? -5.093  6.237   6.359   1.00 0.00 ? 40  LEU A HB3  5  
ATOM   8725  H  HG   . LEU A 1 40  ? -3.698  3.544   6.524   1.00 0.00 ? 40  LEU A HG   5  
ATOM   8726  H  HD11 . LEU A 1 40  ? -5.867  4.394   4.545   1.00 0.00 ? 40  LEU A HD11 5  
ATOM   8727  H  HD12 . LEU A 1 40  ? -4.945  2.873   4.502   1.00 0.00 ? 40  LEU A HD12 5  
ATOM   8728  H  HD13 . LEU A 1 40  ? -6.058  3.187   5.834   1.00 0.00 ? 40  LEU A HD13 5  
ATOM   8729  H  HD21 . LEU A 1 40  ? -3.641  5.664   4.365   1.00 0.00 ? 40  LEU A HD21 5  
ATOM   8730  H  HD22 . LEU A 1 40  ? -2.328  5.228   5.491   1.00 0.00 ? 40  LEU A HD22 5  
ATOM   8731  H  HD23 . LEU A 1 40  ? -2.880  4.068   4.291   1.00 0.00 ? 40  LEU A HD23 5  
ATOM   8732  N  N    . GLU A 1 41  ? -4.405  8.107   8.656   1.00 0.00 ? 41  GLU A N    5  
ATOM   8733  C  CA   . GLU A 1 41  ? -5.100  9.250   9.244   1.00 0.00 ? 41  GLU A CA   5  
ATOM   8734  C  C    . GLU A 1 41  ? -5.679  10.102  8.104   1.00 0.00 ? 41  GLU A C    5  
ATOM   8735  O  O    . GLU A 1 41  ? -5.409  11.298  7.974   1.00 0.00 ? 41  GLU A O    5  
ATOM   8736  C  CB   . GLU A 1 41  ? -4.164  10.006  10.205  1.00 0.00 ? 41  GLU A CB   5  
ATOM   8737  C  CG   . GLU A 1 41  ? -3.842  9.195   11.472  1.00 0.00 ? 41  GLU A CG   5  
ATOM   8738  C  CD   . GLU A 1 41  ? -5.059  9.049   12.411  1.00 0.00 ? 41  GLU A CD   5  
ATOM   8739  O  OE1  . GLU A 1 41  ? -5.310  9.966   13.226  1.00 0.00 ? 41  GLU A OE1  5  
ATOM   8740  O  OE2  . GLU A 1 41  ? -5.771  8.016   12.363  1.00 0.00 ? 41  GLU A OE2  5  
ATOM   8741  H  H    . GLU A 1 41  ? -3.620  8.323   8.052   1.00 0.00 ? 41  GLU A H    5  
ATOM   8742  H  HA   . GLU A 1 41  ? -5.954  8.893   9.820   1.00 0.00 ? 41  GLU A HA   5  
ATOM   8743  H  HB2  . GLU A 1 41  ? -3.232  10.239  9.687   1.00 0.00 ? 41  GLU A HB2  5  
ATOM   8744  H  HB3  . GLU A 1 41  ? -4.630  10.944  10.508  1.00 0.00 ? 41  GLU A HB3  5  
ATOM   8745  H  HG2  . GLU A 1 41  ? -3.463  8.214   11.185  1.00 0.00 ? 41  GLU A HG2  5  
ATOM   8746  H  HG3  . GLU A 1 41  ? -3.039  9.706   12.008  1.00 0.00 ? 41  GLU A HG3  5  
ATOM   8747  N  N    . PHE A 1 42  ? -6.451  9.438   7.235   1.00 0.00 ? 42  PHE A N    5  
ATOM   8748  C  CA   . PHE A 1 42  ? -7.274  10.063  6.201   1.00 0.00 ? 42  PHE A CA   5  
ATOM   8749  C  C    . PHE A 1 42  ? -8.288  11.057  6.818   1.00 0.00 ? 42  PHE A C    5  
ATOM   8750  O  O    . PHE A 1 42  ? -8.571  10.952  8.018   1.00 0.00 ? 42  PHE A O    5  
ATOM   8751  C  CB   . PHE A 1 42  ? -7.942  8.942   5.381   1.00 0.00 ? 42  PHE A CB   5  
ATOM   8752  C  CG   . PHE A 1 42  ? -8.788  7.947   6.160   1.00 0.00 ? 42  PHE A CG   5  
ATOM   8753  C  CD1  . PHE A 1 42  ? -10.043 8.332   6.676   1.00 0.00 ? 42  PHE A CD1  5  
ATOM   8754  C  CD2  . PHE A 1 42  ? -8.372  6.606   6.279   1.00 0.00 ? 42  PHE A CD2  5  
ATOM   8755  C  CE1  . PHE A 1 42  ? -10.868 7.386   7.308   1.00 0.00 ? 42  PHE A CE1  5  
ATOM   8756  C  CE2  . PHE A 1 42  ? -9.198  5.661   6.913   1.00 0.00 ? 42  PHE A CE2  5  
ATOM   8757  C  CZ   . PHE A 1 42  ? -10.448 6.051   7.423   1.00 0.00 ? 42  PHE A CZ   5  
ATOM   8758  H  H    . PHE A 1 42  ? -6.617  8.458   7.412   1.00 0.00 ? 42  PHE A H    5  
ATOM   8759  H  HA   . PHE A 1 42  ? -6.614  10.621  5.543   1.00 0.00 ? 42  PHE A HA   5  
ATOM   8760  H  HB2  . PHE A 1 42  ? -8.571  9.373   4.608   1.00 0.00 ? 42  PHE A HB2  5  
ATOM   8761  H  HB3  . PHE A 1 42  ? -7.156  8.395   4.859   1.00 0.00 ? 42  PHE A HB3  5  
ATOM   8762  H  HD1  . PHE A 1 42  ? -10.399 9.346   6.560   1.00 0.00 ? 42  PHE A HD1  5  
ATOM   8763  H  HD2  . PHE A 1 42  ? -7.426  6.287   5.863   1.00 0.00 ? 42  PHE A HD2  5  
ATOM   8764  H  HE1  . PHE A 1 42  ? -11.835 7.685   7.692   1.00 0.00 ? 42  PHE A HE1  5  
ATOM   8765  H  HE2  . PHE A 1 42  ? -8.877  4.633   7.002   1.00 0.00 ? 42  PHE A HE2  5  
ATOM   8766  H  HZ   . PHE A 1 42  ? -11.092 5.326   7.900   1.00 0.00 ? 42  PHE A HZ   5  
ATOM   8767  N  N    . PRO A 1 43  ? -8.886  11.990  6.046   1.00 0.00 ? 43  PRO A N    5  
ATOM   8768  C  CA   . PRO A 1 43  ? -8.696  12.230  4.612   1.00 0.00 ? 43  PRO A CA   5  
ATOM   8769  C  C    . PRO A 1 43  ? -7.284  12.732  4.291   1.00 0.00 ? 43  PRO A C    5  
ATOM   8770  O  O    . PRO A 1 43  ? -6.645  13.363  5.136   1.00 0.00 ? 43  PRO A O    5  
ATOM   8771  C  CB   . PRO A 1 43  ? -9.753  13.276  4.236   1.00 0.00 ? 43  PRO A CB   5  
ATOM   8772  C  CG   . PRO A 1 43  ? -9.985  14.048  5.530   1.00 0.00 ? 43  PRO A CG   5  
ATOM   8773  C  CD   . PRO A 1 43  ? -9.829  12.961  6.590   1.00 0.00 ? 43  PRO A CD   5  
ATOM   8774  H  HA   . PRO A 1 43  ? -8.891  11.326  4.043   1.00 0.00 ? 43  PRO A HA   5  
ATOM   8775  H  HB2  . PRO A 1 43  ? -9.425  13.930  3.427   1.00 0.00 ? 43  PRO A HB2  5  
ATOM   8776  H  HB3  . PRO A 1 43  ? -10.677 12.771  3.959   1.00 0.00 ? 43  PRO A HB3  5  
ATOM   8777  H  HG2  . PRO A 1 43  ? -9.207  14.802  5.657   1.00 0.00 ? 43  PRO A HG2  5  
ATOM   8778  H  HG3  . PRO A 1 43  ? -10.974 14.505  5.561   1.00 0.00 ? 43  PRO A HG3  5  
ATOM   8779  H  HD2  . PRO A 1 43  ? -9.461  13.395  7.520   1.00 0.00 ? 43  PRO A HD2  5  
ATOM   8780  H  HD3  . PRO A 1 43  ? -10.789 12.470  6.760   1.00 0.00 ? 43  PRO A HD3  5  
ATOM   8781  N  N    . PHE A 1 44  ? -6.794  12.457  3.077   1.00 0.00 ? 44  PHE A N    5  
ATOM   8782  C  CA   . PHE A 1 44  ? -5.495  12.950  2.618   1.00 0.00 ? 44  PHE A CA   5  
ATOM   8783  C  C    . PHE A 1 44  ? -5.510  13.127  1.099   1.00 0.00 ? 44  PHE A C    5  
ATOM   8784  O  O    . PHE A 1 44  ? -6.367  12.567  0.421   1.00 0.00 ? 44  PHE A O    5  
ATOM   8785  C  CB   . PHE A 1 44  ? -4.358  12.016  3.080   1.00 0.00 ? 44  PHE A CB   5  
ATOM   8786  C  CG   . PHE A 1 44  ? -4.370  10.583  2.564   1.00 0.00 ? 44  PHE A CG   5  
ATOM   8787  C  CD1  . PHE A 1 44  ? -3.959  10.308  1.249   1.00 0.00 ? 44  PHE A CD1  5  
ATOM   8788  C  CD2  . PHE A 1 44  ? -4.715  9.509   3.406   1.00 0.00 ? 44  PHE A CD2  5  
ATOM   8789  C  CE1  . PHE A 1 44  ? -3.908  8.994   0.762   1.00 0.00 ? 44  PHE A CE1  5  
ATOM   8790  C  CE2  . PHE A 1 44  ? -4.673  8.187   2.924   1.00 0.00 ? 44  PHE A CE2  5  
ATOM   8791  C  CZ   . PHE A 1 44  ? -4.268  7.926   1.602   1.00 0.00 ? 44  PHE A CZ   5  
ATOM   8792  H  H    . PHE A 1 44  ? -7.365  11.955  2.397   1.00 0.00 ? 44  PHE A H    5  
ATOM   8793  H  HA   . PHE A 1 44  ? -5.321  13.933  3.060   1.00 0.00 ? 44  PHE A HA   5  
ATOM   8794  H  HB2  . PHE A 1 44  ? -3.414  12.469  2.774   1.00 0.00 ? 44  PHE A HB2  5  
ATOM   8795  H  HB3  . PHE A 1 44  ? -4.351  11.994  4.171   1.00 0.00 ? 44  PHE A HB3  5  
ATOM   8796  H  HD1  . PHE A 1 44  ? -3.665  11.111  0.605   1.00 0.00 ? 44  PHE A HD1  5  
ATOM   8797  H  HD2  . PHE A 1 44  ? -4.991  9.690   4.432   1.00 0.00 ? 44  PHE A HD2  5  
ATOM   8798  H  HE1  . PHE A 1 44  ? -3.568  8.820   -0.250  1.00 0.00 ? 44  PHE A HE1  5  
ATOM   8799  H  HE2  . PHE A 1 44  ? -4.952  7.370   3.573   1.00 0.00 ? 44  PHE A HE2  5  
ATOM   8800  H  HZ   . PHE A 1 44  ? -4.229  6.909   1.235   1.00 0.00 ? 44  PHE A HZ   5  
ATOM   8801  N  N    . MET A 1 45  ? -4.572  13.891  0.541   1.00 0.00 ? 45  MET A N    5  
ATOM   8802  C  CA   . MET A 1 45  ? -4.447  14.051  -0.906  1.00 0.00 ? 45  MET A CA   5  
ATOM   8803  C  C    . MET A 1 45  ? -3.565  12.929  -1.454  1.00 0.00 ? 45  MET A C    5  
ATOM   8804  O  O    . MET A 1 45  ? -2.558  12.590  -0.833  1.00 0.00 ? 45  MET A O    5  
ATOM   8805  C  CB   . MET A 1 45  ? -3.815  15.423  -1.184  1.00 0.00 ? 45  MET A CB   5  
ATOM   8806  C  CG   . MET A 1 45  ? -3.620  15.688  -2.677  1.00 0.00 ? 45  MET A CG   5  
ATOM   8807  S  SD   . MET A 1 45  ? -2.771  17.242  -3.044  1.00 0.00 ? 45  MET A SD   5  
ATOM   8808  C  CE   . MET A 1 45  ? -2.779  17.106  -4.847  1.00 0.00 ? 45  MET A CE   5  
ATOM   8809  H  H    . MET A 1 45  ? -3.852  14.299  1.120   1.00 0.00 ? 45  MET A H    5  
ATOM   8810  H  HA   . MET A 1 45  ? -5.437  13.991  -1.364  1.00 0.00 ? 45  MET A HA   5  
ATOM   8811  H  HB2  . MET A 1 45  ? -4.456  16.203  -0.771  1.00 0.00 ? 45  MET A HB2  5  
ATOM   8812  H  HB3  . MET A 1 45  ? -2.842  15.476  -0.692  1.00 0.00 ? 45  MET A HB3  5  
ATOM   8813  H  HG2  . MET A 1 45  ? -3.026  14.885  -3.109  1.00 0.00 ? 45  MET A HG2  5  
ATOM   8814  H  HG3  . MET A 1 45  ? -4.594  15.688  -3.163  1.00 0.00 ? 45  MET A HG3  5  
ATOM   8815  H  HE1  . MET A 1 45  ? -3.804  17.180  -5.205  1.00 0.00 ? 45  MET A HE1  5  
ATOM   8816  H  HE2  . MET A 1 45  ? -2.183  17.907  -5.283  1.00 0.00 ? 45  MET A HE2  5  
ATOM   8817  H  HE3  . MET A 1 45  ? -2.370  16.139  -5.145  1.00 0.00 ? 45  MET A HE3  5  
ATOM   8818  N  N    . GLY A 1 46  ? -3.873  12.393  -2.635  1.00 0.00 ? 46  GLY A N    5  
ATOM   8819  C  CA   . GLY A 1 46  ? -3.023  11.415  -3.290  1.00 0.00 ? 46  GLY A CA   5  
ATOM   8820  C  C    . GLY A 1 46  ? -3.145  11.486  -4.803  1.00 0.00 ? 46  GLY A C    5  
ATOM   8821  O  O    . GLY A 1 46  ? -4.041  12.133  -5.350  1.00 0.00 ? 46  GLY A O    5  
ATOM   8822  H  H    . GLY A 1 46  ? -4.679  12.726  -3.159  1.00 0.00 ? 46  GLY A H    5  
ATOM   8823  H  HA2  . GLY A 1 46  ? -1.984  11.597  -3.022  1.00 0.00 ? 46  GLY A HA2  5  
ATOM   8824  H  HA3  . GLY A 1 46  ? -3.297  10.412  -2.960  1.00 0.00 ? 46  GLY A HA3  5  
ATOM   8825  N  N    . LYS A 1 47  ? -2.219  10.821  -5.488  1.00 0.00 ? 47  LYS A N    5  
ATOM   8826  C  CA   . LYS A 1 47  ? -2.325  10.602  -6.924  1.00 0.00 ? 47  LYS A CA   5  
ATOM   8827  C  C    . LYS A 1 47  ? -2.882  9.198   -7.107  1.00 0.00 ? 47  LYS A C    5  
ATOM   8828  O  O    . LYS A 1 47  ? -2.359  8.242   -6.529  1.00 0.00 ? 47  LYS A O    5  
ATOM   8829  C  CB   . LYS A 1 47  ? -0.951  10.737  -7.614  1.00 0.00 ? 47  LYS A CB   5  
ATOM   8830  C  CG   . LYS A 1 47  ? -1.074  10.946  -9.136  1.00 0.00 ? 47  LYS A CG   5  
ATOM   8831  C  CD   . LYS A 1 47  ? -1.480  12.383  -9.517  1.00 0.00 ? 47  LYS A CD   5  
ATOM   8832  C  CE   . LYS A 1 47  ? -0.330  13.396  -9.400  1.00 0.00 ? 47  LYS A CE   5  
ATOM   8833  N  NZ   . LYS A 1 47  ? 0.562   13.395  -10.587 1.00 0.00 ? 47  LYS A NZ   5  
ATOM   8834  H  H    . LYS A 1 47  ? -1.542  10.284  -4.968  1.00 0.00 ? 47  LYS A H    5  
ATOM   8835  H  HA   . LYS A 1 47  ? -3.028  11.330  -7.338  1.00 0.00 ? 47  LYS A HA   5  
ATOM   8836  H  HB2  . LYS A 1 47  ? -0.396  11.569  -7.189  1.00 0.00 ? 47  LYS A HB2  5  
ATOM   8837  H  HB3  . LYS A 1 47  ? -0.368  9.833   -7.426  1.00 0.00 ? 47  LYS A HB3  5  
ATOM   8838  H  HG2  . LYS A 1 47  ? -0.118  10.709  -9.601  1.00 0.00 ? 47  LYS A HG2  5  
ATOM   8839  H  HG3  . LYS A 1 47  ? -1.814  10.250  -9.536  1.00 0.00 ? 47  LYS A HG3  5  
ATOM   8840  H  HD2  . LYS A 1 47  ? -1.878  12.399  -10.531 1.00 0.00 ? 47  LYS A HD2  5  
ATOM   8841  H  HD3  . LYS A 1 47  ? -2.281  12.713  -8.859  1.00 0.00 ? 47  LYS A HD3  5  
ATOM   8842  H  HE2  . LYS A 1 47  ? -0.764  14.394  -9.291  1.00 0.00 ? 47  LYS A HE2  5  
ATOM   8843  H  HE3  . LYS A 1 47  ? 0.248   13.182  -8.499  1.00 0.00 ? 47  LYS A HE3  5  
ATOM   8844  H  HZ1  . LYS A 1 47  ? 1.374   13.973  -10.426 1.00 0.00 ? 47  LYS A HZ1  5  
ATOM   8845  H  HZ2  . LYS A 1 47  ? 0.892   12.457  -10.829 1.00 0.00 ? 47  LYS A HZ2  5  
ATOM   8846  H  HZ3  . LYS A 1 47  ? 0.086   13.763  -11.396 1.00 0.00 ? 47  LYS A HZ3  5  
ATOM   8847  N  N    . TRP A 1 48  ? -3.945  9.068   -7.891  1.00 0.00 ? 48  TRP A N    5  
ATOM   8848  C  CA   . TRP A 1 48  ? -4.444  7.784   -8.338  1.00 0.00 ? 48  TRP A CA   5  
ATOM   8849  C  C    . TRP A 1 48  ? -3.580  7.449   -9.551  1.00 0.00 ? 48  TRP A C    5  
ATOM   8850  O  O    . TRP A 1 48  ? -3.723  8.075   -10.602 1.00 0.00 ? 48  TRP A O    5  
ATOM   8851  C  CB   . TRP A 1 48  ? -5.940  7.898   -8.670  1.00 0.00 ? 48  TRP A CB   5  
ATOM   8852  C  CG   . TRP A 1 48  ? -6.671  6.632   -9.010  1.00 0.00 ? 48  TRP A CG   5  
ATOM   8853  C  CD1  . TRP A 1 48  ? -6.132  5.399   -9.143  1.00 0.00 ? 48  TRP A CD1  5  
ATOM   8854  C  CD2  . TRP A 1 48  ? -8.102  6.454   -9.245  1.00 0.00 ? 48  TRP A CD2  5  
ATOM   8855  N  NE1  . TRP A 1 48  ? -7.110  4.487   -9.471  1.00 0.00 ? 48  TRP A NE1  5  
ATOM   8856  C  CE2  . TRP A 1 48  ? -8.349  5.083   -9.555  1.00 0.00 ? 48  TRP A CE2  5  
ATOM   8857  C  CE3  . TRP A 1 48  ? -9.222  7.315   -9.208  1.00 0.00 ? 48  TRP A CE3  5  
ATOM   8858  C  CZ2  . TRP A 1 48  ? -9.636  4.597   -9.833  1.00 0.00 ? 48  TRP A CZ2  5  
ATOM   8859  C  CZ3  . TRP A 1 48  ? -10.521 6.833   -9.461  1.00 0.00 ? 48  TRP A CZ3  5  
ATOM   8860  C  CH2  . TRP A 1 48  ? -10.728 5.478   -9.779  1.00 0.00 ? 48  TRP A CH2  5  
ATOM   8861  H  H    . TRP A 1 48  ? -4.293  9.887   -8.377  1.00 0.00 ? 48  TRP A H    5  
ATOM   8862  H  HA   . TRP A 1 48  ? -4.306  7.034   -7.558  1.00 0.00 ? 48  TRP A HA   5  
ATOM   8863  H  HB2  . TRP A 1 48  ? -6.447  8.341   -7.813  1.00 0.00 ? 48  TRP A HB2  5  
ATOM   8864  H  HB3  . TRP A 1 48  ? -6.064  8.590   -9.502  1.00 0.00 ? 48  TRP A HB3  5  
ATOM   8865  H  HD1  . TRP A 1 48  ? -5.089  5.151   -9.018  1.00 0.00 ? 48  TRP A HD1  5  
ATOM   8866  H  HE1  . TRP A 1 48  ? -6.908  3.507   -9.614  1.00 0.00 ? 48  TRP A HE1  5  
ATOM   8867  H  HE3  . TRP A 1 48  ? -9.078  8.355   -8.954  1.00 0.00 ? 48  TRP A HE3  5  
ATOM   8868  H  HZ2  . TRP A 1 48  ? -9.790  3.551   -10.061 1.00 0.00 ? 48  TRP A HZ2  5  
ATOM   8869  H  HZ3  . TRP A 1 48  ? -11.368 7.505   -9.396  1.00 0.00 ? 48  TRP A HZ3  5  
ATOM   8870  H  HH2  . TRP A 1 48  ? -11.730 5.111   -9.962  1.00 0.00 ? 48  TRP A HH2  5  
ATOM   8871  N  N    . LYS A 1 49  ? -2.641  6.516   -9.399  1.00 0.00 ? 49  LYS A N    5  
ATOM   8872  C  CA   . LYS A 1 49  ? -1.719  6.074   -10.444 1.00 0.00 ? 49  LYS A CA   5  
ATOM   8873  C  C    . LYS A 1 49  ? -2.334  4.822   -11.071 1.00 0.00 ? 49  LYS A C    5  
ATOM   8874  O  O    . LYS A 1 49  ? -1.841  3.706   -10.904 1.00 0.00 ? 49  LYS A O    5  
ATOM   8875  C  CB   . LYS A 1 49  ? -0.328  5.843   -9.825  1.00 0.00 ? 49  LYS A CB   5  
ATOM   8876  C  CG   . LYS A 1 49  ? 0.363   7.182   -9.514  1.00 0.00 ? 49  LYS A CG   5  
ATOM   8877  C  CD   . LYS A 1 49  ? 1.651   7.050   -8.690  1.00 0.00 ? 49  LYS A CD   5  
ATOM   8878  C  CE   . LYS A 1 49  ? 2.691   6.117   -9.328  1.00 0.00 ? 49  LYS A CE   5  
ATOM   8879  N  NZ   . LYS A 1 49  ? 4.002   6.201   -8.639  1.00 0.00 ? 49  LYS A NZ   5  
ATOM   8880  H  H    . LYS A 1 49  ? -2.624  5.966   -8.560  1.00 0.00 ? 49  LYS A H    5  
ATOM   8881  H  HA   . LYS A 1 49  ? -1.639  6.838   -11.220 1.00 0.00 ? 49  LYS A HA   5  
ATOM   8882  H  HB2  . LYS A 1 49  ? -0.427  5.252   -8.913  1.00 0.00 ? 49  LYS A HB2  5  
ATOM   8883  H  HB3  . LYS A 1 49  ? 0.290   5.289   -10.531 1.00 0.00 ? 49  LYS A HB3  5  
ATOM   8884  H  HG2  . LYS A 1 49  ? 0.603   7.677   -10.454 1.00 0.00 ? 49  LYS A HG2  5  
ATOM   8885  H  HG3  . LYS A 1 49  ? -0.321  7.824   -8.959  1.00 0.00 ? 49  LYS A HG3  5  
ATOM   8886  H  HD2  . LYS A 1 49  ? 2.079   8.047   -8.580  1.00 0.00 ? 49  LYS A HD2  5  
ATOM   8887  H  HD3  . LYS A 1 49  ? 1.395   6.672   -7.701  1.00 0.00 ? 49  LYS A HD3  5  
ATOM   8888  H  HE2  . LYS A 1 49  ? 2.317   5.092   -9.274  1.00 0.00 ? 49  LYS A HE2  5  
ATOM   8889  H  HE3  . LYS A 1 49  ? 2.817   6.384   -10.380 1.00 0.00 ? 49  LYS A HE3  5  
ATOM   8890  H  HZ1  . LYS A 1 49  ? 3.898   6.111   -7.626  1.00 0.00 ? 49  LYS A HZ1  5  
ATOM   8891  H  HZ2  . LYS A 1 49  ? 4.626   5.474   -8.958  1.00 0.00 ? 49  LYS A HZ2  5  
ATOM   8892  H  HZ3  . LYS A 1 49  ? 4.449   7.088   -8.815  1.00 0.00 ? 49  LYS A HZ3  5  
ATOM   8893  N  N    . LYS A 1 50  ? -3.494  5.016   -11.695 1.00 0.00 ? 50  LYS A N    5  
ATOM   8894  C  CA   . LYS A 1 50  ? -4.349  3.944   -12.181 1.00 0.00 ? 50  LYS A CA   5  
ATOM   8895  C  C    . LYS A 1 50  ? -3.616  3.109   -13.234 1.00 0.00 ? 50  LYS A C    5  
ATOM   8896  O  O    . LYS A 1 50  ? -3.250  3.634   -14.288 1.00 0.00 ? 50  LYS A O    5  
ATOM   8897  C  CB   . LYS A 1 50  ? -5.644  4.542   -12.749 1.00 0.00 ? 50  LYS A CB   5  
ATOM   8898  C  CG   . LYS A 1 50  ? -6.649  3.419   -13.036 1.00 0.00 ? 50  LYS A CG   5  
ATOM   8899  C  CD   . LYS A 1 50  ? -7.809  3.901   -13.911 1.00 0.00 ? 50  LYS A CD   5  
ATOM   8900  C  CE   . LYS A 1 50  ? -8.599  2.724   -14.504 1.00 0.00 ? 50  LYS A CE   5  
ATOM   8901  N  NZ   . LYS A 1 50  ? -7.770  1.890   -15.414 1.00 0.00 ? 50  LYS A NZ   5  
ATOM   8902  H  H    . LYS A 1 50  ? -3.793  5.990   -11.816 1.00 0.00 ? 50  LYS A H    5  
ATOM   8903  H  HA   . LYS A 1 50  ? -4.606  3.305   -11.338 1.00 0.00 ? 50  LYS A HA   5  
ATOM   8904  H  HB2  . LYS A 1 50  ? -6.084  5.242   -12.038 1.00 0.00 ? 50  LYS A HB2  5  
ATOM   8905  H  HB3  . LYS A 1 50  ? -5.413  5.082   -13.669 1.00 0.00 ? 50  LYS A HB3  5  
ATOM   8906  H  HG2  . LYS A 1 50  ? -6.135  2.617   -13.554 1.00 0.00 ? 50  LYS A HG2  5  
ATOM   8907  H  HG3  . LYS A 1 50  ? -7.037  3.020   -12.098 1.00 0.00 ? 50  LYS A HG3  5  
ATOM   8908  H  HD2  . LYS A 1 50  ? -8.473  4.517   -13.304 1.00 0.00 ? 50  LYS A HD2  5  
ATOM   8909  H  HD3  . LYS A 1 50  ? -7.422  4.513   -14.728 1.00 0.00 ? 50  LYS A HD3  5  
ATOM   8910  H  HE2  . LYS A 1 50  ? -8.997  2.108   -13.694 1.00 0.00 ? 50  LYS A HE2  5  
ATOM   8911  H  HE3  . LYS A 1 50  ? -9.445  3.130   -15.064 1.00 0.00 ? 50  LYS A HE3  5  
ATOM   8912  H  HZ1  . LYS A 1 50  ? -8.343  1.233   -15.924 1.00 0.00 ? 50  LYS A HZ1  5  
ATOM   8913  H  HZ2  . LYS A 1 50  ? -7.263  2.475   -16.071 1.00 0.00 ? 50  LYS A HZ2  5  
ATOM   8914  H  HZ3  . LYS A 1 50  ? -7.061  1.369   -14.904 1.00 0.00 ? 50  LYS A HZ3  5  
ATOM   8915  N  N    . LYS A 1 51  ? -3.439  1.810   -12.991 1.00 0.00 ? 51  LYS A N    5  
ATOM   8916  C  CA   . LYS A 1 51  ? -2.966  0.870   -14.009 1.00 0.00 ? 51  LYS A CA   5  
ATOM   8917  C  C    . LYS A 1 51  ? -4.074  0.758   -15.060 1.00 0.00 ? 51  LYS A C    5  
ATOM   8918  O  O    . LYS A 1 51  ? -5.240  0.543   -14.710 1.00 0.00 ? 51  LYS A O    5  
ATOM   8919  C  CB   . LYS A 1 51  ? -2.665  -0.484  -13.343 1.00 0.00 ? 51  LYS A CB   5  
ATOM   8920  C  CG   . LYS A 1 51  ? -1.297  -0.455  -12.635 1.00 0.00 ? 51  LYS A CG   5  
ATOM   8921  C  CD   . LYS A 1 51  ? -1.156  -1.495  -11.516 1.00 0.00 ? 51  LYS A CD   5  
ATOM   8922  C  CE   . LYS A 1 51  ? -1.918  -0.992  -10.282 1.00 0.00 ? 51  LYS A CE   5  
ATOM   8923  N  NZ   . LYS A 1 51  ? -1.773  -1.865  -9.095  1.00 0.00 ? 51  LYS A NZ   5  
ATOM   8924  H  H    . LYS A 1 51  ? -3.749  1.423   -12.101 1.00 0.00 ? 51  LYS A H    5  
ATOM   8925  H  HA   . LYS A 1 51  ? -2.057  1.267   -14.473 1.00 0.00 ? 51  LYS A HA   5  
ATOM   8926  H  HB2  . LYS A 1 51  ? -3.461  -0.720  -12.636 1.00 0.00 ? 51  LYS A HB2  5  
ATOM   8927  H  HB3  . LYS A 1 51  ? -2.649  -1.272  -14.096 1.00 0.00 ? 51  LYS A HB3  5  
ATOM   8928  H  HG2  . LYS A 1 51  ? -0.519  -0.623  -13.380 1.00 0.00 ? 51  LYS A HG2  5  
ATOM   8929  H  HG3  . LYS A 1 51  ? -1.133  0.528   -12.196 1.00 0.00 ? 51  LYS A HG3  5  
ATOM   8930  H  HD2  . LYS A 1 51  ? -1.542  -2.461  -11.847 1.00 0.00 ? 51  LYS A HD2  5  
ATOM   8931  H  HD3  . LYS A 1 51  ? -0.098  -1.598  -11.268 1.00 0.00 ? 51  LYS A HD3  5  
ATOM   8932  H  HE2  . LYS A 1 51  ? -1.554  0.007   -10.032 1.00 0.00 ? 51  LYS A HE2  5  
ATOM   8933  H  HE3  . LYS A 1 51  ? -2.977  -0.902  -10.533 1.00 0.00 ? 51  LYS A HE3  5  
ATOM   8934  H  HZ1  . LYS A 1 51  ? -0.804  -1.983  -8.843  1.00 0.00 ? 51  LYS A HZ1  5  
ATOM   8935  H  HZ2  . LYS A 1 51  ? -2.245  -1.427  -8.304  1.00 0.00 ? 51  LYS A HZ2  5  
ATOM   8936  H  HZ3  . LYS A 1 51  ? -2.189  -2.771  -9.252  1.00 0.00 ? 51  LYS A HZ3  5  
ATOM   8937  N  N    . SER A 1 52  ? -3.726  0.910   -16.336 1.00 0.00 ? 52  SER A N    5  
ATOM   8938  C  CA   . SER A 1 52  ? -4.673  1.054   -17.436 1.00 0.00 ? 52  SER A CA   5  
ATOM   8939  C  C    . SER A 1 52  ? -4.131  0.405   -18.721 1.00 0.00 ? 52  SER A C    5  
ATOM   8940  O  O    . SER A 1 52  ? -3.129  -0.319  -18.694 1.00 0.00 ? 52  SER A O    5  
ATOM   8941  C  CB   . SER A 1 52  ? -4.942  2.560   -17.624 1.00 0.00 ? 52  SER A CB   5  
ATOM   8942  O  OG   . SER A 1 52  ? -5.397  3.157   -16.418 1.00 0.00 ? 52  SER A OG   5  
ATOM   8943  H  H    . SER A 1 52  ? -2.764  1.136   -16.563 1.00 0.00 ? 52  SER A H    5  
ATOM   8944  H  HA   . SER A 1 52  ? -5.611  0.558   -17.185 1.00 0.00 ? 52  SER A HA   5  
ATOM   8945  H  HB2  . SER A 1 52  ? -4.027  3.055   -17.949 1.00 0.00 ? 52  SER A HB2  5  
ATOM   8946  H  HB3  . SER A 1 52  ? -5.704  2.704   -18.390 1.00 0.00 ? 52  SER A HB3  5  
ATOM   8947  H  HG   . SER A 1 52  ? -4.613  3.458   -15.927 1.00 0.00 ? 52  SER A HG   5  
ATOM   8948  N  N    . ARG A 1 53  ? -4.816  0.642   -19.853 1.00 0.00 ? 53  ARG A N    5  
ATOM   8949  C  CA   . ARG A 1 53  ? -4.435  0.217   -21.211 1.00 0.00 ? 53  ARG A CA   5  
ATOM   8950  C  C    . ARG A 1 53  ? -4.433  -1.312  -21.395 1.00 0.00 ? 53  ARG A C    5  
ATOM   8951  O  O    . ARG A 1 53  ? -4.030  -1.808  -22.445 1.00 0.00 ? 53  ARG A O    5  
ATOM   8952  C  CB   . ARG A 1 53  ? -3.099  0.904   -21.576 1.00 0.00 ? 53  ARG A CB   5  
ATOM   8953  C  CG   . ARG A 1 53  ? -2.749  0.940   -23.071 1.00 0.00 ? 53  ARG A CG   5  
ATOM   8954  C  CD   . ARG A 1 53  ? -1.374  1.588   -23.266 1.00 0.00 ? 53  ARG A CD   5  
ATOM   8955  N  NE   . ARG A 1 53  ? -0.917  1.491   -24.662 1.00 0.00 ? 53  ARG A NE   5  
ATOM   8956  C  CZ   . ARG A 1 53  ? -0.333  0.423   -25.223 1.00 0.00 ? 53  ARG A CZ   5  
ATOM   8957  N  NH1  . ARG A 1 53  ? -0.158  -0.707  -24.539 1.00 0.00 ? 53  ARG A NH1  5  
ATOM   8958  N  NH2  . ARG A 1 53  ? 0.076   0.492   -26.486 1.00 0.00 ? 53  ARG A NH2  5  
ATOM   8959  H  H    . ARG A 1 53  ? -5.657  1.202   -19.790 1.00 0.00 ? 53  ARG A H    5  
ATOM   8960  H  HA   . ARG A 1 53  ? -5.199  0.606   -21.886 1.00 0.00 ? 53  ARG A HA   5  
ATOM   8961  H  HB2  . ARG A 1 53  ? -3.132  1.937   -21.226 1.00 0.00 ? 53  ARG A HB2  5  
ATOM   8962  H  HB3  . ARG A 1 53  ? -2.296  0.400   -21.041 1.00 0.00 ? 53  ARG A HB3  5  
ATOM   8963  H  HG2  . ARG A 1 53  ? -2.710  -0.067  -23.477 1.00 0.00 ? 53  ARG A HG2  5  
ATOM   8964  H  HG3  . ARG A 1 53  ? -3.504  1.512   -23.613 1.00 0.00 ? 53  ARG A HG3  5  
ATOM   8965  H  HD2  . ARG A 1 53  ? -1.429  2.639   -22.979 1.00 0.00 ? 53  ARG A HD2  5  
ATOM   8966  H  HD3  . ARG A 1 53  ? -0.644  1.099   -22.622 1.00 0.00 ? 53  ARG A HD3  5  
ATOM   8967  H  HE   . ARG A 1 53  ? -1.041  2.329   -25.218 1.00 0.00 ? 53  ARG A HE   5  
ATOM   8968  H  HH11 . ARG A 1 53  ? -0.484  -0.802  -23.575 1.00 0.00 ? 53  ARG A HH11 5  
ATOM   8969  H  HH12 . ARG A 1 53  ? 0.289   -1.513  -24.949 1.00 0.00 ? 53  ARG A HH12 5  
ATOM   8970  H  HH21 . ARG A 1 53  ? -0.044  1.336   -27.031 1.00 0.00 ? 53  ARG A HH21 5  
ATOM   8971  H  HH22 . ARG A 1 53  ? 0.519   -0.288  -26.951 1.00 0.00 ? 53  ARG A HH22 5  
ATOM   8972  N  N    . LYS A 1 54  ? -4.905  -2.078  -20.400 1.00 0.00 ? 54  LYS A N    5  
ATOM   8973  C  CA   . LYS A 1 54  ? -4.775  -3.540  -20.332 1.00 0.00 ? 54  LYS A CA   5  
ATOM   8974  C  C    . LYS A 1 54  ? -3.309  -3.991  -20.482 1.00 0.00 ? 54  LYS A C    5  
ATOM   8975  O  O    . LYS A 1 54  ? -3.055  -5.141  -20.842 1.00 0.00 ? 54  LYS A O    5  
ATOM   8976  C  CB   . LYS A 1 54  ? -5.738  -4.240  -21.320 1.00 0.00 ? 54  LYS A CB   5  
ATOM   8977  C  CG   . LYS A 1 54  ? -7.217  -3.820  -21.213 1.00 0.00 ? 54  LYS A CG   5  
ATOM   8978  C  CD   . LYS A 1 54  ? -7.879  -4.072  -19.847 1.00 0.00 ? 54  LYS A CD   5  
ATOM   8979  C  CE   . LYS A 1 54  ? -7.898  -5.564  -19.480 1.00 0.00 ? 54  LYS A CE   5  
ATOM   8980  N  NZ   . LYS A 1 54  ? -8.605  -5.820  -18.200 1.00 0.00 ? 54  LYS A NZ   5  
ATOM   8981  H  H    . LYS A 1 54  ? -5.265  -1.612  -19.581 1.00 0.00 ? 54  LYS A H    5  
ATOM   8982  H  HA   . LYS A 1 54  ? -5.066  -3.835  -19.323 1.00 0.00 ? 54  LYS A HA   5  
ATOM   8983  H  HB2  . LYS A 1 54  ? -5.405  -4.044  -22.340 1.00 0.00 ? 54  LYS A HB2  5  
ATOM   8984  H  HB3  . LYS A 1 54  ? -5.673  -5.319  -21.171 1.00 0.00 ? 54  LYS A HB3  5  
ATOM   8985  H  HG2  . LYS A 1 54  ? -7.303  -2.758  -21.448 1.00 0.00 ? 54  LYS A HG2  5  
ATOM   8986  H  HG3  . LYS A 1 54  ? -7.780  -4.363  -21.973 1.00 0.00 ? 54  LYS A HG3  5  
ATOM   8987  H  HD2  . LYS A 1 54  ? -7.357  -3.505  -19.076 1.00 0.00 ? 54  LYS A HD2  5  
ATOM   8988  H  HD3  . LYS A 1 54  ? -8.906  -3.705  -19.899 1.00 0.00 ? 54  LYS A HD3  5  
ATOM   8989  H  HE2  . LYS A 1 54  ? -8.393  -6.116  -20.283 1.00 0.00 ? 54  LYS A HE2  5  
ATOM   8990  H  HE3  . LYS A 1 54  ? -6.871  -5.927  -19.405 1.00 0.00 ? 54  LYS A HE3  5  
ATOM   8991  H  HZ1  . LYS A 1 54  ? -8.607  -6.806  -17.985 1.00 0.00 ? 54  LYS A HZ1  5  
ATOM   8992  H  HZ2  . LYS A 1 54  ? -8.161  -5.342  -17.431 1.00 0.00 ? 54  LYS A HZ2  5  
ATOM   8993  H  HZ3  . LYS A 1 54  ? -9.568  -5.519  -18.247 1.00 0.00 ? 54  LYS A HZ3  5  
ATOM   8994  N  N    . THR A 1 55  ? -2.351  -3.116  -20.162 1.00 0.00 ? 55  THR A N    5  
ATOM   8995  C  CA   . THR A 1 55  ? -0.916  -3.399  -20.160 1.00 0.00 ? 55  THR A CA   5  
ATOM   8996  C  C    . THR A 1 55  ? -0.278  -2.883  -18.856 1.00 0.00 ? 55  THR A C    5  
ATOM   8997  O  O    . THR A 1 55  ? 0.942   -2.723  -18.773 1.00 0.00 ? 55  THR A O    5  
ATOM   8998  C  CB   . THR A 1 55  ? -0.270  -2.846  -21.455 1.00 0.00 ? 55  THR A CB   5  
ATOM   8999  O  OG1  . THR A 1 55  ? -0.743  -1.556  -21.808 1.00 0.00 ? 55  THR A OG1  5  
ATOM   9000  C  CG2  . THR A 1 55  ? -0.576  -3.755  -22.650 1.00 0.00 ? 55  THR A CG2  5  
ATOM   9001  H  H    . THR A 1 55  ? -2.612  -2.166  -19.932 1.00 0.00 ? 55  THR A H    5  
ATOM   9002  H  HA   . THR A 1 55  ? -0.774  -4.481  -20.149 1.00 0.00 ? 55  THR A HA   5  
ATOM   9003  H  HB   . THR A 1 55  ? 0.813   -2.811  -21.334 1.00 0.00 ? 55  THR A HB   5  
ATOM   9004  H  HG1  . THR A 1 55  ? -0.328  -0.901  -21.206 1.00 0.00 ? 55  THR A HG1  5  
ATOM   9005  H  HG21 . THR A 1 55  ? -0.290  -4.782  -22.419 1.00 0.00 ? 55  THR A HG21 5  
ATOM   9006  H  HG22 . THR A 1 55  ? -1.639  -3.722  -22.892 1.00 0.00 ? 55  THR A HG22 5  
ATOM   9007  H  HG23 . THR A 1 55  ? -0.002  -3.428  -23.516 1.00 0.00 ? 55  THR A HG23 5  
ATOM   9008  N  N    . SER A 1 56  ? -1.104  -2.626  -17.829 1.00 0.00 ? 56  SER A N    5  
ATOM   9009  C  CA   . SER A 1 56  ? -0.719  -2.029  -16.551 1.00 0.00 ? 56  SER A CA   5  
ATOM   9010  C  C    . SER A 1 56  ? 0.024   -0.693  -16.724 1.00 0.00 ? 56  SER A C    5  
ATOM   9011  O  O    . SER A 1 56  ? 0.830   -0.305  -15.876 1.00 0.00 ? 56  SER A O    5  
ATOM   9012  C  CB   . SER A 1 56  ? 0.041   -3.056  -15.695 1.00 0.00 ? 56  SER A CB   5  
ATOM   9013  O  OG   . SER A 1 56  ? -0.689  -4.273  -15.601 1.00 0.00 ? 56  SER A OG   5  
ATOM   9014  H  H    . SER A 1 56  ? -2.085  -2.826  -17.943 1.00 0.00 ? 56  SER A H    5  
ATOM   9015  H  HA   . SER A 1 56  ? -1.647  -1.795  -16.032 1.00 0.00 ? 56  SER A HA   5  
ATOM   9016  H  HB2  . SER A 1 56  ? 1.017   -3.252  -16.141 1.00 0.00 ? 56  SER A HB2  5  
ATOM   9017  H  HB3  . SER A 1 56  ? 0.192   -2.649  -14.694 1.00 0.00 ? 56  SER A HB3  5  
ATOM   9018  H  HG   . SER A 1 56  ? -0.163  -4.897  -15.070 1.00 0.00 ? 56  SER A HG   5  
ATOM   9019  N  N    . THR A 1 57  ? -0.240  0.016   -17.822 1.00 0.00 ? 57  THR A N    5  
ATOM   9020  C  CA   . THR A 1 57  ? 0.371   1.296   -18.131 1.00 0.00 ? 57  THR A CA   5  
ATOM   9021  C  C    . THR A 1 57  ? -0.240  2.320   -17.174 1.00 0.00 ? 57  THR A C    5  
ATOM   9022  O  O    . THR A 1 57  ? -1.464  2.404   -17.063 1.00 0.00 ? 57  THR A O    5  
ATOM   9023  C  CB   . THR A 1 57  ? 0.089   1.616   -19.606 1.00 0.00 ? 57  THR A CB   5  
ATOM   9024  O  OG1  . THR A 1 57  ? 0.382   0.475   -20.398 1.00 0.00 ? 57  THR A OG1  5  
ATOM   9025  C  CG2  . THR A 1 57  ? 0.905   2.798   -20.131 1.00 0.00 ? 57  THR A CG2  5  
ATOM   9026  H  H    . THR A 1 57  ? -0.948  -0.310  -18.469 1.00 0.00 ? 57  THR A H    5  
ATOM   9027  H  HA   . THR A 1 57  ? 1.448   1.227   -17.971 1.00 0.00 ? 57  THR A HA   5  
ATOM   9028  H  HB   . THR A 1 57  ? -0.970  1.847   -19.721 1.00 0.00 ? 57  THR A HB   5  
ATOM   9029  H  HG1  . THR A 1 57  ? 1.316   0.249   -20.267 1.00 0.00 ? 57  THR A HG1  5  
ATOM   9030  H  HG21 . THR A 1 57  ? 0.685   2.952   -21.187 1.00 0.00 ? 57  THR A HG21 5  
ATOM   9031  H  HG22 . THR A 1 57  ? 0.638   3.703   -19.584 1.00 0.00 ? 57  THR A HG22 5  
ATOM   9032  H  HG23 . THR A 1 57  ? 1.971   2.606   -20.009 1.00 0.00 ? 57  THR A HG23 5  
ATOM   9033  N  N    . ILE A 1 58  ? 0.594   3.041   -16.428 1.00 0.00 ? 58  ILE A N    5  
ATOM   9034  C  CA   . ILE A 1 58  ? 0.119   3.972   -15.413 1.00 0.00 ? 58  ILE A CA   5  
ATOM   9035  C  C    . ILE A 1 58  ? -0.473  5.194   -16.117 1.00 0.00 ? 58  ILE A C    5  
ATOM   9036  O  O    . ILE A 1 58  ? 0.121   5.746   -17.047 1.00 0.00 ? 58  ILE A O    5  
ATOM   9037  C  CB   . ILE A 1 58  ? 1.272   4.335   -14.445 1.00 0.00 ? 58  ILE A CB   5  
ATOM   9038  C  CG1  . ILE A 1 58  ? 1.785   3.094   -13.674 1.00 0.00 ? 58  ILE A CG1  5  
ATOM   9039  C  CG2  . ILE A 1 58  ? 0.887   5.456   -13.459 1.00 0.00 ? 58  ILE A CG2  5  
ATOM   9040  C  CD1  . ILE A 1 58  ? 0.844   2.561   -12.588 1.00 0.00 ? 58  ILE A CD1  5  
ATOM   9041  H  H    . ILE A 1 58  ? 1.589   2.967   -16.572 1.00 0.00 ? 58  ILE A H    5  
ATOM   9042  H  HA   . ILE A 1 58  ? -0.671  3.490   -14.841 1.00 0.00 ? 58  ILE A HA   5  
ATOM   9043  H  HB   . ILE A 1 58  ? 2.099   4.708   -15.048 1.00 0.00 ? 58  ILE A HB   5  
ATOM   9044  H  HG12 . ILE A 1 58  ? 1.974   2.280   -14.374 1.00 0.00 ? 58  ILE A HG12 5  
ATOM   9045  H  HG13 . ILE A 1 58  ? 2.736   3.344   -13.203 1.00 0.00 ? 58  ILE A HG13 5  
ATOM   9046  H  HG21 . ILE A 1 58  ? -0.046  5.212   -12.951 1.00 0.00 ? 58  ILE A HG21 5  
ATOM   9047  H  HG22 . ILE A 1 58  ? 1.677   5.596   -12.720 1.00 0.00 ? 58  ILE A HG22 5  
ATOM   9048  H  HG23 . ILE A 1 58  ? 0.756   6.398   -13.992 1.00 0.00 ? 58  ILE A HG23 5  
ATOM   9049  H  HD11 . ILE A 1 58  ? 1.227   1.610   -12.215 1.00 0.00 ? 58  ILE A HD11 5  
ATOM   9050  H  HD12 . ILE A 1 58  ? 0.794   3.261   -11.755 1.00 0.00 ? 58  ILE A HD12 5  
ATOM   9051  H  HD13 . ILE A 1 58  ? -0.153  2.409   -12.996 1.00 0.00 ? 58  ILE A HD13 5  
ATOM   9052  N  N    . GLU A 1 59  ? -1.624  5.633   -15.624 1.00 0.00 ? 59  GLU A N    5  
ATOM   9053  C  CA   . GLU A 1 59  ? -2.280  6.884   -15.954 1.00 0.00 ? 59  GLU A CA   5  
ATOM   9054  C  C    . GLU A 1 59  ? -2.492  7.574   -14.604 1.00 0.00 ? 59  GLU A C    5  
ATOM   9055  O  O    . GLU A 1 59  ? -2.565  6.905   -13.569 1.00 0.00 ? 59  GLU A O    5  
ATOM   9056  C  CB   . GLU A 1 59  ? -3.612  6.617   -16.676 1.00 0.00 ? 59  GLU A CB   5  
ATOM   9057  C  CG   . GLU A 1 59  ? -3.440  6.018   -18.083 1.00 0.00 ? 59  GLU A CG   5  
ATOM   9058  C  CD   . GLU A 1 59  ? -2.672  6.924   -19.068 1.00 0.00 ? 59  GLU A CD   5  
ATOM   9059  O  OE1  . GLU A 1 59  ? -2.774  8.170   -18.990 1.00 0.00 ? 59  GLU A OE1  5  
ATOM   9060  O  OE2  . GLU A 1 59  ? -1.991  6.391   -19.973 1.00 0.00 ? 59  GLU A OE2  5  
ATOM   9061  H  H    . GLU A 1 59  ? -2.080  5.105   -14.884 1.00 0.00 ? 59  GLU A H    5  
ATOM   9062  H  HA   . GLU A 1 59  ? -1.633  7.503   -16.576 1.00 0.00 ? 59  GLU A HA   5  
ATOM   9063  H  HB2  . GLU A 1 59  ? -4.211  5.930   -16.075 1.00 0.00 ? 59  GLU A HB2  5  
ATOM   9064  H  HB3  . GLU A 1 59  ? -4.169  7.552   -16.755 1.00 0.00 ? 59  GLU A HB3  5  
ATOM   9065  H  HG2  . GLU A 1 59  ? -2.929  5.058   -17.996 1.00 0.00 ? 59  GLU A HG2  5  
ATOM   9066  H  HG3  . GLU A 1 59  ? -4.434  5.822   -18.492 1.00 0.00 ? 59  GLU A HG3  5  
ATOM   9067  N  N    . GLU A 1 60  ? -2.576  8.902   -14.583 1.00 0.00 ? 60  GLU A N    5  
ATOM   9068  C  CA   . GLU A 1 60  ? -2.552  9.660   -13.337 1.00 0.00 ? 60  GLU A CA   5  
ATOM   9069  C  C    . GLU A 1 60  ? -3.765  10.578  -13.250 1.00 0.00 ? 60  GLU A C    5  
ATOM   9070  O  O    . GLU A 1 60  ? -4.098  11.274  -14.214 1.00 0.00 ? 60  GLU A O    5  
ATOM   9071  C  CB   . GLU A 1 60  ? -1.247  10.466  -13.242 1.00 0.00 ? 60  GLU A CB   5  
ATOM   9072  C  CG   . GLU A 1 60  ? -0.018  9.567   -13.057 1.00 0.00 ? 60  GLU A CG   5  
ATOM   9073  C  CD   . GLU A 1 60  ? 1.265   10.394  -12.875 1.00 0.00 ? 60  GLU A CD   5  
ATOM   9074  O  OE1  . GLU A 1 60  ? 1.397   11.090  -11.843 1.00 0.00 ? 60  GLU A OE1  5  
ATOM   9075  O  OE2  . GLU A 1 60  ? 2.152   10.352  -13.759 1.00 0.00 ? 60  GLU A OE2  5  
ATOM   9076  H  H    . GLU A 1 60  ? -2.573  9.428   -15.445 1.00 0.00 ? 60  GLU A H    5  
ATOM   9077  H  HA   . GLU A 1 60  ? -2.574  8.981   -12.488 1.00 0.00 ? 60  GLU A HA   5  
ATOM   9078  H  HB2  . GLU A 1 60  ? -1.121  11.072  -14.141 1.00 0.00 ? 60  GLU A HB2  5  
ATOM   9079  H  HB3  . GLU A 1 60  ? -1.319  11.134  -12.385 1.00 0.00 ? 60  GLU A HB3  5  
ATOM   9080  H  HG2  . GLU A 1 60  ? -0.172  8.940   -12.178 1.00 0.00 ? 60  GLU A HG2  5  
ATOM   9081  H  HG3  . GLU A 1 60  ? 0.084   8.912   -13.925 1.00 0.00 ? 60  GLU A HG3  5  
ATOM   9082  N  N    . LYS A 1 61  ? -4.392  10.610  -12.072 1.00 0.00 ? 61  LYS A N    5  
ATOM   9083  C  CA   . LYS A 1 61  ? -5.434  11.567  -11.706 1.00 0.00 ? 61  LYS A CA   5  
ATOM   9084  C  C    . LYS A 1 61  ? -5.103  12.047  -10.298 1.00 0.00 ? 61  LYS A C    5  
ATOM   9085  O  O    . LYS A 1 61  ? -4.546  11.282  -9.509  1.00 0.00 ? 61  LYS A O    5  
ATOM   9086  C  CB   . LYS A 1 61  ? -6.823  10.904  -11.738 1.00 0.00 ? 61  LYS A CB   5  
ATOM   9087  C  CG   . LYS A 1 61  ? -7.257  10.495  -13.156 1.00 0.00 ? 61  LYS A CG   5  
ATOM   9088  C  CD   . LYS A 1 61  ? -8.647  9.840   -13.195 1.00 0.00 ? 61  LYS A CD   5  
ATOM   9089  C  CE   . LYS A 1 61  ? -8.663  8.477   -12.482 1.00 0.00 ? 61  LYS A CE   5  
ATOM   9090  N  NZ   . LYS A 1 61  ? -9.989  7.813   -12.570 1.00 0.00 ? 61  LYS A NZ   5  
ATOM   9091  H  H    . LYS A 1 61  ? -4.089  9.967   -11.308 1.00 0.00 ? 61  LYS A H    5  
ATOM   9092  H  HA   . LYS A 1 61  ? -5.416  12.417  -12.390 1.00 0.00 ? 61  LYS A HA   5  
ATOM   9093  H  HB2  . LYS A 1 61  ? -6.812  10.029  -11.090 1.00 0.00 ? 61  LYS A HB2  5  
ATOM   9094  H  HB3  . LYS A 1 61  ? -7.556  11.610  -11.342 1.00 0.00 ? 61  LYS A HB3  5  
ATOM   9095  H  HG2  . LYS A 1 61  ? -7.276  11.390  -13.779 1.00 0.00 ? 61  LYS A HG2  5  
ATOM   9096  H  HG3  . LYS A 1 61  ? -6.533  9.797   -13.578 1.00 0.00 ? 61  LYS A HG3  5  
ATOM   9097  H  HD2  . LYS A 1 61  ? -9.372  10.512  -12.731 1.00 0.00 ? 61  LYS A HD2  5  
ATOM   9098  H  HD3  . LYS A 1 61  ? -8.926  9.700   -14.240 1.00 0.00 ? 61  LYS A HD3  5  
ATOM   9099  H  HE2  . LYS A 1 61  ? -7.902  7.835   -12.932 1.00 0.00 ? 61  LYS A HE2  5  
ATOM   9100  H  HE3  . LYS A 1 61  ? -8.401  8.623   -11.432 1.00 0.00 ? 61  LYS A HE3  5  
ATOM   9101  H  HZ1  . LYS A 1 61  ? -10.716 8.399   -12.185 1.00 0.00 ? 61  LYS A HZ1  5  
ATOM   9102  H  HZ2  . LYS A 1 61  ? -10.231 7.601   -13.528 1.00 0.00 ? 61  LYS A HZ2  5  
ATOM   9103  H  HZ3  . LYS A 1 61  ? -9.989  6.947   -12.047 1.00 0.00 ? 61  LYS A HZ3  5  
ATOM   9104  N  N    . THR A 1 62  ? -5.452  13.281  -9.964  1.00 0.00 ? 62  THR A N    5  
ATOM   9105  C  CA   . THR A 1 62  ? -5.084  13.891  -8.692  1.00 0.00 ? 62  THR A CA   5  
ATOM   9106  C  C    . THR A 1 62  ? -6.360  13.952  -7.861  1.00 0.00 ? 62  THR A C    5  
ATOM   9107  O  O    . THR A 1 62  ? -7.360  14.524  -8.303  1.00 0.00 ? 62  THR A O    5  
ATOM   9108  C  CB   . THR A 1 62  ? -4.432  15.256  -8.966  1.00 0.00 ? 62  THR A CB   5  
ATOM   9109  O  OG1  . THR A 1 62  ? -3.427  15.113  -9.957  1.00 0.00 ? 62  THR A OG1  5  
ATOM   9110  C  CG2  . THR A 1 62  ? -3.773  15.816  -7.710  1.00 0.00 ? 62  THR A CG2  5  
ATOM   9111  H  H    . THR A 1 62  ? -5.944  13.860  -10.627 1.00 0.00 ? 62  THR A H    5  
ATOM   9112  H  HA   . THR A 1 62  ? -4.359  13.265  -8.172  1.00 0.00 ? 62  THR A HA   5  
ATOM   9113  H  HB   . THR A 1 62  ? -5.192  15.955  -9.318  1.00 0.00 ? 62  THR A HB   5  
ATOM   9114  H  HG1  . THR A 1 62  ? -3.256  15.987  -10.343 1.00 0.00 ? 62  THR A HG1  5  
ATOM   9115  H  HG21 . THR A 1 62  ? -4.530  15.951  -6.940  1.00 0.00 ? 62  THR A HG21 5  
ATOM   9116  H  HG22 . THR A 1 62  ? -3.006  15.130  -7.348  1.00 0.00 ? 62  THR A HG22 5  
ATOM   9117  H  HG23 . THR A 1 62  ? -3.322  16.784  -7.930  1.00 0.00 ? 62  THR A HG23 5  
ATOM   9118  N  N    . VAL A 1 63  ? -6.353  13.345  -6.672  1.00 0.00 ? 63  VAL A N    5  
ATOM   9119  C  CA   . VAL A 1 63  ? -7.568  13.134  -5.902  1.00 0.00 ? 63  VAL A CA   5  
ATOM   9120  C  C    . VAL A 1 63  ? -7.348  13.430  -4.421  1.00 0.00 ? 63  VAL A C    5  
ATOM   9121  O  O    . VAL A 1 63  ? -6.235  13.374  -3.898  1.00 0.00 ? 63  VAL A O    5  
ATOM   9122  C  CB   . VAL A 1 63  ? -8.092  11.692  -6.119  1.00 0.00 ? 63  VAL A CB   5  
ATOM   9123  C  CG1  . VAL A 1 63  ? -8.404  11.378  -7.592  1.00 0.00 ? 63  VAL A CG1  5  
ATOM   9124  C  CG2  . VAL A 1 63  ? -7.136  10.601  -5.606  1.00 0.00 ? 63  VAL A CG2  5  
ATOM   9125  H  H    . VAL A 1 63  ? -5.497  12.959  -6.285  1.00 0.00 ? 63  VAL A H    5  
ATOM   9126  H  HA   . VAL A 1 63  ? -8.339  13.814  -6.260  1.00 0.00 ? 63  VAL A HA   5  
ATOM   9127  H  HB   . VAL A 1 63  ? -9.028  11.605  -5.569  1.00 0.00 ? 63  VAL A HB   5  
ATOM   9128  H  HG11 . VAL A 1 63  ? -8.931  10.426  -7.657  1.00 0.00 ? 63  VAL A HG11 5  
ATOM   9129  H  HG12 . VAL A 1 63  ? -9.043  12.151  -8.012  1.00 0.00 ? 63  VAL A HG12 5  
ATOM   9130  H  HG13 . VAL A 1 63  ? -7.488  11.314  -8.179  1.00 0.00 ? 63  VAL A HG13 5  
ATOM   9131  H  HG21 . VAL A 1 63  ? -7.598  9.623   -5.739  1.00 0.00 ? 63  VAL A HG21 5  
ATOM   9132  H  HG22 . VAL A 1 63  ? -6.194  10.626  -6.155  1.00 0.00 ? 63  VAL A HG22 5  
ATOM   9133  H  HG23 . VAL A 1 63  ? -6.933  10.742  -4.545  1.00 0.00 ? 63  VAL A HG23 5  
ATOM   9134  N  N    . GLU A 1 64  ? -8.438  13.742  -3.738  1.00 0.00 ? 64  GLU A N    5  
ATOM   9135  C  CA   . GLU A 1 64  ? -8.503  13.842  -2.292  1.00 0.00 ? 64  GLU A CA   5  
ATOM   9136  C  C    . GLU A 1 64  ? -9.220  12.570  -1.849  1.00 0.00 ? 64  GLU A C    5  
ATOM   9137  O  O    . GLU A 1 64  ? -10.341 12.314  -2.291  1.00 0.00 ? 64  GLU A O    5  
ATOM   9138  C  CB   . GLU A 1 64  ? -9.239  15.127  -1.881  1.00 0.00 ? 64  GLU A CB   5  
ATOM   9139  C  CG   . GLU A 1 64  ? -9.265  15.279  -0.353  1.00 0.00 ? 64  GLU A CG   5  
ATOM   9140  C  CD   . GLU A 1 64  ? -9.850  16.638  0.069   1.00 0.00 ? 64  GLU A CD   5  
ATOM   9141  O  OE1  . GLU A 1 64  ? -11.089 16.763  0.203   1.00 0.00 ? 64  GLU A OE1  5  
ATOM   9142  O  OE2  . GLU A 1 64  ? -9.074  17.595  0.292   1.00 0.00 ? 64  GLU A OE2  5  
ATOM   9143  H  H    . GLU A 1 64  ? -9.310  13.811  -4.252  1.00 0.00 ? 64  GLU A H    5  
ATOM   9144  H  HA   . GLU A 1 64  ? -7.500  13.863  -1.869  1.00 0.00 ? 64  GLU A HA   5  
ATOM   9145  H  HB2  . GLU A 1 64  ? -8.724  15.987  -2.313  1.00 0.00 ? 64  GLU A HB2  5  
ATOM   9146  H  HB3  . GLU A 1 64  ? -10.259 15.113  -2.267  1.00 0.00 ? 64  GLU A HB3  5  
ATOM   9147  H  HG2  . GLU A 1 64  ? -9.858  14.471  0.081   1.00 0.00 ? 64  GLU A HG2  5  
ATOM   9148  H  HG3  . GLU A 1 64  ? -8.246  15.186  0.030   1.00 0.00 ? 64  GLU A HG3  5  
ATOM   9149  N  N    . VAL A 1 65  ? -8.563  11.734  -1.049  1.00 0.00 ? 65  VAL A N    5  
ATOM   9150  C  CA   . VAL A 1 65  ? -9.173  10.536  -0.491  1.00 0.00 ? 65  VAL A CA   5  
ATOM   9151  C  C    . VAL A 1 65  ? -9.980  10.959  0.731   1.00 0.00 ? 65  VAL A C    5  
ATOM   9152  O  O    . VAL A 1 65  ? -9.500  11.749  1.548   1.00 0.00 ? 65  VAL A O    5  
ATOM   9153  C  CB   . VAL A 1 65  ? -8.153  9.409   -0.191  1.00 0.00 ? 65  VAL A CB   5  
ATOM   9154  C  CG1  . VAL A 1 65  ? -7.018  9.332   -1.229  1.00 0.00 ? 65  VAL A CG1  5  
ATOM   9155  C  CG2  . VAL A 1 65  ? -7.554  9.385   1.219   1.00 0.00 ? 65  VAL A CG2  5  
ATOM   9156  H  H    . VAL A 1 65  ? -7.670  12.023  -0.667  1.00 0.00 ? 65  VAL A H    5  
ATOM   9157  H  HA   . VAL A 1 65  ? -9.859  10.142  -1.236  1.00 0.00 ? 65  VAL A HA   5  
ATOM   9158  H  HB   . VAL A 1 65  ? -8.717  8.486   -0.257  1.00 0.00 ? 65  VAL A HB   5  
ATOM   9159  H  HG11 . VAL A 1 65  ? -7.426  9.355   -2.239  1.00 0.00 ? 65  VAL A HG11 5  
ATOM   9160  H  HG12 . VAL A 1 65  ? -6.330  10.169  -1.103  1.00 0.00 ? 65  VAL A HG12 5  
ATOM   9161  H  HG13 . VAL A 1 65  ? -6.463  8.402   -1.099  1.00 0.00 ? 65  VAL A HG13 5  
ATOM   9162  H  HG21 . VAL A 1 65  ? -6.962  10.277  1.393   1.00 0.00 ? 65  VAL A HG21 5  
ATOM   9163  H  HG22 . VAL A 1 65  ? -8.344  9.304   1.968   1.00 0.00 ? 65  VAL A HG22 5  
ATOM   9164  H  HG23 . VAL A 1 65  ? -6.920  8.507   1.321   1.00 0.00 ? 65  VAL A HG23 5  
ATOM   9165  N  N    . LEU A 1 66  ? -11.190 10.421  0.869   1.00 0.00 ? 66  LEU A N    5  
ATOM   9166  C  CA   . LEU A 1 66  ? -12.076 10.736  1.981   1.00 0.00 ? 66  LEU A CA   5  
ATOM   9167  C  C    . LEU A 1 66  ? -11.908 9.710   3.103   1.00 0.00 ? 66  LEU A C    5  
ATOM   9168  O  O    . LEU A 1 66  ? -12.151 10.033  4.265   1.00 0.00 ? 66  LEU A O    5  
ATOM   9169  C  CB   . LEU A 1 66  ? -13.545 10.797  1.518   1.00 0.00 ? 66  LEU A CB   5  
ATOM   9170  C  CG   . LEU A 1 66  ? -13.902 11.862  0.457   1.00 0.00 ? 66  LEU A CG   5  
ATOM   9171  C  CD1  . LEU A 1 66  ? -13.249 13.226  0.721   1.00 0.00 ? 66  LEU A CD1  5  
ATOM   9172  C  CD2  . LEU A 1 66  ? -13.563 11.416  -0.970  1.00 0.00 ? 66  LEU A CD2  5  
ATOM   9173  H  H    . LEU A 1 66  ? -11.553 9.806   0.128   1.00 0.00 ? 66  LEU A H    5  
ATOM   9174  H  HA   . LEU A 1 66  ? -11.811 11.712  2.384   1.00 0.00 ? 66  LEU A HA   5  
ATOM   9175  H  HB2  . LEU A 1 66  ? -13.853 9.813   1.161   1.00 0.00 ? 66  LEU A HB2  5  
ATOM   9176  H  HB3  . LEU A 1 66  ? -14.149 11.012  2.402   1.00 0.00 ? 66  LEU A HB3  5  
ATOM   9177  H  HG   . LEU A 1 66  ? -14.983 11.999  0.496   1.00 0.00 ? 66  LEU A HG   5  
ATOM   9178  H  HD11 . LEU A 1 66  ? -13.650 13.965  0.027   1.00 0.00 ? 66  LEU A HD11 5  
ATOM   9179  H  HD12 . LEU A 1 66  ? -13.467 13.549  1.739   1.00 0.00 ? 66  LEU A HD12 5  
ATOM   9180  H  HD13 . LEU A 1 66  ? -12.167 13.169  0.581   1.00 0.00 ? 66  LEU A HD13 5  
ATOM   9181  H  HD21 . LEU A 1 66  ? -14.002 12.118  -1.677  1.00 0.00 ? 66  LEU A HD21 5  
ATOM   9182  H  HD22 . LEU A 1 66  ? -12.487 11.404  -1.129  1.00 0.00 ? 66  LEU A HD22 5  
ATOM   9183  H  HD23 . LEU A 1 66  ? -13.973 10.425  -1.160  1.00 0.00 ? 66  LEU A HD23 5  
ATOM   9184  N  N    . GLY A 1 67  ? -11.473 8.491   2.773   1.00 0.00 ? 67  GLY A N    5  
ATOM   9185  C  CA   . GLY A 1 67  ? -11.255 7.411   3.708   1.00 0.00 ? 67  GLY A CA   5  
ATOM   9186  C  C    . GLY A 1 67  ? -11.215 6.095   2.954   1.00 0.00 ? 67  GLY A C    5  
ATOM   9187  O  O    . GLY A 1 67  ? -11.424 6.057   1.738   1.00 0.00 ? 67  GLY A O    5  
ATOM   9188  H  H    . GLY A 1 67  ? -11.297 8.256   1.808   1.00 0.00 ? 67  GLY A H    5  
ATOM   9189  H  HA2  . GLY A 1 67  ? -10.295 7.557   4.188   1.00 0.00 ? 67  GLY A HA2  5  
ATOM   9190  H  HA3  . GLY A 1 67  ? -12.047 7.384   4.458   1.00 0.00 ? 67  GLY A HA3  5  
ATOM   9191  N  N    . MET A 1 68  ? -10.934 5.011   3.670   1.00 0.00 ? 68  MET A N    5  
ATOM   9192  C  CA   . MET A 1 68  ? -11.069 3.668   3.115   1.00 0.00 ? 68  MET A CA   5  
ATOM   9193  C  C    . MET A 1 68  ? -12.536 3.403   2.763   1.00 0.00 ? 68  MET A C    5  
ATOM   9194  O  O    . MET A 1 68  ? -13.451 3.930   3.404   1.00 0.00 ? 68  MET A O    5  
ATOM   9195  C  CB   . MET A 1 68  ? -10.511 2.595   4.057   1.00 0.00 ? 68  MET A CB   5  
ATOM   9196  C  CG   . MET A 1 68  ? -8.993  2.730   4.226   1.00 0.00 ? 68  MET A CG   5  
ATOM   9197  S  SD   . MET A 1 68  ? -8.210  1.327   5.065   1.00 0.00 ? 68  MET A SD   5  
ATOM   9198  C  CE   . MET A 1 68  ? -8.003  0.184   3.673   1.00 0.00 ? 68  MET A CE   5  
ATOM   9199  H  H    . MET A 1 68  ? -10.791 5.123   4.660   1.00 0.00 ? 68  MET A H    5  
ATOM   9200  H  HA   . MET A 1 68  ? -10.494 3.621   2.195   1.00 0.00 ? 68  MET A HA   5  
ATOM   9201  H  HB2  . MET A 1 68  ? -10.999 2.658   5.030   1.00 0.00 ? 68  MET A HB2  5  
ATOM   9202  H  HB3  . MET A 1 68  ? -10.722 1.618   3.621   1.00 0.00 ? 68  MET A HB3  5  
ATOM   9203  H  HG2  . MET A 1 68  ? -8.529  2.845   3.245   1.00 0.00 ? 68  MET A HG2  5  
ATOM   9204  H  HG3  . MET A 1 68  ? -8.786  3.632   4.801   1.00 0.00 ? 68  MET A HG3  5  
ATOM   9205  H  HE1  . MET A 1 68  ? -7.539  -0.735  4.032   1.00 0.00 ? 68  MET A HE1  5  
ATOM   9206  H  HE2  . MET A 1 68  ? -8.972  -0.047  3.232   1.00 0.00 ? 68  MET A HE2  5  
ATOM   9207  H  HE3  . MET A 1 68  ? -7.362  0.638   2.918   1.00 0.00 ? 68  MET A HE3  5  
ATOM   9208  N  N    . ALA A 1 69  ? -12.747 2.587   1.730   1.00 0.00 ? 69  ALA A N    5  
ATOM   9209  C  CA   . ALA A 1 69  ? -14.068 2.161   1.288   1.00 0.00 ? 69  ALA A CA   5  
ATOM   9210  C  C    . ALA A 1 69  ? -14.756 1.299   2.366   1.00 0.00 ? 69  ALA A C    5  
ATOM   9211  O  O    . ALA A 1 69  ? -14.077 0.818   3.280   1.00 0.00 ? 69  ALA A O    5  
ATOM   9212  C  CB   . ALA A 1 69  ? -13.906 1.379   -0.018  1.00 0.00 ? 69  ALA A CB   5  
ATOM   9213  H  H    . ALA A 1 69  ? -11.943 2.147   1.295   1.00 0.00 ? 69  ALA A H    5  
ATOM   9214  H  HA   . ALA A 1 69  ? -14.668 3.050   1.099   1.00 0.00 ? 69  ALA A HA   5  
ATOM   9215  H  HB1  . ALA A 1 69  ? -14.878 1.153   -0.450  1.00 0.00 ? 69  ALA A HB1  5  
ATOM   9216  H  HB2  . ALA A 1 69  ? -13.337 1.968   -0.737  1.00 0.00 ? 69  ALA A HB2  5  
ATOM   9217  H  HB3  . ALA A 1 69  ? -13.393 0.442   0.195   1.00 0.00 ? 69  ALA A HB3  5  
ATOM   9218  N  N    . PRO A 1 70  ? -16.081 1.071   2.266   1.00 0.00 ? 70  PRO A N    5  
ATOM   9219  C  CA   . PRO A 1 70  ? -16.789 0.108   3.100   1.00 0.00 ? 70  PRO A CA   5  
ATOM   9220  C  C    . PRO A 1 70  ? -16.115 -1.268  3.110   1.00 0.00 ? 70  PRO A C    5  
ATOM   9221  O  O    . PRO A 1 70  ? -15.517 -1.696  2.117   1.00 0.00 ? 70  PRO A O    5  
ATOM   9222  C  CB   . PRO A 1 70  ? -18.209 0.026   2.530   1.00 0.00 ? 70  PRO A CB   5  
ATOM   9223  C  CG   . PRO A 1 70  ? -18.405 1.395   1.884   1.00 0.00 ? 70  PRO A CG   5  
ATOM   9224  C  CD   . PRO A 1 70  ? -17.012 1.714   1.348   1.00 0.00 ? 70  PRO A CD   5  
ATOM   9225  H  HA   . PRO A 1 70  ? -16.832 0.506   4.115   1.00 0.00 ? 70  PRO A HA   5  
ATOM   9226  H  HB2  . PRO A 1 70  ? -18.262 -0.746  1.759   1.00 0.00 ? 70  PRO A HB2  5  
ATOM   9227  H  HB3  . PRO A 1 70  ? -18.948 -0.163  3.310   1.00 0.00 ? 70  PRO A HB3  5  
ATOM   9228  H  HG2  . PRO A 1 70  ? -19.150 1.367   1.088   1.00 0.00 ? 70  PRO A HG2  5  
ATOM   9229  H  HG3  . PRO A 1 70  ? -18.682 2.125   2.647   1.00 0.00 ? 70  PRO A HG3  5  
ATOM   9230  H  HD2  . PRO A 1 70  ? -16.905 1.282   0.353   1.00 0.00 ? 70  PRO A HD2  5  
ATOM   9231  H  HD3  . PRO A 1 70  ? -16.862 2.793   1.313   1.00 0.00 ? 70  PRO A HD3  5  
ATOM   9232  N  N    . ASP A 1 71  ? -16.288 -1.998  4.214   1.00 0.00 ? 71  ASP A N    5  
ATOM   9233  C  CA   . ASP A 1 71  ? -15.700 -3.321  4.420   1.00 0.00 ? 71  ASP A CA   5  
ATOM   9234  C  C    . ASP A 1 71  ? -16.074 -4.315  3.318   1.00 0.00 ? 71  ASP A C    5  
ATOM   9235  O  O    . ASP A 1 71  ? -15.290 -5.211  3.021   1.00 0.00 ? 71  ASP A O    5  
ATOM   9236  C  CB   . ASP A 1 71  ? -16.093 -3.892  5.789   1.00 0.00 ? 71  ASP A CB   5  
ATOM   9237  C  CG   . ASP A 1 71  ? -17.497 -4.523  5.809   1.00 0.00 ? 71  ASP A CG   5  
ATOM   9238  O  OD1  . ASP A 1 71  ? -18.496 -3.769  5.835   1.00 0.00 ? 71  ASP A OD1  5  
ATOM   9239  O  OD2  . ASP A 1 71  ? -17.612 -5.768  5.839   1.00 0.00 ? 71  ASP A OD2  5  
ATOM   9240  H  H    . ASP A 1 71  ? -16.816 -1.605  4.980   1.00 0.00 ? 71  ASP A H    5  
ATOM   9241  H  HA   . ASP A 1 71  ? -14.619 -3.194  4.415   1.00 0.00 ? 71  ASP A HA   5  
ATOM   9242  H  HB2  . ASP A 1 71  ? -15.362 -4.658  6.046   1.00 0.00 ? 71  ASP A HB2  5  
ATOM   9243  H  HB3  . ASP A 1 71  ? -16.025 -3.108  6.544   1.00 0.00 ? 71  ASP A HB3  5  
ATOM   9244  N  N    . ASP A 1 72  ? -17.234 -4.138  2.679   1.00 0.00 ? 72  ASP A N    5  
ATOM   9245  C  CA   . ASP A 1 72  ? -17.709 -5.019  1.614   1.00 0.00 ? 72  ASP A CA   5  
ATOM   9246  C  C    . ASP A 1 72  ? -16.797 -4.972  0.383   1.00 0.00 ? 72  ASP A C    5  
ATOM   9247  O  O    . ASP A 1 72  ? -16.638 -5.977  -0.309  1.00 0.00 ? 72  ASP A O    5  
ATOM   9248  C  CB   . ASP A 1 72  ? -19.141 -4.644  1.223   1.00 0.00 ? 72  ASP A CB   5  
ATOM   9249  C  CG   . ASP A 1 72  ? -19.690 -5.593  0.144   1.00 0.00 ? 72  ASP A CG   5  
ATOM   9250  O  OD1  . ASP A 1 72  ? -19.921 -6.786  0.443   1.00 0.00 ? 72  ASP A OD1  5  
ATOM   9251  O  OD2  . ASP A 1 72  ? -19.949 -5.140  -0.993  1.00 0.00 ? 72  ASP A OD2  5  
ATOM   9252  H  H    . ASP A 1 72  ? -17.817 -3.362  2.951   1.00 0.00 ? 72  ASP A H    5  
ATOM   9253  H  HA   . ASP A 1 72  ? -17.717 -6.038  1.995   1.00 0.00 ? 72  ASP A HA   5  
ATOM   9254  H  HB2  . ASP A 1 72  ? -19.779 -4.697  2.108   1.00 0.00 ? 72  ASP A HB2  5  
ATOM   9255  H  HB3  . ASP A 1 72  ? -19.155 -3.614  0.859   1.00 0.00 ? 72  ASP A HB3  5  
ATOM   9256  N  N    . GLU A 1 73  ? -16.161 -3.824  0.133   1.00 0.00 ? 73  GLU A N    5  
ATOM   9257  C  CA   . GLU A 1 73  ? -15.153 -3.685  -0.915  1.00 0.00 ? 73  GLU A CA   5  
ATOM   9258  C  C    . GLU A 1 73  ? -13.834 -4.275  -0.406  1.00 0.00 ? 73  GLU A C    5  
ATOM   9259  O  O    . GLU A 1 73  ? -13.175 -5.046  -1.108  1.00 0.00 ? 73  GLU A O    5  
ATOM   9260  C  CB   . GLU A 1 73  ? -14.958 -2.203  -1.284  1.00 0.00 ? 73  GLU A CB   5  
ATOM   9261  C  CG   . GLU A 1 73  ? -16.204 -1.520  -1.868  1.00 0.00 ? 73  GLU A CG   5  
ATOM   9262  C  CD   . GLU A 1 73  ? -16.627 -2.122  -3.221  1.00 0.00 ? 73  GLU A CD   5  
ATOM   9263  O  OE1  . GLU A 1 73  ? -16.022 -1.778  -4.261  1.00 0.00 ? 73  GLU A OE1  5  
ATOM   9264  O  OE2  . GLU A 1 73  ? -17.589 -2.921  -3.267  1.00 0.00 ? 73  GLU A OE2  5  
ATOM   9265  H  H    . GLU A 1 73  ? -16.248 -3.071  0.808   1.00 0.00 ? 73  GLU A H    5  
ATOM   9266  H  HA   . GLU A 1 73  ? -15.465 -4.238  -1.802  1.00 0.00 ? 73  GLU A HA   5  
ATOM   9267  H  HB2  . GLU A 1 73  ? -14.645 -1.650  -0.399  1.00 0.00 ? 73  GLU A HB2  5  
ATOM   9268  H  HB3  . GLU A 1 73  ? -14.155 -2.129  -2.016  1.00 0.00 ? 73  GLU A HB3  5  
ATOM   9269  H  HG2  . GLU A 1 73  ? -17.026 -1.580  -1.151  1.00 0.00 ? 73  GLU A HG2  5  
ATOM   9270  H  HG3  . GLU A 1 73  ? -15.979 -0.460  -2.005  1.00 0.00 ? 73  GLU A HG3  5  
ATOM   9271  N  N    . CYS A 1 74  ? -13.477 -3.963  0.844   1.00 0.00 ? 74  CYS A N    5  
ATOM   9272  C  CA   . CYS A 1 74  ? -12.203 -4.334  1.452   1.00 0.00 ? 74  CYS A CA   5  
ATOM   9273  C  C    . CYS A 1 74  ? -12.061 -5.833  1.769   1.00 0.00 ? 74  CYS A C    5  
ATOM   9274  O  O    . CYS A 1 74  ? -11.119 -6.223  2.457   1.00 0.00 ? 74  CYS A O    5  
ATOM   9275  C  CB   . CYS A 1 74  ? -11.943 -3.455  2.679   1.00 0.00 ? 74  CYS A CB   5  
ATOM   9276  S  SG   . CYS A 1 74  ? -11.853 -1.711  2.174   1.00 0.00 ? 74  CYS A SG   5  
ATOM   9277  H  H    . CYS A 1 74  ? -14.094 -3.366  1.384   1.00 0.00 ? 74  CYS A H    5  
ATOM   9278  H  HA   . CYS A 1 74  ? -11.437 -4.106  0.723   1.00 0.00 ? 74  CYS A HA   5  
ATOM   9279  H  HB2  . CYS A 1 74  ? -12.732 -3.599  3.416   1.00 0.00 ? 74  CYS A HB2  5  
ATOM   9280  H  HB3  . CYS A 1 74  ? -10.991 -3.742  3.127   1.00 0.00 ? 74  CYS A HB3  5  
ATOM   9281  H  HG   . CYS A 1 74  ? -11.817 -1.208  3.416   1.00 0.00 ? 74  CYS A HG   5  
ATOM   9282  N  N    . LEU A 1 75  ? -12.971 -6.684  1.289   1.00 0.00 ? 75  LEU A N    5  
ATOM   9283  C  CA   . LEU A 1 75  ? -12.887 -8.140  1.403   1.00 0.00 ? 75  LEU A CA   5  
ATOM   9284  C  C    . LEU A 1 75  ? -12.065 -8.764  0.268   1.00 0.00 ? 75  LEU A C    5  
ATOM   9285  O  O    . LEU A 1 75  ? -11.735 -9.947  0.356   1.00 0.00 ? 75  LEU A O    5  
ATOM   9286  C  CB   . LEU A 1 75  ? -14.305 -8.744  1.409   1.00 0.00 ? 75  LEU A CB   5  
ATOM   9287  C  CG   . LEU A 1 75  ? -14.980 -8.684  2.792   1.00 0.00 ? 75  LEU A CG   5  
ATOM   9288  C  CD1  . LEU A 1 75  ? -16.487 -8.899  2.642   1.00 0.00 ? 75  LEU A CD1  5  
ATOM   9289  C  CD2  . LEU A 1 75  ? -14.413 -9.738  3.754   1.00 0.00 ? 75  LEU A CD2  5  
ATOM   9290  H  H    . LEU A 1 75  ? -13.704 -6.295  0.714   1.00 0.00 ? 75  LEU A H    5  
ATOM   9291  H  HA   . LEU A 1 75  ? -12.389 -8.389  2.339   1.00 0.00 ? 75  LEU A HA   5  
ATOM   9292  H  HB2  . LEU A 1 75  ? -14.911 -8.214  0.672   1.00 0.00 ? 75  LEU A HB2  5  
ATOM   9293  H  HB3  . LEU A 1 75  ? -14.261 -9.790  1.100   1.00 0.00 ? 75  LEU A HB3  5  
ATOM   9294  H  HG   . LEU A 1 75  ? -14.822 -7.701  3.227   1.00 0.00 ? 75  LEU A HG   5  
ATOM   9295  H  HD11 . LEU A 1 75  ? -16.892 -8.149  1.964   1.00 0.00 ? 75  LEU A HD11 5  
ATOM   9296  H  HD12 . LEU A 1 75  ? -16.691 -9.891  2.240   1.00 0.00 ? 75  LEU A HD12 5  
ATOM   9297  H  HD13 . LEU A 1 75  ? -16.973 -8.790  3.612   1.00 0.00 ? 75  LEU A HD13 5  
ATOM   9298  H  HD21 . LEU A 1 75  ? -14.605 -10.738 3.368   1.00 0.00 ? 75  LEU A HD21 5  
ATOM   9299  H  HD22 . LEU A 1 75  ? -13.340 -9.609  3.883   1.00 0.00 ? 75  LEU A HD22 5  
ATOM   9300  H  HD23 . LEU A 1 75  ? -14.889 -9.635  4.730   1.00 0.00 ? 75  LEU A HD23 5  
ATOM   9301  N  N    . LYS A 1 76  ? -11.742 -8.011  -0.794  1.00 0.00 ? 76  LYS A N    5  
ATOM   9302  C  CA   . LYS A 1 76  ? -11.151 -8.570  -2.019  1.00 0.00 ? 76  LYS A CA   5  
ATOM   9303  C  C    . LYS A 1 76  ? -9.825  -7.905  -2.377  1.00 0.00 ? 76  LYS A C    5  
ATOM   9304  O  O    . LYS A 1 76  ? -8.914  -8.578  -2.856  1.00 0.00 ? 76  LYS A O    5  
ATOM   9305  C  CB   . LYS A 1 76  ? -12.145 -8.428  -3.186  1.00 0.00 ? 76  LYS A CB   5  
ATOM   9306  C  CG   . LYS A 1 76  ? -13.447 -9.217  -2.967  1.00 0.00 ? 76  LYS A CG   5  
ATOM   9307  C  CD   . LYS A 1 76  ? -14.382 -9.075  -4.178  1.00 0.00 ? 76  LYS A CD   5  
ATOM   9308  C  CE   . LYS A 1 76  ? -15.730 -9.785  -3.971  1.00 0.00 ? 76  LYS A CE   5  
ATOM   9309  N  NZ   . LYS A 1 76  ? -15.612 -11.266 -3.940  1.00 0.00 ? 76  LYS A NZ   5  
ATOM   9310  H  H    . LYS A 1 76  ? -12.039 -7.043  -0.805  1.00 0.00 ? 76  LYS A H    5  
ATOM   9311  H  HA   . LYS A 1 76  ? -10.950 -9.634  -1.879  1.00 0.00 ? 76  LYS A HA   5  
ATOM   9312  H  HB2  . LYS A 1 76  ? -12.381 -7.372  -3.330  1.00 0.00 ? 76  LYS A HB2  5  
ATOM   9313  H  HB3  . LYS A 1 76  ? -11.665 -8.796  -4.095  1.00 0.00 ? 76  LYS A HB3  5  
ATOM   9314  H  HG2  . LYS A 1 76  ? -13.203 -10.268 -2.813  1.00 0.00 ? 76  LYS A HG2  5  
ATOM   9315  H  HG3  . LYS A 1 76  ? -13.961 -8.839  -2.083  1.00 0.00 ? 76  LYS A HG3  5  
ATOM   9316  H  HD2  . LYS A 1 76  ? -14.583 -8.014  -4.340  1.00 0.00 ? 76  LYS A HD2  5  
ATOM   9317  H  HD3  . LYS A 1 76  ? -13.894 -9.466  -5.072  1.00 0.00 ? 76  LYS A HD3  5  
ATOM   9318  H  HE2  . LYS A 1 76  ? -16.177 -9.430  -3.040  1.00 0.00 ? 76  LYS A HE2  5  
ATOM   9319  H  HE3  . LYS A 1 76  ? -16.395 -9.500  -4.789  1.00 0.00 ? 76  LYS A HE3  5  
ATOM   9320  H  HZ1  . LYS A 1 76  ? -15.218 -11.619 -4.799  1.00 0.00 ? 76  LYS A HZ1  5  
ATOM   9321  H  HZ2  . LYS A 1 76  ? -15.037 -11.577 -3.172  1.00 0.00 ? 76  LYS A HZ2  5  
ATOM   9322  H  HZ3  . LYS A 1 76  ? -16.521 -11.690 -3.829  1.00 0.00 ? 76  LYS A HZ3  5  
ATOM   9323  N  N    . ASP A 1 77  ? -9.708  -6.605  -2.127  1.00 0.00 ? 77  ASP A N    5  
ATOM   9324  C  CA   . ASP A 1 77  ? -8.510  -5.780  -2.301  1.00 0.00 ? 77  ASP A CA   5  
ATOM   9325  C  C    . ASP A 1 77  ? -8.740  -4.561  -1.402  1.00 0.00 ? 77  ASP A C    5  
ATOM   9326  O  O    . ASP A 1 77  ? -9.861  -4.375  -0.923  1.00 0.00 ? 77  ASP A O    5  
ATOM   9327  C  CB   . ASP A 1 77  ? -8.351  -5.374  -3.779  1.00 0.00 ? 77  ASP A CB   5  
ATOM   9328  C  CG   . ASP A 1 77  ? -7.033  -4.651  -4.119  1.00 0.00 ? 77  ASP A CG   5  
ATOM   9329  O  OD1  . ASP A 1 77  ? -6.115  -4.570  -3.273  1.00 0.00 ? 77  ASP A OD1  5  
ATOM   9330  O  OD2  . ASP A 1 77  ? -6.900  -4.198  -5.277  1.00 0.00 ? 77  ASP A OD2  5  
ATOM   9331  H  H    . ASP A 1 77  ? -10.480 -6.114  -1.689  1.00 0.00 ? 77  ASP A H    5  
ATOM   9332  H  HA   . ASP A 1 77  ? -7.624  -6.326  -1.976  1.00 0.00 ? 77  ASP A HA   5  
ATOM   9333  H  HB2  . ASP A 1 77  ? -8.404  -6.275  -4.393  1.00 0.00 ? 77  ASP A HB2  5  
ATOM   9334  H  HB3  . ASP A 1 77  ? -9.189  -4.736  -4.061  1.00 0.00 ? 77  ASP A HB3  5  
ATOM   9335  N  N    . MET A 1 78  ? -7.732  -3.742  -1.118  1.00 0.00 ? 78  MET A N    5  
ATOM   9336  C  CA   . MET A 1 78  ? -7.934  -2.533  -0.320  1.00 0.00 ? 78  MET A CA   5  
ATOM   9337  C  C    . MET A 1 78  ? -8.431  -1.416  -1.240  1.00 0.00 ? 78  MET A C    5  
ATOM   9338  O  O    . MET A 1 78  ? -7.938  -1.272  -2.362  1.00 0.00 ? 78  MET A O    5  
ATOM   9339  C  CB   . MET A 1 78  ? -6.636  -2.147  0.399   1.00 0.00 ? 78  MET A CB   5  
ATOM   9340  C  CG   . MET A 1 78  ? -6.216  -3.174  1.457   1.00 0.00 ? 78  MET A CG   5  
ATOM   9341  S  SD   . MET A 1 78  ? -7.349  -3.427  2.854   1.00 0.00 ? 78  MET A SD   5  
ATOM   9342  C  CE   . MET A 1 78  ? -8.139  -4.981  2.346   1.00 0.00 ? 78  MET A CE   5  
ATOM   9343  H  H    . MET A 1 78  ? -6.850  -3.869  -1.610  1.00 0.00 ? 78  MET A H    5  
ATOM   9344  H  HA   . MET A 1 78  ? -8.698  -2.718  0.435   1.00 0.00 ? 78  MET A HA   5  
ATOM   9345  H  HB2  . MET A 1 78  ? -5.834  -2.059  -0.335  1.00 0.00 ? 78  MET A HB2  5  
ATOM   9346  H  HB3  . MET A 1 78  ? -6.770  -1.181  0.888   1.00 0.00 ? 78  MET A HB3  5  
ATOM   9347  H  HG2  . MET A 1 78  ? -6.063  -4.134  0.969   1.00 0.00 ? 78  MET A HG2  5  
ATOM   9348  H  HG3  . MET A 1 78  ? -5.254  -2.858  1.856   1.00 0.00 ? 78  MET A HG3  5  
ATOM   9349  H  HE1  . MET A 1 78  ? -8.759  -5.365  3.154   1.00 0.00 ? 78  MET A HE1  5  
ATOM   9350  H  HE2  . MET A 1 78  ? -8.765  -4.807  1.472   1.00 0.00 ? 78  MET A HE2  5  
ATOM   9351  H  HE3  . MET A 1 78  ? -7.378  -5.724  2.109   1.00 0.00 ? 78  MET A HE3  5  
ATOM   9352  N  N    . TYR A 1 79  ? -9.367  -0.589  -0.765  1.00 0.00 ? 79  TYR A N    5  
ATOM   9353  C  CA   . TYR A 1 79  ? -10.016 0.460   -1.553  1.00 0.00 ? 79  TYR A CA   5  
ATOM   9354  C  C    . TYR A 1 79  ? -10.210 1.716   -0.703  1.00 0.00 ? 79  TYR A C    5  
ATOM   9355  O  O    . TYR A 1 79  ? -10.259 1.647   0.527   1.00 0.00 ? 79  TYR A O    5  
ATOM   9356  C  CB   . TYR A 1 79  ? -11.387 -0.023  -2.061  1.00 0.00 ? 79  TYR A CB   5  
ATOM   9357  C  CG   . TYR A 1 79  ? -11.391 -1.074  -3.152  1.00 0.00 ? 79  TYR A CG   5  
ATOM   9358  C  CD1  . TYR A 1 79  ? -11.394 -0.689  -4.506  1.00 0.00 ? 79  TYR A CD1  5  
ATOM   9359  C  CD2  . TYR A 1 79  ? -11.501 -2.435  -2.815  1.00 0.00 ? 79  TYR A CD2  5  
ATOM   9360  C  CE1  . TYR A 1 79  ? -11.498 -1.660  -5.518  1.00 0.00 ? 79  TYR A CE1  5  
ATOM   9361  C  CE2  . TYR A 1 79  ? -11.602 -3.413  -3.818  1.00 0.00 ? 79  TYR A CE2  5  
ATOM   9362  C  CZ   . TYR A 1 79  ? -11.594 -3.029  -5.180  1.00 0.00 ? 79  TYR A CZ   5  
ATOM   9363  O  OH   . TYR A 1 79  ? -11.690 -3.961  -6.170  1.00 0.00 ? 79  TYR A OH   5  
ATOM   9364  H  H    . TYR A 1 79  ? -9.698  -0.696  0.184   1.00 0.00 ? 79  TYR A H    5  
ATOM   9365  H  HA   . TYR A 1 79  ? -9.392  0.728   -2.404  1.00 0.00 ? 79  TYR A HA   5  
ATOM   9366  H  HB2  . TYR A 1 79  ? -11.947 -0.416  -1.214  1.00 0.00 ? 79  TYR A HB2  5  
ATOM   9367  H  HB3  . TYR A 1 79  ? -11.941 0.837   -2.440  1.00 0.00 ? 79  TYR A HB3  5  
ATOM   9368  H  HD1  . TYR A 1 79  ? -11.340 0.357   -4.774  1.00 0.00 ? 79  TYR A HD1  5  
ATOM   9369  H  HD2  . TYR A 1 79  ? -11.531 -2.735  -1.777  1.00 0.00 ? 79  TYR A HD2  5  
ATOM   9370  H  HE1  . TYR A 1 79  ? -11.510 -1.356  -6.556  1.00 0.00 ? 79  TYR A HE1  5  
ATOM   9371  H  HE2  . TYR A 1 79  ? -11.692 -4.452  -3.535  1.00 0.00 ? 79  TYR A HE2  5  
ATOM   9372  H  HH   . TYR A 1 79  ? -11.762 -4.870  -5.839  1.00 0.00 ? 79  TYR A HH   5  
ATOM   9373  N  N    . VAL A 1 80  ? -10.365 2.856   -1.373  1.00 0.00 ? 80  VAL A N    5  
ATOM   9374  C  CA   . VAL A 1 80  ? -10.502 4.178   -0.782  1.00 0.00 ? 80  VAL A CA   5  
ATOM   9375  C  C    . VAL A 1 80  ? -11.534 4.952   -1.596  1.00 0.00 ? 80  VAL A C    5  
ATOM   9376  O  O    . VAL A 1 80  ? -11.574 4.836   -2.821  1.00 0.00 ? 80  VAL A O    5  
ATOM   9377  C  CB   . VAL A 1 80  ? -9.138  4.910   -0.736  1.00 0.00 ? 80  VAL A CB   5  
ATOM   9378  C  CG1  . VAL A 1 80  ? -8.295  4.463   0.465   1.00 0.00 ? 80  VAL A CG1  5  
ATOM   9379  C  CG2  . VAL A 1 80  ? -8.292  4.729   -2.009  1.00 0.00 ? 80  VAL A CG2  5  
ATOM   9380  H  H    . VAL A 1 80  ? -10.331 2.819   -2.389  1.00 0.00 ? 80  VAL A H    5  
ATOM   9381  H  HA   . VAL A 1 80  ? -10.888 4.084   0.228   1.00 0.00 ? 80  VAL A HA   5  
ATOM   9382  H  HB   . VAL A 1 80  ? -9.333  5.976   -0.610  1.00 0.00 ? 80  VAL A HB   5  
ATOM   9383  H  HG11 . VAL A 1 80  ? -8.815  4.716   1.387   1.00 0.00 ? 80  VAL A HG11 5  
ATOM   9384  H  HG12 . VAL A 1 80  ? -8.109  3.389   0.430   1.00 0.00 ? 80  VAL A HG12 5  
ATOM   9385  H  HG13 . VAL A 1 80  ? -7.343  4.995   0.466   1.00 0.00 ? 80  VAL A HG13 5  
ATOM   9386  H  HG21 . VAL A 1 80  ? -8.871  5.036   -2.878  1.00 0.00 ? 80  VAL A HG21 5  
ATOM   9387  H  HG22 . VAL A 1 80  ? -7.400  5.352   -1.949  1.00 0.00 ? 80  VAL A HG22 5  
ATOM   9388  H  HG23 . VAL A 1 80  ? -7.992  3.687   -2.132  1.00 0.00 ? 80  VAL A HG23 5  
ATOM   9389  N  N    . GLU A 1 81  ? -12.380 5.723   -0.922  1.00 0.00 ? 81  GLU A N    5  
ATOM   9390  C  CA   . GLU A 1 81  ? -13.271 6.675   -1.568  1.00 0.00 ? 81  GLU A CA   5  
ATOM   9391  C  C    . GLU A 1 81  ? -12.441 7.915   -1.887  1.00 0.00 ? 81  GLU A C    5  
ATOM   9392  O  O    . GLU A 1 81  ? -11.664 8.366   -1.040  1.00 0.00 ? 81  GLU A O    5  
ATOM   9393  C  CB   . GLU A 1 81  ? -14.446 7.034   -0.648  1.00 0.00 ? 81  GLU A CB   5  
ATOM   9394  C  CG   . GLU A 1 81  ? -15.390 5.843   -0.437  1.00 0.00 ? 81  GLU A CG   5  
ATOM   9395  C  CD   . GLU A 1 81  ? -16.629 6.245   0.384   1.00 0.00 ? 81  GLU A CD   5  
ATOM   9396  O  OE1  . GLU A 1 81  ? -16.567 6.239   1.634   1.00 0.00 ? 81  GLU A OE1  5  
ATOM   9397  O  OE2  . GLU A 1 81  ? -17.685 6.554   -0.214  1.00 0.00 ? 81  GLU A OE2  5  
ATOM   9398  H  H    . GLU A 1 81  ? -12.220 5.852   0.072   1.00 0.00 ? 81  GLU A H    5  
ATOM   9399  H  HA   . GLU A 1 81  ? -13.660 6.241   -2.489  1.00 0.00 ? 81  GLU A HA   5  
ATOM   9400  H  HB2  . GLU A 1 81  ? -14.067 7.374   0.317   1.00 0.00 ? 81  GLU A HB2  5  
ATOM   9401  H  HB3  . GLU A 1 81  ? -15.009 7.849   -1.105  1.00 0.00 ? 81  GLU A HB3  5  
ATOM   9402  H  HG2  . GLU A 1 81  ? -15.703 5.461   -1.412  1.00 0.00 ? 81  GLU A HG2  5  
ATOM   9403  H  HG3  . GLU A 1 81  ? -14.853 5.044   0.076   1.00 0.00 ? 81  GLU A HG3  5  
ATOM   9404  N  N    . VAL A 1 82  ? -12.597 8.474   -3.086  1.00 0.00 ? 82  VAL A N    5  
ATOM   9405  C  CA   . VAL A 1 82  ? -11.766 9.569   -3.575  1.00 0.00 ? 82  VAL A CA   5  
ATOM   9406  C  C    . VAL A 1 82  ? -12.626 10.571  -4.345  1.00 0.00 ? 82  VAL A C    5  
ATOM   9407  O  O    . VAL A 1 82  ? -13.609 10.184  -4.974  1.00 0.00 ? 82  VAL A O    5  
ATOM   9408  C  CB   . VAL A 1 82  ? -10.589 9.023   -4.422  1.00 0.00 ? 82  VAL A CB   5  
ATOM   9409  C  CG1  . VAL A 1 82  ? -9.736  7.985   -3.676  1.00 0.00 ? 82  VAL A CG1  5  
ATOM   9410  C  CG2  . VAL A 1 82  ? -11.012 8.404   -5.764  1.00 0.00 ? 82  VAL A CG2  5  
ATOM   9411  H  H    . VAL A 1 82  ? -13.293 8.096   -3.723  1.00 0.00 ? 82  VAL A H    5  
ATOM   9412  H  HA   . VAL A 1 82  ? -11.347 10.093  -2.721  1.00 0.00 ? 82  VAL A HA   5  
ATOM   9413  H  HB   . VAL A 1 82  ? -9.941  9.867   -4.637  1.00 0.00 ? 82  VAL A HB   5  
ATOM   9414  H  HG11 . VAL A 1 82  ? -8.812  7.802   -4.225  1.00 0.00 ? 82  VAL A HG11 5  
ATOM   9415  H  HG12 . VAL A 1 82  ? -9.486  8.354   -2.685  1.00 0.00 ? 82  VAL A HG12 5  
ATOM   9416  H  HG13 . VAL A 1 82  ? -10.278 7.046   -3.577  1.00 0.00 ? 82  VAL A HG13 5  
ATOM   9417  H  HG21 . VAL A 1 82  ? -10.132 8.049   -6.300  1.00 0.00 ? 82  VAL A HG21 5  
ATOM   9418  H  HG22 . VAL A 1 82  ? -11.694 7.568   -5.602  1.00 0.00 ? 82  VAL A HG22 5  
ATOM   9419  H  HG23 . VAL A 1 82  ? -11.500 9.155   -6.386  1.00 0.00 ? 82  VAL A HG23 5  
ATOM   9420  N  N    . ALA A 1 83  ? -12.250 11.848  -4.344  1.00 0.00 ? 83  ALA A N    5  
ATOM   9421  C  CA   . ALA A 1 83  ? -12.905 12.905  -5.101  1.00 0.00 ? 83  ALA A CA   5  
ATOM   9422  C  C    . ALA A 1 83  ? -11.839 13.580  -5.956  1.00 0.00 ? 83  ALA A C    5  
ATOM   9423  O  O    . ALA A 1 83  ? -10.716 13.802  -5.498  1.00 0.00 ? 83  ALA A O    5  
ATOM   9424  C  CB   . ALA A 1 83  ? -13.567 13.907  -4.151  1.00 0.00 ? 83  ALA A CB   5  
ATOM   9425  H  H    . ALA A 1 83  ? -11.427 12.119  -3.812  1.00 0.00 ? 83  ALA A H    5  
ATOM   9426  H  HA   . ALA A 1 83  ? -13.676 12.484  -5.749  1.00 0.00 ? 83  ALA A HA   5  
ATOM   9427  H  HB1  . ALA A 1 83  ? -12.827 14.315  -3.461  1.00 0.00 ? 83  ALA A HB1  5  
ATOM   9428  H  HB2  . ALA A 1 83  ? -14.004 14.722  -4.730  1.00 0.00 ? 83  ALA A HB2  5  
ATOM   9429  H  HB3  . ALA A 1 83  ? -14.360 13.414  -3.590  1.00 0.00 ? 83  ALA A HB3  5  
ATOM   9430  N  N    . ASP A 1 84  ? -12.178 13.869  -7.208  1.00 0.00 ? 84  ASP A N    5  
ATOM   9431  C  CA   . ASP A 1 84  ? -11.241 14.447  -8.170  1.00 0.00 ? 84  ASP A CA   5  
ATOM   9432  C  C    . ASP A 1 84  ? -10.940 15.903  -7.822  1.00 0.00 ? 84  ASP A C    5  
ATOM   9433  O  O    . ASP A 1 84  ? -11.859 16.713  -7.706  1.00 0.00 ? 84  ASP A O    5  
ATOM   9434  C  CB   . ASP A 1 84  ? -11.834 14.371  -9.579  1.00 0.00 ? 84  ASP A CB   5  
ATOM   9435  C  CG   . ASP A 1 84  ? -10.978 15.151  -10.582 1.00 0.00 ? 84  ASP A CG   5  
ATOM   9436  O  OD1  . ASP A 1 84  ? -9.748  14.936  -10.626 1.00 0.00 ? 84  ASP A OD1  5  
ATOM   9437  O  OD2  . ASP A 1 84  ? -11.543 16.007  -11.294 1.00 0.00 ? 84  ASP A OD2  5  
ATOM   9438  H  H    . ASP A 1 84  ? -13.133 13.715  -7.501  1.00 0.00 ? 84  ASP A H    5  
ATOM   9439  H  HA   . ASP A 1 84  ? -10.307 13.885  -8.144  1.00 0.00 ? 84  ASP A HA   5  
ATOM   9440  H  HB2  . ASP A 1 84  ? -11.913 13.329  -9.890  1.00 0.00 ? 84  ASP A HB2  5  
ATOM   9441  H  HB3  . ASP A 1 84  ? -12.834 14.807  -9.556  1.00 0.00 ? 84  ASP A HB3  5  
ATOM   9442  N  N    . ILE A 1 85  ? -9.659  16.249  -7.687  1.00 0.00 ? 85  ILE A N    5  
ATOM   9443  C  CA   . ILE A 1 85  ? -9.225  17.623  -7.440  1.00 0.00 ? 85  ILE A CA   5  
ATOM   9444  C  C    . ILE A 1 85  ? -9.161  18.389  -8.778  1.00 0.00 ? 85  ILE A C    5  
ATOM   9445  O  O    . ILE A 1 85  ? -9.274  19.616  -8.781  1.00 0.00 ? 85  ILE A O    5  
ATOM   9446  C  CB   . ILE A 1 85  ? -7.884  17.620  -6.660  1.00 0.00 ? 85  ILE A CB   5  
ATOM   9447  C  CG1  . ILE A 1 85  ? -8.031  16.885  -5.304  1.00 0.00 ? 85  ILE A CG1  5  
ATOM   9448  C  CG2  . ILE A 1 85  ? -7.368  19.040  -6.367  1.00 0.00 ? 85  ILE A CG2  5  
ATOM   9449  C  CD1  . ILE A 1 85  ? -6.707  16.681  -4.556  1.00 0.00 ? 85  ILE A CD1  5  
ATOM   9450  H  H    . ILE A 1 85  ? -8.937  15.553  -7.852  1.00 0.00 ? 85  ILE A H    5  
ATOM   9451  H  HA   . ILE A 1 85  ? -9.965  18.112  -6.809  1.00 0.00 ? 85  ILE A HA   5  
ATOM   9452  H  HB   . ILE A 1 85  ? -7.144  17.103  -7.268  1.00 0.00 ? 85  ILE A HB   5  
ATOM   9453  H  HG12 . ILE A 1 85  ? -8.717  17.440  -4.661  1.00 0.00 ? 85  ILE A HG12 5  
ATOM   9454  H  HG13 . ILE A 1 85  ? -8.465  15.903  -5.467  1.00 0.00 ? 85  ILE A HG13 5  
ATOM   9455  H  HG21 . ILE A 1 85  ? -6.388  19.001  -5.896  1.00 0.00 ? 85  ILE A HG21 5  
ATOM   9456  H  HG22 . ILE A 1 85  ? -7.249  19.609  -7.286  1.00 0.00 ? 85  ILE A HG22 5  
ATOM   9457  H  HG23 . ILE A 1 85  ? -8.065  19.552  -5.702  1.00 0.00 ? 85  ILE A HG23 5  
ATOM   9458  H  HD11 . ILE A 1 85  ? -6.003  16.150  -5.196  1.00 0.00 ? 85  ILE A HD11 5  
ATOM   9459  H  HD12 . ILE A 1 85  ? -6.279  17.630  -4.238  1.00 0.00 ? 85  ILE A HD12 5  
ATOM   9460  H  HD13 . ILE A 1 85  ? -6.880  16.091  -3.660  1.00 0.00 ? 85  ILE A HD13 5  
ATOM   9461  N  N    . GLY A 1 86  ? -9.012  17.692  -9.914  1.00 0.00 ? 86  GLY A N    5  
ATOM   9462  C  CA   . GLY A 1 86  ? -8.868  18.297  -11.234 1.00 0.00 ? 86  GLY A CA   5  
ATOM   9463  C  C    . GLY A 1 86  ? -10.042 19.213  -11.590 1.00 0.00 ? 86  GLY A C    5  
ATOM   9464  O  O    . GLY A 1 86  ? -9.825  20.322  -12.085 1.00 0.00 ? 86  GLY A O    5  
ATOM   9465  H  H    . GLY A 1 86  ? -9.021  16.675  -9.882  1.00 0.00 ? 86  GLY A H    5  
ATOM   9466  H  HA2  . GLY A 1 86  ? -7.939  18.867  -11.266 1.00 0.00 ? 86  GLY A HA2  5  
ATOM   9467  H  HA3  . GLY A 1 86  ? -8.814  17.499  -11.974 1.00 0.00 ? 86  GLY A HA3  5  
ATOM   9468  N  N    . GLY A 1 87  ? -11.272 18.789  -11.292 1.00 0.00 ? 87  GLY A N    5  
ATOM   9469  C  CA   . GLY A 1 87  ? -12.464 19.606  -11.474 1.00 0.00 ? 87  GLY A CA   5  
ATOM   9470  C  C    . GLY A 1 87  ? -13.759 18.937  -11.020 1.00 0.00 ? 87  GLY A C    5  
ATOM   9471  O  O    . GLY A 1 87  ? -14.680 19.636  -10.596 1.00 0.00 ? 87  GLY A O    5  
ATOM   9472  H  H    . GLY A 1 87  ? -11.385 17.827  -10.976 1.00 0.00 ? 87  GLY A H    5  
ATOM   9473  H  HA2  . GLY A 1 87  ? -12.339 20.537  -10.923 1.00 0.00 ? 87  GLY A HA2  5  
ATOM   9474  H  HA3  . GLY A 1 87  ? -12.560 19.830  -12.535 1.00 0.00 ? 87  GLY A HA3  5  
ATOM   9475  N  N    . LYS A 1 88  ? -13.853 17.603  -11.054 1.00 0.00 ? 88  LYS A N    5  
ATOM   9476  C  CA   . LYS A 1 88  ? -15.079 16.861  -10.738 1.00 0.00 ? 88  LYS A CA   5  
ATOM   9477  C  C    . LYS A 1 88  ? -15.227 16.651  -9.224  1.00 0.00 ? 88  LYS A C    5  
ATOM   9478  O  O    . LYS A 1 88  ? -15.705 15.609  -8.781  1.00 0.00 ? 88  LYS A O    5  
ATOM   9479  C  CB   . LYS A 1 88  ? -15.128 15.546  -11.541 1.00 0.00 ? 88  LYS A CB   5  
ATOM   9480  C  CG   . LYS A 1 88  ? -15.047 15.781  -13.060 1.00 0.00 ? 88  LYS A CG   5  
ATOM   9481  C  CD   . LYS A 1 88  ? -15.232 14.498  -13.883 1.00 0.00 ? 88  LYS A CD   5  
ATOM   9482  C  CE   . LYS A 1 88  ? -14.130 13.465  -13.602 1.00 0.00 ? 88  LYS A CE   5  
ATOM   9483  N  NZ   . LYS A 1 88  ? -14.256 12.265  -14.467 1.00 0.00 ? 88  LYS A NZ   5  
ATOM   9484  H  H    . LYS A 1 88  ? -13.038 17.055  -11.329 1.00 0.00 ? 88  LYS A H    5  
ATOM   9485  H  HA   . LYS A 1 88  ? -15.929 17.469  -11.056 1.00 0.00 ? 88  LYS A HA   5  
ATOM   9486  H  HB2  . LYS A 1 88  ? -14.314 14.896  -11.227 1.00 0.00 ? 88  LYS A HB2  5  
ATOM   9487  H  HB3  . LYS A 1 88  ? -16.072 15.043  -11.322 1.00 0.00 ? 88  LYS A HB3  5  
ATOM   9488  H  HG2  . LYS A 1 88  ? -15.827 16.487  -13.348 1.00 0.00 ? 88  LYS A HG2  5  
ATOM   9489  H  HG3  . LYS A 1 88  ? -14.080 16.218  -13.315 1.00 0.00 ? 88  LYS A HG3  5  
ATOM   9490  H  HD2  . LYS A 1 88  ? -16.209 14.067  -13.656 1.00 0.00 ? 88  LYS A HD2  5  
ATOM   9491  H  HD3  . LYS A 1 88  ? -15.211 14.769  -14.939 1.00 0.00 ? 88  LYS A HD3  5  
ATOM   9492  H  HE2  . LYS A 1 88  ? -13.157 13.934  -13.768 1.00 0.00 ? 88  LYS A HE2  5  
ATOM   9493  H  HE3  . LYS A 1 88  ? -14.189 13.163  -12.554 1.00 0.00 ? 88  LYS A HE3  5  
ATOM   9494  H  HZ1  . LYS A 1 88  ? -15.139 11.800  -14.322 1.00 0.00 ? 88  LYS A HZ1  5  
ATOM   9495  H  HZ2  . LYS A 1 88  ? -14.183 12.508  -15.444 1.00 0.00 ? 88  LYS A HZ2  5  
ATOM   9496  H  HZ3  . LYS A 1 88  ? -13.523 11.600  -14.265 1.00 0.00 ? 88  LYS A HZ3  5  
ATOM   9497  N  N    . ASP A 1 89  ? -14.818 17.637  -8.421  1.00 0.00 ? 89  ASP A N    5  
ATOM   9498  C  CA   . ASP A 1 89  ? -14.914 17.625  -6.958  1.00 0.00 ? 89  ASP A CA   5  
ATOM   9499  C  C    . ASP A 1 89  ? -16.370 17.517  -6.481  1.00 0.00 ? 89  ASP A C    5  
ATOM   9500  O  O    . ASP A 1 89  ? -16.636 17.064  -5.368  1.00 0.00 ? 89  ASP A O    5  
ATOM   9501  C  CB   . ASP A 1 89  ? -14.280 18.907  -6.405  1.00 0.00 ? 89  ASP A CB   5  
ATOM   9502  C  CG   . ASP A 1 89  ? -14.403 18.996  -4.874  1.00 0.00 ? 89  ASP A CG   5  
ATOM   9503  O  OD1  . ASP A 1 89  ? -13.703 18.244  -4.160  1.00 0.00 ? 89  ASP A OD1  5  
ATOM   9504  O  OD2  . ASP A 1 89  ? -15.163 19.858  -4.377  1.00 0.00 ? 89  ASP A OD2  5  
ATOM   9505  H  H    . ASP A 1 89  ? -14.460 18.477  -8.853  1.00 0.00 ? 89  ASP A H    5  
ATOM   9506  H  HA   . ASP A 1 89  ? -14.357 16.770  -6.575  1.00 0.00 ? 89  ASP A HA   5  
ATOM   9507  H  HB2  . ASP A 1 89  ? -13.226 18.940  -6.687  1.00 0.00 ? 89  ASP A HB2  5  
ATOM   9508  H  HB3  . ASP A 1 89  ? -14.772 19.770  -6.861  1.00 0.00 ? 89  ASP A HB3  5  
ATOM   9509  N  N    . ASP A 1 90  ? -17.318 17.908  -7.339  1.00 0.00 ? 90  ASP A N    5  
ATOM   9510  C  CA   . ASP A 1 90  ? -18.760 17.795  -7.117  1.00 0.00 ? 90  ASP A CA   5  
ATOM   9511  C  C    . ASP A 1 90  ? -19.243 16.335  -7.026  1.00 0.00 ? 90  ASP A C    5  
ATOM   9512  O  O    . ASP A 1 90  ? -20.381 16.089  -6.625  1.00 0.00 ? 90  ASP A O    5  
ATOM   9513  C  CB   . ASP A 1 90  ? -19.490 18.529  -8.252  1.00 0.00 ? 90  ASP A CB   5  
ATOM   9514  C  CG   . ASP A 1 90  ? -21.016 18.558  -8.053  1.00 0.00 ? 90  ASP A CG   5  
ATOM   9515  O  OD1  . ASP A 1 90  ? -21.494 19.191  -7.083  1.00 0.00 ? 90  ASP A OD1  5  
ATOM   9516  O  OD2  . ASP A 1 90  ? -21.752 18.005  -8.900  1.00 0.00 ? 90  ASP A OD2  5  
ATOM   9517  H  H    . ASP A 1 90  ? -17.023 18.290  -8.225  1.00 0.00 ? 90  ASP A H    5  
ATOM   9518  H  HA   . ASP A 1 90  ? -19.002 18.294  -6.177  1.00 0.00 ? 90  ASP A HA   5  
ATOM   9519  H  HB2  . ASP A 1 90  ? -19.122 19.556  -8.305  1.00 0.00 ? 90  ASP A HB2  5  
ATOM   9520  H  HB3  . ASP A 1 90  ? -19.250 18.040  -9.199  1.00 0.00 ? 90  ASP A HB3  5  
ATOM   9521  N  N    . ASP A 1 91  ? -18.397 15.356  -7.365  1.00 0.00 ? 91  ASP A N    5  
ATOM   9522  C  CA   . ASP A 1 91  ? -18.719 13.931  -7.360  1.00 0.00 ? 91  ASP A CA   5  
ATOM   9523  C  C    . ASP A 1 91  ? -17.574 13.141  -6.710  1.00 0.00 ? 91  ASP A C    5  
ATOM   9524  O  O    . ASP A 1 91  ? -16.479 13.669  -6.496  1.00 0.00 ? 91  ASP A O    5  
ATOM   9525  C  CB   . ASP A 1 91  ? -19.002 13.460  -8.798  1.00 0.00 ? 91  ASP A CB   5  
ATOM   9526  C  CG   . ASP A 1 91  ? -19.617 12.049  -8.876  1.00 0.00 ? 91  ASP A CG   5  
ATOM   9527  O  OD1  . ASP A 1 91  ? -20.224 11.581  -7.886  1.00 0.00 ? 91  ASP A OD1  5  
ATOM   9528  O  OD2  . ASP A 1 91  ? -19.543 11.421  -9.955  1.00 0.00 ? 91  ASP A OD2  5  
ATOM   9529  H  H    . ASP A 1 91  ? -17.436 15.584  -7.602  1.00 0.00 ? 91  ASP A H    5  
ATOM   9530  H  HA   . ASP A 1 91  ? -19.620 13.770  -6.768  1.00 0.00 ? 91  ASP A HA   5  
ATOM   9531  H  HB2  . ASP A 1 91  ? -19.702 14.158  -9.263  1.00 0.00 ? 91  ASP A HB2  5  
ATOM   9532  H  HB3  . ASP A 1 91  ? -18.071 13.491  -9.367  1.00 0.00 ? 91  ASP A HB3  5  
ATOM   9533  N  N    . VAL A 1 92  ? -17.833 11.883  -6.362  1.00 0.00 ? 92  VAL A N    5  
ATOM   9534  C  CA   . VAL A 1 92  ? -16.945 11.035  -5.575  1.00 0.00 ? 92  VAL A CA   5  
ATOM   9535  C  C    . VAL A 1 92  ? -16.957 9.639   -6.211  1.00 0.00 ? 92  VAL A C    5  
ATOM   9536  O  O    . VAL A 1 92  ? -17.943 9.219   -6.825  1.00 0.00 ? 92  VAL A O    5  
ATOM   9537  C  CB   . VAL A 1 92  ? -17.392 11.014  -4.090  1.00 0.00 ? 92  VAL A CB   5  
ATOM   9538  C  CG1  . VAL A 1 92  ? -16.345 10.369  -3.168  1.00 0.00 ? 92  VAL A CG1  5  
ATOM   9539  C  CG2  . VAL A 1 92  ? -17.695 12.413  -3.518  1.00 0.00 ? 92  VAL A CG2  5  
ATOM   9540  H  H    . VAL A 1 92  ? -18.719 11.473  -6.644  1.00 0.00 ? 92  VAL A H    5  
ATOM   9541  H  HA   . VAL A 1 92  ? -15.933 11.439  -5.626  1.00 0.00 ? 92  VAL A HA   5  
ATOM   9542  H  HB   . VAL A 1 92  ? -18.300 10.421  -4.025  1.00 0.00 ? 92  VAL A HB   5  
ATOM   9543  H  HG11 . VAL A 1 92  ? -16.696 10.379  -2.136  1.00 0.00 ? 92  VAL A HG11 5  
ATOM   9544  H  HG12 . VAL A 1 92  ? -16.172 9.331   -3.448  1.00 0.00 ? 92  VAL A HG12 5  
ATOM   9545  H  HG13 . VAL A 1 92  ? -15.409 10.922  -3.231  1.00 0.00 ? 92  VAL A HG13 5  
ATOM   9546  H  HG21 . VAL A 1 92  ? -16.831 13.066  -3.646  1.00 0.00 ? 92  VAL A HG21 5  
ATOM   9547  H  HG22 . VAL A 1 92  ? -18.556 12.852  -4.021  1.00 0.00 ? 92  VAL A HG22 5  
ATOM   9548  H  HG23 . VAL A 1 92  ? -17.936 12.342  -2.457  1.00 0.00 ? 92  VAL A HG23 5  
ATOM   9549  N  N    . TYR A 1 93  ? -15.846 8.930   -6.052  1.00 0.00 ? 93  TYR A N    5  
ATOM   9550  C  CA   . TYR A 1 93  ? -15.512 7.681   -6.714  1.00 0.00 ? 93  TYR A CA   5  
ATOM   9551  C  C    . TYR A 1 93  ? -14.857 6.745   -5.691  1.00 0.00 ? 93  TYR A C    5  
ATOM   9552  O  O    . TYR A 1 93  ? -14.660 7.117   -4.531  1.00 0.00 ? 93  TYR A O    5  
ATOM   9553  C  CB   . TYR A 1 93  ? -14.545 7.985   -7.877  1.00 0.00 ? 93  TYR A CB   5  
ATOM   9554  C  CG   . TYR A 1 93  ? -14.982 9.108   -8.805  1.00 0.00 ? 93  TYR A CG   5  
ATOM   9555  C  CD1  . TYR A 1 93  ? -15.897 8.847   -9.843  1.00 0.00 ? 93  TYR A CD1  5  
ATOM   9556  C  CD2  . TYR A 1 93  ? -14.497 10.418  -8.611  1.00 0.00 ? 93  TYR A CD2  5  
ATOM   9557  C  CE1  . TYR A 1 93  ? -16.327 9.887   -10.686 1.00 0.00 ? 93  TYR A CE1  5  
ATOM   9558  C  CE2  . TYR A 1 93  ? -14.925 11.464  -9.449  1.00 0.00 ? 93  TYR A CE2  5  
ATOM   9559  C  CZ   . TYR A 1 93  ? -15.843 11.202  -10.491 1.00 0.00 ? 93  TYR A CZ   5  
ATOM   9560  O  OH   . TYR A 1 93  ? -16.247 12.217  -11.305 1.00 0.00 ? 93  TYR A OH   5  
ATOM   9561  H  H    . TYR A 1 93  ? -15.103 9.354   -5.518  1.00 0.00 ? 93  TYR A H    5  
ATOM   9562  H  HA   . TYR A 1 93  ? -16.415 7.212   -7.107  1.00 0.00 ? 93  TYR A HA   5  
ATOM   9563  H  HB2  . TYR A 1 93  ? -13.571 8.244   -7.460  1.00 0.00 ? 93  TYR A HB2  5  
ATOM   9564  H  HB3  . TYR A 1 93  ? -14.407 7.079   -8.469  1.00 0.00 ? 93  TYR A HB3  5  
ATOM   9565  H  HD1  . TYR A 1 93  ? -16.279 7.846   -9.992  1.00 0.00 ? 93  TYR A HD1  5  
ATOM   9566  H  HD2  . TYR A 1 93  ? -13.802 10.625  -7.808  1.00 0.00 ? 93  TYR A HD2  5  
ATOM   9567  H  HE1  . TYR A 1 93  ? -17.032 9.675   -11.478 1.00 0.00 ? 93  TYR A HE1  5  
ATOM   9568  H  HE2  . TYR A 1 93  ? -14.560 12.469  -9.292  1.00 0.00 ? 93  TYR A HE2  5  
ATOM   9569  H  HH   . TYR A 1 93  ? -16.918 11.943  -11.948 1.00 0.00 ? 93  TYR A HH   5  
ATOM   9570  N  N    . THR A 1 94  ? -14.461 5.558   -6.140  1.00 0.00 ? 94  THR A N    5  
ATOM   9571  C  CA   . THR A 1 94  ? -13.689 4.609   -5.348  1.00 0.00 ? 94  THR A CA   5  
ATOM   9572  C  C    . THR A 1 94  ? -12.494 4.184   -6.200  1.00 0.00 ? 94  THR A C    5  
ATOM   9573  O  O    . THR A 1 94  ? -12.638 3.937   -7.401  1.00 0.00 ? 94  THR A O    5  
ATOM   9574  C  CB   . THR A 1 94  ? -14.567 3.421   -4.896  1.00 0.00 ? 94  THR A CB   5  
ATOM   9575  O  OG1  . THR A 1 94  ? -15.866 3.854   -4.519  1.00 0.00 ? 94  THR A OG1  5  
ATOM   9576  C  CG2  . THR A 1 94  ? -13.947 2.694   -3.698  1.00 0.00 ? 94  THR A CG2  5  
ATOM   9577  H  H    . THR A 1 94  ? -14.622 5.343   -7.116  1.00 0.00 ? 94  THR A H    5  
ATOM   9578  H  HA   . THR A 1 94  ? -13.309 5.104   -4.455  1.00 0.00 ? 94  THR A HA   5  
ATOM   9579  H  HB   . THR A 1 94  ? -14.659 2.716   -5.722  1.00 0.00 ? 94  THR A HB   5  
ATOM   9580  H  HG1  . THR A 1 94  ? -16.455 3.083   -4.528  1.00 0.00 ? 94  THR A HG1  5  
ATOM   9581  H  HG21 . THR A 1 94  ? -12.943 2.355   -3.951  1.00 0.00 ? 94  THR A HG21 5  
ATOM   9582  H  HG22 . THR A 1 94  ? -13.891 3.365   -2.839  1.00 0.00 ? 94  THR A HG22 5  
ATOM   9583  H  HG23 . THR A 1 94  ? -14.551 1.824   -3.437  1.00 0.00 ? 94  THR A HG23 5  
ATOM   9584  N  N    . ALA A 1 95  ? -11.324 4.106   -5.572  1.00 0.00 ? 95  ALA A N    5  
ATOM   9585  C  CA   . ALA A 1 95  ? -10.071 3.689   -6.175  1.00 0.00 ? 95  ALA A CA   5  
ATOM   9586  C  C    . ALA A 1 95  ? -9.513  2.552   -5.329  1.00 0.00 ? 95  ALA A C    5  
ATOM   9587  O  O    . ALA A 1 95  ? -9.795  2.462   -4.132  1.00 0.00 ? 95  ALA A O    5  
ATOM   9588  C  CB   . ALA A 1 95  ? -9.101  4.877   -6.209  1.00 0.00 ? 95  ALA A CB   5  
ATOM   9589  H  H    . ALA A 1 95  ? -11.296 4.307   -4.576  1.00 0.00 ? 95  ALA A H    5  
ATOM   9590  H  HA   . ALA A 1 95  ? -10.241 3.336   -7.193  1.00 0.00 ? 95  ALA A HA   5  
ATOM   9591  H  HB1  . ALA A 1 95  ? -8.920  5.245   -5.200  1.00 0.00 ? 95  ALA A HB1  5  
ATOM   9592  H  HB2  . ALA A 1 95  ? -8.151  4.566   -6.644  1.00 0.00 ? 95  ALA A HB2  5  
ATOM   9593  H  HB3  . ALA A 1 95  ? -9.525  5.679   -6.811  1.00 0.00 ? 95  ALA A HB3  5  
ATOM   9594  N  N    . LYS A 1 96  ? -8.707  1.680   -5.930  1.00 0.00 ? 96  LYS A N    5  
ATOM   9595  C  CA   . LYS A 1 96  ? -7.959  0.698   -5.172  1.00 0.00 ? 96  LYS A CA   5  
ATOM   9596  C  C    . LYS A 1 96  ? -6.877  1.462   -4.427  1.00 0.00 ? 96  LYS A C    5  
ATOM   9597  O  O    . LYS A 1 96  ? -6.192  2.296   -5.024  1.00 0.00 ? 96  LYS A O    5  
ATOM   9598  C  CB   . LYS A 1 96  ? -7.327  -0.328  -6.122  1.00 0.00 ? 96  LYS A CB   5  
ATOM   9599  C  CG   . LYS A 1 96  ? -8.362  -1.243  -6.795  1.00 0.00 ? 96  LYS A CG   5  
ATOM   9600  C  CD   . LYS A 1 96  ? -7.730  -2.036  -7.946  1.00 0.00 ? 96  LYS A CD   5  
ATOM   9601  C  CE   . LYS A 1 96  ? -7.657  -1.192  -9.229  1.00 0.00 ? 96  LYS A CE   5  
ATOM   9602  N  NZ   . LYS A 1 96  ? -6.584  -1.652  -10.141 1.00 0.00 ? 96  LYS A NZ   5  
ATOM   9603  H  H    . LYS A 1 96  ? -8.426  1.847   -6.882  1.00 0.00 ? 96  LYS A H    5  
ATOM   9604  H  HA   . LYS A 1 96  ? -8.617  0.186   -4.468  1.00 0.00 ? 96  LYS A HA   5  
ATOM   9605  H  HB2  . LYS A 1 96  ? -6.742  0.194   -6.878  1.00 0.00 ? 96  LYS A HB2  5  
ATOM   9606  H  HB3  . LYS A 1 96  ? -6.649  -0.956  -5.546  1.00 0.00 ? 96  LYS A HB3  5  
ATOM   9607  H  HG2  . LYS A 1 96  ? -8.738  -1.941  -6.047  1.00 0.00 ? 96  LYS A HG2  5  
ATOM   9608  H  HG3  . LYS A 1 96  ? -9.200  -0.661  -7.179  1.00 0.00 ? 96  LYS A HG3  5  
ATOM   9609  H  HD2  . LYS A 1 96  ? -6.732  -2.358  -7.643  1.00 0.00 ? 96  LYS A HD2  5  
ATOM   9610  H  HD3  . LYS A 1 96  ? -8.336  -2.921  -8.144  1.00 0.00 ? 96  LYS A HD3  5  
ATOM   9611  H  HE2  . LYS A 1 96  ? -8.625  -1.232  -9.734  1.00 0.00 ? 96  LYS A HE2  5  
ATOM   9612  H  HE3  . LYS A 1 96  ? -7.457  -0.153  -8.960  1.00 0.00 ? 96  LYS A HE3  5  
ATOM   9613  H  HZ1  . LYS A 1 96  ? -5.680  -1.450  -9.708  1.00 0.00 ? 96  LYS A HZ1  5  
ATOM   9614  H  HZ2  . LYS A 1 96  ? -6.655  -2.639  -10.340 1.00 0.00 ? 96  LYS A HZ2  5  
ATOM   9615  H  HZ3  . LYS A 1 96  ? -6.609  -1.142  -11.012 1.00 0.00 ? 96  LYS A HZ3  5  
ATOM   9616  N  N    . LEU A 1 97  ? -6.667  1.147   -3.151  1.00 0.00 ? 97  LEU A N    5  
ATOM   9617  C  CA   . LEU A 1 97  ? -5.497  1.651   -2.428  1.00 0.00 ? 97  LEU A CA   5  
ATOM   9618  C  C    . LEU A 1 97  ? -4.240  1.145   -3.154  1.00 0.00 ? 97  LEU A C    5  
ATOM   9619  O  O    . LEU A 1 97  ? -3.227  1.834   -3.218  1.00 0.00 ? 97  LEU A O    5  
ATOM   9620  C  CB   . LEU A 1 97  ? -5.517  1.166   -0.969  1.00 0.00 ? 97  LEU A CB   5  
ATOM   9621  C  CG   . LEU A 1 97  ? -4.363  1.731   -0.112  1.00 0.00 ? 97  LEU A CG   5  
ATOM   9622  C  CD1  . LEU A 1 97  ? -4.481  3.249   0.071   1.00 0.00 ? 97  LEU A CD1  5  
ATOM   9623  C  CD2  . LEU A 1 97  ? -4.366  1.055   1.261   1.00 0.00 ? 97  LEU A CD2  5  
ATOM   9624  H  H    . LEU A 1 97  ? -7.220  0.404   -2.740  1.00 0.00 ? 97  LEU A H    5  
ATOM   9625  H  HA   . LEU A 1 97  ? -5.522  2.739   -2.453  1.00 0.00 ? 97  LEU A HA   5  
ATOM   9626  H  HB2  . LEU A 1 97  ? -6.470  1.439   -0.512  1.00 0.00 ? 97  LEU A HB2  5  
ATOM   9627  H  HB3  . LEU A 1 97  ? -5.440  0.080   -0.978  1.00 0.00 ? 97  LEU A HB3  5  
ATOM   9628  H  HG   . LEU A 1 97  ? -3.407  1.505   -0.583  1.00 0.00 ? 97  LEU A HG   5  
ATOM   9629  H  HD11 . LEU A 1 97  ? -5.461  3.504   0.472   1.00 0.00 ? 97  LEU A HD11 5  
ATOM   9630  H  HD12 . LEU A 1 97  ? -3.720  3.599   0.766   1.00 0.00 ? 97  LEU A HD12 5  
ATOM   9631  H  HD13 . LEU A 1 97  ? -4.330  3.759   -0.879  1.00 0.00 ? 97  LEU A HD13 5  
ATOM   9632  H  HD21 . LEU A 1 97  ? -5.300  1.260   1.784   1.00 0.00 ? 97  LEU A HD21 5  
ATOM   9633  H  HD22 . LEU A 1 97  ? -4.245  -0.022  1.139   1.00 0.00 ? 97  LEU A HD22 5  
ATOM   9634  H  HD23 . LEU A 1 97  ? -3.531  1.424   1.859   1.00 0.00 ? 97  LEU A HD23 5  
ATOM   9635  N  N    . SER A 1 98  ? -4.360  -0.031  -3.774  1.00 0.00 ? 98  SER A N    5  
ATOM   9636  C  CA   . SER A 1 98  ? -3.366  -0.698  -4.601  1.00 0.00 ? 98  SER A CA   5  
ATOM   9637  C  C    . SER A 1 98  ? -3.056  0.050   -5.914  1.00 0.00 ? 98  SER A C    5  
ATOM   9638  O  O    . SER A 1 98  ? -2.225  -0.417  -6.694  1.00 0.00 ? 98  SER A O    5  
ATOM   9639  C  CB   . SER A 1 98  ? -3.894  -2.124  -4.842  1.00 0.00 ? 98  SER A CB   5  
ATOM   9640  O  OG   . SER A 1 98  ? -4.237  -2.690  -3.586  1.00 0.00 ? 98  SER A OG   5  
ATOM   9641  H  H    . SER A 1 98  ? -5.235  -0.531  -3.673  1.00 0.00 ? 98  SER A H    5  
ATOM   9642  H  HA   . SER A 1 98  ? -2.439  -0.760  -4.030  1.00 0.00 ? 98  SER A HA   5  
ATOM   9643  H  HB2  . SER A 1 98  ? -4.775  -2.089  -5.480  1.00 0.00 ? 98  SER A HB2  5  
ATOM   9644  H  HB3  . SER A 1 98  ? -3.138  -2.733  -5.332  1.00 0.00 ? 98  SER A HB3  5  
ATOM   9645  H  HG   . SER A 1 98  ? -4.896  -3.411  -3.704  1.00 0.00 ? 98  SER A HG   5  
ATOM   9646  N  N    . ASP A 1 99  ? -3.682  1.209   -6.157  1.00 0.00 ? 99  ASP A N    5  
ATOM   9647  C  CA   . ASP A 1 99  ? -3.449  2.081   -7.312  1.00 0.00 ? 99  ASP A CA   5  
ATOM   9648  C  C    . ASP A 1 99  ? -3.288  3.539   -6.846  1.00 0.00 ? 99  ASP A C    5  
ATOM   9649  O  O    . ASP A 1 99  ? -3.256  4.450   -7.670  1.00 0.00 ? 99  ASP A O    5  
ATOM   9650  C  CB   . ASP A 1 99  ? -4.609  1.959   -8.324  1.00 0.00 ? 99  ASP A CB   5  
ATOM   9651  C  CG   . ASP A 1 99  ? -4.513  0.742   -9.246  1.00 0.00 ? 99  ASP A CG   5  
ATOM   9652  O  OD1  . ASP A 1 99  ? -4.551  -0.411  -8.762  1.00 0.00 ? 99  ASP A OD1  5  
ATOM   9653  O  OD2  . ASP A 1 99  ? -4.466  0.933   -10.481 1.00 0.00 ? 99  ASP A OD2  5  
ATOM   9654  H  H    . ASP A 1 99  ? -4.392  1.529   -5.505  1.00 0.00 ? 99  ASP A H    5  
ATOM   9655  H  HA   . ASP A 1 99  ? -2.523  1.793   -7.808  1.00 0.00 ? 99  ASP A HA   5  
ATOM   9656  H  HB2  . ASP A 1 99  ? -5.562  1.949   -7.795  1.00 0.00 ? 99  ASP A HB2  5  
ATOM   9657  H  HB3  . ASP A 1 99  ? -4.613  2.838   -8.968  1.00 0.00 ? 99  ASP A HB3  5  
ATOM   9658  N  N    . ILE A 1 100 ? -3.180  3.797   -5.540  1.00 0.00 ? 100 ILE A N    5  
ATOM   9659  C  CA   . ILE A 1 100 ? -3.095  5.137   -4.961  1.00 0.00 ? 100 ILE A CA   5  
ATOM   9660  C  C    . ILE A 1 100 ? -1.715  5.306   -4.336  1.00 0.00 ? 100 ILE A C    5  
ATOM   9661  O  O    . ILE A 1 100 ? -1.109  4.359   -3.831  1.00 0.00 ? 100 ILE A O    5  
ATOM   9662  C  CB   . ILE A 1 100 ? -4.270  5.346   -3.965  1.00 0.00 ? 100 ILE A CB   5  
ATOM   9663  C  CG1  . ILE A 1 100 ? -5.517  5.822   -4.741  1.00 0.00 ? 100 ILE A CG1  5  
ATOM   9664  C  CG2  . ILE A 1 100 ? -3.986  6.257   -2.751  1.00 0.00 ? 100 ILE A CG2  5  
ATOM   9665  C  CD1  . ILE A 1 100 ? -5.670  7.337   -4.920  1.00 0.00 ? 100 ILE A CD1  5  
ATOM   9666  H  H    . ILE A 1 100 ? -3.104  3.022   -4.896  1.00 0.00 ? 100 ILE A H    5  
ATOM   9667  H  HA   . ILE A 1 100 ? -3.184  5.883   -5.751  1.00 0.00 ? 100 ILE A HA   5  
ATOM   9668  H  HB   . ILE A 1 100 ? -4.509  4.369   -3.547  1.00 0.00 ? 100 ILE A HB   5  
ATOM   9669  H  HG12 . ILE A 1 100 ? -5.497  5.375   -5.733  1.00 0.00 ? 100 ILE A HG12 5  
ATOM   9670  H  HG13 . ILE A 1 100 ? -6.403  5.463   -4.223  1.00 0.00 ? 100 ILE A HG13 5  
ATOM   9671  H  HG21 . ILE A 1 100 ? -3.659  7.250   -3.069  1.00 0.00 ? 100 ILE A HG21 5  
ATOM   9672  H  HG22 . ILE A 1 100 ? -4.888  6.357   -2.147  1.00 0.00 ? 100 ILE A HG22 5  
ATOM   9673  H  HG23 . ILE A 1 100 ? -3.212  5.814   -2.123  1.00 0.00 ? 100 ILE A HG23 5  
ATOM   9674  H  HD11 . ILE A 1 100 ? -4.759  7.762   -5.335  1.00 0.00 ? 100 ILE A HD11 5  
ATOM   9675  H  HD12 . ILE A 1 100 ? -6.500  7.525   -5.599  1.00 0.00 ? 100 ILE A HD12 5  
ATOM   9676  H  HD13 . ILE A 1 100 ? -5.892  7.813   -3.965  1.00 0.00 ? 100 ILE A HD13 5  
ATOM   9677  N  N    . GLU A 1 101 ? -1.250  6.550   -4.348  1.00 0.00 ? 101 GLU A N    5  
ATOM   9678  C  CA   . GLU A 1 101 ? -0.023  6.976   -3.695  1.00 0.00 ? 101 GLU A CA   5  
ATOM   9679  C  C    . GLU A 1 101 ? -0.330  8.304   -3.002  1.00 0.00 ? 101 GLU A C    5  
ATOM   9680  O  O    . GLU A 1 101 ? -0.759  9.257   -3.655  1.00 0.00 ? 101 GLU A O    5  
ATOM   9681  C  CB   . GLU A 1 101 ? 1.087   7.089   -4.751  1.00 0.00 ? 101 GLU A CB   5  
ATOM   9682  C  CG   . GLU A 1 101 ? 2.463   7.348   -4.127  1.00 0.00 ? 101 GLU A CG   5  
ATOM   9683  C  CD   . GLU A 1 101 ? 3.559   7.435   -5.203  1.00 0.00 ? 101 GLU A CD   5  
ATOM   9684  O  OE1  . GLU A 1 101 ? 3.832   6.420   -5.884  1.00 0.00 ? 101 GLU A OE1  5  
ATOM   9685  O  OE2  . GLU A 1 101 ? 4.167   8.516   -5.372  1.00 0.00 ? 101 GLU A OE2  5  
ATOM   9686  H  H    . GLU A 1 101 ? -1.782  7.255   -4.845  1.00 0.00 ? 101 GLU A H    5  
ATOM   9687  H  HA   . GLU A 1 101 ? 0.273   6.233   -2.953  1.00 0.00 ? 101 GLU A HA   5  
ATOM   9688  H  HB2  . GLU A 1 101 ? 1.132   6.150   -5.306  1.00 0.00 ? 101 GLU A HB2  5  
ATOM   9689  H  HB3  . GLU A 1 101 ? 0.849   7.890   -5.453  1.00 0.00 ? 101 GLU A HB3  5  
ATOM   9690  H  HG2  . GLU A 1 101 ? 2.429   8.280   -3.558  1.00 0.00 ? 101 GLU A HG2  5  
ATOM   9691  H  HG3  . GLU A 1 101 ? 2.699   6.538   -3.434  1.00 0.00 ? 101 GLU A HG3  5  
ATOM   9692  N  N    . ALA A 1 102 ? -0.173  8.362   -1.677  1.00 0.00 ? 102 ALA A N    5  
ATOM   9693  C  CA   . ALA A 1 102 ? -0.459  9.573   -0.917  1.00 0.00 ? 102 ALA A CA   5  
ATOM   9694  C  C    . ALA A 1 102 ? 0.596   10.641  -1.204  1.00 0.00 ? 102 ALA A C    5  
ATOM   9695  O  O    . ALA A 1 102 ? 1.763   10.334  -1.464  1.00 0.00 ? 102 ALA A O    5  
ATOM   9696  C  CB   . ALA A 1 102 ? -0.493  9.276   0.582   1.00 0.00 ? 102 ALA A CB   5  
ATOM   9697  H  H    . ALA A 1 102 ? 0.204   7.561   -1.179  1.00 0.00 ? 102 ALA A H    5  
ATOM   9698  H  HA   . ALA A 1 102 ? -1.437  9.955   -1.210  1.00 0.00 ? 102 ALA A HA   5  
ATOM   9699  H  HB1  . ALA A 1 102 ? 0.469   8.881   0.912   1.00 0.00 ? 102 ALA A HB1  5  
ATOM   9700  H  HB2  . ALA A 1 102 ? -0.715  10.195  1.122   1.00 0.00 ? 102 ALA A HB2  5  
ATOM   9701  H  HB3  . ALA A 1 102 ? -1.281  8.565   0.811   1.00 0.00 ? 102 ALA A HB3  5  
ATOM   9702  N  N    . ILE A 1 103 ? 0.178   11.897  -1.083  1.00 0.00 ? 103 ILE A N    5  
ATOM   9703  C  CA   . ILE A 1 103 ? 1.012   13.075  -1.284  1.00 0.00 ? 103 ILE A CA   5  
ATOM   9704  C  C    . ILE A 1 103 ? 1.067   13.837  0.043   1.00 0.00 ? 103 ILE A C    5  
ATOM   9705  O  O    . ILE A 1 103 ? 0.030   14.123  0.645   1.00 0.00 ? 103 ILE A O    5  
ATOM   9706  C  CB   . ILE A 1 103 ? 0.439   13.936  -2.439  1.00 0.00 ? 103 ILE A CB   5  
ATOM   9707  C  CG1  . ILE A 1 103 ? 0.448   13.175  -3.788  1.00 0.00 ? 103 ILE A CG1  5  
ATOM   9708  C  CG2  . ILE A 1 103 ? 1.223   15.253  -2.593  1.00 0.00 ? 103 ILE A CG2  5  
ATOM   9709  C  CD1  . ILE A 1 103 ? -0.413  13.848  -4.865  1.00 0.00 ? 103 ILE A CD1  5  
ATOM   9710  H  H    . ILE A 1 103 ? -0.812  12.060  -0.904  1.00 0.00 ? 103 ILE A H    5  
ATOM   9711  H  HA   . ILE A 1 103 ? 2.022   12.768  -1.551  1.00 0.00 ? 103 ILE A HA   5  
ATOM   9712  H  HB   . ILE A 1 103 ? -0.592  14.183  -2.187  1.00 0.00 ? 103 ILE A HB   5  
ATOM   9713  H  HG12 . ILE A 1 103 ? 1.473   13.088  -4.152  1.00 0.00 ? 103 ILE A HG12 5  
ATOM   9714  H  HG13 . ILE A 1 103 ? 0.065   12.166  -3.654  1.00 0.00 ? 103 ILE A HG13 5  
ATOM   9715  H  HG21 . ILE A 1 103 ? 2.260   15.042  -2.853  1.00 0.00 ? 103 ILE A HG21 5  
ATOM   9716  H  HG22 . ILE A 1 103 ? 0.776   15.873  -3.368  1.00 0.00 ? 103 ILE A HG22 5  
ATOM   9717  H  HG23 . ILE A 1 103 ? 1.196   15.827  -1.667  1.00 0.00 ? 103 ILE A HG23 5  
ATOM   9718  H  HD11 . ILE A 1 103 ? -1.434  13.966  -4.503  1.00 0.00 ? 103 ILE A HD11 5  
ATOM   9719  H  HD12 . ILE A 1 103 ? -0.006  14.819  -5.142  1.00 0.00 ? 103 ILE A HD12 5  
ATOM   9720  H  HD13 . ILE A 1 103 ? -0.431  13.222  -5.752  1.00 0.00 ? 103 ILE A HD13 5  
ATOM   9721  N  N    . ASP A 1 104 ? 2.291   14.196  0.453   1.00 0.00 ? 104 ASP A N    5  
ATOM   9722  C  CA   . ASP A 1 104 ? 2.603   15.057  1.601   1.00 0.00 ? 104 ASP A CA   5  
ATOM   9723  C  C    . ASP A 1 104 ? 1.835   14.668  2.876   1.00 0.00 ? 104 ASP A C    5  
ATOM   9724  O  O    . ASP A 1 104 ? 1.327   15.519  3.611   1.00 0.00 ? 104 ASP A O    5  
ATOM   9725  C  CB   . ASP A 1 104 ? 2.441   16.534  1.202   1.00 0.00 ? 104 ASP A CB   5  
ATOM   9726  C  CG   . ASP A 1 104 ? 2.956   17.502  2.284   1.00 0.00 ? 104 ASP A CG   5  
ATOM   9727  O  OD1  . ASP A 1 104 ? 4.068   17.294  2.821   1.00 0.00 ? 104 ASP A OD1  5  
ATOM   9728  O  OD2  . ASP A 1 104 ? 2.281   18.521  2.561   1.00 0.00 ? 104 ASP A OD2  5  
ATOM   9729  H  H    . ASP A 1 104 ? 3.078   13.902  -0.104  1.00 0.00 ? 104 ASP A H    5  
ATOM   9730  H  HA   . ASP A 1 104 ? 3.660   14.904  1.814   1.00 0.00 ? 104 ASP A HA   5  
ATOM   9731  H  HB2  . ASP A 1 104 ? 3.001   16.711  0.281   1.00 0.00 ? 104 ASP A HB2  5  
ATOM   9732  H  HB3  . ASP A 1 104 ? 1.387   16.730  0.994   1.00 0.00 ? 104 ASP A HB3  5  
ATOM   9733  N  N    . VAL A 1 105 ? 1.699   13.360  3.111   1.00 0.00 ? 105 VAL A N    5  
ATOM   9734  C  CA   . VAL A 1 105 ? 0.902   12.815  4.207   1.00 0.00 ? 105 VAL A CA   5  
ATOM   9735  C  C    . VAL A 1 105 ? 1.787   12.533  5.434   1.00 0.00 ? 105 VAL A C    5  
ATOM   9736  O  O    . VAL A 1 105 ? 3.013   12.678  5.373   1.00 0.00 ? 105 VAL A O    5  
ATOM   9737  C  CB   . VAL A 1 105 ? 0.096   11.610  3.672   1.00 0.00 ? 105 VAL A CB   5  
ATOM   9738  C  CG1  . VAL A 1 105 ? 0.894   10.300  3.570   1.00 0.00 ? 105 VAL A CG1  5  
ATOM   9739  C  CG2  . VAL A 1 105 ? -1.208  11.428  4.450   1.00 0.00 ? 105 VAL A CG2  5  
ATOM   9740  H  H    . VAL A 1 105 ? 2.161   12.698  2.496   1.00 0.00 ? 105 VAL A H    5  
ATOM   9741  H  HA   . VAL A 1 105 ? 0.179   13.578  4.500   1.00 0.00 ? 105 VAL A HA   5  
ATOM   9742  H  HB   . VAL A 1 105 ? -0.223  11.849  2.663   1.00 0.00 ? 105 VAL A HB   5  
ATOM   9743  H  HG11 . VAL A 1 105 ? 1.714   10.411  2.859   1.00 0.00 ? 105 VAL A HG11 5  
ATOM   9744  H  HG12 . VAL A 1 105 ? 1.302   10.024  4.536   1.00 0.00 ? 105 VAL A HG12 5  
ATOM   9745  H  HG13 . VAL A 1 105 ? 0.245   9.491   3.239   1.00 0.00 ? 105 VAL A HG13 5  
ATOM   9746  H  HG21 . VAL A 1 105 ? -1.023  11.066  5.456   1.00 0.00 ? 105 VAL A HG21 5  
ATOM   9747  H  HG22 . VAL A 1 105 ? -1.742  12.377  4.507   1.00 0.00 ? 105 VAL A HG22 5  
ATOM   9748  H  HG23 . VAL A 1 105 ? -1.834  10.721  3.909   1.00 0.00 ? 105 VAL A HG23 5  
ATOM   9749  N  N    . ASP A 1 106 ? 1.170   12.156  6.561   1.00 0.00 ? 106 ASP A N    5  
ATOM   9750  C  CA   . ASP A 1 106 ? 1.890   11.793  7.782   1.00 0.00 ? 106 ASP A CA   5  
ATOM   9751  C  C    . ASP A 1 106 ? 2.732   10.538  7.563   1.00 0.00 ? 106 ASP A C    5  
ATOM   9752  O  O    . ASP A 1 106 ? 2.471   9.730   6.671   1.00 0.00 ? 106 ASP A O    5  
ATOM   9753  C  CB   . ASP A 1 106 ? 0.927   11.538  8.947   1.00 0.00 ? 106 ASP A CB   5  
ATOM   9754  C  CG   . ASP A 1 106 ? 1.648   11.478  10.301  1.00 0.00 ? 106 ASP A CG   5  
ATOM   9755  O  OD1  . ASP A 1 106 ? 1.939   12.548  10.881  1.00 0.00 ? 106 ASP A OD1  5  
ATOM   9756  O  OD2  . ASP A 1 106 ? 1.952   10.359  10.769  1.00 0.00 ? 106 ASP A OD2  5  
ATOM   9757  H  H    . ASP A 1 106 ? 0.169   12.037  6.562   1.00 0.00 ? 106 ASP A H    5  
ATOM   9758  H  HA   . ASP A 1 106 ? 2.546   12.625  8.040   1.00 0.00 ? 106 ASP A HA   5  
ATOM   9759  H  HB2  . ASP A 1 106 ? 0.170   12.320  8.975   1.00 0.00 ? 106 ASP A HB2  5  
ATOM   9760  H  HB3  . ASP A 1 106 ? 0.455   10.575  8.776   1.00 0.00 ? 106 ASP A HB3  5  
ATOM   9761  N  N    . ASP A 1 107 ? 3.708   10.348  8.438   1.00 0.00 ? 107 ASP A N    5  
ATOM   9762  C  CA   . ASP A 1 107 ? 4.630   9.220   8.402   1.00 0.00 ? 107 ASP A CA   5  
ATOM   9763  C  C    . ASP A 1 107 ? 3.881   7.902   8.562   1.00 0.00 ? 107 ASP A C    5  
ATOM   9764  O  O    . ASP A 1 107 ? 4.183   6.950   7.848   1.00 0.00 ? 107 ASP A O    5  
ATOM   9765  C  CB   . ASP A 1 107 ? 5.677   9.367   9.510   1.00 0.00 ? 107 ASP A CB   5  
ATOM   9766  C  CG   . ASP A 1 107 ? 6.625   8.157   9.541   1.00 0.00 ? 107 ASP A CG   5  
ATOM   9767  O  OD1  . ASP A 1 107 ? 7.512   8.061   8.663   1.00 0.00 ? 107 ASP A OD1  5  
ATOM   9768  O  OD2  . ASP A 1 107 ? 6.527   7.331   10.476  1.00 0.00 ? 107 ASP A OD2  5  
ATOM   9769  H  H    . ASP A 1 107 ? 3.663   10.904  9.278   1.00 0.00 ? 107 ASP A H    5  
ATOM   9770  H  HA   . ASP A 1 107 ? 5.147   9.201   7.442   1.00 0.00 ? 107 ASP A HA   5  
ATOM   9771  H  HB2  . ASP A 1 107 ? 6.252   10.280  9.339   1.00 0.00 ? 107 ASP A HB2  5  
ATOM   9772  H  HB3  . ASP A 1 107 ? 5.171   9.465   10.473  1.00 0.00 ? 107 ASP A HB3  5  
ATOM   9773  N  N    . ASP A 1 108 ? 2.880   7.842   9.447   1.00 0.00 ? 108 ASP A N    5  
ATOM   9774  C  CA   . ASP A 1 108 ? 2.171   6.593   9.711   1.00 0.00 ? 108 ASP A CA   5  
ATOM   9775  C  C    . ASP A 1 108 ? 1.308   6.223   8.502   1.00 0.00 ? 108 ASP A C    5  
ATOM   9776  O  O    . ASP A 1 108 ? 1.326   5.078   8.051   1.00 0.00 ? 108 ASP A O    5  
ATOM   9777  C  CB   . ASP A 1 108 ? 1.328   6.711   10.995  1.00 0.00 ? 108 ASP A CB   5  
ATOM   9778  C  CG   . ASP A 1 108 ? 1.286   5.423   11.838  1.00 0.00 ? 108 ASP A CG   5  
ATOM   9779  O  OD1  . ASP A 1 108 ? 2.270   4.649   11.851  1.00 0.00 ? 108 ASP A OD1  5  
ATOM   9780  O  OD2  . ASP A 1 108 ? 0.301   5.231   12.586  1.00 0.00 ? 108 ASP A OD2  5  
ATOM   9781  H  H    . ASP A 1 108 ? 2.616   8.673   9.972   1.00 0.00 ? 108 ASP A H    5  
ATOM   9782  H  HA   . ASP A 1 108 ? 2.921   5.815   9.849   1.00 0.00 ? 108 ASP A HA   5  
ATOM   9783  H  HB2  . ASP A 1 108 ? 1.741   7.500   11.626  1.00 0.00 ? 108 ASP A HB2  5  
ATOM   9784  H  HB3  . ASP A 1 108 ? 0.310   6.994   10.725  1.00 0.00 ? 108 ASP A HB3  5  
ATOM   9785  N  N    . THR A 1 109 ? 0.616   7.205   7.914   1.00 0.00 ? 109 THR A N    5  
ATOM   9786  C  CA   . THR A 1 109 ? -0.162  7.021   6.696   1.00 0.00 ? 109 THR A CA   5  
ATOM   9787  C  C    . THR A 1 109 ? 0.749   6.553   5.555   1.00 0.00 ? 109 THR A C    5  
ATOM   9788  O  O    . THR A 1 109 ? 0.409   5.593   4.860   1.00 0.00 ? 109 THR A O    5  
ATOM   9789  C  CB   . THR A 1 109 ? -0.913  8.330   6.378   1.00 0.00 ? 109 THR A CB   5  
ATOM   9790  O  OG1  . THR A 1 109 ? -1.578  8.781   7.549   1.00 0.00 ? 109 THR A OG1  5  
ATOM   9791  C  CG2  . THR A 1 109 ? -1.995  8.160   5.312   1.00 0.00 ? 109 THR A CG2  5  
ATOM   9792  H  H    . THR A 1 109 ? 0.623   8.134   8.312   1.00 0.00 ? 109 THR A H    5  
ATOM   9793  H  HA   . THR A 1 109 ? -0.892  6.236   6.875   1.00 0.00 ? 109 THR A HA   5  
ATOM   9794  H  HB   . THR A 1 109 ? -0.206  9.094   6.042   1.00 0.00 ? 109 THR A HB   5  
ATOM   9795  H  HG1  . THR A 1 109 ? -1.636  9.748   7.526   1.00 0.00 ? 109 THR A HG1  5  
ATOM   9796  H  HG21 . THR A 1 109 ? -2.716  7.417   5.632   1.00 0.00 ? 109 THR A HG21 5  
ATOM   9797  H  HG22 . THR A 1 109 ? -2.536  9.093   5.186   1.00 0.00 ? 109 THR A HG22 5  
ATOM   9798  H  HG23 . THR A 1 109 ? -1.551  7.875   4.355   1.00 0.00 ? 109 THR A HG23 5  
ATOM   9799  N  N    . GLN A 1 110 ? 1.925   7.170   5.388   1.00 0.00 ? 110 GLN A N    5  
ATOM   9800  C  CA   . GLN A 1 110 ? 2.863   6.778   4.347   1.00 0.00 ? 110 GLN A CA   5  
ATOM   9801  C  C    . GLN A 1 110 ? 3.341   5.340   4.592   1.00 0.00 ? 110 GLN A C    5  
ATOM   9802  O  O    . GLN A 1 110 ? 3.354   4.541   3.659   1.00 0.00 ? 110 GLN A O    5  
ATOM   9803  C  CB   . GLN A 1 110 ? 4.029   7.785   4.281   1.00 0.00 ? 110 GLN A CB   5  
ATOM   9804  C  CG   . GLN A 1 110 ? 4.656   7.902   2.882   1.00 0.00 ? 110 GLN A CG   5  
ATOM   9805  C  CD   . GLN A 1 110 ? 5.292   6.603   2.381   1.00 0.00 ? 110 GLN A CD   5  
ATOM   9806  O  OE1  . GLN A 1 110 ? 6.276   6.118   2.933   1.00 0.00 ? 110 GLN A OE1  5  
ATOM   9807  N  NE2  . GLN A 1 110 ? 4.746   6.013   1.328   1.00 0.00 ? 110 GLN A NE2  5  
ATOM   9808  H  H    . GLN A 1 110 ? 2.181   7.943   5.996   1.00 0.00 ? 110 GLN A H    5  
ATOM   9809  H  HA   . GLN A 1 110 ? 2.324   6.805   3.399   1.00 0.00 ? 110 GLN A HA   5  
ATOM   9810  H  HB2  . GLN A 1 110 ? 3.656   8.777   4.535   1.00 0.00 ? 110 GLN A HB2  5  
ATOM   9811  H  HB3  . GLN A 1 110 ? 4.794   7.520   5.011   1.00 0.00 ? 110 GLN A HB3  5  
ATOM   9812  H  HG2  . GLN A 1 110 ? 3.888   8.234   2.182   1.00 0.00 ? 110 GLN A HG2  5  
ATOM   9813  H  HG3  . GLN A 1 110 ? 5.426   8.675   2.910   1.00 0.00 ? 110 GLN A HG3  5  
ATOM   9814  H  HE21 . GLN A 1 110 ? 3.935   6.417   0.881   1.00 0.00 ? 110 GLN A HE21 5  
ATOM   9815  H  HE22 . GLN A 1 110 ? 5.093   5.118   1.021   1.00 0.00 ? 110 GLN A HE22 5  
ATOM   9816  N  N    . GLU A 1 111 ? 3.680   4.978   5.833   1.00 0.00 ? 111 GLU A N    5  
ATOM   9817  C  CA   . GLU A 1 111 ? 4.144   3.637   6.164   1.00 0.00 ? 111 GLU A CA   5  
ATOM   9818  C  C    . GLU A 1 111 ? 3.081   2.589   5.866   1.00 0.00 ? 111 GLU A C    5  
ATOM   9819  O  O    . GLU A 1 111 ? 3.422   1.550   5.310   1.00 0.00 ? 111 GLU A O    5  
ATOM   9820  C  CB   . GLU A 1 111 ? 4.571   3.547   7.637   1.00 0.00 ? 111 GLU A CB   5  
ATOM   9821  C  CG   . GLU A 1 111 ? 5.984   4.096   7.857   1.00 0.00 ? 111 GLU A CG   5  
ATOM   9822  C  CD   . GLU A 1 111 ? 7.081   3.249   7.176   1.00 0.00 ? 111 GLU A CD   5  
ATOM   9823  O  OE1  . GLU A 1 111 ? 7.056   2.000   7.275   1.00 0.00 ? 111 GLU A OE1  5  
ATOM   9824  O  OE2  . GLU A 1 111 ? 7.997   3.832   6.552   1.00 0.00 ? 111 GLU A OE2  5  
ATOM   9825  H  H    . GLU A 1 111 ? 3.658   5.669   6.579   1.00 0.00 ? 111 GLU A H    5  
ATOM   9826  H  HA   . GLU A 1 111 ? 4.996   3.405   5.527   1.00 0.00 ? 111 GLU A HA   5  
ATOM   9827  H  HB2  . GLU A 1 111 ? 3.867   4.102   8.258   1.00 0.00 ? 111 GLU A HB2  5  
ATOM   9828  H  HB3  . GLU A 1 111 ? 4.546   2.507   7.964   1.00 0.00 ? 111 GLU A HB3  5  
ATOM   9829  H  HG2  . GLU A 1 111 ? 6.014   5.120   7.481   1.00 0.00 ? 111 GLU A HG2  5  
ATOM   9830  H  HG3  . GLU A 1 111 ? 6.172   4.124   8.931   1.00 0.00 ? 111 GLU A HG3  5  
ATOM   9831  N  N    . ALA A 1 112 ? 1.809   2.856   6.172   1.00 0.00 ? 112 ALA A N    5  
ATOM   9832  C  CA   . ALA A 1 112 ? 0.720   1.937   5.854   1.00 0.00 ? 112 ALA A CA   5  
ATOM   9833  C  C    . ALA A 1 112 ? 0.677   1.649   4.351   1.00 0.00 ? 112 ALA A C    5  
ATOM   9834  O  O    . ALA A 1 112 ? 0.516   0.502   3.935   1.00 0.00 ? 112 ALA A O    5  
ATOM   9835  C  CB   . ALA A 1 112 ? -0.613  2.544   6.296   1.00 0.00 ? 112 ALA A CB   5  
ATOM   9836  H  H    . ALA A 1 112 ? 1.586   3.740   6.623   1.00 0.00 ? 112 ALA A H    5  
ATOM   9837  H  HA   . ALA A 1 112 ? 0.883   1.002   6.391   1.00 0.00 ? 112 ALA A HA   5  
ATOM   9838  H  HB1  . ALA A 1 112 ? -1.414  1.819   6.145   1.00 0.00 ? 112 ALA A HB1  5  
ATOM   9839  H  HB2  . ALA A 1 112 ? -0.568  2.821   7.343   1.00 0.00 ? 112 ALA A HB2  5  
ATOM   9840  H  HB3  . ALA A 1 112 ? -0.822  3.435   5.709   1.00 0.00 ? 112 ALA A HB3  5  
ATOM   9841  N  N    . ILE A 1 113 ? 0.822   2.697   3.540   1.00 0.00 ? 113 ILE A N    5  
ATOM   9842  C  CA   . ILE A 1 113 ? 0.746   2.605   2.091   1.00 0.00 ? 113 ILE A CA   5  
ATOM   9843  C  C    . ILE A 1 113 ? 1.973   1.862   1.563   1.00 0.00 ? 113 ILE A C    5  
ATOM   9844  O  O    . ILE A 1 113 ? 1.816   0.914   0.801   1.00 0.00 ? 113 ILE A O    5  
ATOM   9845  C  CB   . ILE A 1 113 ? 0.583   4.028   1.522   1.00 0.00 ? 113 ILE A CB   5  
ATOM   9846  C  CG1  . ILE A 1 113 ? -0.822  4.545   1.903   1.00 0.00 ? 113 ILE A CG1  5  
ATOM   9847  C  CG2  . ILE A 1 113 ? 0.793   4.079   0.000   1.00 0.00 ? 113 ILE A CG2  5  
ATOM   9848  C  CD1  . ILE A 1 113 ? -0.927  6.064   1.843   1.00 0.00 ? 113 ILE A CD1  5  
ATOM   9849  H  H    . ILE A 1 113 ? 0.965   3.611   3.951   1.00 0.00 ? 113 ILE A H    5  
ATOM   9850  H  HA   . ILE A 1 113 ? -0.136  2.025   1.822   1.00 0.00 ? 113 ILE A HA   5  
ATOM   9851  H  HB   . ILE A 1 113 ? 1.333   4.669   1.982   1.00 0.00 ? 113 ILE A HB   5  
ATOM   9852  H  HG12 . ILE A 1 113 ? -1.566  4.101   1.243   1.00 0.00 ? 113 ILE A HG12 5  
ATOM   9853  H  HG13 . ILE A 1 113 ? -1.067  4.257   2.923   1.00 0.00 ? 113 ILE A HG13 5  
ATOM   9854  H  HG21 . ILE A 1 113 ? 0.117   3.381   -0.498  1.00 0.00 ? 113 ILE A HG21 5  
ATOM   9855  H  HG22 . ILE A 1 113 ? 0.616   5.084   -0.378  1.00 0.00 ? 113 ILE A HG22 5  
ATOM   9856  H  HG23 . ILE A 1 113 ? 1.824   3.811   -0.234  1.00 0.00 ? 113 ILE A HG23 5  
ATOM   9857  H  HD11 . ILE A 1 113 ? -0.836  6.392   0.811   1.00 0.00 ? 113 ILE A HD11 5  
ATOM   9858  H  HD12 . ILE A 1 113 ? -1.893  6.371   2.243   1.00 0.00 ? 113 ILE A HD12 5  
ATOM   9859  H  HD13 . ILE A 1 113 ? -0.140  6.509   2.453   1.00 0.00 ? 113 ILE A HD13 5  
ATOM   9860  N  N    . ALA A 1 114 ? 3.182   2.247   1.981   1.00 0.00 ? 114 ALA A N    5  
ATOM   9861  C  CA   . ALA A 1 114 ? 4.412   1.585   1.564   1.00 0.00 ? 114 ALA A CA   5  
ATOM   9862  C  C    . ALA A 1 114 ? 4.371   0.099   1.928   1.00 0.00 ? 114 ALA A C    5  
ATOM   9863  O  O    . ALA A 1 114 ? 4.667   -0.754  1.094   1.00 0.00 ? 114 ALA A O    5  
ATOM   9864  C  CB   . ALA A 1 114 ? 5.614   2.271   2.221   1.00 0.00 ? 114 ALA A CB   5  
ATOM   9865  H  H    . ALA A 1 114 ? 3.250   3.006   2.633   1.00 0.00 ? 114 ALA A H    5  
ATOM   9866  H  HA   . ALA A 1 114 ? 4.507   1.676   0.481   1.00 0.00 ? 114 ALA A HA   5  
ATOM   9867  H  HB1  . ALA A 1 114 ? 5.646   3.322   1.940   1.00 0.00 ? 114 ALA A HB1  5  
ATOM   9868  H  HB2  . ALA A 1 114 ? 5.549   2.188   3.306   1.00 0.00 ? 114 ALA A HB2  5  
ATOM   9869  H  HB3  . ALA A 1 114 ? 6.530   1.788   1.882   1.00 0.00 ? 114 ALA A HB3  5  
ATOM   9870  N  N    . ASP A 1 115 ? 3.949   -0.210  3.155   1.00 0.00 ? 115 ASP A N    5  
ATOM   9871  C  CA   . ASP A 1 115 ? 3.852   -1.576  3.658   1.00 0.00 ? 115 ASP A CA   5  
ATOM   9872  C  C    . ASP A 1 115 ? 2.870   -2.402  2.828   1.00 0.00 ? 115 ASP A C    5  
ATOM   9873  O  O    . ASP A 1 115 ? 3.171   -3.538  2.450   1.00 0.00 ? 115 ASP A O    5  
ATOM   9874  C  CB   . ASP A 1 115 ? 3.415   -1.561  5.124   1.00 0.00 ? 115 ASP A CB   5  
ATOM   9875  C  CG   . ASP A 1 115 ? 3.510   -2.959  5.735   1.00 0.00 ? 115 ASP A CG   5  
ATOM   9876  O  OD1  . ASP A 1 115 ? 4.622   -3.311  6.190   1.00 0.00 ? 115 ASP A OD1  5  
ATOM   9877  O  OD2  . ASP A 1 115 ? 2.484   -3.666  5.809   1.00 0.00 ? 115 ASP A OD2  5  
ATOM   9878  H  H    . ASP A 1 115 ? 3.705   0.547   3.791   1.00 0.00 ? 115 ASP A H    5  
ATOM   9879  H  HA   . ASP A 1 115 ? 4.835   -2.039  3.603   1.00 0.00 ? 115 ASP A HA   5  
ATOM   9880  H  HB2  . ASP A 1 115 ? 4.071   -0.895  5.684   1.00 0.00 ? 115 ASP A HB2  5  
ATOM   9881  H  HB3  . ASP A 1 115 ? 2.396   -1.179  5.207   1.00 0.00 ? 115 ASP A HB3  5  
ATOM   9882  N  N    . TRP A 1 116 ? 1.724   -1.806  2.483   1.00 0.00 ? 116 TRP A N    5  
ATOM   9883  C  CA   . TRP A 1 116 ? 0.735   -2.444  1.631   1.00 0.00 ? 116 TRP A CA   5  
ATOM   9884  C  C    . TRP A 1 116 ? 1.298   -2.659  0.227   1.00 0.00 ? 116 TRP A C    5  
ATOM   9885  O  O    . TRP A 1 116 ? 1.073   -3.714  -0.357  1.00 0.00 ? 116 TRP A O    5  
ATOM   9886  C  CB   . TRP A 1 116 ? -0.551  -1.609  1.583   1.00 0.00 ? 116 TRP A CB   5  
ATOM   9887  C  CG   . TRP A 1 116 ? -1.613  -2.204  0.709   1.00 0.00 ? 116 TRP A CG   5  
ATOM   9888  C  CD1  . TRP A 1 116 ? -1.989  -1.740  -0.504  1.00 0.00 ? 116 TRP A CD1  5  
ATOM   9889  C  CD2  . TRP A 1 116 ? -2.369  -3.438  0.913   1.00 0.00 ? 116 TRP A CD2  5  
ATOM   9890  N  NE1  . TRP A 1 116 ? -2.901  -2.606  -1.068  1.00 0.00 ? 116 TRP A NE1  5  
ATOM   9891  C  CE2  . TRP A 1 116 ? -3.142  -3.692  -0.258  1.00 0.00 ? 116 TRP A CE2  5  
ATOM   9892  C  CE3  . TRP A 1 116 ? -2.458  -4.387  1.955   1.00 0.00 ? 116 TRP A CE3  5  
ATOM   9893  C  CZ2  . TRP A 1 116 ? -3.927  -4.845  -0.404  1.00 0.00 ? 116 TRP A CZ2  5  
ATOM   9894  C  CZ3  . TRP A 1 116 ? -3.270  -5.531  1.832   1.00 0.00 ? 116 TRP A CZ3  5  
ATOM   9895  C  CH2  . TRP A 1 116 ? -3.990  -5.772  0.649   1.00 0.00 ? 116 TRP A CH2  5  
ATOM   9896  H  H    . TRP A 1 116 ? 1.556   -0.845  2.761   1.00 0.00 ? 116 TRP A H    5  
ATOM   9897  H  HA   . TRP A 1 116 ? 0.497   -3.420  2.055   1.00 0.00 ? 116 TRP A HA   5  
ATOM   9898  H  HB2  . TRP A 1 116 ? -0.945  -1.520  2.595   1.00 0.00 ? 116 TRP A HB2  5  
ATOM   9899  H  HB3  . TRP A 1 116 ? -0.321  -0.607  1.222   1.00 0.00 ? 116 TRP A HB3  5  
ATOM   9900  H  HD1  . TRP A 1 116 ? -1.596  -0.852  -0.984  1.00 0.00 ? 116 TRP A HD1  5  
ATOM   9901  H  HE1  . TRP A 1 116 ? -3.300  -2.480  -2.000  1.00 0.00 ? 116 TRP A HE1  5  
ATOM   9902  H  HE3  . TRP A 1 116 ? -1.887  -4.234  2.858   1.00 0.00 ? 116 TRP A HE3  5  
ATOM   9903  H  HZ2  . TRP A 1 116 ? -4.492  -5.005  -1.310  1.00 0.00 ? 116 TRP A HZ2  5  
ATOM   9904  H  HZ3  . TRP A 1 116 ? -3.318  -6.243  2.644   1.00 0.00 ? 116 TRP A HZ3  5  
ATOM   9905  H  HH2  . TRP A 1 116 ? -4.601  -6.660  0.553   1.00 0.00 ? 116 TRP A HH2  5  
ATOM   9906  N  N    . LEU A 1 117 ? 2.046   -1.697  -0.320  1.00 0.00 ? 117 LEU A N    5  
ATOM   9907  C  CA   . LEU A 1 117 ? 2.626   -1.808  -1.653  1.00 0.00 ? 117 LEU A CA   5  
ATOM   9908  C  C    . LEU A 1 117 ? 3.682   -2.916  -1.704  1.00 0.00 ? 117 LEU A C    5  
ATOM   9909  O  O    . LEU A 1 117 ? 3.757   -3.607  -2.719  1.00 0.00 ? 117 LEU A O    5  
ATOM   9910  C  CB   . LEU A 1 117 ? 3.206   -0.459  -2.110  1.00 0.00 ? 117 LEU A CB   5  
ATOM   9911  C  CG   . LEU A 1 117 ? 2.128   0.589   -2.463  1.00 0.00 ? 117 LEU A CG   5  
ATOM   9912  C  CD1  . LEU A 1 117 ? 2.773   1.974   -2.577  1.00 0.00 ? 117 LEU A CD1  5  
ATOM   9913  C  CD2  . LEU A 1 117 ? 1.392   0.256   -3.768  1.00 0.00 ? 117 LEU A CD2  5  
ATOM   9914  H  H    . LEU A 1 117 ? 2.212   -0.848  0.205   1.00 0.00 ? 117 LEU A H    5  
ATOM   9915  H  HA   . LEU A 1 117 ? 1.831   -2.093  -2.340  1.00 0.00 ? 117 LEU A HA   5  
ATOM   9916  H  HB2  . LEU A 1 117 ? 3.849   -0.071  -1.321  1.00 0.00 ? 117 LEU A HB2  5  
ATOM   9917  H  HB3  . LEU A 1 117 ? 3.831   -0.624  -2.989  1.00 0.00 ? 117 LEU A HB3  5  
ATOM   9918  H  HG   . LEU A 1 117 ? 1.383   0.632   -1.671  1.00 0.00 ? 117 LEU A HG   5  
ATOM   9919  H  HD11 . LEU A 1 117 ? 3.242   2.233   -1.628  1.00 0.00 ? 117 LEU A HD11 5  
ATOM   9920  H  HD12 . LEU A 1 117 ? 3.527   1.977   -3.365  1.00 0.00 ? 117 LEU A HD12 5  
ATOM   9921  H  HD13 . LEU A 1 117 ? 2.010   2.721   -2.801  1.00 0.00 ? 117 LEU A HD13 5  
ATOM   9922  H  HD21 . LEU A 1 117 ? 0.828   -0.668  -3.656  1.00 0.00 ? 117 LEU A HD21 5  
ATOM   9923  H  HD22 . LEU A 1 117 ? 0.685   1.052   -4.006  1.00 0.00 ? 117 LEU A HD22 5  
ATOM   9924  H  HD23 . LEU A 1 117 ? 2.102   0.151   -4.589  1.00 0.00 ? 117 LEU A HD23 5  
ATOM   9925  N  N    . TYR A 1 118 ? 4.456   -3.140  -0.634  1.00 0.00 ? 118 TYR A N    5  
ATOM   9926  C  CA   . TYR A 1 118 ? 5.374   -4.278  -0.568  1.00 0.00 ? 118 TYR A CA   5  
ATOM   9927  C  C    . TYR A 1 118 ? 4.569   -5.579  -0.656  1.00 0.00 ? 118 TYR A C    5  
ATOM   9928  O  O    . TYR A 1 118 ? 4.823   -6.420  -1.515  1.00 0.00 ? 118 TYR A O    5  
ATOM   9929  C  CB   . TYR A 1 118 ? 6.207   -4.268  0.731   1.00 0.00 ? 118 TYR A CB   5  
ATOM   9930  C  CG   . TYR A 1 118 ? 6.969   -3.001  1.087   1.00 0.00 ? 118 TYR A CG   5  
ATOM   9931  C  CD1  . TYR A 1 118 ? 7.512   -2.158  0.095   1.00 0.00 ? 118 TYR A CD1  5  
ATOM   9932  C  CD2  . TYR A 1 118 ? 7.141   -2.673  2.447   1.00 0.00 ? 118 TYR A CD2  5  
ATOM   9933  C  CE1  . TYR A 1 118 ? 8.197   -0.985  0.461   1.00 0.00 ? 118 TYR A CE1  5  
ATOM   9934  C  CE2  . TYR A 1 118 ? 7.810   -1.495  2.821   1.00 0.00 ? 118 TYR A CE2  5  
ATOM   9935  C  CZ   . TYR A 1 118 ? 8.345   -0.646  1.825   1.00 0.00 ? 118 TYR A CZ   5  
ATOM   9936  O  OH   . TYR A 1 118 ? 9.011   0.495   2.165   1.00 0.00 ? 118 TYR A OH   5  
ATOM   9937  H  H    . TYR A 1 118 ? 4.404   -2.510  0.161   1.00 0.00 ? 118 TYR A H    5  
ATOM   9938  H  HA   . TYR A 1 118 ? 6.050   -4.233  -1.423  1.00 0.00 ? 118 TYR A HA   5  
ATOM   9939  H  HB2  . TYR A 1 118 ? 5.542   -4.497  1.564   1.00 0.00 ? 118 TYR A HB2  5  
ATOM   9940  H  HB3  . TYR A 1 118 ? 6.929   -5.082  0.678   1.00 0.00 ? 118 TYR A HB3  5  
ATOM   9941  H  HD1  . TYR A 1 118 ? 7.399   -2.396  -0.953  1.00 0.00 ? 118 TYR A HD1  5  
ATOM   9942  H  HD2  . TYR A 1 118 ? 6.740   -3.321  3.215   1.00 0.00 ? 118 TYR A HD2  5  
ATOM   9943  H  HE1  . TYR A 1 118 ? 8.601   -0.339  -0.306  1.00 0.00 ? 118 TYR A HE1  5  
ATOM   9944  H  HE2  . TYR A 1 118 ? 7.901   -1.245  3.868   1.00 0.00 ? 118 TYR A HE2  5  
ATOM   9945  H  HH   . TYR A 1 118 ? 9.072   0.636   3.123   1.00 0.00 ? 118 TYR A HH   5  
ATOM   9946  N  N    . TRP A 1 119 ? 3.563   -5.727  0.209   1.00 0.00 ? 119 TRP A N    5  
ATOM   9947  C  CA   . TRP A 1 119 ? 2.705   -6.903  0.268   1.00 0.00 ? 119 TRP A CA   5  
ATOM   9948  C  C    . TRP A 1 119 ? 2.012   -7.153  -1.080  1.00 0.00 ? 119 TRP A C    5  
ATOM   9949  O  O    . TRP A 1 119 ? 1.986   -8.287  -1.564  1.00 0.00 ? 119 TRP A O    5  
ATOM   9950  C  CB   . TRP A 1 119 ? 1.724   -6.682  1.427   1.00 0.00 ? 119 TRP A CB   5  
ATOM   9951  C  CG   . TRP A 1 119 ? 0.534   -7.579  1.506   1.00 0.00 ? 119 TRP A CG   5  
ATOM   9952  C  CD1  . TRP A 1 119 ? -0.668  -7.310  0.954   1.00 0.00 ? 119 TRP A CD1  5  
ATOM   9953  C  CD2  . TRP A 1 119 ? 0.383   -8.867  2.180   1.00 0.00 ? 119 TRP A CD2  5  
ATOM   9954  N  NE1  . TRP A 1 119 ? -1.559  -8.308  1.271   1.00 0.00 ? 119 TRP A NE1  5  
ATOM   9955  C  CE2  . TRP A 1 119 ? -0.974  -9.291  2.041   1.00 0.00 ? 119 TRP A CE2  5  
ATOM   9956  C  CE3  . TRP A 1 119 ? 1.252   -9.723  2.894   1.00 0.00 ? 119 TRP A CE3  5  
ATOM   9957  C  CZ2  . TRP A 1 119 ? -1.445  -10.495 2.591   1.00 0.00 ? 119 TRP A CZ2  5  
ATOM   9958  C  CZ3  . TRP A 1 119 ? 0.788   -10.930 3.454   1.00 0.00 ? 119 TRP A CZ3  5  
ATOM   9959  C  CH2  . TRP A 1 119 ? -0.557  -11.317 3.305   1.00 0.00 ? 119 TRP A CH2  5  
ATOM   9960  H  H    . TRP A 1 119 ? 3.383   -4.981  0.874   1.00 0.00 ? 119 TRP A H    5  
ATOM   9961  H  HA   . TRP A 1 119 ? 3.320   -7.776  0.494   1.00 0.00 ? 119 TRP A HA   5  
ATOM   9962  H  HB2  . TRP A 1 119 ? 2.281   -6.770  2.360   1.00 0.00 ? 119 TRP A HB2  5  
ATOM   9963  H  HB3  . TRP A 1 119 ? 1.348   -5.661  1.377   1.00 0.00 ? 119 TRP A HB3  5  
ATOM   9964  H  HD1  . TRP A 1 119 ? -0.908  -6.431  0.364   1.00 0.00 ? 119 TRP A HD1  5  
ATOM   9965  H  HE1  . TRP A 1 119 ? -2.493  -8.331  0.880   1.00 0.00 ? 119 TRP A HE1  5  
ATOM   9966  H  HE3  . TRP A 1 119 ? 2.286   -9.436  3.023   1.00 0.00 ? 119 TRP A HE3  5  
ATOM   9967  H  HZ2  . TRP A 1 119 ? -2.475  -10.787 2.456   1.00 0.00 ? 119 TRP A HZ2  5  
ATOM   9968  H  HZ3  . TRP A 1 119 ? 1.469   -11.564 4.006   1.00 0.00 ? 119 TRP A HZ3  5  
ATOM   9969  H  HH2  . TRP A 1 119 ? -0.903  -12.249 3.733   1.00 0.00 ? 119 TRP A HH2  5  
ATOM   9970  N  N    . LEU A 1 120 ? 1.517   -6.095  -1.727  1.00 0.00 ? 120 LEU A N    5  
ATOM   9971  C  CA   . LEU A 1 120 ? 0.894   -6.134  -3.041  1.00 0.00 ? 120 LEU A CA   5  
ATOM   9972  C  C    . LEU A 1 120 ? 1.871   -6.670  -4.083  1.00 0.00 ? 120 LEU A C    5  
ATOM   9973  O  O    . LEU A 1 120 ? 1.552   -7.628  -4.787  1.00 0.00 ? 120 LEU A O    5  
ATOM   9974  C  CB   . LEU A 1 120 ? 0.430   -4.714  -3.401  1.00 0.00 ? 120 LEU A CB   5  
ATOM   9975  C  CG   . LEU A 1 120 ? -0.257  -4.600  -4.772  1.00 0.00 ? 120 LEU A CG   5  
ATOM   9976  C  CD1  . LEU A 1 120 ? -1.605  -5.327  -4.776  1.00 0.00 ? 120 LEU A CD1  5  
ATOM   9977  C  CD2  . LEU A 1 120 ? -0.445  -3.115  -5.091  1.00 0.00 ? 120 LEU A CD2  5  
ATOM   9978  H  H    . LEU A 1 120 ? 1.557   -5.176  -1.283  1.00 0.00 ? 120 LEU A H    5  
ATOM   9979  H  HA   . LEU A 1 120 ? 0.025   -6.785  -2.999  1.00 0.00 ? 120 LEU A HA   5  
ATOM   9980  H  HB2  . LEU A 1 120 ? -0.257  -4.358  -2.631  1.00 0.00 ? 120 LEU A HB2  5  
ATOM   9981  H  HB3  . LEU A 1 120 ? 1.299   -4.059  -3.401  1.00 0.00 ? 120 LEU A HB3  5  
ATOM   9982  H  HG   . LEU A 1 120 ? 0.378   -5.028  -5.548  1.00 0.00 ? 120 LEU A HG   5  
ATOM   9983  H  HD11 . LEU A 1 120 ? -2.132  -5.134  -5.710  1.00 0.00 ? 120 LEU A HD11 5  
ATOM   9984  H  HD12 . LEU A 1 120 ? -1.444  -6.402  -4.695  1.00 0.00 ? 120 LEU A HD12 5  
ATOM   9985  H  HD13 . LEU A 1 120 ? -2.220  -4.989  -3.938  1.00 0.00 ? 120 LEU A HD13 5  
ATOM   9986  H  HD21 . LEU A 1 120 ? -0.957  -3.001  -6.045  1.00 0.00 ? 120 LEU A HD21 5  
ATOM   9987  H  HD22 . LEU A 1 120 ? -1.022  -2.636  -4.300  1.00 0.00 ? 120 LEU A HD22 5  
ATOM   9988  H  HD23 . LEU A 1 120 ? 0.528   -2.630  -5.165  1.00 0.00 ? 120 LEU A HD23 5  
ATOM   9989  N  N    . ALA A 1 121 ? 3.068   -6.081  -4.160  1.00 0.00 ? 121 ALA A N    5  
ATOM   9990  C  CA   . ALA A 1 121 ? 4.091   -6.474  -5.121  1.00 0.00 ? 121 ALA A CA   5  
ATOM   9991  C  C    . ALA A 1 121 ? 4.559   -7.920  -4.906  1.00 0.00 ? 121 ALA A C    5  
ATOM   9992  O  O    . ALA A 1 121 ? 5.061   -8.543  -5.843  1.00 0.00 ? 121 ALA A O    5  
ATOM   9993  C  CB   . ALA A 1 121 ? 5.271   -5.499  -5.036  1.00 0.00 ? 121 ALA A CB   5  
ATOM   9994  H  H    . ALA A 1 121 ? 3.284   -5.308  -3.535  1.00 0.00 ? 121 ALA A H    5  
ATOM   9995  H  HA   . ALA A 1 121 ? 3.660   -6.404  -6.121  1.00 0.00 ? 121 ALA A HA   5  
ATOM   9996  H  HB1  . ALA A 1 121 ? 5.695   -5.511  -4.032  1.00 0.00 ? 121 ALA A HB1  5  
ATOM   9997  H  HB2  . ALA A 1 121 ? 6.040   -5.791  -5.753  1.00 0.00 ? 121 ALA A HB2  5  
ATOM   9998  H  HB3  . ALA A 1 121 ? 4.934   -4.489  -5.270  1.00 0.00 ? 121 ALA A HB3  5  
ATOM   9999  N  N    . ARG A 1 122 ? 4.386   -8.473  -3.699  1.00 0.00 ? 122 ARG A N    5  
ATOM   10000 C  CA   . ARG A 1 122 ? 4.757   -9.852  -3.388  1.00 0.00 ? 122 ARG A CA   5  
ATOM   10001 C  C    . ARG A 1 122 ? 3.711   -10.866 -3.874  1.00 0.00 ? 122 ARG A C    5  
ATOM   10002 O  O    . ARG A 1 122 ? 3.952   -12.068 -3.763  1.00 0.00 ? 122 ARG A O    5  
ATOM   10003 C  CB   . ARG A 1 122 ? 5.072   -9.966  -1.887  1.00 0.00 ? 122 ARG A CB   5  
ATOM   10004 C  CG   . ARG A 1 122 ? 6.099   -11.078 -1.604  1.00 0.00 ? 122 ARG A CG   5  
ATOM   10005 C  CD   . ARG A 1 122 ? 6.667   -10.965 -0.189  1.00 0.00 ? 122 ARG A CD   5  
ATOM   10006 N  NE   . ARG A 1 122 ? 5.639   -11.237 0.824   1.00 0.00 ? 122 ARG A NE   5  
ATOM   10007 C  CZ   . ARG A 1 122 ? 5.781   -11.005 2.135   1.00 0.00 ? 122 ARG A CZ   5  
ATOM   10008 N  NH1  . ARG A 1 122 ? 6.864   -10.401 2.603   1.00 0.00 ? 122 ARG A NH1  5  
ATOM   10009 N  NH2  . ARG A 1 122 ? 4.839   -11.386 2.989   1.00 0.00 ? 122 ARG A NH2  5  
ATOM   10010 H  H    . ARG A 1 122 ? 3.974   -7.910  -2.959  1.00 0.00 ? 122 ARG A H    5  
ATOM   10011 H  HA   . ARG A 1 122 ? 5.674   -10.067 -3.933  1.00 0.00 ? 122 ARG A HA   5  
ATOM   10012 H  HB2  . ARG A 1 122 ? 5.504   -9.024  -1.546  1.00 0.00 ? 122 ARG A HB2  5  
ATOM   10013 H  HB3  . ARG A 1 122 ? 4.153   -10.142 -1.326  1.00 0.00 ? 122 ARG A HB3  5  
ATOM   10014 H  HG2  . ARG A 1 122 ? 5.642   -12.060 -1.737  1.00 0.00 ? 122 ARG A HG2  5  
ATOM   10015 H  HG3  . ARG A 1 122 ? 6.931   -10.989 -2.300  1.00 0.00 ? 122 ARG A HG3  5  
ATOM   10016 H  HD2  . ARG A 1 122 ? 7.476   -11.688 -0.071  1.00 0.00 ? 122 ARG A HD2  5  
ATOM   10017 H  HD3  . ARG A 1 122 ? 7.074   -9.962  -0.047  1.00 0.00 ? 122 ARG A HD3  5  
ATOM   10018 H  HE   . ARG A 1 122 ? 4.792   -11.671 0.479   1.00 0.00 ? 122 ARG A HE   5  
ATOM   10019 H  HH11 . ARG A 1 122 ? 7.650   -10.140 1.998   1.00 0.00 ? 122 ARG A HH11 5  
ATOM   10020 H  HH12 . ARG A 1 122 ? 6.925   -10.149 3.595   1.00 0.00 ? 122 ARG A HH12 5  
ATOM   10021 H  HH21 . ARG A 1 122 ? 4.001   -11.857 2.680   1.00 0.00 ? 122 ARG A HH21 5  
ATOM   10022 H  HH22 . ARG A 1 122 ? 5.027   -11.366 4.000   1.00 0.00 ? 122 ARG A HH22 5  
ATOM   10023 N  N    . GLY A 1 123 ? 2.583   -10.422 -4.442  1.00 0.00 ? 123 GLY A N    5  
ATOM   10024 C  CA   . GLY A 1 123 ? 1.595   -11.314 -5.041  1.00 0.00 ? 123 GLY A CA   5  
ATOM   10025 C  C    . GLY A 1 123 ? 0.869   -12.130 -3.974  1.00 0.00 ? 123 GLY A C    5  
ATOM   10026 O  O    . GLY A 1 123 ? 0.787   -13.358 -4.084  1.00 0.00 ? 123 GLY A O    5  
ATOM   10027 H  H    . GLY A 1 123 ? 2.408   -9.425  -4.495  1.00 0.00 ? 123 GLY A H    5  
ATOM   10028 H  HA2  . GLY A 1 123 ? 0.864   -10.714 -5.584  1.00 0.00 ? 123 GLY A HA2  5  
ATOM   10029 H  HA3  . GLY A 1 123 ? 2.088   -11.987 -5.743  1.00 0.00 ? 123 GLY A HA3  5  
ATOM   10030 N  N    . TYR A 1 124 ? 0.408   -11.451 -2.918  1.00 0.00 ? 124 TYR A N    5  
ATOM   10031 C  CA   . TYR A 1 124 ? -0.290  -12.052 -1.785  1.00 0.00 ? 124 TYR A CA   5  
ATOM   10032 C  C    . TYR A 1 124 ? -1.526  -12.859 -2.202  1.00 0.00 ? 124 TYR A C    5  
ATOM   10033 O  O    . TYR A 1 124 ? -2.072  -12.680 -3.296  1.00 0.00 ? 124 TYR A O    5  
ATOM   10034 C  CB   . TYR A 1 124 ? -0.690  -10.969 -0.778  1.00 0.00 ? 124 TYR A CB   5  
ATOM   10035 C  CG   . TYR A 1 124 ? -1.843  -10.076 -1.216  1.00 0.00 ? 124 TYR A CG   5  
ATOM   10036 C  CD1  . TYR A 1 124 ? -3.175  -10.414 -0.903  1.00 0.00 ? 124 TYR A CD1  5  
ATOM   10037 C  CD2  . TYR A 1 124 ? -1.577  -8.875  -1.897  1.00 0.00 ? 124 TYR A CD2  5  
ATOM   10038 C  CE1  . TYR A 1 124 ? -4.231  -9.576  -1.297  1.00 0.00 ? 124 TYR A CE1  5  
ATOM   10039 C  CE2  . TYR A 1 124 ? -2.627  -8.014  -2.265  1.00 0.00 ? 124 TYR A CE2  5  
ATOM   10040 C  CZ   . TYR A 1 124 ? -3.967  -8.370  -1.982  1.00 0.00 ? 124 TYR A CZ   5  
ATOM   10041 O  OH   . TYR A 1 124 ? -5.009  -7.573  -2.351  1.00 0.00 ? 124 TYR A OH   5  
ATOM   10042 H  H    . TYR A 1 124 ? 0.536   -10.450 -2.899  1.00 0.00 ? 124 TYR A H    5  
ATOM   10043 H  HA   . TYR A 1 124 ? 0.414   -12.727 -1.293  1.00 0.00 ? 124 TYR A HA   5  
ATOM   10044 H  HB2  . TYR A 1 124 ? -0.976  -11.471 0.145   1.00 0.00 ? 124 TYR A HB2  5  
ATOM   10045 H  HB3  . TYR A 1 124 ? 0.181   -10.354 -0.548  1.00 0.00 ? 124 TYR A HB3  5  
ATOM   10046 H  HD1  . TYR A 1 124 ? -3.401  -11.318 -0.361  1.00 0.00 ? 124 TYR A HD1  5  
ATOM   10047 H  HD2  . TYR A 1 124 ? -0.556  -8.603  -2.106  1.00 0.00 ? 124 TYR A HD2  5  
ATOM   10048 H  HE1  . TYR A 1 124 ? -5.249  -9.855  -1.070  1.00 0.00 ? 124 TYR A HE1  5  
ATOM   10049 H  HE2  . TYR A 1 124 ? -2.401  -7.081  -2.754  1.00 0.00 ? 124 TYR A HE2  5  
ATOM   10050 H  HH   . TYR A 1 124 ? -4.745  -6.766  -2.817  1.00 0.00 ? 124 TYR A HH   5  
ATOM   10051 N  N    . LYS A 1 125 ? -1.988  -13.731 -1.294  1.00 0.00 ? 125 LYS A N    5  
ATOM   10052 C  CA   . LYS A 1 125 ? -3.020  -14.735 -1.582  1.00 0.00 ? 125 LYS A CA   5  
ATOM   10053 C  C    . LYS A 1 125 ? -4.035  -14.877 -0.436  1.00 0.00 ? 125 LYS A C    5  
ATOM   10054 O  O    . LYS A 1 125 ? -4.860  -15.789 -0.491  1.00 0.00 ? 125 LYS A O    5  
ATOM   10055 C  CB   . LYS A 1 125 ? -2.351  -16.090 -1.918  1.00 0.00 ? 125 LYS A CB   5  
ATOM   10056 C  CG   . LYS A 1 125 ? -1.170  -15.954 -2.896  1.00 0.00 ? 125 LYS A CG   5  
ATOM   10057 C  CD   . LYS A 1 125 ? -0.653  -17.291 -3.440  1.00 0.00 ? 125 LYS A CD   5  
ATOM   10058 C  CE   . LYS A 1 125 ? 0.723   -17.139 -4.116  1.00 0.00 ? 125 LYS A CE   5  
ATOM   10059 N  NZ   . LYS A 1 125 ? 0.768   -16.073 -5.152  1.00 0.00 ? 125 LYS A NZ   5  
ATOM   10060 H  H    . LYS A 1 125 ? -1.508  -13.811 -0.406  1.00 0.00 ? 125 LYS A H    5  
ATOM   10061 H  HA   . LYS A 1 125 ? -3.580  -14.410 -2.461  1.00 0.00 ? 125 LYS A HA   5  
ATOM   10062 H  HB2  . LYS A 1 125 ? -1.988  -16.552 -0.997  1.00 0.00 ? 125 LYS A HB2  5  
ATOM   10063 H  HB3  . LYS A 1 125 ? -3.101  -16.749 -2.358  1.00 0.00 ? 125 LYS A HB3  5  
ATOM   10064 H  HG2  . LYS A 1 125 ? -1.485  -15.339 -3.740  1.00 0.00 ? 125 LYS A HG2  5  
ATOM   10065 H  HG3  . LYS A 1 125 ? -0.346  -15.459 -2.380  1.00 0.00 ? 125 LYS A HG3  5  
ATOM   10066 H  HD2  . LYS A 1 125 ? -0.551  -18.000 -2.617  1.00 0.00 ? 125 LYS A HD2  5  
ATOM   10067 H  HD3  . LYS A 1 125 ? -1.374  -17.695 -4.153  1.00 0.00 ? 125 LYS A HD3  5  
ATOM   10068 H  HE2  . LYS A 1 125 ? 1.466   -16.918 -3.346  1.00 0.00 ? 125 LYS A HE2  5  
ATOM   10069 H  HE3  . LYS A 1 125 ? 0.991   -18.097 -4.568  1.00 0.00 ? 125 LYS A HE3  5  
ATOM   10070 H  HZ1  . LYS A 1 125 ? 1.661   -16.080 -5.623  1.00 0.00 ? 125 LYS A HZ1  5  
ATOM   10071 H  HZ2  . LYS A 1 125 ? 0.054   -16.211 -5.852  1.00 0.00 ? 125 LYS A HZ2  5  
ATOM   10072 H  HZ3  . LYS A 1 125 ? 0.655   -15.150 -4.739  1.00 0.00 ? 125 LYS A HZ3  5  
ATOM   10073 N  N    . PHE A 1 126 ? -3.992  -13.976 0.561   1.00 0.00 ? 126 PHE A N    5  
ATOM   10074 C  CA   . PHE A 1 126 ? -4.720  -14.058 1.828   1.00 0.00 ? 126 PHE A CA   5  
ATOM   10075 C  C    . PHE A 1 126 ? -4.643  -15.488 2.377   1.00 0.00 ? 126 PHE A C    5  
ATOM   10076 O  O    . PHE A 1 126 ? -5.659  -16.211 2.431   1.00 0.00 ? 126 PHE A O    5  
ATOM   10077 C  CB   . PHE A 1 126 ? -6.152  -13.494 1.704   1.00 0.00 ? 126 PHE A CB   5  
ATOM   10078 C  CG   . PHE A 1 126 ? -6.300  -11.991 1.499   1.00 0.00 ? 126 PHE A CG   5  
ATOM   10079 C  CD1  . PHE A 1 126 ? -5.508  -11.071 2.219   1.00 0.00 ? 126 PHE A CD1  5  
ATOM   10080 C  CD2  . PHE A 1 126 ? -7.304  -11.503 0.639   1.00 0.00 ? 126 PHE A CD2  5  
ATOM   10081 C  CE1  . PHE A 1 126 ? -5.712  -9.687  2.073   1.00 0.00 ? 126 PHE A CE1  5  
ATOM   10082 C  CE2  . PHE A 1 126 ? -7.511  -10.119 0.496   1.00 0.00 ? 126 PHE A CE2  5  
ATOM   10083 C  CZ   . PHE A 1 126 ? -6.715  -9.209  1.212   1.00 0.00 ? 126 PHE A CZ   5  
ATOM   10084 O  OXT  . PHE A 1 126 ? -3.526  -15.860 2.794   1.00 0.00 ? 126 PHE A OXT  5  
ATOM   10085 H  H    . PHE A 1 126 ? -3.293  -13.255 0.508   1.00 0.00 ? 126 PHE A H    5  
ATOM   10086 H  HA   . PHE A 1 126 ? -4.185  -13.441 2.546   1.00 0.00 ? 126 PHE A HA   5  
ATOM   10087 H  HB2  . PHE A 1 126 ? -6.661  -14.019 0.895   1.00 0.00 ? 126 PHE A HB2  5  
ATOM   10088 H  HB3  . PHE A 1 126 ? -6.688  -13.736 2.619   1.00 0.00 ? 126 PHE A HB3  5  
ATOM   10089 H  HD1  . PHE A 1 126 ? -4.744  -11.418 2.897   1.00 0.00 ? 126 PHE A HD1  5  
ATOM   10090 H  HD2  . PHE A 1 126 ? -7.934  -12.194 0.095   1.00 0.00 ? 126 PHE A HD2  5  
ATOM   10091 H  HE1  . PHE A 1 126 ? -5.102  -8.989  2.631   1.00 0.00 ? 126 PHE A HE1  5  
ATOM   10092 H  HE2  . PHE A 1 126 ? -8.290  -9.756  -0.161  1.00 0.00 ? 126 PHE A HE2  5  
ATOM   10093 H  HZ   . PHE A 1 126 ? -6.875  -8.145  1.101   1.00 0.00 ? 126 PHE A HZ   5  
HETATM 10094 CA CA   . CA  B 2 .   ? -7.165  5.616   11.962  1.00 0.00 ? 127 CA  A CA   5  
HETATM 10095 CA CA   . CA  C 2 .   ? -9.460  -18.436 11.729  1.00 0.00 ? 128 CA  A CA   5  
ATOM   10096 N  N    . MET A 1 1   ? 13.720  -13.850 -4.994  1.00 0.00 ? 1   MET A N    6  
ATOM   10097 C  CA   . MET A 1 1   ? 12.842  -13.739 -3.804  1.00 0.00 ? 1   MET A CA   6  
ATOM   10098 C  C    . MET A 1 1   ? 12.439  -12.275 -3.590  1.00 0.00 ? 1   MET A C    6  
ATOM   10099 O  O    . MET A 1 1   ? 13.268  -11.370 -3.716  1.00 0.00 ? 1   MET A O    6  
ATOM   10100 C  CB   . MET A 1 1   ? 13.516  -14.339 -2.550  1.00 0.00 ? 1   MET A CB   6  
ATOM   10101 C  CG   . MET A 1 1   ? 12.610  -14.313 -1.308  1.00 0.00 ? 1   MET A CG   6  
ATOM   10102 S  SD   . MET A 1 1   ? 13.319  -15.116 0.157   1.00 0.00 ? 1   MET A SD   6  
ATOM   10103 C  CE   . MET A 1 1   ? 12.064  -14.647 1.380   1.00 0.00 ? 1   MET A CE   6  
ATOM   10104 H  H1   . MET A 1 1   ? 13.979  -14.810 -5.157  1.00 0.00 ? 1   MET A H1   6  
ATOM   10105 H  H2   . MET A 1 1   ? 13.242  -13.499 -5.808  1.00 0.00 ? 1   MET A H2   6  
ATOM   10106 H  H3   . MET A 1 1   ? 14.553  -13.300 -4.855  1.00 0.00 ? 1   MET A H3   6  
ATOM   10107 H  HA   . MET A 1 1   ? 11.937  -14.317 -4.005  1.00 0.00 ? 1   MET A HA   6  
ATOM   10108 H  HB2  . MET A 1 1   ? 13.779  -15.379 -2.753  1.00 0.00 ? 1   MET A HB2  6  
ATOM   10109 H  HB3  . MET A 1 1   ? 14.435  -13.794 -2.327  1.00 0.00 ? 1   MET A HB3  6  
ATOM   10110 H  HG2  . MET A 1 1   ? 12.395  -13.276 -1.048  1.00 0.00 ? 1   MET A HG2  6  
ATOM   10111 H  HG3  . MET A 1 1   ? 11.668  -14.809 -1.545  1.00 0.00 ? 1   MET A HG3  6  
ATOM   10112 H  HE1  . MET A 1 1   ? 11.092  -15.041 1.080   1.00 0.00 ? 1   MET A HE1  6  
ATOM   10113 H  HE2  . MET A 1 1   ? 12.333  -15.056 2.354   1.00 0.00 ? 1   MET A HE2  6  
ATOM   10114 H  HE3  . MET A 1 1   ? 12.009  -13.561 1.449   1.00 0.00 ? 1   MET A HE3  6  
ATOM   10115 N  N    . ALA A 1 2   ? 11.164  -12.030 -3.259  1.00 0.00 ? 2   ALA A N    6  
ATOM   10116 C  CA   . ALA A 1 2   ? 10.620  -10.709 -2.944  1.00 0.00 ? 2   ALA A CA   6  
ATOM   10117 C  C    . ALA A 1 2   ? 11.032  -10.271 -1.528  1.00 0.00 ? 2   ALA A C    6  
ATOM   10118 O  O    . ALA A 1 2   ? 10.186  -10.021 -0.671  1.00 0.00 ? 2   ALA A O    6  
ATOM   10119 C  CB   . ALA A 1 2   ? 9.096   -10.729 -3.133  1.00 0.00 ? 2   ALA A CB   6  
ATOM   10120 H  H    . ALA A 1 2   ? 10.527  -12.810 -3.165  1.00 0.00 ? 2   ALA A H    6  
ATOM   10121 H  HA   . ALA A 1 2   ? 11.034  -9.986  -3.650  1.00 0.00 ? 2   ALA A HA   6  
ATOM   10122 H  HB1  . ALA A 1 2   ? 8.851   -10.991 -4.163  1.00 0.00 ? 2   ALA A HB1  6  
ATOM   10123 H  HB2  . ALA A 1 2   ? 8.645   -11.458 -2.458  1.00 0.00 ? 2   ALA A HB2  6  
ATOM   10124 H  HB3  . ALA A 1 2   ? 8.687   -9.740  -2.918  1.00 0.00 ? 2   ALA A HB3  6  
ATOM   10125 N  N    . SER A 1 3   ? 12.332  -10.186 -1.259  1.00 0.00 ? 3   SER A N    6  
ATOM   10126 C  CA   . SER A 1 3   ? 12.943  -9.847  0.028   1.00 0.00 ? 3   SER A CA   6  
ATOM   10127 C  C    . SER A 1 3   ? 12.827  -8.343  0.349   1.00 0.00 ? 3   SER A C    6  
ATOM   10128 O  O    . SER A 1 3   ? 13.724  -7.760  0.961   1.00 0.00 ? 3   SER A O    6  
ATOM   10129 C  CB   . SER A 1 3   ? 14.411  -10.303 -0.002  1.00 0.00 ? 3   SER A CB   6  
ATOM   10130 O  OG   . SER A 1 3   ? 14.530  -11.627 -0.500  1.00 0.00 ? 3   SER A OG   6  
ATOM   10131 H  H    . SER A 1 3   ? 12.977  -10.381 -2.009  1.00 0.00 ? 3   SER A H    6  
ATOM   10132 H  HA   . SER A 1 3   ? 12.423  -10.402 0.809   1.00 0.00 ? 3   SER A HA   6  
ATOM   10133 H  HB2  . SER A 1 3   ? 14.982  -9.633  -0.647  1.00 0.00 ? 3   SER A HB2  6  
ATOM   10134 H  HB3  . SER A 1 3   ? 14.823  -10.255 1.007   1.00 0.00 ? 3   SER A HB3  6  
ATOM   10135 H  HG   . SER A 1 3   ? 15.468  -11.875 -0.463  1.00 0.00 ? 3   SER A HG   6  
ATOM   10136 N  N    . VAL A 1 4   ? 11.767  -7.701  -0.148  1.00 0.00 ? 4   VAL A N    6  
ATOM   10137 C  CA   . VAL A 1 4   ? 11.520  -6.265  -0.095  1.00 0.00 ? 4   VAL A CA   6  
ATOM   10138 C  C    . VAL A 1 4   ? 11.735  -5.710  1.327   1.00 0.00 ? 4   VAL A C    6  
ATOM   10139 O  O    . VAL A 1 4   ? 11.119  -6.163  2.297   1.00 0.00 ? 4   VAL A O    6  
ATOM   10140 C  CB   . VAL A 1 4   ? 10.156  -5.940  -0.757  1.00 0.00 ? 4   VAL A CB   6  
ATOM   10141 C  CG1  . VAL A 1 4   ? 8.952   -6.718  -0.206  1.00 0.00 ? 4   VAL A CG1  6  
ATOM   10142 C  CG2  . VAL A 1 4   ? 9.856   -4.436  -0.734  1.00 0.00 ? 4   VAL A CG2  6  
ATOM   10143 H  H    . VAL A 1 4   ? 11.091  -8.273  -0.636  1.00 0.00 ? 4   VAL A H    6  
ATOM   10144 H  HA   . VAL A 1 4   ? 12.279  -5.812  -0.736  1.00 0.00 ? 4   VAL A HA   6  
ATOM   10145 H  HB   . VAL A 1 4   ? 10.235  -6.231  -1.806  1.00 0.00 ? 4   VAL A HB   6  
ATOM   10146 H  HG11 . VAL A 1 4   ? 8.830   -6.530  0.859   1.00 0.00 ? 4   VAL A HG11 6  
ATOM   10147 H  HG12 . VAL A 1 4   ? 8.046   -6.425  -0.743  1.00 0.00 ? 4   VAL A HG12 6  
ATOM   10148 H  HG13 . VAL A 1 4   ? 9.087   -7.784  -0.371  1.00 0.00 ? 4   VAL A HG13 6  
ATOM   10149 H  HG21 . VAL A 1 4   ? 9.699   -4.095  0.289   1.00 0.00 ? 4   VAL A HG21 6  
ATOM   10150 H  HG22 . VAL A 1 4   ? 10.689  -3.885  -1.172  1.00 0.00 ? 4   VAL A HG22 6  
ATOM   10151 H  HG23 . VAL A 1 4   ? 8.960   -4.230  -1.321  1.00 0.00 ? 4   VAL A HG23 6  
ATOM   10152 N  N    . GLU A 1 5   ? 12.636  -4.723  1.406   1.00 0.00 ? 5   GLU A N    6  
ATOM   10153 C  CA   . GLU A 1 5   ? 13.135  -4.014  2.584   1.00 0.00 ? 5   GLU A CA   6  
ATOM   10154 C  C    . GLU A 1 5   ? 13.127  -4.857  3.871   1.00 0.00 ? 5   GLU A C    6  
ATOM   10155 O  O    . GLU A 1 5   ? 14.017  -5.692  4.047   1.00 0.00 ? 5   GLU A O    6  
ATOM   10156 C  CB   . GLU A 1 5   ? 12.460  -2.632  2.710   1.00 0.00 ? 5   GLU A CB   6  
ATOM   10157 C  CG   . GLU A 1 5   ? 12.880  -1.713  1.548   1.00 0.00 ? 5   GLU A CG   6  
ATOM   10158 C  CD   . GLU A 1 5   ? 12.391  -0.257  1.684   1.00 0.00 ? 5   GLU A CD   6  
ATOM   10159 O  OE1  . GLU A 1 5   ? 12.438  0.323   2.793   1.00 0.00 ? 5   GLU A OE1  6  
ATOM   10160 O  OE2  . GLU A 1 5   ? 12.028  0.350   0.650   1.00 0.00 ? 5   GLU A OE2  6  
ATOM   10161 H  H    . GLU A 1 5   ? 13.086  -4.458  0.542   1.00 0.00 ? 5   GLU A H    6  
ATOM   10162 H  HA   . GLU A 1 5   ? 14.191  -3.814  2.394   1.00 0.00 ? 5   GLU A HA   6  
ATOM   10163 H  HB2  . GLU A 1 5   ? 11.375  -2.743  2.720   1.00 0.00 ? 5   GLU A HB2  6  
ATOM   10164 H  HB3  . GLU A 1 5   ? 12.781  -2.179  3.648   1.00 0.00 ? 5   GLU A HB3  6  
ATOM   10165 H  HG2  . GLU A 1 5   ? 13.971  -1.701  1.487   1.00 0.00 ? 5   GLU A HG2  6  
ATOM   10166 H  HG3  . GLU A 1 5   ? 12.502  -2.133  0.613   1.00 0.00 ? 5   GLU A HG3  6  
ATOM   10167 N  N    . ARG A 1 6   ? 12.174  -4.631  4.788   1.00 0.00 ? 6   ARG A N    6  
ATOM   10168 C  CA   . ARG A 1 6   ? 12.188  -5.211  6.130   1.00 0.00 ? 6   ARG A CA   6  
ATOM   10169 C  C    . ARG A 1 6   ? 12.041  -6.736  6.168   1.00 0.00 ? 6   ARG A C    6  
ATOM   10170 O  O    . ARG A 1 6   ? 12.325  -7.312  7.219   1.00 0.00 ? 6   ARG A O    6  
ATOM   10171 C  CB   . ARG A 1 6   ? 11.101  -4.519  6.966   1.00 0.00 ? 6   ARG A CB   6  
ATOM   10172 C  CG   . ARG A 1 6   ? 11.372  -3.015  7.126   1.00 0.00 ? 6   ARG A CG   6  
ATOM   10173 C  CD   . ARG A 1 6   ? 10.291  -2.335  7.966   1.00 0.00 ? 6   ARG A CD   6  
ATOM   10174 N  NE   . ARG A 1 6   ? 9.030   -2.092  7.227   1.00 0.00 ? 6   ARG A NE   6  
ATOM   10175 C  CZ   . ARG A 1 6   ? 8.472   -0.895  6.988   1.00 0.00 ? 6   ARG A CZ   6  
ATOM   10176 N  NH1  . ARG A 1 6   ? 9.093   0.238   7.302   1.00 0.00 ? 6   ARG A NH1  6  
ATOM   10177 N  NH2  . ARG A 1 6   ? 7.273   -0.823  6.430   1.00 0.00 ? 6   ARG A NH2  6  
ATOM   10178 H  H    . ARG A 1 6   ? 11.479  -3.914  4.621   1.00 0.00 ? 6   ARG A H    6  
ATOM   10179 H  HA   . ARG A 1 6   ? 13.159  -4.987  6.579   1.00 0.00 ? 6   ARG A HA   6  
ATOM   10180 H  HB2  . ARG A 1 6   ? 10.138  -4.654  6.483   1.00 0.00 ? 6   ARG A HB2  6  
ATOM   10181 H  HB3  . ARG A 1 6   ? 11.063  -4.978  7.955   1.00 0.00 ? 6   ARG A HB3  6  
ATOM   10182 H  HG2  . ARG A 1 6   ? 12.330  -2.890  7.633   1.00 0.00 ? 6   ARG A HG2  6  
ATOM   10183 H  HG3  . ARG A 1 6   ? 11.427  -2.518  6.157   1.00 0.00 ? 6   ARG A HG3  6  
ATOM   10184 H  HD2  . ARG A 1 6   ? 10.084  -2.961  8.830   1.00 0.00 ? 6   ARG A HD2  6  
ATOM   10185 H  HD3  . ARG A 1 6   ? 10.710  -1.397  8.317   1.00 0.00 ? 6   ARG A HD3  6  
ATOM   10186 H  HE   . ARG A 1 6   ? 8.497   -2.914  6.975   1.00 0.00 ? 6   ARG A HE   6  
ATOM   10187 H  HH11 . ARG A 1 6   ? 10.011  0.231   7.717   1.00 0.00 ? 6   ARG A HH11 6  
ATOM   10188 H  HH12 . ARG A 1 6   ? 8.638   1.151   7.172   1.00 0.00 ? 6   ARG A HH12 6  
ATOM   10189 H  HH21 . ARG A 1 6   ? 6.744   -1.665  6.177   1.00 0.00 ? 6   ARG A HH21 6  
ATOM   10190 H  HH22 . ARG A 1 6   ? 6.846   0.099   6.274   1.00 0.00 ? 6   ARG A HH22 6  
ATOM   10191 N  N    . ASP A 1 7   ? 11.622  -7.374  5.067   1.00 0.00 ? 7   ASP A N    6  
ATOM   10192 C  CA   . ASP A 1 7   ? 11.462  -8.825  4.907   1.00 0.00 ? 7   ASP A CA   6  
ATOM   10193 C  C    . ASP A 1 7   ? 10.923  -9.499  6.183   1.00 0.00 ? 7   ASP A C    6  
ATOM   10194 O  O    . ASP A 1 7   ? 9.834   -9.142  6.634   1.00 0.00 ? 7   ASP A O    6  
ATOM   10195 C  CB   . ASP A 1 7   ? 12.759  -9.434  4.349   1.00 0.00 ? 7   ASP A CB   6  
ATOM   10196 C  CG   . ASP A 1 7   ? 12.614  -10.934 4.057   1.00 0.00 ? 7   ASP A CG   6  
ATOM   10197 O  OD1  . ASP A 1 7   ? 11.796  -11.306 3.187   1.00 0.00 ? 7   ASP A OD1  6  
ATOM   10198 O  OD2  . ASP A 1 7   ? 13.311  -11.730 4.724   1.00 0.00 ? 7   ASP A OD2  6  
ATOM   10199 H  H    . ASP A 1 7   ? 11.450  -6.814  4.239   1.00 0.00 ? 7   ASP A H    6  
ATOM   10200 H  HA   . ASP A 1 7   ? 10.702  -8.981  4.141   1.00 0.00 ? 7   ASP A HA   6  
ATOM   10201 H  HB2  . ASP A 1 7   ? 13.020  -8.920  3.422   1.00 0.00 ? 7   ASP A HB2  6  
ATOM   10202 H  HB3  . ASP A 1 7   ? 13.570  -9.268  5.062   1.00 0.00 ? 7   ASP A HB3  6  
ATOM   10203 N  N    . GLU A 1 8   ? 11.631  -10.449 6.799   1.00 0.00 ? 8   GLU A N    6  
ATOM   10204 C  CA   . GLU A 1 8   ? 11.102  -11.227 7.914   1.00 0.00 ? 8   GLU A CA   6  
ATOM   10205 C  C    . GLU A 1 8   ? 10.728  -10.380 9.137   1.00 0.00 ? 8   GLU A C    6  
ATOM   10206 O  O    . GLU A 1 8   ? 9.850   -10.778 9.899   1.00 0.00 ? 8   GLU A O    6  
ATOM   10207 C  CB   . GLU A 1 8   ? 12.068  -12.367 8.280   1.00 0.00 ? 8   GLU A CB   6  
ATOM   10208 C  CG   . GLU A 1 8   ? 13.423  -11.888 8.828   1.00 0.00 ? 8   GLU A CG   6  
ATOM   10209 C  CD   . GLU A 1 8   ? 14.340  -13.073 9.177   1.00 0.00 ? 8   GLU A CD   6  
ATOM   10210 O  OE1  . GLU A 1 8   ? 14.241  -13.618 10.301  1.00 0.00 ? 8   GLU A OE1  6  
ATOM   10211 O  OE2  . GLU A 1 8   ? 15.188  -13.465 8.343   1.00 0.00 ? 8   GLU A OE2  6  
ATOM   10212 H  H    . GLU A 1 8   ? 12.510  -10.756 6.395   1.00 0.00 ? 8   GLU A H    6  
ATOM   10213 H  HA   . GLU A 1 8   ? 10.174  -11.671 7.562   1.00 0.00 ? 8   GLU A HA   6  
ATOM   10214 H  HB2  . GLU A 1 8   ? 11.590  -12.999 9.029   1.00 0.00 ? 8   GLU A HB2  6  
ATOM   10215 H  HB3  . GLU A 1 8   ? 12.242  -12.976 7.392   1.00 0.00 ? 8   GLU A HB3  6  
ATOM   10216 H  HG2  . GLU A 1 8   ? 13.910  -11.252 8.086   1.00 0.00 ? 8   GLU A HG2  6  
ATOM   10217 H  HG3  . GLU A 1 8   ? 13.259  -11.286 9.725   1.00 0.00 ? 8   GLU A HG3  6  
ATOM   10218 N  N    . THR A 1 9   ? 11.331  -9.202  9.310   1.00 0.00 ? 9   THR A N    6  
ATOM   10219 C  CA   . THR A 1 9   ? 10.989  -8.288  10.396  1.00 0.00 ? 9   THR A CA   6  
ATOM   10220 C  C    . THR A 1 9   ? 9.539   -7.824  10.246  1.00 0.00 ? 9   THR A C    6  
ATOM   10221 O  O    . THR A 1 9   ? 8.786   -7.822  11.222  1.00 0.00 ? 9   THR A O    6  
ATOM   10222 C  CB   . THR A 1 9   ? 11.957  -7.081  10.416  1.00 0.00 ? 9   THR A CB   6  
ATOM   10223 O  OG1  . THR A 1 9   ? 13.218  -7.379  9.839   1.00 0.00 ? 9   THR A OG1  6  
ATOM   10224 C  CG2  . THR A 1 9   ? 12.189  -6.580  11.845  1.00 0.00 ? 9   THR A CG2  6  
ATOM   10225 H  H    . THR A 1 9   ? 12.004  -8.883  8.623   1.00 0.00 ? 9   THR A H    6  
ATOM   10226 H  HA   . THR A 1 9   ? 11.058  -8.822  11.346  1.00 0.00 ? 9   THR A HA   6  
ATOM   10227 H  HB   . THR A 1 9   ? 11.519  -6.268  9.837   1.00 0.00 ? 9   THR A HB   6  
ATOM   10228 H  HG1  . THR A 1 9   ? 13.098  -7.318  8.873   1.00 0.00 ? 9   THR A HG1  6  
ATOM   10229 H  HG21 . THR A 1 9   ? 12.842  -5.707  11.829  1.00 0.00 ? 9   THR A HG21 6  
ATOM   10230 H  HG22 . THR A 1 9   ? 11.237  -6.295  12.294  1.00 0.00 ? 9   THR A HG22 6  
ATOM   10231 H  HG23 . THR A 1 9   ? 12.649  -7.364  12.449  1.00 0.00 ? 9   THR A HG23 6  
ATOM   10232 N  N    . ARG A 1 10  ? 9.115   -7.475  9.023   1.00 0.00 ? 10  ARG A N    6  
ATOM   10233 C  CA   . ARG A 1 10  ? 7.741   -7.018  8.816   1.00 0.00 ? 10  ARG A CA   6  
ATOM   10234 C  C    . ARG A 1 10  ? 6.802   -8.214  8.803   1.00 0.00 ? 10  ARG A C    6  
ATOM   10235 O  O    . ARG A 1 10  ? 5.721   -8.111  9.368   1.00 0.00 ? 10  ARG A O    6  
ATOM   10236 C  CB   . ARG A 1 10  ? 7.582   -6.109  7.582   1.00 0.00 ? 10  ARG A CB   6  
ATOM   10237 C  CG   . ARG A 1 10  ? 8.157   -6.686  6.281   1.00 0.00 ? 10  ARG A CG   6  
ATOM   10238 C  CD   . ARG A 1 10  ? 7.887   -5.826  5.038   1.00 0.00 ? 10  ARG A CD   6  
ATOM   10239 N  NE   . ARG A 1 10  ? 6.457   -5.702  4.745   1.00 0.00 ? 10  ARG A NE   6  
ATOM   10240 C  CZ   . ARG A 1 10  ? 5.652   -6.675  4.316   1.00 0.00 ? 10  ARG A CZ   6  
ATOM   10241 N  NH1  . ARG A 1 10  ? 6.125   -7.895  4.074   1.00 0.00 ? 10  ARG A NH1  6  
ATOM   10242 N  NH2  . ARG A 1 10  ? 4.371   -6.401  4.155   1.00 0.00 ? 10  ARG A NH2  6  
ATOM   10243 H  H    . ARG A 1 10  ? 9.685   -7.710  8.217   1.00 0.00 ? 10  ARG A H    6  
ATOM   10244 H  HA   . ARG A 1 10  ? 7.455   -6.415  9.680   1.00 0.00 ? 10  ARG A HA   6  
ATOM   10245 H  HB2  . ARG A 1 10  ? 6.518   -5.905  7.449   1.00 0.00 ? 10  ARG A HB2  6  
ATOM   10246 H  HB3  . ARG A 1 10  ? 8.074   -5.159  7.789   1.00 0.00 ? 10  ARG A HB3  6  
ATOM   10247 H  HG2  . ARG A 1 10  ? 9.233   -6.764  6.391   1.00 0.00 ? 10  ARG A HG2  6  
ATOM   10248 H  HG3  . ARG A 1 10  ? 7.755   -7.683  6.121   1.00 0.00 ? 10  ARG A HG3  6  
ATOM   10249 H  HD2  . ARG A 1 10  ? 8.285   -4.827  5.198   1.00 0.00 ? 10  ARG A HD2  6  
ATOM   10250 H  HD3  . ARG A 1 10  ? 8.392   -6.268  4.179   1.00 0.00 ? 10  ARG A HD3  6  
ATOM   10251 H  HE   . ARG A 1 10  ? 6.038   -4.807  5.018   1.00 0.00 ? 10  ARG A HE   6  
ATOM   10252 H  HH11 . ARG A 1 10  ? 7.113   -8.072  4.159   1.00 0.00 ? 10  ARG A HH11 6  
ATOM   10253 H  HH12 . ARG A 1 10  ? 5.538   -8.737  4.154   1.00 0.00 ? 10  ARG A HH12 6  
ATOM   10254 H  HH21 . ARG A 1 10  ? 4.018   -5.489  4.483   1.00 0.00 ? 10  ARG A HH21 6  
ATOM   10255 H  HH22 . ARG A 1 10  ? 3.709   -7.086  3.839   1.00 0.00 ? 10  ARG A HH22 6  
ATOM   10256 N  N    . GLU A 1 11  ? 7.207   -9.356  8.243   1.00 0.00 ? 11  GLU A N    6  
ATOM   10257 C  CA   . GLU A 1 11  ? 6.363   -10.550 8.224   1.00 0.00 ? 11  GLU A CA   6  
ATOM   10258 C  C    . GLU A 1 11  ? 6.064   -11.014 9.657   1.00 0.00 ? 11  GLU A C    6  
ATOM   10259 O  O    . GLU A 1 11  ? 4.928   -11.378 9.955   1.00 0.00 ? 11  GLU A O    6  
ATOM   10260 C  CB   . GLU A 1 11  ? 7.032   -11.673 7.422   1.00 0.00 ? 11  GLU A CB   6  
ATOM   10261 C  CG   . GLU A 1 11  ? 7.291   -11.326 5.948   1.00 0.00 ? 11  GLU A CG   6  
ATOM   10262 C  CD   . GLU A 1 11  ? 6.042   -11.402 5.054   1.00 0.00 ? 11  GLU A CD   6  
ATOM   10263 O  OE1  . GLU A 1 11  ? 5.331   -10.382 4.911   1.00 0.00 ? 11  GLU A OE1  6  
ATOM   10264 O  OE2  . GLU A 1 11  ? 5.845   -12.458 4.406   1.00 0.00 ? 11  GLU A OE2  6  
ATOM   10265 H  H    . GLU A 1 11  ? 8.113   -9.399  7.786   1.00 0.00 ? 11  GLU A H    6  
ATOM   10266 H  HA   . GLU A 1 11  ? 5.416   -10.306 7.744   1.00 0.00 ? 11  GLU A HA   6  
ATOM   10267 H  HB2  . GLU A 1 11  ? 7.984   -11.910 7.894   1.00 0.00 ? 11  GLU A HB2  6  
ATOM   10268 H  HB3  . GLU A 1 11  ? 6.409   -12.567 7.467   1.00 0.00 ? 11  GLU A HB3  6  
ATOM   10269 H  HG2  . GLU A 1 11  ? 7.730   -10.334 5.860   1.00 0.00 ? 11  GLU A HG2  6  
ATOM   10270 H  HG3  . GLU A 1 11  ? 8.035   -12.033 5.582   1.00 0.00 ? 11  GLU A HG3  6  
ATOM   10271 N  N    . HIS A 1 12  ? 7.050   -10.950 10.561  1.00 0.00 ? 12  HIS A N    6  
ATOM   10272 C  CA   . HIS A 1 12  ? 6.859   -11.279 11.969  1.00 0.00 ? 12  HIS A CA   6  
ATOM   10273 C  C    . HIS A 1 12  ? 5.871   -10.310 12.624  1.00 0.00 ? 12  HIS A C    6  
ATOM   10274 O  O    . HIS A 1 12  ? 4.973   -10.746 13.348  1.00 0.00 ? 12  HIS A O    6  
ATOM   10275 C  CB   . HIS A 1 12  ? 8.213   -11.261 12.691  1.00 0.00 ? 12  HIS A CB   6  
ATOM   10276 C  CG   . HIS A 1 12  ? 8.113   -11.586 14.162  1.00 0.00 ? 12  HIS A CG   6  
ATOM   10277 N  ND1  . HIS A 1 12  ? 7.830   -12.817 14.713  1.00 0.00 ? 12  HIS A ND1  6  
ATOM   10278 C  CD2  . HIS A 1 12  ? 8.277   -10.708 15.200  1.00 0.00 ? 12  HIS A CD2  6  
ATOM   10279 C  CE1  . HIS A 1 12  ? 7.828   -12.683 16.050  1.00 0.00 ? 12  HIS A CE1  6  
ATOM   10280 N  NE2  . HIS A 1 12  ? 8.100   -11.411 16.400  1.00 0.00 ? 12  HIS A NE2  6  
ATOM   10281 H  H    . HIS A 1 12  ? 7.982   -10.684 10.262  1.00 0.00 ? 12  HIS A H    6  
ATOM   10282 H  HA   . HIS A 1 12  ? 6.444   -12.286 12.034  1.00 0.00 ? 12  HIS A HA   6  
ATOM   10283 H  HB2  . HIS A 1 12  ? 8.875   -11.991 12.223  1.00 0.00 ? 12  HIS A HB2  6  
ATOM   10284 H  HB3  . HIS A 1 12  ? 8.669   -10.276 12.581  1.00 0.00 ? 12  HIS A HB3  6  
ATOM   10285 H  HD1  . HIS A 1 12  ? 7.661   -13.682 14.209  1.00 0.00 ? 12  HIS A HD1  6  
ATOM   10286 H  HD2  . HIS A 1 12  ? 8.505   -9.653  15.106  1.00 0.00 ? 12  HIS A HD2  6  
ATOM   10287 H  HE1  . HIS A 1 12  ? 7.637   -13.493 16.746  1.00 0.00 ? 12  HIS A HE1  6  
ATOM   10288 N  N    . ARG A 1 13  ? 5.994   -9.002  12.363  1.00 0.00 ? 13  ARG A N    6  
ATOM   10289 C  CA   . ARG A 1 13  ? 5.037   -8.022  12.880  1.00 0.00 ? 13  ARG A CA   6  
ATOM   10290 C  C    . ARG A 1 13  ? 3.634   -8.314  12.357  1.00 0.00 ? 13  ARG A C    6  
ATOM   10291 O  O    . ARG A 1 13  ? 2.700   -8.397  13.147  1.00 0.00 ? 13  ARG A O    6  
ATOM   10292 C  CB   . ARG A 1 13  ? 5.470   -6.592  12.544  1.00 0.00 ? 13  ARG A CB   6  
ATOM   10293 C  CG   . ARG A 1 13  ? 6.636   -6.148  13.445  1.00 0.00 ? 13  ARG A CG   6  
ATOM   10294 C  CD   . ARG A 1 13  ? 6.817   -4.628  13.421  1.00 0.00 ? 13  ARG A CD   6  
ATOM   10295 N  NE   . ARG A 1 13  ? 5.665   -3.935  14.026  1.00 0.00 ? 13  ARG A NE   6  
ATOM   10296 C  CZ   . ARG A 1 13  ? 5.481   -2.615  14.121  1.00 0.00 ? 13  ARG A CZ   6  
ATOM   10297 N  NH1  . ARG A 1 13  ? 6.414   -1.766  13.695  1.00 0.00 ? 13  ARG A NH1  6  
ATOM   10298 N  NH2  . ARG A 1 13  ? 4.352   -2.154  14.646  1.00 0.00 ? 13  ARG A NH2  6  
ATOM   10299 H  H    . ARG A 1 13  ? 6.751   -8.679  11.773  1.00 0.00 ? 13  ARG A H    6  
ATOM   10300 H  HA   . ARG A 1 13  ? 4.999   -8.103  13.966  1.00 0.00 ? 13  ARG A HA   6  
ATOM   10301 H  HB2  . ARG A 1 13  ? 5.753   -6.509  11.495  1.00 0.00 ? 13  ARG A HB2  6  
ATOM   10302 H  HB3  . ARG A 1 13  ? 4.613   -5.939  12.711  1.00 0.00 ? 13  ARG A HB3  6  
ATOM   10303 H  HG2  . ARG A 1 13  ? 6.451   -6.455  14.475  1.00 0.00 ? 13  ARG A HG2  6  
ATOM   10304 H  HG3  . ARG A 1 13  ? 7.560   -6.626  13.108  1.00 0.00 ? 13  ARG A HG3  6  
ATOM   10305 H  HD2  . ARG A 1 13  ? 7.716   -4.385  13.986  1.00 0.00 ? 13  ARG A HD2  6  
ATOM   10306 H  HD3  . ARG A 1 13  ? 6.939   -4.308  12.387  1.00 0.00 ? 13  ARG A HD3  6  
ATOM   10307 H  HE   . ARG A 1 13  ? 4.929   -4.543  14.403  1.00 0.00 ? 13  ARG A HE   6  
ATOM   10308 H  HH11 . ARG A 1 13  ? 7.279   -2.106  13.301  1.00 0.00 ? 13  ARG A HH11 6  
ATOM   10309 H  HH12 . ARG A 1 13  ? 6.298   -0.764  13.757  1.00 0.00 ? 13  ARG A HH12 6  
ATOM   10310 H  HH21 . ARG A 1 13  ? 3.604   -2.799  14.936  1.00 0.00 ? 13  ARG A HH21 6  
ATOM   10311 H  HH22 . ARG A 1 13  ? 4.161   -1.167  14.731  1.00 0.00 ? 13  ARG A HH22 6  
ATOM   10312 N  N    . ILE A 1 14  ? 3.486   -8.523  11.050  1.00 0.00 ? 14  ILE A N    6  
ATOM   10313 C  CA   . ILE A 1 14  ? 2.216   -8.845  10.405  1.00 0.00 ? 14  ILE A CA   6  
ATOM   10314 C  C    . ILE A 1 14  ? 1.587   -10.048 11.114  1.00 0.00 ? 14  ILE A C    6  
ATOM   10315 O  O    . ILE A 1 14  ? 0.429   -9.986  11.536  1.00 0.00 ? 14  ILE A O    6  
ATOM   10316 C  CB   . ILE A 1 14  ? 2.481   -9.071  8.896   1.00 0.00 ? 14  ILE A CB   6  
ATOM   10317 C  CG1  . ILE A 1 14  ? 2.777   -7.719  8.212   1.00 0.00 ? 14  ILE A CG1  6  
ATOM   10318 C  CG2  . ILE A 1 14  ? 1.332   -9.795  8.176   1.00 0.00 ? 14  ILE A CG2  6  
ATOM   10319 C  CD1  . ILE A 1 14  ? 3.564   -7.841  6.908   1.00 0.00 ? 14  ILE A CD1  6  
ATOM   10320 H  H    . ILE A 1 14  ? 4.302   -8.453  10.454  1.00 0.00 ? 14  ILE A H    6  
ATOM   10321 H  HA   . ILE A 1 14  ? 1.541   -7.998  10.523  1.00 0.00 ? 14  ILE A HA   6  
ATOM   10322 H  HB   . ILE A 1 14  ? 3.362   -9.703  8.799   1.00 0.00 ? 14  ILE A HB   6  
ATOM   10323 H  HG12 . ILE A 1 14  ? 1.842   -7.208  7.997   1.00 0.00 ? 14  ILE A HG12 6  
ATOM   10324 H  HG13 . ILE A 1 14  ? 3.354   -7.078  8.878   1.00 0.00 ? 14  ILE A HG13 6  
ATOM   10325 H  HG21 . ILE A 1 14  ? 0.403   -9.234  8.282   1.00 0.00 ? 14  ILE A HG21 6  
ATOM   10326 H  HG22 . ILE A 1 14  ? 1.565   -9.912  7.118   1.00 0.00 ? 14  ILE A HG22 6  
ATOM   10327 H  HG23 . ILE A 1 14  ? 1.207   -10.794 8.597   1.00 0.00 ? 14  ILE A HG23 6  
ATOM   10328 H  HD11 . ILE A 1 14  ? 3.848   -6.837  6.601   1.00 0.00 ? 14  ILE A HD11 6  
ATOM   10329 H  HD12 . ILE A 1 14  ? 4.474   -8.417  7.053   1.00 0.00 ? 14  ILE A HD12 6  
ATOM   10330 H  HD13 . ILE A 1 14  ? 2.956   -8.310  6.135   1.00 0.00 ? 14  ILE A HD13 6  
ATOM   10331 N  N    . GLU A 1 15  ? 2.363   -11.118 11.287  1.00 0.00 ? 15  GLU A N    6  
ATOM   10332 C  CA   . GLU A 1 15  ? 1.903   -12.336 11.924  1.00 0.00 ? 15  GLU A CA   6  
ATOM   10333 C  C    . GLU A 1 15  ? 1.445   -12.072 13.362  1.00 0.00 ? 15  GLU A C    6  
ATOM   10334 O  O    . GLU A 1 15  ? 0.413   -12.595 13.770  1.00 0.00 ? 15  GLU A O    6  
ATOM   10335 C  CB   . GLU A 1 15  ? 3.026   -13.384 11.855  1.00 0.00 ? 15  GLU A CB   6  
ATOM   10336 C  CG   . GLU A 1 15  ? 2.660   -14.692 12.565  1.00 0.00 ? 15  GLU A CG   6  
ATOM   10337 C  CD   . GLU A 1 15  ? 3.725   -15.778 12.333  1.00 0.00 ? 15  GLU A CD   6  
ATOM   10338 O  OE1  . GLU A 1 15  ? 4.693   -15.870 13.122  1.00 0.00 ? 15  GLU A OE1  6  
ATOM   10339 O  OE2  . GLU A 1 15  ? 3.595   -16.569 11.370  1.00 0.00 ? 15  GLU A OE2  6  
ATOM   10340 H  H    . GLU A 1 15  ? 3.299   -11.116 10.898  1.00 0.00 ? 15  GLU A H    6  
ATOM   10341 H  HA   . GLU A 1 15  ? 1.048   -12.702 11.356  1.00 0.00 ? 15  GLU A HA   6  
ATOM   10342 H  HB2  . GLU A 1 15  ? 3.234   -13.598 10.805  1.00 0.00 ? 15  GLU A HB2  6  
ATOM   10343 H  HB3  . GLU A 1 15  ? 3.931   -12.983 12.310  1.00 0.00 ? 15  GLU A HB3  6  
ATOM   10344 H  HG2  . GLU A 1 15  ? 2.566   -14.496 13.636  1.00 0.00 ? 15  GLU A HG2  6  
ATOM   10345 H  HG3  . GLU A 1 15  ? 1.692   -15.039 12.197  1.00 0.00 ? 15  GLU A HG3  6  
ATOM   10346 N  N    . THR A 1 16  ? 2.177   -11.266 14.131  1.00 0.00 ? 16  THR A N    6  
ATOM   10347 C  CA   . THR A 1 16  ? 1.918   -11.108 15.560  1.00 0.00 ? 16  THR A CA   6  
ATOM   10348 C  C    . THR A 1 16  ? 0.873   -10.023 15.879  1.00 0.00 ? 16  THR A C    6  
ATOM   10349 O  O    . THR A 1 16  ? 0.269   -10.091 16.953  1.00 0.00 ? 16  THR A O    6  
ATOM   10350 C  CB   . THR A 1 16  ? 3.245   -10.892 16.316  1.00 0.00 ? 16  THR A CB   6  
ATOM   10351 O  OG1  . THR A 1 16  ? 4.049   -9.888  15.727  1.00 0.00 ? 16  THR A OG1  6  
ATOM   10352 C  CG2  . THR A 1 16  ? 4.070   -12.183 16.375  1.00 0.00 ? 16  THR A CG2  6  
ATOM   10353 H  H    . THR A 1 16  ? 3.021   -10.853 13.753  1.00 0.00 ? 16  THR A H    6  
ATOM   10354 H  HA   . THR A 1 16  ? 1.496   -12.045 15.927  1.00 0.00 ? 16  THR A HA   6  
ATOM   10355 H  HB   . THR A 1 16  ? 3.015   -10.594 17.339  1.00 0.00 ? 16  THR A HB   6  
ATOM   10356 H  HG1  . THR A 1 16  ? 4.394   -10.242 14.887  1.00 0.00 ? 16  THR A HG1  6  
ATOM   10357 H  HG21 . THR A 1 16  ? 4.332   -12.523 15.372  1.00 0.00 ? 16  THR A HG21 6  
ATOM   10358 H  HG22 . THR A 1 16  ? 4.982   -12.010 16.946  1.00 0.00 ? 16  THR A HG22 6  
ATOM   10359 H  HG23 . THR A 1 16  ? 3.494   -12.964 16.874  1.00 0.00 ? 16  THR A HG23 6  
ATOM   10360 N  N    . GLU A 1 17  ? 0.621   -9.056  14.983  1.00 0.00 ? 17  GLU A N    6  
ATOM   10361 C  CA   . GLU A 1 17  ? -0.197  -7.880  15.312  1.00 0.00 ? 17  GLU A CA   6  
ATOM   10362 C  C    . GLU A 1 17  ? -1.243  -7.502  14.251  1.00 0.00 ? 17  GLU A C    6  
ATOM   10363 O  O    . GLU A 1 17  ? -2.032  -6.589  14.504  1.00 0.00 ? 17  GLU A O    6  
ATOM   10364 C  CB   . GLU A 1 17  ? 0.707   -6.698  15.733  1.00 0.00 ? 17  GLU A CB   6  
ATOM   10365 C  CG   . GLU A 1 17  ? 1.173   -5.766  14.602  1.00 0.00 ? 17  GLU A CG   6  
ATOM   10366 C  CD   . GLU A 1 17  ? 2.323   -4.851  15.057  1.00 0.00 ? 17  GLU A CD   6  
ATOM   10367 O  OE1  . GLU A 1 17  ? 3.490   -5.294  15.097  1.00 0.00 ? 17  GLU A OE1  6  
ATOM   10368 O  OE2  . GLU A 1 17  ? 2.093   -3.655  15.343  1.00 0.00 ? 17  GLU A OE2  6  
ATOM   10369 H  H    . GLU A 1 17  ? 1.213   -9.020  14.174  1.00 0.00 ? 17  GLU A H    6  
ATOM   10370 H  HA   . GLU A 1 17  ? -0.782  -8.131  16.197  1.00 0.00 ? 17  GLU A HA   6  
ATOM   10371 H  HB2  . GLU A 1 17  ? 0.159   -6.089  16.453  1.00 0.00 ? 17  GLU A HB2  6  
ATOM   10372 H  HB3  . GLU A 1 17  ? 1.580   -7.096  16.255  1.00 0.00 ? 17  GLU A HB3  6  
ATOM   10373 H  HG2  . GLU A 1 17  ? 1.500   -6.350  13.746  1.00 0.00 ? 17  GLU A HG2  6  
ATOM   10374 H  HG3  . GLU A 1 17  ? 0.331   -5.156  14.271  1.00 0.00 ? 17  GLU A HG3  6  
ATOM   10375 N  N    . ILE A 1 18  ? -1.309  -8.196  13.105  1.00 0.00 ? 18  ILE A N    6  
ATOM   10376 C  CA   . ILE A 1 18  ? -2.281  -7.892  12.045  1.00 0.00 ? 18  ILE A CA   6  
ATOM   10377 C  C    . ILE A 1 18  ? -3.159  -9.117  11.762  1.00 0.00 ? 18  ILE A C    6  
ATOM   10378 O  O    . ILE A 1 18  ? -4.377  -8.965  11.662  1.00 0.00 ? 18  ILE A O    6  
ATOM   10379 C  CB   . ILE A 1 18  ? -1.579  -7.335  10.776  1.00 0.00 ? 18  ILE A CB   6  
ATOM   10380 C  CG1  . ILE A 1 18  ? -0.630  -6.168  11.145  1.00 0.00 ? 18  ILE A CG1  6  
ATOM   10381 C  CG2  . ILE A 1 18  ? -2.616  -6.870  9.733   1.00 0.00 ? 18  ILE A CG2  6  
ATOM   10382 C  CD1  . ILE A 1 18  ? 0.011   -5.451  9.953   1.00 0.00 ? 18  ILE A CD1  6  
ATOM   10383 H  H    . ILE A 1 18  ? -0.625  -8.924  12.923  1.00 0.00 ? 18  ILE A H    6  
ATOM   10384 H  HA   . ILE A 1 18  ? -2.952  -7.108  12.397  1.00 0.00 ? 18  ILE A HA   6  
ATOM   10385 H  HB   . ILE A 1 18  ? -0.988  -8.131  10.323  1.00 0.00 ? 18  ILE A HB   6  
ATOM   10386 H  HG12 . ILE A 1 18  ? -1.177  -5.434  11.735  1.00 0.00 ? 18  ILE A HG12 6  
ATOM   10387 H  HG13 . ILE A 1 18  ? 0.183   -6.554  11.758  1.00 0.00 ? 18  ILE A HG13 6  
ATOM   10388 H  HG21 . ILE A 1 18  ? -3.336  -7.657  9.520   1.00 0.00 ? 18  ILE A HG21 6  
ATOM   10389 H  HG22 . ILE A 1 18  ? -3.155  -6.001  10.107  1.00 0.00 ? 18  ILE A HG22 6  
ATOM   10390 H  HG23 . ILE A 1 18  ? -2.126  -6.619  8.793   1.00 0.00 ? 18  ILE A HG23 6  
ATOM   10391 H  HD11 . ILE A 1 18  ? 0.451   -6.183  9.283   1.00 0.00 ? 18  ILE A HD11 6  
ATOM   10392 H  HD12 . ILE A 1 18  ? -0.735  -4.873  9.409   1.00 0.00 ? 18  ILE A HD12 6  
ATOM   10393 H  HD13 . ILE A 1 18  ? 0.788   -4.776  10.311  1.00 0.00 ? 18  ILE A HD13 6  
ATOM   10394 N  N    . ILE A 1 19  ? -2.586  -10.325 11.680  1.00 0.00 ? 19  ILE A N    6  
ATOM   10395 C  CA   . ILE A 1 19  ? -3.302  -11.517 11.214  1.00 0.00 ? 19  ILE A CA   6  
ATOM   10396 C  C    . ILE A 1 19  ? -3.124  -12.730 12.150  1.00 0.00 ? 19  ILE A C    6  
ATOM   10397 O  O    . ILE A 1 19  ? -3.263  -13.870 11.717  1.00 0.00 ? 19  ILE A O    6  
ATOM   10398 C  CB   . ILE A 1 19  ? -2.915  -11.813 9.753   1.00 0.00 ? 19  ILE A CB   6  
ATOM   10399 C  CG1  . ILE A 1 19  ? -1.393  -12.003 9.653   1.00 0.00 ? 19  ILE A CG1  6  
ATOM   10400 C  CG2  . ILE A 1 19  ? -3.412  -10.717 8.786   1.00 0.00 ? 19  ILE A CG2  6  
ATOM   10401 C  CD1  . ILE A 1 19  ? -1.035  -12.822 8.429   1.00 0.00 ? 19  ILE A CD1  6  
ATOM   10402 H  H    . ILE A 1 19  ? -1.571  -10.391 11.685  1.00 0.00 ? 19  ILE A H    6  
ATOM   10403 H  HA   . ILE A 1 19  ? -4.365  -11.313 11.195  1.00 0.00 ? 19  ILE A HA   6  
ATOM   10404 H  HB   . ILE A 1 19  ? -3.410  -12.740 9.461   1.00 0.00 ? 19  ILE A HB   6  
ATOM   10405 H  HG12 . ILE A 1 19  ? -0.902  -11.034 9.598   1.00 0.00 ? 19  ILE A HG12 6  
ATOM   10406 H  HG13 . ILE A 1 19  ? -1.024  -12.535 10.530  1.00 0.00 ? 19  ILE A HG13 6  
ATOM   10407 H  HG21 . ILE A 1 19  ? -2.836  -9.801  8.911   1.00 0.00 ? 19  ILE A HG21 6  
ATOM   10408 H  HG22 . ILE A 1 19  ? -3.305  -11.049 7.754   1.00 0.00 ? 19  ILE A HG22 6  
ATOM   10409 H  HG23 . ILE A 1 19  ? -4.466  -10.502 8.967   1.00 0.00 ? 19  ILE A HG23 6  
ATOM   10410 H  HD11 . ILE A 1 19  ? 0.042   -12.969 8.407   1.00 0.00 ? 19  ILE A HD11 6  
ATOM   10411 H  HD12 . ILE A 1 19  ? -1.542  -13.780 8.513   1.00 0.00 ? 19  ILE A HD12 6  
ATOM   10412 H  HD13 . ILE A 1 19  ? -1.364  -12.298 7.535   1.00 0.00 ? 19  ILE A HD13 6  
ATOM   10413 N  N    . VAL A 1 20  ? -2.805  -12.507 13.427  1.00 0.00 ? 20  VAL A N    6  
ATOM   10414 C  CA   . VAL A 1 20  ? -2.450  -13.560 14.388  1.00 0.00 ? 20  VAL A CA   6  
ATOM   10415 C  C    . VAL A 1 20  ? -3.447  -14.728 14.452  1.00 0.00 ? 20  VAL A C    6  
ATOM   10416 O  O    . VAL A 1 20  ? -3.030  -15.880 14.588  1.00 0.00 ? 20  VAL A O    6  
ATOM   10417 C  CB   . VAL A 1 20  ? -2.188  -12.914 15.766  1.00 0.00 ? 20  VAL A CB   6  
ATOM   10418 C  CG1  . VAL A 1 20  ? -3.472  -12.404 16.442  1.00 0.00 ? 20  VAL A CG1  6  
ATOM   10419 C  CG2  . VAL A 1 20  ? -1.456  -13.873 16.714  1.00 0.00 ? 20  VAL A CG2  6  
ATOM   10420 H  H    . VAL A 1 20  ? -2.631  -11.554 13.704  1.00 0.00 ? 20  VAL A H    6  
ATOM   10421 H  HA   . VAL A 1 20  ? -1.513  -13.989 14.039  1.00 0.00 ? 20  VAL A HA   6  
ATOM   10422 H  HB   . VAL A 1 20  ? -1.539  -12.053 15.610  1.00 0.00 ? 20  VAL A HB   6  
ATOM   10423 H  HG11 . VAL A 1 20  ? -3.996  -11.710 15.785  1.00 0.00 ? 20  VAL A HG11 6  
ATOM   10424 H  HG12 . VAL A 1 20  ? -4.133  -13.241 16.679  1.00 0.00 ? 20  VAL A HG12 6  
ATOM   10425 H  HG13 . VAL A 1 20  ? -3.218  -11.882 17.365  1.00 0.00 ? 20  VAL A HG13 6  
ATOM   10426 H  HG21 . VAL A 1 20  ? -2.085  -14.737 16.936  1.00 0.00 ? 20  VAL A HG21 6  
ATOM   10427 H  HG22 . VAL A 1 20  ? -0.531  -14.213 16.247  1.00 0.00 ? 20  VAL A HG22 6  
ATOM   10428 H  HG23 . VAL A 1 20  ? -1.211  -13.359 17.643  1.00 0.00 ? 20  VAL A HG23 6  
ATOM   10429 N  N    . ASP A 1 21  ? -4.748  -14.454 14.319  1.00 0.00 ? 21  ASP A N    6  
ATOM   10430 C  CA   . ASP A 1 21  ? -5.826  -15.444 14.403  1.00 0.00 ? 21  ASP A CA   6  
ATOM   10431 C  C    . ASP A 1 21  ? -6.537  -15.618 13.047  1.00 0.00 ? 21  ASP A C    6  
ATOM   10432 O  O    . ASP A 1 21  ? -7.541  -16.344 12.941  1.00 0.00 ? 21  ASP A O    6  
ATOM   10433 C  CB   . ASP A 1 21  ? -6.822  -15.048 15.508  1.00 0.00 ? 21  ASP A CB   6  
ATOM   10434 C  CG   . ASP A 1 21  ? -7.826  -13.963 15.073  1.00 0.00 ? 21  ASP A CG   6  
ATOM   10435 O  OD1  . ASP A 1 21  ? -7.402  -12.924 14.518  1.00 0.00 ? 21  ASP A OD1  6  
ATOM   10436 O  OD2  . ASP A 1 21  ? -9.039  -14.119 15.342  1.00 0.00 ? 21  ASP A OD2  6  
ATOM   10437 H  H    . ASP A 1 21  ? -5.036  -13.490 14.206  1.00 0.00 ? 21  ASP A H    6  
ATOM   10438 H  HA   . ASP A 1 21  ? -5.380  -16.390 14.701  1.00 0.00 ? 21  ASP A HA   6  
ATOM   10439 H  HB2  . ASP A 1 21  ? -7.373  -15.944 15.799  1.00 0.00 ? 21  ASP A HB2  6  
ATOM   10440 H  HB3  . ASP A 1 21  ? -6.273  -14.707 16.388  1.00 0.00 ? 21  ASP A HB3  6  
ATOM   10441 N  N    . ALA A 1 22  ? -5.992  -14.954 12.017  1.00 0.00 ? 22  ALA A N    6  
ATOM   10442 C  CA   . ALA A 1 22  ? -6.587  -14.787 10.709  1.00 0.00 ? 22  ALA A CA   6  
ATOM   10443 C  C    . ALA A 1 22  ? -5.781  -15.524 9.650   1.00 0.00 ? 22  ALA A C    6  
ATOM   10444 O  O    . ALA A 1 22  ? -4.570  -15.367 9.481   1.00 0.00 ? 22  ALA A O    6  
ATOM   10445 C  CB   . ALA A 1 22  ? -6.654  -13.312 10.333  1.00 0.00 ? 22  ALA A CB   6  
ATOM   10446 H  H    . ALA A 1 22  ? -5.081  -14.526 12.155  1.00 0.00 ? 22  ALA A H    6  
ATOM   10447 H  HA   . ALA A 1 22  ? -7.612  -15.166 10.726  1.00 0.00 ? 22  ALA A HA   6  
ATOM   10448 H  HB1  . ALA A 1 22  ? -5.654  -12.890 10.306  1.00 0.00 ? 22  ALA A HB1  6  
ATOM   10449 H  HB2  . ALA A 1 22  ? -7.076  -13.251 9.334   1.00 0.00 ? 22  ALA A HB2  6  
ATOM   10450 H  HB3  . ALA A 1 22  ? -7.282  -12.764 11.035  1.00 0.00 ? 22  ALA A HB3  6  
ATOM   10451 N  N    . GLU A 1 23  ? -6.523  -16.297 8.889   1.00 0.00 ? 23  GLU A N    6  
ATOM   10452 C  CA   . GLU A 1 23  ? -6.047  -17.257 7.902   1.00 0.00 ? 23  GLU A CA   6  
ATOM   10453 C  C    . GLU A 1 23  ? -7.131  -17.587 6.877   1.00 0.00 ? 23  GLU A C    6  
ATOM   10454 O  O    . GLU A 1 23  ? -6.829  -17.914 5.728   1.00 0.00 ? 23  GLU A O    6  
ATOM   10455 C  CB   . GLU A 1 23  ? -5.519  -18.518 8.602   1.00 0.00 ? 23  GLU A CB   6  
ATOM   10456 C  CG   . GLU A 1 23  ? -6.543  -19.571 9.047   1.00 0.00 ? 23  GLU A CG   6  
ATOM   10457 C  CD   . GLU A 1 23  ? -7.428  -19.132 10.221  1.00 0.00 ? 23  GLU A CD   6  
ATOM   10458 O  OE1  . GLU A 1 23  ? -8.074  -18.063 10.157  1.00 0.00 ? 23  GLU A OE1  6  
ATOM   10459 O  OE2  . GLU A 1 23  ? -7.551  -19.862 11.231  1.00 0.00 ? 23  GLU A OE2  6  
ATOM   10460 H  H    . GLU A 1 23  ? -7.485  -16.372 9.196   1.00 0.00 ? 23  GLU A H    6  
ATOM   10461 H  HA   . GLU A 1 23  ? -5.219  -16.811 7.374   1.00 0.00 ? 23  GLU A HA   6  
ATOM   10462 H  HB2  . GLU A 1 23  ? -4.849  -19.005 7.898   1.00 0.00 ? 23  GLU A HB2  6  
ATOM   10463 H  HB3  . GLU A 1 23  ? -4.943  -18.213 9.470   1.00 0.00 ? 23  GLU A HB3  6  
ATOM   10464 H  HG2  . GLU A 1 23  ? -7.166  -19.840 8.196   1.00 0.00 ? 23  GLU A HG2  6  
ATOM   10465 H  HG3  . GLU A 1 23  ? -5.986  -20.463 9.337   1.00 0.00 ? 23  GLU A HG3  6  
ATOM   10466 N  N    . ASP A 1 24  ? -8.394  -17.473 7.289   1.00 0.00 ? 24  ASP A N    6  
ATOM   10467 C  CA   . ASP A 1 24  ? -9.548  -17.527 6.423   1.00 0.00 ? 24  ASP A CA   6  
ATOM   10468 C  C    . ASP A 1 24  ? -9.478  -16.199 5.676   1.00 0.00 ? 24  ASP A C    6  
ATOM   10469 O  O    . ASP A 1 24  ? -9.151  -15.168 6.278   1.00 0.00 ? 24  ASP A O    6  
ATOM   10470 C  CB   . ASP A 1 24  ? -10.847 -17.618 7.244   1.00 0.00 ? 24  ASP A CB   6  
ATOM   10471 C  CG   . ASP A 1 24  ? -10.890 -18.753 8.292   1.00 0.00 ? 24  ASP A CG   6  
ATOM   10472 O  OD1  . ASP A 1 24  ? -11.010 -19.933 7.891   1.00 0.00 ? 24  ASP A OD1  6  
ATOM   10473 O  OD2  . ASP A 1 24  ? -10.846 -18.473 9.520   1.00 0.00 ? 24  ASP A OD2  6  
ATOM   10474 H  H    . ASP A 1 24  ? -8.571  -17.146 8.221   1.00 0.00 ? 24  ASP A H    6  
ATOM   10475 H  HA   . ASP A 1 24  ? -9.473  -18.376 5.743   1.00 0.00 ? 24  ASP A HA   6  
ATOM   10476 H  HB2  . ASP A 1 24  ? -10.991 -16.670 7.750   1.00 0.00 ? 24  ASP A HB2  6  
ATOM   10477 H  HB3  . ASP A 1 24  ? -11.673 -17.737 6.539   1.00 0.00 ? 24  ASP A HB3  6  
ATOM   10478 N  N    . LYS A 1 25  ? -9.757  -16.194 4.375   1.00 0.00 ? 25  LYS A N    6  
ATOM   10479 C  CA   . LYS A 1 25  ? -9.494  -15.010 3.550   1.00 0.00 ? 25  LYS A CA   6  
ATOM   10480 C  C    . LYS A 1 25  ? -10.250 -13.775 4.034   1.00 0.00 ? 25  LYS A C    6  
ATOM   10481 O  O    . LYS A 1 25  ? -9.736  -12.664 3.916   1.00 0.00 ? 25  LYS A O    6  
ATOM   10482 C  CB   . LYS A 1 25  ? -9.764  -15.302 2.069   1.00 0.00 ? 25  LYS A CB   6  
ATOM   10483 C  CG   . LYS A 1 25  ? -11.239 -15.620 1.774   1.00 0.00 ? 25  LYS A CG   6  
ATOM   10484 C  CD   . LYS A 1 25  ? -11.496 -15.927 0.293   1.00 0.00 ? 25  LYS A CD   6  
ATOM   10485 C  CE   . LYS A 1 25  ? -10.736 -17.179 -0.172  1.00 0.00 ? 25  LYS A CE   6  
ATOM   10486 N  NZ   . LYS A 1 25  ? -11.018 -17.514 -1.590  1.00 0.00 ? 25  LYS A NZ   6  
ATOM   10487 H  H    . LYS A 1 25  ? -10.062 -17.050 3.934   1.00 0.00 ? 25  LYS A H    6  
ATOM   10488 H  HA   . LYS A 1 25  ? -8.431  -14.790 3.644   1.00 0.00 ? 25  LYS A HA   6  
ATOM   10489 H  HB2  . LYS A 1 25  ? -9.472  -14.426 1.489   1.00 0.00 ? 25  LYS A HB2  6  
ATOM   10490 H  HB3  . LYS A 1 25  ? -9.131  -16.136 1.768   1.00 0.00 ? 25  LYS A HB3  6  
ATOM   10491 H  HG2  . LYS A 1 25  ? -11.557 -16.469 2.380   1.00 0.00 ? 25  LYS A HG2  6  
ATOM   10492 H  HG3  . LYS A 1 25  ? -11.844 -14.758 2.052   1.00 0.00 ? 25  LYS A HG3  6  
ATOM   10493 H  HD2  . LYS A 1 25  ? -12.567 -16.083 0.158   1.00 0.00 ? 25  LYS A HD2  6  
ATOM   10494 H  HD3  . LYS A 1 25  ? -11.190 -15.067 -0.304  1.00 0.00 ? 25  LYS A HD3  6  
ATOM   10495 H  HE2  . LYS A 1 25  ? -9.664  -17.007 -0.044  1.00 0.00 ? 25  LYS A HE2  6  
ATOM   10496 H  HE3  . LYS A 1 25  ? -11.020 -18.019 0.467   1.00 0.00 ? 25  LYS A HE3  6  
ATOM   10497 H  HZ1  . LYS A 1 25  ? -10.507 -18.339 -1.871  1.00 0.00 ? 25  LYS A HZ1  6  
ATOM   10498 H  HZ2  . LYS A 1 25  ? -11.999 -17.702 -1.735  1.00 0.00 ? 25  LYS A HZ2  6  
ATOM   10499 H  HZ3  . LYS A 1 25  ? -10.745 -16.763 -2.206  1.00 0.00 ? 25  LYS A HZ3  6  
ATOM   10500 N  N    . GLU A 1 26  ? -11.444 -13.968 4.601   1.00 0.00 ? 26  GLU A N    6  
ATOM   10501 C  CA   . GLU A 1 26  ? -12.256 -12.874 5.106   1.00 0.00 ? 26  GLU A CA   6  
ATOM   10502 C  C    . GLU A 1 26  ? -11.578 -12.285 6.338   1.00 0.00 ? 26  GLU A C    6  
ATOM   10503 O  O    . GLU A 1 26  ? -11.536 -11.065 6.494   1.00 0.00 ? 26  GLU A O    6  
ATOM   10504 C  CB   . GLU A 1 26  ? -13.669 -13.373 5.446   1.00 0.00 ? 26  GLU A CB   6  
ATOM   10505 C  CG   . GLU A 1 26  ? -14.448 -13.809 4.196   1.00 0.00 ? 26  GLU A CG   6  
ATOM   10506 C  CD   . GLU A 1 26  ? -15.876 -14.260 4.547   1.00 0.00 ? 26  GLU A CD   6  
ATOM   10507 O  OE1  . GLU A 1 26  ? -16.079 -15.448 4.888   1.00 0.00 ? 26  GLU A OE1  6  
ATOM   10508 O  OE2  . GLU A 1 26  ? -16.819 -13.440 4.466   1.00 0.00 ? 26  GLU A OE2  6  
ATOM   10509 H  H    . GLU A 1 26  ? -11.765 -14.909 4.766   1.00 0.00 ? 26  GLU A H    6  
ATOM   10510 H  HA   . GLU A 1 26  ? -12.324 -12.095 4.345   1.00 0.00 ? 26  GLU A HA   6  
ATOM   10511 H  HB2  . GLU A 1 26  ? -13.600 -14.212 6.140   1.00 0.00 ? 26  GLU A HB2  6  
ATOM   10512 H  HB3  . GLU A 1 26  ? -14.218 -12.568 5.936   1.00 0.00 ? 26  GLU A HB3  6  
ATOM   10513 H  HG2  . GLU A 1 26  ? -14.486 -12.974 3.492   1.00 0.00 ? 26  GLU A HG2  6  
ATOM   10514 H  HG3  . GLU A 1 26  ? -13.920 -14.630 3.706   1.00 0.00 ? 26  GLU A HG3  6  
ATOM   10515 N  N    . GLU A 1 27  ? -10.996 -13.126 7.199   1.00 0.00 ? 27  GLU A N    6  
ATOM   10516 C  CA   . GLU A 1 27  ? -10.323 -12.648 8.392   1.00 0.00 ? 27  GLU A CA   6  
ATOM   10517 C  C    . GLU A 1 27  ? -9.026  -11.960 8.017   1.00 0.00 ? 27  GLU A C    6  
ATOM   10518 O  O    . GLU A 1 27  ? -8.728  -10.917 8.593   1.00 0.00 ? 27  GLU A O    6  
ATOM   10519 C  CB   . GLU A 1 27  ? -10.038 -13.771 9.388   1.00 0.00 ? 27  GLU A CB   6  
ATOM   10520 C  CG   . GLU A 1 27  ? -11.327 -14.482 9.807   1.00 0.00 ? 27  GLU A CG   6  
ATOM   10521 C  CD   . GLU A 1 27  ? -11.156 -15.376 11.038  1.00 0.00 ? 27  GLU A CD   6  
ATOM   10522 O  OE1  . GLU A 1 27  ? -10.077 -15.387 11.664  1.00 0.00 ? 27  GLU A OE1  6  
ATOM   10523 O  OE2  . GLU A 1 27  ? -12.066 -16.157 11.391  1.00 0.00 ? 27  GLU A OE2  6  
ATOM   10524 H  H    . GLU A 1 27  ? -10.927 -14.118 7.009   1.00 0.00 ? 27  GLU A H    6  
ATOM   10525 H  HA   . GLU A 1 27  ? -10.962 -11.924 8.889   1.00 0.00 ? 27  GLU A HA   6  
ATOM   10526 H  HB2  . GLU A 1 27  ? -9.346  -14.495 8.956   1.00 0.00 ? 27  GLU A HB2  6  
ATOM   10527 H  HB3  . GLU A 1 27  ? -9.580  -13.314 10.265  1.00 0.00 ? 27  GLU A HB3  6  
ATOM   10528 H  HG2  . GLU A 1 27  ? -12.096 -13.739 10.014  1.00 0.00 ? 27  GLU A HG2  6  
ATOM   10529 H  HG3  . GLU A 1 27  ? -11.633 -15.095 8.964   1.00 0.00 ? 27  GLU A HG3  6  
ATOM   10530 N  N    . ARG A 1 28  ? -8.251  -12.497 7.061   1.00 0.00 ? 28  ARG A N    6  
ATOM   10531 C  CA   . ARG A 1 28  ? -7.032  -11.787 6.657   1.00 0.00 ? 28  ARG A CA   6  
ATOM   10532 C  C    . ARG A 1 28  ? -7.377  -10.434 6.049   1.00 0.00 ? 28  ARG A C    6  
ATOM   10533 O  O    . ARG A 1 28  ? -6.730  -9.448  6.402   1.00 0.00 ? 28  ARG A O    6  
ATOM   10534 C  CB   . ARG A 1 28  ? -6.127  -12.627 5.744   1.00 0.00 ? 28  ARG A CB   6  
ATOM   10535 C  CG   . ARG A 1 28  ? -5.413  -13.688 6.590   1.00 0.00 ? 28  ARG A CG   6  
ATOM   10536 C  CD   . ARG A 1 28  ? -4.204  -14.321 5.895   1.00 0.00 ? 28  ARG A CD   6  
ATOM   10537 N  NE   . ARG A 1 28  ? -3.438  -15.117 6.869   1.00 0.00 ? 28  ARG A NE   6  
ATOM   10538 C  CZ   . ARG A 1 28  ? -2.408  -15.932 6.618   1.00 0.00 ? 28  ARG A CZ   6  
ATOM   10539 N  NH1  . ARG A 1 28  ? -1.924  -16.061 5.386   1.00 0.00 ? 28  ARG A NH1  6  
ATOM   10540 N  NH2  . ARG A 1 28  ? -1.878  -16.618 7.625   1.00 0.00 ? 28  ARG A NH2  6  
ATOM   10541 H  H    . ARG A 1 28  ? -8.511  -13.388 6.626   1.00 0.00 ? 28  ARG A H    6  
ATOM   10542 H  HA   . ARG A 1 28  ? -6.472  -11.553 7.564   1.00 0.00 ? 28  ARG A HA   6  
ATOM   10543 H  HB2  . ARG A 1 28  ? -6.708  -13.094 4.948   1.00 0.00 ? 28  ARG A HB2  6  
ATOM   10544 H  HB3  . ARG A 1 28  ? -5.378  -11.968 5.299   1.00 0.00 ? 28  ARG A HB3  6  
ATOM   10545 H  HG2  . ARG A 1 28  ? -5.055  -13.222 7.509   1.00 0.00 ? 28  ARG A HG2  6  
ATOM   10546 H  HG3  . ARG A 1 28  ? -6.128  -14.467 6.851   1.00 0.00 ? 28  ARG A HG3  6  
ATOM   10547 H  HD2  . ARG A 1 28  ? -4.550  -14.955 5.077   1.00 0.00 ? 28  ARG A HD2  6  
ATOM   10548 H  HD3  . ARG A 1 28  ? -3.561  -13.533 5.499   1.00 0.00 ? 28  ARG A HD3  6  
ATOM   10549 H  HE   . ARG A 1 28  ? -3.758  -15.049 7.836   1.00 0.00 ? 28  ARG A HE   6  
ATOM   10550 H  HH11 . ARG A 1 28  ? -2.323  -15.541 4.618   1.00 0.00 ? 28  ARG A HH11 6  
ATOM   10551 H  HH12 . ARG A 1 28  ? -1.148  -16.673 5.175   1.00 0.00 ? 28  ARG A HH12 6  
ATOM   10552 H  HH21 . ARG A 1 28  ? -2.245  -16.529 8.564   1.00 0.00 ? 28  ARG A HH21 6  
ATOM   10553 H  HH22 . ARG A 1 28  ? -1.098  -17.249 7.493   1.00 0.00 ? 28  ARG A HH22 6  
ATOM   10554 N  N    . ALA A 1 29  ? -8.420  -10.357 5.219   1.00 0.00 ? 29  ALA A N    6  
ATOM   10555 C  CA   . ALA A 1 29  ? -8.874  -9.095  4.665   1.00 0.00 ? 29  ALA A CA   6  
ATOM   10556 C  C    . ALA A 1 29  ? -9.237  -8.113  5.783   1.00 0.00 ? 29  ALA A C    6  
ATOM   10557 O  O    . ALA A 1 29  ? -8.789  -6.968  5.751   1.00 0.00 ? 29  ALA A O    6  
ATOM   10558 C  CB   . ALA A 1 29  ? -10.055 -9.349  3.726   1.00 0.00 ? 29  ALA A CB   6  
ATOM   10559 H  H    . ALA A 1 29  ? -8.915  -11.194 4.948   1.00 0.00 ? 29  ALA A H    6  
ATOM   10560 H  HA   . ALA A 1 29  ? -8.057  -8.661  4.090   1.00 0.00 ? 29  ALA A HA   6  
ATOM   10561 H  HB1  . ALA A 1 29  ? -10.337 -8.417  3.241   1.00 0.00 ? 29  ALA A HB1  6  
ATOM   10562 H  HB2  . ALA A 1 29  ? -9.772  -10.069 2.958   1.00 0.00 ? 29  ALA A HB2  6  
ATOM   10563 H  HB3  . ALA A 1 29  ? -10.905 -9.742  4.282   1.00 0.00 ? 29  ALA A HB3  6  
ATOM   10564 N  N    . MET A 1 30  ? -9.994  -8.552  6.795   1.00 0.00 ? 30  MET A N    6  
ATOM   10565 C  CA   . MET A 1 30  ? -10.365 -7.697  7.918   1.00 0.00 ? 30  MET A CA   6  
ATOM   10566 C  C    . MET A 1 30  ? -9.158  -7.295  8.765   1.00 0.00 ? 30  MET A C    6  
ATOM   10567 O  O    . MET A 1 30  ? -9.054  -6.126  9.126   1.00 0.00 ? 30  MET A O    6  
ATOM   10568 C  CB   . MET A 1 30  ? -11.456 -8.354  8.770   1.00 0.00 ? 30  MET A CB   6  
ATOM   10569 C  CG   . MET A 1 30  ? -12.817 -8.403  8.060   1.00 0.00 ? 30  MET A CG   6  
ATOM   10570 S  SD   . MET A 1 30  ? -13.595 -6.806  7.659   1.00 0.00 ? 30  MET A SD   6  
ATOM   10571 C  CE   . MET A 1 30  ? -12.921 -6.451  6.009   1.00 0.00 ? 30  MET A CE   6  
ATOM   10572 H  H    . MET A 1 30  ? -10.335 -9.509  6.788   1.00 0.00 ? 30  MET A H    6  
ATOM   10573 H  HA   . MET A 1 30  ? -10.769 -6.772  7.524   1.00 0.00 ? 30  MET A HA   6  
ATOM   10574 H  HB2  . MET A 1 30  ? -11.150 -9.366  9.037   1.00 0.00 ? 30  MET A HB2  6  
ATOM   10575 H  HB3  . MET A 1 30  ? -11.574 -7.784  9.690   1.00 0.00 ? 30  MET A HB3  6  
ATOM   10576 H  HG2  . MET A 1 30  ? -12.729 -8.986  7.145   1.00 0.00 ? 30  MET A HG2  6  
ATOM   10577 H  HG3  . MET A 1 30  ? -13.501 -8.940  8.718   1.00 0.00 ? 30  MET A HG3  6  
ATOM   10578 H  HE1  . MET A 1 30  ? -12.810 -7.378  5.450   1.00 0.00 ? 30  MET A HE1  6  
ATOM   10579 H  HE2  . MET A 1 30  ? -13.602 -5.787  5.477   1.00 0.00 ? 30  MET A HE2  6  
ATOM   10580 H  HE3  . MET A 1 30  ? -11.952 -5.962  6.078   1.00 0.00 ? 30  MET A HE3  6  
ATOM   10581 N  N    . GLY A 1 31  ? -8.226  -8.206  9.048   1.00 0.00 ? 31  GLY A N    6  
ATOM   10582 C  CA   . GLY A 1 31  ? -7.035  -7.906  9.830   1.00 0.00 ? 31  GLY A CA   6  
ATOM   10583 C  C    . GLY A 1 31  ? -6.221  -6.800  9.164   1.00 0.00 ? 31  GLY A C    6  
ATOM   10584 O  O    . GLY A 1 31  ? -5.902  -5.793  9.804   1.00 0.00 ? 31  GLY A O    6  
ATOM   10585 H  H    . GLY A 1 31  ? -8.357  -9.166  8.744   1.00 0.00 ? 31  GLY A H    6  
ATOM   10586 H  HA2  . GLY A 1 31  ? -7.327  -7.591  10.833  1.00 0.00 ? 31  GLY A HA2  6  
ATOM   10587 H  HA3  . GLY A 1 31  ? -6.425  -8.806  9.901   1.00 0.00 ? 31  GLY A HA3  6  
ATOM   10588 N  N    . TRP A 1 32  ? -5.956  -6.949  7.861   1.00 0.00 ? 32  TRP A N    6  
ATOM   10589 C  CA   . TRP A 1 32  ? -5.286  -5.920  7.081   1.00 0.00 ? 32  TRP A CA   6  
ATOM   10590 C  C    . TRP A 1 32  ? -6.091  -4.620  7.091   1.00 0.00 ? 32  TRP A C    6  
ATOM   10591 O  O    . TRP A 1 32  ? -5.522  -3.570  7.376   1.00 0.00 ? 32  TRP A O    6  
ATOM   10592 C  CB   . TRP A 1 32  ? -5.034  -6.411  5.648   1.00 0.00 ? 32  TRP A CB   6  
ATOM   10593 C  CG   . TRP A 1 32  ? -3.809  -7.259  5.505   1.00 0.00 ? 32  TRP A CG   6  
ATOM   10594 C  CD1  . TRP A 1 32  ? -3.765  -8.596  5.324   1.00 0.00 ? 32  TRP A CD1  6  
ATOM   10595 C  CD2  . TRP A 1 32  ? -2.420  -6.825  5.534   1.00 0.00 ? 32  TRP A CD2  6  
ATOM   10596 N  NE1  . TRP A 1 32  ? -2.455  -9.019  5.222   1.00 0.00 ? 32  TRP A NE1  6  
ATOM   10597 C  CE2  . TRP A 1 32  ? -1.577  -7.966  5.397   1.00 0.00 ? 32  TRP A CE2  6  
ATOM   10598 C  CE3  . TRP A 1 32  ? -1.795  -5.569  5.669   1.00 0.00 ? 32  TRP A CE3  6  
ATOM   10599 C  CZ2  . TRP A 1 32  ? -0.179  -7.857  5.435   1.00 0.00 ? 32  TRP A CZ2  6  
ATOM   10600 C  CZ3  . TRP A 1 32  ? -0.394  -5.446  5.677   1.00 0.00 ? 32  TRP A CZ3  6  
ATOM   10601 C  CH2  . TRP A 1 32  ? 0.413   -6.589  5.562   1.00 0.00 ? 32  TRP A CH2  6  
ATOM   10602 H  H    . TRP A 1 32  ? -6.264  -7.785  7.377   1.00 0.00 ? 32  TRP A H    6  
ATOM   10603 H  HA   . TRP A 1 32  ? -4.322  -5.719  7.549   1.00 0.00 ? 32  TRP A HA   6  
ATOM   10604 H  HB2  . TRP A 1 32  ? -5.908  -6.948  5.275   1.00 0.00 ? 32  TRP A HB2  6  
ATOM   10605 H  HB3  . TRP A 1 32  ? -4.893  -5.539  5.007   1.00 0.00 ? 32  TRP A HB3  6  
ATOM   10606 H  HD1  . TRP A 1 32  ? -4.634  -9.232  5.240   1.00 0.00 ? 32  TRP A HD1  6  
ATOM   10607 H  HE1  . TRP A 1 32  ? -2.204  -9.972  4.971   1.00 0.00 ? 32  TRP A HE1  6  
ATOM   10608 H  HE3  . TRP A 1 32  ? -2.411  -4.691  5.758   1.00 0.00 ? 32  TRP A HE3  6  
ATOM   10609 H  HZ2  . TRP A 1 32  ? 0.435   -8.739  5.353   1.00 0.00 ? 32  TRP A HZ2  6  
ATOM   10610 H  HZ3  . TRP A 1 32  ? 0.063   -4.470  5.776   1.00 0.00 ? 32  TRP A HZ3  6  
ATOM   10611 H  HH2  . TRP A 1 32  ? 1.488   -6.486  5.570   1.00 0.00 ? 32  TRP A HH2  6  
ATOM   10612 N  N    . TYR A 1 33  ? -7.399  -4.680  6.823   1.00 0.00 ? 33  TYR A N    6  
ATOM   10613 C  CA   . TYR A 1 33  ? -8.265  -3.507  6.742   1.00 0.00 ? 33  TYR A CA   6  
ATOM   10614 C  C    . TYR A 1 33  ? -8.236  -2.701  8.042   1.00 0.00 ? 33  TYR A C    6  
ATOM   10615 O  O    . TYR A 1 33  ? -8.067  -1.482  7.996   1.00 0.00 ? 33  TYR A O    6  
ATOM   10616 C  CB   . TYR A 1 33  ? -9.693  -3.964  6.397   1.00 0.00 ? 33  TYR A CB   6  
ATOM   10617 C  CG   . TYR A 1 33  ? -10.801 -2.947  6.605   1.00 0.00 ? 33  TYR A CG   6  
ATOM   10618 C  CD1  . TYR A 1 33  ? -10.749 -1.682  5.990   1.00 0.00 ? 33  TYR A CD1  6  
ATOM   10619 C  CD2  . TYR A 1 33  ? -11.897 -3.275  7.423   1.00 0.00 ? 33  TYR A CD2  6  
ATOM   10620 C  CE1  . TYR A 1 33  ? -11.782 -0.751  6.193   1.00 0.00 ? 33  TYR A CE1  6  
ATOM   10621 C  CE2  . TYR A 1 33  ? -12.923 -2.343  7.652   1.00 0.00 ? 33  TYR A CE2  6  
ATOM   10622 C  CZ   . TYR A 1 33  ? -12.876 -1.074  7.028   1.00 0.00 ? 33  TYR A CZ   6  
ATOM   10623 O  OH   . TYR A 1 33  ? -13.864 -0.158  7.235   1.00 0.00 ? 33  TYR A OH   6  
ATOM   10624 H  H    . TYR A 1 33  ? -7.825  -5.586  6.652   1.00 0.00 ? 33  TYR A H    6  
ATOM   10625 H  HA   . TYR A 1 33  ? -7.903  -2.864  5.940   1.00 0.00 ? 33  TYR A HA   6  
ATOM   10626 H  HB2  . TYR A 1 33  ? -9.718  -4.297  5.361   1.00 0.00 ? 33  TYR A HB2  6  
ATOM   10627 H  HB3  . TYR A 1 33  ? -9.923  -4.827  7.015   1.00 0.00 ? 33  TYR A HB3  6  
ATOM   10628 H  HD1  . TYR A 1 33  ? -9.915  -1.418  5.359   1.00 0.00 ? 33  TYR A HD1  6  
ATOM   10629 H  HD2  . TYR A 1 33  ? -11.948 -4.245  7.898   1.00 0.00 ? 33  TYR A HD2  6  
ATOM   10630 H  HE1  . TYR A 1 33  ? -11.737 0.214   5.712   1.00 0.00 ? 33  TYR A HE1  6  
ATOM   10631 H  HE2  . TYR A 1 33  ? -13.736 -2.604  8.313   1.00 0.00 ? 33  TYR A HE2  6  
ATOM   10632 H  HH   . TYR A 1 33  ? -14.557 -0.467  7.839   1.00 0.00 ? 33  TYR A HH   6  
ATOM   10633 N  N    . TYR A 1 34  ? -8.364  -3.359  9.198   1.00 0.00 ? 34  TYR A N    6  
ATOM   10634 C  CA   . TYR A 1 34  ? -8.436  -2.677  10.481  1.00 0.00 ? 34  TYR A CA   6  
ATOM   10635 C  C    . TYR A 1 34  ? -7.112  -1.978  10.790  1.00 0.00 ? 34  TYR A C    6  
ATOM   10636 O  O    . TYR A 1 34  ? -7.118  -0.820  11.206  1.00 0.00 ? 34  TYR A O    6  
ATOM   10637 C  CB   . TYR A 1 34  ? -8.774  -3.680  11.598  1.00 0.00 ? 34  TYR A CB   6  
ATOM   10638 C  CG   . TYR A 1 34  ? -10.100 -4.431  11.524  1.00 0.00 ? 34  TYR A CG   6  
ATOM   10639 C  CD1  . TYR A 1 34  ? -11.167 -4.016  10.696  1.00 0.00 ? 34  TYR A CD1  6  
ATOM   10640 C  CD2  . TYR A 1 34  ? -10.261 -5.573  12.335  1.00 0.00 ? 34  TYR A CD2  6  
ATOM   10641 C  CE1  . TYR A 1 34  ? -12.383 -4.726  10.696  1.00 0.00 ? 34  TYR A CE1  6  
ATOM   10642 C  CE2  . TYR A 1 34  ? -11.470 -6.290  12.334  1.00 0.00 ? 34  TYR A CE2  6  
ATOM   10643 C  CZ   . TYR A 1 34  ? -12.541 -5.867  11.516  1.00 0.00 ? 34  TYR A CZ   6  
ATOM   10644 O  OH   . TYR A 1 34  ? -13.710 -6.566  11.527  1.00 0.00 ? 34  TYR A OH   6  
ATOM   10645 H  H    . TYR A 1 34  ? -8.416  -4.371  9.211   1.00 0.00 ? 34  TYR A H    6  
ATOM   10646 H  HA   . TYR A 1 34  ? -9.218  -1.918  10.437  1.00 0.00 ? 34  TYR A HA   6  
ATOM   10647 H  HB2  . TYR A 1 34  ? -7.972  -4.418  11.644  1.00 0.00 ? 34  TYR A HB2  6  
ATOM   10648 H  HB3  . TYR A 1 34  ? -8.763  -3.136  12.544  1.00 0.00 ? 34  TYR A HB3  6  
ATOM   10649 H  HD1  . TYR A 1 34  ? -11.065 -3.162  10.041  1.00 0.00 ? 34  TYR A HD1  6  
ATOM   10650 H  HD2  . TYR A 1 34  ? -9.447  -5.904  12.965  1.00 0.00 ? 34  TYR A HD2  6  
ATOM   10651 H  HE1  . TYR A 1 34  ? -13.194 -4.397  10.061  1.00 0.00 ? 34  TYR A HE1  6  
ATOM   10652 H  HE2  . TYR A 1 34  ? -11.577 -7.164  12.962  1.00 0.00 ? 34  TYR A HE2  6  
ATOM   10653 H  HH   . TYR A 1 34  ? -14.385 -6.199  10.935  1.00 0.00 ? 34  TYR A HH   6  
ATOM   10654 N  N    . TYR A 1 35  ? -5.978  -2.655  10.584  1.00 0.00 ? 35  TYR A N    6  
ATOM   10655 C  CA   . TYR A 1 35  ? -4.673  -2.081  10.887  1.00 0.00 ? 35  TYR A CA   6  
ATOM   10656 C  C    . TYR A 1 35  ? -4.330  -0.960  9.905   1.00 0.00 ? 35  TYR A C    6  
ATOM   10657 O  O    . TYR A 1 35  ? -3.783  0.063   10.323  1.00 0.00 ? 35  TYR A O    6  
ATOM   10658 C  CB   . TYR A 1 35  ? -3.618  -3.193  10.840  1.00 0.00 ? 35  TYR A CB   6  
ATOM   10659 C  CG   . TYR A 1 35  ? -2.220  -2.736  11.210  1.00 0.00 ? 35  TYR A CG   6  
ATOM   10660 C  CD1  . TYR A 1 35  ? -1.347  -2.259  10.212  1.00 0.00 ? 35  TYR A CD1  6  
ATOM   10661 C  CD2  . TYR A 1 35  ? -1.788  -2.792  12.549  1.00 0.00 ? 35  TYR A CD2  6  
ATOM   10662 C  CE1  . TYR A 1 35  ? -0.047  -1.844  10.545  1.00 0.00 ? 35  TYR A CE1  6  
ATOM   10663 C  CE2  . TYR A 1 35  ? -0.486  -2.385  12.889  1.00 0.00 ? 35  TYR A CE2  6  
ATOM   10664 C  CZ   . TYR A 1 35  ? 0.392   -1.908  11.888  1.00 0.00 ? 35  TYR A CZ   6  
ATOM   10665 O  OH   . TYR A 1 35  ? 1.654   -1.519  12.228  1.00 0.00 ? 35  TYR A OH   6  
ATOM   10666 H  H    . TYR A 1 35  ? -6.011  -3.603  10.225  1.00 0.00 ? 35  TYR A H    6  
ATOM   10667 H  HA   . TYR A 1 35  ? -4.703  -1.646  11.893  1.00 0.00 ? 35  TYR A HA   6  
ATOM   10668 H  HB2  . TYR A 1 35  ? -3.916  -3.989  11.525  1.00 0.00 ? 35  TYR A HB2  6  
ATOM   10669 H  HB3  . TYR A 1 35  ? -3.596  -3.618  9.835   1.00 0.00 ? 35  TYR A HB3  6  
ATOM   10670 H  HD1  . TYR A 1 35  ? -1.672  -2.216  9.182   1.00 0.00 ? 35  TYR A HD1  6  
ATOM   10671 H  HD2  . TYR A 1 35  ? -2.451  -3.161  13.320  1.00 0.00 ? 35  TYR A HD2  6  
ATOM   10672 H  HE1  . TYR A 1 35  ? 0.609   -1.480  9.767   1.00 0.00 ? 35  TYR A HE1  6  
ATOM   10673 H  HE2  . TYR A 1 35  ? -0.159  -2.441  13.917  1.00 0.00 ? 35  TYR A HE2  6  
ATOM   10674 H  HH   . TYR A 1 35  ? 2.176   -1.205  11.473  1.00 0.00 ? 35  TYR A HH   6  
ATOM   10675 N  N    . LEU A 1 36  ? -4.656  -1.121  8.616   1.00 0.00 ? 36  LEU A N    6  
ATOM   10676 C  CA   . LEU A 1 36  ? -4.417  -0.094  7.615   1.00 0.00 ? 36  LEU A CA   6  
ATOM   10677 C  C    . LEU A 1 36  ? -5.237  1.129   7.958   1.00 0.00 ? 36  LEU A C    6  
ATOM   10678 O  O    . LEU A 1 36  ? -4.627  2.188   8.073   1.00 0.00 ? 36  LEU A O    6  
ATOM   10679 C  CB   . LEU A 1 36  ? -4.735  -0.580  6.192   1.00 0.00 ? 36  LEU A CB   6  
ATOM   10680 C  CG   . LEU A 1 36  ? -3.499  -1.062  5.411   1.00 0.00 ? 36  LEU A CG   6  
ATOM   10681 C  CD1  . LEU A 1 36  ? -2.542  -1.962  6.203   1.00 0.00 ? 36  LEU A CD1  6  
ATOM   10682 C  CD2  . LEU A 1 36  ? -3.975  -1.808  4.161   1.00 0.00 ? 36  LEU A CD2  6  
ATOM   10683 H  H    . LEU A 1 36  ? -5.116  -1.962  8.310   1.00 0.00 ? 36  LEU A H    6  
ATOM   10684 H  HA   . LEU A 1 36  ? -3.369  0.205   7.662   1.00 0.00 ? 36  LEU A HA   6  
ATOM   10685 H  HB2  . LEU A 1 36  ? -5.501  -1.352  6.227   1.00 0.00 ? 36  LEU A HB2  6  
ATOM   10686 H  HB3  . LEU A 1 36  ? -5.157  0.253   5.626   1.00 0.00 ? 36  LEU A HB3  6  
ATOM   10687 H  HG   . LEU A 1 36  ? -2.935  -0.181  5.105   1.00 0.00 ? 36  LEU A HG   6  
ATOM   10688 H  HD11 . LEU A 1 36  ? -1.787  -2.378  5.535   1.00 0.00 ? 36  LEU A HD11 6  
ATOM   10689 H  HD12 . LEU A 1 36  ? -2.024  -1.381  6.964   1.00 0.00 ? 36  LEU A HD12 6  
ATOM   10690 H  HD13 . LEU A 1 36  ? -3.098  -2.766  6.683   1.00 0.00 ? 36  LEU A HD13 6  
ATOM   10691 H  HD21 . LEU A 1 36  ? -4.472  -2.735  4.448   1.00 0.00 ? 36  LEU A HD21 6  
ATOM   10692 H  HD22 . LEU A 1 36  ? -4.676  -1.186  3.604   1.00 0.00 ? 36  LEU A HD22 6  
ATOM   10693 H  HD23 . LEU A 1 36  ? -3.127  -2.040  3.518   1.00 0.00 ? 36  LEU A HD23 6  
ATOM   10694 N  N    . ASP A 1 37  ? -6.552  1.001   8.203   1.00 0.00 ? 37  ASP A N    6  
ATOM   10695 C  CA   . ASP A 1 37  ? -7.337  2.153   8.644   1.00 0.00 ? 37  ASP A CA   6  
ATOM   10696 C  C    . ASP A 1 37  ? -6.663  2.745   9.830   1.00 0.00 ? 37  ASP A C    6  
ATOM   10697 O  O    . ASP A 1 37  ? -6.444  3.959   9.829   1.00 0.00 ? 37  ASP A O    6  
ATOM   10698 C  CB   . ASP A 1 37  ? -8.787  1.858   9.090   1.00 0.00 ? 37  ASP A CB   6  
ATOM   10699 C  CG   . ASP A 1 37  ? -9.532  3.034   9.824   1.00 0.00 ? 37  ASP A CG   6  
ATOM   10700 O  OD1  . ASP A 1 37  ? -8.995  3.799   10.680  1.00 0.00 ? 37  ASP A OD1  6  
ATOM   10701 O  OD2  . ASP A 1 37  ? -10.752 3.155   9.574   1.00 0.00 ? 37  ASP A OD2  6  
ATOM   10702 H  H    . ASP A 1 37  ? -6.995  0.084   8.172   1.00 0.00 ? 37  ASP A H    6  
ATOM   10703 H  HA   . ASP A 1 37  ? -7.325  2.903   7.860   1.00 0.00 ? 37  ASP A HA   6  
ATOM   10704 H  HB2  . ASP A 1 37  ? -9.354  1.569   8.203   1.00 0.00 ? 37  ASP A HB2  6  
ATOM   10705 H  HB3  . ASP A 1 37  ? -8.779  0.996   9.760   1.00 0.00 ? 37  ASP A HB3  6  
ATOM   10706 N  N    . ASP A 1 38  ? -6.315  1.936   10.839  1.00 0.00 ? 38  ASP A N    6  
ATOM   10707 C  CA   . ASP A 1 38  ? -5.917  2.607   12.043  1.00 0.00 ? 38  ASP A CA   6  
ATOM   10708 C  C    . ASP A 1 38  ? -4.649  3.433   11.876  1.00 0.00 ? 38  ASP A C    6  
ATOM   10709 O  O    . ASP A 1 38  ? -4.573  4.535   12.422  1.00 0.00 ? 38  ASP A O    6  
ATOM   10710 C  CB   . ASP A 1 38  ? -5.991  1.819   13.340  1.00 0.00 ? 38  ASP A CB   6  
ATOM   10711 C  CG   . ASP A 1 38  ? -6.162  2.868   14.476  1.00 0.00 ? 38  ASP A CG   6  
ATOM   10712 O  OD1  . ASP A 1 38  ? -6.761  3.958   14.235  1.00 0.00 ? 38  ASP A OD1  6  
ATOM   10713 O  OD2  . ASP A 1 38  ? -5.709  2.602   15.612  1.00 0.00 ? 38  ASP A OD2  6  
ATOM   10714 H  H    . ASP A 1 38  ? -6.442  0.927   10.821  1.00 0.00 ? 38  ASP A H    6  
ATOM   10715 H  HA   . ASP A 1 38  ? -6.736  3.302   12.133  1.00 0.00 ? 38  ASP A HA   6  
ATOM   10716 H  HB2  . ASP A 1 38  ? -6.860  1.158   13.322  1.00 0.00 ? 38  ASP A HB2  6  
ATOM   10717 H  HB3  . ASP A 1 38  ? -5.091  1.208   13.459  1.00 0.00 ? 38  ASP A HB3  6  
ATOM   10718 N  N    . THR A 1 39  ? -3.765  2.984   10.992  1.00 0.00 ? 39  THR A N    6  
ATOM   10719 C  CA   . THR A 1 39  ? -2.480  3.610   10.767  1.00 0.00 ? 39  THR A CA   6  
ATOM   10720 C  C    . THR A 1 39  ? -2.650  4.855   9.881   1.00 0.00 ? 39  THR A C    6  
ATOM   10721 O  O    . THR A 1 39  ? -2.024  5.886   10.133  1.00 0.00 ? 39  THR A O    6  
ATOM   10722 C  CB   . THR A 1 39  ? -1.565  2.543   10.147  1.00 0.00 ? 39  THR A CB   6  
ATOM   10723 O  OG1  . THR A 1 39  ? -1.492  1.395   10.969  1.00 0.00 ? 39  THR A OG1  6  
ATOM   10724 C  CG2  . THR A 1 39  ? -0.161  3.095   9.960   1.00 0.00 ? 39  THR A CG2  6  
ATOM   10725 H  H    . THR A 1 39  ? -4.058  2.243   10.341  1.00 0.00 ? 39  THR A H    6  
ATOM   10726 H  HA   . THR A 1 39  ? -2.064  3.921   11.727  1.00 0.00 ? 39  THR A HA   6  
ATOM   10727 H  HB   . THR A 1 39  ? -1.965  2.248   9.176   1.00 0.00 ? 39  THR A HB   6  
ATOM   10728 H  HG1  . THR A 1 39  ? -2.317  0.894   10.826  1.00 0.00 ? 39  THR A HG1  6  
ATOM   10729 H  HG21 . THR A 1 39  ? 0.482   2.344   9.502   1.00 0.00 ? 39  THR A HG21 6  
ATOM   10730 H  HG22 . THR A 1 39  ? -0.244  3.947   9.292   1.00 0.00 ? 39  THR A HG22 6  
ATOM   10731 H  HG23 . THR A 1 39  ? 0.257   3.419   10.912  1.00 0.00 ? 39  THR A HG23 6  
ATOM   10732 N  N    . LEU A 1 40  ? -3.506  4.771   8.861   1.00 0.00 ? 40  LEU A N    6  
ATOM   10733 C  CA   . LEU A 1 40  ? -3.920  5.900   8.034   1.00 0.00 ? 40  LEU A CA   6  
ATOM   10734 C  C    . LEU A 1 40  ? -4.695  6.917   8.889   1.00 0.00 ? 40  LEU A C    6  
ATOM   10735 O  O    . LEU A 1 40  ? -5.466  6.556   9.789   1.00 0.00 ? 40  LEU A O    6  
ATOM   10736 C  CB   . LEU A 1 40  ? -4.825  5.419   6.881   1.00 0.00 ? 40  LEU A CB   6  
ATOM   10737 C  CG   . LEU A 1 40  ? -4.204  4.386   5.915   1.00 0.00 ? 40  LEU A CG   6  
ATOM   10738 C  CD1  . LEU A 1 40  ? -5.307  3.693   5.104   1.00 0.00 ? 40  LEU A CD1  6  
ATOM   10739 C  CD2  . LEU A 1 40  ? -3.190  4.970   4.933   1.00 0.00 ? 40  LEU A CD2  6  
ATOM   10740 H  H    . LEU A 1 40  ? -3.959  3.887   8.687   1.00 0.00 ? 40  LEU A H    6  
ATOM   10741 H  HA   . LEU A 1 40  ? -3.033  6.369   7.608   1.00 0.00 ? 40  LEU A HA   6  
ATOM   10742 H  HB2  . LEU A 1 40  ? -5.717  4.978   7.332   1.00 0.00 ? 40  LEU A HB2  6  
ATOM   10743 H  HB3  . LEU A 1 40  ? -5.146  6.287   6.304   1.00 0.00 ? 40  LEU A HB3  6  
ATOM   10744 H  HG   . LEU A 1 40  ? -3.670  3.642   6.497   1.00 0.00 ? 40  LEU A HG   6  
ATOM   10745 H  HD11 . LEU A 1 40  ? -5.837  4.415   4.483   1.00 0.00 ? 40  LEU A HD11 6  
ATOM   10746 H  HD12 . LEU A 1 40  ? -4.873  2.921   4.467   1.00 0.00 ? 40  LEU A HD12 6  
ATOM   10747 H  HD13 . LEU A 1 40  ? -6.013  3.215   5.782   1.00 0.00 ? 40  LEU A HD13 6  
ATOM   10748 H  HD21 . LEU A 1 40  ? -2.815  4.174   4.292   1.00 0.00 ? 40  LEU A HD21 6  
ATOM   10749 H  HD22 . LEU A 1 40  ? -3.647  5.733   4.308   1.00 0.00 ? 40  LEU A HD22 6  
ATOM   10750 H  HD23 . LEU A 1 40  ? -2.349  5.388   5.477   1.00 0.00 ? 40  LEU A HD23 6  
ATOM   10751 N  N    . GLU A 1 41  ? -4.576  8.195   8.532   1.00 0.00 ? 41  GLU A N    6  
ATOM   10752 C  CA   . GLU A 1 41  ? -5.337  9.305   9.106   1.00 0.00 ? 41  GLU A CA   6  
ATOM   10753 C  C    . GLU A 1 41  ? -5.996  10.091  7.961   1.00 0.00 ? 41  GLU A C    6  
ATOM   10754 O  O    . GLU A 1 41  ? -5.810  11.300  7.804   1.00 0.00 ? 41  GLU A O    6  
ATOM   10755 C  CB   . GLU A 1 41  ? -4.436  10.149  10.026  1.00 0.00 ? 41  GLU A CB   6  
ATOM   10756 C  CG   . GLU A 1 41  ? -4.035  9.403   11.309  1.00 0.00 ? 41  GLU A CG   6  
ATOM   10757 C  CD   . GLU A 1 41  ? -5.215  9.226   12.286  1.00 0.00 ? 41  GLU A CD   6  
ATOM   10758 O  OE1  . GLU A 1 41  ? -5.465  10.138  13.108  1.00 0.00 ? 41  GLU A OE1  6  
ATOM   10759 O  OE2  . GLU A 1 41  ? -5.902  8.175   12.261  1.00 0.00 ? 41  GLU A OE2  6  
ATOM   10760 H  H    . GLU A 1 41  ? -3.821  8.448   7.905   1.00 0.00 ? 41  GLU A H    6  
ATOM   10761 H  HA   . GLU A 1 41  ? -6.152  8.906   9.710   1.00 0.00 ? 41  GLU A HA   6  
ATOM   10762 H  HB2  . GLU A 1 41  ? -3.533  10.430  9.481   1.00 0.00 ? 41  GLU A HB2  6  
ATOM   10763 H  HB3  . GLU A 1 41  ? -4.958  11.063  10.312  1.00 0.00 ? 41  GLU A HB3  6  
ATOM   10764 H  HG2  . GLU A 1 41  ? -3.610  8.433   11.043  1.00 0.00 ? 41  GLU A HG2  6  
ATOM   10765 H  HG3  . GLU A 1 41  ? -3.249  9.977   11.802  1.00 0.00 ? 41  GLU A HG3  6  
ATOM   10766 N  N    . PHE A 1 42  ? -6.738  9.365   7.117   1.00 0.00 ? 42  PHE A N    6  
ATOM   10767 C  CA   . PHE A 1 42  ? -7.589  9.924   6.068   1.00 0.00 ? 42  PHE A CA   6  
ATOM   10768 C  C    . PHE A 1 42  ? -8.684  10.846  6.653   1.00 0.00 ? 42  PHE A C    6  
ATOM   10769 O  O    . PHE A 1 42  ? -8.983  10.730  7.848   1.00 0.00 ? 42  PHE A O    6  
ATOM   10770 C  CB   . PHE A 1 42  ? -8.155  8.761   5.234   1.00 0.00 ? 42  PHE A CB   6  
ATOM   10771 C  CG   . PHE A 1 42  ? -8.936  7.695   5.988   1.00 0.00 ? 42  PHE A CG   6  
ATOM   10772 C  CD1  . PHE A 1 42  ? -10.223 7.976   6.490   1.00 0.00 ? 42  PHE A CD1  6  
ATOM   10773 C  CD2  . PHE A 1 42  ? -8.430  6.382   6.078   1.00 0.00 ? 42  PHE A CD2  6  
ATOM   10774 C  CE1  . PHE A 1 42  ? -10.992 6.958   7.078   1.00 0.00 ? 42  PHE A CE1  6  
ATOM   10775 C  CE2  . PHE A 1 42  ? -9.199  5.365   6.670   1.00 0.00 ? 42  PHE A CE2  6  
ATOM   10776 C  CZ   . PHE A 1 42  ? -10.483 5.652   7.163   1.00 0.00 ? 42  PHE A CZ   6  
ATOM   10777 H  H    . PHE A 1 42  ? -6.844  8.380   7.311   1.00 0.00 ? 42  PHE A H    6  
ATOM   10778 H  HA   . PHE A 1 42  ? -6.958  10.528  5.424   1.00 0.00 ? 42  PHE A HA   6  
ATOM   10779 H  HB2  . PHE A 1 42  ? -8.802  9.151   4.454   1.00 0.00 ? 42  PHE A HB2  6  
ATOM   10780 H  HB3  . PHE A 1 42  ? -7.321  8.282   4.720   1.00 0.00 ? 42  PHE A HB3  6  
ATOM   10781 H  HD1  . PHE A 1 42  ? -10.647 8.966   6.392   1.00 0.00 ? 42  PHE A HD1  6  
ATOM   10782 H  HD2  . PHE A 1 42  ? -7.459  6.142   5.668   1.00 0.00 ? 42  PHE A HD2  6  
ATOM   10783 H  HE1  . PHE A 1 42  ? -11.984 7.177   7.450   1.00 0.00 ? 42  PHE A HE1  6  
ATOM   10784 H  HE2  . PHE A 1 42  ? -8.809  4.360   6.736   1.00 0.00 ? 42  PHE A HE2  6  
ATOM   10785 H  HZ   . PHE A 1 42  ? -11.084 4.868   7.604   1.00 0.00 ? 42  PHE A HZ   6  
ATOM   10786 N  N    . PRO A 1 43  ? -9.332  11.726  5.858   1.00 0.00 ? 43  PRO A N    6  
ATOM   10787 C  CA   . PRO A 1 43  ? -9.104  11.990  4.433   1.00 0.00 ? 43  PRO A CA   6  
ATOM   10788 C  C    . PRO A 1 43  ? -7.720  12.597  4.177   1.00 0.00 ? 43  PRO A C    6  
ATOM   10789 O  O    . PRO A 1 43  ? -7.180  13.292  5.042   1.00 0.00 ? 43  PRO A O    6  
ATOM   10790 C  CB   . PRO A 1 43  ? -10.219 12.958  4.016   1.00 0.00 ? 43  PRO A CB   6  
ATOM   10791 C  CG   . PRO A 1 43  ? -10.564 13.697  5.304   1.00 0.00 ? 43  PRO A CG   6  
ATOM   10792 C  CD   . PRO A 1 43  ? -10.368 12.618  6.365   1.00 0.00 ? 43  PRO A CD   6  
ATOM   10793 H  HA   . PRO A 1 43  ? -9.212  11.080  3.850   1.00 0.00 ? 43  PRO A HA   6  
ATOM   10794 H  HB2  . PRO A 1 43  ? -9.906  13.642  3.225   1.00 0.00 ? 43  PRO A HB2  6  
ATOM   10795 H  HB3  . PRO A 1 43  ? -11.091 12.391  3.693   1.00 0.00 ? 43  PRO A HB3  6  
ATOM   10796 H  HG2  . PRO A 1 43  ? -9.854  14.510  5.467   1.00 0.00 ? 43  PRO A HG2  6  
ATOM   10797 H  HG3  . PRO A 1 43  ? -11.587 14.075  5.295   1.00 0.00 ? 43  PRO A HG3  6  
ATOM   10798 H  HD2  . PRO A 1 43  ? -10.073 13.074  7.312   1.00 0.00 ? 43  PRO A HD2  6  
ATOM   10799 H  HD3  . PRO A 1 43  ? -11.293 12.055  6.495   1.00 0.00 ? 43  PRO A HD3  6  
ATOM   10800 N  N    . PHE A 1 44  ? -7.141  12.340  3.000   1.00 0.00 ? 44  PHE A N    6  
ATOM   10801 C  CA   . PHE A 1 44  ? -5.863  12.929  2.595   1.00 0.00 ? 44  PHE A CA   6  
ATOM   10802 C  C    . PHE A 1 44  ? -5.808  13.061  1.073   1.00 0.00 ? 44  PHE A C    6  
ATOM   10803 O  O    . PHE A 1 44  ? -6.618  12.467  0.369   1.00 0.00 ? 44  PHE A O    6  
ATOM   10804 C  CB   . PHE A 1 44  ? -4.676  12.116  3.149   1.00 0.00 ? 44  PHE A CB   6  
ATOM   10805 C  CG   . PHE A 1 44  ? -4.562  10.658  2.728   1.00 0.00 ? 44  PHE A CG   6  
ATOM   10806 C  CD1  . PHE A 1 44  ? -4.119  10.326  1.436   1.00 0.00 ? 44  PHE A CD1  6  
ATOM   10807 C  CD2  . PHE A 1 44  ? -4.827  9.621   3.641   1.00 0.00 ? 44  PHE A CD2  6  
ATOM   10808 C  CE1  . PHE A 1 44  ? -3.958  8.989   1.044   1.00 0.00 ? 44  PHE A CE1  6  
ATOM   10809 C  CE2  . PHE A 1 44  ? -4.699  8.277   3.246   1.00 0.00 ? 44  PHE A CE2  6  
ATOM   10810 C  CZ   . PHE A 1 44  ? -4.255  7.957   1.950   1.00 0.00 ? 44  PHE A CZ   6  
ATOM   10811 H  H    . PHE A 1 44  ? -7.641  11.798  2.293   1.00 0.00 ? 44  PHE A H    6  
ATOM   10812 H  HA   . PHE A 1 44  ? -5.795  13.935  3.013   1.00 0.00 ? 44  PHE A HA   6  
ATOM   10813 H  HB2  . PHE A 1 44  ? -3.764  12.625  2.840   1.00 0.00 ? 44  PHE A HB2  6  
ATOM   10814 H  HB3  . PHE A 1 44  ? -4.703  12.165  4.239   1.00 0.00 ? 44  PHE A HB3  6  
ATOM   10815 H  HD1  . PHE A 1 44  ? -3.889  11.103  0.736   1.00 0.00 ? 44  PHE A HD1  6  
ATOM   10816 H  HD2  . PHE A 1 44  ? -5.109  9.850   4.655   1.00 0.00 ? 44  PHE A HD2  6  
ATOM   10817 H  HE1  . PHE A 1 44  ? -3.596  8.770   0.048   1.00 0.00 ? 44  PHE A HE1  6  
ATOM   10818 H  HE2  . PHE A 1 44  ? -4.933  7.492   3.948   1.00 0.00 ? 44  PHE A HE2  6  
ATOM   10819 H  HZ   . PHE A 1 44  ? -4.143  6.923   1.653   1.00 0.00 ? 44  PHE A HZ   6  
ATOM   10820 N  N    . MET A 1 45  ? -4.859  13.829  0.543   1.00 0.00 ? 45  MET A N    6  
ATOM   10821 C  CA   . MET A 1 45  ? -4.669  13.971  -0.898  1.00 0.00 ? 45  MET A CA   6  
ATOM   10822 C  C    . MET A 1 45  ? -3.735  12.865  -1.393  1.00 0.00 ? 45  MET A C    6  
ATOM   10823 O  O    . MET A 1 45  ? -2.758  12.543  -0.718  1.00 0.00 ? 45  MET A O    6  
ATOM   10824 C  CB   . MET A 1 45  ? -4.054  15.356  -1.150  1.00 0.00 ? 45  MET A CB   6  
ATOM   10825 C  CG   . MET A 1 45  ? -3.811  15.643  -2.630  1.00 0.00 ? 45  MET A CG   6  
ATOM   10826 S  SD   . MET A 1 45  ? -2.974  17.218  -2.929  1.00 0.00 ? 45  MET A SD   6  
ATOM   10827 C  CE   . MET A 1 45  ? -2.922  17.132  -4.732  1.00 0.00 ? 45  MET A CE   6  
ATOM   10828 H  H    . MET A 1 45  ? -4.176  14.265  1.146   1.00 0.00 ? 45  MET A H    6  
ATOM   10829 H  HA   . MET A 1 45  ? -5.634  13.887  -1.403  1.00 0.00 ? 45  MET A HA   6  
ATOM   10830 H  HB2  . MET A 1 45  ? -4.724  16.121  -0.755  1.00 0.00 ? 45  MET A HB2  6  
ATOM   10831 H  HB3  . MET A 1 45  ? -3.101  15.426  -0.622  1.00 0.00 ? 45  MET A HB3  6  
ATOM   10832 H  HG2  . MET A 1 45  ? -3.190  14.855  -3.053  1.00 0.00 ? 45  MET A HG2  6  
ATOM   10833 H  HG3  . MET A 1 45  ? -4.767  15.639  -3.150  1.00 0.00 ? 45  MET A HG3  6  
ATOM   10834 H  HE1  . MET A 1 45  ? -3.937  17.194  -5.121  1.00 0.00 ? 45  MET A HE1  6  
ATOM   10835 H  HE2  . MET A 1 45  ? -2.330  17.957  -5.127  1.00 0.00 ? 45  MET A HE2  6  
ATOM   10836 H  HE3  . MET A 1 45  ? -2.481  16.182  -5.039  1.00 0.00 ? 45  MET A HE3  6  
ATOM   10837 N  N    . GLY A 1 46  ? -3.959  12.324  -2.590  1.00 0.00 ? 46  GLY A N    6  
ATOM   10838 C  CA   . GLY A 1 46  ? -3.024  11.404  -3.211  1.00 0.00 ? 46  GLY A CA   6  
ATOM   10839 C  C    . GLY A 1 46  ? -3.110  11.462  -4.725  1.00 0.00 ? 46  GLY A C    6  
ATOM   10840 O  O    . GLY A 1 46  ? -3.985  12.111  -5.301  1.00 0.00 ? 46  GLY A O    6  
ATOM   10841 H  H    . GLY A 1 46  ? -4.754  12.617  -3.152  1.00 0.00 ? 46  GLY A H    6  
ATOM   10842 H  HA2  . GLY A 1 46  ? -2.009  11.658  -2.917  1.00 0.00 ? 46  GLY A HA2  6  
ATOM   10843 H  HA3  . GLY A 1 46  ? -3.240  10.386  -2.882  1.00 0.00 ? 46  GLY A HA3  6  
ATOM   10844 N  N    . LYS A 1 47  ? -2.171  10.791  -5.379  1.00 0.00 ? 47  LYS A N    6  
ATOM   10845 C  CA   . LYS A 1 47  ? -2.232  10.551  -6.812  1.00 0.00 ? 47  LYS A CA   6  
ATOM   10846 C  C    . LYS A 1 47  ? -2.749  9.129   -6.982  1.00 0.00 ? 47  LYS A C    6  
ATOM   10847 O  O    . LYS A 1 47  ? -2.159  8.189   -6.444  1.00 0.00 ? 47  LYS A O    6  
ATOM   10848 C  CB   . LYS A 1 47  ? -0.839  10.717  -7.457  1.00 0.00 ? 47  LYS A CB   6  
ATOM   10849 C  CG   . LYS A 1 47  ? -0.926  11.056  -8.957  1.00 0.00 ? 47  LYS A CG   6  
ATOM   10850 C  CD   . LYS A 1 47  ? -1.308  12.526  -9.223  1.00 0.00 ? 47  LYS A CD   6  
ATOM   10851 C  CE   . LYS A 1 47  ? -0.179  13.531  -8.943  1.00 0.00 ? 47  LYS A CE   6  
ATOM   10852 N  NZ   . LYS A 1 47  ? 0.793   13.639  -10.060 1.00 0.00 ? 47  LYS A NZ   6  
ATOM   10853 H  H    . LYS A 1 47  ? -1.485  10.290  -4.841  1.00 0.00 ? 47  LYS A H    6  
ATOM   10854 H  HA   . LYS A 1 47  ? -2.942  11.251  -7.258  1.00 0.00 ? 47  LYS A HA   6  
ATOM   10855 H  HB2  . LYS A 1 47  ? -0.279  11.498  -6.949  1.00 0.00 ? 47  LYS A HB2  6  
ATOM   10856 H  HB3  . LYS A 1 47  ? -0.273  9.792   -7.336  1.00 0.00 ? 47  LYS A HB3  6  
ATOM   10857 H  HG2  . LYS A 1 47  ? 0.039   10.849  -9.417  1.00 0.00 ? 47  LYS A HG2  6  
ATOM   10858 H  HG3  . LYS A 1 47  ? -1.663  10.403  -9.427  1.00 0.00 ? 47  LYS A HG3  6  
ATOM   10859 H  HD2  . LYS A 1 47  ? -1.651  12.640  -10.252 1.00 0.00 ? 47  LYS A HD2  6  
ATOM   10860 H  HD3  . LYS A 1 47  ? -2.143  12.790  -8.582  1.00 0.00 ? 47  LYS A HD3  6  
ATOM   10861 H  HE2  . LYS A 1 47  ? -0.631  14.513  -8.781  1.00 0.00 ? 47  LYS A HE2  6  
ATOM   10862 H  HE3  . LYS A 1 47  ? 0.340   13.246  -8.026  1.00 0.00 ? 47  LYS A HE3  6  
ATOM   10863 H  HZ1  . LYS A 1 47  ? 0.359   14.033  -10.881 1.00 0.00 ? 47  LYS A HZ1  6  
ATOM   10864 H  HZ2  . LYS A 1 47  ? 1.562   14.242  -9.807  1.00 0.00 ? 47  LYS A HZ2  6  
ATOM   10865 H  HZ3  . LYS A 1 47  ? 1.187   12.733  -10.323 1.00 0.00 ? 47  LYS A HZ3  6  
ATOM   10866 N  N    . TRP A 1 48  ? -3.859  8.964   -7.693  1.00 0.00 ? 48  TRP A N    6  
ATOM   10867 C  CA   . TRP A 1 48  ? -4.316  7.657   -8.122  1.00 0.00 ? 48  TRP A CA   6  
ATOM   10868 C  C    . TRP A 1 48  ? -3.475  7.384   -9.362  1.00 0.00 ? 48  TRP A C    6  
ATOM   10869 O  O    . TRP A 1 48  ? -3.622  8.060   -10.381 1.00 0.00 ? 48  TRP A O    6  
ATOM   10870 C  CB   . TRP A 1 48  ? -5.825  7.671   -8.421  1.00 0.00 ? 48  TRP A CB   6  
ATOM   10871 C  CG   . TRP A 1 48  ? -6.442  6.368   -8.849  1.00 0.00 ? 48  TRP A CG   6  
ATOM   10872 C  CD1  . TRP A 1 48  ? -5.811  5.178   -8.945  1.00 0.00 ? 48  TRP A CD1  6  
ATOM   10873 C  CD2  . TRP A 1 48  ? -7.823  6.096   -9.247  1.00 0.00 ? 48  TRP A CD2  6  
ATOM   10874 N  NE1  . TRP A 1 48  ? -6.680  4.201   -9.365  1.00 0.00 ? 48  TRP A NE1  6  
ATOM   10875 C  CE2  . TRP A 1 48  ? -7.944  4.709   -9.573  1.00 0.00 ? 48  TRP A CE2  6  
ATOM   10876 C  CE3  . TRP A 1 48  ? -8.989  6.883   -9.360  1.00 0.00 ? 48  TRP A CE3  6  
ATOM   10877 C  CZ2  . TRP A 1 48  ? -9.156  4.139   -9.990  1.00 0.00 ? 48  TRP A CZ2  6  
ATOM   10878 C  CZ3  . TRP A 1 48  ? -10.212 6.322   -9.774  1.00 0.00 ? 48  TRP A CZ3  6  
ATOM   10879 C  CH2  . TRP A 1 48  ? -10.297 4.953   -10.089 1.00 0.00 ? 48  TRP A CH2  6  
ATOM   10880 H  H    . TRP A 1 48  ? -4.285  9.770   -8.138  1.00 0.00 ? 48  TRP A H    6  
ATOM   10881 H  HA   . TRP A 1 48  ? -4.108  6.913   -7.351  1.00 0.00 ? 48  TRP A HA   6  
ATOM   10882 H  HB2  . TRP A 1 48  ? -6.348  7.996   -7.523  1.00 0.00 ? 48  TRP A HB2  6  
ATOM   10883 H  HB3  . TRP A 1 48  ? -6.025  8.410   -9.194  1.00 0.00 ? 48  TRP A HB3  6  
ATOM   10884 H  HD1  . TRP A 1 48  ? -4.771  5.003   -8.734  1.00 0.00 ? 48  TRP A HD1  6  
ATOM   10885 H  HE1  . TRP A 1 48  ? -6.367  3.236   -9.522  1.00 0.00 ? 48  TRP A HE1  6  
ATOM   10886 H  HE3  . TRP A 1 48  ? -8.941  7.933   -9.112  1.00 0.00 ? 48  TRP A HE3  6  
ATOM   10887 H  HZ2  . TRP A 1 48  ? -9.215  3.086   -10.224 1.00 0.00 ? 48  TRP A HZ2  6  
ATOM   10888 H  HZ3  . TRP A 1 48  ? -11.094 6.945   -9.845  1.00 0.00 ? 48  TRP A HZ3  6  
ATOM   10889 H  HH2  . TRP A 1 48  ? -11.242 4.525   -10.399 1.00 0.00 ? 48  TRP A HH2  6  
ATOM   10890 N  N    . LYS A 1 49  ? -2.537  6.448   -9.272  1.00 0.00 ? 49  LYS A N    6  
ATOM   10891 C  CA   . LYS A 1 49  ? -1.681  6.046   -10.382 1.00 0.00 ? 49  LYS A CA   6  
ATOM   10892 C  C    . LYS A 1 49  ? -2.440  4.945   -11.118 1.00 0.00 ? 49  LYS A C    6  
ATOM   10893 O  O    . LYS A 1 49  ? -2.063  3.775   -11.061 1.00 0.00 ? 49  LYS A O    6  
ATOM   10894 C  CB   . LYS A 1 49  ? -0.319  5.598   -9.820  1.00 0.00 ? 49  LYS A CB   6  
ATOM   10895 C  CG   . LYS A 1 49  ? 0.461   6.792   -9.242  1.00 0.00 ? 49  LYS A CG   6  
ATOM   10896 C  CD   . LYS A 1 49  ? 1.638   6.362   -8.363  1.00 0.00 ? 49  LYS A CD   6  
ATOM   10897 C  CE   . LYS A 1 49  ? 2.793   5.721   -9.141  1.00 0.00 ? 49  LYS A CE   6  
ATOM   10898 N  NZ   . LYS A 1 49  ? 3.865   5.257   -8.227  1.00 0.00 ? 49  LYS A NZ   6  
ATOM   10899 H  H    . LYS A 1 49  ? -2.479  5.875   -8.445  1.00 0.00 ? 49  LYS A H    6  
ATOM   10900 H  HA   . LYS A 1 49  ? -1.530  6.883   -11.066 1.00 0.00 ? 49  LYS A HA   6  
ATOM   10901 H  HB2  . LYS A 1 49  ? -0.484  4.851   -9.041  1.00 0.00 ? 49  LYS A HB2  6  
ATOM   10902 H  HB3  . LYS A 1 49  ? 0.271   5.141   -10.613 1.00 0.00 ? 49  LYS A HB3  6  
ATOM   10903 H  HG2  . LYS A 1 49  ? 0.823   7.420   -10.056 1.00 0.00 ? 49  LYS A HG2  6  
ATOM   10904 H  HG3  . LYS A 1 49  ? -0.200  7.396   -8.619  1.00 0.00 ? 49  LYS A HG3  6  
ATOM   10905 H  HD2  . LYS A 1 49  ? 2.016   7.253   -7.863  1.00 0.00 ? 49  LYS A HD2  6  
ATOM   10906 H  HD3  . LYS A 1 49  ? 1.272   5.664   -7.610  1.00 0.00 ? 49  LYS A HD3  6  
ATOM   10907 H  HE2  . LYS A 1 49  ? 2.418   4.876   -9.724  1.00 0.00 ? 49  LYS A HE2  6  
ATOM   10908 H  HE3  . LYS A 1 49  ? 3.199   6.464   -9.831  1.00 0.00 ? 49  LYS A HE3  6  
ATOM   10909 H  HZ1  . LYS A 1 49  ? 4.703   5.022   -8.739  1.00 0.00 ? 49  LYS A HZ1  6  
ATOM   10910 H  HZ2  . LYS A 1 49  ? 4.099   5.976   -7.539  1.00 0.00 ? 49  LYS A HZ2  6  
ATOM   10911 H  HZ3  . LYS A 1 49  ? 3.577   4.438   -7.713  1.00 0.00 ? 49  LYS A HZ3  6  
ATOM   10912 N  N    . LYS A 1 50  ? -3.587  5.303   -11.700 1.00 0.00 ? 50  LYS A N    6  
ATOM   10913 C  CA   . LYS A 1 50  ? -4.526  4.338   -12.251 1.00 0.00 ? 50  LYS A CA   6  
ATOM   10914 C  C    . LYS A 1 50  ? -3.846  3.559   -13.371 1.00 0.00 ? 50  LYS A C    6  
ATOM   10915 O  O    . LYS A 1 50  ? -3.171  4.169   -14.198 1.00 0.00 ? 50  LYS A O    6  
ATOM   10916 C  CB   . LYS A 1 50  ? -5.784  5.067   -12.747 1.00 0.00 ? 50  LYS A CB   6  
ATOM   10917 C  CG   . LYS A 1 50  ? -6.880  4.057   -13.110 1.00 0.00 ? 50  LYS A CG   6  
ATOM   10918 C  CD   . LYS A 1 50  ? -8.081  4.723   -13.789 1.00 0.00 ? 50  LYS A CD   6  
ATOM   10919 C  CE   . LYS A 1 50  ? -8.948  3.671   -14.499 1.00 0.00 ? 50  LYS A CE   6  
ATOM   10920 N  NZ   . LYS A 1 50  ? -8.302  3.129   -15.727 1.00 0.00 ? 50  LYS A NZ   6  
ATOM   10921 H  H    . LYS A 1 50  ? -3.796  6.291   -11.810 1.00 0.00 ? 50  LYS A H    6  
ATOM   10922 H  HA   . LYS A 1 50  ? -4.813  3.656   -11.460 1.00 0.00 ? 50  LYS A HA   6  
ATOM   10923 H  HB2  . LYS A 1 50  ? -6.159  5.732   -11.967 1.00 0.00 ? 50  LYS A HB2  6  
ATOM   10924 H  HB3  . LYS A 1 50  ? -5.529  5.663   -13.625 1.00 0.00 ? 50  LYS A HB3  6  
ATOM   10925 H  HG2  . LYS A 1 50  ? -6.468  3.317   -13.784 1.00 0.00 ? 50  LYS A HG2  6  
ATOM   10926 H  HG3  . LYS A 1 50  ? -7.214  3.537   -12.212 1.00 0.00 ? 50  LYS A HG3  6  
ATOM   10927 H  HD2  . LYS A 1 50  ? -8.674  5.229   -13.026 1.00 0.00 ? 50  LYS A HD2  6  
ATOM   10928 H  HD3  . LYS A 1 50  ? -7.742  5.465   -14.514 1.00 0.00 ? 50  LYS A HD3  6  
ATOM   10929 H  HE2  . LYS A 1 50  ? -9.158  2.858   -13.800 1.00 0.00 ? 50  LYS A HE2  6  
ATOM   10930 H  HE3  . LYS A 1 50  ? -9.902  4.131   -14.771 1.00 0.00 ? 50  LYS A HE3  6  
ATOM   10931 H  HZ1  . LYS A 1 50  ? -7.373  2.758   -15.542 1.00 0.00 ? 50  LYS A HZ1  6  
ATOM   10932 H  HZ2  . LYS A 1 50  ? -8.861  2.385   -16.119 1.00 0.00 ? 50  LYS A HZ2  6  
ATOM   10933 H  HZ3  . LYS A 1 50  ? -8.214  3.846   -16.432 1.00 0.00 ? 50  LYS A HZ3  6  
ATOM   10934 N  N    . LYS A 1 51  ? -4.026  2.237   -13.447 1.00 0.00 ? 51  LYS A N    6  
ATOM   10935 C  CA   . LYS A 1 51  ? -3.583  1.483   -14.621 1.00 0.00 ? 51  LYS A CA   6  
ATOM   10936 C  C    . LYS A 1 51  ? -4.268  2.064   -15.864 1.00 0.00 ? 51  LYS A C    6  
ATOM   10937 O  O    . LYS A 1 51  ? -5.471  2.348   -15.830 1.00 0.00 ? 51  LYS A O    6  
ATOM   10938 C  CB   . LYS A 1 51  ? -3.902  -0.008  -14.452 1.00 0.00 ? 51  LYS A CB   6  
ATOM   10939 C  CG   . LYS A 1 51  ? -3.153  -0.849  -15.502 1.00 0.00 ? 51  LYS A CG   6  
ATOM   10940 C  CD   . LYS A 1 51  ? -3.636  -2.305  -15.562 1.00 0.00 ? 51  LYS A CD   6  
ATOM   10941 C  CE   . LYS A 1 51  ? -5.091  -2.469  -16.037 1.00 0.00 ? 51  LYS A CE   6  
ATOM   10942 N  NZ   . LYS A 1 51  ? -5.327  -1.911  -17.393 1.00 0.00 ? 51  LYS A NZ   6  
ATOM   10943 H  H    . LYS A 1 51  ? -4.438  1.733   -12.676 1.00 0.00 ? 51  LYS A H    6  
ATOM   10944 H  HA   . LYS A 1 51  ? -2.503  1.612   -14.713 1.00 0.00 ? 51  LYS A HA   6  
ATOM   10945 H  HB2  . LYS A 1 51  ? -3.591  -0.340  -13.460 1.00 0.00 ? 51  LYS A HB2  6  
ATOM   10946 H  HB3  . LYS A 1 51  ? -4.979  -0.150  -14.545 1.00 0.00 ? 51  LYS A HB3  6  
ATOM   10947 H  HG2  . LYS A 1 51  ? -3.261  -0.404  -16.489 1.00 0.00 ? 51  LYS A HG2  6  
ATOM   10948 H  HG3  . LYS A 1 51  ? -2.090  -0.843  -15.255 1.00 0.00 ? 51  LYS A HG3  6  
ATOM   10949 H  HD2  . LYS A 1 51  ? -2.982  -2.860  -16.237 1.00 0.00 ? 51  LYS A HD2  6  
ATOM   10950 H  HD3  . LYS A 1 51  ? -3.539  -2.751  -14.571 1.00 0.00 ? 51  LYS A HD3  6  
ATOM   10951 H  HE2  . LYS A 1 51  ? -5.318  -3.538  -16.051 1.00 0.00 ? 51  LYS A HE2  6  
ATOM   10952 H  HE3  . LYS A 1 51  ? -5.767  -2.000  -15.320 1.00 0.00 ? 51  LYS A HE3  6  
ATOM   10953 H  HZ1  . LYS A 1 51  ? -5.324  -0.895  -17.404 1.00 0.00 ? 51  LYS A HZ1  6  
ATOM   10954 H  HZ2  . LYS A 1 51  ? -4.582  -2.188  -18.028 1.00 0.00 ? 51  LYS A HZ2  6  
ATOM   10955 H  HZ3  . LYS A 1 51  ? -6.211  -2.228  -17.763 1.00 0.00 ? 51  LYS A HZ3  6  
ATOM   10956 N  N    . SER A 1 52  ? -3.522  2.235   -16.951 1.00 0.00 ? 52  SER A N    6  
ATOM   10957 C  CA   . SER A 1 52  ? -4.024  2.811   -18.185 1.00 0.00 ? 52  SER A CA   6  
ATOM   10958 C  C    . SER A 1 52  ? -5.116  1.941   -18.825 1.00 0.00 ? 52  SER A C    6  
ATOM   10959 O  O    . SER A 1 52  ? -5.250  0.741   -18.543 1.00 0.00 ? 52  SER A O    6  
ATOM   10960 C  CB   . SER A 1 52  ? -2.835  3.071   -19.114 1.00 0.00 ? 52  SER A CB   6  
ATOM   10961 O  OG   . SER A 1 52  ? -2.050  1.910   -19.291 1.00 0.00 ? 52  SER A OG   6  
ATOM   10962 H  H    . SER A 1 52  ? -2.544  1.961   -16.946 1.00 0.00 ? 52  SER A H    6  
ATOM   10963 H  HA   . SER A 1 52  ? -4.470  3.776   -17.940 1.00 0.00 ? 52  SER A HA   6  
ATOM   10964 H  HB2  . SER A 1 52  ? -3.184  3.436   -20.081 1.00 0.00 ? 52  SER A HB2  6  
ATOM   10965 H  HB3  . SER A 1 52  ? -2.200  3.834   -18.665 1.00 0.00 ? 52  SER A HB3  6  
ATOM   10966 H  HG   . SER A 1 52  ? -1.164  2.225   -19.580 1.00 0.00 ? 52  SER A HG   6  
ATOM   10967 N  N    . ARG A 1 53  ? -5.924  2.564   -19.687 1.00 0.00 ? 53  ARG A N    6  
ATOM   10968 C  CA   . ARG A 1 53  ? -7.048  1.924   -20.364 1.00 0.00 ? 53  ARG A CA   6  
ATOM   10969 C  C    . ARG A 1 53  ? -6.523  0.867   -21.339 1.00 0.00 ? 53  ARG A C    6  
ATOM   10970 O  O    . ARG A 1 53  ? -5.884  1.210   -22.333 1.00 0.00 ? 53  ARG A O    6  
ATOM   10971 C  CB   . ARG A 1 53  ? -7.886  3.009   -21.066 1.00 0.00 ? 53  ARG A CB   6  
ATOM   10972 C  CG   . ARG A 1 53  ? -9.154  2.440   -21.722 1.00 0.00 ? 53  ARG A CG   6  
ATOM   10973 C  CD   . ARG A 1 53  ? -9.982  3.557   -22.368 1.00 0.00 ? 53  ARG A CD   6  
ATOM   10974 N  NE   . ARG A 1 53  ? -11.198 3.027   -23.012 1.00 0.00 ? 53  ARG A NE   6  
ATOM   10975 C  CZ   . ARG A 1 53  ? -11.302 2.571   -24.268 1.00 0.00 ? 53  ARG A CZ   6  
ATOM   10976 N  NH1  . ARG A 1 53  ? -10.245 2.555   -25.079 1.00 0.00 ? 53  ARG A NH1  6  
ATOM   10977 N  NH2  . ARG A 1 53  ? -12.474 2.125   -24.710 1.00 0.00 ? 53  ARG A NH2  6  
ATOM   10978 H  H    . ARG A 1 53  ? -5.744  3.534   -19.907 1.00 0.00 ? 53  ARG A H    6  
ATOM   10979 H  HA   . ARG A 1 53  ? -7.670  1.442   -19.606 1.00 0.00 ? 53  ARG A HA   6  
ATOM   10980 H  HB2  . ARG A 1 53  ? -8.178  3.758   -20.326 1.00 0.00 ? 53  ARG A HB2  6  
ATOM   10981 H  HB3  . ARG A 1 53  ? -7.277  3.507   -21.824 1.00 0.00 ? 53  ARG A HB3  6  
ATOM   10982 H  HG2  . ARG A 1 53  ? -8.877  1.714   -22.488 1.00 0.00 ? 53  ARG A HG2  6  
ATOM   10983 H  HG3  . ARG A 1 53  ? -9.759  1.939   -20.965 1.00 0.00 ? 53  ARG A HG3  6  
ATOM   10984 H  HD2  . ARG A 1 53  ? -10.279 4.268   -21.596 1.00 0.00 ? 53  ARG A HD2  6  
ATOM   10985 H  HD3  . ARG A 1 53  ? -9.374  4.092   -23.100 1.00 0.00 ? 53  ARG A HD3  6  
ATOM   10986 H  HE   . ARG A 1 53  ? -12.027 3.028   -22.430 1.00 0.00 ? 53  ARG A HE   6  
ATOM   10987 H  HH11 . ARG A 1 53  ? -9.350  2.898   -24.765 1.00 0.00 ? 53  ARG A HH11 6  
ATOM   10988 H  HH12 . ARG A 1 53  ? -10.303 2.219   -26.031 1.00 0.00 ? 53  ARG A HH12 6  
ATOM   10989 H  HH21 . ARG A 1 53  ? -13.292 2.126   -24.116 1.00 0.00 ? 53  ARG A HH21 6  
ATOM   10990 H  HH22 . ARG A 1 53  ? -12.595 1.775   -25.650 1.00 0.00 ? 53  ARG A HH22 6  
ATOM   10991 N  N    . LYS A 1 54  ? -6.843  -0.406  -21.076 1.00 0.00 ? 54  LYS A N    6  
ATOM   10992 C  CA   . LYS A 1 54  ? -6.469  -1.568  -21.895 1.00 0.00 ? 54  LYS A CA   6  
ATOM   10993 C  C    . LYS A 1 54  ? -4.950  -1.669  -22.148 1.00 0.00 ? 54  LYS A C    6  
ATOM   10994 O  O    . LYS A 1 54  ? -4.525  -2.265  -23.138 1.00 0.00 ? 54  LYS A O    6  
ATOM   10995 C  CB   . LYS A 1 54  ? -7.341  -1.593  -23.172 1.00 0.00 ? 54  LYS A CB   6  
ATOM   10996 C  CG   . LYS A 1 54  ? -7.558  -3.011  -23.728 1.00 0.00 ? 54  LYS A CG   6  
ATOM   10997 C  CD   . LYS A 1 54  ? -8.451  -2.982  -24.976 1.00 0.00 ? 54  LYS A CD   6  
ATOM   10998 C  CE   . LYS A 1 54  ? -8.653  -4.408  -25.509 1.00 0.00 ? 54  LYS A CE   6  
ATOM   10999 N  NZ   . LYS A 1 54  ? -9.509  -4.439  -26.721 1.00 0.00 ? 54  LYS A NZ   6  
ATOM   11000 H  H    . LYS A 1 54  ? -7.383  -0.595  -20.243 1.00 0.00 ? 54  LYS A H    6  
ATOM   11001 H  HA   . LYS A 1 54  ? -6.735  -2.445  -21.303 1.00 0.00 ? 54  LYS A HA   6  
ATOM   11002 H  HB2  . LYS A 1 54  ? -8.324  -1.179  -22.938 1.00 0.00 ? 54  LYS A HB2  6  
ATOM   11003 H  HB3  . LYS A 1 54  ? -6.883  -0.963  -23.936 1.00 0.00 ? 54  LYS A HB3  6  
ATOM   11004 H  HG2  . LYS A 1 54  ? -6.601  -3.461  -23.991 1.00 0.00 ? 54  LYS A HG2  6  
ATOM   11005 H  HG3  . LYS A 1 54  ? -8.034  -3.625  -22.963 1.00 0.00 ? 54  LYS A HG3  6  
ATOM   11006 H  HD2  . LYS A 1 54  ? -9.418  -2.548  -24.717 1.00 0.00 ? 54  LYS A HD2  6  
ATOM   11007 H  HD3  . LYS A 1 54  ? -7.976  -2.368  -25.743 1.00 0.00 ? 54  LYS A HD3  6  
ATOM   11008 H  HE2  . LYS A 1 54  ? -7.676  -4.837  -25.744 1.00 0.00 ? 54  LYS A HE2  6  
ATOM   11009 H  HE3  . LYS A 1 54  ? -9.110  -5.016  -24.725 1.00 0.00 ? 54  LYS A HE3  6  
ATOM   11010 H  HZ1  . LYS A 1 54  ? -10.429 -4.070  -26.530 1.00 0.00 ? 54  LYS A HZ1  6  
ATOM   11011 H  HZ2  . LYS A 1 54  ? -9.102  -3.903  -27.472 1.00 0.00 ? 54  LYS A HZ2  6  
ATOM   11012 H  HZ3  . LYS A 1 54  ? -9.624  -5.386  -27.051 1.00 0.00 ? 54  LYS A HZ3  6  
ATOM   11013 N  N    . THR A 1 55  ? -4.128  -1.135  -21.245 1.00 0.00 ? 55  THR A N    6  
ATOM   11014 C  CA   . THR A 1 55  ? -2.668  -1.239  -21.255 1.00 0.00 ? 55  THR A CA   6  
ATOM   11015 C  C    . THR A 1 55  ? -2.200  -1.400  -19.796 1.00 0.00 ? 55  THR A C    6  
ATOM   11016 O  O    . THR A 1 55  ? -3.039  -1.591  -18.909 1.00 0.00 ? 55  THR A O    6  
ATOM   11017 C  CB   . THR A 1 55  ? -2.050  -0.028  -22.004 1.00 0.00 ? 55  THR A CB   6  
ATOM   11018 O  OG1  . THR A 1 55  ? -2.765  1.170   -21.783 1.00 0.00 ? 55  THR A OG1  6  
ATOM   11019 C  CG2  . THR A 1 55  ? -2.009  -0.242  -23.522 1.00 0.00 ? 55  THR A CG2  6  
ATOM   11020 H  H    . THR A 1 55  ? -4.515  -0.657  -20.444 1.00 0.00 ? 55  THR A H    6  
ATOM   11021 H  HA   . THR A 1 55  ? -2.375  -2.151  -21.777 1.00 0.00 ? 55  THR A HA   6  
ATOM   11022 H  HB   . THR A 1 55  ? -1.021  0.113   -21.671 1.00 0.00 ? 55  THR A HB   6  
ATOM   11023 H  HG1  . THR A 1 55  ? -2.587  1.437   -20.861 1.00 0.00 ? 55  THR A HG1  6  
ATOM   11024 H  HG21 . THR A 1 55  ? -1.504  -1.180  -23.752 1.00 0.00 ? 55  THR A HG21 6  
ATOM   11025 H  HG22 . THR A 1 55  ? -3.018  -0.265  -23.934 1.00 0.00 ? 55  THR A HG22 6  
ATOM   11026 H  HG23 . THR A 1 55  ? -1.455  0.572   -23.990 1.00 0.00 ? 55  THR A HG23 6  
ATOM   11027 N  N    . SER A 1 56  ? -0.889  -1.366  -19.533 1.00 0.00 ? 56  SER A N    6  
ATOM   11028 C  CA   . SER A 1 56  ? -0.316  -1.658  -18.213 1.00 0.00 ? 56  SER A CA   6  
ATOM   11029 C  C    . SER A 1 56  ? 0.574   -0.517  -17.690 1.00 0.00 ? 56  SER A C    6  
ATOM   11030 O  O    . SER A 1 56  ? 1.210   -0.655  -16.642 1.00 0.00 ? 56  SER A O    6  
ATOM   11031 C  CB   . SER A 1 56  ? 0.445   -2.991  -18.280 1.00 0.00 ? 56  SER A CB   6  
ATOM   11032 O  OG   . SER A 1 56  ? -0.361  -4.021  -18.840 1.00 0.00 ? 56  SER A OG   6  
ATOM   11033 H  H    . SER A 1 56  ? -0.235  -1.269  -20.296 1.00 0.00 ? 56  SER A H    6  
ATOM   11034 H  HA   . SER A 1 56  ? -1.124  -1.776  -17.491 1.00 0.00 ? 56  SER A HA   6  
ATOM   11035 H  HB2  . SER A 1 56  ? 1.339   -2.863  -18.894 1.00 0.00 ? 56  SER A HB2  6  
ATOM   11036 H  HB3  . SER A 1 56  ? 0.753   -3.280  -17.274 1.00 0.00 ? 56  SER A HB3  6  
ATOM   11037 H  HG   . SER A 1 56  ? 0.170   -4.836  -18.862 1.00 0.00 ? 56  SER A HG   6  
ATOM   11038 N  N    . THR A 1 57  ? 0.635   0.604   -18.411 1.00 0.00 ? 57  THR A N    6  
ATOM   11039 C  CA   . THR A 1 57  ? 1.252   1.850   -17.969 1.00 0.00 ? 57  THR A CA   6  
ATOM   11040 C  C    . THR A 1 57  ? 0.367   2.525   -16.900 1.00 0.00 ? 57  THR A C    6  
ATOM   11041 O  O    . THR A 1 57  ? -0.689  2.002   -16.529 1.00 0.00 ? 57  THR A O    6  
ATOM   11042 C  CB   . THR A 1 57  ? 1.495   2.731   -19.214 1.00 0.00 ? 57  THR A CB   6  
ATOM   11043 O  OG1  . THR A 1 57  ? 0.366   2.709   -20.073 1.00 0.00 ? 57  THR A OG1  6  
ATOM   11044 C  CG2  . THR A 1 57  ? 2.693   2.216   -20.018 1.00 0.00 ? 57  THR A CG2  6  
ATOM   11045 H  H    . THR A 1 57  ? 0.063   0.686   -19.238 1.00 0.00 ? 57  THR A H    6  
ATOM   11046 H  HA   . THR A 1 57  ? 2.215   1.630   -17.505 1.00 0.00 ? 57  THR A HA   6  
ATOM   11047 H  HB   . THR A 1 57  ? 1.699   3.757   -18.905 1.00 0.00 ? 57  THR A HB   6  
ATOM   11048 H  HG1  . THR A 1 57  ? 0.502   3.381   -20.761 1.00 0.00 ? 57  THR A HG1  6  
ATOM   11049 H  HG21 . THR A 1 57  ? 3.586   2.219   -19.392 1.00 0.00 ? 57  THR A HG21 6  
ATOM   11050 H  HG22 . THR A 1 57  ? 2.508   1.202   -20.373 1.00 0.00 ? 57  THR A HG22 6  
ATOM   11051 H  HG23 . THR A 1 57  ? 2.869   2.868   -20.874 1.00 0.00 ? 57  THR A HG23 6  
ATOM   11052 N  N    . ILE A 1 58  ? 0.790   3.687   -16.390 1.00 0.00 ? 58  ILE A N    6  
ATOM   11053 C  CA   . ILE A 1 58  ? 0.084   4.438   -15.354 1.00 0.00 ? 58  ILE A CA   6  
ATOM   11054 C  C    . ILE A 1 58  ? -0.483  5.700   -16.011 1.00 0.00 ? 58  ILE A C    6  
ATOM   11055 O  O    . ILE A 1 58  ? 0.170   6.346   -16.834 1.00 0.00 ? 58  ILE A O    6  
ATOM   11056 C  CB   . ILE A 1 58  ? 1.043   4.707   -14.157 1.00 0.00 ? 58  ILE A CB   6  
ATOM   11057 C  CG1  . ILE A 1 58  ? 1.002   3.590   -13.090 1.00 0.00 ? 58  ILE A CG1  6  
ATOM   11058 C  CG2  . ILE A 1 58  ? 0.771   6.026   -13.405 1.00 0.00 ? 58  ILE A CG2  6  
ATOM   11059 C  CD1  . ILE A 1 58  ? 1.125   2.157   -13.610 1.00 0.00 ? 58  ILE A CD1  6  
ATOM   11060 H  H    . ILE A 1 58  ? 1.599   4.144   -16.800 1.00 0.00 ? 58  ILE A H    6  
ATOM   11061 H  HA   . ILE A 1 58  ? -0.759  3.854   -14.981 1.00 0.00 ? 58  ILE A HA   6  
ATOM   11062 H  HB   . ILE A 1 58  ? 2.064   4.771   -14.541 1.00 0.00 ? 58  ILE A HB   6  
ATOM   11063 H  HG12 . ILE A 1 58  ? 1.814   3.760   -12.381 1.00 0.00 ? 58  ILE A HG12 6  
ATOM   11064 H  HG13 . ILE A 1 58  ? 0.061   3.655   -12.547 1.00 0.00 ? 58  ILE A HG13 6  
ATOM   11065 H  HG21 . ILE A 1 58  ? 0.950   6.873   -14.066 1.00 0.00 ? 58  ILE A HG21 6  
ATOM   11066 H  HG22 . ILE A 1 58  ? -0.259  6.057   -13.050 1.00 0.00 ? 58  ILE A HG22 6  
ATOM   11067 H  HG23 . ILE A 1 58  ? 1.445   6.124   -12.550 1.00 0.00 ? 58  ILE A HG23 6  
ATOM   11068 H  HD11 . ILE A 1 58  ? 1.977   2.073   -14.284 1.00 0.00 ? 58  ILE A HD11 6  
ATOM   11069 H  HD12 . ILE A 1 58  ? 1.263   1.480   -12.768 1.00 0.00 ? 58  ILE A HD12 6  
ATOM   11070 H  HD13 . ILE A 1 58  ? 0.204   1.884   -14.123 1.00 0.00 ? 58  ILE A HD13 6  
ATOM   11071 N  N    . GLU A 1 59  ? -1.691  6.056   -15.589 1.00 0.00 ? 59  GLU A N    6  
ATOM   11072 C  CA   . GLU A 1 59  ? -2.403  7.286   -15.890 1.00 0.00 ? 59  GLU A CA   6  
ATOM   11073 C  C    . GLU A 1 59  ? -2.639  7.940   -14.527 1.00 0.00 ? 59  GLU A C    6  
ATOM   11074 O  O    . GLU A 1 59  ? -3.493  7.508   -13.751 1.00 0.00 ? 59  GLU A O    6  
ATOM   11075 C  CB   . GLU A 1 59  ? -3.730  6.981   -16.615 1.00 0.00 ? 59  GLU A CB   6  
ATOM   11076 C  CG   . GLU A 1 59  ? -3.564  6.648   -18.105 1.00 0.00 ? 59  GLU A CG   6  
ATOM   11077 C  CD   . GLU A 1 59  ? -3.230  7.894   -18.948 1.00 0.00 ? 59  GLU A CD   6  
ATOM   11078 O  OE1  . GLU A 1 59  ? -4.159  8.642   -19.329 1.00 0.00 ? 59  GLU A OE1  6  
ATOM   11079 O  OE2  . GLU A 1 59  ? -2.041  8.131   -19.258 1.00 0.00 ? 59  GLU A OE2  6  
ATOM   11080 H  H    . GLU A 1 59  ? -2.166  5.432   -14.941 1.00 0.00 ? 59  GLU A H    6  
ATOM   11081 H  HA   . GLU A 1 59  ? -1.791  7.943   -16.510 1.00 0.00 ? 59  GLU A HA   6  
ATOM   11082 H  HB2  . GLU A 1 59  ? -4.220  6.138   -16.124 1.00 0.00 ? 59  GLU A HB2  6  
ATOM   11083 H  HB3  . GLU A 1 59  ? -4.391  7.844   -16.527 1.00 0.00 ? 59  GLU A HB3  6  
ATOM   11084 H  HG2  . GLU A 1 59  ? -2.784  5.897   -18.223 1.00 0.00 ? 59  GLU A HG2  6  
ATOM   11085 H  HG3  . GLU A 1 59  ? -4.497  6.208   -18.471 1.00 0.00 ? 59  GLU A HG3  6  
ATOM   11086 N  N    . GLU A 1 60  ? -1.814  8.929   -14.189 1.00 0.00 ? 60  GLU A N    6  
ATOM   11087 C  CA   . GLU A 1 60  ? -1.930  9.660   -12.933 1.00 0.00 ? 60  GLU A CA   6  
ATOM   11088 C  C    . GLU A 1 60  ? -3.215  10.498  -12.940 1.00 0.00 ? 60  GLU A C    6  
ATOM   11089 O  O    . GLU A 1 60  ? -3.507  11.186  -13.925 1.00 0.00 ? 60  GLU A O    6  
ATOM   11090 C  CB   . GLU A 1 60  ? -0.701  10.566  -12.748 1.00 0.00 ? 60  GLU A CB   6  
ATOM   11091 C  CG   . GLU A 1 60  ? 0.573   9.767   -12.444 1.00 0.00 ? 60  GLU A CG   6  
ATOM   11092 C  CD   . GLU A 1 60  ? 1.796   10.687  -12.291 1.00 0.00 ? 60  GLU A CD   6  
ATOM   11093 O  OE1  . GLU A 1 60  ? 1.873   11.430  -11.287 1.00 0.00 ? 60  GLU A OE1  6  
ATOM   11094 O  OE2  . GLU A 1 60  ? 2.689   10.671  -13.169 1.00 0.00 ? 60  GLU A OE2  6  
ATOM   11095 H  H    . GLU A 1 60  ? -1.122  9.248   -14.852 1.00 0.00 ? 60  GLU A H    6  
ATOM   11096 H  HA   . GLU A 1 60  ? -1.973  8.948   -12.108 1.00 0.00 ? 60  GLU A HA   6  
ATOM   11097 H  HB2  . GLU A 1 60  ? -0.549  11.164  -13.647 1.00 0.00 ? 60  GLU A HB2  6  
ATOM   11098 H  HB3  . GLU A 1 60  ? -0.890  11.242  -11.917 1.00 0.00 ? 60  GLU A HB3  6  
ATOM   11099 H  HG2  . GLU A 1 60  ? 0.423   9.204   -11.521 1.00 0.00 ? 60  GLU A HG2  6  
ATOM   11100 H  HG3  . GLU A 1 60  ? 0.753   9.056   -13.250 1.00 0.00 ? 60  GLU A HG3  6  
ATOM   11101 N  N    . LYS A 1 61  ? -3.950  10.497  -11.824 1.00 0.00 ? 61  LYS A N    6  
ATOM   11102 C  CA   . LYS A 1 61  ? -5.108  11.353  -11.585 1.00 0.00 ? 61  LYS A CA   6  
ATOM   11103 C  C    . LYS A 1 61  ? -4.962  11.891  -10.168 1.00 0.00 ? 61  LYS A C    6  
ATOM   11104 O  O    . LYS A 1 61  ? -4.738  11.114  -9.241  1.00 0.00 ? 61  LYS A O    6  
ATOM   11105 C  CB   . LYS A 1 61  ? -6.388  10.513  -11.745 1.00 0.00 ? 61  LYS A CB   6  
ATOM   11106 C  CG   . LYS A 1 61  ? -7.679  11.342  -11.623 1.00 0.00 ? 61  LYS A CG   6  
ATOM   11107 C  CD   . LYS A 1 61  ? -8.935  10.467  -11.466 1.00 0.00 ? 61  LYS A CD   6  
ATOM   11108 C  CE   . LYS A 1 61  ? -9.128  9.393   -12.552 1.00 0.00 ? 61  LYS A CE   6  
ATOM   11109 N  NZ   . LYS A 1 61  ? -9.400  9.967   -13.897 1.00 0.00 ? 61  LYS A NZ   6  
ATOM   11110 H  H    . LYS A 1 61  ? -3.739  9.813   -11.076 1.00 0.00 ? 61  LYS A H    6  
ATOM   11111 H  HA   . LYS A 1 61  ? -5.119  12.177  -12.302 1.00 0.00 ? 61  LYS A HA   6  
ATOM   11112 H  HB2  . LYS A 1 61  ? -6.370  10.032  -12.725 1.00 0.00 ? 61  LYS A HB2  6  
ATOM   11113 H  HB3  . LYS A 1 61  ? -6.393  9.732   -10.986 1.00 0.00 ? 61  LYS A HB3  6  
ATOM   11114 H  HG2  . LYS A 1 61  ? -7.618  11.987  -10.746 1.00 0.00 ? 61  LYS A HG2  6  
ATOM   11115 H  HG3  . LYS A 1 61  ? -7.779  11.980  -12.502 1.00 0.00 ? 61  LYS A HG3  6  
ATOM   11116 H  HD2  . LYS A 1 61  ? -8.875  9.960   -10.503 1.00 0.00 ? 61  LYS A HD2  6  
ATOM   11117 H  HD3  . LYS A 1 61  ? -9.814  11.114  -11.434 1.00 0.00 ? 61  LYS A HD3  6  
ATOM   11118 H  HE2  . LYS A 1 61  ? -8.241  8.756   -12.588 1.00 0.00 ? 61  LYS A HE