data_2KBX
# 
_entry.id   2KBX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KBX         
RCSB  RCSB100929   
WWPDB D_1000100929 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KBX 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2008-12-10 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
_audit_author.name           'Qin, J.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     'Cytosketal proteins' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
_citation_author.citation_id   primary 
_citation_author.name          'Qin, J.' 
_citation_author.ordinal       1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Integrin-linked protein kinase'                                  19379.928 1 2.7.11.1 ? 'N-terminal domain' ? 
2 polymer     man 'LIM and senescent cell antigen-like-containing domain protein 1' 7963.024  1 ?        ? 
'LIM zinc-binding 1 domain' ? 
3 non-polymer syn 'ZINC ION'                                                        65.409    2 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ILK-1, ILK-2, 59 kDa serine/threonine-protein kinase, p59ILK'                               
2 'Particularly interesting new Cys-His protein 1, PINCH-1, Renal carcinoma antigen NY-REN-48' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHR
DIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLN
RIPYKDTFWKG
;
;MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHR
DIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLN
RIPYKDTFWKG
;
A ? 
2 'polypeptide(L)' no no MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC 
MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ASP n 
1 3   ASP n 
1 4   ILE n 
1 5   PHE n 
1 6   THR n 
1 7   GLN n 
1 8   CYS n 
1 9   ARG n 
1 10  GLU n 
1 11  GLY n 
1 12  ASN n 
1 13  ALA n 
1 14  VAL n 
1 15  ALA n 
1 16  VAL n 
1 17  ARG n 
1 18  LEU n 
1 19  TRP n 
1 20  LEU n 
1 21  ASP n 
1 22  ASN n 
1 23  THR n 
1 24  GLU n 
1 25  ASN n 
1 26  ASP n 
1 27  LEU n 
1 28  ASN n 
1 29  GLN n 
1 30  GLY n 
1 31  ASP n 
1 32  ASP n 
1 33  HIS n 
1 34  GLY n 
1 35  PHE n 
1 36  SER n 
1 37  PRO n 
1 38  LEU n 
1 39  HIS n 
1 40  TRP n 
1 41  ALA n 
1 42  CYS n 
1 43  ARG n 
1 44  GLU n 
1 45  GLY n 
1 46  ARG n 
1 47  SER n 
1 48  ALA n 
1 49  VAL n 
1 50  VAL n 
1 51  GLU n 
1 52  MET n 
1 53  LEU n 
1 54  ILE n 
1 55  MET n 
1 56  ARG n 
1 57  GLY n 
1 58  ALA n 
1 59  ARG n 
1 60  ILE n 
1 61  ASN n 
1 62  VAL n 
1 63  MET n 
1 64  ASN n 
1 65  ARG n 
1 66  GLY n 
1 67  ASP n 
1 68  ASP n 
1 69  THR n 
1 70  PRO n 
1 71  LEU n 
1 72  HIS n 
1 73  LEU n 
1 74  ALA n 
1 75  ALA n 
1 76  SER n 
1 77  HIS n 
1 78  GLY n 
1 79  HIS n 
1 80  ARG n 
1 81  ASP n 
1 82  ILE n 
1 83  VAL n 
1 84  GLN n 
1 85  LYS n 
1 86  LEU n 
1 87  LEU n 
1 88  GLN n 
1 89  TYR n 
1 90  LYS n 
1 91  ALA n 
1 92  ASP n 
1 93  ILE n 
1 94  ASN n 
1 95  ALA n 
1 96  VAL n 
1 97  ASN n 
1 98  GLU n 
1 99  HIS n 
1 100 GLY n 
1 101 ASN n 
1 102 VAL n 
1 103 PRO n 
1 104 LEU n 
1 105 HIS n 
1 106 TYR n 
1 107 ALA n 
1 108 CYS n 
1 109 PHE n 
1 110 TRP n 
1 111 GLY n 
1 112 GLN n 
1 113 ASP n 
1 114 GLN n 
1 115 VAL n 
1 116 ALA n 
1 117 GLU n 
1 118 ASP n 
1 119 LEU n 
1 120 VAL n 
1 121 ALA n 
1 122 ASN n 
1 123 GLY n 
1 124 ALA n 
1 125 LEU n 
1 126 VAL n 
1 127 SER n 
1 128 ILE n 
1 129 CYS n 
1 130 ASN n 
1 131 LYS n 
1 132 TYR n 
1 133 GLY n 
1 134 GLU n 
1 135 MET n 
1 136 PRO n 
1 137 VAL n 
1 138 ASP n 
1 139 LYS n 
1 140 ALA n 
1 141 LYS n 
1 142 ALA n 
1 143 PRO n 
1 144 LEU n 
1 145 ARG n 
1 146 GLU n 
1 147 LEU n 
1 148 LEU n 
1 149 ARG n 
1 150 GLU n 
1 151 ARG n 
1 152 ALA n 
1 153 GLU n 
1 154 LYS n 
1 155 MET n 
1 156 GLY n 
1 157 GLN n 
1 158 ASN n 
1 159 LEU n 
1 160 ASN n 
1 161 ARG n 
1 162 ILE n 
1 163 PRO n 
1 164 TYR n 
1 165 LYS n 
1 166 ASP n 
1 167 THR n 
1 168 PHE n 
1 169 TRP n 
1 170 LYS n 
1 171 GLY n 
2 1   MET n 
2 2   ALA n 
2 3   ASN n 
2 4   ALA n 
2 5   LEU n 
2 6   ALA n 
2 7   SER n 
2 8   ALA n 
2 9   THR n 
2 10  CYS n 
2 11  GLU n 
2 12  ARG n 
2 13  CYS n 
2 14  LYS n 
2 15  GLY n 
2 16  GLY n 
2 17  PHE n 
2 18  ALA n 
2 19  PRO n 
2 20  ALA n 
2 21  GLU n 
2 22  LYS n 
2 23  ILE n 
2 24  VAL n 
2 25  ASN n 
2 26  SER n 
2 27  ASN n 
2 28  GLY n 
2 29  GLU n 
2 30  LEU n 
2 31  TYR n 
2 32  HIS n 
2 33  GLU n 
2 34  GLN n 
2 35  CYS n 
2 36  PHE n 
2 37  VAL n 
2 38  CYS n 
2 39  ALA n 
2 40  GLN n 
2 41  CYS n 
2 42  PHE n 
2 43  GLN n 
2 44  GLN n 
2 45  PHE n 
2 46  PRO n 
2 47  GLU n 
2 48  GLY n 
2 49  LEU n 
2 50  PHE n 
2 51  TYR n 
2 52  GLU n 
2 53  PHE n 
2 54  GLU n 
2 55  GLY n 
2 56  ARG n 
2 57  LYS n 
2 58  TYR n 
2 59  CYS n 
2 60  GLU n 
2 61  HIS n 
2 62  ASP n 
2 63  PHE n 
2 64  GLN n 
2 65  MET n 
2 66  LEU n 
2 67  PHE n 
2 68  ALA n 
2 69  PRO n 
2 70  CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'ILK, ILK1, ILK2'      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? pGEX ? ? ? ? ? 
2 1 sample ? ? ? human ? 'LIMS1, PINCH, PINCH1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? pGEX ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP ILK_HUMAN   Q13418 1 
;MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHR
DIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLN
RIPYKDTFWKG
;
1 ? 
2 UNP LIMS1_HUMAN P48059 2 MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC 1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KBX A 1 ? 171 ? Q13418 1 ? 171 ? 1 171 
2 2 2KBX B 1 ? 70  ? P48059 1 ? 70  ? 1 70  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_pdbx_nmr_exptl.conditions_id   1 
_pdbx_nmr_exptl.experiment_id   1 
_pdbx_nmr_exptl.solution_id     1 
_pdbx_nmr_exptl.type            '2D 1H-15N HSQC' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50mM 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         30 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;0.1-0.5 mM [U-100% 15N] Integrin-linked protein kinase, 0.1-0.5 mM [U-100% 13C; U-100% 15N] LIM and senescent cell antigen-like-containing domain protein 1, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KBX 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
'C-N bond distance between PHE 42 and GLN 43 chain B is in the range of 1.16-1.21A in all models.' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KBX 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KBX 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' X-PLOR_NIH ? 1 
'Schwieters, Kuszewski, Tjandra and Clore' refinement           X-PLOR_NIH ? 2 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KBX 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KBX 
_struct.title                     'Solution structure of ILK-PINCH complex' 
_struct.pdbx_descriptor           
'Integrin-linked protein kinase (E.C.2.7.11.1), LIM and senescent cell antigen-like-containing domain protein 1' 
_struct.pdbx_model_details        'lowest energy, model 2' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KBX 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            
;cytoskeletal regulators, ANK repeat, ATP-binding, Cell junction, Cell membrane, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Acetylation, LIM domain, Metal-binding, Zinc, CELL ADHESION
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 2   ? ARG A 9   ? ASP A 2   ARG A 9   1 ? 8  
HELX_P HELX_P2  2  ASN A 12  ? ASP A 21  ? ASN A 12  ASP A 21  1 ? 10 
HELX_P HELX_P3  3  SER A 36  ? GLY A 45  ? SER A 36  GLY A 45  1 ? 10 
HELX_P HELX_P4  4  ARG A 46  ? GLY A 57  ? ARG A 46  GLY A 57  1 ? 12 
HELX_P HELX_P5  5  THR A 69  ? GLY A 78  ? THR A 69  GLY A 78  1 ? 10 
HELX_P HELX_P6  6  HIS A 79  ? GLN A 88  ? HIS A 79  GLN A 88  1 ? 10 
HELX_P HELX_P7  7  ALA A 91  ? ALA A 95  ? ALA A 91  ALA A 95  5 ? 5  
HELX_P HELX_P8  8  VAL A 102 ? GLY A 111 ? VAL A 102 GLY A 111 1 ? 10 
HELX_P HELX_P9  9  GLN A 112 ? ALA A 121 ? GLN A 112 ALA A 121 1 ? 10 
HELX_P HELX_P10 10 MET A 135 ? ALA A 142 ? MET A 135 ALA A 142 1 ? 8  
HELX_P HELX_P11 11 GLU A 146 ? LYS A 154 ? GLU A 146 LYS A 154 1 ? 9  
HELX_P HELX_P12 12 PHE B 45  ? LEU B 49  ? PHE B 45  LEU B 49  5 ? 5  
HELX_P HELX_P13 13 CYS B 59  ? ALA B 68  ? CYS B 59  ALA B 68  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 10 SG  ? ? ? 1_555 B CYS 35 SG ? ? B CYS 10 B CYS 35  1_555 ? ? ? ? ? ? ? 2.456 ? 
metalc1 metalc ? ? B CYS 10 SG  ? ? ? 1_555 C ZN  .  ZN ? ? B CYS 10 B ZN  298 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc2 metalc ? ? B CYS 13 SG  ? ? ? 1_555 C ZN  .  ZN ? ? B CYS 13 B ZN  298 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc3 metalc ? ? B HIS 32 ND1 ? ? ? 1_555 C ZN  .  ZN ? ? B HIS 32 B ZN  298 1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc4 metalc ? ? B CYS 35 SG  ? ? ? 1_555 C ZN  .  ZN ? ? B CYS 35 B ZN  298 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc5 metalc ? ? B CYS 38 SG  ? ? ? 1_555 D ZN  .  ZN ? ? B CYS 38 B ZN  299 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc6 metalc ? ? B CYS 41 SG  ? ? ? 1_555 D ZN  .  ZN ? ? B CYS 41 B ZN  299 1_555 ? ? ? ? ? ? ? 2.296 ? 
metalc7 metalc ? ? B CYS 59 SG  ? ? ? 1_555 D ZN  .  ZN ? ? B CYS 59 B ZN  299 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc8 metalc ? ? B ASP 62 OD2 ? ? ? 1_555 D ZN  .  ZN ? ? B ASP 62 B ZN  299 1_555 ? ? ? ? ? ? ? 1.994 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL B 24 ? SER B 26 ? VAL B 24 SER B 26 
A 2 GLU B 29 ? TYR B 31 ? GLU B 29 TYR B 31 
B 1 TYR B 51 ? PHE B 53 ? TYR B 51 PHE B 53 
B 2 ARG B 56 ? TYR B 58 ? ARG B 56 TYR B 58 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL B 24 ? N VAL B 24 O TYR B 31 ? O TYR B 31 
B 1 2 N PHE B 53 ? N PHE B 53 O ARG B 56 ? O ARG B 56 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 298' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 299' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS B 10 ? CYS B 10 . ? 1_555 ? 
2 AC1 4 GLU B 11 ? GLU B 11 . ? 1_555 ? 
3 AC1 4 ARG B 12 ? ARG B 12 . ? 1_555 ? 
4 AC1 4 CYS B 13 ? CYS B 13 . ? 1_555 ? 
5 AC2 5 HIS A 99 ? HIS A 99 . ? 1_555 ? 
6 AC2 5 CYS B 38 ? CYS B 38 . ? 1_555 ? 
7 AC2 5 GLN B 40 ? GLN B 40 . ? 1_555 ? 
8 AC2 5 CYS B 41 ? CYS B 41 . ? 1_555 ? 
9 AC2 5 GLN B 43 ? GLN B 43 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2KBX 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A 1 1   ? -3.192  73.868 -15.063 1.00 0.00  ? 1   MET A N    1  
ATOM   2     C  CA   . MET A 1 1   ? -4.554  74.177 -14.542 1.00 0.00  ? 1   MET A CA   1  
ATOM   3     C  C    . MET A 1 1   ? -5.117  72.946 -13.826 1.00 0.00  ? 1   MET A C    1  
ATOM   4     O  O    . MET A 1 1   ? -6.241  72.543 -14.053 1.00 0.00  ? 1   MET A O    1  
ATOM   5     C  CB   . MET A 1 1   ? -5.472  74.558 -15.708 1.00 0.00  ? 1   MET A CB   1  
ATOM   6     C  CG   . MET A 1 1   ? -6.722  75.259 -15.173 1.00 0.00  ? 1   MET A CG   1  
ATOM   7     S  SD   . MET A 1 1   ? -6.301  76.951 -14.685 1.00 0.00  ? 1   MET A SD   1  
ATOM   8     C  CE   . MET A 1 1   ? -7.935  77.678 -14.957 1.00 0.00  ? 1   MET A CE   1  
ATOM   9     H  H1   . MET A 1 1   ? -2.676  74.755 -15.230 1.00 0.00  ? 1   MET A H1   1  
ATOM   10    H  H2   . MET A 1 1   ? -3.274  73.340 -15.955 1.00 0.00  ? 1   MET A H2   1  
ATOM   11    H  H3   . MET A 1 1   ? -2.675  73.295 -14.366 1.00 0.00  ? 1   MET A H3   1  
ATOM   12    H  HA   . MET A 1 1   ? -4.494  75.001 -13.846 1.00 0.00  ? 1   MET A HA   1  
ATOM   13    H  HB2  . MET A 1 1   ? -4.944  75.223 -16.377 1.00 0.00  ? 1   MET A HB2  1  
ATOM   14    H  HB3  . MET A 1 1   ? -5.763  73.667 -16.245 1.00 0.00  ? 1   MET A HB3  1  
ATOM   15    H  HG2  . MET A 1 1   ? -7.478  75.285 -15.944 1.00 0.00  ? 1   MET A HG2  1  
ATOM   16    H  HG3  . MET A 1 1   ? -7.099  74.721 -14.317 1.00 0.00  ? 1   MET A HG3  1  
ATOM   17    H  HE1  . MET A 1 1   ? -7.911  78.726 -14.688 1.00 0.00  ? 1   MET A HE1  1  
ATOM   18    H  HE2  . MET A 1 1   ? -8.663  77.170 -14.346 1.00 0.00  ? 1   MET A HE2  1  
ATOM   19    H  HE3  . MET A 1 1   ? -8.206  77.574 -15.998 1.00 0.00  ? 1   MET A HE3  1  
ATOM   20    N  N    . ASP A 1 2   ? -4.344  72.344 -12.963 1.00 0.00  ? 2   ASP A N    1  
ATOM   21    C  CA   . ASP A 1 2   ? -4.832  71.140 -12.233 1.00 0.00  ? 2   ASP A CA   1  
ATOM   22    C  C    . ASP A 1 2   ? -5.677  71.573 -11.030 1.00 0.00  ? 2   ASP A C    1  
ATOM   23    O  O    . ASP A 1 2   ? -5.627  70.976 -9.973  1.00 0.00  ? 2   ASP A O    1  
ATOM   24    C  CB   . ASP A 1 2   ? -3.638  70.315 -11.754 1.00 0.00  ? 2   ASP A CB   1  
ATOM   25    C  CG   . ASP A 1 2   ? -2.716  70.017 -12.938 1.00 0.00  ? 2   ASP A CG   1  
ATOM   26    O  OD1  . ASP A 1 2   ? -2.469  70.925 -13.715 1.00 0.00  ? 2   ASP A OD1  1  
ATOM   27    O  OD2  . ASP A 1 2   ? -2.272  68.886 -13.048 1.00 0.00  ? 2   ASP A OD2  1  
ATOM   28    H  H    . ASP A 1 2   ? -3.440  72.685 -12.796 1.00 0.00  ? 2   ASP A H    1  
ATOM   29    H  HA   . ASP A 1 2   ? -5.438  70.539 -12.896 1.00 0.00  ? 2   ASP A HA   1  
ATOM   30    H  HB2  . ASP A 1 2   ? -3.096  70.870 -11.007 1.00 0.00  ? 2   ASP A HB2  1  
ATOM   31    H  HB3  . ASP A 1 2   ? -3.987  69.385 -11.331 1.00 0.00  ? 2   ASP A HB3  1  
ATOM   32    N  N    . ASP A 1 3   ? -6.462  72.602 -11.194 1.00 0.00  ? 3   ASP A N    1  
ATOM   33    C  CA   . ASP A 1 3   ? -7.337  73.080 -10.082 1.00 0.00  ? 3   ASP A CA   1  
ATOM   34    C  C    . ASP A 1 3   ? -6.526  73.320 -8.799  1.00 0.00  ? 3   ASP A C    1  
ATOM   35    O  O    . ASP A 1 3   ? -5.568  74.068 -8.785  1.00 0.00  ? 3   ASP A O    1  
ATOM   36    C  CB   . ASP A 1 3   ? -8.419  72.031 -9.812  1.00 0.00  ? 3   ASP A CB   1  
ATOM   37    C  CG   . ASP A 1 3   ? -9.194  71.753 -11.102 1.00 0.00  ? 3   ASP A CG   1  
ATOM   38    O  OD1  . ASP A 1 3   ? -8.691  71.004 -11.922 1.00 0.00  ? 3   ASP A OD1  1  
ATOM   39    O  OD2  . ASP A 1 3   ? -10.278 72.295 -11.246 1.00 0.00  ? 3   ASP A OD2  1  
ATOM   40    H  H    . ASP A 1 3   ? -6.490  73.057 -12.062 1.00 0.00  ? 3   ASP A H    1  
ATOM   41    H  HA   . ASP A 1 3   ? -7.810  74.004 -10.378 1.00 0.00  ? 3   ASP A HA   1  
ATOM   42    H  HB2  . ASP A 1 3   ? -7.957  71.118 -9.465  1.00 0.00  ? 3   ASP A HB2  1  
ATOM   43    H  HB3  . ASP A 1 3   ? -9.098  72.400 -9.059  1.00 0.00  ? 3   ASP A HB3  1  
ATOM   44    N  N    . ILE A 1 4   ? -6.929  72.703 -7.718  1.00 0.00  ? 4   ILE A N    1  
ATOM   45    C  CA   . ILE A 1 4   ? -6.224  72.894 -6.415  1.00 0.00  ? 4   ILE A CA   1  
ATOM   46    C  C    . ILE A 1 4   ? -4.780  72.402 -6.514  1.00 0.00  ? 4   ILE A C    1  
ATOM   47    O  O    . ILE A 1 4   ? -3.861  73.039 -6.041  1.00 0.00  ? 4   ILE A O    1  
ATOM   48    C  CB   . ILE A 1 4   ? -6.960  72.095 -5.332  1.00 0.00  ? 4   ILE A CB   1  
ATOM   49    C  CG1  . ILE A 1 4   ? -8.389  72.631 -5.195  1.00 0.00  ? 4   ILE A CG1  1  
ATOM   50    C  CG2  . ILE A 1 4   ? -6.226  72.221 -3.991  1.00 0.00  ? 4   ILE A CG2  1  
ATOM   51    C  CD1  . ILE A 1 4   ? -9.227  71.645 -4.378  1.00 0.00  ? 4   ILE A CD1  1  
ATOM   52    H  H    . ILE A 1 4   ? -7.712  72.121 -7.761  1.00 0.00  ? 4   ILE A H    1  
ATOM   53    H  HA   . ILE A 1 4   ? -6.232  73.939 -6.151  1.00 0.00  ? 4   ILE A HA   1  
ATOM   54    H  HB   . ILE A 1 4   ? -6.994  71.054 -5.619  1.00 0.00  ? 4   ILE A HB   1  
ATOM   55    H  HG12 . ILE A 1 4   ? -8.368  73.589 -4.694  1.00 0.00  ? 4   ILE A HG12 1  
ATOM   56    H  HG13 . ILE A 1 4   ? -8.827  72.747 -6.175  1.00 0.00  ? 4   ILE A HG13 1  
ATOM   57    H  HG21 . ILE A 1 4   ? -5.411  71.515 -3.964  1.00 0.00  ? 4   ILE A HG21 1  
ATOM   58    H  HG22 . ILE A 1 4   ? -6.908  72.008 -3.179  1.00 0.00  ? 4   ILE A HG22 1  
ATOM   59    H  HG23 . ILE A 1 4   ? -5.839  73.224 -3.879  1.00 0.00  ? 4   ILE A HG23 1  
ATOM   60    H  HD11 . ILE A 1 4   ? -9.170  70.665 -4.828  1.00 0.00  ? 4   ILE A HD11 1  
ATOM   61    H  HD12 . ILE A 1 4   ? -10.256 71.974 -4.362  1.00 0.00  ? 4   ILE A HD12 1  
ATOM   62    H  HD13 . ILE A 1 4   ? -8.848  71.600 -3.368  1.00 0.00  ? 4   ILE A HD13 1  
ATOM   63    N  N    . PHE A 1 5   ? -4.577  71.276 -7.127  1.00 0.00  ? 5   PHE A N    1  
ATOM   64    C  CA   . PHE A 1 5   ? -3.192  70.746 -7.252  1.00 0.00  ? 5   PHE A CA   1  
ATOM   65    C  C    . PHE A 1 5   ? -2.311  71.791 -7.954  1.00 0.00  ? 5   PHE A C    1  
ATOM   66    O  O    . PHE A 1 5   ? -1.220  72.101 -7.504  1.00 0.00  ? 5   PHE A O    1  
ATOM   67    C  CB   . PHE A 1 5   ? -3.207  69.440 -8.051  1.00 0.00  ? 5   PHE A CB   1  
ATOM   68    C  CG   . PHE A 1 5   ? -4.348  68.567 -7.572  1.00 0.00  ? 5   PHE A CG   1  
ATOM   69    C  CD1  . PHE A 1 5   ? -4.357  68.091 -6.255  1.00 0.00  ? 5   PHE A CD1  1  
ATOM   70    C  CD2  . PHE A 1 5   ? -5.395  68.234 -8.443  1.00 0.00  ? 5   PHE A CD2  1  
ATOM   71    C  CE1  . PHE A 1 5   ? -5.411  67.282 -5.810  1.00 0.00  ? 5   PHE A CE1  1  
ATOM   72    C  CE2  . PHE A 1 5   ? -6.447  67.426 -7.997  1.00 0.00  ? 5   PHE A CE2  1  
ATOM   73    C  CZ   . PHE A 1 5   ? -6.455  66.950 -6.681  1.00 0.00  ? 5   PHE A CZ   1  
ATOM   74    H  H    . PHE A 1 5   ? -5.345  70.797 -7.503  1.00 0.00  ? 5   PHE A H    1  
ATOM   75    H  HA   . PHE A 1 5   ? -2.797  70.555 -6.265  1.00 0.00  ? 5   PHE A HA   1  
ATOM   76    H  HB2  . PHE A 1 5   ? -3.334  69.659 -9.095  1.00 0.00  ? 5   PHE A HB2  1  
ATOM   77    H  HB3  . PHE A 1 5   ? -2.273  68.919 -7.903  1.00 0.00  ? 5   PHE A HB3  1  
ATOM   78    H  HD1  . PHE A 1 5   ? -3.552  68.347 -5.583  1.00 0.00  ? 5   PHE A HD1  1  
ATOM   79    H  HD2  . PHE A 1 5   ? -5.390  68.600 -9.459  1.00 0.00  ? 5   PHE A HD2  1  
ATOM   80    H  HE1  . PHE A 1 5   ? -5.417  66.915 -4.795  1.00 0.00  ? 5   PHE A HE1  1  
ATOM   81    H  HE2  . PHE A 1 5   ? -7.253  67.169 -8.669  1.00 0.00  ? 5   PHE A HE2  1  
ATOM   82    H  HZ   . PHE A 1 5   ? -7.267  66.327 -6.337  1.00 0.00  ? 5   PHE A HZ   1  
ATOM   83    N  N    . THR A 1 6   ? -2.776  72.350 -9.043  1.00 0.00  ? 6   THR A N    1  
ATOM   84    C  CA   . THR A 1 6   ? -1.957  73.381 -9.754  1.00 0.00  ? 6   THR A CA   1  
ATOM   85    C  C    . THR A 1 6   ? -1.922  74.661 -8.922  1.00 0.00  ? 6   THR A C    1  
ATOM   86    O  O    . THR A 1 6   ? -0.883  75.252 -8.708  1.00 0.00  ? 6   THR A O    1  
ATOM   87    C  CB   . THR A 1 6   ? -2.562  73.663 -11.145 1.00 0.00  ? 6   THR A CB   1  
ATOM   88    O  OG1  . THR A 1 6   ? -2.122  72.668 -12.057 1.00 0.00  ? 6   THR A OG1  1  
ATOM   89    C  CG2  . THR A 1 6   ? -2.120  75.037 -11.667 1.00 0.00  ? 6   THR A CG2  1  
ATOM   90    H  H    . THR A 1 6   ? -3.664  72.100 -9.385  1.00 0.00  ? 6   THR A H    1  
ATOM   91    H  HA   . THR A 1 6   ? -0.958  73.015 -9.868  1.00 0.00  ? 6   THR A HA   1  
ATOM   92    H  HB   . THR A 1 6   ? -3.639  73.639 -11.076 1.00 0.00  ? 6   THR A HB   1  
ATOM   93    H  HG1  . THR A 1 6   ? -1.657  71.993 -11.558 1.00 0.00  ? 6   THR A HG1  1  
ATOM   94    H  HG21 . THR A 1 6   ? -2.693  75.810 -11.176 1.00 0.00  ? 6   THR A HG21 1  
ATOM   95    H  HG22 . THR A 1 6   ? -2.286  75.088 -12.733 1.00 0.00  ? 6   THR A HG22 1  
ATOM   96    H  HG23 . THR A 1 6   ? -1.070  75.181 -11.459 1.00 0.00  ? 6   THR A HG23 1  
ATOM   97    N  N    . GLN A 1 7   ? -3.052  75.090 -8.463  1.00 0.00  ? 7   GLN A N    1  
ATOM   98    C  CA   . GLN A 1 7   ? -3.096  76.335 -7.650  1.00 0.00  ? 7   GLN A CA   1  
ATOM   99    C  C    . GLN A 1 7   ? -2.264  76.133 -6.384  1.00 0.00  ? 7   GLN A C    1  
ATOM   100   O  O    . GLN A 1 7   ? -1.621  77.038 -5.894  1.00 0.00  ? 7   GLN A O    1  
ATOM   101   C  CB   . GLN A 1 7   ? -4.543  76.654 -7.270  1.00 0.00  ? 7   GLN A CB   1  
ATOM   102   C  CG   . GLN A 1 7   ? -5.328  77.046 -8.524  1.00 0.00  ? 7   GLN A CG   1  
ATOM   103   C  CD   . GLN A 1 7   ? -4.888  78.435 -8.991  1.00 0.00  ? 7   GLN A CD   1  
ATOM   104   O  OE1  . GLN A 1 7   ? -4.115  78.560 -9.920  1.00 0.00  ? 7   GLN A OE1  1  
ATOM   105   N  NE2  . GLN A 1 7   ? -5.351  79.492 -8.381  1.00 0.00  ? 7   GLN A NE2  1  
ATOM   106   H  H    . GLN A 1 7   ? -3.868  74.592 -8.654  1.00 0.00  ? 7   GLN A H    1  
ATOM   107   H  HA   . GLN A 1 7   ? -2.690  77.151 -8.226  1.00 0.00  ? 7   GLN A HA   1  
ATOM   108   H  HB2  . GLN A 1 7   ? -4.995  75.785 -6.818  1.00 0.00  ? 7   GLN A HB2  1  
ATOM   109   H  HB3  . GLN A 1 7   ? -4.559  77.474 -6.568  1.00 0.00  ? 7   GLN A HB3  1  
ATOM   110   H  HG2  . GLN A 1 7   ? -5.138  76.326 -9.307  1.00 0.00  ? 7   GLN A HG2  1  
ATOM   111   H  HG3  . GLN A 1 7   ? -6.383  77.062 -8.298  1.00 0.00  ? 7   GLN A HG3  1  
ATOM   112   H  HE21 . GLN A 1 7   ? -5.975  79.392 -7.632  1.00 0.00  ? 7   GLN A HE21 1  
ATOM   113   H  HE22 . GLN A 1 7   ? -5.075  80.386 -8.673  1.00 0.00  ? 7   GLN A HE22 1  
ATOM   114   N  N    . CYS A 1 8   ? -2.275  74.943 -5.855  1.00 0.00  ? 8   CYS A N    1  
ATOM   115   C  CA   . CYS A 1 8   ? -1.497  74.654 -4.618  1.00 0.00  ? 8   CYS A CA   1  
ATOM   116   C  C    . CYS A 1 8   ? -0.015  74.986 -4.829  1.00 0.00  ? 8   CYS A C    1  
ATOM   117   O  O    . CYS A 1 8   ? 0.579   75.718 -4.062  1.00 0.00  ? 8   CYS A O    1  
ATOM   118   C  CB   . CYS A 1 8   ? -1.641  73.166 -4.283  1.00 0.00  ? 8   CYS A CB   1  
ATOM   119   S  SG   . CYS A 1 8   ? -3.205  72.900 -3.419  1.00 0.00  ? 8   CYS A SG   1  
ATOM   120   H  H    . CYS A 1 8   ? -2.804  74.231 -6.273  1.00 0.00  ? 8   CYS A H    1  
ATOM   121   H  HA   . CYS A 1 8   ? -1.890  75.244 -3.798  1.00 0.00  ? 8   CYS A HA   1  
ATOM   122   H  HB2  . CYS A 1 8   ? -1.634  72.590 -5.196  1.00 0.00  ? 8   CYS A HB2  1  
ATOM   123   H  HB3  . CYS A 1 8   ? -0.823  72.849 -3.652  1.00 0.00  ? 8   CYS A HB3  1  
ATOM   124   H  HG   . CYS A 1 8   ? -3.569  72.063 -3.716  1.00 0.00  ? 8   CYS A HG   1  
ATOM   125   N  N    . ARG A 1 9   ? 0.594   74.439 -5.847  1.00 0.00  ? 9   ARG A N    1  
ATOM   126   C  CA   . ARG A 1 9   ? 2.044   74.714 -6.077  1.00 0.00  ? 9   ARG A CA   1  
ATOM   127   C  C    . ARG A 1 9   ? 2.238   76.157 -6.540  1.00 0.00  ? 9   ARG A C    1  
ATOM   128   O  O    . ARG A 1 9   ? 3.345   76.595 -6.786  1.00 0.00  ? 9   ARG A O    1  
ATOM   129   C  CB   . ARG A 1 9   ? 2.585   73.757 -7.141  1.00 0.00  ? 9   ARG A CB   1  
ATOM   130   C  CG   . ARG A 1 9   ? 1.708   73.834 -8.392  1.00 0.00  ? 9   ARG A CG   1  
ATOM   131   C  CD   . ARG A 1 9   ? 2.259   72.889 -9.461  1.00 0.00  ? 9   ARG A CD   1  
ATOM   132   N  NE   . ARG A 1 9   ? 3.665   73.264 -9.779  1.00 0.00  ? 9   ARG A NE   1  
ATOM   133   C  CZ   . ARG A 1 9   ? 4.430   72.432 -10.430 1.00 0.00  ? 9   ARG A CZ   1  
ATOM   134   N  NH1  . ARG A 1 9   ? 3.964   71.271 -10.801 1.00 0.00  ? 9   ARG A NH1  1  
ATOM   135   N  NH2  . ARG A 1 9   ? 5.662   72.761 -10.711 1.00 0.00  ? 9   ARG A NH2  1  
ATOM   136   H  H    . ARG A 1 9   ? 0.104   73.837 -6.452  1.00 0.00  ? 9   ARG A H    1  
ATOM   137   H  HA   . ARG A 1 9   ? 2.584   74.566 -5.151  1.00 0.00  ? 9   ARG A HA   1  
ATOM   138   H  HB2  . ARG A 1 9   ? 3.598   74.035 -7.392  1.00 0.00  ? 9   ARG A HB2  1  
ATOM   139   H  HB3  . ARG A 1 9   ? 2.573   72.748 -6.757  1.00 0.00  ? 9   ARG A HB3  1  
ATOM   140   H  HG2  . ARG A 1 9   ? 0.697   73.546 -8.141  1.00 0.00  ? 9   ARG A HG2  1  
ATOM   141   H  HG3  . ARG A 1 9   ? 1.710   74.845 -8.772  1.00 0.00  ? 9   ARG A HG3  1  
ATOM   142   H  HD2  . ARG A 1 9   ? 2.231   71.874 -9.093  1.00 0.00  ? 9   ARG A HD2  1  
ATOM   143   H  HD3  . ARG A 1 9   ? 1.655   72.965 -10.354 1.00 0.00  ? 9   ARG A HD3  1  
ATOM   144   H  HE   . ARG A 1 9   ? 4.015   74.136 -9.500  1.00 0.00  ? 9   ARG A HE   1  
ATOM   145   H  HH11 . ARG A 1 9   ? 3.021   71.019 -10.586 1.00 0.00  ? 9   ARG A HH11 1  
ATOM   146   H  HH12 . ARG A 1 9   ? 4.551   70.633 -11.300 1.00 0.00  ? 9   ARG A HH12 1  
ATOM   147   H  HH21 . ARG A 1 9   ? 6.019   73.651 -10.427 1.00 0.00  ? 9   ARG A HH21 1  
ATOM   148   H  HH22 . ARG A 1 9   ? 6.248   72.123 -11.210 1.00 0.00  ? 9   ARG A HH22 1  
ATOM   149   N  N    . GLU A 1 10  ? 1.179   76.902 -6.653  1.00 0.00  ? 10  GLU A N    1  
ATOM   150   C  CA   . GLU A 1 10  ? 1.313   78.306 -7.087  1.00 0.00  ? 10  GLU A CA   1  
ATOM   151   C  C    . GLU A 1 10  ? 2.107   79.069 -6.026  1.00 0.00  ? 10  GLU A C    1  
ATOM   152   O  O    . GLU A 1 10  ? 2.391   80.242 -6.162  1.00 0.00  ? 10  GLU A O    1  
ATOM   153   C  CB   . GLU A 1 10  ? -0.082  78.908 -7.237  1.00 0.00  ? 10  GLU A CB   1  
ATOM   154   C  CG   . GLU A 1 10  ? 0.006   80.212 -8.015  1.00 0.00  ? 10  GLU A CG   1  
ATOM   155   C  CD   . GLU A 1 10  ? -1.400  80.759 -8.264  1.00 0.00  ? 10  GLU A CD   1  
ATOM   156   O  OE1  . GLU A 1 10  ? -2.039  80.293 -9.193  1.00 0.00  ? 10  GLU A OE1  1  
ATOM   157   O  OE2  . GLU A 1 10  ? -1.815  81.634 -7.523  1.00 0.00  ? 10  GLU A OE2  1  
ATOM   158   H  H    . GLU A 1 10  ? 0.301   76.537 -6.443  1.00 0.00  ? 10  GLU A H    1  
ATOM   159   H  HA   . GLU A 1 10  ? 1.831   78.342 -8.032  1.00 0.00  ? 10  GLU A HA   1  
ATOM   160   H  HB2  . GLU A 1 10  ? -0.712  78.216 -7.769  1.00 0.00  ? 10  GLU A HB2  1  
ATOM   161   H  HB3  . GLU A 1 10  ? -0.500  79.100 -6.260  1.00 0.00  ? 10  GLU A HB3  1  
ATOM   162   H  HG2  . GLU A 1 10  ? 0.572   80.921 -7.440  1.00 0.00  ? 10  GLU A HG2  1  
ATOM   163   H  HG3  . GLU A 1 10  ? 0.497   80.037 -8.959  1.00 0.00  ? 10  GLU A HG3  1  
ATOM   164   N  N    . GLY A 1 11  ? 2.464   78.402 -4.961  1.00 0.00  ? 11  GLY A N    1  
ATOM   165   C  CA   . GLY A 1 11  ? 3.230   79.066 -3.874  1.00 0.00  ? 11  GLY A CA   1  
ATOM   166   C  C    . GLY A 1 11  ? 2.238   79.591 -2.853  1.00 0.00  ? 11  GLY A C    1  
ATOM   167   O  O    . GLY A 1 11  ? 2.601   80.110 -1.816  1.00 0.00  ? 11  GLY A O    1  
ATOM   168   H  H    . GLY A 1 11  ? 2.219   77.459 -4.871  1.00 0.00  ? 11  GLY A H    1  
ATOM   169   H  HA2  . GLY A 1 11  ? 3.882   78.343 -3.408  1.00 0.00  ? 11  GLY A HA2  1  
ATOM   170   H  HA3  . GLY A 1 11  ? 3.810   79.881 -4.267  1.00 0.00  ? 11  GLY A HA3  1  
ATOM   171   N  N    . ASN A 1 12  ? 0.978   79.429 -3.134  1.00 0.00  ? 12  ASN A N    1  
ATOM   172   C  CA   . ASN A 1 12  ? -0.055  79.878 -2.182  1.00 0.00  ? 12  ASN A CA   1  
ATOM   173   C  C    . ASN A 1 12  ? -0.104  78.842 -1.075  1.00 0.00  ? 12  ASN A C    1  
ATOM   174   O  O    . ASN A 1 12  ? -1.094  78.179 -0.857  1.00 0.00  ? 12  ASN A O    1  
ATOM   175   C  CB   . ASN A 1 12  ? -1.414  79.990 -2.876  1.00 0.00  ? 12  ASN A CB   1  
ATOM   176   C  CG   . ASN A 1 12  ? -1.618  78.805 -3.816  1.00 0.00  ? 12  ASN A CG   1  
ATOM   177   O  OD1  . ASN A 1 12  ? -2.489  78.834 -4.663  1.00 0.00  ? 12  ASN A OD1  1  
ATOM   178   N  ND2  . ASN A 1 12  ? -0.853  77.754 -3.701  1.00 0.00  ? 12  ASN A ND2  1  
ATOM   179   H  H    . ASN A 1 12  ? 0.720   78.983 -3.956  1.00 0.00  ? 12  ASN A H    1  
ATOM   180   H  HA   . ASN A 1 12  ? 0.226   80.837 -1.768  1.00 0.00  ? 12  ASN A HA   1  
ATOM   181   H  HB2  . ASN A 1 12  ? -2.195  79.999 -2.131  1.00 0.00  ? 12  ASN A HB2  1  
ATOM   182   H  HB3  . ASN A 1 12  ? -1.451  80.907 -3.445  1.00 0.00  ? 12  ASN A HB3  1  
ATOM   183   H  HD21 . ASN A 1 12  ? -0.154  77.730 -3.015  1.00 0.00  ? 12  ASN A HD21 1  
ATOM   184   H  HD22 . ASN A 1 12  ? -0.977  76.989 -4.300  1.00 0.00  ? 12  ASN A HD22 1  
ATOM   185   N  N    . ALA A 1 13  ? 0.990   78.711 -0.389  1.00 0.00  ? 13  ALA A N    1  
ATOM   186   C  CA   . ALA A 1 13  ? 1.091   77.733 0.738   1.00 0.00  ? 13  ALA A CA   1  
ATOM   187   C  C    . ALA A 1 13  ? -0.198  77.765 1.578   1.00 0.00  ? 13  ALA A C    1  
ATOM   188   O  O    . ALA A 1 13  ? -0.507  76.855 2.326   1.00 0.00  ? 13  ALA A O    1  
ATOM   189   C  CB   . ALA A 1 13  ? 2.279   78.109 1.625   1.00 0.00  ? 13  ALA A CB   1  
ATOM   190   H  H    . ALA A 1 13  ? 1.752   79.276 -0.628  1.00 0.00  ? 13  ALA A H    1  
ATOM   191   H  HA   . ALA A 1 13  ? 1.244   76.751 0.340   1.00 0.00  ? 13  ALA A HA   1  
ATOM   192   H  HB1  . ALA A 1 13  ? 2.425   77.346 2.375   1.00 0.00  ? 13  ALA A HB1  1  
ATOM   193   H  HB2  . ALA A 1 13  ? 2.083   79.055 2.107   1.00 0.00  ? 13  ALA A HB2  1  
ATOM   194   H  HB3  . ALA A 1 13  ? 3.169   78.192 1.019   1.00 0.00  ? 13  ALA A HB3  1  
ATOM   195   N  N    . VAL A 1 14  ? -0.965  78.802 1.429   1.00 0.00  ? 14  VAL A N    1  
ATOM   196   C  CA   . VAL A 1 14  ? -2.243  78.912 2.184   1.00 0.00  ? 14  VAL A CA   1  
ATOM   197   C  C    . VAL A 1 14  ? -3.318  78.095 1.462   1.00 0.00  ? 14  VAL A C    1  
ATOM   198   O  O    . VAL A 1 14  ? -4.222  77.555 2.067   1.00 0.00  ? 14  VAL A O    1  
ATOM   199   C  CB   . VAL A 1 14  ? -2.653  80.397 2.272   1.00 0.00  ? 14  VAL A CB   1  
ATOM   200   C  CG1  . VAL A 1 14  ? -1.392  81.250 2.388   1.00 0.00  ? 14  VAL A CG1  1  
ATOM   201   C  CG2  . VAL A 1 14  ? -3.423  80.831 1.014   1.00 0.00  ? 14  VAL A CG2  1  
ATOM   202   H  H    . VAL A 1 14  ? -0.705  79.490 0.785   1.00 0.00  ? 14  VAL A H    1  
ATOM   203   H  HA   . VAL A 1 14  ? -2.106  78.518 3.182   1.00 0.00  ? 14  VAL A HA   1  
ATOM   204   H  HB   . VAL A 1 14  ? -3.270  80.549 3.146   1.00 0.00  ? 14  VAL A HB   1  
ATOM   205   H  HG11 . VAL A 1 14  ? -0.771  80.869 3.186   1.00 0.00  ? 14  VAL A HG11 1  
ATOM   206   H  HG12 . VAL A 1 14  ? -1.666  82.272 2.600   1.00 0.00  ? 14  VAL A HG12 1  
ATOM   207   H  HG13 . VAL A 1 14  ? -0.847  81.206 1.456   1.00 0.00  ? 14  VAL A HG13 1  
ATOM   208   H  HG21 . VAL A 1 14  ? -4.422  80.420 1.044   1.00 0.00  ? 14  VAL A HG21 1  
ATOM   209   H  HG22 . VAL A 1 14  ? -2.911  80.469 0.135   1.00 0.00  ? 14  VAL A HG22 1  
ATOM   210   H  HG23 . VAL A 1 14  ? -3.479  81.909 0.979   1.00 0.00  ? 14  VAL A HG23 1  
ATOM   211   N  N    . ALA A 1 15  ? -3.221  78.016 0.165   1.00 0.00  ? 15  ALA A N    1  
ATOM   212   C  CA   . ALA A 1 15  ? -4.232  77.258 -0.618  1.00 0.00  ? 15  ALA A CA   1  
ATOM   213   C  C    . ALA A 1 15  ? -4.026  75.756 -0.427  1.00 0.00  ? 15  ALA A C    1  
ATOM   214   O  O    . ALA A 1 15  ? -4.974  74.990 -0.424  1.00 0.00  ? 15  ALA A O    1  
ATOM   215   C  CB   . ALA A 1 15  ? -4.091  77.596 -2.102  1.00 0.00  ? 15  ALA A CB   1  
ATOM   216   H  H    . ALA A 1 15  ? -2.482  78.470 -0.296  1.00 0.00  ? 15  ALA A H    1  
ATOM   217   H  HA   . ALA A 1 15  ? -5.219  77.534 -0.285  1.00 0.00  ? 15  ALA A HA   1  
ATOM   218   H  HB1  . ALA A 1 15  ? -3.158  77.200 -2.472  1.00 0.00  ? 15  ALA A HB1  1  
ATOM   219   H  HB2  . ALA A 1 15  ? -4.107  78.667 -2.231  1.00 0.00  ? 15  ALA A HB2  1  
ATOM   220   H  HB3  . ALA A 1 15  ? -4.911  77.156 -2.650  1.00 0.00  ? 15  ALA A HB3  1  
ATOM   221   N  N    . VAL A 1 16  ? -2.804  75.315 -0.265  1.00 0.00  ? 16  VAL A N    1  
ATOM   222   C  CA   . VAL A 1 16  ? -2.576  73.862 -0.079  1.00 0.00  ? 16  VAL A CA   1  
ATOM   223   C  C    . VAL A 1 16  ? -3.018  73.497 1.343   1.00 0.00  ? 16  VAL A C    1  
ATOM   224   O  O    . VAL A 1 16  ? -3.620  72.466 1.572   1.00 0.00  ? 16  VAL A O    1  
ATOM   225   C  CB   . VAL A 1 16  ? -1.084  73.524 -0.346  1.00 0.00  ? 16  VAL A CB   1  
ATOM   226   C  CG1  . VAL A 1 16  ? -0.226  74.771 -0.206  1.00 0.00  ? 16  VAL A CG1  1  
ATOM   227   C  CG2  . VAL A 1 16  ? -0.576  72.466 0.636   1.00 0.00  ? 16  VAL A CG2  1  
ATOM   228   H  H    . VAL A 1 16  ? -2.039  75.927 -0.256  1.00 0.00  ? 16  VAL A H    1  
ATOM   229   H  HA   . VAL A 1 16  ? -3.190  73.323 -0.783  1.00 0.00  ? 16  VAL A HA   1  
ATOM   230   H  HB   . VAL A 1 16  ? -0.980  73.157 -1.352  1.00 0.00  ? 16  VAL A HB   1  
ATOM   231   H  HG11 . VAL A 1 16  ? 0.819   74.495 -0.205  1.00 0.00  ? 16  VAL A HG11 1  
ATOM   232   H  HG12 . VAL A 1 16  ? -0.468  75.259 0.717   1.00 0.00  ? 16  VAL A HG12 1  
ATOM   233   H  HG13 . VAL A 1 16  ? -0.417  75.440 -1.034  1.00 0.00  ? 16  VAL A HG13 1  
ATOM   234   H  HG21 . VAL A 1 16  ? -0.490  72.909 1.616   1.00 0.00  ? 16  VAL A HG21 1  
ATOM   235   H  HG22 . VAL A 1 16  ? 0.390   72.110 0.313   1.00 0.00  ? 16  VAL A HG22 1  
ATOM   236   H  HG23 . VAL A 1 16  ? -1.273  71.644 0.671   1.00 0.00  ? 16  VAL A HG23 1  
ATOM   237   N  N    . ARG A 1 17  ? -2.752  74.342 2.300   1.00 0.00  ? 17  ARG A N    1  
ATOM   238   C  CA   . ARG A 1 17  ? -3.195  74.027 3.685   1.00 0.00  ? 17  ARG A CA   1  
ATOM   239   C  C    . ARG A 1 17  ? -4.732  74.061 3.704   1.00 0.00  ? 17  ARG A C    1  
ATOM   240   O  O    . ARG A 1 17  ? -5.380  73.301 4.396   1.00 0.00  ? 17  ARG A O    1  
ATOM   241   C  CB   . ARG A 1 17  ? -2.606  75.082 4.656   1.00 0.00  ? 17  ARG A CB   1  
ATOM   242   C  CG   . ARG A 1 17  ? -1.941  74.405 5.866   1.00 0.00  ? 17  ARG A CG   1  
ATOM   243   C  CD   . ARG A 1 17  ? -3.012  73.777 6.759   1.00 0.00  ? 17  ARG A CD   1  
ATOM   244   N  NE   . ARG A 1 17  ? -3.676  74.846 7.557   1.00 0.00  ? 17  ARG A NE   1  
ATOM   245   C  CZ   . ARG A 1 17  ? -4.795  74.597 8.181   1.00 0.00  ? 17  ARG A CZ   1  
ATOM   246   N  NH1  . ARG A 1 17  ? -5.326  73.407 8.117   1.00 0.00  ? 17  ARG A NH1  1  
ATOM   247   N  NH2  . ARG A 1 17  ? -5.380  75.537 8.871   1.00 0.00  ? 17  ARG A NH2  1  
ATOM   248   H  H    . ARG A 1 17  ? -2.282  75.189 2.107   1.00 0.00  ? 17  ARG A H    1  
ATOM   249   H  HA   . ARG A 1 17  ? -2.856  73.036 3.950   1.00 0.00  ? 17  ARG A HA   1  
ATOM   250   H  HB2  . ARG A 1 17  ? -1.864  75.665 4.131   1.00 0.00  ? 17  ARG A HB2  1  
ATOM   251   H  HB3  . ARG A 1 17  ? -3.387  75.744 5.007   1.00 0.00  ? 17  ARG A HB3  1  
ATOM   252   H  HG2  . ARG A 1 17  ? -1.260  73.639 5.523   1.00 0.00  ? 17  ARG A HG2  1  
ATOM   253   H  HG3  . ARG A 1 17  ? -1.393  75.143 6.432   1.00 0.00  ? 17  ARG A HG3  1  
ATOM   254   H  HD2  . ARG A 1 17  ? -3.747  73.275 6.148   1.00 0.00  ? 17  ARG A HD2  1  
ATOM   255   H  HD3  . ARG A 1 17  ? -2.550  73.062 7.425   1.00 0.00  ? 17  ARG A HD3  1  
ATOM   256   H  HE   . ARG A 1 17  ? -3.274  75.738 7.610   1.00 0.00  ? 17  ARG A HE   1  
ATOM   257   H  HH11 . ARG A 1 17  ? -4.876  72.686 7.590   1.00 0.00  ? 17  ARG A HH11 1  
ATOM   258   H  HH12 . ARG A 1 17  ? -6.183  73.216 8.595   1.00 0.00  ? 17  ARG A HH12 1  
ATOM   259   H  HH21 . ARG A 1 17  ? -4.972  76.448 8.922   1.00 0.00  ? 17  ARG A HH21 1  
ATOM   260   H  HH22 . ARG A 1 17  ? -6.238  75.346 9.349   1.00 0.00  ? 17  ARG A HH22 1  
ATOM   261   N  N    . LEU A 1 18  ? -5.304  74.961 2.950   1.00 0.00  ? 18  LEU A N    1  
ATOM   262   C  CA   . LEU A 1 18  ? -6.788  75.106 2.898   1.00 0.00  ? 18  LEU A CA   1  
ATOM   263   C  C    . LEU A 1 18  ? -7.472  73.771 2.550   1.00 0.00  ? 18  LEU A C    1  
ATOM   264   O  O    . LEU A 1 18  ? -8.336  73.323 3.273   1.00 0.00  ? 18  LEU A O    1  
ATOM   265   C  CB   . LEU A 1 18  ? -7.112  76.200 1.855   1.00 0.00  ? 18  LEU A CB   1  
ATOM   266   C  CG   . LEU A 1 18  ? -8.576  76.110 1.320   1.00 0.00  ? 18  LEU A CG   1  
ATOM   267   C  CD1  . LEU A 1 18  ? -9.201  77.512 1.255   1.00 0.00  ? 18  LEU A CD1  1  
ATOM   268   C  CD2  . LEU A 1 18  ? -8.585  75.500 -0.099  1.00 0.00  ? 18  LEU A CD2  1  
ATOM   269   H  H    . LEU A 1 18  ? -4.751  75.575 2.423   1.00 0.00  ? 18  LEU A H    1  
ATOM   270   H  HA   . LEU A 1 18  ? -7.140  75.432 3.866   1.00 0.00  ? 18  LEU A HA   1  
ATOM   271   H  HB2  . LEU A 1 18  ? -6.955  77.166 2.316   1.00 0.00  ? 18  LEU A HB2  1  
ATOM   272   H  HB3  . LEU A 1 18  ? -6.422  76.099 1.035   1.00 0.00  ? 18  LEU A HB3  1  
ATOM   273   H  HG   . LEU A 1 18  ? -9.178  75.502 1.978   1.00 0.00  ? 18  LEU A HG   1  
ATOM   274   H  HD11 . LEU A 1 18  ? -8.573  78.160 0.661   1.00 0.00  ? 18  LEU A HD11 1  
ATOM   275   H  HD12 . LEU A 1 18  ? -9.290  77.914 2.254   1.00 0.00  ? 18  LEU A HD12 1  
ATOM   276   H  HD13 . LEU A 1 18  ? -10.181 77.449 0.805   1.00 0.00  ? 18  LEU A HD13 1  
ATOM   277   H  HD21 . LEU A 1 18  ? -9.567  75.109 -0.318  1.00 0.00  ? 18  LEU A HD21 1  
ATOM   278   H  HD22 . LEU A 1 18  ? -7.861  74.703 -0.159  1.00 0.00  ? 18  LEU A HD22 1  
ATOM   279   H  HD23 . LEU A 1 18  ? -8.331  76.261 -0.825  1.00 0.00  ? 18  LEU A HD23 1  
ATOM   280   N  N    . TRP A 1 19  ? -7.144  73.136 1.453   1.00 0.00  ? 19  TRP A N    1  
ATOM   281   C  CA   . TRP A 1 19  ? -7.862  71.853 1.133   1.00 0.00  ? 19  TRP A CA   1  
ATOM   282   C  C    . TRP A 1 19  ? -7.306  70.712 1.988   1.00 0.00  ? 19  TRP A C    1  
ATOM   283   O  O    . TRP A 1 19  ? -7.962  69.711 2.200   1.00 0.00  ? 19  TRP A O    1  
ATOM   284   C  CB   . TRP A 1 19  ? -7.753  71.511 -0.365  1.00 0.00  ? 19  TRP A CB   1  
ATOM   285   C  CG   . TRP A 1 19  ? -6.380  71.031 -0.698  1.00 0.00  ? 19  TRP A CG   1  
ATOM   286   C  CD1  . TRP A 1 19  ? -5.259  71.735 -0.486  1.00 0.00  ? 19  TRP A CD1  1  
ATOM   287   C  CD2  . TRP A 1 19  ? -5.967  69.770 -1.306  1.00 0.00  ? 19  TRP A CD2  1  
ATOM   288   N  NE1  . TRP A 1 19  ? -4.173  70.997 -0.918  1.00 0.00  ? 19  TRP A NE1  1  
ATOM   289   C  CE2  . TRP A 1 19  ? -4.558  69.775 -1.430  1.00 0.00  ? 19  TRP A CE2  1  
ATOM   290   C  CE3  . TRP A 1 19  ? -6.667  68.636 -1.754  1.00 0.00  ? 19  TRP A CE3  1  
ATOM   291   C  CZ2  . TRP A 1 19  ? -3.867  68.695 -1.977  1.00 0.00  ? 19  TRP A CZ2  1  
ATOM   292   C  CZ3  . TRP A 1 19  ? -5.974  67.546 -2.306  1.00 0.00  ? 19  TRP A CZ3  1  
ATOM   293   C  CH2  . TRP A 1 19  ? -4.577  67.575 -2.417  1.00 0.00  ? 19  TRP A CH2  1  
ATOM   294   H  H    . TRP A 1 19  ? -6.461  73.504 0.844   1.00 0.00  ? 19  TRP A H    1  
ATOM   295   H  HA   . TRP A 1 19  ? -8.910  71.978 1.378   1.00 0.00  ? 19  TRP A HA   1  
ATOM   296   H  HB2  . TRP A 1 19  ? -8.467  70.739 -0.607  1.00 0.00  ? 19  TRP A HB2  1  
ATOM   297   H  HB3  . TRP A 1 19  ? -7.973  72.394 -0.947  1.00 0.00  ? 19  TRP A HB3  1  
ATOM   298   H  HD1  . TRP A 1 19  ? -5.223  72.714 -0.052  1.00 0.00  ? 19  TRP A HD1  1  
ATOM   299   H  HE1  . TRP A 1 19  ? -3.240  71.287 -0.875  1.00 0.00  ? 19  TRP A HE1  1  
ATOM   300   H  HE3  . TRP A 1 19  ? -7.742  68.603 -1.677  1.00 0.00  ? 19  TRP A HE3  1  
ATOM   301   H  HZ2  . TRP A 1 19  ? -2.790  68.723 -2.059  1.00 0.00  ? 19  TRP A HZ2  1  
ATOM   302   H  HZ3  . TRP A 1 19  ? -6.521  66.679 -2.647  1.00 0.00  ? 19  TRP A HZ3  1  
ATOM   303   H  HH2  . TRP A 1 19  ? -4.050  66.734 -2.842  1.00 0.00  ? 19  TRP A HH2  1  
ATOM   304   N  N    . LEU A 1 20  ? -6.110  70.849 2.487   1.00 0.00  ? 20  LEU A N    1  
ATOM   305   C  CA   . LEU A 1 20  ? -5.530  69.766 3.330   1.00 0.00  ? 20  LEU A CA   1  
ATOM   306   C  C    . LEU A 1 20  ? -6.342  69.629 4.624   1.00 0.00  ? 20  LEU A C    1  
ATOM   307   O  O    . LEU A 1 20  ? -6.299  68.611 5.286   1.00 0.00  ? 20  LEU A O    1  
ATOM   308   C  CB   . LEU A 1 20  ? -4.070  70.112 3.665   1.00 0.00  ? 20  LEU A CB   1  
ATOM   309   C  CG   . LEU A 1 20  ? -3.413  68.971 4.494   1.00 0.00  ? 20  LEU A CG   1  
ATOM   310   C  CD1  . LEU A 1 20  ? -1.969  68.742 4.028   1.00 0.00  ? 20  LEU A CD1  1  
ATOM   311   C  CD2  . LEU A 1 20  ? -3.390  69.339 5.986   1.00 0.00  ? 20  LEU A CD2  1  
ATOM   312   H  H    . LEU A 1 20  ? -5.590  71.658 2.305   1.00 0.00  ? 20  LEU A H    1  
ATOM   313   H  HA   . LEU A 1 20  ? -5.561  68.833 2.787   1.00 0.00  ? 20  LEU A HA   1  
ATOM   314   H  HB2  . LEU A 1 20  ? -3.528  70.253 2.738   1.00 0.00  ? 20  LEU A HB2  1  
ATOM   315   H  HB3  . LEU A 1 20  ? -4.046  71.035 4.228   1.00 0.00  ? 20  LEU A HB3  1  
ATOM   316   H  HG   . LEU A 1 20  ? -3.971  68.052 4.361   1.00 0.00  ? 20  LEU A HG   1  
ATOM   317   H  HD11 . LEU A 1 20  ? -1.972  68.404 3.002   1.00 0.00  ? 20  LEU A HD11 1  
ATOM   318   H  HD12 . LEU A 1 20  ? -1.504  67.994 4.652   1.00 0.00  ? 20  LEU A HD12 1  
ATOM   319   H  HD13 . LEU A 1 20  ? -1.417  69.667 4.101   1.00 0.00  ? 20  LEU A HD13 1  
ATOM   320   H  HD21 . LEU A 1 20  ? -2.937  68.535 6.547   1.00 0.00  ? 20  LEU A HD21 1  
ATOM   321   H  HD22 . LEU A 1 20  ? -4.398  69.498 6.337   1.00 0.00  ? 20  LEU A HD22 1  
ATOM   322   H  HD23 . LEU A 1 20  ? -2.815  70.242 6.124   1.00 0.00  ? 20  LEU A HD23 1  
ATOM   323   N  N    . ASP A 1 21  ? -7.087  70.641 4.989   1.00 0.00  ? 21  ASP A N    1  
ATOM   324   C  CA   . ASP A 1 21  ? -7.901  70.556 6.241   1.00 0.00  ? 21  ASP A CA   1  
ATOM   325   C  C    . ASP A 1 21  ? -9.228  69.854 5.942   1.00 0.00  ? 21  ASP A C    1  
ATOM   326   O  O    . ASP A 1 21  ? -10.287 70.316 6.318   1.00 0.00  ? 21  ASP A O    1  
ATOM   327   C  CB   . ASP A 1 21  ? -8.172  71.966 6.782   1.00 0.00  ? 21  ASP A CB   1  
ATOM   328   C  CG   . ASP A 1 21  ? -8.932  72.796 5.744   1.00 0.00  ? 21  ASP A CG   1  
ATOM   329   O  OD1  . ASP A 1 21  ? -9.758  72.233 5.045   1.00 0.00  ? 21  ASP A OD1  1  
ATOM   330   O  OD2  . ASP A 1 21  ? -8.674  73.985 5.666   1.00 0.00  ? 21  ASP A OD2  1  
ATOM   331   H  H    . ASP A 1 21  ? -7.116  71.451 4.439   1.00 0.00  ? 21  ASP A H    1  
ATOM   332   H  HA   . ASP A 1 21  ? -7.358  69.988 6.984   1.00 0.00  ? 21  ASP A HA   1  
ATOM   333   H  HB2  . ASP A 1 21  ? -8.760  71.896 7.685   1.00 0.00  ? 21  ASP A HB2  1  
ATOM   334   H  HB3  . ASP A 1 21  ? -7.232  72.450 7.003   1.00 0.00  ? 21  ASP A HB3  1  
ATOM   335   N  N    . ASN A 1 22  ? -9.178  68.742 5.263   1.00 0.00  ? 22  ASN A N    1  
ATOM   336   C  CA   . ASN A 1 22  ? -10.432 68.012 4.930   1.00 0.00  ? 22  ASN A CA   1  
ATOM   337   C  C    . ASN A 1 22  ? -11.122 67.546 6.213   1.00 0.00  ? 22  ASN A C    1  
ATOM   338   O  O    . ASN A 1 22  ? -10.695 66.603 6.850   1.00 0.00  ? 22  ASN A O    1  
ATOM   339   C  CB   . ASN A 1 22  ? -10.094 66.793 4.067   1.00 0.00  ? 22  ASN A CB   1  
ATOM   340   C  CG   . ASN A 1 22  ? -11.365 66.279 3.388   1.00 0.00  ? 22  ASN A CG   1  
ATOM   341   O  OD1  . ASN A 1 22  ? -12.098 67.041 2.789   1.00 0.00  ? 22  ASN A OD1  1  
ATOM   342   N  ND2  . ASN A 1 22  ? -11.661 65.010 3.459   1.00 0.00  ? 22  ASN A ND2  1  
ATOM   343   H  H    . ASN A 1 22  ? -8.315  68.390 4.967   1.00 0.00  ? 22  ASN A H    1  
ATOM   344   H  HA   . ASN A 1 22  ? -11.094 68.667 4.384   1.00 0.00  ? 22  ASN A HA   1  
ATOM   345   H  HB2  . ASN A 1 22  ? -9.372  67.074 3.317   1.00 0.00  ? 22  ASN A HB2  1  
ATOM   346   H  HB3  . ASN A 1 22  ? -9.680  66.012 4.688   1.00 0.00  ? 22  ASN A HB3  1  
ATOM   347   H  HD21 . ASN A 1 22  ? -11.071 64.396 3.944   1.00 0.00  ? 22  ASN A HD21 1  
ATOM   348   H  HD22 . ASN A 1 22  ? -12.472 64.671 3.026   1.00 0.00  ? 22  ASN A HD22 1  
ATOM   349   N  N    . THR A 1 23  ? -12.194 68.185 6.590   1.00 0.00  ? 23  THR A N    1  
ATOM   350   C  CA   . THR A 1 23  ? -12.912 67.757 7.822   1.00 0.00  ? 23  THR A CA   1  
ATOM   351   C  C    . THR A 1 23  ? -13.522 66.378 7.575   1.00 0.00  ? 23  THR A C    1  
ATOM   352   O  O    . THR A 1 23  ? -14.108 65.778 8.455   1.00 0.00  ? 23  THR A O    1  
ATOM   353   C  CB   . THR A 1 23  ? -14.024 68.759 8.145   1.00 0.00  ? 23  THR A CB   1  
ATOM   354   O  OG1  . THR A 1 23  ? -14.971 68.770 7.086   1.00 0.00  ? 23  THR A OG1  1  
ATOM   355   C  CG2  . THR A 1 23  ? -13.425 70.156 8.311   1.00 0.00  ? 23  THR A CG2  1  
ATOM   356   H  H    . THR A 1 23  ? -12.532 68.936 6.059   1.00 0.00  ? 23  THR A H    1  
ATOM   357   H  HA   . THR A 1 23  ? -12.217 67.705 8.647   1.00 0.00  ? 23  THR A HA   1  
ATOM   358   H  HB   . THR A 1 23  ? -14.512 68.470 9.063   1.00 0.00  ? 23  THR A HB   1  
ATOM   359   H  HG1  . THR A 1 23  ? -14.591 69.259 6.353   1.00 0.00  ? 23  THR A HG1  1  
ATOM   360   H  HG21 . THR A 1 23  ? -12.711 70.148 9.122   1.00 0.00  ? 23  THR A HG21 1  
ATOM   361   H  HG22 . THR A 1 23  ? -14.212 70.861 8.533   1.00 0.00  ? 23  THR A HG22 1  
ATOM   362   H  HG23 . THR A 1 23  ? -12.928 70.446 7.397   1.00 0.00  ? 23  THR A HG23 1  
ATOM   363   N  N    . GLU A 1 24  ? -13.380 65.872 6.374   1.00 0.00  ? 24  GLU A N    1  
ATOM   364   C  CA   . GLU A 1 24  ? -13.940 64.525 6.031   1.00 0.00  ? 24  GLU A CA   1  
ATOM   365   C  C    . GLU A 1 24  ? -12.789 63.540 5.825   1.00 0.00  ? 24  GLU A C    1  
ATOM   366   O  O    . GLU A 1 24  ? -12.986 62.344 5.745   1.00 0.00  ? 24  GLU A O    1  
ATOM   367   C  CB   . GLU A 1 24  ? -14.748 64.629 4.736   1.00 0.00  ? 24  GLU A CB   1  
ATOM   368   C  CG   . GLU A 1 24  ? -15.839 65.689 4.895   1.00 0.00  ? 24  GLU A CG   1  
ATOM   369   C  CD   . GLU A 1 24  ? -16.837 65.239 5.964   1.00 0.00  ? 24  GLU A CD   1  
ATOM   370   O  OE1  . GLU A 1 24  ? -17.457 64.206 5.770   1.00 0.00  ? 24  GLU A OE1  1  
ATOM   371   O  OE2  . GLU A 1 24  ? -16.964 65.934 6.958   1.00 0.00  ? 24  GLU A OE2  1  
ATOM   372   H  H    . GLU A 1 24  ? -12.897 66.384 5.690   1.00 0.00  ? 24  GLU A H    1  
ATOM   373   H  HA   . GLU A 1 24  ? -14.581 64.170 6.827   1.00 0.00  ? 24  GLU A HA   1  
ATOM   374   H  HB2  . GLU A 1 24  ? -14.090 64.907 3.925   1.00 0.00  ? 24  GLU A HB2  1  
ATOM   375   H  HB3  . GLU A 1 24  ? -15.204 63.675 4.518   1.00 0.00  ? 24  GLU A HB3  1  
ATOM   376   H  HG2  . GLU A 1 24  ? -15.390 66.626 5.192   1.00 0.00  ? 24  GLU A HG2  1  
ATOM   377   H  HG3  . GLU A 1 24  ? -16.355 65.818 3.956   1.00 0.00  ? 24  GLU A HG3  1  
ATOM   378   N  N    . ASN A 1 25  ? -11.587 64.040 5.738   1.00 0.00  ? 25  ASN A N    1  
ATOM   379   C  CA   . ASN A 1 25  ? -10.409 63.150 5.538   1.00 0.00  ? 25  ASN A CA   1  
ATOM   380   C  C    . ASN A 1 25  ? -10.622 62.257 4.313   1.00 0.00  ? 25  ASN A C    1  
ATOM   381   O  O    . ASN A 1 25  ? -10.913 61.082 4.423   1.00 0.00  ? 25  ASN A O    1  
ATOM   382   C  CB   . ASN A 1 25  ? -10.199 62.294 6.788   1.00 0.00  ? 25  ASN A CB   1  
ATOM   383   C  CG   . ASN A 1 25  ? -9.789  63.205 7.944   1.00 0.00  ? 25  ASN A CG   1  
ATOM   384   O  OD1  . ASN A 1 25  ? -9.469  62.740 9.020   1.00 0.00  ? 25  ASN A OD1  1  
ATOM   385   N  ND2  . ASN A 1 25  ? -9.785  64.498 7.761   1.00 0.00  ? 25  ASN A ND2  1  
ATOM   386   H  H    . ASN A 1 25  ? -11.458 65.010 5.805   1.00 0.00  ? 25  ASN A H    1  
ATOM   387   H  HA   . ASN A 1 25  ? -9.532  63.760 5.379   1.00 0.00  ? 25  ASN A HA   1  
ATOM   388   H  HB2  . ASN A 1 25  ? -11.117 61.781 7.037   1.00 0.00  ? 25  ASN A HB2  1  
ATOM   389   H  HB3  . ASN A 1 25  ? -9.418  61.571 6.606   1.00 0.00  ? 25  ASN A HB3  1  
ATOM   390   H  HD21 . ASN A 1 25  ? -10.043 64.870 6.892   1.00 0.00  ? 25  ASN A HD21 1  
ATOM   391   H  HD22 . ASN A 1 25  ? -9.522  65.097 8.489   1.00 0.00  ? 25  ASN A HD22 1  
ATOM   392   N  N    . ASP A 1 26  ? -10.458 62.815 3.144   1.00 0.00  ? 26  ASP A N    1  
ATOM   393   C  CA   . ASP A 1 26  ? -10.623 62.031 1.886   1.00 0.00  ? 26  ASP A CA   1  
ATOM   394   C  C    . ASP A 1 26  ? -9.759  62.680 0.813   1.00 0.00  ? 26  ASP A C    1  
ATOM   395   O  O    . ASP A 1 26  ? -9.011  62.032 0.109   1.00 0.00  ? 26  ASP A O    1  
ATOM   396   C  CB   . ASP A 1 26  ? -12.090 62.047 1.451   1.00 0.00  ? 26  ASP A CB   1  
ATOM   397   C  CG   . ASP A 1 26  ? -12.985 61.755 2.656   1.00 0.00  ? 26  ASP A CG   1  
ATOM   398   O  OD1  . ASP A 1 26  ? -13.171 60.588 2.961   1.00 0.00  ? 26  ASP A OD1  1  
ATOM   399   O  OD2  . ASP A 1 26  ? -13.468 62.702 3.254   1.00 0.00  ? 26  ASP A OD2  1  
ATOM   400   H  H    . ASP A 1 26  ? -10.211 63.762 3.093   1.00 0.00  ? 26  ASP A H    1  
ATOM   401   H  HA   . ASP A 1 26  ? -10.299 61.022 2.044   1.00 0.00  ? 26  ASP A HA   1  
ATOM   402   H  HB2  . ASP A 1 26  ? -12.334 63.019 1.046   1.00 0.00  ? 26  ASP A HB2  1  
ATOM   403   H  HB3  . ASP A 1 26  ? -12.249 61.293 0.695   1.00 0.00  ? 26  ASP A HB3  1  
ATOM   404   N  N    . LEU A 1 27  ? -9.865  63.967 0.704   1.00 0.00  ? 27  LEU A N    1  
ATOM   405   C  CA   . LEU A 1 27  ? -9.062  64.720 -0.305  1.00 0.00  ? 27  LEU A CA   1  
ATOM   406   C  C    . LEU A 1 27  ? -7.585  64.314 -0.182  1.00 0.00  ? 27  LEU A C    1  
ATOM   407   O  O    . LEU A 1 27  ? -6.764  64.656 -1.009  1.00 0.00  ? 27  LEU A O    1  
ATOM   408   C  CB   . LEU A 1 27  ? -9.214  66.226 -0.046  1.00 0.00  ? 27  LEU A CB   1  
ATOM   409   C  CG   . LEU A 1 27  ? -10.514 66.756 -0.683  1.00 0.00  ? 27  LEU A CG   1  
ATOM   410   C  CD1  . LEU A 1 27  ? -10.419 66.744 -2.223  1.00 0.00  ? 27  LEU A CD1  1  
ATOM   411   C  CD2  . LEU A 1 27  ? -11.696 65.890 -0.227  1.00 0.00  ? 27  LEU A CD2  1  
ATOM   412   H  H    . LEU A 1 27  ? -10.490 64.432 1.291   1.00 0.00  ? 27  LEU A H    1  
ATOM   413   H  HA   . LEU A 1 27  ? -9.414  64.481 -1.295  1.00 0.00  ? 27  LEU A HA   1  
ATOM   414   H  HB2  . LEU A 1 27  ? -9.247  66.400 1.020   1.00 0.00  ? 27  LEU A HB2  1  
ATOM   415   H  HB3  . LEU A 1 27  ? -8.371  66.751 -0.463  1.00 0.00  ? 27  LEU A HB3  1  
ATOM   416   H  HG   . LEU A 1 27  ? -10.674 67.773 -0.353  1.00 0.00  ? 27  LEU A HG   1  
ATOM   417   H  HD11 . LEU A 1 27  ? -9.394  66.900 -2.531  1.00 0.00  ? 27  LEU A HD11 1  
ATOM   418   H  HD12 . LEU A 1 27  ? -11.032 67.537 -2.622  1.00 0.00  ? 27  LEU A HD12 1  
ATOM   419   H  HD13 . LEU A 1 27  ? -10.769 65.797 -2.611  1.00 0.00  ? 27  LEU A HD13 1  
ATOM   420   H  HD21 . LEU A 1 27  ? -12.622 66.367 -0.513  1.00 0.00  ? 27  LEU A HD21 1  
ATOM   421   H  HD22 . LEU A 1 27  ? -11.668 65.779 0.846   1.00 0.00  ? 27  LEU A HD22 1  
ATOM   422   H  HD23 . LEU A 1 27  ? -11.634 64.918 -0.692  1.00 0.00  ? 27  LEU A HD23 1  
ATOM   423   N  N    . ASN A 1 28  ? -7.258  63.562 0.831   1.00 77.83 ? 28  ASN A N    1  
ATOM   424   C  CA   . ASN A 1 28  ? -5.852  63.099 0.997   1.00 78.20 ? 28  ASN A CA   1  
ATOM   425   C  C    . ASN A 1 28  ? -5.593  61.980 -0.014  1.00 78.50 ? 28  ASN A C    1  
ATOM   426   O  O    . ASN A 1 28  ? -4.845  61.055 0.237   1.00 79.07 ? 28  ASN A O    1  
ATOM   427   C  CB   . ASN A 1 28  ? -5.650  62.570 2.417   1.00 79.28 ? 28  ASN A CB   1  
ATOM   428   C  CG   . ASN A 1 28  ? -5.607  63.746 3.393   1.00 83.99 ? 28  ASN A CG   1  
ATOM   429   O  OD1  . ASN A 1 28  ? -6.569  64.011 4.086   1.00 87.93 ? 28  ASN A OD1  1  
ATOM   430   N  ND2  . ASN A 1 28  ? -4.522  64.467 3.478   1.00 85.70 ? 28  ASN A ND2  1  
ATOM   431   H  H    . ASN A 1 28  ? -7.957  63.289 1.458   1.00 0.00  ? 28  ASN A H    1  
ATOM   432   H  HA   . ASN A 1 28  ? -5.175  63.921 0.813   1.00 0.00  ? 28  ASN A HA   1  
ATOM   433   H  HB2  . ASN A 1 28  ? -6.468  61.914 2.677   1.00 0.00  ? 28  ASN A HB2  1  
ATOM   434   H  HB3  . ASN A 1 28  ? -4.719  62.026 2.471   1.00 0.00  ? 28  ASN A HB3  1  
ATOM   435   H  HD21 . ASN A 1 28  ? -3.746  64.252 2.919   1.00 0.00  ? 28  ASN A HD21 1  
ATOM   436   H  HD22 . ASN A 1 28  ? -4.484  65.223 4.100   1.00 0.00  ? 28  ASN A HD22 1  
ATOM   437   N  N    . GLN A 1 29  ? -6.218  62.065 -1.159  1.00 0.00  ? 29  GLN A N    1  
ATOM   438   C  CA   . GLN A 1 29  ? -6.032  61.020 -2.205  1.00 0.00  ? 29  GLN A CA   1  
ATOM   439   C  C    . GLN A 1 29  ? -4.758  61.297 -3.002  1.00 0.00  ? 29  GLN A C    1  
ATOM   440   O  O    . GLN A 1 29  ? -4.436  62.426 -3.314  1.00 0.00  ? 29  GLN A O    1  
ATOM   441   C  CB   . GLN A 1 29  ? -7.245  61.016 -3.146  1.00 0.00  ? 29  GLN A CB   1  
ATOM   442   C  CG   . GLN A 1 29  ? -7.216  62.258 -4.047  1.00 0.00  ? 29  GLN A CG   1  
ATOM   443   C  CD   . GLN A 1 29  ? -8.612  62.513 -4.625  1.00 0.00  ? 29  GLN A CD   1  
ATOM   444   O  OE1  . GLN A 1 29  ? -8.998  61.902 -5.601  1.00 0.00  ? 29  GLN A OE1  1  
ATOM   445   N  NE2  . GLN A 1 29  ? -9.388  63.396 -4.059  1.00 0.00  ? 29  GLN A NE2  1  
ATOM   446   H  H    . GLN A 1 29  ? -6.806  62.829 -1.328  1.00 0.00  ? 29  GLN A H    1  
ATOM   447   H  HA   . GLN A 1 29  ? -5.946  60.052 -1.735  1.00 0.00  ? 29  GLN A HA   1  
ATOM   448   H  HB2  . GLN A 1 29  ? -7.219  60.127 -3.760  1.00 0.00  ? 29  GLN A HB2  1  
ATOM   449   H  HB3  . GLN A 1 29  ? -8.152  61.020 -2.559  1.00 0.00  ? 29  GLN A HB3  1  
ATOM   450   H  HG2  . GLN A 1 29  ? -6.902  63.114 -3.469  1.00 0.00  ? 29  GLN A HG2  1  
ATOM   451   H  HG3  . GLN A 1 29  ? -6.519  62.098 -4.856  1.00 0.00  ? 29  GLN A HG3  1  
ATOM   452   H  HE21 . GLN A 1 29  ? -9.077  63.890 -3.272  1.00 0.00  ? 29  GLN A HE21 1  
ATOM   453   H  HE22 . GLN A 1 29  ? -10.283 63.566 -4.421  1.00 0.00  ? 29  GLN A HE22 1  
ATOM   454   N  N    . GLY A 1 30  ? -4.043  60.267 -3.342  1.00 0.00  ? 30  GLY A N    1  
ATOM   455   C  CA   . GLY A 1 30  ? -2.797  60.453 -4.130  1.00 0.00  ? 30  GLY A CA   1  
ATOM   456   C  C    . GLY A 1 30  ? -3.164  60.662 -5.597  1.00 0.00  ? 30  GLY A C    1  
ATOM   457   O  O    . GLY A 1 30  ? -4.007  61.474 -5.925  1.00 0.00  ? 30  GLY A O    1  
ATOM   458   H  H    . GLY A 1 30  ? -4.333  59.370 -3.081  1.00 0.00  ? 30  GLY A H    1  
ATOM   459   H  HA2  . GLY A 1 30  ? -2.260  61.316 -3.764  1.00 0.00  ? 30  GLY A HA2  1  
ATOM   460   H  HA3  . GLY A 1 30  ? -2.178  59.574 -4.039  1.00 0.00  ? 30  GLY A HA3  1  
ATOM   461   N  N    . ASP A 1 31  ? -2.543  59.927 -6.480  1.00 0.00  ? 31  ASP A N    1  
ATOM   462   C  CA   . ASP A 1 31  ? -2.849  60.058 -7.943  1.00 0.00  ? 31  ASP A CA   1  
ATOM   463   C  C    . ASP A 1 31  ? -3.077  58.666 -8.537  1.00 0.00  ? 31  ASP A C    1  
ATOM   464   O  O    . ASP A 1 31  ? -2.818  57.662 -7.905  1.00 0.00  ? 31  ASP A O    1  
ATOM   465   C  CB   . ASP A 1 31  ? -1.668  60.724 -8.655  1.00 0.00  ? 31  ASP A CB   1  
ATOM   466   C  CG   . ASP A 1 31  ? -2.103  61.183 -10.048 1.00 0.00  ? 31  ASP A CG   1  
ATOM   467   O  OD1  . ASP A 1 31  ? -3.231  61.627 -10.179 1.00 0.00  ? 31  ASP A OD1  1  
ATOM   468   O  OD2  . ASP A 1 31  ? -1.299  61.082 -10.961 1.00 0.00  ? 31  ASP A OD2  1  
ATOM   469   H  H    . ASP A 1 31  ? -1.874  59.277 -6.179  1.00 0.00  ? 31  ASP A H    1  
ATOM   470   H  HA   . ASP A 1 31  ? -3.739  60.655 -8.087  1.00 0.00  ? 31  ASP A HA   1  
ATOM   471   H  HB2  . ASP A 1 31  ? -1.338  61.577 -8.081  1.00 0.00  ? 31  ASP A HB2  1  
ATOM   472   H  HB3  . ASP A 1 31  ? -0.859  60.016 -8.749  1.00 0.00  ? 31  ASP A HB3  1  
ATOM   473   N  N    . ASP A 1 32  ? -3.554  58.597 -9.751  1.00 0.00  ? 32  ASP A N    1  
ATOM   474   C  CA   . ASP A 1 32  ? -3.789  57.267 -10.380 1.00 0.00  ? 32  ASP A CA   1  
ATOM   475   C  C    . ASP A 1 32  ? -2.506  56.441 -10.291 1.00 0.00  ? 32  ASP A C    1  
ATOM   476   O  O    . ASP A 1 32  ? -2.537  55.240 -10.111 1.00 0.00  ? 32  ASP A O    1  
ATOM   477   C  CB   . ASP A 1 32  ? -4.175  57.455 -11.849 1.00 0.00  ? 32  ASP A CB   1  
ATOM   478   C  CG   . ASP A 1 32  ? -3.058  58.204 -12.578 1.00 0.00  ? 32  ASP A CG   1  
ATOM   479   O  OD1  . ASP A 1 32  ? -2.392  59.003 -11.940 1.00 0.00  ? 32  ASP A OD1  1  
ATOM   480   O  OD2  . ASP A 1 32  ? -2.888  57.966 -13.763 1.00 0.00  ? 32  ASP A OD2  1  
ATOM   481   H  H    . ASP A 1 32  ? -3.753  59.418 -10.248 1.00 0.00  ? 32  ASP A H    1  
ATOM   482   H  HA   . ASP A 1 32  ? -4.585  56.756 -9.859  1.00 0.00  ? 32  ASP A HA   1  
ATOM   483   H  HB2  . ASP A 1 32  ? -4.322  56.489 -12.308 1.00 0.00  ? 32  ASP A HB2  1  
ATOM   484   H  HB3  . ASP A 1 32  ? -5.089  58.027 -11.911 1.00 0.00  ? 32  ASP A HB3  1  
ATOM   485   N  N    . HIS A 1 33  ? -1.375  57.082 -10.407 1.00 0.00  ? 33  HIS A N    1  
ATOM   486   C  CA   . HIS A 1 33  ? -0.084  56.345 -10.321 1.00 0.00  ? 33  HIS A CA   1  
ATOM   487   C  C    . HIS A 1 33  ? 0.260   56.110 -8.849  1.00 0.00  ? 33  HIS A C    1  
ATOM   488   O  O    . HIS A 1 33  ? 1.266   55.521 -8.524  1.00 0.00  ? 33  HIS A O    1  
ATOM   489   C  CB   . HIS A 1 33  ? 1.020   57.171 -10.992 1.00 0.00  ? 33  HIS A CB   1  
ATOM   490   C  CG   . HIS A 1 33  ? 0.453   57.889 -12.186 1.00 0.00  ? 33  HIS A CG   1  
ATOM   491   N  ND1  . HIS A 1 33  ? 0.352   59.272 -12.237 1.00 0.00  ? 33  HIS A ND1  1  
ATOM   492   C  CD2  . HIS A 1 33  ? -0.046  57.433 -13.381 1.00 0.00  ? 33  HIS A CD2  1  
ATOM   493   C  CE1  . HIS A 1 33  ? -0.189  59.596 -13.426 1.00 0.00  ? 33  HIS A CE1  1  
ATOM   494   N  NE2  . HIS A 1 33  ? -0.450  58.513 -14.160 1.00 0.00  ? 33  HIS A NE2  1  
ATOM   495   H  H    . HIS A 1 33  ? -1.375  58.053 -10.544 1.00 0.00  ? 33  HIS A H    1  
ATOM   496   H  HA   . HIS A 1 33  ? -0.176  55.393 -10.822 1.00 0.00  ? 33  HIS A HA   1  
ATOM   497   H  HB2  . HIS A 1 33  ? 1.407   57.894 -10.291 1.00 0.00  ? 33  HIS A HB2  1  
ATOM   498   H  HB3  . HIS A 1 33  ? 1.817   56.517 -11.311 1.00 0.00  ? 33  HIS A HB3  1  
ATOM   499   H  HD2  . HIS A 1 33  ? -0.116  56.395 -13.671 1.00 0.00  ? 33  HIS A HD2  1  
ATOM   500   H  HE1  . HIS A 1 33  ? -0.388  60.608 -13.746 1.00 0.00  ? 33  HIS A HE1  1  
ATOM   501   H  HE2  . HIS A 1 33  ? -0.844  58.493 -15.057 1.00 0.00  ? 33  HIS A HE2  1  
ATOM   502   N  N    . GLY A 1 34  ? -0.582  56.552 -7.957  1.00 0.00  ? 34  GLY A N    1  
ATOM   503   C  CA   . GLY A 1 34  ? -0.321  56.338 -6.507  1.00 0.00  ? 34  GLY A CA   1  
ATOM   504   C  C    . GLY A 1 34  ? 0.561   57.456 -5.956  1.00 0.00  ? 34  GLY A C    1  
ATOM   505   O  O    . GLY A 1 34  ? 1.027   57.383 -4.836  1.00 0.00  ? 34  GLY A O    1  
ATOM   506   H  H    . GLY A 1 34  ? -1.399  57.004 -8.244  1.00 0.00  ? 34  GLY A H    1  
ATOM   507   H  HA2  . GLY A 1 34  ? -1.261  56.330 -5.975  1.00 0.00  ? 34  GLY A HA2  1  
ATOM   508   H  HA3  . GLY A 1 34  ? 0.177   55.390 -6.365  1.00 0.00  ? 34  GLY A HA3  1  
ATOM   509   N  N    . PHE A 1 35  ? 0.798   58.496 -6.710  1.00 0.00  ? 35  PHE A N    1  
ATOM   510   C  CA   . PHE A 1 35  ? 1.649   59.588 -6.167  1.00 0.00  ? 35  PHE A CA   1  
ATOM   511   C  C    . PHE A 1 35  ? 0.960   60.159 -4.928  1.00 0.00  ? 35  PHE A C    1  
ATOM   512   O  O    . PHE A 1 35  ? -0.216  60.469 -4.956  1.00 0.00  ? 35  PHE A O    1  
ATOM   513   C  CB   . PHE A 1 35  ? 1.843   60.711 -7.200  1.00 0.00  ? 35  PHE A CB   1  
ATOM   514   C  CG   . PHE A 1 35  ? 2.707   60.241 -8.360  1.00 0.00  ? 35  PHE A CG   1  
ATOM   515   C  CD1  . PHE A 1 35  ? 4.008   59.767 -8.131  1.00 0.00  ? 35  PHE A CD1  1  
ATOM   516   C  CD2  . PHE A 1 35  ? 2.209   60.294 -9.671  1.00 0.00  ? 35  PHE A CD2  1  
ATOM   517   C  CE1  . PHE A 1 35  ? 4.801   59.344 -9.204  1.00 0.00  ? 35  PHE A CE1  1  
ATOM   518   C  CE2  . PHE A 1 35  ? 3.007   59.872 -10.743 1.00 0.00  ? 35  PHE A CE2  1  
ATOM   519   C  CZ   . PHE A 1 35  ? 4.301   59.395 -10.508 1.00 0.00  ? 35  PHE A CZ   1  
ATOM   520   H  H    . PHE A 1 35  ? 0.416   58.560 -7.611  1.00 0.00  ? 35  PHE A H    1  
ATOM   521   H  HA   . PHE A 1 35  ? 2.600   59.178 -5.885  1.00 0.00  ? 35  PHE A HA   1  
ATOM   522   H  HB2  . PHE A 1 35  ? 0.880   61.022 -7.571  1.00 0.00  ? 35  PHE A HB2  1  
ATOM   523   H  HB3  . PHE A 1 35  ? 2.323   61.552 -6.720  1.00 0.00  ? 35  PHE A HB3  1  
ATOM   524   H  HD1  . PHE A 1 35  ? 4.404   59.732 -7.132  1.00 0.00  ? 35  PHE A HD1  1  
ATOM   525   H  HD2  . PHE A 1 35  ? 1.209   60.658 -9.856  1.00 0.00  ? 35  PHE A HD2  1  
ATOM   526   H  HE1  . PHE A 1 35  ? 5.799   58.973 -9.025  1.00 0.00  ? 35  PHE A HE1  1  
ATOM   527   H  HE2  . PHE A 1 35  ? 2.623   59.914 -11.751 1.00 0.00  ? 35  PHE A HE2  1  
ATOM   528   H  HZ   . PHE A 1 35  ? 4.915   59.070 -11.334 1.00 0.00  ? 35  PHE A HZ   1  
ATOM   529   N  N    . SER A 1 36  ? 1.671   60.290 -3.834  1.00 0.00  ? 36  SER A N    1  
ATOM   530   C  CA   . SER A 1 36  ? 1.039   60.831 -2.589  1.00 0.00  ? 36  SER A CA   1  
ATOM   531   C  C    . SER A 1 36  ? 1.232   62.361 -2.547  1.00 0.00  ? 36  SER A C    1  
ATOM   532   O  O    . SER A 1 36  ? 2.139   62.869 -3.166  1.00 0.00  ? 36  SER A O    1  
ATOM   533   C  CB   . SER A 1 36  ? 1.741   60.183 -1.388  1.00 0.00  ? 36  SER A CB   1  
ATOM   534   O  OG   . SER A 1 36  ? 2.838   60.995 -0.991  1.00 0.00  ? 36  SER A OG   1  
ATOM   535   H  H    . SER A 1 36  ? 2.626   60.023 -3.825  1.00 0.00  ? 36  SER A H    1  
ATOM   536   H  HA   . SER A 1 36  ? -0.010  60.582 -2.578  1.00 0.00  ? 36  SER A HA   1  
ATOM   537   H  HB2  . SER A 1 36  ? 1.057   60.081 -0.566  1.00 0.00  ? 36  SER A HB2  1  
ATOM   538   H  HB3  . SER A 1 36  ? 2.097   59.202 -1.674  1.00 0.00  ? 36  SER A HB3  1  
ATOM   539   H  HG   . SER A 1 36  ? 3.614   60.705 -1.479  1.00 0.00  ? 36  SER A HG   1  
ATOM   540   N  N    . PRO A 1 37  ? 0.404   63.077 -1.815  1.00 63.85 ? 37  PRO A N    1  
ATOM   541   C  CA   . PRO A 1 37  ? 0.579   64.534 -1.723  1.00 61.79 ? 37  PRO A CA   1  
ATOM   542   C  C    . PRO A 1 37  ? 1.991   64.808 -1.184  1.00 59.66 ? 37  PRO A C    1  
ATOM   543   O  O    . PRO A 1 37  ? 2.695   65.681 -1.652  1.00 58.96 ? 37  PRO A O    1  
ATOM   544   C  CB   . PRO A 1 37  ? -0.517  65.011 -0.740  1.00 62.05 ? 37  PRO A CB   1  
ATOM   545   C  CG   . PRO A 1 37  ? -1.334  63.756 -0.310  1.00 61.89 ? 37  PRO A CG   1  
ATOM   546   C  CD   . PRO A 1 37  ? -0.742  62.535 -1.051  1.00 64.50 ? 37  PRO A CD   1  
ATOM   547   H  HA   . PRO A 1 37  ? 0.447   64.993 -2.692  1.00 0.00  ? 37  PRO A HA   1  
ATOM   548   H  HB2  . PRO A 1 37  ? -0.067  65.478 0.129   1.00 0.00  ? 37  PRO A HB2  1  
ATOM   549   H  HB3  . PRO A 1 37  ? -1.172  65.718 -1.232  1.00 0.00  ? 37  PRO A HB3  1  
ATOM   550   H  HG2  . PRO A 1 37  ? -1.255  63.615 0.763   1.00 0.00  ? 37  PRO A HG2  1  
ATOM   551   H  HG3  . PRO A 1 37  ? -2.375  63.879 -0.581  1.00 0.00  ? 37  PRO A HG3  1  
ATOM   552   H  HD2  . PRO A 1 37  ? -0.415  61.791 -0.344  1.00 0.00  ? 37  PRO A HD2  1  
ATOM   553   H  HD3  . PRO A 1 37  ? -1.473  62.117 -1.725  1.00 0.00  ? 37  PRO A HD3  1  
ATOM   554   N  N    . LEU A 1 38  ? 2.400   64.045 -0.205  1.00 58.19 ? 38  LEU A N    1  
ATOM   555   C  CA   . LEU A 1 38  ? 3.758   64.219 0.385   1.00 52.32 ? 38  LEU A CA   1  
ATOM   556   C  C    . LEU A 1 38  ? 4.807   64.112 -0.721  1.00 48.07 ? 38  LEU A C    1  
ATOM   557   O  O    . LEU A 1 38  ? 5.748   64.878 -0.783  1.00 45.49 ? 38  LEU A O    1  
ATOM   558   C  CB   . LEU A 1 38  ? 3.967   63.122 1.447   1.00 49.74 ? 38  LEU A CB   1  
ATOM   559   C  CG   . LEU A 1 38  ? 5.395   63.149 2.038   1.00 48.31 ? 38  LEU A CG   1  
ATOM   560   C  CD1  . LEU A 1 38  ? 6.432   62.559 1.052   1.00 46.15 ? 38  LEU A CD1  1  
ATOM   561   C  CD2  . LEU A 1 38  ? 5.778   64.588 2.415   1.00 46.72 ? 38  LEU A CD2  1  
ATOM   562   H  H    . LEU A 1 38  ? 1.805   63.348 0.144   1.00 0.00  ? 38  LEU A H    1  
ATOM   563   H  HA   . LEU A 1 38  ? 3.819   65.184 0.840   1.00 0.00  ? 38  LEU A HA   1  
ATOM   564   H  HB2  . LEU A 1 38  ? 3.258   63.277 2.248   1.00 0.00  ? 38  LEU A HB2  1  
ATOM   565   H  HB3  . LEU A 1 38  ? 3.779   62.157 1.001   1.00 0.00  ? 38  LEU A HB3  1  
ATOM   566   H  HG   . LEU A 1 38  ? 5.401   62.545 2.935   1.00 0.00  ? 38  LEU A HG   1  
ATOM   567   H  HD11 . LEU A 1 38  ? 7.154   61.978 1.606   1.00 0.00  ? 38  LEU A HD11 1  
ATOM   568   H  HD12 . LEU A 1 38  ? 6.945   63.353 0.531   1.00 0.00  ? 38  LEU A HD12 1  
ATOM   569   H  HD13 . LEU A 1 38  ? 5.944   61.920 0.331   1.00 0.00  ? 38  LEU A HD13 1  
ATOM   570   H  HD21 . LEU A 1 38  ? 6.055   65.134 1.526   1.00 0.00  ? 38  LEU A HD21 1  
ATOM   571   H  HD22 . LEU A 1 38  ? 6.614   64.570 3.099   1.00 0.00  ? 38  LEU A HD22 1  
ATOM   572   H  HD23 . LEU A 1 38  ? 4.937   65.073 2.889   1.00 0.00  ? 38  LEU A HD23 1  
ATOM   573   N  N    . HIS A 1 39  ? 4.638   63.177 -1.603  1.00 45.97 ? 39  HIS A N    1  
ATOM   574   C  CA   . HIS A 1 39  ? 5.612   63.012 -2.723  1.00 46.91 ? 39  HIS A CA   1  
ATOM   575   C  C    . HIS A 1 39  ? 5.731   64.332 -3.482  1.00 48.94 ? 39  HIS A C    1  
ATOM   576   O  O    . HIS A 1 39  ? 6.775   64.956 -3.529  1.00 49.68 ? 39  HIS A O    1  
ATOM   577   C  CB   . HIS A 1 39  ? 5.119   61.909 -3.688  1.00 45.05 ? 39  HIS A CB   1  
ATOM   578   C  CG   . HIS A 1 39  ? 5.721   60.578 -3.332  1.00 47.92 ? 39  HIS A CG   1  
ATOM   579   N  ND1  . HIS A 1 39  ? 4.940   59.489 -2.973  1.00 46.54 ? 39  HIS A ND1  1  
ATOM   580   C  CD2  . HIS A 1 39  ? 7.023   60.142 -3.291  1.00 52.78 ? 39  HIS A CD2  1  
ATOM   581   C  CE1  . HIS A 1 39  ? 5.779   58.458 -2.734  1.00 52.72 ? 39  HIS A CE1  1  
ATOM   582   N  NE2  . HIS A 1 39  ? 7.058   58.804 -2.917  1.00 47.81 ? 39  HIS A NE2  1  
ATOM   583   H  H    . HIS A 1 39  ? 3.859   62.592 -1.532  1.00 0.00  ? 39  HIS A H    1  
ATOM   584   H  HA   . HIS A 1 39  ? 6.570   62.751 -2.328  1.00 0.00  ? 39  HIS A HA   1  
ATOM   585   H  HB2  . HIS A 1 39  ? 4.053   61.830 -3.624  1.00 0.00  ? 39  HIS A HB2  1  
ATOM   586   H  HB3  . HIS A 1 39  ? 5.393   62.163 -4.701  1.00 0.00  ? 39  HIS A HB3  1  
ATOM   587   H  HD2  . HIS A 1 39  ? 7.885   60.749 -3.509  1.00 0.00  ? 39  HIS A HD2  1  
ATOM   588   H  HE1  . HIS A 1 39  ? 5.460   57.479 -2.421  1.00 0.00  ? 39  HIS A HE1  1  
ATOM   589   H  HE2  . HIS A 1 39  ? 7.850   58.223 -2.821  1.00 0.00  ? 39  HIS A HE2  1  
ATOM   590   N  N    . TRP A 1 40  ? 4.665   64.746 -4.085  1.00 0.00  ? 40  TRP A N    1  
ATOM   591   C  CA   . TRP A 1 40  ? 4.695   66.016 -4.857  1.00 0.00  ? 40  TRP A CA   1  
ATOM   592   C  C    . TRP A 1 40  ? 5.236   67.124 -3.968  1.00 0.00  ? 40  TRP A C    1  
ATOM   593   O  O    . TRP A 1 40  ? 6.102   67.884 -4.348  1.00 0.00  ? 40  TRP A O    1  
ATOM   594   C  CB   . TRP A 1 40  ? 3.277   66.372 -5.308  1.00 0.00  ? 40  TRP A CB   1  
ATOM   595   C  CG   . TRP A 1 40  ? 2.821   65.405 -6.344  1.00 0.00  ? 40  TRP A CG   1  
ATOM   596   C  CD1  . TRP A 1 40  ? 1.823   64.512 -6.181  1.00 0.00  ? 40  TRP A CD1  1  
ATOM   597   C  CD2  . TRP A 1 40  ? 3.319   65.222 -7.700  1.00 0.00  ? 40  TRP A CD2  1  
ATOM   598   N  NE1  . TRP A 1 40  ? 1.677   63.794 -7.350  1.00 0.00  ? 40  TRP A NE1  1  
ATOM   599   C  CE2  . TRP A 1 40  ? 2.575   64.192 -8.312  1.00 0.00  ? 40  TRP A CE2  1  
ATOM   600   C  CE3  . TRP A 1 40  ? 4.334   65.841 -8.451  1.00 0.00  ? 40  TRP A CE3  1  
ATOM   601   C  CZ2  . TRP A 1 40  ? 2.819   63.785 -9.617  1.00 0.00  ? 40  TRP A CZ2  1  
ATOM   602   C  CZ3  . TRP A 1 40  ? 4.587   65.434 -9.772  1.00 0.00  ? 40  TRP A CZ3  1  
ATOM   603   C  CH2  . TRP A 1 40  ? 3.830   64.407 -10.355 1.00 0.00  ? 40  TRP A CH2  1  
ATOM   604   H  H    . TRP A 1 40  ? 3.847   64.214 -4.032  1.00 0.00  ? 40  TRP A H    1  
ATOM   605   H  HA   . TRP A 1 40  ? 5.329   65.903 -5.711  1.00 0.00  ? 40  TRP A HA   1  
ATOM   606   H  HB2  . TRP A 1 40  ? 2.608   66.332 -4.461  1.00 0.00  ? 40  TRP A HB2  1  
ATOM   607   H  HB3  . TRP A 1 40  ? 3.268   67.364 -5.725  1.00 0.00  ? 40  TRP A HB3  1  
ATOM   608   H  HD1  . TRP A 1 40  ? 1.234   64.382 -5.285  1.00 0.00  ? 40  TRP A HD1  1  
ATOM   609   H  HE1  . TRP A 1 40  ? 1.027   63.087 -7.500  1.00 0.00  ? 40  TRP A HE1  1  
ATOM   610   H  HE3  . TRP A 1 40  ? 4.922   66.633 -8.011  1.00 0.00  ? 40  TRP A HE3  1  
ATOM   611   H  HZ2  . TRP A 1 40  ? 2.229   62.993 -10.052 1.00 0.00  ? 40  TRP A HZ2  1  
ATOM   612   H  HZ3  . TRP A 1 40  ? 5.368   65.915 -10.342 1.00 0.00  ? 40  TRP A HZ3  1  
ATOM   613   H  HH2  . TRP A 1 40  ? 4.028   64.097 -11.370 1.00 0.00  ? 40  TRP A HH2  1  
ATOM   614   N  N    . ALA A 1 41  ? 4.713   67.221 -2.793  1.00 48.90 ? 41  ALA A N    1  
ATOM   615   C  CA   . ALA A 1 41  ? 5.161   68.287 -1.850  1.00 51.55 ? 41  ALA A CA   1  
ATOM   616   C  C    . ALA A 1 41  ? 6.666   68.171 -1.596  1.00 52.34 ? 41  ALA A C    1  
ATOM   617   O  O    . ALA A 1 41  ? 7.377   69.155 -1.561  1.00 50.40 ? 41  ALA A O    1  
ATOM   618   C  CB   . ALA A 1 41  ? 4.407   68.138 -0.530  1.00 54.82 ? 41  ALA A CB   1  
ATOM   619   H  H    . ALA A 1 41  ? 4.003   66.603 -2.531  1.00 0.00  ? 41  ALA A H    1  
ATOM   620   H  HA   . ALA A 1 41  ? 4.942   69.254 -2.277  1.00 0.00  ? 41  ALA A HA   1  
ATOM   621   H  HB1  . ALA A 1 41  ? 4.614   67.167 -0.107  1.00 0.00  ? 41  ALA A HB1  1  
ATOM   622   H  HB2  . ALA A 1 41  ? 3.347   68.235 -0.707  1.00 0.00  ? 41  ALA A HB2  1  
ATOM   623   H  HB3  . ALA A 1 41  ? 4.728   68.906 0.157   1.00 0.00  ? 41  ALA A HB3  1  
ATOM   624   N  N    . CYS A 1 42  ? 7.152   66.980 -1.398  1.00 0.00  ? 42  CYS A N    1  
ATOM   625   C  CA   . CYS A 1 42  ? 8.608   66.805 -1.130  1.00 0.00  ? 42  CYS A CA   1  
ATOM   626   C  C    . CYS A 1 42  ? 9.432   67.509 -2.215  1.00 0.00  ? 42  CYS A C    1  
ATOM   627   O  O    . CYS A 1 42  ? 10.392  68.194 -1.923  1.00 0.00  ? 42  CYS A O    1  
ATOM   628   C  CB   . CYS A 1 42  ? 8.956   65.315 -1.114  1.00 0.00  ? 42  CYS A CB   1  
ATOM   629   S  SG   . CYS A 1 42  ? 10.755  65.112 -1.112  1.00 0.00  ? 42  CYS A SG   1  
ATOM   630   H  H    . CYS A 1 42  ? 6.551   66.206 -1.410  1.00 0.00  ? 42  CYS A H    1  
ATOM   631   H  HA   . CYS A 1 42  ? 8.847   67.236 -0.169  1.00 0.00  ? 42  CYS A HA   1  
ATOM   632   H  HB2  . CYS A 1 42  ? 8.544   64.861 -0.227  1.00 0.00  ? 42  CYS A HB2  1  
ATOM   633   H  HB3  . CYS A 1 42  ? 8.541   64.838 -1.989  1.00 0.00  ? 42  CYS A HB3  1  
ATOM   634   H  HG   . CYS A 1 42  ? 11.050  65.086 -0.199  1.00 0.00  ? 42  CYS A HG   1  
ATOM   635   N  N    . ARG A 1 43  ? 9.084   67.338 -3.465  1.00 0.00  ? 43  ARG A N    1  
ATOM   636   C  CA   . ARG A 1 43  ? 9.880   67.996 -4.550  1.00 0.00  ? 43  ARG A CA   1  
ATOM   637   C  C    . ARG A 1 43  ? 9.468   69.467 -4.713  1.00 0.00  ? 43  ARG A C    1  
ATOM   638   O  O    . ARG A 1 43  ? 10.215  70.265 -5.242  1.00 0.00  ? 43  ARG A O    1  
ATOM   639   C  CB   . ARG A 1 43  ? 9.681   67.253 -5.875  1.00 0.00  ? 43  ARG A CB   1  
ATOM   640   C  CG   . ARG A 1 43  ? 8.186   67.028 -6.138  1.00 0.00  ? 43  ARG A CG   1  
ATOM   641   C  CD   . ARG A 1 43  ? 7.966   66.410 -7.544  1.00 0.00  ? 43  ARG A CD   1  
ATOM   642   N  NE   . ARG A 1 43  ? 7.064   65.210 -7.455  1.00 0.00  ? 43  ARG A NE   1  
ATOM   643   C  CZ   . ARG A 1 43  ? 7.332   64.204 -6.663  1.00 0.00  ? 43  ARG A CZ   1  
ATOM   644   N  NH1  . ARG A 1 43  ? 8.447   64.175 -5.988  1.00 0.00  ? 43  ARG A NH1  1  
ATOM   645   N  NH2  . ARG A 1 43  ? 6.492   63.210 -6.572  1.00 0.00  ? 43  ARG A NH2  1  
ATOM   646   H  H    . ARG A 1 43  ? 8.313   66.770 -3.691  1.00 0.00  ? 43  ARG A H    1  
ATOM   647   H  HA   . ARG A 1 43  ? 10.927  67.959 -4.285  1.00 0.00  ? 43  ARG A HA   1  
ATOM   648   H  HB2  . ARG A 1 43  ? 10.101  67.840 -6.679  1.00 0.00  ? 43  ARG A HB2  1  
ATOM   649   H  HB3  . ARG A 1 43  ? 10.185  66.300 -5.828  1.00 0.00  ? 43  ARG A HB3  1  
ATOM   650   H  HG2  . ARG A 1 43  ? 7.785   66.374 -5.380  1.00 0.00  ? 43  ARG A HG2  1  
ATOM   651   H  HG3  . ARG A 1 43  ? 7.676   67.980 -6.082  1.00 0.00  ? 43  ARG A HG3  1  
ATOM   652   H  HD2  . ARG A 1 43  ? 7.477   67.126 -8.179  1.00 0.00  ? 43  ARG A HD2  1  
ATOM   653   H  HD3  . ARG A 1 43  ? 8.926   66.148 -7.993  1.00 0.00  ? 43  ARG A HD3  1  
ATOM   654   H  HE   . ARG A 1 43  ? 6.242   65.191 -7.987  1.00 0.00  ? 43  ARG A HE   1  
ATOM   655   H  HH11 . ARG A 1 43  ? 9.102   64.923 -6.073  1.00 0.00  ? 43  ARG A HH11 1  
ATOM   656   H  HH12 . ARG A 1 43  ? 8.646   63.403 -5.384  1.00 0.00  ? 43  ARG A HH12 1  
ATOM   657   H  HH21 . ARG A 1 43  ? 5.646   63.220 -7.105  1.00 0.00  ? 43  ARG A HH21 1  
ATOM   658   H  HH22 . ARG A 1 43  ? 6.694   62.439 -5.968  1.00 0.00  ? 43  ARG A HH22 1  
ATOM   659   N  N    . GLU A 1 44  ? 8.297   69.841 -4.271  1.00 0.00  ? 44  GLU A N    1  
ATOM   660   C  CA   . GLU A 1 44  ? 7.877   71.269 -4.417  1.00 0.00  ? 44  GLU A CA   1  
ATOM   661   C  C    . GLU A 1 44  ? 8.914   72.175 -3.743  1.00 0.00  ? 44  GLU A C    1  
ATOM   662   O  O    . GLU A 1 44  ? 9.540   72.993 -4.387  1.00 0.00  ? 44  GLU A O    1  
ATOM   663   C  CB   . GLU A 1 44  ? 6.507   71.477 -3.757  1.00 0.00  ? 44  GLU A CB   1  
ATOM   664   C  CG   . GLU A 1 44  ? 5.397   70.986 -4.694  1.00 0.00  ? 44  GLU A CG   1  
ATOM   665   C  CD   . GLU A 1 44  ? 5.156   72.022 -5.795  1.00 0.00  ? 44  GLU A CD   1  
ATOM   666   O  OE1  . GLU A 1 44  ? 5.099   73.197 -5.473  1.00 0.00  ? 44  GLU A OE1  1  
ATOM   667   O  OE2  . GLU A 1 44  ? 5.033   71.622 -6.941  1.00 0.00  ? 44  GLU A OE2  1  
ATOM   668   H  H    . GLU A 1 44  ? 7.700   69.192 -3.845  1.00 0.00  ? 44  GLU A H    1  
ATOM   669   H  HA   . GLU A 1 44  ? 7.814   71.518 -5.467  1.00 0.00  ? 44  GLU A HA   1  
ATOM   670   H  HB2  . GLU A 1 44  ? 6.470   70.922 -2.832  1.00 0.00  ? 44  GLU A HB2  1  
ATOM   671   H  HB3  . GLU A 1 44  ? 6.361   72.528 -3.550  1.00 0.00  ? 44  GLU A HB3  1  
ATOM   672   H  HG2  . GLU A 1 44  ? 5.691   70.049 -5.142  1.00 0.00  ? 44  GLU A HG2  1  
ATOM   673   H  HG3  . GLU A 1 44  ? 4.487   70.845 -4.131  1.00 0.00  ? 44  GLU A HG3  1  
ATOM   674   N  N    . GLY A 1 45  ? 9.106   72.027 -2.451  1.00 0.00  ? 45  GLY A N    1  
ATOM   675   C  CA   . GLY A 1 45  ? 10.114  72.868 -1.721  1.00 0.00  ? 45  GLY A CA   1  
ATOM   676   C  C    . GLY A 1 45  ? 9.431   73.686 -0.617  1.00 0.00  ? 45  GLY A C    1  
ATOM   677   O  O    . GLY A 1 45  ? 10.078  74.412 0.112   1.00 0.00  ? 45  GLY A O    1  
ATOM   678   H  H    . GLY A 1 45  ? 8.591   71.354 -1.959  1.00 0.00  ? 45  GLY A H    1  
ATOM   679   H  HA2  . GLY A 1 45  ? 10.852  72.220 -1.274  1.00 0.00  ? 45  GLY A HA2  1  
ATOM   680   H  HA3  . GLY A 1 45  ? 10.605  73.544 -2.406  1.00 0.00  ? 45  GLY A HA3  1  
ATOM   681   N  N    . ARG A 1 46  ? 8.137   73.580 -0.481  1.00 0.00  ? 46  ARG A N    1  
ATOM   682   C  CA   . ARG A 1 46  ? 7.434   74.361 0.584   1.00 0.00  ? 46  ARG A CA   1  
ATOM   683   C  C    . ARG A 1 46  ? 7.556   73.621 1.923   1.00 0.00  ? 46  ARG A C    1  
ATOM   684   O  O    . ARG A 1 46  ? 6.583   73.144 2.478   1.00 0.00  ? 46  ARG A O    1  
ATOM   685   C  CB   . ARG A 1 46  ? 5.958   74.534 0.201   1.00 0.00  ? 46  ARG A CB   1  
ATOM   686   C  CG   . ARG A 1 46  ? 5.859   75.426 -1.044  1.00 0.00  ? 46  ARG A CG   1  
ATOM   687   C  CD   . ARG A 1 46  ? 4.420   75.918 -1.230  1.00 0.00  ? 46  ARG A CD   1  
ATOM   688   N  NE   . ARG A 1 46  ? 3.452   74.786 -1.052  1.00 0.00  ? 46  ARG A NE   1  
ATOM   689   C  CZ   . ARG A 1 46  ? 3.542   73.688 -1.755  1.00 0.00  ? 46  ARG A CZ   1  
ATOM   690   N  NH1  . ARG A 1 46  ? 4.358   73.613 -2.769  1.00 0.00  ? 46  ARG A NH1  1  
ATOM   691   N  NH2  . ARG A 1 46  ? 2.762   72.678 -1.480  1.00 0.00  ? 46  ARG A NH2  1  
ATOM   692   H  H    . ARG A 1 46  ? 7.628   72.991 -1.075  1.00 0.00  ? 46  ARG A H    1  
ATOM   693   H  HA   . ARG A 1 46  ? 7.896   75.334 0.678   1.00 0.00  ? 46  ARG A HA   1  
ATOM   694   H  HB2  . ARG A 1 46  ? 5.525   73.567 -0.011  1.00 0.00  ? 46  ARG A HB2  1  
ATOM   695   H  HB3  . ARG A 1 46  ? 5.424   74.997 1.018   1.00 0.00  ? 46  ARG A HB3  1  
ATOM   696   H  HG2  . ARG A 1 46  ? 6.509   76.281 -0.921  1.00 0.00  ? 46  ARG A HG2  1  
ATOM   697   H  HG3  . ARG A 1 46  ? 6.169   74.870 -1.911  1.00 0.00  ? 46  ARG A HG3  1  
ATOM   698   H  HD2  . ARG A 1 46  ? 4.199   76.654 -0.481  1.00 0.00  ? 46  ARG A HD2  1  
ATOM   699   H  HD3  . ARG A 1 46  ? 4.323   76.377 -2.212  1.00 0.00  ? 46  ARG A HD3  1  
ATOM   700   H  HE   . ARG A 1 46  ? 2.761   74.856 -0.360  1.00 0.00  ? 46  ARG A HE   1  
ATOM   701   H  HH11 . ARG A 1 46  ? 4.918   74.401 -3.019  1.00 0.00  ? 46  ARG A HH11 1  
ATOM   702   H  HH12 . ARG A 1 46  ? 4.422   72.767 -3.297  1.00 0.00  ? 46  ARG A HH12 1  
ATOM   703   H  HH21 . ARG A 1 46  ? 2.099   72.747 -0.734  1.00 0.00  ? 46  ARG A HH21 1  
ATOM   704   H  HH22 . ARG A 1 46  ? 2.827   71.836 -2.015  1.00 0.00  ? 46  ARG A HH22 1  
ATOM   705   N  N    . SER A 1 47  ? 8.760   73.527 2.432   1.00 0.00  ? 47  SER A N    1  
ATOM   706   C  CA   . SER A 1 47  ? 9.011   72.821 3.729   1.00 0.00  ? 47  SER A CA   1  
ATOM   707   C  C    . SER A 1 47  ? 7.852   73.035 4.712   1.00 0.00  ? 47  SER A C    1  
ATOM   708   O  O    . SER A 1 47  ? 7.442   72.132 5.411   1.00 0.00  ? 47  SER A O    1  
ATOM   709   C  CB   . SER A 1 47  ? 10.298  73.363 4.349   1.00 0.00  ? 47  SER A CB   1  
ATOM   710   O  OG   . SER A 1 47  ? 10.109  74.726 4.705   1.00 0.00  ? 47  SER A OG   1  
ATOM   711   H  H    . SER A 1 47  ? 9.516   73.924 1.950   1.00 0.00  ? 47  SER A H    1  
ATOM   712   H  HA   . SER A 1 47  ? 9.131   71.766 3.540   1.00 0.00  ? 47  SER A HA   1  
ATOM   713   H  HB2  . SER A 1 47  ? 10.542  72.796 5.232   1.00 0.00  ? 47  SER A HB2  1  
ATOM   714   H  HB3  . SER A 1 47  ? 11.105  73.276 3.633   1.00 0.00  ? 47  SER A HB3  1  
ATOM   715   H  HG   . SER A 1 47  ? 10.152  75.251 3.902   1.00 0.00  ? 47  SER A HG   1  
ATOM   716   N  N    . ALA A 1 48  ? 7.321   74.216 4.781   1.00 0.00  ? 48  ALA A N    1  
ATOM   717   C  CA   . ALA A 1 48  ? 6.201   74.456 5.730   1.00 0.00  ? 48  ALA A CA   1  
ATOM   718   C  C    . ALA A 1 48  ? 5.098   73.416 5.502   1.00 0.00  ? 48  ALA A C    1  
ATOM   719   O  O    . ALA A 1 48  ? 4.995   72.439 6.205   1.00 0.00  ? 48  ALA A O    1  
ATOM   720   C  CB   . ALA A 1 48  ? 5.633   75.858 5.500   1.00 0.00  ? 48  ALA A CB   1  
ATOM   721   H  H    . ALA A 1 48  ? 7.657   74.944 4.218   1.00 0.00  ? 48  ALA A H    1  
ATOM   722   H  HA   . ALA A 1 48  ? 6.564   74.377 6.743   1.00 0.00  ? 48  ALA A HA   1  
ATOM   723   H  HB1  . ALA A 1 48  ? 6.364   76.596 5.797   1.00 0.00  ? 48  ALA A HB1  1  
ATOM   724   H  HB2  . ALA A 1 48  ? 4.735   75.984 6.087   1.00 0.00  ? 48  ALA A HB2  1  
ATOM   725   H  HB3  . ALA A 1 48  ? 5.399   75.984 4.454   1.00 0.00  ? 48  ALA A HB3  1  
ATOM   726   N  N    . VAL A 1 49  ? 4.228   73.678 4.574   1.00 0.00  ? 49  VAL A N    1  
ATOM   727   C  CA   . VAL A 1 49  ? 3.075   72.757 4.333   1.00 0.00  ? 49  VAL A CA   1  
ATOM   728   C  C    . VAL A 1 49  ? 3.482   71.268 4.412   1.00 0.00  ? 49  VAL A C    1  
ATOM   729   O  O    . VAL A 1 49  ? 2.764   70.470 4.984   1.00 0.00  ? 49  VAL A O    1  
ATOM   730   C  CB   . VAL A 1 49  ? 2.437   73.053 2.969   1.00 0.00  ? 49  VAL A CB   1  
ATOM   731   C  CG1  . VAL A 1 49  ? 2.117   74.545 2.873   1.00 0.00  ? 49  VAL A CG1  1  
ATOM   732   C  CG2  . VAL A 1 49  ? 3.392   72.668 1.839   1.00 0.00  ? 49  VAL A CG2  1  
ATOM   733   H  H    . VAL A 1 49  ? 4.302   74.534 4.104   1.00 0.00  ? 49  VAL A H    1  
ATOM   734   H  HA   . VAL A 1 49  ? 2.334   72.942 5.098   1.00 0.00  ? 49  VAL A HA   1  
ATOM   735   H  HB   . VAL A 1 49  ? 1.521   72.486 2.875   1.00 0.00  ? 49  VAL A HB   1  
ATOM   736   H  HG11 . VAL A 1 49  ? 1.646   74.872 3.788   1.00 0.00  ? 49  VAL A HG11 1  
ATOM   737   H  HG12 . VAL A 1 49  ? 1.448   74.716 2.043   1.00 0.00  ? 49  VAL A HG12 1  
ATOM   738   H  HG13 . VAL A 1 49  ? 3.030   75.100 2.719   1.00 0.00  ? 49  VAL A HG13 1  
ATOM   739   H  HG21 . VAL A 1 49  ? 3.531   71.597 1.828   1.00 0.00  ? 49  VAL A HG21 1  
ATOM   740   H  HG22 . VAL A 1 49  ? 4.339   73.154 1.991   1.00 0.00  ? 49  VAL A HG22 1  
ATOM   741   H  HG23 . VAL A 1 49  ? 2.975   72.984 0.895   1.00 0.00  ? 49  VAL A HG23 1  
ATOM   742   N  N    . VAL A 1 50  ? 4.595   70.862 3.846   1.00 0.00  ? 50  VAL A N    1  
ATOM   743   C  CA   . VAL A 1 50  ? 4.948   69.403 3.916   1.00 0.00  ? 50  VAL A CA   1  
ATOM   744   C  C    . VAL A 1 50  ? 5.349   69.022 5.343   1.00 0.00  ? 50  VAL A C    1  
ATOM   745   O  O    . VAL A 1 50  ? 4.996   67.975 5.845   1.00 0.00  ? 50  VAL A O    1  
ATOM   746   C  CB   . VAL A 1 50  ? 6.073   69.068 2.913   1.00 0.00  ? 50  VAL A CB   1  
ATOM   747   C  CG1  . VAL A 1 50  ? 7.444   69.407 3.502   1.00 0.00  ? 50  VAL A CG1  1  
ATOM   748   C  CG2  . VAL A 1 50  ? 6.031   67.574 2.567   1.00 0.00  ? 50  VAL A CG2  1  
ATOM   749   H  H    . VAL A 1 50  ? 5.181   71.497 3.376   1.00 0.00  ? 50  VAL A H    1  
ATOM   750   H  HA   . VAL A 1 50  ? 4.072   68.840 3.659   1.00 0.00  ? 50  VAL A HA   1  
ATOM   751   H  HB   . VAL A 1 50  ? 5.926   69.646 2.014   1.00 0.00  ? 50  VAL A HB   1  
ATOM   752   H  HG11 . VAL A 1 50  ? 7.381   70.337 4.028   1.00 0.00  ? 50  VAL A HG11 1  
ATOM   753   H  HG12 . VAL A 1 50  ? 8.165   69.494 2.704   1.00 0.00  ? 50  VAL A HG12 1  
ATOM   754   H  HG13 . VAL A 1 50  ? 7.753   68.627 4.184   1.00 0.00  ? 50  VAL A HG13 1  
ATOM   755   H  HG21 . VAL A 1 50  ? 6.230   66.992 3.455   1.00 0.00  ? 50  VAL A HG21 1  
ATOM   756   H  HG22 . VAL A 1 50  ? 6.779   67.356 1.820   1.00 0.00  ? 50  VAL A HG22 1  
ATOM   757   H  HG23 . VAL A 1 50  ? 5.054   67.320 2.182   1.00 0.00  ? 50  VAL A HG23 1  
ATOM   758   N  N    . GLU A 1 51  ? 6.079   69.869 5.989   1.00 70.68 ? 51  GLU A N    1  
ATOM   759   C  CA   . GLU A 1 51  ? 6.510   69.590 7.387   1.00 73.00 ? 51  GLU A CA   1  
ATOM   760   C  C    . GLU A 1 51  ? 5.296   69.210 8.228   1.00 75.05 ? 51  GLU A C    1  
ATOM   761   O  O    . GLU A 1 51  ? 5.294   68.226 8.941   1.00 73.61 ? 51  GLU A O    1  
ATOM   762   C  CB   . GLU A 1 51  ? 7.164   70.843 7.975   1.00 71.29 ? 51  GLU A CB   1  
ATOM   763   C  CG   . GLU A 1 51  ? 7.483   70.611 9.454   1.00 75.77 ? 51  GLU A CG   1  
ATOM   764   C  CD   . GLU A 1 51  ? 8.406   71.721 9.959   1.00 78.77 ? 51  GLU A CD   1  
ATOM   765   O  OE1  . GLU A 1 51  ? 8.260   72.841 9.497   1.00 77.06 ? 51  GLU A OE1  1  
ATOM   766   O  OE2  . GLU A 1 51  ? 9.243   71.433 10.798  1.00 79.68 ? 51  GLU A OE2  1  
ATOM   767   H  H    . GLU A 1 51  ? 6.345   70.698 5.546   1.00 0.00  ? 51  GLU A H    1  
ATOM   768   H  HA   . GLU A 1 51  ? 7.207   68.786 7.393   1.00 0.00  ? 51  GLU A HA   1  
ATOM   769   H  HB2  . GLU A 1 51  ? 8.076   71.057 7.438   1.00 0.00  ? 51  GLU A HB2  1  
ATOM   770   H  HB3  . GLU A 1 51  ? 6.487   71.679 7.883   1.00 0.00  ? 51  GLU A HB3  1  
ATOM   771   H  HG2  . GLU A 1 51  ? 6.565   70.617 10.025  1.00 0.00  ? 51  GLU A HG2  1  
ATOM   772   H  HG3  . GLU A 1 51  ? 7.973   69.657 9.571   1.00 0.00  ? 51  GLU A HG3  1  
ATOM   773   N  N    . MET A 1 52  ? 4.273   69.996 8.149   1.00 0.00  ? 52  MET A N    1  
ATOM   774   C  CA   . MET A 1 52  ? 3.040   69.721 8.939   1.00 0.00  ? 52  MET A CA   1  
ATOM   775   C  C    . MET A 1 52  ? 2.444   68.383 8.501   1.00 0.00  ? 52  MET A C    1  
ATOM   776   O  O    . MET A 1 52  ? 2.007   67.590 9.311   1.00 0.00  ? 52  MET A O    1  
ATOM   777   C  CB   . MET A 1 52  ? 2.026   70.842 8.698   1.00 0.00  ? 52  MET A CB   1  
ATOM   778   C  CG   . MET A 1 52  ? 2.677   72.195 9.000   1.00 0.00  ? 52  MET A CG   1  
ATOM   779   S  SD   . MET A 1 52  ? 2.850   72.395 10.790  1.00 0.00  ? 52  MET A SD   1  
ATOM   780   C  CE   . MET A 1 52  ? 3.142   74.181 10.793  1.00 0.00  ? 52  MET A CE   1  
ATOM   781   H  H    . MET A 1 52  ? 4.321   70.781 7.570   1.00 0.00  ? 52  MET A H    1  
ATOM   782   H  HA   . MET A 1 52  ? 3.288   69.679 9.989   1.00 0.00  ? 52  MET A HA   1  
ATOM   783   H  HB2  . MET A 1 52  ? 1.702   70.819 7.668   1.00 0.00  ? 52  MET A HB2  1  
ATOM   784   H  HB3  . MET A 1 52  ? 1.175   70.702 9.347   1.00 0.00  ? 52  MET A HB3  1  
ATOM   785   H  HG2  . MET A 1 52  ? 3.654   72.241 8.536   1.00 0.00  ? 52  MET A HG2  1  
ATOM   786   H  HG3  . MET A 1 52  ? 2.057   72.988 8.608   1.00 0.00  ? 52  MET A HG3  1  
ATOM   787   H  HE1  . MET A 1 52  ? 4.066   74.395 10.274  1.00 0.00  ? 52  MET A HE1  1  
ATOM   788   H  HE2  . MET A 1 52  ? 3.213   74.534 11.809  1.00 0.00  ? 52  MET A HE2  1  
ATOM   789   H  HE3  . MET A 1 52  ? 2.321   74.680 10.297  1.00 0.00  ? 52  MET A HE3  1  
ATOM   790   N  N    . LEU A 1 53  ? 2.433   68.122 7.226   1.00 74.35 ? 53  LEU A N    1  
ATOM   791   C  CA   . LEU A 1 53  ? 1.879   66.831 6.733   1.00 75.09 ? 53  LEU A CA   1  
ATOM   792   C  C    . LEU A 1 53  ? 2.613   65.677 7.430   1.00 74.89 ? 53  LEU A C    1  
ATOM   793   O  O    . LEU A 1 53  ? 2.009   64.822 8.047   1.00 71.43 ? 53  LEU A O    1  
ATOM   794   C  CB   . LEU A 1 53  ? 2.087   66.750 5.211   1.00 75.65 ? 53  LEU A CB   1  
ATOM   795   C  CG   . LEU A 1 53  ? 1.047   65.819 4.578   1.00 76.44 ? 53  LEU A CG   1  
ATOM   796   C  CD1  . LEU A 1 53  ? 1.312   65.717 3.074   1.00 76.32 ? 53  LEU A CD1  1  
ATOM   797   C  CD2  . LEU A 1 53  ? 1.145   64.426 5.212   1.00 80.73 ? 53  LEU A CD2  1  
ATOM   798   H  H    . LEU A 1 53  ? 2.799   68.773 6.589   1.00 0.00  ? 53  LEU A H    1  
ATOM   799   H  HA   . LEU A 1 53  ? 0.825   66.781 6.963   1.00 0.00  ? 53  LEU A HA   1  
ATOM   800   H  HB2  . LEU A 1 53  ? 1.983   67.738 4.787   1.00 0.00  ? 53  LEU A HB2  1  
ATOM   801   H  HB3  . LEU A 1 53  ? 3.079   66.375 4.998   1.00 0.00  ? 53  LEU A HB3  1  
ATOM   802   H  HG   . LEU A 1 53  ? 0.058   66.223 4.742   1.00 0.00  ? 53  LEU A HG   1  
ATOM   803   H  HD11 . LEU A 1 53  ? 2.301   65.317 2.909   1.00 0.00  ? 53  LEU A HD11 1  
ATOM   804   H  HD12 . LEU A 1 53  ? 1.241   66.698 2.629   1.00 0.00  ? 53  LEU A HD12 1  
ATOM   805   H  HD13 . LEU A 1 53  ? 0.579   65.064 2.623   1.00 0.00  ? 53  LEU A HD13 1  
ATOM   806   H  HD21 . LEU A 1 53  ? 0.656   64.436 6.174   1.00 0.00  ? 53  LEU A HD21 1  
ATOM   807   H  HD22 . LEU A 1 53  ? 2.183   64.157 5.338   1.00 0.00  ? 53  LEU A HD22 1  
ATOM   808   H  HD23 . LEU A 1 53  ? 0.661   63.703 4.572   1.00 0.00  ? 53  LEU A HD23 1  
ATOM   809   N  N    . ILE A 1 54  ? 3.916   65.654 7.337   1.00 0.00  ? 54  ILE A N    1  
ATOM   810   C  CA   . ILE A 1 54  ? 4.700   64.566 7.990   1.00 0.00  ? 54  ILE A CA   1  
ATOM   811   C  C    . ILE A 1 54  ? 4.300   64.443 9.460   1.00 0.00  ? 54  ILE A C    1  
ATOM   812   O  O    . ILE A 1 54  ? 4.419   63.394 10.061  1.00 0.00  ? 54  ILE A O    1  
ATOM   813   C  CB   . ILE A 1 54  ? 6.189   64.897 7.908   1.00 0.00  ? 54  ILE A CB   1  
ATOM   814   C  CG1  . ILE A 1 54  ? 6.590   65.112 6.447   1.00 0.00  ? 54  ILE A CG1  1  
ATOM   815   C  CG2  . ILE A 1 54  ? 7.003   63.743 8.496   1.00 0.00  ? 54  ILE A CG2  1  
ATOM   816   C  CD1  . ILE A 1 54  ? 8.012   65.674 6.383   1.00 0.00  ? 54  ILE A CD1  1  
ATOM   817   H  H    . ILE A 1 54  ? 4.381   66.358 6.838   1.00 0.00  ? 54  ILE A H    1  
ATOM   818   H  HA   . ILE A 1 54  ? 4.512   63.633 7.487   1.00 0.00  ? 54  ILE A HA   1  
ATOM   819   H  HB   . ILE A 1 54  ? 6.383   65.797 8.472   1.00 0.00  ? 54  ILE A HB   1  
ATOM   820   H  HG12 . ILE A 1 54  ? 6.551   64.169 5.921   1.00 0.00  ? 54  ILE A HG12 1  
ATOM   821   H  HG13 . ILE A 1 54  ? 5.909   65.810 5.986   1.00 0.00  ? 54  ILE A HG13 1  
ATOM   822   H  HG21 . ILE A 1 54  ? 6.719   62.820 8.012   1.00 0.00  ? 54  ILE A HG21 1  
ATOM   823   H  HG22 . ILE A 1 54  ? 6.808   63.668 9.556   1.00 0.00  ? 54  ILE A HG22 1  
ATOM   824   H  HG23 . ILE A 1 54  ? 8.055   63.925 8.335   1.00 0.00  ? 54  ILE A HG23 1  
ATOM   825   H  HD11 . ILE A 1 54  ? 8.356   65.666 5.359   1.00 0.00  ? 54  ILE A HD11 1  
ATOM   826   H  HD12 . ILE A 1 54  ? 8.668   65.066 6.988   1.00 0.00  ? 54  ILE A HD12 1  
ATOM   827   H  HD13 . ILE A 1 54  ? 8.015   66.687 6.755   1.00 0.00  ? 54  ILE A HD13 1  
ATOM   828   N  N    . MET A 1 55  ? 3.835   65.509 10.046  1.00 0.00  ? 55  MET A N    1  
ATOM   829   C  CA   . MET A 1 55  ? 3.437   65.460 11.480  1.00 0.00  ? 55  MET A CA   1  
ATOM   830   C  C    . MET A 1 55  ? 2.029   64.878 11.597  1.00 0.00  ? 55  MET A C    1  
ATOM   831   O  O    . MET A 1 55  ? 1.658   64.324 12.612  1.00 0.00  ? 55  MET A O    1  
ATOM   832   C  CB   . MET A 1 55  ? 3.457   66.880 12.059  1.00 0.00  ? 55  MET A CB   1  
ATOM   833   C  CG   . MET A 1 55  ? 4.857   67.501 11.889  1.00 0.00  ? 55  MET A CG   1  
ATOM   834   S  SD   . MET A 1 55  ? 5.862   67.136 13.350  1.00 0.00  ? 55  MET A SD   1  
ATOM   835   C  CE   . MET A 1 55  ? 5.343   68.559 14.341  1.00 0.00  ? 55  MET A CE   1  
ATOM   836   H  H    . MET A 1 55  ? 3.752   66.344 9.543   1.00 0.00  ? 55  MET A H    1  
ATOM   837   H  HA   . MET A 1 55  ? 4.130   64.839 12.028  1.00 0.00  ? 55  MET A HA   1  
ATOM   838   H  HB2  . MET A 1 55  ? 2.727   67.486 11.541  1.00 0.00  ? 55  MET A HB2  1  
ATOM   839   H  HB3  . MET A 1 55  ? 3.208   66.841 13.109  1.00 0.00  ? 55  MET A HB3  1  
ATOM   840   H  HG2  . MET A 1 55  ? 5.341   67.096 11.012  1.00 0.00  ? 55  MET A HG2  1  
ATOM   841   H  HG3  . MET A 1 55  ? 4.764   68.571 11.779  1.00 0.00  ? 55  MET A HG3  1  
ATOM   842   H  HE1  . MET A 1 55  ? 5.736   69.465 13.901  1.00 0.00  ? 55  MET A HE1  1  
ATOM   843   H  HE2  . MET A 1 55  ? 5.721   68.457 15.346  1.00 0.00  ? 55  MET A HE2  1  
ATOM   844   H  HE3  . MET A 1 55  ? 4.263   68.603 14.368  1.00 0.00  ? 55  MET A HE3  1  
ATOM   845   N  N    . ARG A 1 56  ? 1.243   64.997 10.563  1.00 0.00  ? 56  ARG A N    1  
ATOM   846   C  CA   . ARG A 1 56  ? -0.137  64.447 10.617  1.00 0.00  ? 56  ARG A CA   1  
ATOM   847   C  C    . ARG A 1 56  ? -0.060  62.932 10.796  1.00 0.00  ? 56  ARG A C    1  
ATOM   848   O  O    . ARG A 1 56  ? -0.853  62.339 11.500  1.00 0.00  ? 56  ARG A O    1  
ATOM   849   C  CB   . ARG A 1 56  ? -0.875  64.777 9.317   1.00 0.00  ? 56  ARG A CB   1  
ATOM   850   C  CG   . ARG A 1 56  ? -2.377  64.564 9.516   1.00 0.00  ? 56  ARG A CG   1  
ATOM   851   C  CD   . ARG A 1 56  ? -3.121  64.941 8.236   1.00 0.00  ? 56  ARG A CD   1  
ATOM   852   N  NE   . ARG A 1 56  ? -2.888  63.896 7.201   1.00 0.00  ? 56  ARG A NE   1  
ATOM   853   C  CZ   . ARG A 1 56  ? -3.657  63.841 6.150   1.00 0.00  ? 56  ARG A CZ   1  
ATOM   854   N  NH1  . ARG A 1 56  ? -4.631  64.698 6.010   1.00 0.00  ? 56  ARG A NH1  1  
ATOM   855   N  NH2  . ARG A 1 56  ? -3.453  62.927 5.240   1.00 0.00  ? 56  ARG A NH2  1  
ATOM   856   H  H    . ARG A 1 56  ? 1.561   65.445 9.754   1.00 0.00  ? 56  ARG A H    1  
ATOM   857   H  HA   . ARG A 1 56  ? -0.665  64.882 11.454  1.00 0.00  ? 56  ARG A HA   1  
ATOM   858   H  HB2  . ARG A 1 56  ? -0.689  65.808 9.051   1.00 0.00  ? 56  ARG A HB2  1  
ATOM   859   H  HB3  . ARG A 1 56  ? -0.523  64.131 8.527   1.00 0.00  ? 56  ARG A HB3  1  
ATOM   860   H  HG2  . ARG A 1 56  ? -2.565  63.526 9.751   1.00 0.00  ? 56  ARG A HG2  1  
ATOM   861   H  HG3  . ARG A 1 56  ? -2.724  65.185 10.328  1.00 0.00  ? 56  ARG A HG3  1  
ATOM   862   H  HD2  . ARG A 1 56  ? -4.179  65.015 8.443   1.00 0.00  ? 56  ARG A HD2  1  
ATOM   863   H  HD3  . ARG A 1 56  ? -2.757  65.891 7.874   1.00 0.00  ? 56  ARG A HD3  1  
ATOM   864   H  HE   . ARG A 1 56  ? -2.158  63.252 7.309   1.00 0.00  ? 56  ARG A HE   1  
ATOM   865   H  HH11 . ARG A 1 56  ? -4.785  65.397 6.709   1.00 0.00  ? 56  ARG A HH11 1  
ATOM   866   H  HH12 . ARG A 1 56  ? -5.223  64.657 5.206   1.00 0.00  ? 56  ARG A HH12 1  
ATOM   867   H  HH21 . ARG A 1 56  ? -2.707  62.270 5.350   1.00 0.00  ? 56  ARG A HH21 1  
ATOM   868   H  HH22 . ARG A 1 56  ? -4.042  62.883 4.434   1.00 0.00  ? 56  ARG A HH22 1  
ATOM   869   N  N    . GLY A 1 57  ? 0.901   62.298 10.174  1.00 75.30 ? 57  GLY A N    1  
ATOM   870   C  CA   . GLY A 1 57  ? 1.035   60.820 10.325  1.00 74.65 ? 57  GLY A CA   1  
ATOM   871   C  C    . GLY A 1 57  ? 1.709   60.206 9.094   1.00 75.56 ? 57  GLY A C    1  
ATOM   872   O  O    . GLY A 1 57  ? 1.985   59.023 9.062   1.00 73.49 ? 57  GLY A O    1  
ATOM   873   H  H    . GLY A 1 57  ? 1.537   62.796 9.621   1.00 0.00  ? 57  GLY A H    1  
ATOM   874   H  HA2  . GLY A 1 57  ? 1.635   60.613 11.195  1.00 0.00  ? 57  GLY A HA2  1  
ATOM   875   H  HA3  . GLY A 1 57  ? 0.057   60.377 10.450  1.00 0.00  ? 57  GLY A HA3  1  
ATOM   876   N  N    . ALA A 1 58  ? 1.975   60.981 8.078   1.00 0.00  ? 58  ALA A N    1  
ATOM   877   C  CA   . ALA A 1 58  ? 2.627   60.402 6.867   1.00 0.00  ? 58  ALA A CA   1  
ATOM   878   C  C    . ALA A 1 58  ? 4.047   59.960 7.226   1.00 0.00  ? 58  ALA A C    1  
ATOM   879   O  O    . ALA A 1 58  ? 4.797   60.695 7.837   1.00 0.00  ? 58  ALA A O    1  
ATOM   880   C  CB   . ALA A 1 58  ? 2.677   61.450 5.755   1.00 0.00  ? 58  ALA A CB   1  
ATOM   881   H  H    . ALA A 1 58  ? 1.746   61.934 8.108   1.00 0.00  ? 58  ALA A H    1  
ATOM   882   H  HA   . ALA A 1 58  ? 2.060   59.546 6.530   1.00 0.00  ? 58  ALA A HA   1  
ATOM   883   H  HB1  . ALA A 1 58  ? 1.697   61.884 5.627   1.00 0.00  ? 58  ALA A HB1  1  
ATOM   884   H  HB2  . ALA A 1 58  ? 2.987   60.982 4.833   1.00 0.00  ? 58  ALA A HB2  1  
ATOM   885   H  HB3  . ALA A 1 58  ? 3.381   62.223 6.019   1.00 0.00  ? 58  ALA A HB3  1  
ATOM   886   N  N    . ARG A 1 59  ? 4.423   58.760 6.863   1.00 0.00  ? 59  ARG A N    1  
ATOM   887   C  CA   . ARG A 1 59  ? 5.791   58.262 7.195   1.00 0.00  ? 59  ARG A CA   1  
ATOM   888   C  C    . ARG A 1 59  ? 6.755   58.571 6.046   1.00 0.00  ? 59  ARG A C    1  
ATOM   889   O  O    . ARG A 1 59  ? 6.367   58.644 4.897   1.00 0.00  ? 59  ARG A O    1  
ATOM   890   C  CB   . ARG A 1 59  ? 5.736   56.746 7.403   1.00 0.00  ? 59  ARG A CB   1  
ATOM   891   C  CG   . ARG A 1 59  ? 4.545   56.386 8.296   1.00 0.00  ? 59  ARG A CG   1  
ATOM   892   C  CD   . ARG A 1 59  ? 4.491   54.869 8.492   1.00 0.00  ? 59  ARG A CD   1  
ATOM   893   N  NE   . ARG A 1 59  ? 5.519   54.458 9.490   1.00 0.00  ? 59  ARG A NE   1  
ATOM   894   C  CZ   . ARG A 1 59  ? 5.459   53.275 10.039  1.00 0.00  ? 59  ARG A CZ   1  
ATOM   895   N  NH1  . ARG A 1 59  ? 4.498   52.454 9.714   1.00 0.00  ? 59  ARG A NH1  1  
ATOM   896   N  NH2  . ARG A 1 59  ? 6.359   52.914 10.912  1.00 0.00  ? 59  ARG A NH2  1  
ATOM   897   H  H    . ARG A 1 59  ? 3.812   58.168 6.377   1.00 0.00  ? 59  ARG A H    1  
ATOM   898   H  HA   . ARG A 1 59  ? 6.146   58.735 8.099   1.00 0.00  ? 59  ARG A HA   1  
ATOM   899   H  HB2  . ARG A 1 59  ? 5.628   56.255 6.446   1.00 0.00  ? 59  ARG A HB2  1  
ATOM   900   H  HB3  . ARG A 1 59  ? 6.648   56.414 7.874   1.00 0.00  ? 59  ARG A HB3  1  
ATOM   901   H  HG2  . ARG A 1 59  ? 4.656   56.870 9.255   1.00 0.00  ? 59  ARG A HG2  1  
ATOM   902   H  HG3  . ARG A 1 59  ? 3.630   56.717 7.829   1.00 0.00  ? 59  ARG A HG3  1  
ATOM   903   H  HD2  . ARG A 1 59  ? 3.511   54.588 8.849   1.00 0.00  ? 59  ARG A HD2  1  
ATOM   904   H  HD3  . ARG A 1 59  ? 4.686   54.374 7.552   1.00 0.00  ? 59  ARG A HD3  1  
ATOM   905   H  HE   . ARG A 1 59  ? 6.240   55.075 9.734   1.00 0.00  ? 59  ARG A HE   1  
ATOM   906   H  HH11 . ARG A 1 59  ? 3.809   52.731 9.045   1.00 0.00  ? 59  ARG A HH11 1  
ATOM   907   H  HH12 . ARG A 1 59  ? 4.452   51.548 10.134  1.00 0.00  ? 59  ARG A HH12 1  
ATOM   908   H  HH21 . ARG A 1 59  ? 7.095   53.543 11.161  1.00 0.00  ? 59  ARG A HH21 1  
ATOM   909   H  HH22 . ARG A 1 59  ? 6.312   52.008 11.332  1.00 0.00  ? 59  ARG A HH22 1  
ATOM   910   N  N    . ILE A 1 60  ? 8.012   58.740 6.351   1.00 0.00  ? 60  ILE A N    1  
ATOM   911   C  CA   . ILE A 1 60  ? 9.012   59.029 5.286   1.00 0.00  ? 60  ILE A CA   1  
ATOM   912   C  C    . ILE A 1 60  ? 9.423   57.714 4.619   1.00 0.00  ? 60  ILE A C    1  
ATOM   913   O  O    . ILE A 1 60  ? 9.896   57.693 3.500   1.00 0.00  ? 60  ILE A O    1  
ATOM   914   C  CB   . ILE A 1 60  ? 10.241  59.692 5.916   1.00 0.00  ? 60  ILE A CB   1  
ATOM   915   C  CG1  . ILE A 1 60  ? 9.806   60.885 6.780   1.00 0.00  ? 60  ILE A CG1  1  
ATOM   916   C  CG2  . ILE A 1 60  ? 11.187  60.174 4.816   1.00 0.00  ? 60  ILE A CG2  1  
ATOM   917   C  CD1  . ILE A 1 60  ? 8.890   61.818 5.980   1.00 0.00  ? 60  ILE A CD1  1  
ATOM   918   H  H    . ILE A 1 60  ? 8.301   58.665 7.283   1.00 0.00  ? 60  ILE A H    1  
ATOM   919   H  HA   . ILE A 1 60  ? 8.579   59.687 4.548   1.00 0.00  ? 60  ILE A HA   1  
ATOM   920   H  HB   . ILE A 1 60  ? 10.755  58.970 6.534   1.00 0.00  ? 60  ILE A HB   1  
ATOM   921   H  HG12 . ILE A 1 60  ? 9.275   60.523 7.647   1.00 0.00  ? 60  ILE A HG12 1  
ATOM   922   H  HG13 . ILE A 1 60  ? 10.681  61.432 7.099   1.00 0.00  ? 60  ILE A HG13 1  
ATOM   923   H  HG21 . ILE A 1 60  ? 12.081  60.583 5.264   1.00 0.00  ? 60  ILE A HG21 1  
ATOM   924   H  HG22 . ILE A 1 60  ? 10.697  60.936 4.230   1.00 0.00  ? 60  ILE A HG22 1  
ATOM   925   H  HG23 . ILE A 1 60  ? 11.452  59.343 4.179   1.00 0.00  ? 60  ILE A HG23 1  
ATOM   926   H  HD11 . ILE A 1 60  ? 7.887   61.418 5.973   1.00 0.00  ? 60  ILE A HD11 1  
ATOM   927   H  HD12 . ILE A 1 60  ? 9.251   61.903 4.966   1.00 0.00  ? 60  ILE A HD12 1  
ATOM   928   H  HD13 . ILE A 1 60  ? 8.883   62.795 6.441   1.00 0.00  ? 60  ILE A HD13 1  
ATOM   929   N  N    . ASN A 1 61  ? 9.237   56.615 5.299   1.00 0.00  ? 61  ASN A N    1  
ATOM   930   C  CA   . ASN A 1 61  ? 9.606   55.294 4.713   1.00 0.00  ? 61  ASN A CA   1  
ATOM   931   C  C    . ASN A 1 61  ? 8.503   54.844 3.754   1.00 0.00  ? 61  ASN A C    1  
ATOM   932   O  O    . ASN A 1 61  ? 7.980   53.752 3.862   1.00 0.00  ? 61  ASN A O    1  
ATOM   933   C  CB   . ASN A 1 61  ? 9.766   54.263 5.832   1.00 0.00  ? 61  ASN A CB   1  
ATOM   934   C  CG   . ASN A 1 61  ? 8.602   54.389 6.816   1.00 0.00  ? 61  ASN A CG   1  
ATOM   935   O  OD1  . ASN A 1 61  ? 7.577   53.759 6.647   1.00 0.00  ? 61  ASN A OD1  1  
ATOM   936   N  ND2  . ASN A 1 61  ? 8.718   55.183 7.845   1.00 0.00  ? 61  ASN A ND2  1  
ATOM   937   H  H    . ASN A 1 61  ? 8.849   56.658 6.198   1.00 0.00  ? 61  ASN A H    1  
ATOM   938   H  HA   . ASN A 1 61  ? 10.537  55.387 4.171   1.00 0.00  ? 61  ASN A HA   1  
ATOM   939   H  HB2  . ASN A 1 61  ? 9.773   53.269 5.408   1.00 0.00  ? 61  ASN A HB2  1  
ATOM   940   H  HB3  . ASN A 1 61  ? 10.695  54.439 6.353   1.00 0.00  ? 61  ASN A HB3  1  
ATOM   941   H  HD21 . ASN A 1 61  ? 9.545   55.691 7.982   1.00 0.00  ? 61  ASN A HD21 1  
ATOM   942   H  HD22 . ASN A 1 61  ? 7.978   55.271 8.482   1.00 0.00  ? 61  ASN A HD22 1  
ATOM   943   N  N    . VAL A 1 62  ? 8.158   55.680 2.806   1.00 0.00  ? 62  VAL A N    1  
ATOM   944   C  CA   . VAL A 1 62  ? 7.098   55.323 1.809   1.00 0.00  ? 62  VAL A CA   1  
ATOM   945   C  C    . VAL A 1 62  ? 7.747   55.159 0.430   1.00 0.00  ? 62  VAL A C    1  
ATOM   946   O  O    . VAL A 1 62  ? 8.632   55.906 0.063   1.00 0.00  ? 62  VAL A O    1  
ATOM   947   C  CB   . VAL A 1 62  ? 6.052   56.439 1.759   1.00 0.00  ? 62  VAL A CB   1  
ATOM   948   C  CG1  . VAL A 1 62  ? 5.173   56.369 3.010   1.00 0.00  ? 62  VAL A CG1  1  
ATOM   949   C  CG2  . VAL A 1 62  ? 6.753   57.798 1.707   1.00 0.00  ? 62  VAL A CG2  1  
ATOM   950   H  H    . VAL A 1 62  ? 8.621   56.541 2.735   1.00 0.00  ? 62  VAL A H    1  
ATOM   951   H  HA   . VAL A 1 62  ? 6.618   54.394 2.089   1.00 0.00  ? 62  VAL A HA   1  
ATOM   952   H  HB   . VAL A 1 62  ? 5.436   56.315 0.879   1.00 0.00  ? 62  VAL A HB   1  
ATOM   953   H  HG11 . VAL A 1 62  ? 4.437   57.159 2.978   1.00 0.00  ? 62  VAL A HG11 1  
ATOM   954   H  HG12 . VAL A 1 62  ? 5.788   56.486 3.890   1.00 0.00  ? 62  VAL A HG12 1  
ATOM   955   H  HG13 . VAL A 1 62  ? 4.672   55.413 3.046   1.00 0.00  ? 62  VAL A HG13 1  
ATOM   956   H  HG21 . VAL A 1 62  ? 6.014   58.582 1.637   1.00 0.00  ? 62  VAL A HG21 1  
ATOM   957   H  HG22 . VAL A 1 62  ? 7.400   57.835 0.843   1.00 0.00  ? 62  VAL A HG22 1  
ATOM   958   H  HG23 . VAL A 1 62  ? 7.340   57.935 2.603   1.00 0.00  ? 62  VAL A HG23 1  
ATOM   959   N  N    . MET A 1 63  ? 7.316   54.184 -0.334  1.00 0.00  ? 63  MET A N    1  
ATOM   960   C  CA   . MET A 1 63  ? 7.903   53.954 -1.694  1.00 0.00  ? 63  MET A CA   1  
ATOM   961   C  C    . MET A 1 63  ? 6.870   54.314 -2.761  1.00 0.00  ? 63  MET A C    1  
ATOM   962   O  O    . MET A 1 63  ? 5.795   53.750 -2.815  1.00 0.00  ? 63  MET A O    1  
ATOM   963   C  CB   . MET A 1 63  ? 8.281   52.478 -1.837  1.00 0.00  ? 63  MET A CB   1  
ATOM   964   C  CG   . MET A 1 63  ? 9.320   52.110 -0.775  1.00 0.00  ? 63  MET A CG   1  
ATOM   965   S  SD   . MET A 1 63  ? 8.513   51.983 0.840   1.00 0.00  ? 63  MET A SD   1  
ATOM   966   C  CE   . MET A 1 63  ? 8.063   50.233 0.732   1.00 0.00  ? 63  MET A CE   1  
ATOM   967   H  H    . MET A 1 63  ? 6.604   53.596 -0.013  1.00 0.00  ? 63  MET A H    1  
ATOM   968   H  HA   . MET A 1 63  ? 8.786   54.563 -1.829  1.00 0.00  ? 63  MET A HA   1  
ATOM   969   H  HB2  . MET A 1 63  ? 7.399   51.867 -1.706  1.00 0.00  ? 63  MET A HB2  1  
ATOM   970   H  HB3  . MET A 1 63  ? 8.696   52.305 -2.818  1.00 0.00  ? 63  MET A HB3  1  
ATOM   971   H  HG2  . MET A 1 63  ? 9.772   51.162 -1.027  1.00 0.00  ? 63  MET A HG2  1  
ATOM   972   H  HG3  . MET A 1 63  ? 10.082  52.874 -0.738  1.00 0.00  ? 63  MET A HG3  1  
ATOM   973   H  HE1  . MET A 1 63  ? 8.960   49.637 0.641   1.00 0.00  ? 63  MET A HE1  1  
ATOM   974   H  HE2  . MET A 1 63  ? 7.439   50.073 -0.132  1.00 0.00  ? 63  MET A HE2  1  
ATOM   975   H  HE3  . MET A 1 63  ? 7.522   49.946 1.623   1.00 0.00  ? 63  MET A HE3  1  
ATOM   976   N  N    . ASN A 1 64  ? 7.187   55.251 -3.610  1.00 0.00  ? 64  ASN A N    1  
ATOM   977   C  CA   . ASN A 1 64  ? 6.226   55.653 -4.674  1.00 0.00  ? 64  ASN A CA   1  
ATOM   978   C  C    . ASN A 1 64  ? 5.894   54.434 -5.543  1.00 0.00  ? 64  ASN A C    1  
ATOM   979   O  O    . ASN A 1 64  ? 6.504   53.389 -5.426  1.00 0.00  ? 64  ASN A O    1  
ATOM   980   C  CB   . ASN A 1 64  ? 6.866   56.776 -5.526  1.00 0.00  ? 64  ASN A CB   1  
ATOM   981   C  CG   . ASN A 1 64  ? 5.848   57.890 -5.797  1.00 0.00  ? 64  ASN A CG   1  
ATOM   982   O  OD1  . ASN A 1 64  ? 4.718   57.623 -6.156  1.00 0.00  ? 64  ASN A OD1  1  
ATOM   983   N  ND2  . ASN A 1 64  ? 6.207   59.135 -5.633  1.00 0.00  ? 64  ASN A ND2  1  
ATOM   984   H  H    . ASN A 1 64  ? 8.058   55.694 -3.547  1.00 0.00  ? 64  ASN A H    1  
ATOM   985   H  HA   . ASN A 1 64  ? 5.319   56.011 -4.211  1.00 0.00  ? 64  ASN A HA   1  
ATOM   986   H  HB2  . ASN A 1 64  ? 7.705   57.190 -4.987  1.00 0.00  ? 64  ASN A HB2  1  
ATOM   987   H  HB3  . ASN A 1 64  ? 7.215   56.377 -6.469  1.00 0.00  ? 64  ASN A HB3  1  
ATOM   988   H  HD21 . ASN A 1 64  ? 7.118   59.347 -5.341  1.00 0.00  ? 64  ASN A HD21 1  
ATOM   989   H  HD22 . ASN A 1 64  ? 5.566   59.857 -5.797  1.00 0.00  ? 64  ASN A HD22 1  
ATOM   990   N  N    . ARG A 1 65  ? 4.930   54.562 -6.412  1.00 0.00  ? 65  ARG A N    1  
ATOM   991   C  CA   . ARG A 1 65  ? 4.556   53.416 -7.286  1.00 0.00  ? 65  ARG A CA   1  
ATOM   992   C  C    . ARG A 1 65  ? 5.737   53.071 -8.191  1.00 0.00  ? 65  ARG A C    1  
ATOM   993   O  O    . ARG A 1 65  ? 5.943   51.929 -8.549  1.00 0.00  ? 65  ARG A O    1  
ATOM   994   C  CB   . ARG A 1 65  ? 3.333   53.805 -8.130  1.00 0.00  ? 65  ARG A CB   1  
ATOM   995   C  CG   . ARG A 1 65  ? 3.132   52.812 -9.299  1.00 0.00  ? 65  ARG A CG   1  
ATOM   996   C  CD   . ARG A 1 65  ? 4.049   53.156 -10.505 1.00 0.00  ? 65  ARG A CD   1  
ATOM   997   N  NE   . ARG A 1 65  ? 3.250   53.148 -11.775 1.00 0.00  ? 65  ARG A NE   1  
ATOM   998   C  CZ   . ARG A 1 65  ? 2.436   52.164 -12.061 1.00 0.00  ? 65  ARG A CZ   1  
ATOM   999   N  NH1  . ARG A 1 65  ? 2.357   51.123 -11.279 1.00 0.00  ? 65  ARG A NH1  1  
ATOM   1000  N  NH2  . ARG A 1 65  ? 1.714   52.215 -13.148 1.00 0.00  ? 65  ARG A NH2  1  
ATOM   1001  H  H    . ARG A 1 65  ? 4.451   55.413 -6.490  1.00 0.00  ? 65  ARG A H    1  
ATOM   1002  H  HA   . ARG A 1 65  ? 4.313   52.561 -6.673  1.00 0.00  ? 65  ARG A HA   1  
ATOM   1003  H  HB2  . ARG A 1 65  ? 2.456   53.786 -7.498  1.00 0.00  ? 65  ARG A HB2  1  
ATOM   1004  H  HB3  . ARG A 1 65  ? 3.466   54.803 -8.516  1.00 0.00  ? 65  ARG A HB3  1  
ATOM   1005  H  HG2  . ARG A 1 65  ? 3.355   51.814 -8.948  1.00 0.00  ? 65  ARG A HG2  1  
ATOM   1006  H  HG3  . ARG A 1 65  ? 2.100   52.852 -9.612  1.00 0.00  ? 65  ARG A HG3  1  
ATOM   1007  H  HD2  . ARG A 1 65  ? 4.473   54.139 -10.393 1.00 0.00  ? 65  ARG A HD2  1  
ATOM   1008  H  HD3  . ARG A 1 65  ? 4.858   52.434 -10.563 1.00 0.00  ? 65  ARG A HD3  1  
ATOM   1009  H  HE   . ARG A 1 65  ? 3.324   53.905 -12.394 1.00 0.00  ? 65  ARG A HE   1  
ATOM   1010  H  HH11 . ARG A 1 65  ? 2.922   51.071 -10.459 1.00 0.00  ? 65  ARG A HH11 1  
ATOM   1011  H  HH12 . ARG A 1 65  ? 1.731   50.377 -11.503 1.00 0.00  ? 65  ARG A HH12 1  
ATOM   1012  H  HH21 . ARG A 1 65  ? 1.785   53.003 -13.759 1.00 0.00  ? 65  ARG A HH21 1  
ATOM   1013  H  HH22 . ARG A 1 65  ? 1.091   51.465 -13.369 1.00 0.00  ? 65  ARG A HH22 1  
ATOM   1014  N  N    . GLY A 1 66  ? 6.518   54.047 -8.564  1.00 0.00  ? 66  GLY A N    1  
ATOM   1015  C  CA   . GLY A 1 66  ? 7.681   53.763 -9.447  1.00 0.00  ? 66  GLY A CA   1  
ATOM   1016  C  C    . GLY A 1 66  ? 8.847   53.258 -8.601  1.00 0.00  ? 66  GLY A C    1  
ATOM   1017  O  O    . GLY A 1 66  ? 9.884   52.905 -9.122  1.00 0.00  ? 66  GLY A O    1  
ATOM   1018  H  H    . GLY A 1 66  ? 6.341   54.964 -8.261  1.00 0.00  ? 66  GLY A H    1  
ATOM   1019  H  HA2  . GLY A 1 66  ? 7.409   53.012 -10.175 1.00 0.00  ? 66  GLY A HA2  1  
ATOM   1020  H  HA3  . GLY A 1 66  ? 7.975   54.668 -9.956  1.00 0.00  ? 66  GLY A HA3  1  
ATOM   1021  N  N    . ASP A 1 67  ? 8.704   53.282 -7.298  1.00 0.00  ? 67  ASP A N    1  
ATOM   1022  C  CA   . ASP A 1 67  ? 9.816   52.868 -6.392  1.00 0.00  ? 67  ASP A CA   1  
ATOM   1023  C  C    . ASP A 1 67  ? 10.771  54.054 -6.261  1.00 0.00  ? 67  ASP A C    1  
ATOM   1024  O  O    . ASP A 1 67  ? 11.759  54.166 -6.960  1.00 0.00  ? 67  ASP A O    1  
ATOM   1025  C  CB   . ASP A 1 67  ? 10.557  51.635 -6.956  1.00 0.00  ? 67  ASP A CB   1  
ATOM   1026  C  CG   . ASP A 1 67  ? 11.154  50.813 -5.808  1.00 0.00  ? 67  ASP A CG   1  
ATOM   1027  O  OD1  . ASP A 1 67  ? 11.817  51.400 -4.968  1.00 0.00  ? 67  ASP A OD1  1  
ATOM   1028  O  OD2  . ASP A 1 67  ? 10.938  49.613 -5.789  1.00 0.00  ? 67  ASP A OD2  1  
ATOM   1029  H  H    . ASP A 1 67  ? 7.891   53.652 -6.896  1.00 0.00  ? 67  ASP A H    1  
ATOM   1030  H  HA   . ASP A 1 67  ? 9.405   52.636 -5.418  1.00 0.00  ? 67  ASP A HA   1  
ATOM   1031  H  HB2  . ASP A 1 67  ? 9.862   51.021 -7.508  1.00 0.00  ? 67  ASP A HB2  1  
ATOM   1032  H  HB3  . ASP A 1 67  ? 11.353  51.951 -7.615  1.00 0.00  ? 67  ASP A HB3  1  
ATOM   1033  N  N    . ASP A 1 68  ? 10.467  54.944 -5.354  1.00 0.00  ? 68  ASP A N    1  
ATOM   1034  C  CA   . ASP A 1 68  ? 11.321  56.138 -5.134  1.00 0.00  ? 68  ASP A CA   1  
ATOM   1035  C  C    . ASP A 1 68  ? 11.038  56.678 -3.731  1.00 0.00  ? 68  ASP A C    1  
ATOM   1036  O  O    . ASP A 1 68  ? 9.931   57.103 -3.429  1.00 0.00  ? 68  ASP A O    1  
ATOM   1037  C  CB   . ASP A 1 68  ? 10.985  57.207 -6.176  1.00 0.00  ? 68  ASP A CB   1  
ATOM   1038  C  CG   . ASP A 1 68  ? 12.056  58.299 -6.151  1.00 0.00  ? 68  ASP A CG   1  
ATOM   1039  O  OD1  . ASP A 1 68  ? 12.641  58.502 -5.101  1.00 0.00  ? 68  ASP A OD1  1  
ATOM   1040  O  OD2  . ASP A 1 68  ? 12.271  58.914 -7.183  1.00 0.00  ? 68  ASP A OD2  1  
ATOM   1041  H  H    . ASP A 1 68  ? 9.675   54.818 -4.791  1.00 0.00  ? 68  ASP A H    1  
ATOM   1042  H  HA   . ASP A 1 68  ? 12.363  55.863 -5.216  1.00 0.00  ? 68  ASP A HA   1  
ATOM   1043  H  HB2  . ASP A 1 68  ? 10.952  56.755 -7.157  1.00 0.00  ? 68  ASP A HB2  1  
ATOM   1044  H  HB3  . ASP A 1 68  ? 10.024  57.643 -5.948  1.00 0.00  ? 68  ASP A HB3  1  
ATOM   1045  N  N    . THR A 1 69  ? 12.016  56.662 -2.864  1.00 37.95 ? 69  THR A N    1  
ATOM   1046  C  CA   . THR A 1 69  ? 11.789  57.168 -1.484  1.00 36.30 ? 69  THR A CA   1  
ATOM   1047  C  C    . THR A 1 69  ? 11.949  58.699 -1.490  1.00 38.10 ? 69  THR A C    1  
ATOM   1048  O  O    . THR A 1 69  ? 12.733  59.222 -2.266  1.00 39.86 ? 69  THR A O    1  
ATOM   1049  C  CB   . THR A 1 69  ? 12.831  56.551 -0.541  1.00 38.07 ? 69  THR A CB   1  
ATOM   1050  O  OG1  . THR A 1 69  ? 14.121  57.031 -0.886  1.00 39.54 ? 69  THR A OG1  1  
ATOM   1051  C  CG2  . THR A 1 69  ? 12.799  55.026 -0.665  1.00 41.20 ? 69  THR A CG2  1  
ATOM   1052  H  H    . THR A 1 69  ? 12.896  56.315 -3.119  1.00 0.00  ? 69  THR A H    1  
ATOM   1053  H  HA   . THR A 1 69  ? 10.800  56.884 -1.166  1.00 0.00  ? 69  THR A HA   1  
ATOM   1054  H  HB   . THR A 1 69  ? 12.612  56.825 0.477   1.00 0.00  ? 69  THR A HB   1  
ATOM   1055  H  HG1  . THR A 1 69  ? 14.719  56.282 -0.911  1.00 0.00  ? 69  THR A HG1  1  
ATOM   1056  H  HG21 . THR A 1 69  ? 11.859  54.655 -0.284  1.00 0.00  ? 69  THR A HG21 1  
ATOM   1057  H  HG22 . THR A 1 69  ? 13.611  54.602 -0.092  1.00 0.00  ? 69  THR A HG22 1  
ATOM   1058  H  HG23 . THR A 1 69  ? 12.905  54.746 -1.702  1.00 0.00  ? 69  THR A HG23 1  
ATOM   1059  N  N    . PRO A 1 70  ? 11.227  59.394 -0.634  1.00 40.33 ? 70  PRO A N    1  
ATOM   1060  C  CA   . PRO A 1 70  ? 11.341  60.856 -0.573  1.00 40.65 ? 70  PRO A CA   1  
ATOM   1061  C  C    . PRO A 1 70  ? 12.806  61.241 -0.342  1.00 38.76 ? 70  PRO A C    1  
ATOM   1062  O  O    . PRO A 1 70  ? 13.267  62.251 -0.822  1.00 37.74 ? 70  PRO A O    1  
ATOM   1063  C  CB   . PRO A 1 70  ? 10.443  61.282 0.613   1.00 43.22 ? 70  PRO A CB   1  
ATOM   1064  C  CG   . PRO A 1 70  ? 9.851   59.984 1.232   1.00 40.01 ? 70  PRO A CG   1  
ATOM   1065  C  CD   . PRO A 1 70  ? 10.259  58.810 0.320   1.00 42.85 ? 70  PRO A CD   1  
ATOM   1066  H  HA   . PRO A 1 70  ? 10.980  61.296 -1.488  1.00 0.00  ? 70  PRO A HA   1  
ATOM   1067  H  HB2  . PRO A 1 70  ? 11.025  61.818 1.356   1.00 0.00  ? 70  PRO A HB2  1  
ATOM   1068  H  HB3  . PRO A 1 70  ? 9.639   61.914 0.260   1.00 0.00  ? 70  PRO A HB3  1  
ATOM   1069  H  HG2  . PRO A 1 70  ? 10.255  59.836 2.225   1.00 0.00  ? 70  PRO A HG2  1  
ATOM   1070  H  HG3  . PRO A 1 70  ? 8.772   60.052 1.284   1.00 0.00  ? 70  PRO A HG3  1  
ATOM   1071  H  HD2  . PRO A 1 70  ? 10.717  58.023 0.899   1.00 0.00  ? 70  PRO A HD2  1  
ATOM   1072  H  HD3  . PRO A 1 70  ? 9.398   58.433 -0.213  1.00 0.00  ? 70  PRO A HD3  1  
ATOM   1073  N  N    . LEU A 1 71  ? 13.550  60.432 0.368   1.00 38.12 ? 71  LEU A N    1  
ATOM   1074  C  CA   . LEU A 1 71  ? 14.984  60.766 0.604   1.00 34.17 ? 71  LEU A CA   1  
ATOM   1075  C  C    . LEU A 1 71  ? 15.638  61.056 -0.744  1.00 31.24 ? 71  LEU A C    1  
ATOM   1076  O  O    . LEU A 1 71  ? 16.240  62.093 -0.941  1.00 28.70 ? 71  LEU A O    1  
ATOM   1077  C  CB   . LEU A 1 71  ? 15.683  59.585 1.315   1.00 31.35 ? 71  LEU A CB   1  
ATOM   1078  C  CG   . LEU A 1 71  ? 15.772  59.850 2.826   1.00 36.03 ? 71  LEU A CG   1  
ATOM   1079  C  CD1  . LEU A 1 71  ? 14.365  59.927 3.427   1.00 30.93 ? 71  LEU A CD1  1  
ATOM   1080  C  CD2  . LEU A 1 71  ? 16.551  58.715 3.494   1.00 33.08 ? 71  LEU A CD2  1  
ATOM   1081  H  H    . LEU A 1 71  ? 13.175  59.598 0.722   1.00 0.00  ? 71  LEU A H    1  
ATOM   1082  H  HA   . LEU A 1 71  ? 15.045  61.657 1.216   1.00 0.00  ? 71  LEU A HA   1  
ATOM   1083  H  HB2  . LEU A 1 71  ? 15.113  58.683 1.146   1.00 0.00  ? 71  LEU A HB2  1  
ATOM   1084  H  HB3  . LEU A 1 71  ? 16.681  59.454 0.921   1.00 0.00  ? 71  LEU A HB3  1  
ATOM   1085  H  HG   . LEU A 1 71  ? 16.284  60.786 2.996   1.00 0.00  ? 71  LEU A HG   1  
ATOM   1086  H  HD11 . LEU A 1 71  ? 13.881  58.971 3.334   1.00 0.00  ? 71  LEU A HD11 1  
ATOM   1087  H  HD12 . LEU A 1 71  ? 13.786  60.666 2.902   1.00 0.00  ? 71  LEU A HD12 1  
ATOM   1088  H  HD13 . LEU A 1 71  ? 14.434  60.198 4.471   1.00 0.00  ? 71  LEU A HD13 1  
ATOM   1089  H  HD21 . LEU A 1 71  ? 16.202  57.766 3.115   1.00 0.00  ? 71  LEU A HD21 1  
ATOM   1090  H  HD22 . LEU A 1 71  ? 16.400  58.753 4.563   1.00 0.00  ? 71  LEU A HD22 1  
ATOM   1091  H  HD23 . LEU A 1 71  ? 17.603  58.825 3.275   1.00 0.00  ? 71  LEU A HD23 1  
ATOM   1092  N  N    . HIS A 1 72  ? 15.499  60.169 -1.687  1.00 31.23 ? 72  HIS A N    1  
ATOM   1093  C  CA   . HIS A 1 72  ? 16.088  60.438 -3.023  1.00 33.99 ? 72  HIS A CA   1  
ATOM   1094  C  C    . HIS A 1 72  ? 15.511  61.771 -3.513  1.00 33.71 ? 72  HIS A C    1  
ATOM   1095  O  O    . HIS A 1 72  ? 16.207  62.751 -3.673  1.00 34.60 ? 72  HIS A O    1  
ATOM   1096  C  CB   . HIS A 1 72  ? 15.696  59.326 -4.007  1.00 37.54 ? 72  HIS A CB   1  
ATOM   1097  C  CG   . HIS A 1 72  ? 16.039  57.966 -3.446  1.00 39.41 ? 72  HIS A CG   1  
ATOM   1098  N  ND1  . HIS A 1 72  ? 15.062  57.043 -3.099  1.00 37.82 ? 72  HIS A ND1  1  
ATOM   1099  C  CD2  . HIS A 1 72  ? 17.240  57.344 -3.202  1.00 43.02 ? 72  HIS A CD2  1  
ATOM   1100  C  CE1  . HIS A 1 72  ? 15.686  55.927 -2.675  1.00 38.43 ? 72  HIS A CE1  1  
ATOM   1101  N  NE2  . HIS A 1 72  ? 17.012  56.055 -2.719  1.00 38.41 ? 72  HIS A NE2  1  
ATOM   1102  H  H    . HIS A 1 72  ? 14.986  59.349 -1.524  1.00 0.00  ? 72  HIS A H    1  
ATOM   1103  H  HA   . HIS A 1 72  ? 17.163  60.507 -2.947  1.00 0.00  ? 72  HIS A HA   1  
ATOM   1104  H  HB2  . HIS A 1 72  ? 14.633  59.374 -4.193  1.00 0.00  ? 72  HIS A HB2  1  
ATOM   1105  H  HB3  . HIS A 1 72  ? 16.226  59.471 -4.937  1.00 0.00  ? 72  HIS A HB3  1  
ATOM   1106  H  HD2  . HIS A 1 72  ? 18.211  57.787 -3.356  1.00 0.00  ? 72  HIS A HD2  1  
ATOM   1107  H  HE1  . HIS A 1 72  ? 15.174  55.040 -2.332  1.00 0.00  ? 72  HIS A HE1  1  
ATOM   1108  H  HE2  . HIS A 1 72  ? 17.677  55.382 -2.465  1.00 0.00  ? 72  HIS A HE2  1  
ATOM   1109  N  N    . LEU A 1 73  ? 14.234  61.782 -3.775  1.00 29.46 ? 73  LEU A N    1  
ATOM   1110  C  CA   . LEU A 1 73  ? 13.574  63.024 -4.282  1.00 30.94 ? 73  LEU A CA   1  
ATOM   1111  C  C    . LEU A 1 73  ? 14.032  64.240 -3.457  1.00 31.79 ? 73  LEU A C    1  
ATOM   1112  O  O    . LEU A 1 73  ? 14.394  65.273 -3.995  1.00 30.31 ? 73  LEU A O    1  
ATOM   1113  C  CB   . LEU A 1 73  ? 12.052  62.868 -4.186  1.00 29.19 ? 73  LEU A CB   1  
ATOM   1114  C  CG   . LEU A 1 73  ? 11.600  61.646 -5.009  1.00 29.25 ? 73  LEU A CG   1  
ATOM   1115  C  CD1  . LEU A 1 73  ? 10.199  61.214 -4.565  1.00 30.59 ? 73  LEU A CD1  1  
ATOM   1116  C  CD2  . LEU A 1 73  ? 11.571  61.992 -6.506  1.00 29.01 ? 73  LEU A CD2  1  
ATOM   1117  H  H    . LEU A 1 73  ? 13.735  60.940 -3.669  1.00 0.00  ? 73  LEU A H    1  
ATOM   1118  H  HA   . LEU A 1 73  ? 13.853  63.175 -5.312  1.00 0.00  ? 73  LEU A HA   1  
ATOM   1119  H  HB2  . LEU A 1 73  ? 11.774  62.729 -3.152  1.00 0.00  ? 73  LEU A HB2  1  
ATOM   1120  H  HB3  . LEU A 1 73  ? 11.574  63.757 -4.567  1.00 0.00  ? 73  LEU A HB3  1  
ATOM   1121  H  HG   . LEU A 1 73  ? 12.290  60.830 -4.843  1.00 0.00  ? 73  LEU A HG   1  
ATOM   1122  H  HD11 . LEU A 1 73  ? 9.767   60.560 -5.310  1.00 0.00  ? 73  LEU A HD11 1  
ATOM   1123  H  HD12 . LEU A 1 73  ? 9.573   62.085 -4.447  1.00 0.00  ? 73  LEU A HD12 1  
ATOM   1124  H  HD13 . LEU A 1 73  ? 10.264  60.689 -3.624  1.00 0.00  ? 73  LEU A HD13 1  
ATOM   1125  H  HD21 . LEU A 1 73  ? 11.073  62.939 -6.655  1.00 0.00  ? 73  LEU A HD21 1  
ATOM   1126  H  HD22 . LEU A 1 73  ? 11.036  61.221 -7.040  1.00 0.00  ? 73  LEU A HD22 1  
ATOM   1127  H  HD23 . LEU A 1 73  ? 12.580  62.052 -6.884  1.00 0.00  ? 73  LEU A HD23 1  
ATOM   1128  N  N    . ALA A 1 74  ? 14.021  64.127 -2.157  1.00 33.77 ? 74  ALA A N    1  
ATOM   1129  C  CA   . ALA A 1 74  ? 14.453  65.268 -1.297  1.00 31.56 ? 74  ALA A CA   1  
ATOM   1130  C  C    . ALA A 1 74  ? 15.815  65.782 -1.766  1.00 32.36 ? 74  ALA A C    1  
ATOM   1131  O  O    . ALA A 1 74  ? 15.970  66.939 -2.097  1.00 33.38 ? 74  ALA A O    1  
ATOM   1132  C  CB   . ALA A 1 74  ? 14.558  64.800 0.156   1.00 31.99 ? 74  ALA A CB   1  
ATOM   1133  H  H    . ALA A 1 74  ? 13.729  63.290 -1.744  1.00 0.00  ? 74  ALA A H    1  
ATOM   1134  H  HA   . ALA A 1 74  ? 13.726  66.064 -1.365  1.00 0.00  ? 74  ALA A HA   1  
ATOM   1135  H  HB1  . ALA A 1 74  ? 14.884  65.622 0.776   1.00 0.00  ? 74  ALA A HB1  1  
ATOM   1136  H  HB2  . ALA A 1 74  ? 15.273  63.993 0.223   1.00 0.00  ? 74  ALA A HB2  1  
ATOM   1137  H  HB3  . ALA A 1 74  ? 13.592  64.454 0.493   1.00 0.00  ? 74  ALA A HB3  1  
ATOM   1138  N  N    . ALA A 1 75  ? 16.805  64.934 -1.803  1.00 0.00  ? 75  ALA A N    1  
ATOM   1139  C  CA   . ALA A 1 75  ? 18.149  65.383 -2.262  1.00 0.00  ? 75  ALA A CA   1  
ATOM   1140  C  C    . ALA A 1 75  ? 18.068  65.752 -3.746  1.00 0.00  ? 75  ALA A C    1  
ATOM   1141  O  O    . ALA A 1 75  ? 18.700  66.683 -4.204  1.00 0.00  ? 75  ALA A O    1  
ATOM   1142  C  CB   . ALA A 1 75  ? 19.161  64.252 -2.069  1.00 0.00  ? 75  ALA A CB   1  
ATOM   1143  H  H    . ALA A 1 75  ? 16.663  64.002 -1.535  1.00 0.00  ? 75  ALA A H    1  
ATOM   1144  H  HA   . ALA A 1 75  ? 18.457  66.247 -1.691  1.00 0.00  ? 75  ALA A HA   1  
ATOM   1145  H  HB1  . ALA A 1 75  ? 18.883  63.411 -2.688  1.00 0.00  ? 75  ALA A HB1  1  
ATOM   1146  H  HB2  . ALA A 1 75  ? 19.169  63.949 -1.033  1.00 0.00  ? 75  ALA A HB2  1  
ATOM   1147  H  HB3  . ALA A 1 75  ? 20.145  64.596 -2.351  1.00 0.00  ? 75  ALA A HB3  1  
ATOM   1148  N  N    . SER A 1 76  ? 17.281  65.028 -4.494  1.00 0.00  ? 76  SER A N    1  
ATOM   1149  C  CA   . SER A 1 76  ? 17.134  65.324 -5.947  1.00 0.00  ? 76  SER A CA   1  
ATOM   1150  C  C    . SER A 1 76  ? 16.438  66.679 -6.123  1.00 0.00  ? 76  SER A C    1  
ATOM   1151  O  O    . SER A 1 76  ? 16.287  67.172 -7.223  1.00 0.00  ? 76  SER A O    1  
ATOM   1152  C  CB   . SER A 1 76  ? 16.303  64.219 -6.617  1.00 0.00  ? 76  SER A CB   1  
ATOM   1153  O  OG   . SER A 1 76  ? 14.955  64.653 -6.757  1.00 0.00  ? 76  SER A OG   1  
ATOM   1154  H  H    . SER A 1 76  ? 16.777  64.288 -4.096  1.00 0.00  ? 76  SER A H    1  
ATOM   1155  H  HA   . SER A 1 76  ? 18.114  65.367 -6.401  1.00 0.00  ? 76  SER A HA   1  
ATOM   1156  H  HB2  . SER A 1 76  ? 16.703  63.998 -7.594  1.00 0.00  ? 76  SER A HB2  1  
ATOM   1157  H  HB3  . SER A 1 76  ? 16.341  63.326 -6.007  1.00 0.00  ? 76  SER A HB3  1  
ATOM   1158  H  HG   . SER A 1 76  ? 14.777  65.293 -6.064  1.00 0.00  ? 76  SER A HG   1  
ATOM   1159  N  N    . HIS A 1 77  ? 16.038  67.299 -5.042  1.00 0.00  ? 77  HIS A N    1  
ATOM   1160  C  CA   . HIS A 1 77  ? 15.379  68.639 -5.148  1.00 0.00  ? 77  HIS A CA   1  
ATOM   1161  C  C    . HIS A 1 77  ? 16.444  69.734 -5.021  1.00 0.00  ? 77  HIS A C    1  
ATOM   1162  O  O    . HIS A 1 77  ? 16.640  70.521 -5.926  1.00 0.00  ? 77  HIS A O    1  
ATOM   1163  C  CB   . HIS A 1 77  ? 14.346  68.813 -4.035  1.00 0.00  ? 77  HIS A CB   1  
ATOM   1164  C  CG   . HIS A 1 77  ? 13.731  70.179 -4.157  1.00 0.00  ? 77  HIS A CG   1  
ATOM   1165  N  ND1  . HIS A 1 77  ? 12.623  70.426 -4.954  1.00 0.00  ? 77  HIS A ND1  1  
ATOM   1166  C  CD2  . HIS A 1 77  ? 14.071  71.388 -3.604  1.00 0.00  ? 77  HIS A CD2  1  
ATOM   1167  C  CE1  . HIS A 1 77  ? 12.340  71.738 -4.860  1.00 0.00  ? 77  HIS A CE1  1  
ATOM   1168  N  NE2  . HIS A 1 77  ? 13.192  72.369 -4.050  1.00 0.00  ? 77  HIS A NE2  1  
ATOM   1169  H  H    . HIS A 1 77  ? 16.213  66.898 -4.163  1.00 0.00  ? 77  HIS A H    1  
ATOM   1170  H  HA   . HIS A 1 77  ? 14.888  68.729 -6.108  1.00 0.00  ? 77  HIS A HA   1  
ATOM   1171  H  HB2  . HIS A 1 77  ? 13.578  68.059 -4.131  1.00 0.00  ? 77  HIS A HB2  1  
ATOM   1172  H  HB3  . HIS A 1 77  ? 14.827  68.722 -3.075  1.00 0.00  ? 77  HIS A HB3  1  
ATOM   1173  H  HD2  . HIS A 1 77  ? 14.899  71.553 -2.932  1.00 0.00  ? 77  HIS A HD2  1  
ATOM   1174  H  HE1  . HIS A 1 77  ? 11.527  72.222 -5.380  1.00 0.00  ? 77  HIS A HE1  1  
ATOM   1175  H  HE2  . HIS A 1 77  ? 13.190  73.322 -3.823  1.00 0.00  ? 77  HIS A HE2  1  
ATOM   1176  N  N    . GLY A 1 78  ? 17.142  69.781 -3.907  1.00 46.01 ? 78  GLY A N    1  
ATOM   1177  C  CA   . GLY A 1 78  ? 18.215  70.816 -3.713  1.00 42.98 ? 78  GLY A CA   1  
ATOM   1178  C  C    . GLY A 1 78  ? 17.881  71.721 -2.520  1.00 44.14 ? 78  GLY A C    1  
ATOM   1179  O  O    . GLY A 1 78  ? 18.469  72.770 -2.350  1.00 46.10 ? 78  GLY A O    1  
ATOM   1180  H  H    . GLY A 1 78  ? 16.968  69.127 -3.199  1.00 0.00  ? 78  GLY A H    1  
ATOM   1181  H  HA2  . GLY A 1 78  ? 19.155  70.317 -3.525  1.00 0.00  ? 78  GLY A HA2  1  
ATOM   1182  H  HA3  . GLY A 1 78  ? 18.311  71.426 -4.601  1.00 0.00  ? 78  GLY A HA3  1  
ATOM   1183  N  N    . HIS A 1 79  ? 16.948  71.331 -1.688  1.00 0.00  ? 79  HIS A N    1  
ATOM   1184  C  CA   . HIS A 1 79  ? 16.590  72.180 -0.505  1.00 0.00  ? 79  HIS A CA   1  
ATOM   1185  C  C    . HIS A 1 79  ? 17.391  71.709 0.717   1.00 0.00  ? 79  HIS A C    1  
ATOM   1186  O  O    . HIS A 1 79  ? 16.965  70.853 1.456   1.00 0.00  ? 79  HIS A O    1  
ATOM   1187  C  CB   . HIS A 1 79  ? 15.076  72.054 -0.221  1.00 0.00  ? 79  HIS A CB   1  
ATOM   1188  C  CG   . HIS A 1 79  ? 14.317  73.135 -0.949  1.00 0.00  ? 79  HIS A CG   1  
ATOM   1189  N  ND1  . HIS A 1 79  ? 14.842  73.796 -2.050  1.00 0.00  ? 79  HIS A ND1  1  
ATOM   1190  C  CD2  . HIS A 1 79  ? 13.074  73.682 -0.741  1.00 0.00  ? 79  HIS A CD2  1  
ATOM   1191  C  CE1  . HIS A 1 79  ? 13.927  74.694 -2.459  1.00 0.00  ? 79  HIS A CE1  1  
ATOM   1192  N  NE2  . HIS A 1 79  ? 12.832  74.665 -1.696  1.00 0.00  ? 79  HIS A NE2  1  
ATOM   1193  H  H    . HIS A 1 79  ? 16.485  70.480 -1.837  1.00 0.00  ? 79  HIS A H    1  
ATOM   1194  H  HA   . HIS A 1 79  ? 16.840  73.215 -0.709  1.00 0.00  ? 79  HIS A HA   1  
ATOM   1195  H  HB2  . HIS A 1 79  ? 14.730  71.089 -0.558  1.00 0.00  ? 79  HIS A HB2  1  
ATOM   1196  H  HB3  . HIS A 1 79  ? 14.891  72.147 0.841   1.00 0.00  ? 79  HIS A HB3  1  
ATOM   1197  H  HD2  . HIS A 1 79  ? 12.391  73.396 0.045   1.00 0.00  ? 79  HIS A HD2  1  
ATOM   1198  H  HE1  . HIS A 1 79  ? 14.062  75.357 -3.301  1.00 0.00  ? 79  HIS A HE1  1  
ATOM   1199  H  HE2  . HIS A 1 79  ? 12.032  75.222 -1.795  1.00 0.00  ? 79  HIS A HE2  1  
ATOM   1200  N  N    . ARG A 1 80  ? 18.554  72.254 0.925   1.00 0.00  ? 80  ARG A N    1  
ATOM   1201  C  CA   . ARG A 1 80  ? 19.385  71.829 2.092   1.00 0.00  ? 80  ARG A CA   1  
ATOM   1202  C  C    . ARG A 1 80  ? 18.511  71.689 3.355   1.00 0.00  ? 80  ARG A C    1  
ATOM   1203  O  O    . ARG A 1 80  ? 18.560  70.691 4.045   1.00 0.00  ? 80  ARG A O    1  
ATOM   1204  C  CB   . ARG A 1 80  ? 20.496  72.873 2.344   1.00 0.00  ? 80  ARG A CB   1  
ATOM   1205  C  CG   . ARG A 1 80  ? 20.882  73.571 1.028   1.00 0.00  ? 80  ARG A CG   1  
ATOM   1206  C  CD   . ARG A 1 80  ? 21.200  72.533 -0.067  1.00 0.00  ? 80  ARG A CD   1  
ATOM   1207  N  NE   . ARG A 1 80  ? 22.374  72.995 -0.872  1.00 0.00  ? 80  ARG A NE   1  
ATOM   1208  C  CZ   . ARG A 1 80  ? 22.441  74.216 -1.334  1.00 0.00  ? 80  ARG A CZ   1  
ATOM   1209  N  NH1  . ARG A 1 80  ? 21.415  75.016 -1.244  1.00 0.00  ? 80  ARG A NH1  1  
ATOM   1210  N  NH2  . ARG A 1 80  ? 23.527  74.621 -1.935  1.00 0.00  ? 80  ARG A NH2  1  
ATOM   1211  H  H    . ARG A 1 80  ? 18.890  72.929 0.304   1.00 0.00  ? 80  ARG A H    1  
ATOM   1212  H  HA   . ARG A 1 80  ? 19.837  70.873 1.873   1.00 0.00  ? 80  ARG A HA   1  
ATOM   1213  H  HB2  . ARG A 1 80  ? 20.146  73.618 3.046   1.00 0.00  ? 80  ARG A HB2  1  
ATOM   1214  H  HB3  . ARG A 1 80  ? 21.367  72.381 2.752   1.00 0.00  ? 80  ARG A HB3  1  
ATOM   1215  H  HG2  . ARG A 1 80  ? 20.064  74.200 0.713   1.00 0.00  ? 80  ARG A HG2  1  
ATOM   1216  H  HG3  . ARG A 1 80  ? 21.754  74.185 1.198   1.00 0.00  ? 80  ARG A HG3  1  
ATOM   1217  H  HD2  . ARG A 1 80  ? 21.463  71.592 0.383   1.00 0.00  ? 80  ARG A HD2  1  
ATOM   1218  H  HD3  . ARG A 1 80  ? 20.329  72.392 -0.701  1.00 0.00  ? 80  ARG A HD3  1  
ATOM   1219  H  HE   . ARG A 1 80  ? 23.127  72.385 -1.017  1.00 0.00  ? 80  ARG A HE   1  
ATOM   1220  H  HH11 . ARG A 1 80  ? 20.569  74.699 -0.825  1.00 0.00  ? 80  ARG A HH11 1  
ATOM   1221  H  HH12 . ARG A 1 80  ? 21.478  75.950 -1.597  1.00 0.00  ? 80  ARG A HH12 1  
ATOM   1222  H  HH21 . ARG A 1 80  ? 24.303  73.999 -2.039  1.00 0.00  ? 80  ARG A HH21 1  
ATOM   1223  H  HH22 . ARG A 1 80  ? 23.583  75.554 -2.291  1.00 0.00  ? 80  ARG A HH22 1  
ATOM   1224  N  N    . ASP A 1 81  ? 17.745  72.697 3.679   1.00 0.00  ? 81  ASP A N    1  
ATOM   1225  C  CA   . ASP A 1 81  ? 16.904  72.645 4.916   1.00 0.00  ? 81  ASP A CA   1  
ATOM   1226  C  C    . ASP A 1 81  ? 15.984  71.413 4.944   1.00 0.00  ? 81  ASP A C    1  
ATOM   1227  O  O    . ASP A 1 81  ? 16.071  70.597 5.840   1.00 0.00  ? 81  ASP A O    1  
ATOM   1228  C  CB   . ASP A 1 81  ? 16.044  73.909 4.986   1.00 0.00  ? 81  ASP A CB   1  
ATOM   1229  C  CG   . ASP A 1 81  ? 15.242  73.910 6.289   1.00 0.00  ? 81  ASP A CG   1  
ATOM   1230  O  OD1  . ASP A 1 81  ? 15.827  73.629 7.322   1.00 0.00  ? 81  ASP A OD1  1  
ATOM   1231  O  OD2  . ASP A 1 81  ? 14.057  74.192 6.231   1.00 0.00  ? 81  ASP A OD2  1  
ATOM   1232  H  H    . ASP A 1 81  ? 17.747  73.509 3.131   1.00 0.00  ? 81  ASP A H    1  
ATOM   1233  H  HA   . ASP A 1 81  ? 17.552  72.617 5.778   1.00 0.00  ? 81  ASP A HA   1  
ATOM   1234  H  HB2  . ASP A 1 81  ? 16.683  74.780 4.955   1.00 0.00  ? 81  ASP A HB2  1  
ATOM   1235  H  HB3  . ASP A 1 81  ? 15.365  73.929 4.147   1.00 0.00  ? 81  ASP A HB3  1  
ATOM   1236  N  N    . ILE A 1 82  ? 15.081  71.281 4.006   1.00 0.00  ? 82  ILE A N    1  
ATOM   1237  C  CA   . ILE A 1 82  ? 14.152  70.106 4.051   1.00 0.00  ? 82  ILE A CA   1  
ATOM   1238  C  C    . ILE A 1 82  ? 14.959  68.819 4.265   1.00 0.00  ? 82  ILE A C    1  
ATOM   1239  O  O    . ILE A 1 82  ? 14.608  67.986 5.075   1.00 0.00  ? 82  ILE A O    1  
ATOM   1240  C  CB   . ILE A 1 82  ? 13.307  70.019 2.755   1.00 0.00  ? 82  ILE A CB   1  
ATOM   1241  C  CG1  . ILE A 1 82  ? 12.002  69.262 3.048   1.00 0.00  ? 82  ILE A CG1  1  
ATOM   1242  C  CG2  . ILE A 1 82  ? 14.070  69.280 1.648   1.00 0.00  ? 82  ILE A CG2  1  
ATOM   1243  C  CD1  . ILE A 1 82  ? 11.218  69.048 1.750   1.00 0.00  ? 82  ILE A CD1  1  
ATOM   1244  H  H    . ILE A 1 82  ? 14.999  71.964 3.309   1.00 0.00  ? 82  ILE A H    1  
ATOM   1245  H  HA   . ILE A 1 82  ? 13.489  70.236 4.896   1.00 0.00  ? 82  ILE A HA   1  
ATOM   1246  H  HB   . ILE A 1 82  ? 13.071  71.017 2.417   1.00 0.00  ? 82  ILE A HB   1  
ATOM   1247  H  HG12 . ILE A 1 82  ? 12.235  68.304 3.489   1.00 0.00  ? 82  ILE A HG12 1  
ATOM   1248  H  HG13 . ILE A 1 82  ? 11.402  69.838 3.737   1.00 0.00  ? 82  ILE A HG13 1  
ATOM   1249  H  HG21 . ILE A 1 82  ? 15.069  69.656 1.590   1.00 0.00  ? 82  ILE A HG21 1  
ATOM   1250  H  HG22 . ILE A 1 82  ? 13.573  69.436 0.702   1.00 0.00  ? 82  ILE A HG22 1  
ATOM   1251  H  HG23 . ILE A 1 82  ? 14.095  68.223 1.872   1.00 0.00  ? 82  ILE A HG23 1  
ATOM   1252  H  HD11 . ILE A 1 82  ? 11.719  68.311 1.141   1.00 0.00  ? 82  ILE A HD11 1  
ATOM   1253  H  HD12 . ILE A 1 82  ? 11.155  69.980 1.208   1.00 0.00  ? 82  ILE A HD12 1  
ATOM   1254  H  HD13 . ILE A 1 82  ? 10.224  68.701 1.984   1.00 0.00  ? 82  ILE A HD13 1  
ATOM   1255  N  N    . VAL A 1 83  ? 16.035  68.656 3.547   1.00 45.62 ? 83  VAL A N    1  
ATOM   1256  C  CA   . VAL A 1 83  ? 16.865  67.428 3.703   1.00 41.66 ? 83  VAL A CA   1  
ATOM   1257  C  C    . VAL A 1 83  ? 17.229  67.216 5.172   1.00 43.89 ? 83  VAL A C    1  
ATOM   1258  O  O    . VAL A 1 83  ? 16.970  66.175 5.737   1.00 46.97 ? 83  VAL A O    1  
ATOM   1259  C  CB   . VAL A 1 83  ? 18.151  67.583 2.889   1.00 38.08 ? 83  VAL A CB   1  
ATOM   1260  C  CG1  . VAL A 1 83  ? 19.037  66.353 3.094   1.00 28.61 ? 83  VAL A CG1  1  
ATOM   1261  C  CG2  . VAL A 1 83  ? 17.806  67.719 1.404   1.00 33.67 ? 83  VAL A CG2  1  
ATOM   1262  H  H    . VAL A 1 83  ? 16.299  69.345 2.902   1.00 0.00  ? 83  VAL A H    1  
ATOM   1263  H  HA   . VAL A 1 83  ? 16.317  66.570 3.345   1.00 0.00  ? 83  VAL A HA   1  
ATOM   1264  H  HB   . VAL A 1 83  ? 18.681  68.465 3.219   1.00 0.00  ? 83  VAL A HB   1  
ATOM   1265  H  HG11 . VAL A 1 83  ? 18.444  65.458 2.974   1.00 0.00  ? 83  VAL A HG11 1  
ATOM   1266  H  HG12 . VAL A 1 83  ? 19.459  66.375 4.088   1.00 0.00  ? 83  VAL A HG12 1  
ATOM   1267  H  HG13 . VAL A 1 83  ? 19.834  66.357 2.365   1.00 0.00  ? 83  VAL A HG13 1  
ATOM   1268  H  HG21 . VAL A 1 83  ? 17.393  66.788 1.043   1.00 0.00  ? 83  VAL A HG21 1  
ATOM   1269  H  HG22 . VAL A 1 83  ? 18.700  67.956 0.847   1.00 0.00  ? 83  VAL A HG22 1  
ATOM   1270  H  HG23 . VAL A 1 83  ? 17.082  68.508 1.274   1.00 0.00  ? 83  VAL A HG23 1  
ATOM   1271  N  N    . GLN A 1 84  ? 17.842  68.184 5.790   1.00 0.00  ? 84  GLN A N    1  
ATOM   1272  C  CA   . GLN A 1 84  ? 18.246  68.027 7.216   1.00 0.00  ? 84  GLN A CA   1  
ATOM   1273  C  C    . GLN A 1 84  ? 17.073  67.545 8.077   1.00 0.00  ? 84  GLN A C    1  
ATOM   1274  O  O    . GLN A 1 84  ? 17.180  66.564 8.778   1.00 0.00  ? 84  GLN A O    1  
ATOM   1275  C  CB   . GLN A 1 84  ? 18.745  69.368 7.755   1.00 0.00  ? 84  GLN A CB   1  
ATOM   1276  C  CG   . GLN A 1 84  ? 19.965  69.822 6.950   1.00 0.00  ? 84  GLN A CG   1  
ATOM   1277  C  CD   . GLN A 1 84  ? 20.364  71.234 7.382   1.00 0.00  ? 84  GLN A CD   1  
ATOM   1278  O  OE1  . GLN A 1 84  ? 20.765  72.041 6.566   1.00 0.00  ? 84  GLN A OE1  1  
ATOM   1279  N  NE2  . GLN A 1 84  ? 20.271  71.570 8.640   1.00 0.00  ? 84  GLN A NE2  1  
ATOM   1280  H  H    . GLN A 1 84  ? 18.051  69.015 5.314   1.00 0.00  ? 84  GLN A H    1  
ATOM   1281  H  HA   . GLN A 1 84  ? 19.047  67.306 7.277   1.00 0.00  ? 84  GLN A HA   1  
ATOM   1282  H  HB2  . GLN A 1 84  ? 17.961  70.106 7.668   1.00 0.00  ? 84  GLN A HB2  1  
ATOM   1283  H  HB3  . GLN A 1 84  ? 19.023  69.256 8.792   1.00 0.00  ? 84  GLN A HB3  1  
ATOM   1284  H  HG2  . GLN A 1 84  ? 20.787  69.144 7.130   1.00 0.00  ? 84  GLN A HG2  1  
ATOM   1285  H  HG3  . GLN A 1 84  ? 19.723  69.824 5.899   1.00 0.00  ? 84  GLN A HG3  1  
ATOM   1286  H  HE21 . GLN A 1 84  ? 19.948  70.919 9.297   1.00 0.00  ? 84  GLN A HE21 1  
ATOM   1287  H  HE22 . GLN A 1 84  ? 20.524  72.472 8.926   1.00 0.00  ? 84  GLN A HE22 1  
ATOM   1288  N  N    . LYS A 1 85  ? 15.964  68.227 8.053   1.00 0.00  ? 85  LYS A N    1  
ATOM   1289  C  CA   . LYS A 1 85  ? 14.814  67.796 8.903   1.00 0.00  ? 85  LYS A CA   1  
ATOM   1290  C  C    . LYS A 1 85  ? 14.125  66.566 8.304   1.00 0.00  ? 85  LYS A C    1  
ATOM   1291  O  O    . LYS A 1 85  ? 13.435  65.840 8.989   1.00 0.00  ? 85  LYS A O    1  
ATOM   1292  C  CB   . LYS A 1 85  ? 13.800  68.936 9.005   1.00 0.00  ? 85  LYS A CB   1  
ATOM   1293  C  CG   . LYS A 1 85  ? 13.376  69.369 7.597   1.00 0.00  ? 85  LYS A CG   1  
ATOM   1294  C  CD   . LYS A 1 85  ? 12.372  70.527 7.684   1.00 0.00  ? 85  LYS A CD   1  
ATOM   1295  C  CE   . LYS A 1 85  ? 11.111  70.090 8.446   1.00 0.00  ? 85  LYS A CE   1  
ATOM   1296  N  NZ   . LYS A 1 85  ? 10.808  68.661 8.152   1.00 0.00  ? 85  LYS A NZ   1  
ATOM   1297  H  H    . LYS A 1 85  ? 15.887  69.024 7.487   1.00 0.00  ? 85  LYS A H    1  
ATOM   1298  H  HA   . LYS A 1 85  ? 15.174  67.554 9.892   1.00 0.00  ? 85  LYS A HA   1  
ATOM   1299  H  HB2  . LYS A 1 85  ? 12.936  68.596 9.556   1.00 0.00  ? 85  LYS A HB2  1  
ATOM   1300  H  HB3  . LYS A 1 85  ? 14.248  69.774 9.518   1.00 0.00  ? 85  LYS A HB3  1  
ATOM   1301  H  HG2  . LYS A 1 85  ? 14.249  69.694 7.049   1.00 0.00  ? 85  LYS A HG2  1  
ATOM   1302  H  HG3  . LYS A 1 85  ? 12.923  68.536 7.083   1.00 0.00  ? 85  LYS A HG3  1  
ATOM   1303  H  HD2  . LYS A 1 85  ? 12.831  71.359 8.198   1.00 0.00  ? 85  LYS A HD2  1  
ATOM   1304  H  HD3  . LYS A 1 85  ? 12.097  70.833 6.685   1.00 0.00  ? 85  LYS A HD3  1  
ATOM   1305  H  HE2  . LYS A 1 85  ? 11.269  70.212 9.507   1.00 0.00  ? 85  LYS A HE2  1  
ATOM   1306  H  HE3  . LYS A 1 85  ? 10.277  70.703 8.139   1.00 0.00  ? 85  LYS A HE3  1  
ATOM   1307  H  HZ1  . LYS A 1 85  ? 11.437  68.050 8.710   1.00 0.00  ? 85  LYS A HZ1  1  
ATOM   1308  H  HZ2  . LYS A 1 85  ? 10.954  68.478 7.138   1.00 0.00  ? 85  LYS A HZ2  1  
ATOM   1309  H  HZ3  . LYS A 1 85  ? 9.820   68.457 8.403   1.00 0.00  ? 85  LYS A HZ3  1  
ATOM   1310  N  N    . LEU A 1 86  ? 14.293  66.329 7.036   1.00 51.35 ? 86  LEU A N    1  
ATOM   1311  C  CA   . LEU A 1 86  ? 13.635  65.161 6.395   1.00 49.20 ? 86  LEU A CA   1  
ATOM   1312  C  C    . LEU A 1 86  ? 14.513  63.919 6.594   1.00 50.55 ? 86  LEU A C    1  
ATOM   1313  O  O    . LEU A 1 86  ? 14.029  62.812 6.718   1.00 53.46 ? 86  LEU A O    1  
ATOM   1314  C  CB   . LEU A 1 86  ? 13.463  65.505 4.903   1.00 45.52 ? 86  LEU A CB   1  
ATOM   1315  C  CG   . LEU A 1 86  ? 12.832  64.354 4.101   1.00 42.66 ? 86  LEU A CG   1  
ATOM   1316  C  CD1  . LEU A 1 86  ? 13.857  63.227 3.838   1.00 46.99 ? 86  LEU A CD1  1  
ATOM   1317  C  CD2  . LEU A 1 86  ? 11.603  63.803 4.841   1.00 42.69 ? 86  LEU A CD2  1  
ATOM   1318  H  H    . LEU A 1 86  ? 14.850  66.920 6.494   1.00 0.00  ? 86  LEU A H    1  
ATOM   1319  H  HA   . LEU A 1 86  ? 12.669  65.001 6.849   1.00 0.00  ? 86  LEU A HA   1  
ATOM   1320  H  HB2  . LEU A 1 86  ? 12.826  66.373 4.820   1.00 0.00  ? 86  LEU A HB2  1  
ATOM   1321  H  HB3  . LEU A 1 86  ? 14.429  65.745 4.484   1.00 0.00  ? 86  LEU A HB3  1  
ATOM   1322  H  HG   . LEU A 1 86  ? 12.511  64.746 3.146   1.00 0.00  ? 86  LEU A HG   1  
ATOM   1323  H  HD11 . LEU A 1 86  ? 13.639  62.374 4.461   1.00 0.00  ? 86  LEU A HD11 1  
ATOM   1324  H  HD12 . LEU A 1 86  ? 14.862  63.568 4.042   1.00 0.00  ? 86  LEU A HD12 1  
ATOM   1325  H  HD13 . LEU A 1 86  ? 13.791  62.938 2.801   1.00 0.00  ? 86  LEU A HD13 1  
ATOM   1326  H  HD21 . LEU A 1 86  ? 10.987  63.250 4.148   1.00 0.00  ? 86  LEU A HD21 1  
ATOM   1327  H  HD22 . LEU A 1 86  ? 11.031  64.622 5.252   1.00 0.00  ? 86  LEU A HD22 1  
ATOM   1328  H  HD23 . LEU A 1 86  ? 11.924  63.149 5.638   1.00 0.00  ? 86  LEU A HD23 1  
ATOM   1329  N  N    . LEU A 1 87  ? 15.805  64.106 6.632   1.00 0.00  ? 87  LEU A N    1  
ATOM   1330  C  CA   . LEU A 1 87  ? 16.747  62.969 6.825   1.00 0.00  ? 87  LEU A CA   1  
ATOM   1331  C  C    . LEU A 1 87  ? 17.012  62.752 8.328   1.00 0.00  ? 87  LEU A C    1  
ATOM   1332  O  O    . LEU A 1 87  ? 17.557  61.748 8.739   1.00 0.00  ? 87  LEU A O    1  
ATOM   1333  C  CB   . LEU A 1 87  ? 18.046  63.333 6.086   1.00 0.00  ? 87  LEU A CB   1  
ATOM   1334  C  CG   . LEU A 1 87  ? 19.221  62.420 6.512   1.00 0.00  ? 87  LEU A CG   1  
ATOM   1335  C  CD1  . LEU A 1 87  ? 20.102  62.114 5.301   1.00 0.00  ? 87  LEU A CD1  1  
ATOM   1336  C  CD2  . LEU A 1 87  ? 20.087  63.117 7.577   1.00 0.00  ? 87  LEU A CD2  1  
ATOM   1337  H  H    . LEU A 1 87  ? 16.165  65.009 6.535   1.00 0.00  ? 87  LEU A H    1  
ATOM   1338  H  HA   . LEU A 1 87  ? 16.329  62.070 6.396   1.00 0.00  ? 87  LEU A HA   1  
ATOM   1339  H  HB2  . LEU A 1 87  ? 17.872  63.232 5.023   1.00 0.00  ? 87  LEU A HB2  1  
ATOM   1340  H  HB3  . LEU A 1 87  ? 18.291  64.362 6.299   1.00 0.00  ? 87  LEU A HB3  1  
ATOM   1341  H  HG   . LEU A 1 87  ? 18.838  61.495 6.903   1.00 0.00  ? 87  LEU A HG   1  
ATOM   1342  H  HD11 . LEU A 1 87  ? 20.423  63.041 4.850   1.00 0.00  ? 87  LEU A HD11 1  
ATOM   1343  H  HD12 . LEU A 1 87  ? 19.536  61.540 4.585   1.00 0.00  ? 87  LEU A HD12 1  
ATOM   1344  H  HD13 . LEU A 1 87  ? 20.965  61.549 5.618   1.00 0.00  ? 87  LEU A HD13 1  
ATOM   1345  H  HD21 . LEU A 1 87  ? 20.414  64.077 7.200   1.00 0.00  ? 87  LEU A HD21 1  
ATOM   1346  H  HD22 . LEU A 1 87  ? 20.948  62.506 7.794   1.00 0.00  ? 87  LEU A HD22 1  
ATOM   1347  H  HD23 . LEU A 1 87  ? 19.515  63.263 8.478   1.00 0.00  ? 87  LEU A HD23 1  
ATOM   1348  N  N    . GLN A 1 88  ? 16.622  63.686 9.154   1.00 0.00  ? 88  GLN A N    1  
ATOM   1349  C  CA   . GLN A 1 88  ? 16.853  63.538 10.635  1.00 0.00  ? 88  GLN A CA   1  
ATOM   1350  C  C    . GLN A 1 88  ? 15.602  62.994 11.317  1.00 0.00  ? 88  GLN A C    1  
ATOM   1351  O  O    . GLN A 1 88  ? 15.530  62.907 12.527  1.00 0.00  ? 88  GLN A O    1  
ATOM   1352  C  CB   . GLN A 1 88  ? 17.212  64.898 11.237  1.00 0.00  ? 88  GLN A CB   1  
ATOM   1353  C  CG   . GLN A 1 88  ? 18.664  65.219 10.896  1.00 0.00  ? 88  GLN A CG   1  
ATOM   1354  C  CD   . GLN A 1 88  ? 19.058  66.561 11.515  1.00 0.00  ? 88  GLN A CD   1  
ATOM   1355  O  OE1  . GLN A 1 88  ? 18.594  66.910 12.583  1.00 0.00  ? 88  GLN A OE1  1  
ATOM   1356  N  NE2  . GLN A 1 88  ? 19.899  67.333 10.885  1.00 0.00  ? 88  GLN A NE2  1  
ATOM   1357  H  H    . GLN A 1 88  ? 16.165  64.476 8.796   1.00 0.00  ? 88  GLN A H    1  
ATOM   1358  H  HA   . GLN A 1 88  ? 17.668  62.847 10.807  1.00 0.00  ? 88  GLN A HA   1  
ATOM   1359  H  HB2  . GLN A 1 88  ? 16.563  65.658 10.830  1.00 0.00  ? 88  GLN A HB2  1  
ATOM   1360  H  HB3  . GLN A 1 88  ? 17.097  64.863 12.310  1.00 0.00  ? 88  GLN A HB3  1  
ATOM   1361  H  HG2  . GLN A 1 88  ? 19.293  64.437 11.289  1.00 0.00  ? 88  GLN A HG2  1  
ATOM   1362  H  HG3  . GLN A 1 88  ? 18.782  65.265 9.826   1.00 0.00  ? 88  GLN A HG3  1  
ATOM   1363  H  HE21 . GLN A 1 88  ? 20.273  67.051 10.024  1.00 0.00  ? 88  GLN A HE21 1  
ATOM   1364  H  HE22 . GLN A 1 88  ? 20.158  68.195 11.273  1.00 0.00  ? 88  GLN A HE22 1  
ATOM   1365  N  N    . TYR A 1 89  ? 14.620  62.630 10.556  1.00 0.00  ? 89  TYR A N    1  
ATOM   1366  C  CA   . TYR A 1 89  ? 13.364  62.090 11.162  1.00 0.00  ? 89  TYR A CA   1  
ATOM   1367  C  C    . TYR A 1 89  ? 13.508  60.578 11.394  1.00 0.00  ? 89  TYR A C    1  
ATOM   1368  O  O    . TYR A 1 89  ? 13.218  60.081 12.465  1.00 0.00  ? 89  TYR A O    1  
ATOM   1369  C  CB   . TYR A 1 89  ? 12.178  62.372 10.210  1.00 0.00  ? 89  TYR A CB   1  
ATOM   1370  C  CG   . TYR A 1 89  ? 11.485  63.663 10.602  1.00 0.00  ? 89  TYR A CG   1  
ATOM   1371  C  CD1  . TYR A 1 89  ? 12.237  64.759 11.044  1.00 0.00  ? 89  TYR A CD1  1  
ATOM   1372  C  CD2  . TYR A 1 89  ? 10.089  63.759 10.525  1.00 0.00  ? 89  TYR A CD2  1  
ATOM   1373  C  CE1  . TYR A 1 89  ? 11.594  65.948 11.409  1.00 0.00  ? 89  TYR A CE1  1  
ATOM   1374  C  CE2  . TYR A 1 89  ? 9.447   64.948 10.890  1.00 0.00  ? 89  TYR A CE2  1  
ATOM   1375  C  CZ   . TYR A 1 89  ? 10.200  66.043 11.332  1.00 0.00  ? 89  TYR A CZ   1  
ATOM   1376  O  OH   . TYR A 1 89  ? 9.567   67.215 11.692  1.00 0.00  ? 89  TYR A OH   1  
ATOM   1377  H  H    . TYR A 1 89  ? 14.709  62.708 9.586   1.00 0.00  ? 89  TYR A H    1  
ATOM   1378  H  HA   . TYR A 1 89  ? 13.188  62.572 12.116  1.00 0.00  ? 89  TYR A HA   1  
ATOM   1379  H  HB2  . TYR A 1 89  ? 12.547  62.460 9.200   1.00 0.00  ? 89  TYR A HB2  1  
ATOM   1380  H  HB3  . TYR A 1 89  ? 11.464  61.559 10.258  1.00 0.00  ? 89  TYR A HB3  1  
ATOM   1381  H  HD1  . TYR A 1 89  ? 13.313  64.689 11.103  1.00 0.00  ? 89  TYR A HD1  1  
ATOM   1382  H  HD2  . TYR A 1 89  ? 9.508   62.915 10.184  1.00 0.00  ? 89  TYR A HD2  1  
ATOM   1383  H  HE1  . TYR A 1 89  ? 12.174  66.793 11.749  1.00 0.00  ? 89  TYR A HE1  1  
ATOM   1384  H  HE2  . TYR A 1 89  ? 8.371   65.021 10.831  1.00 0.00  ? 89  TYR A HE2  1  
ATOM   1385  H  HH   . TYR A 1 89  ? 9.741   67.372 12.623  1.00 0.00  ? 89  TYR A HH   1  
ATOM   1386  N  N    . LYS A 1 90  ? 13.933  59.840 10.396  1.00 0.00  ? 90  LYS A N    1  
ATOM   1387  C  CA   . LYS A 1 90  ? 14.073  58.353 10.548  1.00 0.00  ? 90  LYS A CA   1  
ATOM   1388  C  C    . LYS A 1 90  ? 15.417  57.892 9.992   1.00 0.00  ? 90  LYS A C    1  
ATOM   1389  O  O    . LYS A 1 90  ? 15.786  56.740 10.109  1.00 0.00  ? 90  LYS A O    1  
ATOM   1390  C  CB   . LYS A 1 90  ? 12.970  57.668 9.748   1.00 0.00  ? 90  LYS A CB   1  
ATOM   1391  C  CG   . LYS A 1 90  ? 11.594  57.983 10.358  1.00 0.00  ? 90  LYS A CG   1  
ATOM   1392  C  CD   . LYS A 1 90  ? 10.499  57.830 9.279   1.00 0.00  ? 90  LYS A CD   1  
ATOM   1393  C  CE   . LYS A 1 90  ? 9.207   57.293 9.907   1.00 0.00  ? 90  LYS A CE   1  
ATOM   1394  N  NZ   . LYS A 1 90  ? 9.469   55.960 10.519  1.00 0.00  ? 90  LYS A NZ   1  
ATOM   1395  H  H    . LYS A 1 90  ? 14.144  60.262 9.538   1.00 0.00  ? 90  LYS A H    1  
ATOM   1396  H  HA   . LYS A 1 90  ? 13.995  58.068 11.587  1.00 0.00  ? 90  LYS A HA   1  
ATOM   1397  H  HB2  . LYS A 1 90  ? 13.004  58.022 8.726   1.00 0.00  ? 90  LYS A HB2  1  
ATOM   1398  H  HB3  . LYS A 1 90  ? 13.131  56.600 9.760   1.00 0.00  ? 90  LYS A HB3  1  
ATOM   1399  H  HG2  . LYS A 1 90  ? 11.408  57.300 11.174  1.00 0.00  ? 90  LYS A HG2  1  
ATOM   1400  H  HG3  . LYS A 1 90  ? 11.583  58.994 10.735  1.00 0.00  ? 90  LYS A HG3  1  
ATOM   1401  H  HD2  . LYS A 1 90  ? 10.301  58.793 8.830   1.00 0.00  ? 90  LYS A HD2  1  
ATOM   1402  H  HD3  . LYS A 1 90  ? 10.837  57.146 8.514   1.00 0.00  ? 90  LYS A HD3  1  
ATOM   1403  H  HE2  . LYS A 1 90  ? 8.866   57.978 10.670  1.00 0.00  ? 90  LYS A HE2  1  
ATOM   1404  H  HE3  . LYS A 1 90  ? 8.449   57.198 9.145   1.00 0.00  ? 90  LYS A HE3  1  
ATOM   1405  H  HZ1  . LYS A 1 90  ? 10.194  55.461 9.966   1.00 0.00  ? 90  LYS A HZ1  1  
ATOM   1406  H  HZ2  . LYS A 1 90  ? 8.590   55.402 10.524  1.00 0.00  ? 90  LYS A HZ2  1  
ATOM   1407  H  HZ3  . LYS A 1 90  ? 9.806   56.086 11.494  1.00 0.00  ? 90  LYS A HZ3  1  
ATOM   1408  N  N    . ALA A 1 91  ? 16.153  58.777 9.393   1.00 0.00  ? 91  ALA A N    1  
ATOM   1409  C  CA   . ALA A 1 91  ? 17.480  58.386 8.833   1.00 0.00  ? 91  ALA A CA   1  
ATOM   1410  C  C    . ALA A 1 91  ? 17.335  57.103 8.010   1.00 0.00  ? 91  ALA A C    1  
ATOM   1411  O  O    . ALA A 1 91  ? 18.091  56.164 8.164   1.00 0.00  ? 91  ALA A O    1  
ATOM   1412  C  CB   . ALA A 1 91  ? 18.466  58.147 9.979   1.00 0.00  ? 91  ALA A CB   1  
ATOM   1413  H  H    . ALA A 1 91  ? 15.842  59.702 9.322   1.00 0.00  ? 91  ALA A H    1  
ATOM   1414  H  HA   . ALA A 1 91  ? 17.850  59.179 8.201   1.00 0.00  ? 91  ALA A HA   1  
ATOM   1415  H  HB1  . ALA A 1 91  ? 18.143  57.297 10.560  1.00 0.00  ? 91  ALA A HB1  1  
ATOM   1416  H  HB2  . ALA A 1 91  ? 18.503  59.022 10.611  1.00 0.00  ? 91  ALA A HB2  1  
ATOM   1417  H  HB3  . ALA A 1 91  ? 19.448  57.954 9.574   1.00 0.00  ? 91  ALA A HB3  1  
ATOM   1418  N  N    . ASP A 1 92  ? 16.371  57.062 7.131   1.00 0.00  ? 92  ASP A N    1  
ATOM   1419  C  CA   . ASP A 1 92  ? 16.170  55.853 6.284   1.00 0.00  ? 92  ASP A CA   1  
ATOM   1420  C  C    . ASP A 1 92  ? 17.096  55.937 5.070   1.00 0.00  ? 92  ASP A C    1  
ATOM   1421  O  O    . ASP A 1 92  ? 16.775  55.473 3.994   1.00 0.00  ? 92  ASP A O    1  
ATOM   1422  C  CB   . ASP A 1 92  ? 14.711  55.763 5.833   1.00 0.00  ? 92  ASP A CB   1  
ATOM   1423  C  CG   . ASP A 1 92  ? 14.383  56.938 4.921   1.00 0.00  ? 92  ASP A CG   1  
ATOM   1424  O  OD1  . ASP A 1 92  ? 14.323  58.048 5.423   1.00 0.00  ? 92  ASP A OD1  1  
ATOM   1425  O  OD2  . ASP A 1 92  ? 14.194  56.706 3.738   1.00 0.00  ? 92  ASP A OD2  1  
ATOM   1426  H  H    . ASP A 1 92  ? 15.783  57.835 7.022   1.00 0.00  ? 92  ASP A H    1  
ATOM   1427  H  HA   . ASP A 1 92  ? 16.419  54.970 6.858   1.00 0.00  ? 92  ASP A HA   1  
ATOM   1428  H  HB2  . ASP A 1 92  ? 14.557  54.838 5.297   1.00 0.00  ? 92  ASP A HB2  1  
ATOM   1429  H  HB3  . ASP A 1 92  ? 14.065  55.789 6.697   1.00 0.00  ? 92  ASP A HB3  1  
ATOM   1430  N  N    . ILE A 1 93  ? 18.278  56.461 5.262   1.00 0.00  ? 93  ILE A N    1  
ATOM   1431  C  CA   . ILE A 1 93  ? 19.278  56.507 4.156   1.00 0.00  ? 93  ILE A CA   1  
ATOM   1432  C  C    . ILE A 1 93  ? 19.784  55.077 4.000   1.00 0.00  ? 93  ILE A C    1  
ATOM   1433  O  O    . ILE A 1 93  ? 20.180  54.647 2.935   1.00 0.00  ? 93  ILE A O    1  
ATOM   1434  C  CB   . ILE A 1 93  ? 20.413  57.500 4.534   1.00 0.00  ? 93  ILE A CB   1  
ATOM   1435  C  CG1  . ILE A 1 93  ? 21.777  57.085 3.910   1.00 0.00  ? 93  ILE A CG1  1  
ATOM   1436  C  CG2  . ILE A 1 93  ? 20.533  57.597 6.063   1.00 0.00  ? 93  ILE A CG2  1  
ATOM   1437  C  CD1  . ILE A 1 93  ? 22.590  56.199 4.876   1.00 0.00  ? 93  ILE A CD1  1  
ATOM   1438  H  H    . ILE A 1 93  ? 18.553  56.725 6.163   1.00 0.00  ? 93  ILE A H    1  
ATOM   1439  H  HA   . ILE A 1 93  ? 18.804  56.816 3.227   1.00 0.00  ? 93  ILE A HA   1  
ATOM   1440  H  HB   . ILE A 1 93  ? 20.141  58.479 4.158   1.00 0.00  ? 93  ILE A HB   1  
ATOM   1441  H  HG12 . ILE A 1 93  ? 21.608  56.548 2.989   1.00 0.00  ? 93  ILE A HG12 1  
ATOM   1442  H  HG13 . ILE A 1 93  ? 22.350  57.976 3.693   1.00 0.00  ? 93  ILE A HG13 1  
ATOM   1443  H  HG21 . ILE A 1 93  ? 20.492  56.606 6.492   1.00 0.00  ? 93  ILE A HG21 1  
ATOM   1444  H  HG22 . ILE A 1 93  ? 19.722  58.194 6.452   1.00 0.00  ? 93  ILE A HG22 1  
ATOM   1445  H  HG23 . ILE A 1 93  ? 21.474  58.061 6.320   1.00 0.00  ? 93  ILE A HG23 1  
ATOM   1446  H  HD11 . ILE A 1 93  ? 23.392  55.719 4.336   1.00 0.00  ? 93  ILE A HD11 1  
ATOM   1447  H  HD12 . ILE A 1 93  ? 21.951  55.448 5.311   1.00 0.00  ? 93  ILE A HD12 1  
ATOM   1448  H  HD13 . ILE A 1 93  ? 23.003  56.814 5.664   1.00 0.00  ? 93  ILE A HD13 1  
ATOM   1449  N  N    . ASN A 1 94  ? 19.739  54.335 5.073   1.00 0.00  ? 94  ASN A N    1  
ATOM   1450  C  CA   . ASN A 1 94  ? 20.178  52.920 5.026   1.00 0.00  ? 94  ASN A CA   1  
ATOM   1451  C  C    . ASN A 1 94  ? 19.052  52.098 4.408   1.00 0.00  ? 94  ASN A C    1  
ATOM   1452  O  O    . ASN A 1 94  ? 18.942  50.908 4.624   1.00 0.00  ? 94  ASN A O    1  
ATOM   1453  C  CB   . ASN A 1 94  ? 20.464  52.420 6.443   1.00 0.00  ? 94  ASN A CB   1  
ATOM   1454  C  CG   . ASN A 1 94  ? 19.179  52.476 7.273   1.00 0.00  ? 94  ASN A CG   1  
ATOM   1455  O  OD1  . ASN A 1 94  ? 18.505  51.478 7.438   1.00 0.00  ? 94  ASN A OD1  1  
ATOM   1456  N  ND2  . ASN A 1 94  ? 18.809  53.609 7.804   1.00 0.00  ? 94  ASN A ND2  1  
ATOM   1457  H  H    . ASN A 1 94  ? 19.395  54.710 5.911   1.00 0.00  ? 94  ASN A H    1  
ATOM   1458  H  HA   . ASN A 1 94  ? 21.069  52.834 4.420   1.00 0.00  ? 94  ASN A HA   1  
ATOM   1459  H  HB2  . ASN A 1 94  ? 20.821  51.401 6.400   1.00 0.00  ? 94  ASN A HB2  1  
ATOM   1460  H  HB3  . ASN A 1 94  ? 21.213  53.046 6.903   1.00 0.00  ? 94  ASN A HB3  1  
ATOM   1461  H  HD21 . ASN A 1 94  ? 19.352  54.413 7.670   1.00 0.00  ? 94  ASN A HD21 1  
ATOM   1462  H  HD22 . ASN A 1 94  ? 17.988  53.655 8.336   1.00 0.00  ? 94  ASN A HD22 1  
ATOM   1463  N  N    . ALA A 1 95  ? 18.225  52.730 3.613   1.00 47.14 ? 95  ALA A N    1  
ATOM   1464  C  CA   . ALA A 1 95  ? 17.110  52.002 2.939   1.00 47.00 ? 95  ALA A CA   1  
ATOM   1465  C  C    . ALA A 1 95  ? 17.005  52.522 1.506   1.00 47.76 ? 95  ALA A C    1  
ATOM   1466  O  O    . ALA A 1 95  ? 16.326  53.490 1.225   1.00 52.93 ? 95  ALA A O    1  
ATOM   1467  C  CB   . ALA A 1 95  ? 15.799  52.269 3.682   1.00 42.03 ? 95  ALA A CB   1  
ATOM   1468  H  H    . ALA A 1 95  ? 18.355  53.686 3.429   1.00 0.00  ? 95  ALA A H    1  
ATOM   1469  H  HA   . ALA A 1 95  ? 17.313  50.939 2.924   1.00 0.00  ? 95  ALA A HA   1  
ATOM   1470  H  HB1  . ALA A 1 95  ? 14.990  51.761 3.177   1.00 0.00  ? 95  ALA A HB1  1  
ATOM   1471  H  HB2  . ALA A 1 95  ? 15.603  53.331 3.698   1.00 0.00  ? 95  ALA A HB2  1  
ATOM   1472  H  HB3  . ALA A 1 95  ? 15.878  51.902 4.695   1.00 0.00  ? 95  ALA A HB3  1  
ATOM   1473  N  N    . VAL A 1 96  ? 17.703  51.891 0.611   1.00 0.00  ? 96  VAL A N    1  
ATOM   1474  C  CA   . VAL A 1 96  ? 17.703  52.326 -0.812  1.00 0.00  ? 96  VAL A CA   1  
ATOM   1475  C  C    . VAL A 1 96  ? 16.396  51.928 -1.497  1.00 0.00  ? 96  VAL A C    1  
ATOM   1476  O  O    . VAL A 1 96  ? 15.519  51.336 -0.900  1.00 0.00  ? 96  VAL A O    1  
ATOM   1477  C  CB   . VAL A 1 96  ? 18.873  51.650 -1.525  1.00 0.00  ? 96  VAL A CB   1  
ATOM   1478  C  CG1  . VAL A 1 96  ? 20.184  52.092 -0.872  1.00 0.00  ? 96  VAL A CG1  1  
ATOM   1479  C  CG2  . VAL A 1 96  ? 18.729  50.119 -1.422  1.00 0.00  ? 96  VAL A CG2  1  
ATOM   1480  H  H    . VAL A 1 96  ? 18.266  51.140 0.886   1.00 0.00  ? 96  VAL A H    1  
ATOM   1481  H  HA   . VAL A 1 96  ? 17.829  53.398 -0.863  1.00 0.00  ? 96  VAL A HA   1  
ATOM   1482  H  HB   . VAL A 1 96  ? 18.872  51.946 -2.563  1.00 0.00  ? 96  VAL A HB   1  
ATOM   1483  H  HG11 . VAL A 1 96  ? 21.013  51.815 -1.507  1.00 0.00  ? 96  VAL A HG11 1  
ATOM   1484  H  HG12 . VAL A 1 96  ? 20.289  51.609 0.088   1.00 0.00  ? 96  VAL A HG12 1  
ATOM   1485  H  HG13 . VAL A 1 96  ? 20.175  53.163 -0.738  1.00 0.00  ? 96  VAL A HG13 1  
ATOM   1486  H  HG21 . VAL A 1 96  ? 19.697  49.652 -1.542  1.00 0.00  ? 96  VAL A HG21 1  
ATOM   1487  H  HG22 . VAL A 1 96  ? 18.065  49.768 -2.197  1.00 0.00  ? 96  VAL A HG22 1  
ATOM   1488  H  HG23 . VAL A 1 96  ? 18.324  49.851 -0.457  1.00 0.00  ? 96  VAL A HG23 1  
ATOM   1489  N  N    . ASN A 1 97  ? 16.284  52.218 -2.768  1.00 45.59 ? 97  ASN A N    1  
ATOM   1490  C  CA   . ASN A 1 97  ? 15.058  51.825 -3.523  1.00 43.57 ? 97  ASN A CA   1  
ATOM   1491  C  C    . ASN A 1 97  ? 15.272  50.413 -4.083  1.00 42.16 ? 97  ASN A C    1  
ATOM   1492  O  O    . ASN A 1 97  ? 15.703  49.523 -3.377  1.00 42.44 ? 97  ASN A O    1  
ATOM   1493  C  CB   . ASN A 1 97  ? 14.811  52.812 -4.669  1.00 45.87 ? 97  ASN A CB   1  
ATOM   1494  C  CG   . ASN A 1 97  ? 15.914  52.671 -5.717  1.00 46.86 ? 97  ASN A CG   1  
ATOM   1495  O  OD1  . ASN A 1 97  ? 15.785  53.159 -6.821  1.00 49.23 ? 97  ASN A OD1  1  
ATOM   1496  N  ND2  . ASN A 1 97  ? 17.007  52.027 -5.409  1.00 47.99 ? 97  ASN A ND2  1  
ATOM   1497  H  H    . ASN A 1 97  ? 17.033  52.654 -3.229  1.00 0.00  ? 97  ASN A H    1  
ATOM   1498  H  HA   . ASN A 1 97  ? 14.204  51.822 -2.859  1.00 0.00  ? 97  ASN A HA   1  
ATOM   1499  H  HB2  . ASN A 1 97  ? 13.854  52.604 -5.121  1.00 0.00  ? 97  ASN A HB2  1  
ATOM   1500  H  HB3  . ASN A 1 97  ? 14.813  53.819 -4.283  1.00 0.00  ? 97  ASN A HB3  1  
ATOM   1501  H  HD21 . ASN A 1 97  ? 17.114  51.642 -4.513  1.00 0.00  ? 97  ASN A HD21 1  
ATOM   1502  H  HD22 . ASN A 1 97  ? 17.722  51.930 -6.073  1.00 0.00  ? 97  ASN A HD22 1  
ATOM   1503  N  N    . GLU A 1 98  ? 14.976  50.190 -5.341  1.00 0.00  ? 98  GLU A N    1  
ATOM   1504  C  CA   . GLU A 1 98  ? 15.163  48.835 -5.933  1.00 0.00  ? 98  GLU A CA   1  
ATOM   1505  C  C    . GLU A 1 98  ? 16.495  48.769 -6.693  1.00 0.00  ? 98  GLU A C    1  
ATOM   1506  O  O    . GLU A 1 98  ? 17.088  47.718 -6.829  1.00 0.00  ? 98  GLU A O    1  
ATOM   1507  C  CB   . GLU A 1 98  ? 14.000  48.561 -6.891  1.00 0.00  ? 98  GLU A CB   1  
ATOM   1508  C  CG   . GLU A 1 98  ? 14.140  49.400 -8.169  1.00 0.00  ? 98  GLU A CG   1  
ATOM   1509  C  CD   . GLU A 1 98  ? 14.409  50.864 -7.838  1.00 0.00  ? 98  GLU A CD   1  
ATOM   1510  O  OE1  . GLU A 1 98  ? 13.603  51.449 -7.137  1.00 0.00  ? 98  GLU A OE1  1  
ATOM   1511  O  OE2  . GLU A 1 98  ? 15.414  51.377 -8.297  1.00 0.00  ? 98  GLU A OE2  1  
ATOM   1512  H  H    . GLU A 1 98  ? 14.623  50.907 -5.903  1.00 0.00  ? 98  GLU A H    1  
ATOM   1513  H  HA   . GLU A 1 98  ? 15.161  48.087 -5.152  1.00 0.00  ? 98  GLU A HA   1  
ATOM   1514  H  HB2  . GLU A 1 98  ? 13.994  47.513 -7.151  1.00 0.00  ? 98  GLU A HB2  1  
ATOM   1515  H  HB3  . GLU A 1 98  ? 13.070  48.811 -6.402  1.00 0.00  ? 98  GLU A HB3  1  
ATOM   1516  H  HG2  . GLU A 1 98  ? 14.951  49.019 -8.760  1.00 0.00  ? 98  GLU A HG2  1  
ATOM   1517  H  HG3  . GLU A 1 98  ? 13.229  49.335 -8.726  1.00 0.00  ? 98  GLU A HG3  1  
ATOM   1518  N  N    . HIS A 1 99  ? 16.971  49.882 -7.191  1.00 0.00  ? 99  HIS A N    1  
ATOM   1519  C  CA   . HIS A 1 99  ? 18.261  49.874 -7.942  1.00 0.00  ? 99  HIS A CA   1  
ATOM   1520  C  C    . HIS A 1 99  ? 19.416  50.034 -6.957  1.00 0.00  ? 99  HIS A C    1  
ATOM   1521  O  O    . HIS A 1 99  ? 20.562  49.794 -7.285  1.00 0.00  ? 99  HIS A O    1  
ATOM   1522  C  CB   . HIS A 1 99  ? 18.284  51.031 -8.946  1.00 0.00  ? 99  HIS A CB   1  
ATOM   1523  C  CG   . HIS A 1 99  ? 17.270  50.789 -10.034 1.00 0.00  ? 99  HIS A CG   1  
ATOM   1524  N  ND1  . HIS A 1 99  ? 16.566  51.827 -10.626 1.00 0.00  ? 99  HIS A ND1  1  
ATOM   1525  C  CD2  . HIS A 1 99  ? 16.827  49.640 -10.648 1.00 0.00  ? 99  HIS A CD2  1  
ATOM   1526  C  CE1  . HIS A 1 99  ? 15.748  51.291 -11.550 1.00 0.00  ? 99  HIS A CE1  1  
ATOM   1527  N  NE2  . HIS A 1 99  ? 15.868  49.963 -11.603 1.00 0.00  ? 99  HIS A NE2  1  
ATOM   1528  H  H    . HIS A 1 99  ? 16.481  50.720 -7.072  1.00 0.00  ? 99  HIS A H    1  
ATOM   1529  H  HA   . HIS A 1 99  ? 18.370  48.938 -8.469  1.00 0.00  ? 99  HIS A HA   1  
ATOM   1530  H  HB2  . HIS A 1 99  ? 18.049  51.953 -8.435  1.00 0.00  ? 99  HIS A HB2  1  
ATOM   1531  H  HB3  . HIS A 1 99  ? 19.268  51.105 -9.384  1.00 0.00  ? 99  HIS A HB3  1  
ATOM   1532  H  HD2  . HIS A 1 99  ? 17.172  48.641 -10.429 1.00 0.00  ? 99  HIS A HD2  1  
ATOM   1533  H  HE1  . HIS A 1 99  ? 15.077  51.865 -12.172 1.00 0.00  ? 99  HIS A HE1  1  
ATOM   1534  H  HE2  . HIS A 1 99  ? 15.378  49.353 -12.192 1.00 0.00  ? 99  HIS A HE2  1  
ATOM   1535  N  N    . GLY A 1 100 ? 19.121  50.424 -5.744  1.00 45.39 ? 100 GLY A N    1  
ATOM   1536  C  CA   . GLY A 1 100 ? 20.198  50.586 -4.719  1.00 47.70 ? 100 GLY A CA   1  
ATOM   1537  C  C    . GLY A 1 100 ? 20.605  52.060 -4.592  1.00 45.14 ? 100 GLY A C    1  
ATOM   1538  O  O    . GLY A 1 100 ? 21.402  52.423 -3.749  1.00 48.55 ? 100 GLY A O    1  
ATOM   1539  H  H    . GLY A 1 100 ? 18.187  50.597 -5.505  1.00 0.00  ? 100 GLY A H    1  
ATOM   1540  H  HA2  . GLY A 1 100 ? 19.834  50.233 -3.773  1.00 0.00  ? 100 GLY A HA2  1  
ATOM   1541  H  HA3  . GLY A 1 100 ? 21.058  50.005 -5.004  1.00 0.00  ? 100 GLY A HA3  1  
ATOM   1542  N  N    . ASN A 1 101 ? 20.089  52.901 -5.440  1.00 0.00  ? 101 ASN A N    1  
ATOM   1543  C  CA   . ASN A 1 101 ? 20.471  54.346 -5.393  1.00 0.00  ? 101 ASN A CA   1  
ATOM   1544  C  C    . ASN A 1 101 ? 20.385  54.897 -3.959  1.00 0.00  ? 101 ASN A C    1  
ATOM   1545  O  O    . ASN A 1 101 ? 19.326  55.002 -3.374  1.00 0.00  ? 101 ASN A O    1  
ATOM   1546  C  CB   . ASN A 1 101 ? 19.544  55.154 -6.306  1.00 0.00  ? 101 ASN A CB   1  
ATOM   1547  C  CG   . ASN A 1 101 ? 18.085  54.829 -5.982  1.00 0.00  ? 101 ASN A CG   1  
ATOM   1548  O  OD1  . ASN A 1 101 ? 17.790  54.275 -4.945  1.00 0.00  ? 101 ASN A OD1  1  
ATOM   1549  N  ND2  . ASN A 1 101 ? 17.151  55.157 -6.834  1.00 0.00  ? 101 ASN A ND2  1  
ATOM   1550  H  H    . ASN A 1 101 ? 19.479  52.570 -6.130  1.00 0.00  ? 101 ASN A H    1  
ATOM   1551  H  HA   . ASN A 1 101 ? 21.487  54.451 -5.747  1.00 0.00  ? 101 ASN A HA   1  
ATOM   1552  H  HB2  . ASN A 1 101 ? 19.720  56.209 -6.152  1.00 0.00  ? 101 ASN A HB2  1  
ATOM   1553  H  HB3  . ASN A 1 101 ? 19.746  54.903 -7.336  1.00 0.00  ? 101 ASN A HB3  1  
ATOM   1554  H  HD21 . ASN A 1 101 ? 17.388  55.607 -7.671  1.00 0.00  ? 101 ASN A HD21 1  
ATOM   1555  H  HD22 . ASN A 1 101 ? 16.214  54.952 -6.635  1.00 0.00  ? 101 ASN A HD22 1  
ATOM   1556  N  N    . VAL A 1 102 ? 21.508  55.268 -3.402  1.00 0.00  ? 102 VAL A N    1  
ATOM   1557  C  CA   . VAL A 1 102 ? 21.534  55.840 -2.018  1.00 0.00  ? 102 VAL A CA   1  
ATOM   1558  C  C    . VAL A 1 102 ? 21.357  57.375 -2.163  1.00 0.00  ? 102 VAL A C    1  
ATOM   1559  O  O    . VAL A 1 102 ? 21.758  57.932 -3.167  1.00 0.00  ? 102 VAL A O    1  
ATOM   1560  C  CB   . VAL A 1 102 ? 22.918  55.448 -1.394  1.00 0.00  ? 102 VAL A CB   1  
ATOM   1561  C  CG1  . VAL A 1 102 ? 23.685  56.656 -0.834  1.00 0.00  ? 102 VAL A CG1  1  
ATOM   1562  C  CG2  . VAL A 1 102 ? 22.739  54.404 -0.279  1.00 0.00  ? 102 VAL A CG2  1  
ATOM   1563  H  H    . VAL A 1 102 ? 22.350  55.185 -3.904  1.00 0.00  ? 102 VAL A H    1  
ATOM   1564  H  HA   . VAL A 1 102 ? 20.719  55.424 -1.433  1.00 0.00  ? 102 VAL A HA   1  
ATOM   1565  H  HB   . VAL A 1 102 ? 23.521  55.006 -2.173  1.00 0.00  ? 102 VAL A HB   1  
ATOM   1566  H  HG11 . VAL A 1 102 ? 24.619  56.319 -0.411  1.00 0.00  ? 102 VAL A HG11 1  
ATOM   1567  H  HG12 . VAL A 1 102 ? 23.104  57.139 -0.070  1.00 0.00  ? 102 VAL A HG12 1  
ATOM   1568  H  HG13 . VAL A 1 102 ? 23.888  57.353 -1.630  1.00 0.00  ? 102 VAL A HG13 1  
ATOM   1569  H  HG21 . VAL A 1 102 ? 21.951  54.709 0.389   1.00 0.00  ? 102 VAL A HG21 1  
ATOM   1570  H  HG22 . VAL A 1 102 ? 23.661  54.308 0.275   1.00 0.00  ? 102 VAL A HG22 1  
ATOM   1571  H  HG23 . VAL A 1 102 ? 22.489  53.452 -0.721  1.00 0.00  ? 102 VAL A HG23 1  
ATOM   1572  N  N    . PRO A 1 103 ? 20.756  58.030 -1.189  1.00 0.00  ? 103 PRO A N    1  
ATOM   1573  C  CA   . PRO A 1 103 ? 20.559  59.490 -1.273  1.00 0.00  ? 103 PRO A CA   1  
ATOM   1574  C  C    . PRO A 1 103 ? 21.871  60.194 -1.668  1.00 0.00  ? 103 PRO A C    1  
ATOM   1575  O  O    . PRO A 1 103 ? 21.859  61.195 -2.356  1.00 0.00  ? 103 PRO A O    1  
ATOM   1576  C  CB   . PRO A 1 103 ? 20.082  59.905 0.139   1.00 0.00  ? 103 PRO A CB   1  
ATOM   1577  C  CG   . PRO A 1 103 ? 19.847  58.598 0.954   1.00 0.00  ? 103 PRO A CG   1  
ATOM   1578  C  CD   . PRO A 1 103 ? 20.222  57.407 0.043   1.00 0.00  ? 103 PRO A CD   1  
ATOM   1579  H  HA   . PRO A 1 103 ? 19.792  59.714 -1.998  1.00 0.00  ? 103 PRO A HA   1  
ATOM   1580  H  HB2  . PRO A 1 103 ? 20.835  60.516 0.625   1.00 0.00  ? 103 PRO A HB2  1  
ATOM   1581  H  HB3  . PRO A 1 103 ? 19.156  60.461 0.070   1.00 0.00  ? 103 PRO A HB3  1  
ATOM   1582  H  HG2  . PRO A 1 103 ? 20.472  58.600 1.840   1.00 0.00  ? 103 PRO A HG2  1  
ATOM   1583  H  HG3  . PRO A 1 103 ? 18.808  58.522 1.245   1.00 0.00  ? 103 PRO A HG3  1  
ATOM   1584  H  HD2  . PRO A 1 103 ? 20.963  56.788 0.516   1.00 0.00  ? 103 PRO A HD2  1  
ATOM   1585  H  HD3  . PRO A 1 103 ? 19.344  56.823 -0.193  1.00 0.00  ? 103 PRO A HD3  1  
ATOM   1586  N  N    . LEU A 1 104 ? 22.998  59.690 -1.236  1.00 29.14 ? 104 LEU A N    1  
ATOM   1587  C  CA   . LEU A 1 104 ? 24.290  60.354 -1.593  1.00 27.06 ? 104 LEU A CA   1  
ATOM   1588  C  C    . LEU A 1 104 ? 24.545  60.227 -3.098  1.00 26.37 ? 104 LEU A C    1  
ATOM   1589  O  O    . LEU A 1 104 ? 24.946  61.172 -3.746  1.00 28.34 ? 104 LEU A O    1  
ATOM   1590  C  CB   . LEU A 1 104 ? 25.447  59.710 -0.814  1.00 25.36 ? 104 LEU A CB   1  
ATOM   1591  C  CG   . LEU A 1 104 ? 26.675  60.639 -0.834  1.00 26.22 ? 104 LEU A CG   1  
ATOM   1592  C  CD1  . LEU A 1 104 ? 26.364  61.961 -0.122  1.00 35.25 ? 104 LEU A CD1  1  
ATOM   1593  C  CD2  . LEU A 1 104 ? 27.852  59.947 -0.140  1.00 24.97 ? 104 LEU A CD2  1  
ATOM   1594  H  H    . LEU A 1 104 ? 22.995  58.891 -0.675  1.00 0.00  ? 104 LEU A H    1  
ATOM   1595  H  HA   . LEU A 1 104 ? 24.218  61.397 -1.339  1.00 0.00  ? 104 LEU A HA   1  
ATOM   1596  H  HB2  . LEU A 1 104 ? 25.141  59.542 0.208   1.00 0.00  ? 104 LEU A HB2  1  
ATOM   1597  H  HB3  . LEU A 1 104 ? 25.708  58.768 -1.270  1.00 0.00  ? 104 LEU A HB3  1  
ATOM   1598  H  HG   . LEU A 1 104 ? 26.939  60.856 -1.855  1.00 0.00  ? 104 LEU A HG   1  
ATOM   1599  H  HD11 . LEU A 1 104 ? 25.537  61.831 0.560   1.00 0.00  ? 104 LEU A HD11 1  
ATOM   1600  H  HD12 . LEU A 1 104 ? 26.102  62.698 -0.864  1.00 0.00  ? 104 LEU A HD12 1  
ATOM   1601  H  HD13 . LEU A 1 104 ? 27.230  62.305 0.427   1.00 0.00  ? 104 LEU A HD13 1  
ATOM   1602  H  HD21 . LEU A 1 104 ? 27.510  59.496 0.779   1.00 0.00  ? 104 LEU A HD21 1  
ATOM   1603  H  HD22 . LEU A 1 104 ? 28.615  60.682 0.081   1.00 0.00  ? 104 LEU A HD22 1  
ATOM   1604  H  HD23 . LEU A 1 104 ? 28.258  59.187 -0.789  1.00 0.00  ? 104 LEU A HD23 1  
ATOM   1605  N  N    . HIS A 1 105 ? 24.304  59.077 -3.665  1.00 24.64 ? 105 HIS A N    1  
ATOM   1606  C  CA   . HIS A 1 105 ? 24.518  58.913 -5.130  1.00 27.54 ? 105 HIS A CA   1  
ATOM   1607  C  C    . HIS A 1 105 ? 23.797  60.048 -5.855  1.00 26.02 ? 105 HIS A C    1  
ATOM   1608  O  O    . HIS A 1 105 ? 24.330  60.676 -6.748  1.00 25.72 ? 105 HIS A O    1  
ATOM   1609  C  CB   . HIS A 1 105 ? 23.939  57.561 -5.594  1.00 30.63 ? 105 HIS A CB   1  
ATOM   1610  C  CG   . HIS A 1 105 ? 24.934  56.451 -5.371  1.00 44.65 ? 105 HIS A CG   1  
ATOM   1611  N  ND1  . HIS A 1 105 ? 24.678  55.388 -4.515  1.00 53.08 ? 105 HIS A ND1  1  
ATOM   1612  C  CD2  . HIS A 1 105 ? 26.176  56.210 -5.910  1.00 49.05 ? 105 HIS A CD2  1  
ATOM   1613  C  CE1  . HIS A 1 105 ? 25.744  54.561 -4.567  1.00 56.72 ? 105 HIS A CE1  1  
ATOM   1614  N  NE2  . HIS A 1 105 ? 26.684  55.017 -5.403  1.00 50.00 ? 105 HIS A NE2  1  
ATOM   1615  H  H    . HIS A 1 105 ? 23.971  58.327 -3.132  1.00 0.00  ? 105 HIS A H    1  
ATOM   1616  H  HA   . HIS A 1 105 ? 25.564  58.960 -5.349  1.00 0.00  ? 105 HIS A HA   1  
ATOM   1617  H  HB2  . HIS A 1 105 ? 23.041  57.347 -5.036  1.00 0.00  ? 105 HIS A HB2  1  
ATOM   1618  H  HB3  . HIS A 1 105 ? 23.698  57.612 -6.647  1.00 0.00  ? 105 HIS A HB3  1  
ATOM   1619  H  HD2  . HIS A 1 105 ? 26.680  56.849 -6.621  1.00 0.00  ? 105 HIS A HD2  1  
ATOM   1620  H  HE1  . HIS A 1 105 ? 25.828  53.645 -4.002  1.00 0.00  ? 105 HIS A HE1  1  
ATOM   1621  H  HE2  . HIS A 1 105 ? 27.540  54.590 -5.616  1.00 0.00  ? 105 HIS A HE2  1  
ATOM   1622  N  N    . TYR A 1 106 ? 22.588  60.312 -5.464  1.00 0.00  ? 106 TYR A N    1  
ATOM   1623  C  CA   . TYR A 1 106 ? 21.806  61.407 -6.118  1.00 0.00  ? 106 TYR A CA   1  
ATOM   1624  C  C    . TYR A 1 106 ? 22.316  62.772 -5.631  1.00 0.00  ? 106 TYR A C    1  
ATOM   1625  O  O    . TYR A 1 106 ? 22.421  63.717 -6.392  1.00 0.00  ? 106 TYR A O    1  
ATOM   1626  C  CB   . TYR A 1 106 ? 20.312  61.253 -5.756  1.00 0.00  ? 106 TYR A CB   1  
ATOM   1627  C  CG   . TYR A 1 106 ? 19.608  60.378 -6.776  1.00 0.00  ? 106 TYR A CG   1  
ATOM   1628  C  CD1  . TYR A 1 106 ? 19.527  60.793 -8.111  1.00 0.00  ? 106 TYR A CD1  1  
ATOM   1629  C  CD2  . TYR A 1 106 ? 19.029  59.162 -6.387  1.00 0.00  ? 106 TYR A CD2  1  
ATOM   1630  C  CE1  . TYR A 1 106 ? 18.871  59.995 -9.056  1.00 0.00  ? 106 TYR A CE1  1  
ATOM   1631  C  CE2  . TYR A 1 106 ? 18.372  58.365 -7.332  1.00 0.00  ? 106 TYR A CE2  1  
ATOM   1632  C  CZ   . TYR A 1 106 ? 18.294  58.781 -8.666  1.00 0.00  ? 106 TYR A CZ   1  
ATOM   1633  O  OH   . TYR A 1 106 ? 17.647  57.994 -9.597  1.00 0.00  ? 106 TYR A OH   1  
ATOM   1634  H  H    . TYR A 1 106 ? 22.191  59.792 -4.729  1.00 0.00  ? 106 TYR A H    1  
ATOM   1635  H  HA   . TYR A 1 106 ? 21.931  61.343 -7.188  1.00 0.00  ? 106 TYR A HA   1  
ATOM   1636  H  HB2  . TYR A 1 106 ? 20.229  60.802 -4.778  1.00 0.00  ? 106 TYR A HB2  1  
ATOM   1637  H  HB3  . TYR A 1 106 ? 19.836  62.225 -5.738  1.00 0.00  ? 106 TYR A HB3  1  
ATOM   1638  H  HD1  . TYR A 1 106 ? 19.972  61.730 -8.413  1.00 0.00  ? 106 TYR A HD1  1  
ATOM   1639  H  HD2  . TYR A 1 106 ? 19.089  58.840 -5.358  1.00 0.00  ? 106 TYR A HD2  1  
ATOM   1640  H  HE1  . TYR A 1 106 ? 18.811  60.315 -10.085 1.00 0.00  ? 106 TYR A HE1  1  
ATOM   1641  H  HE2  . TYR A 1 106 ? 17.926  57.429 -7.032  1.00 0.00  ? 106 TYR A HE2  1  
ATOM   1642  H  HH   . TYR A 1 106 ? 16.923  58.506 -9.966  1.00 0.00  ? 106 TYR A HH   1  
ATOM   1643  N  N    . ALA A 1 107 ? 22.617  62.887 -4.369  1.00 29.64 ? 107 ALA A N    1  
ATOM   1644  C  CA   . ALA A 1 107 ? 23.103  64.188 -3.830  1.00 30.31 ? 107 ALA A CA   1  
ATOM   1645  C  C    . ALA A 1 107 ? 24.292  64.693 -4.653  1.00 31.78 ? 107 ALA A C    1  
ATOM   1646  O  O    . ALA A 1 107 ? 24.387  65.865 -4.960  1.00 33.04 ? 107 ALA A O    1  
ATOM   1647  C  CB   . ALA A 1 107 ? 23.538  64.005 -2.376  1.00 25.67 ? 107 ALA A CB   1  
ATOM   1648  H  H    . ALA A 1 107 ? 22.514  62.118 -3.770  1.00 0.00  ? 107 ALA A H    1  
ATOM   1649  H  HA   . ALA A 1 107 ? 22.305  64.913 -3.873  1.00 0.00  ? 107 ALA A HA   1  
ATOM   1650  H  HB1  . ALA A 1 107 ? 24.486  63.490 -2.348  1.00 0.00  ? 107 ALA A HB1  1  
ATOM   1651  H  HB2  . ALA A 1 107 ? 22.797  63.424 -1.848  1.00 0.00  ? 107 ALA A HB2  1  
ATOM   1652  H  HB3  . ALA A 1 107 ? 23.640  64.971 -1.907  1.00 0.00  ? 107 ALA A HB3  1  
ATOM   1653  N  N    . CYS A 1 108 ? 25.204  63.827 -5.012  1.00 0.00  ? 108 CYS A N    1  
ATOM   1654  C  CA   . CYS A 1 108 ? 26.382  64.280 -5.810  1.00 0.00  ? 108 CYS A CA   1  
ATOM   1655  C  C    . CYS A 1 108 ? 26.004  64.307 -7.291  1.00 0.00  ? 108 CYS A C    1  
ATOM   1656  O  O    . CYS A 1 108 ? 26.553  65.062 -8.068  1.00 0.00  ? 108 CYS A O    1  
ATOM   1657  C  CB   . CYS A 1 108 ? 27.556  63.323 -5.582  1.00 0.00  ? 108 CYS A CB   1  
ATOM   1658  S  SG   . CYS A 1 108 ? 28.811  63.568 -6.865  1.00 0.00  ? 108 CYS A SG   1  
ATOM   1659  H  H    . CYS A 1 108 ? 25.115  62.883 -4.757  1.00 0.00  ? 108 CYS A H    1  
ATOM   1660  H  HA   . CYS A 1 108 ? 26.667  65.275 -5.497  1.00 0.00  ? 108 CYS A HA   1  
ATOM   1661  H  HB2  . CYS A 1 108 ? 27.994  63.522 -4.614  1.00 0.00  ? 108 CYS A HB2  1  
ATOM   1662  H  HB3  . CYS A 1 108 ? 27.201  62.303 -5.614  1.00 0.00  ? 108 CYS A HB3  1  
ATOM   1663  H  HG   . CYS A 1 108 ? 29.431  64.230 -6.551  1.00 0.00  ? 108 CYS A HG   1  
ATOM   1664  N  N    . PHE A 1 109 ? 25.059  63.500 -7.685  1.00 0.00  ? 109 PHE A N    1  
ATOM   1665  C  CA   . PHE A 1 109 ? 24.639  63.499 -9.111  1.00 0.00  ? 109 PHE A CA   1  
ATOM   1666  C  C    . PHE A 1 109 ? 24.263  64.924 -9.510  1.00 0.00  ? 109 PHE A C    1  
ATOM   1667  O  O    . PHE A 1 109 ? 24.455  65.337 -10.636 1.00 0.00  ? 109 PHE A O    1  
ATOM   1668  C  CB   . PHE A 1 109 ? 23.426  62.584 -9.290  1.00 0.00  ? 109 PHE A CB   1  
ATOM   1669  C  CG   . PHE A 1 109 ? 23.049  62.528 -10.751 1.00 0.00  ? 109 PHE A CG   1  
ATOM   1670  C  CD1  . PHE A 1 109 ? 22.169  63.479 -11.283 1.00 0.00  ? 109 PHE A CD1  1  
ATOM   1671  C  CD2  . PHE A 1 109 ? 23.578  61.526 -11.574 1.00 0.00  ? 109 PHE A CD2  1  
ATOM   1672  C  CE1  . PHE A 1 109 ? 21.819  63.428 -12.637 1.00 0.00  ? 109 PHE A CE1  1  
ATOM   1673  C  CE2  . PHE A 1 109 ? 23.227  61.475 -12.928 1.00 0.00  ? 109 PHE A CE2  1  
ATOM   1674  C  CZ   . PHE A 1 109 ? 22.348  62.426 -13.460 1.00 0.00  ? 109 PHE A CZ   1  
ATOM   1675  H  H    . PHE A 1 109 ? 24.617  62.908 -7.041  1.00 0.00  ? 109 PHE A H    1  
ATOM   1676  H  HA   . PHE A 1 109 ? 25.453  63.150 -9.730  1.00 0.00  ? 109 PHE A HA   1  
ATOM   1677  H  HB2  . PHE A 1 109 ? 23.668  61.591 -8.941  1.00 0.00  ? 109 PHE A HB2  1  
ATOM   1678  H  HB3  . PHE A 1 109 ? 22.596  62.974 -8.721  1.00 0.00  ? 109 PHE A HB3  1  
ATOM   1679  H  HD1  . PHE A 1 109 ? 21.761  64.252 -10.648 1.00 0.00  ? 109 PHE A HD1  1  
ATOM   1680  H  HD2  . PHE A 1 109 ? 24.256  60.793 -11.163 1.00 0.00  ? 109 PHE A HD2  1  
ATOM   1681  H  HE1  . PHE A 1 109 ? 21.140  64.162 -13.047 1.00 0.00  ? 109 PHE A HE1  1  
ATOM   1682  H  HE2  . PHE A 1 109 ? 23.635  60.703 -13.563 1.00 0.00  ? 109 PHE A HE2  1  
ATOM   1683  H  HZ   . PHE A 1 109 ? 22.077  62.387 -14.505 1.00 0.00  ? 109 PHE A HZ   1  
ATOM   1684  N  N    . TRP A 1 110 ? 23.730  65.686 -8.588  1.00 0.00  ? 110 TRP A N    1  
ATOM   1685  C  CA   . TRP A 1 110 ? 23.344  67.092 -8.905  1.00 0.00  ? 110 TRP A CA   1  
ATOM   1686  C  C    . TRP A 1 110 ? 24.501  68.018 -8.535  1.00 0.00  ? 110 TRP A C    1  
ATOM   1687  O  O    . TRP A 1 110 ? 24.994  68.767 -9.355  1.00 0.00  ? 110 TRP A O    1  
ATOM   1688  C  CB   . TRP A 1 110 ? 22.103  67.476 -8.090  1.00 0.00  ? 110 TRP A CB   1  
ATOM   1689  C  CG   . TRP A 1 110 ? 20.887  66.848 -8.694  1.00 0.00  ? 110 TRP A CG   1  
ATOM   1690  C  CD1  . TRP A 1 110 ? 20.533  65.549 -8.560  1.00 0.00  ? 110 TRP A CD1  1  
ATOM   1691  C  CD2  . TRP A 1 110 ? 19.860  67.468 -9.521  1.00 0.00  ? 110 TRP A CD2  1  
ATOM   1692  N  NE1  . TRP A 1 110 ? 19.355  65.332 -9.252  1.00 0.00  ? 110 TRP A NE1  1  
ATOM   1693  C  CE2  . TRP A 1 110 ? 18.900  66.485 -9.862  1.00 0.00  ? 110 TRP A CE2  1  
ATOM   1694  C  CE3  . TRP A 1 110 ? 19.669  68.775 -10.005 1.00 0.00  ? 110 TRP A CE3  1  
ATOM   1695  C  CZ2  . TRP A 1 110 ? 17.792  66.788 -10.653 1.00 0.00  ? 110 TRP A CZ2  1  
ATOM   1696  C  CZ3  . TRP A 1 110 ? 18.555  69.083 -10.802 1.00 0.00  ? 110 TRP A CZ3  1  
ATOM   1697  C  CH2  . TRP A 1 110 ? 17.618  68.092 -11.125 1.00 0.00  ? 110 TRP A CH2  1  
ATOM   1698  H  H    . TRP A 1 110 ? 23.587  65.335 -7.680  1.00 0.00  ? 110 TRP A H    1  
ATOM   1699  H  HA   . TRP A 1 110 ? 23.128  67.187 -9.961  1.00 0.00  ? 110 TRP A HA   1  
ATOM   1700  H  HB2  . TRP A 1 110 ? 22.219  67.129 -7.074  1.00 0.00  ? 110 TRP A HB2  1  
ATOM   1701  H  HB3  . TRP A 1 110 ? 21.990  68.550 -8.091  1.00 0.00  ? 110 TRP A HB3  1  
ATOM   1702  H  HD1  . TRP A 1 110 ? 21.081  64.803 -8.003  1.00 0.00  ? 110 TRP A HD1  1  
ATOM   1703  H  HE1  . TRP A 1 110 ? 18.885  64.474 -9.314  1.00 0.00  ? 110 TRP A HE1  1  
ATOM   1704  H  HE3  . TRP A 1 110 ? 20.385  69.546 -9.762  1.00 0.00  ? 110 TRP A HE3  1  
ATOM   1705  H  HZ2  . TRP A 1 110 ? 17.073  66.020 -10.899 1.00 0.00  ? 110 TRP A HZ2  1  
ATOM   1706  H  HZ3  . TRP A 1 110 ? 18.419  70.090 -11.168 1.00 0.00  ? 110 TRP A HZ3  1  
ATOM   1707  H  HH2  . TRP A 1 110 ? 16.763  68.335 -11.739 1.00 0.00  ? 110 TRP A HH2  1  
ATOM   1708  N  N    . GLY A 1 111 ? 24.935  67.974 -7.299  1.00 25.81 ? 111 GLY A N    1  
ATOM   1709  C  CA   . GLY A 1 111 ? 26.062  68.852 -6.855  1.00 25.30 ? 111 GLY A CA   1  
ATOM   1710  C  C    . GLY A 1 111 ? 25.711  69.473 -5.503  1.00 24.23 ? 111 GLY A C    1  
ATOM   1711  O  O    . GLY A 1 111 ? 25.474  70.661 -5.404  1.00 32.41 ? 111 GLY A O    1  
ATOM   1712  H  H    . GLY A 1 111 ? 24.516  67.362 -6.659  1.00 0.00  ? 111 GLY A H    1  
ATOM   1713  H  HA2  . GLY A 1 111 ? 26.961  68.260 -6.758  1.00 0.00  ? 111 GLY A HA2  1  
ATOM   1714  H  HA3  . GLY A 1 111 ? 26.226  69.639 -7.575  1.00 0.00  ? 111 GLY A HA3  1  
ATOM   1715  N  N    . GLN A 1 112 ? 25.683  68.682 -4.456  1.00 0.00  ? 112 GLN A N    1  
ATOM   1716  C  CA   . GLN A 1 112 ? 25.355  69.224 -3.096  1.00 0.00  ? 112 GLN A CA   1  
ATOM   1717  C  C    . GLN A 1 112 ? 26.381  68.703 -2.080  1.00 0.00  ? 112 GLN A C    1  
ATOM   1718  O  O    . GLN A 1 112 ? 26.165  67.713 -1.412  1.00 0.00  ? 112 GLN A O    1  
ATOM   1719  C  CB   . GLN A 1 112 ? 23.952  68.760 -2.701  1.00 0.00  ? 112 GLN A CB   1  
ATOM   1720  C  CG   . GLN A 1 112 ? 22.947  69.210 -3.763  1.00 0.00  ? 112 GLN A CG   1  
ATOM   1721  C  CD   . GLN A 1 112 ? 22.915  70.738 -3.825  1.00 0.00  ? 112 GLN A CD   1  
ATOM   1722  O  OE1  . GLN A 1 112 ? 22.910  71.314 -4.895  1.00 0.00  ? 112 GLN A OE1  1  
ATOM   1723  N  NE2  . GLN A 1 112 ? 22.892  71.425 -2.716  1.00 0.00  ? 112 GLN A NE2  1  
ATOM   1724  H  H    . GLN A 1 112 ? 25.897  67.729 -4.554  1.00 0.00  ? 112 GLN A H    1  
ATOM   1725  H  HA   . GLN A 1 112 ? 25.386  70.306 -3.107  1.00 0.00  ? 112 GLN A HA   1  
ATOM   1726  H  HB2  . GLN A 1 112 ? 23.938  67.682 -2.628  1.00 0.00  ? 112 GLN A HB2  1  
ATOM   1727  H  HB3  . GLN A 1 112 ? 23.685  69.192 -1.749  1.00 0.00  ? 112 GLN A HB3  1  
ATOM   1728  H  HG2  . GLN A 1 112 ? 23.240  68.816 -4.725  1.00 0.00  ? 112 GLN A HG2  1  
ATOM   1729  H  HG3  . GLN A 1 112 ? 21.964  68.842 -3.507  1.00 0.00  ? 112 GLN A HG3  1  
ATOM   1730  H  HE21 . GLN A 1 112 ? 22.896  70.961 -1.852  1.00 0.00  ? 112 GLN A HE21 1  
ATOM   1731  H  HE22 . GLN A 1 112 ? 22.871  72.404 -2.746  1.00 0.00  ? 112 GLN A HE22 1  
ATOM   1732  N  N    . ASP A 1 113 ? 27.514  69.343 -1.990  1.00 0.00  ? 113 ASP A N    1  
ATOM   1733  C  CA   . ASP A 1 113 ? 28.575  68.872 -1.054  1.00 0.00  ? 113 ASP A CA   1  
ATOM   1734  C  C    . ASP A 1 113 ? 28.057  68.909 0.380   1.00 0.00  ? 113 ASP A C    1  
ATOM   1735  O  O    . ASP A 1 113 ? 28.128  67.939 1.106   1.00 0.00  ? 113 ASP A O    1  
ATOM   1736  C  CB   . ASP A 1 113 ? 29.799  69.782 -1.174  1.00 0.00  ? 113 ASP A CB   1  
ATOM   1737  C  CG   . ASP A 1 113 ? 29.387  71.231 -0.910  1.00 0.00  ? 113 ASP A CG   1  
ATOM   1738  O  OD1  . ASP A 1 113 ? 28.511  71.714 -1.608  1.00 0.00  ? 113 ASP A OD1  1  
ATOM   1739  O  OD2  . ASP A 1 113 ? 29.955  71.834 -0.014  1.00 0.00  ? 113 ASP A OD2  1  
ATOM   1740  H  H    . ASP A 1 113 ? 27.678  70.106 -2.575  1.00 0.00  ? 113 ASP A H    1  
ATOM   1741  H  HA   . ASP A 1 113 ? 28.854  67.861 -1.309  1.00 0.00  ? 113 ASP A HA   1  
ATOM   1742  H  HB2  . ASP A 1 113 ? 30.543  69.481 -0.451  1.00 0.00  ? 113 ASP A HB2  1  
ATOM   1743  H  HB3  . ASP A 1 113 ? 30.211  69.702 -2.169  1.00 0.00  ? 113 ASP A HB3  1  
ATOM   1744  N  N    . GLN A 1 114 ? 27.557  70.029 0.801   1.00 0.00  ? 114 GLN A N    1  
ATOM   1745  C  CA   . GLN A 1 114 ? 27.053  70.157 2.182   1.00 0.00  ? 114 GLN A CA   1  
ATOM   1746  C  C    . GLN A 1 114 ? 26.146  68.971 2.545   1.00 0.00  ? 114 GLN A C    1  
ATOM   1747  O  O    . GLN A 1 114 ? 26.441  68.200 3.434   1.00 0.00  ? 114 GLN A O    1  
ATOM   1748  C  CB   . GLN A 1 114 ? 26.249  71.447 2.231   1.00 0.00  ? 114 GLN A CB   1  
ATOM   1749  C  CG   . GLN A 1 114 ? 27.152  72.641 1.901   1.00 0.00  ? 114 GLN A CG   1  
ATOM   1750  C  CD   . GLN A 1 114 ? 28.015  72.988 3.117   1.00 0.00  ? 114 GLN A CD   1  
ATOM   1751  O  OE1  . GLN A 1 114 ? 27.946  72.328 4.134   1.00 0.00  ? 114 GLN A OE1  1  
ATOM   1752  N  NE2  . GLN A 1 114 ? 28.831  74.005 3.053   1.00 0.00  ? 114 GLN A NE2  1  
ATOM   1753  H  H    . GLN A 1 114 ? 27.528  70.811 0.218   1.00 0.00  ? 114 GLN A H    1  
ATOM   1754  H  HA   . GLN A 1 114 ? 27.878  70.218 2.873   1.00 0.00  ? 114 GLN A HA   1  
ATOM   1755  H  HB2  . GLN A 1 114 ? 25.446  71.395 1.510   1.00 0.00  ? 114 GLN A HB2  1  
ATOM   1756  H  HB3  . GLN A 1 114 ? 25.842  71.566 3.201   1.00 0.00  ? 114 GLN A HB3  1  
ATOM   1757  H  HG2  . GLN A 1 114 ? 27.790  72.393 1.066   1.00 0.00  ? 114 GLN A HG2  1  
ATOM   1758  H  HG3  . GLN A 1 114 ? 26.539  73.490 1.643   1.00 0.00  ? 114 GLN A HG3  1  
ATOM   1759  H  HE21 . GLN A 1 114 ? 28.887  74.538 2.232   1.00 0.00  ? 114 GLN A HE21 1  
ATOM   1760  H  HE22 . GLN A 1 114 ? 29.388  74.235 3.826   1.00 0.00  ? 114 GLN A HE22 1  
ATOM   1761  N  N    . VAL A 1 115 ? 25.025  68.859 1.893   1.00 0.00  ? 115 VAL A N    1  
ATOM   1762  C  CA   . VAL A 1 115 ? 24.079  67.749 2.232   1.00 0.00  ? 115 VAL A CA   1  
ATOM   1763  C  C    . VAL A 1 115 ? 24.786  66.393 2.108   1.00 0.00  ? 115 VAL A C    1  
ATOM   1764  O  O    . VAL A 1 115 ? 24.527  65.475 2.862   1.00 0.00  ? 115 VAL A O    1  
ATOM   1765  C  CB   . VAL A 1 115 ? 22.838  67.797 1.323   1.00 0.00  ? 115 VAL A CB   1  
ATOM   1766  C  CG1  . VAL A 1 115 ? 22.424  69.252 1.100   1.00 0.00  ? 115 VAL A CG1  1  
ATOM   1767  C  CG2  . VAL A 1 115 ? 23.136  67.133 -0.029  1.00 0.00  ? 115 VAL A CG2  1  
ATOM   1768  H  H    . VAL A 1 115 ? 24.808  69.549 1.232   1.00 0.00  ? 115 VAL A H    1  
ATOM   1769  H  HA   . VAL A 1 115 ? 23.770  67.872 3.250   1.00 0.00  ? 115 VAL A HA   1  
ATOM   1770  H  HB   . VAL A 1 115 ? 22.026  67.271 1.807   1.00 0.00  ? 115 VAL A HB   1  
ATOM   1771  H  HG11 . VAL A 1 115 ? 21.453  69.279 0.629   1.00 0.00  ? 115 VAL A HG11 1  
ATOM   1772  H  HG12 . VAL A 1 115 ? 23.148  69.740 0.464   1.00 0.00  ? 115 VAL A HG12 1  
ATOM   1773  H  HG13 . VAL A 1 115 ? 22.377  69.763 2.051   1.00 0.00  ? 115 VAL A HG13 1  
ATOM   1774  H  HG21 . VAL A 1 115 ? 23.053  66.061 0.075   1.00 0.00  ? 115 VAL A HG21 1  
ATOM   1775  H  HG22 . VAL A 1 115 ? 24.135  67.385 -0.338  1.00 0.00  ? 115 VAL A HG22 1  
ATOM   1776  H  HG23 . VAL A 1 115 ? 22.429  67.476 -0.771  1.00 0.00  ? 115 VAL A HG23 1  
ATOM   1777  N  N    . ALA A 1 116 ? 25.666  66.260 1.162   1.00 0.00  ? 116 ALA A N    1  
ATOM   1778  C  CA   . ALA A 1 116 ? 26.383  64.972 0.976   1.00 0.00  ? 116 ALA A CA   1  
ATOM   1779  C  C    . ALA A 1 116 ? 27.177  64.641 2.237   1.00 0.00  ? 116 ALA A C    1  
ATOM   1780  O  O    . ALA A 1 116 ? 27.321  63.496 2.621   1.00 0.00  ? 116 ALA A O    1  
ATOM   1781  C  CB   . ALA A 1 116 ? 27.325  65.089 -0.231  1.00 0.00  ? 116 ALA A CB   1  
ATOM   1782  H  H    . ALA A 1 116 ? 25.852  67.003 0.567   1.00 0.00  ? 116 ALA A H    1  
ATOM   1783  H  HA   . ALA A 1 116 ? 25.665  64.201 0.802   1.00 0.00  ? 116 ALA A HA   1  
ATOM   1784  H  HB1  . ALA A 1 116 ? 28.118  64.360 -0.152  1.00 0.00  ? 116 ALA A HB1  1  
ATOM   1785  H  HB2  . ALA A 1 116 ? 27.751  66.079 -0.258  1.00 0.00  ? 116 ALA A HB2  1  
ATOM   1786  H  HB3  . ALA A 1 116 ? 26.768  64.916 -1.139  1.00 0.00  ? 116 ALA A HB3  1  
ATOM   1787  N  N    . GLU A 1 117 ? 27.679  65.642 2.884   1.00 35.87 ? 117 GLU A N    1  
ATOM   1788  C  CA   . GLU A 1 117 ? 28.457  65.422 4.131   1.00 39.73 ? 117 GLU A CA   1  
ATOM   1789  C  C    . GLU A 1 117 ? 27.513  64.920 5.225   1.00 39.65 ? 117 GLU A C    1  
ATOM   1790  O  O    . GLU A 1 117 ? 27.746  63.900 5.842   1.00 38.68 ? 117 GLU A O    1  
ATOM   1791  C  CB   . GLU A 1 117 ? 29.092  66.744 4.571   1.00 40.98 ? 117 GLU A CB   1  
ATOM   1792  C  CG   . GLU A 1 117 ? 30.079  66.489 5.715   1.00 45.91 ? 117 GLU A CG   1  
ATOM   1793  C  CD   . GLU A 1 117 ? 31.365  65.878 5.154   1.00 48.33 ? 117 GLU A CD   1  
ATOM   1794  O  OE1  . GLU A 1 117 ? 32.213  66.636 4.712   1.00 42.84 ? 117 GLU A OE1  1  
ATOM   1795  O  OE2  . GLU A 1 117 ? 31.479  64.664 5.177   1.00 49.21 ? 117 GLU A OE2  1  
ATOM   1796  H  H    . GLU A 1 117 ? 27.532  66.548 2.551   1.00 0.00  ? 117 GLU A H    1  
ATOM   1797  H  HA   . GLU A 1 117 ? 29.231  64.691 3.952   1.00 0.00  ? 117 GLU A HA   1  
ATOM   1798  H  HB2  . GLU A 1 117 ? 29.614  67.187 3.735   1.00 0.00  ? 117 GLU A HB2  1  
ATOM   1799  H  HB3  . GLU A 1 117 ? 28.319  67.417 4.910   1.00 0.00  ? 117 GLU A HB3  1  
ATOM   1800  H  HG2  . GLU A 1 117 ? 30.308  67.425 6.205   1.00 0.00  ? 117 GLU A HG2  1  
ATOM   1801  H  HG3  . GLU A 1 117 ? 29.641  65.808 6.428   1.00 0.00  ? 117 GLU A HG3  1  
ATOM   1802  N  N    . ASP A 1 118 ? 26.450  65.636 5.471   1.00 0.00  ? 118 ASP A N    1  
ATOM   1803  C  CA   . ASP A 1 118 ? 25.487  65.215 6.529   1.00 0.00  ? 118 ASP A CA   1  
ATOM   1804  C  C    . ASP A 1 118 ? 25.031  63.773 6.285   1.00 0.00  ? 118 ASP A C    1  
ATOM   1805  O  O    . ASP A 1 118 ? 24.649  63.073 7.201   1.00 0.00  ? 118 ASP A O    1  
ATOM   1806  C  CB   . ASP A 1 118 ? 24.271  66.143 6.510   1.00 0.00  ? 118 ASP A CB   1  
ATOM   1807  C  CG   . ASP A 1 118 ? 23.417  65.890 7.754   1.00 0.00  ? 118 ASP A CG   1  
ATOM   1808  O  OD1  . ASP A 1 118 ? 22.900  64.792 7.880   1.00 0.00  ? 118 ASP A OD1  1  
ATOM   1809  O  OD2  . ASP A 1 118 ? 23.295  66.797 8.559   1.00 0.00  ? 118 ASP A OD2  1  
ATOM   1810  H  H    . ASP A 1 118 ? 26.288  66.460 4.962   1.00 0.00  ? 118 ASP A H    1  
ATOM   1811  H  HA   . ASP A 1 118 ? 25.969  65.278 7.493   1.00 0.00  ? 118 ASP A HA   1  
ATOM   1812  H  HB2  . ASP A 1 118 ? 24.603  67.171 6.503   1.00 0.00  ? 118 ASP A HB2  1  
ATOM   1813  H  HB3  . ASP A 1 118 ? 23.683  65.948 5.626   1.00 0.00  ? 118 ASP A HB3  1  
ATOM   1814  N  N    . LEU A 1 119 ? 25.062  63.322 5.062   1.00 35.74 ? 119 LEU A N    1  
ATOM   1815  C  CA   . LEU A 1 119 ? 24.626  61.924 4.778   1.00 32.73 ? 119 LEU A CA   1  
ATOM   1816  C  C    . LEU A 1 119 ? 25.697  60.954 5.294   1.00 33.43 ? 119 LEU A C    1  
ATOM   1817  O  O    . LEU A 1 119 ? 25.439  60.128 6.147   1.00 35.67 ? 119 LEU A O    1  
ATOM   1818  C  CB   . LEU A 1 119 ? 24.434  61.757 3.256   1.00 28.12 ? 119 LEU A CB   1  
ATOM   1819  C  CG   . LEU A 1 119 ? 22.967  62.046 2.864   1.00 28.79 ? 119 LEU A CG   1  
ATOM   1820  C  CD1  . LEU A 1 119 ? 22.891  62.482 1.397   1.00 27.73 ? 119 LEU A CD1  1  
ATOM   1821  C  CD2  . LEU A 1 119 ? 22.119  60.781 3.049   1.00 19.25 ? 119 LEU A CD2  1  
ATOM   1822  H  H    . LEU A 1 119 ? 25.370  63.900 4.332   1.00 0.00  ? 119 LEU A H    1  
ATOM   1823  H  HA   . LEU A 1 119 ? 23.696  61.730 5.292   1.00 0.00  ? 119 LEU A HA   1  
ATOM   1824  H  HB2  . LEU A 1 119 ? 25.086  62.452 2.749   1.00 0.00  ? 119 LEU A HB2  1  
ATOM   1825  H  HB3  . LEU A 1 119 ? 24.692  60.748 2.960   1.00 0.00  ? 119 LEU A HB3  1  
ATOM   1826  H  HG   . LEU A 1 119 ? 22.575  62.836 3.489   1.00 0.00  ? 119 LEU A HG   1  
ATOM   1827  H  HD11 . LEU A 1 119 ? 21.873  62.748 1.154   1.00 0.00  ? 119 LEU A HD11 1  
ATOM   1828  H  HD12 . LEU A 1 119 ? 23.210  61.668 0.763   1.00 0.00  ? 119 LEU A HD12 1  
ATOM   1829  H  HD13 . LEU A 1 119 ? 23.533  63.335 1.239   1.00 0.00  ? 119 LEU A HD13 1  
ATOM   1830  H  HD21 . LEU A 1 119 ? 22.262  60.391 4.045   1.00 0.00  ? 119 LEU A HD21 1  
ATOM   1831  H  HD22 . LEU A 1 119 ? 22.420  60.038 2.325   1.00 0.00  ? 119 LEU A HD22 1  
ATOM   1832  H  HD23 . LEU A 1 119 ? 21.077  61.023 2.902   1.00 0.00  ? 119 LEU A HD23 1  
ATOM   1833  N  N    . VAL A 1 120 ? 26.898  61.056 4.794   1.00 31.62 ? 120 VAL A N    1  
ATOM   1834  C  CA   . VAL A 1 120 ? 27.981  60.150 5.269   1.00 34.22 ? 120 VAL A CA   1  
ATOM   1835  C  C    . VAL A 1 120 ? 28.311  60.502 6.720   1.00 36.23 ? 120 VAL A C    1  
ATOM   1836  O  O    . VAL A 1 120 ? 29.058  59.813 7.387   1.00 37.37 ? 120 VAL A O    1  
ATOM   1837  C  CB   . VAL A 1 120 ? 29.226  60.336 4.397   1.00 31.31 ? 120 VAL A CB   1  
ATOM   1838  C  CG1  . VAL A 1 120 ? 29.678  61.794 4.462   1.00 19.57 ? 120 VAL A CG1  1  
ATOM   1839  C  CG2  . VAL A 1 120 ? 30.351  59.427 4.903   1.00 27.86 ? 120 VAL A CG2  1  
ATOM   1840  H  H    . VAL A 1 120 ? 27.089  61.736 4.115   1.00 0.00  ? 120 VAL A H    1  
ATOM   1841  H  HA   . VAL A 1 120 ? 27.649  59.123 5.211   1.00 0.00  ? 120 VAL A HA   1  
ATOM   1842  H  HB   . VAL A 1 120 ? 28.987  60.080 3.374   1.00 0.00  ? 120 VAL A HB   1  
ATOM   1843  H  HG11 . VAL A 1 120 ? 28.822  62.439 4.339   1.00 0.00  ? 120 VAL A HG11 1  
ATOM   1844  H  HG12 . VAL A 1 120 ? 30.391  61.986 3.673   1.00 0.00  ? 120 VAL A HG12 1  
ATOM   1845  H  HG13 . VAL A 1 120 ? 30.140  61.986 5.419   1.00 0.00  ? 120 VAL A HG13 1  
ATOM   1846  H  HG21 . VAL A 1 120 ? 29.952  58.449 5.127   1.00 0.00  ? 120 VAL A HG21 1  
ATOM   1847  H  HG22 . VAL A 1 120 ? 30.786  59.851 5.796   1.00 0.00  ? 120 VAL A HG22 1  
ATOM   1848  H  HG23 . VAL A 1 120 ? 31.112  59.338 4.141   1.00 0.00  ? 120 VAL A HG23 1  
ATOM   1849  N  N    . ALA A 1 121 ? 27.755  61.577 7.212   1.00 0.00  ? 121 ALA A N    1  
ATOM   1850  C  CA   . ALA A 1 121 ? 28.030  61.987 8.618   1.00 0.00  ? 121 ALA A CA   1  
ATOM   1851  C  C    . ALA A 1 121 ? 27.394  60.983 9.576   1.00 0.00  ? 121 ALA A C    1  
ATOM   1852  O  O    . ALA A 1 121 ? 27.584  61.053 10.774  1.00 0.00  ? 121 ALA A O    1  
ATOM   1853  C  CB   . ALA A 1 121 ? 27.448  63.378 8.878   1.00 0.00  ? 121 ALA A CB   1  
ATOM   1854  H  H    . ALA A 1 121 ? 27.155  62.111 6.654   1.00 0.00  ? 121 ALA A H    1  
ATOM   1855  H  HA   . ALA A 1 121 ? 29.098  62.010 8.781   1.00 0.00  ? 121 ALA A HA   1  
ATOM   1856  H  HB1  . ALA A 1 121 ? 27.867  64.082 8.176   1.00 0.00  ? 121 ALA A HB1  1  
ATOM   1857  H  HB2  . ALA A 1 121 ? 27.693  63.687 9.884   1.00 0.00  ? 121 ALA A HB2  1  
ATOM   1858  H  HB3  . ALA A 1 121 ? 26.376  63.348 8.763   1.00 0.00  ? 121 ALA A HB3  1  
ATOM   1859  N  N    . ASN A 1 122 ? 26.665  60.026 9.057   1.00 0.00  ? 122 ASN A N    1  
ATOM   1860  C  CA   . ASN A 1 122 ? 26.045  58.991 9.937   1.00 0.00  ? 122 ASN A CA   1  
ATOM   1861  C  C    . ASN A 1 122 ? 26.905  57.735 9.836   1.00 0.00  ? 122 ASN A C    1  
ATOM   1862  O  O    . ASN A 1 122 ? 27.160  57.051 10.806  1.00 0.00  ? 122 ASN A O    1  
ATOM   1863  C  CB   . ASN A 1 122 ? 24.625  58.681 9.435   1.00 0.00  ? 122 ASN A CB   1  
ATOM   1864  C  CG   . ASN A 1 122 ? 23.823  57.995 10.544  1.00 0.00  ? 122 ASN A CG   1  
ATOM   1865  O  OD1  . ASN A 1 122 ? 24.355  57.195 11.288  1.00 0.00  ? 122 ASN A OD1  1  
ATOM   1866  N  ND2  . ASN A 1 122 ? 22.557  58.275 10.684  1.00 0.00  ? 122 ASN A ND2  1  
ATOM   1867  H  H    . ASN A 1 122 ? 26.553  59.966 8.085   1.00 0.00  ? 122 ASN A H    1  
ATOM   1868  H  HA   . ASN A 1 122 ? 26.010  59.334 10.964  1.00 0.00  ? 122 ASN A HA   1  
ATOM   1869  H  HB2  . ASN A 1 122 ? 24.133  59.599 9.151   1.00 0.00  ? 122 ASN A HB2  1  
ATOM   1870  H  HB3  . ASN A 1 122 ? 24.677  58.027 8.576   1.00 0.00  ? 122 ASN A HB3  1  
ATOM   1871  H  HD21 . ASN A 1 122 ? 22.128  58.920 10.083  1.00 0.00  ? 122 ASN A HD21 1  
ATOM   1872  H  HD22 . ASN A 1 122 ? 22.034  57.841 11.390  1.00 0.00  ? 122 ASN A HD22 1  
ATOM   1873  N  N    . GLY A 1 123 ? 27.340  57.433 8.644   1.00 0.00  ? 123 GLY A N    1  
ATOM   1874  C  CA   . GLY A 1 123 ? 28.180  56.223 8.417   1.00 0.00  ? 123 GLY A CA   1  
ATOM   1875  C  C    . GLY A 1 123 ? 27.875  55.646 7.030   1.00 0.00  ? 123 GLY A C    1  
ATOM   1876  O  O    . GLY A 1 123 ? 28.431  54.641 6.634   1.00 0.00  ? 123 GLY A O    1  
ATOM   1877  H  H    . GLY A 1 123 ? 27.083  57.991 7.883   1.00 0.00  ? 123 GLY A H    1  
ATOM   1878  H  HA2  . GLY A 1 123 ? 29.224  56.496 8.473   1.00 0.00  ? 123 GLY A HA2  1  
ATOM   1879  H  HA3  . GLY A 1 123 ? 27.960  55.478 9.168   1.00 0.00  ? 123 GLY A HA3  1  
ATOM   1880  N  N    . ALA A 1 124 ? 26.989  56.267 6.285   1.00 30.80 ? 124 ALA A N    1  
ATOM   1881  C  CA   . ALA A 1 124 ? 26.646  55.745 4.931   1.00 27.84 ? 124 ALA A CA   1  
ATOM   1882  C  C    . ALA A 1 124 ? 27.928  55.412 4.179   1.00 28.26 ? 124 ALA A C    1  
ATOM   1883  O  O    . ALA A 1 124 ? 27.922  54.680 3.212   1.00 31.12 ? 124 ALA A O    1  
ATOM   1884  C  CB   . ALA A 1 124 ? 25.868  56.811 4.154   1.00 24.33 ? 124 ALA A CB   1  
ATOM   1885  H  H    . ALA A 1 124 ? 26.539  57.069 6.614   1.00 0.00  ? 124 ALA A H    1  
ATOM   1886  H  HA   . ALA A 1 124 ? 26.042  54.855 5.028   1.00 0.00  ? 124 ALA A HA   1  
ATOM   1887  H  HB1  . ALA A 1 124 ? 25.392  56.356 3.298   1.00 0.00  ? 124 ALA A HB1  1  
ATOM   1888  H  HB2  . ALA A 1 124 ? 26.546  57.583 3.821   1.00 0.00  ? 124 ALA A HB2  1  
ATOM   1889  H  HB3  . ALA A 1 124 ? 25.117  57.246 4.794   1.00 0.00  ? 124 ALA A HB3  1  
ATOM   1890  N  N    . LEU A 1 125 ? 29.027  55.949 4.618   1.00 0.00  ? 125 LEU A N    1  
ATOM   1891  C  CA   . LEU A 1 125 ? 30.315  55.669 3.928   1.00 0.00  ? 125 LEU A CA   1  
ATOM   1892  C  C    . LEU A 1 125 ? 30.222  56.199 2.487   1.00 0.00  ? 125 LEU A C    1  
ATOM   1893  O  O    . LEU A 1 125 ? 29.387  55.782 1.713   1.00 0.00  ? 125 LEU A O    1  
ATOM   1894  C  CB   . LEU A 1 125 ? 30.573  54.137 3.935   1.00 0.00  ? 125 LEU A CB   1  
ATOM   1895  C  CG   . LEU A 1 125 ? 31.959  53.793 4.529   1.00 0.00  ? 125 LEU A CG   1  
ATOM   1896  C  CD1  . LEU A 1 125 ? 33.075  54.554 3.785   1.00 0.00  ? 125 LEU A CD1  1  
ATOM   1897  C  CD2  . LEU A 1 125 ? 31.997  54.134 6.034   1.00 0.00  ? 125 LEU A CD2  1  
ATOM   1898  H  H    . LEU A 1 125 ? 29.003  56.540 5.402   1.00 0.00  ? 125 LEU A H    1  
ATOM   1899  H  HA   . LEU A 1 125 ? 31.107  56.187 4.443   1.00 0.00  ? 125 LEU A HA   1  
ATOM   1900  H  HB2  . LEU A 1 125 ? 29.811  53.656 4.529   1.00 0.00  ? 125 LEU A HB2  1  
ATOM   1901  H  HB3  . LEU A 1 125 ? 30.521  53.749 2.927   1.00 0.00  ? 125 LEU A HB3  1  
ATOM   1902  H  HG   . LEU A 1 125 ? 32.128  52.733 4.406   1.00 0.00  ? 125 LEU A HG   1  
ATOM   1903  H  HD11 . LEU A 1 125 ? 33.966  53.944 3.765   1.00 0.00  ? 125 LEU A HD11 1  
ATOM   1904  H  HD12 . LEU A 1 125 ? 33.293  55.485 4.289   1.00 0.00  ? 125 LEU A HD12 1  
ATOM   1905  H  HD13 . LEU A 1 125 ? 32.764  54.759 2.772   1.00 0.00  ? 125 LEU A HD13 1  
ATOM   1906  H  HD21 . LEU A 1 125 ? 32.735  53.513 6.520   1.00 0.00  ? 125 LEU A HD21 1  
ATOM   1907  H  HD22 . LEU A 1 125 ? 31.030  53.951 6.477   1.00 0.00  ? 125 LEU A HD22 1  
ATOM   1908  H  HD23 . LEU A 1 125 ? 32.263  55.172 6.168   1.00 0.00  ? 125 LEU A HD23 1  
ATOM   1909  N  N    . VAL A 1 126 ? 31.071  57.117 2.130   1.00 21.92 ? 126 VAL A N    1  
ATOM   1910  C  CA   . VAL A 1 126 ? 31.037  57.676 0.750   1.00 22.67 ? 126 VAL A CA   1  
ATOM   1911  C  C    . VAL A 1 126 ? 31.656  56.659 -0.214  1.00 19.37 ? 126 VAL A C    1  
ATOM   1912  O  O    . VAL A 1 126 ? 31.459  56.714 -1.412  1.00 18.80 ? 126 VAL A O    1  
ATOM   1913  C  CB   . VAL A 1 126 ? 31.840  58.981 0.723   1.00 22.73 ? 126 VAL A CB   1  
ATOM   1914  C  CG1  . VAL A 1 126 ? 33.218  58.748 1.348   1.00 31.25 ? 126 VAL A CG1  1  
ATOM   1915  C  CG2  . VAL A 1 126 ? 32.010  59.451 -0.722  1.00 14.06 ? 126 VAL A CG2  1  
ATOM   1916  H  H    . VAL A 1 126 ? 31.731  57.442 2.771   1.00 0.00  ? 126 VAL A H    1  
ATOM   1917  H  HA   . VAL A 1 126 ? 30.015  57.872 0.463   1.00 0.00  ? 126 VAL A HA   1  
ATOM   1918  H  HB   . VAL A 1 126 ? 31.313  59.736 1.289   1.00 0.00  ? 126 VAL A HB   1  
ATOM   1919  H  HG11 . VAL A 1 126 ? 33.837  59.618 1.187   1.00 0.00  ? 126 VAL A HG11 1  
ATOM   1920  H  HG12 . VAL A 1 126 ? 33.681  57.888 0.888   1.00 0.00  ? 126 VAL A HG12 1  
ATOM   1921  H  HG13 . VAL A 1 126 ? 33.109  58.575 2.408   1.00 0.00  ? 126 VAL A HG13 1  
ATOM   1922  H  HG21 . VAL A 1 126 ? 31.068  59.365 -1.242  1.00 0.00  ? 126 VAL A HG21 1  
ATOM   1923  H  HG22 . VAL A 1 126 ? 32.748  58.836 -1.211  1.00 0.00  ? 126 VAL A HG22 1  
ATOM   1924  H  HG23 . VAL A 1 126 ? 32.335  60.480 -0.731  1.00 0.00  ? 126 VAL A HG23 1  
ATOM   1925  N  N    . SER A 1 127 ? 32.405  55.731 0.314   1.00 0.00  ? 127 SER A N    1  
ATOM   1926  C  CA   . SER A 1 127 ? 33.055  54.694 -0.544  1.00 0.00  ? 127 SER A CA   1  
ATOM   1927  C  C    . SER A 1 127 ? 32.171  53.443 -0.603  1.00 0.00  ? 127 SER A C    1  
ATOM   1928  O  O    . SER A 1 127 ? 32.656  52.330 -0.650  1.00 0.00  ? 127 SER A O    1  
ATOM   1929  C  CB   . SER A 1 127 ? 34.418  54.330 0.047   1.00 0.00  ? 127 SER A CB   1  
ATOM   1930  O  OG   . SER A 1 127 ? 34.881  53.121 -0.542  1.00 0.00  ? 127 SER A OG   1  
ATOM   1931  H  H    . SER A 1 127 ? 32.536  55.731 1.283   1.00 0.00  ? 127 SER A H    1  
ATOM   1932  H  HA   . SER A 1 127 ? 33.193  55.081 -1.545  1.00 0.00  ? 127 SER A HA   1  
ATOM   1933  H  HB2  . SER A 1 127 ? 35.123  55.117 -0.161  1.00 0.00  ? 127 SER A HB2  1  
ATOM   1934  H  HB3  . SER A 1 127 ? 34.324  54.209 1.117   1.00 0.00  ? 127 SER A HB3  1  
ATOM   1935  H  HG   . SER A 1 127 ? 34.842  53.222 -1.496  1.00 0.00  ? 127 SER A HG   1  
ATOM   1936  N  N    . ILE A 1 128 ? 30.875  53.615 -0.605  1.00 0.00  ? 128 ILE A N    1  
ATOM   1937  C  CA   . ILE A 1 128 ? 29.963  52.430 -0.665  1.00 0.00  ? 128 ILE A CA   1  
ATOM   1938  C  C    . ILE A 1 128 ? 30.261  51.609 -1.930  1.00 0.00  ? 128 ILE A C    1  
ATOM   1939  O  O    . ILE A 1 128 ? 30.492  50.423 -1.846  1.00 0.00  ? 128 ILE A O    1  
ATOM   1940  C  CB   . ILE A 1 128 ? 28.492  52.919 -0.670  1.00 0.00  ? 128 ILE A CB   1  
ATOM   1941  C  CG1  . ILE A 1 128 ? 28.009  53.118 0.776   1.00 0.00  ? 128 ILE A CG1  1  
ATOM   1942  C  CG2  . ILE A 1 128 ? 27.571  51.900 -1.363  1.00 0.00  ? 128 ILE A CG2  1  
ATOM   1943  C  CD1  . ILE A 1 128 ? 26.778  54.029 0.792   1.00 0.00  ? 128 ILE A CD1  1  
ATOM   1944  H  H    . ILE A 1 128 ? 30.498  54.522 -0.567  1.00 0.00  ? 128 ILE A H    1  
ATOM   1945  H  HA   . ILE A 1 128 ? 30.134  51.808 0.202   1.00 0.00  ? 128 ILE A HA   1  
ATOM   1946  H  HB   . ILE A 1 128 ? 28.437  53.861 -1.198  1.00 0.00  ? 128 ILE A HB   1  
ATOM   1947  H  HG12 . ILE A 1 128 ? 27.753  52.160 1.207   1.00 0.00  ? 128 ILE A HG12 1  
ATOM   1948  H  HG13 . ILE A 1 128 ? 28.796  53.569 1.356   1.00 0.00  ? 128 ILE A HG13 1  
ATOM   1949  H  HG21 . ILE A 1 128 ? 27.799  50.907 -1.006  1.00 0.00  ? 128 ILE A HG21 1  
ATOM   1950  H  HG22 . ILE A 1 128 ? 27.724  51.943 -2.431  1.00 0.00  ? 128 ILE A HG22 1  
ATOM   1951  H  HG23 . ILE A 1 128 ? 26.540  52.135 -1.139  1.00 0.00  ? 128 ILE A HG23 1  
ATOM   1952  H  HD11 . ILE A 1 128 ? 27.089  55.057 0.674   1.00 0.00  ? 128 ILE A HD11 1  
ATOM   1953  H  HD12 . ILE A 1 128 ? 26.259  53.916 1.732   1.00 0.00  ? 128 ILE A HD12 1  
ATOM   1954  H  HD13 . ILE A 1 128 ? 26.117  53.758 -0.018  1.00 0.00  ? 128 ILE A HD13 1  
ATOM   1955  N  N    . CYS A 1 129 ? 30.209  52.233 -3.089  1.00 0.00  ? 129 CYS A N    1  
ATOM   1956  C  CA   . CYS A 1 129 ? 30.441  51.525 -4.386  1.00 0.00  ? 129 CYS A CA   1  
ATOM   1957  C  C    . CYS A 1 129 ? 29.088  51.024 -4.868  1.00 0.00  ? 129 CYS A C    1  
ATOM   1958  O  O    . CYS A 1 129 ? 28.567  50.043 -4.376  1.00 0.00  ? 129 CYS A O    1  
ATOM   1959  C  CB   . CYS A 1 129 ? 31.428  50.349 -4.250  1.00 0.00  ? 129 CYS A CB   1  
ATOM   1960  S  SG   . CYS A 1 129 ? 32.801  50.815 -3.163  1.00 0.00  ? 129 CYS A SG   1  
ATOM   1961  H  H    . CYS A 1 129 ? 29.974  53.181 -3.114  1.00 0.00  ? 129 CYS A H    1  
ATOM   1962  H  HA   . CYS A 1 129 ? 30.826  52.236 -5.104  1.00 0.00  ? 129 CYS A HA   1  
ATOM   1963  H  HB2  . CYS A 1 129 ? 30.921  49.485 -3.851  1.00 0.00  ? 129 CYS A HB2  1  
ATOM   1964  H  HB3  . CYS A 1 129 ? 31.819  50.103 -5.226  1.00 0.00  ? 129 CYS A HB3  1  
ATOM   1965  H  HG   . CYS A 1 129 ? 32.576  51.647 -2.741  1.00 0.00  ? 129 CYS A HG   1  
ATOM   1966  N  N    . ASN A 1 130 ? 28.496  51.716 -5.799  1.00 0.00  ? 130 ASN A N    1  
ATOM   1967  C  CA   . ASN A 1 130 ? 27.155  51.307 -6.287  1.00 0.00  ? 130 ASN A CA   1  
ATOM   1968  C  C    . ASN A 1 130 ? 27.203  49.892 -6.864  1.00 0.00  ? 130 ASN A C    1  
ATOM   1969  O  O    . ASN A 1 130 ? 27.789  48.987 -6.305  1.00 0.00  ? 130 ASN A O    1  
ATOM   1970  C  CB   . ASN A 1 130 ? 26.691  52.286 -7.371  1.00 0.00  ? 130 ASN A CB   1  
ATOM   1971  C  CG   . ASN A 1 130 ? 25.184  52.134 -7.589  1.00 0.00  ? 130 ASN A CG   1  
ATOM   1972  O  OD1  . ASN A 1 130 ? 24.579  52.912 -8.300  1.00 0.00  ? 130 ASN A OD1  1  
ATOM   1973  N  ND2  . ASN A 1 130 ? 24.547  51.156 -7.004  1.00 0.00  ? 130 ASN A ND2  1  
ATOM   1974  H  H    . ASN A 1 130 ? 28.925  52.524 -6.163  1.00 0.00  ? 130 ASN A H    1  
ATOM   1975  H  HA   . ASN A 1 130 ? 26.456  51.332 -5.464  1.00 0.00  ? 130 ASN A HA   1  
ATOM   1976  H  HB2  . ASN A 1 130 ? 26.910  53.296 -7.060  1.00 0.00  ? 130 ASN A HB2  1  
ATOM   1977  H  HB3  . ASN A 1 130 ? 27.209  52.074 -8.294  1.00 0.00  ? 130 ASN A HB3  1  
ATOM   1978  H  HD21 . ASN A 1 130 ? 25.034  50.528 -6.430  1.00 0.00  ? 130 ASN A HD21 1  
ATOM   1979  H  HD22 . ASN A 1 130 ? 23.582  51.050 -7.137  1.00 0.00  ? 130 ASN A HD22 1  
ATOM   1980  N  N    . LYS A 1 131 ? 26.577  49.708 -7.983  1.00 0.00  ? 131 LYS A N    1  
ATOM   1981  C  CA   . LYS A 1 131 ? 26.552  48.364 -8.630  1.00 0.00  ? 131 LYS A CA   1  
ATOM   1982  C  C    . LYS A 1 131 ? 27.831  48.168 -9.443  1.00 0.00  ? 131 LYS A C    1  
ATOM   1983  O  O    . LYS A 1 131 ? 28.287  47.060 -9.644  1.00 0.00  ? 131 LYS A O    1  
ATOM   1984  C  CB   . LYS A 1 131 ? 25.338  48.267 -9.556  1.00 0.00  ? 131 LYS A CB   1  
ATOM   1985  C  CG   . LYS A 1 131 ? 24.069  48.099 -8.715  1.00 0.00  ? 131 LYS A CG   1  
ATOM   1986  C  CD   . LYS A 1 131 ? 22.863  47.874 -9.634  1.00 0.00  ? 131 LYS A CD   1  
ATOM   1987  C  CE   . LYS A 1 131 ? 22.723  49.045 -10.616 1.00 0.00  ? 131 LYS A CE   1  
ATOM   1988  N  NZ   . LYS A 1 131 ? 23.570  48.790 -11.816 1.00 0.00  ? 131 LYS A NZ   1  
ATOM   1989  H  H    . LYS A 1 131 ? 26.118  50.463 -8.396  1.00 0.00  ? 131 LYS A H    1  
ATOM   1990  H  HA   . LYS A 1 131 ? 26.487  47.599 -7.872  1.00 0.00  ? 131 LYS A HA   1  
ATOM   1991  H  HB2  . LYS A 1 131 ? 25.267  49.170 -10.145 1.00 0.00  ? 131 LYS A HB2  1  
ATOM   1992  H  HB3  . LYS A 1 131 ? 25.450  47.416 -10.210 1.00 0.00  ? 131 LYS A HB3  1  
ATOM   1993  H  HG2  . LYS A 1 131 ? 24.182  47.248 -8.058  1.00 0.00  ? 131 LYS A HG2  1  
ATOM   1994  H  HG3  . LYS A 1 131 ? 23.907  48.989 -8.126  1.00 0.00  ? 131 LYS A HG3  1  
ATOM   1995  H  HD2  . LYS A 1 131 ? 23.002  46.956 -10.188 1.00 0.00  ? 131 LYS A HD2  1  
ATOM   1996  H  HD3  . LYS A 1 131 ? 21.967  47.799 -9.036  1.00 0.00  ? 131 LYS A HD3  1  
ATOM   1997  H  HE2  . LYS A 1 131 ? 21.691  49.139 -10.921 1.00 0.00  ? 131 LYS A HE2  1  
ATOM   1998  H  HE3  . LYS A 1 131 ? 23.041  49.963 -10.140 1.00 0.00  ? 131 LYS A HE3  1  
ATOM   1999  H  HZ1  . LYS A 1 131 ? 22.962  48.565 -12.628 1.00 0.00  ? 131 LYS A HZ1  1  
ATOM   2000  H  HZ2  . LYS A 1 131 ? 24.206  47.989 -11.625 1.00 0.00  ? 131 LYS A HZ2  1  
ATOM   2001  H  HZ3  . LYS A 1 131 ? 24.132  49.637 -12.030 1.00 0.00  ? 131 LYS A HZ3  1  
ATOM   2002  N  N    . TYR A 1 132 ? 28.415  49.244 -9.902  1.00 0.00  ? 132 TYR A N    1  
ATOM   2003  C  CA   . TYR A 1 132 ? 29.676  49.156 -10.700 1.00 0.00  ? 132 TYR A CA   1  
ATOM   2004  C  C    . TYR A 1 132 ? 30.681  50.150 -10.121 1.00 0.00  ? 132 TYR A C    1  
ATOM   2005  O  O    . TYR A 1 132 ? 31.596  50.591 -10.788 1.00 0.00  ? 132 TYR A O    1  
ATOM   2006  C  CB   . TYR A 1 132 ? 29.382  49.511 -12.162 1.00 0.00  ? 132 TYR A CB   1  
ATOM   2007  C  CG   . TYR A 1 132 ? 30.537  49.077 -13.033 1.00 0.00  ? 132 TYR A CG   1  
ATOM   2008  C  CD1  . TYR A 1 132 ? 30.636  47.744 -13.450 1.00 0.00  ? 132 TYR A CD1  1  
ATOM   2009  C  CD2  . TYR A 1 132 ? 31.509  50.007 -13.423 1.00 0.00  ? 132 TYR A CD2  1  
ATOM   2010  C  CE1  . TYR A 1 132 ? 31.707  47.341 -14.257 1.00 0.00  ? 132 TYR A CE1  1  
ATOM   2011  C  CE2  . TYR A 1 132 ? 32.579  49.603 -14.230 1.00 0.00  ? 132 TYR A CE2  1  
ATOM   2012  C  CZ   . TYR A 1 132 ? 32.678  48.271 -14.647 1.00 0.00  ? 132 TYR A CZ   1  
ATOM   2013  O  OH   . TYR A 1 132 ? 33.733  47.873 -15.443 1.00 0.00  ? 132 TYR A OH   1  
ATOM   2014  H  H    . TYR A 1 132 ? 28.025  50.123 -9.714  1.00 0.00  ? 132 TYR A H    1  
ATOM   2015  H  HA   . TYR A 1 132 ? 30.088  48.156 -10.643 1.00 0.00  ? 132 TYR A HA   1  
ATOM   2016  H  HB2  . TYR A 1 132 ? 28.482  49.005 -12.479 1.00 0.00  ? 132 TYR A HB2  1  
ATOM   2017  H  HB3  . TYR A 1 132 ? 29.245  50.578 -12.253 1.00 0.00  ? 132 TYR A HB3  1  
ATOM   2018  H  HD1  . TYR A 1 132 ? 29.887  47.027 -13.149 1.00 0.00  ? 132 TYR A HD1  1  
ATOM   2019  H  HD2  . TYR A 1 132 ? 31.433  51.035 -13.101 1.00 0.00  ? 132 TYR A HD2  1  
ATOM   2020  H  HE1  . TYR A 1 132 ? 31.783  46.313 -14.579 1.00 0.00  ? 132 TYR A HE1  1  
ATOM   2021  H  HE2  . TYR A 1 132 ? 33.329  50.321 -14.531 1.00 0.00  ? 132 TYR A HE2  1  
ATOM   2022  H  HH   . TYR A 1 132 ? 33.567  48.187 -16.335 1.00 0.00  ? 132 TYR A HH   1  
ATOM   2023  N  N    . GLY A 1 133 ? 30.507  50.507 -8.877  1.00 0.00  ? 133 GLY A N    1  
ATOM   2024  C  CA   . GLY A 1 133 ? 31.435  51.474 -8.233  1.00 0.00  ? 133 GLY A CA   1  
ATOM   2025  C  C    . GLY A 1 133 ? 30.986  52.890 -8.561  1.00 0.00  ? 133 GLY A C    1  
ATOM   2026  O  O    . GLY A 1 133 ? 31.645  53.856 -8.233  1.00 0.00  ? 133 GLY A O    1  
ATOM   2027  H  H    . GLY A 1 133 ? 29.761  50.138 -8.365  1.00 0.00  ? 133 GLY A H    1  
ATOM   2028  H  HA2  . GLY A 1 133 ? 31.420  51.328 -7.165  1.00 0.00  ? 133 GLY A HA2  1  
ATOM   2029  H  HA3  . GLY A 1 133 ? 32.431  51.324 -8.600  1.00 0.00  ? 133 GLY A HA3  1  
ATOM   2030  N  N    . GLU A 1 134 ? 29.863  53.021 -9.203  1.00 0.00  ? 134 GLU A N    1  
ATOM   2031  C  CA   . GLU A 1 134 ? 29.369  54.377 -9.547  1.00 0.00  ? 134 GLU A CA   1  
ATOM   2032  C  C    . GLU A 1 134 ? 29.096  55.138 -8.252  1.00 0.00  ? 134 GLU A C    1  
ATOM   2033  O  O    . GLU A 1 134 ? 27.963  55.261 -7.827  1.00 0.00  ? 134 GLU A O    1  
ATOM   2034  C  CB   . GLU A 1 134 ? 28.077  54.267 -10.363 1.00 0.00  ? 134 GLU A CB   1  
ATOM   2035  C  CG   . GLU A 1 134 ? 28.226  53.163 -11.410 1.00 0.00  ? 134 GLU A CG   1  
ATOM   2036  C  CD   . GLU A 1 134 ? 27.070  53.246 -12.409 1.00 0.00  ? 134 GLU A CD   1  
ATOM   2037  O  OE1  . GLU A 1 134 ? 25.937  53.347 -11.967 1.00 0.00  ? 134 GLU A OE1  1  
ATOM   2038  O  OE2  . GLU A 1 134 ? 27.337  53.208 -13.598 1.00 0.00  ? 134 GLU A OE2  1  
ATOM   2039  H  H    . GLU A 1 134 ? 29.344  52.229 -9.453  1.00 0.00  ? 134 GLU A H    1  
ATOM   2040  H  HA   . GLU A 1 134 ? 30.119  54.894 -10.122 1.00 0.00  ? 134 GLU A HA   1  
ATOM   2041  H  HB2  . GLU A 1 134 ? 27.252  54.030 -9.706  1.00 0.00  ? 134 GLU A HB2  1  
ATOM   2042  H  HB3  . GLU A 1 134 ? 27.883  55.206 -10.859 1.00 0.00  ? 134 GLU A HB3  1  
ATOM   2043  H  HG2  . GLU A 1 134 ? 29.164  53.287 -11.932 1.00 0.00  ? 134 GLU A HG2  1  
ATOM   2044  H  HG3  . GLU A 1 134 ? 28.209  52.201 -10.922 1.00 0.00  ? 134 GLU A HG3  1  
ATOM   2045  N  N    . MET A 1 135 ? 30.123  55.637 -7.607  1.00 0.00  ? 135 MET A N    1  
ATOM   2046  C  CA   . MET A 1 135 ? 29.946  56.381 -6.324  1.00 0.00  ? 135 MET A CA   1  
ATOM   2047  C  C    . MET A 1 135 ? 30.459  57.828 -6.546  1.00 0.00  ? 135 MET A C    1  
ATOM   2048  O  O    . MET A 1 135 ? 31.164  58.069 -7.508  1.00 0.00  ? 135 MET A O    1  
ATOM   2049  C  CB   . MET A 1 135 ? 30.764  55.621 -5.253  1.00 0.00  ? 135 MET A CB   1  
ATOM   2050  C  CG   . MET A 1 135 ? 32.232  56.063 -5.263  1.00 0.00  ? 135 MET A CG   1  
ATOM   2051  S  SD   . MET A 1 135 ? 32.866  56.040 -6.962  1.00 0.00  ? 135 MET A SD   1  
ATOM   2052  C  CE   . MET A 1 135 ? 33.786  54.483 -6.861  1.00 0.00  ? 135 MET A CE   1  
ATOM   2053  H  H    . MET A 1 135 ? 31.038  55.529 -7.937  1.00 0.00  ? 135 MET A H    1  
ATOM   2054  H  HA   . MET A 1 135 ? 28.905  56.397 -6.043  1.00 0.00  ? 135 MET A HA   1  
ATOM   2055  H  HB2  . MET A 1 135 ? 30.344  55.787 -4.279  1.00 0.00  ? 135 MET A HB2  1  
ATOM   2056  H  HB3  . MET A 1 135 ? 30.720  54.564 -5.471  1.00 0.00  ? 135 MET A HB3  1  
ATOM   2057  H  HG2  . MET A 1 135 ? 32.305  57.059 -4.867  1.00 0.00  ? 135 MET A HG2  1  
ATOM   2058  H  HG3  . MET A 1 135 ? 32.813  55.391 -4.649  1.00 0.00  ? 135 MET A HG3  1  
ATOM   2059  H  HE1  . MET A 1 135 ? 34.676  54.630 -6.265  1.00 0.00  ? 135 MET A HE1  1  
ATOM   2060  H  HE2  . MET A 1 135 ? 34.068  54.166 -7.852  1.00 0.00  ? 135 MET A HE2  1  
ATOM   2061  H  HE3  . MET A 1 135 ? 33.162  53.726 -6.407  1.00 0.00  ? 135 MET A HE3  1  
ATOM   2062  N  N    . PRO A 1 136 ? 30.086  58.764 -5.690  1.00 0.00  ? 136 PRO A N    1  
ATOM   2063  C  CA   . PRO A 1 136 ? 30.518  60.171 -5.858  1.00 0.00  ? 136 PRO A CA   1  
ATOM   2064  C  C    . PRO A 1 136 ? 32.041  60.282 -6.044  1.00 0.00  ? 136 PRO A C    1  
ATOM   2065  O  O    . PRO A 1 136 ? 32.518  61.124 -6.774  1.00 0.00  ? 136 PRO A O    1  
ATOM   2066  C  CB   . PRO A 1 136 ? 30.050  60.883 -4.570  1.00 0.00  ? 136 PRO A CB   1  
ATOM   2067  C  CG   . PRO A 1 136 ? 29.095  59.909 -3.828  1.00 0.00  ? 136 PRO A CG   1  
ATOM   2068  C  CD   . PRO A 1 136 ? 29.225  58.526 -4.507  1.00 0.00  ? 136 PRO A CD   1  
ATOM   2069  H  HA   . PRO A 1 136 ? 30.017  60.603 -6.711  1.00 0.00  ? 136 PRO A HA   1  
ATOM   2070  H  HB2  . PRO A 1 136 ? 30.903  61.117 -3.941  1.00 0.00  ? 136 PRO A HB2  1  
ATOM   2071  H  HB3  . PRO A 1 136 ? 29.524  61.792 -4.817  1.00 0.00  ? 136 PRO A HB3  1  
ATOM   2072  H  HG2  . PRO A 1 136 ? 29.374  59.842 -2.783  1.00 0.00  ? 136 PRO A HG2  1  
ATOM   2073  H  HG3  . PRO A 1 136 ? 28.074  60.259 -3.908  1.00 0.00  ? 136 PRO A HG3  1  
ATOM   2074  H  HD2  . PRO A 1 136 ? 29.692  57.832 -3.830  1.00 0.00  ? 136 PRO A HD2  1  
ATOM   2075  H  HD3  . PRO A 1 136 ? 28.256  58.165 -4.812  1.00 0.00  ? 136 PRO A HD3  1  
ATOM   2076  N  N    . VAL A 1 137 ? 32.807  59.452 -5.395  1.00 0.00  ? 137 VAL A N    1  
ATOM   2077  C  CA   . VAL A 1 137 ? 34.291  59.534 -5.547  1.00 0.00  ? 137 VAL A CA   1  
ATOM   2078  C  C    . VAL A 1 137 ? 34.666  59.591 -7.032  1.00 0.00  ? 137 VAL A C    1  
ATOM   2079  O  O    . VAL A 1 137 ? 35.528  60.345 -7.435  1.00 0.00  ? 137 VAL A O    1  
ATOM   2080  C  CB   . VAL A 1 137 ? 34.939  58.300 -4.919  1.00 0.00  ? 137 VAL A CB   1  
ATOM   2081  C  CG1  . VAL A 1 137 ? 36.459  58.412 -5.029  1.00 0.00  ? 137 VAL A CG1  1  
ATOM   2082  C  CG2  . VAL A 1 137 ? 34.542  58.209 -3.445  1.00 0.00  ? 137 VAL A CG2  1  
ATOM   2083  H  H    . VAL A 1 137 ? 32.413  58.778 -4.809  1.00 0.00  ? 137 VAL A H    1  
ATOM   2084  H  HA   . VAL A 1 137 ? 34.655  60.422 -5.051  1.00 0.00  ? 137 VAL A HA   1  
ATOM   2085  H  HB   . VAL A 1 137 ? 34.604  57.416 -5.441  1.00 0.00  ? 137 VAL A HB   1  
ATOM   2086  H  HG11 . VAL A 1 137 ? 36.779  59.362 -4.628  1.00 0.00  ? 137 VAL A HG11 1  
ATOM   2087  H  HG12 . VAL A 1 137 ? 36.751  58.342 -6.067  1.00 0.00  ? 137 VAL A HG12 1  
ATOM   2088  H  HG13 . VAL A 1 137 ? 36.921  57.612 -4.470  1.00 0.00  ? 137 VAL A HG13 1  
ATOM   2089  H  HG21 . VAL A 1 137 ? 33.482  58.378 -3.350  1.00 0.00  ? 137 VAL A HG21 1  
ATOM   2090  H  HG22 . VAL A 1 137 ? 35.079  58.957 -2.880  1.00 0.00  ? 137 VAL A HG22 1  
ATOM   2091  H  HG23 . VAL A 1 137 ? 34.786  57.228 -3.066  1.00 0.00  ? 137 VAL A HG23 1  
ATOM   2092  N  N    . ASP A 1 138 ? 34.025  58.799 -7.845  1.00 0.00  ? 138 ASP A N    1  
ATOM   2093  C  CA   . ASP A 1 138 ? 34.341  58.799 -9.301  1.00 0.00  ? 138 ASP A CA   1  
ATOM   2094  C  C    . ASP A 1 138 ? 33.721  60.039 -9.924  1.00 0.00  ? 138 ASP A C    1  
ATOM   2095  O  O    . ASP A 1 138 ? 34.367  60.793 -10.622 1.00 0.00  ? 138 ASP A O    1  
ATOM   2096  C  CB   . ASP A 1 138 ? 33.754  57.546 -9.956  1.00 0.00  ? 138 ASP A CB   1  
ATOM   2097  C  CG   . ASP A 1 138 ? 34.541  56.315 -9.502  1.00 0.00  ? 138 ASP A CG   1  
ATOM   2098  O  OD1  . ASP A 1 138 ? 35.168  56.389 -8.458  1.00 0.00  ? 138 ASP A OD1  1  
ATOM   2099  O  OD2  . ASP A 1 138 ? 34.503  55.320 -10.206 1.00 0.00  ? 138 ASP A OD2  1  
ATOM   2100  H  H    . ASP A 1 138 ? 33.335  58.207 -7.499  1.00 0.00  ? 138 ASP A H    1  
ATOM   2101  H  HA   . ASP A 1 138 ? 35.411  58.817 -9.441  1.00 0.00  ? 138 ASP A HA   1  
ATOM   2102  H  HB2  . ASP A 1 138 ? 32.719  57.440 -9.666  1.00 0.00  ? 138 ASP A HB2  1  
ATOM   2103  H  HB3  . ASP A 1 138 ? 33.820  57.637 -11.030 1.00 0.00  ? 138 ASP A HB3  1  
ATOM   2104  N  N    . LYS A 1 139 ? 32.464  60.252 -9.676  1.00 0.00  ? 139 LYS A N    1  
ATOM   2105  C  CA   . LYS A 1 139 ? 31.803  61.452 -10.247 1.00 0.00  ? 139 LYS A CA   1  
ATOM   2106  C  C    . LYS A 1 139 ? 32.506  62.690 -9.698  1.00 0.00  ? 139 LYS A C    1  
ATOM   2107  O  O    . LYS A 1 139 ? 32.401  63.768 -10.243 1.00 0.00  ? 139 LYS A O    1  
ATOM   2108  C  CB   . LYS A 1 139 ? 30.327  61.475 -9.847  1.00 0.00  ? 139 LYS A CB   1  
ATOM   2109  C  CG   . LYS A 1 139 ? 29.555  62.492 -10.711 1.00 0.00  ? 139 LYS A CG   1  
ATOM   2110  C  CD   . LYS A 1 139 ? 29.103  61.840 -12.024 1.00 0.00  ? 139 LYS A CD   1  
ATOM   2111  C  CE   . LYS A 1 139 ? 28.254  62.832 -12.821 1.00 0.00  ? 139 LYS A CE   1  
ATOM   2112  N  NZ   . LYS A 1 139 ? 27.874  62.225 -14.128 1.00 0.00  ? 139 LYS A NZ   1  
ATOM   2113  H  H    . LYS A 1 139 ? 31.968  59.610 -9.120  1.00 0.00  ? 139 LYS A H    1  
ATOM   2114  H  HA   . LYS A 1 139 ? 31.892  61.434 -11.322 1.00 0.00  ? 139 LYS A HA   1  
ATOM   2115  H  HB2  . LYS A 1 139 ? 29.913  60.492 -9.986  1.00 0.00  ? 139 LYS A HB2  1  
ATOM   2116  H  HB3  . LYS A 1 139 ? 30.243  61.753 -8.806  1.00 0.00  ? 139 LYS A HB3  1  
ATOM   2117  H  HG2  . LYS A 1 139 ? 28.685  62.833 -10.167 1.00 0.00  ? 139 LYS A HG2  1  
ATOM   2118  H  HG3  . LYS A 1 139 ? 30.189  63.339 -10.932 1.00 0.00  ? 139 LYS A HG3  1  
ATOM   2119  H  HD2  . LYS A 1 139 ? 29.967  61.559 -12.607 1.00 0.00  ? 139 LYS A HD2  1  
ATOM   2120  H  HD3  . LYS A 1 139 ? 28.515  60.961 -11.807 1.00 0.00  ? 139 LYS A HD3  1  
ATOM   2121  H  HE2  . LYS A 1 139 ? 27.361  63.072 -12.262 1.00 0.00  ? 139 LYS A HE2  1  
ATOM   2122  H  HE3  . LYS A 1 139 ? 28.823  63.734 -12.995 1.00 0.00  ? 139 LYS A HE3  1  
ATOM   2123  H  HZ1  . LYS A 1 139 ? 27.294  62.897 -14.668 1.00 0.00  ? 139 LYS A HZ1  1  
ATOM   2124  H  HZ2  . LYS A 1 139 ? 27.330  61.353 -13.959 1.00 0.00  ? 139 LYS A HZ2  1  
ATOM   2125  H  HZ3  . LYS A 1 139 ? 28.732  61.999 -14.668 1.00 0.00  ? 139 LYS A HZ3  1  
ATOM   2126  N  N    . ALA A 1 140 ? 33.238  62.539 -8.622  1.00 16.48 ? 140 ALA A N    1  
ATOM   2127  C  CA   . ALA A 1 140 ? 33.963  63.706 -8.034  1.00 12.13 ? 140 ALA A CA   1  
ATOM   2128  C  C    . ALA A 1 140 ? 35.390  63.706 -8.562  1.00 16.12 ? 140 ALA A C    1  
ATOM   2129  O  O    . ALA A 1 140 ? 36.035  64.730 -8.667  1.00 20.15 ? 140 ALA A O    1  
ATOM   2130  C  CB   . ALA A 1 140 ? 33.983  63.582 -6.510  1.00 8.08  ? 140 ALA A CB   1  
ATOM   2131  H  H    . ALA A 1 140 ? 33.320  61.651 -8.200  1.00 0.00  ? 140 ALA A H    1  
ATOM   2132  H  HA   . ALA A 1 140 ? 33.477  64.622 -8.318  1.00 0.00  ? 140 ALA A HA   1  
ATOM   2133  H  HB1  . ALA A 1 140 ? 34.685  64.292 -6.103  1.00 0.00  ? 140 ALA A HB1  1  
ATOM   2134  H  HB2  . ALA A 1 140 ? 34.282  62.582 -6.233  1.00 0.00  ? 140 ALA A HB2  1  
ATOM   2135  H  HB3  . ALA A 1 140 ? 32.997  63.785 -6.119  1.00 0.00  ? 140 ALA A HB3  1  
ATOM   2136  N  N    . LYS A 1 141 ? 35.873  62.555 -8.906  1.00 0.00  ? 141 LYS A N    1  
ATOM   2137  C  CA   . LYS A 1 141 ? 37.250  62.445 -9.448  1.00 0.00  ? 141 LYS A CA   1  
ATOM   2138  C  C    . LYS A 1 141 ? 37.237  62.835 -10.924 1.00 0.00  ? 141 LYS A C    1  
ATOM   2139  O  O    . LYS A 1 141 ? 38.273  63.037 -11.525 1.00 0.00  ? 141 LYS A O    1  
ATOM   2140  C  CB   . LYS A 1 141 ? 37.749  60.998 -9.305  1.00 0.00  ? 141 LYS A CB   1  
ATOM   2141  C  CG   . LYS A 1 141 ? 39.216  60.874 -9.794  1.00 0.00  ? 141 LYS A CG   1  
ATOM   2142  C  CD   . LYS A 1 141 ? 39.266  60.314 -11.231 1.00 0.00  ? 141 LYS A CD   1  
ATOM   2143  C  CE   . LYS A 1 141 ? 39.181  58.784 -11.200 1.00 0.00  ? 141 LYS A CE   1  
ATOM   2144  N  NZ   . LYS A 1 141 ? 39.120  58.262 -12.595 1.00 0.00  ? 141 LYS A NZ   1  
ATOM   2145  H  H    . LYS A 1 141 ? 35.317  61.756 -8.817  1.00 0.00  ? 141 LYS A H    1  
ATOM   2146  H  HA   . LYS A 1 141 ? 37.907  63.109 -8.905  1.00 0.00  ? 141 LYS A HA   1  
ATOM   2147  H  HB2  . LYS A 1 141 ? 37.691  60.709 -8.264  1.00 0.00  ? 141 LYS A HB2  1  
ATOM   2148  H  HB3  . LYS A 1 141 ? 37.114  60.347 -9.886  1.00 0.00  ? 141 LYS A HB3  1  
ATOM   2149  H  HG2  . LYS A 1 141 ? 39.692  61.846 -9.777  1.00 0.00  ? 141 LYS A HG2  1  
ATOM   2150  H  HG3  . LYS A 1 141 ? 39.759  60.209 -9.136  1.00 0.00  ? 141 LYS A HG3  1  
ATOM   2151  H  HD2  . LYS A 1 141 ? 38.437  60.705 -11.801 1.00 0.00  ? 141 LYS A HD2  1  
ATOM   2152  H  HD3  . LYS A 1 141 ? 40.193  60.610 -11.699 1.00 0.00  ? 141 LYS A HD3  1  
ATOM   2153  H  HE2  . LYS A 1 141 ? 40.054  58.386 -10.705 1.00 0.00  ? 141 LYS A HE2  1  
ATOM   2154  H  HE3  . LYS A 1 141 ? 38.294  58.482 -10.664 1.00 0.00  ? 141 LYS A HE3  1  
ATOM   2155  H  HZ1  . LYS A 1 141 ? 38.216  58.536 -13.029 1.00 0.00  ? 141 LYS A HZ1  1  
ATOM   2156  H  HZ2  . LYS A 1 141 ? 39.198  57.224 -12.579 1.00 0.00  ? 141 LYS A HZ2  1  
ATOM   2157  H  HZ3  . LYS A 1 141 ? 39.903  58.660 -13.150 1.00 0.00  ? 141 LYS A HZ3  1  
ATOM   2158  N  N    . ALA A 1 142 ? 36.077  62.955 -11.524 1.00 0.00  ? 142 ALA A N    1  
ATOM   2159  C  CA   . ALA A 1 142 ? 36.027  63.342 -12.960 1.00 0.00  ? 142 ALA A CA   1  
ATOM   2160  C  C    . ALA A 1 142 ? 36.298  64.850 -13.077 1.00 0.00  ? 142 ALA A C    1  
ATOM   2161  O  O    . ALA A 1 142 ? 37.285  65.231 -13.675 1.00 0.00  ? 142 ALA A O    1  
ATOM   2162  C  CB   . ALA A 1 142 ? 34.657  62.958 -13.559 1.00 0.00  ? 142 ALA A CB   1  
ATOM   2163  H  H    . ALA A 1 142 ? 35.230  62.806 -11.047 1.00 0.00  ? 142 ALA A H    1  
ATOM   2164  H  HA   . ALA A 1 142 ? 36.810  62.811 -13.489 1.00 0.00  ? 142 ALA A HA   1  
ATOM   2165  H  HB1  . ALA A 1 142 ? 33.954  62.777 -12.760 1.00 0.00  ? 142 ALA A HB1  1  
ATOM   2166  H  HB2  . ALA A 1 142 ? 34.758  62.056 -14.148 1.00 0.00  ? 142 ALA A HB2  1  
ATOM   2167  H  HB3  . ALA A 1 142 ? 34.289  63.753 -14.193 1.00 0.00  ? 142 ALA A HB3  1  
ATOM   2168  N  N    . PRO A 1 143 ? 35.459  65.686 -12.484 1.00 0.00  ? 143 PRO A N    1  
ATOM   2169  C  CA   . PRO A 1 143 ? 35.701  67.137 -12.530 1.00 0.00  ? 143 PRO A CA   1  
ATOM   2170  C  C    . PRO A 1 143 ? 37.150  67.390 -12.101 1.00 0.00  ? 143 PRO A C    1  
ATOM   2171  O  O    . PRO A 1 143 ? 37.798  68.308 -12.564 1.00 0.00  ? 143 PRO A O    1  
ATOM   2172  C  CB   . PRO A 1 143 ? 34.683  67.743 -11.534 1.00 0.00  ? 143 PRO A CB   1  
ATOM   2173  C  CG   . PRO A 1 143 ? 33.806  66.573 -10.995 1.00 0.00  ? 143 PRO A CG   1  
ATOM   2174  C  CD   . PRO A 1 143 ? 34.241  65.287 -11.738 1.00 0.00  ? 143 PRO A CD   1  
ATOM   2175  H  HA   . PRO A 1 143 ? 35.529  67.517 -13.526 1.00 0.00  ? 143 PRO A HA   1  
ATOM   2176  H  HB2  . PRO A 1 143 ? 35.201  68.228 -10.714 1.00 0.00  ? 143 PRO A HB2  1  
ATOM   2177  H  HB3  . PRO A 1 143 ? 34.054  68.463 -12.040 1.00 0.00  ? 143 PRO A HB3  1  
ATOM   2178  H  HG2  . PRO A 1 143 ? 33.962  66.457 -9.927  1.00 0.00  ? 143 PRO A HG2  1  
ATOM   2179  H  HG3  . PRO A 1 143 ? 32.760  66.772 -11.188 1.00 0.00  ? 143 PRO A HG3  1  
ATOM   2180  H  HD2  . PRO A 1 143 ? 34.449  64.497 -11.033 1.00 0.00  ? 143 PRO A HD2  1  
ATOM   2181  H  HD3  . PRO A 1 143 ? 33.469  64.984 -12.427 1.00 0.00  ? 143 PRO A HD3  1  
ATOM   2182  N  N    . LEU A 1 144 ? 37.636  66.569 -11.198 1.00 0.00  ? 144 LEU A N    1  
ATOM   2183  C  CA   . LEU A 1 144 ? 39.028  66.698 -10.680 1.00 0.00  ? 144 LEU A CA   1  
ATOM   2184  C  C    . LEU A 1 144 ? 38.996  67.668 -9.508  1.00 0.00  ? 144 LEU A C    1  
ATOM   2185  O  O    . LEU A 1 144 ? 39.882  68.477 -9.326  1.00 0.00  ? 144 LEU A O    1  
ATOM   2186  C  CB   . LEU A 1 144 ? 39.989  67.192 -11.792 1.00 0.00  ? 144 LEU A CB   1  
ATOM   2187  C  CG   . LEU A 1 144 ? 41.412  66.617 -11.614 1.00 0.00  ? 144 LEU A CG   1  
ATOM   2188  C  CD1  . LEU A 1 144 ? 41.978  66.996 -10.240 1.00 0.00  ? 144 LEU A CD1  1  
ATOM   2189  C  CD2  . LEU A 1 144 ? 41.403  65.079 -11.775 1.00 0.00  ? 144 LEU A CD2  1  
ATOM   2190  H  H    . LEU A 1 144 ? 37.054  65.871 -10.832 1.00 0.00  ? 144 LEU A H    1  
ATOM   2191  H  HA   . LEU A 1 144 ? 39.350  65.732 -10.322 1.00 0.00  ? 144 LEU A HA   1  
ATOM   2192  H  HB2  . LEU A 1 144 ? 39.610  66.875 -12.752 1.00 0.00  ? 144 LEU A HB2  1  
ATOM   2193  H  HB3  . LEU A 1 144 ? 40.039  68.272 -11.774 1.00 0.00  ? 144 LEU A HB3  1  
ATOM   2194  H  HG   . LEU A 1 144 ? 42.050  67.043 -12.376 1.00 0.00  ? 144 LEU A HG   1  
ATOM   2195  H  HD11 . LEU A 1 144 ? 42.022  68.071 -10.153 1.00 0.00  ? 144 LEU A HD11 1  
ATOM   2196  H  HD12 . LEU A 1 144 ? 42.973  66.588 -10.139 1.00 0.00  ? 144 LEU A HD12 1  
ATOM   2197  H  HD13 . LEU A 1 144 ? 41.347  66.595 -9.463  1.00 0.00  ? 144 LEU A HD13 1  
ATOM   2198  H  HD21 . LEU A 1 144 ? 42.334  64.766 -12.225 1.00 0.00  ? 144 LEU A HD21 1  
ATOM   2199  H  HD22 . LEU A 1 144 ? 40.583  64.779 -12.412 1.00 0.00  ? 144 LEU A HD22 1  
ATOM   2200  H  HD23 . LEU A 1 144 ? 41.299  64.603 -10.809 1.00 0.00  ? 144 LEU A HD23 1  
ATOM   2201  N  N    . ARG A 1 145 ? 37.976  67.584 -8.697  1.00 0.00  ? 145 ARG A N    1  
ATOM   2202  C  CA   . ARG A 1 145 ? 37.903  68.497 -7.528  1.00 0.00  ? 145 ARG A CA   1  
ATOM   2203  C  C    . ARG A 1 145 ? 39.173  68.280 -6.700  1.00 0.00  ? 145 ARG A C    1  
ATOM   2204  O  O    . ARG A 1 145 ? 39.986  69.168 -6.548  1.00 0.00  ? 145 ARG A O    1  
ATOM   2205  C  CB   . ARG A 1 145 ? 36.639  68.166 -6.692  1.00 0.00  ? 145 ARG A CB   1  
ATOM   2206  C  CG   . ARG A 1 145 ? 35.693  69.377 -6.622  1.00 0.00  ? 145 ARG A CG   1  
ATOM   2207  C  CD   . ARG A 1 145 ? 35.004  69.578 -7.975  1.00 0.00  ? 145 ARG A CD   1  
ATOM   2208  N  NE   . ARG A 1 145 ? 33.896  68.592 -8.119  1.00 0.00  ? 145 ARG A NE   1  
ATOM   2209  C  CZ   . ARG A 1 145 ? 32.983  68.766 -9.036  1.00 0.00  ? 145 ARG A CZ   1  
ATOM   2210  N  NH1  . ARG A 1 145 ? 33.041  69.804 -9.825  1.00 0.00  ? 145 ARG A NH1  1  
ATOM   2211  N  NH2  . ARG A 1 145 ? 32.013  67.902 -9.164  1.00 0.00  ? 145 ARG A NH2  1  
ATOM   2212  H  H    . ARG A 1 145 ? 37.267  66.913 -8.853  1.00 0.00  ? 145 ARG A H    1  
ATOM   2213  H  HA   . ARG A 1 145 ? 37.872  69.519 -7.873  1.00 0.00  ? 145 ARG A HA   1  
ATOM   2214  H  HB2  . ARG A 1 145 ? 36.119  67.340 -7.152  1.00 0.00  ? 145 ARG A HB2  1  
ATOM   2215  H  HB3  . ARG A 1 145 ? 36.923  67.886 -5.686  1.00 0.00  ? 145 ARG A HB3  1  
ATOM   2216  H  HG2  . ARG A 1 145 ? 34.946  69.203 -5.862  1.00 0.00  ? 145 ARG A HG2  1  
ATOM   2217  H  HG3  . ARG A 1 145 ? 36.258  70.263 -6.373  1.00 0.00  ? 145 ARG A HG3  1  
ATOM   2218  H  HD2  . ARG A 1 145 ? 34.603  70.579 -8.028  1.00 0.00  ? 145 ARG A HD2  1  
ATOM   2219  H  HD3  . ARG A 1 145 ? 35.718  69.434 -8.771  1.00 0.00  ? 145 ARG A HD3  1  
ATOM   2220  H  HE   . ARG A 1 145 ? 33.852  67.813 -7.526  1.00 0.00  ? 145 ARG A HE   1  
ATOM   2221  H  HH11 . ARG A 1 145 ? 33.784  70.466 -9.727  1.00 0.00  ? 145 ARG A HH11 1  
ATOM   2222  H  HH12 . ARG A 1 145 ? 32.342  69.937 -10.528 1.00 0.00  ? 145 ARG A HH12 1  
ATOM   2223  H  HH21 . ARG A 1 145 ? 31.969  67.107 -8.559  1.00 0.00  ? 145 ARG A HH21 1  
ATOM   2224  H  HH22 . ARG A 1 145 ? 31.314  68.036 -9.866  1.00 0.00  ? 145 ARG A HH22 1  
ATOM   2225  N  N    . GLU A 1 146 ? 39.317  67.103 -6.149  1.00 0.00  ? 146 GLU A N    1  
ATOM   2226  C  CA   . GLU A 1 146 ? 40.504  66.792 -5.301  1.00 0.00  ? 146 GLU A CA   1  
ATOM   2227  C  C    . GLU A 1 146 ? 40.265  67.402 -3.929  1.00 0.00  ? 146 GLU A C    1  
ATOM   2228  O  O    . GLU A 1 146 ? 40.877  67.043 -2.949  1.00 0.00  ? 146 GLU A O    1  
ATOM   2229  C  CB   . GLU A 1 146 ? 41.785  67.383 -5.933  1.00 0.00  ? 146 GLU A CB   1  
ATOM   2230  C  CG   . GLU A 1 146 ? 43.000  66.539 -5.540  1.00 0.00  ? 146 GLU A CG   1  
ATOM   2231  C  CD   . GLU A 1 146 ? 44.231  67.026 -6.306  1.00 0.00  ? 146 GLU A CD   1  
ATOM   2232  O  OE1  . GLU A 1 146 ? 44.496  68.216 -6.266  1.00 0.00  ? 146 GLU A OE1  1  
ATOM   2233  O  OE2  . GLU A 1 146 ? 44.888  66.200 -6.919  1.00 0.00  ? 146 GLU A OE2  1  
ATOM   2234  H  H    . GLU A 1 146 ? 38.611  66.435 -6.273  1.00 0.00  ? 146 GLU A H    1  
ATOM   2235  H  HA   . GLU A 1 146 ? 40.602  65.725 -5.203  1.00 0.00  ? 146 GLU A HA   1  
ATOM   2236  H  HB2  . GLU A 1 146 ? 41.685  67.384 -7.008  1.00 0.00  ? 146 GLU A HB2  1  
ATOM   2237  H  HB3  . GLU A 1 146 ? 41.935  68.397 -5.588  1.00 0.00  ? 146 GLU A HB3  1  
ATOM   2238  H  HG2  . GLU A 1 146 ? 43.174  66.631 -4.478  1.00 0.00  ? 146 GLU A HG2  1  
ATOM   2239  H  HG3  . GLU A 1 146 ? 42.810  65.508 -5.786  1.00 0.00  ? 146 GLU A HG3  1  
ATOM   2240  N  N    . LEU A 1 147 ? 39.357  68.318 -3.862  1.00 0.00  ? 147 LEU A N    1  
ATOM   2241  C  CA   . LEU A 1 147 ? 39.054  68.972 -2.561  1.00 0.00  ? 147 LEU A CA   1  
ATOM   2242  C  C    . LEU A 1 147 ? 38.283  68.001 -1.672  1.00 0.00  ? 147 LEU A C    1  
ATOM   2243  O  O    . LEU A 1 147 ? 38.713  67.652 -0.589  1.00 0.00  ? 147 LEU A O    1  
ATOM   2244  C  CB   . LEU A 1 147 ? 38.212  70.229 -2.805  1.00 0.00  ? 147 LEU A CB   1  
ATOM   2245  C  CG   . LEU A 1 147 ? 38.778  71.001 -3.999  1.00 0.00  ? 147 LEU A CG   1  
ATOM   2246  C  CD1  . LEU A 1 147 ? 38.004  72.309 -4.173  1.00 0.00  ? 147 LEU A CD1  1  
ATOM   2247  C  CD2  . LEU A 1 147 ? 40.257  71.313 -3.753  1.00 0.00  ? 147 LEU A CD2  1  
ATOM   2248  H  H    . LEU A 1 147 ? 38.866  68.568 -4.673  1.00 0.00  ? 147 LEU A H    1  
ATOM   2249  H  HA   . LEU A 1 147 ? 39.977  69.247 -2.073  1.00 0.00  ? 147 LEU A HA   1  
ATOM   2250  H  HB2  . LEU A 1 147 ? 37.190  69.945 -3.011  1.00 0.00  ? 147 LEU A HB2  1  
ATOM   2251  H  HB3  . LEU A 1 147 ? 38.242  70.857 -1.927  1.00 0.00  ? 147 LEU A HB3  1  
ATOM   2252  H  HG   . LEU A 1 147 ? 38.678  70.402 -4.893  1.00 0.00  ? 147 LEU A HG   1  
ATOM   2253  H  HD11 . LEU A 1 147 ? 38.457  72.893 -4.961  1.00 0.00  ? 147 LEU A HD11 1  
ATOM   2254  H  HD12 . LEU A 1 147 ? 38.030  72.869 -3.250  1.00 0.00  ? 147 LEU A HD12 1  
ATOM   2255  H  HD13 . LEU A 1 147 ? 36.979  72.089 -4.432  1.00 0.00  ? 147 LEU A HD13 1  
ATOM   2256  H  HD21 . LEU A 1 147 ? 40.585  72.076 -4.444  1.00 0.00  ? 147 LEU A HD21 1  
ATOM   2257  H  HD22 . LEU A 1 147 ? 40.844  70.418 -3.903  1.00 0.00  ? 147 LEU A HD22 1  
ATOM   2258  H  HD23 . LEU A 1 147 ? 40.389  71.665 -2.740  1.00 0.00  ? 147 LEU A HD23 1  
ATOM   2259  N  N    . LEU A 1 148 ? 37.147  67.555 -2.124  1.00 25.11 ? 148 LEU A N    1  
ATOM   2260  C  CA   . LEU A 1 148 ? 36.349  66.608 -1.304  1.00 22.71 ? 148 LEU A CA   1  
ATOM   2261  C  C    . LEU A 1 148 ? 37.012  65.225 -1.361  1.00 23.41 ? 148 LEU A C    1  
ATOM   2262  O  O    . LEU A 1 148 ? 36.777  64.386 -0.516  1.00 25.25 ? 148 LEU A O    1  
ATOM   2263  C  CB   . LEU A 1 148 ? 34.875  66.548 -1.801  1.00 23.35 ? 148 LEU A CB   1  
ATOM   2264  C  CG   . LEU A 1 148 ? 34.751  67.080 -3.237  1.00 23.72 ? 148 LEU A CG   1  
ATOM   2265  C  CD1  . LEU A 1 148 ? 35.476  66.142 -4.191  1.00 9.66  ? 148 LEU A CD1  1  
ATOM   2266  C  CD2  . LEU A 1 148 ? 33.277  67.134 -3.636  1.00 17.82 ? 148 LEU A CD2  1  
ATOM   2267  H  H    . LEU A 1 148 ? 36.827  67.840 -3.000  1.00 0.00  ? 148 LEU A H    1  
ATOM   2268  H  HA   . LEU A 1 148 ? 36.362  66.948 -0.276  1.00 0.00  ? 148 LEU A HA   1  
ATOM   2269  H  HB2  . LEU A 1 148 ? 34.520  65.527 -1.771  1.00 0.00  ? 148 LEU A HB2  1  
ATOM   2270  H  HB3  . LEU A 1 148 ? 34.255  67.151 -1.151  1.00 0.00  ? 148 LEU A HB3  1  
ATOM   2271  H  HG   . LEU A 1 148 ? 35.171  68.071 -3.303  1.00 0.00  ? 148 LEU A HG   1  
ATOM   2272  H  HD11 . LEU A 1 148 ? 35.179  65.127 -3.981  1.00 0.00  ? 148 LEU A HD11 1  
ATOM   2273  H  HD12 . LEU A 1 148 ? 36.540  66.244 -4.056  1.00 0.00  ? 148 LEU A HD12 1  
ATOM   2274  H  HD13 . LEU A 1 148 ? 35.213  66.388 -5.209  1.00 0.00  ? 148 LEU A HD13 1  
ATOM   2275  H  HD21 . LEU A 1 148 ? 33.202  67.403 -4.681  1.00 0.00  ? 148 LEU A HD21 1  
ATOM   2276  H  HD22 . LEU A 1 148 ? 32.768  67.873 -3.035  1.00 0.00  ? 148 LEU A HD22 1  
ATOM   2277  H  HD23 . LEU A 1 148 ? 32.826  66.166 -3.480  1.00 0.00  ? 148 LEU A HD23 1  
ATOM   2278  N  N    . ARG A 1 149 ? 37.867  64.986 -2.326  1.00 0.00  ? 149 ARG A N    1  
ATOM   2279  C  CA   . ARG A 1 149 ? 38.547  63.653 -2.380  1.00 0.00  ? 149 ARG A CA   1  
ATOM   2280  C  C    . ARG A 1 149 ? 39.418  63.515 -1.148  1.00 0.00  ? 149 ARG A C    1  
ATOM   2281  O  O    . ARG A 1 149 ? 39.336  62.554 -0.409  1.00 0.00  ? 149 ARG A O    1  
ATOM   2282  C  CB   . ARG A 1 149 ? 39.442  63.552 -3.619  1.00 0.00  ? 149 ARG A CB   1  
ATOM   2283  C  CG   . ARG A 1 149 ? 38.681  64.020 -4.853  1.00 0.00  ? 149 ARG A CG   1  
ATOM   2284  C  CD   . ARG A 1 149 ? 37.421  63.188 -5.029  1.00 0.00  ? 149 ARG A CD   1  
ATOM   2285  N  NE   . ARG A 1 149 ? 37.744  61.727 -4.893  1.00 0.00  ? 149 ARG A NE   1  
ATOM   2286  C  CZ   . ARG A 1 149 ? 38.639  61.147 -5.651  1.00 0.00  ? 149 ARG A CZ   1  
ATOM   2287  N  NH1  . ARG A 1 149 ? 39.145  61.772 -6.678  1.00 0.00  ? 149 ARG A NH1  1  
ATOM   2288  N  NH2  . ARG A 1 149 ? 38.992  59.914 -5.410  1.00 0.00  ? 149 ARG A NH2  1  
ATOM   2289  H  H    . ARG A 1 149 ? 38.079  65.685 -2.993  1.00 0.00  ? 149 ARG A H    1  
ATOM   2290  H  HA   . ARG A 1 149 ? 37.814  62.861 -2.387  1.00 0.00  ? 149 ARG A HA   1  
ATOM   2291  H  HB2  . ARG A 1 149 ? 40.317  64.172 -3.483  1.00 0.00  ? 149 ARG A HB2  1  
ATOM   2292  H  HB3  . ARG A 1 149 ? 39.750  62.527 -3.755  1.00 0.00  ? 149 ARG A HB3  1  
ATOM   2293  H  HG2  . ARG A 1 149 ? 38.412  65.058 -4.732  1.00 0.00  ? 149 ARG A HG2  1  
ATOM   2294  H  HG3  . ARG A 1 149 ? 39.306  63.915 -5.722  1.00 0.00  ? 149 ARG A HG3  1  
ATOM   2295  H  HD2  . ARG A 1 149 ? 36.713  63.438 -4.269  1.00 0.00  ? 149 ARG A HD2  1  
ATOM   2296  H  HD3  . ARG A 1 149 ? 36.993  63.421 -5.988  1.00 0.00  ? 149 ARG A HD3  1  
ATOM   2297  H  HE   . ARG A 1 149 ? 37.312  61.208 -4.183  1.00 0.00  ? 149 ARG A HE   1  
ATOM   2298  H  HH11 . ARG A 1 149 ? 38.847  62.701 -6.895  1.00 0.00  ? 149 ARG A HH11 1  
ATOM   2299  H  HH12 . ARG A 1 149 ? 39.831  61.322 -7.249  1.00 0.00  ? 149 ARG A HH12 1  
ATOM   2300  H  HH21 . ARG A 1 149 ? 38.579  59.416 -4.648  1.00 0.00  ? 149 ARG A HH21 1  
ATOM   2301  H  HH22 . ARG A 1 149 ? 39.675  59.467 -5.987  1.00 0.00  ? 149 ARG A HH22 1  
ATOM   2302  N  N    . GLU A 1 150 ? 40.248  64.480 -0.924  1.00 0.00  ? 150 GLU A N    1  
ATOM   2303  C  CA   . GLU A 1 150 ? 41.135  64.428 0.269   1.00 0.00  ? 150 GLU A CA   1  
ATOM   2304  C  C    . GLU A 1 150 ? 40.274  64.354 1.519   1.00 0.00  ? 150 GLU A C    1  
ATOM   2305  O  O    . GLU A 1 150 ? 40.497  63.539 2.386   1.00 0.00  ? 150 GLU A O    1  
ATOM   2306  C  CB   . GLU A 1 150 ? 42.003  65.683 0.319   1.00 0.00  ? 150 GLU A CB   1  
ATOM   2307  C  CG   . GLU A 1 150 ? 42.836  65.756 -0.956  1.00 0.00  ? 150 GLU A CG   1  
ATOM   2308  C  CD   . GLU A 1 150 ? 43.470  67.142 -1.083  1.00 0.00  ? 150 GLU A CD   1  
ATOM   2309  O  OE1  . GLU A 1 150 ? 42.737  68.115 -1.016  1.00 0.00  ? 150 GLU A OE1  1  
ATOM   2310  O  OE2  . GLU A 1 150 ? 44.677  67.208 -1.245  1.00 0.00  ? 150 GLU A OE2  1  
ATOM   2311  H  H    . GLU A 1 150 ? 40.282  65.250 -1.539  1.00 0.00  ? 150 GLU A H    1  
ATOM   2312  H  HA   . GLU A 1 150 ? 41.767  63.552 0.214   1.00 0.00  ? 150 GLU A HA   1  
ATOM   2313  H  HB2  . GLU A 1 150 ? 41.372  66.556 0.392   1.00 0.00  ? 150 GLU A HB2  1  
ATOM   2314  H  HB3  . GLU A 1 150 ? 42.659  65.636 1.175   1.00 0.00  ? 150 GLU A HB3  1  
ATOM   2315  H  HG2  . GLU A 1 150 ? 43.608  65.005 -0.921  1.00 0.00  ? 150 GLU A HG2  1  
ATOM   2316  H  HG3  . GLU A 1 150 ? 42.201  65.572 -1.804  1.00 0.00  ? 150 GLU A HG3  1  
ATOM   2317  N  N    . ARG A 1 151 ? 39.278  65.186 1.615   1.00 0.00  ? 151 ARG A N    1  
ATOM   2318  C  CA   . ARG A 1 151 ? 38.399  65.137 2.821   1.00 0.00  ? 151 ARG A CA   1  
ATOM   2319  C  C    . ARG A 1 151 ? 37.743  63.761 2.885   1.00 0.00  ? 151 ARG A C    1  
ATOM   2320  O  O    . ARG A 1 151 ? 37.608  63.165 3.936   1.00 0.00  ? 151 ARG A O    1  
ATOM   2321  C  CB   . ARG A 1 151 ? 37.323  66.222 2.727   1.00 0.00  ? 151 ARG A CB   1  
ATOM   2322  C  CG   . ARG A 1 151 ? 37.986  67.601 2.608   1.00 0.00  ? 151 ARG A CG   1  
ATOM   2323  C  CD   . ARG A 1 151 ? 38.793  67.919 3.878   1.00 0.00  ? 151 ARG A CD   1  
ATOM   2324  N  NE   . ARG A 1 151 ? 40.174  67.377 3.737   1.00 0.00  ? 151 ARG A NE   1  
ATOM   2325  C  CZ   . ARG A 1 151 ? 41.118  67.779 4.543   1.00 0.00  ? 151 ARG A CZ   1  
ATOM   2326  N  NH1  . ARG A 1 151 ? 40.853  68.657 5.472   1.00 0.00  ? 151 ARG A NH1  1  
ATOM   2327  N  NH2  . ARG A 1 151 ? 42.327  67.304 4.421   1.00 0.00  ? 151 ARG A NH2  1  
ATOM   2328  H  H    . ARG A 1 151 ? 39.102  65.830 0.888   1.00 0.00  ? 151 ARG A H    1  
ATOM   2329  H  HA   . ARG A 1 151 ? 38.994  65.288 3.709   1.00 0.00  ? 151 ARG A HA   1  
ATOM   2330  H  HB2  . ARG A 1 151 ? 36.708  66.041 1.858   1.00 0.00  ? 151 ARG A HB2  1  
ATOM   2331  H  HB3  . ARG A 1 151 ? 36.708  66.196 3.614   1.00 0.00  ? 151 ARG A HB3  1  
ATOM   2332  H  HG2  . ARG A 1 151 ? 38.648  67.605 1.755   1.00 0.00  ? 151 ARG A HG2  1  
ATOM   2333  H  HG3  . ARG A 1 151 ? 37.222  68.352 2.472   1.00 0.00  ? 151 ARG A HG3  1  
ATOM   2334  H  HD2  . ARG A 1 151 ? 38.843  68.990 4.012   1.00 0.00  ? 151 ARG A HD2  1  
ATOM   2335  H  HD3  . ARG A 1 151 ? 38.317  67.473 4.740   1.00 0.00  ? 151 ARG A HD3  1  
ATOM   2336  H  HE   . ARG A 1 151 ? 40.373  66.718 3.039   1.00 0.00  ? 151 ARG A HE   1  
ATOM   2337  H  HH11 . ARG A 1 151 ? 39.926  69.021 5.565   1.00 0.00  ? 151 ARG A HH11 1  
ATOM   2338  H  HH12 . ARG A 1 151 ? 41.576  68.965 6.089   1.00 0.00  ? 151 ARG A HH12 1  
ATOM   2339  H  HH21 . ARG A 1 151 ? 42.530  66.631 3.709   1.00 0.00  ? 151 ARG A HH21 1  
ATOM   2340  H  HH22 . ARG A 1 151 ? 43.050  67.612 5.038   1.00 0.00  ? 151 ARG A HH22 1  
ATOM   2341  N  N    . ALA A 1 152 ? 37.349  63.251 1.757   1.00 0.00  ? 152 ALA A N    1  
ATOM   2342  C  CA   . ALA A 1 152 ? 36.716  61.906 1.727   1.00 0.00  ? 152 ALA A CA   1  
ATOM   2343  C  C    . ALA A 1 152 ? 37.764  60.858 2.104   1.00 0.00  ? 152 ALA A C    1  
ATOM   2344  O  O    . ALA A 1 152 ? 37.552  60.035 2.972   1.00 0.00  ? 152 ALA A O    1  
ATOM   2345  C  CB   . ALA A 1 152 ? 36.186  61.619 0.322   1.00 0.00  ? 152 ALA A CB   1  
ATOM   2346  H  H    . ALA A 1 152 ? 37.487  63.763 0.933   1.00 0.00  ? 152 ALA A H    1  
ATOM   2347  H  HA   . ALA A 1 152 ? 35.903  61.872 2.436   1.00 0.00  ? 152 ALA A HA   1  
ATOM   2348  H  HB1  . ALA A 1 152 ? 36.952  61.846 -0.405  1.00 0.00  ? 152 ALA A HB1  1  
ATOM   2349  H  HB2  . ALA A 1 152 ? 35.317  62.231 0.133   1.00 0.00  ? 152 ALA A HB2  1  
ATOM   2350  H  HB3  . ALA A 1 152 ? 35.916  60.576 0.246   1.00 0.00  ? 152 ALA A HB3  1  
ATOM   2351  N  N    . GLU A 1 153 ? 38.887  60.871 1.440   1.00 0.00  ? 153 GLU A N    1  
ATOM   2352  C  CA   . GLU A 1 153 ? 39.944  59.864 1.738   1.00 0.00  ? 153 GLU A CA   1  
ATOM   2353  C  C    . GLU A 1 153 ? 40.625  60.171 3.071   1.00 0.00  ? 153 GLU A C    1  
ATOM   2354  O  O    . GLU A 1 153 ? 41.217  59.308 3.685   1.00 0.00  ? 153 GLU A O    1  
ATOM   2355  C  CB   . GLU A 1 153 ? 40.992  59.875 0.624   1.00 0.00  ? 153 GLU A CB   1  
ATOM   2356  C  CG   . GLU A 1 153 ? 40.318  59.656 -0.734  1.00 0.00  ? 153 GLU A CG   1  
ATOM   2357  C  CD   . GLU A 1 153 ? 39.994  58.171 -0.919  1.00 0.00  ? 153 GLU A CD   1  
ATOM   2358  O  OE1  . GLU A 1 153 ? 38.920  57.763 -0.507  1.00 0.00  ? 153 GLU A OE1  1  
ATOM   2359  O  OE2  . GLU A 1 153 ? 40.825  57.467 -1.469  1.00 0.00  ? 153 GLU A OE2  1  
ATOM   2360  H  H    . GLU A 1 153 ? 39.028  61.528 0.727   1.00 0.00  ? 153 GLU A H    1  
ATOM   2361  H  HA   . GLU A 1 153 ? 39.495  58.894 1.794   1.00 0.00  ? 153 GLU A HA   1  
ATOM   2362  H  HB2  . GLU A 1 153 ? 41.502  60.827 0.623   1.00 0.00  ? 153 GLU A HB2  1  
ATOM   2363  H  HB3  . GLU A 1 153 ? 41.707  59.086 0.801   1.00 0.00  ? 153 GLU A HB3  1  
ATOM   2364  H  HG2  . GLU A 1 153 ? 39.406  60.232 -0.787  1.00 0.00  ? 153 GLU A HG2  1  
ATOM   2365  H  HG3  . GLU A 1 153 ? 40.987  59.975 -1.516  1.00 0.00  ? 153 GLU A HG3  1  
ATOM   2366  N  N    . LYS A 1 154 ? 40.548  61.382 3.526   1.00 21.61 ? 154 LYS A N    1  
ATOM   2367  C  CA   . LYS A 1 154 ? 41.203  61.721 4.826   1.00 20.81 ? 154 LYS A CA   1  
ATOM   2368  C  C    . LYS A 1 154 ? 40.348  61.168 5.959   1.00 21.70 ? 154 LYS A C    1  
ATOM   2369  O  O    . LYS A 1 154 ? 40.632  61.365 7.124   1.00 20.17 ? 154 LYS A O    1  
ATOM   2370  C  CB   . LYS A 1 154 ? 41.333  63.247 4.984   1.00 18.21 ? 154 LYS A CB   1  
ATOM   2371  C  CG   . LYS A 1 154 ? 42.474  63.803 4.084   1.00 23.64 ? 154 LYS A CG   1  
ATOM   2372  C  CD   . LYS A 1 154 ? 43.716  64.147 4.924   1.00 23.42 ? 154 LYS A CD   1  
ATOM   2373  C  CE   . LYS A 1 154 ? 44.336  62.869 5.491   1.00 31.30 ? 154 LYS A CE   1  
ATOM   2374  N  NZ   . LYS A 1 154 ? 44.575  61.899 4.385   1.00 37.57 ? 154 LYS A NZ   1  
ATOM   2375  H  H    . LYS A 1 154 ? 40.065  62.062 3.017   1.00 0.00  ? 154 LYS A H    1  
ATOM   2376  H  HA   . LYS A 1 154 ? 42.179  61.266 4.861   1.00 0.00  ? 154 LYS A HA   1  
ATOM   2377  H  HB2  . LYS A 1 154 ? 40.395  63.707 4.706   1.00 0.00  ? 154 LYS A HB2  1  
ATOM   2378  H  HB3  . LYS A 1 154 ? 41.540  63.477 6.020   1.00 0.00  ? 154 LYS A HB3  1  
ATOM   2379  H  HG2  . LYS A 1 154 ? 42.745  63.071 3.336   1.00 0.00  ? 154 LYS A HG2  1  
ATOM   2380  H  HG3  . LYS A 1 154 ? 42.132  64.701 3.587   1.00 0.00  ? 154 LYS A HG3  1  
ATOM   2381  H  HD2  . LYS A 1 154 ? 44.441  64.649 4.299   1.00 0.00  ? 154 LYS A HD2  1  
ATOM   2382  H  HD3  . LYS A 1 154 ? 43.434  64.800 5.736   1.00 0.00  ? 154 LYS A HD3  1  
ATOM   2383  H  HE2  . LYS A 1 154 ? 45.275  63.107 5.969   1.00 0.00  ? 154 LYS A HE2  1  
ATOM   2384  H  HE3  . LYS A 1 154 ? 43.665  62.434 6.216   1.00 0.00  ? 154 LYS A HE3  1  
ATOM   2385  H  HZ1  . LYS A 1 154 ? 43.925  61.095 4.481   1.00 0.00  ? 154 LYS A HZ1  1  
ATOM   2386  H  HZ2  . LYS A 1 154 ? 45.557  61.559 4.430   1.00 0.00  ? 154 LYS A HZ2  1  
ATOM   2387  H  HZ3  . LYS A 1 154 ? 44.411  62.367 3.471   1.00 0.00  ? 154 LYS A HZ3  1  
ATOM   2388  N  N    . MET A 1 155 ? 39.304  60.467 5.621   1.00 0.00  ? 155 MET A N    1  
ATOM   2389  C  CA   . MET A 1 155 ? 38.420  59.879 6.666   1.00 0.00  ? 155 MET A CA   1  
ATOM   2390  C  C    . MET A 1 155 ? 38.929  58.484 7.018   1.00 0.00  ? 155 MET A C    1  
ATOM   2391  O  O    . MET A 1 155 ? 38.663  57.958 8.080   1.00 0.00  ? 155 MET A O    1  
ATOM   2392  C  CB   . MET A 1 155 ? 36.993  59.788 6.123   1.00 0.00  ? 155 MET A CB   1  
ATOM   2393  C  CG   . MET A 1 155 ? 36.113  59.015 7.108   1.00 0.00  ? 155 MET A CG   1  
ATOM   2394  S  SD   . MET A 1 155 ? 34.372  59.249 6.674   1.00 0.00  ? 155 MET A SD   1  
ATOM   2395  C  CE   . MET A 1 155 ? 34.247  57.881 5.496   1.00 0.00  ? 155 MET A CE   1  
ATOM   2396  H  H    . MET A 1 155 ? 39.106  60.319 4.671   1.00 0.00  ? 155 MET A H    1  
ATOM   2397  H  HA   . MET A 1 155 ? 38.434  60.497 7.546   1.00 0.00  ? 155 MET A HA   1  
ATOM   2398  H  HB2  . MET A 1 155 ? 36.596  60.783 5.989   1.00 0.00  ? 155 MET A HB2  1  
ATOM   2399  H  HB3  . MET A 1 155 ? 37.006  59.275 5.173   1.00 0.00  ? 155 MET A HB3  1  
ATOM   2400  H  HG2  . MET A 1 155 ? 36.358  57.964 7.061   1.00 0.00  ? 155 MET A HG2  1  
ATOM   2401  H  HG3  . MET A 1 155 ? 36.287  59.380 8.109   1.00 0.00  ? 155 MET A HG3  1  
ATOM   2402  H  HE1  . MET A 1 155 ? 34.947  58.039 4.687   1.00 0.00  ? 155 MET A HE1  1  
ATOM   2403  H  HE2  . MET A 1 155 ? 33.246  57.836 5.099   1.00 0.00  ? 155 MET A HE2  1  
ATOM   2404  H  HE3  . MET A 1 155 ? 34.475  56.952 6.000   1.00 0.00  ? 155 MET A HE3  1  
ATOM   2405  N  N    . GLY A 1 156 ? 39.665  57.886 6.125   1.00 20.89 ? 156 GLY A N    1  
ATOM   2406  C  CA   . GLY A 1 156 ? 40.213  56.519 6.380   1.00 17.19 ? 156 GLY A CA   1  
ATOM   2407  C  C    . GLY A 1 156 ? 40.231  55.734 5.069   1.00 17.35 ? 156 GLY A C    1  
ATOM   2408  O  O    . GLY A 1 156 ? 39.431  54.845 4.857   1.00 17.97 ? 156 GLY A O    1  
ATOM   2409  H  H    . GLY A 1 156 ? 39.860  58.341 5.281   1.00 0.00  ? 156 GLY A H    1  
ATOM   2410  H  HA2  . GLY A 1 156 ? 41.219  56.602 6.767   1.00 0.00  ? 156 GLY A HA2  1  
ATOM   2411  H  HA3  . GLY A 1 156 ? 39.591  56.000 7.096   1.00 0.00  ? 156 GLY A HA3  1  
ATOM   2412  N  N    . GLN A 1 157 ? 41.133  56.057 4.182   1.00 0.00  ? 157 GLN A N    1  
ATOM   2413  C  CA   . GLN A 1 157 ? 41.188  55.326 2.886   1.00 0.00  ? 157 GLN A CA   1  
ATOM   2414  C  C    . GLN A 1 157 ? 42.538  55.574 2.207   1.00 0.00  ? 157 GLN A C    1  
ATOM   2415  O  O    . GLN A 1 157 ? 43.255  54.651 1.876   1.00 0.00  ? 157 GLN A O    1  
ATOM   2416  C  CB   . GLN A 1 157 ? 40.053  55.823 1.982   1.00 0.00  ? 157 GLN A CB   1  
ATOM   2417  C  CG   . GLN A 1 157 ? 39.767  54.794 0.887   1.00 0.00  ? 157 GLN A CG   1  
ATOM   2418  C  CD   . GLN A 1 157 ? 39.107  53.559 1.504   1.00 0.00  ? 157 GLN A CD   1  
ATOM   2419  O  OE1  . GLN A 1 157 ? 38.205  53.676 2.310   1.00 0.00  ? 157 GLN A OE1  1  
ATOM   2420  N  NE2  . GLN A 1 157 ? 39.521  52.371 1.157   1.00 0.00  ? 157 GLN A NE2  1  
ATOM   2421  H  H    . GLN A 1 157 ? 41.768  56.780 4.366   1.00 0.00  ? 157 GLN A H    1  
ATOM   2422  H  HA   . GLN A 1 157 ? 41.069  54.269 3.068   1.00 0.00  ? 157 GLN A HA   1  
ATOM   2423  H  HB2  . GLN A 1 157 ? 39.162  55.975 2.574   1.00 0.00  ? 157 GLN A HB2  1  
ATOM   2424  H  HB3  . GLN A 1 157 ? 40.340  56.758 1.524   1.00 0.00  ? 157 GLN A HB3  1  
ATOM   2425  H  HG2  . GLN A 1 157 ? 39.104  55.229 0.155   1.00 0.00  ? 157 GLN A HG2  1  
ATOM   2426  H  HG3  . GLN A 1 157 ? 40.692  54.506 0.412   1.00 0.00  ? 157 GLN A HG3  1  
ATOM   2427  H  HE21 . GLN A 1 157 ? 40.248  52.277 0.507   1.00 0.00  ? 157 GLN A HE21 1  
ATOM   2428  H  HE22 . GLN A 1 157 ? 39.104  51.574 1.546   1.00 0.00  ? 157 GLN A HE22 1  
ATOM   2429  N  N    . ASN A 1 158 ? 42.890  56.813 1.996   1.00 0.00  ? 158 ASN A N    1  
ATOM   2430  C  CA   . ASN A 1 158 ? 44.197  57.109 1.338   1.00 0.00  ? 158 ASN A CA   1  
ATOM   2431  C  C    . ASN A 1 158 ? 45.318  56.456 2.151   1.00 0.00  ? 158 ASN A C    1  
ATOM   2432  O  O    . ASN A 1 158 ? 46.042  55.614 1.658   1.00 0.00  ? 158 ASN A O    1  
ATOM   2433  C  CB   . ASN A 1 158 ? 44.410  58.632 1.262   1.00 0.00  ? 158 ASN A CB   1  
ATOM   2434  C  CG   . ASN A 1 158 ? 43.717  59.302 2.447   1.00 0.00  ? 158 ASN A CG   1  
ATOM   2435  O  OD1  . ASN A 1 158 ? 43.462  58.666 3.450   1.00 0.00  ? 158 ASN A OD1  1  
ATOM   2436  N  ND2  . ASN A 1 158 ? 43.398  60.565 2.375   1.00 0.00  ? 158 ASN A ND2  1  
ATOM   2437  H  H    . ASN A 1 158 ? 42.299  57.544 2.271   1.00 0.00  ? 158 ASN A H    1  
ATOM   2438  H  HA   . ASN A 1 158 ? 44.195  56.694 0.339   1.00 0.00  ? 158 ASN A HA   1  
ATOM   2439  H  HB2  . ASN A 1 158 ? 45.468  58.858 1.288   1.00 0.00  ? 158 ASN A HB2  1  
ATOM   2440  H  HB3  . ASN A 1 158 ? 43.989  59.010 0.343   1.00 0.00  ? 158 ASN A HB3  1  
ATOM   2441  H  HD21 . ASN A 1 158 ? 43.604  61.077 1.565   1.00 0.00  ? 158 ASN A HD21 1  
ATOM   2442  H  HD22 . ASN A 1 158 ? 42.953  61.002 3.131   1.00 0.00  ? 158 ASN A HD22 1  
ATOM   2443  N  N    . LEU A 1 159 ? 45.462  56.825 3.396   1.00 0.00  ? 159 LEU A N    1  
ATOM   2444  C  CA   . LEU A 1 159 ? 46.531  56.205 4.231   1.00 0.00  ? 159 LEU A CA   1  
ATOM   2445  C  C    . LEU A 1 159 ? 46.000  54.885 4.793   1.00 0.00  ? 159 LEU A C    1  
ATOM   2446  O  O    . LEU A 1 159 ? 45.699  54.770 5.965   1.00 0.00  ? 159 LEU A O    1  
ATOM   2447  C  CB   . LEU A 1 159 ? 46.914  57.151 5.386   1.00 0.00  ? 159 LEU A CB   1  
ATOM   2448  C  CG   . LEU A 1 159 ? 45.662  57.896 5.913   1.00 0.00  ? 159 LEU A CG   1  
ATOM   2449  C  CD1  . LEU A 1 159 ? 45.807  58.169 7.416   1.00 0.00  ? 159 LEU A CD1  1  
ATOM   2450  C  CD2  . LEU A 1 159 ? 45.497  59.237 5.180   1.00 0.00  ? 159 LEU A CD2  1  
ATOM   2451  H  H    . LEU A 1 159 ? 44.863  57.497 3.783   1.00 0.00  ? 159 LEU A H    1  
ATOM   2452  H  HA   . LEU A 1 159 ? 47.403  56.010 3.620   1.00 0.00  ? 159 LEU A HA   1  
ATOM   2453  H  HB2  . LEU A 1 159 ? 47.359  56.570 6.186   1.00 0.00  ? 159 LEU A HB2  1  
ATOM   2454  H  HB3  . LEU A 1 159 ? 47.640  57.868 5.030   1.00 0.00  ? 159 LEU A HB3  1  
ATOM   2455  H  HG   . LEU A 1 159 ? 44.781  57.288 5.751   1.00 0.00  ? 159 LEU A HG   1  
ATOM   2456  H  HD11 . LEU A 1 159 ? 45.811  57.232 7.953   1.00 0.00  ? 159 LEU A HD11 1  
ATOM   2457  H  HD12 . LEU A 1 159 ? 44.979  58.774 7.754   1.00 0.00  ? 159 LEU A HD12 1  
ATOM   2458  H  HD13 . LEU A 1 159 ? 46.734  58.693 7.599   1.00 0.00  ? 159 LEU A HD13 1  
ATOM   2459  H  HD21 . LEU A 1 159 ? 45.681  59.097 4.126   1.00 0.00  ? 159 LEU A HD21 1  
ATOM   2460  H  HD22 . LEU A 1 159 ? 46.203  59.954 5.573   1.00 0.00  ? 159 LEU A HD22 1  
ATOM   2461  H  HD23 . LEU A 1 159 ? 44.493  59.606 5.325   1.00 0.00  ? 159 LEU A HD23 1  
ATOM   2462  N  N    . ASN A 1 160 ? 45.880  53.886 3.956   1.00 0.00  ? 160 ASN A N    1  
ATOM   2463  C  CA   . ASN A 1 160 ? 45.366  52.561 4.416   1.00 0.00  ? 160 ASN A CA   1  
ATOM   2464  C  C    . ASN A 1 160 ? 46.535  51.590 4.580   1.00 0.00  ? 160 ASN A C    1  
ATOM   2465  O  O    . ASN A 1 160 ? 47.125  51.145 3.616   1.00 0.00  ? 160 ASN A O    1  
ATOM   2466  C  CB   . ASN A 1 160 ? 44.389  52.020 3.369   1.00 0.00  ? 160 ASN A CB   1  
ATOM   2467  C  CG   . ASN A 1 160 ? 45.129  51.783 2.050   1.00 0.00  ? 160 ASN A CG   1  
ATOM   2468  O  OD1  . ASN A 1 160 ? 45.314  50.655 1.639   1.00 0.00  ? 160 ASN A OD1  1  
ATOM   2469  N  ND2  . ASN A 1 160 ? 45.562  52.806 1.366   1.00 0.00  ? 160 ASN A ND2  1  
ATOM   2470  H  H    . ASN A 1 160 ? 46.128  54.010 3.017   1.00 0.00  ? 160 ASN A H    1  
ATOM   2471  H  HA   . ASN A 1 160 ? 44.851  52.663 5.361   1.00 0.00  ? 160 ASN A HA   1  
ATOM   2472  H  HB2  . ASN A 1 160 ? 43.965  51.090 3.718   1.00 0.00  ? 160 ASN A HB2  1  
ATOM   2473  H  HB3  . ASN A 1 160 ? 43.598  52.741 3.210   1.00 0.00  ? 160 ASN A HB3  1  
ATOM   2474  H  HD21 . ASN A 1 160 ? 45.412  53.716 1.698   1.00 0.00  ? 160 ASN A HD21 1  
ATOM   2475  H  HD22 . ASN A 1 160 ? 46.036  52.664 0.520   1.00 0.00  ? 160 ASN A HD22 1  
ATOM   2476  N  N    . ARG A 1 161 ? 46.868  51.243 5.794   1.00 0.00  ? 161 ARG A N    1  
ATOM   2477  C  CA   . ARG A 1 161 ? 47.987  50.285 6.002   1.00 0.00  ? 161 ARG A CA   1  
ATOM   2478  C  C    . ARG A 1 161 ? 47.625  48.989 5.282   1.00 0.00  ? 161 ARG A C    1  
ATOM   2479  O  O    . ARG A 1 161 ? 46.468  48.721 5.055   1.00 0.00  ? 161 ARG A O    1  
ATOM   2480  C  CB   . ARG A 1 161 ? 48.169  50.014 7.501   1.00 0.00  ? 161 ARG A CB   1  
ATOM   2481  C  CG   . ARG A 1 161 ? 48.966  51.154 8.146   1.00 0.00  ? 161 ARG A CG   1  
ATOM   2482  C  CD   . ARG A 1 161 ? 48.276  52.495 7.880   1.00 0.00  ? 161 ARG A CD   1  
ATOM   2483  N  NE   . ARG A 1 161 ? 46.824  52.387 8.202   1.00 0.00  ? 161 ARG A NE   1  
ATOM   2484  C  CZ   . ARG A 1 161 ? 46.103  53.466 8.337   1.00 0.00  ? 161 ARG A CZ   1  
ATOM   2485  N  NH1  . ARG A 1 161 ? 46.652  54.641 8.190   1.00 0.00  ? 161 ARG A NH1  1  
ATOM   2486  N  NH2  . ARG A 1 161 ? 44.832  53.371 8.619   1.00 0.00  ? 161 ARG A NH2  1  
ATOM   2487  H  H    . ARG A 1 161 ? 46.375  51.600 6.561   1.00 0.00  ? 161 ARG A H    1  
ATOM   2488  H  HA   . ARG A 1 161 ? 48.898  50.691 5.586   1.00 0.00  ? 161 ARG A HA   1  
ATOM   2489  H  HB2  . ARG A 1 161 ? 47.200  49.941 7.972   1.00 0.00  ? 161 ARG A HB2  1  
ATOM   2490  H  HB3  . ARG A 1 161 ? 48.704  49.086 7.638   1.00 0.00  ? 161 ARG A HB3  1  
ATOM   2491  H  HG2  . ARG A 1 161 ? 49.030  50.988 9.211   1.00 0.00  ? 161 ARG A HG2  1  
ATOM   2492  H  HG3  . ARG A 1 161 ? 49.961  51.176 7.727   1.00 0.00  ? 161 ARG A HG3  1  
ATOM   2493  H  HD2  . ARG A 1 161 ? 48.723  53.257 8.501   1.00 0.00  ? 161 ARG A HD2  1  
ATOM   2494  H  HD3  . ARG A 1 161 ? 48.397  52.764 6.842   1.00 0.00  ? 161 ARG A HD3  1  
ATOM   2495  H  HE   . ARG A 1 161 ? 46.411  51.506 8.312   1.00 0.00  ? 161 ARG A HE   1  
ATOM   2496  H  HH11 . ARG A 1 161 ? 47.626  54.714 7.974   1.00 0.00  ? 161 ARG A HH11 1  
ATOM   2497  H  HH12 . ARG A 1 161 ? 46.100  55.468 8.294   1.00 0.00  ? 161 ARG A HH12 1  
ATOM   2498  H  HH21 . ARG A 1 161 ? 44.411  52.471 8.732   1.00 0.00  ? 161 ARG A HH21 1  
ATOM   2499  H  HH22 . ARG A 1 161 ? 44.280  54.198 8.723   1.00 0.00  ? 161 ARG A HH22 1  
ATOM   2500  N  N    . ILE A 1 162 ? 48.590  48.188 4.920   1.00 0.00  ? 162 ILE A N    1  
ATOM   2501  C  CA   . ILE A 1 162 ? 48.271  46.916 4.204   1.00 0.00  ? 162 ILE A CA   1  
ATOM   2502  C  C    . ILE A 1 162 ? 47.347  46.052 5.092   1.00 0.00  ? 162 ILE A C    1  
ATOM   2503  O  O    . ILE A 1 162 ? 47.790  45.579 6.119   1.00 0.00  ? 162 ILE A O    1  
ATOM   2504  C  CB   . ILE A 1 162 ? 49.580  46.150 3.949   1.00 0.00  ? 162 ILE A CB   1  
ATOM   2505  C  CG1  . ILE A 1 162 ? 50.397  45.998 5.274   1.00 0.00  ? 162 ILE A CG1  1  
ATOM   2506  C  CG2  . ILE A 1 162 ? 50.400  46.921 2.904   1.00 0.00  ? 162 ILE A CG2  1  
ATOM   2507  C  CD1  . ILE A 1 162 ? 50.479  44.521 5.689   1.00 0.00  ? 162 ILE A CD1  1  
ATOM   2508  H  H    . ILE A 1 162 ? 49.521  48.423 5.112   1.00 0.00  ? 162 ILE A H    1  
ATOM   2509  H  HA   . ILE A 1 162 ? 47.812  47.142 3.260   1.00 0.00  ? 162 ILE A HA   1  
ATOM   2510  H  HB   . ILE A 1 162 ? 49.339  45.175 3.546   1.00 0.00  ? 162 ILE A HB   1  
ATOM   2511  H  HG12 . ILE A 1 162 ? 51.402  46.374 5.134   1.00 0.00  ? 162 ILE A HG12 1  
ATOM   2512  H  HG13 . ILE A 1 162 ? 49.925  46.558 6.069   1.00 0.00  ? 162 ILE A HG13 1  
ATOM   2513  H  HG21 . ILE A 1 162 ? 51.329  46.401 2.720   1.00 0.00  ? 162 ILE A HG21 1  
ATOM   2514  H  HG22 . ILE A 1 162 ? 50.611  47.914 3.273   1.00 0.00  ? 162 ILE A HG22 1  
ATOM   2515  H  HG23 . ILE A 1 162 ? 49.837  46.990 1.985   1.00 0.00  ? 162 ILE A HG23 1  
ATOM   2516  H  HD11 . ILE A 1 162 ? 49.505  44.064 5.597   1.00 0.00  ? 162 ILE A HD11 1  
ATOM   2517  H  HD12 . ILE A 1 162 ? 50.813  44.453 6.714   1.00 0.00  ? 162 ILE A HD12 1  
ATOM   2518  H  HD13 . ILE A 1 162 ? 51.181  44.006 5.049   1.00 0.00  ? 162 ILE A HD13 1  
ATOM   2519  N  N    . PRO A 1 163 ? 46.086  45.861 4.710   1.00 0.00  ? 163 PRO A N    1  
ATOM   2520  C  CA   . PRO A 1 163 ? 45.169  45.051 5.537   1.00 0.00  ? 163 PRO A CA   1  
ATOM   2521  C  C    . PRO A 1 163 ? 45.687  43.607 5.624   1.00 0.00  ? 163 PRO A C    1  
ATOM   2522  O  O    . PRO A 1 163 ? 46.284  43.095 4.698   1.00 0.00  ? 163 PRO A O    1  
ATOM   2523  C  CB   . PRO A 1 163 ? 43.800  45.125 4.816   1.00 0.00  ? 163 PRO A CB   1  
ATOM   2524  C  CG   . PRO A 1 163 ? 43.974  46.051 3.578   1.00 0.00  ? 163 PRO A CG   1  
ATOM   2525  C  CD   . PRO A 1 163 ? 45.473  46.405 3.470   1.00 0.00  ? 163 PRO A CD   1  
ATOM   2526  H  HA   . PRO A 1 163 ? 45.090  45.476 6.527   1.00 0.00  ? 163 PRO A HA   1  
ATOM   2527  H  HB2  . PRO A 1 163 ? 43.488  44.135 4.498   1.00 0.00  ? 163 PRO A HB2  1  
ATOM   2528  H  HB3  . PRO A 1 163 ? 43.054  45.542 5.479   1.00 0.00  ? 163 PRO A HB3  1  
ATOM   2529  H  HG2  . PRO A 1 163 ? 43.645  45.539 2.681   1.00 0.00  ? 163 PRO A HG2  1  
ATOM   2530  H  HG3  . PRO A 1 163 ? 43.397  46.962 3.712   1.00 0.00  ? 163 PRO A HG3  1  
ATOM   2531  H  HD2  . PRO A 1 163 ? 45.910  45.935 2.597   1.00 0.00  ? 163 PRO A HD2  1  
ATOM   2532  H  HD3  . PRO A 1 163 ? 45.596  47.471 3.420   1.00 0.00  ? 163 PRO A HD3  1  
ATOM   2533  N  N    . TYR A 1 164 ? 45.464  42.949 6.732   1.00 21.59 ? 164 TYR A N    1  
ATOM   2534  C  CA   . TYR A 1 164 ? 45.943  41.544 6.885   1.00 23.23 ? 164 TYR A CA   1  
ATOM   2535  C  C    . TYR A 1 164 ? 44.972  40.779 7.791   1.00 28.07 ? 164 TYR A C    1  
ATOM   2536  O  O    . TYR A 1 164 ? 43.776  40.989 7.743   1.00 28.03 ? 164 TYR A O    1  
ATOM   2537  C  CB   . TYR A 1 164 ? 47.339  41.559 7.513   1.00 21.58 ? 164 TYR A CB   1  
ATOM   2538  C  CG   . TYR A 1 164 ? 47.285  42.274 8.843   1.00 24.37 ? 164 TYR A CG   1  
ATOM   2539  C  CD1  . TYR A 1 164 ? 47.218  43.672 8.882   1.00 21.98 ? 164 TYR A CD1  1  
ATOM   2540  C  CD2  . TYR A 1 164 ? 47.301  41.541 10.036  1.00 21.25 ? 164 TYR A CD2  1  
ATOM   2541  C  CE1  . TYR A 1 164 ? 47.167  44.337 10.113  1.00 26.65 ? 164 TYR A CE1  1  
ATOM   2542  C  CE2  . TYR A 1 164 ? 47.250  42.206 11.267  1.00 20.80 ? 164 TYR A CE2  1  
ATOM   2543  C  CZ   . TYR A 1 164 ? 47.183  43.604 11.306  1.00 27.39 ? 164 TYR A CZ   1  
ATOM   2544  O  OH   . TYR A 1 164 ? 47.133  44.259 12.519  1.00 29.41 ? 164 TYR A OH   1  
ATOM   2545  H  H    . TYR A 1 164 ? 44.983  43.382 7.469   1.00 0.00  ? 164 TYR A H    1  
ATOM   2546  H  HA   . TYR A 1 164 ? 45.986  41.062 5.918   1.00 0.00  ? 164 TYR A HA   1  
ATOM   2547  H  HB2  . TYR A 1 164 ? 47.684  40.546 7.657   1.00 0.00  ? 164 TYR A HB2  1  
ATOM   2548  H  HB3  . TYR A 1 164 ? 48.021  42.079 6.856   1.00 0.00  ? 164 TYR A HB3  1  
ATOM   2549  H  HD1  . TYR A 1 164 ? 47.205  44.237 7.963   1.00 0.00  ? 164 TYR A HD1  1  
ATOM   2550  H  HD2  . TYR A 1 164 ? 47.352  40.465 10.006  1.00 0.00  ? 164 TYR A HD2  1  
ATOM   2551  H  HE1  . TYR A 1 164 ? 47.116  45.415 10.143  1.00 0.00  ? 164 TYR A HE1  1  
ATOM   2552  H  HE2  . TYR A 1 164 ? 47.262  41.640 12.187  1.00 0.00  ? 164 TYR A HE2  1  
ATOM   2553  H  HH   . TYR A 1 164 ? 46.212  44.443 12.719  1.00 0.00  ? 164 TYR A HH   1  
ATOM   2554  N  N    . LYS A 1 165 ? 45.471  39.897 8.614   1.00 0.00  ? 165 LYS A N    1  
ATOM   2555  C  CA   . LYS A 1 165 ? 44.573  39.125 9.520   1.00 0.00  ? 165 LYS A CA   1  
ATOM   2556  C  C    . LYS A 1 165 ? 43.561  38.335 8.686   1.00 0.00  ? 165 LYS A C    1  
ATOM   2557  O  O    . LYS A 1 165 ? 42.423  38.165 9.074   1.00 0.00  ? 165 LYS A O    1  
ATOM   2558  C  CB   . LYS A 1 165 ? 43.834  40.097 10.453  1.00 0.00  ? 165 LYS A CB   1  
ATOM   2559  C  CG   . LYS A 1 165 ? 43.271  39.342 11.665  1.00 0.00  ? 165 LYS A CG   1  
ATOM   2560  C  CD   . LYS A 1 165 ? 42.799  40.347 12.722  1.00 0.00  ? 165 LYS A CD   1  
ATOM   2561  C  CE   . LYS A 1 165 ? 41.827  41.351 12.094  1.00 0.00  ? 165 LYS A CE   1  
ATOM   2562  N  NZ   . LYS A 1 165 ? 41.028  42.005 13.169  1.00 0.00  ? 165 LYS A NZ   1  
ATOM   2563  H  H    . LYS A 1 165 ? 46.436  39.741 8.638   1.00 0.00  ? 165 LYS A H    1  
ATOM   2564  H  HA   . LYS A 1 165 ? 45.165  38.441 10.106  1.00 0.00  ? 165 LYS A HA   1  
ATOM   2565  H  HB2  . LYS A 1 165 ? 44.521  40.858 10.793  1.00 0.00  ? 165 LYS A HB2  1  
ATOM   2566  H  HB3  . LYS A 1 165 ? 43.022  40.562 9.916   1.00 0.00  ? 165 LYS A HB3  1  
ATOM   2567  H  HG2  . LYS A 1 165 ? 42.437  38.731 11.353  1.00 0.00  ? 165 LYS A HG2  1  
ATOM   2568  H  HG3  . LYS A 1 165 ? 44.038  38.714 12.092  1.00 0.00  ? 165 LYS A HG3  1  
ATOM   2569  H  HD2  . LYS A 1 165 ? 42.301  39.818 13.522  1.00 0.00  ? 165 LYS A HD2  1  
ATOM   2570  H  HD3  . LYS A 1 165 ? 43.652  40.877 13.120  1.00 0.00  ? 165 LYS A HD3  1  
ATOM   2571  H  HE2  . LYS A 1 165 ? 42.384  42.102 11.554  1.00 0.00  ? 165 LYS A HE2  1  
ATOM   2572  H  HE3  . LYS A 1 165 ? 41.162  40.837 11.415  1.00 0.00  ? 165 LYS A HE3  1  
ATOM   2573  H  HZ1  . LYS A 1 165 ? 41.514  41.890 14.081  1.00 0.00  ? 165 LYS A HZ1  1  
ATOM   2574  H  HZ2  . LYS A 1 165 ? 40.087  41.563 13.219  1.00 0.00  ? 165 LYS A HZ2  1  
ATOM   2575  H  HZ3  . LYS A 1 165 ? 40.926  43.017 12.958  1.00 0.00  ? 165 LYS A HZ3  1  
ATOM   2576  N  N    . ASP A 1 166 ? 43.965  37.848 7.542   1.00 0.00  ? 166 ASP A N    1  
ATOM   2577  C  CA   . ASP A 1 166 ? 43.018  37.071 6.694   1.00 0.00  ? 166 ASP A CA   1  
ATOM   2578  C  C    . ASP A 1 166 ? 43.768  36.430 5.522   1.00 0.00  ? 166 ASP A C    1  
ATOM   2579  O  O    . ASP A 1 166 ? 43.259  36.350 4.422   1.00 0.00  ? 166 ASP A O    1  
ATOM   2580  C  CB   . ASP A 1 166 ? 41.937  38.007 6.148   1.00 0.00  ? 166 ASP A CB   1  
ATOM   2581  C  CG   . ASP A 1 166 ? 40.942  37.205 5.308   1.00 0.00  ? 166 ASP A CG   1  
ATOM   2582  O  OD1  . ASP A 1 166 ? 40.179  36.451 5.888   1.00 0.00  ? 166 ASP A OD1  1  
ATOM   2583  O  OD2  . ASP A 1 166 ? 40.960  37.360 4.098   1.00 0.00  ? 166 ASP A OD2  1  
ATOM   2584  H  H    . ASP A 1 166 ? 44.887  37.993 7.244   1.00 0.00  ? 166 ASP A H    1  
ATOM   2585  H  HA   . ASP A 1 166 ? 42.555  36.298 7.288   1.00 0.00  ? 166 ASP A HA   1  
ATOM   2586  H  HB2  . ASP A 1 166 ? 41.418  38.477 6.971   1.00 0.00  ? 166 ASP A HB2  1  
ATOM   2587  H  HB3  . ASP A 1 166 ? 42.396  38.766 5.532   1.00 0.00  ? 166 ASP A HB3  1  
ATOM   2588  N  N    . THR A 1 167 ? 44.969  35.965 5.743   1.00 0.00  ? 167 THR A N    1  
ATOM   2589  C  CA   . THR A 1 167 ? 45.727  35.328 4.629   1.00 0.00  ? 167 THR A CA   1  
ATOM   2590  C  C    . THR A 1 167 ? 46.871  34.504 5.194   1.00 0.00  ? 167 THR A C    1  
ATOM   2591  O  O    . THR A 1 167 ? 47.016  33.338 4.884   1.00 0.00  ? 167 THR A O    1  
ATOM   2592  C  CB   . THR A 1 167 ? 46.256  36.404 3.670   1.00 0.00  ? 167 THR A CB   1  
ATOM   2593  O  OG1  . THR A 1 167 ? 47.424  35.924 3.022   1.00 0.00  ? 167 THR A OG1  1  
ATOM   2594  C  CG2  . THR A 1 167 ? 46.587  37.682 4.446   1.00 0.00  ? 167 THR A CG2  1  
ATOM   2595  H  H    . THR A 1 167 ? 45.369  36.030 6.636   1.00 0.00  ? 167 THR A H    1  
ATOM   2596  H  HA   . THR A 1 167 ? 45.076  34.669 4.103   1.00 0.00  ? 167 THR A HA   1  
ATOM   2597  H  HB   . THR A 1 167 ? 45.503  36.628 2.928   1.00 0.00  ? 167 THR A HB   1  
ATOM   2598  H  HG1  . THR A 1 167 ? 47.184  35.143 2.519   1.00 0.00  ? 167 THR A HG1  1  
ATOM   2599  H  HG21 . THR A 1 167 ? 45.686  38.082 4.886   1.00 0.00  ? 167 THR A HG21 1  
ATOM   2600  H  HG22 . THR A 1 167 ? 47.008  38.412 3.771   1.00 0.00  ? 167 THR A HG22 1  
ATOM   2601  H  HG23 . THR A 1 167 ? 47.300  37.458 5.225   1.00 0.00  ? 167 THR A HG23 1  
ATOM   2602  N  N    . PHE A 1 168 ? 47.661  35.089 6.043   1.00 0.00  ? 168 PHE A N    1  
ATOM   2603  C  CA   . PHE A 1 168 ? 48.793  34.340 6.680   1.00 0.00  ? 168 PHE A CA   1  
ATOM   2604  C  C    . PHE A 1 168 ? 48.622  34.423 8.178   1.00 0.00  ? 168 PHE A C    1  
ATOM   2605  O  O    . PHE A 1 168 ? 49.085  35.328 8.842   1.00 0.00  ? 168 PHE A O    1  
ATOM   2606  C  CB   . PHE A 1 168 ? 50.154  34.912 6.252   1.00 0.00  ? 168 PHE A CB   1  
ATOM   2607  C  CG   . PHE A 1 168 ? 49.981  36.330 5.768   1.00 0.00  ? 168 PHE A CG   1  
ATOM   2608  C  CD1  . PHE A 1 168 ? 50.080  37.400 6.665   1.00 0.00  ? 168 PHE A CD1  1  
ATOM   2609  C  CD2  . PHE A 1 168 ? 49.715  36.570 4.418   1.00 0.00  ? 168 PHE A CD2  1  
ATOM   2610  C  CE1  . PHE A 1 168 ? 49.910  38.713 6.206   1.00 0.00  ? 168 PHE A CE1  1  
ATOM   2611  C  CE2  . PHE A 1 168 ? 49.545  37.878 3.959   1.00 0.00  ? 168 PHE A CE2  1  
ATOM   2612  C  CZ   . PHE A 1 168 ? 49.641  38.952 4.853   1.00 0.00  ? 168 PHE A CZ   1  
ATOM   2613  H  H    . PHE A 1 168 ? 47.493  36.018 6.283   1.00 0.00  ? 168 PHE A H    1  
ATOM   2614  H  HA   . PHE A 1 168 ? 48.730  33.299 6.415   1.00 0.00  ? 168 PHE A HA   1  
ATOM   2615  H  HB2  . PHE A 1 168 ? 50.832  34.892 7.090   1.00 0.00  ? 168 PHE A HB2  1  
ATOM   2616  H  HB3  . PHE A 1 168 ? 50.562  34.311 5.450   1.00 0.00  ? 168 PHE A HB3  1  
ATOM   2617  H  HD1  . PHE A 1 168 ? 50.286  37.215 7.709   1.00 0.00  ? 168 PHE A HD1  1  
ATOM   2618  H  HD2  . PHE A 1 168 ? 49.643  35.742 3.728   1.00 0.00  ? 168 PHE A HD2  1  
ATOM   2619  H  HE1  . PHE A 1 168 ? 49.985  39.540 6.896   1.00 0.00  ? 168 PHE A HE1  1  
ATOM   2620  H  HE2  . PHE A 1 168 ? 49.333  38.059 2.916   1.00 0.00  ? 168 PHE A HE2  1  
ATOM   2621  H  HZ   . PHE A 1 168 ? 49.510  39.963 4.498   1.00 0.00  ? 168 PHE A HZ   1  
ATOM   2622  N  N    . TRP A 1 169 ? 47.925  33.473 8.684   1.00 0.00  ? 169 TRP A N    1  
ATOM   2623  C  CA   . TRP A 1 169 ? 47.632  33.426 10.127  1.00 0.00  ? 169 TRP A CA   1  
ATOM   2624  C  C    . TRP A 1 169 ? 47.212  32.006 10.485  1.00 0.00  ? 169 TRP A C    1  
ATOM   2625  O  O    . TRP A 1 169 ? 47.372  31.552 11.600  1.00 0.00  ? 169 TRP A O    1  
ATOM   2626  C  CB   . TRP A 1 169 ? 46.473  34.384 10.362  1.00 0.00  ? 169 TRP A CB   1  
ATOM   2627  C  CG   . TRP A 1 169 ? 46.976  35.786 10.492  1.00 0.00  ? 169 TRP A CG   1  
ATOM   2628  C  CD1  . TRP A 1 169 ? 46.988  36.694 9.492   1.00 0.00  ? 169 TRP A CD1  1  
ATOM   2629  C  CD2  . TRP A 1 169 ? 47.533  36.454 11.661  1.00 0.00  ? 169 TRP A CD2  1  
ATOM   2630  N  NE1  . TRP A 1 169 ? 47.520  37.879 9.970   1.00 0.00  ? 169 TRP A NE1  1  
ATOM   2631  C  CE2  . TRP A 1 169 ? 47.869  37.781 11.303  1.00 0.00  ? 169 TRP A CE2  1  
ATOM   2632  C  CE3  . TRP A 1 169 ? 47.776  36.041 12.983  1.00 0.00  ? 169 TRP A CE3  1  
ATOM   2633  C  CZ2  . TRP A 1 169 ? 48.428  38.667 12.224  1.00 0.00  ? 169 TRP A CZ2  1  
ATOM   2634  C  CZ3  . TRP A 1 169 ? 48.338  36.932 13.913  1.00 0.00  ? 169 TRP A CZ3  1  
ATOM   2635  C  CH2  . TRP A 1 169 ? 48.663  38.242 13.534  1.00 0.00  ? 169 TRP A CH2  1  
ATOM   2636  H  H    . TRP A 1 169 ? 47.566  32.788 8.092   1.00 0.00  ? 169 TRP A H    1  
ATOM   2637  H  HA   . TRP A 1 169 ? 48.492  33.717 10.698  1.00 0.00  ? 169 TRP A HA   1  
ATOM   2638  H  HB2  . TRP A 1 169 ? 45.822  34.326 9.498   1.00 0.00  ? 169 TRP A HB2  1  
ATOM   2639  H  HB3  . TRP A 1 169 ? 45.929  34.105 11.254  1.00 0.00  ? 169 TRP A HB3  1  
ATOM   2640  H  HD1  . TRP A 1 169 ? 46.643  36.519 8.483   1.00 0.00  ? 169 TRP A HD1  1  
ATOM   2641  H  HE1  . TRP A 1 169 ? 47.640  38.697 9.445   1.00 0.00  ? 169 TRP A HE1  1  
ATOM   2642  H  HE3  . TRP A 1 169 ? 47.529  35.034 13.286  1.00 0.00  ? 169 TRP A HE3  1  
ATOM   2643  H  HZ2  . TRP A 1 169 ? 48.676  39.676 11.927  1.00 0.00  ? 169 TRP A HZ2  1  
ATOM   2644  H  HZ3  . TRP A 1 169 ? 48.521  36.605 14.926  1.00 0.00  ? 169 TRP A HZ3  1  
ATOM   2645  H  HH2  . TRP A 1 169 ? 49.095  38.921 14.254  1.00 0.00  ? 169 TRP A HH2  1  
ATOM   2646  N  N    . LYS A 1 170 ? 46.668  31.308 9.528   1.00 0.00  ? 170 LYS A N    1  
ATOM   2647  C  CA   . LYS A 1 170 ? 46.213  29.906 9.768   1.00 0.00  ? 170 LYS A CA   1  
ATOM   2648  C  C    . LYS A 1 170 ? 46.577  29.042 8.561   1.00 0.00  ? 170 LYS A C    1  
ATOM   2649  O  O    . LYS A 1 170 ? 47.716  28.665 8.370   1.00 0.00  ? 170 LYS A O    1  
ATOM   2650  C  CB   . LYS A 1 170 ? 44.699  29.898 9.971   1.00 0.00  ? 170 LYS A CB   1  
ATOM   2651  C  CG   . LYS A 1 170 ? 44.346  30.379 11.393  1.00 0.00  ? 170 LYS A CG   1  
ATOM   2652  C  CD   . LYS A 1 170 ? 44.389  29.201 12.388  1.00 0.00  ? 170 LYS A CD   1  
ATOM   2653  C  CE   . LYS A 1 170 ? 43.044  28.463 12.395  1.00 0.00  ? 170 LYS A CE   1  
ATOM   2654  N  NZ   . LYS A 1 170 ? 43.076  27.384 13.422  1.00 0.00  ? 170 LYS A NZ   1  
ATOM   2655  H  H    . LYS A 1 170 ? 46.555  31.716 8.642   1.00 0.00  ? 170 LYS A H    1  
ATOM   2656  H  HA   . LYS A 1 170 ? 46.684  29.512 10.639  1.00 0.00  ? 170 LYS A HA   1  
ATOM   2657  H  HB2  . LYS A 1 170 ? 44.260  30.558 9.253   1.00 0.00  ? 170 LYS A HB2  1  
ATOM   2658  H  HB3  . LYS A 1 170 ? 44.317  28.899 9.821   1.00 0.00  ? 170 LYS A HB3  1  
ATOM   2659  H  HG2  . LYS A 1 170 ? 45.054  31.136 11.704  1.00 0.00  ? 170 LYS A HG2  1  
ATOM   2660  H  HG3  . LYS A 1 170 ? 43.354  30.809 11.388  1.00 0.00  ? 170 LYS A HG3  1  
ATOM   2661  H  HD2  . LYS A 1 170 ? 45.172  28.513 12.104  1.00 0.00  ? 170 LYS A HD2  1  
ATOM   2662  H  HD3  . LYS A 1 170 ? 44.590  29.578 13.380  1.00 0.00  ? 170 LYS A HD3  1  
ATOM   2663  H  HE2  . LYS A 1 170 ? 42.253  29.159 12.630  1.00 0.00  ? 170 LYS A HE2  1  
ATOM   2664  H  HE3  . LYS A 1 170 ? 42.865  28.029 11.423  1.00 0.00  ? 170 LYS A HE3  1  
ATOM   2665  H  HZ1  . LYS A 1 170 ? 42.128  27.264 13.829  1.00 0.00  ? 170 LYS A HZ1  1  
ATOM   2666  H  HZ2  . LYS A 1 170 ? 43.748  27.642 14.174  1.00 0.00  ? 170 LYS A HZ2  1  
ATOM   2667  H  HZ3  . LYS A 1 170 ? 43.376  26.493 12.979  1.00 0.00  ? 170 LYS A HZ3  1  
ATOM   2668  N  N    . GLY A 1 171 ? 45.613  28.726 7.747   1.00 0.00  ? 171 GLY A N    1  
ATOM   2669  C  CA   . GLY A 1 171 ? 45.890  27.885 6.549   1.00 0.00  ? 171 GLY A CA   1  
ATOM   2670  C  C    . GLY A 1 171 ? 44.600  27.697 5.748   1.00 0.00  ? 171 GLY A C    1  
ATOM   2671  O  O    . GLY A 1 171 ? 44.149  26.569 5.645   1.00 0.00  ? 171 GLY A O    1  
ATOM   2672  O  OXT  . GLY A 1 171 ? 44.086  28.686 5.250   1.00 0.00  ? 171 GLY A OXT  1  
ATOM   2673  H  H    . GLY A 1 171 ? 44.705  29.043 7.927   1.00 0.00  ? 171 GLY A H    1  
ATOM   2674  H  HA2  . GLY A 1 171 ? 46.632  28.372 5.931   1.00 0.00  ? 171 GLY A HA2  1  
ATOM   2675  H  HA3  . GLY A 1 171 ? 46.258  26.920 6.862   1.00 0.00  ? 171 GLY A HA3  1  
ATOM   2676  N  N    . MET B 2 1   ? 54.619  78.307 -24.412 1.00 7.62  ? 1   MET B N    1  
ATOM   2677  C  CA   . MET B 2 1   ? 53.695  78.476 -25.569 1.00 7.57  ? 1   MET B CA   1  
ATOM   2678  C  C    . MET B 2 1   ? 52.247  78.408 -25.078 1.00 6.87  ? 1   MET B C    1  
ATOM   2679  O  O    . MET B 2 1   ? 51.355  78.986 -25.666 1.00 7.06  ? 1   MET B O    1  
ATOM   2680  C  CB   . MET B 2 1   ? 53.942  77.359 -26.585 1.00 8.22  ? 1   MET B CB   1  
ATOM   2681  C  CG   . MET B 2 1   ? 55.404  77.391 -27.033 1.00 8.89  ? 1   MET B CG   1  
ATOM   2682  S  SD   . MET B 2 1   ? 55.713  78.904 -27.978 1.00 9.69  ? 1   MET B SD   1  
ATOM   2683  C  CE   . MET B 2 1   ? 57.502  78.697 -28.160 1.00 10.47 ? 1   MET B CE   1  
ATOM   2684  H  H1   . MET B 2 1   ? 54.131  78.578 -23.535 1.00 7.70  ? 1   MET B H1   1  
ATOM   2685  H  H2   . MET B 2 1   ? 55.455  78.913 -24.545 1.00 7.68  ? 1   MET B H2   1  
ATOM   2686  H  H3   . MET B 2 1   ? 54.917  77.313 -24.348 1.00 7.83  ? 1   MET B H3   1  
ATOM   2687  H  HA   . MET B 2 1   ? 53.873  79.434 -26.035 1.00 7.86  ? 1   MET B HA   1  
ATOM   2688  H  HB2  . MET B 2 1   ? 53.724  76.404 -26.130 1.00 8.21  ? 1   MET B HB2  1  
ATOM   2689  H  HB3  . MET B 2 1   ? 53.302  77.504 -27.443 1.00 8.52  ? 1   MET B HB3  1  
ATOM   2690  H  HG2  . MET B 2 1   ? 56.047  77.372 -26.165 1.00 8.92  ? 1   MET B HG2  1  
ATOM   2691  H  HG3  . MET B 2 1   ? 55.610  76.531 -27.653 1.00 9.14  ? 1   MET B HG3  1  
ATOM   2692  H  HE1  . MET B 2 1   ? 57.896  79.500 -28.767 1.00 10.65 ? 1   MET B HE1  1  
ATOM   2693  H  HE2  . MET B 2 1   ? 57.709  77.753 -28.638 1.00 10.84 ? 1   MET B HE2  1  
ATOM   2694  H  HE3  . MET B 2 1   ? 57.966  78.714 -27.184 1.00 10.61 ? 1   MET B HE3  1  
ATOM   2695  N  N    . ALA B 2 2   ? 52.008  77.707 -24.004 1.00 6.37  ? 2   ALA B N    1  
ATOM   2696  C  CA   . ALA B 2 2   ? 50.619  77.604 -23.476 1.00 5.98  ? 2   ALA B CA   1  
ATOM   2697  C  C    . ALA B 2 2   ? 49.689  77.095 -24.579 1.00 5.18  ? 2   ALA B C    1  
ATOM   2698  O  O    . ALA B 2 2   ? 50.085  76.941 -25.717 1.00 5.33  ? 2   ALA B O    1  
ATOM   2699  C  CB   . ALA B 2 2   ? 50.148  78.981 -23.005 1.00 6.35  ? 2   ALA B CB   1  
ATOM   2700  H  H    . ALA B 2 2   ? 52.742  77.249 -23.544 1.00 6.49  ? 2   ALA B H    1  
ATOM   2701  H  HA   . ALA B 2 2   ? 50.601  76.914 -22.645 1.00 6.37  ? 2   ALA B HA   1  
ATOM   2702  H  HB1  . ALA B 2 2   ? 49.958  79.609 -23.862 1.00 6.56  ? 2   ALA B HB1  1  
ATOM   2703  H  HB2  . ALA B 2 2   ? 50.913  79.432 -22.391 1.00 6.56  ? 2   ALA B HB2  1  
ATOM   2704  H  HB3  . ALA B 2 2   ? 49.241  78.874 -22.429 1.00 6.56  ? 2   ALA B HB3  1  
ATOM   2705  N  N    . ASN B 2 3   ? 48.454  76.832 -24.250 1.00 4.74  ? 3   ASN B N    1  
ATOM   2706  C  CA   . ASN B 2 3   ? 47.499  76.331 -25.279 1.00 4.38  ? 3   ASN B CA   1  
ATOM   2707  C  C    . ASN B 2 3   ? 46.103  76.214 -24.663 1.00 3.55  ? 3   ASN B C    1  
ATOM   2708  O  O    . ASN B 2 3   ? 45.416  77.197 -24.465 1.00 3.87  ? 3   ASN B O    1  
ATOM   2709  C  CB   . ASN B 2 3   ? 47.956  74.956 -25.769 1.00 4.98  ? 3   ASN B CB   1  
ATOM   2710  C  CG   . ASN B 2 3   ? 48.334  74.088 -24.567 1.00 5.68  ? 3   ASN B CG   1  
ATOM   2711  O  OD1  . ASN B 2 3   ? 49.161  74.471 -23.763 1.00 6.06  ? 3   ASN B OD1  1  
ATOM   2712  N  ND2  . ASN B 2 3   ? 47.760  72.928 -24.408 1.00 6.21  ? 3   ASN B ND2  1  
ATOM   2713  H  H    . ASN B 2 3   ? 48.154  76.962 -23.326 1.00 4.97  ? 3   ASN B H    1  
ATOM   2714  H  HA   . ASN B 2 3   ? 47.470  77.019 -26.111 1.00 4.77  ? 3   ASN B HA   1  
ATOM   2715  H  HB2  . ASN B 2 3   ? 47.153  74.484 -26.317 1.00 5.11  ? 3   ASN B HB2  1  
ATOM   2716  H  HB3  . ASN B 2 3   ? 48.814  75.069 -26.413 1.00 5.25  ? 3   ASN B HB3  1  
ATOM   2717  H  HD21 . ASN B 2 3   ? 47.092  72.618 -25.055 1.00 6.18  ? 3   ASN B HD21 1  
ATOM   2718  H  HD22 . ASN B 2 3   ? 47.996  72.365 -23.641 1.00 6.83  ? 3   ASN B HD22 1  
ATOM   2719  N  N    . ALA B 2 4   ? 45.679  75.018 -24.357 1.00 2.99  ? 4   ALA B N    1  
ATOM   2720  C  CA   . ALA B 2 4   ? 44.330  74.837 -23.753 1.00 2.69  ? 4   ALA B CA   1  
ATOM   2721  C  C    . ALA B 2 4   ? 43.274  75.479 -24.656 1.00 1.96  ? 4   ALA B C    1  
ATOM   2722  O  O    . ALA B 2 4   ? 42.592  76.406 -24.268 1.00 2.51  ? 4   ALA B O    1  
ATOM   2723  C  CB   . ALA B 2 4   ? 44.295  75.500 -22.375 1.00 3.52  ? 4   ALA B CB   1  
ATOM   2724  H  H    . ALA B 2 4   ? 46.250  74.239 -24.524 1.00 3.25  ? 4   ALA B H    1  
ATOM   2725  H  HA   . ALA B 2 4   ? 44.121  73.782 -23.650 1.00 3.12  ? 4   ALA B HA   1  
ATOM   2726  H  HB1  . ALA B 2 4   ? 44.282  76.574 -22.492 1.00 3.91  ? 4   ALA B HB1  1  
ATOM   2727  H  HB2  . ALA B 2 4   ? 45.171  75.210 -21.814 1.00 3.98  ? 4   ALA B HB2  1  
ATOM   2728  H  HB3  . ALA B 2 4   ? 43.408  75.185 -21.845 1.00 3.83  ? 4   ALA B HB3  1  
ATOM   2729  N  N    . LEU B 2 5   ? 43.135  74.992 -25.859 1.00 1.63  ? 5   LEU B N    1  
ATOM   2730  C  CA   . LEU B 2 5   ? 42.124  75.570 -26.790 1.00 2.08  ? 5   LEU B CA   1  
ATOM   2731  C  C    . LEU B 2 5   ? 40.755  74.955 -26.488 1.00 1.73  ? 5   LEU B C    1  
ATOM   2732  O  O    . LEU B 2 5   ? 40.038  74.542 -27.379 1.00 2.53  ? 5   LEU B O    1  
ATOM   2733  C  CB   . LEU B 2 5   ? 42.520  75.250 -28.237 1.00 2.84  ? 5   LEU B CB   1  
ATOM   2734  C  CG   . LEU B 2 5   ? 43.683  76.152 -28.691 1.00 3.64  ? 5   LEU B CG   1  
ATOM   2735  C  CD1  . LEU B 2 5   ? 43.223  77.620 -28.810 1.00 4.30  ? 5   LEU B CD1  1  
ATOM   2736  C  CD2  . LEU B 2 5   ? 44.837  76.049 -27.684 1.00 4.44  ? 5   LEU B CD2  1  
ATOM   2737  H  H    . LEU B 2 5   ? 43.696  74.243 -26.151 1.00 1.95  ? 5   LEU B H    1  
ATOM   2738  H  HA   . LEU B 2 5   ? 42.074  76.639 -26.654 1.00 2.70  ? 5   LEU B HA   1  
ATOM   2739  H  HB2  . LEU B 2 5   ? 42.828  74.217 -28.299 1.00 3.04  ? 5   LEU B HB2  1  
ATOM   2740  H  HB3  . LEU B 2 5   ? 41.671  75.407 -28.886 1.00 3.24  ? 5   LEU B HB3  1  
ATOM   2741  H  HG   . LEU B 2 5   ? 44.028  75.816 -29.658 1.00 3.77  ? 5   LEU B HG   1  
ATOM   2742  H  HD11 . LEU B 2 5   ? 42.182  77.658 -29.097 1.00 4.94  ? 5   LEU B HD11 1  
ATOM   2743  H  HD12 . LEU B 2 5   ? 43.816  78.116 -29.563 1.00 4.44  ? 5   LEU B HD12 1  
ATOM   2744  H  HD13 . LEU B 2 5   ? 43.355  78.128 -27.865 1.00 4.47  ? 5   LEU B HD13 1  
ATOM   2745  H  HD21 . LEU B 2 5   ? 45.743  76.425 -28.137 1.00 4.77  ? 5   LEU B HD21 1  
ATOM   2746  H  HD22 . LEU B 2 5   ? 44.979  75.016 -27.401 1.00 4.82  ? 5   LEU B HD22 1  
ATOM   2747  H  HD23 . LEU B 2 5   ? 44.604  76.635 -26.807 1.00 4.75  ? 5   LEU B HD23 1  
ATOM   2748  N  N    . ALA B 2 6   ? 40.389  74.886 -25.237 1.00 0.89  ? 6   ALA B N    1  
ATOM   2749  C  CA   . ALA B 2 6   ? 39.070  74.292 -24.874 1.00 0.76  ? 6   ALA B CA   1  
ATOM   2750  C  C    . ALA B 2 6   ? 37.942  75.242 -25.285 1.00 0.73  ? 6   ALA B C    1  
ATOM   2751  O  O    . ALA B 2 6   ? 38.137  76.434 -25.419 1.00 0.79  ? 6   ALA B O    1  
ATOM   2752  C  CB   . ALA B 2 6   ? 39.017  74.062 -23.362 1.00 0.92  ? 6   ALA B CB   1  
ATOM   2753  H  H    . ALA B 2 6   ? 40.985  75.221 -24.535 1.00 1.04  ? 6   ALA B H    1  
ATOM   2754  H  HA   . ALA B 2 6   ? 38.949  73.348 -25.385 1.00 0.94  ? 6   ALA B HA   1  
ATOM   2755  H  HB1  . ALA B 2 6   ? 38.076  73.602 -23.101 1.00 1.37  ? 6   ALA B HB1  1  
ATOM   2756  H  HB2  . ALA B 2 6   ? 39.109  75.009 -22.851 1.00 1.41  ? 6   ALA B HB2  1  
ATOM   2757  H  HB3  . ALA B 2 6   ? 39.829  73.414 -23.068 1.00 1.46  ? 6   ALA B HB3  1  
ATOM   2758  N  N    . SER B 2 7   ? 36.760  74.722 -25.482 1.00 0.71  ? 7   SER B N    1  
ATOM   2759  C  CA   . SER B 2 7   ? 35.614  75.591 -25.881 1.00 0.75  ? 7   SER B CA   1  
ATOM   2760  C  C    . SER B 2 7   ? 34.320  74.788 -25.757 1.00 0.81  ? 7   SER B C    1  
ATOM   2761  O  O    . SER B 2 7   ? 34.308  73.599 -25.963 1.00 1.38  ? 7   SER B O    1  
ATOM   2762  C  CB   . SER B 2 7   ? 35.798  76.049 -27.328 1.00 0.79  ? 7   SER B CB   1  
ATOM   2763  O  OG   . SER B 2 7   ? 34.553  76.514 -27.835 1.00 1.36  ? 7   SER B OG   1  
ATOM   2764  H  H    . SER B 2 7   ? 36.624  73.754 -25.366 1.00 0.71  ? 7   SER B H    1  
ATOM   2765  H  HA   . SER B 2 7   ? 35.570  76.452 -25.230 1.00 0.80  ? 7   SER B HA   1  
ATOM   2766  H  HB2  . SER B 2 7   ? 36.517  76.850 -27.366 1.00 1.25  ? 7   SER B HB2  1  
ATOM   2767  H  HB3  . SER B 2 7   ? 36.154  75.220 -27.925 1.00 1.20  ? 7   SER B HB3  1  
ATOM   2768  H  HG   . SER B 2 7   ? 34.204  75.842 -28.425 1.00 1.90  ? 7   SER B HG   1  
ATOM   2769  N  N    . ALA B 2 8   ? 33.232  75.419 -25.412 1.00 0.67  ? 8   ALA B N    1  
ATOM   2770  C  CA   . ALA B 2 8   ? 31.954  74.662 -25.267 1.00 0.62  ? 8   ALA B CA   1  
ATOM   2771  C  C    . ALA B 2 8   ? 32.112  73.637 -24.138 1.00 0.60  ? 8   ALA B C    1  
ATOM   2772  O  O    . ALA B 2 8   ? 33.077  72.904 -24.087 1.00 0.69  ? 8   ALA B O    1  
ATOM   2773  C  CB   . ALA B 2 8   ? 31.618  73.950 -26.585 1.00 0.62  ? 8   ALA B CB   1  
ATOM   2774  H  H    . ALA B 2 8   ? 33.256  76.383 -25.238 1.00 1.03  ? 8   ALA B H    1  
ATOM   2775  H  HA   . ALA B 2 8   ? 31.159  75.350 -25.016 1.00 0.64  ? 8   ALA B HA   1  
ATOM   2776  H  HB1  . ALA B 2 8   ? 32.147  73.010 -26.641 1.00 1.12  ? 8   ALA B HB1  1  
ATOM   2777  H  HB2  . ALA B 2 8   ? 31.911  74.576 -27.415 1.00 1.20  ? 8   ALA B HB2  1  
ATOM   2778  H  HB3  . ALA B 2 8   ? 30.554  73.767 -26.633 1.00 1.22  ? 8   ALA B HB3  1  
ATOM   2779  N  N    . THR B 2 9   ? 31.196  73.632 -23.197 1.00 0.54  ? 9   THR B N    1  
ATOM   2780  C  CA   . THR B 2 9   ? 31.298  72.719 -22.011 1.00 0.54  ? 9   THR B CA   1  
ATOM   2781  C  C    . THR B 2 9   ? 30.014  71.911 -21.811 1.00 0.50  ? 9   THR B C    1  
ATOM   2782  O  O    . THR B 2 9   ? 28.945  72.301 -22.237 1.00 0.50  ? 9   THR B O    1  
ATOM   2783  C  CB   . THR B 2 9   ? 31.551  73.571 -20.746 1.00 0.59  ? 9   THR B CB   1  
ATOM   2784  O  OG1  . THR B 2 9   ? 30.826  74.788 -20.856 1.00 0.63  ? 9   THR B OG1  1  
ATOM   2785  C  CG2  . THR B 2 9   ? 33.044  73.890 -20.590 1.00 0.62  ? 9   THR B CG2  1  
ATOM   2786  H  H    . THR B 2 9   ? 30.483  74.284 -23.234 1.00 0.56  ? 9   THR B H    1  
ATOM   2787  H  HA   . THR B 2 9   ? 32.115  72.029 -22.151 1.00 0.54  ? 9   THR B HA   1  
ATOM   2788  H  HB   . THR B 2 9   ? 31.213  73.036 -19.869 1.00 0.58  ? 9   THR B HB   1  
ATOM   2789  H  HG1  . THR B 2 9   ? 30.971  75.141 -21.737 1.00 1.08  ? 9   THR B HG1  1  
ATOM   2790  H  HG21 . THR B 2 9   ? 33.153  74.819 -20.051 1.00 1.15  ? 9   THR B HG21 1  
ATOM   2791  H  HG22 . THR B 2 9   ? 33.502  73.986 -21.563 1.00 1.15  ? 9   THR B HG22 1  
ATOM   2792  H  HG23 . THR B 2 9   ? 33.530  73.098 -20.036 1.00 1.28  ? 9   THR B HG23 1  
ATOM   2793  N  N    . CYS B 2 10  ? 30.119  70.781 -21.146 1.00 0.49  ? 10  CYS B N    1  
ATOM   2794  C  CA   . CYS B 2 10  ? 28.924  69.961 -20.903 1.00 0.47  ? 10  CYS B CA   1  
ATOM   2795  C  C    . CYS B 2 10  ? 27.886  70.775 -20.219 1.00 0.49  ? 10  CYS B C    1  
ATOM   2796  O  O    . CYS B 2 10  ? 28.155  71.520 -19.298 1.00 0.55  ? 10  CYS B O    1  
ATOM   2797  C  CB   . CYS B 2 10  ? 29.206  68.784 -20.013 1.00 0.50  ? 10  CYS B CB   1  
ATOM   2798  S  SG   . CYS B 2 10  ? 27.708  67.790 -19.965 1.00 0.61  ? 10  CYS B SG   1  
ATOM   2799  H  H    . CYS B 2 10  ? 30.975  70.490 -20.798 1.00 0.50  ? 10  CYS B H    1  
ATOM   2800  H  HA   . CYS B 2 10  ? 28.538  69.603 -21.824 1.00 0.45  ? 10  CYS B HA   1  
ATOM   2801  H  HB2  . CYS B 2 10  ? 30.002  68.229 -20.403 1.00 0.47  ? 10  CYS B HB2  1  
ATOM   2802  H  HB3  . CYS B 2 10  ? 29.451  69.110 -19.034 1.00 0.65  ? 10  CYS B HB3  1  
ATOM   2803  N  N    . GLU B 2 11  ? 26.692  70.596 -20.623 1.00 0.49  ? 11  GLU B N    1  
ATOM   2804  C  CA   . GLU B 2 11  ? 25.599  71.354 -19.944 1.00 0.53  ? 11  GLU B CA   1  
ATOM   2805  C  C    . GLU B 2 11  ? 25.263  70.648 -18.627 1.00 0.57  ? 11  GLU B C    1  
ATOM   2806  O  O    . GLU B 2 11  ? 24.391  71.073 -17.897 1.00 0.65  ? 11  GLU B O    1  
ATOM   2807  C  CB   . GLU B 2 11  ? 24.344  71.449 -20.822 1.00 0.55  ? 11  GLU B CB   1  
ATOM   2808  C  CG   . GLU B 2 11  ? 23.395  72.553 -20.279 1.00 1.08  ? 11  GLU B CG   1  
ATOM   2809  C  CD   . GLU B 2 11  ? 23.598  73.868 -21.050 1.00 1.61  ? 11  GLU B CD   1  
ATOM   2810  O  OE1  . GLU B 2 11  ? 23.831  73.807 -22.247 1.00 2.31  ? 11  GLU B OE1  1  
ATOM   2811  O  OE2  . GLU B 2 11  ? 23.517  74.913 -20.426 1.00 2.09  ? 11  GLU B OE2  1  
ATOM   2812  H  H    . GLU B 2 11  ? 26.521  69.930 -21.353 1.00 0.47  ? 11  GLU B H    1  
ATOM   2813  H  HA   . GLU B 2 11  ? 25.949  72.357 -19.724 1.00 0.57  ? 11  GLU B HA   1  
ATOM   2814  H  HB2  . GLU B 2 11  ? 24.635  71.686 -21.833 1.00 0.91  ? 11  GLU B HB2  1  
ATOM   2815  H  HB3  . GLU B 2 11  ? 23.834  70.500 -20.813 1.00 0.90  ? 11  GLU B HB3  1  
ATOM   2816  H  HG2  . GLU B 2 11  ? 22.371  72.232 -20.386 1.00 1.51  ? 11  GLU B HG2  1  
ATOM   2817  H  HG3  . GLU B 2 11  ? 23.593  72.733 -19.234 1.00 1.55  ? 11  GLU B HG3  1  
ATOM   2818  N  N    . ARG B 2 12  ? 25.950  69.565 -18.305 1.00 0.57  ? 12  ARG B N    1  
ATOM   2819  C  CA   . ARG B 2 12  ? 25.646  68.846 -17.014 1.00 0.67  ? 12  ARG B CA   1  
ATOM   2820  C  C    . ARG B 2 12  ? 26.927  68.543 -16.230 1.00 0.69  ? 12  ARG B C    1  
ATOM   2821  O  O    . ARG B 2 12  ? 26.948  68.673 -15.022 1.00 0.79  ? 12  ARG B O    1  
ATOM   2822  C  CB   . ARG B 2 12  ? 24.853  67.548 -17.317 1.00 0.72  ? 12  ARG B CB   1  
ATOM   2823  C  CG   . ARG B 2 12  ? 23.429  67.651 -16.725 1.00 1.25  ? 12  ARG B CG   1  
ATOM   2824  C  CD   . ARG B 2 12  ? 22.514  66.524 -17.250 1.00 1.90  ? 12  ARG B CD   1  
ATOM   2825  N  NE   . ARG B 2 12  ? 21.154  67.089 -17.531 1.00 2.40  ? 12  ARG B NE   1  
ATOM   2826  C  CZ   . ARG B 2 12  ? 20.551  67.862 -16.662 1.00 3.03  ? 12  ARG B CZ   1  
ATOM   2827  N  NH1  . ARG B 2 12  ? 21.029  67.999 -15.456 1.00 3.43  ? 12  ARG B NH1  1  
ATOM   2828  N  NH2  . ARG B 2 12  ? 19.439  68.464 -16.987 1.00 3.74  ? 12  ARG B NH2  1  
ATOM   2829  H  H    . ARG B 2 12  ? 26.655  69.228 -18.911 1.00 0.52  ? 12  ARG B H    1  
ATOM   2830  H  HA   . ARG B 2 12  ? 25.056  69.487 -16.391 1.00 0.75  ? 12  ARG B HA   1  
ATOM   2831  H  HB2  . ARG B 2 12  ? 24.791  67.421 -18.384 1.00 1.21  ? 12  ARG B HB2  1  
ATOM   2832  H  HB3  . ARG B 2 12  ? 25.354  66.691 -16.886 1.00 1.16  ? 12  ARG B HB3  1  
ATOM   2833  H  HG2  . ARG B 2 12  ? 23.497  67.592 -15.649 1.00 1.73  ? 12  ARG B HG2  1  
ATOM   2834  H  HG3  . ARG B 2 12  ? 23.005  68.607 -16.999 1.00 1.74  ? 12  ARG B HG3  1  
ATOM   2835  H  HD2  . ARG B 2 12  ? 22.906  66.123 -18.169 1.00 2.39  ? 12  ARG B HD2  1  
ATOM   2836  H  HD3  . ARG B 2 12  ? 22.455  65.729 -16.512 1.00 2.32  ? 12  ARG B HD3  1  
ATOM   2837  H  HE   . ARG B 2 12  ? 20.736  66.924 -18.402 1.00 2.69  ? 12  ARG B HE   1  
ATOM   2838  H  HH11 . ARG B 2 12  ? 21.855  67.510 -15.187 1.00 3.27  ? 12  ARG B HH11 1  
ATOM   2839  H  HH12 . ARG B 2 12  ? 20.566  68.594 -14.800 1.00 4.16  ? 12  ARG B HH12 1  
ATOM   2840  H  HH21 . ARG B 2 12  ? 19.048  68.335 -17.899 1.00 3.93  ? 12  ARG B HH21 1  
ATOM   2841  H  HH22 . ARG B 2 12  ? 18.977  69.054 -16.325 1.00 4.33  ? 12  ARG B HH22 1  
ATOM   2842  N  N    . CYS B 2 13  ? 27.992  68.163 -16.879 1.00 0.64  ? 13  CYS B N    1  
ATOM   2843  C  CA   . CYS B 2 13  ? 29.257  67.883 -16.126 1.00 0.72  ? 13  CYS B CA   1  
ATOM   2844  C  C    . CYS B 2 13  ? 30.132  69.130 -16.206 1.00 0.69  ? 13  CYS B C    1  
ATOM   2845  O  O    . CYS B 2 13  ? 31.136  69.250 -15.535 1.00 0.73  ? 13  CYS B O    1  
ATOM   2846  C  CB   . CYS B 2 13  ? 29.966  66.653 -16.725 1.00 0.80  ? 13  CYS B CB   1  
ATOM   2847  S  SG   . CYS B 2 13  ? 31.107  67.138 -18.038 1.00 0.87  ? 13  CYS B SG   1  
ATOM   2848  H  H    . CYS B 2 13  ? 27.969  68.083 -17.855 1.00 0.60  ? 13  CYS B H    1  
ATOM   2849  H  HA   . CYS B 2 13  ? 29.029  67.687 -15.085 1.00 0.80  ? 13  CYS B HA   1  
ATOM   2850  H  HB2  . CYS B 2 13  ? 30.519  66.143 -15.951 1.00 1.29  ? 13  CYS B HB2  1  
ATOM   2851  H  HB3  . CYS B 2 13  ? 29.225  65.985 -17.131 1.00 1.32  ? 13  CYS B HB3  1  
ATOM   2852  N  N    . LYS B 2 14  ? 29.733  70.056 -17.036 1.00 0.64  ? 14  LYS B N    1  
ATOM   2853  C  CA   . LYS B 2 14  ? 30.483  71.319 -17.205 1.00 0.64  ? 14  LYS B CA   1  
ATOM   2854  C  C    . LYS B 2 14  ? 31.826  71.060 -17.833 1.00 0.67  ? 14  LYS B C    1  
ATOM   2855  O  O    . LYS B 2 14  ? 32.654  71.945 -17.918 1.00 0.79  ? 14  LYS B O    1  
ATOM   2856  C  CB   . LYS B 2 14  ? 30.664  72.015 -15.859 1.00 0.67  ? 14  LYS B CB   1  
ATOM   2857  C  CG   . LYS B 2 14  ? 29.351  71.982 -15.058 1.00 0.69  ? 14  LYS B CG   1  
ATOM   2858  C  CD   . LYS B 2 14  ? 28.163  72.339 -15.966 1.00 0.70  ? 14  LYS B CD   1  
ATOM   2859  C  CE   . LYS B 2 14  ? 26.986  72.832 -15.120 1.00 1.04  ? 14  LYS B CE   1  
ATOM   2860  N  NZ   . LYS B 2 14  ? 25.875  73.257 -16.016 1.00 1.55  ? 14  LYS B NZ   1  
ATOM   2861  H  H    . LYS B 2 14  ? 28.918  69.914 -17.568 1.00 0.62  ? 14  LYS B H    1  
ATOM   2862  H  HA   . LYS B 2 14  ? 29.935  71.962 -17.870 1.00 0.62  ? 14  LYS B HA   1  
ATOM   2863  H  HB2  . LYS B 2 14  ? 31.443  71.523 -15.296 1.00 0.70  ? 14  LYS B HB2  1  
ATOM   2864  H  HB3  . LYS B 2 14  ? 30.948  73.032 -16.038 1.00 0.69  ? 14  LYS B HB3  1  
ATOM   2865  H  HG2  . LYS B 2 14  ? 29.206  70.993 -14.650 1.00 0.71  ? 14  LYS B HG2  1  
ATOM   2866  H  HG3  . LYS B 2 14  ? 29.413  72.695 -14.250 1.00 0.71  ? 14  LYS B HG3  1  
ATOM   2867  H  HD2  . LYS B 2 14  ? 28.458  73.112 -16.656 1.00 0.71  ? 14  LYS B HD2  1  
ATOM   2868  H  HD3  . LYS B 2 14  ? 27.860  71.465 -16.520 1.00 0.71  ? 14  LYS B HD3  1  
ATOM   2869  H  HE2  . LYS B 2 14  ? 26.645  72.035 -14.477 1.00 1.46  ? 14  LYS B HE2  1  
ATOM   2870  H  HE3  . LYS B 2 14  ? 27.302  73.671 -14.517 1.00 1.42  ? 14  LYS B HE3  1  
ATOM   2871  H  HZ1  . LYS B 2 14  ? 25.179  73.802 -15.471 1.00 2.01  ? 14  LYS B HZ1  1  
ATOM   2872  H  HZ2  . LYS B 2 14  ? 25.418  72.416 -16.424 1.00 2.02  ? 14  LYS B HZ2  1  
ATOM   2873  H  HZ3  . LYS B 2 14  ? 26.254  73.851 -16.782 1.00 1.96  ? 14  LYS B HZ3  1  
ATOM   2874  N  N    . GLY B 2 15  ? 32.059  69.886 -18.317 1.00 0.61  ? 15  GLY B N    1  
ATOM   2875  C  CA   . GLY B 2 15  ? 33.301  69.571 -18.974 1.00 0.65  ? 15  GLY B CA   1  
ATOM   2876  C  C    . GLY B 2 15  ? 33.359  70.447 -20.166 1.00 0.64  ? 15  GLY B C    1  
ATOM   2877  O  O    . GLY B 2 15  ? 32.445  71.140 -20.453 1.00 0.71  ? 15  GLY B O    1  
ATOM   2878  H  H    . GLY B 2 15  ? 31.469  69.164 -18.316 1.00 0.58  ? 15  GLY B H    1  
ATOM   2879  H  HA2  . GLY B 2 15  ? 34.127  69.793 -18.310 1.00 0.71  ? 15  GLY B HA2  1  
ATOM   2880  H  HA3  . GLY B 2 15  ? 33.331  68.540 -19.259 1.00 0.63  ? 15  GLY B HA3  1  
ATOM   2881  N  N    . GLY B 2 16  ? 34.453  70.421 -20.767 1.00 0.59  ? 16  GLY B N    1  
ATOM   2882  C  CA   . GLY B 2 16  ? 34.810  71.238 -21.931 1.00 0.61  ? 16  GLY B CA   1  
ATOM   2883  C  C    . GLY B 2 16  ? 35.258  70.340 -23.051 1.00 0.59  ? 16  GLY B C    1  
ATOM   2884  O  O    . GLY B 2 16  ? 36.333  69.773 -23.025 1.00 0.62  ? 16  GLY B O    1  
ATOM   2885  H  H    . GLY B 2 16  ? 35.057  69.834 -20.449 1.00 0.54  ? 16  GLY B H    1  
ATOM   2886  H  HA2  . GLY B 2 16  ? 33.993  71.823 -22.251 1.00 0.61  ? 16  GLY B HA2  1  
ATOM   2887  H  HA3  . GLY B 2 16  ? 35.627  71.890 -21.666 1.00 0.66  ? 16  GLY B HA3  1  
ATOM   2888  N  N    . PHE B 2 17  ? 34.435  70.220 -24.038 1.00 0.57  ? 17  PHE B N    1  
ATOM   2889  C  CA   . PHE B 2 17  ? 34.760  69.377 -25.202 1.00 0.57  ? 17  PHE B CA   1  
ATOM   2890  C  C    . PHE B 2 17  ? 35.082  70.257 -26.398 1.00 0.62  ? 17  PHE B C    1  
ATOM   2891  O  O    . PHE B 2 17  ? 34.855  71.441 -26.467 1.00 0.66  ? 17  PHE B O    1  
ATOM   2892  C  CB   . PHE B 2 17  ? 33.612  68.419 -25.586 1.00 0.52  ? 17  PHE B CB   1  
ATOM   2893  C  CG   . PHE B 2 17  ? 32.262  68.955 -25.207 1.00 0.50  ? 17  PHE B CG   1  
ATOM   2894  C  CD1  . PHE B 2 17  ? 32.025  70.316 -25.173 1.00 0.52  ? 17  PHE B CD1  1  
ATOM   2895  C  CD2  . PHE B 2 17  ? 31.260  68.062 -24.834 1.00 0.46  ? 17  PHE B CD2  1  
ATOM   2896  C  CE1  . PHE B 2 17  ? 30.777  70.787 -24.768 1.00 0.51  ? 17  PHE B CE1  1  
ATOM   2897  C  CE2  . PHE B 2 17  ? 30.020  68.524 -24.405 1.00 0.45  ? 17  PHE B CE2  1  
ATOM   2898  C  CZ   . PHE B 2 17  ? 29.770  69.893 -24.372 1.00 0.46  ? 17  PHE B CZ   1  
ATOM   2899  H  H    . PHE B 2 17  ? 33.587  70.661 -23.990 1.00 0.57  ? 17  PHE B H    1  
ATOM   2900  H  HA   . PHE B 2 17  ? 35.643  68.787 -24.984 1.00 0.59  ? 17  PHE B HA   1  
ATOM   2901  H  HB2  . PHE B 2 17  ? 33.625  68.244 -26.640 1.00 0.54  ? 17  PHE B HB2  1  
ATOM   2902  H  HB3  . PHE B 2 17  ? 33.769  67.491 -25.077 1.00 0.51  ? 17  PHE B HB3  1  
ATOM   2903  H  HD1  . PHE B 2 17  ? 32.794  71.006 -25.498 1.00 0.57  ? 17  PHE B HD1  1  
ATOM   2904  H  HD2  . PHE B 2 17  ? 31.442  67.015 -24.910 1.00 0.46  ? 17  PHE B HD2  1  
ATOM   2905  H  HE1  . PHE B 2 17  ? 30.593  71.827 -24.763 1.00 0.54  ? 17  PHE B HE1  1  
ATOM   2906  H  HE2  . PHE B 2 17  ? 29.250  67.823 -24.126 1.00 0.43  ? 17  PHE B HE2  1  
ATOM   2907  H  HZ   . PHE B 2 17  ? 28.811  70.262 -24.019 1.00 0.46  ? 17  PHE B HZ   1  
ATOM   2908  N  N    . ALA B 2 18  ? 35.621  69.588 -27.310 1.00 0.63  ? 18  ALA B N    1  
ATOM   2909  C  CA   . ALA B 2 18  ? 36.087  70.103 -28.659 1.00 0.70  ? 18  ALA B CA   1  
ATOM   2910  C  C    . ALA B 2 18  ? 34.979  69.521 -29.450 1.00 0.70  ? 18  ALA B C    1  
ATOM   2911  O  O    . ALA B 2 18  ? 34.825  68.315 -29.370 1.00 0.72  ? 18  ALA B O    1  
ATOM   2912  C  CB   . ALA B 2 18  ? 37.412  69.496 -29.063 1.00 0.76  ? 18  ALA B CB   1  
ATOM   2913  H  H    . ALA B 2 18  ? 35.663  68.723 -27.187 1.00 0.60  ? 18  ALA B H    1  
ATOM   2914  H  HA   . ALA B 2 18  ? 36.138  71.176 -28.653 1.00 0.71  ? 18  ALA B HA   1  
ATOM   2915  H  HB1  . ALA B 2 18  ? 38.207  70.147 -28.743 1.00 1.18  ? 18  ALA B HB1  1  
ATOM   2916  H  HB2  . ALA B 2 18  ? 37.438  69.396 -30.136 1.00 1.22  ? 18  ALA B HB2  1  
ATOM   2917  H  HB3  . ALA B 2 18  ? 37.518  68.536 -28.599 1.00 1.43  ? 18  ALA B HB3  1  
ATOM   2918  N  N    . PRO B 2 19  ? 34.057  70.301 -29.862 1.00 0.70  ? 19  PRO B N    1  
ATOM   2919  C  CA   . PRO B 2 19  ? 32.875  69.596 -30.166 1.00 0.72  ? 19  PRO B CA   1  
ATOM   2920  C  C    . PRO B 2 19  ? 32.231  68.934 -31.337 1.00 0.67  ? 19  PRO B C    1  
ATOM   2921  O  O    . PRO B 2 19  ? 31.079  68.995 -31.722 1.00 0.70  ? 19  PRO B O    1  
ATOM   2922  C  CB   . PRO B 2 19  ? 31.965  70.846 -29.954 1.00 0.73  ? 19  PRO B CB   1  
ATOM   2923  C  CG   . PRO B 2 19  ? 32.836  72.004 -30.435 1.00 0.72  ? 19  PRO B CG   1  
ATOM   2924  C  CD   . PRO B 2 19  ? 34.143  71.651 -29.856 1.00 0.70  ? 19  PRO B CD   1  
ATOM   2925  H  HA   . PRO B 2 19  ? 32.612  68.990 -29.312 1.00 0.77  ? 19  PRO B HA   1  
ATOM   2926  H  HB2  . PRO B 2 19  ? 31.046  70.821 -30.527 1.00 0.72  ? 19  PRO B HB2  1  
ATOM   2927  H  HB3  . PRO B 2 19  ? 31.758  70.976 -28.902 1.00 0.79  ? 19  PRO B HB3  1  
ATOM   2928  H  HG2  . PRO B 2 19  ? 32.900  71.971 -31.515 1.00 0.70  ? 19  PRO B HG2  1  
ATOM   2929  H  HG3  . PRO B 2 19  ? 32.502  72.950 -30.069 1.00 0.77  ? 19  PRO B HG3  1  
ATOM   2930  H  HD2  . PRO B 2 19  ? 34.997  71.945 -30.392 1.00 0.65  ? 19  PRO B HD2  1  
ATOM   2931  H  HD3  . PRO B 2 19  ? 34.210  71.904 -28.832 1.00 0.74  ? 19  PRO B HD3  1  
ATOM   2932  N  N    . ALA B 2 20  ? 33.113  68.209 -31.791 1.00 0.63  ? 20  ALA B N    1  
ATOM   2933  C  CA   . ALA B 2 20  ? 32.958  67.283 -32.875 1.00 0.60  ? 20  ALA B CA   1  
ATOM   2934  C  C    . ALA B 2 20  ? 33.703  66.087 -32.326 1.00 0.59  ? 20  ALA B C    1  
ATOM   2935  O  O    . ALA B 2 20  ? 33.977  65.128 -33.020 1.00 0.63  ? 20  ALA B O    1  
ATOM   2936  C  CB   . ALA B 2 20  ? 33.619  67.840 -34.135 1.00 0.66  ? 20  ALA B CB   1  
ATOM   2937  H  H    . ALA B 2 20  ? 33.968  68.242 -31.309 1.00 0.63  ? 20  ALA B H    1  
ATOM   2938  H  HA   . ALA B 2 20  ? 31.915  67.044 -33.045 1.00 0.57  ? 20  ALA B HA   1  
ATOM   2939  H  HB1  . ALA B 2 20  ? 34.693  67.769 -34.042 1.00 1.25  ? 20  ALA B HB1  1  
ATOM   2940  H  HB2  . ALA B 2 20  ? 33.335  68.878 -34.251 1.00 1.14  ? 20  ALA B HB2  1  
ATOM   2941  H  HB3  . ALA B 2 20  ? 33.290  67.277 -34.994 1.00 1.24  ? 20  ALA B HB3  1  
ATOM   2942  N  N    . GLU B 2 21  ? 34.007  66.127 -31.014 1.00 0.58  ? 21  GLU B N    1  
ATOM   2943  C  CA   . GLU B 2 21  ? 34.697  64.967 -30.405 1.00 0.61  ? 21  GLU B CA   1  
ATOM   2944  C  C    . GLU B 2 21  ? 33.601  64.205 -29.760 1.00 0.59  ? 21  GLU B C    1  
ATOM   2945  O  O    . GLU B 2 21  ? 32.970  63.366 -30.373 1.00 0.70  ? 21  GLU B O    1  
ATOM   2946  C  CB   . GLU B 2 21  ? 35.682  65.427 -29.347 1.00 0.66  ? 21  GLU B CB   1  
ATOM   2947  C  CG   . GLU B 2 21  ? 36.894  66.105 -30.011 1.00 0.76  ? 21  GLU B CG   1  
ATOM   2948  C  CD   . GLU B 2 21  ? 38.095  66.063 -29.061 1.00 1.09  ? 21  GLU B CD   1  
ATOM   2949  O  OE1  . GLU B 2 21  ? 37.904  66.320 -27.884 1.00 1.63  ? 21  GLU B OE1  1  
ATOM   2950  O  OE2  . GLU B 2 21  ? 39.185  65.774 -29.528 1.00 1.64  ? 21  GLU B OE2  1  
ATOM   2951  H  H    . GLU B 2 21  ? 33.725  66.925 -30.406 1.00 0.57  ? 21  GLU B H    1  
ATOM   2952  H  HA   . GLU B 2 21  ? 35.184  64.364 -31.148 1.00 0.67  ? 21  GLU B HA   1  
ATOM   2953  H  HB2  . GLU B 2 21  ? 35.175  66.124 -28.691 1.00 0.65  ? 21  GLU B HB2  1  
ATOM   2954  H  HB3  . GLU B 2 21  ? 36.013  64.569 -28.782 1.00 0.68  ? 21  GLU B HB3  1  
ATOM   2955  H  HG2  . GLU B 2 21  ? 37.147  65.586 -30.926 1.00 0.75  ? 21  GLU B HG2  1  
ATOM   2956  H  HG3  . GLU B 2 21  ? 36.653  67.131 -30.239 1.00 0.90  ? 21  GLU B HG3  1  
ATOM   2957  N  N    . LYS B 2 22  ? 33.267  64.577 -28.560 1.00 0.57  ? 22  LYS B N    1  
ATOM   2958  C  CA   . LYS B 2 22  ? 32.089  63.951 -27.955 1.00 0.63  ? 22  LYS B CA   1  
ATOM   2959  C  C    . LYS B 2 22  ? 31.398  64.960 -27.065 1.00 0.57  ? 22  LYS B C    1  
ATOM   2960  O  O    . LYS B 2 22  ? 31.564  65.065 -25.885 1.00 0.63  ? 22  LYS B O    1  
ATOM   2961  C  CB   . LYS B 2 22  ? 32.485  62.706 -27.141 1.00 0.74  ? 22  LYS B CB   1  
ATOM   2962  C  CG   . LYS B 2 22  ? 33.992  62.716 -26.832 1.00 0.96  ? 22  LYS B CG   1  
ATOM   2963  C  CD   . LYS B 2 22  ? 34.322  63.511 -25.546 1.00 1.04  ? 22  LYS B CD   1  
ATOM   2964  C  CE   . LYS B 2 22  ? 34.638  64.986 -25.859 1.00 0.74  ? 22  LYS B CE   1  
ATOM   2965  N  NZ   . LYS B 2 22  ? 35.193  65.634 -24.636 1.00 1.41  ? 22  LYS B NZ   1  
ATOM   2966  H  H    . LYS B 2 22  ? 33.715  65.332 -28.135 1.00 0.60  ? 22  LYS B H    1  
ATOM   2967  H  HA   . LYS B 2 22  ? 31.390  63.653 -28.734 1.00 0.70  ? 22  LYS B HA   1  
ATOM   2968  H  HB2  . LYS B 2 22  ? 31.919  62.663 -26.222 1.00 1.08  ? 22  LYS B HB2  1  
ATOM   2969  H  HB3  . LYS B 2 22  ? 32.257  61.820 -27.724 1.00 1.05  ? 22  LYS B HB3  1  
ATOM   2970  H  HG2  . LYS B 2 22  ? 34.295  61.709 -26.705 1.00 1.70  ? 22  LYS B HG2  1  
ATOM   2971  H  HG3  . LYS B 2 22  ? 34.532  63.128 -27.656 1.00 1.60  ? 22  LYS B HG3  1  
ATOM   2972  H  HD2  . LYS B 2 22  ? 33.491  63.467 -24.873 1.00 1.70  ? 22  LYS B HD2  1  
ATOM   2973  H  HD3  . LYS B 2 22  ? 35.184  63.067 -25.067 1.00 1.71  ? 22  LYS B HD3  1  
ATOM   2974  H  HE2  . LYS B 2 22  ? 35.355  65.058 -26.653 1.00 1.04  ? 22  LYS B HE2  1  
ATOM   2975  H  HE3  . LYS B 2 22  ? 33.745  65.492 -26.154 1.00 1.06  ? 22  LYS B HE3  1  
ATOM   2976  H  HZ1  . LYS B 2 22  ? 35.900  65.008 -24.203 1.00 1.95  ? 22  LYS B HZ1  1  
ATOM   2977  H  HZ2  . LYS B 2 22  ? 34.423  65.811 -23.958 1.00 1.89  ? 22  LYS B HZ2  1  
ATOM   2978  H  HZ3  . LYS B 2 22  ? 35.642  66.535 -24.894 1.00 1.86  ? 22  LYS B HZ3  1  
ATOM   2979  N  N    . ILE B 2 23  ? 30.537  65.562 -27.720 1.00 0.51  ? 23  ILE B N    1  
ATOM   2980  C  CA   . ILE B 2 23  ? 29.572  66.547 -27.230 1.00 0.52  ? 23  ILE B CA   1  
ATOM   2981  C  C    . ILE B 2 23  ? 28.213  66.166 -27.837 1.00 0.52  ? 23  ILE B C    1  
ATOM   2982  O  O    . ILE B 2 23  ? 28.150  65.664 -28.942 1.00 0.60  ? 23  ILE B O    1  
ATOM   2983  C  CB   . ILE B 2 23  ? 29.953  67.921 -27.781 1.00 0.55  ? 23  ILE B CB   1  
ATOM   2984  C  CG1  . ILE B 2 23  ? 28.830  68.905 -27.504 1.00 0.69  ? 23  ILE B CG1  1  
ATOM   2985  C  CG2  . ILE B 2 23  ? 30.162  67.849 -29.289 1.00 0.54  ? 23  ILE B CG2  1  
ATOM   2986  C  CD1  . ILE B 2 23  ? 29.313  70.315 -27.809 1.00 0.50  ? 23  ILE B CD1  1  
ATOM   2987  H  H    . ILE B 2 23  ? 30.549  65.355 -28.613 1.00 0.51  ? 23  ILE B H    1  
ATOM   2988  H  HA   . ILE B 2 23  ? 29.529  66.557 -26.153 1.00 0.58  ? 23  ILE B HA   1  
ATOM   2989  H  HB   . ILE B 2 23  ? 30.859  68.265 -27.318 1.00 0.61  ? 23  ILE B HB   1  
ATOM   2990  H  HG12 . ILE B 2 23  ? 27.979  68.679 -28.132 1.00 1.03  ? 23  ILE B HG12 1  
ATOM   2991  H  HG13 . ILE B 2 23  ? 28.551  68.822 -26.480 1.00 1.06  ? 23  ILE B HG13 1  
ATOM   2992  H  HG21 . ILE B 2 23  ? 31.024  67.238 -29.512 1.00 1.13  ? 23  ILE B HG21 1  
ATOM   2993  H  HG22 . ILE B 2 23  ? 30.318  68.840 -29.650 1.00 1.20  ? 23  ILE B HG22 1  
ATOM   2994  H  HG23 . ILE B 2 23  ? 29.290  67.440 -29.771 1.00 1.14  ? 23  ILE B HG23 1  
ATOM   2995  H  HD11 . ILE B 2 23  ? 28.556  71.016 -27.545 1.00 1.16  ? 23  ILE B HD11 1  
ATOM   2996  H  HD12 . ILE B 2 23  ? 29.516  70.397 -28.862 1.00 1.16  ? 23  ILE B HD12 1  
ATOM   2997  H  HD13 . ILE B 2 23  ? 30.209  70.519 -27.251 1.00 1.14  ? 23  ILE B HD13 1  
ATOM   2998  N  N    . VAL B 2 24  ? 27.132  66.384 -27.146 1.00 0.48  ? 24  VAL B N    1  
ATOM   2999  C  CA   . VAL B 2 24  ? 25.801  66.036 -27.717 1.00 0.51  ? 24  VAL B CA   1  
ATOM   3000  C  C    . VAL B 2 24  ? 24.836  67.195 -27.463 1.00 0.62  ? 24  VAL B C    1  
ATOM   3001  O  O    . VAL B 2 24  ? 24.625  67.632 -26.350 1.00 1.38  ? 24  VAL B O    1  
ATOM   3002  C  CB   . VAL B 2 24  ? 25.297  64.739 -27.091 1.00 0.48  ? 24  VAL B CB   1  
ATOM   3003  C  CG1  . VAL B 2 24  ? 24.057  64.259 -27.843 1.00 0.49  ? 24  VAL B CG1  1  
ATOM   3004  C  CG2  . VAL B 2 24  ? 26.394  63.677 -27.195 1.00 0.48  ? 24  VAL B CG2  1  
ATOM   3005  H  H    . VAL B 2 24  ? 27.198  66.748 -26.245 1.00 0.47  ? 24  VAL B H    1  
ATOM   3006  H  HA   . VAL B 2 24  ? 25.883  65.898 -28.788 1.00 0.54  ? 24  VAL B HA   1  
ATOM   3007  H  HB   . VAL B 2 24  ? 25.055  64.906 -26.062 1.00 0.51  ? 24  VAL B HB   1  
ATOM   3008  H  HG11 . VAL B 2 24  ? 23.254  64.967 -27.702 1.00 0.99  ? 24  VAL B HG11 1  
ATOM   3009  H  HG12 . VAL B 2 24  ? 23.758  63.293 -27.465 1.00 1.08  ? 24  VAL B HG12 1  
ATOM   3010  H  HG13 . VAL B 2 24  ? 24.283  64.178 -28.896 1.00 1.21  ? 24  VAL B HG13 1  
ATOM   3011  H  HG21 . VAL B 2 24  ? 27.240  63.974 -26.592 1.00 1.12  ? 24  VAL B HG21 1  
ATOM   3012  H  HG22 . VAL B 2 24  ? 26.704  63.578 -28.225 1.00 1.06  ? 24  VAL B HG22 1  
ATOM   3013  H  HG23 . VAL B 2 24  ? 26.014  62.730 -26.841 1.00 1.17  ? 24  VAL B HG23 1  
ATOM   3014  N  N    . ASN B 2 25  ? 24.258  67.685 -28.522 1.00 0.61  ? 25  ASN B N    1  
ATOM   3015  C  CA   . ASN B 2 25  ? 23.294  68.818 -28.440 1.00 0.55  ? 25  ASN B CA   1  
ATOM   3016  C  C    . ASN B 2 25  ? 21.882  68.248 -28.432 1.00 0.56  ? 25  ASN B C    1  
ATOM   3017  O  O    . ASN B 2 25  ? 21.507  67.481 -29.298 1.00 0.66  ? 25  ASN B O    1  
ATOM   3018  C  CB   . ASN B 2 25  ? 23.475  69.726 -29.660 1.00 0.58  ? 25  ASN B CB   1  
ATOM   3019  C  CG   . ASN B 2 25  ? 22.663  71.011 -29.489 1.00 0.57  ? 25  ASN B CG   1  
ATOM   3020  O  OD1  . ASN B 2 25  ? 22.545  71.796 -30.409 1.00 0.63  ? 25  ASN B OD1  1  
ATOM   3021  N  ND2  . ASN B 2 25  ? 22.095  71.259 -28.346 1.00 0.52  ? 25  ASN B ND2  1  
ATOM   3022  H  H    . ASN B 2 25  ? 24.456  67.281 -29.378 1.00 1.20  ? 25  ASN B H    1  
ATOM   3023  H  HA   . ASN B 2 25  ? 23.466  69.383 -27.537 1.00 0.51  ? 25  ASN B HA   1  
ATOM   3024  H  HB2  . ASN B 2 25  ? 24.519  69.974 -29.767 1.00 0.60  ? 25  ASN B HB2  1  
ATOM   3025  H  HB3  . ASN B 2 25  ? 23.137  69.208 -30.541 1.00 0.63  ? 25  ASN B HB3  1  
ATOM   3026  H  HD21 . ASN B 2 25  ? 22.191  70.626 -27.610 1.00 0.50  ? 25  ASN B HD21 1  
ATOM   3027  H  HD22 . ASN B 2 25  ? 21.573  72.079 -28.224 1.00 0.54  ? 25  ASN B HD22 1  
ATOM   3028  N  N    . SER B 2 26  ? 21.088  68.631 -27.476 1.00 0.49  ? 26  SER B N    1  
ATOM   3029  C  CA   . SER B 2 26  ? 19.714  68.163 -27.393 1.00 0.52  ? 26  SER B CA   1  
ATOM   3030  C  C    . SER B 2 26  ? 18.899  69.372 -27.013 1.00 0.56  ? 26  SER B C    1  
ATOM   3031  O  O    . SER B 2 26  ? 18.899  69.795 -25.876 1.00 1.08  ? 26  SER B O    1  
ATOM   3032  C  CB   . SER B 2 26  ? 19.606  67.076 -26.324 1.00 0.54  ? 26  SER B CB   1  
ATOM   3033  O  OG   . SER B 2 26  ? 18.383  66.370 -26.492 1.00 0.92  ? 26  SER B OG   1  
ATOM   3034  H  H    . SER B 2 26  ? 21.377  69.277 -26.829 1.00 0.48  ? 26  SER B H    1  
ATOM   3035  H  HA   . SER B 2 26  ? 19.379  67.781 -28.350 1.00 0.55  ? 26  SER B HA   1  
ATOM   3036  H  HB2  . SER B 2 26  ? 20.431  66.389 -26.429 1.00 0.63  ? 26  SER B HB2  1  
ATOM   3037  H  HB3  . SER B 2 26  ? 19.642  67.529 -25.341 1.00 0.68  ? 26  SER B HB3  1  
ATOM   3038  H  HG   . SER B 2 26  ? 18.004  66.222 -25.623 1.00 1.29  ? 26  SER B HG   1  
ATOM   3039  N  N    . ASN B 2 27  ? 18.231  69.917 -27.965 1.00 0.66  ? 27  ASN B N    1  
ATOM   3040  C  CA   . ASN B 2 27  ? 17.367  71.115 -27.762 1.00 0.67  ? 27  ASN B CA   1  
ATOM   3041  C  C    . ASN B 2 27  ? 18.157  72.404 -27.988 1.00 0.70  ? 27  ASN B C    1  
ATOM   3042  O  O    . ASN B 2 27  ? 17.627  73.393 -28.454 1.00 0.78  ? 27  ASN B O    1  
ATOM   3043  C  CB   . ASN B 2 27  ? 16.721  71.094 -26.354 1.00 0.66  ? 27  ASN B CB   1  
ATOM   3044  C  CG   . ASN B 2 27  ? 17.515  71.944 -25.347 1.00 0.83  ? 27  ASN B CG   1  
ATOM   3045  O  OD1  . ASN B 2 27  ? 17.677  73.135 -25.530 1.00 1.65  ? 27  ASN B OD1  1  
ATOM   3046  N  ND2  . ASN B 2 27  ? 18.012  71.376 -24.283 1.00 1.17  ? 27  ASN B ND2  1  
ATOM   3047  H  H    . ASN B 2 27  ? 18.310  69.535 -28.846 1.00 1.09  ? 27  ASN B H    1  
ATOM   3048  H  HA   . ASN B 2 27  ? 16.596  71.069 -28.497 1.00 0.71  ? 27  ASN B HA   1  
ATOM   3049  H  HB2  . ASN B 2 27  ? 15.714  71.475 -26.415 1.00 0.81  ? 27  ASN B HB2  1  
ATOM   3050  H  HB3  . ASN B 2 27  ? 16.691  70.079 -26.003 1.00 0.71  ? 27  ASN B HB3  1  
ATOM   3051  H  HD21 . ASN B 2 27  ? 17.877  70.417 -24.133 1.00 1.83  ? 27  ASN B HD21 1  
ATOM   3052  H  HD22 . ASN B 2 27  ? 18.519  71.907 -23.635 1.00 1.26  ? 27  ASN B HD22 1  
ATOM   3053  N  N    . GLY B 2 28  ? 19.409  72.408 -27.648 1.00 0.68  ? 28  GLY B N    1  
ATOM   3054  C  CA   . GLY B 2 28  ? 20.226  73.639 -27.826 1.00 0.75  ? 28  GLY B CA   1  
ATOM   3055  C  C    . GLY B 2 28  ? 21.241  73.719 -26.692 1.00 0.75  ? 28  GLY B C    1  
ATOM   3056  O  O    . GLY B 2 28  ? 22.031  74.640 -26.617 1.00 0.86  ? 28  GLY B O    1  
ATOM   3057  H  H    . GLY B 2 28  ? 19.812  71.605 -27.267 1.00 0.63  ? 28  GLY B H    1  
ATOM   3058  H  HA2  . GLY B 2 28  ? 20.741  73.600 -28.776 1.00 0.88  ? 28  GLY B HA2  1  
ATOM   3059  H  HA3  . GLY B 2 28  ? 19.589  74.510 -27.793 1.00 0.75  ? 28  GLY B HA3  1  
ATOM   3060  N  N    . GLU B 2 29  ? 21.237  72.742 -25.817 1.00 0.69  ? 29  GLU B N    1  
ATOM   3061  C  CA   . GLU B 2 29  ? 22.198  72.713 -24.691 1.00 0.75  ? 29  GLU B CA   1  
ATOM   3062  C  C    . GLU B 2 29  ? 23.125  71.544 -25.008 1.00 0.84  ? 29  GLU B C    1  
ATOM   3063  O  O    . GLU B 2 29  ? 22.735  70.626 -25.698 1.00 1.78  ? 29  GLU B O    1  
ATOM   3064  C  CB   . GLU B 2 29  ? 21.413  72.538 -23.381 1.00 0.67  ? 29  GLU B CB   1  
ATOM   3065  C  CG   . GLU B 2 29  ? 20.952  73.904 -22.851 1.00 0.73  ? 29  GLU B CG   1  
ATOM   3066  C  CD   . GLU B 2 29  ? 20.531  73.772 -21.386 1.00 1.58  ? 29  GLU B CD   1  
ATOM   3067  O  OE1  . GLU B 2 29  ? 19.682  72.942 -21.105 1.00 2.32  ? 29  GLU B OE1  1  
ATOM   3068  O  OE2  . GLU B 2 29  ? 21.065  74.504 -20.569 1.00 2.22  ? 29  GLU B OE2  1  
ATOM   3069  H  H    . GLU B 2 29  ? 20.604  71.996 -25.915 1.00 0.67  ? 29  GLU B H    1  
ATOM   3070  H  HA   . GLU B 2 29  ? 22.781  73.626 -24.668 1.00 0.86  ? 29  GLU B HA   1  
ATOM   3071  H  HB2  . GLU B 2 29  ? 20.535  71.942 -23.573 1.00 0.69  ? 29  GLU B HB2  1  
ATOM   3072  H  HB3  . GLU B 2 29  ? 22.034  72.053 -22.649 1.00 0.81  ? 29  GLU B HB3  1  
ATOM   3073  H  HG2  . GLU B 2 29  ? 21.750  74.619 -22.932 1.00 1.03  ? 29  GLU B HG2  1  
ATOM   3074  H  HG3  . GLU B 2 29  ? 20.108  74.244 -23.431 1.00 1.10  ? 29  GLU B HG3  1  
ATOM   3075  N  N    . LEU B 2 30  ? 24.363  71.588 -24.603 1.00 0.55  ? 30  LEU B N    1  
ATOM   3076  C  CA   . LEU B 2 30  ? 25.331  70.530 -24.973 1.00 0.48  ? 30  LEU B CA   1  
ATOM   3077  C  C    . LEU B 2 30  ? 25.548  69.539 -23.826 1.00 0.48  ? 30  LEU B C    1  
ATOM   3078  O  O    . LEU B 2 30  ? 25.689  69.911 -22.687 1.00 0.63  ? 30  LEU B O    1  
ATOM   3079  C  CB   . LEU B 2 30  ? 26.652  71.241 -25.314 1.00 0.51  ? 30  LEU B CB   1  
ATOM   3080  C  CG   . LEU B 2 30  ? 26.453  72.301 -26.427 1.00 0.51  ? 30  LEU B CG   1  
ATOM   3081  C  CD1  . LEU B 2 30  ? 25.798  71.650 -27.654 1.00 0.48  ? 30  LEU B CD1  1  
ATOM   3082  C  CD2  . LEU B 2 30  ? 25.599  73.490 -25.934 1.00 0.58  ? 30  LEU B CD2  1  
ATOM   3083  H  H    . LEU B 2 30  ? 24.722  72.312 -24.082 1.00 1.21  ? 30  LEU B H    1  
ATOM   3084  H  HA   . LEU B 2 30  ? 24.985  69.989 -25.844 1.00 0.45  ? 30  LEU B HA   1  
ATOM   3085  H  HB2  . LEU B 2 30  ? 27.048  71.726 -24.429 1.00 0.57  ? 30  LEU B HB2  1  
ATOM   3086  H  HB3  . LEU B 2 30  ? 27.347  70.510 -25.659 1.00 0.50  ? 30  LEU B HB3  1  
ATOM   3087  H  HG   . LEU B 2 30  ? 27.420  72.683 -26.714 1.00 0.53  ? 30  LEU B HG   1  
ATOM   3088  H  HD11 . LEU B 2 30  ? 24.727  71.613 -27.516 1.00 1.13  ? 30  LEU B HD11 1  
ATOM   3089  H  HD12 . LEU B 2 30  ? 26.179  70.643 -27.780 1.00 1.16  ? 30  LEU B HD12 1  
ATOM   3090  H  HD13 . LEU B 2 30  ? 26.027  72.233 -28.534 1.00 1.05  ? 30  LEU B HD13 1  
ATOM   3091  H  HD21 . LEU B 2 30  ? 25.951  74.395 -26.407 1.00 1.09  ? 30  LEU B HD21 1  
ATOM   3092  H  HD22 . LEU B 2 30  ? 25.695  73.593 -24.864 1.00 1.27  ? 30  LEU B HD22 1  
ATOM   3093  H  HD23 . LEU B 2 30  ? 24.561  73.339 -26.192 1.00 1.18  ? 30  LEU B HD23 1  
ATOM   3094  N  N    . TYR B 2 31  ? 25.585  68.274 -24.127 1.00 0.40  ? 31  TYR B N    1  
ATOM   3095  C  CA   . TYR B 2 31  ? 25.792  67.248 -23.072 1.00 0.40  ? 31  TYR B CA   1  
ATOM   3096  C  C    . TYR B 2 31  ? 26.733  66.160 -23.587 1.00 0.40  ? 31  TYR B C    1  
ATOM   3097  O  O    . TYR B 2 31  ? 26.636  65.715 -24.705 1.00 0.43  ? 31  TYR B O    1  
ATOM   3098  C  CB   . TYR B 2 31  ? 24.458  66.609 -22.779 1.00 0.41  ? 31  TYR B CB   1  
ATOM   3099  C  CG   . TYR B 2 31  ? 23.458  67.622 -22.332 1.00 0.44  ? 31  TYR B CG   1  
ATOM   3100  C  CD1  . TYR B 2 31  ? 22.872  68.463 -23.270 1.00 0.49  ? 31  TYR B CD1  1  
ATOM   3101  C  CD2  . TYR B 2 31  ? 23.073  67.678 -20.995 1.00 0.47  ? 31  TYR B CD2  1  
ATOM   3102  C  CE1  . TYR B 2 31  ? 21.901  69.365 -22.876 1.00 0.55  ? 31  TYR B CE1  1  
ATOM   3103  C  CE2  . TYR B 2 31  ? 22.100  68.595 -20.587 1.00 0.52  ? 31  TYR B CE2  1  
ATOM   3104  C  CZ   . TYR B 2 31  ? 21.508  69.442 -21.532 1.00 0.56  ? 31  TYR B CZ   1  
ATOM   3105  O  OH   . TYR B 2 31  ? 20.540  70.344 -21.143 1.00 0.63  ? 31  TYR B OH   1  
ATOM   3106  H  H    . TYR B 2 31  ? 25.470  67.998 -25.052 1.00 0.44  ? 31  TYR B H    1  
ATOM   3107  H  HA   . TYR B 2 31  ? 26.193  67.691 -22.174 1.00 0.41  ? 31  TYR B HA   1  
ATOM   3108  H  HB2  . TYR B 2 31  ? 24.112  66.177 -23.673 1.00 0.42  ? 31  TYR B HB2  1  
ATOM   3109  H  HB3  . TYR B 2 31  ? 24.559  65.848 -22.034 1.00 0.42  ? 31  TYR B HB3  1  
ATOM   3110  H  HD1  . TYR B 2 31  ? 23.184  68.427 -24.304 1.00 0.49  ? 31  TYR B HD1  1  
ATOM   3111  H  HD2  . TYR B 2 31  ? 23.540  67.022 -20.280 1.00 0.46  ? 31  TYR B HD2  1  
ATOM   3112  H  HE1  . TYR B 2 31  ? 21.452  69.994 -23.610 1.00 0.60  ? 31  TYR B HE1  1  
ATOM   3113  H  HE2  . TYR B 2 31  ? 21.803  68.648 -19.550 1.00 0.56  ? 31  TYR B HE2  1  
ATOM   3114  H  HH   . TYR B 2 31  ? 20.170  70.741 -21.934 1.00 1.00  ? 31  TYR B HH   1  
ATOM   3115  N  N    . HIS B 2 32  ? 27.630  65.720 -22.770 1.00 0.40  ? 32  HIS B N    1  
ATOM   3116  C  CA   . HIS B 2 32  ? 28.529  64.657 -23.214 1.00 0.42  ? 32  HIS B CA   1  
ATOM   3117  C  C    . HIS B 2 32  ? 27.633  63.475 -23.402 1.00 0.43  ? 32  HIS B C    1  
ATOM   3118  O  O    . HIS B 2 32  ? 26.711  63.296 -22.639 1.00 0.46  ? 32  HIS B O    1  
ATOM   3119  C  CB   . HIS B 2 32  ? 29.550  64.297 -22.122 1.00 0.43  ? 32  HIS B CB   1  
ATOM   3120  C  CG   . HIS B 2 32  ? 30.685  65.258 -22.122 1.00 0.45  ? 32  HIS B CG   1  
ATOM   3121  N  ND1  . HIS B 2 32  ? 30.780  66.255 -21.195 1.00 0.46  ? 32  HIS B ND1  1  
ATOM   3122  C  CD2  . HIS B 2 32  ? 31.769  65.396 -22.938 1.00 0.48  ? 32  HIS B CD2  1  
ATOM   3123  C  CE1  . HIS B 2 32  ? 31.880  66.976 -21.479 1.00 0.50  ? 32  HIS B CE1  1  
ATOM   3124  N  NE2  . HIS B 2 32  ? 32.523  66.488 -22.535 1.00 0.51  ? 32  HIS B NE2  1  
ATOM   3125  H  H    . HIS B 2 32  ? 27.652  66.106 -21.883 1.00 0.41  ? 32  HIS B H    1  
ATOM   3126  H  HA   . HIS B 2 32  ? 29.030  64.924 -24.142 1.00 0.43  ? 32  HIS B HA   1  
ATOM   3127  H  HB2  . HIS B 2 32  ? 29.066  64.323 -21.159 1.00 0.43  ? 32  HIS B HB2  1  
ATOM   3128  H  HB3  . HIS B 2 32  ? 29.935  63.309 -22.303 1.00 0.45  ? 32  HIS B HB3  1  
ATOM   3129  H  HD2  . HIS B 2 32  ? 32.020  64.733 -23.734 1.00 0.49  ? 32  HIS B HD2  1  
ATOM   3130  H  HE1  . HIS B 2 32  ? 32.171  67.869 -20.945 1.00 0.53  ? 32  HIS B HE1  1  
ATOM   3131  H  HE2  . HIS B 2 32  ? 33.348  66.833 -22.935 1.00 0.55  ? 32  HIS B HE2  1  
ATOM   3132  N  N    . GLU B 2 33  ? 27.908  62.594 -24.294 1.00 0.43  ? 33  GLU B N    1  
ATOM   3133  C  CA   . GLU B 2 33  ? 27.071  61.375 -24.301 1.00 0.46  ? 33  GLU B CA   1  
ATOM   3134  C  C    . GLU B 2 33  ? 27.250  60.778 -22.877 1.00 0.49  ? 33  GLU B C    1  
ATOM   3135  O  O    . GLU B 2 33  ? 26.645  59.798 -22.492 1.00 0.55  ? 33  GLU B O    1  
ATOM   3136  C  CB   . GLU B 2 33  ? 27.596  60.389 -25.347 1.00 0.51  ? 33  GLU B CB   1  
ATOM   3137  C  CG   . GLU B 2 33  ? 29.109  60.216 -25.170 1.00 0.56  ? 33  GLU B CG   1  
ATOM   3138  C  CD   . GLU B 2 33  ? 29.614  59.139 -26.133 1.00 0.66  ? 33  GLU B CD   1  
ATOM   3139  O  OE1  . GLU B 2 33  ? 29.148  58.017 -26.031 1.00 1.33  ? 33  GLU B OE1  1  
ATOM   3140  O  OE2  . GLU B 2 33  ? 30.456  59.457 -26.956 1.00 1.24  ? 33  GLU B OE2  1  
ATOM   3141  H  H    . GLU B 2 33  ? 28.695  62.679 -24.868 1.00 0.43  ? 33  GLU B H    1  
ATOM   3142  H  HA   . GLU B 2 33  ? 26.041  61.632 -24.493 1.00 0.45  ? 33  GLU B HA   1  
ATOM   3143  H  HB2  . GLU B 2 33  ? 27.106  59.434 -25.219 1.00 0.63  ? 33  GLU B HB2  1  
ATOM   3144  H  HB3  . GLU B 2 33  ? 27.393  60.769 -26.336 1.00 0.56  ? 33  GLU B HB3  1  
ATOM   3145  H  HG2  . GLU B 2 33  ? 29.604  61.153 -25.386 1.00 0.61  ? 33  GLU B HG2  1  
ATOM   3146  H  HG3  . GLU B 2 33  ? 29.328  59.919 -24.152 1.00 0.62  ? 33  GLU B HG3  1  
ATOM   3147  N  N    . GLN B 2 34  ? 28.107  61.439 -22.101 1.00 0.48  ? 34  GLN B N    1  
ATOM   3148  C  CA   . GLN B 2 34  ? 28.400  61.057 -20.696 1.00 0.53  ? 34  GLN B CA   1  
ATOM   3149  C  C    . GLN B 2 34  ? 27.392  61.742 -19.809 1.00 0.53  ? 34  GLN B C    1  
ATOM   3150  O  O    . GLN B 2 34  ? 27.217  61.416 -18.651 1.00 0.59  ? 34  GLN B O    1  
ATOM   3151  C  CB   . GLN B 2 34  ? 29.839  61.470 -20.320 1.00 0.58  ? 34  GLN B CB   1  
ATOM   3152  C  CG   . GLN B 2 34  ? 30.391  60.541 -19.219 1.00 1.14  ? 34  GLN B CG   1  
ATOM   3153  C  CD   . GLN B 2 34  ? 31.050  59.307 -19.850 1.00 2.23  ? 34  GLN B CD   1  
ATOM   3154  O  OE1  . GLN B 2 34  ? 31.786  58.596 -19.196 1.00 2.85  ? 34  GLN B OE1  1  
ATOM   3155  N  NE2  . GLN B 2 34  ? 30.816  59.025 -21.103 1.00 2.84  ? 34  GLN B NE2  1  
ATOM   3156  H  H    . GLN B 2 34  ? 28.486  62.291 -22.441 1.00 0.45  ? 34  GLN B H    1  
ATOM   3157  H  HA   . GLN B 2 34  ? 28.291  59.986 -20.594 1.00 0.55  ? 34  GLN B HA   1  
ATOM   3158  H  HB2  . GLN B 2 34  ? 30.469  61.399 -21.195 1.00 1.14  ? 34  GLN B HB2  1  
ATOM   3159  H  HB3  . GLN B 2 34  ? 29.844  62.489 -19.961 1.00 1.13  ? 34  GLN B HB3  1  
ATOM   3160  H  HG2  . GLN B 2 34  ? 31.126  61.075 -18.636 1.00 1.62  ? 34  GLN B HG2  1  
ATOM   3161  H  HG3  . GLN B 2 34  ? 29.586  60.223 -18.575 1.00 1.69  ? 34  GLN B HG3  1  
ATOM   3162  H  HE21 . GLN B 2 34  ? 30.224  59.599 -21.632 1.00 2.47  ? 34  GLN B HE21 1  
ATOM   3163  H  HE22 . GLN B 2 34  ? 31.234  58.240 -21.515 1.00 3.77  ? 34  GLN B HE22 1  
ATOM   3164  N  N    . CYS B 2 35  ? 26.753  62.738 -20.358 1.00 0.50  ? 35  CYS B N    1  
ATOM   3165  C  CA   . CYS B 2 35  ? 25.795  63.523 -19.632 1.00 0.53  ? 35  CYS B CA   1  
ATOM   3166  C  C    . CYS B 2 35  ? 24.461  62.952 -20.074 1.00 0.53  ? 35  CYS B C    1  
ATOM   3167  O  O    . CYS B 2 35  ? 23.419  63.166 -19.486 1.00 0.58  ? 35  CYS B O    1  
ATOM   3168  C  CB   . CYS B 2 35  ? 26.090  64.931 -20.061 1.00 0.58  ? 35  CYS B CB   1  
ATOM   3169  S  SG   . CYS B 2 35  ? 27.567  65.474 -19.161 1.00 0.64  ? 35  CYS B SG   1  
ATOM   3170  H  H    . CYS B 2 35  ? 26.925  63.007 -21.288 1.00 0.47  ? 35  CYS B H    1  
ATOM   3171  H  HA   . CYS B 2 35  ? 25.932  63.419 -18.572 1.00 0.56  ? 35  CYS B HA   1  
ATOM   3172  H  HB2  . CYS B 2 35  ? 26.308  64.926 -21.111 1.00 0.65  ? 35  CYS B HB2  1  
ATOM   3173  H  HB3  . CYS B 2 35  ? 25.271  65.568 -19.849 1.00 0.56  ? 35  CYS B HB3  1  
ATOM   3174  N  N    . PHE B 2 36  ? 24.567  62.082 -21.053 1.00 0.51  ? 36  PHE B N    1  
ATOM   3175  C  CA   . PHE B 2 36  ? 23.380  61.294 -21.508 1.00 0.53  ? 36  PHE B CA   1  
ATOM   3176  C  C    . PHE B 2 36  ? 23.335  60.104 -20.573 1.00 0.54  ? 36  PHE B C    1  
ATOM   3177  O  O    . PHE B 2 36  ? 23.896  59.054 -20.821 1.00 0.66  ? 36  PHE B O    1  
ATOM   3178  C  CB   . PHE B 2 36  ? 23.545  60.722 -22.929 1.00 0.51  ? 36  PHE B CB   1  
ATOM   3179  C  CG   . PHE B 2 36  ? 22.974  61.685 -23.897 1.00 0.52  ? 36  PHE B CG   1  
ATOM   3180  C  CD1  . PHE B 2 36  ? 23.438  62.973 -23.857 1.00 0.49  ? 36  PHE B CD1  1  
ATOM   3181  C  CD2  . PHE B 2 36  ? 21.977  61.301 -24.806 1.00 0.60  ? 36  PHE B CD2  1  
ATOM   3182  C  CE1  . PHE B 2 36  ? 22.908  63.914 -24.734 1.00 0.51  ? 36  PHE B CE1  1  
ATOM   3183  C  CE2  . PHE B 2 36  ? 21.448  62.243 -25.688 1.00 0.63  ? 36  PHE B CE2  1  
ATOM   3184  C  CZ   . PHE B 2 36  ? 21.914  63.554 -25.650 1.00 0.56  ? 36  PHE B CZ   1  
ATOM   3185  H  H    . PHE B 2 36  ? 25.460  61.926 -21.446 1.00 0.51  ? 36  PHE B H    1  
ATOM   3186  H  HA   . PHE B 2 36  ? 22.474  61.879 -21.416 1.00 0.56  ? 36  PHE B HA   1  
ATOM   3187  H  HB2  . PHE B 2 36  ? 24.585  60.577 -23.136 1.00 0.50  ? 36  PHE B HB2  1  
ATOM   3188  H  HB3  . PHE B 2 36  ? 23.026  59.774 -23.019 1.00 0.54  ? 36  PHE B HB3  1  
ATOM   3189  H  HD1  . PHE B 2 36  ? 24.217  63.240 -23.131 1.00 0.50  ? 36  PHE B HD1  1  
ATOM   3190  H  HD2  . PHE B 2 36  ? 21.624  60.280 -24.826 1.00 0.67  ? 36  PHE B HD2  1  
ATOM   3191  H  HE1  . PHE B 2 36  ? 23.259  64.904 -24.710 1.00 0.53  ? 36  PHE B HE1  1  
ATOM   3192  H  HE2  . PHE B 2 36  ? 20.681  61.962 -26.392 1.00 0.72  ? 36  PHE B HE2  1  
ATOM   3193  H  HZ   . PHE B 2 36  ? 21.506  64.292 -26.324 1.00 0.59  ? 36  PHE B HZ   1  
ATOM   3194  N  N    . VAL B 2 37  ? 22.653  60.292 -19.508 1.00 0.48  ? 37  VAL B N    1  
ATOM   3195  C  CA   . VAL B 2 37  ? 22.521  59.217 -18.467 1.00 0.51  ? 37  VAL B CA   1  
ATOM   3196  C  C    . VAL B 2 37  ? 21.097  59.210 -17.928 1.00 0.49  ? 37  VAL B C    1  
ATOM   3197  O  O    . VAL B 2 37  ? 20.590  60.215 -17.498 1.00 0.48  ? 37  VAL B O    1  
ATOM   3198  C  CB   . VAL B 2 37  ? 23.495  59.514 -17.319 1.00 0.55  ? 37  VAL B CB   1  
ATOM   3199  C  CG1  . VAL B 2 37  ? 24.890  59.777 -17.890 1.00 0.58  ? 37  VAL B CG1  1  
ATOM   3200  C  CG2  . VAL B 2 37  ? 23.020  60.743 -16.530 1.00 0.55  ? 37  VAL B CG2  1  
ATOM   3201  H  H    . VAL B 2 37  ? 22.226  61.167 -19.393 1.00 0.49  ? 37  VAL B H    1  
ATOM   3202  H  HA   . VAL B 2 37  ? 22.745  58.254 -18.894 1.00 0.53  ? 37  VAL B HA   1  
ATOM   3203  H  HB   . VAL B 2 37  ? 23.534  58.665 -16.660 1.00 0.57  ? 37  VAL B HB   1  
ATOM   3204  H  HG11 . VAL B 2 37  ? 25.607  59.827 -17.084 1.00 1.18  ? 37  VAL B HG11 1  
ATOM   3205  H  HG12 . VAL B 2 37  ? 24.888  60.714 -18.428 1.00 1.10  ? 37  VAL B HG12 1  
ATOM   3206  H  HG13 . VAL B 2 37  ? 25.161  58.977 -18.563 1.00 1.20  ? 37  VAL B HG13 1  
ATOM   3207  H  HG21 . VAL B 2 37  ? 22.646  61.491 -17.214 1.00 1.17  ? 37  VAL B HG21 1  
ATOM   3208  H  HG22 . VAL B 2 37  ? 23.843  61.153 -15.963 1.00 1.13  ? 37  VAL B HG22 1  
ATOM   3209  H  HG23 . VAL B 2 37  ? 22.230  60.448 -15.852 1.00 1.15  ? 37  VAL B HG23 1  
ATOM   3210  N  N    . CYS B 2 38  ? 20.476  58.046 -17.906 1.00 0.51  ? 38  CYS B N    1  
ATOM   3211  C  CA   . CYS B 2 38  ? 19.090  57.924 -17.357 1.00 0.51  ? 38  CYS B CA   1  
ATOM   3212  C  C    . CYS B 2 38  ? 19.127  58.115 -15.850 1.00 0.55  ? 38  CYS B C    1  
ATOM   3213  O  O    . CYS B 2 38  ? 19.889  57.463 -15.195 1.00 0.64  ? 38  CYS B O    1  
ATOM   3214  C  CB   . CYS B 2 38  ? 18.553  56.563 -17.741 1.00 0.52  ? 38  CYS B CB   1  
ATOM   3215  S  SG   . CYS B 2 38  ? 17.328  56.716 -19.075 1.00 0.55  ? 38  CYS B SG   1  
ATOM   3216  H  H    . CYS B 2 38  ? 20.968  57.211 -18.172 1.00 0.54  ? 38  CYS B H    1  
ATOM   3217  H  HA   . CYS B 2 38  ? 18.470  58.682 -17.782 1.00 0.51  ? 38  CYS B HA   1  
ATOM   3218  H  HB2  . CYS B 2 38  ? 19.379  55.977 -18.077 1.00 0.55  ? 38  CYS B HB2  1  
ATOM   3219  H  HB3  . CYS B 2 38  ? 18.100  56.093 -16.897 1.00 0.57  ? 38  CYS B HB3  1  
ATOM   3220  N  N    . ALA B 2 39  ? 18.292  58.954 -15.298 1.00 0.55  ? 39  ALA B N    1  
ATOM   3221  C  CA   . ALA B 2 39  ? 18.323  59.185 -13.815 1.00 0.60  ? 39  ALA B CA   1  
ATOM   3222  C  C    . ALA B 2 39  ? 18.102  57.859 -13.062 1.00 0.63  ? 39  ALA B C    1  
ATOM   3223  O  O    . ALA B 2 39  ? 18.557  57.681 -11.952 1.00 0.71  ? 39  ALA B O    1  
ATOM   3224  C  CB   . ALA B 2 39  ? 17.192  60.155 -13.450 1.00 0.63  ? 39  ALA B CB   1  
ATOM   3225  H  H    . ALA B 2 39  ? 17.660  59.446 -15.859 1.00 0.57  ? 39  ALA B H    1  
ATOM   3226  H  HA   . ALA B 2 39  ? 19.263  59.630 -13.532 1.00 0.66  ? 39  ALA B HA   1  
ATOM   3227  H  HB1  . ALA B 2 39  ? 17.045  60.150 -12.380 1.00 1.29  ? 39  ALA B HB1  1  
ATOM   3228  H  HB2  . ALA B 2 39  ? 16.279  59.846 -13.939 1.00 1.19  ? 39  ALA B HB2  1  
ATOM   3229  H  HB3  . ALA B 2 39  ? 17.452  61.155 -13.772 1.00 1.14  ? 39  ALA B HB3  1  
ATOM   3230  N  N    . GLN B 2 40  ? 17.450  56.921 -13.680 1.00 0.62  ? 40  GLN B N    1  
ATOM   3231  C  CA   . GLN B 2 40  ? 17.229  55.567 -13.056 1.00 0.71  ? 40  GLN B CA   1  
ATOM   3232  C  C    . GLN B 2 40  ? 18.268  54.619 -13.645 1.00 0.68  ? 40  GLN B C    1  
ATOM   3233  O  O    . GLN B 2 40  ? 18.865  53.774 -13.008 1.00 0.76  ? 40  GLN B O    1  
ATOM   3234  C  CB   . GLN B 2 40  ? 15.824  55.062 -13.394 1.00 0.84  ? 40  GLN B CB   1  
ATOM   3235  C  CG   . GLN B 2 40  ? 14.798  55.782 -12.519 1.00 1.12  ? 40  GLN B CG   1  
ATOM   3236  C  CD   . GLN B 2 40  ? 13.408  55.194 -12.766 1.00 1.82  ? 40  GLN B CD   1  
ATOM   3237  O  OE1  . GLN B 2 40  ? 12.498  55.409 -11.990 1.00 2.40  ? 40  GLN B OE1  1  
ATOM   3238  N  NE2  . GLN B 2 40  ? 13.202  54.456 -13.823 1.00 2.54  ? 40  GLN B NE2  1  
ATOM   3239  H  H    . GLN B 2 40  ? 17.144  57.082 -14.601 1.00 0.60  ? 40  GLN B H    1  
ATOM   3240  H  HA   . GLN B 2 40  ? 17.354  55.627 -11.986 1.00 0.82  ? 40  GLN B HA   1  
ATOM   3241  H  HB2  . GLN B 2 40  ? 15.612  55.258 -14.435 1.00 1.38  ? 40  GLN B HB2  1  
ATOM   3242  H  HB3  . GLN B 2 40  ? 15.768  54.000 -13.209 1.00 1.26  ? 40  GLN B HB3  1  
ATOM   3243  H  HG2  . GLN B 2 40  ? 15.063  55.658 -11.479 1.00 1.58  ? 40  GLN B HG2  1  
ATOM   3244  H  HG3  . GLN B 2 40  ? 14.792  56.832 -12.765 1.00 1.61  ? 40  GLN B HG3  1  
ATOM   3245  H  HE21 . GLN B 2 40  ? 13.935  54.282 -14.449 1.00 2.67  ? 40  GLN B HE21 1  
ATOM   3246  H  HE22 . GLN B 2 40  ? 12.314  54.075 -13.989 1.00 3.25  ? 40  GLN B HE22 1  
ATOM   3247  N  N    . CYS B 2 41  ? 18.396  54.800 -14.910 1.00 0.64  ? 41  CYS B N    1  
ATOM   3248  C  CA   . CYS B 2 41  ? 19.266  54.053 -15.840 1.00 0.71  ? 41  CYS B CA   1  
ATOM   3249  C  C    . CYS B 2 41  ? 20.560  54.851 -16.064 1.00 0.67  ? 41  CYS B C    1  
ATOM   3250  O  O    . CYS B 2 41  ? 21.224  54.625 -17.038 1.00 0.77  ? 41  CYS B O    1  
ATOM   3251  C  CB   . CYS B 2 41  ? 18.551  53.551 -17.133 1.00 0.79  ? 41  CYS B CB   1  
ATOM   3252  S  SG   . CYS B 2 41  ? 16.763  53.794 -17.001 1.00 0.67  ? 41  CYS B SG   1  
ATOM   3253  H  H    . CYS B 2 41  ? 17.851  55.505 -15.305 1.00 0.63  ? 41  CYS B H    1  
ATOM   3254  H  HA   . CYS B 2 41  ? 19.579  53.165 -15.290 1.00 0.77  ? 41  CYS B HA   1  
ATOM   3255  H  HB2  . CYS B 2 41  ? 18.925  54.042 -17.998 1.00 0.96  ? 41  CYS B HB2  1  
ATOM   3256  H  HB3  . CYS B 2 41  ? 18.740  52.490 -17.248 1.00 0.99  ? 41  CYS B HB3  1  
ATOM   3257  N  N    . PHE B 2 42  ? 20.804  55.928 -15.268 1.00 0.60  ? 42  PHE B N    1  
ATOM   3258  C  CA   . PHE B 2 42  ? 21.942  56.966 -15.413 1.00 0.60  ? 42  PHE B CA   1  
ATOM   3259  C  C    . PHE B 2 42  ? 23.207  56.310 -15.637 1.00 0.64  ? 42  PHE B C    1  
ATOM   3260  O  O    . PHE B 2 42  ? 24.298  56.849 -15.554 1.00 0.72  ? 42  PHE B O    1  
ATOM   3261  C  CB   . PHE B 2 42  ? 22.144  57.835 -14.160 1.00 0.67  ? 42  PHE B CB   1  
ATOM   3262  C  CG   . PHE B 2 42  ? 21.722  57.089 -12.904 1.00 1.00  ? 42  PHE B CG   1  
ATOM   3263  C  CD1  . PHE B 2 42  ? 21.886  55.695 -12.791 1.00 1.93  ? 42  PHE B CD1  1  
ATOM   3264  C  CD2  . PHE B 2 42  ? 21.164  57.808 -11.841 1.00 1.19  ? 42  PHE B CD2  1  
ATOM   3265  C  CE1  . PHE B 2 42  ? 21.490  55.036 -11.620 1.00 2.70  ? 42  PHE B CE1  1  
ATOM   3266  C  CE2  . PHE B 2 42  ? 20.770  57.144 -10.673 1.00 1.79  ? 42  PHE B CE2  1  
ATOM   3267  C  CZ   . PHE B 2 42  ? 20.933  55.760 -10.563 1.00 2.52  ? 42  PHE B CZ   1  
ATOM   3268  H  H    . PHE B 2 42  ? 20.130  56.149 -14.642 1.00 0.58  ? 42  PHE B H    1  
ATOM   3269  H  HA   . PHE B 2 42  ? 21.751  57.581 -16.236 1.00 0.56  ? 42  PHE B HA   1  
ATOM   3270  H  HB2  . PHE B 2 42  ? 23.202  58.095 -14.095 1.00 0.97  ? 42  PHE B HB2  1  
ATOM   3271  H  HB3  . PHE B 2 42  ? 21.565  58.745 -14.249 1.00 1.05  ? 42  PHE B HB3  1  
ATOM   3272  H  HD1  . PHE B 2 42  ? 22.314  55.127 -13.596 1.00 2.23  ? 42  PHE B HD1  1  
ATOM   3273  H  HD2  . PHE B 2 42  ? 21.036  58.877 -11.922 1.00 1.44  ? 42  PHE B HD2  1  
ATOM   3274  H  HE1  . PHE B 2 42  ? 21.616  53.967 -11.534 1.00 3.53  ? 42  PHE B HE1  1  
ATOM   3275  H  HE2  . PHE B 2 42  ? 20.340  57.702 -9.858  1.00 2.01  ? 42  PHE B HE2  1  
ATOM   3276  H  HZ   . PHE B 2 42  ? 20.627  55.251 -9.661  1.00 3.15  ? 42  PHE B HZ   1  
ATOM   3277  N  N    . GLN B 2 43  ? 23.002  55.259 -16.191 1.00 0.63  ? 43  GLN B N    1  
ATOM   3278  C  CA   . GLN B 2 43  ? 24.127  54.590 -16.788 1.00 0.71  ? 43  GLN B CA   1  
ATOM   3279  C  C    . GLN B 2 43  ? 23.850  55.132 -18.171 1.00 0.70  ? 43  GLN B C    1  
ATOM   3280  O  O    . GLN B 2 43  ? 22.732  55.537 -18.488 1.00 0.86  ? 43  GLN B O    1  
ATOM   3281  C  CB   . GLN B 2 43  ? 24.052  53.040 -16.715 1.00 0.75  ? 43  GLN B CB   1  
ATOM   3282  C  CG   . GLN B 2 43  ? 22.717  52.481 -17.236 1.00 1.44  ? 43  GLN B CG   1  
ATOM   3283  C  CD   . GLN B 2 43  ? 22.877  50.992 -17.561 1.00 2.08  ? 43  GLN B CD   1  
ATOM   3284  O  OE1  . GLN B 2 43  ? 22.020  50.193 -17.239 1.00 2.80  ? 43  GLN B OE1  1  
ATOM   3285  N  NE2  . GLN B 2 43  ? 23.945  50.583 -18.190 1.00 2.62  ? 43  GLN B NE2  1  
ATOM   3286  H  H    . GLN B 2 43  ? 22.060  55.062 -16.438 1.00 0.61  ? 43  GLN B H    1  
ATOM   3287  H  HA   . GLN B 2 43  ? 25.087  54.956 -16.421 1.00 0.78  ? 43  GLN B HA   1  
ATOM   3288  H  HB2  . GLN B 2 43  ? 24.858  52.628 -17.303 1.00 1.21  ? 43  GLN B HB2  1  
ATOM   3289  H  HB3  . GLN B 2 43  ? 24.182  52.734 -15.686 1.00 1.13  ? 43  GLN B HB3  1  
ATOM   3290  H  HG2  . GLN B 2 43  ? 21.962  52.589 -16.473 1.00 2.07  ? 43  GLN B HG2  1  
ATOM   3291  H  HG3  . GLN B 2 43  ? 22.418  53.005 -18.129 1.00 2.01  ? 43  GLN B HG3  1  
ATOM   3292  H  HE21 . GLN B 2 43  ? 24.637  51.226 -18.451 1.00 2.58  ? 43  GLN B HE21 1  
ATOM   3293  H  HE22 . GLN B 2 43  ? 24.055  49.632 -18.402 1.00 3.43  ? 43  GLN B HE22 1  
ATOM   3294  N  N    . GLN B 2 44  ? 24.816  55.297 -18.928 1.00 0.63  ? 44  GLN B N    1  
ATOM   3295  C  CA   . GLN B 2 44  ? 24.575  55.973 -20.216 1.00 0.64  ? 44  GLN B CA   1  
ATOM   3296  C  C    . GLN B 2 44  ? 23.494  55.241 -20.994 1.00 0.65  ? 44  GLN B C    1  
ATOM   3297  O  O    . GLN B 2 44  ? 23.409  54.029 -21.007 1.00 0.80  ? 44  GLN B O    1  
ATOM   3298  C  CB   . GLN B 2 44  ? 25.868  55.985 -21.033 1.00 0.72  ? 44  GLN B CB   1  
ATOM   3299  C  CG   . GLN B 2 44  ? 26.878  56.926 -20.374 1.00 1.12  ? 44  GLN B CG   1  
ATOM   3300  C  CD   . GLN B 2 44  ? 28.188  56.906 -21.164 1.00 1.75  ? 44  GLN B CD   1  
ATOM   3301  O  OE1  . GLN B 2 44  ? 28.940  55.954 -21.091 1.00 2.36  ? 44  GLN B OE1  1  
ATOM   3302  N  NE2  . GLN B 2 44  ? 28.494  57.923 -21.921 1.00 2.21  ? 44  GLN B NE2  1  
ATOM   3303  H  H    . GLN B 2 44  ? 25.671  55.145 -18.585 1.00 0.65  ? 44  GLN B H    1  
ATOM   3304  H  HA   . GLN B 2 44  ? 24.264  56.977 -20.031 1.00 0.61  ? 44  GLN B HA   1  
ATOM   3305  H  HB2  . GLN B 2 44  ? 26.278  54.986 -21.075 1.00 0.90  ? 44  GLN B HB2  1  
ATOM   3306  H  HB3  . GLN B 2 44  ? 25.658  56.331 -22.034 1.00 1.03  ? 44  GLN B HB3  1  
ATOM   3307  H  HG2  . GLN B 2 44  ? 26.479  57.930 -20.362 1.00 1.59  ? 44  GLN B HG2  1  
ATOM   3308  H  HG3  . GLN B 2 44  ? 27.065  56.601 -19.362 1.00 1.74  ? 44  GLN B HG3  1  
ATOM   3309  H  HE21 . GLN B 2 44  ? 27.886  58.690 -21.980 1.00 1.96  ? 44  GLN B HE21 1  
ATOM   3310  H  HE22 . GLN B 2 44  ? 29.331  57.921 -22.430 1.00 2.99  ? 44  GLN B HE22 1  
ATOM   3311  N  N    . PHE B 2 45  ? 22.673  56.003 -21.649 1.00 0.67  ? 45  PHE B N    1  
ATOM   3312  C  CA   . PHE B 2 45  ? 21.571  55.423 -22.459 1.00 0.71  ? 45  PHE B CA   1  
ATOM   3313  C  C    . PHE B 2 45  ? 22.114  54.877 -23.803 1.00 0.68  ? 45  PHE B C    1  
ATOM   3314  O  O    . PHE B 2 45  ? 22.742  55.617 -24.534 1.00 0.75  ? 45  PHE B O    1  
ATOM   3315  C  CB   . PHE B 2 45  ? 20.484  56.442 -22.776 1.00 0.80  ? 45  PHE B CB   1  
ATOM   3316  C  CG   . PHE B 2 45  ? 19.372  55.681 -23.467 1.00 1.19  ? 45  PHE B CG   1  
ATOM   3317  C  CD1  . PHE B 2 45  ? 18.376  55.051 -22.711 1.00 1.78  ? 45  PHE B CD1  1  
ATOM   3318  C  CD2  . PHE B 2 45  ? 19.364  55.565 -24.861 1.00 1.79  ? 45  PHE B CD2  1  
ATOM   3319  C  CE1  . PHE B 2 45  ? 17.372  54.310 -23.351 1.00 2.26  ? 45  PHE B CE1  1  
ATOM   3320  C  CE2  . PHE B 2 45  ? 18.356  54.828 -25.498 1.00 2.44  ? 45  PHE B CE2  1  
ATOM   3321  C  CZ   . PHE B 2 45  ? 17.362  54.202 -24.743 1.00 2.47  ? 45  PHE B CZ   1  
ATOM   3322  H  H    . PHE B 2 45  ? 22.775  56.961 -21.580 1.00 0.78  ? 45  PHE B H    1  
ATOM   3323  H  HA   . PHE B 2 45  ? 21.132  54.646 -21.871 1.00 0.72  ? 45  PHE B HA   1  
ATOM   3324  H  HB2  . PHE B 2 45  ? 20.119  56.890 -21.862 1.00 0.96  ? 45  PHE B HB2  1  
ATOM   3325  H  HB3  . PHE B 2 45  ? 20.870  57.203 -23.436 1.00 1.02  ? 45  PHE B HB3  1  
ATOM   3326  H  HD1  . PHE B 2 45  ? 18.379  55.139 -21.635 1.00 2.22  ? 45  PHE B HD1  1  
ATOM   3327  H  HD2  . PHE B 2 45  ? 20.134  56.044 -25.444 1.00 2.12  ? 45  PHE B HD2  1  
ATOM   3328  H  HE1  . PHE B 2 45  ? 16.606  53.821 -22.768 1.00 2.80  ? 45  PHE B HE1  1  
ATOM   3329  H  HE2  . PHE B 2 45  ? 18.348  54.740 -26.572 1.00 3.14  ? 45  PHE B HE2  1  
ATOM   3330  H  HZ   . PHE B 2 45  ? 16.589  53.631 -25.235 1.00 3.00  ? 45  PHE B HZ   1  
ATOM   3331  N  N    . PRO B 2 46  ? 21.870  53.620 -24.113 1.00 0.64  ? 46  PRO B N    1  
ATOM   3332  C  CA   . PRO B 2 46  ? 22.343  53.020 -25.374 1.00 0.66  ? 46  PRO B CA   1  
ATOM   3333  C  C    . PRO B 2 46  ? 21.708  53.692 -26.605 1.00 0.68  ? 46  PRO B C    1  
ATOM   3334  O  O    . PRO B 2 46  ? 20.530  53.967 -26.666 1.00 0.76  ? 46  PRO B O    1  
ATOM   3335  C  CB   . PRO B 2 46  ? 21.973  51.527 -25.287 1.00 0.72  ? 46  PRO B CB   1  
ATOM   3336  C  CG   . PRO B 2 46  ? 21.055  51.367 -24.055 1.00 0.74  ? 46  PRO B CG   1  
ATOM   3337  C  CD   . PRO B 2 46  ? 21.113  52.686 -23.256 1.00 0.66  ? 46  PRO B CD   1  
ATOM   3338  H  HA   . PRO B 2 46  ? 23.415  53.120 -25.440 1.00 0.70  ? 46  PRO B HA   1  
ATOM   3339  H  HB2  . PRO B 2 46  ? 21.457  51.209 -26.187 1.00 0.75  ? 46  PRO B HB2  1  
ATOM   3340  H  HB3  . PRO B 2 46  ? 22.866  50.930 -25.152 1.00 0.78  ? 46  PRO B HB3  1  
ATOM   3341  H  HG2  . PRO B 2 46  ? 20.046  51.187 -24.392 1.00 0.80  ? 46  PRO B HG2  1  
ATOM   3342  H  HG3  . PRO B 2 46  ? 21.389  50.545 -23.436 1.00 0.81  ? 46  PRO B HG3  1  
ATOM   3343  H  HD2  . PRO B 2 46  ? 20.111  53.059 -23.081 1.00 0.68  ? 46  PRO B HD2  1  
ATOM   3344  H  HD3  . PRO B 2 46  ? 21.638  52.548 -22.317 1.00 0.67  ? 46  PRO B HD3  1  
ATOM   3345  N  N    . GLU B 2 47  ? 22.539  53.968 -27.554 1.00 0.70  ? 47  GLU B N    1  
ATOM   3346  C  CA   . GLU B 2 47  ? 22.169  54.647 -28.822 1.00 0.77  ? 47  GLU B CA   1  
ATOM   3347  C  C    . GLU B 2 47  ? 21.836  56.089 -28.539 1.00 0.76  ? 47  GLU B C    1  
ATOM   3348  O  O    . GLU B 2 47  ? 21.536  56.870 -29.420 1.00 0.95  ? 47  GLU B O    1  
ATOM   3349  C  CB   . GLU B 2 47  ? 20.955  53.937 -29.423 1.00 0.79  ? 47  GLU B CB   1  
ATOM   3350  C  CG   . GLU B 2 47  ? 20.883  54.224 -30.920 1.00 1.60  ? 47  GLU B CG   1  
ATOM   3351  C  CD   . GLU B 2 47  ? 19.723  53.443 -31.541 1.00 1.99  ? 47  GLU B CD   1  
ATOM   3352  O  OE1  . GLU B 2 47  ? 19.550  52.290 -31.181 1.00 2.25  ? 47  GLU B OE1  1  
ATOM   3353  O  OE2  . GLU B 2 47  ? 19.028  54.010 -32.368 1.00 2.69  ? 47  GLU B OE2  1  
ATOM   3354  H  H    . GLU B 2 47  ? 23.468  53.771 -27.405 1.00 0.73  ? 47  GLU B H    1  
ATOM   3355  H  HA   . GLU B 2 47  ? 23.001  54.597 -29.509 1.00 0.88  ? 47  GLU B HA   1  
ATOM   3356  H  HB2  . GLU B 2 47  ? 21.054  52.879 -29.260 1.00 1.24  ? 47  GLU B HB2  1  
ATOM   3357  H  HB3  . GLU B 2 47  ? 20.050  54.288 -28.948 1.00 1.25  ? 47  GLU B HB3  1  
ATOM   3358  H  HG2  . GLU B 2 47  ? 20.732  55.281 -31.069 1.00 2.15  ? 47  GLU B HG2  1  
ATOM   3359  H  HG3  . GLU B 2 47  ? 21.808  53.924 -31.383 1.00 2.25  ? 47  GLU B HG3  1  
ATOM   3360  N  N    . GLY B 2 48  ? 22.093  56.470 -27.344 1.00 0.67  ? 48  GLY B N    1  
ATOM   3361  C  CA   . GLY B 2 48  ? 22.027  57.895 -26.993 1.00 0.75  ? 48  GLY B CA   1  
ATOM   3362  C  C    . GLY B 2 48  ? 20.613  58.502 -26.940 1.00 0.71  ? 48  GLY B C    1  
ATOM   3363  O  O    . GLY B 2 48  ? 20.488  59.705 -26.871 1.00 0.87  ? 48  GLY B O    1  
ATOM   3364  H  H    . GLY B 2 48  ? 22.464  55.828 -26.712 1.00 0.66  ? 48  GLY B H    1  
ATOM   3365  H  HA2  . GLY B 2 48  ? 22.488  58.007 -26.027 1.00 0.80  ? 48  GLY B HA2  1  
ATOM   3366  H  HA3  . GLY B 2 48  ? 22.618  58.422 -27.715 1.00 0.84  ? 48  GLY B HA3  1  
ATOM   3367  N  N    . LEU B 2 49  ? 19.550  57.744 -26.992 1.00 0.63  ? 49  LEU B N    1  
ATOM   3368  C  CA   . LEU B 2 49  ? 18.196  58.396 -26.965 1.00 0.73  ? 49  LEU B CA   1  
ATOM   3369  C  C    . LEU B 2 49  ? 17.746  58.570 -25.555 1.00 0.65  ? 49  LEU B C    1  
ATOM   3370  O  O    . LEU B 2 49  ? 17.675  57.646 -24.768 1.00 0.97  ? 49  LEU B O    1  
ATOM   3371  C  CB   . LEU B 2 49  ? 17.184  57.566 -27.765 1.00 1.02  ? 49  LEU B CB   1  
ATOM   3372  C  CG   . LEU B 2 49  ? 17.325  57.874 -29.258 1.00 0.77  ? 49  LEU B CG   1  
ATOM   3373  C  CD1  . LEU B 2 49  ? 18.729  57.493 -29.729 1.00 1.63  ? 49  LEU B CD1  1  
ATOM   3374  C  CD2  . LEU B 2 49  ? 16.288  57.066 -30.041 1.00 1.41  ? 49  LEU B CD2  1  
ATOM   3375  H  H    . LEU B 2 49  ? 19.631  56.774 -27.064 1.00 0.63  ? 49  LEU B H    1  
ATOM   3376  H  HA   . LEU B 2 49  ? 18.247  59.385 -27.362 1.00 0.82  ? 49  LEU B HA   1  
ATOM   3377  H  HB2  . LEU B 2 49  ? 17.367  56.522 -27.599 1.00 1.54  ? 49  LEU B HB2  1  
ATOM   3378  H  HB3  . LEU B 2 49  ? 16.186  57.807 -27.446 1.00 1.51  ? 49  LEU B HB3  1  
ATOM   3379  H  HG   . LEU B 2 49  ? 17.163  58.930 -29.424 1.00 1.54  ? 49  LEU B HG   1  
ATOM   3380  H  HD11 . LEU B 2 49  ? 18.754  57.476 -30.809 1.00 2.12  ? 49  LEU B HD11 1  
ATOM   3381  H  HD12 . LEU B 2 49  ? 18.983  56.515 -29.348 1.00 2.18  ? 49  LEU B HD12 1  
ATOM   3382  H  HD13 . LEU B 2 49  ? 19.440  58.218 -29.364 1.00 2.21  ? 49  LEU B HD13 1  
ATOM   3383  H  HD21 . LEU B 2 49  ? 15.302  57.270 -29.649 1.00 1.98  ? 49  LEU B HD21 1  
ATOM   3384  H  HD22 . LEU B 2 49  ? 16.504  56.013 -29.943 1.00 1.99  ? 49  LEU B HD22 1  
ATOM   3385  H  HD23 . LEU B 2 49  ? 16.326  57.346 -31.083 1.00 1.96  ? 49  LEU B HD23 1  
ATOM   3386  N  N    . PHE B 2 50  ? 17.487  59.811 -25.236 1.00 0.57  ? 50  PHE B N    1  
ATOM   3387  C  CA   . PHE B 2 50  ? 17.083  60.162 -23.874 1.00 0.66  ? 50  PHE B CA   1  
ATOM   3388  C  C    . PHE B 2 50  ? 15.837  61.086 -23.878 1.00 0.69  ? 50  PHE B C    1  
ATOM   3389  O  O    . PHE B 2 50  ? 15.589  61.786 -24.840 1.00 0.88  ? 50  PHE B O    1  
ATOM   3390  C  CB   . PHE B 2 50  ? 18.305  60.916 -23.306 1.00 0.82  ? 50  PHE B CB   1  
ATOM   3391  C  CG   . PHE B 2 50  ? 18.380  60.899 -21.804 1.00 1.20  ? 50  PHE B CG   1  
ATOM   3392  C  CD1  . PHE B 2 50  ? 17.435  60.221 -21.045 1.00 1.07  ? 50  PHE B CD1  1  
ATOM   3393  C  CD2  . PHE B 2 50  ? 19.418  61.594 -21.173 1.00 2.22  ? 50  PHE B CD2  1  
ATOM   3394  C  CE1  . PHE B 2 50  ? 17.524  60.233 -19.658 1.00 1.66  ? 50  PHE B CE1  1  
ATOM   3395  C  CE2  . PHE B 2 50  ? 19.507  61.600 -19.783 1.00 2.92  ? 50  PHE B CE2  1  
ATOM   3396  C  CZ   . PHE B 2 50  ? 18.555  60.916 -19.031 1.00 2.58  ? 50  PHE B CZ   1  
ATOM   3397  H  H    . PHE B 2 50  ? 17.599  60.511 -25.909 1.00 0.74  ? 50  PHE B H    1  
ATOM   3398  H  HA   . PHE B 2 50  ? 16.894  59.267 -23.324 1.00 0.76  ? 50  PHE B HA   1  
ATOM   3399  H  HB2  . PHE B 2 50  ? 19.203  60.463 -23.695 1.00 1.15  ? 50  PHE B HB2  1  
ATOM   3400  H  HB3  . PHE B 2 50  ? 18.267  61.944 -23.642 1.00 0.95  ? 50  PHE B HB3  1  
ATOM   3401  H  HD1  . PHE B 2 50  ? 16.647  59.678 -21.535 1.00 1.13  ? 50  PHE B HD1  1  
ATOM   3402  H  HD2  . PHE B 2 50  ? 20.152  62.121 -21.763 1.00 2.56  ? 50  PHE B HD2  1  
ATOM   3403  H  HE1  . PHE B 2 50  ? 16.795  59.723 -19.067 1.00 1.66  ? 50  PHE B HE1  1  
ATOM   3404  H  HE2  . PHE B 2 50  ? 20.309  62.131 -19.292 1.00 3.78  ? 50  PHE B HE2  1  
ATOM   3405  H  HZ   . PHE B 2 50  ? 18.608  60.919 -17.960 1.00 3.16  ? 50  PHE B HZ   1  
ATOM   3406  N  N    . TYR B 2 51  ? 15.077  61.137 -22.787 1.00 0.64  ? 51  TYR B N    1  
ATOM   3407  C  CA   . TYR B 2 51  ? 13.920  62.033 -22.699 1.00 0.70  ? 51  TYR B CA   1  
ATOM   3408  C  C    . TYR B 2 51  ? 13.932  62.662 -21.304 1.00 0.64  ? 51  TYR B C    1  
ATOM   3409  O  O    . TYR B 2 51  ? 14.034  61.987 -20.299 1.00 0.81  ? 51  TYR B O    1  
ATOM   3410  C  CB   . TYR B 2 51  ? 12.661  61.212 -22.922 1.00 0.88  ? 51  TYR B CB   1  
ATOM   3411  C  CG   . TYR B 2 51  ? 12.733  60.613 -24.304 1.00 1.43  ? 51  TYR B CG   1  
ATOM   3412  C  CD1  . TYR B 2 51  ? 13.421  59.413 -24.521 1.00 2.16  ? 51  TYR B CD1  1  
ATOM   3413  C  CD2  . TYR B 2 51  ? 12.120  61.268 -25.369 1.00 2.30  ? 51  TYR B CD2  1  
ATOM   3414  C  CE1  . TYR B 2 51  ? 13.489  58.870 -25.810 1.00 3.09  ? 51  TYR B CE1  1  
ATOM   3415  C  CE2  . TYR B 2 51  ? 12.186  60.728 -26.657 1.00 3.31  ? 51  TYR B CE2  1  
ATOM   3416  C  CZ   . TYR B 2 51  ? 12.870  59.528 -26.879 1.00 3.55  ? 51  TYR B CZ   1  
ATOM   3417  O  OH   . TYR B 2 51  ? 12.935  58.994 -28.150 1.00 4.66  ? 51  TYR B OH   1  
ATOM   3418  H  H    . TYR B 2 51  ? 15.285  60.621 -22.011 1.00 0.68  ? 51  TYR B H    1  
ATOM   3419  H  HA   . TYR B 2 51  ? 13.989  62.811 -23.448 1.00 0.74  ? 51  TYR B HA   1  
ATOM   3420  H  HB2  . TYR B 2 51  ? 12.601  60.425 -22.184 1.00 1.39  ? 51  TYR B HB2  1  
ATOM   3421  H  HB3  . TYR B 2 51  ? 11.797  61.848 -22.851 1.00 1.33  ? 51  TYR B HB3  1  
ATOM   3422  H  HD1  . TYR B 2 51  ? 13.899  58.908 -23.697 1.00 2.46  ? 51  TYR B HD1  1  
ATOM   3423  H  HD2  . TYR B 2 51  ? 11.597  62.193 -25.195 1.00 2.60  ? 51  TYR B HD2  1  
ATOM   3424  H  HE1  . TYR B 2 51  ? 14.020  57.944 -25.980 1.00 3.78  ? 51  TYR B HE1  1  
ATOM   3425  H  HE2  . TYR B 2 51  ? 11.710  61.237 -27.478 1.00 4.15  ? 51  TYR B HE2  1  
ATOM   3426  H  HH   . TYR B 2 51  ? 12.377  58.214 -28.173 1.00 4.93  ? 51  TYR B HH   1  
ATOM   3427  N  N    . GLU B 2 52  ? 13.863  63.938 -21.257 1.00 0.56  ? 52  GLU B N    1  
ATOM   3428  C  CA   . GLU B 2 52  ? 13.902  64.686 -19.979 1.00 0.59  ? 52  GLU B CA   1  
ATOM   3429  C  C    . GLU B 2 52  ? 12.503  64.993 -19.389 1.00 0.53  ? 52  GLU B C    1  
ATOM   3430  O  O    . GLU B 2 52  ? 11.639  65.500 -20.077 1.00 0.59  ? 52  GLU B O    1  
ATOM   3431  C  CB   . GLU B 2 52  ? 14.603  66.002 -20.294 1.00 0.66  ? 52  GLU B CB   1  
ATOM   3432  C  CG   . GLU B 2 52  ? 14.576  66.925 -19.063 1.00 0.70  ? 52  GLU B CG   1  
ATOM   3433  C  CD   . GLU B 2 52  ? 15.907  67.675 -18.919 1.00 1.52  ? 52  GLU B CD   1  
ATOM   3434  O  OE1  . GLU B 2 52  ? 16.332  68.281 -19.889 1.00 2.16  ? 52  GLU B OE1  1  
ATOM   3435  O  OE2  . GLU B 2 52  ? 16.475  67.630 -17.840 1.00 2.20  ? 52  GLU B OE2  1  
ATOM   3436  H  H    . GLU B 2 52  ? 13.840  64.412 -22.070 1.00 0.60  ? 52  GLU B H    1  
ATOM   3437  H  HA   . GLU B 2 52  ? 14.486  64.156 -19.275 1.00 0.68  ? 52  GLU B HA   1  
ATOM   3438  H  HB2  . GLU B 2 52  ? 15.616  65.782 -20.581 1.00 0.79  ? 52  GLU B HB2  1  
ATOM   3439  H  HB3  . GLU B 2 52  ? 14.099  66.484 -21.120 1.00 0.79  ? 52  GLU B HB3  1  
ATOM   3440  H  HG2  . GLU B 2 52  ? 13.773  67.640 -19.168 1.00 0.94  ? 52  GLU B HG2  1  
ATOM   3441  H  HG3  . GLU B 2 52  ? 14.406  66.330 -18.187 1.00 1.11  ? 52  GLU B HG3  1  
ATOM   3442  N  N    . PHE B 2 53  ? 12.293  64.763 -18.090 1.00 0.49  ? 53  PHE B N    1  
ATOM   3443  C  CA   . PHE B 2 53  ? 10.995  65.127 -17.463 1.00 0.48  ? 53  PHE B CA   1  
ATOM   3444  C  C    . PHE B 2 53  ? 11.169  65.656 -16.026 1.00 0.49  ? 53  PHE B C    1  
ATOM   3445  O  O    . PHE B 2 53  ? 11.819  65.066 -15.190 1.00 0.61  ? 53  PHE B O    1  
ATOM   3446  C  CB   . PHE B 2 53  ? 10.067  63.922 -17.486 1.00 0.57  ? 53  PHE B CB   1  
ATOM   3447  C  CG   . PHE B 2 53  ? 9.418   63.879 -18.854 1.00 0.73  ? 53  PHE B CG   1  
ATOM   3448  C  CD1  . PHE B 2 53  ? 8.242   64.608 -19.069 1.00 0.95  ? 53  PHE B CD1  1  
ATOM   3449  C  CD2  . PHE B 2 53  ? 9.999   63.161 -19.906 1.00 1.03  ? 53  PHE B CD2  1  
ATOM   3450  C  CE1  . PHE B 2 53  ? 7.640   64.617 -20.330 1.00 1.28  ? 53  PHE B CE1  1  
ATOM   3451  C  CE2  . PHE B 2 53  ? 9.388   63.165 -21.169 1.00 1.33  ? 53  PHE B CE2  1  
ATOM   3452  C  CZ   . PHE B 2 53  ? 8.211   63.892 -21.379 1.00 1.40  ? 53  PHE B CZ   1  
ATOM   3453  H  H    . PHE B 2 53  ? 12.999  64.407 -17.535 1.00 0.52  ? 53  PHE B H    1  
ATOM   3454  H  HA   . PHE B 2 53  ? 10.546  65.928 -18.041 1.00 0.48  ? 53  PHE B HA   1  
ATOM   3455  H  HB2  . PHE B 2 53  ? 10.635  63.020 -17.286 1.00 0.71  ? 53  PHE B HB2  1  
ATOM   3456  H  HB3  . PHE B 2 53  ? 9.306   64.035 -16.736 1.00 0.66  ? 53  PHE B HB3  1  
ATOM   3457  H  HD1  . PHE B 2 53  ? 7.796   65.162 -18.256 1.00 1.07  ? 53  PHE B HD1  1  
ATOM   3458  H  HD2  . PHE B 2 53  ? 10.907  62.600 -19.743 1.00 1.20  ? 53  PHE B HD2  1  
ATOM   3459  H  HE1  . PHE B 2 53  ? 6.734   65.181 -20.491 1.00 1.56  ? 53  PHE B HE1  1  
ATOM   3460  H  HE2  . PHE B 2 53  ? 9.823   62.606 -21.979 1.00 1.63  ? 53  PHE B HE2  1  
ATOM   3461  H  HZ   . PHE B 2 53  ? 7.747   63.898 -22.354 1.00 1.69  ? 53  PHE B HZ   1  
ATOM   3462  N  N    . GLU B 2 54  ? 10.509  66.747 -15.762 1.00 0.46  ? 54  GLU B N    1  
ATOM   3463  C  CA   . GLU B 2 54  ? 10.471  67.402 -14.413 1.00 0.49  ? 54  GLU B CA   1  
ATOM   3464  C  C    . GLU B 2 54  ? 11.833  67.547 -13.706 1.00 0.62  ? 54  GLU B C    1  
ATOM   3465  O  O    . GLU B 2 54  ? 11.923  67.388 -12.505 1.00 1.07  ? 54  GLU B O    1  
ATOM   3466  C  CB   . GLU B 2 54  ? 9.500   66.624 -13.510 1.00 0.61  ? 54  GLU B CB   1  
ATOM   3467  C  CG   . GLU B 2 54  ? 8.943   67.545 -12.416 1.00 1.62  ? 54  GLU B CG   1  
ATOM   3468  C  CD   . GLU B 2 54  ? 8.198   66.709 -11.374 1.00 1.85  ? 54  GLU B CD   1  
ATOM   3469  O  OE1  . GLU B 2 54  ? 8.479   65.525 -11.283 1.00 2.33  ? 54  GLU B OE1  1  
ATOM   3470  O  OE2  . GLU B 2 54  ? 7.359   67.266 -10.686 1.00 2.20  ? 54  GLU B OE2  1  
ATOM   3471  H  H    . GLU B 2 54  ? 9.973   67.138 -16.475 1.00 0.51  ? 54  GLU B H    1  
ATOM   3472  H  HA   . GLU B 2 54  ? 10.076  68.385 -14.560 1.00 0.55  ? 54  GLU B HA   1  
ATOM   3473  H  HB2  . GLU B 2 54  ? 8.684   66.246 -14.108 1.00 1.10  ? 54  GLU B HB2  1  
ATOM   3474  H  HB3  . GLU B 2 54  ? 10.016  65.797 -13.050 1.00 1.27  ? 54  GLU B HB3  1  
ATOM   3475  H  HG2  . GLU B 2 54  ? 9.756   68.074 -11.940 1.00 2.25  ? 54  GLU B HG2  1  
ATOM   3476  H  HG3  . GLU B 2 54  ? 8.261   68.256 -12.858 1.00 2.25  ? 54  GLU B HG3  1  
ATOM   3477  N  N    . GLY B 2 55  ? 12.873  67.908 -14.397 1.00 0.66  ? 55  GLY B N    1  
ATOM   3478  C  CA   . GLY B 2 55  ? 14.192  68.115 -13.709 1.00 0.81  ? 55  GLY B CA   1  
ATOM   3479  C  C    . GLY B 2 55  ? 14.999  66.825 -13.663 1.00 0.75  ? 55  GLY B C    1  
ATOM   3480  O  O    . GLY B 2 55  ? 16.204  66.850 -13.508 1.00 0.94  ? 55  GLY B O    1  
ATOM   3481  H  H    . GLY B 2 55  ? 12.791  68.072 -15.355 1.00 0.91  ? 55  GLY B H    1  
ATOM   3482  H  HA2  . GLY B 2 55  ? 14.753  68.856 -14.250 1.00 0.96  ? 55  GLY B HA2  1  
ATOM   3483  H  HA3  . GLY B 2 55  ? 14.024  68.465 -12.700 1.00 0.92  ? 55  GLY B HA3  1  
ATOM   3484  N  N    . ARG B 2 56  ? 14.368  65.710 -13.862 1.00 0.62  ? 56  ARG B N    1  
ATOM   3485  C  CA   . ARG B 2 56  ? 15.114  64.420 -13.905 1.00 0.66  ? 56  ARG B CA   1  
ATOM   3486  C  C    . ARG B 2 56  ? 14.970  63.955 -15.328 1.00 0.61  ? 56  ARG B C    1  
ATOM   3487  O  O    . ARG B 2 56  ? 13.985  64.249 -15.978 1.00 0.79  ? 56  ARG B O    1  
ATOM   3488  C  CB   . ARG B 2 56  ? 14.472  63.375 -12.975 1.00 0.79  ? 56  ARG B CB   1  
ATOM   3489  C  CG   . ARG B 2 56  ? 13.691  64.045 -11.834 1.00 1.09  ? 56  ARG B CG   1  
ATOM   3490  C  CD   . ARG B 2 56  ? 12.235  64.322 -12.261 1.00 1.33  ? 56  ARG B CD   1  
ATOM   3491  N  NE   . ARG B 2 56  ? 11.403  64.683 -11.061 1.00 1.90  ? 56  ARG B NE   1  
ATOM   3492  C  CZ   . ARG B 2 56  ? 11.246  63.863 -10.055 1.00 2.39  ? 56  ARG B CZ   1  
ATOM   3493  N  NH1  . ARG B 2 56  ? 11.692  62.638 -10.120 1.00 2.63  ? 56  ARG B NH1  1  
ATOM   3494  N  NH2  . ARG B 2 56  ? 10.599  64.259 -8.991  1.00 3.20  ? 56  ARG B NH2  1  
ATOM   3495  H  H    . ARG B 2 56  ? 13.407  65.718 -14.044 1.00 0.60  ? 56  ARG B H    1  
ATOM   3496  H  HA   . ARG B 2 56  ? 16.171  64.538 -13.663 1.00 0.73  ? 56  ARG B HA   1  
ATOM   3497  H  HB2  . ARG B 2 56  ? 13.807  62.762 -13.545 1.00 1.19  ? 56  ARG B HB2  1  
ATOM   3498  H  HB3  . ARG B 2 56  ? 15.250  62.749 -12.554 1.00 1.09  ? 56  ARG B HB3  1  
ATOM   3499  H  HG2  . ARG B 2 56  ? 13.707  63.395 -10.984 1.00 1.55  ? 56  ARG B HG2  1  
ATOM   3500  H  HG3  . ARG B 2 56  ? 14.167  64.979 -11.572 1.00 1.74  ? 56  ARG B HG3  1  
ATOM   3501  H  HD2  . ARG B 2 56  ? 12.228  65.157 -12.906 1.00 1.83  ? 56  ARG B HD2  1  
ATOM   3502  H  HD3  . ARG B 2 56  ? 11.822  63.467 -12.805 1.00 1.61  ? 56  ARG B HD3  1  
ATOM   3503  H  HE   . ARG B 2 56  ? 10.997  65.574 -11.016 1.00 2.41  ? 56  ARG B HE   1  
ATOM   3504  H  HH11 . ARG B 2 56  ? 12.158  62.320 -10.946 1.00 2.50  ? 56  ARG B HH11 1  
ATOM   3505  H  HH12 . ARG B 2 56  ? 11.568  62.019 -9.345  1.00 3.32  ? 56  ARG B HH12 1  
ATOM   3506  H  HH21 . ARG B 2 56  ? 10.224  65.186 -8.948  1.00 3.57  ? 56  ARG B HH21 1  
ATOM   3507  H  HH22 . ARG B 2 56  ? 10.478  63.635 -8.219  1.00 3.69  ? 56  ARG B HH22 1  
ATOM   3508  N  N    . LYS B 2 57  ? 15.914  63.229 -15.814 1.00 0.54  ? 57  LYS B N    1  
ATOM   3509  C  CA   . LYS B 2 57  ? 15.813  62.726 -17.208 1.00 0.57  ? 57  LYS B CA   1  
ATOM   3510  C  C    . LYS B 2 57  ? 15.715  61.205 -17.208 1.00 0.55  ? 57  LYS B C    1  
ATOM   3511  O  O    . LYS B 2 57  ? 16.446  60.524 -16.516 1.00 0.75  ? 57  LYS B O    1  
ATOM   3512  C  CB   . LYS B 2 57  ? 17.017  63.253 -17.999 1.00 0.66  ? 57  LYS B CB   1  
ATOM   3513  C  CG   . LYS B 2 57  ? 17.077  64.807 -17.939 1.00 1.05  ? 57  LYS B CG   1  
ATOM   3514  C  CD   . LYS B 2 57  ? 18.406  65.292 -17.322 1.00 1.19  ? 57  LYS B CD   1  
ATOM   3515  C  CE   . LYS B 2 57  ? 18.394  65.116 -15.797 1.00 1.49  ? 57  LYS B CE   1  
ATOM   3516  N  NZ   . LYS B 2 57  ? 18.615  63.683 -15.452 1.00 1.97  ? 57  LYS B NZ   1  
ATOM   3517  H  H    . LYS B 2 57  ? 16.677  62.996 -15.253 1.00 0.62  ? 57  LYS B H    1  
ATOM   3518  H  HA   . LYS B 2 57  ? 14.917  63.093 -17.653 1.00 0.60  ? 57  LYS B HA   1  
ATOM   3519  H  HB2  . LYS B 2 57  ? 17.899  62.859 -17.571 1.00 0.83  ? 57  LYS B HB2  1  
ATOM   3520  H  HB3  . LYS B 2 57  ? 16.937  62.933 -19.027 1.00 0.87  ? 57  LYS B HB3  1  
ATOM   3521  H  HG2  . LYS B 2 57  ? 17.008  65.202 -18.935 1.00 1.63  ? 57  LYS B HG2  1  
ATOM   3522  H  HG3  . LYS B 2 57  ? 16.255  65.190 -17.353 1.00 1.66  ? 57  LYS B HG3  1  
ATOM   3523  H  HD2  . LYS B 2 57  ? 19.228  64.730 -17.741 1.00 1.93  ? 57  LYS B HD2  1  
ATOM   3524  H  HD3  . LYS B 2 57  ? 18.540  66.335 -17.556 1.00 1.71  ? 57  LYS B HD3  1  
ATOM   3525  H  HE2  . LYS B 2 57  ? 19.184  65.711 -15.364 1.00 1.97  ? 57  LYS B HE2  1  
ATOM   3526  H  HE3  . LYS B 2 57  ? 17.445  65.441 -15.400 1.00 1.97  ? 57  LYS B HE3  1  
ATOM   3527  H  HZ1  . LYS B 2 57  ? 17.809  63.118 -15.784 1.00 2.46  ? 57  LYS B HZ1  1  
ATOM   3528  H  HZ2  . LYS B 2 57  ? 18.707  63.586 -14.421 1.00 2.28  ? 57  LYS B HZ2  1  
ATOM   3529  H  HZ3  . LYS B 2 57  ? 19.484  63.346 -15.912 1.00 2.28  ? 57  LYS B HZ3  1  
ATOM   3530  N  N    . TYR B 2 58  ? 14.790  60.663 -17.959 1.00 0.49  ? 58  TYR B N    1  
ATOM   3531  C  CA   . TYR B 2 58  ? 14.578  59.179 -18.009 1.00 0.49  ? 58  TYR B CA   1  
ATOM   3532  C  C    . TYR B 2 58  ? 14.460  58.751 -19.469 1.00 0.50  ? 58  TYR B C    1  
ATOM   3533  O  O    . TYR B 2 58  ? 13.971  59.519 -20.282 1.00 0.74  ? 58  TYR B O    1  
ATOM   3534  C  CB   . TYR B 2 58  ? 13.235  58.800 -17.378 1.00 0.51  ? 58  TYR B CB   1  
ATOM   3535  C  CG   . TYR B 2 58  ? 13.035  59.423 -16.037 1.00 0.51  ? 58  TYR B CG   1  
ATOM   3536  C  CD1  . TYR B 2 58  ? 13.454  58.751 -14.888 1.00 0.54  ? 58  TYR B CD1  1  
ATOM   3537  C  CD2  . TYR B 2 58  ? 12.374  60.643 -15.943 1.00 0.54  ? 58  TYR B CD2  1  
ATOM   3538  C  CE1  . TYR B 2 58  ? 13.220  59.315 -13.631 1.00 0.58  ? 58  TYR B CE1  1  
ATOM   3539  C  CE2  . TYR B 2 58  ? 12.129  61.204 -14.695 1.00 0.60  ? 58  TYR B CE2  1  
ATOM   3540  C  CZ   . TYR B 2 58  ? 12.554  60.543 -13.533 1.00 0.62  ? 58  TYR B CZ   1  
ATOM   3541  O  OH   . TYR B 2 58  ? 12.310  61.099 -12.293 1.00 0.70  ? 58  TYR B OH   1  
ATOM   3542  H  H    . TYR B 2 58  ? 14.167  61.205 -18.498 1.00 0.60  ? 58  TYR B H    1  
ATOM   3543  H  HA   . TYR B 2 58  ? 15.390  58.656 -17.516 1.00 0.50  ? 58  TYR B HA   1  
ATOM   3544  H  HB2  . TYR B 2 58  ? 12.432  59.119 -18.024 1.00 0.54  ? 58  TYR B HB2  1  
ATOM   3545  H  HB3  . TYR B 2 58  ? 13.189  57.741 -17.280 1.00 0.55  ? 58  TYR B HB3  1  
ATOM   3546  H  HD1  . TYR B 2 58  ? 13.963  57.800 -14.977 1.00 0.55  ? 58  TYR B HD1  1  
ATOM   3547  H  HD2  . TYR B 2 58  ? 12.060  61.155 -16.844 1.00 0.55  ? 58  TYR B HD2  1  
ATOM   3548  H  HE1  . TYR B 2 58  ? 13.547  58.805 -12.738 1.00 0.62  ? 58  TYR B HE1  1  
ATOM   3549  H  HE2  . TYR B 2 58  ? 11.614  62.147 -14.627 1.00 0.65  ? 58  TYR B HE2  1  
ATOM   3550  H  HH   . TYR B 2 58  ? 11.360  61.201 -12.197 1.00 1.08  ? 58  TYR B HH   1  
ATOM   3551  N  N    . CYS B 2 59  ? 14.814  57.537 -19.844 1.00 0.60  ? 59  CYS B N    1  
ATOM   3552  C  CA   . CYS B 2 59  ? 14.564  57.198 -21.255 1.00 0.60  ? 59  CYS B CA   1  
ATOM   3553  C  C    . CYS B 2 59  ? 13.050  57.308 -21.346 1.00 0.59  ? 59  CYS B C    1  
ATOM   3554  O  O    . CYS B 2 59  ? 12.390  57.404 -20.328 1.00 0.61  ? 59  CYS B O    1  
ATOM   3555  C  CB   . CYS B 2 59  ? 15.053  55.797 -21.619 1.00 0.62  ? 59  CYS B CB   1  
ATOM   3556  S  SG   . CYS B 2 59  ? 14.556  54.577 -20.388 1.00 0.59  ? 59  CYS B SG   1  
ATOM   3557  H  H    . CYS B 2 59  ? 15.167  56.883 -19.211 1.00 0.84  ? 59  CYS B H    1  
ATOM   3558  H  HA   . CYS B 2 59  ? 15.025  57.941 -21.895 1.00 0.63  ? 59  CYS B HA   1  
ATOM   3559  H  HB2  . CYS B 2 59  ? 14.644  55.520 -22.570 1.00 0.65  ? 59  CYS B HB2  1  
ATOM   3560  H  HB3  . CYS B 2 59  ? 16.118  55.816 -21.687 1.00 0.68  ? 59  CYS B HB3  1  
ATOM   3561  N  N    . GLU B 2 60  ? 12.483  57.403 -22.492 1.00 0.61  ? 60  GLU B N    1  
ATOM   3562  C  CA   . GLU B 2 60  ? 11.040  57.631 -22.527 1.00 0.64  ? 60  GLU B CA   1  
ATOM   3563  C  C    . GLU B 2 60  ? 10.360  56.565 -21.754 1.00 0.59  ? 60  GLU B C    1  
ATOM   3564  O  O    . GLU B 2 60  ? 9.344   56.755 -21.142 1.00 0.60  ? 60  GLU B O    1  
ATOM   3565  C  CB   . GLU B 2 60  ? 10.509  57.631 -23.950 1.00 0.74  ? 60  GLU B CB   1  
ATOM   3566  C  CG   . GLU B 2 60  ? 10.586  56.225 -24.532 1.00 0.74  ? 60  GLU B CG   1  
ATOM   3567  C  CD   . GLU B 2 60  ? 10.079  56.234 -25.976 1.00 0.90  ? 60  GLU B CD   1  
ATOM   3568  O  OE1  . GLU B 2 60  ? 10.503  57.097 -26.727 1.00 1.53  ? 60  GLU B OE1  1  
ATOM   3569  O  OE2  . GLU B 2 60  ? 9.276   55.376 -26.306 1.00 1.33  ? 60  GLU B OE2  1  
ATOM   3570  H  H    . GLU B 2 60  ? 12.991  57.377 -23.293 1.00 0.65  ? 60  GLU B H    1  
ATOM   3571  H  HA   . GLU B 2 60  ? 10.843  58.568 -22.077 1.00 0.68  ? 60  GLU B HA   1  
ATOM   3572  H  HB2  . GLU B 2 60  ? 9.482   57.936 -23.915 1.00 0.78  ? 60  GLU B HB2  1  
ATOM   3573  H  HB3  . GLU B 2 60  ? 11.076  58.313 -24.561 1.00 0.81  ? 60  GLU B HB3  1  
ATOM   3574  H  HG2  . GLU B 2 60  ? 11.608  55.875 -24.505 1.00 0.73  ? 60  GLU B HG2  1  
ATOM   3575  H  HG3  . GLU B 2 60  ? 9.963   55.579 -23.936 1.00 0.72  ? 60  GLU B HG3  1  
ATOM   3576  N  N    . HIS B 2 61  ? 10.911  55.424 -21.854 1.00 0.59  ? 61  HIS B N    1  
ATOM   3577  C  CA   . HIS B 2 61  ? 10.306  54.264 -21.234 1.00 0.60  ? 61  HIS B CA   1  
ATOM   3578  C  C    . HIS B 2 61  ? 10.026  54.526 -19.781 1.00 0.60  ? 61  HIS B C    1  
ATOM   3579  O  O    . HIS B 2 61  ? 8.901   54.397 -19.319 1.00 0.63  ? 61  HIS B O    1  
ATOM   3580  C  CB   . HIS B 2 61  ? 11.292  53.103 -21.405 1.00 0.63  ? 61  HIS B CB   1  
ATOM   3581  C  CG   . HIS B 2 61  ? 11.057  52.026 -20.378 1.00 0.61  ? 61  HIS B CG   1  
ATOM   3582  N  ND1  . HIS B 2 61  ? 9.809   51.784 -19.826 1.00 0.59  ? 61  HIS B ND1  1  
ATOM   3583  C  CD2  . HIS B 2 61  ? 11.911  51.133 -19.785 1.00 0.66  ? 61  HIS B CD2  1  
ATOM   3584  C  CE1  . HIS B 2 61  ? 9.946   50.782 -18.939 1.00 0.63  ? 61  HIS B CE1  1  
ATOM   3585  N  NE2  . HIS B 2 61  ? 11.208  50.349 -18.877 1.00 0.68  ? 61  HIS B NE2  1  
ATOM   3586  H  H    . HIS B 2 61  ? 11.724  55.321 -22.401 1.00 0.61  ? 61  HIS B H    1  
ATOM   3587  H  HA   . HIS B 2 61  ? 9.388   54.044 -21.731 1.00 0.64  ? 61  HIS B HA   1  
ATOM   3588  H  HB2  . HIS B 2 61  ? 11.184  52.687 -22.391 1.00 0.71  ? 61  HIS B HB2  1  
ATOM   3589  H  HB3  . HIS B 2 61  ? 12.299  53.490 -21.295 1.00 0.63  ? 61  HIS B HB3  1  
ATOM   3590  H  HD2  . HIS B 2 61  ? 12.967  51.055 -19.990 1.00 0.71  ? 61  HIS B HD2  1  
ATOM   3591  H  HE1  . HIS B 2 61  ? 9.138   50.382 -18.347 1.00 0.66  ? 61  HIS B HE1  1  
ATOM   3592  H  HE2  . HIS B 2 61  ? 11.555  49.631 -18.307 1.00 0.73  ? 61  HIS B HE2  1  
ATOM   3593  N  N    . ASP B 2 62  ? 11.006  54.898 -19.041 1.00 0.61  ? 62  ASP B N    1  
ATOM   3594  C  CA   . ASP B 2 62  ? 10.714  55.122 -17.610 1.00 0.68  ? 62  ASP B CA   1  
ATOM   3595  C  C    . ASP B 2 62  ? 9.960   56.390 -17.451 1.00 0.66  ? 62  ASP B C    1  
ATOM   3596  O  O    . ASP B 2 62  ? 9.161   56.538 -16.553 1.00 0.70  ? 62  ASP B O    1  
ATOM   3597  C  CB   . ASP B 2 62  ? 11.966  55.156 -16.730 1.00 0.79  ? 62  ASP B CB   1  
ATOM   3598  C  CG   . ASP B 2 62  ? 13.243  54.905 -17.526 1.00 0.92  ? 62  ASP B CG   1  
ATOM   3599  O  OD1  . ASP B 2 62  ? 13.323  53.876 -18.173 1.00 1.38  ? 62  ASP B OD1  1  
ATOM   3600  O  OD2  . ASP B 2 62  ? 14.131  55.748 -17.434 1.00 1.50  ? 62  ASP B OD2  1  
ATOM   3601  H  H    . ASP B 2 62  ? 11.906  55.049 -19.427 1.00 0.61  ? 62  ASP B H    1  
ATOM   3602  H  HA   . ASP B 2 62  ? 10.075  54.321 -17.271 1.00 0.72  ? 62  ASP B HA   1  
ATOM   3603  H  HB2  . ASP B 2 62  ? 12.049  56.104 -16.225 1.00 0.81  ? 62  ASP B HB2  1  
ATOM   3604  H  HB3  . ASP B 2 62  ? 11.852  54.400 -16.003 1.00 0.80  ? 62  ASP B HB3  1  
ATOM   3605  N  N    . PHE B 2 63  ? 10.202  57.315 -18.298 1.00 0.65  ? 63  PHE B N    1  
ATOM   3606  C  CA   . PHE B 2 63  ? 9.514   58.582 -18.126 1.00 0.69  ? 63  PHE B CA   1  
ATOM   3607  C  C    . PHE B 2 63  ? 8.041   58.324 -18.206 1.00 0.64  ? 63  PHE B C    1  
ATOM   3608  O  O    . PHE B 2 63  ? 7.291   58.831 -17.398 1.00 0.69  ? 63  PHE B O    1  
ATOM   3609  C  CB   . PHE B 2 63  ? 9.953   59.582 -19.219 1.00 0.76  ? 63  PHE B CB   1  
ATOM   3610  C  CG   . PHE B 2 63  ? 8.749   60.291 -19.798 1.00 1.13  ? 63  PHE B CG   1  
ATOM   3611  C  CD1  . PHE B 2 63  ? 8.131   61.283 -19.047 1.00 1.51  ? 63  PHE B CD1  1  
ATOM   3612  C  CD2  . PHE B 2 63  ? 8.237   59.936 -21.053 1.00 1.96  ? 63  PHE B CD2  1  
ATOM   3613  C  CE1  . PHE B 2 63  ? 7.000   61.936 -19.549 1.00 2.24  ? 63  PHE B CE1  1  
ATOM   3614  C  CE2  . PHE B 2 63  ? 7.109   60.589 -21.557 1.00 2.72  ? 63  PHE B CE2  1  
ATOM   3615  C  CZ   . PHE B 2 63  ? 6.491   61.590 -20.804 1.00 2.75  ? 63  PHE B CZ   1  
ATOM   3616  H  H    . PHE B 2 63  ? 10.851  57.181 -19.023 1.00 0.65  ? 63  PHE B H    1  
ATOM   3617  H  HA   . PHE B 2 63  ? 9.740   58.978 -17.161 1.00 0.76  ? 63  PHE B HA   1  
ATOM   3618  H  HB2  . PHE B 2 63  ? 10.620  60.318 -18.794 1.00 1.08  ? 63  PHE B HB2  1  
ATOM   3619  H  HB3  . PHE B 2 63  ? 10.463  59.050 -19.991 1.00 1.14  ? 63  PHE B HB3  1  
ATOM   3620  H  HD1  . PHE B 2 63  ? 8.543   61.553 -18.079 1.00 1.72  ? 63  PHE B HD1  1  
ATOM   3621  H  HD2  . PHE B 2 63  ? 8.708   59.162 -21.632 1.00 2.27  ? 63  PHE B HD2  1  
ATOM   3622  H  HE1  . PHE B 2 63  ? 6.519   62.704 -18.973 1.00 2.69  ? 63  PHE B HE1  1  
ATOM   3623  H  HE2  . PHE B 2 63  ? 6.717   60.322 -22.527 1.00 3.47  ? 63  PHE B HE2  1  
ATOM   3624  H  HZ   . PHE B 2 63  ? 5.619   62.093 -21.189 1.00 3.43  ? 63  PHE B HZ   1  
ATOM   3625  N  N    . GLN B 2 64  ? 7.596   57.514 -19.117 1.00 0.62  ? 64  GLN B N    1  
ATOM   3626  C  CA   . GLN B 2 64  ? 6.114   57.330 -19.133 1.00 0.68  ? 64  GLN B CA   1  
ATOM   3627  C  C    . GLN B 2 64  ? 5.730   56.663 -17.862 1.00 0.72  ? 64  GLN B C    1  
ATOM   3628  O  O    . GLN B 2 64  ? 4.697   56.926 -17.310 1.00 0.81  ? 64  GLN B O    1  
ATOM   3629  C  CB   . GLN B 2 64  ? 5.587   56.531 -20.338 1.00 0.77  ? 64  GLN B CB   1  
ATOM   3630  C  CG   . GLN B 2 64  ? 6.736   56.205 -21.265 1.00 0.86  ? 64  GLN B CG   1  
ATOM   3631  C  CD   . GLN B 2 64  ? 6.245   55.402 -22.455 1.00 1.65  ? 64  GLN B CD   1  
ATOM   3632  O  OE1  . GLN B 2 64  ? 5.063   55.165 -22.608 1.00 1.96  ? 64  GLN B OE1  1  
ATOM   3633  N  NE2  . GLN B 2 64  ? 7.119   54.971 -23.312 1.00 2.63  ? 64  GLN B NE2  1  
ATOM   3634  H  H    . GLN B 2 64  ? 8.230   57.023 -19.737 1.00 0.62  ? 64  GLN B H    1  
ATOM   3635  H  HA   . GLN B 2 64  ? 5.659   58.308 -19.134 1.00 0.70  ? 64  GLN B HA   1  
ATOM   3636  H  HB2  . GLN B 2 64  ? 5.110   55.614 -20.008 1.00 0.85  ? 64  GLN B HB2  1  
ATOM   3637  H  HB3  . GLN B 2 64  ? 4.858   57.133 -20.863 1.00 0.98  ? 64  GLN B HB3  1  
ATOM   3638  H  HG2  . GLN B 2 64  ? 7.177   57.125 -21.616 1.00 1.09  ? 64  GLN B HG2  1  
ATOM   3639  H  HG3  . GLN B 2 64  ? 7.466   55.624 -20.725 1.00 1.24  ? 64  GLN B HG3  1  
ATOM   3640  H  HE21 . GLN B 2 64  ? 8.071   55.167 -23.182 1.00 2.86  ? 64  GLN B HE21 1  
ATOM   3641  H  HE22 . GLN B 2 64  ? 6.832   54.453 -24.078 1.00 3.34  ? 64  GLN B HE22 1  
ATOM   3642  N  N    . MET B 2 65  ? 6.521   55.768 -17.408 1.00 0.74  ? 65  MET B N    1  
ATOM   3643  C  CA   . MET B 2 65  ? 6.074   55.028 -16.211 1.00 0.88  ? 65  MET B CA   1  
ATOM   3644  C  C    . MET B 2 65  ? 5.813   56.029 -15.095 1.00 0.92  ? 65  MET B C    1  
ATOM   3645  O  O    . MET B 2 65  ? 4.744   56.030 -14.514 1.00 1.04  ? 65  MET B O    1  
ATOM   3646  C  CB   . MET B 2 65  ? 7.181   54.028 -15.802 1.00 0.92  ? 65  MET B CB   1  
ATOM   3647  C  CG   . MET B 2 65  ? 6.584   52.646 -15.529 1.00 1.15  ? 65  MET B CG   1  
ATOM   3648  S  SD   . MET B 2 65  ? 7.772   51.648 -14.597 1.00 1.91  ? 65  MET B SD   1  
ATOM   3649  C  CE   . MET B 2 65  ? 7.303   52.218 -12.944 1.00 2.40  ? 65  MET B CE   1  
ATOM   3650  H  H    . MET B 2 65  ? 7.324   55.500 -17.929 1.00 0.71  ? 65  MET B H    1  
ATOM   3651  H  HA   . MET B 2 65  ? 5.159   54.501 -16.441 1.00 0.97  ? 65  MET B HA   1  
ATOM   3652  H  HB2  . MET B 2 65  ? 7.890   53.946 -16.609 1.00 1.21  ? 65  MET B HB2  1  
ATOM   3653  H  HB3  . MET B 2 65  ? 7.694   54.375 -14.915 1.00 1.30  ? 65  MET B HB3  1  
ATOM   3654  H  HG2  . MET B 2 65  ? 5.673   52.751 -14.959 1.00 1.77  ? 65  MET B HG2  1  
ATOM   3655  H  HG3  . MET B 2 65  ? 6.369   52.166 -16.470 1.00 1.49  ? 65  MET B HG3  1  
ATOM   3656  H  HE1  . MET B 2 65  ? 7.858   51.661 -12.201 1.00 2.73  ? 65  MET B HE1  1  
ATOM   3657  H  HE2  . MET B 2 65  ? 6.248   52.060 -12.793 1.00 2.78  ? 65  MET B HE2  1  
ATOM   3658  H  HE3  . MET B 2 65  ? 7.525   53.272 -12.851 1.00 2.92  ? 65  MET B HE3  1  
ATOM   3659  N  N    . LEU B 2 66  ? 6.690   56.941 -14.851 1.00 0.90  ? 66  LEU B N    1  
ATOM   3660  C  CA   . LEU B 2 66  ? 6.366   57.934 -13.802 1.00 1.01  ? 66  LEU B CA   1  
ATOM   3661  C  C    . LEU B 2 66  ? 5.238   58.789 -14.314 1.00 1.09  ? 66  LEU B C    1  
ATOM   3662  O  O    . LEU B 2 66  ? 4.316   59.131 -13.601 1.00 1.32  ? 66  LEU B O    1  
ATOM   3663  C  CB   . LEU B 2 66  ? 7.582   58.811 -13.492 1.00 1.06  ? 66  LEU B CB   1  
ATOM   3664  C  CG   . LEU B 2 66  ? 8.834   57.957 -13.553 1.00 1.02  ? 66  LEU B CG   1  
ATOM   3665  C  CD1  . LEU B 2 66  ? 10.036  58.788 -13.115 1.00 1.36  ? 66  LEU B CD1  1  
ATOM   3666  C  CD2  . LEU B 2 66  ? 8.685   56.746 -12.626 1.00 1.28  ? 66  LEU B CD2  1  
ATOM   3667  H  H    . LEU B 2 66  ? 7.509   57.014 -15.394 1.00 0.84  ? 66  LEU B H    1  
ATOM   3668  H  HA   . LEU B 2 66  ? 6.051   57.431 -12.910 1.00 1.10  ? 66  LEU B HA   1  
ATOM   3669  H  HB2  . LEU B 2 66  ? 7.658   59.610 -14.219 1.00 1.27  ? 66  LEU B HB2  1  
ATOM   3670  H  HB3  . LEU B 2 66  ? 7.484   59.232 -12.502 1.00 1.25  ? 66  LEU B HB3  1  
ATOM   3671  H  HG   . LEU B 2 66  ? 8.971   57.627 -14.567 1.00 0.94  ? 66  LEU B HG   1  
ATOM   3672  H  HD11 . LEU B 2 66  ? 10.124  59.655 -13.753 1.00 1.75  ? 66  LEU B HD11 1  
ATOM   3673  H  HD12 . LEU B 2 66  ? 10.930  58.190 -13.191 1.00 1.78  ? 66  LEU B HD12 1  
ATOM   3674  H  HD13 . LEU B 2 66  ? 9.899   59.105 -12.092 1.00 1.75  ? 66  LEU B HD13 1  
ATOM   3675  H  HD21 . LEU B 2 66  ? 8.277   57.065 -11.678 1.00 1.67  ? 66  LEU B HD21 1  
ATOM   3676  H  HD22 . LEU B 2 66  ? 9.653   56.292 -12.466 1.00 1.65  ? 66  LEU B HD22 1  
ATOM   3677  H  HD23 . LEU B 2 66  ? 8.022   56.024 -13.078 1.00 1.78  ? 66  LEU B HD23 1  
ATOM   3678  N  N    . PHE B 2 67  ? 5.361   59.219 -15.527 1.00 0.97  ? 67  PHE B N    1  
ATOM   3679  C  CA   . PHE B 2 67  ? 4.351   60.151 -16.059 1.00 1.11  ? 67  PHE B CA   1  
ATOM   3680  C  C    . PHE B 2 67  ? 3.030   59.476 -16.371 1.00 1.09  ? 67  PHE B C    1  
ATOM   3681  O  O    . PHE B 2 67  ? 2.046   60.168 -16.541 1.00 1.22  ? 67  PHE B O    1  
ATOM   3682  C  CB   . PHE B 2 67  ? 4.911   60.945 -17.269 1.00 1.21  ? 67  PHE B CB   1  
ATOM   3683  C  CG   . PHE B 2 67  ? 5.173   62.383 -16.847 1.00 1.49  ? 67  PHE B CG   1  
ATOM   3684  C  CD1  . PHE B 2 67  ? 6.400   62.755 -16.250 1.00 1.93  ? 67  PHE B CD1  1  
ATOM   3685  C  CD2  . PHE B 2 67  ? 4.165   63.339 -17.024 1.00 1.95  ? 67  PHE B CD2  1  
ATOM   3686  C  CE1  . PHE B 2 67  ? 6.594   64.083 -15.842 1.00 2.64  ? 67  PHE B CE1  1  
ATOM   3687  C  CE2  . PHE B 2 67  ? 4.371   64.661 -16.620 1.00 2.57  ? 67  PHE B CE2  1  
ATOM   3688  C  CZ   . PHE B 2 67  ? 5.582   65.032 -16.029 1.00 2.88  ? 67  PHE B CZ   1  
ATOM   3689  H  H    . PHE B 2 67  ? 6.175   59.004 -16.034 1.00 0.86  ? 67  PHE B H    1  
ATOM   3690  H  HA   . PHE B 2 67  ? 4.134   60.844 -15.282 1.00 1.27  ? 67  PHE B HA   1  
ATOM   3691  H  HB2  . PHE B 2 67  ? 5.829   60.502 -17.601 1.00 1.58  ? 67  PHE B HB2  1  
ATOM   3692  H  HB3  . PHE B 2 67  ? 4.198   60.939 -18.082 1.00 1.40  ? 67  PHE B HB3  1  
ATOM   3693  H  HD1  . PHE B 2 67  ? 7.202   62.024 -16.112 1.00 2.01  ? 67  PHE B HD1  1  
ATOM   3694  H  HD2  . PHE B 2 67  ? 3.228   63.054 -17.480 1.00 2.13  ? 67  PHE B HD2  1  
ATOM   3695  H  HE1  . PHE B 2 67  ? 7.521   64.376 -15.378 1.00 3.19  ? 67  PHE B HE1  1  
ATOM   3696  H  HE2  . PHE B 2 67  ? 3.592   65.396 -16.763 1.00 3.03  ? 67  PHE B HE2  1  
ATOM   3697  H  HZ   . PHE B 2 67  ? 5.736   66.054 -15.714 1.00 3.50  ? 67  PHE B HZ   1  
ATOM   3698  N  N    . ALA B 2 68  ? 2.930   58.177 -16.492 1.00 1.04  ? 68  ALA B N    1  
ATOM   3699  C  CA   . ALA B 2 68  ? 1.596   57.596 -16.837 1.00 1.16  ? 68  ALA B CA   1  
ATOM   3700  C  C    . ALA B 2 68  ? 1.508   56.189 -16.209 1.00 1.70  ? 68  ALA B C    1  
ATOM   3701  O  O    . ALA B 2 68  ? 2.510   55.667 -15.760 1.00 2.34  ? 68  ALA B O    1  
ATOM   3702  C  CB   . ALA B 2 68  ? 1.484   57.517 -18.378 1.00 1.60  ? 68  ALA B CB   1  
ATOM   3703  H  H    . ALA B 2 68  ? 3.665   57.517 -16.421 1.00 1.01  ? 68  ALA B H    1  
ATOM   3704  H  HA   . ALA B 2 68  ? 0.815   58.215 -16.444 1.00 1.57  ? 68  ALA B HA   1  
ATOM   3705  H  HB1  . ALA B 2 68  ? 2.379   57.931 -18.821 1.00 2.20  ? 68  ALA B HB1  1  
ATOM   3706  H  HB2  . ALA B 2 68  ? 0.627   58.086 -18.714 1.00 1.97  ? 68  ALA B HB2  1  
ATOM   3707  H  HB3  . ALA B 2 68  ? 1.374   56.489 -18.696 1.00 2.00  ? 68  ALA B HB3  1  
ATOM   3708  N  N    . PRO B 2 69  ? 0.327   55.607 -16.191 1.00 2.27  ? 69  PRO B N    1  
ATOM   3709  C  CA   . PRO B 2 69  ? 0.148   54.259 -15.615 1.00 3.24  ? 69  PRO B CA   1  
ATOM   3710  C  C    . PRO B 2 69  ? 1.075   53.260 -16.325 1.00 3.50  ? 69  PRO B C    1  
ATOM   3711  O  O    . PRO B 2 69  ? 2.024   53.638 -16.983 1.00 3.97  ? 69  PRO B O    1  
ATOM   3712  C  CB   . PRO B 2 69  ? -1.344  53.917 -15.849 1.00 3.94  ? 69  PRO B CB   1  
ATOM   3713  C  CG   . PRO B 2 69  ? -1.998  55.140 -16.558 1.00 3.76  ? 69  PRO B CG   1  
ATOM   3714  C  CD   . PRO B 2 69  ? -0.907  56.222 -16.730 1.00 2.69  ? 69  PRO B CD   1  
ATOM   3715  H  HA   . PRO B 2 69  ? 0.363   54.276 -14.557 1.00 3.77  ? 69  PRO B HA   1  
ATOM   3716  H  HB2  . PRO B 2 69  ? -1.435  53.034 -16.472 1.00 4.21  ? 69  PRO B HB2  1  
ATOM   3717  H  HB3  . PRO B 2 69  ? -1.836  53.741 -14.902 1.00 4.68  ? 69  PRO B HB3  1  
ATOM   3718  H  HG2  . PRO B 2 69  ? -2.381  54.840 -17.528 1.00 4.05  ? 69  PRO B HG2  1  
ATOM   3719  H  HG3  . PRO B 2 69  ? -2.808  55.529 -15.955 1.00 4.47  ? 69  PRO B HG3  1  
ATOM   3720  H  HD2  . PRO B 2 69  ? -0.785  56.468 -17.775 1.00 2.57  ? 69  PRO B HD2  1  
ATOM   3721  H  HD3  . PRO B 2 69  ? -1.161  57.104 -16.162 1.00 2.98  ? 69  PRO B HD3  1  
ATOM   3722  N  N    . CYS B 2 70  ? 0.804   51.989 -16.194 1.00 3.83  ? 70  CYS B N    1  
ATOM   3723  C  CA   . CYS B 2 70  ? 1.664   50.969 -16.859 1.00 4.68  ? 70  CYS B CA   1  
ATOM   3724  C  C    . CYS B 2 70  ? 0.882   49.662 -17.007 1.00 5.32  ? 70  CYS B C    1  
ATOM   3725  O  O    . CYS B 2 70  ? -0.043  49.458 -16.239 1.00 5.77  ? 70  CYS B O    1  
ATOM   3726  C  CB   . CYS B 2 70  ? 2.912   50.722 -16.009 1.00 5.20  ? 70  CYS B CB   1  
ATOM   3727  S  SG   . CYS B 2 70  ? 2.445   49.862 -14.487 1.00 5.73  ? 70  CYS B SG   1  
ATOM   3728  O  OXT  . CYS B 2 70  ? 1.222   48.888 -17.887 1.00 5.68  ? 70  CYS B OXT  1  
ATOM   3729  H  H    . CYS B 2 70  ? 0.034   51.706 -15.659 1.00 3.89  ? 70  CYS B H    1  
ATOM   3730  H  HA   . CYS B 2 70  ? 1.958   51.326 -17.835 1.00 4.95  ? 70  CYS B HA   1  
ATOM   3731  H  HB2  . CYS B 2 70  ? 3.612   50.116 -16.565 1.00 5.44  ? 70  CYS B HB2  1  
ATOM   3732  H  HB3  . CYS B 2 70  ? 3.373   51.667 -15.762 1.00 5.51  ? 70  CYS B HB3  1  
ATOM   3733  H  HG   . CYS B 2 70  ? 1.684   50.312 -14.113 1.00 5.87  ? 70  CYS B HG   1  
HETATM 3734  ZN ZN   . ZN  C 3 .   ? 29.571  66.511 -19.625 1.00 0.46  ? 298 ZN  B ZN   1  
HETATM 3735  ZN ZN   . ZN  D 3 .   ? 15.715  55.178 -18.503 1.00 0.56  ? 299 ZN  B ZN   1  
ATOM   3736  N  N    . MET A 1 1   ? -8.668  69.464 -12.392 1.00 0.00  ? 1   MET A N    2  
ATOM   3737  C  CA   . MET A 1 1   ? -7.684  68.868 -11.445 1.00 0.00  ? 1   MET A CA   2  
ATOM   3738  C  C    . MET A 1 1   ? -6.898  69.986 -10.758 1.00 0.00  ? 1   MET A C    2  
ATOM   3739  O  O    . MET A 1 1   ? -6.265  69.779 -9.741  1.00 0.00  ? 1   MET A O    2  
ATOM   3740  C  CB   . MET A 1 1   ? -6.719  67.964 -12.214 1.00 0.00  ? 1   MET A CB   2  
ATOM   3741  C  CG   . MET A 1 1   ? -5.810  67.229 -11.228 1.00 0.00  ? 1   MET A CG   2  
ATOM   3742  S  SD   . MET A 1 1   ? -4.799  66.024 -12.123 1.00 0.00  ? 1   MET A SD   2  
ATOM   3743  C  CE   . MET A 1 1   ? -3.434  67.138 -12.537 1.00 0.00  ? 1   MET A CE   2  
ATOM   3744  H  H1   . MET A 1 1   ? -9.270  70.143 -11.885 1.00 0.00  ? 1   MET A H1   2  
ATOM   3745  H  H2   . MET A 1 1   ? -9.259  68.710 -12.797 1.00 0.00  ? 1   MET A H2   2  
ATOM   3746  H  H3   . MET A 1 1   ? -8.161  69.956 -13.155 1.00 0.00  ? 1   MET A H3   2  
ATOM   3747  H  HA   . MET A 1 1   ? -8.207  68.286 -10.701 1.00 0.00  ? 1   MET A HA   2  
ATOM   3748  H  HB2  . MET A 1 1   ? -7.282  67.245 -12.792 1.00 0.00  ? 1   MET A HB2  2  
ATOM   3749  H  HB3  . MET A 1 1   ? -6.115  68.565 -12.878 1.00 0.00  ? 1   MET A HB3  2  
ATOM   3750  H  HG2  . MET A 1 1   ? -5.167  67.940 -10.731 1.00 0.00  ? 1   MET A HG2  2  
ATOM   3751  H  HG3  . MET A 1 1   ? -6.415  66.716 -10.494 1.00 0.00  ? 1   MET A HG3  2  
ATOM   3752  H  HE1  . MET A 1 1   ? -2.680  66.593 -13.089 1.00 0.00  ? 1   MET A HE1  2  
ATOM   3753  H  HE2  . MET A 1 1   ? -3.000  67.530 -11.631 1.00 0.00  ? 1   MET A HE2  2  
ATOM   3754  H  HE3  . MET A 1 1   ? -3.808  67.956 -13.138 1.00 0.00  ? 1   MET A HE3  2  
ATOM   3755  N  N    . ASP A 1 2   ? -6.932  71.171 -11.304 1.00 0.00  ? 2   ASP A N    2  
ATOM   3756  C  CA   . ASP A 1 2   ? -6.186  72.300 -10.681 1.00 0.00  ? 2   ASP A CA   2  
ATOM   3757  C  C    . ASP A 1 2   ? -6.974  72.832 -9.483  1.00 0.00  ? 2   ASP A C    2  
ATOM   3758  O  O    . ASP A 1 2   ? -6.942  72.267 -8.409  1.00 0.00  ? 2   ASP A O    2  
ATOM   3759  C  CB   . ASP A 1 2   ? -6.002  73.418 -11.711 1.00 0.00  ? 2   ASP A CB   2  
ATOM   3760  C  CG   . ASP A 1 2   ? -7.319  73.647 -12.455 1.00 0.00  ? 2   ASP A CG   2  
ATOM   3761  O  OD1  . ASP A 1 2   ? -7.641  72.840 -13.311 1.00 0.00  ? 2   ASP A OD1  2  
ATOM   3762  O  OD2  . ASP A 1 2   ? -7.983  74.626 -12.156 1.00 0.00  ? 2   ASP A OD2  2  
ATOM   3763  H  H    . ASP A 1 2   ? -7.448  71.318 -12.124 1.00 0.00  ? 2   ASP A H    2  
ATOM   3764  H  HA   . ASP A 1 2   ? -5.219  71.952 -10.350 1.00 0.00  ? 2   ASP A HA   2  
ATOM   3765  H  HB2  . ASP A 1 2   ? -5.709  74.328 -11.207 1.00 0.00  ? 2   ASP A HB2  2  
ATOM   3766  H  HB3  . ASP A 1 2   ? -5.237  73.134 -12.417 1.00 0.00  ? 2   ASP A HB3  2  
ATOM   3767  N  N    . ASP A 1 3   ? -7.683  73.913 -9.659  1.00 0.00  ? 3   ASP A N    2  
ATOM   3768  C  CA   . ASP A 1 3   ? -8.478  74.478 -8.530  1.00 0.00  ? 3   ASP A CA   2  
ATOM   3769  C  C    . ASP A 1 3   ? -7.581  74.659 -7.300  1.00 0.00  ? 3   ASP A C    2  
ATOM   3770  O  O    . ASP A 1 3   ? -6.496  75.200 -7.374  1.00 0.00  ? 3   ASP A O    2  
ATOM   3771  C  CB   . ASP A 1 3   ? -9.637  73.521 -8.193  1.00 0.00  ? 3   ASP A CB   2  
ATOM   3772  C  CG   . ASP A 1 3   ? -10.180 72.907 -9.484  1.00 0.00  ? 3   ASP A CG   2  
ATOM   3773  O  OD1  . ASP A 1 3   ? -10.619 73.661 -10.336 1.00 0.00  ? 3   ASP A OD1  2  
ATOM   3774  O  OD2  . ASP A 1 3   ? -10.148 71.692 -9.598  1.00 0.00  ? 3   ASP A OD2  2  
ATOM   3775  H  H    . ASP A 1 3   ? -7.696  74.352 -10.534 1.00 0.00  ? 3   ASP A H    2  
ATOM   3776  H  HA   . ASP A 1 3   ? -8.881  75.437 -8.823  1.00 0.00  ? 3   ASP A HA   2  
ATOM   3777  H  HB2  . ASP A 1 3   ? -9.289  72.728 -7.535  1.00 0.00  ? 3   ASP A HB2  2  
ATOM   3778  H  HB3  . ASP A 1 3   ? -10.425 74.072 -7.702  1.00 0.00  ? 3   ASP A HB3  2  
ATOM   3779  N  N    . ILE A 1 4   ? -8.042  74.201 -6.174  1.00 0.00  ? 4   ILE A N    2  
ATOM   3780  C  CA   . ILE A 1 4   ? -7.267  74.315 -4.916  1.00 0.00  ? 4   ILE A CA   2  
ATOM   3781  C  C    . ILE A 1 4   ? -5.928  73.589 -5.068  1.00 0.00  ? 4   ILE A C    2  
ATOM   3782  O  O    . ILE A 1 4   ? -4.892  74.094 -4.687  1.00 0.00  ? 4   ILE A O    2  
ATOM   3783  C  CB   . ILE A 1 4   ? -8.097  73.650 -3.823  1.00 0.00  ? 4   ILE A CB   2  
ATOM   3784  C  CG1  . ILE A 1 4   ? -7.409  73.792 -2.468  1.00 0.00  ? 4   ILE A CG1  2  
ATOM   3785  C  CG2  . ILE A 1 4   ? -8.282  72.161 -4.149  1.00 0.00  ? 4   ILE A CG2  2  
ATOM   3786  C  CD1  . ILE A 1 4   ? -8.235  73.040 -1.426  1.00 0.00  ? 4   ILE A CD1  2  
ATOM   3787  H  H    . ILE A 1 4   ? -8.920  73.773 -6.153  1.00 0.00  ? 4   ILE A H    2  
ATOM   3788  H  HA   . ILE A 1 4   ? -7.104  75.353 -4.670  1.00 0.00  ? 4   ILE A HA   2  
ATOM   3789  H  HB   . ILE A 1 4   ? -9.068  74.124 -3.782  1.00 0.00  ? 4   ILE A HB   2  
ATOM   3790  H  HG12 . ILE A 1 4   ? -6.415  73.371 -2.518  1.00 0.00  ? 4   ILE A HG12 2  
ATOM   3791  H  HG13 . ILE A 1 4   ? -7.350  74.835 -2.197  1.00 0.00  ? 4   ILE A HG13 2  
ATOM   3792  H  HG21 . ILE A 1 4   ? -7.384  71.619 -3.891  1.00 0.00  ? 4   ILE A HG21 2  
ATOM   3793  H  HG22 . ILE A 1 4   ? -8.484  72.042 -5.204  1.00 0.00  ? 4   ILE A HG22 2  
ATOM   3794  H  HG23 . ILE A 1 4   ? -9.112  71.771 -3.579  1.00 0.00  ? 4   ILE A HG23 2  
ATOM   3795  H  HD11 . ILE A 1 4   ? -8.089  71.979 -1.556  1.00 0.00  ? 4   ILE A HD11 2  
ATOM   3796  H  HD12 . ILE A 1 4   ? -9.282  73.277 -1.560  1.00 0.00  ? 4   ILE A HD12 2  
ATOM   3797  H  HD13 . ILE A 1 4   ? -7.921  73.332 -0.436  1.00 0.00  ? 4   ILE A HD13 2  
ATOM   3798  N  N    . PHE A 1 5   ? -5.939  72.413 -5.632  1.00 0.00  ? 5   PHE A N    2  
ATOM   3799  C  CA   . PHE A 1 5   ? -4.665  71.659 -5.815  1.00 0.00  ? 5   PHE A CA   2  
ATOM   3800  C  C    . PHE A 1 5   ? -3.621  72.588 -6.436  1.00 0.00  ? 5   PHE A C    2  
ATOM   3801  O  O    . PHE A 1 5   ? -2.482  72.642 -6.009  1.00 0.00  ? 5   PHE A O    2  
ATOM   3802  C  CB   . PHE A 1 5   ? -4.902  70.464 -6.742  1.00 0.00  ? 5   PHE A CB   2  
ATOM   3803  C  CG   . PHE A 1 5   ? -5.973  69.574 -6.152  1.00 0.00  ? 5   PHE A CG   2  
ATOM   3804  C  CD1  . PHE A 1 5   ? -5.707  68.836 -4.992  1.00 0.00  ? 5   PHE A CD1  2  
ATOM   3805  C  CD2  . PHE A 1 5   ? -7.230  69.486 -6.764  1.00 0.00  ? 5   PHE A CD2  2  
ATOM   3806  C  CE1  . PHE A 1 5   ? -6.697  68.011 -4.444  1.00 0.00  ? 5   PHE A CE1  2  
ATOM   3807  C  CE2  . PHE A 1 5   ? -8.220  68.661 -6.216  1.00 0.00  ? 5   PHE A CE2  2  
ATOM   3808  C  CZ   . PHE A 1 5   ? -7.953  67.924 -5.056  1.00 0.00  ? 5   PHE A CZ   2  
ATOM   3809  H  H    . PHE A 1 5   ? -6.788  72.034 -5.940  1.00 0.00  ? 5   PHE A H    2  
ATOM   3810  H  HA   . PHE A 1 5   ? -4.311  71.309 -4.856  1.00 0.00  ? 5   PHE A HA   2  
ATOM   3811  H  HB2  . PHE A 1 5   ? -5.217  70.819 -7.713  1.00 0.00  ? 5   PHE A HB2  2  
ATOM   3812  H  HB3  . PHE A 1 5   ? -3.986  69.902 -6.845  1.00 0.00  ? 5   PHE A HB3  2  
ATOM   3813  H  HD1  . PHE A 1 5   ? -4.738  68.903 -4.520  1.00 0.00  ? 5   PHE A HD1  2  
ATOM   3814  H  HD2  . PHE A 1 5   ? -7.436  70.054 -7.659  1.00 0.00  ? 5   PHE A HD2  2  
ATOM   3815  H  HE1  . PHE A 1 5   ? -6.491  67.442 -3.550  1.00 0.00  ? 5   PHE A HE1  2  
ATOM   3816  H  HE2  . PHE A 1 5   ? -9.189  68.593 -6.688  1.00 0.00  ? 5   PHE A HE2  2  
ATOM   3817  H  HZ   . PHE A 1 5   ? -8.716  67.287 -4.633  1.00 0.00  ? 5   PHE A HZ   2  
ATOM   3818  N  N    . THR A 1 6   ? -4.006  73.330 -7.436  1.00 0.00  ? 6   THR A N    2  
ATOM   3819  C  CA   . THR A 1 6   ? -3.044  74.265 -8.078  1.00 0.00  ? 6   THR A CA   2  
ATOM   3820  C  C    . THR A 1 6   ? -2.818  75.456 -7.154  1.00 0.00  ? 6   THR A C    2  
ATOM   3821  O  O    . THR A 1 6   ? -1.709  75.765 -6.769  1.00 0.00  ? 6   THR A O    2  
ATOM   3822  C  CB   . THR A 1 6   ? -3.617  74.744 -9.416  1.00 0.00  ? 6   THR A CB   2  
ATOM   3823  O  OG1  . THR A 1 6   ? -3.617  73.665 -10.340 1.00 0.00  ? 6   THR A OG1  2  
ATOM   3824  C  CG2  . THR A 1 6   ? -2.765  75.887 -9.971  1.00 0.00  ? 6   THR A CG2  2  
ATOM   3825  H  H    . THR A 1 6   ? -4.932  73.277 -7.759  1.00 0.00  ? 6   THR A H    2  
ATOM   3826  H  HA   . THR A 1 6   ? -2.113  73.765 -8.243  1.00 0.00  ? 6   THR A HA   2  
ATOM   3827  H  HB   . THR A 1 6   ? -4.627  75.093 -9.269  1.00 0.00  ? 6   THR A HB   2  
ATOM   3828  H  HG1  . THR A 1 6   ? -3.384  72.866 -9.862  1.00 0.00  ? 6   THR A HG1  2  
ATOM   3829  H  HG21 . THR A 1 6   ? -2.963  76.787 -9.408  1.00 0.00  ? 6   THR A HG21 2  
ATOM   3830  H  HG22 . THR A 1 6   ? -3.012  76.049 -11.009 1.00 0.00  ? 6   THR A HG22 2  
ATOM   3831  H  HG23 . THR A 1 6   ? -1.720  75.630 -9.884  1.00 0.00  ? 6   THR A HG23 2  
ATOM   3832  N  N    . GLN A 1 7   ? -3.871  76.118 -6.799  1.00 0.00  ? 7   GLN A N    2  
ATOM   3833  C  CA   . GLN A 1 7   ? -3.753  77.296 -5.896  1.00 0.00  ? 7   GLN A CA   2  
ATOM   3834  C  C    . GLN A 1 7   ? -3.104  76.863 -4.580  1.00 0.00  ? 7   GLN A C    2  
ATOM   3835  O  O    . GLN A 1 7   ? -2.777  77.678 -3.744  1.00 0.00  ? 7   GLN A O    2  
ATOM   3836  C  CB   . GLN A 1 7   ? -5.147  77.865 -5.615  1.00 0.00  ? 7   GLN A CB   2  
ATOM   3837  C  CG   . GLN A 1 7   ? -5.022  79.237 -4.947  1.00 0.00  ? 7   GLN A CG   2  
ATOM   3838  C  CD   . GLN A 1 7   ? -6.400  79.897 -4.875  1.00 0.00  ? 7   GLN A CD   2  
ATOM   3839  O  OE1  . GLN A 1 7   ? -6.939  80.090 -3.803  1.00 0.00  ? 7   GLN A OE1  2  
ATOM   3840  N  NE2  . GLN A 1 7   ? -6.996  80.255 -5.979  1.00 0.00  ? 7   GLN A NE2  2  
ATOM   3841  H  H    . GLN A 1 7   ? -4.744  75.835 -7.129  1.00 0.00  ? 7   GLN A H    2  
ATOM   3842  H  HA   . GLN A 1 7   ? -3.143  78.051 -6.367  1.00 0.00  ? 7   GLN A HA   2  
ATOM   3843  H  HB2  . GLN A 1 7   ? -5.687  77.966 -6.546  1.00 0.00  ? 7   GLN A HB2  2  
ATOM   3844  H  HB3  . GLN A 1 7   ? -5.682  77.195 -4.959  1.00 0.00  ? 7   GLN A HB3  2  
ATOM   3845  H  HG2  . GLN A 1 7   ? -4.628  79.116 -3.948  1.00 0.00  ? 7   GLN A HG2  2  
ATOM   3846  H  HG3  . GLN A 1 7   ? -4.356  79.861 -5.524  1.00 0.00  ? 7   GLN A HG3  2  
ATOM   3847  H  HE21 . GLN A 1 7   ? -6.561  80.099 -6.843  1.00 0.00  ? 7   GLN A HE21 2  
ATOM   3848  H  HE22 . GLN A 1 7   ? -7.879  80.679 -5.944  1.00 0.00  ? 7   GLN A HE22 2  
ATOM   3849  N  N    . CYS A 1 8   ? -2.921  75.584 -4.390  1.00 0.00  ? 8   CYS A N    2  
ATOM   3850  C  CA   . CYS A 1 8   ? -2.299  75.093 -3.124  1.00 0.00  ? 8   CYS A CA   2  
ATOM   3851  C  C    . CYS A 1 8   ? -0.774  75.084 -3.260  1.00 0.00  ? 8   CYS A C    2  
ATOM   3852  O  O    . CYS A 1 8   ? -0.074  75.757 -2.530  1.00 0.00  ? 8   CYS A O    2  
ATOM   3853  C  CB   . CYS A 1 8   ? -2.783  73.677 -2.844  1.00 0.00  ? 8   CYS A CB   2  
ATOM   3854  S  SG   . CYS A 1 8   ? -1.907  73.009 -1.409  1.00 0.00  ? 8   CYS A SG   2  
ATOM   3855  H  H    . CYS A 1 8   ? -3.196  74.944 -5.078  1.00 0.00  ? 8   CYS A H    2  
ATOM   3856  H  HA   . CYS A 1 8   ? -2.591  75.736 -2.302  1.00 0.00  ? 8   CYS A HA   2  
ATOM   3857  H  HB2  . CYS A 1 8   ? -3.838  73.703 -2.641  1.00 0.00  ? 8   CYS A HB2  2  
ATOM   3858  H  HB3  . CYS A 1 8   ? -2.596  73.053 -3.704  1.00 0.00  ? 8   CYS A HB3  2  
ATOM   3859  H  HG   . CYS A 1 8   ? -1.519  72.168 -1.664  1.00 0.00  ? 8   CYS A HG   2  
ATOM   3860  N  N    . ARG A 1 9   ? -0.251  74.329 -4.192  1.00 0.00  ? 9   ARG A N    2  
ATOM   3861  C  CA   . ARG A 1 9   ? 1.229   74.287 -4.369  1.00 0.00  ? 9   ARG A CA   2  
ATOM   3862  C  C    . ARG A 1 9   ? 1.698   75.670 -4.803  1.00 0.00  ? 9   ARG A C    2  
ATOM   3863  O  O    . ARG A 1 9   ? 2.875   75.974 -4.825  1.00 0.00  ? 9   ARG A O    2  
ATOM   3864  C  CB   . ARG A 1 9   ? 1.592   73.246 -5.437  1.00 0.00  ? 9   ARG A CB   2  
ATOM   3865  C  CG   . ARG A 1 9   ? 0.899   73.591 -6.778  1.00 0.00  ? 9   ARG A CG   2  
ATOM   3866  C  CD   . ARG A 1 9   ? 1.726   74.611 -7.612  1.00 0.00  ? 9   ARG A CD   2  
ATOM   3867  N  NE   . ARG A 1 9   ? 2.033   74.050 -8.973  1.00 0.00  ? 9   ARG A NE   2  
ATOM   3868  C  CZ   . ARG A 1 9   ? 2.584   72.872 -9.129  1.00 0.00  ? 9   ARG A CZ   2  
ATOM   3869  N  NH1  . ARG A 1 9   ? 2.948   72.170 -8.092  1.00 0.00  ? 9   ARG A NH1  2  
ATOM   3870  N  NH2  . ARG A 1 9   ? 2.787   72.405 -10.330 1.00 0.00  ? 9   ARG A NH2  2  
ATOM   3871  H  H    . ARG A 1 9   ? -0.832  73.797 -4.778  1.00 0.00  ? 9   ARG A H    2  
ATOM   3872  H  HA   . ARG A 1 9   ? 1.697   74.026 -3.433  1.00 0.00  ? 9   ARG A HA   2  
ATOM   3873  H  HB2  . ARG A 1 9   ? 2.663   73.222 -5.565  1.00 0.00  ? 9   ARG A HB2  2  
ATOM   3874  H  HB3  . ARG A 1 9   ? 1.256   72.273 -5.107  1.00 0.00  ? 9   ARG A HB3  2  
ATOM   3875  H  HG2  . ARG A 1 9   ? 0.762   72.686 -7.348  1.00 0.00  ? 9   ARG A HG2  2  
ATOM   3876  H  HG3  . ARG A 1 9   ? -0.077  74.011 -6.570  1.00 0.00  ? 9   ARG A HG3  2  
ATOM   3877  H  HD2  . ARG A 1 9   ? 1.146   75.505 -7.760  1.00 0.00  ? 9   ARG A HD2  2  
ATOM   3878  H  HD3  . ARG A 1 9   ? 2.641   74.878 -7.089  1.00 0.00  ? 9   ARG A HD3  2  
ATOM   3879  H  HE   . ARG A 1 9   ? 1.796   74.574 -9.768  1.00 0.00  ? 9   ARG A HE   2  
ATOM   3880  H  HH11 . ARG A 1 9   ? 2.808   72.529 -7.172  1.00 0.00  ? 9   ARG A HH11 2  
ATOM   3881  H  HH12 . ARG A 1 9   ? 3.369   71.272 -8.219  1.00 0.00  ? 9   ARG A HH12 2  
ATOM   3882  H  HH21 . ARG A 1 9   ? 2.522   72.946 -11.128 1.00 0.00  ? 9   ARG A HH21 2  
ATOM   3883  H  HH22 . ARG A 1 9   ? 3.208   71.506 -10.452 1.00 0.00  ? 9   ARG A HH22 2  
ATOM   3884  N  N    . GLU A 1 10  ? 0.766   76.504 -5.154  1.00 0.00  ? 10  GLU A N    2  
ATOM   3885  C  CA   . GLU A 1 10  ? 1.119   77.880 -5.599  1.00 0.00  ? 10  GLU A CA   2  
ATOM   3886  C  C    . GLU A 1 10  ? 1.868   78.587 -4.464  1.00 0.00  ? 10  GLU A C    2  
ATOM   3887  O  O    . GLU A 1 10  ? 2.265   79.729 -4.582  1.00 0.00  ? 10  GLU A O    2  
ATOM   3888  C  CB   . GLU A 1 10  ? -0.165  78.659 -5.963  1.00 0.00  ? 10  GLU A CB   2  
ATOM   3889  C  CG   . GLU A 1 10  ? -0.458  78.525 -7.464  1.00 0.00  ? 10  GLU A CG   2  
ATOM   3890  C  CD   . GLU A 1 10  ? 0.598   79.295 -8.260  1.00 0.00  ? 10  GLU A CD   2  
ATOM   3891  O  OE1  . GLU A 1 10  ? 0.464   80.502 -8.371  1.00 0.00  ? 10  GLU A OE1  2  
ATOM   3892  O  OE2  . GLU A 1 10  ? 1.523   78.664 -8.745  1.00 0.00  ? 10  GLU A OE2  2  
ATOM   3893  H  H    . GLU A 1 10  ? -0.163  76.199 -5.128  1.00 0.00  ? 10  GLU A H    2  
ATOM   3894  H  HA   . GLU A 1 10  ? 1.766   77.813 -6.461  1.00 0.00  ? 10  GLU A HA   2  
ATOM   3895  H  HB2  . GLU A 1 10  ? -0.996  78.258 -5.402  1.00 0.00  ? 10  GLU A HB2  2  
ATOM   3896  H  HB3  . GLU A 1 10  ? -0.043  79.706 -5.720  1.00 0.00  ? 10  GLU A HB3  2  
ATOM   3897  H  HG2  . GLU A 1 10  ? -0.432  77.482 -7.746  1.00 0.00  ? 10  GLU A HG2  2  
ATOM   3898  H  HG3  . GLU A 1 10  ? -1.433  78.933 -7.680  1.00 0.00  ? 10  GLU A HG3  2  
ATOM   3899  N  N    . GLY A 1 11  ? 2.059   77.909 -3.363  1.00 0.00  ? 11  GLY A N    2  
ATOM   3900  C  CA   . GLY A 1 11  ? 2.773   78.515 -2.210  1.00 0.00  ? 11  GLY A CA   2  
ATOM   3901  C  C    . GLY A 1 11  ? 1.738   79.001 -1.212  1.00 0.00  ? 11  GLY A C    2  
ATOM   3902  O  O    . GLY A 1 11  ? 2.052   79.609 -0.208  1.00 0.00  ? 11  GLY A O    2  
ATOM   3903  H  H    . GLY A 1 11  ? 1.726   76.995 -3.290  1.00 0.00  ? 11  GLY A H    2  
ATOM   3904  H  HA2  . GLY A 1 11  ? 3.395   77.764 -1.753  1.00 0.00  ? 11  GLY A HA2  2  
ATOM   3905  H  HA3  . GLY A 1 11  ? 3.379   79.342 -2.532  1.00 0.00  ? 11  GLY A HA3  2  
ATOM   3906  N  N    . ASN A 1 12  ? 0.501   78.709 -1.478  1.00 0.00  ? 12  ASN A N    2  
ATOM   3907  C  CA   . ASN A 1 12  ? -0.572  79.114 -0.552  1.00 0.00  ? 12  ASN A CA   2  
ATOM   3908  C  C    . ASN A 1 12  ? -0.448  78.234 0.673   1.00 0.00  ? 12  ASN A C    2  
ATOM   3909  O  O    . ASN A 1 12  ? -1.357  77.530 1.041   1.00 0.00  ? 12  ASN A O    2  
ATOM   3910  C  CB   . ASN A 1 12  ? -1.938  78.903 -1.206  1.00 0.00  ? 12  ASN A CB   2  
ATOM   3911  C  CG   . ASN A 1 12  ? -2.091  79.861 -2.390  1.00 0.00  ? 12  ASN A CG   2  
ATOM   3912  O  OD1  . ASN A 1 12  ? -2.848  80.809 -2.324  1.00 0.00  ? 12  ASN A OD1  2  
ATOM   3913  N  ND2  . ASN A 1 12  ? -1.400  79.653 -3.477  1.00 0.00  ? 12  ASN A ND2  2  
ATOM   3914  H  H    . ASN A 1 12  ? 0.287   78.201 -2.276  1.00 0.00  ? 12  ASN A H    2  
ATOM   3915  H  HA   . ASN A 1 12  ? -0.449  80.151 -0.275  1.00 0.00  ? 12  ASN A HA   2  
ATOM   3916  H  HB2  . ASN A 1 12  ? -2.015  77.884 -1.551  1.00 0.00  ? 12  ASN A HB2  2  
ATOM   3917  H  HB3  . ASN A 1 12  ? -2.716  79.099 -0.484  1.00 0.00  ? 12  ASN A HB3  2  
ATOM   3918  H  HD21 . ASN A 1 12  ? -0.789  78.889 -3.531  1.00 0.00  ? 12  ASN A HD21 2  
ATOM   3919  H  HD22 . ASN A 1 12  ? -1.492  80.262 -4.240  1.00 0.00  ? 12  ASN A HD22 2  
ATOM   3920  N  N    . ALA A 1 13  ? 0.701   78.260 1.283   1.00 0.00  ? 13  ALA A N    2  
ATOM   3921  C  CA   . ALA A 1 13  ? 0.946   77.422 2.496   1.00 0.00  ? 13  ALA A CA   2  
ATOM   3922  C  C    . ALA A 1 13  ? -0.284  77.448 3.407   1.00 0.00  ? 13  ALA A C    2  
ATOM   3923  O  O    . ALA A 1 13  ? -0.490  76.574 4.223   1.00 0.00  ? 13  ALA A O    2  
ATOM   3924  C  CB   . ALA A 1 13  ? 2.154   77.974 3.255   1.00 0.00  ? 13  ALA A CB   2  
ATOM   3925  H  H    . ALA A 1 13  ? 1.415   78.828 0.925   1.00 0.00  ? 13  ALA A H    2  
ATOM   3926  H  HA   . ALA A 1 13  ? 1.146   76.414 2.194   1.00 0.00  ? 13  ALA A HA   2  
ATOM   3927  H  HB1  . ALA A 1 13  ? 3.023   77.951 2.615   1.00 0.00  ? 13  ALA A HB1  2  
ATOM   3928  H  HB2  . ALA A 1 13  ? 2.336   77.369 4.131   1.00 0.00  ? 13  ALA A HB2  2  
ATOM   3929  H  HB3  . ALA A 1 13  ? 1.955   78.992 3.556   1.00 0.00  ? 13  ALA A HB3  2  
ATOM   3930  N  N    . VAL A 1 14  ? -1.117  78.430 3.238   1.00 0.00  ? 14  VAL A N    2  
ATOM   3931  C  CA   . VAL A 1 14  ? -2.355  78.515 4.063   1.00 0.00  ? 14  VAL A CA   2  
ATOM   3932  C  C    . VAL A 1 14  ? -3.362  77.488 3.548   1.00 0.00  ? 14  VAL A C    2  
ATOM   3933  O  O    . VAL A 1 14  ? -4.166  76.958 4.289   1.00 0.00  ? 14  VAL A O    2  
ATOM   3934  C  CB   . VAL A 1 14  ? -2.950  79.920 3.947   1.00 0.00  ? 14  VAL A CB   2  
ATOM   3935  C  CG1  . VAL A 1 14  ? -3.265  80.221 2.481   1.00 0.00  ? 14  VAL A CG1  2  
ATOM   3936  C  CG2  . VAL A 1 14  ? -4.237  79.997 4.771   1.00 0.00  ? 14  VAL A CG2  2  
ATOM   3937  H  H    . VAL A 1 14  ? -0.939  79.089 2.536   1.00 0.00  ? 14  VAL A H    2  
ATOM   3938  H  HA   . VAL A 1 14  ? -2.117  78.306 5.095   1.00 0.00  ? 14  VAL A HA   2  
ATOM   3939  H  HB   . VAL A 1 14  ? -2.238  80.643 4.318   1.00 0.00  ? 14  VAL A HB   2  
ATOM   3940  H  HG11 . VAL A 1 14  ? -3.524  81.264 2.376   1.00 0.00  ? 14  VAL A HG11 2  
ATOM   3941  H  HG12 . VAL A 1 14  ? -4.095  79.610 2.159   1.00 0.00  ? 14  VAL A HG12 2  
ATOM   3942  H  HG13 . VAL A 1 14  ? -2.399  80.002 1.874   1.00 0.00  ? 14  VAL A HG13 2  
ATOM   3943  H  HG21 . VAL A 1 14  ? -4.558  81.026 4.842   1.00 0.00  ? 14  VAL A HG21 2  
ATOM   3944  H  HG22 . VAL A 1 14  ? -4.055  79.607 5.761   1.00 0.00  ? 14  VAL A HG22 2  
ATOM   3945  H  HG23 . VAL A 1 14  ? -5.008  79.413 4.290   1.00 0.00  ? 14  VAL A HG23 2  
ATOM   3946  N  N    . ALA A 1 15  ? -3.318  77.205 2.276   1.00 0.00  ? 15  ALA A N    2  
ATOM   3947  C  CA   . ALA A 1 15  ? -4.261  76.219 1.686   1.00 0.00  ? 15  ALA A CA   2  
ATOM   3948  C  C    . ALA A 1 15  ? -3.862  74.806 2.120   1.00 0.00  ? 15  ALA A C    2  
ATOM   3949  O  O    . ALA A 1 15  ? -4.699  73.992 2.465   1.00 0.00  ? 15  ALA A O    2  
ATOM   3950  C  CB   . ALA A 1 15  ? -4.206  76.321 0.162   1.00 0.00  ? 15  ALA A CB   2  
ATOM   3951  H  H    . ALA A 1 15  ? -2.660  77.652 1.703   1.00 0.00  ? 15  ALA A H    2  
ATOM   3952  H  HA   . ALA A 1 15  ? -5.264  76.434 2.024   1.00 0.00  ? 15  ALA A HA   2  
ATOM   3953  H  HB1  . ALA A 1 15  ? -4.647  75.439 -0.278  1.00 0.00  ? 15  ALA A HB1  2  
ATOM   3954  H  HB2  . ALA A 1 15  ? -3.177  76.404 -0.152  1.00 0.00  ? 15  ALA A HB2  2  
ATOM   3955  H  HB3  . ALA A 1 15  ? -4.752  77.196 -0.161  1.00 0.00  ? 15  ALA A HB3  2  
ATOM   3956  N  N    . VAL A 1 16  ? -2.599  74.477 2.106   1.00 0.00  ? 16  VAL A N    2  
ATOM   3957  C  CA   . VAL A 1 16  ? -2.213  73.117 2.522   1.00 0.00  ? 16  VAL A CA   2  
ATOM   3958  C  C    . VAL A 1 16  ? -2.331  73.052 4.052   1.00 0.00  ? 16  VAL A C    2  
ATOM   3959  O  O    . VAL A 1 16  ? -2.682  72.033 4.618   1.00 0.00  ? 16  VAL A O    2  
ATOM   3960  C  CB   . VAL A 1 16  ? -0.786  72.832 2.021   1.00 0.00  ? 16  VAL A CB   2  
ATOM   3961  C  CG1  . VAL A 1 16  ? 0.061   74.104 2.070   1.00 0.00  ? 16  VAL A CG1  2  
ATOM   3962  C  CG2  . VAL A 1 16  ? -0.141  71.755 2.879   1.00 0.00  ? 16  VAL A CG2  2  
ATOM   3963  H  H    . VAL A 1 16  ? -1.899  75.097 1.824   1.00 0.00  ? 16  VAL A H    2  
ATOM   3964  H  HA   . VAL A 1 16  ? -2.898  72.402 2.085   1.00 0.00  ? 16  VAL A HA   2  
ATOM   3965  H  HB   . VAL A 1 16  ? -0.834  72.491 0.999   1.00 0.00  ? 16  VAL A HB   2  
ATOM   3966  H  HG11 . VAL A 1 16  ? -0.105  74.612 3.007   1.00 0.00  ? 16  VAL A HG11 2  
ATOM   3967  H  HG12 . VAL A 1 16  ? -0.214  74.756 1.251   1.00 0.00  ? 16  VAL A HG12 2  
ATOM   3968  H  HG13 . VAL A 1 16  ? 1.107   73.848 1.980   1.00 0.00  ? 16  VAL A HG13 2  
ATOM   3969  H  HG21 . VAL A 1 16  ? -0.841  70.946 3.014   1.00 0.00  ? 16  VAL A HG21 2  
ATOM   3970  H  HG22 . VAL A 1 16  ? 0.118   72.177 3.836   1.00 0.00  ? 16  VAL A HG22 2  
ATOM   3971  H  HG23 . VAL A 1 16  ? 0.747   71.390 2.389   1.00 0.00  ? 16  VAL A HG23 2  
ATOM   3972  N  N    . ARG A 1 17  ? -2.101  74.147 4.727   1.00 0.00  ? 17  ARG A N    2  
ATOM   3973  C  CA   . ARG A 1 17  ? -2.271  74.133 6.202   1.00 0.00  ? 17  ARG A CA   2  
ATOM   3974  C  C    . ARG A 1 17  ? -3.764  73.960 6.453   1.00 0.00  ? 17  ARG A C    2  
ATOM   3975  O  O    . ARG A 1 17  ? -4.189  73.197 7.292   1.00 0.00  ? 17  ARG A O    2  
ATOM   3976  C  CB   . ARG A 1 17  ? -1.767  75.446 6.807   1.00 0.00  ? 17  ARG A CB   2  
ATOM   3977  C  CG   . ARG A 1 17  ? -2.192  75.553 8.283   1.00 0.00  ? 17  ARG A CG   2  
ATOM   3978  C  CD   . ARG A 1 17  ? -1.574  76.816 8.930   1.00 0.00  ? 17  ARG A CD   2  
ATOM   3979  N  NE   . ARG A 1 17  ? -0.954  76.472 10.252  1.00 0.00  ? 17  ARG A NE   2  
ATOM   3980  C  CZ   . ARG A 1 17  ? -1.588  75.739 11.132  1.00 0.00  ? 17  ARG A CZ   2  
ATOM   3981  N  NH1  . ARG A 1 17  ? -2.814  75.356 10.911  1.00 0.00  ? 17  ARG A NH1  2  
ATOM   3982  N  NH2  . ARG A 1 17  ? -0.996  75.410 12.248  1.00 0.00  ? 17  ARG A NH2  2  
ATOM   3983  H  H    . ARG A 1 17  ? -1.864  74.978 4.262   1.00 0.00  ? 17  ARG A H    2  
ATOM   3984  H  HA   . ARG A 1 17  ? -1.730  73.299 6.622   1.00 0.00  ? 17  ARG A HA   2  
ATOM   3985  H  HB2  . ARG A 1 17  ? -0.689  75.468 6.746   1.00 0.00  ? 17  ARG A HB2  2  
ATOM   3986  H  HB3  . ARG A 1 17  ? -2.177  76.276 6.255   1.00 0.00  ? 17  ARG A HB3  2  
ATOM   3987  H  HG2  . ARG A 1 17  ? -3.270  75.610 8.339   1.00 0.00  ? 17  ARG A HG2  2  
ATOM   3988  H  HG3  . ARG A 1 17  ? -1.852  74.675 8.809   1.00 0.00  ? 17  ARG A HG3  2  
ATOM   3989  H  HD2  . ARG A 1 17  ? -0.799  77.216 8.297   1.00 0.00  ? 17  ARG A HD2  2  
ATOM   3990  H  HD3  . ARG A 1 17  ? -2.345  77.571 9.057   1.00 0.00  ? 17  ARG A HD3  2  
ATOM   3991  H  HE   . ARG A 1 17  ? -0.047  76.785 10.452  1.00 0.00  ? 17  ARG A HE   2  
ATOM   3992  H  HH11 . ARG A 1 17  ? -3.278  75.622 10.070  1.00 0.00  ? 17  ARG A HH11 2  
ATOM   3993  H  HH12 . ARG A 1 17  ? -3.291  74.793 11.587  1.00 0.00  ? 17  ARG A HH12 2  
ATOM   3994  H  HH21 . ARG A 1 17  ? -0.062  75.718 12.429  1.00 0.00  ? 17  ARG A HH21 2  
ATOM   3995  H  HH22 . ARG A 1 17  ? -1.478  74.850 12.922  1.00 0.00  ? 17  ARG A HH22 2  
ATOM   3996  N  N    . LEU A 1 18  ? -4.572  74.646 5.693   1.00 0.00  ? 18  LEU A N    2  
ATOM   3997  C  CA   . LEU A 1 18  ? -6.045  74.498 5.839   1.00 0.00  ? 18  LEU A CA   2  
ATOM   3998  C  C    . LEU A 1 18  ? -6.342  72.988 5.857   1.00 0.00  ? 18  LEU A C    2  
ATOM   3999  O  O    . LEU A 1 18  ? -7.160  72.515 6.621   1.00 0.00  ? 18  LEU A O    2  
ATOM   4000  C  CB   . LEU A 1 18  ? -6.704  75.242 4.650   1.00 0.00  ? 18  LEU A CB   2  
ATOM   4001  C  CG   . LEU A 1 18  ? -8.076  74.666 4.230   1.00 0.00  ? 18  LEU A CG   2  
ATOM   4002  C  CD1  . LEU A 1 18  ? -9.160  75.173 5.181   1.00 0.00  ? 18  LEU A CD1  2  
ATOM   4003  C  CD2  . LEU A 1 18  ? -8.394  75.143 2.801   1.00 0.00  ? 18  LEU A CD2  2  
ATOM   4004  H  H    . LEU A 1 18  ? -4.210  75.246 5.008   1.00 0.00  ? 18  LEU A H    2  
ATOM   4005  H  HA   . LEU A 1 18  ? -6.361  74.941 6.774   1.00 0.00  ? 18  LEU A HA   2  
ATOM   4006  H  HB2  . LEU A 1 18  ? -6.835  76.278 4.922   1.00 0.00  ? 18  LEU A HB2  2  
ATOM   4007  H  HB3  . LEU A 1 18  ? -6.033  75.197 3.815   1.00 0.00  ? 18  LEU A HB3  2  
ATOM   4008  H  HG   . LEU A 1 18  ? -8.064  73.592 4.244   1.00 0.00  ? 18  LEU A HG   2  
ATOM   4009  H  HD11 . LEU A 1 18  ? -8.950  74.828 6.183   1.00 0.00  ? 18  LEU A HD11 2  
ATOM   4010  H  HD12 . LEU A 1 18  ? -10.121 74.797 4.865   1.00 0.00  ? 18  LEU A HD12 2  
ATOM   4011  H  HD13 . LEU A 1 18  ? -9.173  76.253 5.168   1.00 0.00  ? 18  LEU A HD13 2  
ATOM   4012  H  HD21 . LEU A 1 18  ? -9.329  74.714 2.476   1.00 0.00  ? 18  LEU A HD21 2  
ATOM   4013  H  HD22 . LEU A 1 18  ? -7.602  74.832 2.128   1.00 0.00  ? 18  LEU A HD22 2  
ATOM   4014  H  HD23 . LEU A 1 18  ? -8.468  76.221 2.788   1.00 0.00  ? 18  LEU A HD23 2  
ATOM   4015  N  N    . TRP A 1 19  ? -5.657  72.226 5.033   1.00 0.00  ? 19  TRP A N    2  
ATOM   4016  C  CA   . TRP A 1 19  ? -5.878  70.761 5.027   1.00 0.00  ? 19  TRP A CA   2  
ATOM   4017  C  C    . TRP A 1 19  ? -5.431  70.171 6.366   1.00 0.00  ? 19  TRP A C    2  
ATOM   4018  O  O    . TRP A 1 19  ? -5.987  69.202 6.843   1.00 0.00  ? 19  TRP A O    2  
ATOM   4019  C  CB   . TRP A 1 19  ? -5.036  70.092 3.940   1.00 0.00  ? 19  TRP A CB   2  
ATOM   4020  C  CG   . TRP A 1 19  ? -5.216  70.729 2.602   1.00 0.00  ? 19  TRP A CG   2  
ATOM   4021  C  CD1  . TRP A 1 19  ? -6.109  71.693 2.285   1.00 0.00  ? 19  TRP A CD1  2  
ATOM   4022  C  CD2  . TRP A 1 19  ? -4.482  70.432 1.382   1.00 0.00  ? 19  TRP A CD2  2  
ATOM   4023  N  NE1  . TRP A 1 19  ? -5.958  72.015 0.948   1.00 0.00  ? 19  TRP A NE1  2  
ATOM   4024  C  CE2  . TRP A 1 19  ? -4.966  71.262 0.350   1.00 0.00  ? 19  TRP A CE2  2  
ATOM   4025  C  CE3  . TRP A 1 19  ? -3.444  69.530 1.078   1.00 0.00  ? 19  TRP A CE3  2  
ATOM   4026  C  CZ2  . TRP A 1 19  ? -4.441  71.202 -0.939  1.00 0.00  ? 19  TRP A CZ2  2  
ATOM   4027  C  CZ3  . TRP A 1 19  ? -2.915  69.466 -0.220  1.00 0.00  ? 19  TRP A CZ3  2  
ATOM   4028  C  CH2  . TRP A 1 19  ? -3.412  70.302 -1.227  1.00 0.00  ? 19  TRP A CH2  2  
ATOM   4029  H  H    . TRP A 1 19  ? -4.999  72.623 4.427   1.00 0.00  ? 19  TRP A H    2  
ATOM   4030  H  HA   . TRP A 1 19  ? -6.920  70.550 4.869   1.00 0.00  ? 19  TRP A HA   2  
ATOM   4031  H  HB2  . TRP A 1 19  ? -3.994  70.146 4.212   1.00 0.00  ? 19  TRP A HB2  2  
ATOM   4032  H  HB3  . TRP A 1 19  ? -5.322  69.068 3.877   1.00 0.00  ? 19  TRP A HB3  2  
ATOM   4033  H  HD1  . TRP A 1 19  ? -6.819  72.139 2.959   1.00 0.00  ? 19  TRP A HD1  2  
ATOM   4034  H  HE1  . TRP A 1 19  ? -6.479  72.690 0.467   1.00 0.00  ? 19  TRP A HE1  2  
ATOM   4035  H  HE3  . TRP A 1 19  ? -3.058  68.877 1.848   1.00 0.00  ? 19  TRP A HE3  2  
ATOM   4036  H  HZ2  . TRP A 1 19  ? -4.826  71.845 -1.708  1.00 0.00  ? 19  TRP A HZ2  2  
ATOM   4037  H  HZ3  . TRP A 1 19  ? -2.120  68.770 -0.442  1.00 0.00  ? 19  TRP A HZ3  2  
ATOM   4038  H  HH2  . TRP A 1 19  ? -3.003  70.249 -2.224  1.00 0.00  ? 19  TRP A HH2  2  
ATOM   4039  N  N    . LEU A 1 20  ? -4.422  70.740 6.974   1.00 0.00  ? 20  LEU A N    2  
ATOM   4040  C  CA   . LEU A 1 20  ? -3.944  70.191 8.276   1.00 0.00  ? 20  LEU A CA   2  
ATOM   4041  C  C    . LEU A 1 20  ? -5.049  70.356 9.326   1.00 0.00  ? 20  LEU A C    2  
ATOM   4042  O  O    . LEU A 1 20  ? -5.295  69.467 10.118  1.00 0.00  ? 20  LEU A O    2  
ATOM   4043  C  CB   . LEU A 1 20  ? -2.657  70.936 8.721   1.00 0.00  ? 20  LEU A CB   2  
ATOM   4044  C  CG   . LEU A 1 20  ? -1.399  70.139 8.310   1.00 0.00  ? 20  LEU A CG   2  
ATOM   4045  C  CD1  . LEU A 1 20  ? -0.199  71.086 8.156   1.00 0.00  ? 20  LEU A CD1  2  
ATOM   4046  C  CD2  . LEU A 1 20  ? -1.084  69.098 9.386   1.00 0.00  ? 20  LEU A CD2  2  
ATOM   4047  H  H    . LEU A 1 20  ? -3.985  71.528 6.579   1.00 0.00  ? 20  LEU A H    2  
ATOM   4048  H  HA   . LEU A 1 20  ? -3.732  69.137 8.157   1.00 0.00  ? 20  LEU A HA   2  
ATOM   4049  H  HB2  . LEU A 1 20  ? -2.629  71.902 8.253   1.00 0.00  ? 20  LEU A HB2  2  
ATOM   4050  H  HB3  . LEU A 1 20  ? -2.660  71.068 9.796   1.00 0.00  ? 20  LEU A HB3  2  
ATOM   4051  H  HG   . LEU A 1 20  ? -1.580  69.640 7.368   1.00 0.00  ? 20  LEU A HG   2  
ATOM   4052  H  HD11 . LEU A 1 20  ? -0.259  71.590 7.203   1.00 0.00  ? 20  LEU A HD11 2  
ATOM   4053  H  HD12 . LEU A 1 20  ? 0.721   70.520 8.202   1.00 0.00  ? 20  LEU A HD12 2  
ATOM   4054  H  HD13 . LEU A 1 20  ? -0.212  71.817 8.951   1.00 0.00  ? 20  LEU A HD13 2  
ATOM   4055  H  HD21 . LEU A 1 20  ? -0.640  69.590 10.239  1.00 0.00  ? 20  LEU A HD21 2  
ATOM   4056  H  HD22 . LEU A 1 20  ? -0.394  68.369 8.989   1.00 0.00  ? 20  LEU A HD22 2  
ATOM   4057  H  HD23 . LEU A 1 20  ? -1.997  68.607 9.688   1.00 0.00  ? 20  LEU A HD23 2  
ATOM   4058  N  N    . ASP A 1 21  ? -5.705  71.488 9.356   1.00 0.00  ? 21  ASP A N    2  
ATOM   4059  C  CA   . ASP A 1 21  ? -6.780  71.712 10.374  1.00 0.00  ? 21  ASP A CA   2  
ATOM   4060  C  C    . ASP A 1 21  ? -8.150  71.447 9.755   1.00 0.00  ? 21  ASP A C    2  
ATOM   4061  O  O    . ASP A 1 21  ? -9.098  72.172 9.984   1.00 0.00  ? 21  ASP A O    2  
ATOM   4062  C  CB   . ASP A 1 21  ? -6.717  73.161 10.852  1.00 0.00  ? 21  ASP A CB   2  
ATOM   4063  C  CG   . ASP A 1 21  ? -7.564  73.323 12.115  1.00 0.00  ? 21  ASP A CG   2  
ATOM   4064  O  OD1  . ASP A 1 21  ? -7.055  73.037 13.186  1.00 0.00  ? 21  ASP A OD1  2  
ATOM   4065  O  OD2  . ASP A 1 21  ? -8.707  73.730 11.989  1.00 0.00  ? 21  ASP A OD2  2  
ATOM   4066  H  H    . ASP A 1 21  ? -5.485  72.207 8.725   1.00 0.00  ? 21  ASP A H    2  
ATOM   4067  H  HA   . ASP A 1 21  ? -6.633  71.052 11.219  1.00 0.00  ? 21  ASP A HA   2  
ATOM   4068  H  HB2  . ASP A 1 21  ? -5.692  73.417 11.068  1.00 0.00  ? 21  ASP A HB2  2  
ATOM   4069  H  HB3  . ASP A 1 21  ? -7.096  73.813 10.080  1.00 0.00  ? 21  ASP A HB3  2  
ATOM   4070  N  N    . ASN A 1 22  ? -8.262  70.412 8.972   1.00 0.00  ? 22  ASN A N    2  
ATOM   4071  C  CA   . ASN A 1 22  ? -9.569  70.083 8.327   1.00 0.00  ? 22  ASN A CA   2  
ATOM   4072  C  C    . ASN A 1 22  ? -10.277 68.994 9.137   1.00 0.00  ? 22  ASN A C    2  
ATOM   4073  O  O    . ASN A 1 22  ? -9.691  67.995 9.493   1.00 0.00  ? 22  ASN A O    2  
ATOM   4074  C  CB   . ASN A 1 22  ? -9.316  69.590 6.901   1.00 0.00  ? 22  ASN A CB   2  
ATOM   4075  C  CG   . ASN A 1 22  ? -8.644  68.217 6.927   1.00 0.00  ? 22  ASN A CG   2  
ATOM   4076  O  OD1  . ASN A 1 22  ? -8.848  67.415 6.039   1.00 0.00  ? 22  ASN A OD1  2  
ATOM   4077  N  ND2  . ASN A 1 22  ? -7.842  67.914 7.911   1.00 0.00  ? 22  ASN A ND2  2  
ATOM   4078  H  H    . ASN A 1 22  ? -7.481  69.846 8.807   1.00 0.00  ? 22  ASN A H    2  
ATOM   4079  H  HA   . ASN A 1 22  ? -10.195 70.965 8.292   1.00 0.00  ? 22  ASN A HA   2  
ATOM   4080  H  HB2  . ASN A 1 22  ? -10.253 69.523 6.371   1.00 0.00  ? 22  ASN A HB2  2  
ATOM   4081  H  HB3  . ASN A 1 22  ? -8.669  70.287 6.398   1.00 0.00  ? 22  ASN A HB3  2  
ATOM   4082  H  HD21 . ASN A 1 22  ? -7.675  68.565 8.624   1.00 0.00  ? 22  ASN A HD21 2  
ATOM   4083  H  HD22 . ASN A 1 22  ? -7.407  67.037 7.935   1.00 0.00  ? 22  ASN A HD22 2  
ATOM   4084  N  N    . THR A 1 23  ? -11.531 69.184 9.436   1.00 0.00  ? 23  THR A N    2  
ATOM   4085  C  CA   . THR A 1 23  ? -12.270 68.159 10.228  1.00 0.00  ? 23  THR A CA   2  
ATOM   4086  C  C    . THR A 1 23  ? -12.707 67.011 9.312   1.00 0.00  ? 23  THR A C    2  
ATOM   4087  O  O    . THR A 1 23  ? -13.376 66.090 9.738   1.00 0.00  ? 23  THR A O    2  
ATOM   4088  C  CB   . THR A 1 23  ? -13.506 68.801 10.863  1.00 0.00  ? 23  THR A CB   2  
ATOM   4089  O  OG1  . THR A 1 23  ? -14.341 69.329 9.842   1.00 0.00  ? 23  THR A OG1  2  
ATOM   4090  C  CG2  . THR A 1 23  ? -13.073 69.925 11.806  1.00 0.00  ? 23  THR A CG2  2  
ATOM   4091  H  H    . THR A 1 23  ? -11.986 70.001 9.145   1.00 0.00  ? 23  THR A H    2  
ATOM   4092  H  HA   . THR A 1 23  ? -11.628 67.773 11.006  1.00 0.00  ? 23  THR A HA   2  
ATOM   4093  H  HB   . THR A 1 23  ? -14.050 68.057 11.424  1.00 0.00  ? 23  THR A HB   2  
ATOM   4094  H  HG1  . THR A 1 23  ? -13.937 70.138 9.518   1.00 0.00  ? 23  THR A HG1  2  
ATOM   4095  H  HG21 . THR A 1 23  ? -13.943 70.341 12.294  1.00 0.00  ? 23  THR A HG21 2  
ATOM   4096  H  HG22 . THR A 1 23  ? -12.575 70.698 11.239  1.00 0.00  ? 23  THR A HG22 2  
ATOM   4097  H  HG23 . THR A 1 23  ? -12.397 69.531 12.550  1.00 0.00  ? 23  THR A HG23 2  
ATOM   4098  N  N    . GLU A 1 24  ? -12.337 67.058 8.056   1.00 0.00  ? 24  GLU A N    2  
ATOM   4099  C  CA   . GLU A 1 24  ? -12.734 65.969 7.107   1.00 0.00  ? 24  GLU A CA   2  
ATOM   4100  C  C    . GLU A 1 24  ? -11.562 64.999 6.919   1.00 0.00  ? 24  GLU A C    2  
ATOM   4101  O  O    . GLU A 1 24  ? -11.746 63.808 6.768   1.00 0.00  ? 24  GLU A O    2  
ATOM   4102  C  CB   . GLU A 1 24  ? -13.097 66.594 5.754   1.00 0.00  ? 24  GLU A CB   2  
ATOM   4103  C  CG   . GLU A 1 24  ? -12.197 67.802 5.490   1.00 0.00  ? 24  GLU A CG   2  
ATOM   4104  C  CD   . GLU A 1 24  ? -12.430 68.311 4.066   1.00 0.00  ? 24  GLU A CD   2  
ATOM   4105  O  OE1  . GLU A 1 24  ? -13.575 68.334 3.646   1.00 0.00  ? 24  GLU A OE1  2  
ATOM   4106  O  OE2  . GLU A 1 24  ? -11.459 68.669 3.420   1.00 0.00  ? 24  GLU A OE2  2  
ATOM   4107  H  H    . GLU A 1 24  ? -11.799 67.812 7.734   1.00 0.00  ? 24  GLU A H    2  
ATOM   4108  H  HA   . GLU A 1 24  ? -13.588 65.430 7.495   1.00 0.00  ? 24  GLU A HA   2  
ATOM   4109  H  HB2  . GLU A 1 24  ? -12.956 65.866 4.968   1.00 0.00  ? 24  GLU A HB2  2  
ATOM   4110  H  HB3  . GLU A 1 24  ? -14.129 66.913 5.769   1.00 0.00  ? 24  GLU A HB3  2  
ATOM   4111  H  HG2  . GLU A 1 24  ? -12.430 68.586 6.196   1.00 0.00  ? 24  GLU A HG2  2  
ATOM   4112  H  HG3  . GLU A 1 24  ? -11.164 67.511 5.601   1.00 0.00  ? 24  GLU A HG3  2  
ATOM   4113  N  N    . ASN A 1 25  ? -10.363 65.505 6.920   1.00 0.00  ? 25  ASN A N    2  
ATOM   4114  C  CA   . ASN A 1 25  ? -9.176  64.621 6.738   1.00 0.00  ? 25  ASN A CA   2  
ATOM   4115  C  C    . ASN A 1 25  ? -9.347  63.784 5.472   1.00 0.00  ? 25  ASN A C    2  
ATOM   4116  O  O    . ASN A 1 25  ? -9.568  62.590 5.521   1.00 0.00  ? 25  ASN A O    2  
ATOM   4117  C  CB   . ASN A 1 25  ? -9.020  63.716 7.961   1.00 0.00  ? 25  ASN A CB   2  
ATOM   4118  C  CG   . ASN A 1 25  ? -8.593  64.580 9.146   1.00 0.00  ? 25  ASN A CG   2  
ATOM   4119  O  OD1  . ASN A 1 25  ? -8.184  64.077 10.173  1.00 0.00  ? 25  ASN A OD1  2  
ATOM   4120  N  ND2  . ASN A 1 25  ? -8.675  65.879 9.034   1.00 0.00  ? 25  ASN A ND2  2  
ATOM   4121  H  H    . ASN A 1 25  ? -10.243 66.471 7.035   1.00 0.00  ? 25  ASN A H    2  
ATOM   4122  H  HA   . ASN A 1 25  ? -8.291  65.232 6.637   1.00 0.00  ? 25  ASN A HA   2  
ATOM   4123  H  HB2  . ASN A 1 25  ? -9.962  63.234 8.181   1.00 0.00  ? 25  ASN A HB2  2  
ATOM   4124  H  HB3  . ASN A 1 25  ? -8.265  62.970 7.769   1.00 0.00  ? 25  ASN A HB3  2  
ATOM   4125  H  HD21 . ASN A 1 25  ? -9.010  66.274 8.202   1.00 0.00  ? 25  ASN A HD21 2  
ATOM   4126  H  HD22 . ASN A 1 25  ? -8.401  66.459 9.774   1.00 0.00  ? 25  ASN A HD22 2  
ATOM   4127  N  N    . ASP A 1 26  ? -9.234  64.415 4.334   1.00 0.00  ? 26  ASP A N    2  
ATOM   4128  C  CA   . ASP A 1 26  ? -9.374  63.688 3.038   1.00 0.00  ? 26  ASP A CA   2  
ATOM   4129  C  C    . ASP A 1 26  ? -8.501  64.373 1.992   1.00 0.00  ? 26  ASP A C    2  
ATOM   4130  O  O    . ASP A 1 26  ? -7.913  63.738 1.139   1.00 0.00  ? 26  ASP A O    2  
ATOM   4131  C  CB   . ASP A 1 26  ? -10.835 63.716 2.585   1.00 0.00  ? 26  ASP A CB   2  
ATOM   4132  C  CG   . ASP A 1 26  ? -11.712 63.042 3.642   1.00 0.00  ? 26  ASP A CG   2  
ATOM   4133  O  OD1  . ASP A 1 26  ? -11.403 61.922 4.012   1.00 0.00  ? 26  ASP A OD1  2  
ATOM   4134  O  OD2  . ASP A 1 26  ? -12.677 63.659 4.063   1.00 0.00  ? 26  ASP A OD2  2  
ATOM   4135  H  H    . ASP A 1 26  ? -9.049  65.377 4.333   1.00 0.00  ? 26  ASP A H    2  
ATOM   4136  H  HA   . ASP A 1 26  ? -9.051  62.673 3.157   1.00 0.00  ? 26  ASP A HA   2  
ATOM   4137  H  HB2  . ASP A 1 26  ? -11.151 64.741 2.453   1.00 0.00  ? 26  ASP A HB2  2  
ATOM   4138  H  HB3  . ASP A 1 26  ? -10.932 63.186 1.649   1.00 0.00  ? 26  ASP A HB3  2  
ATOM   4139  N  N    . LEU A 1 27  ? -8.413  65.667 2.060   1.00 0.00  ? 27  LEU A N    2  
ATOM   4140  C  CA   . LEU A 1 27  ? -7.578  66.418 1.080   1.00 0.00  ? 27  LEU A CA   2  
ATOM   4141  C  C    . LEU A 1 27  ? -6.182  65.777 1.039   1.00 0.00  ? 27  LEU A C    2  
ATOM   4142  O  O    . LEU A 1 27  ? -5.397  66.020 0.145   1.00 0.00  ? 27  LEU A O    2  
ATOM   4143  C  CB   . LEU A 1 27  ? -7.491  67.899 1.516   1.00 0.00  ? 27  LEU A CB   2  
ATOM   4144  C  CG   . LEU A 1 27  ? -7.504  68.846 0.297   1.00 0.00  ? 27  LEU A CG   2  
ATOM   4145  C  CD1  . LEU A 1 27  ? -6.348  68.498 -0.650  1.00 0.00  ? 27  LEU A CD1  2  
ATOM   4146  C  CD2  . LEU A 1 27  ? -8.852  68.750 -0.455  1.00 0.00  ? 27  LEU A CD2  2  
ATOM   4147  H  H    . LEU A 1 27  ? -8.903  66.140 2.758   1.00 0.00  ? 27  LEU A H    2  
ATOM   4148  H  HA   . LEU A 1 27  ? -8.032  66.342 0.106   1.00 0.00  ? 27  LEU A HA   2  
ATOM   4149  H  HB2  . LEU A 1 27  ? -8.338  68.128 2.146   1.00 0.00  ? 27  LEU A HB2  2  
ATOM   4150  H  HB3  . LEU A 1 27  ? -6.583  68.062 2.081   1.00 0.00  ? 27  LEU A HB3  2  
ATOM   4151  H  HG   . LEU A 1 27  ? -7.368  69.860 0.647   1.00 0.00  ? 27  LEU A HG   2  
ATOM   4152  H  HD11 . LEU A 1 27  ? -6.198  69.311 -1.345  1.00 0.00  ? 27  LEU A HD11 2  
ATOM   4153  H  HD12 . LEU A 1 27  ? -6.585  67.598 -1.198  1.00 0.00  ? 27  LEU A HD12 2  
ATOM   4154  H  HD13 . LEU A 1 27  ? -5.448  68.345 -0.077  1.00 0.00  ? 27  LEU A HD13 2  
ATOM   4155  H  HD21 . LEU A 1 27  ? -8.779  68.036 -1.264  1.00 0.00  ? 27  LEU A HD21 2  
ATOM   4156  H  HD22 . LEU A 1 27  ? -9.099  69.719 -0.861  1.00 0.00  ? 27  LEU A HD22 2  
ATOM   4157  H  HD23 . LEU A 1 27  ? -9.633  68.442 0.226   1.00 0.00  ? 27  LEU A HD23 2  
ATOM   4158  N  N    . ASN A 1 28  ? -5.889  64.935 1.992   1.00 77.83 ? 28  ASN A N    2  
ATOM   4159  C  CA   . ASN A 1 28  ? -4.573  64.249 2.009   1.00 78.20 ? 28  ASN A CA   2  
ATOM   4160  C  C    . ASN A 1 28  ? -4.563  63.178 0.916   1.00 78.50 ? 28  ASN A C    2  
ATOM   4161  O  O    . ASN A 1 28  ? -3.860  62.191 1.005   1.00 79.07 ? 28  ASN A O    2  
ATOM   4162  C  CB   . ASN A 1 28  ? -4.370  63.588 3.374   1.00 79.28 ? 28  ASN A CB   2  
ATOM   4163  C  CG   . ASN A 1 28  ? -2.899  63.224 3.545   1.00 83.99 ? 28  ASN A CG   2  
ATOM   4164  O  OD1  . ASN A 1 28  ? -2.519  62.081 3.386   1.00 87.93 ? 28  ASN A OD1  2  
ATOM   4165  N  ND2  . ASN A 1 28  ? -2.048  64.156 3.863   1.00 85.70 ? 28  ASN A ND2  2  
ATOM   4166  H  H    . ASN A 1 28  ? -6.552  64.741 2.683   1.00 0.00  ? 28  ASN A H    2  
ATOM   4167  H  HA   . ASN A 1 28  ? -3.785  64.966 1.827   1.00 0.00  ? 28  ASN A HA   2  
ATOM   4168  H  HB2  . ASN A 1 28  ? -4.664  64.275 4.155   1.00 0.00  ? 28  ASN A HB2  2  
ATOM   4169  H  HB3  . ASN A 1 28  ? -4.970  62.693 3.438   1.00 0.00  ? 28  ASN A HB3  2  
ATOM   4170  H  HD21 . ASN A 1 28  ? -2.353  65.076 3.993   1.00 0.00  ? 28  ASN A HD21 2  
ATOM   4171  H  HD22 . ASN A 1 28  ? -1.107  63.937 3.968   1.00 0.00  ? 28  ASN A HD22 2  
ATOM   4172  N  N    . GLN A 1 29  ? -5.350  63.362 -0.110  1.00 0.00  ? 29  GLN A N    2  
ATOM   4173  C  CA   . GLN A 1 29  ? -5.400  62.353 -1.204  1.00 0.00  ? 29  GLN A CA   2  
ATOM   4174  C  C    . GLN A 1 29  ? -4.204  62.533 -2.127  1.00 0.00  ? 29  GLN A C    2  
ATOM   4175  O  O    . GLN A 1 29  ? -3.717  63.626 -2.338  1.00 0.00  ? 29  GLN A O    2  
ATOM   4176  C  CB   . GLN A 1 29  ? -6.703  62.511 -2.000  1.00 0.00  ? 29  GLN A CB   2  
ATOM   4177  C  CG   . GLN A 1 29  ? -6.670  63.810 -2.817  1.00 0.00  ? 29  GLN A CG   2  
ATOM   4178  C  CD   . GLN A 1 29  ? -8.095  64.203 -3.219  1.00 0.00  ? 29  GLN A CD   2  
ATOM   4179  O  OE1  . GLN A 1 29  ? -8.534  65.303 -2.946  1.00 0.00  ? 29  GLN A OE1  2  
ATOM   4180  N  NE2  . GLN A 1 29  ? -8.842  63.344 -3.858  1.00 0.00  ? 29  GLN A NE2  2  
ATOM   4181  H  H    . GLN A 1 29  ? -5.912  64.160 -0.158  1.00 0.00  ? 29  GLN A H    2  
ATOM   4182  H  HA   . GLN A 1 29  ? -5.363  61.361 -0.781  1.00 0.00  ? 29  GLN A HA   2  
ATOM   4183  H  HB2  . GLN A 1 29  ? -6.817  61.670 -2.669  1.00 0.00  ? 29  GLN A HB2  2  
ATOM   4184  H  HB3  . GLN A 1 29  ? -7.538  62.539 -1.315  1.00 0.00  ? 29  GLN A HB3  2  
ATOM   4185  H  HG2  . GLN A 1 29  ? -6.232  64.598 -2.223  1.00 0.00  ? 29  GLN A HG2  2  
ATOM   4186  H  HG3  . GLN A 1 29  ? -6.078  63.659 -3.707  1.00 0.00  ? 29  GLN A HG3  2  
ATOM   4187  H  HE21 . GLN A 1 29  ? -8.489  62.456 -4.078  1.00 0.00  ? 29  GLN A HE21 2  
ATOM   4188  H  HE22 . GLN A 1 29  ? -9.756  63.586 -4.118  1.00 0.00  ? 29  GLN A HE22 2  
ATOM   4189  N  N    . GLY A 1 30  ? -3.732  61.455 -2.676  1.00 0.00  ? 30  GLY A N    2  
ATOM   4190  C  CA   . GLY A 1 30  ? -2.566  61.526 -3.592  1.00 0.00  ? 30  GLY A CA   2  
ATOM   4191  C  C    . GLY A 1 30  ? -3.065  61.734 -5.018  1.00 0.00  ? 30  GLY A C    2  
ATOM   4192  O  O    . GLY A 1 30  ? -3.928  62.551 -5.273  1.00 0.00  ? 30  GLY A O    2  
ATOM   4193  H  H    . GLY A 1 30  ? -4.152  60.592 -2.480  1.00 0.00  ? 30  GLY A H    2  
ATOM   4194  H  HA2  . GLY A 1 30  ? -1.922  62.348 -3.307  1.00 0.00  ? 30  GLY A HA2  2  
ATOM   4195  H  HA3  . GLY A 1 30  ? -2.015  60.600 -3.540  1.00 0.00  ? 30  GLY A HA3  2  
ATOM   4196  N  N    . ASP A 1 31  ? -2.546  60.978 -5.944  1.00 0.00  ? 31  ASP A N    2  
ATOM   4197  C  CA   . ASP A 1 31  ? -2.998  61.089 -7.367  1.00 0.00  ? 31  ASP A CA   2  
ATOM   4198  C  C    . ASP A 1 31  ? -3.171  59.685 -7.945  1.00 0.00  ? 31  ASP A C    2  
ATOM   4199  O  O    . ASP A 1 31  ? -2.929  58.696 -7.282  1.00 0.00  ? 31  ASP A O    2  
ATOM   4200  C  CB   . ASP A 1 31  ? -1.964  61.856 -8.191  1.00 0.00  ? 31  ASP A CB   2  
ATOM   4201  C  CG   . ASP A 1 31  ? -1.628  63.174 -7.489  1.00 0.00  ? 31  ASP A CG   2  
ATOM   4202  O  OD1  . ASP A 1 31  ? -1.257  63.126 -6.328  1.00 0.00  ? 31  ASP A OD1  2  
ATOM   4203  O  OD2  . ASP A 1 31  ? -1.748  64.208 -8.125  1.00 0.00  ? 31  ASP A OD2  2  
ATOM   4204  H  H    . ASP A 1 31  ? -1.879  60.305 -5.699  1.00 0.00  ? 31  ASP A H    2  
ATOM   4205  H  HA   . ASP A 1 31  ? -3.947  61.607 -7.413  1.00 0.00  ? 31  ASP A HA   2  
ATOM   4206  H  HB2  . ASP A 1 31  ? -1.073  61.257 -8.294  1.00 0.00  ? 31  ASP A HB2  2  
ATOM   4207  H  HB3  . ASP A 1 31  ? -2.370  62.066 -9.169  1.00 0.00  ? 31  ASP A HB3  2  
ATOM   4208  N  N    . ASP A 1 32  ? -3.582  59.591 -9.177  1.00 0.00  ? 32  ASP A N    2  
ATOM   4209  C  CA   . ASP A 1 32  ? -3.766  58.253 -9.803  1.00 0.00  ? 32  ASP A CA   2  
ATOM   4210  C  C    . ASP A 1 32  ? -2.406  57.564 -9.962  1.00 0.00  ? 32  ASP A C    2  
ATOM   4211  O  O    . ASP A 1 32  ? -2.300  56.356 -9.877  1.00 0.00  ? 32  ASP A O    2  
ATOM   4212  C  CB   . ASP A 1 32  ? -4.414  58.427 -11.177 1.00 0.00  ? 32  ASP A CB   2  
ATOM   4213  C  CG   . ASP A 1 32  ? -4.703  57.054 -11.784 1.00 0.00  ? 32  ASP A CG   2  
ATOM   4214  O  OD1  . ASP A 1 32  ? -5.076  56.164 -11.037 1.00 0.00  ? 32  ASP A OD1  2  
ATOM   4215  O  OD2  . ASP A 1 32  ? -4.547  56.915 -12.986 1.00 0.00  ? 32  ASP A OD2  2  
ATOM   4216  H  H    . ASP A 1 32  ? -3.767  60.403 -9.694  1.00 0.00  ? 32  ASP A H    2  
ATOM   4217  H  HA   . ASP A 1 32  ? -4.406  57.648 -9.178  1.00 0.00  ? 32  ASP A HA   2  
ATOM   4218  H  HB2  . ASP A 1 32  ? -5.338  58.977 -11.072 1.00 0.00  ? 32  ASP A HB2  2  
ATOM   4219  H  HB3  . ASP A 1 32  ? -3.743  58.970 -11.825 1.00 0.00  ? 32  ASP A HB3  2  
ATOM   4220  N  N    . HIS A 1 33  ? -1.364  58.319 -10.191 1.00 0.00  ? 33  HIS A N    2  
ATOM   4221  C  CA   . HIS A 1 33  ? -0.015  57.701 -10.354 1.00 0.00  ? 33  HIS A CA   2  
ATOM   4222  C  C    . HIS A 1 33  ? 0.543   57.321 -8.983  1.00 0.00  ? 33  HIS A C    2  
ATOM   4223  O  O    . HIS A 1 33  ? 1.586   56.711 -8.873  1.00 0.00  ? 33  HIS A O    2  
ATOM   4224  C  CB   . HIS A 1 33  ? 0.928   58.698 -11.032 1.00 0.00  ? 33  HIS A CB   2  
ATOM   4225  C  CG   . HIS A 1 33  ? 0.254   59.281 -12.243 1.00 0.00  ? 33  HIS A CG   2  
ATOM   4226  N  ND1  . HIS A 1 33  ? 0.338   60.629 -12.559 1.00 0.00  ? 33  HIS A ND1  2  
ATOM   4227  C  CD2  . HIS A 1 33  ? -0.517  58.712 -13.228 1.00 0.00  ? 33  HIS A CD2  2  
ATOM   4228  C  CE1  . HIS A 1 33  ? -0.365  60.825 -13.691 1.00 0.00  ? 33  HIS A CE1  2  
ATOM   4229  N  NE2  . HIS A 1 33  ? -0.905  59.690 -14.138 1.00 0.00  ? 33  HIS A NE2  2  
ATOM   4230  H  H    . HIS A 1 33  ? -1.468  59.292 -10.254 1.00 0.00  ? 33  HIS A H    2  
ATOM   4231  H  HA   . HIS A 1 33  ? -0.096  56.813 -10.963 1.00 0.00  ? 33  HIS A HA   2  
ATOM   4232  H  HB2  . HIS A 1 33  ? 1.173   59.489 -10.339 1.00 0.00  ? 33  HIS A HB2  2  
ATOM   4233  H  HB3  . HIS A 1 33  ? 1.832   58.190 -11.333 1.00 0.00  ? 33  HIS A HB3  2  
ATOM   4234  H  HD2  . HIS A 1 33  ? -0.781  57.667 -13.286 1.00 0.00  ? 33  HIS A HD2  2  
ATOM   4235  H  HE1  . HIS A 1 33  ? -0.477  61.783 -14.176 1.00 0.00  ? 33  HIS A HE1  2  
ATOM   4236  H  HE2  . HIS A 1 33  ? -1.457  59.578 -14.940 1.00 0.00  ? 33  HIS A HE2  2  
ATOM   4237  N  N    . GLY A 1 34  ? -0.154  57.659 -7.933  1.00 0.00  ? 34  GLY A N    2  
ATOM   4238  C  CA   . GLY A 1 34  ? 0.323   57.300 -6.564  1.00 0.00  ? 34  GLY A CA   2  
ATOM   4239  C  C    . GLY A 1 34  ? 1.076   58.474 -5.931  1.00 0.00  ? 34  GLY A C    2  
ATOM   4240  O  O    . GLY A 1 34  ? 1.700   58.326 -4.900  1.00 0.00  ? 34  GLY A O    2  
ATOM   4241  H  H    . GLY A 1 34  ? -1.002  58.134 -8.045  1.00 0.00  ? 34  GLY A H    2  
ATOM   4242  H  HA2  . GLY A 1 34  ? -0.529  57.053 -5.947  1.00 0.00  ? 34  GLY A HA2  2  
ATOM   4243  H  HA3  . GLY A 1 34  ? 0.982   56.444 -6.616  1.00 0.00  ? 34  GLY A HA3  2  
ATOM   4244  N  N    . PHE A 1 35  ? 1.016   59.644 -6.512  1.00 0.00  ? 35  PHE A N    2  
ATOM   4245  C  CA   . PHE A 1 35  ? 1.728   60.794 -5.886  1.00 0.00  ? 35  PHE A CA   2  
ATOM   4246  C  C    . PHE A 1 35  ? 1.001   61.148 -4.595  1.00 0.00  ? 35  PHE A C    2  
ATOM   4247  O  O    . PHE A 1 35  ? -0.157  61.508 -4.609  1.00 0.00  ? 35  PHE A O    2  
ATOM   4248  C  CB   . PHE A 1 35  ? 1.727   62.008 -6.817  1.00 0.00  ? 35  PHE A CB   2  
ATOM   4249  C  CG   . PHE A 1 35  ? 2.698   61.782 -7.950  1.00 0.00  ? 35  PHE A CG   2  
ATOM   4250  C  CD1  . PHE A 1 35  ? 4.072   61.739 -7.689  1.00 0.00  ? 35  PHE A CD1  2  
ATOM   4251  C  CD2  . PHE A 1 35  ? 2.227   61.621 -9.259  1.00 0.00  ? 35  PHE A CD2  2  
ATOM   4252  C  CE1  . PHE A 1 35  ? 4.976   61.533 -8.736  1.00 0.00  ? 35  PHE A CE1  2  
ATOM   4253  C  CE2  . PHE A 1 35  ? 3.132   61.416 -10.307 1.00 0.00  ? 35  PHE A CE2  2  
ATOM   4254  C  CZ   . PHE A 1 35  ? 4.507   61.372 -10.045 1.00 0.00  ? 35  PHE A CZ   2  
ATOM   4255  H  H    . PHE A 1 35  ? 0.497   59.768 -7.334  1.00 0.00  ? 35  PHE A H    2  
ATOM   4256  H  HA   . PHE A 1 35  ? 2.744   60.507 -5.662  1.00 0.00  ? 35  PHE A HA   2  
ATOM   4257  H  HB2  . PHE A 1 35  ? 0.738   62.158 -7.209  1.00 0.00  ? 35  PHE A HB2  2  
ATOM   4258  H  HB3  . PHE A 1 35  ? 2.026   62.883 -6.260  1.00 0.00  ? 35  PHE A HB3  2  
ATOM   4259  H  HD1  . PHE A 1 35  ? 4.433   61.864 -6.679  1.00 0.00  ? 35  PHE A HD1  2  
ATOM   4260  H  HD2  . PHE A 1 35  ? 1.166   61.655 -9.458  1.00 0.00  ? 35  PHE A HD2  2  
ATOM   4261  H  HE1  . PHE A 1 35  ? 6.036   61.499 -8.535  1.00 0.00  ? 35  PHE A HE1  2  
ATOM   4262  H  HE2  . PHE A 1 35  ? 2.770   61.291 -11.316 1.00 0.00  ? 35  PHE A HE2  2  
ATOM   4263  H  HZ   . PHE A 1 35  ? 5.206   61.216 -10.852 1.00 0.00  ? 35  PHE A HZ   2  
ATOM   4264  N  N    . SER A 1 36  ? 1.664   61.026 -3.480  1.00 0.00  ? 36  SER A N    2  
ATOM   4265  C  CA   . SER A 1 36  ? 1.009   61.330 -2.169  1.00 0.00  ? 36  SER A CA   2  
ATOM   4266  C  C    . SER A 1 36  ? 1.281   62.801 -1.786  1.00 0.00  ? 36  SER A C    2  
ATOM   4267  O  O    . SER A 1 36  ? 2.077   63.459 -2.424  1.00 0.00  ? 36  SER A O    2  
ATOM   4268  C  CB   . SER A 1 36  ? 1.604   60.366 -1.118  1.00 0.00  ? 36  SER A CB   2  
ATOM   4269  O  OG   . SER A 1 36  ? 2.515   59.484 -1.765  1.00 0.00  ? 36  SER A OG   2  
ATOM   4270  H  H    . SER A 1 36  ? 2.597   60.716 -3.500  1.00 0.00  ? 36  SER A H    2  
ATOM   4271  H  HA   . SER A 1 36  ? -0.056  61.167 -2.254  1.00 0.00  ? 36  SER A HA   2  
ATOM   4272  H  HB2  . SER A 1 36  ? 2.133   60.915 -0.354  1.00 0.00  ? 36  SER A HB2  2  
ATOM   4273  H  HB3  . SER A 1 36  ? 0.810   59.791 -0.655  1.00 0.00  ? 36  SER A HB3  2  
ATOM   4274  H  HG   . SER A 1 36  ? 3.287   59.992 -2.032  1.00 0.00  ? 36  SER A HG   2  
ATOM   4275  N  N    . PRO A 1 37  ? 0.630   63.287 -0.748  1.00 63.85 ? 37  PRO A N    2  
ATOM   4276  C  CA   . PRO A 1 37  ? 0.859   64.671 -0.302  1.00 61.79 ? 37  PRO A CA   2  
ATOM   4277  C  C    . PRO A 1 37  ? 2.336   64.804 0.094   1.00 59.66 ? 37  PRO A C    2  
ATOM   4278  O  O    . PRO A 1 37  ? 3.048   65.660 -0.392  1.00 58.96 ? 37  PRO A O    2  
ATOM   4279  C  CB   . PRO A 1 37  ? -0.084  64.866 0.909   1.00 62.05 ? 37  PRO A CB   2  
ATOM   4280  C  CG   . PRO A 1 37  ? -0.847  63.525 1.127   1.00 61.89 ? 37  PRO A CG   2  
ATOM   4281  C  CD   . PRO A 1 37  ? -0.367  62.532 0.043   1.00 64.50 ? 37  PRO A CD   2  
ATOM   4282  H  HA   . PRO A 1 37  ? 0.615   65.367 -1.091  1.00 0.00  ? 37  PRO A HA   2  
ATOM   4283  H  HB2  . PRO A 1 37  ? 0.487   65.118 1.796   1.00 0.00  ? 37  PRO A HB2  2  
ATOM   4284  H  HB3  . PRO A 1 37  ? -0.794  65.655 0.700   1.00 0.00  ? 37  PRO A HB3  2  
ATOM   4285  H  HG2  . PRO A 1 37  ? -0.627  63.133 2.114   1.00 0.00  ? 37  PRO A HG2  2  
ATOM   4286  H  HG3  . PRO A 1 37  ? -1.913  63.684 1.030   1.00 0.00  ? 37  PRO A HG3  2  
ATOM   4287  H  HD2  . PRO A 1 37  ? 0.085   61.668 0.504   1.00 0.00  ? 37  PRO A HD2  2  
ATOM   4288  H  HD3  . PRO A 1 37  ? -1.193  62.234 -0.587  1.00 0.00  ? 37  PRO A HD3  2  
ATOM   4289  N  N    . LEU A 1 38  ? 2.799   63.942 0.962   1.00 58.19 ? 38  LEU A N    2  
ATOM   4290  C  CA   . LEU A 1 38  ? 4.230   63.993 1.378   1.00 52.32 ? 38  LEU A CA   2  
ATOM   4291  C  C    . LEU A 1 38  ? 5.093   64.014 0.116   1.00 48.07 ? 38  LEU A C    2  
ATOM   4292  O  O    . LEU A 1 38  ? 6.087   64.707 0.023   1.00 45.49 ? 38  LEU A O    2  
ATOM   4293  C  CB   . LEU A 1 38  ? 4.555   62.738 2.216   1.00 49.74 ? 38  LEU A CB   2  
ATOM   4294  C  CG   . LEU A 1 38  ? 5.707   63.007 3.202   1.00 48.31 ? 38  LEU A CG   2  
ATOM   4295  C  CD1  . LEU A 1 38  ? 6.186   61.674 3.803   1.00 46.15 ? 38  LEU A CD1  2  
ATOM   4296  C  CD2  . LEU A 1 38  ? 6.886   63.682 2.486   1.00 46.72 ? 38  LEU A CD2  2  
ATOM   4297  H  H    . LEU A 1 38  ? 2.204   63.258 1.333   1.00 0.00  ? 38  LEU A H    2  
ATOM   4298  H  HA   . LEU A 1 38  ? 4.398   64.880 1.955   1.00 0.00  ? 38  LEU A HA   2  
ATOM   4299  H  HB2  . LEU A 1 38  ? 3.676   62.454 2.776   1.00 0.00  ? 38  LEU A HB2  2  
ATOM   4300  H  HB3  . LEU A 1 38  ? 4.832   61.923 1.561   1.00 0.00  ? 38  LEU A HB3  2  
ATOM   4301  H  HG   . LEU A 1 38  ? 5.352   63.647 3.998   1.00 0.00  ? 38  LEU A HG   2  
ATOM   4302  H  HD11 . LEU A 1 38  ? 6.860   61.184 3.113   1.00 0.00  ? 38  LEU A HD11 2  
ATOM   4303  H  HD12 . LEU A 1 38  ? 5.339   61.029 3.988   1.00 0.00  ? 38  LEU A HD12 2  
ATOM   4304  H  HD13 . LEU A 1 38  ? 6.701   61.864 4.733   1.00 0.00  ? 38  LEU A HD13 2  
ATOM   4305  H  HD21 . LEU A 1 38  ? 7.764   63.623 3.112   1.00 0.00  ? 38  LEU A HD21 2  
ATOM   4306  H  HD22 . LEU A 1 38  ? 6.654   64.718 2.298   1.00 0.00  ? 38  LEU A HD22 2  
ATOM   4307  H  HD23 . LEU A 1 38  ? 7.079   63.178 1.552   1.00 0.00  ? 38  LEU A HD23 2  
ATOM   4308  N  N    . HIS A 1 39  ? 4.697   63.245 -0.849  1.00 45.97 ? 39  HIS A N    2  
ATOM   4309  C  CA   . HIS A 1 39  ? 5.449   63.168 -2.133  1.00 46.91 ? 39  HIS A CA   2  
ATOM   4310  C  C    . HIS A 1 39  ? 5.627   64.581 -2.699  1.00 48.94 ? 39  HIS A C    2  
ATOM   4311  O  O    . HIS A 1 39  ? 6.728   65.060 -2.885  1.00 49.68 ? 39  HIS A O    2  
ATOM   4312  C  CB   . HIS A 1 39  ? 4.644   62.281 -3.122  1.00 45.05 ? 39  HIS A CB   2  
ATOM   4313  C  CG   . HIS A 1 39  ? 5.422   61.063 -3.544  1.00 47.92 ? 39  HIS A CG   2  
ATOM   4314  N  ND1  . HIS A 1 39  ? 4.787   59.867 -3.838  1.00 46.54 ? 39  HIS A ND1  2  
ATOM   4315  C  CD2  . HIS A 1 39  ? 6.764   60.836 -3.741  1.00 52.78 ? 39  HIS A CD2  2  
ATOM   4316  C  CE1  . HIS A 1 39  ? 5.734   58.982 -4.196  1.00 52.72 ? 39  HIS A CE1  2  
ATOM   4317  N  NE2  . HIS A 1 39  ? 6.955   59.519 -4.152  1.00 47.81 ? 39  HIS A NE2  2  
ATOM   4318  H  H    . HIS A 1 39  ? 3.891   62.707 -0.724  1.00 0.00  ? 39  HIS A H    2  
ATOM   4319  H  HA   . HIS A 1 39  ? 6.412   62.743 -1.951  1.00 0.00  ? 39  HIS A HA   2  
ATOM   4320  H  HB2  . HIS A 1 39  ? 3.745   61.946 -2.634  1.00 0.00  ? 39  HIS A HB2  2  
ATOM   4321  H  HB3  . HIS A 1 39  ? 4.373   62.850 -4.002  1.00 0.00  ? 39  HIS A HB3  2  
ATOM   4322  H  HD2  . HIS A 1 39  ? 7.547   61.565 -3.604  1.00 0.00  ? 39  HIS A HD2  2  
ATOM   4323  H  HE1  . HIS A 1 39  ? 5.531   57.968 -4.498  1.00 0.00  ? 39  HIS A HE1  2  
ATOM   4324  H  HE2  . HIS A 1 39  ? 7.801   59.074 -4.365  1.00 0.00  ? 39  HIS A HE2  2  
ATOM   4325  N  N    . TRP A 1 40  ? 4.544   65.234 -2.980  1.00 0.00  ? 40  TRP A N    2  
ATOM   4326  C  CA   . TRP A 1 40  ? 4.618   66.612 -3.548  1.00 0.00  ? 40  TRP A CA   2  
ATOM   4327  C  C    . TRP A 1 40  ? 5.391   67.523 -2.601  1.00 0.00  ? 40  TRP A C    2  
ATOM   4328  O  O    . TRP A 1 40  ? 6.257   68.270 -3.006  1.00 0.00  ? 40  TRP A O    2  
ATOM   4329  C  CB   . TRP A 1 40  ? 3.202   67.162 -3.744  1.00 0.00  ? 40  TRP A CB   2  
ATOM   4330  C  CG   . TRP A 1 40  ? 2.563   66.505 -4.920  1.00 0.00  ? 40  TRP A CG   2  
ATOM   4331  C  CD1  . TRP A 1 40  ? 1.456   65.734 -4.868  1.00 0.00  ? 40  TRP A CD1  2  
ATOM   4332  C  CD2  . TRP A 1 40  ? 2.965   66.552 -6.321  1.00 0.00  ? 40  TRP A CD2  2  
ATOM   4333  N  NE1  . TRP A 1 40  ? 1.154   65.306 -6.145  1.00 0.00  ? 40  TRP A NE1  2  
ATOM   4334  C  CE2  . TRP A 1 40  ? 2.052   65.780 -7.071  1.00 0.00  ? 40  TRP A CE2  2  
ATOM   4335  C  CE3  . TRP A 1 40  ? 4.021   67.180 -7.007  1.00 0.00  ? 40  TRP A CE3  2  
ATOM   4336  C  CZ2  . TRP A 1 40  ? 2.173   65.633 -8.447  1.00 0.00  ? 40  TRP A CZ2  2  
ATOM   4337  C  CZ3  . TRP A 1 40  ? 4.148   67.035 -8.399  1.00 0.00  ? 40  TRP A CZ3  2  
ATOM   4338  C  CH2  . TRP A 1 40  ? 3.225   66.261 -9.118  1.00 0.00  ? 40  TRP A CH2  2  
ATOM   4339  H  H    . TRP A 1 40  ? 3.679   64.810 -2.824  1.00 0.00  ? 40  TRP A H    2  
ATOM   4340  H  HA   . TRP A 1 40  ? 5.124   66.579 -4.489  1.00 0.00  ? 40  TRP A HA   2  
ATOM   4341  H  HB2  . TRP A 1 40  ? 2.614   66.966 -2.861  1.00 0.00  ? 40  TRP A HB2  2  
ATOM   4342  H  HB3  . TRP A 1 40  ? 3.247   68.224 -3.916  1.00 0.00  ? 40  TRP A HB3  2  
ATOM   4343  H  HD1  . TRP A 1 40  ? 0.898   65.493 -3.975  1.00 0.00  ? 40  TRP A HD1  2  
ATOM   4344  H  HE1  . TRP A 1 40  ? 0.403   64.737 -6.386  1.00 0.00  ? 40  TRP A HE1  2  
ATOM   4345  H  HE3  . TRP A 1 40  ? 4.736   67.779 -6.461  1.00 0.00  ? 40  TRP A HE3  2  
ATOM   4346  H  HZ2  . TRP A 1 40  ? 1.456   65.035 -8.988  1.00 0.00  ? 40  TRP A HZ2  2  
ATOM   4347  H  HZ3  . TRP A 1 40  ? 4.962   67.520 -8.917  1.00 0.00  ? 40  TRP A HZ3  2  
ATOM   4348  H  HH2  . TRP A 1 40  ? 3.328   66.152 -10.187 1.00 0.00  ? 40  TRP A HH2  2  
ATOM   4349  N  N    . ALA A 1 41  ? 5.065   67.482 -1.349  1.00 48.90 ? 41  ALA A N    2  
ATOM   4350  C  CA   . ALA A 1 41  ? 5.758   68.355 -0.357  1.00 51.55 ? 41  ALA A CA   2  
ATOM   4351  C  C    . ALA A 1 41  ? 7.274   68.147 -0.438  1.00 52.34 ? 41  ALA A C    2  
ATOM   4352  O  O    . ALA A 1 41  ? 8.029   69.085 -0.595  1.00 50.40 ? 41  ALA A O    2  
ATOM   4353  C  CB   . ALA A 1 41  ? 5.273   68.003 1.049   1.00 54.82 ? 41  ALA A CB   2  
ATOM   4354  H  H    . ALA A 1 41  ? 4.341   66.894 -1.061  1.00 0.00  ? 41  ALA A H    2  
ATOM   4355  H  HA   . ALA A 1 41  ? 5.527   69.388 -0.567  1.00 0.00  ? 41  ALA A HA   2  
ATOM   4356  H  HB1  . ALA A 1 41  ? 4.257   68.349 1.177   1.00 0.00  ? 41  ALA A HB1  2  
ATOM   4357  H  HB2  . ALA A 1 41  ? 5.910   68.479 1.780   1.00 0.00  ? 41  ALA A HB2  2  
ATOM   4358  H  HB3  . ALA A 1 41  ? 5.308   66.932 1.184   1.00 0.00  ? 41  ALA A HB3  2  
ATOM   4359  N  N    . CYS A 1 42  ? 7.728   66.928 -0.323  1.00 0.00  ? 42  CYS A N    2  
ATOM   4360  C  CA   . CYS A 1 42  ? 9.196   66.669 -0.387  1.00 0.00  ? 42  CYS A CA   2  
ATOM   4361  C  C    . CYS A 1 42  ? 9.765   67.260 -1.679  1.00 0.00  ? 42  CYS A C    2  
ATOM   4362  O  O    . CYS A 1 42  ? 10.895  67.703 -1.727  1.00 0.00  ? 42  CYS A O    2  
ATOM   4363  C  CB   . CYS A 1 42  ? 9.443   65.158 -0.364  1.00 0.00  ? 42  CYS A CB   2  
ATOM   4364  S  SG   . CYS A 1 42  ? 11.172  64.820 -0.777  1.00 0.00  ? 42  CYS A SG   2  
ATOM   4365  H  H    . CYS A 1 42  ? 7.105   66.183 -0.192  1.00 0.00  ? 42  CYS A H    2  
ATOM   4366  H  HA   . CYS A 1 42  ? 9.680   67.126 0.462   1.00 0.00  ? 42  CYS A HA   2  
ATOM   4367  H  HB2  . CYS A 1 42  ? 9.227   64.774 0.621   1.00 0.00  ? 42  CYS A HB2  2  
ATOM   4368  H  HB3  . CYS A 1 42  ? 8.800   64.678 -1.087  1.00 0.00  ? 42  CYS A HB3  2  
ATOM   4369  H  HG   . CYS A 1 42  ? 11.460  65.478 -1.415  1.00 0.00  ? 42  CYS A HG   2  
ATOM   4370  N  N    . ARG A 1 43  ? 8.989   67.265 -2.726  1.00 0.00  ? 43  ARG A N    2  
ATOM   4371  C  CA   . ARG A 1 43  ? 9.472   67.822 -4.021  1.00 0.00  ? 43  ARG A CA   2  
ATOM   4372  C  C    . ARG A 1 43  ? 9.567   69.349 -3.932  1.00 0.00  ? 43  ARG A C    2  
ATOM   4373  O  O    . ARG A 1 43  ? 10.534  69.945 -4.364  1.00 0.00  ? 43  ARG A O    2  
ATOM   4374  C  CB   . ARG A 1 43  ? 8.488   67.438 -5.130  1.00 0.00  ? 43  ARG A CB   2  
ATOM   4375  C  CG   . ARG A 1 43  ? 9.140   67.674 -6.504  1.00 0.00  ? 43  ARG A CG   2  
ATOM   4376  C  CD   . ARG A 1 43  ? 10.199  66.583 -6.819  1.00 0.00  ? 43  ARG A CD   2  
ATOM   4377  N  NE   . ARG A 1 43  ? 9.919   65.950 -8.155  1.00 0.00  ? 43  ARG A NE   2  
ATOM   4378  C  CZ   . ARG A 1 43  ? 8.749   65.440 -8.447  1.00 0.00  ? 43  ARG A CZ   2  
ATOM   4379  N  NH1  . ARG A 1 43  ? 7.803   65.396 -7.551  1.00 0.00  ? 43  ARG A NH1  2  
ATOM   4380  N  NH2  . ARG A 1 43  ? 8.534   64.951 -9.638  1.00 0.00  ? 43  ARG A NH2  2  
ATOM   4381  H  H    . ARG A 1 43  ? 8.082   66.900 -2.661  1.00 0.00  ? 43  ARG A H    2  
ATOM   4382  H  HA   . ARG A 1 43  ? 10.446  67.413 -4.248  1.00 0.00  ? 43  ARG A HA   2  
ATOM   4383  H  HB2  . ARG A 1 43  ? 8.217   66.399 -5.024  1.00 0.00  ? 43  ARG A HB2  2  
ATOM   4384  H  HB3  . ARG A 1 43  ? 7.601   68.049 -5.047  1.00 0.00  ? 43  ARG A HB3  2  
ATOM   4385  H  HG2  . ARG A 1 43  ? 8.375   67.674 -7.263  1.00 0.00  ? 43  ARG A HG2  2  
ATOM   4386  H  HG3  . ARG A 1 43  ? 9.619   68.645 -6.497  1.00 0.00  ? 43  ARG A HG3  2  
ATOM   4387  H  HD2  . ARG A 1 43  ? 11.172  67.036 -6.880  1.00 0.00  ? 43  ARG A HD2  2  
ATOM   4388  H  HD3  . ARG A 1 43  ? 10.216  65.835 -6.028  1.00 0.00  ? 43  ARG A HD3  2  
ATOM   4389  H  HE   . ARG A 1 43  ? 10.627  65.938 -8.833  1.00 0.00  ? 43  ARG A HE   2  
ATOM   4390  H  HH11 . ARG A 1 43  ? 7.968   65.753 -6.635  1.00 0.00  ? 43  ARG A HH11 2  
ATOM   4391  H  HH12 . ARG A 1 43  ? 6.913   65.004 -7.782  1.00 0.00  ? 43  ARG A HH12 2  
ATOM   4392  H  HH21 . ARG A 1 43  ? 9.261   64.967 -10.324 1.00 0.00  ? 43  ARG A HH21 2  
ATOM   4393  H  HH22 . ARG A 1 43  ? 7.642   64.560 -9.864  1.00 0.00  ? 43  ARG A HH22 2  
ATOM   4394  N  N    . GLU A 1 44  ? 8.568   69.989 -3.385  1.00 0.00  ? 44  GLU A N    2  
ATOM   4395  C  CA   . GLU A 1 44  ? 8.602   71.477 -3.283  1.00 0.00  ? 44  GLU A CA   2  
ATOM   4396  C  C    . GLU A 1 44  ? 9.672   71.907 -2.276  1.00 0.00  ? 44  GLU A C    2  
ATOM   4397  O  O    . GLU A 1 44  ? 10.616  72.589 -2.622  1.00 0.00  ? 44  GLU A O    2  
ATOM   4398  C  CB   . GLU A 1 44  ? 7.235   71.989 -2.823  1.00 0.00  ? 44  GLU A CB   2  
ATOM   4399  C  CG   . GLU A 1 44  ? 6.197   71.724 -3.916  1.00 0.00  ? 44  GLU A CG   2  
ATOM   4400  C  CD   . GLU A 1 44  ? 4.810   72.125 -3.413  1.00 0.00  ? 44  GLU A CD   2  
ATOM   4401  O  OE1  . GLU A 1 44  ? 4.273   71.410 -2.583  1.00 0.00  ? 44  GLU A OE1  2  
ATOM   4402  O  OE2  . GLU A 1 44  ? 4.307   73.141 -3.866  1.00 0.00  ? 44  GLU A OE2  2  
ATOM   4403  H  H    . GLU A 1 44  ? 7.792   69.492 -3.049  1.00 0.00  ? 44  GLU A H    2  
ATOM   4404  H  HA   . GLU A 1 44  ? 8.833   71.897 -4.251  1.00 0.00  ? 44  GLU A HA   2  
ATOM   4405  H  HB2  . GLU A 1 44  ? 6.944   71.476 -1.918  1.00 0.00  ? 44  GLU A HB2  2  
ATOM   4406  H  HB3  . GLU A 1 44  ? 7.292   73.050 -2.634  1.00 0.00  ? 44  GLU A HB3  2  
ATOM   4407  H  HG2  . GLU A 1 44  ? 6.444   72.304 -4.794  1.00 0.00  ? 44  GLU A HG2  2  
ATOM   4408  H  HG3  . GLU A 1 44  ? 6.198   70.674 -4.166  1.00 0.00  ? 44  GLU A HG3  2  
ATOM   4409  N  N    . GLY A 1 45  ? 9.533   71.511 -1.031  1.00 0.00  ? 45  GLY A N    2  
ATOM   4410  C  CA   . GLY A 1 45  ? 10.541  71.889 0.014   1.00 0.00  ? 45  GLY A CA   2  
ATOM   4411  C  C    . GLY A 1 45  ? 9.847   72.635 1.156   1.00 0.00  ? 45  GLY A C    2  
ATOM   4412  O  O    . GLY A 1 45  ? 10.488  73.179 2.033   1.00 0.00  ? 45  GLY A O    2  
ATOM   4413  H  H    . GLY A 1 45  ? 8.761   70.960 -0.783  1.00 0.00  ? 45  GLY A H    2  
ATOM   4414  H  HA2  . GLY A 1 45  ? 11.005  70.994 0.402   1.00 0.00  ? 45  GLY A HA2  2  
ATOM   4415  H  HA3  . GLY A 1 45  ? 11.299  72.528 -0.411  1.00 0.00  ? 45  GLY A HA3  2  
ATOM   4416  N  N    . ARG A 1 46  ? 8.545   72.664 1.151   1.00 0.00  ? 46  ARG A N    2  
ATOM   4417  C  CA   . ARG A 1 46  ? 7.807   73.373 2.238   1.00 0.00  ? 46  ARG A CA   2  
ATOM   4418  C  C    . ARG A 1 46  ? 8.001   72.607 3.555   1.00 0.00  ? 46  ARG A C    2  
ATOM   4419  O  O    . ARG A 1 46  ? 7.053   72.162 4.178   1.00 0.00  ? 46  ARG A O    2  
ATOM   4420  C  CB   . ARG A 1 46  ? 6.315   73.440 1.887   1.00 0.00  ? 46  ARG A CB   2  
ATOM   4421  C  CG   . ARG A 1 46  ? 6.136   73.838 0.413   1.00 0.00  ? 46  ARG A CG   2  
ATOM   4422  C  CD   . ARG A 1 46  ? 4.641   73.850 0.048   1.00 0.00  ? 46  ARG A CD   2  
ATOM   4423  N  NE   . ARG A 1 46  ? 4.057   75.186 0.362   1.00 0.00  ? 46  ARG A NE   2  
ATOM   4424  C  CZ   . ARG A 1 46  ? 2.894   75.520 -0.128  1.00 0.00  ? 46  ARG A CZ   2  
ATOM   4425  N  NH1  . ARG A 1 46  ? 2.243   74.687 -0.893  1.00 0.00  ? 46  ARG A NH1  2  
ATOM   4426  N  NH2  . ARG A 1 46  ? 2.382   76.688 0.147   1.00 0.00  ? 46  ARG A NH2  2  
ATOM   4427  H  H    . ARG A 1 46  ? 8.053   72.218 0.433   1.00 0.00  ? 46  ARG A H    2  
ATOM   4428  H  HA   . ARG A 1 46  ? 8.199   74.375 2.344   1.00 0.00  ? 46  ARG A HA   2  
ATOM   4429  H  HB2  . ARG A 1 46  ? 5.865   72.474 2.054   1.00 0.00  ? 46  ARG A HB2  2  
ATOM   4430  H  HB3  . ARG A 1 46  ? 5.833   74.176 2.513   1.00 0.00  ? 46  ARG A HB3  2  
ATOM   4431  H  HG2  . ARG A 1 46  ? 6.551   74.823 0.256   1.00 0.00  ? 46  ARG A HG2  2  
ATOM   4432  H  HG3  . ARG A 1 46  ? 6.650   73.128 -0.217  1.00 0.00  ? 46  ARG A HG3  2  
ATOM   4433  H  HD2  . ARG A 1 46  ? 4.528   73.654 -1.009  1.00 0.00  ? 46  ARG A HD2  2  
ATOM   4434  H  HD3  . ARG A 1 46  ? 4.119   73.087 0.609   1.00 0.00  ? 46  ARG A HD3  2  
ATOM   4435  H  HE   . ARG A 1 46  ? 4.544   75.813 0.934   1.00 0.00  ? 46  ARG A HE   2  
ATOM   4436  H  HH11 . ARG A 1 46  ? 2.635   73.791 -1.104  1.00 0.00  ? 46  ARG A HH11 2  
ATOM   4437  H  HH12 . ARG A 1 46  ? 1.353   74.943 -1.268  1.00 0.00  ? 46  ARG A HH12 2  
ATOM   4438  H  HH21 . ARG A 1 46  ? 2.880   77.327 0.733   1.00 0.00  ? 46  ARG A HH21 2  
ATOM   4439  H  HH22 . ARG A 1 46  ? 1.491   76.944 -0.228  1.00 0.00  ? 46  ARG A HH22 2  
ATOM   4440  N  N    . SER A 1 47  ? 9.237   72.446 3.964   1.00 0.00  ? 47  SER A N    2  
ATOM   4441  C  CA   . SER A 1 47  ? 9.558   71.701 5.223   1.00 0.00  ? 47  SER A CA   2  
ATOM   4442  C  C    . SER A 1 47  ? 8.508   71.955 6.310   1.00 0.00  ? 47  SER A C    2  
ATOM   4443  O  O    . SER A 1 47  ? 8.140   71.063 7.045   1.00 0.00  ? 47  SER A O    2  
ATOM   4444  C  CB   . SER A 1 47  ? 10.928  72.149 5.734   1.00 0.00  ? 47  SER A CB   2  
ATOM   4445  O  OG   . SER A 1 47  ? 10.878  73.531 6.060   1.00 0.00  ? 47  SER A OG   2  
ATOM   4446  H  H    . SER A 1 47  ? 9.969   72.813 3.426   1.00 0.00  ? 47  SER A H    2  
ATOM   4447  H  HA   . SER A 1 47  ? 9.594   70.644 5.007   1.00 0.00  ? 47  SER A HA   2  
ATOM   4448  H  HB2  . SER A 1 47  ? 11.188  71.586 6.614   1.00 0.00  ? 47  SER A HB2  2  
ATOM   4449  H  HB3  . SER A 1 47  ? 11.670  71.976 4.966   1.00 0.00  ? 47  SER A HB3  2  
ATOM   4450  H  HG   . SER A 1 47  ? 11.730  73.918 5.845   1.00 0.00  ? 47  SER A HG   2  
ATOM   4451  N  N    . ALA A 1 48  ? 8.020   73.154 6.432   1.00 0.00  ? 48  ALA A N    2  
ATOM   4452  C  CA   . ALA A 1 48  ? 7.000   73.418 7.485   1.00 0.00  ? 48  ALA A CA   2  
ATOM   4453  C  C    . ALA A 1 48  ? 5.870   72.392 7.358   1.00 0.00  ? 48  ALA A C    2  
ATOM   4454  O  O    . ALA A 1 48  ? 5.827   71.412 8.059   1.00 0.00  ? 48  ALA A O    2  
ATOM   4455  C  CB   . ALA A 1 48  ? 6.433   74.828 7.304   1.00 0.00  ? 48  ALA A CB   2  
ATOM   4456  H  H    . ALA A 1 48  ? 8.320   73.875 5.840   1.00 0.00  ? 48  ALA A H    2  
ATOM   4457  H  HA   . ALA A 1 48  ? 7.457   73.333 8.460   1.00 0.00  ? 48  ALA A HA   2  
ATOM   4458  H  HB1  . ALA A 1 48  ? 6.106   74.956 6.283   1.00 0.00  ? 48  ALA A HB1  2  
ATOM   4459  H  HB2  . ALA A 1 48  ? 7.199   75.555 7.531   1.00 0.00  ? 48  ALA A HB2  2  
ATOM   4460  H  HB3  . ALA A 1 48  ? 5.595   74.967 7.971   1.00 0.00  ? 48  ALA A HB3  2  
ATOM   4461  N  N    . VAL A 1 49  ? 4.928   72.661 6.508   1.00 0.00  ? 49  VAL A N    2  
ATOM   4462  C  CA   . VAL A 1 49  ? 3.757   71.744 6.352   1.00 0.00  ? 49  VAL A CA   2  
ATOM   4463  C  C    . VAL A 1 49  ? 4.178   70.258 6.394   1.00 0.00  ? 49  VAL A C    2  
ATOM   4464  O  O    . VAL A 1 49  ? 3.509   69.449 7.005   1.00 0.00  ? 49  VAL A O    2  
ATOM   4465  C  CB   . VAL A 1 49  ? 3.048   72.035 5.028   1.00 0.00  ? 49  VAL A CB   2  
ATOM   4466  C  CG1  . VAL A 1 49  ? 2.333   73.384 5.122   1.00 0.00  ? 49  VAL A CG1  2  
ATOM   4467  C  CG2  . VAL A 1 49  ? 4.075   72.084 3.898   1.00 0.00  ? 49  VAL A CG2  2  
ATOM   4468  H  H    . VAL A 1 49  ? 4.973   73.515 6.030   1.00 0.00  ? 49  VAL A H    2  
ATOM   4469  H  HA   . VAL A 1 49  ? 3.066   71.928 7.161   1.00 0.00  ? 49  VAL A HA   2  
ATOM   4470  H  HB   . VAL A 1 49  ? 2.325   71.258 4.828   1.00 0.00  ? 49  VAL A HB   2  
ATOM   4471  H  HG11 . VAL A 1 49  ? 3.031   74.140 5.449   1.00 0.00  ? 49  VAL A HG11 2  
ATOM   4472  H  HG12 . VAL A 1 49  ? 1.522   73.312 5.832   1.00 0.00  ? 49  VAL A HG12 2  
ATOM   4473  H  HG13 . VAL A 1 49  ? 1.940   73.651 4.154   1.00 0.00  ? 49  VAL A HG13 2  
ATOM   4474  H  HG21 . VAL A 1 49  ? 4.563   71.124 3.812   1.00 0.00  ? 49  VAL A HG21 2  
ATOM   4475  H  HG22 . VAL A 1 49  ? 4.808   72.843 4.115   1.00 0.00  ? 49  VAL A HG22 2  
ATOM   4476  H  HG23 . VAL A 1 49  ? 3.577   72.319 2.969   1.00 0.00  ? 49  VAL A HG23 2  
ATOM   4477  N  N    . VAL A 1 50  ? 5.255   69.874 5.747   1.00 0.00  ? 50  VAL A N    2  
ATOM   4478  C  CA   . VAL A 1 50  ? 5.647   68.422 5.767   1.00 0.00  ? 50  VAL A CA   2  
ATOM   4479  C  C    . VAL A 1 50  ? 6.032   68.000 7.193   1.00 0.00  ? 50  VAL A C    2  
ATOM   4480  O  O    . VAL A 1 50  ? 5.665   66.946 7.665   1.00 0.00  ? 50  VAL A O    2  
ATOM   4481  C  CB   . VAL A 1 50  ? 6.803   68.177 4.750   1.00 0.00  ? 50  VAL A CB   2  
ATOM   4482  C  CG1  . VAL A 1 50  ? 8.176   68.114 5.439   1.00 0.00  ? 50  VAL A CG1  2  
ATOM   4483  C  CG2  . VAL A 1 50  ? 6.576   66.857 4.001   1.00 0.00  ? 50  VAL A CG2  2  
ATOM   4484  H  H    . VAL A 1 50  ? 5.789   70.524 5.241   1.00 0.00  ? 50  VAL A H    2  
ATOM   4485  H  HA   . VAL A 1 50  ? 4.788   67.849 5.476   1.00 0.00  ? 50  VAL A HA   2  
ATOM   4486  H  HB   . VAL A 1 50  ? 6.811   68.987 4.035   1.00 0.00  ? 50  VAL A HB   2  
ATOM   4487  H  HG11 . VAL A 1 50  ? 8.233   67.228 6.054   1.00 0.00  ? 50  VAL A HG11 2  
ATOM   4488  H  HG12 . VAL A 1 50  ? 8.314   68.986 6.052   1.00 0.00  ? 50  VAL A HG12 2  
ATOM   4489  H  HG13 . VAL A 1 50  ? 8.951   68.079 4.688   1.00 0.00  ? 50  VAL A HG13 2  
ATOM   4490  H  HG21 . VAL A 1 50  ? 5.616   66.884 3.507   1.00 0.00  ? 50  VAL A HG21 2  
ATOM   4491  H  HG22 . VAL A 1 50  ? 6.598   66.036 4.702   1.00 0.00  ? 50  VAL A HG22 2  
ATOM   4492  H  HG23 . VAL A 1 50  ? 7.356   66.724 3.266   1.00 0.00  ? 50  VAL A HG23 2  
ATOM   4493  N  N    . GLU A 1 51  ? 6.774   68.816 7.860   1.00 70.68 ? 51  GLU A N    2  
ATOM   4494  C  CA   . GLU A 1 51  ? 7.207   68.506 9.255   1.00 73.00 ? 51  GLU A CA   2  
ATOM   4495  C  C    . GLU A 1 51  ? 5.995   68.167 10.119  1.00 75.05 ? 51  GLU A C    2  
ATOM   4496  O  O    . GLU A 1 51  ? 5.949   67.152 10.787  1.00 73.61 ? 51  GLU A O    2  
ATOM   4497  C  CB   . GLU A 1 51  ? 7.920   69.732 9.834   1.00 71.29 ? 51  GLU A CB   2  
ATOM   4498  C  CG   . GLU A 1 51  ? 8.208   69.525 11.329  1.00 75.77 ? 51  GLU A CG   2  
ATOM   4499  C  CD   . GLU A 1 51  ? 6.980   69.901 12.166  1.00 78.77 ? 51  GLU A CD   2  
ATOM   4500  O  OE1  . GLU A 1 51  ? 6.758   71.085 12.356  1.00 77.06 ? 51  GLU A OE1  2  
ATOM   4501  O  OE2  . GLU A 1 51  ? 6.289   68.997 12.605  1.00 79.68 ? 51  GLU A OE2  2  
ATOM   4502  H  H    . GLU A 1 51  ? 7.061   69.642 7.425   1.00 0.00  ? 51  GLU A H    2  
ATOM   4503  H  HA   . GLU A 1 51  ? 7.873   67.675 9.248   1.00 0.00  ? 51  GLU A HA   2  
ATOM   4504  H  HB2  . GLU A 1 51  ? 8.853   69.880 9.307   1.00 0.00  ? 51  GLU A HB2  2  
ATOM   4505  H  HB3  . GLU A 1 51  ? 7.297   70.604 9.704   1.00 0.00  ? 51  GLU A HB3  2  
ATOM   4506  H  HG2  . GLU A 1 51  ? 8.463   68.491 11.512  1.00 0.00  ? 51  GLU A HG2  2  
ATOM   4507  H  HG3  . GLU A 1 51  ? 9.031   70.152 11.617  1.00 0.00  ? 51  GLU A HG3  2  
ATOM   4508  N  N    . MET A 1 52  ? 5.024   69.016 10.106  1.00 0.00  ? 52  MET A N    2  
ATOM   4509  C  CA   . MET A 1 52  ? 3.793   68.780 10.920  1.00 0.00  ? 52  MET A CA   2  
ATOM   4510  C  C    . MET A 1 52  ? 3.052   67.556 10.378  1.00 0.00  ? 52  MET A C    2  
ATOM   4511  O  O    . MET A 1 52  ? 2.334   66.882 11.090  1.00 0.00  ? 52  MET A O    2  
ATOM   4512  C  CB   . MET A 1 52  ? 2.894   70.028 10.847  1.00 0.00  ? 52  MET A CB   2  
ATOM   4513  C  CG   . MET A 1 52  ? 3.763   71.290 10.704  1.00 0.00  ? 52  MET A CG   2  
ATOM   4514  S  SD   . MET A 1 52  ? 2.910   72.699 11.455  1.00 0.00  ? 52  MET A SD   2  
ATOM   4515  C  CE   . MET A 1 52  ? 3.472   72.427 13.154  1.00 0.00  ? 52  MET A CE   2  
ATOM   4516  H  H    . MET A 1 52  ? 5.107   69.813 9.549   1.00 0.00  ? 52  MET A H    2  
ATOM   4517  H  HA   . MET A 1 52  ? 4.073   68.597 11.946  1.00 0.00  ? 52  MET A HA   2  
ATOM   4518  H  HB2  . MET A 1 52  ? 2.229   69.951 9.995   1.00 0.00  ? 52  MET A HB2  2  
ATOM   4519  H  HB3  . MET A 1 52  ? 2.306   70.100 11.751  1.00 0.00  ? 52  MET A HB3  2  
ATOM   4520  H  HG2  . MET A 1 52  ? 4.714   71.141 11.199  1.00 0.00  ? 52  MET A HG2  2  
ATOM   4521  H  HG3  . MET A 1 52  ? 3.934   71.492 9.656   1.00 0.00  ? 52  MET A HG3  2  
ATOM   4522  H  HE1  . MET A 1 52  ? 2.872   73.021 13.830  1.00 0.00  ? 52  MET A HE1  2  
ATOM   4523  H  HE2  . MET A 1 52  ? 4.506   72.719 13.243  1.00 0.00  ? 52  MET A HE2  2  
ATOM   4524  H  HE3  . MET A 1 52  ? 3.374   71.379 13.401  1.00 0.00  ? 52  MET A HE3  2  
ATOM   4525  N  N    . LEU A 1 53  ? 3.235   67.263 9.125   1.00 74.35 ? 53  LEU A N    2  
ATOM   4526  C  CA   . LEU A 1 53  ? 2.564   66.081 8.519   1.00 75.09 ? 53  LEU A CA   2  
ATOM   4527  C  C    . LEU A 1 53  ? 3.380   64.822 8.832   1.00 74.89 ? 53  LEU A C    2  
ATOM   4528  O  O    . LEU A 1 53  ? 2.842   63.796 9.196   1.00 71.43 ? 53  LEU A O    2  
ATOM   4529  C  CB   . LEU A 1 53  ? 2.492   66.266 6.998   1.00 75.65 ? 53  LEU A CB   2  
ATOM   4530  C  CG   . LEU A 1 53  ? 1.627   65.146 6.357   1.00 76.44 ? 53  LEU A CG   2  
ATOM   4531  C  CD1  . LEU A 1 53  ? 0.202   65.653 6.107   1.00 76.32 ? 53  LEU A CD1  2  
ATOM   4532  C  CD2  . LEU A 1 53  ? 2.237   64.712 5.019   1.00 80.73 ? 53  LEU A CD2  2  
ATOM   4533  H  H    . LEU A 1 53  ? 3.828   67.819 8.578   1.00 0.00  ? 53  LEU A H    2  
ATOM   4534  H  HA   . LEU A 1 53  ? 1.567   65.980 8.921   1.00 0.00  ? 53  LEU A HA   2  
ATOM   4535  H  HB2  . LEU A 1 53  ? 2.064   67.237 6.780   1.00 0.00  ? 53  LEU A HB2  2  
ATOM   4536  H  HB3  . LEU A 1 53  ? 3.495   66.228 6.598   1.00 0.00  ? 53  LEU A HB3  2  
ATOM   4537  H  HG   . LEU A 1 53  ? 1.584   64.290 7.019   1.00 0.00  ? 53  LEU A HG   2  
ATOM   4538  H  HD11 . LEU A 1 53  ? 0.204   66.328 5.264   1.00 0.00  ? 53  LEU A HD11 2  
ATOM   4539  H  HD12 . LEU A 1 53  ? -0.155  66.172 6.984   1.00 0.00  ? 53  LEU A HD12 2  
ATOM   4540  H  HD13 . LEU A 1 53  ? -0.446  64.815 5.895   1.00 0.00  ? 53  LEU A HD13 2  
ATOM   4541  H  HD21 . LEU A 1 53  ? 3.256   64.393 5.176   1.00 0.00  ? 53  LEU A HD21 2  
ATOM   4542  H  HD22 . LEU A 1 53  ? 2.221   65.543 4.329   1.00 0.00  ? 53  LEU A HD22 2  
ATOM   4543  H  HD23 . LEU A 1 53  ? 1.663   63.894 4.611   1.00 0.00  ? 53  LEU A HD23 2  
ATOM   4544  N  N    . ILE A 1 54  ? 4.680   64.899 8.686   1.00 0.00  ? 54  ILE A N    2  
ATOM   4545  C  CA   . ILE A 1 54  ? 5.549   63.716 8.967   1.00 0.00  ? 54  ILE A CA   2  
ATOM   4546  C  C    . ILE A 1 54  ? 5.100   63.046 10.273  1.00 0.00  ? 54  ILE A C    2  
ATOM   4547  O  O    . ILE A 1 54  ? 5.155   61.841 10.415  1.00 0.00  ? 54  ILE A O    2  
ATOM   4548  C  CB   . ILE A 1 54  ? 7.012   64.185 9.090   1.00 0.00  ? 54  ILE A CB   2  
ATOM   4549  C  CG1  . ILE A 1 54  ? 7.573   64.531 7.689   1.00 0.00  ? 54  ILE A CG1  2  
ATOM   4550  C  CG2  . ILE A 1 54  ? 7.871   63.093 9.750   1.00 0.00  ? 54  ILE A CG2  2  
ATOM   4551  C  CD1  . ILE A 1 54  ? 8.094   63.275 6.968   1.00 0.00  ? 54  ILE A CD1  2  
ATOM   4552  H  H    . ILE A 1 54  ? 5.086   65.739 8.388   1.00 0.00  ? 54  ILE A H    2  
ATOM   4553  H  HA   . ILE A 1 54  ? 5.465   63.011 8.156   1.00 0.00  ? 54  ILE A HA   2  
ATOM   4554  H  HB   . ILE A 1 54  ? 7.041   65.070 9.710   1.00 0.00  ? 54  ILE A HB   2  
ATOM   4555  H  HG12 . ILE A 1 54  ? 6.795   64.981 7.092   1.00 0.00  ? 54  ILE A HG12 2  
ATOM   4556  H  HG13 . ILE A 1 54  ? 8.385   65.235 7.799   1.00 0.00  ? 54  ILE A HG13 2  
ATOM   4557  H  HG21 . ILE A 1 54  ? 8.915   63.287 9.552   1.00 0.00  ? 54  ILE A HG21 2  
ATOM   4558  H  HG22 . ILE A 1 54  ? 7.601   62.129 9.345   1.00 0.00  ? 54  ILE A HG22 2  
ATOM   4559  H  HG23 . ILE A 1 54  ? 7.700   63.096 10.817  1.00 0.00  ? 54  ILE A HG23 2  
ATOM   4560  H  HD11 . ILE A 1 54  ? 8.018   63.418 5.900   1.00 0.00  ? 54  ILE A HD11 2  
ATOM   4561  H  HD12 . ILE A 1 54  ? 7.510   62.415 7.257   1.00 0.00  ? 54  ILE A HD12 2  
ATOM   4562  H  HD13 . ILE A 1 54  ? 9.128   63.112 7.234   1.00 0.00  ? 54  ILE A HD13 2  
ATOM   4563  N  N    . MET A 1 55  ? 4.661   63.821 11.230  1.00 0.00  ? 55  MET A N    2  
ATOM   4564  C  CA   . MET A 1 55  ? 4.215   63.235 12.533  1.00 0.00  ? 55  MET A CA   2  
ATOM   4565  C  C    . MET A 1 55  ? 2.716   62.906 12.460  1.00 0.00  ? 55  MET A C    2  
ATOM   4566  O  O    . MET A 1 55  ? 2.183   62.221 13.310  1.00 0.00  ? 55  MET A O    2  
ATOM   4567  C  CB   . MET A 1 55  ? 4.491   64.237 13.687  1.00 0.00  ? 55  MET A CB   2  
ATOM   4568  C  CG   . MET A 1 55  ? 4.806   65.622 13.115  1.00 0.00  ? 55  MET A CG   2  
ATOM   4569  S  SD   . MET A 1 55  ? 5.078   66.794 14.469  1.00 0.00  ? 55  MET A SD   2  
ATOM   4570  C  CE   . MET A 1 55  ? 3.398   66.779 15.144  1.00 0.00  ? 55  MET A CE   2  
ATOM   4571  H  H    . MET A 1 55  ? 4.630   64.791 11.095  1.00 0.00  ? 55  MET A H    2  
ATOM   4572  H  HA   . MET A 1 55  ? 4.765   62.322 12.716  1.00 0.00  ? 55  MET A HA   2  
ATOM   4573  H  HB2  . MET A 1 55  ? 3.629   64.308 14.336  1.00 0.00  ? 55  MET A HB2  2  
ATOM   4574  H  HB3  . MET A 1 55  ? 5.340   63.898 14.266  1.00 0.00  ? 55  MET A HB3  2  
ATOM   4575  H  HG2  . MET A 1 55  ? 5.697   65.560 12.510  1.00 0.00  ? 55  MET A HG2  2  
ATOM   4576  H  HG3  . MET A 1 55  ? 3.980   65.958 12.506  1.00 0.00  ? 55  MET A HG3  2  
ATOM   4577  H  HE1  . MET A 1 55  ? 3.326   66.021 15.911  1.00 0.00  ? 55  MET A HE1  2  
ATOM   4578  H  HE2  . MET A 1 55  ? 2.693   66.561 14.359  1.00 0.00  ? 55  MET A HE2  2  
ATOM   4579  H  HE3  . MET A 1 55  ? 3.173   67.749 15.567  1.00 0.00  ? 55  MET A HE3  2  
ATOM   4580  N  N    . ARG A 1 56  ? 2.027   63.396 11.463  1.00 0.00  ? 56  ARG A N    2  
ATOM   4581  C  CA   . ARG A 1 56  ? 0.565   63.111 11.365  1.00 0.00  ? 56  ARG A CA   2  
ATOM   4582  C  C    . ARG A 1 56  ? 0.335   61.676 10.881  1.00 0.00  ? 56  ARG A C    2  
ATOM   4583  O  O    . ARG A 1 56  ? -0.746  61.138 11.015  1.00 0.00  ? 56  ARG A O    2  
ATOM   4584  C  CB   . ARG A 1 56  ? -0.076  64.089 10.379  1.00 0.00  ? 56  ARG A CB   2  
ATOM   4585  C  CG   . ARG A 1 56  ? -1.564  63.754 10.223  1.00 0.00  ? 56  ARG A CG   2  
ATOM   4586  C  CD   . ARG A 1 56  ? -2.281  64.878 9.467   1.00 0.00  ? 56  ARG A CD   2  
ATOM   4587  N  NE   . ARG A 1 56  ? -1.944  66.210 10.073  1.00 0.00  ? 56  ARG A NE   2  
ATOM   4588  C  CZ   . ARG A 1 56  ? -2.160  66.463 11.337  1.00 0.00  ? 56  ARG A CZ   2  
ATOM   4589  N  NH1  . ARG A 1 56  ? -2.854  65.637 12.071  1.00 0.00  ? 56  ARG A NH1  2  
ATOM   4590  N  NH2  . ARG A 1 56  ? -1.727  67.579 11.857  1.00 0.00  ? 56  ARG A NH2  2  
ATOM   4591  H  H    . ARG A 1 56  ? 2.466   63.959 10.788  1.00 0.00  ? 56  ARG A H    2  
ATOM   4592  H  HA   . ARG A 1 56  ? 0.111   63.237 12.337  1.00 0.00  ? 56  ARG A HA   2  
ATOM   4593  H  HB2  . ARG A 1 56  ? 0.035   65.096 10.752  1.00 0.00  ? 56  ARG A HB2  2  
ATOM   4594  H  HB3  . ARG A 1 56  ? 0.412   64.004 9.420   1.00 0.00  ? 56  ARG A HB3  2  
ATOM   4595  H  HG2  . ARG A 1 56  ? -1.662  62.834 9.664   1.00 0.00  ? 56  ARG A HG2  2  
ATOM   4596  H  HG3  . ARG A 1 56  ? -2.008  63.625 11.194  1.00 0.00  ? 56  ARG A HG3  2  
ATOM   4597  H  HD2  . ARG A 1 56  ? -1.939  64.893 8.450   1.00 0.00  ? 56  ARG A HD2  2  
ATOM   4598  H  HD3  . ARG A 1 56  ? -3.353  64.689 9.476   1.00 0.00  ? 56  ARG A HD3  2  
ATOM   4599  H  HE   . ARG A 1 56  ? -1.502  66.886 9.520   1.00 0.00  ? 56  ARG A HE   2  
ATOM   4600  H  HH11 . ARG A 1 56  ? -3.228  64.803 11.668  1.00 0.00  ? 56  ARG A HH11 2  
ATOM   4601  H  HH12 . ARG A 1 56  ? -3.010  65.838 13.038  1.00 0.00  ? 56  ARG A HH12 2  
ATOM   4602  H  HH21 . ARG A 1 56  ? -1.232  68.236 11.288  1.00 0.00  ? 56  ARG A HH21 2  
ATOM   4603  H  HH22 . ARG A 1 56  ? -1.890  67.777 12.823  1.00 0.00  ? 56  ARG A HH22 2  
ATOM   4604  N  N    . GLY A 1 57  ? 1.339   61.057 10.311  1.00 75.30 ? 57  GLY A N    2  
ATOM   4605  C  CA   . GLY A 1 57  ? 1.191   59.654 9.799   1.00 74.65 ? 57  GLY A CA   2  
ATOM   4606  C  C    . GLY A 1 57  ? 1.537   59.643 8.315   1.00 75.56 ? 57  GLY A C    2  
ATOM   4607  O  O    . GLY A 1 57  ? 1.091   58.804 7.557   1.00 73.49 ? 57  GLY A O    2  
ATOM   4608  H  H    . GLY A 1 57  ? 2.197   61.519 10.211  1.00 0.00  ? 57  GLY A H    2  
ATOM   4609  H  HA2  . GLY A 1 57  ? 1.866   59.002 10.334  1.00 0.00  ? 57  GLY A HA2  2  
ATOM   4610  H  HA3  . GLY A 1 57  ? 0.180   59.311 9.927   1.00 0.00  ? 57  GLY A HA3  2  
ATOM   4611  N  N    . ALA A 1 58  ? 2.331   60.583 7.908   1.00 0.00  ? 58  ALA A N    2  
ATOM   4612  C  CA   . ALA A 1 58  ? 2.737   60.680 6.482   1.00 0.00  ? 58  ALA A CA   2  
ATOM   4613  C  C    . ALA A 1 58  ? 3.315   59.346 6.001   1.00 0.00  ? 58  ALA A C    2  
ATOM   4614  O  O    . ALA A 1 58  ? 3.629   58.468 6.780   1.00 0.00  ? 58  ALA A O    2  
ATOM   4615  C  CB   . ALA A 1 58  ? 3.770   61.796 6.320   1.00 0.00  ? 58  ALA A CB   2  
ATOM   4616  H  H    . ALA A 1 58  ? 2.665   61.235 8.552   1.00 0.00  ? 58  ALA A H    2  
ATOM   4617  H  HA   . ALA A 1 58  ? 1.868   60.917 5.887   1.00 0.00  ? 58  ALA A HA   2  
ATOM   4618  H  HB1  . ALA A 1 58  ? 3.781   62.126 5.293   1.00 0.00  ? 58  ALA A HB1  2  
ATOM   4619  H  HB2  . ALA A 1 58  ? 4.748   61.429 6.593   1.00 0.00  ? 58  ALA A HB2  2  
ATOM   4620  H  HB3  . ALA A 1 58  ? 3.502   62.625 6.958   1.00 0.00  ? 58  ALA A HB3  2  
ATOM   4621  N  N    . ARG A 1 59  ? 3.498   59.223 4.714   1.00 0.00  ? 59  ARG A N    2  
ATOM   4622  C  CA   . ARG A 1 59  ? 4.104   57.985 4.142   1.00 0.00  ? 59  ARG A CA   2  
ATOM   4623  C  C    . ARG A 1 59  ? 5.576   58.267 3.840   1.00 0.00  ? 59  ARG A C    2  
ATOM   4624  O  O    . ARG A 1 59  ? 5.903   58.951 2.891   1.00 0.00  ? 59  ARG A O    2  
ATOM   4625  C  CB   . ARG A 1 59  ? 3.369   57.597 2.861   1.00 0.00  ? 59  ARG A CB   2  
ATOM   4626  C  CG   . ARG A 1 59  ? 1.866   57.496 3.147   1.00 0.00  ? 59  ARG A CG   2  
ATOM   4627  C  CD   . ARG A 1 59  ? 1.174   56.732 2.015   1.00 0.00  ? 59  ARG A CD   2  
ATOM   4628  N  NE   . ARG A 1 59  ? -0.242  56.463 2.393   1.00 0.00  ? 59  ARG A NE   2  
ATOM   4629  C  CZ   . ARG A 1 59  ? -1.095  56.078 1.484   1.00 0.00  ? 59  ARG A CZ   2  
ATOM   4630  N  NH1  . ARG A 1 59  ? -0.707  55.943 0.245   1.00 0.00  ? 59  ARG A NH1  2  
ATOM   4631  N  NH2  . ARG A 1 59  ? -2.333  55.829 1.812   1.00 0.00  ? 59  ARG A NH2  2  
ATOM   4632  H  H    . ARG A 1 59  ? 3.309   59.995 4.149   1.00 0.00  ? 59  ARG A H    2  
ATOM   4633  H  HA   . ARG A 1 59  ? 4.034   57.174 4.857   1.00 0.00  ? 59  ARG A HA   2  
ATOM   4634  H  HB2  . ARG A 1 59  ? 3.547   58.345 2.102   1.00 0.00  ? 59  ARG A HB2  2  
ATOM   4635  H  HB3  . ARG A 1 59  ? 3.735   56.642 2.520   1.00 0.00  ? 59  ARG A HB3  2  
ATOM   4636  H  HG2  . ARG A 1 59  ? 1.710   56.974 4.080   1.00 0.00  ? 59  ARG A HG2  2  
ATOM   4637  H  HG3  . ARG A 1 59  ? 1.447   58.489 3.216   1.00 0.00  ? 59  ARG A HG3  2  
ATOM   4638  H  HD2  . ARG A 1 59  ? 1.198   57.323 1.113   1.00 0.00  ? 59  ARG A HD2  2  
ATOM   4639  H  HD3  . ARG A 1 59  ? 1.684   55.796 1.845   1.00 0.00  ? 59  ARG A HD3  2  
ATOM   4640  H  HE   . ARG A 1 59  ? -0.532  56.571 3.323   1.00 0.00  ? 59  ARG A HE   2  
ATOM   4641  H  HH11 . ARG A 1 59  ? 0.242   56.135 -0.005  1.00 0.00  ? 59  ARG A HH11 2  
ATOM   4642  H  HH12 . ARG A 1 59  ? -1.358  55.647 -0.453  1.00 0.00  ? 59  ARG A HH12 2  
ATOM   4643  H  HH21 . ARG A 1 59  ? -2.630  55.933 2.761   1.00 0.00  ? 59  ARG A HH21 2  
ATOM   4644  H  HH22 . ARG A 1 59  ? -2.985  55.532 1.114   1.00 0.00  ? 59  ARG A HH22 2  
ATOM   4645  N  N    . ILE A 1 60  ? 6.467   57.761 4.645   1.00 0.00  ? 60  ILE A N    2  
ATOM   4646  C  CA   . ILE A 1 60  ? 7.922   58.013 4.415   1.00 0.00  ? 60  ILE A CA   2  
ATOM   4647  C  C    . ILE A 1 60  ? 8.526   56.877 3.585   1.00 0.00  ? 60  ILE A C    2  
ATOM   4648  O  O    . ILE A 1 60  ? 9.699   56.890 3.270   1.00 0.00  ? 60  ILE A O    2  
ATOM   4649  C  CB   . ILE A 1 60  ? 8.632   58.105 5.773   1.00 0.00  ? 60  ILE A CB   2  
ATOM   4650  C  CG1  . ILE A 1 60  ? 7.984   59.220 6.608   1.00 0.00  ? 60  ILE A CG1  2  
ATOM   4651  C  CG2  . ILE A 1 60  ? 10.120  58.421 5.567   1.00 0.00  ? 60  ILE A CG2  2  
ATOM   4652  C  CD1  . ILE A 1 60  ? 8.379   59.060 8.077   1.00 0.00  ? 60  ILE A CD1  2  
ATOM   4653  H  H    . ILE A 1 60  ? 6.182   57.221 5.411   1.00 0.00  ? 60  ILE A H    2  
ATOM   4654  H  HA   . ILE A 1 60  ? 8.051   58.947 3.885   1.00 0.00  ? 60  ILE A HA   2  
ATOM   4655  H  HB   . ILE A 1 60  ? 8.534   57.162 6.292   1.00 0.00  ? 60  ILE A HB   2  
ATOM   4656  H  HG12 . ILE A 1 60  ? 8.321   60.182 6.248   1.00 0.00  ? 60  ILE A HG12 2  
ATOM   4657  H  HG13 . ILE A 1 60  ? 6.909   59.162 6.521   1.00 0.00  ? 60  ILE A HG13 2  
ATOM   4658  H  HG21 . ILE A 1 60  ? 10.537  58.815 6.483   1.00 0.00  ? 60  ILE A HG21 2  
ATOM   4659  H  HG22 . ILE A 1 60  ? 10.229  59.153 4.780   1.00 0.00  ? 60  ILE A HG22 2  
ATOM   4660  H  HG23 . ILE A 1 60  ? 10.646  57.519 5.295   1.00 0.00  ? 60  ILE A HG23 2  
ATOM   4661  H  HD11 . ILE A 1 60  ? 7.807   58.256 8.516   1.00 0.00  ? 60  ILE A HD11 2  
ATOM   4662  H  HD12 . ILE A 1 60  ? 8.173   59.978 8.606   1.00 0.00  ? 60  ILE A HD12 2  
ATOM   4663  H  HD13 . ILE A 1 60  ? 9.433   58.833 8.145   1.00 0.00  ? 60  ILE A HD13 2  
ATOM   4664  N  N    . ASN A 1 61  ? 7.738   55.888 3.235   1.00 0.00  ? 61  ASN A N    2  
ATOM   4665  C  CA   . ASN A 1 61  ? 8.273   54.732 2.434   1.00 0.00  ? 61  ASN A CA   2  
ATOM   4666  C  C    . ASN A 1 61  ? 7.583   54.661 1.070   1.00 0.00  ? 61  ASN A C    2  
ATOM   4667  O  O    . ASN A 1 61  ? 7.994   53.923 0.197   1.00 0.00  ? 61  ASN A O    2  
ATOM   4668  C  CB   . ASN A 1 61  ? 8.015   53.434 3.207   1.00 0.00  ? 61  ASN A CB   2  
ATOM   4669  C  CG   . ASN A 1 61  ? 6.630   53.494 3.852   1.00 0.00  ? 61  ASN A CG   2  
ATOM   4670  O  OD1  . ASN A 1 61  ? 5.649   53.104 3.251   1.00 0.00  ? 61  ASN A OD1  2  
ATOM   4671  N  ND2  . ASN A 1 61  ? 6.506   53.973 5.061   1.00 0.00  ? 61  ASN A ND2  2  
ATOM   4672  H  H    . ASN A 1 61  ? 6.792   55.902 3.508   1.00 0.00  ? 61  ASN A H    2  
ATOM   4673  H  HA   . ASN A 1 61  ? 9.333   54.845 2.280   1.00 0.00  ? 61  ASN A HA   2  
ATOM   4674  H  HB2  . ASN A 1 61  ? 8.065   52.590 2.533   1.00 0.00  ? 61  ASN A HB2  2  
ATOM   4675  H  HB3  . ASN A 1 61  ? 8.763   53.322 3.978   1.00 0.00  ? 61  ASN A HB3  2  
ATOM   4676  H  HD21 . ASN A 1 61  ? 7.297   54.290 5.547   1.00 0.00  ? 61  ASN A HD21 2  
ATOM   4677  H  HD22 . ASN A 1 61  ? 5.623   54.016 5.483   1.00 0.00  ? 61  ASN A HD22 2  
ATOM   4678  N  N    . VAL A 1 62  ? 6.541   55.410 0.879   1.00 0.00  ? 62  VAL A N    2  
ATOM   4679  C  CA   . VAL A 1 62  ? 5.830   55.370 -0.431  1.00 0.00  ? 62  VAL A CA   2  
ATOM   4680  C  C    . VAL A 1 62  ? 6.823   55.634 -1.568  1.00 0.00  ? 62  VAL A C    2  
ATOM   4681  O  O    . VAL A 1 62  ? 7.852   56.250 -1.380  1.00 0.00  ? 62  VAL A O    2  
ATOM   4682  C  CB   . VAL A 1 62  ? 4.732   56.435 -0.449  1.00 0.00  ? 62  VAL A CB   2  
ATOM   4683  C  CG1  . VAL A 1 62  ? 5.330   57.793 -0.078  1.00 0.00  ? 62  VAL A CG1  2  
ATOM   4684  C  CG2  . VAL A 1 62  ? 4.119   56.513 -1.847  1.00 0.00  ? 62  VAL A CG2  2  
ATOM   4685  H  H    . VAL A 1 62  ? 6.216   55.990 1.598   1.00 0.00  ? 62  VAL A H    2  
ATOM   4686  H  HA   . VAL A 1 62  ? 5.385   54.395 -0.565  1.00 0.00  ? 62  VAL A HA   2  
ATOM   4687  H  HB   . VAL A 1 62  ? 3.967   56.172 0.265   1.00 0.00  ? 62  VAL A HB   2  
ATOM   4688  H  HG11 . VAL A 1 62  ? 5.833   57.717 0.875   1.00 0.00  ? 62  VAL A HG11 2  
ATOM   4689  H  HG12 . VAL A 1 62  ? 4.542   58.528 -0.012  1.00 0.00  ? 62  VAL A HG12 2  
ATOM   4690  H  HG13 . VAL A 1 62  ? 6.039   58.094 -0.835  1.00 0.00  ? 62  VAL A HG13 2  
ATOM   4691  H  HG21 . VAL A 1 62  ? 3.198   57.075 -1.807  1.00 0.00  ? 62  VAL A HG21 2  
ATOM   4692  H  HG22 . VAL A 1 62  ? 3.917   55.515 -2.209  1.00 0.00  ? 62  VAL A HG22 2  
ATOM   4693  H  HG23 . VAL A 1 62  ? 4.811   57.003 -2.513  1.00 0.00  ? 62  VAL A HG23 2  
ATOM   4694  N  N    . MET A 1 63  ? 6.511   55.172 -2.753  1.00 0.00  ? 63  MET A N    2  
ATOM   4695  C  CA   . MET A 1 63  ? 7.414   55.384 -3.922  1.00 0.00  ? 63  MET A CA   2  
ATOM   4696  C  C    . MET A 1 63  ? 6.556   55.683 -5.152  1.00 0.00  ? 63  MET A C    2  
ATOM   4697  O  O    . MET A 1 63  ? 5.442   55.213 -5.270  1.00 0.00  ? 63  MET A O    2  
ATOM   4698  C  CB   . MET A 1 63  ? 8.236   54.118 -4.167  1.00 0.00  ? 63  MET A CB   2  
ATOM   4699  C  CG   . MET A 1 63  ? 7.294   52.942 -4.430  1.00 0.00  ? 63  MET A CG   2  
ATOM   4700  S  SD   . MET A 1 63  ? 8.233   51.395 -4.388  1.00 0.00  ? 63  MET A SD   2  
ATOM   4701  C  CE   . MET A 1 63  ? 8.083   51.085 -2.611  1.00 0.00  ? 63  MET A CE   2  
ATOM   4702  H  H    . MET A 1 63  ? 5.674   54.683 -2.878  1.00 0.00  ? 63  MET A H    2  
ATOM   4703  H  HA   . MET A 1 63  ? 8.077   56.218 -3.733  1.00 0.00  ? 63  MET A HA   2  
ATOM   4704  H  HB2  . MET A 1 63  ? 8.879   54.265 -5.022  1.00 0.00  ? 63  MET A HB2  2  
ATOM   4705  H  HB3  . MET A 1 63  ? 8.837   53.905 -3.296  1.00 0.00  ? 63  MET A HB3  2  
ATOM   4706  H  HG2  . MET A 1 63  ? 6.526   52.918 -3.671  1.00 0.00  ? 63  MET A HG2  2  
ATOM   4707  H  HG3  . MET A 1 63  ? 6.836   53.059 -5.402  1.00 0.00  ? 63  MET A HG3  2  
ATOM   4708  H  HE1  . MET A 1 63  ? 8.436   51.949 -2.065  1.00 0.00  ? 63  MET A HE1  2  
ATOM   4709  H  HE2  . MET A 1 63  ? 8.677   50.226 -2.344  1.00 0.00  ? 63  MET A HE2  2  
ATOM   4710  H  HE3  . MET A 1 63  ? 7.048   50.894 -2.366  1.00 0.00  ? 63  MET A HE3  2  
ATOM   4711  N  N    . ASN A 1 64  ? 7.056   56.469 -6.063  1.00 0.00  ? 64  ASN A N    2  
ATOM   4712  C  CA   . ASN A 1 64  ? 6.255   56.805 -7.275  1.00 0.00  ? 64  ASN A CA   2  
ATOM   4713  C  C    . ASN A 1 64  ? 6.313   55.654 -8.276  1.00 0.00  ? 64  ASN A C    2  
ATOM   4714  O  O    . ASN A 1 64  ? 7.210   54.834 -8.251  1.00 0.00  ? 64  ASN A O    2  
ATOM   4715  C  CB   . ASN A 1 64  ? 6.818   58.062 -7.941  1.00 0.00  ? 64  ASN A CB   2  
ATOM   4716  C  CG   . ASN A 1 64  ? 6.925   59.192 -6.917  1.00 0.00  ? 64  ASN A CG   2  
ATOM   4717  O  OD1  . ASN A 1 64  ? 7.967   59.397 -6.328  1.00 0.00  ? 64  ASN A OD1  2  
ATOM   4718  N  ND2  . ASN A 1 64  ? 5.884   59.944 -6.684  1.00 0.00  ? 64  ASN A ND2  2  
ATOM   4719  H  H    . ASN A 1 64  ? 7.951   56.844 -5.947  1.00 0.00  ? 64  ASN A H    2  
ATOM   4720  H  HA   . ASN A 1 64  ? 5.228   56.981 -6.989  1.00 0.00  ? 64  ASN A HA   2  
ATOM   4721  H  HB2  . ASN A 1 64  ? 7.795   57.846 -8.344  1.00 0.00  ? 64  ASN A HB2  2  
ATOM   4722  H  HB3  . ASN A 1 64  ? 6.160   58.368 -8.742  1.00 0.00  ? 64  ASN A HB3  2  
ATOM   4723  H  HD21 . ASN A 1 64  ? 5.045   59.782 -7.163  1.00 0.00  ? 64  ASN A HD21 2  
ATOM   4724  H  HD22 . ASN A 1 64  ? 5.942   60.672 -6.031  1.00 0.00  ? 64  ASN A HD22 2  
ATOM   4725  N  N    . ARG A 1 65  ? 5.369   55.603 -9.172  1.00 0.00  ? 65  ARG A N    2  
ATOM   4726  C  CA   . ARG A 1 65  ? 5.371   54.524 -10.194 1.00 0.00  ? 65  ARG A CA   2  
ATOM   4727  C  C    . ARG A 1 65  ? 6.659   54.639 -11.016 1.00 0.00  ? 65  ARG A C    2  
ATOM   4728  O  O    . ARG A 1 65  ? 6.946   53.812 -11.858 1.00 0.00  ? 65  ARG A O    2  
ATOM   4729  C  CB   . ARG A 1 65  ? 4.135   54.653 -11.112 1.00 0.00  ? 65  ARG A CB   2  
ATOM   4730  C  CG   . ARG A 1 65  ? 3.729   56.124 -11.287 1.00 0.00  ? 65  ARG A CG   2  
ATOM   4731  C  CD   . ARG A 1 65  ? 4.918   56.958 -11.768 1.00 0.00  ? 65  ARG A CD   2  
ATOM   4732  N  NE   . ARG A 1 65  ? 4.416   58.229 -12.363 1.00 0.00  ? 65  ARG A NE   2  
ATOM   4733  C  CZ   . ARG A 1 65  ? 5.229   59.234 -12.539 1.00 0.00  ? 65  ARG A CZ   2  
ATOM   4734  N  NH1  . ARG A 1 65  ? 6.483   59.128 -12.193 1.00 0.00  ? 65  ARG A NH1  2  
ATOM   4735  N  NH2  . ARG A 1 65  ? 4.788   60.346 -13.062 1.00 0.00  ? 65  ARG A NH2  2  
ATOM   4736  H  H    . ARG A 1 65  ? 4.670   56.285 -9.180  1.00 0.00  ? 65  ARG A H    2  
ATOM   4737  H  HA   . ARG A 1 65  ? 5.353   53.564 -9.697  1.00 0.00  ? 65  ARG A HA   2  
ATOM   4738  H  HB2  . ARG A 1 65  ? 4.356   54.229 -12.081 1.00 0.00  ? 65  ARG A HB2  2  
ATOM   4739  H  HB3  . ARG A 1 65  ? 3.307   54.114 -10.672 1.00 0.00  ? 65  ARG A HB3  2  
ATOM   4740  H  HG2  . ARG A 1 65  ? 2.935   56.187 -12.017 1.00 0.00  ? 65  ARG A HG2  2  
ATOM   4741  H  HG3  . ARG A 1 65  ? 3.375   56.515 -10.349 1.00 0.00  ? 65  ARG A HG3  2  
ATOM   4742  H  HD2  . ARG A 1 65  ? 5.565   57.184 -10.933 1.00 0.00  ? 65  ARG A HD2  2  
ATOM   4743  H  HD3  . ARG A 1 65  ? 5.466   56.407 -12.514 1.00 0.00  ? 65  ARG A HD3  2  
ATOM   4744  H  HE   . ARG A 1 65  ? 3.475   58.310 -12.623 1.00 0.00  ? 65  ARG A HE   2  
ATOM   4745  H  HH11 . ARG A 1 65  ? 6.821   58.276 -11.793 1.00 0.00  ? 65  ARG A HH11 2  
ATOM   4746  H  HH12 . ARG A 1 65  ? 7.106   59.899 -12.328 1.00 0.00  ? 65  ARG A HH12 2  
ATOM   4747  H  HH21 . ARG A 1 65  ? 3.828   60.427 -13.327 1.00 0.00  ? 65  ARG A HH21 2  
ATOM   4748  H  HH22 . ARG A 1 65  ? 5.411   61.116 -13.196 1.00 0.00  ? 65  ARG A HH22 2  
ATOM   4749  N  N    . GLY A 1 66  ? 7.432   55.671 -10.773 1.00 0.00  ? 66  GLY A N    2  
ATOM   4750  C  CA   . GLY A 1 66  ? 8.709   55.873 -11.528 1.00 0.00  ? 66  GLY A CA   2  
ATOM   4751  C  C    . GLY A 1 66  ? 9.909   55.646 -10.603 1.00 0.00  ? 66  GLY A C    2  
ATOM   4752  O  O    . GLY A 1 66  ? 10.931  56.290 -10.736 1.00 0.00  ? 66  GLY A O    2  
ATOM   4753  H  H    . GLY A 1 66  ? 7.168   56.322 -10.089 1.00 0.00  ? 66  GLY A H    2  
ATOM   4754  H  HA2  . GLY A 1 66  ? 8.762   55.184 -12.361 1.00 0.00  ? 66  GLY A HA2  2  
ATOM   4755  H  HA3  . GLY A 1 66  ? 8.742   56.885 -11.903 1.00 0.00  ? 66  GLY A HA3  2  
ATOM   4756  N  N    . ASP A 1 67  ? 9.812   54.723 -9.681  1.00 0.00  ? 67  ASP A N    2  
ATOM   4757  C  CA   . ASP A 1 67  ? 10.965  54.451 -8.776  1.00 0.00  ? 67  ASP A CA   2  
ATOM   4758  C  C    . ASP A 1 67  ? 11.513  55.766 -8.228  1.00 0.00  ? 67  ASP A C    2  
ATOM   4759  O  O    . ASP A 1 67  ? 12.523  56.268 -8.680  1.00 0.00  ? 67  ASP A O    2  
ATOM   4760  C  CB   . ASP A 1 67  ? 12.064  53.726 -9.556  1.00 0.00  ? 67  ASP A CB   2  
ATOM   4761  C  CG   . ASP A 1 67  ? 13.185  53.320 -8.598  1.00 0.00  ? 67  ASP A CG   2  
ATOM   4762  O  OD1  . ASP A 1 67  ? 13.969  54.182 -8.236  1.00 0.00  ? 67  ASP A OD1  2  
ATOM   4763  O  OD2  . ASP A 1 67  ? 13.240  52.155 -8.241  1.00 0.00  ? 67  ASP A OD2  2  
ATOM   4764  H  H    . ASP A 1 67  ? 8.994   54.192 -9.594  1.00 0.00  ? 67  ASP A H    2  
ATOM   4765  H  HA   . ASP A 1 67  ? 10.638  53.829 -7.957  1.00 0.00  ? 67  ASP A HA   2  
ATOM   4766  H  HB2  . ASP A 1 67  ? 11.651  52.844 -10.024 1.00 0.00  ? 67  ASP A HB2  2  
ATOM   4767  H  HB3  . ASP A 1 67  ? 12.462  54.384 -10.314 1.00 0.00  ? 67  ASP A HB3  2  
ATOM   4768  N  N    . ASP A 1 68  ? 10.861  56.314 -7.245  1.00 0.00  ? 68  ASP A N    2  
ATOM   4769  C  CA   . ASP A 1 68  ? 11.345  57.589 -6.648  1.00 0.00  ? 68  ASP A CA   2  
ATOM   4770  C  C    . ASP A 1 68  ? 10.776  57.734 -5.239  1.00 0.00  ? 68  ASP A C    2  
ATOM   4771  O  O    . ASP A 1 68  ? 9.647   58.146 -5.059  1.00 0.00  ? 68  ASP A O    2  
ATOM   4772  C  CB   . ASP A 1 68  ? 10.889  58.770 -7.507  1.00 0.00  ? 68  ASP A CB   2  
ATOM   4773  C  CG   . ASP A 1 68  ? 11.543  58.686 -8.886  1.00 0.00  ? 68  ASP A CG   2  
ATOM   4774  O  OD1  . ASP A 1 68  ? 12.762  58.708 -8.944  1.00 0.00  ? 68  ASP A OD1  2  
ATOM   4775  O  OD2  . ASP A 1 68  ? 10.815  58.601 -9.861  1.00 0.00  ? 68  ASP A OD2  2  
ATOM   4776  H  H    . ASP A 1 68  ? 10.062  55.871 -6.890  1.00 0.00  ? 68  ASP A H    2  
ATOM   4777  H  HA   . ASP A 1 68  ? 12.425  57.577 -6.598  1.00 0.00  ? 68  ASP A HA   2  
ATOM   4778  H  HB2  . ASP A 1 68  ? 9.816   58.742 -7.615  1.00 0.00  ? 68  ASP A HB2  2  
ATOM   4779  H  HB3  . ASP A 1 68  ? 11.178  59.694 -7.030  1.00 0.00  ? 68  ASP A HB3  2  
ATOM   4780  N  N    . THR A 1 69  ? 11.547  57.416 -4.232  1.00 37.95 ? 69  THR A N    2  
ATOM   4781  C  CA   . THR A 1 69  ? 11.040  57.559 -2.841  1.00 36.30 ? 69  THR A CA   2  
ATOM   4782  C  C    . THR A 1 69  ? 11.347  58.994 -2.392  1.00 38.10 ? 69  THR A C    2  
ATOM   4783  O  O    . THR A 1 69  ? 12.258  59.606 -2.916  1.00 39.86 ? 69  THR A O    2  
ATOM   4784  C  CB   . THR A 1 69  ? 11.766  56.546 -1.933  1.00 38.07 ? 69  THR A CB   2  
ATOM   4785  O  OG1  . THR A 1 69  ? 13.078  56.339 -2.424  1.00 39.54 ? 69  THR A OG1  2  
ATOM   4786  C  CG2  . THR A 1 69  ? 11.016  55.211 -1.930  1.00 41.20 ? 69  THR A CG2  2  
ATOM   4787  H  H    . THR A 1 69  ? 12.462  57.099 -4.388  1.00 0.00  ? 69  THR A H    2  
ATOM   4788  H  HA   . THR A 1 69  ? 9.973   57.380 -2.825  1.00 0.00  ? 69  THR A HA   2  
ATOM   4789  H  HB   . THR A 1 69  ? 11.822  56.924 -0.925  1.00 0.00  ? 69  THR A HB   2  
ATOM   4790  H  HG1  . THR A 1 69  ? 13.018  56.160 -3.365  1.00 0.00  ? 69  THR A HG1  2  
ATOM   4791  H  HG21 . THR A 1 69  ? 11.545  54.503 -1.308  1.00 0.00  ? 69  THR A HG21 2  
ATOM   4792  H  HG22 . THR A 1 69  ? 10.957  54.830 -2.938  1.00 0.00  ? 69  THR A HG22 2  
ATOM   4793  H  HG23 . THR A 1 69  ? 10.020  55.358 -1.541  1.00 0.00  ? 69  THR A HG23 2  
ATOM   4794  N  N    . PRO A 1 70  ? 10.597  59.509 -1.447  1.00 40.33 ? 70  PRO A N    2  
ATOM   4795  C  CA   . PRO A 1 70  ? 10.831  60.877 -0.966  1.00 40.65 ? 70  PRO A CA   2  
ATOM   4796  C  C    . PRO A 1 70  ? 12.317  61.066 -0.631  1.00 38.76 ? 70  PRO A C    2  
ATOM   4797  O  O    . PRO A 1 70  ? 12.897  62.089 -0.925  1.00 37.74 ? 70  PRO A O    2  
ATOM   4798  C  CB   . PRO A 1 70  ? 9.932   61.016 0.286   1.00 43.22 ? 70  PRO A CB   2  
ATOM   4799  C  CG   . PRO A 1 70  ? 9.131   59.688 0.430   1.00 40.01 ? 70  PRO A CG   2  
ATOM   4800  C  CD   . PRO A 1 70  ? 9.481   58.801 -0.783  1.00 42.85 ? 70  PRO A CD   2  
ATOM   4801  H  HA   . PRO A 1 70  ? 10.529  61.590 -1.719  1.00 0.00  ? 70  PRO A HA   2  
ATOM   4802  H  HB2  . PRO A 1 70  ? 10.539  61.183 1.169   1.00 0.00  ? 70  PRO A HB2  2  
ATOM   4803  H  HB3  . PRO A 1 70  ? 9.245   61.842 0.159   1.00 0.00  ? 70  PRO A HB3  2  
ATOM   4804  H  HG2  . PRO A 1 70  ? 9.417   59.187 1.347   1.00 0.00  ? 70  PRO A HG2  2  
ATOM   4805  H  HG3  . PRO A 1 70  ? 8.068   59.891 0.441   1.00 0.00  ? 70  PRO A HG3  2  
ATOM   4806  H  HD2  . PRO A 1 70  ? 9.784   57.818 -0.460  1.00 0.00  ? 70  PRO A HD2  2  
ATOM   4807  H  HD3  . PRO A 1 70  ? 8.639   58.730 -1.457  1.00 0.00  ? 70  PRO A HD3  2  
ATOM   4808  N  N    . LEU A 1 71  ? 12.936  60.092 -0.014  1.00 38.12 ? 71  LEU A N    2  
ATOM   4809  C  CA   . LEU A 1 71  ? 14.376  60.242 0.346   1.00 34.17 ? 71  LEU A CA   2  
ATOM   4810  C  C    . LEU A 1 71  ? 15.150  60.758 -0.864  1.00 31.24 ? 71  LEU A C    2  
ATOM   4811  O  O    . LEU A 1 71  ? 15.834  61.760 -0.798  1.00 28.70 ? 71  LEU A O    2  
ATOM   4812  C  CB   . LEU A 1 71  ? 14.958  58.892 0.782   1.00 31.35 ? 71  LEU A CB   2  
ATOM   4813  C  CG   . LEU A 1 71  ? 16.301  59.121 1.528   1.00 36.03 ? 71  LEU A CG   2  
ATOM   4814  C  CD1  . LEU A 1 71  ? 16.075  59.150 3.049   1.00 30.93 ? 71  LEU A CD1  2  
ATOM   4815  C  CD2  . LEU A 1 71  ? 17.286  57.996 1.187   1.00 33.08 ? 71  LEU A CD2  2  
ATOM   4816  H  H    . LEU A 1 71  ? 12.451  59.275 0.221   1.00 0.00  ? 71  LEU A H    2  
ATOM   4817  H  HA   . LEU A 1 71  ? 14.469  60.950 1.156   1.00 0.00  ? 71  LEU A HA   2  
ATOM   4818  H  HB2  . LEU A 1 71  ? 14.251  58.394 1.434   1.00 0.00  ? 71  LEU A HB2  2  
ATOM   4819  H  HB3  . LEU A 1 71  ? 15.125  58.280 -0.094  1.00 0.00  ? 71  LEU A HB3  2  
ATOM   4820  H  HG   . LEU A 1 71  ? 16.731  60.068 1.224   1.00 0.00  ? 71  LEU A HG   2  
ATOM   4821  H  HD11 . LEU A 1 71  ? 16.070  58.143 3.441   1.00 0.00  ? 71  LEU A HD11 2  
ATOM   4822  H  HD12 . LEU A 1 71  ? 15.129  59.619 3.265   1.00 0.00  ? 71  LEU A HD12 2  
ATOM   4823  H  HD13 . LEU A 1 71  ? 16.869  59.712 3.519   1.00 0.00  ? 71  LEU A HD13 2  
ATOM   4824  H  HD21 . LEU A 1 71  ? 16.826  57.043 1.394   1.00 0.00  ? 71  LEU A HD21 2  
ATOM   4825  H  HD22 . LEU A 1 71  ? 18.173  58.107 1.789   1.00 0.00  ? 71  LEU A HD22 2  
ATOM   4826  H  HD23 . LEU A 1 71  ? 17.548  58.051 0.141   1.00 0.00  ? 71  LEU A HD23 2  
ATOM   4827  N  N    . HIS A 1 72  ? 15.034  60.088 -1.972  1.00 31.23 ? 72  HIS A N    2  
ATOM   4828  C  CA   . HIS A 1 72  ? 15.749  60.550 -3.188  1.00 33.99 ? 72  HIS A CA   2  
ATOM   4829  C  C    . HIS A 1 72  ? 15.302  61.986 -3.495  1.00 33.71 ? 72  HIS A C    2  
ATOM   4830  O  O    . HIS A 1 72  ? 16.077  62.919 -3.435  1.00 34.60 ? 72  HIS A O    2  
ATOM   4831  C  CB   . HIS A 1 72  ? 15.398  59.631 -4.365  1.00 37.54 ? 72  HIS A CB   2  
ATOM   4832  C  CG   . HIS A 1 72  ? 15.724  58.197 -4.016  1.00 39.41 ? 72  HIS A CG   2  
ATOM   4833  N  ND1  . HIS A 1 72  ? 14.748  57.217 -3.918  1.00 37.82 ? 72  HIS A ND1  2  
ATOM   4834  C  CD2  . HIS A 1 72  ? 16.915  57.562 -3.757  1.00 43.02 ? 72  HIS A CD2  2  
ATOM   4835  C  CE1  . HIS A 1 72  ? 15.364  56.055 -3.614  1.00 38.43 ? 72  HIS A CE1  2  
ATOM   4836  N  NE2  . HIS A 1 72  ? 16.686  56.208 -3.511  1.00 38.41 ? 72  HIS A NE2  2  
ATOM   4837  H  H    . HIS A 1 72  ? 14.465  59.289 -2.006  1.00 0.00  ? 72  HIS A H    2  
ATOM   4838  H  HA   . HIS A 1 72  ? 16.815  60.530 -3.014  1.00 0.00  ? 72  HIS A HA   2  
ATOM   4839  H  HB2  . HIS A 1 72  ? 14.343  59.715 -4.584  1.00 0.00  ? 72  HIS A HB2  2  
ATOM   4840  H  HB3  . HIS A 1 72  ? 15.968  59.926 -5.233  1.00 0.00  ? 72  HIS A HB3  2  
ATOM   4841  H  HD2  . HIS A 1 72  ? 17.874  58.046 -3.719  1.00 0.00  ? 72  HIS A HD2  2  
ATOM   4842  H  HE1  . HIS A 1 72  ? 14.846  55.125 -3.439  1.00 0.00  ? 72  HIS A HE1  2  
ATOM   4843  H  HE2  . HIS A 1 72  ? 17.349  55.512 -3.314  1.00 0.00  ? 72  HIS A HE2  2  
ATOM   4844  N  N    . LEU A 1 73  ? 14.052  62.157 -3.828  1.00 29.46 ? 73  LEU A N    2  
ATOM   4845  C  CA   . LEU A 1 73  ? 13.535  63.523 -4.149  1.00 30.94 ? 73  LEU A CA   2  
ATOM   4846  C  C    . LEU A 1 73  ? 13.988  64.517 -3.073  1.00 31.79 ? 73  LEU A C    2  
ATOM   4847  O  O    . LEU A 1 73  ? 14.437  65.610 -3.366  1.00 30.31 ? 73  LEU A O    2  
ATOM   4848  C  CB   . LEU A 1 73  ? 12.006  63.491 -4.202  1.00 29.19 ? 73  LEU A CB   2  
ATOM   4849  C  CG   . LEU A 1 73  ? 11.540  62.358 -5.123  1.00 29.25 ? 73  LEU A CG   2  
ATOM   4850  C  CD1  . LEU A 1 73  ? 10.012  62.384 -5.224  1.00 30.59 ? 73  LEU A CD1  2  
ATOM   4851  C  CD2  . LEU A 1 73  ? 12.152  62.536 -6.521  1.00 29.01 ? 73  LEU A CD2  2  
ATOM   4852  H  H    . LEU A 1 73  ? 13.464  61.373 -3.880  1.00 0.00  ? 73  LEU A H    2  
ATOM   4853  H  HA   . LEU A 1 73  ? 13.919  63.837 -5.107  1.00 0.00  ? 73  LEU A HA   2  
ATOM   4854  H  HB2  . LEU A 1 73  ? 11.616  63.330 -3.207  1.00 0.00  ? 73  LEU A HB2  2  
ATOM   4855  H  HB3  . LEU A 1 73  ? 11.640  64.433 -4.582  1.00 0.00  ? 73  LEU A HB3  2  
ATOM   4856  H  HG   . LEU A 1 73  ? 11.854  61.410 -4.709  1.00 0.00  ? 73  LEU A HG   2  
ATOM   4857  H  HD11 . LEU A 1 73  ? 9.589   62.515 -4.239  1.00 0.00  ? 73  LEU A HD11 2  
ATOM   4858  H  HD12 . LEU A 1 73  ? 9.664   61.453 -5.645  1.00 0.00  ? 73  LEU A HD12 2  
ATOM   4859  H  HD13 . LEU A 1 73  ? 9.708   63.203 -5.859  1.00 0.00  ? 73  LEU A HD13 2  
ATOM   4860  H  HD21 . LEU A 1 73  ? 12.164  63.585 -6.783  1.00 0.00  ? 73  LEU A HD21 2  
ATOM   4861  H  HD22 . LEU A 1 73  ? 11.565  61.993 -7.248  1.00 0.00  ? 73  LEU A HD22 2  
ATOM   4862  H  HD23 . LEU A 1 73  ? 13.162  62.153 -6.523  1.00 0.00  ? 73  LEU A HD23 2  
ATOM   4863  N  N    . ALA A 1 74  ? 13.872  64.148 -1.830  1.00 33.77 ? 74  ALA A N    2  
ATOM   4864  C  CA   . ALA A 1 74  ? 14.290  65.064 -0.734  1.00 31.56 ? 74  ALA A CA   2  
ATOM   4865  C  C    . ALA A 1 74  ? 15.722  65.546 -0.988  1.00 32.36 ? 74  ALA A C    2  
ATOM   4866  O  O    . ALA A 1 74  ? 15.976  66.726 -1.126  1.00 33.38 ? 74  ALA A O    2  
ATOM   4867  C  CB   . ALA A 1 74  ? 14.225  64.314 0.601   1.00 31.99 ? 74  ALA A CB   2  
ATOM   4868  H  H    . ALA A 1 74  ? 13.506  63.264 -1.615  1.00 0.00  ? 74  ALA A H    2  
ATOM   4869  H  HA   . ALA A 1 74  ? 13.626  65.915 -0.701  1.00 0.00  ? 74  ALA A HA   2  
ATOM   4870  H  HB1  . ALA A 1 74  ? 14.849  64.810 1.330   1.00 0.00  ? 74  ALA A HB1  2  
ATOM   4871  H  HB2  . ALA A 1 74  ? 14.573  63.302 0.461   1.00 0.00  ? 74  ALA A HB2  2  
ATOM   4872  H  HB3  . ALA A 1 74  ? 13.204  64.298 0.954   1.00 0.00  ? 74  ALA A HB3  2  
ATOM   4873  N  N    . ALA A 1 75  ? 16.658  64.640 -1.044  1.00 0.00  ? 75  ALA A N    2  
ATOM   4874  C  CA   . ALA A 1 75  ? 18.072  65.042 -1.282  1.00 0.00  ? 75  ALA A CA   2  
ATOM   4875  C  C    . ALA A 1 75  ? 18.235  65.540 -2.720  1.00 0.00  ? 75  ALA A C    2  
ATOM   4876  O  O    . ALA A 1 75  ? 19.143  66.288 -3.026  1.00 0.00  ? 75  ALA A O    2  
ATOM   4877  C  CB   . ALA A 1 75  ? 18.988  63.838 -1.054  1.00 0.00  ? 75  ALA A CB   2  
ATOM   4878  H  H    . ALA A 1 75  ? 16.431  63.694 -0.926  1.00 0.00  ? 75  ALA A H    2  
ATOM   4879  H  HA   . ALA A 1 75  ? 18.341  65.832 -0.596  1.00 0.00  ? 75  ALA A HA   2  
ATOM   4880  H  HB1  . ALA A 1 75  ? 20.013  64.128 -1.227  1.00 0.00  ? 75  ALA A HB1  2  
ATOM   4881  H  HB2  . ALA A 1 75  ? 18.717  63.045 -1.736  1.00 0.00  ? 75  ALA A HB2  2  
ATOM   4882  H  HB3  . ALA A 1 75  ? 18.878  63.490 -0.037  1.00 0.00  ? 75  ALA A HB3  2  
ATOM   4883  N  N    . SER A 1 76  ? 17.375  65.125 -3.610  1.00 0.00  ? 76  SER A N    2  
ATOM   4884  C  CA   . SER A 1 76  ? 17.503  65.570 -5.025  1.00 0.00  ? 76  SER A CA   2  
ATOM   4885  C  C    . SER A 1 76  ? 17.599  67.089 -5.090  1.00 0.00  ? 76  SER A C    2  
ATOM   4886  O  O    . SER A 1 76  ? 18.483  67.637 -5.719  1.00 0.00  ? 76  SER A O    2  
ATOM   4887  C  CB   . SER A 1 76  ? 16.293  65.099 -5.832  1.00 0.00  ? 76  SER A CB   2  
ATOM   4888  O  OG   . SER A 1 76  ? 16.507  65.382 -7.208  1.00 0.00  ? 76  SER A OG   2  
ATOM   4889  H  H    . SER A 1 76  ? 16.654  64.514 -3.349  1.00 0.00  ? 76  SER A H    2  
ATOM   4890  H  HA   . SER A 1 76  ? 18.391  65.152 -5.445  1.00 0.00  ? 76  SER A HA   2  
ATOM   4891  H  HB2  . SER A 1 76  ? 16.165  64.038 -5.704  1.00 0.00  ? 76  SER A HB2  2  
ATOM   4892  H  HB3  . SER A 1 76  ? 15.407  65.612 -5.484  1.00 0.00  ? 76  SER A HB3  2  
ATOM   4893  H  HG   . SER A 1 76  ? 16.036  66.192 -7.421  1.00 0.00  ? 76  SER A HG   2  
ATOM   4894  N  N    . HIS A 1 77  ? 16.696  67.775 -4.465  1.00 0.00  ? 77  HIS A N    2  
ATOM   4895  C  CA   . HIS A 1 77  ? 16.727  69.267 -4.506  1.00 0.00  ? 77  HIS A CA   2  
ATOM   4896  C  C    . HIS A 1 77  ? 18.075  69.785 -3.996  1.00 0.00  ? 77  HIS A C    2  
ATOM   4897  O  O    . HIS A 1 77  ? 18.800  70.448 -4.710  1.00 0.00  ? 77  HIS A O    2  
ATOM   4898  C  CB   . HIS A 1 77  ? 15.606  69.813 -3.619  1.00 0.00  ? 77  HIS A CB   2  
ATOM   4899  C  CG   . HIS A 1 77  ? 15.439  71.288 -3.859  1.00 0.00  ? 77  HIS A CG   2  
ATOM   4900  N  ND1  . HIS A 1 77  ? 14.404  72.015 -3.289  1.00 0.00  ? 77  HIS A ND1  2  
ATOM   4901  C  CD2  . HIS A 1 77  ? 16.164  72.187 -4.601  1.00 0.00  ? 77  HIS A CD2  2  
ATOM   4902  C  CE1  . HIS A 1 77  ? 14.534  73.292 -3.693  1.00 0.00  ? 77  HIS A CE1  2  
ATOM   4903  N  NE2  . HIS A 1 77  ? 15.590  73.450 -4.494  1.00 0.00  ? 77  HIS A NE2  2  
ATOM   4904  H  H    . HIS A 1 77  ? 15.974  67.328 -3.978  1.00 0.00  ? 77  HIS A H    2  
ATOM   4905  H  HA   . HIS A 1 77  ? 16.575  69.602 -5.521  1.00 0.00  ? 77  HIS A HA   2  
ATOM   4906  H  HB2  . HIS A 1 77  ? 14.683  69.304 -3.854  1.00 0.00  ? 77  HIS A HB2  2  
ATOM   4907  H  HB3  . HIS A 1 77  ? 15.854  69.644 -2.581  1.00 0.00  ? 77  HIS A HB3  2  
ATOM   4908  H  HD2  . HIS A 1 77  ? 17.045  71.951 -5.179  1.00 0.00  ? 77  HIS A HD2  2  
ATOM   4909  H  HE1  . HIS A 1 77  ? 13.866  74.090 -3.405  1.00 0.00  ? 77  HIS A HE1  2  
ATOM   4910  H  HE2  . HIS A 1 77  ? 15.889  74.284 -4.913  1.00 0.00  ? 77  HIS A HE2  2  
ATOM   4911  N  N    . GLY A 1 78  ? 18.415  69.490 -2.765  1.00 46.01 ? 78  GLY A N    2  
ATOM   4912  C  CA   . GLY A 1 78  ? 19.719  69.966 -2.198  1.00 42.98 ? 78  GLY A CA   2  
ATOM   4913  C  C    . GLY A 1 78  ? 19.496  70.542 -0.796  1.00 44.14 ? 78  GLY A C    2  
ATOM   4914  O  O    . GLY A 1 78  ? 20.410  71.035 -0.166  1.00 46.10 ? 78  GLY A O    2  
ATOM   4915  H  H    . GLY A 1 78  ? 17.811  68.955 -2.209  1.00 0.00  ? 78  GLY A H    2  
ATOM   4916  H  HA2  . GLY A 1 78  ? 20.406  69.135 -2.139  1.00 0.00  ? 78  GLY A HA2  2  
ATOM   4917  H  HA3  . GLY A 1 78  ? 20.143  70.735 -2.830  1.00 0.00  ? 78  GLY A HA3  2  
ATOM   4918  N  N    . HIS A 1 79  ? 18.291  70.479 -0.295  1.00 0.00  ? 79  HIS A N    2  
ATOM   4919  C  CA   . HIS A 1 79  ? 18.023  71.018 1.072   1.00 0.00  ? 79  HIS A CA   2  
ATOM   4920  C  C    . HIS A 1 79  ? 18.371  69.941 2.102   1.00 0.00  ? 79  HIS A C    2  
ATOM   4921  O  O    . HIS A 1 79  ? 17.547  69.129 2.465   1.00 0.00  ? 79  HIS A O    2  
ATOM   4922  C  CB   . HIS A 1 79  ? 16.544  71.388 1.196   1.00 0.00  ? 79  HIS A CB   2  
ATOM   4923  C  CG   . HIS A 1 79  ? 16.204  72.444 0.180   1.00 0.00  ? 79  HIS A CG   2  
ATOM   4924  N  ND1  . HIS A 1 79  ? 17.074  72.794 -0.842  1.00 0.00  ? 79  HIS A ND1  2  
ATOM   4925  C  CD2  . HIS A 1 79  ? 15.094  73.236 0.015   1.00 0.00  ? 79  HIS A CD2  2  
ATOM   4926  C  CE1  . HIS A 1 79  ? 16.480  73.757 -1.570  1.00 0.00  ? 79  HIS A CE1  2  
ATOM   4927  N  NE2  . HIS A 1 79  ? 15.272  74.062 -1.090  1.00 0.00  ? 79  HIS A NE2  2  
ATOM   4928  H  H    . HIS A 1 79  ? 17.565  70.075 -0.814  1.00 0.00  ? 79  HIS A H    2  
ATOM   4929  H  HA   . HIS A 1 79  ? 18.632  71.894 1.245   1.00 0.00  ? 79  HIS A HA   2  
ATOM   4930  H  HB2  . HIS A 1 79  ? 15.937  70.512 1.022   1.00 0.00  ? 79  HIS A HB2  2  
ATOM   4931  H  HB3  . HIS A 1 79  ? 16.351  71.769 2.188   1.00 0.00  ? 79  HIS A HB3  2  
ATOM   4932  H  HD2  . HIS A 1 79  ? 14.218  73.219 0.646   1.00 0.00  ? 79  HIS A HD2  2  
ATOM   4933  H  HE1  . HIS A 1 79  ? 16.924  74.225 -2.436  1.00 0.00  ? 79  HIS A HE1  2  
ATOM   4934  H  HE2  . HIS A 1 79  ? 14.649  74.729 -1.447  1.00 0.00  ? 79  HIS A HE2  2  
ATOM   4935  N  N    . ARG A 1 80  ? 19.591  69.916 2.562   1.00 0.00  ? 80  ARG A N    2  
ATOM   4936  C  CA   . ARG A 1 80  ? 19.989  68.873 3.551   1.00 0.00  ? 80  ARG A CA   2  
ATOM   4937  C  C    . ARG A 1 80  ? 19.069  68.928 4.781   1.00 0.00  ? 80  ARG A C    2  
ATOM   4938  O  O    . ARG A 1 80  ? 18.947  67.965 5.512   1.00 0.00  ? 80  ARG A O    2  
ATOM   4939  C  CB   . ARG A 1 80  ? 21.465  69.064 3.978   1.00 0.00  ? 80  ARG A CB   2  
ATOM   4940  C  CG   . ARG A 1 80  ? 21.871  70.548 3.946   1.00 0.00  ? 80  ARG A CG   2  
ATOM   4941  C  CD   . ARG A 1 80  ? 20.940  71.385 4.835   1.00 0.00  ? 80  ARG A CD   2  
ATOM   4942  N  NE   . ARG A 1 80  ? 21.630  72.656 5.244   1.00 0.00  ? 80  ARG A NE   2  
ATOM   4943  C  CZ   . ARG A 1 80  ? 22.739  72.647 5.935   1.00 0.00  ? 80  ARG A CZ   2  
ATOM   4944  N  NH1  . ARG A 1 80  ? 23.210  71.530 6.419   1.00 0.00  ? 80  ARG A NH1  2  
ATOM   4945  N  NH2  . ARG A 1 80  ? 23.358  73.770 6.179   1.00 0.00  ? 80  ARG A NH2  2  
ATOM   4946  H  H    . ARG A 1 80  ? 20.243  70.570 2.244   1.00 0.00  ? 80  ARG A H    2  
ATOM   4947  H  HA   . ARG A 1 80  ? 19.883  67.903 3.086   1.00 0.00  ? 80  ARG A HA   2  
ATOM   4948  H  HB2  . ARG A 1 80  ? 21.607  68.682 4.979   1.00 0.00  ? 80  ARG A HB2  2  
ATOM   4949  H  HB3  . ARG A 1 80  ? 22.104  68.514 3.301   1.00 0.00  ? 80  ARG A HB3  2  
ATOM   4950  H  HG2  . ARG A 1 80  ? 22.885  70.639 4.294   1.00 0.00  ? 80  ARG A HG2  2  
ATOM   4951  H  HG3  . ARG A 1 80  ? 21.820  70.913 2.933   1.00 0.00  ? 80  ARG A HG3  2  
ATOM   4952  H  HD2  . ARG A 1 80  ? 20.073  71.666 4.274   1.00 0.00  ? 80  ARG A HD2  2  
ATOM   4953  H  HD3  . ARG A 1 80  ? 20.628  70.794 5.697   1.00 0.00  ? 80  ARG A HD3  2  
ATOM   4954  H  HE   . ARG A 1 80  ? 21.259  73.514 4.951   1.00 0.00  ? 80  ARG A HE   2  
ATOM   4955  H  HH11 . ARG A 1 80  ? 22.721  70.672 6.261   1.00 0.00  ? 80  ARG A HH11 2  
ATOM   4956  H  HH12 . ARG A 1 80  ? 24.059  71.532 6.946   1.00 0.00  ? 80  ARG A HH12 2  
ATOM   4957  H  HH21 . ARG A 1 80  ? 22.984  74.632 5.838   1.00 0.00  ? 80  ARG A HH21 2  
ATOM   4958  H  HH22 . ARG A 1 80  ? 24.207  73.767 6.708   1.00 0.00  ? 80  ARG A HH22 2  
ATOM   4959  N  N    . ASP A 1 81  ? 18.437  70.043 5.031   1.00 0.00  ? 81  ASP A N    2  
ATOM   4960  C  CA   . ASP A 1 81  ? 17.550  70.146 6.227   1.00 0.00  ? 81  ASP A CA   2  
ATOM   4961  C  C    . ASP A 1 81  ? 16.389  69.153 6.123   1.00 0.00  ? 81  ASP A C    2  
ATOM   4962  O  O    . ASP A 1 81  ? 16.182  68.333 6.998   1.00 0.00  ? 81  ASP A O    2  
ATOM   4963  C  CB   . ASP A 1 81  ? 16.992  71.567 6.322   1.00 0.00  ? 81  ASP A CB   2  
ATOM   4964  C  CG   . ASP A 1 81  ? 18.148  72.569 6.330   1.00 0.00  ? 81  ASP A CG   2  
ATOM   4965  O  OD1  . ASP A 1 81  ? 19.028  72.422 7.161   1.00 0.00  ? 81  ASP A OD1  2  
ATOM   4966  O  OD2  . ASP A 1 81  ? 18.132  73.467 5.504   1.00 0.00  ? 81  ASP A OD2  2  
ATOM   4967  H  H    . ASP A 1 81  ? 18.555  70.821 4.451   1.00 0.00  ? 81  ASP A H    2  
ATOM   4968  H  HA   . ASP A 1 81  ? 18.124  69.930 7.116   1.00 0.00  ? 81  ASP A HA   2  
ATOM   4969  H  HB2  . ASP A 1 81  ? 16.352  71.760 5.473   1.00 0.00  ? 81  ASP A HB2  2  
ATOM   4970  H  HB3  . ASP A 1 81  ? 16.423  71.670 7.233   1.00 0.00  ? 81  ASP A HB3  2  
ATOM   4971  N  N    . ILE A 1 82  ? 15.621  69.221 5.069   1.00 0.00  ? 82  ILE A N    2  
ATOM   4972  C  CA   . ILE A 1 82  ? 14.472  68.282 4.933   1.00 0.00  ? 82  ILE A CA   2  
ATOM   4973  C  C    . ILE A 1 82  ? 14.986  66.837 5.036   1.00 0.00  ? 82  ILE A C    2  
ATOM   4974  O  O    . ILE A 1 82  ? 14.320  65.956 5.549   1.00 0.00  ? 82  ILE A O    2  
ATOM   4975  C  CB   . ILE A 1 82  ? 13.768  68.527 3.581   1.00 0.00  ? 82  ILE A CB   2  
ATOM   4976  C  CG1  . ILE A 1 82  ? 12.321  68.024 3.651   1.00 0.00  ? 82  ILE A CG1  2  
ATOM   4977  C  CG2  . ILE A 1 82  ? 14.505  67.804 2.447   1.00 0.00  ? 82  ILE A CG2  2  
ATOM   4978  C  CD1  . ILE A 1 82  ? 11.603  68.349 2.340   1.00 0.00  ? 82  ILE A CD1  2  
ATOM   4979  H  H    . ILE A 1 82  ? 15.795  69.888 4.373   1.00 0.00  ? 82  ILE A H    2  
ATOM   4980  H  HA   . ILE A 1 82  ? 13.777  68.469 5.736   1.00 0.00  ? 82  ILE A HA   2  
ATOM   4981  H  HB   . ILE A 1 82  ? 13.765  69.588 3.376   1.00 0.00  ? 82  ILE A HB   2  
ATOM   4982  H  HG12 . ILE A 1 82  ? 12.318  66.957 3.808   1.00 0.00  ? 82  ILE A HG12 2  
ATOM   4983  H  HG13 . ILE A 1 82  ? 11.809  68.510 4.468   1.00 0.00  ? 82  ILE A HG13 2  
ATOM   4984  H  HG21 . ILE A 1 82  ? 15.569  67.896 2.594   1.00 0.00  ? 82  ILE A HG21 2  
ATOM   4985  H  HG22 . ILE A 1 82  ? 14.233  68.246 1.500   1.00 0.00  ? 82  ILE A HG22 2  
ATOM   4986  H  HG23 . ILE A 1 82  ? 14.232  66.759 2.447   1.00 0.00  ? 82  ILE A HG23 2  
ATOM   4987  H  HD11 . ILE A 1 82  ? 11.975  67.704 1.557   1.00 0.00  ? 82  ILE A HD11 2  
ATOM   4988  H  HD12 . ILE A 1 82  ? 11.786  69.380 2.075   1.00 0.00  ? 82  ILE A HD12 2  
ATOM   4989  H  HD13 . ILE A 1 82  ? 10.541  68.191 2.462   1.00 0.00  ? 82  ILE A HD13 2  
ATOM   4990  N  N    . VAL A 1 83  ? 16.174  66.596 4.556   1.00 45.62 ? 83  VAL A N    2  
ATOM   4991  C  CA   . VAL A 1 83  ? 16.747  65.223 4.622   1.00 41.66 ? 83  VAL A CA   2  
ATOM   4992  C  C    . VAL A 1 83  ? 16.979  64.831 6.084   1.00 43.89 ? 83  VAL A C    2  
ATOM   4993  O  O    . VAL A 1 83  ? 16.537  63.802 6.543   1.00 46.97 ? 83  VAL A O    2  
ATOM   4994  C  CB   . VAL A 1 83  ? 18.084  65.201 3.875   1.00 38.08 ? 83  VAL A CB   2  
ATOM   4995  C  CG1  . VAL A 1 83  ? 18.656  63.781 3.881   1.00 28.61 ? 83  VAL A CG1  2  
ATOM   4996  C  CG2  . VAL A 1 83  ? 17.868  65.660 2.430   1.00 33.67 ? 83  VAL A CG2  2  
ATOM   4997  H  H    . VAL A 1 83  ? 16.694  67.322 4.152   1.00 0.00  ? 83  VAL A H    2  
ATOM   4998  H  HA   . VAL A 1 83  ? 16.068  64.523 4.161   1.00 0.00  ? 83  VAL A HA   2  
ATOM   4999  H  HB   . VAL A 1 83  ? 18.778  65.868 4.365   1.00 0.00  ? 83  VAL A HB   2  
ATOM   5000  H  HG11 . VAL A 1 83  ? 19.430  63.700 3.131   1.00 0.00  ? 83  VAL A HG11 2  
ATOM   5001  H  HG12 . VAL A 1 83  ? 17.870  63.073 3.663   1.00 0.00  ? 83  VAL A HG12 2  
ATOM   5002  H  HG13 . VAL A 1 83  ? 19.074  63.567 4.853   1.00 0.00  ? 83  VAL A HG13 2  
ATOM   5003  H  HG21 . VAL A 1 83  ? 18.784  65.534 1.872   1.00 0.00  ? 83  VAL A HG21 2  
ATOM   5004  H  HG22 . VAL A 1 83  ? 17.583  66.702 2.423   1.00 0.00  ? 83  VAL A HG22 2  
ATOM   5005  H  HG23 . VAL A 1 83  ? 17.086  65.069 1.978   1.00 0.00  ? 83  VAL A HG23 2  
ATOM   5006  N  N    . GLN A 1 84  ? 17.693  65.638 6.809   1.00 0.00  ? 84  GLN A N    2  
ATOM   5007  C  CA   . GLN A 1 84  ? 17.987  65.314 8.234   1.00 0.00  ? 84  GLN A CA   2  
ATOM   5008  C  C    . GLN A 1 84  ? 16.716  64.919 9.000   1.00 0.00  ? 84  GLN A C    2  
ATOM   5009  O  O    . GLN A 1 84  ? 16.717  63.969 9.761   1.00 0.00  ? 84  GLN A O    2  
ATOM   5010  C  CB   . GLN A 1 84  ? 18.607  66.538 8.910   1.00 0.00  ? 84  GLN A CB   2  
ATOM   5011  C  CG   . GLN A 1 84  ? 20.005  66.783 8.344   1.00 0.00  ? 84  GLN A CG   2  
ATOM   5012  C  CD   . GLN A 1 84  ? 20.971  65.733 8.895   1.00 0.00  ? 84  GLN A CD   2  
ATOM   5013  O  OE1  . GLN A 1 84  ? 21.597  65.013 8.143   1.00 0.00  ? 84  GLN A OE1  2  
ATOM   5014  N  NE2  . GLN A 1 84  ? 21.120  65.614 10.186  1.00 0.00  ? 84  GLN A NE2  2  
ATOM   5015  H  H    . GLN A 1 84  ? 18.059  66.455 6.408   1.00 0.00  ? 84  GLN A H    2  
ATOM   5016  H  HA   . GLN A 1 84  ? 18.692  64.498 8.274   1.00 0.00  ? 84  GLN A HA   2  
ATOM   5017  H  HB2  . GLN A 1 84  ? 17.986  67.403 8.724   1.00 0.00  ? 84  GLN A HB2  2  
ATOM   5018  H  HB3  . GLN A 1 84  ? 18.676  66.366 9.973   1.00 0.00  ? 84  GLN A HB3  2  
ATOM   5019  H  HG2  . GLN A 1 84  ? 19.975  66.717 7.266   1.00 0.00  ? 84  GLN A HG2  2  
ATOM   5020  H  HG3  . GLN A 1 84  ? 20.341  67.766 8.636   1.00 0.00  ? 84  GLN A HG3  2  
ATOM   5021  H  HE21 . GLN A 1 84  ? 20.616  66.195 10.793  1.00 0.00  ? 84  GLN A HE21 2  
ATOM   5022  H  HE22 . GLN A 1 84  ? 21.737  64.944 10.548  1.00 0.00  ? 84  GLN A HE22 2  
ATOM   5023  N  N    . LYS A 1 85  ? 15.640  65.643 8.841   1.00 0.00  ? 85  LYS A N    2  
ATOM   5024  C  CA   . LYS A 1 85  ? 14.413  65.293 9.617   1.00 0.00  ? 85  LYS A CA   2  
ATOM   5025  C  C    . LYS A 1 85  ? 13.818  63.957 9.157   1.00 0.00  ? 85  LYS A C    2  
ATOM   5026  O  O    . LYS A 1 85  ? 13.333  63.194 9.966   1.00 0.00  ? 85  LYS A O    2  
ATOM   5027  C  CB   . LYS A 1 85  ? 13.364  66.398 9.487   1.00 0.00  ? 85  LYS A CB   2  
ATOM   5028  C  CG   . LYS A 1 85  ? 13.093  66.684 8.012   1.00 0.00  ? 85  LYS A CG   2  
ATOM   5029  C  CD   . LYS A 1 85  ? 11.969  67.723 7.875   1.00 0.00  ? 85  LYS A CD   2  
ATOM   5030  C  CE   . LYS A 1 85  ? 10.667  67.196 8.503   1.00 0.00  ? 85  LYS A CE   2  
ATOM   5031  N  NZ   . LYS A 1 85  ? 10.602  67.618 9.931   1.00 0.00  ? 85  LYS A NZ   2  
ATOM   5032  H  H    . LYS A 1 85  ? 15.645  66.417 8.237   1.00 0.00  ? 85  LYS A H    2  
ATOM   5033  H  HA   . LYS A 1 85  ? 14.687  65.203 10.658  1.00 0.00  ? 85  LYS A HA   2  
ATOM   5034  H  HB2  . LYS A 1 85  ? 12.453  66.078 9.970   1.00 0.00  ? 85  LYS A HB2  2  
ATOM   5035  H  HB3  . LYS A 1 85  ? 13.727  67.296 9.965   1.00 0.00  ? 85  LYS A HB3  2  
ATOM   5036  H  HG2  . LYS A 1 85  ? 13.994  67.068 7.561   1.00 0.00  ? 85  LYS A HG2  2  
ATOM   5037  H  HG3  . LYS A 1 85  ? 12.801  65.773 7.514   1.00 0.00  ? 85  LYS A HG3  2  
ATOM   5038  H  HD2  . LYS A 1 85  ? 12.263  68.634 8.375   1.00 0.00  ? 85  LYS A HD2  2  
ATOM   5039  H  HD3  . LYS A 1 85  ? 11.801  67.929 6.828   1.00 0.00  ? 85  LYS A HD3  2  
ATOM   5040  H  HE2  . LYS A 1 85  ? 9.819   67.604 7.971   1.00 0.00  ? 85  LYS A HE2  2  
ATOM   5041  H  HE3  . LYS A 1 85  ? 10.638  66.116 8.446   1.00 0.00  ? 85  LYS A HE3  2  
ATOM   5042  H  HZ1  . LYS A 1 85  ? 9.928   68.403 10.030  1.00 0.00  ? 85  LYS A HZ1  2  
ATOM   5043  H  HZ2  . LYS A 1 85  ? 11.545  67.927 10.243  1.00 0.00  ? 85  LYS A HZ2  2  
ATOM   5044  H  HZ3  . LYS A 1 85  ? 10.287  66.818 10.515  1.00 0.00  ? 85  LYS A HZ3  2  
ATOM   5045  N  N    . LEU A 1 86  ? 13.845  63.644 7.884   1.00 51.35 ? 86  LEU A N    2  
ATOM   5046  C  CA   . LEU A 1 86  ? 13.269  62.332 7.434   1.00 49.20 ? 86  LEU A CA   2  
ATOM   5047  C  C    . LEU A 1 86  ? 14.375  61.272 7.425   1.00 50.55 ? 86  LEU A C    2  
ATOM   5048  O  O    . LEU A 1 86  ? 14.117  60.086 7.458   1.00 53.46 ? 86  LEU A O    2  
ATOM   5049  C  CB   . LEU A 1 86  ? 12.656  62.475 6.029   1.00 45.52 ? 86  LEU A CB   2  
ATOM   5050  C  CG   . LEU A 1 86  ? 13.693  63.043 5.023   1.00 42.66 ? 86  LEU A CG   2  
ATOM   5051  C  CD1  . LEU A 1 86  ? 14.370  61.909 4.246   1.00 46.99 ? 86  LEU A CD1  2  
ATOM   5052  C  CD2  . LEU A 1 86  ? 12.996  63.963 4.012   1.00 42.69 ? 86  LEU A CD2  2  
ATOM   5053  H  H    . LEU A 1 86  ? 14.249  64.254 7.225   1.00 0.00  ? 86  LEU A H    2  
ATOM   5054  H  HA   . LEU A 1 86  ? 12.494  62.022 8.124   1.00 0.00  ? 86  LEU A HA   2  
ATOM   5055  H  HB2  . LEU A 1 86  ? 12.311  61.506 5.695   1.00 0.00  ? 86  LEU A HB2  2  
ATOM   5056  H  HB3  . LEU A 1 86  ? 11.808  63.143 6.092   1.00 0.00  ? 86  LEU A HB3  2  
ATOM   5057  H  HG   . LEU A 1 86  ? 14.442  63.607 5.554   1.00 0.00  ? 86  LEU A HG   2  
ATOM   5058  H  HD11 . LEU A 1 86  ? 15.017  62.330 3.489   1.00 0.00  ? 86  LEU A HD11 2  
ATOM   5059  H  HD12 . LEU A 1 86  ? 13.615  61.300 3.772   1.00 0.00  ? 86  LEU A HD12 2  
ATOM   5060  H  HD13 . LEU A 1 86  ? 14.954  61.301 4.918   1.00 0.00  ? 86  LEU A HD13 2  
ATOM   5061  H  HD21 . LEU A 1 86  ? 12.480  64.751 4.538   1.00 0.00  ? 86  LEU A HD21 2  
ATOM   5062  H  HD22 . LEU A 1 86  ? 12.287  63.389 3.434   1.00 0.00  ? 86  LEU A HD22 2  
ATOM   5063  H  HD23 . LEU A 1 86  ? 13.734  64.392 3.351   1.00 0.00  ? 86  LEU A HD23 2  
ATOM   5064  N  N    . LEU A 1 87  ? 15.607  61.700 7.383   1.00 0.00  ? 87  LEU A N    2  
ATOM   5065  C  CA   . LEU A 1 87  ? 16.746  60.746 7.376   1.00 0.00  ? 87  LEU A CA   2  
ATOM   5066  C  C    . LEU A 1 87  ? 16.964  60.211 8.794   1.00 0.00  ? 87  LEU A C    2  
ATOM   5067  O  O    . LEU A 1 87  ? 17.582  59.186 9.003   1.00 0.00  ? 87  LEU A O    2  
ATOM   5068  C  CB   . LEU A 1 87  ? 17.999  61.502 6.908   1.00 0.00  ? 87  LEU A CB   2  
ATOM   5069  C  CG   . LEU A 1 87  ? 19.223  60.547 6.821   1.00 0.00  ? 87  LEU A CG   2  
ATOM   5070  C  CD1  . LEU A 1 87  ? 19.687  60.415 5.369   1.00 0.00  ? 87  LEU A CD1  2  
ATOM   5071  C  CD2  . LEU A 1 87  ? 20.389  61.094 7.660   1.00 0.00  ? 87  LEU A CD2  2  
ATOM   5072  H  H    . LEU A 1 87  ? 15.787  62.659 7.360   1.00 0.00  ? 87  LEU A H    2  
ATOM   5073  H  HA   . LEU A 1 87  ? 16.539  59.929 6.702   1.00 0.00  ? 87  LEU A HA   2  
ATOM   5074  H  HB2  . LEU A 1 87  ? 17.797  61.935 5.937   1.00 0.00  ? 87  LEU A HB2  2  
ATOM   5075  H  HB3  . LEU A 1 87  ? 18.203  62.300 7.609   1.00 0.00  ? 87  LEU A HB3  2  
ATOM   5076  H  HG   . LEU A 1 87  ? 18.952  59.571 7.187   1.00 0.00  ? 87  LEU A HG   2  
ATOM   5077  H  HD11 . LEU A 1 87  ? 20.459  59.663 5.304   1.00 0.00  ? 87  LEU A HD11 2  
ATOM   5078  H  HD12 . LEU A 1 87  ? 20.076  61.363 5.030   1.00 0.00  ? 87  LEU A HD12 2  
ATOM   5079  H  HD13 . LEU A 1 87  ? 18.849  60.127 4.752   1.00 0.00  ? 87  LEU A HD13 2  
ATOM   5080  H  HD21 . LEU A 1 87  ? 20.154  60.996 8.709   1.00 0.00  ? 87  LEU A HD21 2  
ATOM   5081  H  HD22 . LEU A 1 87  ? 20.545  62.135 7.421   1.00 0.00  ? 87  LEU A HD22 2  
ATOM   5082  H  HD23 . LEU A 1 87  ? 21.285  60.534 7.437   1.00 0.00  ? 87  LEU A HD23 2  
ATOM   5083  N  N    . GLN A 1 88  ? 16.440  60.895 9.772   1.00 0.00  ? 88  GLN A N    2  
ATOM   5084  C  CA   . GLN A 1 88  ? 16.595  60.434 11.188  1.00 0.00  ? 88  GLN A CA   2  
ATOM   5085  C  C    . GLN A 1 88  ? 15.355  59.655 11.609  1.00 0.00  ? 88  GLN A C    2  
ATOM   5086  O  O    . GLN A 1 88  ? 15.382  58.861 12.529  1.00 0.00  ? 88  GLN A O    2  
ATOM   5087  C  CB   . GLN A 1 88  ? 16.751  61.653 12.099  1.00 0.00  ? 88  GLN A CB   2  
ATOM   5088  C  CG   . GLN A 1 88  ? 17.970  62.491 11.661  1.00 0.00  ? 88  GLN A CG   2  
ATOM   5089  C  CD   . GLN A 1 88  ? 19.210  62.098 12.474  1.00 0.00  ? 88  GLN A CD   2  
ATOM   5090  O  OE1  . GLN A 1 88  ? 19.165  62.054 13.688  1.00 0.00  ? 88  GLN A OE1  2  
ATOM   5091  N  NE2  . GLN A 1 88  ? 20.320  61.808 11.852  1.00 0.00  ? 88  GLN A NE2  2  
ATOM   5092  H  H    . GLN A 1 88  ? 15.926  61.707 9.570   1.00 0.00  ? 88  GLN A H    2  
ATOM   5093  H  HA   . GLN A 1 88  ? 17.462  59.804 11.278  1.00 0.00  ? 88  GLN A HA   2  
ATOM   5094  H  HB2  . GLN A 1 88  ? 15.854  62.256 12.032  1.00 0.00  ? 88  GLN A HB2  2  
ATOM   5095  H  HB3  . GLN A 1 88  ? 16.880  61.322 13.120  1.00 0.00  ? 88  GLN A HB3  2  
ATOM   5096  H  HG2  . GLN A 1 88  ? 18.172  62.334 10.609  1.00 0.00  ? 88  GLN A HG2  2  
ATOM   5097  H  HG3  . GLN A 1 88  ? 17.756  63.533 11.823  1.00 0.00  ? 88  GLN A HG3  2  
ATOM   5098  H  HE21 . GLN A 1 88  ? 20.356  61.843 10.873  1.00 0.00  ? 88  GLN A HE21 2  
ATOM   5099  H  HE22 . GLN A 1 88  ? 21.117  61.556 12.363  1.00 0.00  ? 88  GLN A HE22 2  
ATOM   5100  N  N    . TYR A 1 89  ? 14.268  59.887 10.944  1.00 0.00  ? 89  TYR A N    2  
ATOM   5101  C  CA   . TYR A 1 89  ? 13.006  59.177 11.295  1.00 0.00  ? 89  TYR A CA   2  
ATOM   5102  C  C    . TYR A 1 89  ? 13.066  57.737 10.773  1.00 0.00  ? 89  TYR A C    2  
ATOM   5103  O  O    . TYR A 1 89  ? 12.518  56.832 11.370  1.00 0.00  ? 89  TYR A O    2  
ATOM   5104  C  CB   . TYR A 1 89  ? 11.811  59.911 10.655  1.00 0.00  ? 89  TYR A CB   2  
ATOM   5105  C  CG   . TYR A 1 89  ? 11.326  61.030 11.559  1.00 0.00  ? 89  TYR A CG   2  
ATOM   5106  C  CD1  . TYR A 1 89  ? 12.239  61.947 12.097  1.00 0.00  ? 89  TYR A CD1  2  
ATOM   5107  C  CD2  . TYR A 1 89  ? 9.960   61.154 11.850  1.00 0.00  ? 89  TYR A CD2  2  
ATOM   5108  C  CE1  . TYR A 1 89  ? 11.786  62.983 12.924  1.00 0.00  ? 89  TYR A CE1  2  
ATOM   5109  C  CE2  . TYR A 1 89  ? 9.510   62.190 12.677  1.00 0.00  ? 89  TYR A CE2  2  
ATOM   5110  C  CZ   . TYR A 1 89  ? 10.422  63.105 13.213  1.00 0.00  ? 89  TYR A CZ   2  
ATOM   5111  O  OH   . TYR A 1 89  ? 9.978   64.126 14.028  1.00 0.00  ? 89  TYR A OH   2  
ATOM   5112  H  H    . TYR A 1 89  ? 14.282  60.538 10.214  1.00 0.00  ? 89  TYR A H    2  
ATOM   5113  H  HA   . TYR A 1 89  ? 12.891  59.161 12.369  1.00 0.00  ? 89  TYR A HA   2  
ATOM   5114  H  HB2  . TYR A 1 89  ? 12.118  60.328 9.708   1.00 0.00  ? 89  TYR A HB2  2  
ATOM   5115  H  HB3  . TYR A 1 89  ? 11.001  59.212 10.489  1.00 0.00  ? 89  TYR A HB3  2  
ATOM   5116  H  HD1  . TYR A 1 89  ? 13.291  61.855 11.879  1.00 0.00  ? 89  TYR A HD1  2  
ATOM   5117  H  HD2  . TYR A 1 89  ? 9.254   60.449 11.437  1.00 0.00  ? 89  TYR A HD2  2  
ATOM   5118  H  HE1  . TYR A 1 89  ? 12.490  63.691 13.336  1.00 0.00  ? 89  TYR A HE1  2  
ATOM   5119  H  HE2  . TYR A 1 89  ? 8.457   62.283 12.900  1.00 0.00  ? 89  TYR A HE2  2  
ATOM   5120  H  HH   . TYR A 1 89  ? 10.196  64.960 13.604  1.00 0.00  ? 89  TYR A HH   2  
ATOM   5121  N  N    . LYS A 1 90  ? 13.715  57.519 9.656   1.00 0.00  ? 90  LYS A N    2  
ATOM   5122  C  CA   . LYS A 1 90  ? 13.789  56.129 9.088   1.00 0.00  ? 90  LYS A CA   2  
ATOM   5123  C  C    . LYS A 1 90  ? 15.173  55.874 8.483   1.00 0.00  ? 90  LYS A C    2  
ATOM   5124  O  O    . LYS A 1 90  ? 15.570  54.743 8.285   1.00 0.00  ? 90  LYS A O    2  
ATOM   5125  C  CB   . LYS A 1 90  ? 12.717  55.944 7.989   1.00 0.00  ? 90  LYS A CB   2  
ATOM   5126  C  CG   . LYS A 1 90  ? 11.421  56.702 8.339   1.00 0.00  ? 90  LYS A CG   2  
ATOM   5127  C  CD   . LYS A 1 90  ? 10.695  56.043 9.545   1.00 0.00  ? 90  LYS A CD   2  
ATOM   5128  C  CE   . LYS A 1 90  ? 9.402   55.351 9.086   1.00 0.00  ? 90  LYS A CE   2  
ATOM   5129  N  NZ   . LYS A 1 90  ? 8.878   54.494 10.187  1.00 0.00  ? 90  LYS A NZ   2  
ATOM   5130  H  H    . LYS A 1 90  ? 14.142  58.269 9.188   1.00 0.00  ? 90  LYS A H    2  
ATOM   5131  H  HA   . LYS A 1 90  ? 13.623  55.406 9.872   1.00 0.00  ? 90  LYS A HA   2  
ATOM   5132  H  HB2  . LYS A 1 90  ? 13.097  56.318 7.048   1.00 0.00  ? 90  LYS A HB2  2  
ATOM   5133  H  HB3  . LYS A 1 90  ? 12.494  54.892 7.886   1.00 0.00  ? 90  LYS A HB3  2  
ATOM   5134  H  HG2  . LYS A 1 90  ? 11.659  57.730 8.573   1.00 0.00  ? 90  LYS A HG2  2  
ATOM   5135  H  HG3  . LYS A 1 90  ? 10.771  56.690 7.475   1.00 0.00  ? 90  LYS A HG3  2  
ATOM   5136  H  HD2  . LYS A 1 90  ? 11.336  55.309 10.012  1.00 0.00  ? 90  LYS A HD2  2  
ATOM   5137  H  HD3  . LYS A 1 90  ? 10.447  56.803 10.271  1.00 0.00  ? 90  LYS A HD3  2  
ATOM   5138  H  HE2  . LYS A 1 90  ? 8.666   56.098 8.830   1.00 0.00  ? 90  LYS A HE2  2  
ATOM   5139  H  HE3  . LYS A 1 90  ? 9.609   54.738 8.220   1.00 0.00  ? 90  LYS A HE3  2  
ATOM   5140  H  HZ1  . LYS A 1 90  ? 8.039   54.942 10.606  1.00 0.00  ? 90  LYS A HZ1  2  
ATOM   5141  H  HZ2  . LYS A 1 90  ? 9.612   54.380 10.916  1.00 0.00  ? 90  LYS A HZ2  2  
ATOM   5142  H  HZ3  . LYS A 1 90  ? 8.617   53.562 9.808   1.00 0.00  ? 90  LYS A HZ3  2  
ATOM   5143  N  N    . ALA A 1 91  ? 15.910  56.904 8.183   1.00 0.00  ? 91  ALA A N    2  
ATOM   5144  C  CA   . ALA A 1 91  ? 17.262  56.703 7.586   1.00 0.00  ? 91  ALA A CA   2  
ATOM   5145  C  C    . ALA A 1 91  ? 17.184  55.681 6.446   1.00 0.00  ? 91  ALA A C    2  
ATOM   5146  O  O    . ALA A 1 91  ? 17.905  54.704 6.426   1.00 0.00  ? 91  ALA A O    2  
ATOM   5147  C  CB   . ALA A 1 91  ? 18.230  56.200 8.661   1.00 0.00  ? 91  ALA A CB   2  
ATOM   5148  H  H    . ALA A 1 91  ? 15.579  57.811 8.349   1.00 0.00  ? 91  ALA A H    2  
ATOM   5149  H  HA   . ALA A 1 91  ? 17.623  57.643 7.196   1.00 0.00  ? 91  ALA A HA   2  
ATOM   5150  H  HB1  . ALA A 1 91  ? 18.053  55.150 8.845   1.00 0.00  ? 91  ALA A HB1  2  
ATOM   5151  H  HB2  . ALA A 1 91  ? 18.074  56.756 9.574   1.00 0.00  ? 91  ALA A HB2  2  
ATOM   5152  H  HB3  . ALA A 1 91  ? 19.247  56.341 8.323   1.00 0.00  ? 91  ALA A HB3  2  
ATOM   5153  N  N    . ASP A 1 92  ? 16.327  55.910 5.486   1.00 0.00  ? 92  ASP A N    2  
ATOM   5154  C  CA   . ASP A 1 92  ? 16.215  54.965 4.336   1.00 0.00  ? 92  ASP A CA   2  
ATOM   5155  C  C    . ASP A 1 92  ? 17.413  55.183 3.409   1.00 0.00  ? 92  ASP A C    2  
ATOM   5156  O  O    . ASP A 1 92  ? 17.359  54.928 2.223   1.00 0.00  ? 92  ASP A O    2  
ATOM   5157  C  CB   . ASP A 1 92  ? 14.913  55.228 3.573   1.00 0.00  ? 92  ASP A CB   2  
ATOM   5158  C  CG   . ASP A 1 92  ? 14.603  54.038 2.662   1.00 0.00  ? 92  ASP A CG   2  
ATOM   5159  O  OD1  . ASP A 1 92  ? 13.936  53.125 3.119   1.00 0.00  ? 92  ASP A OD1  2  
ATOM   5160  O  OD2  . ASP A 1 92  ? 15.037  54.061 1.522   1.00 0.00  ? 92  ASP A OD2  2  
ATOM   5161  H  H    . ASP A 1 92  ? 15.766  56.709 5.515   1.00 0.00  ? 92  ASP A H    2  
ATOM   5162  H  HA   . ASP A 1 92  ? 16.223  53.948 4.703   1.00 0.00  ? 92  ASP A HA   2  
ATOM   5163  H  HB2  . ASP A 1 92  ? 14.105  55.363 4.277   1.00 0.00  ? 92  ASP A HB2  2  
ATOM   5164  H  HB3  . ASP A 1 92  ? 15.018  56.118 2.972   1.00 0.00  ? 92  ASP A HB3  2  
ATOM   5165  N  N    . ILE A 1 93  ? 18.509  55.604 3.971   1.00 0.00  ? 93  ILE A N    2  
ATOM   5166  C  CA   . ILE A 1 93  ? 19.752  55.798 3.177   1.00 0.00  ? 93  ILE A CA   2  
ATOM   5167  C  C    . ILE A 1 93  ? 20.345  54.427 2.896   1.00 0.00  ? 93  ILE A C    2  
ATOM   5168  O  O    . ILE A 1 93  ? 20.883  54.171 1.838   1.00 0.00  ? 93  ILE A O    2  
ATOM   5169  C  CB   . ILE A 1 93  ? 20.737  56.639 3.993   1.00 0.00  ? 93  ILE A CB   2  
ATOM   5170  C  CG1  . ILE A 1 93  ? 22.037  56.842 3.206   1.00 0.00  ? 93  ILE A CG1  2  
ATOM   5171  C  CG2  . ILE A 1 93  ? 21.047  55.924 5.310   1.00 0.00  ? 93  ILE A CG2  2  
ATOM   5172  C  CD1  . ILE A 1 93  ? 23.041  57.598 4.077   1.00 0.00  ? 93  ILE A CD1  2  
ATOM   5173  H  H    . ILE A 1 93  ? 18.528  55.716 4.941   1.00 0.00  ? 93  ILE A H    2  
ATOM   5174  H  HA   . ILE A 1 93  ? 19.529  56.291 2.239   1.00 0.00  ? 93  ILE A HA   2  
ATOM   5175  H  HB   . ILE A 1 93  ? 20.292  57.600 4.206   1.00 0.00  ? 93  ILE A HB   2  
ATOM   5176  H  HG12 . ILE A 1 93  ? 22.454  55.884 2.933   1.00 0.00  ? 93  ILE A HG12 2  
ATOM   5177  H  HG13 . ILE A 1 93  ? 21.835  57.415 2.315   1.00 0.00  ? 93  ILE A HG13 2  
ATOM   5178  H  HG21 . ILE A 1 93  ? 21.563  56.601 5.975   1.00 0.00  ? 93  ILE A HG21 2  
ATOM   5179  H  HG22 . ILE A 1 93  ? 21.673  55.065 5.115   1.00 0.00  ? 93  ILE A HG22 2  
ATOM   5180  H  HG23 . ILE A 1 93  ? 20.125  55.601 5.770   1.00 0.00  ? 93  ILE A HG23 2  
ATOM   5181  H  HD11 . ILE A 1 93  ? 23.453  56.925 4.814   1.00 0.00  ? 93  ILE A HD11 2  
ATOM   5182  H  HD12 . ILE A 1 93  ? 22.543  58.417 4.575   1.00 0.00  ? 93  ILE A HD12 2  
ATOM   5183  H  HD13 . ILE A 1 93  ? 23.835  57.983 3.457   1.00 0.00  ? 93  ILE A HD13 2  
ATOM   5184  N  N    . ASN A 1 94  ? 20.263  53.545 3.852   1.00 0.00  ? 94  ASN A N    2  
ATOM   5185  C  CA   . ASN A 1 94  ? 20.839  52.192 3.649   1.00 0.00  ? 94  ASN A CA   2  
ATOM   5186  C  C    . ASN A 1 94  ? 19.933  51.379 2.732   1.00 0.00  ? 94  ASN A C    2  
ATOM   5187  O  O    . ASN A 1 94  ? 20.296  50.304 2.295   1.00 0.00  ? 94  ASN A O    2  
ATOM   5188  C  CB   . ASN A 1 94  ? 20.970  51.483 4.999   1.00 0.00  ? 94  ASN A CB   2  
ATOM   5189  C  CG   . ASN A 1 94  ? 19.596  51.394 5.665   1.00 0.00  ? 94  ASN A CG   2  
ATOM   5190  O  OD1  . ASN A 1 94  ? 19.438  50.733 6.672   1.00 0.00  ? 94  ASN A OD1  2  
ATOM   5191  N  ND2  . ASN A 1 94  ? 18.588  52.036 5.141   1.00 0.00  ? 94  ASN A ND2  2  
ATOM   5192  H  H    . ASN A 1 94  ? 19.833  53.781 4.703   1.00 0.00  ? 94  ASN A H    2  
ATOM   5193  H  HA   . ASN A 1 94  ? 21.810  52.285 3.197   1.00 0.00  ? 94  ASN A HA   2  
ATOM   5194  H  HB2  . ASN A 1 94  ? 21.362  50.488 4.845   1.00 0.00  ? 94  ASN A HB2  2  
ATOM   5195  H  HB3  . ASN A 1 94  ? 21.641  52.041 5.635   1.00 0.00  ? 94  ASN A HB3  2  
ATOM   5196  H  HD21 . ASN A 1 94  ? 18.716  52.569 4.328   1.00 0.00  ? 94  ASN A HD21 2  
ATOM   5197  H  HD22 . ASN A 1 94  ? 17.703  51.985 5.559   1.00 0.00  ? 94  ASN A HD22 2  
ATOM   5198  N  N    . ALA A 1 95  ? 18.759  51.876 2.427   1.00 47.14 ? 95  ALA A N    2  
ATOM   5199  C  CA   . ALA A 1 95  ? 17.822  51.134 1.527   1.00 47.00 ? 95  ALA A CA   2  
ATOM   5200  C  C    . ALA A 1 95  ? 17.666  51.921 0.225   1.00 47.76 ? 95  ALA A C    2  
ATOM   5201  O  O    . ALA A 1 95  ? 16.906  52.864 0.138   1.00 52.93 ? 95  ALA A O    2  
ATOM   5202  C  CB   . ALA A 1 95  ? 16.459  51.004 2.208   1.00 42.03 ? 95  ALA A CB   2  
ATOM   5203  H  H    . ALA A 1 95  ? 18.466  52.736 2.791   1.00 0.00  ? 95  ALA A H    2  
ATOM   5204  H  HA   . ALA A 1 95  ? 18.209  50.148 1.306   1.00 0.00  ? 95  ALA A HA   2  
ATOM   5205  H  HB1  . ALA A 1 95  ? 16.179  51.955 2.638   1.00 0.00  ? 95  ALA A HB1  2  
ATOM   5206  H  HB2  . ALA A 1 95  ? 16.515  50.259 2.988   1.00 0.00  ? 95  ALA A HB2  2  
ATOM   5207  H  HB3  . ALA A 1 95  ? 15.719  50.707 1.480   1.00 0.00  ? 95  ALA A HB3  2  
ATOM   5208  N  N    . VAL A 1 96  ? 18.390  51.533 -0.780  1.00 0.00  ? 96  VAL A N    2  
ATOM   5209  C  CA   . VAL A 1 96  ? 18.321  52.234 -2.092  1.00 0.00  ? 96  VAL A CA   2  
ATOM   5210  C  C    . VAL A 1 96  ? 16.980  51.945 -2.771  1.00 0.00  ? 96  VAL A C    2  
ATOM   5211  O  O    . VAL A 1 96  ? 16.138  51.253 -2.235  1.00 0.00  ? 96  VAL A O    2  
ATOM   5212  C  CB   . VAL A 1 96  ? 19.463  51.723 -2.976  1.00 0.00  ? 96  VAL A CB   2  
ATOM   5213  C  CG1  . VAL A 1 96  ? 20.782  51.818 -2.201  1.00 0.00  ? 96  VAL A CG1  2  
ATOM   5214  C  CG2  . VAL A 1 96  ? 19.201  50.256 -3.361  1.00 0.00  ? 96  VAL A CG2  2  
ATOM   5215  H  H    . VAL A 1 96  ? 18.995  50.770 -0.673  1.00 0.00  ? 96  VAL A H    2  
ATOM   5216  H  HA   . VAL A 1 96  ? 18.430  53.298 -1.942  1.00 0.00  ? 96  VAL A HA   2  
ATOM   5217  H  HB   . VAL A 1 96  ? 19.526  52.327 -3.869  1.00 0.00  ? 96  VAL A HB   2  
ATOM   5218  H  HG11 . VAL A 1 96  ? 20.822  52.758 -1.670  1.00 0.00  ? 96  VAL A HG11 2  
ATOM   5219  H  HG12 . VAL A 1 96  ? 21.609  51.760 -2.893  1.00 0.00  ? 96  VAL A HG12 2  
ATOM   5220  H  HG13 . VAL A 1 96  ? 20.847  51.004 -1.494  1.00 0.00  ? 96  VAL A HG13 2  
ATOM   5221  H  HG21 . VAL A 1 96  ? 18.483  50.220 -4.167  1.00 0.00  ? 96  VAL A HG21 2  
ATOM   5222  H  HG22 . VAL A 1 96  ? 18.809  49.722 -2.507  1.00 0.00  ? 96  VAL A HG22 2  
ATOM   5223  H  HG23 . VAL A 1 96  ? 20.123  49.793 -3.679  1.00 0.00  ? 96  VAL A HG23 2  
ATOM   5224  N  N    . ASN A 1 97  ? 16.808  52.410 -3.980  1.00 45.59 ? 97  ASN A N    2  
ATOM   5225  C  CA   . ASN A 1 97  ? 15.556  52.086 -4.719  1.00 43.57 ? 97  ASN A CA   2  
ATOM   5226  C  C    . ASN A 1 97  ? 15.753  50.689 -5.314  1.00 42.16 ? 97  ASN A C    2  
ATOM   5227  O  O    . ASN A 1 97  ? 16.197  49.785 -4.633  1.00 42.44 ? 97  ASN A O    2  
ATOM   5228  C  CB   . ASN A 1 97  ? 15.304  53.101 -5.844  1.00 45.87 ? 97  ASN A CB   2  
ATOM   5229  C  CG   . ASN A 1 97  ? 16.379  52.967 -6.923  1.00 46.86 ? 97  ASN A CG   2  
ATOM   5230  O  OD1  . ASN A 1 97  ? 16.241  53.506 -8.004  1.00 49.23 ? 97  ASN A OD1  2  
ATOM   5231  N  ND2  . ASN A 1 97  ? 17.449  52.269 -6.676  1.00 47.99 ? 97  ASN A ND2  2  
ATOM   5232  H  H    . ASN A 1 97  ? 17.539  52.890 -4.421  1.00 0.00  ? 97  ASN A H    2  
ATOM   5233  H  HA   . ASN A 1 97  ? 14.717  52.076 -4.035  1.00 0.00  ? 97  ASN A HA   2  
ATOM   5234  H  HB2  . ASN A 1 97  ? 14.334  52.913 -6.282  1.00 0.00  ? 97  ASN A HB2  2  
ATOM   5235  H  HB3  . ASN A 1 97  ? 15.326  54.099 -5.442  1.00 0.00  ? 97  ASN A HB3  2  
ATOM   5236  H  HD21 . ASN A 1 97  ? 17.561  51.833 -5.805  1.00 0.00  ? 97  ASN A HD21 2  
ATOM   5237  H  HD22 . ASN A 1 97  ? 18.142  52.181 -7.361  1.00 0.00  ? 97  ASN A HD22 2  
ATOM   5238  N  N    . GLU A 1 98  ? 15.447  50.500 -6.572  1.00 0.00  ? 98  GLU A N    2  
ATOM   5239  C  CA   . GLU A 1 98  ? 15.636  49.159 -7.209  1.00 0.00  ? 98  GLU A CA   2  
ATOM   5240  C  C    . GLU A 1 98  ? 16.827  49.229 -8.170  1.00 0.00  ? 98  GLU A C    2  
ATOM   5241  O  O    . GLU A 1 98  ? 17.328  48.221 -8.625  1.00 0.00  ? 98  GLU A O    2  
ATOM   5242  C  CB   . GLU A 1 98  ? 14.374  48.790 -7.991  1.00 0.00  ? 98  GLU A CB   2  
ATOM   5243  C  CG   . GLU A 1 98  ? 13.142  49.058 -7.124  1.00 0.00  ? 98  GLU A CG   2  
ATOM   5244  C  CD   . GLU A 1 98  ? 11.916  48.396 -7.756  1.00 0.00  ? 98  GLU A CD   2  
ATOM   5245  O  OE1  . GLU A 1 98  ? 11.745  48.535 -8.956  1.00 0.00  ? 98  GLU A OE1  2  
ATOM   5246  O  OE2  . GLU A 1 98  ? 11.169  47.762 -7.029  1.00 0.00  ? 98  GLU A OE2  2  
ATOM   5247  H  H    . GLU A 1 98  ? 15.092  51.236 -7.109  1.00 0.00  ? 98  GLU A H    2  
ATOM   5248  H  HA   . GLU A 1 98  ? 15.826  48.405 -6.457  1.00 0.00  ? 98  GLU A HA   2  
ATOM   5249  H  HB2  . GLU A 1 98  ? 14.319  49.387 -8.890  1.00 0.00  ? 98  GLU A HB2  2  
ATOM   5250  H  HB3  . GLU A 1 98  ? 14.405  47.743 -8.255  1.00 0.00  ? 98  GLU A HB3  2  
ATOM   5251  H  HG2  . GLU A 1 98  ? 13.303  48.651 -6.136  1.00 0.00  ? 98  GLU A HG2  2  
ATOM   5252  H  HG3  . GLU A 1 98  ? 12.977  50.122 -7.053  1.00 0.00  ? 98  GLU A HG3  2  
ATOM   5253  N  N    . HIS A 1 99  ? 17.279  50.421 -8.484  1.00 0.00  ? 99  HIS A N    2  
ATOM   5254  C  CA   . HIS A 1 99  ? 18.437  50.582 -9.421  1.00 0.00  ? 99  HIS A CA   2  
ATOM   5255  C  C    . HIS A 1 99  ? 19.697  50.979 -8.639  1.00 0.00  ? 99  HIS A C    2  
ATOM   5256  O  O    . HIS A 1 99  ? 20.751  51.174 -9.209  1.00 0.00  ? 99  HIS A O    2  
ATOM   5257  C  CB   . HIS A 1 99  ? 18.107  51.672 -10.444 1.00 0.00  ? 99  HIS A CB   2  
ATOM   5258  C  CG   . HIS A 1 99  ? 16.915  51.251 -11.260 1.00 0.00  ? 99  HIS A CG   2  
ATOM   5259  N  ND1  . HIS A 1 99  ? 15.688  51.891 -11.165 1.00 0.00  ? 99  HIS A ND1  2  
ATOM   5260  C  CD2  . HIS A 1 99  ? 16.745  50.254 -12.191 1.00 0.00  ? 99  HIS A CD2  2  
ATOM   5261  C  CE1  . HIS A 1 99  ? 14.842  51.280 -12.015 1.00 0.00  ? 99  HIS A CE1  2  
ATOM   5262  N  NE2  . HIS A 1 99  ? 15.437  50.276 -12.664 1.00 0.00  ? 99  HIS A NE2  2  
ATOM   5263  H  H    . HIS A 1 99  ? 16.852  51.217 -8.103  1.00 0.00  ? 99  HIS A H    2  
ATOM   5264  H  HA   . HIS A 1 99  ? 18.622  49.652 -9.943  1.00 0.00  ? 99  HIS A HA   2  
ATOM   5265  H  HB2  . HIS A 1 99  ? 17.882  52.594 -9.927  1.00 0.00  ? 99  HIS A HB2  2  
ATOM   5266  H  HB3  . HIS A 1 99  ? 18.954  51.822 -11.096 1.00 0.00  ? 99  HIS A HB3  2  
ATOM   5267  H  HD2  . HIS A 1 99  ? 17.510  49.560 -12.508 1.00 0.00  ? 99  HIS A HD2  2  
ATOM   5268  H  HE1  . HIS A 1 99  ? 13.810  51.566 -12.155 1.00 0.00  ? 99  HIS A HE1  2  
ATOM   5269  H  HE2  . HIS A 1 99  ? 15.028  49.684 -13.330 1.00 0.00  ? 99  HIS A HE2  2  
ATOM   5270  N  N    . GLY A 1 100 ? 19.603  51.094 -7.337  1.00 45.39 ? 100 GLY A N    2  
ATOM   5271  C  CA   . GLY A 1 100 ? 20.804  51.469 -6.525  1.00 47.70 ? 100 GLY A CA   2  
ATOM   5272  C  C    . GLY A 1 100 ? 20.945  52.995 -6.445  1.00 45.14 ? 100 GLY A C    2  
ATOM   5273  O  O    . GLY A 1 100 ? 22.024  53.520 -6.252  1.00 48.55 ? 100 GLY A O    2  
ATOM   5274  H  H    . GLY A 1 100 ? 18.746  50.926 -6.893  1.00 0.00  ? 100 GLY A H    2  
ATOM   5275  H  HA2  . GLY A 1 100 ? 20.699  51.068 -5.530  1.00 0.00  ? 100 GLY A HA2  2  
ATOM   5276  H  HA3  . GLY A 1 100 ? 21.686  51.055 -6.984  1.00 0.00  ? 100 GLY A HA3  2  
ATOM   5277  N  N    . ASN A 1 101 ? 19.867  53.705 -6.612  1.00 0.00  ? 101 ASN A N    2  
ATOM   5278  C  CA   . ASN A 1 101 ? 19.941  55.196 -6.567  1.00 0.00  ? 101 ASN A CA   2  
ATOM   5279  C  C    . ASN A 1 101 ? 20.235  55.692 -5.138  1.00 0.00  ? 101 ASN A C    2  
ATOM   5280  O  O    . ASN A 1 101 ? 19.345  56.087 -4.408  1.00 0.00  ? 101 ASN A O    2  
ATOM   5281  C  CB   . ASN A 1 101 ? 18.619  55.796 -7.066  1.00 0.00  ? 101 ASN A CB   2  
ATOM   5282  C  CG   . ASN A 1 101 ? 17.489  55.472 -6.088  1.00 0.00  ? 101 ASN A CG   2  
ATOM   5283  O  OD1  . ASN A 1 101 ? 16.432  56.069 -6.144  1.00 0.00  ? 101 ASN A OD1  2  
ATOM   5284  N  ND2  . ASN A 1 101 ? 17.668  54.548 -5.187  1.00 0.00  ? 101 ASN A ND2  2  
ATOM   5285  H  H    . ASN A 1 101 ? 19.022  53.245 -6.792  1.00 0.00  ? 101 ASN A H    2  
ATOM   5286  H  HA   . ASN A 1 101 ? 20.738  55.524 -7.218  1.00 0.00  ? 101 ASN A HA   2  
ATOM   5287  H  HB2  . ASN A 1 101 ? 18.722  56.868 -7.151  1.00 0.00  ? 101 ASN A HB2  2  
ATOM   5288  H  HB3  . ASN A 1 101 ? 18.381  55.382 -8.034  1.00 0.00  ? 101 ASN A HB3  2  
ATOM   5289  H  HD21 . ASN A 1 101 ? 18.521  54.068 -5.140  1.00 0.00  ? 101 ASN A HD21 2  
ATOM   5290  H  HD22 . ASN A 1 101 ? 16.950  54.334 -4.555  1.00 0.00  ? 101 ASN A HD22 2  
ATOM   5291  N  N    . VAL A 1 102 ? 21.484  55.713 -4.740  1.00 0.00  ? 102 VAL A N    2  
ATOM   5292  C  CA   . VAL A 1 102 ? 21.814  56.229 -3.376  1.00 0.00  ? 102 VAL A CA   2  
ATOM   5293  C  C    . VAL A 1 102 ? 21.720  57.771 -3.470  1.00 0.00  ? 102 VAL A C    2  
ATOM   5294  O  O    . VAL A 1 102 ? 22.044  58.323 -4.503  1.00 0.00  ? 102 VAL A O    2  
ATOM   5295  C  CB   . VAL A 1 102 ? 23.253  55.740 -3.003  1.00 0.00  ? 102 VAL A CB   2  
ATOM   5296  C  CG1  . VAL A 1 102 ? 24.142  56.864 -2.442  1.00 0.00  ? 102 VAL A CG1  2  
ATOM   5297  C  CG2  . VAL A 1 102 ? 23.184  54.611 -1.965  1.00 0.00  ? 102 VAL A CG2  2  
ATOM   5298  H  H    . VAL A 1 102 ? 22.207  55.421 -5.345  1.00 0.00  ? 102 VAL A H    2  
ATOM   5299  H  HA   . VAL A 1 102 ? 21.084  55.851 -2.668  1.00 0.00  ? 102 VAL A HA   2  
ATOM   5300  H  HB   . VAL A 1 102 ? 23.720  55.354 -3.895  1.00 0.00  ? 102 VAL A HB   2  
ATOM   5301  H  HG11 . VAL A 1 102 ? 25.099  56.452 -2.158  1.00 0.00  ? 102 VAL A HG11 2  
ATOM   5302  H  HG12 . VAL A 1 102 ? 23.678  57.305 -1.580  1.00 0.00  ? 102 VAL A HG12 2  
ATOM   5303  H  HG13 . VAL A 1 102 ? 24.291  57.616 -3.194  1.00 0.00  ? 102 VAL A HG13 2  
ATOM   5304  H  HG21 . VAL A 1 102 ? 22.788  53.723 -2.430  1.00 0.00  ? 102 VAL A HG21 2  
ATOM   5305  H  HG22 . VAL A 1 102 ? 22.545  54.906 -1.145  1.00 0.00  ? 102 VAL A HG22 2  
ATOM   5306  H  HG23 . VAL A 1 102 ? 24.176  54.406 -1.589  1.00 0.00  ? 102 VAL A HG23 2  
ATOM   5307  N  N    . PRO A 1 103 ? 21.267  58.437 -2.429  1.00 0.00  ? 103 PRO A N    2  
ATOM   5308  C  CA   . PRO A 1 103 ? 21.144  59.905 -2.471  1.00 0.00  ? 103 PRO A CA   2  
ATOM   5309  C  C    . PRO A 1 103 ? 22.429  60.547 -3.024  1.00 0.00  ? 103 PRO A C    2  
ATOM   5310  O  O    . PRO A 1 103 ? 22.381  61.558 -3.697  1.00 0.00  ? 103 PRO A O    2  
ATOM   5311  C  CB   . PRO A 1 103 ? 20.876  60.320 -1.006  1.00 0.00  ? 103 PRO A CB   2  
ATOM   5312  C  CG   . PRO A 1 103 ? 20.677  59.013 -0.182  1.00 0.00  ? 103 PRO A CG   2  
ATOM   5313  C  CD   . PRO A 1 103 ? 20.843  57.821 -1.151  1.00 0.00  ? 103 PRO A CD   2  
ATOM   5314  H  HA   . PRO A 1 103 ? 20.303  60.183 -3.088  1.00 0.00  ? 103 PRO A HA   2  
ATOM   5315  H  HB2  . PRO A 1 103 ? 21.717  60.881 -0.615  1.00 0.00  ? 103 PRO A HB2  2  
ATOM   5316  H  HB3  . PRO A 1 103 ? 19.981  60.925 -0.949  1.00 0.00  ? 103 PRO A HB3  2  
ATOM   5317  H  HG2  . PRO A 1 103 ? 21.420  58.958 0.606   1.00 0.00  ? 103 PRO A HG2  2  
ATOM   5318  H  HG3  . PRO A 1 103 ? 19.688  58.996 0.253   1.00 0.00  ? 103 PRO A HG3  2  
ATOM   5319  H  HD2  . PRO A 1 103 ? 21.588  57.133 -0.783  1.00 0.00  ? 103 PRO A HD2  2  
ATOM   5320  H  HD3  . PRO A 1 103 ? 19.900  57.310 -1.286  1.00 0.00  ? 103 PRO A HD3  2  
ATOM   5321  N  N    . LEU A 1 104 ? 23.573  59.987 -2.737  1.00 29.14 ? 104 LEU A N    2  
ATOM   5322  C  CA   . LEU A 1 104 ? 24.840  60.596 -3.242  1.00 27.06 ? 104 LEU A CA   2  
ATOM   5323  C  C    . LEU A 1 104 ? 24.938  60.424 -4.765  1.00 26.37 ? 104 LEU A C    2  
ATOM   5324  O  O    . LEU A 1 104 ? 25.266  61.350 -5.480  1.00 28.34 ? 104 LEU A O    2  
ATOM   5325  C  CB   . LEU A 1 104 ? 26.048  59.936 -2.538  1.00 25.36 ? 104 LEU A CB   2  
ATOM   5326  C  CG   . LEU A 1 104 ? 27.177  60.963 -2.317  1.00 26.22 ? 104 LEU A CG   2  
ATOM   5327  C  CD1  . LEU A 1 104 ? 26.710  62.085 -1.373  1.00 35.25 ? 104 LEU A CD1  2  
ATOM   5328  C  CD2  . LEU A 1 104 ? 28.397  60.260 -1.715  1.00 24.97 ? 104 LEU A CD2  2  
ATOM   5329  H  H    . LEU A 1 104 ? 23.602  59.184 -2.179  1.00 0.00  ? 104 LEU A H    2  
ATOM   5330  H  HA   . LEU A 1 104 ? 24.816  61.648 -3.020  1.00 0.00  ? 104 LEU A HA   2  
ATOM   5331  H  HB2  . LEU A 1 104 ? 25.729  59.549 -1.581  1.00 0.00  ? 104 LEU A HB2  2  
ATOM   5332  H  HB3  . LEU A 1 104 ? 26.423  59.120 -3.140  1.00 0.00  ? 104 LEU A HB3  2  
ATOM   5333  H  HG   . LEU A 1 104 ? 27.448  61.402 -3.264  1.00 0.00  ? 104 LEU A HG   2  
ATOM   5334  H  HD11 . LEU A 1 104 ? 27.516  62.385 -0.719  1.00 0.00  ? 104 LEU A HD11 2  
ATOM   5335  H  HD12 . LEU A 1 104 ? 25.876  61.747 -0.774  1.00 0.00  ? 104 LEU A HD12 2  
ATOM   5336  H  HD13 . LEU A 1 104 ? 26.404  62.931 -1.969  1.00 0.00  ? 104 LEU A HD13 2  
ATOM   5337  H  HD21 . LEU A 1 104 ? 28.882  59.665 -2.472  1.00 0.00  ? 104 LEU A HD21 2  
ATOM   5338  H  HD22 . LEU A 1 104 ? 28.080  59.624 -0.902  1.00 0.00  ? 104 LEU A HD22 2  
ATOM   5339  H  HD23 . LEU A 1 104 ? 29.086  61.005 -1.341  1.00 0.00  ? 104 LEU A HD23 2  
ATOM   5340  N  N    . HIS A 1 105 ? 24.644  59.259 -5.270  1.00 24.64 ? 105 HIS A N    2  
ATOM   5341  C  CA   . HIS A 1 105 ? 24.703  59.044 -6.742  1.00 27.54 ? 105 HIS A CA   2  
ATOM   5342  C  C    . HIS A 1 105 ? 23.943  60.171 -7.433  1.00 26.02 ? 105 HIS A C    2  
ATOM   5343  O  O    . HIS A 1 105 ? 24.375  60.722 -8.426  1.00 25.72 ? 105 HIS A O    2  
ATOM   5344  C  CB   . HIS A 1 105 ? 24.045  57.702 -7.088  1.00 30.63 ? 105 HIS A CB   2  
ATOM   5345  C  CG   . HIS A 1 105 ? 24.981  56.568 -6.770  1.00 44.65 ? 105 HIS A CG   2  
ATOM   5346  N  ND1  . HIS A 1 105 ? 24.549  55.411 -6.135  1.00 53.08 ? 105 HIS A ND1  2  
ATOM   5347  C  CD2  . HIS A 1 105 ? 26.324  56.390 -7.005  1.00 49.05 ? 105 HIS A CD2  2  
ATOM   5348  C  CE1  . HIS A 1 105 ? 25.616  54.594 -6.012  1.00 56.72 ? 105 HIS A CE1  2  
ATOM   5349  N  NE2  . HIS A 1 105 ? 26.722  55.144 -6.528  1.00 50.00 ? 105 HIS A NE2  2  
ATOM   5350  H  H    . HIS A 1 105 ? 24.370  58.529 -4.685  1.00 0.00  ? 105 HIS A H    2  
ATOM   5351  H  HA   . HIS A 1 105 ? 25.722  59.048 -7.067  1.00 0.00  ? 105 HIS A HA   2  
ATOM   5352  H  HB2  . HIS A 1 105 ? 23.139  57.589 -6.511  1.00 0.00  ? 105 HIS A HB2  2  
ATOM   5353  H  HB3  . HIS A 1 105 ? 23.802  57.680 -8.140  1.00 0.00  ? 105 HIS A HB3  2  
ATOM   5354  H  HD2  . HIS A 1 105 ? 26.971  57.107 -7.488  1.00 0.00  ? 105 HIS A HD2  2  
ATOM   5355  H  HE1  . HIS A 1 105 ? 25.582  53.617 -5.555  1.00 0.00  ? 105 HIS A HE1  2  
ATOM   5356  H  HE2  . HIS A 1 105 ? 27.617  54.744 -6.568  1.00 0.00  ? 105 HIS A HE2  2  
ATOM   5357  N  N    . TYR A 1 106 ? 22.813  60.514 -6.898  1.00 0.00  ? 106 TYR A N    2  
ATOM   5358  C  CA   . TYR A 1 106 ? 21.995  61.606 -7.497  1.00 0.00  ? 106 TYR A CA   2  
ATOM   5359  C  C    . TYR A 1 106 ? 22.707  62.948 -7.306  1.00 0.00  ? 106 TYR A C    2  
ATOM   5360  O  O    . TYR A 1 106 ? 22.932  63.688 -8.245  1.00 0.00  ? 106 TYR A O    2  
ATOM   5361  C  CB   . TYR A 1 106 ? 20.630  61.652 -6.808  1.00 0.00  ? 106 TYR A CB   2  
ATOM   5362  C  CG   . TYR A 1 106 ? 19.704  62.551 -7.588  1.00 0.00  ? 106 TYR A CG   2  
ATOM   5363  C  CD1  . TYR A 1 106 ? 19.745  63.937 -7.393  1.00 0.00  ? 106 TYR A CD1  2  
ATOM   5364  C  CD2  . TYR A 1 106 ? 18.803  62.000 -8.507  1.00 0.00  ? 106 TYR A CD2  2  
ATOM   5365  C  CE1  . TYR A 1 106 ? 18.886  64.771 -8.116  1.00 0.00  ? 106 TYR A CE1  2  
ATOM   5366  C  CE2  . TYR A 1 106 ? 17.943  62.835 -9.231  1.00 0.00  ? 106 TYR A CE2  2  
ATOM   5367  C  CZ   . TYR A 1 106 ? 17.985  64.220 -9.036  1.00 0.00  ? 106 TYR A CZ   2  
ATOM   5368  O  OH   . TYR A 1 106 ? 17.137  65.043 -9.749  1.00 0.00  ? 106 TYR A OH   2  
ATOM   5369  H  H    . TYR A 1 106 ? 22.501  60.049 -6.093  1.00 0.00  ? 106 TYR A H    2  
ATOM   5370  H  HA   . TYR A 1 106 ? 21.859  61.418 -8.550  1.00 0.00  ? 106 TYR A HA   2  
ATOM   5371  H  HB2  . TYR A 1 106 ? 20.215  60.656 -6.766  1.00 0.00  ? 106 TYR A HB2  2  
ATOM   5372  H  HB3  . TYR A 1 106 ? 20.746  62.038 -5.806  1.00 0.00  ? 106 TYR A HB3  2  
ATOM   5373  H  HD1  . TYR A 1 106 ? 20.440  64.361 -6.684  1.00 0.00  ? 106 TYR A HD1  2  
ATOM   5374  H  HD2  . TYR A 1 106 ? 18.771  60.931 -8.658  1.00 0.00  ? 106 TYR A HD2  2  
ATOM   5375  H  HE1  . TYR A 1 106 ? 18.917  65.840 -7.965  1.00 0.00  ? 106 TYR A HE1  2  
ATOM   5376  H  HE2  . TYR A 1 106 ? 17.248  62.410 -9.940  1.00 0.00  ? 106 TYR A HE2  2  
ATOM   5377  H  HH   . TYR A 1 106 ? 16.631  64.495 -10.353 1.00 0.00  ? 106 TYR A HH   2  
ATOM   5378  N  N    . ALA A 1 107 ? 23.069  63.263 -6.094  1.00 29.64 ? 107 ALA A N    2  
ATOM   5379  C  CA   . ALA A 1 107 ? 23.769  64.550 -5.835  1.00 30.31 ? 107 ALA A CA   2  
ATOM   5380  C  C    . ALA A 1 107 ? 25.079  64.568 -6.619  1.00 31.78 ? 107 ALA A C    2  
ATOM   5381  O  O    . ALA A 1 107 ? 25.560  65.606 -7.027  1.00 33.04 ? 107 ALA A O    2  
ATOM   5382  C  CB   . ALA A 1 107 ? 24.067  64.680 -4.341  1.00 25.67 ? 107 ALA A CB   2  
ATOM   5383  H  H    . ALA A 1 107 ? 22.884  62.651 -5.357  1.00 0.00  ? 107 ALA A H    2  
ATOM   5384  H  HA   . ALA A 1 107 ? 23.145  65.372 -6.152  1.00 0.00  ? 107 ALA A HA   2  
ATOM   5385  H  HB1  . ALA A 1 107 ? 24.780  65.476 -4.183  1.00 0.00  ? 107 ALA A HB1  2  
ATOM   5386  H  HB2  . ALA A 1 107 ? 24.478  63.752 -3.974  1.00 0.00  ? 107 ALA A HB2  2  
ATOM   5387  H  HB3  . ALA A 1 107 ? 23.154  64.905 -3.809  1.00 0.00  ? 107 ALA A HB3  2  
ATOM   5388  N  N    . CYS A 1 108 ? 25.656  63.419 -6.837  1.00 0.00  ? 108 CYS A N    2  
ATOM   5389  C  CA   . CYS A 1 108 ? 26.931  63.359 -7.599  1.00 0.00  ? 108 CYS A CA   2  
ATOM   5390  C  C    . CYS A 1 108 ? 26.686  63.864 -9.023  1.00 0.00  ? 108 CYS A C    2  
ATOM   5391  O  O    . CYS A 1 108 ? 27.458  64.633 -9.558  1.00 0.00  ? 108 CYS A O    2  
ATOM   5392  C  CB   . CYS A 1 108 ? 27.435  61.910 -7.631  1.00 0.00  ? 108 CYS A CB   2  
ATOM   5393  S  SG   . CYS A 1 108 ? 28.596  61.677 -9.004  1.00 0.00  ? 108 CYS A SG   2  
ATOM   5394  H  H    . CYS A 1 108 ? 25.247  62.594 -6.501  1.00 0.00  ? 108 CYS A H    2  
ATOM   5395  H  HA   . CYS A 1 108 ? 27.666  63.986 -7.115  1.00 0.00  ? 108 CYS A HA   2  
ATOM   5396  H  HB2  . CYS A 1 108 ? 27.937  61.688 -6.700  1.00 0.00  ? 108 CYS A HB2  2  
ATOM   5397  H  HB3  . CYS A 1 108 ? 26.595  61.241 -7.753  1.00 0.00  ? 108 CYS A HB3  2  
ATOM   5398  H  HG   . CYS A 1 108 ? 28.365  60.861 -9.454  1.00 0.00  ? 108 CYS A HG   2  
ATOM   5399  N  N    . PHE A 1 109 ? 25.618  63.438 -9.644  1.00 0.00  ? 109 PHE A N    2  
ATOM   5400  C  CA   . PHE A 1 109 ? 25.336  63.895 -11.023 1.00 0.00  ? 109 PHE A CA   2  
ATOM   5401  C  C    . PHE A 1 109 ? 24.952  65.377 -11.002 1.00 0.00  ? 109 PHE A C    2  
ATOM   5402  O  O    . PHE A 1 109 ? 25.087  66.073 -11.989 1.00 0.00  ? 109 PHE A O    2  
ATOM   5403  C  CB   . PHE A 1 109 ? 24.195  63.059 -11.600 1.00 0.00  ? 109 PHE A CB   2  
ATOM   5404  C  CG   . PHE A 1 109 ? 24.360  61.596 -11.224 1.00 0.00  ? 109 PHE A CG   2  
ATOM   5405  C  CD1  . PHE A 1 109 ? 25.625  60.983 -11.252 1.00 0.00  ? 109 PHE A CD1  2  
ATOM   5406  C  CD2  . PHE A 1 109 ? 23.236  60.847 -10.852 1.00 0.00  ? 109 PHE A CD2  2  
ATOM   5407  C  CE1  . PHE A 1 109 ? 25.758  59.633 -10.909 1.00 0.00  ? 109 PHE A CE1  2  
ATOM   5408  C  CE2  . PHE A 1 109 ? 23.373  59.496 -10.508 1.00 0.00  ? 109 PHE A CE2  2  
ATOM   5409  C  CZ   . PHE A 1 109 ? 24.633  58.890 -10.536 1.00 0.00  ? 109 PHE A CZ   2  
ATOM   5410  H  H    . PHE A 1 109 ? 24.999  62.818 -9.205  1.00 0.00  ? 109 PHE A H    2  
ATOM   5411  H  HA   . PHE A 1 109 ? 26.218  63.775 -11.632 1.00 0.00  ? 109 PHE A HA   2  
ATOM   5412  H  HB2  . PHE A 1 109 ? 23.252  63.422 -11.217 1.00 0.00  ? 109 PHE A HB2  2  
ATOM   5413  H  HB3  . PHE A 1 109 ? 24.203  63.150 -12.664 1.00 0.00  ? 109 PHE A HB3  2  
ATOM   5414  H  HD1  . PHE A 1 109 ? 26.497  61.545 -11.539 1.00 0.00  ? 109 PHE A HD1  2  
ATOM   5415  H  HD2  . PHE A 1 109 ? 22.262  61.312 -10.834 1.00 0.00  ? 109 PHE A HD2  2  
ATOM   5416  H  HE1  . PHE A 1 109 ? 26.730  59.163 -10.931 1.00 0.00  ? 109 PHE A HE1  2  
ATOM   5417  H  HE2  . PHE A 1 109 ? 22.506  58.923 -10.218 1.00 0.00  ? 109 PHE A HE2  2  
ATOM   5418  H  HZ   . PHE A 1 109 ? 24.738  57.848 -10.273 1.00 0.00  ? 109 PHE A HZ   2  
ATOM   5419  N  N    . TRP A 1 110 ? 24.496  65.875 -9.883  1.00 0.00  ? 110 TRP A N    2  
ATOM   5420  C  CA   . TRP A 1 110 ? 24.132  67.320 -9.805  1.00 0.00  ? 110 TRP A CA   2  
ATOM   5421  C  C    . TRP A 1 110 ? 25.376  68.102 -9.383  1.00 0.00  ? 110 TRP A C    2  
ATOM   5422  O  O    . TRP A 1 110 ? 25.927  68.865 -10.152 1.00 0.00  ? 110 TRP A O    2  
ATOM   5423  C  CB   . TRP A 1 110 ? 23.015  67.519 -8.771  1.00 0.00  ? 110 TRP A CB   2  
ATOM   5424  C  CG   . TRP A 1 110 ? 21.696  67.145 -9.374  1.00 0.00  ? 110 TRP A CG   2  
ATOM   5425  C  CD1  . TRP A 1 110 ? 21.410  65.950 -9.941  1.00 0.00  ? 110 TRP A CD1  2  
ATOM   5426  C  CD2  . TRP A 1 110 ? 20.487  67.950 -9.483  1.00 0.00  ? 110 TRP A CD2  2  
ATOM   5427  N  NE1  . TRP A 1 110 ? 20.101  65.971 -10.390 1.00 0.00  ? 110 TRP A NE1  2  
ATOM   5428  C  CE2  . TRP A 1 110 ? 19.490  67.182 -10.130 1.00 0.00  ? 110 TRP A CE2  2  
ATOM   5429  C  CE3  . TRP A 1 110 ? 20.161  69.259 -9.085  1.00 0.00  ? 110 TRP A CE3  2  
ATOM   5430  C  CZ2  . TRP A 1 110 ? 18.216  67.695 -10.375 1.00 0.00  ? 110 TRP A CZ2  2  
ATOM   5431  C  CZ3  . TRP A 1 110 ? 18.879  69.779 -9.330  1.00 0.00  ? 110 TRP A CZ3  2  
ATOM   5432  C  CH2  . TRP A 1 110 ? 17.908  68.998 -9.974  1.00 0.00  ? 110 TRP A CH2  2  
ATOM   5433  H  H    . TRP A 1 110 ? 24.410  65.305 -9.090  1.00 0.00  ? 110 TRP A H    2  
ATOM   5434  H  HA   . TRP A 1 110 ? 23.800  67.669 -10.775 1.00 0.00  ? 110 TRP A HA   2  
ATOM   5435  H  HB2  . TRP A 1 110 ? 23.207  66.895 -7.913  1.00 0.00  ? 110 TRP A HB2  2  
ATOM   5436  H  HB3  . TRP A 1 110 ? 22.988  68.554 -8.464  1.00 0.00  ? 110 TRP A HB3  2  
ATOM   5437  H  HD1  . TRP A 1 110 ? 22.091  65.117 -10.028 1.00 0.00  ? 110 TRP A HD1  2  
ATOM   5438  H  HE1  . TRP A 1 110 ? 19.645  65.228 -10.839 1.00 0.00  ? 110 TRP A HE1  2  
ATOM   5439  H  HE3  . TRP A 1 110 ? 20.901  69.869 -8.589  1.00 0.00  ? 110 TRP A HE3  2  
ATOM   5440  H  HZ2  . TRP A 1 110 ? 17.472  67.089 -10.871 1.00 0.00  ? 110 TRP A HZ2  2  
ATOM   5441  H  HZ3  . TRP A 1 110 ? 18.639  70.785 -9.021  1.00 0.00  ? 110 TRP A HZ3  2  
ATOM   5442  H  HH2  . TRP A 1 110 ? 16.925  69.403 -10.159 1.00 0.00  ? 110 TRP A HH2  2  
ATOM   5443  N  N    . GLY A 1 111 ? 25.831  67.904 -8.168  1.00 25.81 ? 111 GLY A N    2  
ATOM   5444  C  CA   . GLY A 1 111 ? 27.055  68.620 -7.683  1.00 25.30 ? 111 GLY A CA   2  
ATOM   5445  C  C    . GLY A 1 111 ? 26.782  69.245 -6.313  1.00 24.23 ? 111 GLY A C    2  
ATOM   5446  O  O    . GLY A 1 111 ? 27.352  70.258 -5.959  1.00 32.41 ? 111 GLY A O    2  
ATOM   5447  H  H    . GLY A 1 111 ? 25.369  67.277 -7.574  1.00 0.00  ? 111 GLY A H    2  
ATOM   5448  H  HA2  . GLY A 1 111 ? 27.869  67.915 -7.598  1.00 0.00  ? 111 GLY A HA2  2  
ATOM   5449  H  HA3  . GLY A 1 111 ? 27.328  69.398 -8.378  1.00 0.00  ? 111 GLY A HA3  2  
ATOM   5450  N  N    . GLN A 1 112 ? 25.910  68.656 -5.540  1.00 0.00  ? 112 GLN A N    2  
ATOM   5451  C  CA   . GLN A 1 112 ? 25.597  69.224 -4.196  1.00 0.00  ? 112 GLN A CA   2  
ATOM   5452  C  C    . GLN A 1 112 ? 26.647  68.762 -3.174  1.00 0.00  ? 112 GLN A C    2  
ATOM   5453  O  O    . GLN A 1 112 ? 26.480  67.773 -2.493  1.00 0.00  ? 112 GLN A O    2  
ATOM   5454  C  CB   . GLN A 1 112 ? 24.205  68.752 -3.771  1.00 0.00  ? 112 GLN A CB   2  
ATOM   5455  C  CG   . GLN A 1 112 ? 23.191  69.115 -4.858  1.00 0.00  ? 112 GLN A CG   2  
ATOM   5456  C  CD   . GLN A 1 112 ? 23.108  70.637 -4.991  1.00 0.00  ? 112 GLN A CD   2  
ATOM   5457  O  OE1  . GLN A 1 112 ? 23.359  71.356 -4.045  1.00 0.00  ? 112 GLN A OE1  2  
ATOM   5458  N  NE2  . GLN A 1 112 ? 22.764  71.161 -6.136  1.00 0.00  ? 112 GLN A NE2  2  
ATOM   5459  H  H    . GLN A 1 112 ? 25.452  67.845 -5.845  1.00 0.00  ? 112 GLN A H    2  
ATOM   5460  H  HA   . GLN A 1 112 ? 25.605  70.304 -4.252  1.00 0.00  ? 112 GLN A HA   2  
ATOM   5461  H  HB2  . GLN A 1 112 ? 24.215  67.681 -3.632  1.00 0.00  ? 112 GLN A HB2  2  
ATOM   5462  H  HB3  . GLN A 1 112 ? 23.925  69.234 -2.847  1.00 0.00  ? 112 GLN A HB3  2  
ATOM   5463  H  HG2  . GLN A 1 112 ? 23.504  68.687 -5.799  1.00 0.00  ? 112 GLN A HG2  2  
ATOM   5464  H  HG3  . GLN A 1 112 ? 22.220  68.726 -4.591  1.00 0.00  ? 112 GLN A HG3  2  
ATOM   5465  H  HE21 . GLN A 1 112 ? 22.561  70.581 -6.899  1.00 0.00  ? 112 GLN A HE21 2  
ATOM   5466  H  HE22 . GLN A 1 112 ? 22.707  72.135 -6.232  1.00 0.00  ? 112 GLN A HE22 2  
ATOM   5467  N  N    . ASP A 1 113 ? 27.748  69.454 -3.098  1.00 0.00  ? 113 ASP A N    2  
ATOM   5468  C  CA   . ASP A 1 113 ? 28.834  69.047 -2.154  1.00 0.00  ? 113 ASP A CA   2  
ATOM   5469  C  C    . ASP A 1 113 ? 28.334  69.078 -0.703  1.00 0.00  ? 113 ASP A C    2  
ATOM   5470  O  O    . ASP A 1 113 ? 28.430  68.106 0.017   1.00 0.00  ? 113 ASP A O    2  
ATOM   5471  C  CB   . ASP A 1 113 ? 30.017  70.007 -2.301  1.00 0.00  ? 113 ASP A CB   2  
ATOM   5472  C  CG   . ASP A 1 113 ? 29.541  71.443 -2.071  1.00 0.00  ? 113 ASP A CG   2  
ATOM   5473  O  OD1  . ASP A 1 113 ? 28.881  71.975 -2.949  1.00 0.00  ? 113 ASP A OD1  2  
ATOM   5474  O  OD2  . ASP A 1 113 ? 29.845  71.986 -1.022  1.00 0.00  ? 113 ASP A OD2  2  
ATOM   5475  H  H    . ASP A 1 113 ? 27.875  70.213 -3.703  1.00 0.00  ? 113 ASP A H    2  
ATOM   5476  H  HA   . ASP A 1 113 ? 29.158  68.046 -2.396  1.00 0.00  ? 113 ASP A HA   2  
ATOM   5477  H  HB2  . ASP A 1 113 ? 30.775  69.757 -1.573  1.00 0.00  ? 113 ASP A HB2  2  
ATOM   5478  H  HB3  . ASP A 1 113 ? 30.429  69.921 -3.295  1.00 0.00  ? 113 ASP A HB3  2  
ATOM   5479  N  N    . GLN A 1 114 ? 27.830  70.195 -0.260  1.00 0.00  ? 114 GLN A N    2  
ATOM   5480  C  CA   . GLN A 1 114 ? 27.347  70.308 1.150   1.00 0.00  ? 114 GLN A CA   2  
ATOM   5481  C  C    . GLN A 1 114 ? 26.459  69.111 1.549   1.00 0.00  ? 114 GLN A C    2  
ATOM   5482  O  O    . GLN A 1 114 ? 26.749  68.408 2.498   1.00 0.00  ? 114 GLN A O    2  
ATOM   5483  C  CB   . GLN A 1 114 ? 26.582  71.636 1.328   1.00 0.00  ? 114 GLN A CB   2  
ATOM   5484  C  CG   . GLN A 1 114 ? 25.307  71.698 0.461   1.00 0.00  ? 114 GLN A CG   2  
ATOM   5485  C  CD   . GLN A 1 114 ? 25.579  71.201 -0.960  1.00 0.00  ? 114 GLN A CD   2  
ATOM   5486  O  OE1  . GLN A 1 114 ? 25.437  70.031 -1.243  1.00 0.00  ? 114 GLN A OE1  2  
ATOM   5487  N  NE2  . GLN A 1 114 ? 25.967  72.050 -1.872  1.00 0.00  ? 114 GLN A NE2  2  
ATOM   5488  H  H    . GLN A 1 114 ? 27.788  70.978 -0.847  1.00 0.00  ? 114 GLN A H    2  
ATOM   5489  H  HA   . GLN A 1 114 ? 28.209  70.322 1.802   1.00 0.00  ? 114 GLN A HA   2  
ATOM   5490  H  HB2  . GLN A 1 114 ? 26.304  71.744 2.365   1.00 0.00  ? 114 GLN A HB2  2  
ATOM   5491  H  HB3  . GLN A 1 114 ? 27.233  72.454 1.054   1.00 0.00  ? 114 GLN A HB3  2  
ATOM   5492  H  HG2  . GLN A 1 114 ? 24.533  71.098 0.910   1.00 0.00  ? 114 GLN A HG2  2  
ATOM   5493  H  HG3  . GLN A 1 114 ? 24.973  72.720 0.408   1.00 0.00  ? 114 GLN A HG3  2  
ATOM   5494  H  HE21 . GLN A 1 114 ? 26.082  72.996 -1.644  1.00 0.00  ? 114 GLN A HE21 2  
ATOM   5495  H  HE22 . GLN A 1 114 ? 26.143  71.741 -2.785  1.00 0.00  ? 114 GLN A HE22 2  
ATOM   5496  N  N    . VAL A 1 115 ? 25.372  68.891 0.865   1.00 0.00  ? 115 VAL A N    2  
ATOM   5497  C  CA   . VAL A 1 115 ? 24.482  67.753 1.254   1.00 0.00  ? 115 VAL A CA   2  
ATOM   5498  C  C    . VAL A 1 115 ? 25.256  66.437 1.150   1.00 0.00  ? 115 VAL A C    2  
ATOM   5499  O  O    . VAL A 1 115 ? 25.110  65.542 1.964   1.00 0.00  ? 115 VAL A O    2  
ATOM   5500  C  CB   . VAL A 1 115 ? 23.228  67.704 0.366   1.00 0.00  ? 115 VAL A CB   2  
ATOM   5501  C  CG1  . VAL A 1 115 ? 22.642  69.109 0.228   1.00 0.00  ? 115 VAL A CG1  2  
ATOM   5502  C  CG2  . VAL A 1 115 ? 23.583  67.156 -1.020  1.00 0.00  ? 115 VAL A CG2  2  
ATOM   5503  H  H    . VAL A 1 115 ? 25.152  69.501 0.132   1.00 0.00  ? 115 VAL A H    2  
ATOM   5504  H  HA   . VAL A 1 115 ? 24.184  67.893 2.272   1.00 0.00  ? 115 VAL A HA   2  
ATOM   5505  H  HB   . VAL A 1 115 ? 22.493  67.060 0.828   1.00 0.00  ? 115 VAL A HB   2  
ATOM   5506  H  HG11 . VAL A 1 115 ? 21.631  69.038 -0.144  1.00 0.00  ? 115 VAL A HG11 2  
ATOM   5507  H  HG12 . VAL A 1 115 ? 23.241  69.685 -0.461  1.00 0.00  ? 115 VAL A HG12 2  
ATOM   5508  H  HG13 . VAL A 1 115 ? 22.636  69.593 1.193   1.00 0.00  ? 115 VAL A HG13 2  
ATOM   5509  H  HG21 . VAL A 1 115 ? 23.661  66.080 -0.971  1.00 0.00  ? 115 VAL A HG21 2  
ATOM   5510  H  HG22 . VAL A 1 115 ? 24.524  67.568 -1.332  1.00 0.00  ? 115 VAL A HG22 2  
ATOM   5511  H  HG23 . VAL A 1 115 ? 22.815  67.429 -1.730  1.00 0.00  ? 115 VAL A HG23 2  
ATOM   5512  N  N    . ALA A 1 116 ? 26.083  66.322 0.157   1.00 0.00  ? 116 ALA A N    2  
ATOM   5513  C  CA   . ALA A 1 116 ? 26.881  65.080 -0.022  1.00 0.00  ? 116 ALA A CA   2  
ATOM   5514  C  C    . ALA A 1 116 ? 27.779  64.875 1.191   1.00 0.00  ? 116 ALA A C    2  
ATOM   5515  O  O    . ALA A 1 116 ? 28.118  63.765 1.553   1.00 0.00  ? 116 ALA A O    2  
ATOM   5516  C  CB   . ALA A 1 116 ? 27.739  65.208 -1.285  1.00 0.00  ? 116 ALA A CB   2  
ATOM   5517  H  H    . ALA A 1 116 ? 26.181  67.058 -0.472  1.00 0.00  ? 116 ALA A H    2  
ATOM   5518  H  HA   . ALA A 1 116 ? 26.217  64.248 -0.115  1.00 0.00  ? 116 ALA A HA   2  
ATOM   5519  H  HB1  . ALA A 1 116 ? 28.471  64.416 -1.307  1.00 0.00  ? 116 ALA A HB1  2  
ATOM   5520  H  HB2  . ALA A 1 116 ? 28.245  66.161 -1.280  1.00 0.00  ? 116 ALA A HB2  2  
ATOM   5521  H  HB3  . ALA A 1 116 ? 27.108  65.142 -2.158  1.00 0.00  ? 116 ALA A HB3  2  
ATOM   5522  N  N    . GLU A 1 117 ? 28.150  65.943 1.823   1.00 35.87 ? 117 GLU A N    2  
ATOM   5523  C  CA   . GLU A 1 117 ? 29.018  65.850 3.025   1.00 39.73 ? 117 GLU A CA   2  
ATOM   5524  C  C    . GLU A 1 117 ? 28.217  65.226 4.167   1.00 39.65 ? 117 GLU A C    2  
ATOM   5525  O  O    . GLU A 1 117 ? 28.585  64.209 4.718   1.00 38.68 ? 117 GLU A O    2  
ATOM   5526  C  CB   . GLU A 1 117 ? 29.475  67.252 3.433   1.00 40.98 ? 117 GLU A CB   2  
ATOM   5527  C  CG   . GLU A 1 117 ? 30.515  67.147 4.549   1.00 45.91 ? 117 GLU A CG   2  
ATOM   5528  C  CD   . GLU A 1 117 ? 30.999  68.548 4.929   1.00 48.33 ? 117 GLU A CD   2  
ATOM   5529  O  OE1  . GLU A 1 117 ? 31.211  69.344 4.030   1.00 49.21 ? 117 GLU A OE1  2  
ATOM   5530  O  OE2  . GLU A 1 117 ? 31.148  68.801 6.114   1.00 42.84 ? 117 GLU A OE2  2  
ATOM   5531  H  H    . GLU A 1 117 ? 27.844  66.815 1.509   1.00 0.00  ? 117 GLU A H    2  
ATOM   5532  H  HA   . GLU A 1 117 ? 29.880  65.241 2.806   1.00 0.00  ? 117 GLU A HA   2  
ATOM   5533  H  HB2  . GLU A 1 117 ? 29.910  67.751 2.579   1.00 0.00  ? 117 GLU A HB2  2  
ATOM   5534  H  HB3  . GLU A 1 117 ? 28.627  67.819 3.787   1.00 0.00  ? 117 GLU A HB3  2  
ATOM   5535  H  HG2  . GLU A 1 117 ? 30.071  66.672 5.412   1.00 0.00  ? 117 GLU A HG2  2  
ATOM   5536  H  HG3  . GLU A 1 117 ? 31.354  66.560 4.207   1.00 0.00  ? 117 GLU A HG3  2  
ATOM   5537  N  N    . ASP A 1 118 ? 27.131  65.843 4.538   1.00 0.00  ? 118 ASP A N    2  
ATOM   5538  C  CA   . ASP A 1 118 ? 26.314  65.298 5.661   1.00 0.00  ? 118 ASP A CA   2  
ATOM   5539  C  C    . ASP A 1 118 ? 26.092  63.793 5.476   1.00 0.00  ? 118 ASP A C    2  
ATOM   5540  O  O    . ASP A 1 118 ? 26.041  63.045 6.431   1.00 0.00  ? 118 ASP A O    2  
ATOM   5541  C  CB   . ASP A 1 118 ? 24.959  66.026 5.731   1.00 0.00  ? 118 ASP A CB   2  
ATOM   5542  C  CG   . ASP A 1 118 ? 23.993  65.483 4.669   1.00 0.00  ? 118 ASP A CG   2  
ATOM   5543  O  OD1  . ASP A 1 118 ? 23.643  64.318 4.754   1.00 0.00  ? 118 ASP A OD1  2  
ATOM   5544  O  OD2  . ASP A 1 118 ? 23.615  66.243 3.797   1.00 0.00  ? 118 ASP A OD2  2  
ATOM   5545  H  H    . ASP A 1 118 ? 26.866  66.679 4.092   1.00 0.00  ? 118 ASP A H    2  
ATOM   5546  H  HA   . ASP A 1 118 ? 26.846  65.456 6.585   1.00 0.00  ? 118 ASP A HA   2  
ATOM   5547  H  HB2  . ASP A 1 118 ? 24.527  65.879 6.709   1.00 0.00  ? 118 ASP A HB2  2  
ATOM   5548  H  HB3  . ASP A 1 118 ? 25.114  67.082 5.565   1.00 0.00  ? 118 ASP A HB3  2  
ATOM   5549  N  N    . LEU A 1 119 ? 25.940  63.341 4.264   1.00 35.74 ? 119 LEU A N    2  
ATOM   5550  C  CA   . LEU A 1 119 ? 25.704  61.886 4.058   1.00 32.73 ? 119 LEU A CA   2  
ATOM   5551  C  C    . LEU A 1 119 ? 26.953  61.093 4.454   1.00 33.43 ? 119 LEU A C    2  
ATOM   5552  O  O    . LEU A 1 119 ? 26.912  60.281 5.351   1.00 35.67 ? 119 LEU A O    2  
ATOM   5553  C  CB   . LEU A 1 119 ? 25.345  61.625 2.587   1.00 28.12 ? 119 LEU A CB   2  
ATOM   5554  C  CG   . LEU A 1 119 ? 23.854  61.950 2.346   1.00 28.79 ? 119 LEU A CG   2  
ATOM   5555  C  CD1  . LEU A 1 119 ? 23.622  62.271 0.867   1.00 27.73 ? 119 LEU A CD1  2  
ATOM   5556  C  CD2  . LEU A 1 119 ? 22.983  60.744 2.736   1.00 19.25 ? 119 LEU A CD2  2  
ATOM   5557  H  H    . LEU A 1 119 ? 25.966  63.955 3.498   1.00 0.00  ? 119 LEU A H    2  
ATOM   5558  H  HA   . LEU A 1 119 ? 24.887  61.576 4.689   1.00 0.00  ? 119 LEU A HA   2  
ATOM   5559  H  HB2  . LEU A 1 119 ? 25.962  62.255 1.960   1.00 0.00  ? 119 LEU A HB2  2  
ATOM   5560  H  HB3  . LEU A 1 119 ? 25.533  60.589 2.345   1.00 0.00  ? 119 LEU A HB3  2  
ATOM   5561  H  HG   . LEU A 1 119 ? 23.570  62.807 2.942   1.00 0.00  ? 119 LEU A HG   2  
ATOM   5562  H  HD11 . LEU A 1 119 ? 24.285  63.067 0.560   1.00 0.00  ? 119 LEU A HD11 2  
ATOM   5563  H  HD12 . LEU A 1 119 ? 22.598  62.583 0.724   1.00 0.00  ? 119 LEU A HD12 2  
ATOM   5564  H  HD13 . LEU A 1 119 ? 23.817  61.391 0.273   1.00 0.00  ? 119 LEU A HD13 2  
ATOM   5565  H  HD21 . LEU A 1 119 ? 21.954  60.951 2.486   1.00 0.00  ? 119 LEU A HD21 2  
ATOM   5566  H  HD22 . LEU A 1 119 ? 23.063  60.559 3.798   1.00 0.00  ? 119 LEU A HD22 2  
ATOM   5567  H  HD23 . LEU A 1 119 ? 23.314  59.872 2.194   1.00 0.00  ? 119 LEU A HD23 2  
ATOM   5568  N  N    . VAL A 1 120 ? 28.066  61.324 3.818   1.00 31.62 ? 120 VAL A N    2  
ATOM   5569  C  CA   . VAL A 1 120 ? 29.294  60.570 4.205   1.00 34.22 ? 120 VAL A CA   2  
ATOM   5570  C  C    . VAL A 1 120 ? 29.604  60.882 5.668   1.00 36.23 ? 120 VAL A C    2  
ATOM   5571  O  O    . VAL A 1 120 ? 30.461  60.276 6.280   1.00 37.37 ? 120 VAL A O    2  
ATOM   5572  C  CB   . VAL A 1 120 ? 30.472  60.998 3.325   1.00 31.31 ? 120 VAL A CB   2  
ATOM   5573  C  CG1  . VAL A 1 120 ? 30.618  62.514 3.376   1.00 19.57 ? 120 VAL A CG1  2  
ATOM   5574  C  CG2  . VAL A 1 120 ? 31.762  60.343 3.831   1.00 27.86 ? 120 VAL A CG2  2  
ATOM   5575  H  H    . VAL A 1 120 ? 28.098  61.995 3.104   1.00 0.00  ? 120 VAL A H    2  
ATOM   5576  H  HA   . VAL A 1 120 ? 29.121  59.509 4.089   1.00 0.00  ? 120 VAL A HA   2  
ATOM   5577  H  HB   . VAL A 1 120 ? 30.285  60.691 2.306   1.00 0.00  ? 120 VAL A HB   2  
ATOM   5578  H  HG11 . VAL A 1 120 ? 29.690  62.966 3.075   1.00 0.00  ? 120 VAL A HG11 2  
ATOM   5579  H  HG12 . VAL A 1 120 ? 31.405  62.824 2.704   1.00 0.00  ? 120 VAL A HG12 2  
ATOM   5580  H  HG13 . VAL A 1 120 ? 30.860  62.821 4.383   1.00 0.00  ? 120 VAL A HG13 2  
ATOM   5581  H  HG21 . VAL A 1 120 ? 32.102  60.853 4.721   1.00 0.00  ? 120 VAL A HG21 2  
ATOM   5582  H  HG22 . VAL A 1 120 ? 32.523  60.411 3.068   1.00 0.00  ? 120 VAL A HG22 2  
ATOM   5583  H  HG23 . VAL A 1 120 ? 31.574  59.305 4.061   1.00 0.00  ? 120 VAL A HG23 2  
ATOM   5584  N  N    . ALA A 1 121 ? 28.907  61.832 6.230   1.00 0.00  ? 121 ALA A N    2  
ATOM   5585  C  CA   . ALA A 1 121 ? 29.154  62.200 7.651   1.00 0.00  ? 121 ALA A CA   2  
ATOM   5586  C  C    . ALA A 1 121 ? 28.470  61.193 8.581   1.00 0.00  ? 121 ALA A C    2  
ATOM   5587  O  O    . ALA A 1 121 ? 28.736  61.168 9.766   1.00 0.00  ? 121 ALA A O    2  
ATOM   5588  C  CB   . ALA A 1 121 ? 28.616  63.610 7.924   1.00 0.00  ? 121 ALA A CB   2  
ATOM   5589  H  H    . ALA A 1 121 ? 28.222  62.306 5.715   1.00 0.00  ? 121 ALA A H    2  
ATOM   5590  H  HA   . ALA A 1 121 ? 30.219  62.185 7.839   1.00 0.00  ? 121 ALA A HA   2  
ATOM   5591  H  HB1  . ALA A 1 121 ? 29.128  64.032 8.776   1.00 0.00  ? 121 ALA A HB1  2  
ATOM   5592  H  HB2  . ALA A 1 121 ? 27.556  63.565 8.129   1.00 0.00  ? 121 ALA A HB2  2  
ATOM   5593  H  HB3  . ALA A 1 121 ? 28.788  64.233 7.059   1.00 0.00  ? 121 ALA A HB3  2  
ATOM   5594  N  N    . ASN A 1 122 ? 27.611  60.341 8.065   1.00 0.00  ? 122 ASN A N    2  
ATOM   5595  C  CA   . ASN A 1 122 ? 26.957  59.331 8.953   1.00 0.00  ? 122 ASN A CA   2  
ATOM   5596  C  C    . ASN A 1 122 ? 27.799  58.057 8.904   1.00 0.00  ? 122 ASN A C    2  
ATOM   5597  O  O    . ASN A 1 122 ? 27.998  57.386 9.898   1.00 0.00  ? 122 ASN A O    2  
ATOM   5598  C  CB   . ASN A 1 122 ? 25.515  59.052 8.475   1.00 0.00  ? 122 ASN A CB   2  
ATOM   5599  C  CG   . ASN A 1 122 ? 25.476  58.702 6.983   1.00 0.00  ? 122 ASN A CG   2  
ATOM   5600  O  OD1  . ASN A 1 122 ? 26.454  58.271 6.413   1.00 0.00  ? 122 ASN A OD1  2  
ATOM   5601  N  ND2  . ASN A 1 122 ? 24.358  58.854 6.325   1.00 0.00  ? 122 ASN A ND2  2  
ATOM   5602  H  H    . ASN A 1 122 ? 27.422  60.343 7.102   1.00 0.00  ? 122 ASN A H    2  
ATOM   5603  H  HA   . ASN A 1 122 ? 26.929  59.699 9.971   1.00 0.00  ? 122 ASN A HA   2  
ATOM   5604  H  HB2  . ASN A 1 122 ? 25.106  58.228 9.034   1.00 0.00  ? 122 ASN A HB2  2  
ATOM   5605  H  HB3  . ASN A 1 122 ? 24.911  59.930 8.646   1.00 0.00  ? 122 ASN A HB3  2  
ATOM   5606  H  HD21 . ASN A 1 122 ? 23.558  59.185 6.786   1.00 0.00  ? 122 ASN A HD21 2  
ATOM   5607  H  HD22 . ASN A 1 122 ? 24.318  58.636 5.370   1.00 0.00  ? 122 ASN A HD22 2  
ATOM   5608  N  N    . GLY A 1 123 ? 28.287  57.721 7.741   1.00 0.00  ? 123 GLY A N    2  
ATOM   5609  C  CA   . GLY A 1 123 ? 29.116  56.492 7.576   1.00 0.00  ? 123 GLY A CA   2  
ATOM   5610  C  C    . GLY A 1 123 ? 28.702  55.771 6.289   1.00 0.00  ? 123 GLY A C    2  
ATOM   5611  O  O    . GLY A 1 123 ? 29.088  54.643 6.052   1.00 0.00  ? 123 GLY A O    2  
ATOM   5612  H  H    . GLY A 1 123 ? 28.069  58.264 6.957   1.00 0.00  ? 123 GLY A H    2  
ATOM   5613  H  HA2  . GLY A 1 123 ? 30.159  56.769 7.515   1.00 0.00  ? 123 GLY A HA2  2  
ATOM   5614  H  HA3  . GLY A 1 123 ? 28.968  55.829 8.417   1.00 0.00  ? 123 GLY A HA3  2  
ATOM   5615  N  N    . ALA A 1 124 ? 27.910  56.402 5.455   1.00 30.80 ? 124 ALA A N    2  
ATOM   5616  C  CA   . ALA A 1 124 ? 27.471  55.734 4.197   1.00 27.84 ? 124 ALA A CA   2  
ATOM   5617  C  C    . ALA A 1 124 ? 28.693  55.288 3.396   1.00 28.26 ? 124 ALA A C    2  
ATOM   5618  O  O    . ALA A 1 124 ? 28.624  54.376 2.597   1.00 31.12 ? 124 ALA A O    2  
ATOM   5619  C  CB   . ALA A 1 124 ? 26.645  56.717 3.365   1.00 24.33 ? 124 ALA A CB   2  
ATOM   5620  H  H    . ALA A 1 124 ? 27.591  57.309 5.657   1.00 0.00  ? 124 ALA A H    2  
ATOM   5621  H  HA   . ALA A 1 124 ? 26.866  54.873 4.439   1.00 0.00  ? 124 ALA A HA   2  
ATOM   5622  H  HB1  . ALA A 1 124 ? 26.074  56.174 2.627   1.00 0.00  ? 124 ALA A HB1  2  
ATOM   5623  H  HB2  . ALA A 1 124 ? 27.303  57.416 2.868   1.00 0.00  ? 124 ALA A HB2  2  
ATOM   5624  H  HB3  . ALA A 1 124 ? 25.974  57.258 4.014   1.00 0.00  ? 124 ALA A HB3  2  
ATOM   5625  N  N    . LEU A 1 125 ? 29.810  55.925 3.605   1.00 0.00  ? 125 LEU A N    2  
ATOM   5626  C  CA   . LEU A 1 125 ? 31.042  55.543 2.857   1.00 0.00  ? 125 LEU A CA   2  
ATOM   5627  C  C    . LEU A 1 125 ? 30.922  56.013 1.402   1.00 0.00  ? 125 LEU A C    2  
ATOM   5628  O  O    . LEU A 1 125 ? 29.970  55.704 0.714   1.00 0.00  ? 125 LEU A O    2  
ATOM   5629  C  CB   . LEU A 1 125 ? 31.220  54.007 2.908   1.00 0.00  ? 125 LEU A CB   2  
ATOM   5630  C  CG   . LEU A 1 125 ? 32.719  53.637 2.919   1.00 0.00  ? 125 LEU A CG   2  
ATOM   5631  C  CD1  . LEU A 1 125 ? 33.273  53.717 4.347   1.00 0.00  ? 125 LEU A CD1  2  
ATOM   5632  C  CD2  . LEU A 1 125 ? 32.904  52.209 2.393   1.00 0.00  ? 125 LEU A CD2  2  
ATOM   5633  H  H    . LEU A 1 125 ? 29.839  56.659 4.255   1.00 0.00  ? 125 LEU A H    2  
ATOM   5634  H  HA   . LEU A 1 125 ? 31.893  56.025 3.314   1.00 0.00  ? 125 LEU A HA   2  
ATOM   5635  H  HB2  . LEU A 1 125 ? 30.747  53.626 3.801   1.00 0.00  ? 125 LEU A HB2  2  
ATOM   5636  H  HB3  . LEU A 1 125 ? 30.747  53.558 2.043   1.00 0.00  ? 125 LEU A HB3  2  
ATOM   5637  H  HG   . LEU A 1 125 ? 33.264  54.325 2.287   1.00 0.00  ? 125 LEU A HG   2  
ATOM   5638  H  HD11 . LEU A 1 125 ? 32.681  53.093 5.000   1.00 0.00  ? 125 LEU A HD11 2  
ATOM   5639  H  HD12 . LEU A 1 125 ? 33.236  54.738 4.696   1.00 0.00  ? 125 LEU A HD12 2  
ATOM   5640  H  HD13 . LEU A 1 125 ? 34.297  53.373 4.354   1.00 0.00  ? 125 LEU A HD13 2  
ATOM   5641  H  HD21 . LEU A 1 125 ? 32.605  52.166 1.357   1.00 0.00  ? 125 LEU A HD21 2  
ATOM   5642  H  HD22 . LEU A 1 125 ? 32.295  51.531 2.973   1.00 0.00  ? 125 LEU A HD22 2  
ATOM   5643  H  HD23 . LEU A 1 125 ? 33.942  51.925 2.481   1.00 0.00  ? 125 LEU A HD23 2  
ATOM   5644  N  N    . VAL A 1 126 ? 31.888  56.751 0.931   1.00 21.92 ? 126 VAL A N    2  
ATOM   5645  C  CA   . VAL A 1 126 ? 31.851  57.240 -0.477  1.00 22.67 ? 126 VAL A CA   2  
ATOM   5646  C  C    . VAL A 1 126 ? 32.513  56.200 -1.375  1.00 19.37 ? 126 VAL A C    2  
ATOM   5647  O  O    . VAL A 1 126 ? 32.710  56.418 -2.550  1.00 18.80 ? 126 VAL A O    2  
ATOM   5648  C  CB   . VAL A 1 126 ? 32.610  58.564 -0.580  1.00 22.73 ? 126 VAL A CB   2  
ATOM   5649  C  CG1  . VAL A 1 126 ? 31.940  59.605 0.318   1.00 31.25 ? 126 VAL A CG1  2  
ATOM   5650  C  CG2  . VAL A 1 126 ? 34.059  58.358 -0.129  1.00 14.06 ? 126 VAL A CG2  2  
ATOM   5651  H  H    . VAL A 1 126 ? 32.644  56.980 1.502   1.00 0.00  ? 126 VAL A H    2  
ATOM   5652  H  HA   . VAL A 1 126 ? 30.826  57.386 -0.788  1.00 0.00  ? 126 VAL A HA   2  
ATOM   5653  H  HB   . VAL A 1 126 ? 32.595  58.908 -1.604  1.00 0.00  ? 126 VAL A HB   2  
ATOM   5654  H  HG11 . VAL A 1 126 ? 31.711  59.159 1.274   1.00 0.00  ? 126 VAL A HG11 2  
ATOM   5655  H  HG12 . VAL A 1 126 ? 31.027  59.947 -0.147  1.00 0.00  ? 126 VAL A HG12 2  
ATOM   5656  H  HG13 . VAL A 1 126 ? 32.607  60.442 0.460   1.00 0.00  ? 126 VAL A HG13 2  
ATOM   5657  H  HG21 . VAL A 1 126 ? 34.560  59.313 -0.081  1.00 0.00  ? 126 VAL A HG21 2  
ATOM   5658  H  HG22 . VAL A 1 126 ? 34.568  57.718 -0.834  1.00 0.00  ? 126 VAL A HG22 2  
ATOM   5659  H  HG23 . VAL A 1 126 ? 34.069  57.897 0.848   1.00 0.00  ? 126 VAL A HG23 2  
ATOM   5660  N  N    . SER A 1 127 ? 32.875  55.074 -0.810  1.00 0.00  ? 127 SER A N    2  
ATOM   5661  C  CA   . SER A 1 127 ? 33.541  53.991 -1.600  1.00 0.00  ? 127 SER A CA   2  
ATOM   5662  C  C    . SER A 1 127 ? 32.592  52.796 -1.727  1.00 0.00  ? 127 SER A C    2  
ATOM   5663  O  O    . SER A 1 127 ? 33.019  51.666 -1.851  1.00 0.00  ? 127 SER A O    2  
ATOM   5664  C  CB   . SER A 1 127 ? 34.813  53.551 -0.875  1.00 0.00  ? 127 SER A CB   2  
ATOM   5665  O  OG   . SER A 1 127 ? 35.452  52.528 -1.627  1.00 0.00  ? 127 SER A OG   2  
ATOM   5666  H  H    . SER A 1 127 ? 32.721  54.954 0.150   1.00 0.00  ? 127 SER A H    2  
ATOM   5667  H  HA   . SER A 1 127 ? 33.798  54.351 -2.587  1.00 0.00  ? 127 SER A HA   2  
ATOM   5668  H  HB2  . SER A 1 127 ? 35.483  54.389 -0.777  1.00 0.00  ? 127 SER A HB2  2  
ATOM   5669  H  HB3  . SER A 1 127 ? 34.556  53.182 0.109   1.00 0.00  ? 127 SER A HB3  2  
ATOM   5670  H  HG   . SER A 1 127 ? 34.885  52.307 -2.369  1.00 0.00  ? 127 SER A HG   2  
ATOM   5671  N  N    . ILE A 1 128 ? 31.307  53.033 -1.695  1.00 0.00  ? 128 ILE A N    2  
ATOM   5672  C  CA   . ILE A 1 128 ? 30.342  51.894 -1.814  1.00 0.00  ? 128 ILE A CA   2  
ATOM   5673  C  C    . ILE A 1 128 ? 30.551  51.180 -3.158  1.00 0.00  ? 128 ILE A C    2  
ATOM   5674  O  O    . ILE A 1 128 ? 30.741  49.984 -3.193  1.00 0.00  ? 128 ILE A O    2  
ATOM   5675  C  CB   . ILE A 1 128 ? 28.902  52.409 -1.709  1.00 0.00  ? 128 ILE A CB   2  
ATOM   5676  C  CG1  . ILE A 1 128 ? 28.644  52.899 -0.281  1.00 0.00  ? 128 ILE A CG1  2  
ATOM   5677  C  CG2  . ILE A 1 128 ? 27.922  51.279 -2.038  1.00 0.00  ? 128 ILE A CG2  2  
ATOM   5678  C  CD1  . ILE A 1 128 ? 27.360  53.728 -0.249  1.00 0.00  ? 128 ILE A CD1  2  
ATOM   5679  H  H    . ILE A 1 128 ? 30.980  53.960 -1.592  1.00 0.00  ? 128 ILE A H    2  
ATOM   5680  H  HA   . ILE A 1 128 ? 30.527  51.192 -1.012  1.00 0.00  ? 128 ILE A HA   2  
ATOM   5681  H  HB   . ILE A 1 128 ? 28.755  53.222 -2.401  1.00 0.00  ? 128 ILE A HB   2  
ATOM   5682  H  HG12 . ILE A 1 128 ? 28.542  52.049 0.378   1.00 0.00  ? 128 ILE A HG12 2  
ATOM   5683  H  HG13 . ILE A 1 128 ? 29.473  53.509 0.044   1.00 0.00  ? 128 ILE A HG13 2  
ATOM   5684  H  HG21 . ILE A 1 128 ? 28.215  50.384 -1.509  1.00 0.00  ? 128 ILE A HG21 2  
ATOM   5685  H  HG22 . ILE A 1 128 ? 27.936  51.090 -3.101  1.00 0.00  ? 128 ILE A HG22 2  
ATOM   5686  H  HG23 . ILE A 1 128 ? 26.926  51.566 -1.736  1.00 0.00  ? 128 ILE A HG23 2  
ATOM   5687  H  HD11 . ILE A 1 128 ? 27.093  53.939 0.776   1.00 0.00  ? 128 ILE A HD11 2  
ATOM   5688  H  HD12 . ILE A 1 128 ? 26.562  53.175 -0.722  1.00 0.00  ? 128 ILE A HD12 2  
ATOM   5689  H  HD13 . ILE A 1 128 ? 27.517  54.656 -0.778  1.00 0.00  ? 128 ILE A HD13 2  
ATOM   5690  N  N    . CYS A 1 129 ? 30.500  51.918 -4.249  1.00 0.00  ? 129 CYS A N    2  
ATOM   5691  C  CA   . CYS A 1 129 ? 30.685  51.346 -5.628  1.00 0.00  ? 129 CYS A CA   2  
ATOM   5692  C  C    . CYS A 1 129 ? 29.322  50.995 -6.210  1.00 0.00  ? 129 CYS A C    2  
ATOM   5693  O  O    . CYS A 1 129 ? 28.794  49.925 -5.983  1.00 0.00  ? 129 CYS A O    2  
ATOM   5694  C  CB   . CYS A 1 129 ? 31.587  50.102 -5.630  1.00 0.00  ? 129 CYS A CB   2  
ATOM   5695  S  SG   . CYS A 1 129 ? 33.016  50.372 -4.549  1.00 0.00  ? 129 CYS A SG   2  
ATOM   5696  H  H    . CYS A 1 129 ? 30.322  52.873 -4.164  1.00 0.00  ? 129 CYS A H    2  
ATOM   5697  H  HA   . CYS A 1 129 ? 31.137  52.101 -6.253  1.00 0.00  ? 129 CYS A HA   2  
ATOM   5698  H  HB2  . CYS A 1 129 ? 31.029  49.241 -5.297  1.00 0.00  ? 129 CYS A HB2  2  
ATOM   5699  H  HB3  . CYS A 1 129 ? 31.935  49.924 -6.638  1.00 0.00  ? 129 CYS A HB3  2  
ATOM   5700  H  HG   . CYS A 1 129 ? 32.976  49.729 -3.838  1.00 0.00  ? 129 CYS A HG   2  
ATOM   5701  N  N    . ASN A 1 130 ? 28.742  51.894 -6.962  1.00 0.00  ? 130 ASN A N    2  
ATOM   5702  C  CA   . ASN A 1 130 ? 27.412  51.610 -7.554  1.00 0.00  ? 130 ASN A CA   2  
ATOM   5703  C  C    . ASN A 1 130 ? 27.446  50.253 -8.251  1.00 0.00  ? 130 ASN A C    2  
ATOM   5704  O  O    . ASN A 1 130 ? 28.464  49.595 -8.321  1.00 0.00  ? 130 ASN A O    2  
ATOM   5705  C  CB   . ASN A 1 130 ? 27.056  52.702 -8.576  1.00 0.00  ? 130 ASN A CB   2  
ATOM   5706  C  CG   . ASN A 1 130 ? 25.536  52.780 -8.749  1.00 0.00  ? 130 ASN A CG   2  
ATOM   5707  O  OD1  . ASN A 1 130 ? 24.830  51.834 -8.457  1.00 0.00  ? 130 ASN A OD1  2  
ATOM   5708  N  ND2  . ASN A 1 130 ? 25.000  53.875 -9.215  1.00 0.00  ? 130 ASN A ND2  2  
ATOM   5709  H  H    . ASN A 1 130 ? 29.181  52.757 -7.134  1.00 0.00  ? 130 ASN A H    2  
ATOM   5710  H  HA   . ASN A 1 130 ? 26.670  51.592 -6.768  1.00 0.00  ? 130 ASN A HA   2  
ATOM   5711  H  HB2  . ASN A 1 130 ? 27.427  53.651 -8.227  1.00 0.00  ? 130 ASN A HB2  2  
ATOM   5712  H  HB3  . ASN A 1 130 ? 27.510  52.473 -9.529  1.00 0.00  ? 130 ASN A HB3  2  
ATOM   5713  H  HD21 . ASN A 1 130 ? 25.569  54.637 -9.450  1.00 0.00  ? 130 ASN A HD21 2  
ATOM   5714  H  HD22 . ASN A 1 130 ? 24.028  53.934 -9.329  1.00 0.00  ? 130 ASN A HD22 2  
ATOM   5715  N  N    . LYS A 1 131 ? 26.334  49.845 -8.770  1.00 0.00  ? 131 LYS A N    2  
ATOM   5716  C  CA   . LYS A 1 131 ? 26.271  48.537 -9.479  1.00 0.00  ? 131 LYS A CA   2  
ATOM   5717  C  C    . LYS A 1 131 ? 27.322  48.527 -10.598 1.00 0.00  ? 131 LYS A C    2  
ATOM   5718  O  O    . LYS A 1 131 ? 27.711  47.485 -11.088 1.00 0.00  ? 131 LYS A O    2  
ATOM   5719  C  CB   . LYS A 1 131 ? 24.854  48.322 -10.050 1.00 0.00  ? 131 LYS A CB   2  
ATOM   5720  C  CG   . LYS A 1 131 ? 24.709  48.992 -11.428 1.00 0.00  ? 131 LYS A CG   2  
ATOM   5721  C  CD   . LYS A 1 131 ? 23.221  49.211 -11.763 1.00 0.00  ? 131 LYS A CD   2  
ATOM   5722  C  CE   . LYS A 1 131 ? 22.741  50.545 -11.182 1.00 0.00  ? 131 LYS A CE   2  
ATOM   5723  N  NZ   . LYS A 1 131 ? 21.321  50.774 -11.572 1.00 0.00  ? 131 LYS A NZ   2  
ATOM   5724  H  H    . LYS A 1 131 ? 25.540  50.407 -8.695  1.00 0.00  ? 131 LYS A H    2  
ATOM   5725  H  HA   . LYS A 1 131 ? 26.496  47.747 -8.778  1.00 0.00  ? 131 LYS A HA   2  
ATOM   5726  H  HB2  . LYS A 1 131 ? 24.669  47.262 -10.151 1.00 0.00  ? 131 LYS A HB2  2  
ATOM   5727  H  HB3  . LYS A 1 131 ? 24.131  48.744 -9.369  1.00 0.00  ? 131 LYS A HB3  2  
ATOM   5728  H  HG2  . LYS A 1 131 ? 25.227  49.941 -11.421 1.00 0.00  ? 131 LYS A HG2  2  
ATOM   5729  H  HG3  . LYS A 1 131 ? 25.151  48.351 -12.176 1.00 0.00  ? 131 LYS A HG3  2  
ATOM   5730  H  HD2  . LYS A 1 131 ? 23.095  49.225 -12.837 1.00 0.00  ? 131 LYS A HD2  2  
ATOM   5731  H  HD3  . LYS A 1 131 ? 22.630  48.407 -11.347 1.00 0.00  ? 131 LYS A HD3  2  
ATOM   5732  H  HE2  . LYS A 1 131 ? 22.820  50.519 -10.106 1.00 0.00  ? 131 LYS A HE2  2  
ATOM   5733  H  HE3  . LYS A 1 131 ? 23.354  51.346 -11.568 1.00 0.00  ? 131 LYS A HE3  2  
ATOM   5734  H  HZ1  . LYS A 1 131 ? 21.265  51.588 -12.215 1.00 0.00  ? 131 LYS A HZ1  2  
ATOM   5735  H  HZ2  . LYS A 1 131 ? 20.754  50.963 -10.720 1.00 0.00  ? 131 LYS A HZ2  2  
ATOM   5736  H  HZ3  . LYS A 1 131 ? 20.954  49.929 -12.054 1.00 0.00  ? 131 LYS A HZ3  2  
ATOM   5737  N  N    . TYR A 1 132 ? 27.790  49.689 -10.991 1.00 0.00  ? 132 TYR A N    2  
ATOM   5738  C  CA   . TYR A 1 132 ? 28.828  49.783 -12.067 1.00 0.00  ? 132 TYR A CA   2  
ATOM   5739  C  C    . TYR A 1 132 ? 30.008  50.598 -11.533 1.00 0.00  ? 132 TYR A C    2  
ATOM   5740  O  O    . TYR A 1 132 ? 30.853  51.052 -12.279 1.00 0.00  ? 132 TYR A O    2  
ATOM   5741  C  CB   . TYR A 1 132 ? 28.240  50.493 -13.294 1.00 0.00  ? 132 TYR A CB   2  
ATOM   5742  C  CG   . TYR A 1 132 ? 27.361  49.536 -14.071 1.00 0.00  ? 132 TYR A CG   2  
ATOM   5743  C  CD1  . TYR A 1 132 ? 27.924  48.409 -14.683 1.00 0.00  ? 132 TYR A CD1  2  
ATOM   5744  C  CD2  . TYR A 1 132 ? 25.984  49.777 -14.183 1.00 0.00  ? 132 TYR A CD2  2  
ATOM   5745  C  CE1  . TYR A 1 132 ? 27.113  47.525 -15.404 1.00 0.00  ? 132 TYR A CE1  2  
ATOM   5746  C  CE2  . TYR A 1 132 ? 25.174  48.892 -14.905 1.00 0.00  ? 132 TYR A CE2  2  
ATOM   5747  C  CZ   . TYR A 1 132 ? 25.739  47.766 -15.515 1.00 0.00  ? 132 TYR A CZ   2  
ATOM   5748  O  OH   . TYR A 1 132 ? 24.940  46.893 -16.226 1.00 0.00  ? 132 TYR A OH   2  
ATOM   5749  H  H    . TYR A 1 132 ? 27.470  50.511 -10.565 1.00 0.00  ? 132 TYR A H    2  
ATOM   5750  H  HA   . TYR A 1 132 ? 29.172  48.796 -12.346 1.00 0.00  ? 132 TYR A HA   2  
ATOM   5751  H  HB2  . TYR A 1 132 ? 27.655  51.342 -12.969 1.00 0.00  ? 132 TYR A HB2  2  
ATOM   5752  H  HB3  . TYR A 1 132 ? 29.043  50.836 -13.931 1.00 0.00  ? 132 TYR A HB3  2  
ATOM   5753  H  HD1  . TYR A 1 132 ? 28.984  48.222 -14.600 1.00 0.00  ? 132 TYR A HD1  2  
ATOM   5754  H  HD2  . TYR A 1 132 ? 25.547  50.646 -13.712 1.00 0.00  ? 132 TYR A HD2  2  
ATOM   5755  H  HE1  . TYR A 1 132 ? 27.548  46.655 -15.875 1.00 0.00  ? 132 TYR A HE1  2  
ATOM   5756  H  HE2  . TYR A 1 132 ? 24.114  49.078 -14.991 1.00 0.00  ? 132 TYR A HE2  2  
ATOM   5757  H  HH   . TYR A 1 132 ? 25.168  45.999 -15.962 1.00 0.00  ? 132 TYR A HH   2  
ATOM   5758  N  N    . GLY A 1 133 ? 30.071  50.782 -10.242 1.00 0.00  ? 133 GLY A N    2  
ATOM   5759  C  CA   . GLY A 1 133 ? 31.190  51.559 -9.647  1.00 0.00  ? 133 GLY A CA   2  
ATOM   5760  C  C    . GLY A 1 133 ? 30.972  53.040 -9.914  1.00 0.00  ? 133 GLY A C    2  
ATOM   5761  O  O    . GLY A 1 133 ? 31.873  53.846 -9.792  1.00 0.00  ? 133 GLY A O    2  
ATOM   5762  H  H    . GLY A 1 133 ? 29.384  50.402 -9.663  1.00 0.00  ? 133 GLY A H    2  
ATOM   5763  H  HA2  . GLY A 1 133 ? 31.224  51.385 -8.582  1.00 0.00  ? 133 GLY A HA2  2  
ATOM   5764  H  HA3  . GLY A 1 133 ? 32.114  51.253 -10.091 1.00 0.00  ? 133 GLY A HA3  2  
ATOM   5765  N  N    . GLU A 1 134 ? 29.781  53.404 -10.276 1.00 0.00  ? 134 GLU A N    2  
ATOM   5766  C  CA   . GLU A 1 134 ? 29.501  54.837 -10.542 1.00 0.00  ? 134 GLU A CA   2  
ATOM   5767  C  C    . GLU A 1 134 ? 29.545  55.588 -9.213  1.00 0.00  ? 134 GLU A C    2  
ATOM   5768  O  O    . GLU A 1 134 ? 28.550  55.689 -8.519  1.00 0.00  ? 134 GLU A O    2  
ATOM   5769  C  CB   . GLU A 1 134 ? 28.115  54.984 -11.173 1.00 0.00  ? 134 GLU A CB   2  
ATOM   5770  C  CG   . GLU A 1 134 ? 27.914  56.427 -11.641 1.00 0.00  ? 134 GLU A CG   2  
ATOM   5771  C  CD   . GLU A 1 134 ? 28.783  56.692 -12.872 1.00 0.00  ? 134 GLU A CD   2  
ATOM   5772  O  OE1  . GLU A 1 134 ? 29.942  57.027 -12.693 1.00 0.00  ? 134 GLU A OE1  2  
ATOM   5773  O  OE2  . GLU A 1 134 ? 28.275  56.553 -13.972 1.00 0.00  ? 134 GLU A OE2  2  
ATOM   5774  H  H    . GLU A 1 134 ? 29.071  52.735 -10.367 1.00 0.00  ? 134 GLU A H    2  
ATOM   5775  H  HA   . GLU A 1 134 ? 30.250  55.225 -11.209 1.00 0.00  ? 134 GLU A HA   2  
ATOM   5776  H  HB2  . GLU A 1 134 ? 28.031  54.316 -12.018 1.00 0.00  ? 134 GLU A HB2  2  
ATOM   5777  H  HB3  . GLU A 1 134 ? 27.360  54.736 -10.442 1.00 0.00  ? 134 GLU A HB3  2  
ATOM   5778  H  HG2  . GLU A 1 134 ? 26.875  56.582 -11.893 1.00 0.00  ? 134 GLU A HG2  2  
ATOM   5779  H  HG3  . GLU A 1 134 ? 28.198  57.105 -10.851 1.00 0.00  ? 134 GLU A HG3  2  
ATOM   5780  N  N    . MET A 1 135 ? 30.697  56.083 -8.824  1.00 0.00  ? 135 MET A N    2  
ATOM   5781  C  CA   . MET A 1 135 ? 30.832  56.793 -7.515  1.00 0.00  ? 135 MET A CA   2  
ATOM   5782  C  C    . MET A 1 135 ? 31.218  58.260 -7.771  1.00 0.00  ? 135 MET A C    2  
ATOM   5783  O  O    . MET A 1 135 ? 31.724  58.563 -8.834  1.00 0.00  ? 135 MET A O    2  
ATOM   5784  C  CB   . MET A 1 135 ? 31.967  56.093 -6.762  1.00 0.00  ? 135 MET A CB   2  
ATOM   5785  C  CG   . MET A 1 135 ? 31.605  54.622 -6.575  1.00 0.00  ? 135 MET A CG   2  
ATOM   5786  S  SD   . MET A 1 135 ? 30.143  54.492 -5.515  1.00 0.00  ? 135 MET A SD   2  
ATOM   5787  C  CE   . MET A 1 135 ? 30.911  55.085 -3.989  1.00 0.00  ? 135 MET A CE   2  
ATOM   5788  H  H    . MET A 1 135 ? 31.511  55.976 -9.359  1.00 0.00  ? 135 MET A H    2  
ATOM   5789  H  HA   . MET A 1 135 ? 29.919  56.728 -6.954  1.00 0.00  ? 135 MET A HA   2  
ATOM   5790  H  HB2  . MET A 1 135 ? 32.876  56.165 -7.341  1.00 0.00  ? 135 MET A HB2  2  
ATOM   5791  H  HB3  . MET A 1 135 ? 32.120  56.548 -5.807  1.00 0.00  ? 135 MET A HB3  2  
ATOM   5792  H  HG2  . MET A 1 135 ? 31.391  54.182 -7.535  1.00 0.00  ? 135 MET A HG2  2  
ATOM   5793  H  HG3  . MET A 1 135 ? 32.432  54.101 -6.119  1.00 0.00  ? 135 MET A HG3  2  
ATOM   5794  H  HE1  . MET A 1 135 ? 30.392  54.668 -3.144  1.00 0.00  ? 135 MET A HE1  2  
ATOM   5795  H  HE2  . MET A 1 135 ? 30.848  56.157 -3.942  1.00 0.00  ? 135 MET A HE2  2  
ATOM   5796  H  HE3  . MET A 1 135 ? 31.949  54.782 -3.968  1.00 0.00  ? 135 MET A HE3  2  
ATOM   5797  N  N    . PRO A 1 136 ? 31.003  59.148 -6.808  1.00 0.00  ? 136 PRO A N    2  
ATOM   5798  C  CA   . PRO A 1 136 ? 31.381  60.555 -7.006  1.00 0.00  ? 136 PRO A CA   2  
ATOM   5799  C  C    . PRO A 1 136 ? 32.907  60.629 -7.123  1.00 0.00  ? 136 PRO A C    2  
ATOM   5800  O  O    . PRO A 1 136 ? 33.454  61.475 -7.794  1.00 0.00  ? 136 PRO A O    2  
ATOM   5801  C  CB   . PRO A 1 136 ? 30.872  61.298 -5.747  1.00 0.00  ? 136 PRO A CB   2  
ATOM   5802  C  CG   . PRO A 1 136 ? 30.210  60.239 -4.818  1.00 0.00  ? 136 PRO A CG   2  
ATOM   5803  C  CD   . PRO A 1 136 ? 30.391  58.855 -5.483  1.00 0.00  ? 136 PRO A CD   2  
ATOM   5804  H  HA   . PRO A 1 136 ? 30.916  60.950 -7.892  1.00 0.00  ? 136 PRO A HA   2  
ATOM   5805  H  HB2  . PRO A 1 136 ? 31.698  61.779 -5.233  1.00 0.00  ? 136 PRO A HB2  2  
ATOM   5806  H  HB3  . PRO A 1 136 ? 30.141  62.043 -6.027  1.00 0.00  ? 136 PRO A HB3  2  
ATOM   5807  H  HG2  . PRO A 1 136 ? 30.690  60.252 -3.845  1.00 0.00  ? 136 PRO A HG2  2  
ATOM   5808  H  HG3  . PRO A 1 136 ? 29.156  60.454 -4.703  1.00 0.00  ? 136 PRO A HG3  2  
ATOM   5809  H  HD2  . PRO A 1 136 ? 31.053  58.253 -4.885  1.00 0.00  ? 136 PRO A HD2  2  
ATOM   5810  H  HD3  . PRO A 1 136 ? 29.437  58.367 -5.596  1.00 0.00  ? 136 PRO A HD3  2  
ATOM   5811  N  N    . VAL A 1 137 ? 33.581  59.724 -6.473  1.00 0.00  ? 137 VAL A N    2  
ATOM   5812  C  CA   . VAL A 1 137 ? 35.069  59.693 -6.518  1.00 0.00  ? 137 VAL A CA   2  
ATOM   5813  C  C    . VAL A 1 137 ? 35.560  59.820 -7.966  1.00 0.00  ? 137 VAL A C    2  
ATOM   5814  O  O    . VAL A 1 137 ? 36.487  60.553 -8.257  1.00 0.00  ? 137 VAL A O    2  
ATOM   5815  C  CB   . VAL A 1 137 ? 35.536  58.358 -5.929  1.00 0.00  ? 137 VAL A CB   2  
ATOM   5816  C  CG1  . VAL A 1 137 ? 37.040  58.392 -5.680  1.00 0.00  ? 137 VAL A CG1  2  
ATOM   5817  C  CG2  . VAL A 1 137 ? 34.813  58.108 -4.602  1.00 0.00  ? 137 VAL A CG2  2  
ATOM   5818  H  H    . VAL A 1 137 ? 33.103  59.044 -5.955  1.00 0.00  ? 137 VAL A H    2  
ATOM   5819  H  HA   . VAL A 1 137 ? 35.467  60.505 -5.928  1.00 0.00  ? 137 VAL A HA   2  
ATOM   5820  H  HB   . VAL A 1 137 ? 35.305  57.561 -6.620  1.00 0.00  ? 137 VAL A HB   2  
ATOM   5821  H  HG11 . VAL A 1 137 ? 37.292  59.277 -5.114  1.00 0.00  ? 137 VAL A HG11 2  
ATOM   5822  H  HG12 . VAL A 1 137 ? 37.562  58.405 -6.624  1.00 0.00  ? 137 VAL A HG12 2  
ATOM   5823  H  HG13 . VAL A 1 137 ? 37.327  57.514 -5.120  1.00 0.00  ? 137 VAL A HG13 2  
ATOM   5824  H  HG21 . VAL A 1 137 ? 33.789  57.829 -4.796  1.00 0.00  ? 137 VAL A HG21 2  
ATOM   5825  H  HG22 . VAL A 1 137 ? 34.834  59.008 -4.005  1.00 0.00  ? 137 VAL A HG22 2  
ATOM   5826  H  HG23 . VAL A 1 137 ? 35.307  57.310 -4.066  1.00 0.00  ? 137 VAL A HG23 2  
ATOM   5827  N  N    . ASP A 1 138 ? 34.948  59.112 -8.874  1.00 0.00  ? 138 ASP A N    2  
ATOM   5828  C  CA   . ASP A 1 138 ? 35.378  59.184 -10.299 1.00 0.00  ? 138 ASP A CA   2  
ATOM   5829  C  C    . ASP A 1 138 ? 34.734  60.403 -10.949 1.00 0.00  ? 138 ASP A C    2  
ATOM   5830  O  O    . ASP A 1 138 ? 35.396  61.224 -11.554 1.00 0.00  ? 138 ASP A O    2  
ATOM   5831  C  CB   . ASP A 1 138 ? 34.932  57.917 -11.032 1.00 0.00  ? 138 ASP A CB   2  
ATOM   5832  C  CG   . ASP A 1 138 ? 35.402  57.974 -12.486 1.00 0.00  ? 138 ASP A CG   2  
ATOM   5833  O  OD1  . ASP A 1 138 ? 36.510  57.536 -12.748 1.00 0.00  ? 138 ASP A OD1  2  
ATOM   5834  O  OD2  . ASP A 1 138 ? 34.646  58.455 -13.314 1.00 0.00  ? 138 ASP A OD2  2  
ATOM   5835  H  H    . ASP A 1 138 ? 34.205  58.535 -8.620  1.00 0.00  ? 138 ASP A H    2  
ATOM   5836  H  HA   . ASP A 1 138 ? 36.454  59.272 -10.351 1.00 0.00  ? 138 ASP A HA   2  
ATOM   5837  H  HB2  . ASP A 1 138 ? 35.361  57.052 -10.548 1.00 0.00  ? 138 ASP A HB2  2  
ATOM   5838  H  HB3  . ASP A 1 138 ? 33.855  57.847 -11.007 1.00 0.00  ? 138 ASP A HB3  2  
ATOM   5839  N  N    . LYS A 1 139 ? 33.445  60.532 -10.827 1.00 0.00  ? 139 LYS A N    2  
ATOM   5840  C  CA   . LYS A 1 139 ? 32.776  61.709 -11.434 1.00 0.00  ? 139 LYS A CA   2  
ATOM   5841  C  C    . LYS A 1 139 ? 33.356  62.966 -10.792 1.00 0.00  ? 139 LYS A C    2  
ATOM   5842  O  O    . LYS A 1 139 ? 33.129  64.067 -11.243 1.00 0.00  ? 139 LYS A O    2  
ATOM   5843  C  CB   . LYS A 1 139 ? 31.265  61.645 -11.183 1.00 0.00  ? 139 LYS A CB   2  
ATOM   5844  C  CG   . LYS A 1 139 ? 30.650  60.454 -11.939 1.00 0.00  ? 139 LYS A CG   2  
ATOM   5845  C  CD   . LYS A 1 139 ? 30.346  60.845 -13.392 1.00 0.00  ? 139 LYS A CD   2  
ATOM   5846  C  CE   . LYS A 1 139 ? 29.610  59.697 -14.085 1.00 0.00  ? 139 LYS A CE   2  
ATOM   5847  N  NZ   . LYS A 1 139 ? 28.403  59.331 -13.292 1.00 0.00  ? 139 LYS A NZ   2  
ATOM   5848  H  H    . LYS A 1 139 ? 32.928  59.856 -10.336 1.00 0.00  ? 139 LYS A H    2  
ATOM   5849  H  HA   . LYS A 1 139 ? 32.970  61.726 -12.496 1.00 0.00  ? 139 LYS A HA   2  
ATOM   5850  H  HB2  . LYS A 1 139 ? 31.088  61.527 -10.125 1.00 0.00  ? 139 LYS A HB2  2  
ATOM   5851  H  HB3  . LYS A 1 139 ? 30.807  62.564 -11.519 1.00 0.00  ? 139 LYS A HB3  2  
ATOM   5852  H  HG2  . LYS A 1 139 ? 31.339  59.622 -11.928 1.00 0.00  ? 139 LYS A HG2  2  
ATOM   5853  H  HG3  . LYS A 1 139 ? 29.731  60.160 -11.453 1.00 0.00  ? 139 LYS A HG3  2  
ATOM   5854  H  HD2  . LYS A 1 139 ? 29.726  61.729 -13.407 1.00 0.00  ? 139 LYS A HD2  2  
ATOM   5855  H  HD3  . LYS A 1 139 ? 31.269  61.043 -13.915 1.00 0.00  ? 139 LYS A HD3  2  
ATOM   5856  H  HE2  . LYS A 1 139 ? 29.309  60.008 -15.075 1.00 0.00  ? 139 LYS A HE2  2  
ATOM   5857  H  HE3  . LYS A 1 139 ? 30.265  58.842 -14.161 1.00 0.00  ? 139 LYS A HE3  2  
ATOM   5858  H  HZ1  . LYS A 1 139 ? 28.697  58.894 -12.395 1.00 0.00  ? 139 LYS A HZ1  2  
ATOM   5859  H  HZ2  . LYS A 1 139 ? 27.824  58.657 -13.834 1.00 0.00  ? 139 LYS A HZ2  2  
ATOM   5860  H  HZ3  . LYS A 1 139 ? 27.846  60.185 -13.092 1.00 0.00  ? 139 LYS A HZ3  2  
ATOM   5861  N  N    . ALA A 1 140 ? 34.117  62.808 -9.738  1.00 16.48 ? 140 ALA A N    2  
ATOM   5862  C  CA   . ALA A 1 140 ? 34.724  63.994 -9.063  1.00 12.13 ? 140 ALA A CA   2  
ATOM   5863  C  C    . ALA A 1 140 ? 36.096  64.260 -9.658  1.00 16.12 ? 140 ALA A C    2  
ATOM   5864  O  O    . ALA A 1 140 ? 36.508  65.389 -9.840  1.00 20.15 ? 140 ALA A O    2  
ATOM   5865  C  CB   . ALA A 1 140 ? 34.877  63.709 -7.570  1.00 8.08  ? 140 ALA A CB   2  
ATOM   5866  H  H    . ALA A 1 140 ? 34.298  61.905 -9.389  1.00 0.00  ? 140 ALA A H    2  
ATOM   5867  H  HA   . ALA A 1 140 ? 34.100  64.855 -9.205  1.00 0.00  ? 140 ALA A HA   2  
ATOM   5868  H  HB1  . ALA A 1 140 ? 35.376  62.761 -7.435  1.00 0.00  ? 140 ALA A HB1  2  
ATOM   5869  H  HB2  . ALA A 1 140 ? 33.903  63.674 -7.107  1.00 0.00  ? 140 ALA A HB2  2  
ATOM   5870  H  HB3  . ALA A 1 140 ? 35.466  64.491 -7.115  1.00 0.00  ? 140 ALA A HB3  2  
ATOM   5871  N  N    . LYS A 1 141 ? 36.803  63.220 -9.961  1.00 0.00  ? 141 LYS A N    2  
ATOM   5872  C  CA   . LYS A 1 141 ? 38.159  63.376 -10.549 1.00 0.00  ? 141 LYS A CA   2  
ATOM   5873  C  C    . LYS A 1 141 ? 38.047  63.629 -12.055 1.00 0.00  ? 141 LYS A C    2  
ATOM   5874  O  O    . LYS A 1 141 ? 39.034  63.860 -12.724 1.00 0.00  ? 141 LYS A O    2  
ATOM   5875  C  CB   . LYS A 1 141 ? 38.975  62.098 -10.295 1.00 0.00  ? 141 LYS A CB   2  
ATOM   5876  C  CG   . LYS A 1 141 ? 40.379  62.206 -10.950 1.00 0.00  ? 141 LYS A CG   2  
ATOM   5877  C  CD   . LYS A 1 141 ? 40.409  61.453 -12.296 1.00 0.00  ? 141 LYS A CD   2  
ATOM   5878  C  CE   . LYS A 1 141 ? 40.678  59.964 -12.056 1.00 0.00  ? 141 LYS A CE   2  
ATOM   5879  N  NZ   . LYS A 1 141 ? 40.600  59.231 -13.351 1.00 0.00  ? 141 LYS A NZ   2  
ATOM   5880  H  H    . LYS A 1 141 ? 36.436  62.328 -9.798  1.00 0.00  ? 141 LYS A H    2  
ATOM   5881  H  HA   . LYS A 1 141 ? 38.655  64.213 -10.085 1.00 0.00  ? 141 LYS A HA   2  
ATOM   5882  H  HB2  . LYS A 1 141 ? 39.086  61.962 -9.227  1.00 0.00  ? 141 LYS A HB2  2  
ATOM   5883  H  HB3  . LYS A 1 141 ? 38.444  61.250 -10.704 1.00 0.00  ? 141 LYS A HB3  2  
ATOM   5884  H  HG2  . LYS A 1 141 ? 40.627  63.246 -11.118 1.00 0.00  ? 141 LYS A HG2  2  
ATOM   5885  H  HG3  . LYS A 1 141 ? 41.118  61.776 -10.287 1.00 0.00  ? 141 LYS A HG3  2  
ATOM   5886  H  HD2  . LYS A 1 141 ? 39.459  61.566 -12.796 1.00 0.00  ? 141 LYS A HD2  2  
ATOM   5887  H  HD3  . LYS A 1 141 ? 41.192  61.861 -12.918 1.00 0.00  ? 141 LYS A HD3  2  
ATOM   5888  H  HE2  . LYS A 1 141 ? 41.663  59.840 -11.631 1.00 0.00  ? 141 LYS A HE2  2  
ATOM   5889  H  HE3  . LYS A 1 141 ? 39.940  59.570 -11.374 1.00 0.00  ? 141 LYS A HE3  2  
ATOM   5890  H  HZ1  . LYS A 1 141 ? 41.230  59.682 -14.044 1.00 0.00  ? 141 LYS A HZ1  2  
ATOM   5891  H  HZ2  . LYS A 1 141 ? 39.621  59.254 -13.704 1.00 0.00  ? 141 LYS A HZ2  2  
ATOM   5892  H  HZ3  . LYS A 1 141 ? 40.895  58.244 -13.210 1.00 0.00  ? 141 LYS A HZ3  2  
ATOM   5893  N  N    . ALA A 1 142 ? 36.856  63.607 -12.607 1.00 0.00  ? 142 ALA A N    2  
ATOM   5894  C  CA   . ALA A 1 142 ? 36.716  63.863 -14.074 1.00 0.00  ? 142 ALA A CA   2  
ATOM   5895  C  C    . ALA A 1 142 ? 36.599  65.384 -14.347 1.00 0.00  ? 142 ALA A C    2  
ATOM   5896  O  O    . ALA A 1 142 ? 37.380  65.909 -15.116 1.00 0.00  ? 142 ALA A O    2  
ATOM   5897  C  CB   . ALA A 1 142 ? 35.489  63.095 -14.622 1.00 0.00  ? 142 ALA A CB   2  
ATOM   5898  H  H    . ALA A 1 142 ? 36.049  63.440 -12.066 1.00 0.00  ? 142 ALA A H    2  
ATOM   5899  H  HA   . ALA A 1 142 ? 37.608  63.501 -14.575 1.00 0.00  ? 142 ALA A HA   2  
ATOM   5900  H  HB1  . ALA A 1 142 ? 35.821  62.277 -15.249 1.00 0.00  ? 142 ALA A HB1  2  
ATOM   5901  H  HB2  . ALA A 1 142 ? 34.863  63.754 -15.207 1.00 0.00  ? 142 ALA A HB2  2  
ATOM   5902  H  HB3  . ALA A 1 142 ? 34.919  62.696 -13.796 1.00 0.00  ? 142 ALA A HB3  2  
ATOM   5903  N  N    . PRO A 1 143 ? 35.645  66.064 -13.728 1.00 0.00  ? 143 PRO A N    2  
ATOM   5904  C  CA   . PRO A 1 143 ? 35.485  67.516 -13.949 1.00 0.00  ? 143 PRO A CA   2  
ATOM   5905  C  C    . PRO A 1 143 ? 36.785  68.253 -13.596 1.00 0.00  ? 143 PRO A C    2  
ATOM   5906  O  O    . PRO A 1 143 ? 37.315  68.977 -14.405 1.00 0.00  ? 143 PRO A O    2  
ATOM   5907  C  CB   . PRO A 1 143 ? 34.323  67.943 -13.018 1.00 0.00  ? 143 PRO A CB   2  
ATOM   5908  C  CG   . PRO A 1 143 ? 33.820  66.667 -12.284 1.00 0.00  ? 143 PRO A CG   2  
ATOM   5909  C  CD   . PRO A 1 143 ? 34.668  65.475 -12.784 1.00 0.00  ? 143 PRO A CD   2  
ATOM   5910  H  HA   . PRO A 1 143 ? 35.222  67.705 -14.979 1.00 0.00  ? 143 PRO A HA   2  
ATOM   5911  H  HB2  . PRO A 1 143 ? 34.667  68.676 -12.296 1.00 0.00  ? 143 PRO A HB2  2  
ATOM   5912  H  HB3  . PRO A 1 143 ? 33.517  68.366 -13.603 1.00 0.00  ? 143 PRO A HB3  2  
ATOM   5913  H  HG2  . PRO A 1 143 ? 33.939  66.786 -11.209 1.00 0.00  ? 143 PRO A HG2  2  
ATOM   5914  H  HG3  . PRO A 1 143 ? 32.776  66.495 -12.513 1.00 0.00  ? 143 PRO A HG3  2  
ATOM   5915  H  HD2  . PRO A 1 143 ? 35.171  65.010 -11.954 1.00 0.00  ? 143 PRO A HD2  2  
ATOM   5916  H  HD3  . PRO A 1 143 ? 34.041  64.764 -13.293 1.00 0.00  ? 143 PRO A HD3  2  
ATOM   5917  N  N    . LEU A 1 144 ? 37.291  68.039 -12.399 1.00 0.00  ? 144 LEU A N    2  
ATOM   5918  C  CA   . LEU A 1 144 ? 38.574  68.686 -11.929 1.00 0.00  ? 144 LEU A CA   2  
ATOM   5919  C  C    . LEU A 1 144 ? 38.543  68.864 -10.405 1.00 0.00  ? 144 LEU A C    2  
ATOM   5920  O  O    . LEU A 1 144 ? 39.440  69.450 -9.832  1.00 0.00  ? 144 LEU A O    2  
ATOM   5921  C  CB   . LEU A 1 144 ? 38.813  70.080 -12.558 1.00 0.00  ? 144 LEU A CB   2  
ATOM   5922  C  CG   . LEU A 1 144 ? 37.569  71.003 -12.383 1.00 0.00  ? 144 LEU A CG   2  
ATOM   5923  C  CD1  . LEU A 1 144 ? 37.746  71.920 -11.162 1.00 0.00  ? 144 LEU A CD1  2  
ATOM   5924  C  CD2  . LEU A 1 144 ? 37.388  71.883 -13.631 1.00 0.00  ? 144 LEU A CD2  2  
ATOM   5925  H  H    . LEU A 1 144 ? 36.832  67.411 -11.806 1.00 0.00  ? 144 LEU A H    2  
ATOM   5926  H  HA   . LEU A 1 144 ? 39.401  68.039 -12.184 1.00 0.00  ? 144 LEU A HA   2  
ATOM   5927  H  HB2  . LEU A 1 144 ? 39.666  70.531 -12.066 1.00 0.00  ? 144 LEU A HB2  2  
ATOM   5928  H  HB3  . LEU A 1 144 ? 39.053  69.970 -13.603 1.00 0.00  ? 144 LEU A HB3  2  
ATOM   5929  H  HG   . LEU A 1 144 ? 36.683  70.404 -12.239 1.00 0.00  ? 144 LEU A HG   2  
ATOM   5930  H  HD11 . LEU A 1 144 ? 36.919  72.613 -11.113 1.00 0.00  ? 144 LEU A HD11 2  
ATOM   5931  H  HD12 . LEU A 1 144 ? 38.670  72.471 -11.253 1.00 0.00  ? 144 LEU A HD12 2  
ATOM   5932  H  HD13 . LEU A 1 144 ? 37.769  71.326 -10.261 1.00 0.00  ? 144 LEU A HD13 2  
ATOM   5933  H  HD21 . LEU A 1 144 ? 36.991  71.288 -14.439 1.00 0.00  ? 144 LEU A HD21 2  
ATOM   5934  H  HD22 . LEU A 1 144 ? 38.343  72.294 -13.923 1.00 0.00  ? 144 LEU A HD22 2  
ATOM   5935  H  HD23 . LEU A 1 144 ? 36.703  72.689 -13.409 1.00 0.00  ? 144 LEU A HD23 2  
ATOM   5936  N  N    . ARG A 1 145 ? 37.526  68.389 -9.736  1.00 0.00  ? 145 ARG A N    2  
ATOM   5937  C  CA   . ARG A 1 145 ? 37.471  68.570 -8.258  1.00 0.00  ? 145 ARG A CA   2  
ATOM   5938  C  C    . ARG A 1 145 ? 38.698  67.927 -7.606  1.00 0.00  ? 145 ARG A C    2  
ATOM   5939  O  O    . ARG A 1 145 ? 39.618  68.606 -7.199  1.00 0.00  ? 145 ARG A O    2  
ATOM   5940  C  CB   . ARG A 1 145 ? 36.196  67.922 -7.707  1.00 0.00  ? 145 ARG A CB   2  
ATOM   5941  C  CG   . ARG A 1 145 ? 34.985  68.333 -8.558  1.00 0.00  ? 145 ARG A CG   2  
ATOM   5942  C  CD   . ARG A 1 145 ? 34.857  69.860 -8.611  1.00 0.00  ? 145 ARG A CD   2  
ATOM   5943  N  NE   . ARG A 1 145 ? 35.062  70.444 -7.244  1.00 0.00  ? 145 ARG A NE   2  
ATOM   5944  C  CZ   . ARG A 1 145 ? 34.317  70.093 -6.229  1.00 0.00  ? 145 ARG A CZ   2  
ATOM   5945  N  NH1  . ARG A 1 145 ? 33.269  69.338 -6.408  1.00 0.00  ? 145 ARG A NH1  2  
ATOM   5946  N  NH2  . ARG A 1 145 ? 34.596  70.540 -5.035  1.00 0.00  ? 145 ARG A NH2  2  
ATOM   5947  H  H    . ARG A 1 145 ? 36.799  67.926 -10.199 1.00 0.00  ? 145 ARG A H    2  
ATOM   5948  H  HA   . ARG A 1 145 ? 37.464  69.624 -8.026  1.00 0.00  ? 145 ARG A HA   2  
ATOM   5949  H  HB2  . ARG A 1 145 ? 36.301  66.848 -7.734  1.00 0.00  ? 145 ARG A HB2  2  
ATOM   5950  H  HB3  . ARG A 1 145 ? 36.045  68.238 -6.688  1.00 0.00  ? 145 ARG A HB3  2  
ATOM   5951  H  HG2  . ARG A 1 145 ? 35.115  67.954 -9.560  1.00 0.00  ? 145 ARG A HG2  2  
ATOM   5952  H  HG3  . ARG A 1 145 ? 34.090  67.909 -8.134  1.00 0.00  ? 145 ARG A HG3  2  
ATOM   5953  H  HD2  . ARG A 1 145 ? 35.617  70.259 -9.252  1.00 0.00  ? 145 ARG A HD2  2  
ATOM   5954  H  HD3  . ARG A 1 145 ? 33.882  70.121 -9.021  1.00 0.00  ? 145 ARG A HD3  2  
ATOM   5955  H  HE   . ARG A 1 145 ? 35.800  71.073 -7.099  1.00 0.00  ? 145 ARG A HE   2  
ATOM   5956  H  HH11 . ARG A 1 145 ? 33.027  69.026 -7.325  1.00 0.00  ? 145 ARG A HH11 2  
ATOM   5957  H  HH12 . ARG A 1 145 ? 32.706  69.070 -5.626  1.00 0.00  ? 145 ARG A HH12 2  
ATOM   5958  H  HH21 . ARG A 1 145 ? 35.378  71.148 -4.899  1.00 0.00  ? 145 ARG A HH21 2  
ATOM   5959  H  HH22 . ARG A 1 145 ? 34.028  70.275 -4.257  1.00 0.00  ? 145 ARG A HH22 2  
ATOM   5960  N  N    . GLU A 1 146 ? 38.702  66.626 -7.478  1.00 0.00  ? 146 GLU A N    2  
ATOM   5961  C  CA   . GLU A 1 146 ? 39.855  65.932 -6.828  1.00 0.00  ? 146 GLU A CA   2  
ATOM   5962  C  C    . GLU A 1 146 ? 39.991  66.417 -5.381  1.00 0.00  ? 146 GLU A C    2  
ATOM   5963  O  O    . GLU A 1 146 ? 40.778  65.902 -4.616  1.00 0.00  ? 146 GLU A O    2  
ATOM   5964  C  CB   . GLU A 1 146 ? 41.157  66.229 -7.584  1.00 0.00  ? 146 GLU A CB   2  
ATOM   5965  C  CG   . GLU A 1 146 ? 40.934  66.071 -9.088  1.00 0.00  ? 146 GLU A CG   2  
ATOM   5966  C  CD   . GLU A 1 146 ? 42.220  66.430 -9.835  1.00 0.00  ? 146 GLU A CD   2  
ATOM   5967  O  OE1  . GLU A 1 146 ? 42.746  67.502 -9.587  1.00 0.00  ? 146 GLU A OE1  2  
ATOM   5968  O  OE2  . GLU A 1 146 ? 42.656  65.627 -10.643 1.00 0.00  ? 146 GLU A OE2  2  
ATOM   5969  H  H    . GLU A 1 146 ? 37.933  66.111 -7.794  1.00 0.00  ? 146 GLU A H    2  
ATOM   5970  H  HA   . GLU A 1 146 ? 39.675  64.866 -6.830  1.00 0.00  ? 146 GLU A HA   2  
ATOM   5971  H  HB2  . GLU A 1 146 ? 41.480  67.237 -7.370  1.00 0.00  ? 146 GLU A HB2  2  
ATOM   5972  H  HB3  . GLU A 1 146 ? 41.920  65.536 -7.264  1.00 0.00  ? 146 GLU A HB3  2  
ATOM   5973  H  HG2  . GLU A 1 146 ? 40.667  65.049 -9.301  1.00 0.00  ? 146 GLU A HG2  2  
ATOM   5974  H  HG3  . GLU A 1 146 ? 40.139  66.727 -9.409  1.00 0.00  ? 146 GLU A HG3  2  
ATOM   5975  N  N    . LEU A 1 147 ? 39.224  67.399 -4.995  1.00 0.00  ? 147 LEU A N    2  
ATOM   5976  C  CA   . LEU A 1 147 ? 39.310  67.910 -3.599  1.00 0.00  ? 147 LEU A CA   2  
ATOM   5977  C  C    . LEU A 1 147 ? 38.580  66.935 -2.681  1.00 0.00  ? 147 LEU A C    2  
ATOM   5978  O  O    . LEU A 1 147 ? 39.149  66.389 -1.754  1.00 0.00  ? 147 LEU A O    2  
ATOM   5979  C  CB   . LEU A 1 147 ? 38.655  69.296 -3.523  1.00 0.00  ? 147 LEU A CB   2  
ATOM   5980  C  CG   . LEU A 1 147 ? 38.502  69.738 -2.060  1.00 0.00  ? 147 LEU A CG   2  
ATOM   5981  C  CD1  . LEU A 1 147 ? 39.835  69.576 -1.320  1.00 0.00  ? 147 LEU A CD1  2  
ATOM   5982  C  CD2  . LEU A 1 147 ? 38.076  71.209 -2.024  1.00 0.00  ? 147 LEU A CD2  2  
ATOM   5983  H  H    . LEU A 1 147 ? 38.587  67.794 -5.618  1.00 0.00  ? 147 LEU A H    2  
ATOM   5984  H  HA   . LEU A 1 147 ? 40.347  67.979 -3.306  1.00 0.00  ? 147 LEU A HA   2  
ATOM   5985  H  HB2  . LEU A 1 147 ? 39.271  70.011 -4.049  1.00 0.00  ? 147 LEU A HB2  2  
ATOM   5986  H  HB3  . LEU A 1 147 ? 37.680  69.256 -3.985  1.00 0.00  ? 147 LEU A HB3  2  
ATOM   5987  H  HG   . LEU A 1 147 ? 37.748  69.134 -1.578  1.00 0.00  ? 147 LEU A HG   2  
ATOM   5988  H  HD11 . LEU A 1 147 ? 40.644  69.908 -1.954  1.00 0.00  ? 147 LEU A HD11 2  
ATOM   5989  H  HD12 . LEU A 1 147 ? 39.981  68.537 -1.066  1.00 0.00  ? 147 LEU A HD12 2  
ATOM   5990  H  HD13 . LEU A 1 147 ? 39.822  70.167 -0.415  1.00 0.00  ? 147 LEU A HD13 2  
ATOM   5991  H  HD21 . LEU A 1 147 ? 37.085  71.307 -2.443  1.00 0.00  ? 147 LEU A HD21 2  
ATOM   5992  H  HD22 . LEU A 1 147 ? 38.771  71.800 -2.602  1.00 0.00  ? 147 LEU A HD22 2  
ATOM   5993  H  HD23 . LEU A 1 147 ? 38.071  71.558 -1.002  1.00 0.00  ? 147 LEU A HD23 2  
ATOM   5994  N  N    . LEU A 1 148 ? 37.326  66.695 -2.943  1.00 25.11 ? 148 LEU A N    2  
ATOM   5995  C  CA   . LEU A 1 148 ? 36.576  65.739 -2.097  1.00 22.71 ? 148 LEU A CA   2  
ATOM   5996  C  C    . LEU A 1 148 ? 37.258  64.378 -2.213  1.00 23.41 ? 148 LEU A C    2  
ATOM   5997  O  O    . LEU A 1 148 ? 37.080  63.507 -1.385  1.00 25.25 ? 148 LEU A O    2  
ATOM   5998  C  CB   . LEU A 1 148 ? 35.110  65.658 -2.567  1.00 23.35 ? 148 LEU A CB   2  
ATOM   5999  C  CG   . LEU A 1 148 ? 35.023  65.162 -4.039  1.00 23.72 ? 148 LEU A CG   2  
ATOM   6000  C  CD1  . LEU A 1 148 ? 34.720  63.652 -4.075  1.00 9.66  ? 148 LEU A CD1  2  
ATOM   6001  C  CD2  . LEU A 1 148 ? 33.903  65.914 -4.788  1.00 17.82 ? 148 LEU A CD2  2  
ATOM   6002  H  H    . LEU A 1 148 ? 36.889  67.131 -3.703  1.00 0.00  ? 148 LEU A H    2  
ATOM   6003  H  HA   . LEU A 1 148 ? 36.608  66.069 -1.068  1.00 0.00  ? 148 LEU A HA   2  
ATOM   6004  H  HB2  . LEU A 1 148 ? 34.570  64.981 -1.918  1.00 0.00  ? 148 LEU A HB2  2  
ATOM   6005  H  HB3  . LEU A 1 148 ? 34.670  66.642 -2.488  1.00 0.00  ? 148 LEU A HB3  2  
ATOM   6006  H  HG   . LEU A 1 148 ? 35.966  65.343 -4.540  1.00 0.00  ? 148 LEU A HG   2  
ATOM   6007  H  HD11 . LEU A 1 148 ? 35.252  63.155 -3.278  1.00 0.00  ? 148 LEU A HD11 2  
ATOM   6008  H  HD12 . LEU A 1 148 ? 35.036  63.244 -5.022  1.00 0.00  ? 148 LEU A HD12 2  
ATOM   6009  H  HD13 . LEU A 1 148 ? 33.658  63.490 -3.951  1.00 0.00  ? 148 LEU A HD13 2  
ATOM   6010  H  HD21 . LEU A 1 148 ? 34.070  66.979 -4.714  1.00 0.00  ? 148 LEU A HD21 2  
ATOM   6011  H  HD22 . LEU A 1 148 ? 32.947  65.668 -4.348  1.00 0.00  ? 148 LEU A HD22 2  
ATOM   6012  H  HD23 . LEU A 1 148 ? 33.902  65.624 -5.828  1.00 0.00  ? 148 LEU A HD23 2  
ATOM   6013  N  N    . ARG A 1 149 ? 38.058  64.197 -3.234  1.00 0.00  ? 149 ARG A N    2  
ATOM   6014  C  CA   . ARG A 1 149 ? 38.770  62.898 -3.396  1.00 0.00  ? 149 ARG A CA   2  
ATOM   6015  C  C    . ARG A 1 149 ? 39.823  62.770 -2.294  1.00 0.00  ? 149 ARG A C    2  
ATOM   6016  O  O    . ARG A 1 149 ? 39.926  61.752 -1.640  1.00 0.00  ? 149 ARG A O    2  
ATOM   6017  C  CB   . ARG A 1 149 ? 39.449  62.838 -4.767  1.00 0.00  ? 149 ARG A CB   2  
ATOM   6018  C  CG   . ARG A 1 149 ? 40.203  61.512 -4.903  1.00 0.00  ? 149 ARG A CG   2  
ATOM   6019  C  CD   . ARG A 1 149 ? 40.542  61.260 -6.373  1.00 0.00  ? 149 ARG A CD   2  
ATOM   6020  N  NE   . ARG A 1 149 ? 41.235  59.947 -6.503  1.00 0.00  ? 149 ARG A NE   2  
ATOM   6021  C  CZ   . ARG A 1 149 ? 41.349  59.381 -7.673  1.00 0.00  ? 149 ARG A CZ   2  
ATOM   6022  N  NH1  . ARG A 1 149 ? 40.853  59.963 -8.730  1.00 0.00  ? 149 ARG A NH1  2  
ATOM   6023  N  NH2  . ARG A 1 149 ? 41.957  58.233 -7.786  1.00 0.00  ? 149 ARG A NH2  2  
ATOM   6024  H  H    . ARG A 1 149 ? 38.199  64.922 -3.884  1.00 0.00  ? 149 ARG A H    2  
ATOM   6025  H  HA   . ARG A 1 149 ? 38.060  62.088 -3.310  1.00 0.00  ? 149 ARG A HA   2  
ATOM   6026  H  HB2  . ARG A 1 149 ? 38.701  62.911 -5.543  1.00 0.00  ? 149 ARG A HB2  2  
ATOM   6027  H  HB3  . ARG A 1 149 ? 40.146  63.656 -4.860  1.00 0.00  ? 149 ARG A HB3  2  
ATOM   6028  H  HG2  . ARG A 1 149 ? 41.115  61.556 -4.326  1.00 0.00  ? 149 ARG A HG2  2  
ATOM   6029  H  HG3  . ARG A 1 149 ? 39.584  60.706 -4.537  1.00 0.00  ? 149 ARG A HG3  2  
ATOM   6030  H  HD2  . ARG A 1 149 ? 39.633  61.247 -6.956  1.00 0.00  ? 149 ARG A HD2  2  
ATOM   6031  H  HD3  . ARG A 1 149 ? 41.191  62.045 -6.733  1.00 0.00  ? 149 ARG A HD3  2  
ATOM   6032  H  HE   . ARG A 1 149 ? 41.605  59.508 -5.709  1.00 0.00  ? 149 ARG A HE   2  
ATOM   6033  H  HH11 . ARG A 1 149 ? 40.386  60.843 -8.643  1.00 0.00  ? 149 ARG A HH11 2  
ATOM   6034  H  HH12 . ARG A 1 149 ? 40.941  59.530 -9.627  1.00 0.00  ? 149 ARG A HH12 2  
ATOM   6035  H  HH21 . ARG A 1 149 ? 42.336  57.786 -6.976  1.00 0.00  ? 149 ARG A HH21 2  
ATOM   6036  H  HH22 . ARG A 1 149 ? 42.045  57.799 -8.683  1.00 0.00  ? 149 ARG A HH22 2  
ATOM   6037  N  N    . GLU A 1 150 ? 40.604  63.796 -2.077  1.00 0.00  ? 150 GLU A N    2  
ATOM   6038  C  CA   . GLU A 1 150 ? 41.635  63.719 -1.003  1.00 0.00  ? 150 GLU A CA   2  
ATOM   6039  C  C    . GLU A 1 150 ? 40.937  63.451 0.327   1.00 0.00  ? 150 GLU A C    2  
ATOM   6040  O  O    . GLU A 1 150 ? 41.373  62.640 1.118   1.00 0.00  ? 150 GLU A O    2  
ATOM   6041  C  CB   . GLU A 1 150 ? 42.398  65.040 -0.912  1.00 0.00  ? 150 GLU A CB   2  
ATOM   6042  C  CG   . GLU A 1 150 ? 43.045  65.335 -2.259  1.00 0.00  ? 150 GLU A CG   2  
ATOM   6043  C  CD   . GLU A 1 150 ? 43.613  66.756 -2.258  1.00 0.00  ? 150 GLU A CD   2  
ATOM   6044  O  OE1  . GLU A 1 150 ? 44.250  67.117 -1.283  1.00 0.00  ? 150 GLU A OE1  2  
ATOM   6045  O  OE2  . GLU A 1 150 ? 43.401  67.457 -3.233  1.00 0.00  ? 150 GLU A OE2  2  
ATOM   6046  H  H    . GLU A 1 150 ? 40.504  64.611 -2.620  1.00 0.00  ? 150 GLU A H    2  
ATOM   6047  H  HA   . GLU A 1 150 ? 42.325  62.915 -1.217  1.00 0.00  ? 150 GLU A HA   2  
ATOM   6048  H  HB2  . GLU A 1 150 ? 41.713  65.835 -0.657  1.00 0.00  ? 150 GLU A HB2  2  
ATOM   6049  H  HB3  . GLU A 1 150 ? 43.164  64.964 -0.155  1.00 0.00  ? 150 GLU A HB3  2  
ATOM   6050  H  HG2  . GLU A 1 150 ? 43.839  64.626 -2.440  1.00 0.00  ? 150 GLU A HG2  2  
ATOM   6051  H  HG3  . GLU A 1 150 ? 42.303  65.246 -3.031  1.00 0.00  ? 150 GLU A HG3  2  
ATOM   6052  N  N    . ARG A 1 151 ? 39.847  64.125 0.573   1.00 0.00  ? 151 ARG A N    2  
ATOM   6053  C  CA   . ARG A 1 151 ? 39.108  63.908 1.853   1.00 0.00  ? 151 ARG A CA   2  
ATOM   6054  C  C    . ARG A 1 151 ? 38.742  62.427 1.969   1.00 0.00  ? 151 ARG A C    2  
ATOM   6055  O  O    . ARG A 1 151 ? 38.786  61.839 3.030   1.00 0.00  ? 151 ARG A O    2  
ATOM   6056  C  CB   . ARG A 1 151 ? 37.833  64.753 1.856   1.00 0.00  ? 151 ARG A CB   2  
ATOM   6057  C  CG   . ARG A 1 151 ? 37.175  64.684 3.235   1.00 0.00  ? 151 ARG A CG   2  
ATOM   6058  C  CD   . ARG A 1 151 ? 35.973  65.629 3.274   1.00 0.00  ? 151 ARG A CD   2  
ATOM   6059  N  NE   . ARG A 1 151 ? 36.429  67.023 3.015   1.00 0.00  ? 151 ARG A NE   2  
ATOM   6060  C  CZ   . ARG A 1 151 ? 35.561  67.947 2.703   1.00 0.00  ? 151 ARG A CZ   2  
ATOM   6061  N  NH1  . ARG A 1 151 ? 34.294  67.649 2.617   1.00 0.00  ? 151 ARG A NH1  2  
ATOM   6062  N  NH2  . ARG A 1 151 ? 35.961  69.168 2.477   1.00 0.00  ? 151 ARG A NH2  2  
ATOM   6063  H  H    . ARG A 1 151 ? 39.512  64.772 -0.090  1.00 0.00  ? 151 ARG A H    2  
ATOM   6064  H  HA   . ARG A 1 151 ? 39.735  64.191 2.685   1.00 0.00  ? 151 ARG A HA   2  
ATOM   6065  H  HB2  . ARG A 1 151 ? 38.082  65.779 1.626   1.00 0.00  ? 151 ARG A HB2  2  
ATOM   6066  H  HB3  . ARG A 1 151 ? 37.148  64.374 1.113   1.00 0.00  ? 151 ARG A HB3  2  
ATOM   6067  H  HG2  . ARG A 1 151 ? 36.846  63.672 3.426   1.00 0.00  ? 151 ARG A HG2  2  
ATOM   6068  H  HG3  . ARG A 1 151 ? 37.888  64.980 3.990   1.00 0.00  ? 151 ARG A HG3  2  
ATOM   6069  H  HD2  . ARG A 1 151 ? 35.261  65.336 2.516   1.00 0.00  ? 151 ARG A HD2  2  
ATOM   6070  H  HD3  . ARG A 1 151 ? 35.506  65.578 4.246   1.00 0.00  ? 151 ARG A HD3  2  
ATOM   6071  H  HE   . ARG A 1 151 ? 37.381  67.247 3.078   1.00 0.00  ? 151 ARG A HE   2  
ATOM   6072  H  HH11 . ARG A 1 151 ? 33.987  66.713 2.790   1.00 0.00  ? 151 ARG A HH11 2  
ATOM   6073  H  HH12 . ARG A 1 151 ? 33.629  68.357 2.379   1.00 0.00  ? 151 ARG A HH12 2  
ATOM   6074  H  HH21 . ARG A 1 151 ? 36.933  69.397 2.542   1.00 0.00  ? 151 ARG A HH21 2  
ATOM   6075  H  HH22 . ARG A 1 151 ? 35.297  69.876 2.239   1.00 0.00  ? 151 ARG A HH22 2  
ATOM   6076  N  N    . ALA A 1 152 ? 38.403  61.820 0.872   1.00 0.00  ? 152 ALA A N    2  
ATOM   6077  C  CA   . ALA A 1 152 ? 38.055  60.374 0.897   1.00 0.00  ? 152 ALA A CA   2  
ATOM   6078  C  C    . ALA A 1 152 ? 39.351  59.564 0.956   1.00 0.00  ? 152 ALA A C    2  
ATOM   6079  O  O    . ALA A 1 152 ? 39.515  58.686 1.778   1.00 0.00  ? 152 ALA A O    2  
ATOM   6080  C  CB   . ALA A 1 152 ? 37.278  60.009 -0.369  1.00 0.00  ? 152 ALA A CB   2  
ATOM   6081  H  H    . ALA A 1 152 ? 38.401  62.324 0.031   1.00 0.00  ? 152 ALA A H    2  
ATOM   6082  H  HA   . ALA A 1 152 ? 37.454  60.160 1.768   1.00 0.00  ? 152 ALA A HA   2  
ATOM   6083  H  HB1  . ALA A 1 152 ? 36.904  58.999 -0.283  1.00 0.00  ? 152 ALA A HB1  2  
ATOM   6084  H  HB2  . ALA A 1 152 ? 37.932  60.078 -1.225  1.00 0.00  ? 152 ALA A HB2  2  
ATOM   6085  H  HB3  . ALA A 1 152 ? 36.449  60.690 -0.492  1.00 0.00  ? 152 ALA A HB3  2  
ATOM   6086  N  N    . GLU A 1 153 ? 40.268  59.855 0.079   1.00 0.00  ? 153 GLU A N    2  
ATOM   6087  C  CA   . GLU A 1 153 ? 41.558  59.111 0.059   1.00 0.00  ? 153 GLU A CA   2  
ATOM   6088  C  C    . GLU A 1 153 ? 42.165  59.062 1.460   1.00 0.00  ? 153 GLU A C    2  
ATOM   6089  O  O    . GLU A 1 153 ? 42.805  58.099 1.834   1.00 0.00  ? 153 GLU A O    2  
ATOM   6090  C  CB   . GLU A 1 153 ? 42.528  59.819 -0.892  1.00 0.00  ? 153 GLU A CB   2  
ATOM   6091  C  CG   . GLU A 1 153 ? 43.761  58.944 -1.139  1.00 0.00  ? 153 GLU A CG   2  
ATOM   6092  C  CD   . GLU A 1 153 ? 44.676  58.968 0.090   1.00 0.00  ? 153 GLU A CD   2  
ATOM   6093  O  OE1  . GLU A 1 153 ? 44.578  59.907 0.861   1.00 0.00  ? 153 GLU A OE1  2  
ATOM   6094  O  OE2  . GLU A 1 153 ? 45.459  58.044 0.236   1.00 0.00  ? 153 GLU A OE2  2  
ATOM   6095  H  H    . GLU A 1 153 ? 40.102  60.560 -0.582  1.00 0.00  ? 153 GLU A H    2  
ATOM   6096  H  HA   . GLU A 1 153 ? 41.384  58.113 -0.283  1.00 0.00  ? 153 GLU A HA   2  
ATOM   6097  H  HB2  . GLU A 1 153 ? 42.030  60.008 -1.833  1.00 0.00  ? 153 GLU A HB2  2  
ATOM   6098  H  HB3  . GLU A 1 153 ? 42.835  60.758 -0.457  1.00 0.00  ? 153 GLU A HB3  2  
ATOM   6099  H  HG2  . GLU A 1 153 ? 43.452  57.929 -1.338  1.00 0.00  ? 153 GLU A HG2  2  
ATOM   6100  H  HG3  . GLU A 1 153 ? 44.302  59.327 -1.989  1.00 0.00  ? 153 GLU A HG3  2  
ATOM   6101  N  N    . LYS A 1 154 ? 41.981  60.092 2.231   1.00 21.61 ? 154 LYS A N    2  
ATOM   6102  C  CA   . LYS A 1 154 ? 42.563  60.111 3.613   1.00 20.81 ? 154 LYS A CA   2  
ATOM   6103  C  C    . LYS A 1 154 ? 41.535  59.592 4.622   1.00 21.70 ? 154 LYS A C    2  
ATOM   6104  O  O    . LYS A 1 154 ? 41.787  59.551 5.810   1.00 20.17 ? 154 LYS A O    2  
ATOM   6105  C  CB   . LYS A 1 154 ? 42.980  61.541 3.983   1.00 18.21 ? 154 LYS A CB   2  
ATOM   6106  C  CG   . LYS A 1 154 ? 41.741  62.410 4.207   1.00 23.64 ? 154 LYS A CG   2  
ATOM   6107  C  CD   . LYS A 1 154 ? 42.147  63.887 4.242   1.00 23.42 ? 154 LYS A CD   2  
ATOM   6108  C  CE   . LYS A 1 154 ? 43.175  64.122 5.355   1.00 31.30 ? 154 LYS A CE   2  
ATOM   6109  N  NZ   . LYS A 1 154 ? 44.528  63.722 4.874   1.00 37.57 ? 154 LYS A NZ   2  
ATOM   6110  H  H    . LYS A 1 154 ? 41.466  60.853 1.900   1.00 0.00  ? 154 LYS A H    2  
ATOM   6111  H  HA   . LYS A 1 154 ? 43.437  59.472 3.644   1.00 0.00  ? 154 LYS A HA   2  
ATOM   6112  H  HB2  . LYS A 1 154 ? 43.570  61.517 4.888   1.00 0.00  ? 154 LYS A HB2  2  
ATOM   6113  H  HB3  . LYS A 1 154 ? 43.571  61.960 3.182   1.00 0.00  ? 154 LYS A HB3  2  
ATOM   6114  H  HG2  . LYS A 1 154 ? 41.042  62.249 3.404   1.00 0.00  ? 154 LYS A HG2  2  
ATOM   6115  H  HG3  . LYS A 1 154 ? 41.279  62.144 5.146   1.00 0.00  ? 154 LYS A HG3  2  
ATOM   6116  H  HD2  . LYS A 1 154 ? 42.578  64.163 3.291   1.00 0.00  ? 154 LYS A HD2  2  
ATOM   6117  H  HD3  . LYS A 1 154 ? 41.274  64.494 4.430   1.00 0.00  ? 154 LYS A HD3  2  
ATOM   6118  H  HE2  . LYS A 1 154 ? 43.183  65.169 5.620   1.00 0.00  ? 154 LYS A HE2  2  
ATOM   6119  H  HE3  . LYS A 1 154 ? 42.913  63.535 6.224   1.00 0.00  ? 154 LYS A HE3  2  
ATOM   6120  H  HZ1  . LYS A 1 154 ? 45.207  64.483 5.077   1.00 0.00  ? 154 LYS A HZ1  2  
ATOM   6121  H  HZ2  . LYS A 1 154 ? 44.494  63.551 3.849   1.00 0.00  ? 154 LYS A HZ2  2  
ATOM   6122  H  HZ3  . LYS A 1 154 ? 44.828  62.855 5.362   1.00 0.00  ? 154 LYS A HZ3  2  
ATOM   6123  N  N    . MET A 1 155 ? 40.382  59.189 4.164   1.00 0.00  ? 155 MET A N    2  
ATOM   6124  C  CA   . MET A 1 155 ? 39.353  58.670 5.109   1.00 0.00  ? 155 MET A CA   2  
ATOM   6125  C  C    . MET A 1 155 ? 39.926  57.459 5.845   1.00 0.00  ? 155 MET A C    2  
ATOM   6126  O  O    . MET A 1 155 ? 39.405  57.025 6.853   1.00 0.00  ? 155 MET A O    2  
ATOM   6127  C  CB   . MET A 1 155 ? 38.095  58.265 4.328   1.00 0.00  ? 155 MET A CB   2  
ATOM   6128  C  CG   . MET A 1 155 ? 37.098  57.543 5.246   1.00 0.00  ? 155 MET A CG   2  
ATOM   6129  S  SD   . MET A 1 155 ? 36.768  58.547 6.717   1.00 0.00  ? 155 MET A SD   2  
ATOM   6130  C  CE   . MET A 1 155 ? 36.085  59.987 5.860   1.00 0.00  ? 155 MET A CE   2  
ATOM   6131  H  H    . MET A 1 155 ? 40.194  59.224 3.203   1.00 0.00  ? 155 MET A H    2  
ATOM   6132  H  HA   . MET A 1 155 ? 39.110  59.438 5.822   1.00 0.00  ? 155 MET A HA   2  
ATOM   6133  H  HB2  . MET A 1 155 ? 37.628  59.150 3.920   1.00 0.00  ? 155 MET A HB2  2  
ATOM   6134  H  HB3  . MET A 1 155 ? 38.374  57.605 3.521   1.00 0.00  ? 155 MET A HB3  2  
ATOM   6135  H  HG2  . MET A 1 155 ? 36.173  57.383 4.711   1.00 0.00  ? 155 MET A HG2  2  
ATOM   6136  H  HG3  . MET A 1 155 ? 37.504  56.588 5.544   1.00 0.00  ? 155 MET A HG3  2  
ATOM   6137  H  HE1  . MET A 1 155 ? 35.395  60.501 6.516   1.00 0.00  ? 155 MET A HE1  2  
ATOM   6138  H  HE2  . MET A 1 155 ? 35.563  59.666 4.973   1.00 0.00  ? 155 MET A HE2  2  
ATOM   6139  H  HE3  . MET A 1 155 ? 36.889  60.654 5.582   1.00 0.00  ? 155 MET A HE3  2  
ATOM   6140  N  N    . GLY A 1 156 ? 41.004  56.917 5.341   1.00 20.89 ? 156 GLY A N    2  
ATOM   6141  C  CA   . GLY A 1 156 ? 41.647  55.728 5.989   1.00 17.19 ? 156 GLY A CA   2  
ATOM   6142  C  C    . GLY A 1 156 ? 41.452  54.497 5.102   1.00 17.35 ? 156 GLY A C    2  
ATOM   6143  O  O    . GLY A 1 156 ? 41.761  53.387 5.489   1.00 17.97 ? 156 GLY A O    2  
ATOM   6144  H  H    . GLY A 1 156 ? 41.396  57.299 4.530   1.00 0.00  ? 156 GLY A H    2  
ATOM   6145  H  HA2  . GLY A 1 156 ? 42.704  55.918 6.110   1.00 0.00  ? 156 GLY A HA2  2  
ATOM   6146  H  HA3  . GLY A 1 156 ? 41.204  55.543 6.957   1.00 0.00  ? 156 GLY A HA3  2  
ATOM   6147  N  N    . GLN A 1 157 ? 40.942  54.682 3.913   1.00 0.00  ? 157 GLN A N    2  
ATOM   6148  C  CA   . GLN A 1 157 ? 40.726  53.520 3.000   1.00 0.00  ? 157 GLN A CA   2  
ATOM   6149  C  C    . GLN A 1 157 ? 42.003  53.253 2.201   1.00 0.00  ? 157 GLN A C    2  
ATOM   6150  O  O    . GLN A 1 157 ? 42.290  52.134 1.824   1.00 0.00  ? 157 GLN A O    2  
ATOM   6151  C  CB   . GLN A 1 157 ? 39.581  53.837 2.036   1.00 0.00  ? 157 GLN A CB   2  
ATOM   6152  C  CG   . GLN A 1 157 ? 39.920  55.098 1.238   1.00 0.00  ? 157 GLN A CG   2  
ATOM   6153  C  CD   . GLN A 1 157 ? 38.718  55.500 0.381   1.00 0.00  ? 157 GLN A CD   2  
ATOM   6154  O  OE1  . GLN A 1 157 ? 38.795  55.500 -0.832  1.00 0.00  ? 157 GLN A OE1  2  
ATOM   6155  N  NE2  . GLN A 1 157 ? 37.603  55.845 0.964   1.00 0.00  ? 157 GLN A NE2  2  
ATOM   6156  H  H    . GLN A 1 157 ? 40.700  55.585 3.620   1.00 0.00  ? 157 GLN A H    2  
ATOM   6157  H  HA   . GLN A 1 157 ? 40.477  52.644 3.579   1.00 0.00  ? 157 GLN A HA   2  
ATOM   6158  H  HB2  . GLN A 1 157 ? 39.442  53.008 1.357   1.00 0.00  ? 157 GLN A HB2  2  
ATOM   6159  H  HB3  . GLN A 1 157 ? 38.673  54.001 2.596   1.00 0.00  ? 157 GLN A HB3  2  
ATOM   6160  H  HG2  . GLN A 1 157 ? 40.161  55.901 1.920   1.00 0.00  ? 157 GLN A HG2  2  
ATOM   6161  H  HG3  . GLN A 1 157 ? 40.767  54.903 0.598   1.00 0.00  ? 157 GLN A HG3  2  
ATOM   6162  H  HE21 . GLN A 1 157 ? 37.540  55.845 1.942   1.00 0.00  ? 157 GLN A HE21 2  
ATOM   6163  H  HE22 . GLN A 1 157 ? 36.827  56.104 0.423   1.00 0.00  ? 157 GLN A HE22 2  
ATOM   6164  N  N    . ASN A 1 158 ? 42.776  54.274 1.945   1.00 0.00  ? 158 ASN A N    2  
ATOM   6165  C  CA   . ASN A 1 158 ? 44.042  54.090 1.175   1.00 0.00  ? 158 ASN A CA   2  
ATOM   6166  C  C    . ASN A 1 158 ? 45.193  53.894 2.159   1.00 0.00  ? 158 ASN A C    2  
ATOM   6167  O  O    . ASN A 1 158 ? 45.975  52.972 2.040   1.00 0.00  ? 158 ASN A O    2  
ATOM   6168  C  CB   . ASN A 1 158 ? 44.304  55.334 0.321   1.00 0.00  ? 158 ASN A CB   2  
ATOM   6169  C  CG   . ASN A 1 158 ? 43.372  55.326 -0.892  1.00 0.00  ? 158 ASN A CG   2  
ATOM   6170  O  OD1  . ASN A 1 158 ? 42.313  55.921 -0.863  1.00 0.00  ? 158 ASN A OD1  2  
ATOM   6171  N  ND2  . ASN A 1 158 ? 43.723  54.671 -1.965  1.00 0.00  ? 158 ASN A ND2  2  
ATOM   6172  H  H    . ASN A 1 158 ? 42.525  55.164 2.265   1.00 0.00  ? 158 ASN A H    2  
ATOM   6173  H  HA   . ASN A 1 158 ? 43.963  53.222 0.534   1.00 0.00  ? 158 ASN A HA   2  
ATOM   6174  H  HB2  . ASN A 1 158 ? 44.121  56.220 0.911   1.00 0.00  ? 158 ASN A HB2  2  
ATOM   6175  H  HB3  . ASN A 1 158 ? 45.330  55.331 -0.016  1.00 0.00  ? 158 ASN A HB3  2  
ATOM   6176  H  HD21 . ASN A 1 158 ? 44.576  54.190 -1.989  1.00 0.00  ? 158 ASN A HD21 2  
ATOM   6177  H  HD22 . ASN A 1 158 ? 43.133  54.660 -2.748  1.00 0.00  ? 158 ASN A HD22 2  
ATOM   6178  N  N    . LEU A 1 159 ? 45.290  54.752 3.143   1.00 0.00  ? 159 LEU A N    2  
ATOM   6179  C  CA   . LEU A 1 159 ? 46.376  54.625 4.163   1.00 0.00  ? 159 LEU A CA   2  
ATOM   6180  C  C    . LEU A 1 159 ? 45.765  54.032 5.435   1.00 0.00  ? 159 LEU A C    2  
ATOM   6181  O  O    . LEU A 1 159 ? 45.556  54.716 6.417   1.00 0.00  ? 159 LEU A O    2  
ATOM   6182  C  CB   . LEU A 1 159 ? 46.979  56.016 4.462   1.00 0.00  ? 159 LEU A CB   2  
ATOM   6183  C  CG   . LEU A 1 159 ? 45.917  57.121 4.249   1.00 0.00  ? 159 LEU A CG   2  
ATOM   6184  C  CD1  . LEU A 1 159 ? 46.203  58.306 5.180   1.00 0.00  ? 159 LEU A CD1  2  
ATOM   6185  C  CD2  . LEU A 1 159 ? 45.953  57.612 2.792   1.00 0.00  ? 159 LEU A CD2  2  
ATOM   6186  H  H    . LEU A 1 159 ? 44.634  55.476 3.218   1.00 0.00  ? 159 LEU A H    2  
ATOM   6187  H  HA   . LEU A 1 159 ? 47.153  53.964 3.799   1.00 0.00  ? 159 LEU A HA   2  
ATOM   6188  H  HB2  . LEU A 1 159 ? 47.333  56.041 5.486   1.00 0.00  ? 159 LEU A HB2  2  
ATOM   6189  H  HB3  . LEU A 1 159 ? 47.818  56.190 3.800   1.00 0.00  ? 159 LEU A HB3  2  
ATOM   6190  H  HG   . LEU A 1 159 ? 44.934  56.730 4.473   1.00 0.00  ? 159 LEU A HG   2  
ATOM   6191  H  HD11 . LEU A 1 159 ? 47.209  58.661 5.013   1.00 0.00  ? 159 LEU A HD11 2  
ATOM   6192  H  HD12 . LEU A 1 159 ? 46.099  57.990 6.208   1.00 0.00  ? 159 LEU A HD12 2  
ATOM   6193  H  HD13 . LEU A 1 159 ? 45.502  59.102 4.976   1.00 0.00  ? 159 LEU A HD13 2  
ATOM   6194  H  HD21 . LEU A 1 159 ? 46.794  58.277 2.654   1.00 0.00  ? 159 LEU A HD21 2  
ATOM   6195  H  HD22 . LEU A 1 159 ? 45.039  58.141 2.567   1.00 0.00  ? 159 LEU A HD22 2  
ATOM   6196  H  HD23 . LEU A 1 159 ? 46.052  56.768 2.127   1.00 0.00  ? 159 LEU A HD23 2  
ATOM   6197  N  N    . ASN A 1 160 ? 45.474  52.760 5.418   1.00 0.00  ? 160 ASN A N    2  
ATOM   6198  C  CA   . ASN A 1 160 ? 44.870  52.105 6.613   1.00 0.00  ? 160 ASN A CA   2  
ATOM   6199  C  C    . ASN A 1 160 ? 45.980  51.584 7.525   1.00 0.00  ? 160 ASN A C    2  
ATOM   6200  O  O    . ASN A 1 160 ? 47.087  51.341 7.088   1.00 0.00  ? 160 ASN A O    2  
ATOM   6201  C  CB   . ASN A 1 160 ? 43.990  50.942 6.151   1.00 0.00  ? 160 ASN A CB   2  
ATOM   6202  C  CG   . ASN A 1 160 ? 44.854  49.889 5.454   1.00 0.00  ? 160 ASN A CG   2  
ATOM   6203  O  OD1  . ASN A 1 160 ? 46.064  49.995 5.433   1.00 0.00  ? 160 ASN A OD1  2  
ATOM   6204  N  ND2  . ASN A 1 160 ? 44.279  48.870 4.877   1.00 0.00  ? 160 ASN A ND2  2  
ATOM   6205  H  H    . ASN A 1 160 ? 45.649  52.232 4.611   1.00 0.00  ? 160 ASN A H    2  
ATOM   6206  H  HA   . ASN A 1 160 ? 44.267  52.812 7.153   1.00 0.00  ? 160 ASN A HA   2  
ATOM   6207  H  HB2  . ASN A 1 160 ? 43.500  50.499 7.006   1.00 0.00  ? 160 ASN A HB2  2  
ATOM   6208  H  HB3  . ASN A 1 160 ? 43.246  51.311 5.457   1.00 0.00  ? 160 ASN A HB3  2  
ATOM   6209  H  HD21 . ASN A 1 160 ? 43.303  48.784 4.893   1.00 0.00  ? 160 ASN A HD21 2  
ATOM   6210  H  HD22 . ASN A 1 160 ? 44.823  48.190 4.427   1.00 0.00  ? 160 ASN A HD22 2  
ATOM   6211  N  N    . ARG A 1 161 ? 45.695  51.396 8.789   1.00 0.00  ? 161 ARG A N    2  
ATOM   6212  C  CA   . ARG A 1 161 ? 46.743  50.873 9.713   1.00 0.00  ? 161 ARG A CA   2  
ATOM   6213  C  C    . ARG A 1 161 ? 47.359  49.637 9.065   1.00 0.00  ? 161 ARG A C    2  
ATOM   6214  O  O    . ARG A 1 161 ? 46.744  49.025 8.225   1.00 0.00  ? 161 ARG A O    2  
ATOM   6215  C  CB   . ARG A 1 161 ? 46.102  50.499 11.054  1.00 0.00  ? 161 ARG A CB   2  
ATOM   6216  C  CG   . ARG A 1 161 ? 47.192  50.323 12.115  1.00 0.00  ? 161 ARG A CG   2  
ATOM   6217  C  CD   . ARG A 1 161 ? 46.595  49.669 13.364  1.00 0.00  ? 161 ARG A CD   2  
ATOM   6218  N  NE   . ARG A 1 161 ? 45.286  50.318 13.710  1.00 0.00  ? 161 ARG A NE   2  
ATOM   6219  C  CZ   . ARG A 1 161 ? 45.193  51.604 13.923  1.00 0.00  ? 161 ARG A CZ   2  
ATOM   6220  N  NH1  . ARG A 1 161 ? 46.266  52.340 14.019  1.00 0.00  ? 161 ARG A NH1  2  
ATOM   6221  N  NH2  . ARG A 1 161 ? 44.020  52.149 14.096  1.00 0.00  ? 161 ARG A NH2  2  
ATOM   6222  H  H    . ARG A 1 161 ? 44.794  51.588 9.124   1.00 0.00  ? 161 ARG A H    2  
ATOM   6223  H  HA   . ARG A 1 161 ? 47.504  51.625 9.866   1.00 0.00  ? 161 ARG A HA   2  
ATOM   6224  H  HB2  . ARG A 1 161 ? 45.425  51.284 11.357  1.00 0.00  ? 161 ARG A HB2  2  
ATOM   6225  H  HB3  . ARG A 1 161 ? 45.555  49.574 10.946  1.00 0.00  ? 161 ARG A HB3  2  
ATOM   6226  H  HG2  . ARG A 1 161 ? 47.973  49.690 11.721  1.00 0.00  ? 161 ARG A HG2  2  
ATOM   6227  H  HG3  . ARG A 1 161 ? 47.607  51.283 12.369  1.00 0.00  ? 161 ARG A HG3  2  
ATOM   6228  H  HD2  . ARG A 1 161 ? 46.398  48.634 13.162  1.00 0.00  ? 161 ARG A HD2  2  
ATOM   6229  H  HD3  . ARG A 1 161 ? 47.310  49.739 14.183  1.00 0.00  ? 161 ARG A HD3  2  
ATOM   6230  H  HE   . ARG A 1 161 ? 44.473  49.771 13.728  1.00 0.00  ? 161 ARG A HE   2  
ATOM   6231  H  HH11 . ARG A 1 161 ? 47.169  51.921 13.933  1.00 0.00  ? 161 ARG A HH11 2  
ATOM   6232  H  HH12 . ARG A 1 161 ? 46.185  53.324 14.178  1.00 0.00  ? 161 ARG A HH12 2  
ATOM   6233  H  HH21 . ARG A 1 161 ? 43.196  51.582 14.065  1.00 0.00  ? 161 ARG A HH21 2  
ATOM   6234  H  HH22 . ARG A 1 161 ? 43.944  53.132 14.259  1.00 0.00  ? 161 ARG A HH22 2  
ATOM   6235  N  N    . ILE A 1 162 ? 48.558  49.268 9.428   1.00 0.00  ? 162 ILE A N    2  
ATOM   6236  C  CA   . ILE A 1 162 ? 49.194  48.077 8.786   1.00 0.00  ? 162 ILE A CA   2  
ATOM   6237  C  C    . ILE A 1 162 ? 48.243  46.865 8.919   1.00 0.00  ? 162 ILE A C    2  
ATOM   6238  O  O    . ILE A 1 162 ? 48.087  46.349 10.007  1.00 0.00  ? 162 ILE A O    2  
ATOM   6239  C  CB   . ILE A 1 162 ? 50.513  47.768 9.523   1.00 0.00  ? 162 ILE A CB   2  
ATOM   6240  C  CG1  . ILE A 1 162 ? 50.353  48.080 11.016  1.00 0.00  ? 162 ILE A CG1  2  
ATOM   6241  C  CG2  . ILE A 1 162 ? 51.645  48.630 8.952   1.00 0.00  ? 162 ILE A CG2  2  
ATOM   6242  C  CD1  . ILE A 1 162 ? 51.495  47.430 11.799  1.00 0.00  ? 162 ILE A CD1  2  
ATOM   6243  H  H    . ILE A 1 162 ? 49.047  49.781 10.106  1.00 0.00  ? 162 ILE A H    2  
ATOM   6244  H  HA   . ILE A 1 162 ? 49.411  48.294 7.756   1.00 0.00  ? 162 ILE A HA   2  
ATOM   6245  H  HB   . ILE A 1 162 ? 50.765  46.723 9.397   1.00 0.00  ? 162 ILE A HB   2  
ATOM   6246  H  HG12 . ILE A 1 162 ? 50.376  49.150 11.166  1.00 0.00  ? 162 ILE A HG12 2  
ATOM   6247  H  HG13 . ILE A 1 162 ? 49.412  47.690 11.370  1.00 0.00  ? 162 ILE A HG13 2  
ATOM   6248  H  HG21 . ILE A 1 162 ? 51.795  48.384 7.911   1.00 0.00  ? 162 ILE A HG21 2  
ATOM   6249  H  HG22 . ILE A 1 162 ? 52.555  48.440 9.501   1.00 0.00  ? 162 ILE A HG22 2  
ATOM   6250  H  HG23 . ILE A 1 162 ? 51.383  49.674 9.041   1.00 0.00  ? 162 ILE A HG23 2  
ATOM   6251  H  HD11 . ILE A 1 162 ? 52.441  47.740 11.381  1.00 0.00  ? 162 ILE A HD11 2  
ATOM   6252  H  HD12 . ILE A 1 162 ? 51.409  46.355 11.736  1.00 0.00  ? 162 ILE A HD12 2  
ATOM   6253  H  HD13 . ILE A 1 162 ? 51.442  47.735 12.834  1.00 0.00  ? 162 ILE A HD13 2  
ATOM   6254  N  N    . PRO A 1 163 ? 47.615  46.424 7.829   1.00 0.00  ? 163 PRO A N    2  
ATOM   6255  C  CA   . PRO A 1 163 ? 46.694  45.274 7.914   1.00 0.00  ? 163 PRO A CA   2  
ATOM   6256  C  C    . PRO A 1 163 ? 47.500  44.003 8.219   1.00 0.00  ? 163 PRO A C    2  
ATOM   6257  O  O    . PRO A 1 163 ? 48.335  43.586 7.441   1.00 0.00  ? 163 PRO A O    2  
ATOM   6258  C  CB   . PRO A 1 163 ? 46.013  45.201 6.524   1.00 0.00  ? 163 PRO A CB   2  
ATOM   6259  C  CG   . PRO A 1 163 ? 46.595  46.356 5.659   1.00 0.00  ? 163 PRO A CG   2  
ATOM   6260  C  CD   . PRO A 1 163 ? 47.747  46.994 6.460   1.00 0.00  ? 163 PRO A CD   2  
ATOM   6261  H  HA   . PRO A 1 163 ? 45.957  45.443 8.685   1.00 0.00  ? 163 PRO A HA   2  
ATOM   6262  H  HB2  . PRO A 1 163 ? 46.217  44.245 6.054   1.00 0.00  ? 163 PRO A HB2  2  
ATOM   6263  H  HB3  . PRO A 1 163 ? 44.944  45.330 6.629   1.00 0.00  ? 163 PRO A HB3  2  
ATOM   6264  H  HG2  . PRO A 1 163 ? 46.964  45.967 4.717   1.00 0.00  ? 163 PRO A HG2  2  
ATOM   6265  H  HG3  . PRO A 1 163 ? 45.828  47.104 5.472   1.00 0.00  ? 163 PRO A HG3  2  
ATOM   6266  H  HD2  . PRO A 1 163 ? 48.703  46.719 6.028   1.00 0.00  ? 163 PRO A HD2  2  
ATOM   6267  H  HD3  . PRO A 1 163 ? 47.638  48.061 6.473   1.00 0.00  ? 163 PRO A HD3  2  
ATOM   6268  N  N    . TYR A 1 164 ? 47.259  43.387 9.345   1.00 21.59 ? 164 TYR A N    2  
ATOM   6269  C  CA   . TYR A 1 164 ? 47.998  42.167 9.699   1.00 23.23 ? 164 TYR A CA   2  
ATOM   6270  C  C    . TYR A 1 164 ? 47.331  41.549 10.943  1.00 28.07 ? 164 TYR A C    2  
ATOM   6271  O  O    . TYR A 1 164 ? 46.122  41.520 11.048  1.00 28.03 ? 164 TYR A O    2  
ATOM   6272  C  CB   . TYR A 1 164 ? 49.475  42.538 9.983   1.00 21.58 ? 164 TYR A CB   2  
ATOM   6273  C  CG   . TYR A 1 164 ? 50.388  41.450 9.473   1.00 24.37 ? 164 TYR A CG   2  
ATOM   6274  C  CD1  . TYR A 1 164 ? 49.999  40.115 9.579   1.00 21.25 ? 164 TYR A CD1  2  
ATOM   6275  C  CD2  . TYR A 1 164 ? 51.610  41.778 8.874   1.00 21.98 ? 164 TYR A CD2  2  
ATOM   6276  C  CE1  . TYR A 1 164 ? 50.815  39.113 9.094   1.00 20.80 ? 164 TYR A CE1  2  
ATOM   6277  C  CE2  . TYR A 1 164 ? 52.441  40.762 8.386   1.00 26.65 ? 164 TYR A CE2  2  
ATOM   6278  C  CZ   . TYR A 1 164 ? 52.042  39.425 8.496   1.00 27.39 ? 164 TYR A CZ   2  
ATOM   6279  O  OH   . TYR A 1 164 ? 52.854  38.419 8.013   1.00 29.41 ? 164 TYR A OH   2  
ATOM   6280  H  H    . TYR A 1 164 ? 46.596  43.723 9.955   1.00 0.00  ? 164 TYR A H    2  
ATOM   6281  H  HA   . TYR A 1 164 ? 47.933  41.476 8.871   1.00 0.00  ? 164 TYR A HA   2  
ATOM   6282  H  HB2  . TYR A 1 164 ? 49.711  43.462 9.477   1.00 0.00  ? 164 TYR A HB2  2  
ATOM   6283  H  HB3  . TYR A 1 164 ? 49.630  42.669 11.045  1.00 0.00  ? 164 TYR A HB3  2  
ATOM   6284  H  HD1  . TYR A 1 164 ? 49.062  39.856 10.043  1.00 0.00  ? 164 TYR A HD1  2  
ATOM   6285  H  HD2  . TYR A 1 164 ? 51.913  42.811 8.792   1.00 0.00  ? 164 TYR A HD2  2  
ATOM   6286  H  HE1  . TYR A 1 164 ? 50.493  38.099 9.179   1.00 0.00  ? 164 TYR A HE1  2  
ATOM   6287  H  HE2  . TYR A 1 164 ? 53.386  41.009 7.926   1.00 0.00  ? 164 TYR A HE2  2  
ATOM   6288  H  HH   . TYR A 1 164 ? 53.679  38.816 7.725   1.00 0.00  ? 164 TYR A HH   2  
ATOM   6289  N  N    . LYS A 1 165 ? 48.105  41.053 11.877  1.00 0.00  ? 165 LYS A N    2  
ATOM   6290  C  CA   . LYS A 1 165 ? 47.515  40.440 13.104  1.00 0.00  ? 165 LYS A CA   2  
ATOM   6291  C  C    . LYS A 1 165 ? 46.708  39.203 12.712  1.00 0.00  ? 165 LYS A C    2  
ATOM   6292  O  O    . LYS A 1 165 ? 47.197  38.094 12.779  1.00 0.00  ? 165 LYS A O    2  
ATOM   6293  C  CB   . LYS A 1 165 ? 46.616  41.455 13.828  1.00 0.00  ? 165 LYS A CB   2  
ATOM   6294  C  CG   . LYS A 1 165 ? 47.312  42.818 13.870  1.00 0.00  ? 165 LYS A CG   2  
ATOM   6295  C  CD   . LYS A 1 165 ? 46.608  43.722 14.885  1.00 0.00  ? 165 LYS A CD   2  
ATOM   6296  C  CE   . LYS A 1 165 ? 47.378  45.037 15.016  1.00 0.00  ? 165 LYS A CE   2  
ATOM   6297  N  NZ   . LYS A 1 165 ? 48.729  44.766 15.584  1.00 0.00  ? 165 LYS A NZ   2  
ATOM   6298  H  H    . LYS A 1 165 ? 49.079  41.075 11.766  1.00 0.00  ? 165 LYS A H    2  
ATOM   6299  H  HA   . LYS A 1 165 ? 48.312  40.143 13.767  1.00 0.00  ? 165 LYS A HA   2  
ATOM   6300  H  HB2  . LYS A 1 165 ? 45.674  41.547 13.314  1.00 0.00  ? 165 LYS A HB2  2  
ATOM   6301  H  HB3  . LYS A 1 165 ? 46.439  41.116 14.838  1.00 0.00  ? 165 LYS A HB3  2  
ATOM   6302  H  HG2  . LYS A 1 165 ? 48.344  42.686 14.159  1.00 0.00  ? 165 LYS A HG2  2  
ATOM   6303  H  HG3  . LYS A 1 165 ? 47.267  43.275 12.894  1.00 0.00  ? 165 LYS A HG3  2  
ATOM   6304  H  HD2  . LYS A 1 165 ? 45.601  43.924 14.549  1.00 0.00  ? 165 LYS A HD2  2  
ATOM   6305  H  HD3  . LYS A 1 165 ? 46.575  43.229 15.845  1.00 0.00  ? 165 LYS A HD3  2  
ATOM   6306  H  HE2  . LYS A 1 165 ? 47.481  45.493 14.042  1.00 0.00  ? 165 LYS A HE2  2  
ATOM   6307  H  HE3  . LYS A 1 165 ? 46.839  45.706 15.671  1.00 0.00  ? 165 LYS A HE3  2  
ATOM   6308  H  HZ1  . LYS A 1 165 ? 48.926  45.443 16.348  1.00 0.00  ? 165 LYS A HZ1  2  
ATOM   6309  H  HZ2  . LYS A 1 165 ? 49.445  44.867 14.836  1.00 0.00  ? 165 LYS A HZ2  2  
ATOM   6310  H  HZ3  . LYS A 1 165 ? 48.757  43.800 15.965  1.00 0.00  ? 165 LYS A HZ3  2  
ATOM   6311  N  N    . ASP A 1 166 ? 45.486  39.378 12.290  1.00 0.00  ? 166 ASP A N    2  
ATOM   6312  C  CA   . ASP A 1 166 ? 44.663  38.207 11.883  1.00 0.00  ? 166 ASP A CA   2  
ATOM   6313  C  C    . ASP A 1 166 ? 44.715  37.125 12.966  1.00 0.00  ? 166 ASP A C    2  
ATOM   6314  O  O    . ASP A 1 166 ? 43.878  37.082 13.846  1.00 0.00  ? 166 ASP A O    2  
ATOM   6315  C  CB   . ASP A 1 166 ? 45.208  37.645 10.573  1.00 0.00  ? 166 ASP A CB   2  
ATOM   6316  C  CG   . ASP A 1 166 ? 44.449  36.368 10.206  1.00 0.00  ? 166 ASP A CG   2  
ATOM   6317  O  OD1  . ASP A 1 166 ? 44.549  35.406 10.950  1.00 0.00  ? 166 ASP A OD1  2  
ATOM   6318  O  OD2  . ASP A 1 166 ? 43.779  36.373 9.186   1.00 0.00  ? 166 ASP A OD2  2  
ATOM   6319  H  H    . ASP A 1 166 ? 45.112  40.281 12.231  1.00 0.00  ? 166 ASP A H    2  
ATOM   6320  H  HA   . ASP A 1 166 ? 43.640  38.520 11.739  1.00 0.00  ? 166 ASP A HA   2  
ATOM   6321  H  HB2  . ASP A 1 166 ? 45.084  38.377 9.788   1.00 0.00  ? 166 ASP A HB2  2  
ATOM   6322  H  HB3  . ASP A 1 166 ? 46.255  37.420 10.693  1.00 0.00  ? 166 ASP A HB3  2  
ATOM   6323  N  N    . THR A 1 167 ? 45.686  36.246 12.916  1.00 0.00  ? 167 THR A N    2  
ATOM   6324  C  CA   . THR A 1 167 ? 45.767  35.180 13.944  1.00 0.00  ? 167 THR A CA   2  
ATOM   6325  C  C    . THR A 1 167 ? 47.130  34.501 13.865  1.00 0.00  ? 167 THR A C    2  
ATOM   6326  O  O    . THR A 1 167 ? 47.274  33.342 14.201  1.00 0.00  ? 167 THR A O    2  
ATOM   6327  C  CB   . THR A 1 167 ? 44.653  34.151 13.700  1.00 0.00  ? 167 THR A CB   2  
ATOM   6328  O  OG1  . THR A 1 167 ? 43.470  34.825 13.295  1.00 0.00  ? 167 THR A OG1  2  
ATOM   6329  C  CG2  . THR A 1 167 ? 44.376  33.370 14.986  1.00 0.00  ? 167 THR A CG2  2  
ATOM   6330  H  H    . THR A 1 167 ? 46.359  36.286 12.205  1.00 0.00  ? 167 THR A H    2  
ATOM   6331  H  HA   . THR A 1 167 ? 45.652  35.619 14.920  1.00 0.00  ? 167 THR A HA   2  
ATOM   6332  H  HB   . THR A 1 167 ? 44.955  33.463 12.925  1.00 0.00  ? 167 THR A HB   2  
ATOM   6333  H  HG1  . THR A 1 167 ? 43.509  34.946 12.344  1.00 0.00  ? 167 THR A HG1  2  
ATOM   6334  H  HG21 . THR A 1 167 ? 44.128  34.059 15.779  1.00 0.00  ? 167 THR A HG21 2  
ATOM   6335  H  HG22 . THR A 1 167 ? 45.254  32.806 15.260  1.00 0.00  ? 167 THR A HG22 2  
ATOM   6336  H  HG23 . THR A 1 167 ? 43.550  32.694 14.825  1.00 0.00  ? 167 THR A HG23 2  
ATOM   6337  N  N    . PHE A 1 168 ? 48.143  35.212 13.440  1.00 0.00  ? 168 PHE A N    2  
ATOM   6338  C  CA   . PHE A 1 168 ? 49.499  34.593 13.366  1.00 0.00  ? 168 PHE A CA   2  
ATOM   6339  C  C    . PHE A 1 168 ? 50.558  35.633 13.682  1.00 0.00  ? 168 PHE A C    2  
ATOM   6340  O  O    . PHE A 1 168 ? 51.034  36.358 12.835  1.00 0.00  ? 168 PHE A O    2  
ATOM   6341  C  CB   . PHE A 1 168 ? 49.747  33.964 11.984  1.00 0.00  ? 168 PHE A CB   2  
ATOM   6342  C  CG   . PHE A 1 168 ? 48.774  34.527 10.975  1.00 0.00  ? 168 PHE A CG   2  
ATOM   6343  C  CD1  . PHE A 1 168 ? 49.075  35.705 10.280  1.00 0.00  ? 168 PHE A CD1  2  
ATOM   6344  C  CD2  . PHE A 1 168 ? 47.571  33.857 10.730  1.00 0.00  ? 168 PHE A CD2  2  
ATOM   6345  C  CE1  . PHE A 1 168 ? 48.170  36.209 9.337   1.00 0.00  ? 168 PHE A CE1  2  
ATOM   6346  C  CE2  . PHE A 1 168 ? 46.666  34.362 9.793   1.00 0.00  ? 168 PHE A CE2  2  
ATOM   6347  C  CZ   . PHE A 1 168 ? 46.965  35.537 9.094   1.00 0.00  ? 168 PHE A CZ   2  
ATOM   6348  H  H    . PHE A 1 168 ? 48.014  36.149 13.184  1.00 0.00  ? 168 PHE A H    2  
ATOM   6349  H  HA   . PHE A 1 168 ? 49.566  33.839 14.123  1.00 0.00  ? 168 PHE A HA   2  
ATOM   6350  H  HB2  . PHE A 1 168 ? 50.756  34.172 11.669  1.00 0.00  ? 168 PHE A HB2  2  
ATOM   6351  H  HB3  . PHE A 1 168 ? 49.611  32.892 12.045  1.00 0.00  ? 168 PHE A HB3  2  
ATOM   6352  H  HD1  . PHE A 1 168 ? 50.001  36.228 10.474  1.00 0.00  ? 168 PHE A HD1  2  
ATOM   6353  H  HD2  . PHE A 1 168 ? 47.339  32.950 11.269  1.00 0.00  ? 168 PHE A HD2  2  
ATOM   6354  H  HE1  . PHE A 1 168 ? 48.400  37.117 8.799   1.00 0.00  ? 168 PHE A HE1  2  
ATOM   6355  H  HE2  . PHE A 1 168 ? 45.736  33.847 9.613   1.00 0.00  ? 168 PHE A HE2  2  
ATOM   6356  H  HZ   . PHE A 1 168 ? 46.268  35.926 8.367   1.00 0.00  ? 168 PHE A HZ   2  
ATOM   6357  N  N    . TRP A 1 169 ? 50.913  35.677 14.919  1.00 0.00  ? 169 TRP A N    2  
ATOM   6358  C  CA   . TRP A 1 169 ? 51.928  36.636 15.403  1.00 0.00  ? 169 TRP A CA   2  
ATOM   6359  C  C    . TRP A 1 169 ? 52.494  36.094 16.713  1.00 0.00  ? 169 TRP A C    2  
ATOM   6360  O  O    . TRP A 1 169 ? 53.609  36.386 17.099  1.00 0.00  ? 169 TRP A O    2  
ATOM   6361  C  CB   . TRP A 1 169 ? 51.215  37.972 15.644  1.00 0.00  ? 169 TRP A CB   2  
ATOM   6362  C  CG   . TRP A 1 169 ? 51.333  38.850 14.439  1.00 0.00  ? 169 TRP A CG   2  
ATOM   6363  C  CD1  . TRP A 1 169 ? 50.491  38.824 13.387  1.00 0.00  ? 169 TRP A CD1  2  
ATOM   6364  C  CD2  . TRP A 1 169 ? 52.326  39.874 14.148  1.00 0.00  ? 169 TRP A CD2  2  
ATOM   6365  N  NE1  . TRP A 1 169 ? 50.901  39.769 12.462  1.00 0.00  ? 169 TRP A NE1  2  
ATOM   6366  C  CE2  . TRP A 1 169 ? 52.029  40.443 12.887  1.00 0.00  ? 169 TRP A CE2  2  
ATOM   6367  C  CE3  . TRP A 1 169 ? 53.445  40.361 14.849  1.00 0.00  ? 169 TRP A CE3  2  
ATOM   6368  C  CZ2  . TRP A 1 169 ? 52.814  41.458 12.339  1.00 0.00  ? 169 TRP A CZ2  2  
ATOM   6369  C  CZ3  . TRP A 1 169 ? 54.237  41.383 14.300  1.00 0.00  ? 169 TRP A CZ3  2  
ATOM   6370  C  CH2  . TRP A 1 169 ? 53.922  41.930 13.048  1.00 0.00  ? 169 TRP A CH2  2  
ATOM   6371  H  H    . TRP A 1 169 ? 50.495  35.065 15.545  1.00 0.00  ? 169 TRP A H    2  
ATOM   6372  H  HA   . TRP A 1 169 ? 52.715  36.743 14.680  1.00 0.00  ? 169 TRP A HA   2  
ATOM   6373  H  HB2  . TRP A 1 169 ? 50.167  37.761 15.823  1.00 0.00  ? 169 TRP A HB2  2  
ATOM   6374  H  HB3  . TRP A 1 169 ? 51.637  38.476 16.503  1.00 0.00  ? 169 TRP A HB3  2  
ATOM   6375  H  HD1  . TRP A 1 169 ? 49.636  38.168 13.288  1.00 0.00  ? 169 TRP A HD1  2  
ATOM   6376  H  HE1  . TRP A 1 169 ? 50.459  39.952 11.607  1.00 0.00  ? 169 TRP A HE1  2  
ATOM   6377  H  HE3  . TRP A 1 169 ? 53.696  39.946 15.813  1.00 0.00  ? 169 TRP A HE3  2  
ATOM   6378  H  HZ2  . TRP A 1 169 ? 52.566  41.876 11.375  1.00 0.00  ? 169 TRP A HZ2  2  
ATOM   6379  H  HZ3  . TRP A 1 169 ? 55.094  41.750 14.846  1.00 0.00  ? 169 TRP A HZ3  2  
ATOM   6380  H  HH2  . TRP A 1 169 ? 54.535  42.716 12.632  1.00 0.00  ? 169 TRP A HH2  2  
ATOM   6381  N  N    . LYS A 1 170 ? 51.719  35.303 17.393  1.00 0.00  ? 170 LYS A N    2  
ATOM   6382  C  CA   . LYS A 1 170 ? 52.180  34.722 18.683  1.00 0.00  ? 170 LYS A CA   2  
ATOM   6383  C  C    . LYS A 1 170 ? 52.778  35.822 19.561  1.00 0.00  ? 170 LYS A C    2  
ATOM   6384  O  O    . LYS A 1 170 ? 53.841  35.668 20.129  1.00 0.00  ? 170 LYS A O    2  
ATOM   6385  C  CB   . LYS A 1 170 ? 53.236  33.657 18.409  1.00 0.00  ? 170 LYS A CB   2  
ATOM   6386  C  CG   . LYS A 1 170 ? 52.643  32.495 17.564  1.00 0.00  ? 170 LYS A CG   2  
ATOM   6387  C  CD   . LYS A 1 170 ? 52.433  31.242 18.431  1.00 0.00  ? 170 LYS A CD   2  
ATOM   6388  C  CE   . LYS A 1 170 ? 51.345  31.502 19.476  1.00 0.00  ? 170 LYS A CE   2  
ATOM   6389  N  NZ   . LYS A 1 170 ? 50.131  32.053 18.810  1.00 0.00  ? 170 LYS A NZ   2  
ATOM   6390  H  H    . LYS A 1 170 ? 50.825  35.090 17.047  1.00 0.00  ? 170 LYS A H    2  
ATOM   6391  H  HA   . LYS A 1 170 ? 51.354  34.272 19.187  1.00 0.00  ? 170 LYS A HA   2  
ATOM   6392  H  HB2  . LYS A 1 170 ? 54.040  34.119 17.873  1.00 0.00  ? 170 LYS A HB2  2  
ATOM   6393  H  HB3  . LYS A 1 170 ? 53.609  33.279 19.348  1.00 0.00  ? 170 LYS A HB3  2  
ATOM   6394  H  HG2  . LYS A 1 170 ? 51.695  32.793 17.137  1.00 0.00  ? 170 LYS A HG2  2  
ATOM   6395  H  HG3  . LYS A 1 170 ? 53.325  32.251 16.761  1.00 0.00  ? 170 LYS A HG3  2  
ATOM   6396  H  HD2  . LYS A 1 170 ? 52.133  30.417 17.800  1.00 0.00  ? 170 LYS A HD2  2  
ATOM   6397  H  HD3  . LYS A 1 170 ? 53.357  30.991 18.931  1.00 0.00  ? 170 LYS A HD3  2  
ATOM   6398  H  HE2  . LYS A 1 170 ? 51.093  30.575 19.969  1.00 0.00  ? 170 LYS A HE2  2  
ATOM   6399  H  HE3  . LYS A 1 170 ? 51.709  32.209 20.207  1.00 0.00  ? 170 LYS A HE3  2  
ATOM   6400  H  HZ1  . LYS A 1 170 ? 50.226  31.957 17.779  1.00 0.00  ? 170 LYS A HZ1  2  
ATOM   6401  H  HZ2  . LYS A 1 170 ? 50.026  33.058 19.057  1.00 0.00  ? 170 LYS A HZ2  2  
ATOM   6402  H  HZ3  . LYS A 1 170 ? 49.292  31.528 19.128  1.00 0.00  ? 170 LYS A HZ3  2  
ATOM   6403  N  N    . GLY A 1 171 ? 52.104  36.933 19.677  1.00 0.00  ? 171 GLY A N    2  
ATOM   6404  C  CA   . GLY A 1 171 ? 52.635  38.042 20.519  1.00 0.00  ? 171 GLY A CA   2  
ATOM   6405  C  C    . GLY A 1 171 ? 53.913  38.596 19.888  1.00 0.00  ? 171 GLY A C    2  
ATOM   6406  O  O    . GLY A 1 171 ? 54.657  39.261 20.590  1.00 0.00  ? 171 GLY A O    2  
ATOM   6407  O  OXT  . GLY A 1 171 ? 54.127  38.345 18.713  1.00 0.00  ? 171 GLY A OXT  2  
ATOM   6408  H  H    . GLY A 1 171 ? 51.249  37.038 19.211  1.00 0.00  ? 171 GLY A H    2  
ATOM   6409  H  HA2  . GLY A 1 171 ? 51.895  38.827 20.587  1.00 0.00  ? 171 GLY A HA2  2  
ATOM   6410  H  HA3  . GLY A 1 171 ? 52.857  37.670 21.507  1.00 0.00  ? 171 GLY A HA3  2  
ATOM   6411  N  N    . MET B 2 1   ? 47.551  68.013 -27.673 1.00 7.62  ? 1   MET B N    2  
ATOM   6412  C  CA   . MET B 2 1   ? 46.867  66.982 -26.843 1.00 7.57  ? 1   MET B CA   2  
ATOM   6413  C  C    . MET B 2 1   ? 45.985  67.671 -25.799 1.00 6.87  ? 1   MET B C    2  
ATOM   6414  O  O    . MET B 2 1   ? 44.929  68.185 -26.108 1.00 7.06  ? 1   MET B O    2  
ATOM   6415  C  CB   . MET B 2 1   ? 47.915  66.119 -26.136 1.00 8.22  ? 1   MET B CB   2  
ATOM   6416  C  CG   . MET B 2 1   ? 48.778  65.406 -27.178 1.00 8.89  ? 1   MET B CG   2  
ATOM   6417  S  SD   . MET B 2 1   ? 47.784  64.155 -28.030 1.00 9.69  ? 1   MET B SD   2  
ATOM   6418  C  CE   . MET B 2 1   ? 49.130  63.406 -28.980 1.00 10.47 ? 1   MET B CE   2  
ATOM   6419  H  H1   . MET B 2 1   ? 48.306  68.462 -27.117 1.00 7.70  ? 1   MET B H1   2  
ATOM   6420  H  H2   . MET B 2 1   ? 46.861  68.734 -27.968 1.00 7.68  ? 1   MET B H2   2  
ATOM   6421  H  H3   . MET B 2 1   ? 47.964  67.563 -28.515 1.00 7.83  ? 1   MET B H3   2  
ATOM   6422  H  HA   . MET B 2 1   ? 46.255  66.358 -27.476 1.00 7.86  ? 1   MET B HA   2  
ATOM   6423  H  HB2  . MET B 2 1   ? 48.540  66.747 -25.518 1.00 8.21  ? 1   MET B HB2  2  
ATOM   6424  H  HB3  . MET B 2 1   ? 47.420  65.385 -25.518 1.00 8.52  ? 1   MET B HB3  2  
ATOM   6425  H  HG2  . MET B 2 1   ? 49.144  66.125 -27.896 1.00 8.92  ? 1   MET B HG2  2  
ATOM   6426  H  HG3  . MET B 2 1   ? 49.614  64.929 -26.688 1.00 9.14  ? 1   MET B HG3  2  
ATOM   6427  H  HE1  . MET B 2 1   ? 49.428  64.079 -29.773 1.00 10.65 ? 1   MET B HE1  2  
ATOM   6428  H  HE2  . MET B 2 1   ? 48.795  62.476 -29.409 1.00 10.84 ? 1   MET B HE2  2  
ATOM   6429  H  HE3  . MET B 2 1   ? 49.970  63.218 -28.326 1.00 10.61 ? 1   MET B HE3  2  
ATOM   6430  N  N    . ALA B 2 2   ? 46.411  67.686 -24.566 1.00 6.37  ? 2   ALA B N    2  
ATOM   6431  C  CA   . ALA B 2 2   ? 45.597  68.342 -23.504 1.00 5.98  ? 2   ALA B CA   2  
ATOM   6432  C  C    . ALA B 2 2   ? 45.721  69.862 -23.632 1.00 5.18  ? 2   ALA B C    2  
ATOM   6433  O  O    . ALA B 2 2   ? 45.656  70.411 -24.714 1.00 5.33  ? 2   ALA B O    2  
ATOM   6434  C  CB   . ALA B 2 2   ? 46.103  67.902 -22.129 1.00 6.35  ? 2   ALA B CB   2  
ATOM   6435  H  H    . ALA B 2 2   ? 47.266  67.265 -24.338 1.00 6.49  ? 2   ALA B H    2  
ATOM   6436  H  HA   . ALA B 2 2   ? 44.562  68.054 -23.615 1.00 6.37  ? 2   ALA B HA   2  
ATOM   6437  H  HB1  . ALA B 2 2   ? 47.122  68.236 -21.997 1.00 6.56  ? 2   ALA B HB1  2  
ATOM   6438  H  HB2  . ALA B 2 2   ? 46.066  66.825 -22.059 1.00 6.56  ? 2   ALA B HB2  2  
ATOM   6439  H  HB3  . ALA B 2 2   ? 45.480  68.334 -21.361 1.00 6.56  ? 2   ALA B HB3  2  
ATOM   6440  N  N    . ASN B 2 3   ? 45.900  70.546 -22.535 1.00 4.74  ? 3   ASN B N    2  
ATOM   6441  C  CA   . ASN B 2 3   ? 46.028  72.030 -22.595 1.00 4.38  ? 3   ASN B CA   2  
ATOM   6442  C  C    . ASN B 2 3   ? 44.821  72.617 -23.330 1.00 3.55  ? 3   ASN B C    2  
ATOM   6443  O  O    . ASN B 2 3   ? 43.703  72.176 -23.155 1.00 3.87  ? 3   ASN B O    2  
ATOM   6444  C  CB   . ASN B 2 3   ? 47.310  72.401 -23.343 1.00 4.98  ? 3   ASN B CB   2  
ATOM   6445  C  CG   . ASN B 2 3   ? 48.482  71.593 -22.783 1.00 5.68  ? 3   ASN B CG   2  
ATOM   6446  O  OD1  . ASN B 2 3   ? 48.533  71.314 -21.602 1.00 6.06  ? 3   ASN B OD1  2  
ATOM   6447  N  ND2  . ASN B 2 3   ? 49.432  71.201 -23.588 1.00 6.21  ? 3   ASN B ND2  2  
ATOM   6448  H  H    . ASN B 2 3   ? 45.949  70.084 -21.672 1.00 4.97  ? 3   ASN B H    2  
ATOM   6449  H  HA   . ASN B 2 3   ? 46.068  72.428 -21.592 1.00 4.77  ? 3   ASN B HA   2  
ATOM   6450  H  HB2  . ASN B 2 3   ? 47.189  72.182 -24.394 1.00 5.11  ? 3   ASN B HB2  2  
ATOM   6451  H  HB3  . ASN B 2 3   ? 47.509  73.455 -23.216 1.00 5.25  ? 3   ASN B HB3  2  
ATOM   6452  H  HD21 . ASN B 2 3   ? 49.391  71.426 -24.541 1.00 6.18  ? 3   ASN B HD21 2  
ATOM   6453  H  HD22 . ASN B 2 3   ? 50.187  70.683 -23.239 1.00 6.83  ? 3   ASN B HD22 2  
ATOM   6454  N  N    . ALA B 2 4   ? 45.041  73.609 -24.151 1.00 2.99  ? 4   ALA B N    2  
ATOM   6455  C  CA   . ALA B 2 4   ? 43.911  74.230 -24.902 1.00 2.69  ? 4   ALA B CA   2  
ATOM   6456  C  C    . ALA B 2 4   ? 42.905  74.833 -23.916 1.00 1.96  ? 4   ALA B C    2  
ATOM   6457  O  O    . ALA B 2 4   ? 42.543  74.221 -22.931 1.00 2.51  ? 4   ALA B O    2  
ATOM   6458  C  CB   . ALA B 2 4   ? 43.221  73.166 -25.763 1.00 3.52  ? 4   ALA B CB   2  
ATOM   6459  H  H    . ALA B 2 4   ? 45.952  73.947 -24.274 1.00 3.25  ? 4   ALA B H    2  
ATOM   6460  H  HA   . ALA B 2 4   ? 44.295  75.012 -25.541 1.00 3.12  ? 4   ALA B HA   2  
ATOM   6461  H  HB1  . ALA B 2 4   ? 43.967  72.516 -26.196 1.00 3.91  ? 4   ALA B HB1  2  
ATOM   6462  H  HB2  . ALA B 2 4   ? 42.665  73.649 -26.553 1.00 3.98  ? 4   ALA B HB2  2  
ATOM   6463  H  HB3  . ALA B 2 4   ? 42.546  72.584 -25.153 1.00 3.83  ? 4   ALA B HB3  2  
ATOM   6464  N  N    . LEU B 2 5   ? 42.450  76.030 -24.174 1.00 1.63  ? 5   LEU B N    2  
ATOM   6465  C  CA   . LEU B 2 5   ? 41.466  76.672 -23.254 1.00 2.08  ? 5   LEU B CA   2  
ATOM   6466  C  C    . LEU B 2 5   ? 40.053  76.220 -23.634 1.00 1.73  ? 5   LEU B C    2  
ATOM   6467  O  O    . LEU B 2 5   ? 39.078  76.640 -23.044 1.00 2.53  ? 5   LEU B O    2  
ATOM   6468  C  CB   . LEU B 2 5   ? 41.567  78.204 -23.365 1.00 2.84  ? 5   LEU B CB   2  
ATOM   6469  C  CG   . LEU B 2 5   ? 41.770  78.626 -24.843 1.00 3.64  ? 5   LEU B CG   2  
ATOM   6470  C  CD1  . LEU B 2 5   ? 41.102  79.986 -25.095 1.00 4.30  ? 5   LEU B CD1  2  
ATOM   6471  C  CD2  . LEU B 2 5   ? 43.272  78.738 -25.160 1.00 4.44  ? 5   LEU B CD2  2  
ATOM   6472  H  H    . LEU B 2 5   ? 42.753  76.506 -24.975 1.00 1.95  ? 5   LEU B H    2  
ATOM   6473  H  HA   . LEU B 2 5   ? 41.675  76.373 -22.236 1.00 2.70  ? 5   LEU B HA   2  
ATOM   6474  H  HB2  . LEU B 2 5   ? 40.656  78.646 -22.980 1.00 3.04  ? 5   LEU B HB2  2  
ATOM   6475  H  HB3  . LEU B 2 5   ? 42.402  78.548 -22.771 1.00 3.24  ? 5   LEU B HB3  2  
ATOM   6476  H  HG   . LEU B 2 5   ? 41.320  77.890 -25.496 1.00 3.77  ? 5   LEU B HG   2  
ATOM   6477  H  HD11 . LEU B 2 5   ? 40.041  79.906 -24.910 1.00 4.94  ? 5   LEU B HD11 2  
ATOM   6478  H  HD12 . LEU B 2 5   ? 41.268  80.283 -26.120 1.00 4.44  ? 5   LEU B HD12 2  
ATOM   6479  H  HD13 . LEU B 2 5   ? 41.529  80.724 -24.433 1.00 4.47  ? 5   LEU B HD13 2  
ATOM   6480  H  HD21 . LEU B 2 5   ? 43.651  79.685 -24.801 1.00 4.77  ? 5   LEU B HD21 2  
ATOM   6481  H  HD22 . LEU B 2 5   ? 43.419  78.675 -26.228 1.00 4.82  ? 5   LEU B HD22 2  
ATOM   6482  H  HD23 . LEU B 2 5   ? 43.806  77.933 -24.677 1.00 4.75  ? 5   LEU B HD23 2  
ATOM   6483  N  N    . ALA B 2 6   ? 39.937  75.369 -24.617 1.00 0.89  ? 6   ALA B N    2  
ATOM   6484  C  CA   . ALA B 2 6   ? 38.589  74.893 -25.036 1.00 0.76  ? 6   ALA B CA   2  
ATOM   6485  C  C    . ALA B 2 6   ? 37.709  76.096 -25.380 1.00 0.73  ? 6   ALA B C    2  
ATOM   6486  O  O    . ALA B 2 6   ? 38.196  77.168 -25.681 1.00 0.79  ? 6   ALA B O    2  
ATOM   6487  C  CB   . ALA B 2 6   ? 37.950  74.100 -23.894 1.00 0.92  ? 6   ALA B CB   2  
ATOM   6488  H  H    . ALA B 2 6   ? 40.737  75.045 -25.081 1.00 1.04  ? 6   ALA B H    2  
ATOM   6489  H  HA   . ALA B 2 6   ? 38.686  74.258 -25.905 1.00 0.94  ? 6   ALA B HA   2  
ATOM   6490  H  HB1  . ALA B 2 6   ? 38.668  73.397 -23.497 1.00 1.37  ? 6   ALA B HB1  2  
ATOM   6491  H  HB2  . ALA B 2 6   ? 37.089  73.563 -24.265 1.00 1.41  ? 6   ALA B HB2  2  
ATOM   6492  H  HB3  . ALA B 2 6   ? 37.640  74.778 -23.113 1.00 1.46  ? 6   ALA B HB3  2  
ATOM   6493  N  N    . SER B 2 7   ? 36.416  75.928 -25.338 1.00 0.71  ? 7   SER B N    2  
ATOM   6494  C  CA   . SER B 2 7   ? 35.507  77.063 -25.663 1.00 0.75  ? 7   SER B CA   2  
ATOM   6495  C  C    . SER B 2 7   ? 34.080  76.705 -25.245 1.00 0.81  ? 7   SER B C    2  
ATOM   6496  O  O    . SER B 2 7   ? 33.761  76.651 -24.073 1.00 1.38  ? 7   SER B O    2  
ATOM   6497  C  CB   . SER B 2 7   ? 35.551  77.335 -27.168 1.00 0.79  ? 7   SER B CB   2  
ATOM   6498  O  OG   . SER B 2 7   ? 36.811  77.903 -27.504 1.00 1.36  ? 7   SER B OG   2  
ATOM   6499  H  H    . SER B 2 7   ? 36.043  75.056 -25.093 1.00 0.71  ? 7   SER B H    2  
ATOM   6500  H  HA   . SER B 2 7   ? 35.824  77.943 -25.130 1.00 0.80  ? 7   SER B HA   2  
ATOM   6501  H  HB2  . SER B 2 7   ? 35.424  76.412 -27.708 1.00 1.25  ? 7   SER B HB2  2  
ATOM   6502  H  HB3  . SER B 2 7   ? 34.755  78.018 -27.433 1.00 1.20  ? 7   SER B HB3  2  
ATOM   6503  H  HG   . SER B 2 7   ? 36.985  77.713 -28.429 1.00 1.90  ? 7   SER B HG   2  
ATOM   6504  N  N    . ALA B 2 8   ? 33.221  76.462 -26.194 1.00 0.67  ? 8   ALA B N    2  
ATOM   6505  C  CA   . ALA B 2 8   ? 31.815  76.106 -25.864 1.00 0.62  ? 8   ALA B CA   2  
ATOM   6506  C  C    . ALA B 2 8   ? 31.798  75.051 -24.758 1.00 0.60  ? 8   ALA B C    2  
ATOM   6507  O  O    . ALA B 2 8   ? 32.706  74.261 -24.628 1.00 0.69  ? 8   ALA B O    2  
ATOM   6508  C  CB   . ALA B 2 8   ? 31.125  75.549 -27.111 1.00 0.62  ? 8   ALA B CB   2  
ATOM   6509  H  H    . ALA B 2 8   ? 33.501  76.513 -27.124 1.00 1.03  ? 8   ALA B H    2  
ATOM   6510  H  HA   . ALA B 2 8   ? 31.291  76.989 -25.528 1.00 0.64  ? 8   ALA B HA   2  
ATOM   6511  H  HB1  . ALA B 2 8   ? 31.274  76.226 -27.938 1.00 1.12  ? 8   ALA B HB1  2  
ATOM   6512  H  HB2  . ALA B 2 8   ? 30.067  75.442 -26.919 1.00 1.20  ? 8   ALA B HB2  2  
ATOM   6513  H  HB3  . ALA B 2 8   ? 31.546  74.584 -27.354 1.00 1.22  ? 8   ALA B HB3  2  
ATOM   6514  N  N    . THR B 2 9   ? 30.799  75.100 -23.917 1.00 0.54  ? 9   THR B N    2  
ATOM   6515  C  CA   . THR B 2 9   ? 30.713  74.170 -22.747 1.00 0.54  ? 9   THR B CA   2  
ATOM   6516  C  C    . THR B 2 9   ? 29.404  73.390 -22.758 1.00 0.50  ? 9   THR B C    2  
ATOM   6517  O  O    . THR B 2 9   ? 28.417  73.805 -23.332 1.00 0.50  ? 9   THR B O    2  
ATOM   6518  C  CB   . THR B 2 9   ? 30.805  74.985 -21.440 1.00 0.59  ? 9   THR B CB   2  
ATOM   6519  O  OG1  . THR B 2 9   ? 30.106  76.209 -21.606 1.00 0.63  ? 9   THR B OG1  2  
ATOM   6520  C  CG2  . THR B 2 9   ? 32.269  75.285 -21.087 1.00 0.62  ? 9   THR B CG2  2  
ATOM   6521  H  H    . THR B 2 9   ? 30.163  75.821 -24.011 1.00 0.56  ? 9   THR B H    2  
ATOM   6522  H  HA   . THR B 2 9   ? 31.524  73.461 -22.787 1.00 0.54  ? 9   THR B HA   2  
ATOM   6523  H  HB   . THR B 2 9   ? 30.356  74.427 -20.628 1.00 0.58  ? 9   THR B HB   2  
ATOM   6524  H  HG1  . THR B 2 9   ? 30.326  76.561 -22.472 1.00 1.08  ? 9   THR B HG1  2  
ATOM   6525  H  HG21 . THR B 2 9   ? 32.670  74.482 -20.485 1.00 1.15  ? 9   THR B HG21 2  
ATOM   6526  H  HG22 . THR B 2 9   ? 32.316  76.207 -20.527 1.00 1.15  ? 9   THR B HG22 2  
ATOM   6527  H  HG23 . THR B 2 9   ? 32.852  75.386 -21.990 1.00 1.28  ? 9   THR B HG23 2  
ATOM   6528  N  N    . CYS B 2 10  ? 29.396  72.254 -22.110 1.00 0.49  ? 10  CYS B N    2  
ATOM   6529  C  CA   . CYS B 2 10  ? 28.173  71.449 -22.065 1.00 0.47  ? 10  CYS B CA   2  
ATOM   6530  C  C    . CYS B 2 10  ? 27.081  72.223 -21.428 1.00 0.49  ? 10  CYS B C    2  
ATOM   6531  O  O    . CYS B 2 10  ? 27.265  72.922 -20.450 1.00 0.55  ? 10  CYS B O    2  
ATOM   6532  C  CB   . CYS B 2 10  ? 28.347  70.197 -21.264 1.00 0.50  ? 10  CYS B CB   2  
ATOM   6533  S  SG   . CYS B 2 10  ? 26.856  69.215 -21.487 1.00 0.61  ? 10  CYS B SG   2  
ATOM   6534  H  H    . CYS B 2 10  ? 30.189  71.946 -21.647 1.00 0.50  ? 10  CYS B H    2  
ATOM   6535  H  HA   . CYS B 2 10  ? 27.879  71.178 -23.047 1.00 0.45  ? 10  CYS B HA   2  
ATOM   6536  H  HB2  . CYS B 2 10  ? 29.190  69.678 -21.609 1.00 0.47  ? 10  CYS B HB2  2  
ATOM   6537  H  HB3  . CYS B 2 10  ? 28.472  70.431 -20.238 1.00 0.65  ? 10  CYS B HB3  2  
ATOM   6538  N  N    . GLU B 2 11  ? 25.935  72.057 -21.947 1.00 0.49  ? 11  GLU B N    2  
ATOM   6539  C  CA   . GLU B 2 11  ? 24.779  72.769 -21.337 1.00 0.53  ? 11  GLU B CA   2  
ATOM   6540  C  C    . GLU B 2 11  ? 24.440  72.080 -20.013 1.00 0.57  ? 11  GLU B C    2  
ATOM   6541  O  O    . GLU B 2 11  ? 23.644  72.566 -19.235 1.00 0.65  ? 11  GLU B O    2  
ATOM   6542  C  CB   . GLU B 2 11  ? 23.554  72.735 -22.261 1.00 0.55  ? 11  GLU B CB   2  
ATOM   6543  C  CG   . GLU B 2 11  ? 22.296  73.202 -21.498 1.00 1.08  ? 11  GLU B CG   2  
ATOM   6544  C  CD   . GLU B 2 11  ? 22.598  74.473 -20.698 1.00 1.61  ? 11  GLU B CD   2  
ATOM   6545  O  OE1  . GLU B 2 11  ? 23.250  75.350 -21.240 1.00 2.09  ? 11  GLU B OE1  2  
ATOM   6546  O  OE2  . GLU B 2 11  ? 22.173  74.545 -19.557 1.00 2.31  ? 11  GLU B OE2  2  
ATOM   6547  H  H    . GLU B 2 11  ? 25.845  71.430 -22.724 1.00 0.47  ? 11  GLU B H    2  
ATOM   6548  H  HA   . GLU B 2 11  ? 25.065  73.798 -21.150 1.00 0.57  ? 11  GLU B HA   2  
ATOM   6549  H  HB2  . GLU B 2 11  ? 23.726  73.385 -23.105 1.00 0.91  ? 11  GLU B HB2  2  
ATOM   6550  H  HB3  . GLU B 2 11  ? 23.400  71.728 -22.608 1.00 0.90  ? 11  GLU B HB3  2  
ATOM   6551  H  HG2  . GLU B 2 11  ? 21.504  73.407 -22.196 1.00 1.51  ? 11  GLU B HG2  2  
ATOM   6552  H  HG3  . GLU B 2 11  ? 21.975  72.423 -20.824 1.00 1.55  ? 11  GLU B HG3  2  
ATOM   6553  N  N    . ARG B 2 12  ? 25.040  70.940 -19.761 1.00 0.57  ? 12  ARG B N    2  
ATOM   6554  C  CA   . ARG B 2 12  ? 24.747  70.188 -18.490 1.00 0.67  ? 12  ARG B CA   2  
ATOM   6555  C  C    . ARG B 2 12  ? 26.040  69.854 -17.746 1.00 0.69  ? 12  ARG B C    2  
ATOM   6556  O  O    . ARG B 2 12  ? 26.170  70.126 -16.569 1.00 0.79  ? 12  ARG B O    2  
ATOM   6557  C  CB   . ARG B 2 12  ? 23.988  68.894 -18.833 1.00 0.72  ? 12  ARG B CB   2  
ATOM   6558  C  CG   . ARG B 2 12  ? 22.489  69.191 -19.044 1.00 1.25  ? 12  ARG B CG   2  
ATOM   6559  C  CD   . ARG B 2 12  ? 21.744  69.137 -17.705 1.00 1.90  ? 12  ARG B CD   2  
ATOM   6560  N  NE   . ARG B 2 12  ? 21.524  67.714 -17.320 1.00 2.40  ? 12  ARG B NE   2  
ATOM   6561  C  CZ   . ARG B 2 12  ? 21.166  67.414 -16.102 1.00 3.03  ? 12  ARG B CZ   2  
ATOM   6562  N  NH1  . ARG B 2 12  ? 20.999  68.361 -15.219 1.00 3.43  ? 12  ARG B NH1  2  
ATOM   6563  N  NH2  . ARG B 2 12  ? 20.975  66.168 -15.766 1.00 3.74  ? 12  ARG B NH2  2  
ATOM   6564  H  H    . ARG B 2 12  ? 25.678  70.575 -20.416 1.00 0.52  ? 12  ARG B H    2  
ATOM   6565  H  HA   . ARG B 2 12  ? 24.141  70.788 -17.845 1.00 0.75  ? 12  ARG B HA   2  
ATOM   6566  H  HB2  . ARG B 2 12  ? 24.395  68.479 -19.740 1.00 1.21  ? 12  ARG B HB2  2  
ATOM   6567  H  HB3  . ARG B 2 12  ? 24.104  68.177 -18.031 1.00 1.16  ? 12  ARG B HB3  2  
ATOM   6568  H  HG2  . ARG B 2 12  ? 22.371  70.174 -19.480 1.00 1.73  ? 12  ARG B HG2  2  
ATOM   6569  H  HG3  . ARG B 2 12  ? 22.069  68.454 -19.713 1.00 1.74  ? 12  ARG B HG3  2  
ATOM   6570  H  HD2  . ARG B 2 12  ? 22.330  69.628 -16.944 1.00 2.39  ? 12  ARG B HD2  2  
ATOM   6571  H  HD3  . ARG B 2 12  ? 20.791  69.636 -17.803 1.00 2.32  ? 12  ARG B HD3  2  
ATOM   6572  H  HE   . ARG B 2 12  ? 21.649  67.003 -17.983 1.00 2.69  ? 12  ARG B HE   2  
ATOM   6573  H  HH11 . ARG B 2 12  ? 21.144  69.316 -15.477 1.00 3.27  ? 12  ARG B HH11 2  
ATOM   6574  H  HH12 . ARG B 2 12  ? 20.724  68.131 -14.285 1.00 4.16  ? 12  ARG B HH12 2  
ATOM   6575  H  HH21 . ARG B 2 12  ? 21.103  65.443 -16.443 1.00 3.93  ? 12  ARG B HH21 2  
ATOM   6576  H  HH22 . ARG B 2 12  ? 20.701  65.937 -14.833 1.00 4.33  ? 12  ARG B HH22 2  
ATOM   6577  N  N    . CYS B 2 13  ? 26.996  69.282 -18.408 1.00 0.64  ? 13  CYS B N    2  
ATOM   6578  C  CA   . CYS B 2 13  ? 28.270  68.957 -17.706 1.00 0.72  ? 13  CYS B CA   2  
ATOM   6579  C  C    . CYS B 2 13  ? 29.026  70.253 -17.503 1.00 0.69  ? 13  CYS B C    2  
ATOM   6580  O  O    . CYS B 2 13  ? 29.997  70.319 -16.775 1.00 0.73  ? 13  CYS B O    2  
ATOM   6581  C  CB   . CYS B 2 13  ? 29.145  68.009 -18.541 1.00 0.80  ? 13  CYS B CB   2  
ATOM   6582  S  SG   . CYS B 2 13  ? 28.263  66.472 -18.883 1.00 0.87  ? 13  CYS B SG   2  
ATOM   6583  H  H    . CYS B 2 13  ? 26.880  69.085 -19.354 1.00 0.60  ? 13  CYS B H    2  
ATOM   6584  H  HA   . CYS B 2 13  ? 28.054  68.511 -16.750 1.00 0.80  ? 13  CYS B HA   2  
ATOM   6585  H  HB2  . CYS B 2 13  ? 29.407  68.483 -19.472 1.00 1.29  ? 13  CYS B HB2  2  
ATOM   6586  H  HB3  . CYS B 2 13  ? 30.048  67.786 -17.992 1.00 1.32  ? 13  CYS B HB3  2  
ATOM   6587  N  N    . LYS B 2 14  ? 28.605  71.280 -18.180 1.00 0.64  ? 14  LYS B N    2  
ATOM   6588  C  CA   . LYS B 2 14  ? 29.306  72.566 -18.076 1.00 0.64  ? 14  LYS B CA   2  
ATOM   6589  C  C    . LYS B 2 14  ? 30.736  72.333 -18.483 1.00 0.67  ? 14  LYS B C    2  
ATOM   6590  O  O    . LYS B 2 14  ? 31.602  73.167 -18.304 1.00 0.79  ? 14  LYS B O    2  
ATOM   6591  C  CB   . LYS B 2 14  ? 29.226  73.083 -16.646 1.00 0.67  ? 14  LYS B CB   2  
ATOM   6592  C  CG   . LYS B 2 14  ? 27.801  72.885 -16.107 1.00 0.69  ? 14  LYS B CG   2  
ATOM   6593  C  CD   . LYS B 2 14  ? 26.770  73.369 -17.141 1.00 0.70  ? 14  LYS B CD   2  
ATOM   6594  C  CE   . LYS B 2 14  ? 25.442  73.683 -16.446 1.00 1.04  ? 14  LYS B CE   2  
ATOM   6595  N  NZ   . LYS B 2 14  ? 24.466  74.193 -17.450 1.00 1.55  ? 14  LYS B NZ   2  
ATOM   6596  H  H    . LYS B 2 14  ? 27.839  71.188 -18.790 1.00 0.62  ? 14  LYS B H    2  
ATOM   6597  H  HA   . LYS B 2 14  ? 28.862  73.275 -18.758 1.00 0.62  ? 14  LYS B HA   2  
ATOM   6598  H  HB2  . LYS B 2 14  ? 29.926  72.542 -16.023 1.00 0.70  ? 14  LYS B HB2  2  
ATOM   6599  H  HB3  . LYS B 2 14  ? 29.472  74.126 -16.639 1.00 0.69  ? 14  LYS B HB3  2  
ATOM   6600  H  HG2  . LYS B 2 14  ? 27.640  71.836 -15.905 1.00 0.71  ? 14  LYS B HG2  2  
ATOM   6601  H  HG3  . LYS B 2 14  ? 27.685  73.444 -15.194 1.00 0.71  ? 14  LYS B HG3  2  
ATOM   6602  H  HD2  . LYS B 2 14  ? 27.139  74.256 -17.632 1.00 0.71  ? 14  LYS B HD2  2  
ATOM   6603  H  HD3  . LYS B 2 14  ? 26.613  72.595 -17.877 1.00 0.71  ? 14  LYS B HD3  2  
ATOM   6604  H  HE2  . LYS B 2 14  ? 25.053  72.786 -15.989 1.00 1.46  ? 14  LYS B HE2  2  
ATOM   6605  H  HE3  . LYS B 2 14  ? 25.603  74.435 -15.687 1.00 1.42  ? 14  LYS B HE3  2  
ATOM   6606  H  HZ1  . LYS B 2 14  ? 24.848  74.054 -18.407 1.00 2.01  ? 14  LYS B HZ1  2  
ATOM   6607  H  HZ2  . LYS B 2 14  ? 24.298  75.206 -17.286 1.00 2.02  ? 14  LYS B HZ2  2  
ATOM   6608  H  HZ3  . LYS B 2 14  ? 23.571  73.673 -17.359 1.00 1.96  ? 14  LYS B HZ3  2  
ATOM   6609  N  N    . GLY B 2 15  ? 30.974  71.211 -19.084 1.00 0.61  ? 15  GLY B N    2  
ATOM   6610  C  CA   . GLY B 2 15  ? 32.272  70.863 -19.583 1.00 0.65  ? 15  GLY B CA   2  
ATOM   6611  C  C    . GLY B 2 15  ? 32.490  71.781 -20.724 1.00 0.64  ? 15  GLY B C    2  
ATOM   6612  O  O    . GLY B 2 15  ? 31.637  72.525 -21.076 1.00 0.71  ? 15  GLY B O    2  
ATOM   6613  H  H    . GLY B 2 15  ? 30.312  70.568 -19.276 1.00 0.58  ? 15  GLY B H    2  
ATOM   6614  H  HA2  . GLY B 2 15  ? 33.016  71.036 -18.815 1.00 0.71  ? 15  GLY B HA2  2  
ATOM   6615  H  HA3  . GLY B 2 15  ? 32.304  69.845 -19.903 1.00 0.63  ? 15  GLY B HA3  2  
ATOM   6616  N  N    . GLY B 2 16  ? 33.640  71.747 -21.202 1.00 0.59  ? 16  GLY B N    2  
ATOM   6617  C  CA   . GLY B 2 16  ? 34.143  72.605 -22.277 1.00 0.61  ? 16  GLY B CA   2  
ATOM   6618  C  C    . GLY B 2 16  ? 34.713  71.744 -23.371 1.00 0.59  ? 16  GLY B C    2  
ATOM   6619  O  O    . GLY B 2 16  ? 35.769  71.157 -23.236 1.00 0.62  ? 16  GLY B O    2  
ATOM   6620  H  H    . GLY B 2 16  ? 34.195  71.137 -20.845 1.00 0.54  ? 16  GLY B H    2  
ATOM   6621  H  HA2  . GLY B 2 16  ? 33.379  73.218 -22.667 1.00 0.61  ? 16  GLY B HA2  2  
ATOM   6622  H  HA3  . GLY B 2 16  ? 34.931  73.231 -21.888 1.00 0.66  ? 16  GLY B HA3  2  
ATOM   6623  N  N    . PHE B 2 17  ? 34.020  71.679 -24.459 1.00 0.57  ? 17  PHE B N    2  
ATOM   6624  C  CA   . PHE B 2 17  ? 34.478  70.879 -25.608 1.00 0.57  ? 17  PHE B CA   2  
ATOM   6625  C  C    . PHE B 2 17  ? 34.957  71.815 -26.710 1.00 0.62  ? 17  PHE B C    2  
ATOM   6626  O  O    . PHE B 2 17  ? 34.760  73.014 -26.734 1.00 0.66  ? 17  PHE B O    2  
ATOM   6627  C  CB   . PHE B 2 17  ? 33.376  69.951 -26.169 1.00 0.52  ? 17  PHE B CB   2  
ATOM   6628  C  CG   . PHE B 2 17  ? 31.993  70.492 -25.945 1.00 0.50  ? 17  PHE B CG   2  
ATOM   6629  C  CD1  . PHE B 2 17  ? 31.774  71.852 -25.908 1.00 0.52  ? 17  PHE B CD1  2  
ATOM   6630  C  CD2  . PHE B 2 17  ? 30.940  69.605 -25.713 1.00 0.46  ? 17  PHE B CD2  2  
ATOM   6631  C  CE1  . PHE B 2 17  ? 30.494  72.336 -25.646 1.00 0.51  ? 17  PHE B CE1  2  
ATOM   6632  C  CE2  . PHE B 2 17  ? 29.664  70.083 -25.425 1.00 0.45  ? 17  PHE B CE2  2  
ATOM   6633  C  CZ   . PHE B 2 17  ? 29.435  71.455 -25.393 1.00 0.46  ? 17  PHE B CZ   2  
ATOM   6634  H  H    . PHE B 2 17  ? 33.177  72.134 -24.501 1.00 0.57  ? 17  PHE B H    2  
ATOM   6635  H  HA   . PHE B 2 17  ? 35.321  70.265 -25.307 1.00 0.59  ? 17  PHE B HA   2  
ATOM   6636  H  HB2  . PHE B 2 17  ? 33.522  69.814 -27.219 1.00 0.54  ? 17  PHE B HB2  2  
ATOM   6637  H  HB3  . PHE B 2 17  ? 33.457  69.004 -25.677 1.00 0.51  ? 17  PHE B HB3  2  
ATOM   6638  H  HD1  . PHE B 2 17  ? 32.583  72.531 -26.124 1.00 0.57  ? 17  PHE B HD1  2  
ATOM   6639  H  HD2  . PHE B 2 17  ? 31.112  68.554 -25.795 1.00 0.46  ? 17  PHE B HD2  2  
ATOM   6640  H  HE1  . PHE B 2 17  ? 30.322  73.378 -25.645 1.00 0.54  ? 17  PHE B HE1  2  
ATOM   6641  H  HE2  . PHE B 2 17  ? 28.853  69.394 -25.249 1.00 0.43  ? 17  PHE B HE2  2  
ATOM   6642  H  HZ   . PHE B 2 17  ? 28.446  71.838 -25.154 1.00 0.46  ? 17  PHE B HZ   2  
ATOM   6643  N  N    . ALA B 2 18  ? 35.589  71.184 -27.592 1.00 0.63  ? 18  ALA B N    2  
ATOM   6644  C  CA   . ALA B 2 18  ? 36.219  71.758 -28.847 1.00 0.70  ? 18  ALA B CA   2  
ATOM   6645  C  C    . ALA B 2 18  ? 35.177  71.247 -29.770 1.00 0.70  ? 18  ALA B C    2  
ATOM   6646  O  O    . ALA B 2 18  ? 34.973  70.046 -29.755 1.00 0.72  ? 18  ALA B O    2  
ATOM   6647  C  CB   . ALA B 2 18  ? 37.583  71.139 -29.129 1.00 0.76  ? 18  ALA B CB   2  
ATOM   6648  H  H    . ALA B 2 18  ? 35.599  70.311 -27.518 1.00 0.60  ? 18  ALA B H    2  
ATOM   6649  H  HA   . ALA B 2 18  ? 36.284  72.829 -28.771 1.00 0.71  ? 18  ALA B HA   2  
ATOM   6650  H  HB1  . ALA B 2 18  ? 37.588  70.701 -30.114 1.00 1.18  ? 18  ALA B HB1  2  
ATOM   6651  H  HB2  . ALA B 2 18  ? 37.792  70.389 -28.390 1.00 1.22  ? 18  ALA B HB2  2  
ATOM   6652  H  HB3  . ALA B 2 18  ? 38.332  71.914 -29.081 1.00 1.43  ? 18  ALA B HB3  2  
ATOM   6653  N  N    . PRO B 2 19  ? 34.326  72.079 -30.223 1.00 0.70  ? 19  PRO B N    2  
ATOM   6654  C  CA   . PRO B 2 19  ? 33.143  71.447 -30.658 1.00 0.72  ? 19  PRO B CA   2  
ATOM   6655  C  C    . PRO B 2 19  ? 32.562  70.887 -31.914 1.00 0.67  ? 19  PRO B C    2  
ATOM   6656  O  O    . PRO B 2 19  ? 31.462  71.061 -32.403 1.00 0.70  ? 19  PRO B O    2  
ATOM   6657  C  CB   . PRO B 2 19  ? 32.281  72.721 -30.429 1.00 0.73  ? 19  PRO B CB   2  
ATOM   6658  C  CG   . PRO B 2 19  ? 33.224  73.848 -30.839 1.00 0.72  ? 19  PRO B CG   2  
ATOM   6659  C  CD   . PRO B 2 19  ? 34.467  73.425 -30.168 1.00 0.70  ? 19  PRO B CD   2  
ATOM   6660  H  HA   . PRO B 2 19  ? 32.788  70.803 -29.867 1.00 0.77  ? 19  PRO B HA   2  
ATOM   6661  H  HB2  . PRO B 2 19  ? 31.375  72.751 -31.021 1.00 0.72  ? 19  PRO B HB2  2  
ATOM   6662  H  HB3  . PRO B 2 19  ? 32.058  72.828 -29.375 1.00 0.79  ? 19  PRO B HB3  2  
ATOM   6663  H  HG2  . PRO B 2 19  ? 33.361  73.823 -31.913 1.00 0.70  ? 19  PRO B HG2  2  
ATOM   6664  H  HG3  . PRO B 2 19  ? 32.906  74.804 -30.482 1.00 0.77  ? 19  PRO B HG3  2  
ATOM   6665  H  HD2  . PRO B 2 19  ? 35.373  73.696 -30.623 1.00 0.65  ? 19  PRO B HD2  2  
ATOM   6666  H  HD3  . PRO B 2 19  ? 34.456  73.646 -29.137 1.00 0.74  ? 19  PRO B HD3  2  
ATOM   6667  N  N    . ALA B 2 20  ? 33.428  70.113 -32.315 1.00 0.63  ? 20  ALA B N    2  
ATOM   6668  C  CA   . ALA B 2 20  ? 33.326  69.244 -33.449 1.00 0.60  ? 20  ALA B CA   2  
ATOM   6669  C  C    . ALA B 2 20  ? 33.993  68.001 -32.897 1.00 0.59  ? 20  ALA B C    2  
ATOM   6670  O  O    . ALA B 2 20  ? 34.309  67.068 -33.608 1.00 0.63  ? 20  ALA B O    2  
ATOM   6671  C  CB   . ALA B 2 20  ? 34.097  69.838 -34.627 1.00 0.66  ? 20  ALA B CB   2  
ATOM   6672  H  H    . ALA B 2 20  ? 34.232  70.065 -31.755 1.00 0.63  ? 20  ALA B H    2  
ATOM   6673  H  HA   . ALA B 2 20  ? 32.291  69.048 -33.706 1.00 0.57  ? 20  ALA B HA   2  
ATOM   6674  H  HB1  . ALA B 2 20  ? 33.803  69.343 -35.540 1.00 1.25  ? 20  ALA B HB1  2  
ATOM   6675  H  HB2  . ALA B 2 20  ? 35.158  69.709 -34.469 1.00 1.14  ? 20  ALA B HB2  2  
ATOM   6676  H  HB3  . ALA B 2 20  ? 33.869  70.894 -34.698 1.00 1.24  ? 20  ALA B HB3  2  
ATOM   6677  N  N    . GLU B 2 21  ? 34.177  67.979 -31.563 1.00 0.58  ? 21  GLU B N    2  
ATOM   6678  C  CA   . GLU B 2 21  ? 34.784  66.784 -30.936 1.00 0.61  ? 21  GLU B CA   2  
ATOM   6679  C  C    . GLU B 2 21  ? 33.611  65.992 -30.494 1.00 0.59  ? 21  GLU B C    2  
ATOM   6680  O  O    . GLU B 2 21  ? 33.059  65.210 -31.244 1.00 0.70  ? 21  GLU B O    2  
ATOM   6681  C  CB   . GLU B 2 21  ? 35.611  67.183 -29.731 1.00 0.66  ? 21  GLU B CB   2  
ATOM   6682  C  CG   . GLU B 2 21  ? 36.861  67.927 -30.196 1.00 0.76  ? 21  GLU B CG   2  
ATOM   6683  C  CD   . GLU B 2 21  ? 37.782  66.959 -30.938 1.00 1.09  ? 21  GLU B CD   2  
ATOM   6684  O  OE1  . GLU B 2 21  ? 38.116  65.934 -30.366 1.00 1.64  ? 21  GLU B OE1  2  
ATOM   6685  O  OE2  . GLU B 2 21  ? 38.139  67.258 -32.066 1.00 1.63  ? 21  GLU B OE2  2  
ATOM   6686  H  H    . GLU B 2 21  ? 33.856  68.756 -30.955 1.00 0.57  ? 21  GLU B H    2  
ATOM   6687  H  HA   . GLU B 2 21  ? 35.372  66.227 -31.640 1.00 0.67  ? 21  GLU B HA   2  
ATOM   6688  H  HB2  . GLU B 2 21  ? 35.011  67.821 -29.094 1.00 0.65  ? 21  GLU B HB2  2  
ATOM   6689  H  HB3  . GLU B 2 21  ? 35.902  66.296 -29.191 1.00 0.68  ? 21  GLU B HB3  2  
ATOM   6690  H  HG2  . GLU B 2 21  ? 36.577  68.732 -30.857 1.00 0.75  ? 21  GLU B HG2  2  
ATOM   6691  H  HG3  . GLU B 2 21  ? 37.379  68.326 -29.340 1.00 0.90  ? 21  GLU B HG3  2  
ATOM   6692  N  N    . LYS B 2 22  ? 33.122  66.286 -29.326 1.00 0.57  ? 22  LYS B N    2  
ATOM   6693  C  CA   . LYS B 2 22  ? 31.868  65.646 -28.930 1.00 0.63  ? 22  LYS B CA   2  
ATOM   6694  C  C    . LYS B 2 22  ? 31.080  66.607 -28.070 1.00 0.57  ? 22  LYS B C    2  
ATOM   6695  O  O    . LYS B 2 22  ? 31.078  66.620 -26.876 1.00 0.63  ? 22  LYS B O    2  
ATOM   6696  C  CB   . LYS B 2 22  ? 32.131  64.338 -28.164 1.00 0.74  ? 22  LYS B CB   2  
ATOM   6697  C  CG   . LYS B 2 22  ? 33.582  64.287 -27.657 1.00 0.96  ? 22  LYS B CG   2  
ATOM   6698  C  CD   . LYS B 2 22  ? 33.750  64.979 -26.283 1.00 1.04  ? 22  LYS B CD   2  
ATOM   6699  C  CE   . LYS B 2 22  ? 34.135  66.462 -26.437 1.00 0.74  ? 22  LYS B CE   2  
ATOM   6700  N  NZ   . LYS B 2 22  ? 34.573  66.989 -25.113 1.00 1.41  ? 22  LYS B NZ   2  
ATOM   6701  H  H    . LYS B 2 22  ? 33.510  67.006 -28.796 1.00 0.60  ? 22  LYS B H    2  
ATOM   6702  H  HA   . LYS B 2 22  ? 31.276  65.420 -29.816 1.00 0.70  ? 22  LYS B HA   2  
ATOM   6703  H  HB2  . LYS B 2 22  ? 31.446  64.246 -27.333 1.00 1.08  ? 22  LYS B HB2  2  
ATOM   6704  H  HB3  . LYS B 2 22  ? 31.968  63.501 -28.833 1.00 1.05  ? 22  LYS B HB3  2  
ATOM   6705  H  HG2  . LYS B 2 22  ? 33.848  63.266 -27.565 1.00 1.70  ? 22  LYS B HG2  2  
ATOM   6706  H  HG3  . LYS B 2 22  ? 34.235  64.741 -28.370 1.00 1.60  ? 22  LYS B HG3  2  
ATOM   6707  H  HD2  . LYS B 2 22  ? 32.833  64.913 -25.731 1.00 1.70  ? 22  LYS B HD2  2  
ATOM   6708  H  HD3  . LYS B 2 22  ? 34.529  64.476 -25.725 1.00 1.71  ? 22  LYS B HD3  2  
ATOM   6709  H  HE2  . LYS B 2 22  ? 34.937  66.572 -27.143 1.00 1.04  ? 22  LYS B HE2  2  
ATOM   6710  H  HE3  . LYS B 2 22  ? 33.290  67.020 -26.781 1.00 1.06  ? 22  LYS B HE3  2  
ATOM   6711  H  HZ1  . LYS B 2 22  ? 35.384  67.626 -25.244 1.00 1.95  ? 22  LYS B HZ1  2  
ATOM   6712  H  HZ2  . LYS B 2 22  ? 34.849  66.196 -24.499 1.00 1.89  ? 22  LYS B HZ2  2  
ATOM   6713  H  HZ3  . LYS B 2 22  ? 33.791  67.514 -24.672 1.00 1.86  ? 22  LYS B HZ3  2  
ATOM   6714  N  N    . ILE B 2 23  ? 30.328  67.276 -28.786 1.00 0.51  ? 23  ILE B N    2  
ATOM   6715  C  CA   . ILE B 2 23  ? 29.318  68.243 -28.352 1.00 0.52  ? 23  ILE B CA   2  
ATOM   6716  C  C    . ILE B 2 23  ? 28.046  67.928 -29.147 1.00 0.52  ? 23  ILE B C    2  
ATOM   6717  O  O    . ILE B 2 23  ? 28.120  67.501 -30.283 1.00 0.60  ? 23  ILE B O    2  
ATOM   6718  C  CB   . ILE B 2 23  ? 29.761  69.649 -28.761 1.00 0.55  ? 23  ILE B CB   2  
ATOM   6719  C  CG1  . ILE B 2 23  ? 28.617  70.625 -28.525 1.00 0.69  ? 23  ILE B CG1  2  
ATOM   6720  C  CG2  . ILE B 2 23  ? 30.108  69.682 -30.240 1.00 0.54  ? 23  ILE B CG2  2  
ATOM   6721  C  CD1  . ILE B 2 23  ? 29.073  72.075 -28.755 1.00 0.50  ? 23  ILE B CD1  2  
ATOM   6722  H  H    . ILE B 2 23  ? 30.459  67.136 -29.685 1.00 0.51  ? 23  ILE B H    2  
ATOM   6723  H  HA   . ILE B 2 23  ? 29.144  68.183 -27.289 1.00 0.58  ? 23  ILE B HA   2  
ATOM   6724  H  HB   . ILE B 2 23  ? 30.620  69.950 -28.190 1.00 0.61  ? 23  ILE B HB   2  
ATOM   6725  H  HG12 . ILE B 2 23  ? 27.806  70.410 -29.207 1.00 1.03  ? 23  ILE B HG12 2  
ATOM   6726  H  HG13 . ILE B 2 23  ? 28.283  70.492 -27.527 1.00 1.06  ? 23  ILE B HG13 2  
ATOM   6727  H  HG21 . ILE B 2 23  ? 29.229  69.461 -30.831 1.00 1.13  ? 23  ILE B HG21 2  
ATOM   6728  H  HG22 . ILE B 2 23  ? 30.886  68.964 -30.451 1.00 1.20  ? 23  ILE B HG22 2  
ATOM   6729  H  HG23 . ILE B 2 23  ? 30.451  70.670 -30.474 1.00 1.14  ? 23  ILE B HG23 2  
ATOM   6730  H  HD11 . ILE B 2 23  ? 28.329  72.592 -29.335 1.00 1.16  ? 23  ILE B HD11 2  
ATOM   6731  H  HD12 . ILE B 2 23  ? 29.995  72.087 -29.295 1.00 1.16  ? 23  ILE B HD12 2  
ATOM   6732  H  HD13 . ILE B 2 23  ? 29.204  72.576 -27.816 1.00 1.14  ? 23  ILE B HD13 2  
ATOM   6733  N  N    . VAL B 2 24  ? 26.889  68.156 -28.594 1.00 0.48  ? 24  VAL B N    2  
ATOM   6734  C  CA   . VAL B 2 24  ? 25.633  67.909 -29.348 1.00 0.51  ? 24  VAL B CA   2  
ATOM   6735  C  C    . VAL B 2 24  ? 24.727  69.121 -29.136 1.00 0.62  ? 24  VAL B C    2  
ATOM   6736  O  O    . VAL B 2 24  ? 24.543  69.602 -28.036 1.00 1.38  ? 24  VAL B O    2  
ATOM   6737  C  CB   . VAL B 2 24  ? 24.964  66.631 -28.852 1.00 0.48  ? 24  VAL B CB   2  
ATOM   6738  C  CG1  . VAL B 2 24  ? 23.764  66.300 -29.741 1.00 0.49  ? 24  VAL B CG1  2  
ATOM   6739  C  CG2  . VAL B 2 24  ? 25.970  65.479 -28.907 1.00 0.48  ? 24  VAL B CG2  2  
ATOM   6740  H  H    . VAL B 2 24  ? 26.834  68.493 -27.683 1.00 0.47  ? 24  VAL B H    2  
ATOM   6741  H  HA   . VAL B 2 24  ? 25.844  67.817 -30.407 1.00 0.54  ? 24  VAL B HA   2  
ATOM   6742  H  HB   . VAL B 2 24  ? 24.635  66.770 -27.845 1.00 0.51  ? 24  VAL B HB   2  
ATOM   6743  H  HG11 . VAL B 2 24  ? 24.073  66.300 -30.777 1.00 0.99  ? 24  VAL B HG11 2  
ATOM   6744  H  HG12 . VAL B 2 24  ? 22.992  67.040 -29.595 1.00 1.08  ? 24  VAL B HG12 2  
ATOM   6745  H  HG13 . VAL B 2 24  ? 23.382  65.324 -29.481 1.00 1.21  ? 24  VAL B HG13 2  
ATOM   6746  H  HG21 . VAL B 2 24  ? 25.480  64.559 -28.626 1.00 1.12  ? 24  VAL B HG21 2  
ATOM   6747  H  HG22 . VAL B 2 24  ? 26.783  65.678 -28.224 1.00 1.06  ? 24  VAL B HG22 2  
ATOM   6748  H  HG23 . VAL B 2 24  ? 26.358  65.388 -29.911 1.00 1.17  ? 24  VAL B HG23 2  
ATOM   6749  N  N    . ASN B 2 25  ? 24.161  69.601 -30.198 1.00 0.61  ? 25  ASN B N    2  
ATOM   6750  C  CA   . ASN B 2 25  ? 23.247  70.782 -30.134 1.00 0.55  ? 25  ASN B CA   2  
ATOM   6751  C  C    . ASN B 2 25  ? 21.808  70.279 -30.175 1.00 0.56  ? 25  ASN B C    2  
ATOM   6752  O  O    . ASN B 2 25  ? 21.420  69.554 -31.070 1.00 0.66  ? 25  ASN B O    2  
ATOM   6753  C  CB   . ASN B 2 25  ? 23.513  71.691 -31.335 1.00 0.58  ? 25  ASN B CB   2  
ATOM   6754  C  CG   . ASN B 2 25  ? 22.685  72.970 -31.217 1.00 0.57  ? 25  ASN B CG   2  
ATOM   6755  O  OD1  . ASN B 2 25  ? 22.590  73.736 -32.155 1.00 0.63  ? 25  ASN B OD1  2  
ATOM   6756  N  ND2  . ASN B 2 25  ? 22.078  73.232 -30.098 1.00 0.52  ? 25  ASN B ND2  2  
ATOM   6757  H  H    . ASN B 2 25  ? 24.324  69.158 -31.042 1.00 1.20  ? 25  ASN B H    2  
ATOM   6758  H  HA   . ASN B 2 25  ? 23.414  71.331 -29.218 1.00 0.51  ? 25  ASN B HA   2  
ATOM   6759  H  HB2  . ASN B 2 25  ? 24.561  71.944 -31.365 1.00 0.60  ? 25  ASN B HB2  2  
ATOM   6760  H  HB3  . ASN B 2 25  ? 23.240  71.175 -32.238 1.00 0.63  ? 25  ASN B HB3  2  
ATOM   6761  H  HD21 . ASN B 2 25  ? 22.157  72.612 -29.348 1.00 0.50  ? 25  ASN B HD21 2  
ATOM   6762  H  HD22 . ASN B 2 25  ? 21.545  74.049 -30.007 1.00 0.54  ? 25  ASN B HD22 2  
ATOM   6763  N  N    . SER B 2 26  ? 21.005  70.674 -29.226 1.00 0.49  ? 26  SER B N    2  
ATOM   6764  C  CA   . SER B 2 26  ? 19.609  70.267 -29.192 1.00 0.52  ? 26  SER B CA   2  
ATOM   6765  C  C    . SER B 2 26  ? 18.834  71.497 -28.798 1.00 0.56  ? 26  SER B C    2  
ATOM   6766  O  O    . SER B 2 26  ? 18.809  71.880 -27.648 1.00 1.08  ? 26  SER B O    2  
ATOM   6767  C  CB   . SER B 2 26  ? 19.419  69.164 -28.152 1.00 0.54  ? 26  SER B CB   2  
ATOM   6768  O  OG   . SER B 2 26  ? 18.139  68.569 -28.327 1.00 0.92  ? 26  SER B OG   2  
ATOM   6769  H  H    . SER B 2 26  ? 21.305  71.287 -28.553 1.00 0.48  ? 26  SER B H    2  
ATOM   6770  H  HA   . SER B 2 26  ? 19.284  69.923 -30.166 1.00 0.55  ? 26  SER B HA   2  
ATOM   6771  H  HB2  . SER B 2 26  ? 20.180  68.412 -28.282 1.00 0.63  ? 26  SER B HB2  2  
ATOM   6772  H  HB3  . SER B 2 26  ? 19.500  69.586 -27.159 1.00 0.68  ? 26  SER B HB3  2  
ATOM   6773  H  HG   . SER B 2 26  ? 17.746  68.452 -27.459 1.00 1.29  ? 26  SER B HG   2  
ATOM   6774  N  N    . ASN B 2 27  ? 18.217  72.098 -29.751 1.00 0.66  ? 27  ASN B N    2  
ATOM   6775  C  CA   . ASN B 2 27  ? 17.388  73.318 -29.535 1.00 0.67  ? 27  ASN B CA   2  
ATOM   6776  C  C    . ASN B 2 27  ? 18.216  74.592 -29.688 1.00 0.70  ? 27  ASN B C    2  
ATOM   6777  O  O    . ASN B 2 27  ? 17.698  75.631 -30.044 1.00 0.78  ? 27  ASN B O    2  
ATOM   6778  C  CB   . ASN B 2 27  ? 16.692  73.269 -28.152 1.00 0.66  ? 27  ASN B CB   2  
ATOM   6779  C  CG   . ASN B 2 27  ? 17.479  74.054 -27.087 1.00 0.83  ? 27  ASN B CG   2  
ATOM   6780  O  OD1  . ASN B 2 27  ? 17.684  75.245 -27.217 1.00 1.65  ? 27  ASN B OD1  2  
ATOM   6781  N  ND2  . ASN B 2 27  ? 17.921  73.429 -26.031 1.00 1.17  ? 27  ASN B ND2  2  
ATOM   6782  H  H    . ASN B 2 27  ? 18.308  71.739 -30.640 1.00 1.09  ? 27  ASN B H    2  
ATOM   6783  H  HA   . ASN B 2 27  ? 16.641  73.320 -30.295 1.00 0.71  ? 27  ASN B HA   2  
ATOM   6784  H  HB2  . ASN B 2 27  ? 15.701  73.687 -28.233 1.00 0.81  ? 27  ASN B HB2  2  
ATOM   6785  H  HB3  . ASN B 2 27  ? 16.615  72.245 -27.841 1.00 0.71  ? 27  ASN B HB3  2  
ATOM   6786  H  HD21 . ASN B 2 27  ? 17.751  72.470 -25.924 1.00 1.83  ? 27  ASN B HD21 2  
ATOM   6787  H  HD22 . ASN B 2 27  ? 18.423  73.918 -25.346 1.00 1.26  ? 27  ASN B HD22 2  
ATOM   6788  N  N    . GLY B 2 28  ? 19.483  74.532 -29.408 1.00 0.68  ? 28  GLY B N    2  
ATOM   6789  C  CA   . GLY B 2 28  ? 20.330  75.754 -29.522 1.00 0.75  ? 28  GLY B CA   2  
ATOM   6790  C  C    . GLY B 2 28  ? 21.321  75.773 -28.364 1.00 0.75  ? 28  GLY B C    2  
ATOM   6791  O  O    . GLY B 2 28  ? 22.200  76.609 -28.301 1.00 0.86  ? 28  GLY B O    2  
ATOM   6792  H  H    . GLY B 2 28  ? 19.879  73.685 -29.115 1.00 0.63  ? 28  GLY B H    2  
ATOM   6793  H  HA2  . GLY B 2 28  ? 20.865  75.738 -30.461 1.00 0.88  ? 28  GLY B HA2  2  
ATOM   6794  H  HA3  . GLY B 2 28  ? 19.712  76.637 -29.470 1.00 0.75  ? 28  GLY B HA3  2  
ATOM   6795  N  N    . GLU B 2 29  ? 21.200  74.831 -27.462 1.00 0.69  ? 29  GLU B N    2  
ATOM   6796  C  CA   . GLU B 2 29  ? 22.137  74.744 -26.316 1.00 0.75  ? 29  GLU B CA   2  
ATOM   6797  C  C    . GLU B 2 29  ? 23.011  73.550 -26.649 1.00 0.84  ? 29  GLU B C    2  
ATOM   6798  O  O    . GLU B 2 29  ? 22.614  72.706 -27.427 1.00 1.78  ? 29  GLU B O    2  
ATOM   6799  C  CB   . GLU B 2 29  ? 21.352  74.555 -25.004 1.00 0.67  ? 29  GLU B CB   2  
ATOM   6800  C  CG   . GLU B 2 29  ? 21.270  75.882 -24.236 1.00 0.73  ? 29  GLU B CG   2  
ATOM   6801  C  CD   . GLU B 2 29  ? 22.660  76.262 -23.722 1.00 1.58  ? 29  GLU B CD   2  
ATOM   6802  O  OE1  . GLU B 2 29  ? 23.600  75.552 -24.036 1.00 2.32  ? 29  GLU B OE1  2  
ATOM   6803  O  OE2  . GLU B 2 29  ? 22.760  77.258 -23.024 1.00 2.22  ? 29  GLU B OE2  2  
ATOM   6804  H  H    . GLU B 2 29  ? 20.500  74.144 -27.558 1.00 0.67  ? 29  GLU B H    2  
ATOM   6805  H  HA   . GLU B 2 29  ? 22.757  75.634 -26.265 1.00 0.86  ? 29  GLU B HA   2  
ATOM   6806  H  HB2  . GLU B 2 29  ? 20.351  74.222 -25.230 1.00 0.69  ? 29  GLU B HB2  2  
ATOM   6807  H  HB3  . GLU B 2 29  ? 21.845  73.825 -24.392 1.00 0.81  ? 29  GLU B HB3  2  
ATOM   6808  H  HG2  . GLU B 2 29  ? 20.904  76.657 -24.894 1.00 1.03  ? 29  GLU B HG2  2  
ATOM   6809  H  HG3  . GLU B 2 29  ? 20.596  75.773 -23.399 1.00 1.10  ? 29  GLU B HG3  2  
ATOM   6810  N  N    . LEU B 2 30  ? 24.196  73.461 -26.130 1.00 0.55  ? 30  LEU B N    2  
ATOM   6811  C  CA   . LEU B 2 30  ? 25.091  72.338 -26.471 1.00 0.48  ? 30  LEU B CA   2  
ATOM   6812  C  C    . LEU B 2 30  ? 25.091  71.304 -25.346 1.00 0.48  ? 30  LEU B C    2  
ATOM   6813  O  O    . LEU B 2 30  ? 25.067  71.635 -24.182 1.00 0.63  ? 30  LEU B O    2  
ATOM   6814  C  CB   . LEU B 2 30  ? 26.485  72.930 -26.679 1.00 0.51  ? 30  LEU B CB   2  
ATOM   6815  C  CG   . LEU B 2 30  ? 26.466  74.017 -27.780 1.00 0.51  ? 30  LEU B CG   2  
ATOM   6816  C  CD1  . LEU B 2 30  ? 25.800  73.473 -29.058 1.00 0.48  ? 30  LEU B CD1  2  
ATOM   6817  C  CD2  . LEU B 2 30  ? 25.721  75.285 -27.295 1.00 0.58  ? 30  LEU B CD2  2  
ATOM   6818  H  H    . LEU B 2 30  ? 24.556  74.090 -25.496 1.00 1.21  ? 30  LEU B H    2  
ATOM   6819  H  HA   . LEU B 2 30  ? 24.765  71.851 -27.378 1.00 0.45  ? 30  LEU B HA   2  
ATOM   6820  H  HB2  . LEU B 2 30  ? 26.844  73.366 -25.752 1.00 0.57  ? 30  LEU B HB2  2  
ATOM   6821  H  HB3  . LEU B 2 30  ? 27.135  72.152 -26.976 1.00 0.50  ? 30  LEU B HB3  2  
ATOM   6822  H  HG   . LEU B 2 30  ? 27.486  74.284 -28.014 1.00 0.53  ? 30  LEU B HG   2  
ATOM   6823  H  HD11 . LEU B 2 30  ? 26.148  74.037 -29.910 1.00 1.13  ? 30  LEU B HD11 2  
ATOM   6824  H  HD12 . LEU B 2 30  ? 24.727  73.571 -28.976 1.00 1.16  ? 30  LEU B HD12 2  
ATOM   6825  H  HD13 . LEU B 2 30  ? 26.054  72.429 -29.190 1.00 1.05  ? 30  LEU B HD13 2  
ATOM   6826  H  HD21 . LEU B 2 30  ? 26.208  76.158 -27.703 1.00 1.09  ? 30  LEU B HD21 2  
ATOM   6827  H  HD22 . LEU B 2 30  ? 25.744  75.341 -26.216 1.00 1.27  ? 30  LEU B HD22 2  
ATOM   6828  H  HD23 . LEU B 2 30  ? 24.694  75.264 -27.629 1.00 1.18  ? 30  LEU B HD23 2  
ATOM   6829  N  N    . TYR B 2 31  ? 25.098  70.051 -25.700 1.00 0.40  ? 31  TYR B N    2  
ATOM   6830  C  CA   . TYR B 2 31  ? 25.068  68.967 -24.689 1.00 0.40  ? 31  TYR B CA   2  
ATOM   6831  C  C    . TYR B 2 31  ? 26.008  67.831 -25.107 1.00 0.40  ? 31  TYR B C    2  
ATOM   6832  O  O    . TYR B 2 31  ? 25.997  67.395 -26.230 1.00 0.43  ? 31  TYR B O    2  
ATOM   6833  C  CB   . TYR B 2 31  ? 23.658  68.429 -24.689 1.00 0.41  ? 31  TYR B CB   2  
ATOM   6834  C  CG   . TYR B 2 31  ? 22.673  69.492 -24.320 1.00 0.44  ? 31  TYR B CG   2  
ATOM   6835  C  CD1  . TYR B 2 31  ? 22.271  70.427 -25.275 1.00 0.49  ? 31  TYR B CD1  2  
ATOM   6836  C  CD2  . TYR B 2 31  ? 22.117  69.503 -23.045 1.00 0.47  ? 31  TYR B CD2  2  
ATOM   6837  C  CE1  . TYR B 2 31  ? 21.306  71.373 -24.956 1.00 0.55  ? 31  TYR B CE1  2  
ATOM   6838  C  CE2  . TYR B 2 31  ? 21.153  70.462 -22.712 1.00 0.52  ? 31  TYR B CE2  2  
ATOM   6839  C  CZ   . TYR B 2 31  ? 20.742  71.397 -23.672 1.00 0.56  ? 31  TYR B CZ   2  
ATOM   6840  O  OH   . TYR B 2 31  ? 19.780  72.336 -23.359 1.00 0.63  ? 31  TYR B OH   2  
ATOM   6841  H  H    . TYR B 2 31  ? 25.104  69.827 -26.643 1.00 0.44  ? 31  TYR B H    2  
ATOM   6842  H  HA   . TYR B 2 31  ? 25.326  69.337 -23.707 1.00 0.41  ? 31  TYR B HA   2  
ATOM   6843  H  HB2  . TYR B 2 31  ? 23.441  68.103 -25.676 1.00 0.42  ? 31  TYR B HB2  2  
ATOM   6844  H  HB3  . TYR B 2 31  ? 23.567  67.604 -24.016 1.00 0.42  ? 31  TYR B HB3  2  
ATOM   6845  H  HD1  . TYR B 2 31  ? 22.716  70.424 -26.259 1.00 0.49  ? 31  TYR B HD1  2  
ATOM   6846  H  HD2  . TYR B 2 31  ? 22.453  68.782 -22.313 1.00 0.46  ? 31  TYR B HD2  2  
ATOM   6847  H  HE1  . TYR B 2 31  ? 20.999  72.088 -25.699 1.00 0.60  ? 31  TYR B HE1  2  
ATOM   6848  H  HE2  . TYR B 2 31  ? 20.720  70.476 -21.722 1.00 0.56  ? 31  TYR B HE2  2  
ATOM   6849  H  HH   . TYR B 2 31  ? 19.448  72.706 -24.180 1.00 1.00  ? 31  TYR B HH   2  
ATOM   6850  N  N    . HIS B 2 32  ? 26.821  67.345 -24.223 1.00 0.40  ? 32  HIS B N    2  
ATOM   6851  C  CA   . HIS B 2 32  ? 27.716  66.247 -24.613 1.00 0.42  ? 32  HIS B CA   2  
ATOM   6852  C  C    . HIS B 2 32  ? 26.787  65.107 -24.914 1.00 0.43  ? 32  HIS B C    2  
ATOM   6853  O  O    . HIS B 2 32  ? 25.795  64.956 -24.249 1.00 0.46  ? 32  HIS B O    2  
ATOM   6854  C  CB   . HIS B 2 32  ? 28.600  65.794 -23.424 1.00 0.43  ? 32  HIS B CB   2  
ATOM   6855  C  CG   . HIS B 2 32  ? 29.789  66.675 -23.224 1.00 0.45  ? 32  HIS B CG   2  
ATOM   6856  N  ND1  . HIS B 2 32  ? 29.872  67.571 -22.182 1.00 0.46  ? 32  HIS B ND1  2  
ATOM   6857  C  CD2  . HIS B 2 32  ? 30.960  66.788 -23.913 1.00 0.48  ? 32  HIS B CD2  2  
ATOM   6858  C  CE1  . HIS B 2 32  ? 31.065  68.202 -22.291 1.00 0.50  ? 32  HIS B CE1  2  
ATOM   6859  N  NE2  . HIS B 2 32  ? 31.763  67.753 -23.328 1.00 0.51  ? 32  HIS B NE2  2  
ATOM   6860  H  H    . HIS B 2 32  ? 26.824  67.721 -23.336 1.00 0.41  ? 32  HIS B H    2  
ATOM   6861  H  HA   . HIS B 2 32  ? 28.323  66.508 -25.478 1.00 0.43  ? 32  HIS B HA   2  
ATOM   6862  H  HB2  . HIS B 2 32  ? 28.011  65.801 -22.528 1.00 0.43  ? 32  HIS B HB2  2  
ATOM   6863  H  HB3  . HIS B 2 32  ? 28.953  64.792 -23.606 1.00 0.45  ? 32  HIS B HB3  2  
ATOM   6864  H  HD2  . HIS B 2 32  ? 31.238  66.176 -24.739 1.00 0.49  ? 32  HIS B HD2  2  
ATOM   6865  H  HE1  . HIS B 2 32  ? 31.383  69.016 -21.657 1.00 0.53  ? 32  HIS B HE1  2  
ATOM   6866  H  HE2  . HIS B 2 32  ? 32.653  68.049 -23.611 1.00 0.55  ? 32  HIS B HE2  2  
ATOM   6867  N  N    . GLU B 2 33  ? 27.097  64.221 -25.787 1.00 0.43  ? 33  GLU B N    2  
ATOM   6868  C  CA   . GLU B 2 33  ? 26.198  63.042 -25.873 1.00 0.46  ? 33  GLU B CA   2  
ATOM   6869  C  C    . GLU B 2 33  ? 26.232  62.430 -24.441 1.00 0.49  ? 33  GLU B C    2  
ATOM   6870  O  O    . GLU B 2 33  ? 25.545  61.487 -24.108 1.00 0.55  ? 33  GLU B O    2  
ATOM   6871  C  CB   . GLU B 2 33  ? 26.754  62.033 -26.881 1.00 0.51  ? 33  GLU B CB   2  
ATOM   6872  C  CG   . GLU B 2 33  ? 28.250  61.818 -26.616 1.00 0.56  ? 33  GLU B CG   2  
ATOM   6873  C  CD   . GLU B 2 33  ? 28.738  60.609 -27.415 1.00 0.66  ? 33  GLU B CD   2  
ATOM   6874  O  OE1  . GLU B 2 33  ? 28.624  60.641 -28.629 1.00 1.33  ? 33  GLU B OE1  2  
ATOM   6875  O  OE2  . GLU B 2 33  ? 29.215  59.671 -26.798 1.00 1.24  ? 33  GLU B OE2  2  
ATOM   6876  H  H    . GLU B 2 33  ? 27.936  64.267 -26.286 1.00 0.43  ? 33  GLU B H    2  
ATOM   6877  H  HA   . GLU B 2 33  ? 25.194  63.351 -26.136 1.00 0.45  ? 33  GLU B HA   2  
ATOM   6878  H  HB2  . GLU B 2 33  ? 26.230  61.094 -26.777 1.00 0.63  ? 33  GLU B HB2  2  
ATOM   6879  H  HB3  . GLU B 2 33  ? 26.619  62.413 -27.882 1.00 0.56  ? 33  GLU B HB3  2  
ATOM   6880  H  HG2  . GLU B 2 33  ? 28.798  62.698 -26.922 1.00 0.61  ? 33  GLU B HG2  2  
ATOM   6881  H  HG3  . GLU B 2 33  ? 28.414  61.641 -25.559 1.00 0.62  ? 33  GLU B HG3  2  
ATOM   6882  N  N    . GLN B 2 34  ? 27.056  63.045 -23.596 1.00 0.48  ? 34  GLN B N    2  
ATOM   6883  C  CA   . GLN B 2 34  ? 27.210  62.653 -22.170 1.00 0.53  ? 34  GLN B CA   2  
ATOM   6884  C  C    . GLN B 2 34  ? 26.166  63.404 -21.383 1.00 0.53  ? 34  GLN B C    2  
ATOM   6885  O  O    . GLN B 2 34  ? 25.922  63.157 -20.221 1.00 0.59  ? 34  GLN B O    2  
ATOM   6886  C  CB   . GLN B 2 34  ? 28.633  62.965 -21.669 1.00 0.58  ? 34  GLN B CB   2  
ATOM   6887  C  CG   . GLN B 2 34  ? 29.008  62.004 -20.540 1.00 1.14  ? 34  GLN B CG   2  
ATOM   6888  C  CD   . GLN B 2 34  ? 29.237  60.606 -21.116 1.00 2.23  ? 34  GLN B CD   2  
ATOM   6889  O  OE1  . GLN B 2 34  ? 29.545  59.680 -20.392 1.00 2.85  ? 34  GLN B OE1  2  
ATOM   6890  N  NE2  . GLN B 2 34  ? 29.098  60.412 -22.399 1.00 2.84  ? 34  GLN B NE2  2  
ATOM   6891  H  H    . GLN B 2 34  ? 27.500  63.874 -23.902 1.00 0.45  ? 34  GLN B H    2  
ATOM   6892  H  HA   . GLN B 2 34  ? 27.016  61.591 -22.081 1.00 0.55  ? 34  GLN B HA   2  
ATOM   6893  H  HB2  . GLN B 2 34  ? 29.332  62.839 -22.482 1.00 1.14  ? 34  GLN B HB2  2  
ATOM   6894  H  HB3  . GLN B 2 34  ? 28.683  63.978 -21.304 1.00 1.13  ? 34  GLN B HB3  2  
ATOM   6895  H  HG2  . GLN B 2 34  ? 29.911  62.349 -20.062 1.00 1.62  ? 34  GLN B HG2  2  
ATOM   6896  H  HG3  . GLN B 2 34  ? 28.207  61.967 -19.820 1.00 1.69  ? 34  GLN B HG3  2  
ATOM   6897  H  HE21 . GLN B 2 34  ? 28.850  61.159 -22.983 1.00 2.47  ? 34  GLN B HE21 2  
ATOM   6898  H  HE22 . GLN B 2 34  ? 29.242  59.520 -22.779 1.00 3.77  ? 34  GLN B HE22 2  
ATOM   6899  N  N    . CYS B 2 35  ? 25.580  64.367 -22.034 1.00 0.50  ? 35  CYS B N    2  
ATOM   6900  C  CA   . CYS B 2 35  ? 24.572  65.210 -21.429 1.00 0.53  ? 35  CYS B CA   2  
ATOM   6901  C  C    . CYS B 2 35  ? 23.264  64.631 -21.937 1.00 0.53  ? 35  CYS B C    2  
ATOM   6902  O  O    . CYS B 2 35  ? 22.192  64.853 -21.411 1.00 0.58  ? 35  CYS B O    2  
ATOM   6903  C  CB   . CYS B 2 35  ? 24.874  66.588 -21.932 1.00 0.58  ? 35  CYS B CB   2  
ATOM   6904  S  SG   . CYS B 2 35  ? 26.319  67.209 -21.049 1.00 0.64  ? 35  CYS B SG   2  
ATOM   6905  H  H    . CYS B 2 35  ? 25.827  64.566 -22.966 1.00 0.47  ? 35  CYS B H    2  
ATOM   6906  H  HA   . CYS B 2 35  ? 24.628  65.176 -20.353 1.00 0.56  ? 35  CYS B HA   2  
ATOM   6907  H  HB2  . CYS B 2 35  ? 25.110  66.521 -22.970 1.00 0.65  ? 35  CYS B HB2  2  
ATOM   6908  H  HB3  . CYS B 2 35  ? 24.046  67.225 -21.779 1.00 0.56  ? 35  CYS B HB3  2  
ATOM   6909  N  N    . PHE B 2 36  ? 23.416  63.771 -22.913 1.00 0.51  ? 36  PHE B N    2  
ATOM   6910  C  CA   . PHE B 2 36  ? 22.241  62.998 -23.447 1.00 0.53  ? 36  PHE B CA   2  
ATOM   6911  C  C    . PHE B 2 36  ? 22.117  61.819 -22.505 1.00 0.54  ? 36  PHE B C    2  
ATOM   6912  O  O    . PHE B 2 36  ? 22.549  60.705 -22.771 1.00 0.66  ? 36  PHE B O    2  
ATOM   6913  C  CB   . PHE B 2 36  ? 22.503  62.412 -24.845 1.00 0.51  ? 36  PHE B CB   2  
ATOM   6914  C  CG   . PHE B 2 36  ? 22.108  63.397 -25.877 1.00 0.52  ? 36  PHE B CG   2  
ATOM   6915  C  CD1  . PHE B 2 36  ? 22.655  64.655 -25.806 1.00 0.49  ? 36  PHE B CD1  2  
ATOM   6916  C  CD2  . PHE B 2 36  ? 21.203  63.059 -26.893 1.00 0.60  ? 36  PHE B CD2  2  
ATOM   6917  C  CE1  . PHE B 2 36  ? 22.302  65.605 -26.759 1.00 0.51  ? 36  PHE B CE1  2  
ATOM   6918  C  CE2  . PHE B 2 36  ? 20.848  64.009 -27.849 1.00 0.63  ? 36  PHE B CE2  2  
ATOM   6919  C  CZ   . PHE B 2 36  ? 21.400  65.288 -27.782 1.00 0.56  ? 36  PHE B CZ   2  
ATOM   6920  H  H    . PHE B 2 36  ? 24.332  63.625 -23.269 1.00 0.51  ? 36  PHE B H    2  
ATOM   6921  H  HA   . PHE B 2 36  ? 21.341  63.596 -23.423 1.00 0.56  ? 36  PHE B HA   2  
ATOM   6922  H  HB2  . PHE B 2 36  ? 23.548  62.191 -24.951 1.00 0.50  ? 36  PHE B HB2  2  
ATOM   6923  H  HB3  . PHE B 2 36  ? 21.931  61.504 -24.977 1.00 0.54  ? 36  PHE B HB3  2  
ATOM   6924  H  HD1  . PHE B 2 36  ? 23.361  64.890 -25.000 1.00 0.50  ? 36  PHE B HD1  2  
ATOM   6925  H  HD2  . PHE B 2 36  ? 20.782  62.066 -26.937 1.00 0.67  ? 36  PHE B HD2  2  
ATOM   6926  H  HE1  . PHE B 2 36  ? 22.718  66.570 -26.708 1.00 0.53  ? 36  PHE B HE1  2  
ATOM   6927  H  HE2  . PHE B 2 36  ? 20.152  63.757 -28.635 1.00 0.72  ? 36  PHE B HE2  2  
ATOM   6928  H  HZ   . PHE B 2 36  ? 21.132  66.032 -28.517 1.00 0.59  ? 36  PHE B HZ   2  
ATOM   6929  N  N    . VAL B 2 37  ? 21.528  62.096 -21.396 1.00 0.48  ? 37  VAL B N    2  
ATOM   6930  C  CA   . VAL B 2 37  ? 21.362  61.059 -20.337 1.00 0.51  ? 37  VAL B CA   2  
ATOM   6931  C  C    . VAL B 2 37  ? 19.999  61.192 -19.644 1.00 0.49  ? 37  VAL B C    2  
ATOM   6932  O  O    . VAL B 2 37  ? 19.512  62.272 -19.386 1.00 0.48  ? 37  VAL B O    2  
ATOM   6933  C  CB   . VAL B 2 37  ? 22.491  61.251 -19.330 1.00 0.55  ? 37  VAL B CB   2  
ATOM   6934  C  CG1  . VAL B 2 37  ? 23.800  61.454 -20.083 1.00 0.58  ? 37  VAL B CG1  2  
ATOM   6935  C  CG2  . VAL B 2 37  ? 22.217  62.478 -18.449 1.00 0.55  ? 37  VAL B CG2  2  
ATOM   6936  H  H    . VAL B 2 37  ? 21.202  63.010 -21.265 1.00 0.49  ? 37  VAL B H    2  
ATOM   6937  H  HA   . VAL B 2 37  ? 21.441  60.073 -20.772 1.00 0.53  ? 37  VAL B HA   2  
ATOM   6938  H  HB   . VAL B 2 37  ? 22.571  60.382 -18.724 1.00 0.57  ? 37  VAL B HB   2  
ATOM   6939  H  HG11 . VAL B 2 37  ? 24.622  61.427 -19.384 1.00 1.18  ? 37  VAL B HG11 2  
ATOM   6940  H  HG12 . VAL B 2 37  ? 23.777  62.409 -20.584 1.00 1.10  ? 37  VAL B HG12 2  
ATOM   6941  H  HG13 . VAL B 2 37  ? 23.921  60.668 -20.812 1.00 1.20  ? 37  VAL B HG13 2  
ATOM   6942  H  HG21 . VAL B 2 37  ? 21.444  62.241 -17.732 1.00 1.17  ? 37  VAL B HG21 2  
ATOM   6943  H  HG22 . VAL B 2 37  ? 21.893  63.302 -19.068 1.00 1.13  ? 37  VAL B HG22 2  
ATOM   6944  H  HG23 . VAL B 2 37  ? 23.121  62.755 -17.925 1.00 1.15  ? 37  VAL B HG23 2  
ATOM   6945  N  N    . CYS B 2 38  ? 19.408  60.072 -19.323 1.00 0.51  ? 38  CYS B N    2  
ATOM   6946  C  CA   . CYS B 2 38  ? 18.095  60.033 -18.619 1.00 0.51  ? 38  CYS B CA   2  
ATOM   6947  C  C    . CYS B 2 38  ? 18.255  60.492 -17.193 1.00 0.55  ? 38  CYS B C    2  
ATOM   6948  O  O    . CYS B 2 38  ? 19.215  60.145 -16.577 1.00 0.64  ? 38  CYS B O    2  
ATOM   6949  C  CB   . CYS B 2 38  ? 17.691  58.615 -18.585 1.00 0.52  ? 38  CYS B CB   2  
ATOM   6950  S  SG   . CYS B 2 38  ? 16.669  58.101 -19.962 1.00 0.55  ? 38  CYS B SG   2  
ATOM   6951  H  H    . CYS B 2 38  ? 19.879  59.203 -19.477 1.00 0.54  ? 38  CYS B H    2  
ATOM   6952  H  HA   . CYS B 2 38  ? 17.355  60.622 -19.116 1.00 0.51  ? 38  CYS B HA   2  
ATOM   6953  H  HB2  . CYS B 2 38  ? 18.578  58.069 -18.641 1.00 0.55  ? 38  CYS B HB2  2  
ATOM   6954  H  HB3  . CYS B 2 38  ? 17.182  58.413 -17.666 1.00 0.57  ? 38  CYS B HB3  2  
ATOM   6955  N  N    . ALA B 2 39  ? 17.280  61.134 -16.639 1.00 0.55  ? 39  ALA B N    2  
ATOM   6956  C  CA   . ALA B 2 39  ? 17.376  61.543 -15.199 1.00 0.60  ? 39  ALA B CA   2  
ATOM   6957  C  C    . ALA B 2 39  ? 17.490  60.304 -14.274 1.00 0.63  ? 39  ALA B C    2  
ATOM   6958  O  O    . ALA B 2 39  ? 18.159  60.327 -13.265 1.00 0.71  ? 39  ALA B O    2  
ATOM   6959  C  CB   . ALA B 2 39  ? 16.118  62.329 -14.830 1.00 0.63  ? 39  ALA B CB   2  
ATOM   6960  H  H    . ALA B 2 39  ? 16.455  61.295 -17.153 1.00 0.57  ? 39  ALA B H    2  
ATOM   6961  H  HA   . ALA B 2 39  ? 18.236  62.179 -15.065 1.00 0.66  ? 39  ALA B HA   2  
ATOM   6962  H  HB1  . ALA B 2 39  ? 16.082  62.471 -13.760 1.00 1.29  ? 39  ALA B HB1  2  
ATOM   6963  H  HB2  . ALA B 2 39  ? 15.244  61.782 -15.150 1.00 1.19  ? 39  ALA B HB2  2  
ATOM   6964  H  HB3  . ALA B 2 39  ? 16.140  63.292 -15.321 1.00 1.14  ? 39  ALA B HB3  2  
ATOM   6965  N  N    . GLN B 2 40  ? 16.833  59.235 -14.625 1.00 0.62  ? 40  GLN B N    2  
ATOM   6966  C  CA   . GLN B 2 40  ? 16.862  57.954 -13.821 1.00 0.71  ? 40  GLN B CA   2  
ATOM   6967  C  C    . GLN B 2 40  ? 17.849  57.001 -14.490 1.00 0.68  ? 40  GLN B C    2  
ATOM   6968  O  O    . GLN B 2 40  ? 18.562  56.222 -13.891 1.00 0.76  ? 40  GLN B O    2  
ATOM   6969  C  CB   . GLN B 2 40  ? 15.437  57.355 -13.710 1.00 0.84  ? 40  GLN B CB   2  
ATOM   6970  C  CG   . GLN B 2 40  ? 15.113  56.387 -14.863 1.00 1.12  ? 40  GLN B CG   2  
ATOM   6971  C  CD   . GLN B 2 40  ? 15.773  55.031 -14.598 1.00 1.82  ? 40  GLN B CD   2  
ATOM   6972  O  OE1  . GLN B 2 40  ? 15.572  54.087 -15.336 1.00 2.40  ? 40  GLN B OE1  2  
ATOM   6973  N  NE2  . GLN B 2 40  ? 16.557  54.896 -13.563 1.00 2.54  ? 40  GLN B NE2  2  
ATOM   6974  H  H    . GLN B 2 40  ? 16.327  59.252 -15.467 1.00 0.60  ? 40  GLN B H    2  
ATOM   6975  H  HA   . GLN B 2 40  ? 17.228  58.179 -12.827 1.00 0.82  ? 40  GLN B HA   2  
ATOM   6976  H  HB2  . GLN B 2 40  ? 15.347  56.824 -12.772 1.00 1.38  ? 40  GLN B HB2  2  
ATOM   6977  H  HB3  . GLN B 2 40  ? 14.724  58.161 -13.718 1.00 1.26  ? 40  GLN B HB3  2  
ATOM   6978  H  HG2  . GLN B 2 40  ? 14.042  56.256 -14.922 1.00 1.58  ? 40  GLN B HG2  2  
ATOM   6979  H  HG3  . GLN B 2 40  ? 15.470  56.791 -15.794 1.00 1.61  ? 40  GLN B HG3  2  
ATOM   6980  H  HE21 . GLN B 2 40  ? 16.718  55.663 -12.971 1.00 2.67  ? 40  GLN B HE21 2  
ATOM   6981  H  HE22 . GLN B 2 40  ? 16.982  54.033 -13.377 1.00 3.25  ? 40  GLN B HE22 2  
ATOM   6982  N  N    . CYS B 2 41  ? 17.767  57.071 -15.761 1.00 0.64  ? 41  CYS B N    2  
ATOM   6983  C  CA   . CYS B 2 41  ? 18.495  56.258 -16.744 1.00 0.71  ? 41  CYS B CA   2  
ATOM   6984  C  C    . CYS B 2 41  ? 19.759  57.054 -17.137 1.00 0.67  ? 41  CYS B C    2  
ATOM   6985  O  O    . CYS B 2 41  ? 20.367  56.719 -18.129 1.00 0.77  ? 41  CYS B O    2  
ATOM   6986  C  CB   . CYS B 2 41  ? 17.582  55.889 -17.960 1.00 0.79  ? 41  CYS B CB   2  
ATOM   6987  S  SG   . CYS B 2 41  ? 17.150  54.165 -17.984 1.00 0.67  ? 41  CYS B SG   2  
ATOM   6988  H  H    . CYS B 2 41  ? 17.123  57.706 -16.121 1.00 0.63  ? 41  CYS B H    2  
ATOM   6989  H  HA   . CYS B 2 41  ? 18.813  55.346 -16.256 1.00 0.77  ? 41  CYS B HA   2  
ATOM   6990  H  HB2  . CYS B 2 41  ? 16.662  56.426 -17.892 1.00 0.96  ? 41  CYS B HB2  2  
ATOM   6991  H  HB3  . CYS B 2 41  ? 18.082  56.110 -18.887 1.00 0.99  ? 41  CYS B HB3  2  
ATOM   6992  N  N    . PHE B 2 42  ? 20.054  58.219 -16.445 1.00 0.60  ? 42  PHE B N    2  
ATOM   6993  C  CA   . PHE B 2 42  ? 21.172  59.272 -16.764 1.00 0.60  ? 42  PHE B CA   2  
ATOM   6994  C  C    . PHE B 2 42  ? 22.398  58.590 -17.076 1.00 0.64  ? 42  PHE B C    2  
ATOM   6995  O  O    . PHE B 2 42  ? 23.515  59.080 -17.090 1.00 0.72  ? 42  PHE B O    2  
ATOM   6996  C  CB   . PHE B 2 42  ? 21.529  60.179 -15.565 1.00 0.67  ? 42  PHE B CB   2  
ATOM   6997  C  CG   . PHE B 2 42  ? 21.185  59.508 -14.247 1.00 1.00  ? 42  PHE B CG   2  
ATOM   6998  C  CD1  . PHE B 2 42  ? 21.326  58.118 -14.080 1.00 1.93  ? 42  PHE B CD1  2  
ATOM   6999  C  CD2  . PHE B 2 42  ? 20.722  60.289 -13.182 1.00 1.19  ? 42  PHE B CD2  2  
ATOM   7000  C  CE1  . PHE B 2 42  ? 21.000  57.524 -12.855 1.00 2.70  ? 42  PHE B CE1  2  
ATOM   7001  C  CE2  . PHE B 2 42  ? 20.397  59.691 -11.959 1.00 1.79  ? 42  PHE B CE2  2  
ATOM   7002  C  CZ   . PHE B 2 42  ? 20.535  58.309 -11.796 1.00 2.52  ? 42  PHE B CZ   2  
ATOM   7003  H  H    . PHE B 2 42  ? 19.431  58.483 -15.782 1.00 0.58  ? 42  PHE B H    2  
ATOM   7004  H  HA   . PHE B 2 42  ? 20.891  59.868 -17.599 1.00 0.56  ? 42  PHE B HA   2  
ATOM   7005  H  HB2  . PHE B 2 42  ? 22.601  60.379 -15.599 1.00 0.97  ? 42  PHE B HB2  2  
ATOM   7006  H  HB3  . PHE B 2 42  ? 21.001  61.120 -15.641 1.00 1.05  ? 42  PHE B HB3  2  
ATOM   7007  H  HD1  . PHE B 2 42  ? 21.686  57.504 -14.887 1.00 2.23  ? 42  PHE B HD1  2  
ATOM   7008  H  HD2  . PHE B 2 42  ? 20.614  61.357 -13.305 1.00 1.44  ? 42  PHE B HD2  2  
ATOM   7009  H  HE1  . PHE B 2 42  ? 21.109  56.457 -12.728 1.00 3.53  ? 42  PHE B HE1  2  
ATOM   7010  H  HE2  . PHE B 2 42  ? 20.038  60.297 -11.141 1.00 2.01  ? 42  PHE B HE2  2  
ATOM   7011  H  HZ   . PHE B 2 42  ? 20.284  57.848 -10.852 1.00 3.15  ? 42  PHE B HZ   2  
ATOM   7012  N  N    . GLN B 2 43  ? 22.099  57.556 -17.566 1.00 0.63  ? 43  GLN B N    2  
ATOM   7013  C  CA   . GLN B 2 43  ? 23.082  56.778 -18.217 1.00 0.71  ? 43  GLN B CA   2  
ATOM   7014  C  C    . GLN B 2 43  ? 22.718  57.206 -19.611 1.00 0.70  ? 43  GLN B C    2  
ATOM   7015  O  O    . GLN B 2 43  ? 21.593  57.593 -19.897 1.00 0.86  ? 43  GLN B O    2  
ATOM   7016  C  CB   . GLN B 2 43  ? 22.831  55.277 -18.011 1.00 0.75  ? 43  GLN B CB   2  
ATOM   7017  C  CG   . GLN B 2 43  ? 23.997  54.481 -18.601 1.00 1.44  ? 43  GLN B CG   2  
ATOM   7018  C  CD   . GLN B 2 43  ? 25.256  54.726 -17.769 1.00 2.08  ? 43  GLN B CD   2  
ATOM   7019  O  OE1  . GLN B 2 43  ? 26.249  55.208 -18.276 1.00 2.80  ? 43  GLN B OE1  2  
ATOM   7020  N  NE2  . GLN B 2 43  ? 25.258  54.414 -16.501 1.00 2.62  ? 43  GLN B NE2  2  
ATOM   7021  H  H    . GLN B 2 43  ? 21.130  57.418 -17.729 1.00 0.61  ? 43  GLN B H    2  
ATOM   7022  H  HA   . GLN B 2 43  ? 24.103  57.060 -17.966 1.00 0.78  ? 43  GLN B HA   2  
ATOM   7023  H  HB2  . GLN B 2 43  ? 22.751  55.068 -16.953 1.00 1.21  ? 43  GLN B HB2  2  
ATOM   7024  H  HB3  . GLN B 2 43  ? 21.915  54.990 -18.504 1.00 1.13  ? 43  GLN B HB3  2  
ATOM   7025  H  HG2  . GLN B 2 43  ? 23.755  53.427 -18.589 1.00 2.07  ? 43  GLN B HG2  2  
ATOM   7026  H  HG3  . GLN B 2 43  ? 24.172  54.799 -19.618 1.00 2.01  ? 43  GLN B HG3  2  
ATOM   7027  H  HE21 . GLN B 2 43  ? 24.457  54.026 -16.091 1.00 2.58  ? 43  GLN B HE21 2  
ATOM   7028  H  HE22 . GLN B 2 43  ? 26.060  54.568 -15.960 1.00 3.43  ? 43  GLN B HE22 2  
ATOM   7029  N  N    . GLN B 2 44  ? 23.622  57.205 -20.432 1.00 0.63  ? 44  GLN B N    2  
ATOM   7030  C  CA   . GLN B 2 44  ? 23.365  57.669 -21.805 1.00 0.64  ? 44  GLN B CA   2  
ATOM   7031  C  C    . GLN B 2 44  ? 22.214  56.859 -22.395 1.00 0.65  ? 44  GLN B C    2  
ATOM   7032  O  O    . GLN B 2 44  ? 21.999  55.711 -22.063 1.00 0.80  ? 44  GLN B O    2  
ATOM   7033  C  CB   . GLN B 2 44  ? 24.625  57.481 -22.661 1.00 0.72  ? 44  GLN B CB   2  
ATOM   7034  C  CG   . GLN B 2 44  ? 25.633  58.593 -22.348 1.00 1.12  ? 44  GLN B CG   2  
ATOM   7035  C  CD   . GLN B 2 44  ? 25.966  58.580 -20.856 1.00 1.75  ? 44  GLN B CD   2  
ATOM   7036  O  OE1  . GLN B 2 44  ? 25.937  59.606 -20.205 1.00 2.36  ? 44  GLN B OE1  2  
ATOM   7037  N  NE2  . GLN B 2 44  ? 26.285  57.454 -20.282 1.00 2.21  ? 44  GLN B NE2  2  
ATOM   7038  H  H    . GLN B 2 44  ? 24.479  56.999 -20.121 1.00 0.65  ? 44  GLN B H    2  
ATOM   7039  H  HA   . GLN B 2 44  ? 23.095  58.708 -21.783 1.00 0.61  ? 44  GLN B HA   2  
ATOM   7040  H  HB2  . GLN B 2 44  ? 25.068  56.521 -22.441 1.00 0.90  ? 44  GLN B HB2  2  
ATOM   7041  H  HB3  . GLN B 2 44  ? 24.360  57.524 -23.707 1.00 1.03  ? 44  GLN B HB3  2  
ATOM   7042  H  HG2  . GLN B 2 44  ? 26.535  58.431 -22.920 1.00 1.59  ? 44  GLN B HG2  2  
ATOM   7043  H  HG3  . GLN B 2 44  ? 25.207  59.549 -22.612 1.00 1.74  ? 44  GLN B HG3  2  
ATOM   7044  H  HE21 . GLN B 2 44  ? 26.310  56.627 -20.806 1.00 1.96  ? 44  GLN B HE21 2  
ATOM   7045  H  HE22 . GLN B 2 44  ? 26.501  57.434 -19.326 1.00 2.99  ? 44  GLN B HE22 2  
ATOM   7046  N  N    . PHE B 2 45  ? 21.452  57.482 -23.237 1.00 0.67  ? 45  PHE B N    2  
ATOM   7047  C  CA   . PHE B 2 45  ? 20.264  56.788 -23.836 1.00 0.71  ? 45  PHE B CA   2  
ATOM   7048  C  C    . PHE B 2 45  ? 20.753  55.656 -24.786 1.00 0.68  ? 45  PHE B C    2  
ATOM   7049  O  O    . PHE B 2 45  ? 21.468  55.936 -25.728 1.00 0.75  ? 45  PHE B O    2  
ATOM   7050  C  CB   . PHE B 2 45  ? 19.463  57.755 -24.726 1.00 0.80  ? 45  PHE B CB   2  
ATOM   7051  C  CG   . PHE B 2 45  ? 19.270  59.090 -24.057 1.00 1.19  ? 45  PHE B CG   2  
ATOM   7052  C  CD1  . PHE B 2 45  ? 18.676  59.164 -22.798 1.00 1.78  ? 45  PHE B CD1  2  
ATOM   7053  C  CD2  . PHE B 2 45  ? 19.661  60.260 -24.716 1.00 1.79  ? 45  PHE B CD2  2  
ATOM   7054  C  CE1  . PHE B 2 45  ? 18.475  60.409 -22.198 1.00 2.26  ? 45  PHE B CE1  2  
ATOM   7055  C  CE2  . PHE B 2 45  ? 19.463  61.499 -24.114 1.00 2.44  ? 45  PHE B CE2  2  
ATOM   7056  C  CZ   . PHE B 2 45  ? 18.869  61.577 -22.855 1.00 2.47  ? 45  PHE B CZ   2  
ATOM   7057  H  H    . PHE B 2 45  ? 21.622  58.419 -23.404 1.00 0.78  ? 45  PHE B H    2  
ATOM   7058  H  HA   . PHE B 2 45  ? 19.632  56.437 -23.053 1.00 0.72  ? 45  PHE B HA   2  
ATOM   7059  H  HB2  . PHE B 2 45  ? 19.984  57.898 -25.664 1.00 0.96  ? 45  PHE B HB2  2  
ATOM   7060  H  HB3  . PHE B 2 45  ? 18.495  57.320 -24.928 1.00 1.02  ? 45  PHE B HB3  2  
ATOM   7061  H  HD1  . PHE B 2 45  ? 18.373  58.262 -22.287 1.00 2.22  ? 45  PHE B HD1  2  
ATOM   7062  H  HD2  . PHE B 2 45  ? 20.119  60.204 -25.691 1.00 2.12  ? 45  PHE B HD2  2  
ATOM   7063  H  HE1  . PHE B 2 45  ? 18.015  60.469 -21.235 1.00 2.80  ? 45  PHE B HE1  2  
ATOM   7064  H  HE2  . PHE B 2 45  ? 19.766  62.391 -24.624 1.00 3.14  ? 45  PHE B HE2  2  
ATOM   7065  H  HZ   . PHE B 2 45  ? 18.713  62.539 -22.389 1.00 3.00  ? 45  PHE B HZ   2  
ATOM   7066  N  N    . PRO B 2 46  ? 20.370  54.411 -24.523 1.00 0.64  ? 46  PRO B N    2  
ATOM   7067  C  CA   . PRO B 2 46  ? 20.789  53.268 -25.365 1.00 0.66  ? 46  PRO B CA   2  
ATOM   7068  C  C    . PRO B 2 46  ? 20.058  53.251 -26.723 1.00 0.68  ? 46  PRO B C    2  
ATOM   7069  O  O    . PRO B 2 46  ? 18.857  53.407 -26.815 1.00 0.76  ? 46  PRO B O    2  
ATOM   7070  C  CB   . PRO B 2 46  ? 20.425  52.021 -24.538 1.00 0.72  ? 46  PRO B CB   2  
ATOM   7071  C  CG   . PRO B 2 46  ? 19.419  52.488 -23.461 1.00 0.74  ? 46  PRO B CG   2  
ATOM   7072  C  CD   . PRO B 2 46  ? 19.522  54.026 -23.376 1.00 0.66  ? 46  PRO B CD   2  
ATOM   7073  H  HA   . PRO B 2 46  ? 21.856  53.299 -25.524 1.00 0.70  ? 46  PRO B HA   2  
ATOM   7074  H  HB2  . PRO B 2 46  ? 19.977  51.259 -25.169 1.00 0.75  ? 46  PRO B HB2  2  
ATOM   7075  H  HB3  . PRO B 2 46  ? 21.308  51.623 -24.059 1.00 0.78  ? 46  PRO B HB3  2  
ATOM   7076  H  HG2  . PRO B 2 46  ? 18.421  52.200 -23.760 1.00 0.80  ? 46  PRO B HG2  2  
ATOM   7077  H  HG3  . PRO B 2 46  ? 19.660  52.047 -22.503 1.00 0.81  ? 46  PRO B HG3  2  
ATOM   7078  H  HD2  . PRO B 2 46  ? 18.539  54.474 -23.460 1.00 0.68  ? 46  PRO B HD2  2  
ATOM   7079  H  HD3  . PRO B 2 46  ? 20.000  54.326 -22.451 1.00 0.67  ? 46  PRO B HD3  2  
ATOM   7080  N  N    . GLU B 2 47  ? 20.823  53.082 -27.757 1.00 0.70  ? 47  GLU B N    2  
ATOM   7081  C  CA   . GLU B 2 47  ? 20.324  53.060 -29.156 1.00 0.77  ? 47  GLU B CA   2  
ATOM   7082  C  C    . GLU B 2 47  ? 19.811  54.433 -29.460 1.00 0.76  ? 47  GLU B C    2  
ATOM   7083  O  O    . GLU B 2 47  ? 19.308  54.725 -30.526 1.00 0.95  ? 47  GLU B O    2  
ATOM   7084  C  CB   . GLU B 2 47  ? 19.205  52.030 -29.312 1.00 0.79  ? 47  GLU B CB   2  
ATOM   7085  C  CG   . GLU B 2 47  ? 19.630  50.708 -28.671 1.00 1.60  ? 47  GLU B CG   2  
ATOM   7086  C  CD   . GLU B 2 47  ? 18.621  49.617 -29.034 1.00 1.99  ? 47  GLU B CD   2  
ATOM   7087  O  OE1  . GLU B 2 47  ? 18.767  49.032 -30.095 1.00 2.69  ? 47  GLU B OE1  2  
ATOM   7088  O  OE2  . GLU B 2 47  ? 17.720  49.384 -28.245 1.00 2.25  ? 47  GLU B OE2  2  
ATOM   7089  H  H    . GLU B 2 47  ? 21.771  53.022 -27.613 1.00 0.73  ? 47  GLU B H    2  
ATOM   7090  H  HA   . GLU B 2 47  ? 21.137  52.821 -29.827 1.00 0.88  ? 47  GLU B HA   2  
ATOM   7091  H  HB2  . GLU B 2 47  ? 18.309  52.392 -28.836 1.00 1.24  ? 47  GLU B HB2  2  
ATOM   7092  H  HB3  . GLU B 2 47  ? 19.013  51.873 -30.358 1.00 1.25  ? 47  GLU B HB3  2  
ATOM   7093  H  HG2  . GLU B 2 47  ? 20.609  50.430 -29.035 1.00 2.15  ? 47  GLU B HG2  2  
ATOM   7094  H  HG3  . GLU B 2 47  ? 19.663  50.822 -27.599 1.00 2.25  ? 47  GLU B HG3  2  
ATOM   7095  N  N    . GLY B 2 48  ? 20.074  55.305 -28.551 1.00 0.67  ? 48  GLY B N    2  
ATOM   7096  C  CA   . GLY B 2 48  ? 19.768  56.715 -28.768 1.00 0.75  ? 48  GLY B CA   2  
ATOM   7097  C  C    . GLY B 2 48  ? 18.263  57.023 -28.738 1.00 0.71  ? 48  GLY B C    2  
ATOM   7098  O  O    . GLY B 2 48  ? 17.869  58.121 -29.077 1.00 0.87  ? 48  GLY B O    2  
ATOM   7099  H  H    . GLY B 2 48  ? 20.563  55.033 -27.752 1.00 0.66  ? 48  GLY B H    2  
ATOM   7100  H  HA2  . GLY B 2 48  ? 20.263  57.281 -27.996 1.00 0.80  ? 48  GLY B HA2  2  
ATOM   7101  H  HA3  . GLY B 2 48  ? 20.176  56.989 -29.717 1.00 0.84  ? 48  GLY B HA3  2  
ATOM   7102  N  N    . LEU B 2 49  ? 17.404  56.091 -28.373 1.00 0.63  ? 49  LEU B N    2  
ATOM   7103  C  CA   . LEU B 2 49  ? 15.932  56.409 -28.389 1.00 0.73  ? 49  LEU B CA   2  
ATOM   7104  C  C    . LEU B 2 49  ? 15.504  56.982 -27.083 1.00 0.65  ? 49  LEU B C    2  
ATOM   7105  O  O    . LEU B 2 49  ? 15.723  56.439 -26.019 1.00 0.97  ? 49  LEU B O    2  
ATOM   7106  C  CB   . LEU B 2 49  ? 15.096  55.179 -28.784 1.00 1.02  ? 49  LEU B CB   2  
ATOM   7107  C  CG   . LEU B 2 49  ? 14.740  54.283 -27.579 1.00 0.77  ? 49  LEU B CG   2  
ATOM   7108  C  CD1  . LEU B 2 49  ? 13.855  53.136 -28.067 1.00 1.63  ? 49  LEU B CD1  2  
ATOM   7109  C  CD2  . LEU B 2 49  ? 16.006  53.695 -26.951 1.00 1.41  ? 49  LEU B CD2  2  
ATOM   7110  H  H    . LEU B 2 49  ? 17.714  55.202 -28.118 1.00 0.63  ? 49  LEU B H    2  
ATOM   7111  H  HA   . LEU B 2 49  ? 15.764  57.188 -29.100 1.00 0.82  ? 49  LEU B HA   2  
ATOM   7112  H  HB2  . LEU B 2 49  ? 14.183  55.511 -29.249 1.00 1.54  ? 49  LEU B HB2  2  
ATOM   7113  H  HB3  . LEU B 2 49  ? 15.656  54.609 -29.495 1.00 1.51  ? 49  LEU B HB3  2  
ATOM   7114  H  HG   . LEU B 2 49  ? 14.193  54.850 -26.842 1.00 1.54  ? 49  LEU B HG   2  
ATOM   7115  H  HD11 . LEU B 2 49  ? 12.882  53.523 -28.333 1.00 2.12  ? 49  LEU B HD11 2  
ATOM   7116  H  HD12 . LEU B 2 49  ? 13.750  52.403 -27.282 1.00 2.18  ? 49  LEU B HD12 2  
ATOM   7117  H  HD13 . LEU B 2 49  ? 14.308  52.676 -28.933 1.00 2.21  ? 49  LEU B HD13 2  
ATOM   7118  H  HD21 . LEU B 2 49  ? 15.755  53.229 -26.009 1.00 1.98  ? 49  LEU B HD21 2  
ATOM   7119  H  HD22 . LEU B 2 49  ? 16.728  54.476 -26.782 1.00 1.99  ? 49  LEU B HD22 2  
ATOM   7120  H  HD23 . LEU B 2 49  ? 16.423  52.955 -27.614 1.00 1.96  ? 49  LEU B HD23 2  
ATOM   7121  N  N    . PHE B 2 50  ? 14.963  58.154 -27.186 1.00 0.57  ? 50  PHE B N    2  
ATOM   7122  C  CA   . PHE B 2 50  ? 14.575  58.893 -25.982 1.00 0.66  ? 50  PHE B CA   2  
ATOM   7123  C  C    . PHE B 2 50  ? 13.163  59.566 -26.014 1.00 0.69  ? 50  PHE B C    2  
ATOM   7124  O  O    . PHE B 2 50  ? 12.672  59.946 -27.058 1.00 0.88  ? 50  PHE B O    2  
ATOM   7125  C  CB   . PHE B 2 50  ? 15.628  59.983 -25.902 1.00 0.82  ? 50  PHE B CB   2  
ATOM   7126  C  CG   . PHE B 2 50  ? 15.307  60.671 -24.678 1.00 1.20  ? 50  PHE B CG   2  
ATOM   7127  C  CD1  . PHE B 2 50  ? 15.619  60.036 -23.511 1.00 1.07  ? 50  PHE B CD1  2  
ATOM   7128  C  CD2  . PHE B 2 50  ? 14.587  61.844 -24.713 1.00 2.22  ? 50  PHE B CD2  2  
ATOM   7129  C  CE1  . PHE B 2 50  ? 15.180  60.582 -22.316 1.00 1.66  ? 50  PHE B CE1  2  
ATOM   7130  C  CE2  . PHE B 2 50  ? 14.180  62.400 -23.539 1.00 2.92  ? 50  PHE B CE2  2  
ATOM   7131  C  CZ   . PHE B 2 50  ? 14.460  61.767 -22.348 1.00 2.58  ? 50  PHE B CZ   2  
ATOM   7132  H  H    . PHE B 2 50  ? 14.874  58.556 -28.072 1.00 0.74  ? 50  PHE B H    2  
ATOM   7133  H  HA   . PHE B 2 50  ? 14.650  58.261 -25.109 1.00 0.76  ? 50  PHE B HA   2  
ATOM   7134  H  HB2  . PHE B 2 50  ? 16.618  59.546 -25.850 1.00 1.15  ? 50  PHE B HB2  2  
ATOM   7135  H  HB3  . PHE B 2 50  ? 15.552  60.647 -26.750 1.00 0.95  ? 50  PHE B HB3  2  
ATOM   7136  H  HD1  . PHE B 2 50  ? 16.177  59.096 -23.562 1.00 1.13  ? 50  PHE B HD1  2  
ATOM   7137  H  HD2  . PHE B 2 50  ? 14.374  62.332 -25.653 1.00 2.56  ? 50  PHE B HD2  2  
ATOM   7138  H  HE1  . PHE B 2 50  ? 15.417  60.124 -21.375 1.00 1.66  ? 50  PHE B HE1  2  
ATOM   7139  H  HE2  . PHE B 2 50  ? 13.629  63.299 -23.545 1.00 3.78  ? 50  PHE B HE2  2  
ATOM   7140  H  HZ   . PHE B 2 50  ? 14.089  62.171 -21.465 1.00 3.16  ? 50  PHE B HZ   2  
ATOM   7141  N  N    . TYR B 2 51  ? 12.582  59.848 -24.825 1.00 0.64  ? 51  TYR B N    2  
ATOM   7142  C  CA   . TYR B 2 51  ? 11.331  60.627 -24.715 1.00 0.70  ? 51  TYR B CA   2  
ATOM   7143  C  C    . TYR B 2 51  ? 11.461  61.548 -23.474 1.00 0.64  ? 51  TYR B C    2  
ATOM   7144  O  O    . TYR B 2 51  ? 11.728  61.088 -22.376 1.00 0.81  ? 51  TYR B O    2  
ATOM   7145  C  CB   . TYR B 2 51  ? 10.135  59.690 -24.552 1.00 0.88  ? 51  TYR B CB   2  
ATOM   7146  C  CG   . TYR B 2 51  ? 9.736   59.161 -25.909 1.00 1.43  ? 51  TYR B CG   2  
ATOM   7147  C  CD1  . TYR B 2 51  ? 9.264   60.041 -26.887 1.00 2.30  ? 51  TYR B CD1  2  
ATOM   7148  C  CD2  . TYR B 2 51  ? 9.852   57.801 -26.192 1.00 2.16  ? 51  TYR B CD2  2  
ATOM   7149  C  CE1  . TYR B 2 51  ? 8.910   59.557 -28.146 1.00 3.31  ? 51  TYR B CE1  2  
ATOM   7150  C  CE2  . TYR B 2 51  ? 9.498   57.312 -27.455 1.00 3.09  ? 51  TYR B CE2  2  
ATOM   7151  C  CZ   . TYR B 2 51  ? 9.027   58.193 -28.434 1.00 3.55  ? 51  TYR B CZ   2  
ATOM   7152  O  OH   . TYR B 2 51  ? 8.676   57.717 -29.682 1.00 4.66  ? 51  TYR B OH   2  
ATOM   7153  H  H    . TYR B 2 51  ? 13.026  59.667 -23.990 1.00 0.68  ? 51  TYR B H    2  
ATOM   7154  H  HA   . TYR B 2 51  ? 11.210  61.239 -25.598 1.00 0.74  ? 51  TYR B HA   2  
ATOM   7155  H  HB2  . TYR B 2 51  ? 10.406  58.870 -23.901 1.00 1.39  ? 51  TYR B HB2  2  
ATOM   7156  H  HB3  . TYR B 2 51  ? 9.310   60.231 -24.121 1.00 1.33  ? 51  TYR B HB3  2  
ATOM   7157  H  HD1  . TYR B 2 51  ? 9.168   61.094 -26.669 1.00 2.60  ? 51  TYR B HD1  2  
ATOM   7158  H  HD2  . TYR B 2 51  ? 10.216  57.132 -25.435 1.00 2.46  ? 51  TYR B HD2  2  
ATOM   7159  H  HE1  . TYR B 2 51  ? 8.553   60.238 -28.895 1.00 4.15  ? 51  TYR B HE1  2  
ATOM   7160  H  HE2  . TYR B 2 51  ? 9.589   56.258 -27.674 1.00 3.78  ? 51  TYR B HE2  2  
ATOM   7161  H  HH   . TYR B 2 51  ? 8.539   58.472 -30.259 1.00 4.93  ? 51  TYR B HH   2  
ATOM   7162  N  N    . GLU B 2 52  ? 11.246  62.810 -23.626 1.00 0.56  ? 52  GLU B N    2  
ATOM   7163  C  CA   . GLU B 2 52  ? 11.314  63.768 -22.447 1.00 0.59  ? 52  GLU B CA   2  
ATOM   7164  C  C    . GLU B 2 52  ? 9.923   64.015 -21.811 1.00 0.53  ? 52  GLU B C    2  
ATOM   7165  O  O    . GLU B 2 52  ? 8.977   64.316 -22.512 1.00 0.59  ? 52  GLU B O    2  
ATOM   7166  C  CB   . GLU B 2 52  ? 11.833  65.160 -22.898 1.00 0.66  ? 52  GLU B CB   2  
ATOM   7167  C  CG   . GLU B 2 52  ? 10.751  65.901 -23.705 1.00 0.70  ? 52  GLU B CG   2  
ATOM   7168  C  CD   . GLU B 2 52  ? 11.394  67.011 -24.542 1.00 1.52  ? 52  GLU B CD   2  
ATOM   7169  O  OE1  . GLU B 2 52  ? 11.723  68.039 -23.974 1.00 2.16  ? 52  GLU B OE1  2  
ATOM   7170  O  OE2  . GLU B 2 52  ? 11.546  66.813 -25.736 1.00 2.20  ? 52  GLU B OE2  2  
ATOM   7171  H  H    . GLU B 2 52  ? 11.045  63.121 -24.502 1.00 0.60  ? 52  GLU B H    2  
ATOM   7172  H  HA   . GLU B 2 52  ? 11.983  63.370 -21.698 1.00 0.68  ? 52  GLU B HA   2  
ATOM   7173  H  HB2  . GLU B 2 52  ? 12.077  65.739 -22.022 1.00 0.79  ? 52  GLU B HB2  2  
ATOM   7174  H  HB3  . GLU B 2 52  ? 12.708  65.061 -23.502 1.00 0.79  ? 52  GLU B HB3  2  
ATOM   7175  H  HG2  . GLU B 2 52  ? 10.249  65.202 -24.358 1.00 0.94  ? 52  GLU B HG2  2  
ATOM   7176  H  HG3  . GLU B 2 52  ? 10.035  66.338 -23.026 1.00 1.11  ? 52  GLU B HG3  2  
ATOM   7177  N  N    . PHE B 2 53  ? 9.801   63.971 -20.491 1.00 0.49  ? 53  PHE B N    2  
ATOM   7178  C  CA   . PHE B 2 53  ? 8.487   64.301 -19.859 1.00 0.48  ? 53  PHE B CA   2  
ATOM   7179  C  C    . PHE B 2 53  ? 8.658   65.116 -18.570 1.00 0.49  ? 53  PHE B C    2  
ATOM   7180  O  O    . PHE B 2 53  ? 9.485   64.853 -17.746 1.00 0.61  ? 53  PHE B O    2  
ATOM   7181  C  CB   . PHE B 2 53  ? 7.680   63.032 -19.585 1.00 0.57  ? 53  PHE B CB   2  
ATOM   7182  C  CG   . PHE B 2 53  ? 6.896   62.696 -20.842 1.00 0.73  ? 53  PHE B CG   2  
ATOM   7183  C  CD1  . PHE B 2 53  ? 7.497   61.990 -21.890 1.00 1.03  ? 53  PHE B CD1  2  
ATOM   7184  C  CD2  . PHE B 2 53  ? 5.574   63.140 -20.967 1.00 0.95  ? 53  PHE B CD2  2  
ATOM   7185  C  CE1  . PHE B 2 53  ? 6.769   61.722 -23.058 1.00 1.33  ? 53  PHE B CE1  2  
ATOM   7186  C  CE2  . PHE B 2 53  ? 4.850   62.875 -22.134 1.00 1.28  ? 53  PHE B CE2  2  
ATOM   7187  C  CZ   . PHE B 2 53  ? 5.448   62.165 -23.179 1.00 1.40  ? 53  PHE B CZ   2  
ATOM   7188  H  H    . PHE B 2 53  ? 10.577  63.741 -19.946 1.00 0.52  ? 53  PHE B H    2  
ATOM   7189  H  HA   . PHE B 2 53  ? 7.925   64.928 -20.544 1.00 0.48  ? 53  PHE B HA   2  
ATOM   7190  H  HB2  . PHE B 2 53  ? 8.350   62.230 -19.318 1.00 0.71  ? 53  PHE B HB2  2  
ATOM   7191  H  HB3  . PHE B 2 53  ? 6.990   63.206 -18.772 1.00 0.66  ? 53  PHE B HB3  2  
ATOM   7192  H  HD1  . PHE B 2 53  ? 8.517   61.648 -21.797 1.00 1.20  ? 53  PHE B HD1  2  
ATOM   7193  H  HD2  . PHE B 2 53  ? 5.113   63.687 -20.159 1.00 1.07  ? 53  PHE B HD2  2  
ATOM   7194  H  HE1  . PHE B 2 53  ? 7.226   61.175 -23.866 1.00 1.63  ? 53  PHE B HE1  2  
ATOM   7195  H  HE2  . PHE B 2 53  ? 3.831   63.219 -22.227 1.00 1.56  ? 53  PHE B HE2  2  
ATOM   7196  H  HZ   . PHE B 2 53  ? 4.890   61.961 -24.081 1.00 1.69  ? 53  PHE B HZ   2  
ATOM   7197  N  N    . GLU B 2 54  ? 7.809   66.087 -18.436 1.00 0.46  ? 54  GLU B N    2  
ATOM   7198  C  CA   . GLU B 2 54  ? 7.719   66.992 -17.243 1.00 0.49  ? 54  GLU B CA   2  
ATOM   7199  C  C    . GLU B 2 54  ? 9.050   67.551 -16.680 1.00 0.62  ? 54  GLU B C    2  
ATOM   7200  O  O    . GLU B 2 54  ? 9.177   67.781 -15.494 1.00 1.07  ? 54  GLU B O    2  
ATOM   7201  C  CB   . GLU B 2 54  ? 6.886   66.278 -16.147 1.00 0.61  ? 54  GLU B CB   2  
ATOM   7202  C  CG   . GLU B 2 54  ? 5.441   66.795 -16.157 1.00 1.62  ? 54  GLU B CG   2  
ATOM   7203  C  CD   . GLU B 2 54  ? 5.373   68.150 -15.448 1.00 1.85  ? 54  GLU B CD   2  
ATOM   7204  O  OE1  . GLU B 2 54  ? 5.400   68.160 -14.228 1.00 2.20  ? 54  GLU B OE1  2  
ATOM   7205  O  OE2  . GLU B 2 54  ? 5.294   69.154 -16.136 1.00 2.33  ? 54  GLU B OE2  2  
ATOM   7206  H  H    . GLU B 2 54  ? 7.156   66.215 -19.148 1.00 0.51  ? 54  GLU B H    2  
ATOM   7207  H  HA   . GLU B 2 54  ? 7.171   67.844 -17.577 1.00 0.55  ? 54  GLU B HA   2  
ATOM   7208  H  HB2  . GLU B 2 54  ? 6.870   65.218 -16.352 1.00 1.10  ? 54  GLU B HB2  2  
ATOM   7209  H  HB3  . GLU B 2 54  ? 7.318   66.446 -15.170 1.00 1.27  ? 54  GLU B HB3  2  
ATOM   7210  H  HG2  . GLU B 2 54  ? 5.115   66.909 -17.181 1.00 2.25  ? 54  GLU B HG2  2  
ATOM   7211  H  HG3  . GLU B 2 54  ? 4.800   66.091 -15.649 1.00 2.25  ? 54  GLU B HG3  2  
ATOM   7212  N  N    . GLY B 2 55  ? 9.993   67.858 -17.511 1.00 0.66  ? 55  GLY B N    2  
ATOM   7213  C  CA   . GLY B 2 55  ? 11.265  68.490 -17.025 1.00 0.81  ? 55  GLY B CA   2  
ATOM   7214  C  C    . GLY B 2 55  ? 12.282  67.430 -16.698 1.00 0.75  ? 55  GLY B C    2  
ATOM   7215  O  O    . GLY B 2 55  ? 13.453  67.707 -16.530 1.00 0.94  ? 55  GLY B O    2  
ATOM   7216  H  H    . GLY B 2 55  ? 9.864   67.696 -18.452 1.00 0.91  ? 55  GLY B H    2  
ATOM   7217  H  HA2  . GLY B 2 55  ? 11.659  69.134 -17.796 1.00 0.96  ? 55  GLY B HA2  2  
ATOM   7218  H  HA3  . GLY B 2 55  ? 11.064  69.077 -16.139 1.00 0.92  ? 55  GLY B HA3  2  
ATOM   7219  N  N    . ARG B 2 56  ? 11.845  66.218 -16.645 1.00 0.62  ? 56  ARG B N    2  
ATOM   7220  C  CA   . ARG B 2 56  ? 12.785  65.117 -16.370 1.00 0.66  ? 56  ARG B CA   2  
ATOM   7221  C  C    . ARG B 2 56  ? 12.877  64.329 -17.643 1.00 0.61  ? 56  ARG B C    2  
ATOM   7222  O  O    . ARG B 2 56  ? 11.963  64.325 -18.445 1.00 0.79  ? 56  ARG B O    2  
ATOM   7223  C  CB   . ARG B 2 56  ? 12.288  64.232 -15.237 1.00 0.79  ? 56  ARG B CB   2  
ATOM   7224  C  CG   . ARG B 2 56  ? 10.836  63.787 -15.411 1.00 1.09  ? 56  ARG B CG   2  
ATOM   7225  C  CD   . ARG B 2 56  ? 9.847   64.860 -14.932 1.00 1.33  ? 56  ARG B CD   2  
ATOM   7226  N  NE   . ARG B 2 56  ? 9.452   64.601 -13.503 1.00 1.90  ? 56  ARG B NE   2  
ATOM   7227  C  CZ   . ARG B 2 56  ? 8.855   63.496 -13.142 1.00 2.39  ? 56  ARG B CZ   2  
ATOM   7228  N  NH1  . ARG B 2 56  ? 8.489   62.621 -14.039 1.00 2.63  ? 56  ARG B NH1  2  
ATOM   7229  N  NH2  . ARG B 2 56  ? 8.595   63.281 -11.882 1.00 3.20  ? 56  ARG B NH2  2  
ATOM   7230  H  H    . ARG B 2 56  ? 10.889  66.070 -16.789 1.00 0.60  ? 56  ARG B H    2  
ATOM   7231  H  HA   . ARG B 2 56  ? 13.776  65.492 -16.119 1.00 0.73  ? 56  ARG B HA   2  
ATOM   7232  H  HB2  . ARG B 2 56  ? 12.890  63.369 -15.254 1.00 1.19  ? 56  ARG B HB2  2  
ATOM   7233  H  HB3  . ARG B 2 56  ? 12.404  64.742 -14.293 1.00 1.09  ? 56  ARG B HB3  2  
ATOM   7234  H  HG2  . ARG B 2 56  ? 10.665  63.551 -16.443 1.00 1.55  ? 56  ARG B HG2  2  
ATOM   7235  H  HG3  . ARG B 2 56  ? 10.691  62.905 -14.829 1.00 1.74  ? 56  ARG B HG3  2  
ATOM   7236  H  HD2  . ARG B 2 56  ? 10.302  65.824 -14.957 1.00 1.83  ? 56  ARG B HD2  2  
ATOM   7237  H  HD3  . ARG B 2 56  ? 8.983   64.854 -15.594 1.00 1.61  ? 56  ARG B HD3  2  
ATOM   7238  H  HE   . ARG B 2 56  ? 9.673   65.268 -12.820 1.00 2.41  ? 56  ARG B HE   2  
ATOM   7239  H  HH11 . ARG B 2 56  ? 8.666   62.794 -15.008 1.00 2.50  ? 56  ARG B HH11 2  
ATOM   7240  H  HH12 . ARG B 2 56  ? 8.032   61.777 -13.758 1.00 3.32  ? 56  ARG B HH12 2  
ATOM   7241  H  HH21 . ARG B 2 56  ? 8.853   63.960 -11.195 1.00 3.57  ? 56  ARG B HH21 2  
ATOM   7242  H  HH22 . ARG B 2 56  ? 8.137   62.436 -11.603 1.00 3.69  ? 56  ARG B HH22 2  
ATOM   7243  N  N    . LYS B 2 57  ? 13.999  63.713 -17.868 1.00 0.54  ? 57  LYS B N    2  
ATOM   7244  C  CA   . LYS B 2 57  ? 14.195  62.978 -19.137 1.00 0.57  ? 57  LYS B CA   2  
ATOM   7245  C  C    . LYS B 2 57  ? 14.315  61.464 -18.910 1.00 0.55  ? 57  LYS B C    2  
ATOM   7246  O  O    . LYS B 2 57  ? 15.041  61.017 -18.044 1.00 0.75  ? 57  LYS B O    2  
ATOM   7247  C  CB   . LYS B 2 57  ? 15.481  63.534 -19.790 1.00 0.66  ? 57  LYS B CB   2  
ATOM   7248  C  CG   . LYS B 2 57  ? 16.541  63.829 -18.715 1.00 1.05  ? 57  LYS B CG   2  
ATOM   7249  C  CD   . LYS B 2 57  ? 17.802  64.406 -19.372 1.00 1.19  ? 57  LYS B CD   2  
ATOM   7250  C  CE   . LYS B 2 57  ? 17.591  65.884 -19.727 1.00 1.49  ? 57  LYS B CE   2  
ATOM   7251  N  NZ   . LYS B 2 57  ? 18.911  66.516 -20.004 1.00 1.97  ? 57  LYS B NZ   2  
ATOM   7252  H  H    . LYS B 2 57  ? 14.723  63.776 -17.221 1.00 0.62  ? 57  LYS B H    2  
ATOM   7253  H  HA   . LYS B 2 57  ? 13.362  63.171 -19.793 1.00 0.60  ? 57  LYS B HA   2  
ATOM   7254  H  HB2  . LYS B 2 57  ? 15.881  62.820 -20.490 1.00 0.83  ? 57  LYS B HB2  2  
ATOM   7255  H  HB3  . LYS B 2 57  ? 15.244  64.447 -20.312 1.00 0.87  ? 57  LYS B HB3  2  
ATOM   7256  H  HG2  . LYS B 2 57  ? 16.154  64.540 -18.002 1.00 1.63  ? 57  LYS B HG2  2  
ATOM   7257  H  HG3  . LYS B 2 57  ? 16.795  62.913 -18.203 1.00 1.66  ? 57  LYS B HG3  2  
ATOM   7258  H  HD2  . LYS B 2 57  ? 18.631  64.321 -18.686 1.00 1.93  ? 57  LYS B HD2  2  
ATOM   7259  H  HD3  . LYS B 2 57  ? 18.023  63.852 -20.273 1.00 1.71  ? 57  LYS B HD3  2  
ATOM   7260  H  HE2  . LYS B 2 57  ? 16.969  65.960 -20.604 1.00 1.97  ? 57  LYS B HE2  2  
ATOM   7261  H  HE3  . LYS B 2 57  ? 17.116  66.396 -18.904 1.00 1.97  ? 57  LYS B HE3  2  
ATOM   7262  H  HZ1  . LYS B 2 57  ? 19.041  66.612 -21.031 1.00 2.46  ? 57  LYS B HZ1  2  
ATOM   7263  H  HZ2  . LYS B 2 57  ? 19.669  65.921 -19.611 1.00 2.28  ? 57  LYS B HZ2  2  
ATOM   7264  H  HZ3  . LYS B 2 57  ? 18.944  67.457 -19.564 1.00 2.28  ? 57  LYS B HZ3  2  
ATOM   7265  N  N    . TYR B 2 58  ? 13.574  60.671 -19.665 1.00 0.49  ? 58  TYR B N    2  
ATOM   7266  C  CA   . TYR B 2 58  ? 13.603  59.175 -19.477 1.00 0.49  ? 58  TYR B CA   2  
ATOM   7267  C  C    . TYR B 2 58  ? 13.742  58.392 -20.807 1.00 0.50  ? 58  TYR B C    2  
ATOM   7268  O  O    . TYR B 2 58  ? 13.203  58.787 -21.824 1.00 0.74  ? 58  TYR B O    2  
ATOM   7269  C  CB   . TYR B 2 58  ? 12.269  58.713 -18.936 1.00 0.51  ? 58  TYR B CB   2  
ATOM   7270  C  CG   . TYR B 2 58  ? 11.932  59.330 -17.610 1.00 0.51  ? 58  TYR B CG   2  
ATOM   7271  C  CD1  . TYR B 2 58  ? 12.616  58.945 -16.452 1.00 0.54  ? 58  TYR B CD1  2  
ATOM   7272  C  CD2  . TYR B 2 58  ? 10.877  60.237 -17.534 1.00 0.54  ? 58  TYR B CD2  2  
ATOM   7273  C  CE1  . TYR B 2 58  ? 12.243  59.478 -15.216 1.00 0.58  ? 58  TYR B CE1  2  
ATOM   7274  C  CE2  . TYR B 2 58  ? 10.495  60.757 -16.303 1.00 0.60  ? 58  TYR B CE2  2  
ATOM   7275  C  CZ   . TYR B 2 58  ? 11.180  60.377 -15.137 1.00 0.62  ? 58  TYR B CZ   2  
ATOM   7276  O  OH   . TYR B 2 58  ? 10.799  60.871 -13.905 1.00 0.70  ? 58  TYR B OH   2  
ATOM   7277  H  H    . TYR B 2 58  ? 12.931  61.057 -20.303 1.00 0.60  ? 58  TYR B H    2  
ATOM   7278  H  HA   . TYR B 2 58  ? 14.393  58.906 -18.783 1.00 0.50  ? 58  TYR B HA   2  
ATOM   7279  H  HB2  . TYR B 2 58  ? 11.513  58.977 -19.647 1.00 0.54  ? 58  TYR B HB2  2  
ATOM   7280  H  HB3  . TYR B 2 58  ? 12.282  57.644 -18.839 1.00 0.55  ? 58  TYR B HB3  2  
ATOM   7281  H  HD1  . TYR B 2 58  ? 13.445  58.257 -16.515 1.00 0.55  ? 58  TYR B HD1  2  
ATOM   7282  H  HD2  . TYR B 2 58  ? 10.356  60.535 -18.439 1.00 0.55  ? 58  TYR B HD2  2  
ATOM   7283  H  HE1  . TYR B 2 58  ? 12.766  59.187 -14.321 1.00 0.62  ? 58  TYR B HE1  2  
ATOM   7284  H  HE2  . TYR B 2 58  ? 9.679   61.452 -16.258 1.00 0.65  ? 58  TYR B HE2  2  
ATOM   7285  H  HH   . TYR B 2 58  ? 10.559  60.127 -13.348 1.00 1.08  ? 58  TYR B HH   2  
ATOM   7286  N  N    . CYS B 2 59  ? 14.354  57.226 -20.773 1.00 0.60  ? 59  CYS B N    2  
ATOM   7287  C  CA   . CYS B 2 59  ? 14.385  56.372 -21.998 1.00 0.60  ? 59  CYS B CA   2  
ATOM   7288  C  C    . CYS B 2 59  ? 12.932  56.027 -22.206 1.00 0.59  ? 59  CYS B C    2  
ATOM   7289  O  O    . CYS B 2 59  ? 12.136  56.240 -21.314 1.00 0.61  ? 59  CYS B O    2  
ATOM   7290  C  CB   . CYS B 2 59  ? 15.152  55.064 -21.805 1.00 0.62  ? 59  CYS B CB   2  
ATOM   7291  S  SG   . CYS B 2 59  ? 16.893  55.393 -21.473 1.00 0.59  ? 59  CYS B SG   2  
ATOM   7292  H  H    . CYS B 2 59  ? 14.696  56.882 -19.924 1.00 0.84  ? 59  CYS B H    2  
ATOM   7293  H  HA   . CYS B 2 59  ? 14.767  56.930 -22.843 1.00 0.63  ? 59  CYS B HA   2  
ATOM   7294  H  HB2  . CYS B 2 59  ? 14.721  54.519 -20.988 1.00 0.65  ? 59  CYS B HB2  2  
ATOM   7295  H  HB3  . CYS B 2 59  ? 15.069  54.472 -22.705 1.00 0.68  ? 59  CYS B HB3  2  
ATOM   7296  N  N    . GLU B 2 60  ? 12.530  55.494 -23.313 1.00 0.61  ? 60  GLU B N    2  
ATOM   7297  C  CA   . GLU B 2 60  ? 11.106  55.166 -23.447 1.00 0.64  ? 60  GLU B CA   2  
ATOM   7298  C  C    . GLU B 2 60  ? 10.735  54.250 -22.323 1.00 0.59  ? 60  GLU B C    2  
ATOM   7299  O  O    . GLU B 2 60  ? 9.676   54.315 -21.752 1.00 0.60  ? 60  GLU B O    2  
ATOM   7300  C  CB   . GLU B 2 60  ? 10.840  54.474 -24.774 1.00 0.74  ? 60  GLU B CB   2  
ATOM   7301  C  CG   . GLU B 2 60  ? 11.501  53.103 -24.786 1.00 0.74  ? 60  GLU B CG   2  
ATOM   7302  C  CD   . GLU B 2 60  ? 11.378  52.485 -26.180 1.00 0.90  ? 60  GLU B CD   2  
ATOM   7303  O  OE1  . GLU B 2 60  ? 10.917  53.176 -27.074 1.00 1.33  ? 60  GLU B OE1  2  
ATOM   7304  O  OE2  . GLU B 2 60  ? 11.747  51.332 -26.331 1.00 1.53  ? 60  GLU B OE2  2  
ATOM   7305  H  H    . GLU B 2 60  ? 13.126  55.235 -24.023 1.00 0.65  ? 60  GLU B H    2  
ATOM   7306  H  HA   . GLU B 2 60  ? 10.533  56.055 -23.381 1.00 0.68  ? 60  GLU B HA   2  
ATOM   7307  H  HB2  . GLU B 2 60  ? 9.782   54.354 -24.881 1.00 0.78  ? 60  GLU B HB2  2  
ATOM   7308  H  HB3  . GLU B 2 60  ? 11.229  55.069 -25.587 1.00 0.81  ? 60  GLU B HB3  2  
ATOM   7309  H  HG2  . GLU B 2 60  ? 12.544  53.201 -24.521 1.00 0.73  ? 60  GLU B HG2  2  
ATOM   7310  H  HG3  . GLU B 2 60  ? 11.001  52.475 -24.069 1.00 0.72  ? 60  GLU B HG3  2  
ATOM   7311  N  N    . HIS B 2 61  ? 11.630  53.364 -22.061 1.00 0.59  ? 61  HIS B N    2  
ATOM   7312  C  CA   . HIS B 2 61  ? 11.420  52.354 -21.031 1.00 0.60  ? 61  HIS B CA   2  
ATOM   7313  C  C    . HIS B 2 61  ? 11.039  53.032 -19.739 1.00 0.60  ? 61  HIS B C    2  
ATOM   7314  O  O    . HIS B 2 61  ? 10.032  52.737 -19.124 1.00 0.63  ? 61  HIS B O    2  
ATOM   7315  C  CB   . HIS B 2 61  ? 12.729  51.576 -20.859 1.00 0.63  ? 61  HIS B CB   2  
ATOM   7316  C  CG   . HIS B 2 61  ? 12.673  50.729 -19.616 1.00 0.61  ? 61  HIS B CG   2  
ATOM   7317  N  ND1  . HIS B 2 61  ? 13.669  50.761 -18.652 1.00 0.59  ? 61  HIS B ND1  2  
ATOM   7318  C  CD2  . HIS B 2 61  ? 11.747  49.822 -19.169 1.00 0.66  ? 61  HIS B CD2  2  
ATOM   7319  C  CE1  . HIS B 2 61  ? 13.321  49.898 -17.681 1.00 0.63  ? 61  HIS B CE1  2  
ATOM   7320  N  NE2  . HIS B 2 61  ? 12.158  49.299 -17.948 1.00 0.68  ? 61  HIS B NE2  2  
ATOM   7321  H  H    . HIS B 2 61  ? 12.452  53.350 -22.588 1.00 0.61  ? 61  HIS B H    2  
ATOM   7322  H  HA   . HIS B 2 61  ? 10.648  51.690 -21.337 1.00 0.64  ? 61  HIS B HA   2  
ATOM   7323  H  HB2  . HIS B 2 61  ? 12.880  50.939 -21.718 1.00 0.71  ? 61  HIS B HB2  2  
ATOM   7324  H  HB3  . HIS B 2 61  ? 13.549  52.278 -20.785 1.00 0.63  ? 61  HIS B HB3  2  
ATOM   7325  H  HD2  . HIS B 2 61  ? 10.837  49.558 -19.687 1.00 0.71  ? 61  HIS B HD2  2  
ATOM   7326  H  HE1  . HIS B 2 61  ? 13.909  49.714 -16.794 1.00 0.66  ? 61  HIS B HE1  2  
ATOM   7327  H  HE2  . HIS B 2 61  ? 11.700  48.633 -17.394 1.00 0.73  ? 61  HIS B HE2  2  
ATOM   7328  N  N    . ASP B 2 62  ? 11.835  53.931 -19.295 1.00 0.61  ? 62  ASP B N    2  
ATOM   7329  C  CA   . ASP B 2 62  ? 11.486  54.578 -18.014 1.00 0.68  ? 62  ASP B CA   2  
ATOM   7330  C  C    . ASP B 2 62  ? 10.345  55.547 -18.207 1.00 0.66  ? 62  ASP B C    2  
ATOM   7331  O  O    . ASP B 2 62  ? 9.522   55.751 -17.328 1.00 0.70  ? 62  ASP B O    2  
ATOM   7332  C  CB   . ASP B 2 62  ? 12.684  55.259 -17.368 1.00 0.79  ? 62  ASP B CB   2  
ATOM   7333  C  CG   . ASP B 2 62  ? 13.952  55.173 -18.224 1.00 0.92  ? 62  ASP B CG   2  
ATOM   7334  O  OD1  . ASP B 2 62  ? 14.481  54.084 -18.357 1.00 1.38  ? 62  ASP B OD1  2  
ATOM   7335  O  OD2  . ASP B 2 62  ? 14.451  56.232 -18.578 1.00 1.50  ? 62  ASP B OD2  2  
ATOM   7336  H  H    . ASP B 2 62  ? 12.647  54.167 -19.797 1.00 0.61  ? 62  ASP B H    2  
ATOM   7337  H  HA   . ASP B 2 62  ? 11.138  53.808 -17.348 1.00 0.72  ? 62  ASP B HA   2  
ATOM   7338  H  HB2  . ASP B 2 62  ? 12.465  56.283 -17.156 1.00 0.81  ? 62  ASP B HB2  2  
ATOM   7339  H  HB3  . ASP B 2 62  ? 12.857  54.765 -16.454 1.00 0.80  ? 62  ASP B HB3  2  
ATOM   7340  N  N    . PHE B 2 63  ? 10.238  56.092 -19.363 1.00 0.65  ? 63  PHE B N    2  
ATOM   7341  C  CA   . PHE B 2 63  ? 9.109   56.983 -19.613 1.00 0.69  ? 63  PHE B CA   2  
ATOM   7342  C  C    . PHE B 2 63  ? 7.864   56.122 -19.601 1.00 0.64  ? 63  PHE B C    2  
ATOM   7343  O  O    . PHE B 2 63  ? 6.868   56.435 -18.990 1.00 0.69  ? 63  PHE B O    2  
ATOM   7344  C  CB   . PHE B 2 63  ? 9.300   57.685 -20.978 1.00 0.76  ? 63  PHE B CB   2  
ATOM   7345  C  CG   . PHE B 2 63  ? 8.004   57.767 -21.741 1.00 1.13  ? 63  PHE B CG   2  
ATOM   7346  C  CD1  . PHE B 2 63  ? 7.182   58.864 -21.542 1.00 1.51  ? 63  PHE B CD1  2  
ATOM   7347  C  CD2  . PHE B 2 63  ? 7.630   56.752 -22.628 1.00 1.96  ? 63  PHE B CD2  2  
ATOM   7348  C  CE1  . PHE B 2 63  ? 5.965   58.963 -22.231 1.00 2.24  ? 63  PHE B CE1  2  
ATOM   7349  C  CE2  . PHE B 2 63  ? 6.419   56.845 -23.321 1.00 2.72  ? 63  PHE B CE2  2  
ATOM   7350  C  CZ   . PHE B 2 63  ? 5.585   57.952 -23.122 1.00 2.75  ? 63  PHE B CZ   2  
ATOM   7351  H  H    . PHE B 2 63  ? 10.838  55.837 -20.095 1.00 0.65  ? 63  PHE B H    2  
ATOM   7352  H  HA   . PHE B 2 63  ? 9.043   57.711 -18.830 1.00 0.76  ? 63  PHE B HA   2  
ATOM   7353  H  HB2  . PHE B 2 63  ? 9.664   58.687 -20.822 1.00 1.08  ? 63  PHE B HB2  2  
ATOM   7354  H  HB3  . PHE B 2 63  ? 10.016  57.142 -21.551 1.00 1.14  ? 63  PHE B HB3  2  
ATOM   7355  H  HD1  . PHE B 2 63  ? 7.496   59.635 -20.851 1.00 1.72  ? 63  PHE B HD1  2  
ATOM   7356  H  HD2  . PHE B 2 63  ? 8.275   55.901 -22.778 1.00 2.27  ? 63  PHE B HD2  2  
ATOM   7357  H  HE1  . PHE B 2 63  ? 5.321   59.814 -22.077 1.00 2.69  ? 63  PHE B HE1  2  
ATOM   7358  H  HE2  . PHE B 2 63  ? 6.127   56.064 -24.007 1.00 3.47  ? 63  PHE B HE2  2  
ATOM   7359  H  HZ   . PHE B 2 63  ? 4.650   58.025 -23.653 1.00 3.43  ? 63  PHE B HZ   2  
ATOM   7360  N  N    . GLN B 2 64  ? 7.938   55.010 -20.264 1.00 0.62  ? 64  GLN B N    2  
ATOM   7361  C  CA   . GLN B 2 64  ? 6.742   54.114 -20.313 1.00 0.68  ? 64  GLN B CA   2  
ATOM   7362  C  C    . GLN B 2 64  ? 6.515   53.521 -18.960 1.00 0.72  ? 64  GLN B C    2  
ATOM   7363  O  O    . GLN B 2 64  ? 5.455   53.073 -18.648 1.00 0.81  ? 64  GLN B O    2  
ATOM   7364  C  CB   . GLN B 2 64  ? 6.798   53.056 -21.423 1.00 0.77  ? 64  GLN B CB   2  
ATOM   7365  C  CG   . GLN B 2 64  ? 7.856   52.009 -21.141 1.00 0.86  ? 64  GLN B CG   2  
ATOM   7366  C  CD   . GLN B 2 64  ? 7.366   51.035 -20.068 1.00 1.65  ? 64  GLN B CD   2  
ATOM   7367  O  OE1  . GLN B 2 64  ? 6.595   50.139 -20.346 1.00 1.96  ? 64  GLN B OE1  2  
ATOM   7368  N  NE2  . GLN B 2 64  ? 7.791   51.179 -18.843 1.00 2.63  ? 64  GLN B NE2  2  
ATOM   7369  H  H    . GLN B 2 64  ? 8.809   54.750 -20.684 1.00 0.62  ? 64  GLN B H    2  
ATOM   7370  H  HA   . GLN B 2 64  ? 5.886   54.743 -20.519 1.00 0.70  ? 64  GLN B HA   2  
ATOM   7371  H  HB2  . GLN B 2 64  ? 5.842   52.576 -21.505 1.00 0.85  ? 64  GLN B HB2  2  
ATOM   7372  H  HB3  . GLN B 2 64  ? 7.010   53.549 -22.348 1.00 0.98  ? 64  GLN B HB3  2  
ATOM   7373  H  HG2  . GLN B 2 64  ? 8.081   51.467 -22.047 1.00 1.09  ? 64  GLN B HG2  2  
ATOM   7374  H  HG3  . GLN B 2 64  ? 8.722   52.499 -20.798 1.00 1.24  ? 64  GLN B HG3  2  
ATOM   7375  H  HE21 . GLN B 2 64  ? 8.415   51.902 -18.622 1.00 2.86  ? 64  GLN B HE21 2  
ATOM   7376  H  HE22 . GLN B 2 64  ? 7.485   50.568 -18.145 1.00 3.34  ? 64  GLN B HE22 2  
ATOM   7377  N  N    . MET B 2 65  ? 7.459   53.610 -18.097 1.00 0.74  ? 65  MET B N    2  
ATOM   7378  C  CA   . MET B 2 65  ? 7.162   53.119 -16.736 1.00 0.88  ? 65  MET B CA   2  
ATOM   7379  C  C    . MET B 2 65  ? 6.102   54.079 -16.167 1.00 0.92  ? 65  MET B C    2  
ATOM   7380  O  O    . MET B 2 65  ? 5.020   53.681 -15.784 1.00 1.04  ? 65  MET B O    2  
ATOM   7381  C  CB   . MET B 2 65  ? 8.434   53.118 -15.874 1.00 0.92  ? 65  MET B CB   2  
ATOM   7382  C  CG   . MET B 2 65  ? 8.374   51.990 -14.840 1.00 1.15  ? 65  MET B CG   2  
ATOM   7383  S  SD   . MET B 2 65  ? 9.586   52.304 -13.533 1.00 1.91  ? 65  MET B SD   2  
ATOM   7384  C  CE   . MET B 2 65  ? 11.062  52.281 -14.580 1.00 2.40  ? 65  MET B CE   2  
ATOM   7385  H  H    . MET B 2 65  ? 8.275   54.126 -18.305 1.00 0.71  ? 65  MET B H    2  
ATOM   7386  H  HA   . MET B 2 65  ? 6.747   52.119 -16.797 1.00 0.97  ? 65  MET B HA   2  
ATOM   7387  H  HB2  . MET B 2 65  ? 9.281   52.956 -16.510 1.00 1.21  ? 65  MET B HB2  2  
ATOM   7388  H  HB3  . MET B 2 65  ? 8.541   54.064 -15.367 1.00 1.30  ? 65  MET B HB3  2  
ATOM   7389  H  HG2  . MET B 2 65  ? 7.383   51.945 -14.412 1.00 1.77  ? 65  MET B HG2  2  
ATOM   7390  H  HG3  . MET B 2 65  ? 8.602   51.051 -15.326 1.00 1.49  ? 65  MET B HG3  2  
ATOM   7391  H  HE1  . MET B 2 65  ? 11.919  51.990 -13.987 1.00 2.73  ? 65  MET B HE1  2  
ATOM   7392  H  HE2  . MET B 2 65  ? 11.230  53.264 -14.990 1.00 2.78  ? 65  MET B HE2  2  
ATOM   7393  H  HE3  . MET B 2 65  ? 10.920  51.576 -15.387 1.00 2.92  ? 65  MET B HE3  2  
ATOM   7394  N  N    . LEU B 2 66  ? 6.395   55.357 -16.173 1.00 0.90  ? 66  LEU B N    2  
ATOM   7395  C  CA   . LEU B 2 66  ? 5.418   56.376 -15.661 1.00 1.01  ? 66  LEU B CA   2  
ATOM   7396  C  C    . LEU B 2 66  ? 4.311   56.642 -16.694 1.00 1.09  ? 66  LEU B C    2  
ATOM   7397  O  O    . LEU B 2 66  ? 3.306   57.253 -16.386 1.00 1.32  ? 66  LEU B O    2  
ATOM   7398  C  CB   . LEU B 2 66  ? 6.131   57.703 -15.276 1.00 1.06  ? 66  LEU B CB   2  
ATOM   7399  C  CG   . LEU B 2 66  ? 7.413   57.923 -16.121 1.00 1.02  ? 66  LEU B CG   2  
ATOM   7400  C  CD1  . LEU B 2 66  ? 7.590   59.410 -16.457 1.00 1.36  ? 66  LEU B CD1  2  
ATOM   7401  C  CD2  . LEU B 2 66  ? 8.646   57.445 -15.338 1.00 1.28  ? 66  LEU B CD2  2  
ATOM   7402  H  H    . LEU B 2 66  ? 7.258   55.656 -16.551 1.00 0.84  ? 66  LEU B H    2  
ATOM   7403  H  HA   . LEU B 2 66  ? 4.949   55.971 -14.776 1.00 1.10  ? 66  LEU B HA   2  
ATOM   7404  H  HB2  . LEU B 2 66  ? 5.446   58.528 -15.424 1.00 1.27  ? 66  LEU B HB2  2  
ATOM   7405  H  HB3  . LEU B 2 66  ? 6.396   57.666 -14.229 1.00 1.25  ? 66  LEU B HB3  2  
ATOM   7406  H  HG   . LEU B 2 66  ? 7.343   57.373 -17.035 1.00 0.94  ? 66  LEU B HG   2  
ATOM   7407  H  HD11 . LEU B 2 66  ? 7.825   59.959 -15.558 1.00 1.75  ? 66  LEU B HD11 2  
ATOM   7408  H  HD12 . LEU B 2 66  ? 6.679   59.797 -16.890 1.00 1.78  ? 66  LEU B HD12 2  
ATOM   7409  H  HD13 . LEU B 2 66  ? 8.394   59.520 -17.167 1.00 1.75  ? 66  LEU B HD13 2  
ATOM   7410  H  HD21 . LEU B 2 66  ? 9.537   57.634 -15.917 1.00 1.67  ? 66  LEU B HD21 2  
ATOM   7411  H  HD22 . LEU B 2 66  ? 8.560   56.387 -15.142 1.00 1.65  ? 66  LEU B HD22 2  
ATOM   7412  H  HD23 . LEU B 2 66  ? 8.706   57.979 -14.400 1.00 1.78  ? 66  LEU B HD23 2  
ATOM   7413  N  N    . PHE B 2 67  ? 4.493   56.203 -17.911 1.00 0.97  ? 67  PHE B N    2  
ATOM   7414  C  CA   . PHE B 2 67  ? 3.481   56.423 -19.000 1.00 1.11  ? 67  PHE B CA   2  
ATOM   7415  C  C    . PHE B 2 67  ? 2.857   55.064 -19.336 1.00 1.09  ? 67  PHE B C    2  
ATOM   7416  O  O    . PHE B 2 67  ? 1.872   54.951 -20.038 1.00 1.22  ? 67  PHE B O    2  
ATOM   7417  C  CB   . PHE B 2 67  ? 4.117   57.136 -20.222 1.00 1.21  ? 67  PHE B CB   2  
ATOM   7418  C  CG   . PHE B 2 67  ? 3.920   58.643 -20.067 1.00 1.49  ? 67  PHE B CG   2  
ATOM   7419  C  CD1  . PHE B 2 67  ? 2.677   59.188 -20.413 1.00 1.95  ? 67  PHE B CD1  2  
ATOM   7420  C  CD2  . PHE B 2 67  ? 4.936   59.491 -19.542 1.00 1.93  ? 67  PHE B CD2  2  
ATOM   7421  C  CE1  . PHE B 2 67  ? 2.435   60.555 -20.254 1.00 2.57  ? 67  PHE B CE1  2  
ATOM   7422  C  CE2  . PHE B 2 67  ? 4.676   60.855 -19.380 1.00 2.64  ? 67  PHE B CE2  2  
ATOM   7423  C  CZ   . PHE B 2 67  ? 3.431   61.387 -19.737 1.00 2.88  ? 67  PHE B CZ   2  
ATOM   7424  H  H    . PHE B 2 67  ? 5.299   55.671 -18.132 1.00 0.86  ? 67  PHE B H    2  
ATOM   7425  H  HA   . PHE B 2 67  ? 2.687   57.039 -18.611 1.00 1.27  ? 67  PHE B HA   2  
ATOM   7426  H  HB2  . PHE B 2 67  ? 5.161   56.915 -20.283 1.00 1.58  ? 67  PHE B HB2  2  
ATOM   7427  H  HB3  . PHE B 2 67  ? 3.627   56.806 -21.124 1.00 1.40  ? 67  PHE B HB3  2  
ATOM   7428  H  HD1  . PHE B 2 67  ? 1.904   58.550 -20.813 1.00 2.13  ? 67  PHE B HD1  2  
ATOM   7429  H  HD2  . PHE B 2 67  ? 5.919   59.107 -19.271 1.00 2.01  ? 67  PHE B HD2  2  
ATOM   7430  H  HE1  . PHE B 2 67  ? 1.476   60.969 -20.528 1.00 3.03  ? 67  PHE B HE1  2  
ATOM   7431  H  HE2  . PHE B 2 67  ? 5.439   61.499 -18.976 1.00 3.19  ? 67  PHE B HE2  2  
ATOM   7432  H  HZ   . PHE B 2 67  ? 3.236   62.441 -19.607 1.00 3.50  ? 67  PHE B HZ   2  
ATOM   7433  N  N    . ALA B 2 68  ? 3.439   54.045 -18.773 1.00 1.04  ? 68  ALA B N    2  
ATOM   7434  C  CA   . ALA B 2 68  ? 2.920   52.652 -18.963 1.00 1.16  ? 68  ALA B CA   2  
ATOM   7435  C  C    . ALA B 2 68  ? 3.301   51.776 -17.753 1.00 1.70  ? 68  ALA B C    2  
ATOM   7436  O  O    . ALA B 2 68  ? 4.103   50.872 -17.878 1.00 2.34  ? 68  ALA B O    2  
ATOM   7437  C  CB   . ALA B 2 68  ? 3.483   52.046 -20.258 1.00 1.60  ? 68  ALA B CB   2  
ATOM   7438  H  H    . ALA B 2 68  ? 4.150   54.270 -18.122 1.00 1.01  ? 68  ALA B H    2  
ATOM   7439  H  HA   . ALA B 2 68  ? 1.850   52.693 -19.044 1.00 1.57  ? 68  ALA B HA   2  
ATOM   7440  H  HB1  . ALA B 2 68  ? 2.784   51.321 -20.651 1.00 2.20  ? 68  ALA B HB1  2  
ATOM   7441  H  HB2  . ALA B 2 68  ? 4.424   51.559 -20.063 1.00 1.97  ? 68  ALA B HB2  2  
ATOM   7442  H  HB3  . ALA B 2 68  ? 3.624   52.832 -20.984 1.00 2.00  ? 68  ALA B HB3  2  
ATOM   7443  N  N    . PRO B 2 69  ? 2.716   52.063 -16.607 1.00 2.27  ? 69  PRO B N    2  
ATOM   7444  C  CA   . PRO B 2 69  ? 3.002   51.290 -15.384 1.00 3.24  ? 69  PRO B CA   2  
ATOM   7445  C  C    . PRO B 2 69  ? 2.559   49.832 -15.579 1.00 3.50  ? 69  PRO B C    2  
ATOM   7446  O  O    . PRO B 2 69  ? 2.396   49.367 -16.689 1.00 3.97  ? 69  PRO B O    2  
ATOM   7447  C  CB   . PRO B 2 69  ? 2.185   51.990 -14.269 1.00 3.94  ? 69  PRO B CB   2  
ATOM   7448  C  CG   . PRO B 2 69  ? 1.420   53.178 -14.924 1.00 3.76  ? 69  PRO B CG   2  
ATOM   7449  C  CD   . PRO B 2 69  ? 1.741   53.164 -16.436 1.00 2.69  ? 69  PRO B CD   2  
ATOM   7450  H  HA   . PRO B 2 69  ? 4.056   51.332 -15.155 1.00 3.77  ? 69  PRO B HA   2  
ATOM   7451  H  HB2  . PRO B 2 69  ? 1.480   51.294 -13.825 1.00 4.21  ? 69  PRO B HB2  2  
ATOM   7452  H  HB3  . PRO B 2 69  ? 2.850   52.366 -13.504 1.00 4.68  ? 69  PRO B HB3  2  
ATOM   7453  H  HG2  . PRO B 2 69  ? 0.354   53.061 -14.768 1.00 4.05  ? 69  PRO B HG2  2  
ATOM   7454  H  HG3  . PRO B 2 69  ? 1.748   54.114 -14.490 1.00 4.47  ? 69  PRO B HG3  2  
ATOM   7455  H  HD2  . PRO B 2 69  ? 0.843   52.967 -17.006 1.00 2.57  ? 69  PRO B HD2  2  
ATOM   7456  H  HD3  . PRO B 2 69  ? 2.181   54.102 -16.741 1.00 2.98  ? 69  PRO B HD3  2  
ATOM   7457  N  N    . CYS B 2 70  ? 2.363   49.111 -14.509 1.00 3.83  ? 70  CYS B N    2  
ATOM   7458  C  CA   . CYS B 2 70  ? 1.932   47.690 -14.636 1.00 4.68  ? 70  CYS B CA   2  
ATOM   7459  C  C    . CYS B 2 70  ? 0.450   47.639 -15.014 1.00 5.32  ? 70  CYS B C    2  
ATOM   7460  O  O    . CYS B 2 70  ? -0.282  48.515 -14.582 1.00 5.77  ? 70  CYS B O    2  
ATOM   7461  C  CB   . CYS B 2 70  ? 2.142   46.971 -13.303 1.00 5.20  ? 70  CYS B CB   2  
ATOM   7462  S  SG   . CYS B 2 70  ? 1.516   45.277 -13.427 1.00 5.73  ? 70  CYS B SG   2  
ATOM   7463  O  OXT  . CYS B 2 70  ? 0.071   46.725 -15.728 1.00 5.68  ? 70  CYS B OXT  2  
ATOM   7464  H  H    . CYS B 2 70  ? 2.499   49.504 -13.621 1.00 3.89  ? 70  CYS B H    2  
ATOM   7465  H  HA   . CYS B 2 70  ? 2.516   47.204 -15.404 1.00 4.95  ? 70  CYS B HA   2  
ATOM   7466  H  HB2  . CYS B 2 70  ? 3.195   46.949 -13.067 1.00 5.44  ? 70  CYS B HB2  2  
ATOM   7467  H  HB3  . CYS B 2 70  ? 1.609   47.495 -12.523 1.00 5.51  ? 70  CYS B HB3  2  
ATOM   7468  H  HG   . CYS B 2 70  ? 1.110   45.173 -14.291 1.00 5.87  ? 70  CYS B HG   2  
HETATM 7469  ZN ZN   . ZN  C 3 .   ? 28.507  67.828 -20.729 1.00 0.46  ? 298 ZN  B ZN   2  
HETATM 7470  ZN ZN   . ZN  D 3 .   ? 16.285  55.887 -19.317 1.00 0.56  ? 299 ZN  B ZN   2  
ATOM   7471  N  N    . MET A 1 1   ? -4.855  71.471 -17.843 1.00 0.00  ? 1   MET A N    3  
ATOM   7472  C  CA   . MET A 1 1   ? -5.347  72.073 -16.571 1.00 0.00  ? 1   MET A CA   3  
ATOM   7473  C  C    . MET A 1 1   ? -5.688  70.960 -15.579 1.00 0.00  ? 1   MET A C    3  
ATOM   7474  O  O    . MET A 1 1   ? -5.593  69.789 -15.888 1.00 0.00  ? 1   MET A O    3  
ATOM   7475  C  CB   . MET A 1 1   ? -6.597  72.908 -16.853 1.00 0.00  ? 1   MET A CB   3  
ATOM   7476  C  CG   . MET A 1 1   ? -6.279  73.962 -17.914 1.00 0.00  ? 1   MET A CG   3  
ATOM   7477  S  SD   . MET A 1 1   ? -7.707  75.053 -18.128 1.00 0.00  ? 1   MET A SD   3  
ATOM   7478  C  CE   . MET A 1 1   ? -8.566  74.059 -19.373 1.00 0.00  ? 1   MET A CE   3  
ATOM   7479  H  H1   . MET A 1 1   ? -4.333  72.187 -18.387 1.00 0.00  ? 1   MET A H1   3  
ATOM   7480  H  H2   . MET A 1 1   ? -5.666  71.134 -18.402 1.00 0.00  ? 1   MET A H2   3  
ATOM   7481  H  H3   . MET A 1 1   ? -4.225  70.673 -17.629 1.00 0.00  ? 1   MET A H3   3  
ATOM   7482  H  HA   . MET A 1 1   ? -4.578  72.706 -16.153 1.00 0.00  ? 1   MET A HA   3  
ATOM   7483  H  HB2  . MET A 1 1   ? -7.387  72.263 -17.211 1.00 0.00  ? 1   MET A HB2  3  
ATOM   7484  H  HB3  . MET A 1 1   ? -6.915  73.398 -15.945 1.00 0.00  ? 1   MET A HB3  3  
ATOM   7485  H  HG2  . MET A 1 1   ? -5.426  74.545 -17.598 1.00 0.00  ? 1   MET A HG2  3  
ATOM   7486  H  HG3  . MET A 1 1   ? -6.054  73.475 -18.851 1.00 0.00  ? 1   MET A HG3  3  
ATOM   7487  H  HE1  . MET A 1 1   ? -8.806  73.090 -18.956 1.00 0.00  ? 1   MET A HE1  3  
ATOM   7488  H  HE2  . MET A 1 1   ? -7.930  73.930 -20.234 1.00 0.00  ? 1   MET A HE2  3  
ATOM   7489  H  HE3  . MET A 1 1   ? -9.474  74.564 -19.671 1.00 0.00  ? 1   MET A HE3  3  
ATOM   7490  N  N    . ASP A 1 2   ? -6.086  71.315 -14.387 1.00 0.00  ? 2   ASP A N    3  
ATOM   7491  C  CA   . ASP A 1 2   ? -6.432  70.276 -13.376 1.00 0.00  ? 2   ASP A CA   3  
ATOM   7492  C  C    . ASP A 1 2   ? -7.062  70.949 -12.148 1.00 0.00  ? 2   ASP A C    3  
ATOM   7493  O  O    . ASP A 1 2   ? -6.658  70.721 -11.027 1.00 0.00  ? 2   ASP A O    3  
ATOM   7494  C  CB   . ASP A 1 2   ? -5.159  69.515 -12.970 1.00 0.00  ? 2   ASP A CB   3  
ATOM   7495  C  CG   . ASP A 1 2   ? -5.524  68.114 -12.467 1.00 0.00  ? 2   ASP A CG   3  
ATOM   7496  O  OD1  . ASP A 1 2   ? -6.674  67.914 -12.114 1.00 0.00  ? 2   ASP A OD1  3  
ATOM   7497  O  OD2  . ASP A 1 2   ? -4.646  67.267 -12.446 1.00 0.00  ? 2   ASP A OD2  3  
ATOM   7498  H  H    . ASP A 1 2   ? -6.157  72.265 -14.157 1.00 0.00  ? 2   ASP A H    3  
ATOM   7499  H  HA   . ASP A 1 2   ? -7.145  69.588 -13.809 1.00 0.00  ? 2   ASP A HA   3  
ATOM   7500  H  HB2  . ASP A 1 2   ? -4.507  69.428 -13.827 1.00 0.00  ? 2   ASP A HB2  3  
ATOM   7501  H  HB3  . ASP A 1 2   ? -4.646  70.054 -12.186 1.00 0.00  ? 2   ASP A HB3  3  
ATOM   7502  N  N    . ASP A 1 3   ? -8.053  71.770 -12.364 1.00 0.00  ? 3   ASP A N    3  
ATOM   7503  C  CA   . ASP A 1 3   ? -8.739  72.467 -11.233 1.00 0.00  ? 3   ASP A CA   3  
ATOM   7504  C  C    . ASP A 1 3   ? -7.733  72.934 -10.172 1.00 0.00  ? 3   ASP A C    3  
ATOM   7505  O  O    . ASP A 1 3   ? -6.804  73.663 -10.460 1.00 0.00  ? 3   ASP A O    3  
ATOM   7506  C  CB   . ASP A 1 3   ? -9.763  71.523 -10.596 1.00 0.00  ? 3   ASP A CB   3  
ATOM   7507  C  CG   . ASP A 1 3   ? -9.081  70.215 -10.193 1.00 0.00  ? 3   ASP A CG   3  
ATOM   7508  O  OD1  . ASP A 1 3   ? -8.485  70.184 -9.128  1.00 0.00  ? 3   ASP A OD1  3  
ATOM   7509  O  OD2  . ASP A 1 3   ? -9.166  69.265 -10.954 1.00 0.00  ? 3   ASP A OD2  3  
ATOM   7510  H  H    . ASP A 1 3   ? -8.356  71.928 -13.282 1.00 0.00  ? 3   ASP A H    3  
ATOM   7511  H  HA   . ASP A 1 3   ? -9.253  73.330 -11.621 1.00 0.00  ? 3   ASP A HA   3  
ATOM   7512  H  HB2  . ASP A 1 3   ? -10.189 71.992 -9.721  1.00 0.00  ? 3   ASP A HB2  3  
ATOM   7513  H  HB3  . ASP A 1 3   ? -10.547 71.312 -11.308 1.00 0.00  ? 3   ASP A HB3  3  
ATOM   7514  N  N    . ILE A 1 4   ? -7.925  72.534 -8.941  1.00 0.00  ? 4   ILE A N    3  
ATOM   7515  C  CA   . ILE A 1 4   ? -6.997  72.969 -7.857  1.00 0.00  ? 4   ILE A CA   3  
ATOM   7516  C  C    . ILE A 1 4   ? -5.681  72.203 -7.977  1.00 0.00  ? 4   ILE A C    3  
ATOM   7517  O  O    . ILE A 1 4   ? -4.628  72.766 -7.869  1.00 0.00  ? 4   ILE A O    3  
ATOM   7518  C  CB   . ILE A 1 4   ? -7.636  72.711 -6.479  1.00 0.00  ? 4   ILE A CB   3  
ATOM   7519  C  CG1  . ILE A 1 4   ? -8.355  71.357 -6.470  1.00 0.00  ? 4   ILE A CG1  3  
ATOM   7520  C  CG2  . ILE A 1 4   ? -8.651  73.814 -6.170  1.00 0.00  ? 4   ILE A CG2  3  
ATOM   7521  C  CD1  . ILE A 1 4   ? -8.770  71.012 -5.037  1.00 0.00  ? 4   ILE A CD1  3  
ATOM   7522  H  H    . ILE A 1 4   ? -8.683  71.957 -8.731  1.00 0.00  ? 4   ILE A H    3  
ATOM   7523  H  HA   . ILE A 1 4   ? -6.799  74.024 -7.965  1.00 0.00  ? 4   ILE A HA   3  
ATOM   7524  H  HB   . ILE A 1 4   ? -6.866  72.715 -5.721  1.00 0.00  ? 4   ILE A HB   3  
ATOM   7525  H  HG12 . ILE A 1 4   ? -9.234  71.410 -7.095  1.00 0.00  ? 4   ILE A HG12 3  
ATOM   7526  H  HG13 . ILE A 1 4   ? -7.694  70.591 -6.841  1.00 0.00  ? 4   ILE A HG13 3  
ATOM   7527  H  HG21 . ILE A 1 4   ? -9.413  73.827 -6.936  1.00 0.00  ? 4   ILE A HG21 3  
ATOM   7528  H  HG22 . ILE A 1 4   ? -8.149  74.770 -6.147  1.00 0.00  ? 4   ILE A HG22 3  
ATOM   7529  H  HG23 . ILE A 1 4   ? -9.108  73.624 -5.210  1.00 0.00  ? 4   ILE A HG23 3  
ATOM   7530  H  HD11 . ILE A 1 4   ? -9.405  71.795 -4.648  1.00 0.00  ? 4   ILE A HD11 3  
ATOM   7531  H  HD12 . ILE A 1 4   ? -7.889  70.923 -4.418  1.00 0.00  ? 4   ILE A HD12 3  
ATOM   7532  H  HD13 . ILE A 1 4   ? -9.308  70.076 -5.033  1.00 0.00  ? 4   ILE A HD13 3  
ATOM   7533  N  N    . PHE A 1 5   ? -5.749  70.924 -8.191  1.00 0.00  ? 5   PHE A N    3  
ATOM   7534  C  CA   . PHE A 1 5   ? -4.505  70.096 -8.319  1.00 0.00  ? 5   PHE A CA   3  
ATOM   7535  C  C    . PHE A 1 5   ? -3.386  70.912 -8.994  1.00 0.00  ? 5   PHE A C    3  
ATOM   7536  O  O    . PHE A 1 5   ? -2.253  70.926 -8.541  1.00 0.00  ? 5   PHE A O    3  
ATOM   7537  C  CB   . PHE A 1 5   ? -4.798  68.846 -9.151  1.00 0.00  ? 5   PHE A CB   3  
ATOM   7538  C  CG   . PHE A 1 5   ? -5.781  67.965 -8.412  1.00 0.00  ? 5   PHE A CG   3  
ATOM   7539  C  CD1  . PHE A 1 5   ? -5.406  67.361 -7.206  1.00 0.00  ? 5   PHE A CD1  3  
ATOM   7540  C  CD2  . PHE A 1 5   ? -7.065  67.750 -8.932  1.00 0.00  ? 5   PHE A CD2  3  
ATOM   7541  C  CE1  . PHE A 1 5   ? -6.312  66.544 -6.520  1.00 0.00  ? 5   PHE A CE1  3  
ATOM   7542  C  CE2  . PHE A 1 5   ? -7.971  66.933 -8.245  1.00 0.00  ? 5   PHE A CE2  3  
ATOM   7543  C  CZ   . PHE A 1 5   ? -7.594  66.330 -7.039  1.00 0.00  ? 5   PHE A CZ   3  
ATOM   7544  H  H    . PHE A 1 5   ? -6.634  70.526 -8.252  1.00 0.00  ? 5   PHE A H    3  
ATOM   7545  H  HA   . PHE A 1 5   ? -4.180  69.799 -7.338  1.00 0.00  ? 5   PHE A HA   3  
ATOM   7546  H  HB2  . PHE A 1 5   ? -5.212  69.138 -10.102 1.00 0.00  ? 5   PHE A HB2  3  
ATOM   7547  H  HB3  . PHE A 1 5   ? -3.880  68.300 -9.312  1.00 0.00  ? 5   PHE A HB3  3  
ATOM   7548  H  HD1  . PHE A 1 5   ? -4.417  67.526 -6.804  1.00 0.00  ? 5   PHE A HD1  3  
ATOM   7549  H  HD2  . PHE A 1 5   ? -7.356  68.215 -9.862  1.00 0.00  ? 5   PHE A HD2  3  
ATOM   7550  H  HE1  . PHE A 1 5   ? -6.022  66.079 -5.589  1.00 0.00  ? 5   PHE A HE1  3  
ATOM   7551  H  HE2  . PHE A 1 5   ? -8.960  66.767 -8.646  1.00 0.00  ? 5   PHE A HE2  3  
ATOM   7552  H  HZ   . PHE A 1 5   ? -8.293  65.699 -6.509  1.00 0.00  ? 5   PHE A HZ   3  
ATOM   7553  N  N    . THR A 1 6   ? -3.698  71.620 -10.055 1.00 0.00  ? 6   THR A N    3  
ATOM   7554  C  CA   . THR A 1 6   ? -2.644  72.445 -10.733 1.00 0.00  ? 6   THR A CA   3  
ATOM   7555  C  C    . THR A 1 6   ? -2.582  73.833 -10.097 1.00 0.00  ? 6   THR A C    3  
ATOM   7556  O  O    . THR A 1 6   ? -1.531  74.311 -9.721  1.00 0.00  ? 6   THR A O    3  
ATOM   7557  C  CB   . THR A 1 6   ? -2.955  72.570 -12.230 1.00 0.00  ? 6   THR A CB   3  
ATOM   7558  O  OG1  . THR A 1 6   ? -1.968  73.385 -12.846 1.00 0.00  ? 6   THR A OG1  3  
ATOM   7559  C  CG2  . THR A 1 6   ? -4.333  73.200 -12.432 1.00 0.00  ? 6   THR A CG2  3  
ATOM   7560  H  H    . THR A 1 6   ? -4.627  71.622 -10.393 1.00 0.00  ? 6   THR A H    3  
ATOM   7561  H  HA   . THR A 1 6   ? -1.692  71.970 -10.611 1.00 0.00  ? 6   THR A HA   3  
ATOM   7562  H  HB   . THR A 1 6   ? -2.943  71.590 -12.681 1.00 0.00  ? 6   THR A HB   3  
ATOM   7563  H  HG1  . THR A 1 6   ? -2.370  73.813 -13.606 1.00 0.00  ? 6   THR A HG1  3  
ATOM   7564  H  HG21 . THR A 1 6   ? -4.266  74.266 -12.284 1.00 0.00  ? 6   THR A HG21 3  
ATOM   7565  H  HG22 . THR A 1 6   ? -5.032  72.779 -11.726 1.00 0.00  ? 6   THR A HG22 3  
ATOM   7566  H  HG23 . THR A 1 6   ? -4.673  73.001 -13.436 1.00 0.00  ? 6   THR A HG23 3  
ATOM   7567  N  N    . GLN A 1 7   ? -3.702  74.469 -9.967  1.00 0.00  ? 7   GLN A N    3  
ATOM   7568  C  CA   . GLN A 1 7   ? -3.743  75.827 -9.346  1.00 0.00  ? 7   GLN A CA   3  
ATOM   7569  C  C    . GLN A 1 7   ? -3.387  75.722 -7.851  1.00 0.00  ? 7   GLN A C    3  
ATOM   7570  O  O    . GLN A 1 7   ? -3.362  76.710 -7.144  1.00 0.00  ? 7   GLN A O    3  
ATOM   7571  C  CB   . GLN A 1 7   ? -5.158  76.412 -9.497  1.00 0.00  ? 7   GLN A CB   3  
ATOM   7572  C  CG   . GLN A 1 7   ? -5.313  77.068 -10.873 1.00 0.00  ? 7   GLN A CG   3  
ATOM   7573  C  CD   . GLN A 1 7   ? -4.524  78.378 -10.905 1.00 0.00  ? 7   GLN A CD   3  
ATOM   7574  O  OE1  . GLN A 1 7   ? -3.529  78.485 -11.594 1.00 0.00  ? 7   GLN A OE1  3  
ATOM   7575  N  NE2  . GLN A 1 7   ? -4.930  79.387 -10.183 1.00 0.00  ? 7   GLN A NE2  3  
ATOM   7576  H  H    . GLN A 1 7   ? -4.526  74.045 -10.274 1.00 0.00  ? 7   GLN A H    3  
ATOM   7577  H  HA   . GLN A 1 7   ? -3.032  76.470 -9.843  1.00 0.00  ? 7   GLN A HA   3  
ATOM   7578  H  HB2  . GLN A 1 7   ? -5.884  75.621 -9.397  1.00 0.00  ? 7   GLN A HB2  3  
ATOM   7579  H  HB3  . GLN A 1 7   ? -5.330  77.155 -8.730  1.00 0.00  ? 7   GLN A HB3  3  
ATOM   7580  H  HG2  . GLN A 1 7   ? -4.936  76.402 -11.634 1.00 0.00  ? 7   GLN A HG2  3  
ATOM   7581  H  HG3  . GLN A 1 7   ? -6.356  77.274 -11.058 1.00 0.00  ? 7   GLN A HG3  3  
ATOM   7582  H  HE21 . GLN A 1 7   ? -5.732  79.301 -9.628  1.00 0.00  ? 7   GLN A HE21 3  
ATOM   7583  H  HE22 . GLN A 1 7   ? -4.432  80.231 -10.197 1.00 0.00  ? 7   GLN A HE22 3  
ATOM   7584  N  N    . CYS A 1 8   ? -3.127  74.530 -7.365  1.00 0.00  ? 8   CYS A N    3  
ATOM   7585  C  CA   . CYS A 1 8   ? -2.789  74.346 -5.913  1.00 0.00  ? 8   CYS A CA   3  
ATOM   7586  C  C    . CYS A 1 8   ? -1.273  74.161 -5.772  1.00 0.00  ? 8   CYS A C    3  
ATOM   7587  O  O    . CYS A 1 8   ? -0.621  74.898 -5.060  1.00 0.00  ? 8   CYS A O    3  
ATOM   7588  C  CB   . CYS A 1 8   ? -3.533  73.121 -5.354  1.00 0.00  ? 8   CYS A CB   3  
ATOM   7589  S  SG   . CYS A 1 8   ? -2.803  71.597 -5.993  1.00 0.00  ? 8   CYS A SG   3  
ATOM   7590  H  H    . CYS A 1 8   ? -3.157  73.749 -7.958  1.00 0.00  ? 8   CYS A H    3  
ATOM   7591  H  HA   . CYS A 1 8   ? -3.094  75.225 -5.353  1.00 0.00  ? 8   CYS A HA   3  
ATOM   7592  H  HB2  . CYS A 1 8   ? -3.467  73.117 -4.283  1.00 0.00  ? 8   CYS A HB2  3  
ATOM   7593  H  HB3  . CYS A 1 8   ? -4.571  73.171 -5.637  1.00 0.00  ? 8   CYS A HB3  3  
ATOM   7594  H  HG   . CYS A 1 8   ? -2.683  71.700 -6.939  1.00 0.00  ? 8   CYS A HG   3  
ATOM   7595  N  N    . ARG A 1 9   ? -0.692  73.208 -6.463  1.00 0.00  ? 9   ARG A N    3  
ATOM   7596  C  CA   . ARG A 1 9   ? 0.787   73.036 -6.366  1.00 0.00  ? 9   ARG A CA   3  
ATOM   7597  C  C    . ARG A 1 9   ? 1.423   74.289 -6.962  1.00 0.00  ? 9   ARG A C    3  
ATOM   7598  O  O    . ARG A 1 9   ? 2.623   74.476 -6.960  1.00 0.00  ? 9   ARG A O    3  
ATOM   7599  C  CB   . ARG A 1 9   ? 1.223   71.799 -7.157  1.00 0.00  ? 9   ARG A CB   3  
ATOM   7600  C  CG   . ARG A 1 9   ? 0.878   71.985 -8.642  1.00 0.00  ? 9   ARG A CG   3  
ATOM   7601  C  CD   . ARG A 1 9   ? 0.854   70.625 -9.346  1.00 0.00  ? 9   ARG A CD   3  
ATOM   7602  N  NE   . ARG A 1 9   ? 2.000   69.779 -8.872  1.00 0.00  ? 9   ARG A NE   3  
ATOM   7603  C  CZ   . ARG A 1 9   ? 3.236   70.194 -8.953  1.00 0.00  ? 9   ARG A CZ   3  
ATOM   7604  N  NH1  . ARG A 1 9   ? 3.528   71.284 -9.607  1.00 0.00  ? 9   ARG A NH1  3  
ATOM   7605  N  NH2  . ARG A 1 9   ? 4.193   69.486 -8.417  1.00 0.00  ? 9   ARG A NH2  3  
ATOM   7606  H  H    . ARG A 1 9   ? -1.224  72.625 -7.059  1.00 0.00  ? 9   ARG A H    3  
ATOM   7607  H  HA   . ARG A 1 9   ? 1.077   72.935 -5.330  1.00 0.00  ? 9   ARG A HA   3  
ATOM   7608  H  HB2  . ARG A 1 9   ? 2.289   71.666 -7.047  1.00 0.00  ? 9   ARG A HB2  3  
ATOM   7609  H  HB3  . ARG A 1 9   ? 0.709   70.930 -6.774  1.00 0.00  ? 9   ARG A HB3  3  
ATOM   7610  H  HG2  . ARG A 1 9   ? -0.097  72.445 -8.727  1.00 0.00  ? 9   ARG A HG2  3  
ATOM   7611  H  HG3  . ARG A 1 9   ? 1.612   72.622 -9.105  1.00 0.00  ? 9   ARG A HG3  3  
ATOM   7612  H  HD2  . ARG A 1 9   ? -0.053  70.111 -9.093  1.00 0.00  ? 9   ARG A HD2  3  
ATOM   7613  H  HD3  . ARG A 1 9   ? 0.885   70.778 -10.424 1.00 0.00  ? 9   ARG A HD3  3  
ATOM   7614  H  HE   . ARG A 1 9   ? 1.812   68.916 -8.448  1.00 0.00  ? 9   ARG A HE   3  
ATOM   7615  H  HH11 . ARG A 1 9   ? 2.806   71.806 -10.056 1.00 0.00  ? 9   ARG A HH11 3  
ATOM   7616  H  HH12 . ARG A 1 9   ? 4.476   71.597 -9.659  1.00 0.00  ? 9   ARG A HH12 3  
ATOM   7617  H  HH21 . ARG A 1 9   ? 3.978   68.629 -7.948  1.00 0.00  ? 9   ARG A HH21 3  
ATOM   7618  H  HH22 . ARG A 1 9   ? 5.140   69.799 -8.477  1.00 0.00  ? 9   ARG A HH22 3  
ATOM   7619  N  N    . GLU A 1 10  ? 0.583   75.139 -7.475  1.00 0.00  ? 10  GLU A N    3  
ATOM   7620  C  CA   . GLU A 1 10  ? 1.030   76.411 -8.100  1.00 0.00  ? 10  GLU A CA   3  
ATOM   7621  C  C    . GLU A 1 10  ? 1.784   77.247 -7.057  1.00 0.00  ? 10  GLU A C    3  
ATOM   7622  O  O    . GLU A 1 10  ? 2.261   78.331 -7.327  1.00 0.00  ? 10  GLU A O    3  
ATOM   7623  C  CB   . GLU A 1 10  ? -0.237  77.127 -8.636  1.00 0.00  ? 10  GLU A CB   3  
ATOM   7624  C  CG   . GLU A 1 10  ? -0.756  78.217 -7.677  1.00 0.00  ? 10  GLU A CG   3  
ATOM   7625  C  CD   . GLU A 1 10  ? 0.030   79.516 -7.882  1.00 0.00  ? 10  GLU A CD   3  
ATOM   7626  O  OE1  . GLU A 1 10  ? 0.023   80.019 -8.994  1.00 0.00  ? 10  GLU A OE1  3  
ATOM   7627  O  OE2  . GLU A 1 10  ? 0.623   79.985 -6.925  1.00 0.00  ? 10  GLU A OE2  3  
ATOM   7628  H  H    . GLU A 1 10  ? -0.365  74.920 -7.452  1.00 0.00  ? 10  GLU A H    3  
ATOM   7629  H  HA   . GLU A 1 10  ? 1.692   76.189 -8.922  1.00 0.00  ? 10  GLU A HA   3  
ATOM   7630  H  HB2  . GLU A 1 10  ? -0.028  77.565 -9.595  1.00 0.00  ? 10  GLU A HB2  3  
ATOM   7631  H  HB3  . GLU A 1 10  ? -1.009  76.387 -8.763  1.00 0.00  ? 10  GLU A HB3  3  
ATOM   7632  H  HG2  . GLU A 1 10  ? -1.798  78.399 -7.886  1.00 0.00  ? 10  GLU A HG2  3  
ATOM   7633  H  HG3  . GLU A 1 10  ? -0.653  77.889 -6.654  1.00 0.00  ? 10  GLU A HG3  3  
ATOM   7634  N  N    . GLY A 1 11  ? 1.900   76.726 -5.867  1.00 0.00  ? 11  GLY A N    3  
ATOM   7635  C  CA   . GLY A 1 11  ? 2.616   77.444 -4.781  1.00 0.00  ? 11  GLY A CA   3  
ATOM   7636  C  C    . GLY A 1 11  ? 1.587   78.111 -3.883  1.00 0.00  ? 11  GLY A C    3  
ATOM   7637  O  O    . GLY A 1 11  ? 1.907   78.680 -2.858  1.00 0.00  ? 11  GLY A O    3  
ATOM   7638  H  H    . GLY A 1 11  ? 1.521   75.843 -5.696  1.00 0.00  ? 11  GLY A H    3  
ATOM   7639  H  HA2  . GLY A 1 11  ? 3.182   76.728 -4.210  1.00 0.00  ? 11  GLY A HA2  3  
ATOM   7640  H  HA3  . GLY A 1 11  ? 3.276   78.190 -5.192  1.00 0.00  ? 11  GLY A HA3  3  
ATOM   7641  N  N    . ASN A 1 12  ? 0.345   78.010 -4.251  1.00 0.00  ? 12  ASN A N    3  
ATOM   7642  C  CA   . ASN A 1 12  ? -0.726  78.594 -3.422  1.00 0.00  ? 12  ASN A CA   3  
ATOM   7643  C  C    . ASN A 1 12  ? -0.833  77.727 -2.184  1.00 0.00  ? 12  ASN A C    3  
ATOM   7644  O  O    . ASN A 1 12  ? -1.847  77.131 -1.919  1.00 0.00  ? 12  ASN A O    3  
ATOM   7645  C  CB   . ASN A 1 12  ? -2.052  78.576 -4.192  1.00 0.00  ? 12  ASN A CB   3  
ATOM   7646  C  CG   . ASN A 1 12  ? -2.103  79.755 -5.167  1.00 0.00  ? 12  ASN A CG   3  
ATOM   7647  O  OD1  . ASN A 1 12  ? -3.099  79.966 -5.830  1.00 0.00  ? 12  ASN A OD1  3  
ATOM   7648  N  ND2  . ASN A 1 12  ? -1.065  80.537 -5.286  1.00 0.00  ? 12  ASN A ND2  3  
ATOM   7649  H  H    . ASN A 1 12  ? 0.119   77.524 -5.057  1.00 0.00  ? 12  ASN A H    3  
ATOM   7650  H  HA   . ASN A 1 12  ? -0.469  79.606 -3.142  1.00 0.00  ? 12  ASN A HA   3  
ATOM   7651  H  HB2  . ASN A 1 12  ? -2.135  77.650 -4.742  1.00 0.00  ? 12  ASN A HB2  3  
ATOM   7652  H  HB3  . ASN A 1 12  ? -2.875  78.654 -3.496  1.00 0.00  ? 12  ASN A HB3  3  
ATOM   7653  H  HD21 . ASN A 1 12  ? -0.260  80.369 -4.753  1.00 0.00  ? 12  ASN A HD21 3  
ATOM   7654  H  HD22 . ASN A 1 12  ? -1.091  81.294 -5.908  1.00 0.00  ? 12  ASN A HD22 3  
ATOM   7655  N  N    . ALA A 1 13  ? 0.239   77.631 -1.454  1.00 0.00  ? 13  ALA A N    3  
ATOM   7656  C  CA   . ALA A 1 13  ? 0.261   76.785 -0.220  1.00 0.00  ? 13  ALA A CA   3  
ATOM   7657  C  C    . ALA A 1 13  ? -1.061  76.918 0.545   1.00 0.00  ? 13  ALA A C    3  
ATOM   7658  O  O    . ALA A 1 13  ? -1.451  76.053 1.305   1.00 0.00  ? 13  ALA A O    3  
ATOM   7659  C  CB   . ALA A 1 13  ? 1.413   77.236 0.680   1.00 0.00  ? 13  ALA A CB   3  
ATOM   7660  H  H    . ALA A 1 13  ? 1.049   78.104 -1.738  1.00 0.00  ? 13  ALA A H    3  
ATOM   7661  H  HA   . ALA A 1 13  ? 0.411   75.763 -0.499  1.00 0.00  ? 13  ALA A HA   3  
ATOM   7662  H  HB1  . ALA A 1 13  ? 1.444   76.616 1.564   1.00 0.00  ? 13  ALA A HB1  3  
ATOM   7663  H  HB2  . ALA A 1 13  ? 1.263   78.266 0.969   1.00 0.00  ? 13  ALA A HB2  3  
ATOM   7664  H  HB3  . ALA A 1 13  ? 2.346   77.145 0.144   1.00 0.00  ? 13  ALA A HB3  3  
ATOM   7665  N  N    . VAL A 1 14  ? -1.775  77.972 0.304   1.00 0.00  ? 14  VAL A N    3  
ATOM   7666  C  CA   . VAL A 1 14  ? -3.088  78.152 0.986   1.00 0.00  ? 14  VAL A CA   3  
ATOM   7667  C  C    . VAL A 1 14  ? -4.111  77.231 0.326   1.00 0.00  ? 14  VAL A C    3  
ATOM   7668  O  O    . VAL A 1 14  ? -5.056  76.780 0.943   1.00 0.00  ? 14  VAL A O    3  
ATOM   7669  C  CB   . VAL A 1 14  ? -3.545  79.606 0.854   1.00 0.00  ? 14  VAL A CB   3  
ATOM   7670  C  CG1  . VAL A 1 14  ? -3.701  79.963 -0.625  1.00 0.00  ? 14  VAL A CG1  3  
ATOM   7671  C  CG2  . VAL A 1 14  ? -4.891  79.781 1.563   1.00 0.00  ? 14  VAL A CG2  3  
ATOM   7672  H  H    . VAL A 1 14  ? -1.460  78.614 -0.366  1.00 0.00  ? 14  VAL A H    3  
ATOM   7673  H  HA   . VAL A 1 14  ? -2.991  77.895 2.031   1.00 0.00  ? 14  VAL A HA   3  
ATOM   7674  H  HB   . VAL A 1 14  ? -2.811  80.257 1.306   1.00 0.00  ? 14  VAL A HB   3  
ATOM   7675  H  HG11 . VAL A 1 14  ? -3.868  81.025 -0.723  1.00 0.00  ? 14  VAL A HG11 3  
ATOM   7676  H  HG12 . VAL A 1 14  ? -4.542  79.426 -1.038  1.00 0.00  ? 14  VAL A HG12 3  
ATOM   7677  H  HG13 . VAL A 1 14  ? -2.802  79.690 -1.158  1.00 0.00  ? 14  VAL A HG13 3  
ATOM   7678  H  HG21 . VAL A 1 14  ? -5.663  79.278 1.000   1.00 0.00  ? 14  VAL A HG21 3  
ATOM   7679  H  HG22 . VAL A 1 14  ? -5.126  80.833 1.635   1.00 0.00  ? 14  VAL A HG22 3  
ATOM   7680  H  HG23 . VAL A 1 14  ? -4.834  79.356 2.555   1.00 0.00  ? 14  VAL A HG23 3  
ATOM   7681  N  N    . ALA A 1 15  ? -3.918  76.952 -0.929  1.00 0.00  ? 15  ALA A N    3  
ATOM   7682  C  CA   . ALA A 1 15  ? -4.856  76.073 -1.664  1.00 0.00  ? 15  ALA A CA   3  
ATOM   7683  C  C    . ALA A 1 15  ? -4.641  74.617 -1.244  1.00 0.00  ? 15  ALA A C    3  
ATOM   7684  O  O    . ALA A 1 15  ? -5.590  73.879 -1.016  1.00 0.00  ? 15  ALA A O    3  
ATOM   7685  C  CB   . ALA A 1 15  ? -4.601  76.221 -3.167  1.00 0.00  ? 15  ALA A CB   3  
ATOM   7686  H  H    . ALA A 1 15  ? -3.144  77.330 -1.395  1.00 0.00  ? 15  ALA A H    3  
ATOM   7687  H  HA   . ALA A 1 15  ? -5.869  76.368 -1.445  1.00 0.00  ? 15  ALA A HA   3  
ATOM   7688  H  HB1  . ALA A 1 15  ? -4.992  75.360 -3.692  1.00 0.00  ? 15  ALA A HB1  3  
ATOM   7689  H  HB2  . ALA A 1 15  ? -3.539  76.299 -3.342  1.00 0.00  ? 15  ALA A HB2  3  
ATOM   7690  H  HB3  . ALA A 1 15  ? -5.091  77.114 -3.527  1.00 0.00  ? 15  ALA A HB3  3  
ATOM   7691  N  N    . VAL A 1 16  ? -3.421  74.156 -1.159  1.00 0.00  ? 16  VAL A N    3  
ATOM   7692  C  CA   . VAL A 1 16  ? -3.236  72.748 -0.785  1.00 0.00  ? 16  VAL A CA   3  
ATOM   7693  C  C    . VAL A 1 16  ? -3.748  72.561 0.646   1.00 0.00  ? 16  VAL A C    3  
ATOM   7694  O  O    . VAL A 1 16  ? -4.318  71.542 0.974   1.00 0.00  ? 16  VAL A O    3  
ATOM   7695  C  CB   . VAL A 1 16  ? -1.747  72.354 -0.946  1.00 0.00  ? 16  VAL A CB   3  
ATOM   7696  C  CG1  . VAL A 1 16  ? -0.849  73.571 -0.761  1.00 0.00  ? 16  VAL A CG1  3  
ATOM   7697  C  CG2  . VAL A 1 16  ? -1.360  71.289 0.078   1.00 0.00  ? 16  VAL A CG2  3  
ATOM   7698  H  H    . VAL A 1 16  ? -2.629  74.692 -1.362  1.00 0.00  ? 16  VAL A H    3  
ATOM   7699  H  HA   . VAL A 1 16  ? -3.833  72.146 -1.448  1.00 0.00  ? 16  VAL A HA   3  
ATOM   7700  H  HB   . VAL A 1 16  ? -1.593  71.967 -1.941  1.00 0.00  ? 16  VAL A HB   3  
ATOM   7701  H  HG11 . VAL A 1 16  ? 0.176   73.250 -0.641  1.00 0.00  ? 16  VAL A HG11 3  
ATOM   7702  H  HG12 . VAL A 1 16  ? -1.158  74.114 0.113   1.00 0.00  ? 16  VAL A HG12 3  
ATOM   7703  H  HG13 . VAL A 1 16  ? -0.920  74.209 -1.631  1.00 0.00  ? 16  VAL A HG13 3  
ATOM   7704  H  HG21 . VAL A 1 16  ? -1.301  71.746 1.053   1.00 0.00  ? 16  VAL A HG21 3  
ATOM   7705  H  HG22 . VAL A 1 16  ? -0.403  70.868 -0.185  1.00 0.00  ? 16  VAL A HG22 3  
ATOM   7706  H  HG23 . VAL A 1 16  ? -2.109  70.513 0.087   1.00 0.00  ? 16  VAL A HG23 3  
ATOM   7707  N  N    . ARG A 1 17  ? -3.592  73.547 1.490   1.00 0.00  ? 17  ARG A N    3  
ATOM   7708  C  CA   . ARG A 1 17  ? -4.121  73.406 2.874   1.00 0.00  ? 17  ARG A CA   3  
ATOM   7709  C  C    . ARG A 1 17  ? -5.642  73.298 2.771   1.00 0.00  ? 17  ARG A C    3  
ATOM   7710  O  O    . ARG A 1 17  ? -6.286  72.575 3.506   1.00 0.00  ? 17  ARG A O    3  
ATOM   7711  C  CB   . ARG A 1 17  ? -3.730  74.638 3.706   1.00 0.00  ? 17  ARG A CB   3  
ATOM   7712  C  CG   . ARG A 1 17  ? -4.162  74.460 5.184   1.00 0.00  ? 17  ARG A CG   3  
ATOM   7713  C  CD   . ARG A 1 17  ? -5.498  75.170 5.444   1.00 0.00  ? 17  ARG A CD   3  
ATOM   7714  N  NE   . ARG A 1 17  ? -5.848  75.059 6.887   1.00 0.00  ? 17  ARG A NE   3  
ATOM   7715  C  CZ   . ARG A 1 17  ? -6.756  75.843 7.400   1.00 0.00  ? 17  ARG A CZ   3  
ATOM   7716  N  NH1  . ARG A 1 17  ? -7.348  76.733 6.651   1.00 0.00  ? 17  ARG A NH1  3  
ATOM   7717  N  NH2  . ARG A 1 17  ? -7.071  75.739 8.663   1.00 0.00  ? 17  ARG A NH2  3  
ATOM   7718  H  H    . ARG A 1 17  ? -3.158  74.385 1.206   1.00 0.00  ? 17  ARG A H    3  
ATOM   7719  H  HA   . ARG A 1 17  ? -3.720  72.510 3.328   1.00 0.00  ? 17  ARG A HA   3  
ATOM   7720  H  HB2  . ARG A 1 17  ? -2.656  74.763 3.658   1.00 0.00  ? 17  ARG A HB2  3  
ATOM   7721  H  HB3  . ARG A 1 17  ? -4.205  75.514 3.288   1.00 0.00  ? 17  ARG A HB3  3  
ATOM   7722  H  HG2  . ARG A 1 17  ? -4.268  73.409 5.415   1.00 0.00  ? 17  ARG A HG2  3  
ATOM   7723  H  HG3  . ARG A 1 17  ? -3.408  74.887 5.831   1.00 0.00  ? 17  ARG A HG3  3  
ATOM   7724  H  HD2  . ARG A 1 17  ? -5.409  76.213 5.174   1.00 0.00  ? 17  ARG A HD2  3  
ATOM   7725  H  HD3  . ARG A 1 17  ? -6.275  74.711 4.853   1.00 0.00  ? 17  ARG A HD3  3  
ATOM   7726  H  HE   . ARG A 1 17  ? -5.400  74.394 7.451   1.00 0.00  ? 17  ARG A HE   3  
ATOM   7727  H  HH11 . ARG A 1 17  ? -7.106  76.814 5.684   1.00 0.00  ? 17  ARG A HH11 3  
ATOM   7728  H  HH12 . ARG A 1 17  ? -8.044  77.334 7.044   1.00 0.00  ? 17  ARG A HH12 3  
ATOM   7729  H  HH21 . ARG A 1 17  ? -6.616  75.059 9.237   1.00 0.00  ? 17  ARG A HH21 3  
ATOM   7730  H  HH22 . ARG A 1 17  ? -7.766  76.341 9.056   1.00 0.00  ? 17  ARG A HH22 3  
ATOM   7731  N  N    . LEU A 1 18  ? -6.208  74.011 1.837   1.00 0.00  ? 18  LEU A N    3  
ATOM   7732  C  CA   . LEU A 1 18  ? -7.682  73.979 1.621   1.00 0.00  ? 18  LEU A CA   3  
ATOM   7733  C  C    . LEU A 1 18  ? -8.180  72.531 1.658   1.00 0.00  ? 18  LEU A C    3  
ATOM   7734  O  O    . LEU A 1 18  ? -8.978  72.162 2.496   1.00 0.00  ? 18  LEU A O    3  
ATOM   7735  C  CB   . LEU A 1 18  ? -7.972  74.586 0.242   1.00 0.00  ? 18  LEU A CB   3  
ATOM   7736  C  CG   . LEU A 1 18  ? -9.419  75.077 0.129   1.00 0.00  ? 18  LEU A CG   3  
ATOM   7737  C  CD1  . LEU A 1 18  ? -9.676  76.261 1.085   1.00 0.00  ? 18  LEU A CD1  3  
ATOM   7738  C  CD2  . LEU A 1 18  ? -9.647  75.514 -1.325  1.00 0.00  ? 18  LEU A CD2  3  
ATOM   7739  H  H    . LEU A 1 18  ? -5.652  74.575 1.260   1.00 0.00  ? 18  LEU A H    3  
ATOM   7740  H  HA   . LEU A 1 18  ? -8.174  74.555 2.386   1.00 0.00  ? 18  LEU A HA   3  
ATOM   7741  H  HB2  . LEU A 1 18  ? -7.307  75.416 0.078   1.00 0.00  ? 18  LEU A HB2  3  
ATOM   7742  H  HB3  . LEU A 1 18  ? -7.802  73.840 -0.520  1.00 0.00  ? 18  LEU A HB3  3  
ATOM   7743  H  HG   . LEU A 1 18  ? -10.092 74.268 0.370   1.00 0.00  ? 18  LEU A HG   3  
ATOM   7744  H  HD11 . LEU A 1 18  ? -10.431 76.912 0.666   1.00 0.00  ? 18  LEU A HD11 3  
ATOM   7745  H  HD12 . LEU A 1 18  ? -8.765  76.823 1.232   1.00 0.00  ? 18  LEU A HD12 3  
ATOM   7746  H  HD13 . LEU A 1 18  ? -10.023 75.885 2.036   1.00 0.00  ? 18  LEU A HD13 3  
ATOM   7747  H  HD21 . LEU A 1 18  ? -9.434  74.686 -1.988  1.00 0.00  ? 18  LEU A HD21 3  
ATOM   7748  H  HD22 . LEU A 1 18  ? -8.986  76.337 -1.562  1.00 0.00  ? 18  LEU A HD22 3  
ATOM   7749  H  HD23 . LEU A 1 18  ? -10.672 75.825 -1.454  1.00 0.00  ? 18  LEU A HD23 3  
ATOM   7750  N  N    . TRP A 1 19  ? -7.726  71.708 0.746   1.00 0.00  ? 19  TRP A N    3  
ATOM   7751  C  CA   . TRP A 1 19  ? -8.208  70.286 0.745   1.00 0.00  ? 19  TRP A CA   3  
ATOM   7752  C  C    . TRP A 1 19  ? -7.594  69.519 1.925   1.00 0.00  ? 19  TRP A C    3  
ATOM   7753  O  O    . TRP A 1 19  ? -8.170  68.571 2.421   1.00 0.00  ? 19  TRP A O    3  
ATOM   7754  C  CB   . TRP A 1 19  ? -7.838  69.587 -0.572  1.00 0.00  ? 19  TRP A CB   3  
ATOM   7755  C  CG   . TRP A 1 19  ? -6.357  69.437 -0.665  1.00 0.00  ? 19  TRP A CG   3  
ATOM   7756  C  CD1  . TRP A 1 19  ? -5.550  70.249 -1.375  1.00 0.00  ? 19  TRP A CD1  3  
ATOM   7757  C  CD2  . TRP A 1 19  ? -5.492  68.435 -0.048  1.00 0.00  ? 19  TRP A CD2  3  
ATOM   7758  N  NE1  . TRP A 1 19  ? -4.243  69.828 -1.222  1.00 0.00  ? 19  TRP A NE1  3  
ATOM   7759  C  CE2  . TRP A 1 19  ? -4.154  68.717 -0.413  1.00 0.00  ? 19  TRP A CE2  3  
ATOM   7760  C  CE3  . TRP A 1 19  ? -5.727  67.328 0.790   1.00 0.00  ? 19  TRP A CE3  3  
ATOM   7761  C  CZ2  . TRP A 1 19  ? -3.091  67.937 0.035   1.00 0.00  ? 19  TRP A CZ2  3  
ATOM   7762  C  CZ3  . TRP A 1 19  ? -4.656  66.541 1.241   1.00 0.00  ? 19  TRP A CZ3  3  
ATOM   7763  C  CH2  . TRP A 1 19  ? -3.342  66.847 0.867   1.00 0.00  ? 19  TRP A CH2  3  
ATOM   7764  H  H    . TRP A 1 19  ? -7.083  72.030 0.060   1.00 0.00  ? 19  TRP A H    3  
ATOM   7765  H  HA   . TRP A 1 19  ? -9.283  70.284 0.853   1.00 0.00  ? 19  TRP A HA   3  
ATOM   7766  H  HB2  . TRP A 1 19  ? -8.300  68.611 -0.603  1.00 0.00  ? 19  TRP A HB2  3  
ATOM   7767  H  HB3  . TRP A 1 19  ? -8.193  70.178 -1.404  1.00 0.00  ? 19  TRP A HB3  3  
ATOM   7768  H  HD1  . TRP A 1 19  ? -5.872  71.097 -1.961  1.00 0.00  ? 19  TRP A HD1  3  
ATOM   7769  H  HE1  . TRP A 1 19  ? -3.461  70.255 -1.629  1.00 0.00  ? 19  TRP A HE1  3  
ATOM   7770  H  HE3  . TRP A 1 19  ? -6.737  67.071 1.078   1.00 0.00  ? 19  TRP A HE3  3  
ATOM   7771  H  HZ2  . TRP A 1 19  ? -2.080  68.178 -0.255  1.00 0.00  ? 19  TRP A HZ2  3  
ATOM   7772  H  HZ3  . TRP A 1 19  ? -4.845  65.700 1.887   1.00 0.00  ? 19  TRP A HZ3  3  
ATOM   7773  H  HH2  . TRP A 1 19  ? -2.526  66.238 1.221   1.00 0.00  ? 19  TRP A HH2  3  
ATOM   7774  N  N    . LEU A 1 20  ? -6.433  69.910 2.374   1.00 0.00  ? 20  LEU A N    3  
ATOM   7775  C  CA   . LEU A 1 20  ? -5.794  69.189 3.517   1.00 0.00  ? 20  LEU A CA   3  
ATOM   7776  C  C    . LEU A 1 20  ? -6.682  69.312 4.765   1.00 0.00  ? 20  LEU A C    3  
ATOM   7777  O  O    . LEU A 1 20  ? -6.869  68.363 5.501   1.00 0.00  ? 20  LEU A O    3  
ATOM   7778  C  CB   . LEU A 1 20  ? -4.403  69.803 3.787   1.00 0.00  ? 20  LEU A CB   3  
ATOM   7779  C  CG   . LEU A 1 20  ? -3.421  68.733 4.285   1.00 0.00  ? 20  LEU A CG   3  
ATOM   7780  C  CD1  . LEU A 1 20  ? -2.027  69.350 4.421   1.00 0.00  ? 20  LEU A CD1  3  
ATOM   7781  C  CD2  . LEU A 1 20  ? -3.878  68.201 5.647   1.00 0.00  ? 20  LEU A CD2  3  
ATOM   7782  H  H    . LEU A 1 20  ? -5.977  70.671 1.957   1.00 0.00  ? 20  LEU A H    3  
ATOM   7783  H  HA   . LEU A 1 20  ? -5.689  68.145 3.259   1.00 0.00  ? 20  LEU A HA   3  
ATOM   7784  H  HB2  . LEU A 1 20  ? -4.022  70.227 2.872   1.00 0.00  ? 20  LEU A HB2  3  
ATOM   7785  H  HB3  . LEU A 1 20  ? -4.483  70.585 4.530   1.00 0.00  ? 20  LEU A HB3  3  
ATOM   7786  H  HG   . LEU A 1 20  ? -3.383  67.920 3.572   1.00 0.00  ? 20  LEU A HG   3  
ATOM   7787  H  HD11 . LEU A 1 20  ? -2.062  70.166 5.128   1.00 0.00  ? 20  LEU A HD11 3  
ATOM   7788  H  HD12 . LEU A 1 20  ? -1.701  69.720 3.460   1.00 0.00  ? 20  LEU A HD12 3  
ATOM   7789  H  HD13 . LEU A 1 20  ? -1.334  68.600 4.772   1.00 0.00  ? 20  LEU A HD13 3  
ATOM   7790  H  HD21 . LEU A 1 20  ? -4.689  67.503 5.506   1.00 0.00  ? 20  LEU A HD21 3  
ATOM   7791  H  HD22 . LEU A 1 20  ? -4.212  69.023 6.263   1.00 0.00  ? 20  LEU A HD22 3  
ATOM   7792  H  HD23 . LEU A 1 20  ? -3.054  67.698 6.134   1.00 0.00  ? 20  LEU A HD23 3  
ATOM   7793  N  N    . ASP A 1 21  ? -7.224  70.473 5.012   1.00 0.00  ? 21  ASP A N    3  
ATOM   7794  C  CA   . ASP A 1 21  ? -8.087  70.654 6.217   1.00 0.00  ? 21  ASP A CA   3  
ATOM   7795  C  C    . ASP A 1 21  ? -9.349  69.794 6.097   1.00 0.00  ? 21  ASP A C    3  
ATOM   7796  O  O    . ASP A 1 21  ? -10.198 69.802 6.966   1.00 0.00  ? 21  ASP A O    3  
ATOM   7797  C  CB   . ASP A 1 21  ? -8.487  72.126 6.338   1.00 0.00  ? 21  ASP A CB   3  
ATOM   7798  C  CG   . ASP A 1 21  ? -9.162  72.361 7.690   1.00 0.00  ? 21  ASP A CG   3  
ATOM   7799  O  OD1  . ASP A 1 21  ? -8.553  72.042 8.698   1.00 0.00  ? 21  ASP A OD1  3  
ATOM   7800  O  OD2  . ASP A 1 21  ? -10.277 72.856 7.696   1.00 0.00  ? 21  ASP A OD2  3  
ATOM   7801  H  H    . ASP A 1 21  ? -7.058  71.229 4.411   1.00 0.00  ? 21  ASP A H    3  
ATOM   7802  H  HA   . ASP A 1 21  ? -7.537  70.361 7.098   1.00 0.00  ? 21  ASP A HA   3  
ATOM   7803  H  HB2  . ASP A 1 21  ? -7.606  72.746 6.261   1.00 0.00  ? 21  ASP A HB2  3  
ATOM   7804  H  HB3  . ASP A 1 21  ? -9.176  72.379 5.546   1.00 0.00  ? 21  ASP A HB3  3  
ATOM   7805  N  N    . ASN A 1 22  ? -9.485  69.059 5.026   1.00 0.00  ? 22  ASN A N    3  
ATOM   7806  C  CA   . ASN A 1 22  ? -10.691 68.205 4.841   1.00 0.00  ? 22  ASN A CA   3  
ATOM   7807  C  C    . ASN A 1 22  ? -11.024 67.467 6.136   1.00 0.00  ? 22  ASN A C    3  
ATOM   7808  O  O    . ASN A 1 22  ? -10.212 66.748 6.682   1.00 0.00  ? 22  ASN A O    3  
ATOM   7809  C  CB   . ASN A 1 22  ? -10.415 67.181 3.742   1.00 0.00  ? 22  ASN A CB   3  
ATOM   7810  C  CG   . ASN A 1 22  ? -9.112  66.445 4.050   1.00 0.00  ? 22  ASN A CG   3  
ATOM   7811  O  OD1  . ASN A 1 22  ? -8.488  66.687 5.063   1.00 0.00  ? 22  ASN A OD1  3  
ATOM   7812  N  ND2  . ASN A 1 22  ? -8.670  65.552 3.210   1.00 0.00  ? 22  ASN A ND2  3  
ATOM   7813  H  H    . ASN A 1 22  ? -8.800  69.071 4.333   1.00 0.00  ? 22  ASN A H    3  
ATOM   7814  H  HA   . ASN A 1 22  ? -11.529 68.821 4.552   1.00 0.00  ? 22  ASN A HA   3  
ATOM   7815  H  HB2  . ASN A 1 22  ? -11.229 66.472 3.696   1.00 0.00  ? 22  ASN A HB2  3  
ATOM   7816  H  HB3  . ASN A 1 22  ? -10.323 67.686 2.796   1.00 0.00  ? 22  ASN A HB3  3  
ATOM   7817  H  HD21 . ASN A 1 22  ? -9.171  65.358 2.391   1.00 0.00  ? 22  ASN A HD21 3  
ATOM   7818  H  HD22 . ASN A 1 22  ? -7.838  65.072 3.401   1.00 0.00  ? 22  ASN A HD22 3  
ATOM   7819  N  N    . THR A 1 23  ? -12.220 67.629 6.622   1.00 0.00  ? 23  THR A N    3  
ATOM   7820  C  CA   . THR A 1 23  ? -12.618 66.927 7.872   1.00 0.00  ? 23  THR A CA   3  
ATOM   7821  C  C    . THR A 1 23  ? -13.027 65.495 7.521   1.00 0.00  ? 23  THR A C    3  
ATOM   7822  O  O    . THR A 1 23  ? -13.539 64.766 8.347   1.00 0.00  ? 23  THR A O    3  
ATOM   7823  C  CB   . THR A 1 23  ? -13.802 67.655 8.518   1.00 0.00  ? 23  THR A CB   3  
ATOM   7824  O  OG1  . THR A 1 23  ? -14.533 66.742 9.325   1.00 0.00  ? 23  THR A OG1  3  
ATOM   7825  C  CG2  . THR A 1 23  ? -14.718 68.221 7.430   1.00 0.00  ? 23  THR A CG2  3  
ATOM   7826  H  H    . THR A 1 23  ? -12.860 68.206 6.158   1.00 0.00  ? 23  THR A H    3  
ATOM   7827  H  HA   . THR A 1 23  ? -11.785 66.907 8.560   1.00 0.00  ? 23  THR A HA   3  
ATOM   7828  H  HB   . THR A 1 23  ? -13.437 68.465 9.131   1.00 0.00  ? 23  THR A HB   3  
ATOM   7829  H  HG1  . THR A 1 23  ? -15.238 67.228 9.759   1.00 0.00  ? 23  THR A HG1  3  
ATOM   7830  H  HG21 . THR A 1 23  ? -15.680 68.462 7.859   1.00 0.00  ? 23  THR A HG21 3  
ATOM   7831  H  HG22 . THR A 1 23  ? -14.847 67.488 6.648   1.00 0.00  ? 23  THR A HG22 3  
ATOM   7832  H  HG23 . THR A 1 23  ? -14.276 69.116 7.016   1.00 0.00  ? 23  THR A HG23 3  
ATOM   7833  N  N    . GLU A 1 24  ? -12.799 65.091 6.293   1.00 0.00  ? 24  GLU A N    3  
ATOM   7834  C  CA   . GLU A 1 24  ? -13.167 63.703 5.859   1.00 0.00  ? 24  GLU A CA   3  
ATOM   7835  C  C    . GLU A 1 24  ? -11.890 62.894 5.621   1.00 0.00  ? 24  GLU A C    3  
ATOM   7836  O  O    . GLU A 1 24  ? -11.847 61.700 5.842   1.00 0.00  ? 24  GLU A O    3  
ATOM   7837  C  CB   . GLU A 1 24  ? -13.969 63.777 4.557   1.00 0.00  ? 24  GLU A CB   3  
ATOM   7838  C  CG   . GLU A 1 24  ? -15.309 64.467 4.822   1.00 0.00  ? 24  GLU A CG   3  
ATOM   7839  C  CD   . GLU A 1 24  ? -16.148 64.464 3.543   1.00 0.00  ? 24  GLU A CD   3  
ATOM   7840  O  OE1  . GLU A 1 24  ? -15.860 65.263 2.668   1.00 0.00  ? 24  GLU A OE1  3  
ATOM   7841  O  OE2  . GLU A 1 24  ? -17.064 63.662 3.461   1.00 0.00  ? 24  GLU A OE2  3  
ATOM   7842  H  H    . GLU A 1 24  ? -12.380 65.706 5.650   1.00 0.00  ? 24  GLU A H    3  
ATOM   7843  H  HA   . GLU A 1 24  ? -13.763 63.217 6.620   1.00 0.00  ? 24  GLU A HA   3  
ATOM   7844  H  HB2  . GLU A 1 24  ? -13.412 64.341 3.823   1.00 0.00  ? 24  GLU A HB2  3  
ATOM   7845  H  HB3  . GLU A 1 24  ? -14.148 62.779 4.186   1.00 0.00  ? 24  GLU A HB3  3  
ATOM   7846  H  HG2  . GLU A 1 24  ? -15.838 63.938 5.602   1.00 0.00  ? 24  GLU A HG2  3  
ATOM   7847  H  HG3  . GLU A 1 24  ? -15.134 65.486 5.133   1.00 0.00  ? 24  GLU A HG3  3  
ATOM   7848  N  N    . ASN A 1 25  ? -10.849 63.543 5.180   1.00 0.00  ? 25  ASN A N    3  
ATOM   7849  C  CA   . ASN A 1 25  ? -9.564  62.830 4.932   1.00 0.00  ? 25  ASN A CA   3  
ATOM   7850  C  C    . ASN A 1 25  ? -9.789  61.624 4.016   1.00 0.00  ? 25  ASN A C    3  
ATOM   7851  O  O    . ASN A 1 25  ? -9.824  60.491 4.453   1.00 0.00  ? 25  ASN A O    3  
ATOM   7852  C  CB   . ASN A 1 25  ? -8.974  62.377 6.267   1.00 0.00  ? 25  ASN A CB   3  
ATOM   7853  C  CG   . ASN A 1 25  ? -8.615  63.616 7.089   1.00 0.00  ? 25  ASN A CG   3  
ATOM   7854  O  OD1  . ASN A 1 25  ? -8.179  63.509 8.218   1.00 0.00  ? 25  ASN A OD1  3  
ATOM   7855  N  ND2  . ASN A 1 25  ? -8.785  64.799 6.559   1.00 0.00  ? 25  ASN A ND2  3  
ATOM   7856  H  H    . ASN A 1 25  ? -10.910 64.507 5.016   1.00 0.00  ? 25  ASN A H    3  
ATOM   7857  H  HA   . ASN A 1 25  ? -8.873  63.508 4.455   1.00 0.00  ? 25  ASN A HA   3  
ATOM   7858  H  HB2  . ASN A 1 25  ? -9.701  61.782 6.802   1.00 0.00  ? 25  ASN A HB2  3  
ATOM   7859  H  HB3  . ASN A 1 25  ? -8.084  61.792 6.091   1.00 0.00  ? 25  ASN A HB3  3  
ATOM   7860  H  HD21 . ASN A 1 25  ? -9.138  64.880 5.648   1.00 0.00  ? 25  ASN A HD21 3  
ATOM   7861  H  HD22 . ASN A 1 25  ? -8.563  65.605 7.070   1.00 0.00  ? 25  ASN A HD22 3  
ATOM   7862  N  N    . ASP A 1 26  ? -9.924  61.870 2.742   1.00 0.00  ? 26  ASP A N    3  
ATOM   7863  C  CA   . ASP A 1 26  ? -10.127 60.760 1.768   1.00 0.00  ? 26  ASP A CA   3  
ATOM   7864  C  C    . ASP A 1 26  ? -9.808  61.281 0.383   1.00 0.00  ? 26  ASP A C    3  
ATOM   7865  O  O    . ASP A 1 26  ? -9.153  60.634 -0.407  1.00 0.00  ? 26  ASP A O    3  
ATOM   7866  C  CB   . ASP A 1 26  ? -11.566 60.277 1.824   1.00 0.00  ? 26  ASP A CB   3  
ATOM   7867  C  CG   . ASP A 1 26  ? -11.840 59.304 0.673   1.00 0.00  ? 26  ASP A CG   3  
ATOM   7868  O  OD1  . ASP A 1 26  ? -11.029 58.417 0.468   1.00 0.00  ? 26  ASP A OD1  3  
ATOM   7869  O  OD2  . ASP A 1 26  ? -12.856 59.466 0.017   1.00 0.00  ? 26  ASP A OD2  3  
ATOM   7870  H  H    . ASP A 1 26  ? -9.879  62.795 2.421   1.00 0.00  ? 26  ASP A H    3  
ATOM   7871  H  HA   . ASP A 1 26  ? -9.462  59.953 2.003   1.00 0.00  ? 26  ASP A HA   3  
ATOM   7872  H  HB2  . ASP A 1 26  ? -11.715 59.776 2.758   1.00 0.00  ? 26  ASP A HB2  3  
ATOM   7873  H  HB3  . ASP A 1 26  ? -12.235 61.120 1.752   1.00 0.00  ? 26  ASP A HB3  3  
ATOM   7874  N  N    . LEU A 1 27  ? -10.211 62.478 0.115   1.00 0.00  ? 27  LEU A N    3  
ATOM   7875  C  CA   . LEU A 1 27  ? -9.872  63.089 -1.187  1.00 0.00  ? 27  LEU A CA   3  
ATOM   7876  C  C    . LEU A 1 27  ? -8.395  63.437 -1.076  1.00 0.00  ? 27  LEU A C    3  
ATOM   7877  O  O    . LEU A 1 27  ? -7.712  63.721 -2.039  1.00 0.00  ? 27  LEU A O    3  
ATOM   7878  C  CB   . LEU A 1 27  ? -10.699 64.364 -1.401  1.00 0.00  ? 27  LEU A CB   3  
ATOM   7879  C  CG   . LEU A 1 27  ? -12.159 64.101 -1.026  1.00 0.00  ? 27  LEU A CG   3  
ATOM   7880  C  CD1  . LEU A 1 27  ? -12.975 65.381 -1.226  1.00 0.00  ? 27  LEU A CD1  3  
ATOM   7881  C  CD2  . LEU A 1 27  ? -12.724 62.992 -1.916  1.00 0.00  ? 27  LEU A CD2  3  
ATOM   7882  H  H    . LEU A 1 27  ? -10.679 62.996 0.798   1.00 0.00  ? 27  LEU A H    3  
ATOM   7883  H  HA   . LEU A 1 27  ? -10.041 62.387 -1.989  1.00 0.00  ? 27  LEU A HA   3  
ATOM   7884  H  HB2  . LEU A 1 27  ? -10.307 65.159 -0.781  1.00 0.00  ? 27  LEU A HB2  3  
ATOM   7885  H  HB3  . LEU A 1 27  ? -10.644 64.657 -2.439  1.00 0.00  ? 27  LEU A HB3  3  
ATOM   7886  H  HG   . LEU A 1 27  ? -12.216 63.799 0.010   1.00 0.00  ? 27  LEU A HG   3  
ATOM   7887  H  HD11 . LEU A 1 27  ? -14.020 65.173 -1.049  1.00 0.00  ? 27  LEU A HD11 3  
ATOM   7888  H  HD12 . LEU A 1 27  ? -12.844 65.737 -2.237  1.00 0.00  ? 27  LEU A HD12 3  
ATOM   7889  H  HD13 . LEU A 1 27  ? -12.636 66.136 -0.532  1.00 0.00  ? 27  LEU A HD13 3  
ATOM   7890  H  HD21 . LEU A 1 27  ? -12.329 62.039 -1.597  1.00 0.00  ? 27  LEU A HD21 3  
ATOM   7891  H  HD22 . LEU A 1 27  ? -12.439 63.175 -2.943  1.00 0.00  ? 27  LEU A HD22 3  
ATOM   7892  H  HD23 . LEU A 1 27  ? -13.801 62.981 -1.838  1.00 0.00  ? 27  LEU A HD23 3  
ATOM   7893  N  N    . ASN A 1 28  ? -7.932  63.437 0.146   1.00 77.83 ? 28  ASN A N    3  
ATOM   7894  C  CA   . ASN A 1 28  ? -6.529  63.786 0.440   1.00 78.20 ? 28  ASN A CA   3  
ATOM   7895  C  C    . ASN A 1 28  ? -5.579  63.037 -0.500  1.00 78.50 ? 28  ASN A C    3  
ATOM   7896  O  O    . ASN A 1 28  ? -4.515  63.535 -0.809  1.00 79.07 ? 28  ASN A O    3  
ATOM   7897  C  CB   . ASN A 1 28  ? -6.254  63.412 1.911   1.00 79.28 ? 28  ASN A CB   3  
ATOM   7898  C  CG   . ASN A 1 28  ? -4.779  63.066 2.135   1.00 83.99 ? 28  ASN A CG   3  
ATOM   7899  O  OD1  . ASN A 1 28  ? -3.907  63.598 1.478   1.00 87.93 ? 28  ASN A OD1  3  
ATOM   7900  N  ND2  . ASN A 1 28  ? -4.467  62.183 3.038   1.00 85.70 ? 28  ASN A ND2  3  
ATOM   7901  H  H    . ASN A 1 28  ? -8.551  63.238 0.881   1.00 0.00  ? 28  ASN A H    3  
ATOM   7902  H  HA   . ASN A 1 28  ? -6.392  64.848 0.310   1.00 0.00  ? 28  ASN A HA   3  
ATOM   7903  H  HB2  . ASN A 1 28  ? -6.524  64.240 2.548   1.00 0.00  ? 28  ASN A HB2  3  
ATOM   7904  H  HB3  . ASN A 1 28  ? -6.860  62.557 2.174   1.00 0.00  ? 28  ASN A HB3  3  
ATOM   7905  H  HD21 . ASN A 1 28  ? -5.169  61.749 3.566   1.00 0.00  ? 28  ASN A HD21 3  
ATOM   7906  H  HD22 . ASN A 1 28  ? -3.535  61.948 3.183   1.00 0.00  ? 28  ASN A HD22 3  
ATOM   7907  N  N    . GLN A 1 29  ? -5.899  61.845 -0.940  1.00 0.00  ? 29  GLN A N    3  
ATOM   7908  C  CA   . GLN A 1 29  ? -4.931  61.120 -1.828  1.00 0.00  ? 29  GLN A CA   3  
ATOM   7909  C  C    . GLN A 1 29  ? -4.550  61.977 -3.040  1.00 0.00  ? 29  GLN A C    3  
ATOM   7910  O  O    . GLN A 1 29  ? -4.847  63.154 -3.103  1.00 0.00  ? 29  GLN A O    3  
ATOM   7911  C  CB   . GLN A 1 29  ? -5.541  59.771 -2.276  1.00 0.00  ? 29  GLN A CB   3  
ATOM   7912  C  CG   . GLN A 1 29  ? -6.430  59.933 -3.523  1.00 0.00  ? 29  GLN A CG   3  
ATOM   7913  C  CD   . GLN A 1 29  ? -7.336  61.150 -3.363  1.00 0.00  ? 29  GLN A CD   3  
ATOM   7914  O  OE1  . GLN A 1 29  ? -8.094  61.227 -2.424  1.00 0.00  ? 29  GLN A OE1  3  
ATOM   7915  N  NE2  . GLN A 1 29  ? -7.289  62.108 -4.247  1.00 0.00  ? 29  GLN A NE2  3  
ATOM   7916  H  H    . GLN A 1 29  ? -6.724  61.367 -0.673  1.00 0.00  ? 29  GLN A H    3  
ATOM   7917  H  HA   . GLN A 1 29  ? -4.033  60.920 -1.261  1.00 0.00  ? 29  GLN A HA   3  
ATOM   7918  H  HB2  . GLN A 1 29  ? -4.743  59.079 -2.503  1.00 0.00  ? 29  GLN A HB2  3  
ATOM   7919  H  HB3  . GLN A 1 29  ? -6.137  59.369 -1.469  1.00 0.00  ? 29  GLN A HB3  3  
ATOM   7920  H  HG2  . GLN A 1 29  ? -5.811  60.055 -4.398  1.00 0.00  ? 29  GLN A HG2  3  
ATOM   7921  H  HG3  . GLN A 1 29  ? -7.041  59.050 -3.640  1.00 0.00  ? 29  GLN A HG3  3  
ATOM   7922  H  HE21 . GLN A 1 29  ? -6.674  62.043 -5.008  1.00 0.00  ? 29  GLN A HE21 3  
ATOM   7923  H  HE22 . GLN A 1 29  ? -7.868  62.893 -4.151  1.00 0.00  ? 29  GLN A HE22 3  
ATOM   7924  N  N    . GLY A 1 30  ? -3.884  61.384 -4.005  1.00 0.00  ? 30  GLY A N    3  
ATOM   7925  C  CA   . GLY A 1 30  ? -3.463  62.144 -5.222  1.00 0.00  ? 30  GLY A CA   3  
ATOM   7926  C  C    . GLY A 1 30  ? -3.735  61.317 -6.483  1.00 0.00  ? 30  GLY A C    3  
ATOM   7927  O  O    . GLY A 1 30  ? -4.869  61.085 -6.853  1.00 0.00  ? 30  GLY A O    3  
ATOM   7928  H  H    . GLY A 1 30  ? -3.666  60.432 -3.928  1.00 0.00  ? 30  GLY A H    3  
ATOM   7929  H  HA2  . GLY A 1 30  ? -4.010  63.076 -5.285  1.00 0.00  ? 30  GLY A HA2  3  
ATOM   7930  H  HA3  . GLY A 1 30  ? -2.406  62.355 -5.161  1.00 0.00  ? 30  GLY A HA3  3  
ATOM   7931  N  N    . ASP A 1 31  ? -2.700  60.905 -7.166  1.00 0.00  ? 31  ASP A N    3  
ATOM   7932  C  CA   . ASP A 1 31  ? -2.901  60.135 -8.428  1.00 0.00  ? 31  ASP A CA   3  
ATOM   7933  C  C    . ASP A 1 31  ? -3.217  58.672 -8.133  1.00 0.00  ? 31  ASP A C    3  
ATOM   7934  O  O    . ASP A 1 31  ? -2.962  58.161 -7.060  1.00 0.00  ? 31  ASP A O    3  
ATOM   7935  C  CB   . ASP A 1 31  ? -1.639  60.210 -9.289  1.00 0.00  ? 31  ASP A CB   3  
ATOM   7936  C  CG   . ASP A 1 31  ? -1.964  59.752 -10.713 1.00 0.00  ? 31  ASP A CG   3  
ATOM   7937  O  OD1  . ASP A 1 31  ? -2.492  60.553 -11.466 1.00 0.00  ? 31  ASP A OD1  3  
ATOM   7938  O  OD2  . ASP A 1 31  ? -1.680  58.607 -11.024 1.00 0.00  ? 31  ASP A OD2  3  
ATOM   7939  H  H    . ASP A 1 31  ? -1.797  61.140 -6.861  1.00 0.00  ? 31  ASP A H    3  
ATOM   7940  H  HA   . ASP A 1 31  ? -3.725  60.568 -8.976  1.00 0.00  ? 31  ASP A HA   3  
ATOM   7941  H  HB2  . ASP A 1 31  ? -1.280  61.229 -9.313  1.00 0.00  ? 31  ASP A HB2  3  
ATOM   7942  H  HB3  . ASP A 1 31  ? -0.880  59.566 -8.873  1.00 0.00  ? 31  ASP A HB3  3  
ATOM   7943  N  N    . ASP A 1 32  ? -3.758  57.999 -9.107  1.00 0.00  ? 32  ASP A N    3  
ATOM   7944  C  CA   . ASP A 1 32  ? -4.096  56.562 -8.954  1.00 0.00  ? 32  ASP A CA   3  
ATOM   7945  C  C    . ASP A 1 32  ? -2.815  55.747 -9.085  1.00 0.00  ? 32  ASP A C    3  
ATOM   7946  O  O    . ASP A 1 32  ? -2.801  54.550 -8.877  1.00 0.00  ? 32  ASP A O    3  
ATOM   7947  C  CB   . ASP A 1 32  ? -5.081  56.147 -10.049 1.00 0.00  ? 32  ASP A CB   3  
ATOM   7948  C  CG   . ASP A 1 32  ? -4.444  56.380 -11.421 1.00 0.00  ? 32  ASP A CG   3  
ATOM   7949  O  OD1  . ASP A 1 32  ? -3.775  55.480 -11.902 1.00 0.00  ? 32  ASP A OD1  3  
ATOM   7950  O  OD2  . ASP A 1 32  ? -4.636  57.454 -11.967 1.00 0.00  ? 32  ASP A OD2  3  
ATOM   7951  H  H    . ASP A 1 32  ? -3.931  58.445 -9.959  1.00 0.00  ? 32  ASP A H    3  
ATOM   7952  H  HA   . ASP A 1 32  ? -4.538  56.393 -7.983  1.00 0.00  ? 32  ASP A HA   3  
ATOM   7953  H  HB2  . ASP A 1 32  ? -5.324  55.100 -9.937  1.00 0.00  ? 32  ASP A HB2  3  
ATOM   7954  H  HB3  . ASP A 1 32  ? -5.981  56.737 -9.968  1.00 0.00  ? 32  ASP A HB3  3  
ATOM   7955  N  N    . HIS A 1 33  ? -1.726  56.395 -9.413  1.00 0.00  ? 33  HIS A N    3  
ATOM   7956  C  CA   . HIS A 1 33  ? -0.431  55.672 -9.540  1.00 0.00  ? 33  HIS A CA   3  
ATOM   7957  C  C    . HIS A 1 33  ? 0.271   55.697 -8.187  1.00 0.00  ? 33  HIS A C    3  
ATOM   7958  O  O    . HIS A 1 33  ? 1.191   54.942 -7.941  1.00 0.00  ? 33  HIS A O    3  
ATOM   7959  C  CB   . HIS A 1 33  ? 0.442   56.358 -10.592 1.00 0.00  ? 33  HIS A CB   3  
ATOM   7960  C  CG   . HIS A 1 33  ? -0.064  56.020 -11.968 1.00 0.00  ? 33  HIS A CG   3  
ATOM   7961  N  ND1  . HIS A 1 33  ? -0.773  54.857 -12.230 1.00 0.00  ? 33  HIS A ND1  3  
ATOM   7962  C  CD2  . HIS A 1 33  ? 0.030   56.680 -13.169 1.00 0.00  ? 33  HIS A CD2  3  
ATOM   7963  C  CE1  . HIS A 1 33  ? -1.076  54.852 -13.541 1.00 0.00  ? 33  HIS A CE1  3  
ATOM   7964  N  NE2  . HIS A 1 33  ? -0.610  55.940 -14.158 1.00 0.00  ? 33  HIS A NE2  3  
ATOM   7965  H  H    . HIS A 1 33  ? -1.745  57.366 -9.539  1.00 0.00  ? 33  HIS A H    3  
ATOM   7966  H  HA   . HIS A 1 33  ? -0.608  54.648 -9.828  1.00 0.00  ? 33  HIS A HA   3  
ATOM   7967  H  HB2  . HIS A 1 33  ? 0.404   57.428 -10.449 1.00 0.00  ? 33  HIS A HB2  3  
ATOM   7968  H  HB3  . HIS A 1 33  ? 1.459   56.016 -10.489 1.00 0.00  ? 33  HIS A HB3  3  
ATOM   7969  H  HD2  . HIS A 1 33  ? 0.525   57.627 -13.322 1.00 0.00  ? 33  HIS A HD2  3  
ATOM   7970  H  HE1  . HIS A 1 33  ? -1.627  54.065 -14.034 1.00 0.00  ? 33  HIS A HE1  3  
ATOM   7971  H  HE2  . HIS A 1 33  ? -0.704  56.162 -15.108 1.00 0.00  ? 33  HIS A HE2  3  
ATOM   7972  N  N    . GLY A 1 34  ? -0.183  56.545 -7.294  1.00 0.00  ? 34  GLY A N    3  
ATOM   7973  C  CA   . GLY A 1 34  ? 0.428   56.609 -5.926  1.00 0.00  ? 34  GLY A CA   3  
ATOM   7974  C  C    . GLY A 1 34  ? 1.201   57.915 -5.724  1.00 0.00  ? 34  GLY A C    3  
ATOM   7975  O  O    . GLY A 1 34  ? 2.068   57.996 -4.877  1.00 0.00  ? 34  GLY A O    3  
ATOM   7976  H  H    . GLY A 1 34  ? -0.949  57.124 -7.520  1.00 0.00  ? 34  GLY A H    3  
ATOM   7977  H  HA2  . GLY A 1 34  ? -0.361  56.553 -5.190  1.00 0.00  ? 34  GLY A HA2  3  
ATOM   7978  H  HA3  . GLY A 1 34  ? 1.102   55.776 -5.779  1.00 0.00  ? 34  GLY A HA3  3  
ATOM   7979  N  N    . PHE A 1 35  ? 0.890   58.950 -6.459  1.00 0.00  ? 35  PHE A N    3  
ATOM   7980  C  CA   . PHE A 1 35  ? 1.614   60.239 -6.246  1.00 0.00  ? 35  PHE A CA   3  
ATOM   7981  C  C    . PHE A 1 35  ? 0.928   60.972 -5.096  1.00 0.00  ? 35  PHE A C    3  
ATOM   7982  O  O    . PHE A 1 35  ? -0.134  61.544 -5.253  1.00 0.00  ? 35  PHE A O    3  
ATOM   7983  C  CB   . PHE A 1 35  ? 1.565   61.098 -7.512  1.00 0.00  ? 35  PHE A CB   3  
ATOM   7984  C  CG   . PHE A 1 35  ? 2.522   60.535 -8.542  1.00 0.00  ? 35  PHE A CG   3  
ATOM   7985  C  CD1  . PHE A 1 35  ? 2.291   59.268 -9.090  1.00 0.00  ? 35  PHE A CD1  3  
ATOM   7986  C  CD2  . PHE A 1 35  ? 3.640   61.278 -8.948  1.00 0.00  ? 35  PHE A CD2  3  
ATOM   7987  C  CE1  . PHE A 1 35  ? 3.175   58.745 -10.042 1.00 0.00  ? 35  PHE A CE1  3  
ATOM   7988  C  CE2  . PHE A 1 35  ? 4.522   60.753 -9.900  1.00 0.00  ? 35  PHE A CE2  3  
ATOM   7989  C  CZ   . PHE A 1 35  ? 4.289   59.486 -10.446 1.00 0.00  ? 35  PHE A CZ   3  
ATOM   7990  H  H    . PHE A 1 35  ? 0.171   58.891 -7.123  1.00 0.00  ? 35  PHE A H    3  
ATOM   7991  H  HA   . PHE A 1 35  ? 2.644   60.040 -5.982  1.00 0.00  ? 35  PHE A HA   3  
ATOM   7992  H  HB2  . PHE A 1 35  ? 0.564   61.096 -7.908  1.00 0.00  ? 35  PHE A HB2  3  
ATOM   7993  H  HB3  . PHE A 1 35  ? 1.851   62.110 -7.268  1.00 0.00  ? 35  PHE A HB3  3  
ATOM   7994  H  HD1  . PHE A 1 35  ? 1.432   58.695 -8.780  1.00 0.00  ? 35  PHE A HD1  3  
ATOM   7995  H  HD2  . PHE A 1 35  ? 3.821   62.256 -8.527  1.00 0.00  ? 35  PHE A HD2  3  
ATOM   7996  H  HE1  . PHE A 1 35  ? 2.997   57.768 -10.464 1.00 0.00  ? 35  PHE A HE1  3  
ATOM   7997  H  HE2  . PHE A 1 35  ? 5.383   61.324 -10.214 1.00 0.00  ? 35  PHE A HE2  3  
ATOM   7998  H  HZ   . PHE A 1 35  ? 4.970   59.081 -11.180 1.00 0.00  ? 35  PHE A HZ   3  
ATOM   7999  N  N    . SER A 1 36  ? 1.516   60.931 -3.934  1.00 0.00  ? 36  SER A N    3  
ATOM   8000  C  CA   . SER A 1 36  ? 0.895   61.594 -2.750  1.00 0.00  ? 36  SER A CA   3  
ATOM   8001  C  C    . SER A 1 36  ? 1.216   63.099 -2.764  1.00 0.00  ? 36  SER A C    3  
ATOM   8002  O  O    . SER A 1 36  ? 2.175   63.510 -3.376  1.00 0.00  ? 36  SER A O    3  
ATOM   8003  C  CB   . SER A 1 36  ? 1.496   60.953 -1.486  1.00 0.00  ? 36  SER A CB   3  
ATOM   8004  O  OG   . SER A 1 36  ? 2.862   60.643 -1.727  1.00 0.00  ? 36  SER A OG   3  
ATOM   8005  H  H    . SER A 1 36  ? 2.366   60.443 -3.832  1.00 0.00  ? 36  SER A H    3  
ATOM   8006  H  HA   . SER A 1 36  ? -0.170  61.436 -2.768  1.00 0.00  ? 36  SER A HA   3  
ATOM   8007  H  HB2  . SER A 1 36  ? 1.440   61.634 -0.655  1.00 0.00  ? 36  SER A HB2  3  
ATOM   8008  H  HB3  . SER A 1 36  ? 0.950   60.051 -1.247  1.00 0.00  ? 36  SER A HB3  3  
ATOM   8009  H  HG   . SER A 1 36  ? 2.897   59.838 -2.245  1.00 0.00  ? 36  SER A HG   3  
ATOM   8010  N  N    . PRO A 1 37  ? 0.443   63.894 -2.063  1.00 63.85 ? 37  PRO A N    3  
ATOM   8011  C  CA   . PRO A 1 37  ? 0.745   65.327 -1.989  1.00 61.79 ? 37  PRO A CA   3  
ATOM   8012  C  C    . PRO A 1 37  ? 2.162   65.455 -1.414  1.00 59.66 ? 37  PRO A C    3  
ATOM   8013  O  O    . PRO A 1 37  ? 2.978   66.224 -1.882  1.00 58.96 ? 37  PRO A O    3  
ATOM   8014  C  CB   . PRO A 1 37  ? -0.325  65.912 -1.039  1.00 62.05 ? 37  PRO A CB   3  
ATOM   8015  C  CG   . PRO A 1 37  ? -1.210  64.726 -0.551  1.00 61.89 ? 37  PRO A CG   3  
ATOM   8016  C  CD   . PRO A 1 37  ? -0.764  63.465 -1.323  1.00 64.50 ? 37  PRO A CD   3  
ATOM   8017  H  HA   . PRO A 1 37  ? 0.684   65.782 -2.967  1.00 0.00  ? 37  PRO A HA   3  
ATOM   8018  H  HB2  . PRO A 1 37  ? 0.148   66.399 -0.193  1.00 0.00  ? 37  PRO A HB2  3  
ATOM   8019  H  HB3  . PRO A 1 37  ? -0.938  66.626 -1.572  1.00 0.00  ? 37  PRO A HB3  3  
ATOM   8020  H  HG2  . PRO A 1 37  ? -1.068  64.576 0.513   1.00 0.00  ? 37  PRO A HG2  3  
ATOM   8021  H  HG3  . PRO A 1 37  ? -2.253  64.931 -0.754  1.00 0.00  ? 37  PRO A HG3  3  
ATOM   8022  H  HD2  . PRO A 1 37  ? -0.538  62.665 -0.638  1.00 0.00  ? 37  PRO A HD2  3  
ATOM   8023  H  HD3  . PRO A 1 37  ? -1.532  63.158 -2.018  1.00 0.00  ? 37  PRO A HD3  3  
ATOM   8024  N  N    . LEU A 1 38  ? 2.446   64.681 -0.398  1.00 58.19 ? 38  LEU A N    3  
ATOM   8025  C  CA   . LEU A 1 38  ? 3.795   64.712 0.234   1.00 52.32 ? 38  LEU A CA   3  
ATOM   8026  C  C    . LEU A 1 38  ? 4.856   64.410 -0.825  1.00 48.07 ? 38  LEU A C    3  
ATOM   8027  O  O    . LEU A 1 38  ? 5.894   65.032 -0.877  1.00 45.49 ? 38  LEU A O    3  
ATOM   8028  C  CB   . LEU A 1 38  ? 3.843   63.648 1.348   1.00 49.74 ? 38  LEU A CB   3  
ATOM   8029  C  CG   . LEU A 1 38  ? 4.992   63.905 2.351   1.00 48.31 ? 38  LEU A CG   3  
ATOM   8030  C  CD1  . LEU A 1 38  ? 6.362   63.760 1.661   1.00 46.15 ? 38  LEU A CD1  3  
ATOM   8031  C  CD2  . LEU A 1 38  ? 4.861   65.308 2.985   1.00 46.72 ? 38  LEU A CD2  3  
ATOM   8032  H  H    . LEU A 1 38  ? 1.759   64.078 -0.046  1.00 0.00  ? 38  LEU A H    3  
ATOM   8033  H  HA   . LEU A 1 38  ? 3.966   65.681 0.640   1.00 0.00  ? 38  LEU A HA   3  
ATOM   8034  H  HB2  . LEU A 1 38  ? 2.905   63.658 1.881   1.00 0.00  ? 38  LEU A HB2  3  
ATOM   8035  H  HB3  . LEU A 1 38  ? 3.979   62.673 0.900   1.00 0.00  ? 38  LEU A HB3  3  
ATOM   8036  H  HG   . LEU A 1 38  ? 4.928   63.164 3.135   1.00 0.00  ? 38  LEU A HG   3  
ATOM   8037  H  HD11 . LEU A 1 38  ? 6.294   63.042 0.855   1.00 0.00  ? 38  LEU A HD11 3  
ATOM   8038  H  HD12 . LEU A 1 38  ? 7.087   63.414 2.382   1.00 0.00  ? 38  LEU A HD12 3  
ATOM   8039  H  HD13 . LEU A 1 38  ? 6.679   64.714 1.269   1.00 0.00  ? 38  LEU A HD13 3  
ATOM   8040  H  HD21 . LEU A 1 38  ? 3.823   65.607 3.003   1.00 0.00  ? 38  LEU A HD21 3  
ATOM   8041  H  HD22 . LEU A 1 38  ? 5.430   66.025 2.410   1.00 0.00  ? 38  LEU A HD22 3  
ATOM   8042  H  HD23 . LEU A 1 38  ? 5.242   65.279 3.995   1.00 0.00  ? 38  LEU A HD23 3  
ATOM   8043  N  N    . HIS A 1 39  ? 4.579   63.480 -1.686  1.00 45.97 ? 39  HIS A N    3  
ATOM   8044  C  CA   . HIS A 1 39  ? 5.559   63.150 -2.763  1.00 46.91 ? 39  HIS A CA   3  
ATOM   8045  C  C    . HIS A 1 39  ? 5.915   64.443 -3.495  1.00 48.94 ? 39  HIS A C    3  
ATOM   8046  O  O    . HIS A 1 39  ? 7.041   64.896 -3.485  1.00 49.68 ? 39  HIS A O    3  
ATOM   8047  C  CB   . HIS A 1 39  ? 4.941   62.127 -3.749  1.00 45.05 ? 39  HIS A CB   3  
ATOM   8048  C  CG   . HIS A 1 39  ? 5.461   60.739 -3.486  1.00 47.92 ? 39  HIS A CG   3  
ATOM   8049  N  ND1  . HIS A 1 39  ? 4.632   59.627 -3.514  1.00 46.54 ? 39  HIS A ND1  3  
ATOM   8050  C  CD2  . HIS A 1 39  ? 6.718   60.266 -3.203  1.00 52.78 ? 39  HIS A CD2  3  
ATOM   8051  C  CE1  . HIS A 1 39  ? 5.397   58.549 -3.255  1.00 52.72 ? 39  HIS A CE1  3  
ATOM   8052  N  NE2  . HIS A 1 39  ? 6.674   58.884 -3.059  1.00 47.81 ? 39  HIS A NE2  3  
ATOM   8053  H  H    . HIS A 1 39  ? 3.712   63.031 -1.633  1.00 0.00  ? 39  HIS A H    3  
ATOM   8054  H  HA   . HIS A 1 39  ? 6.448   62.750 -2.321  1.00 0.00  ? 39  HIS A HA   3  
ATOM   8055  H  HB2  . HIS A 1 39  ? 3.877   62.115 -3.627  1.00 0.00  ? 39  HIS A HB2  3  
ATOM   8056  H  HB3  . HIS A 1 39  ? 5.176   62.406 -4.766  1.00 0.00  ? 39  HIS A HB3  3  
ATOM   8057  H  HD2  . HIS A 1 39  ? 7.604   60.874 -3.106  1.00 0.00  ? 39  HIS A HD2  3  
ATOM   8058  H  HE1  . HIS A 1 39  ? 5.025   57.538 -3.215  1.00 0.00  ? 39  HIS A HE1  3  
ATOM   8059  H  HE2  . HIS A 1 39  ? 7.417   58.277 -2.859  1.00 0.00  ? 39  HIS A HE2  3  
ATOM   8060  N  N    . TRP A 1 40  ? 4.956   65.041 -4.119  1.00 0.00  ? 40  TRP A N    3  
ATOM   8061  C  CA   . TRP A 1 40  ? 5.228   66.310 -4.843  1.00 0.00  ? 40  TRP A CA   3  
ATOM   8062  C  C    . TRP A 1 40  ? 5.881   67.290 -3.876  1.00 0.00  ? 40  TRP A C    3  
ATOM   8063  O  O    . TRP A 1 40  ? 6.856   67.941 -4.185  1.00 0.00  ? 40  TRP A O    3  
ATOM   8064  C  CB   . TRP A 1 40  ? 3.917   66.896 -5.368  1.00 0.00  ? 40  TRP A CB   3  
ATOM   8065  C  CG   . TRP A 1 40  ? 3.412   66.059 -6.492  1.00 0.00  ? 40  TRP A CG   3  
ATOM   8066  C  CD1  . TRP A 1 40  ? 2.250   65.373 -6.482  1.00 0.00  ? 40  TRP A CD1  3  
ATOM   8067  C  CD2  . TRP A 1 40  ? 4.024   65.812 -7.792  1.00 0.00  ? 40  TRP A CD2  3  
ATOM   8068  N  NE1  . TRP A 1 40  ? 2.110   64.721 -7.690  1.00 0.00  ? 40  TRP A NE1  3  
ATOM   8069  C  CE2  . TRP A 1 40  ? 3.174   64.958 -8.527  1.00 0.00  ? 40  TRP A CE2  3  
ATOM   8070  C  CE3  . TRP A 1 40  ? 5.219   66.239 -8.399  1.00 0.00  ? 40  TRP A CE3  3  
ATOM   8071  C  CZ2  . TRP A 1 40  ? 3.489   64.539 -9.813  1.00 0.00  ? 40  TRP A CZ2  3  
ATOM   8072  C  CZ3  . TRP A 1 40  ? 5.544   65.818 -9.700  1.00 0.00  ? 40  TRP A CZ3  3  
ATOM   8073  C  CH2  . TRP A 1 40  ? 4.679   64.968 -10.406 1.00 0.00  ? 40  TRP A CH2  3  
ATOM   8074  H  H    . TRP A 1 40  ? 4.058   64.657 -4.102  1.00 0.00  ? 40  TRP A H    3  
ATOM   8075  H  HA   . TRP A 1 40  ? 5.894   66.120 -5.657  1.00 0.00  ? 40  TRP A HA   3  
ATOM   8076  H  HB2  . TRP A 1 40  ? 3.185   66.912 -4.575  1.00 0.00  ? 40  TRP A HB2  3  
ATOM   8077  H  HB3  . TRP A 1 40  ? 4.084   67.899 -5.723  1.00 0.00  ? 40  TRP A HB3  3  
ATOM   8078  H  HD1  . TRP A 1 40  ? 1.545   65.339 -5.664  1.00 0.00  ? 40  TRP A HD1  3  
ATOM   8079  H  HE1  . TRP A 1 40  ? 1.359   64.156 -7.942  1.00 0.00  ? 40  TRP A HE1  3  
ATOM   8080  H  HE3  . TRP A 1 40  ? 5.891   66.893 -7.864  1.00 0.00  ? 40  TRP A HE3  3  
ATOM   8081  H  HZ2  . TRP A 1 40  ? 2.815   63.885 -10.345 1.00 0.00  ? 40  TRP A HZ2  3  
ATOM   8082  H  HZ3  . TRP A 1 40  ? 6.463   66.150 -10.159 1.00 0.00  ? 40  TRP A HZ3  3  
ATOM   8083  H  HH2  . TRP A 1 40  ? 4.932   64.647 -11.406 1.00 0.00  ? 40  TRP A HH2  3  
ATOM   8084  N  N    . ALA A 1 41  ? 5.322   67.414 -2.719  1.00 48.90 ? 41  ALA A N    3  
ATOM   8085  C  CA   . ALA A 1 41  ? 5.861   68.365 -1.702  1.00 51.55 ? 41  ALA A CA   3  
ATOM   8086  C  C    . ALA A 1 41  ? 7.384   68.220 -1.552  1.00 52.34 ? 41  ALA A C    3  
ATOM   8087  O  O    . ALA A 1 41  ? 8.123   69.143 -1.820  1.00 50.40 ? 41  ALA A O    3  
ATOM   8088  C  CB   . ALA A 1 41  ? 5.190   68.083 -0.360  1.00 54.82 ? 41  ALA A CB   3  
ATOM   8089  H  H    . ALA A 1 41  ? 4.509   66.912 -2.518  1.00 0.00  ? 41  ALA A H    3  
ATOM   8090  H  HA   . ALA A 1 41  ? 5.630   69.375 -2.006  1.00 0.00  ? 41  ALA A HA   3  
ATOM   8091  H  HB1  . ALA A 1 41  ? 5.327   68.928 0.296   1.00 0.00  ? 41  ALA A HB1  3  
ATOM   8092  H  HB2  . ALA A 1 41  ? 5.631   67.204 0.084   1.00 0.00  ? 41  ALA A HB2  3  
ATOM   8093  H  HB3  . ALA A 1 41  ? 4.134   67.916 -0.515  1.00 0.00  ? 41  ALA A HB3  3  
ATOM   8094  N  N    . CYS A 1 42  ? 7.864   67.097 -1.082  1.00 0.00  ? 42  CYS A N    3  
ATOM   8095  C  CA   . CYS A 1 42  ? 9.330   66.950 -0.891  1.00 0.00  ? 42  CYS A CA   3  
ATOM   8096  C  C    . CYS A 1 42  ? 10.060  67.363 -2.177  1.00 0.00  ? 42  CYS A C    3  
ATOM   8097  O  O    . CYS A 1 42  ? 11.107  67.977 -2.134  1.00 0.00  ? 42  CYS A O    3  
ATOM   8098  C  CB   . CYS A 1 42  ? 9.652   65.494 -0.525  1.00 0.00  ? 42  CYS A CB   3  
ATOM   8099  S  SG   . CYS A 1 42  ? 8.461   64.379 -1.298  1.00 0.00  ? 42  CYS A SG   3  
ATOM   8100  H  H    . CYS A 1 42  ? 7.261   66.375 -0.823  1.00 0.00  ? 42  CYS A H    3  
ATOM   8101  H  HA   . CYS A 1 42  ? 9.646   67.599 -0.086  1.00 0.00  ? 42  CYS A HA   3  
ATOM   8102  H  HB2  . CYS A 1 42  ? 10.634  65.247 -0.868  1.00 0.00  ? 42  CYS A HB2  3  
ATOM   8103  H  HB3  . CYS A 1 42  ? 9.608   65.372 0.548   1.00 0.00  ? 42  CYS A HB3  3  
ATOM   8104  H  HG   . CYS A 1 42  ? 8.545   64.469 -2.250  1.00 0.00  ? 42  CYS A HG   3  
ATOM   8105  N  N    . ARG A 1 43  ? 9.514   67.042 -3.317  1.00 0.00  ? 43  ARG A N    3  
ATOM   8106  C  CA   . ARG A 1 43  ? 10.178  67.431 -4.596  1.00 0.00  ? 43  ARG A CA   3  
ATOM   8107  C  C    . ARG A 1 43  ? 10.165  68.961 -4.726  1.00 0.00  ? 43  ARG A C    3  
ATOM   8108  O  O    . ARG A 1 43  ? 11.169  69.574 -5.029  1.00 0.00  ? 43  ARG A O    3  
ATOM   8109  C  CB   . ARG A 1 43  ? 9.423   66.794 -5.769  1.00 0.00  ? 43  ARG A CB   3  
ATOM   8110  C  CG   . ARG A 1 43  ? 9.982   67.308 -7.103  1.00 0.00  ? 43  ARG A CG   3  
ATOM   8111  C  CD   . ARG A 1 43  ? 9.354   66.525 -8.267  1.00 0.00  ? 43  ARG A CD   3  
ATOM   8112  N  NE   . ARG A 1 43  ? 9.333   67.386 -9.483  1.00 0.00  ? 43  ARG A NE   3  
ATOM   8113  C  CZ   . ARG A 1 43  ? 9.103   66.856 -10.652 1.00 0.00  ? 43  ARG A CZ   3  
ATOM   8114  N  NH1  . ARG A 1 43  ? 8.918   65.569 -10.762 1.00 0.00  ? 43  ARG A NH1  3  
ATOM   8115  N  NH2  . ARG A 1 43  ? 9.061   67.614 -11.713 1.00 0.00  ? 43  ARG A NH2  3  
ATOM   8116  H  H    . ARG A 1 43  ? 8.664   66.552 -3.335  1.00 0.00  ? 43  ARG A H    3  
ATOM   8117  H  HA   . ARG A 1 43  ? 11.199  67.080 -4.591  1.00 0.00  ? 43  ARG A HA   3  
ATOM   8118  H  HB2  . ARG A 1 43  ? 9.536   65.721 -5.725  1.00 0.00  ? 43  ARG A HB2  3  
ATOM   8119  H  HB3  . ARG A 1 43  ? 8.377   67.046 -5.703  1.00 0.00  ? 43  ARG A HB3  3  
ATOM   8120  H  HG2  . ARG A 1 43  ? 9.748   68.357 -7.211  1.00 0.00  ? 43  ARG A HG2  3  
ATOM   8121  H  HG3  . ARG A 1 43  ? 11.054  67.175 -7.119  1.00 0.00  ? 43  ARG A HG3  3  
ATOM   8122  H  HD2  . ARG A 1 43  ? 9.937   65.639 -8.466  1.00 0.00  ? 43  ARG A HD2  3  
ATOM   8123  H  HD3  . ARG A 1 43  ? 8.341   66.239 -8.014  1.00 0.00  ? 43  ARG A HD3  3  
ATOM   8124  H  HE   . ARG A 1 43  ? 9.482   68.351 -9.402  1.00 0.00  ? 43  ARG A HE   3  
ATOM   8125  H  HH11 . ARG A 1 43  ? 8.953   64.988 -9.948  1.00 0.00  ? 43  ARG A HH11 3  
ATOM   8126  H  HH12 . ARG A 1 43  ? 8.743   65.163 -11.659 1.00 0.00  ? 43  ARG A HH12 3  
ATOM   8127  H  HH21 . ARG A 1 43  ? 9.206   68.600 -11.630 1.00 0.00  ? 43  ARG A HH21 3  
ATOM   8128  H  HH22 . ARG A 1 43  ? 8.878   67.210 -12.609 1.00 0.00  ? 43  ARG A HH22 3  
ATOM   8129  N  N    . GLU A 1 44  ? 9.038   69.581 -4.491  1.00 0.00  ? 44  GLU A N    3  
ATOM   8130  C  CA   . GLU A 1 44  ? 8.963   71.069 -4.590  1.00 0.00  ? 44  GLU A CA   3  
ATOM   8131  C  C    . GLU A 1 44  ? 9.823   71.704 -3.490  1.00 0.00  ? 44  GLU A C    3  
ATOM   8132  O  O    . GLU A 1 44  ? 10.783  72.395 -3.772  1.00 0.00  ? 44  GLU A O    3  
ATOM   8133  C  CB   . GLU A 1 44  ? 7.510   71.518 -4.422  1.00 0.00  ? 44  GLU A CB   3  
ATOM   8134  C  CG   . GLU A 1 44  ? 6.683   71.030 -5.613  1.00 0.00  ? 44  GLU A CG   3  
ATOM   8135  C  CD   . GLU A 1 44  ? 5.210   71.374 -5.388  1.00 0.00  ? 44  GLU A CD   3  
ATOM   8136  O  OE1  . GLU A 1 44  ? 4.719   71.108 -4.303  1.00 0.00  ? 44  GLU A OE1  3  
ATOM   8137  O  OE2  . GLU A 1 44  ? 4.598   71.898 -6.304  1.00 0.00  ? 44  GLU A OE2  3  
ATOM   8138  H  H    . GLU A 1 44  ? 8.242   69.068 -4.241  1.00 0.00  ? 44  GLU A H    3  
ATOM   8139  H  HA   . GLU A 1 44  ? 9.327   71.383 -5.557  1.00 0.00  ? 44  GLU A HA   3  
ATOM   8140  H  HB2  . GLU A 1 44  ? 7.108   71.102 -3.509  1.00 0.00  ? 44  GLU A HB2  3  
ATOM   8141  H  HB3  . GLU A 1 44  ? 7.469   72.596 -4.376  1.00 0.00  ? 44  GLU A HB3  3  
ATOM   8142  H  HG2  . GLU A 1 44  ? 7.033   71.512 -6.514  1.00 0.00  ? 44  GLU A HG2  3  
ATOM   8143  H  HG3  . GLU A 1 44  ? 6.790   69.960 -5.712  1.00 0.00  ? 44  GLU A HG3  3  
ATOM   8144  N  N    . GLY A 1 45  ? 9.497   71.464 -2.236  1.00 0.00  ? 45  GLY A N    3  
ATOM   8145  C  CA   . GLY A 1 45  ? 10.308  72.041 -1.108  1.00 0.00  ? 45  GLY A CA   3  
ATOM   8146  C  C    . GLY A 1 45  ? 9.413   72.801 -0.117  1.00 0.00  ? 45  GLY A C    3  
ATOM   8147  O  O    . GLY A 1 45  ? 9.893   73.362 0.848   1.00 0.00  ? 45  GLY A O    3  
ATOM   8148  H  H    . GLY A 1 45  ? 8.725   70.894 -2.036  1.00 0.00  ? 45  GLY A H    3  
ATOM   8149  H  HA2  . GLY A 1 45  ? 10.807  71.238 -0.586  1.00 0.00  ? 45  GLY A HA2  3  
ATOM   8150  H  HA3  . GLY A 1 45  ? 11.051  72.722 -1.497  1.00 0.00  ? 45  GLY A HA3  3  
ATOM   8151  N  N    . ARG A 1 46  ? 8.127   72.831 -0.335  1.00 0.00  ? 46  ARG A N    3  
ATOM   8152  C  CA   . ARG A 1 46  ? 7.233   73.565 0.616   1.00 0.00  ? 46  ARG A CA   3  
ATOM   8153  C  C    . ARG A 1 46  ? 7.292   72.894 2.000   1.00 0.00  ? 46  ARG A C    3  
ATOM   8154  O  O    . ARG A 1 46  ? 6.420   72.139 2.381   1.00 0.00  ? 46  ARG A O    3  
ATOM   8155  C  CB   . ARG A 1 46  ? 5.798   73.551 0.084   1.00 0.00  ? 46  ARG A CB   3  
ATOM   8156  C  CG   . ARG A 1 46  ? 5.757   74.203 -1.306  1.00 0.00  ? 46  ARG A CG   3  
ATOM   8157  C  CD   . ARG A 1 46  ? 4.311   74.223 -1.848  1.00 0.00  ? 46  ARG A CD   3  
ATOM   8158  N  NE   . ARG A 1 46  ? 4.314   73.881 -3.307  1.00 0.00  ? 46  ARG A NE   3  
ATOM   8159  C  CZ   . ARG A 1 46  ? 5.148   74.453 -4.135  1.00 0.00  ? 46  ARG A CZ   3  
ATOM   8160  N  NH1  . ARG A 1 46  ? 5.901   75.442 -3.740  1.00 0.00  ? 46  ARG A NH1  3  
ATOM   8161  N  NH2  . ARG A 1 46  ? 5.194   74.064 -5.380  1.00 0.00  ? 46  ARG A NH2  3  
ATOM   8162  H  H    . ARG A 1 46  ? 7.751   72.376 -1.117  1.00 0.00  ? 46  ARG A H    3  
ATOM   8163  H  HA   . ARG A 1 46  ? 7.572   74.588 0.703   1.00 0.00  ? 46  ARG A HA   3  
ATOM   8164  H  HB2  . ARG A 1 46  ? 5.449   72.531 0.014   1.00 0.00  ? 46  ARG A HB2  3  
ATOM   8165  H  HB3  . ARG A 1 46  ? 5.162   74.108 0.754   1.00 0.00  ? 46  ARG A HB3  3  
ATOM   8166  H  HG2  . ARG A 1 46  ? 6.133   75.213 -1.226  1.00 0.00  ? 46  ARG A HG2  3  
ATOM   8167  H  HG3  . ARG A 1 46  ? 6.385   73.642 -1.982  1.00 0.00  ? 46  ARG A HG3  3  
ATOM   8168  H  HD2  . ARG A 1 46  ? 3.715   73.484 -1.338  1.00 0.00  ? 46  ARG A HD2  3  
ATOM   8169  H  HD3  . ARG A 1 46  ? 3.874   75.204 -1.685  1.00 0.00  ? 46  ARG A HD3  3  
ATOM   8170  H  HE   . ARG A 1 46  ? 3.705   73.189 -3.639  1.00 0.00  ? 46  ARG A HE   3  
ATOM   8171  H  HH11 . ARG A 1 46  ? 5.840   75.772 -2.802  1.00 0.00  ? 46  ARG A HH11 3  
ATOM   8172  H  HH12 . ARG A 1 46  ? 6.539   75.871 -4.380  1.00 0.00  ? 46  ARG A HH12 3  
ATOM   8173  H  HH21 . ARG A 1 46  ? 4.592   73.331 -5.697  1.00 0.00  ? 46  ARG A HH21 3  
ATOM   8174  H  HH22 . ARG A 1 46  ? 5.831   74.498 -6.017  1.00 0.00  ? 46  ARG A HH22 3  
ATOM   8175  N  N    . SER A 1 47  ? 8.333   73.163 2.743   1.00 0.00  ? 47  SER A N    3  
ATOM   8176  C  CA   . SER A 1 47  ? 8.503   72.546 4.097   1.00 0.00  ? 47  SER A CA   3  
ATOM   8177  C  C    . SER A 1 47  ? 7.202   72.581 4.915   1.00 0.00  ? 47  SER A C    3  
ATOM   8178  O  O    . SER A 1 47  ? 6.827   71.603 5.526   1.00 0.00  ? 47  SER A O    3  
ATOM   8179  C  CB   . SER A 1 47  ? 9.589   73.306 4.857   1.00 0.00  ? 47  SER A CB   3  
ATOM   8180  O  OG   . SER A 1 47  ? 9.176   74.653 5.044   1.00 0.00  ? 47  SER A OG   3  
ATOM   8181  H  H    . SER A 1 47  ? 9.024   73.768 2.401   1.00 0.00  ? 47  SER A H    3  
ATOM   8182  H  HA   . SER A 1 47  ? 8.815   71.519 3.978   1.00 0.00  ? 47  SER A HA   3  
ATOM   8183  H  HB2  . SER A 1 47  ? 9.746   72.847 5.819   1.00 0.00  ? 47  SER A HB2  3  
ATOM   8184  H  HB3  . SER A 1 47  ? 10.511  73.276 4.292   1.00 0.00  ? 47  SER A HB3  3  
ATOM   8185  H  HG   . SER A 1 47  ? 8.444   74.825 4.446   1.00 0.00  ? 47  SER A HG   3  
ATOM   8186  N  N    . ALA A 1 48  ? 6.526   73.695 4.964   1.00 0.00  ? 48  ALA A N    3  
ATOM   8187  C  CA   . ALA A 1 48  ? 5.270   73.769 5.778   1.00 0.00  ? 48  ALA A CA   3  
ATOM   8188  C  C    . ALA A 1 48  ? 4.392   72.535 5.523   1.00 0.00  ? 48  ALA A C    3  
ATOM   8189  O  O    . ALA A 1 48  ? 4.232   71.690 6.368   1.00 0.00  ? 48  ALA A O    3  
ATOM   8190  C  CB   . ALA A 1 48  ? 4.494   75.031 5.394   1.00 0.00  ? 48  ALA A CB   3  
ATOM   8191  H  H    . ALA A 1 48  ? 6.848   74.487 4.486   1.00 0.00  ? 48  ALA A H    3  
ATOM   8192  H  HA   . ALA A 1 48  ? 5.527   73.813 6.825   1.00 0.00  ? 48  ALA A HA   3  
ATOM   8193  H  HB1  . ALA A 1 48  ? 5.125   75.897 5.531   1.00 0.00  ? 48  ALA A HB1  3  
ATOM   8194  H  HB2  . ALA A 1 48  ? 3.618   75.119 6.020   1.00 0.00  ? 48  ALA A HB2  3  
ATOM   8195  H  HB3  . ALA A 1 48  ? 4.193   74.966 4.359   1.00 0.00  ? 48  ALA A HB3  3  
ATOM   8196  N  N    . VAL A 1 49  ? 3.775   72.484 4.384   1.00 0.00  ? 49  VAL A N    3  
ATOM   8197  C  CA   . VAL A 1 49  ? 2.856   71.338 4.082   1.00 0.00  ? 49  VAL A CA   3  
ATOM   8198  C  C    . VAL A 1 49  ? 3.556   69.997 4.395   1.00 0.00  ? 49  VAL A C    3  
ATOM   8199  O  O    . VAL A 1 49  ? 2.934   69.060 4.860   1.00 0.00  ? 49  VAL A O    3  
ATOM   8200  C  CB   . VAL A 1 49  ? 2.427   71.366 2.614   1.00 0.00  ? 49  VAL A CB   3  
ATOM   8201  C  CG1  . VAL A 1 49  ? 1.505   72.563 2.375   1.00 0.00  ? 49  VAL A CG1  3  
ATOM   8202  C  CG2  . VAL A 1 49  ? 3.659   71.491 1.726   1.00 0.00  ? 49  VAL A CG2  3  
ATOM   8203  H  H    . VAL A 1 49  ? 3.897   73.257 3.794   1.00 0.00  ? 49  VAL A H    3  
ATOM   8204  H  HA   . VAL A 1 49  ? 1.979   71.424 4.707   1.00 0.00  ? 49  VAL A HA   3  
ATOM   8205  H  HB   . VAL A 1 49  ? 1.897   70.453 2.378   1.00 0.00  ? 49  VAL A HB   3  
ATOM   8206  H  HG11 . VAL A 1 49  ? 2.071   73.478 2.472   1.00 0.00  ? 49  VAL A HG11 3  
ATOM   8207  H  HG12 . VAL A 1 49  ? 0.706   72.555 3.101   1.00 0.00  ? 49  VAL A HG12 3  
ATOM   8208  H  HG13 . VAL A 1 49  ? 1.089   72.501 1.381   1.00 0.00  ? 49  VAL A HG13 3  
ATOM   8209  H  HG21 . VAL A 1 49  ? 4.158   72.417 1.951   1.00 0.00  ? 49  VAL A HG21 3  
ATOM   8210  H  HG22 . VAL A 1 49  ? 3.359   71.484 0.688   1.00 0.00  ? 49  VAL A HG22 3  
ATOM   8211  H  HG23 . VAL A 1 49  ? 4.327   70.665 1.915   1.00 0.00  ? 49  VAL A HG23 3  
ATOM   8212  N  N    . VAL A 1 50  ? 4.838   69.896 4.140   1.00 0.00  ? 50  VAL A N    3  
ATOM   8213  C  CA   . VAL A 1 50  ? 5.575   68.615 4.410   1.00 0.00  ? 50  VAL A CA   3  
ATOM   8214  C  C    . VAL A 1 50  ? 5.548   68.273 5.906   1.00 0.00  ? 50  VAL A C    3  
ATOM   8215  O  O    . VAL A 1 50  ? 5.646   67.129 6.301   1.00 0.00  ? 50  VAL A O    3  
ATOM   8216  C  CB   . VAL A 1 50  ? 7.034   68.773 3.955   1.00 0.00  ? 50  VAL A CB   3  
ATOM   8217  C  CG1  . VAL A 1 50  ? 7.856   67.551 4.380   1.00 0.00  ? 50  VAL A CG1  3  
ATOM   8218  C  CG2  . VAL A 1 50  ? 7.079   68.918 2.435   1.00 0.00  ? 50  VAL A CG2  3  
ATOM   8219  H  H    . VAL A 1 50  ? 5.319   70.662 3.762   1.00 0.00  ? 50  VAL A H    3  
ATOM   8220  H  HA   . VAL A 1 50  ? 5.113   67.820 3.859   1.00 0.00  ? 50  VAL A HA   3  
ATOM   8221  H  HB   . VAL A 1 50  ? 7.454   69.656 4.411   1.00 0.00  ? 50  VAL A HB   3  
ATOM   8222  H  HG11 . VAL A 1 50  ? 8.769   67.509 3.803   1.00 0.00  ? 50  VAL A HG11 3  
ATOM   8223  H  HG12 . VAL A 1 50  ? 7.282   66.652 4.212   1.00 0.00  ? 50  VAL A HG12 3  
ATOM   8224  H  HG13 . VAL A 1 50  ? 8.100   67.633 5.428   1.00 0.00  ? 50  VAL A HG13 3  
ATOM   8225  H  HG21 . VAL A 1 50  ? 6.487   69.770 2.137   1.00 0.00  ? 50  VAL A HG21 3  
ATOM   8226  H  HG22 . VAL A 1 50  ? 6.681   68.025 1.979   1.00 0.00  ? 50  VAL A HG22 3  
ATOM   8227  H  HG23 . VAL A 1 50  ? 8.101   69.059 2.117   1.00 0.00  ? 50  VAL A HG23 3  
ATOM   8228  N  N    . GLU A 1 51  ? 5.407   69.260 6.723   1.00 70.68 ? 51  GLU A N    3  
ATOM   8229  C  CA   . GLU A 1 51  ? 5.366   69.050 8.186   1.00 73.00 ? 51  GLU A CA   3  
ATOM   8230  C  C    . GLU A 1 51  ? 3.958   68.685 8.615   1.00 75.05 ? 51  GLU A C    3  
ATOM   8231  O  O    . GLU A 1 51  ? 3.724   67.718 9.313   1.00 73.61 ? 51  GLU A O    3  
ATOM   8232  C  CB   . GLU A 1 51  ? 5.755   70.363 8.853   1.00 71.29 ? 51  GLU A CB   3  
ATOM   8233  C  CG   . GLU A 1 51  ? 7.194   70.746 8.473   1.00 75.77 ? 51  GLU A CG   3  
ATOM   8234  C  CD   . GLU A 1 51  ? 8.188   70.087 9.435   1.00 78.77 ? 51  GLU A CD   3  
ATOM   8235  O  OE1  . GLU A 1 51  ? 7.944   70.130 10.629  1.00 79.68 ? 51  GLU A OE1  3  
ATOM   8236  O  OE2  . GLU A 1 51  ? 9.176   69.551 8.959   1.00 77.06 ? 51  GLU A OE2  3  
ATOM   8237  H  H    . GLU A 1 51  ? 5.309   70.159 6.364   1.00 0.00  ? 51  GLU A H    3  
ATOM   8238  H  HA   . GLU A 1 51  ? 6.046   68.282 8.470   1.00 0.00  ? 51  GLU A HA   3  
ATOM   8239  H  HB2  . GLU A 1 51  ? 5.078   71.139 8.523   1.00 0.00  ? 51  GLU A HB2  3  
ATOM   8240  H  HB3  . GLU A 1 51  ? 5.676   70.256 9.912   1.00 0.00  ? 51  GLU A HB3  3  
ATOM   8241  H  HG2  . GLU A 1 51  ? 7.405   70.422 7.463   1.00 0.00  ? 51  GLU A HG2  3  
ATOM   8242  H  HG3  . GLU A 1 51  ? 7.298   71.817 8.530   1.00 0.00  ? 51  GLU A HG3  3  
ATOM   8243  N  N    . MET A 1 52  ? 3.028   69.466 8.192   1.00 0.00  ? 52  MET A N    3  
ATOM   8244  C  CA   . MET A 1 52  ? 1.606   69.220 8.550   1.00 0.00  ? 52  MET A CA   3  
ATOM   8245  C  C    . MET A 1 52  ? 1.212   67.802 8.143   1.00 0.00  ? 52  MET A C    3  
ATOM   8246  O  O    . MET A 1 52  ? 0.281   67.231 8.676   1.00 0.00  ? 52  MET A O    3  
ATOM   8247  C  CB   . MET A 1 52  ? 0.721   70.231 7.818   1.00 0.00  ? 52  MET A CB   3  
ATOM   8248  C  CG   . MET A 1 52  ? 1.194   71.654 8.133   1.00 0.00  ? 52  MET A CG   3  
ATOM   8249  S  SD   . MET A 1 52  ? 0.609   72.132 9.778   1.00 0.00  ? 52  MET A SD   3  
ATOM   8250  C  CE   . MET A 1 52  ? 1.550   73.671 9.916   1.00 0.00  ? 52  MET A CE   3  
ATOM   8251  H  H    . MET A 1 52  ? 3.272   70.225 7.624   1.00 0.00  ? 52  MET A H    3  
ATOM   8252  H  HA   . MET A 1 52  ? 1.477   69.337 9.616   1.00 0.00  ? 52  MET A HA   3  
ATOM   8253  H  HB2  . MET A 1 52  ? 0.783   70.058 6.753   1.00 0.00  ? 52  MET A HB2  3  
ATOM   8254  H  HB3  . MET A 1 52  ? -0.302  70.115 8.143   1.00 0.00  ? 52  MET A HB3  3  
ATOM   8255  H  HG2  . MET A 1 52  ? 2.276   71.694 8.109   1.00 0.00  ? 52  MET A HG2  3  
ATOM   8256  H  HG3  . MET A 1 52  ? 0.794   72.335 7.398   1.00 0.00  ? 52  MET A HG3  3  
ATOM   8257  H  HE1  . MET A 1 52  ? 1.210   74.223 10.782  1.00 0.00  ? 52  MET A HE1  3  
ATOM   8258  H  HE2  . MET A 1 52  ? 1.399   74.268 9.031   1.00 0.00  ? 52  MET A HE2  3  
ATOM   8259  H  HE3  . MET A 1 52  ? 2.602   73.442 10.019  1.00 0.00  ? 52  MET A HE3  3  
ATOM   8260  N  N    . LEU A 1 53  ? 1.909   67.227 7.201   1.00 74.35 ? 53  LEU A N    3  
ATOM   8261  C  CA   . LEU A 1 53  ? 1.569   65.841 6.759   1.00 75.09 ? 53  LEU A CA   3  
ATOM   8262  C  C    . LEU A 1 53  ? 2.356   64.833 7.605   1.00 74.89 ? 53  LEU A C    3  
ATOM   8263  O  O    . LEU A 1 53  ? 1.794   63.961 8.237   1.00 71.43 ? 53  LEU A O    3  
ATOM   8264  C  CB   . LEU A 1 53  ? 1.944   65.694 5.274   1.00 75.65 ? 53  LEU A CB   3  
ATOM   8265  C  CG   . LEU A 1 53  ? 1.197   64.516 4.616   1.00 76.44 ? 53  LEU A CG   3  
ATOM   8266  C  CD1  . LEU A 1 53  ? 1.534   63.206 5.339   1.00 76.32 ? 53  LEU A CD1  3  
ATOM   8267  C  CD2  . LEU A 1 53  ? -0.328  64.753 4.636   1.00 80.73 ? 53  LEU A CD2  3  
ATOM   8268  H  H    . LEU A 1 53  ? 2.659   67.708 6.779   1.00 0.00  ? 53  LEU A H    3  
ATOM   8269  H  HA   . LEU A 1 53  ? 0.512   65.669 6.890   1.00 0.00  ? 53  LEU A HA   3  
ATOM   8270  H  HB2  . LEU A 1 53  ? 1.688   66.605 4.755   1.00 0.00  ? 53  LEU A HB2  3  
ATOM   8271  H  HB3  . LEU A 1 53  ? 3.008   65.528 5.192   1.00 0.00  ? 53  LEU A HB3  3  
ATOM   8272  H  HG   . LEU A 1 53  ? 1.524   64.435 3.590   1.00 0.00  ? 53  LEU A HG   3  
ATOM   8273  H  HD11 . LEU A 1 53  ? 2.583   63.195 5.600   1.00 0.00  ? 53  LEU A HD11 3  
ATOM   8274  H  HD12 . LEU A 1 53  ? 1.319   62.373 4.687   1.00 0.00  ? 53  LEU A HD12 3  
ATOM   8275  H  HD13 . LEU A 1 53  ? 0.938   63.124 6.234   1.00 0.00  ? 53  LEU A HD13 3  
ATOM   8276  H  HD21 . LEU A 1 53  ? -0.762  64.313 5.524   1.00 0.00  ? 53  LEU A HD21 3  
ATOM   8277  H  HD22 . LEU A 1 53  ? -0.769  64.295 3.763   1.00 0.00  ? 53  LEU A HD22 3  
ATOM   8278  H  HD23 . LEU A 1 53  ? -0.535  65.814 4.622   1.00 0.00  ? 53  LEU A HD23 3  
ATOM   8279  N  N    . ILE A 1 54  ? 3.654   64.950 7.623   1.00 0.00  ? 54  ILE A N    3  
ATOM   8280  C  CA   . ILE A 1 54  ? 4.482   64.002 8.422   1.00 0.00  ? 54  ILE A CA   3  
ATOM   8281  C  C    . ILE A 1 54  ? 4.071   64.061 9.891   1.00 0.00  ? 54  ILE A C    3  
ATOM   8282  O  O    . ILE A 1 54  ? 4.360   63.169 10.664  1.00 0.00  ? 54  ILE A O    3  
ATOM   8283  C  CB   . ILE A 1 54  ? 5.953   64.393 8.285   1.00 0.00  ? 54  ILE A CB   3  
ATOM   8284  C  CG1  . ILE A 1 54  ? 6.421   64.068 6.863   1.00 0.00  ? 54  ILE A CG1  3  
ATOM   8285  C  CG2  . ILE A 1 54  ? 6.803   63.625 9.309   1.00 0.00  ? 54  ILE A CG2  3  
ATOM   8286  C  CD1  . ILE A 1 54  ? 7.811   64.658 6.626   1.00 0.00  ? 54  ILE A CD1  3  
ATOM   8287  H  H    . ILE A 1 54  ? 4.087   65.663 7.109   1.00 0.00  ? 54  ILE A H    3  
ATOM   8288  H  HA   . ILE A 1 54  ? 4.341   63.001 8.051   1.00 0.00  ? 54  ILE A HA   3  
ATOM   8289  H  HB   . ILE A 1 54  ? 6.048   65.451 8.463   1.00 0.00  ? 54  ILE A HB   3  
ATOM   8290  H  HG12 . ILE A 1 54  ? 6.455   62.999 6.732   1.00 0.00  ? 54  ILE A HG12 3  
ATOM   8291  H  HG13 . ILE A 1 54  ? 5.728   64.494 6.152   1.00 0.00  ? 54  ILE A HG13 3  
ATOM   8292  H  HG21 . ILE A 1 54  ? 6.449   62.608 9.381   1.00 0.00  ? 54  ILE A HG21 3  
ATOM   8293  H  HG22 . ILE A 1 54  ? 6.716   64.102 10.274  1.00 0.00  ? 54  ILE A HG22 3  
ATOM   8294  H  HG23 . ILE A 1 54  ? 7.838   63.627 9.002   1.00 0.00  ? 54  ILE A HG23 3  
ATOM   8295  H  HD11 . ILE A 1 54  ? 7.765   65.731 6.720   1.00 0.00  ? 54  ILE A HD11 3  
ATOM   8296  H  HD12 . ILE A 1 54  ? 8.150   64.397 5.635   1.00 0.00  ? 54  ILE A HD12 3  
ATOM   8297  H  HD13 . ILE A 1 54  ? 8.500   64.263 7.358   1.00 0.00  ? 54  ILE A HD13 3  
ATOM   8298  N  N    . MET A 1 55  ? 3.399   65.098 10.281  1.00 0.00  ? 55  MET A N    3  
ATOM   8299  C  CA   . MET A 1 55  ? 2.968   65.207 11.698  1.00 0.00  ? 55  MET A CA   3  
ATOM   8300  C  C    . MET A 1 55  ? 1.790   64.268 11.906  1.00 0.00  ? 55  MET A C    3  
ATOM   8301  O  O    . MET A 1 55  ? 1.522   63.812 13.000  1.00 0.00  ? 55  MET A O    3  
ATOM   8302  C  CB   . MET A 1 55  ? 2.553   66.651 11.992  1.00 0.00  ? 55  MET A CB   3  
ATOM   8303  C  CG   . MET A 1 55  ? 3.794   67.572 11.977  1.00 0.00  ? 55  MET A CG   3  
ATOM   8304  S  SD   . MET A 1 55  ? 4.364   67.863 13.672  1.00 0.00  ? 55  MET A SD   3  
ATOM   8305  C  CE   . MET A 1 55  ? 3.327   69.305 14.017  1.00 0.00  ? 55  MET A CE   3  
ATOM   8306  H  H    . MET A 1 55  ? 3.170   65.800 9.642   1.00 0.00  ? 55  MET A H    3  
ATOM   8307  H  HA   . MET A 1 55  ? 3.783   64.920 12.348  1.00 0.00  ? 55  MET A HA   3  
ATOM   8308  H  HB2  . MET A 1 55  ? 1.849   66.977 11.238  1.00 0.00  ? 55  MET A HB2  3  
ATOM   8309  H  HB3  . MET A 1 55  ? 2.081   66.697 12.962  1.00 0.00  ? 55  MET A HB3  3  
ATOM   8310  H  HG2  . MET A 1 55  ? 4.592   67.113 11.408  1.00 0.00  ? 55  MET A HG2  3  
ATOM   8311  H  HG3  . MET A 1 55  ? 3.536   68.515 11.520  1.00 0.00  ? 55  MET A HG3  3  
ATOM   8312  H  HE1  . MET A 1 55  ? 3.342   69.512 15.078  1.00 0.00  ? 55  MET A HE1  3  
ATOM   8313  H  HE2  . MET A 1 55  ? 2.314   69.104 13.706  1.00 0.00  ? 55  MET A HE2  3  
ATOM   8314  H  HE3  . MET A 1 55  ? 3.707   70.158 13.472  1.00 0.00  ? 55  MET A HE3  3  
ATOM   8315  N  N    . ARG A 1 56  ? 1.094   63.964 10.848  1.00 0.00  ? 56  ARG A N    3  
ATOM   8316  C  CA   . ARG A 1 56  ? -0.062  63.037 10.960  1.00 0.00  ? 56  ARG A CA   3  
ATOM   8317  C  C    . ARG A 1 56  ? 0.471   61.635 11.256  1.00 0.00  ? 56  ARG A C    3  
ATOM   8318  O  O    . ARG A 1 56  ? -0.151  60.858 11.953  1.00 0.00  ? 56  ARG A O    3  
ATOM   8319  C  CB   . ARG A 1 56  ? -0.839  63.029 9.638   1.00 0.00  ? 56  ARG A CB   3  
ATOM   8320  C  CG   . ARG A 1 56  ? -2.242  62.443 9.869   1.00 0.00  ? 56  ARG A CG   3  
ATOM   8321  C  CD   . ARG A 1 56  ? -3.130  63.427 10.676  1.00 0.00  ? 56  ARG A CD   3  
ATOM   8322  N  NE   . ARG A 1 56  ? -4.443  63.641 9.976   1.00 0.00  ? 56  ARG A NE   3  
ATOM   8323  C  CZ   . ARG A 1 56  ? -4.503  64.030 8.728   1.00 0.00  ? 56  ARG A CZ   3  
ATOM   8324  N  NH1  . ARG A 1 56  ? -3.413  64.326 8.075   1.00 0.00  ? 56  ARG A NH1  3  
ATOM   8325  N  NH2  . ARG A 1 56  ? -5.662  64.146 8.140   1.00 0.00  ? 56  ARG A NH2  3  
ATOM   8326  H  H    . ARG A 1 56  ? 1.342   64.340 9.976   1.00 0.00  ? 56  ARG A H    3  
ATOM   8327  H  HA   . ARG A 1 56  ? -0.708  63.359 11.764  1.00 0.00  ? 56  ARG A HA   3  
ATOM   8328  H  HB2  . ARG A 1 56  ? -0.922  64.040 9.265   1.00 0.00  ? 56  ARG A HB2  3  
ATOM   8329  H  HB3  . ARG A 1 56  ? -0.314  62.424 8.914   1.00 0.00  ? 56  ARG A HB3  3  
ATOM   8330  H  HG2  . ARG A 1 56  ? -2.698  62.230 8.916   1.00 0.00  ? 56  ARG A HG2  3  
ATOM   8331  H  HG3  . ARG A 1 56  ? -2.143  61.517 10.420  1.00 0.00  ? 56  ARG A HG3  3  
ATOM   8332  H  HD2  . ARG A 1 56  ? -3.350  63.004 11.640  1.00 0.00  ? 56  ARG A HD2  3  
ATOM   8333  H  HD3  . ARG A 1 56  ? -2.606  64.371 10.825  1.00 0.00  ? 56  ARG A HD3  3  
ATOM   8334  H  HE   . ARG A 1 56  ? -5.276  63.463 10.460  1.00 0.00  ? 56  ARG A HE   3  
ATOM   8335  H  HH11 . ARG A 1 56  ? -2.526  64.257 8.528   1.00 0.00  ? 56  ARG A HH11 3  
ATOM   8336  H  HH12 . ARG A 1 56  ? -3.466  64.623 7.122   1.00 0.00  ? 56  ARG A HH12 3  
ATOM   8337  H  HH21 . ARG A 1 56  ? -6.501  63.938 8.643   1.00 0.00  ? 56  ARG A HH21 3  
ATOM   8338  H  HH22 . ARG A 1 56  ? -5.712  64.443 7.187   1.00 0.00  ? 56  ARG A HH22 3  
ATOM   8339  N  N    . GLY A 1 57  ? 1.625   61.312 10.723  1.00 75.30 ? 57  GLY A N    3  
ATOM   8340  C  CA   . GLY A 1 57  ? 2.231   59.966 10.950  1.00 74.65 ? 57  GLY A CA   3  
ATOM   8341  C  C    . GLY A 1 57  ? 2.220   59.199 9.636   1.00 75.56 ? 57  GLY A C    3  
ATOM   8342  O  O    . GLY A 1 57  ? 2.279   57.986 9.609   1.00 73.49 ? 57  GLY A O    3  
ATOM   8343  H  H    . GLY A 1 57  ? 2.097   61.961 10.161  1.00 0.00  ? 57  GLY A H    3  
ATOM   8344  H  HA2  . GLY A 1 57  ? 3.248   60.081 11.295  1.00 0.00  ? 57  GLY A HA2  3  
ATOM   8345  H  HA3  . GLY A 1 57  ? 1.662   59.419 11.681  1.00 0.00  ? 57  GLY A HA3  3  
ATOM   8346  N  N    . ALA A 1 58  ? 2.129   59.900 8.545   1.00 0.00  ? 58  ALA A N    3  
ATOM   8347  C  CA   . ALA A 1 58  ? 2.096   59.207 7.226   1.00 0.00  ? 58  ALA A CA   3  
ATOM   8348  C  C    . ALA A 1 58  ? 3.438   58.541 6.955   1.00 0.00  ? 58  ALA A C    3  
ATOM   8349  O  O    . ALA A 1 58  ? 4.478   59.160 7.069   1.00 0.00  ? 58  ALA A O    3  
ATOM   8350  C  CB   . ALA A 1 58  ? 1.786   60.217 6.118   1.00 0.00  ? 58  ALA A CB   3  
ATOM   8351  H  H    . ALA A 1 58  ? 2.069   60.884 8.594   1.00 0.00  ? 58  ALA A H    3  
ATOM   8352  H  HA   . ALA A 1 58  ? 1.338   58.455 7.245   1.00 0.00  ? 58  ALA A HA   3  
ATOM   8353  H  HB1  . ALA A 1 58  ? 0.903   60.781 6.381   1.00 0.00  ? 58  ALA A HB1  3  
ATOM   8354  H  HB2  . ALA A 1 58  ? 1.613   59.691 5.190   1.00 0.00  ? 58  ALA A HB2  3  
ATOM   8355  H  HB3  . ALA A 1 58  ? 2.622   60.889 6.000   1.00 0.00  ? 58  ALA A HB3  3  
ATOM   8356  N  N    . ARG A 1 59  ? 3.440   57.279 6.596   1.00 0.00  ? 59  ARG A N    3  
ATOM   8357  C  CA   . ARG A 1 59  ? 4.721   56.582 6.322   1.00 0.00  ? 59  ARG A CA   3  
ATOM   8358  C  C    . ARG A 1 59  ? 5.550   57.393 5.345   1.00 0.00  ? 59  ARG A C    3  
ATOM   8359  O  O    . ARG A 1 59  ? 5.110   57.742 4.271   1.00 0.00  ? 59  ARG A O    3  
ATOM   8360  C  CB   . ARG A 1 59  ? 4.425   55.214 5.706   1.00 0.00  ? 59  ARG A CB   3  
ATOM   8361  C  CG   . ARG A 1 59  ? 5.735   54.519 5.332   1.00 0.00  ? 59  ARG A CG   3  
ATOM   8362  C  CD   . ARG A 1 59  ? 5.454   53.053 5.000   1.00 0.00  ? 59  ARG A CD   3  
ATOM   8363  N  NE   . ARG A 1 59  ? 4.954   52.354 6.218   1.00 0.00  ? 59  ARG A NE   3  
ATOM   8364  C  CZ   . ARG A 1 59  ? 4.362   51.196 6.109   1.00 0.00  ? 59  ARG A CZ   3  
ATOM   8365  N  NH1  . ARG A 1 59  ? 4.200   50.654 4.933   1.00 0.00  ? 59  ARG A NH1  3  
ATOM   8366  N  NH2  . ARG A 1 59  ? 3.930   50.582 7.176   1.00 0.00  ? 59  ARG A NH2  3  
ATOM   8367  H  H    . ARG A 1 59  ? 2.622   56.755 6.498   1.00 0.00  ? 59  ARG A H    3  
ATOM   8368  H  HA   . ARG A 1 59  ? 5.269   56.451 7.243   1.00 0.00  ? 59  ARG A HA   3  
ATOM   8369  H  HB2  . ARG A 1 59  ? 3.890   54.610 6.417   1.00 0.00  ? 59  ARG A HB2  3  
ATOM   8370  H  HB3  . ARG A 1 59  ? 3.823   55.343 4.820   1.00 0.00  ? 59  ARG A HB3  3  
ATOM   8371  H  HG2  . ARG A 1 59  ? 6.170   55.009 4.472   1.00 0.00  ? 59  ARG A HG2  3  
ATOM   8372  H  HG3  . ARG A 1 59  ? 6.422   54.573 6.163   1.00 0.00  ? 59  ARG A HG3  3  
ATOM   8373  H  HD2  . ARG A 1 59  ? 4.707   52.998 4.221   1.00 0.00  ? 59  ARG A HD2  3  
ATOM   8374  H  HD3  . ARG A 1 59  ? 6.363   52.578 4.662   1.00 0.00  ? 59  ARG A HD3  3  
ATOM   8375  H  HE   . ARG A 1 59  ? 5.073   52.763 7.100   1.00 0.00  ? 59  ARG A HE   3  
ATOM   8376  H  HH11 . ARG A 1 59  ? 4.529   51.125 4.115   1.00 0.00  ? 59  ARG A HH11 3  
ATOM   8377  H  HH12 . ARG A 1 59  ? 3.746   49.767 4.850   1.00 0.00  ? 59  ARG A HH12 3  
ATOM   8378  H  HH21 . ARG A 1 59  ? 4.053   50.998 8.077   1.00 0.00  ? 59  ARG A HH21 3  
ATOM   8379  H  HH22 . ARG A 1 59  ? 3.476   49.695 7.093   1.00 0.00  ? 59  ARG A HH22 3  
ATOM   8380  N  N    . ILE A 1 60  ? 6.746   57.697 5.727   1.00 0.00  ? 60  ILE A N    3  
ATOM   8381  C  CA   . ILE A 1 60  ? 7.650   58.490 4.860   1.00 0.00  ? 60  ILE A CA   3  
ATOM   8382  C  C    . ILE A 1 60  ? 8.530   57.526 4.060   1.00 0.00  ? 60  ILE A C    3  
ATOM   8383  O  O    . ILE A 1 60  ? 9.355   57.927 3.264   1.00 0.00  ? 60  ILE A O    3  
ATOM   8384  C  CB   . ILE A 1 60  ? 8.487   59.397 5.763   1.00 0.00  ? 60  ILE A CB   3  
ATOM   8385  C  CG1  . ILE A 1 60  ? 7.534   60.106 6.746   1.00 0.00  ? 60  ILE A CG1  3  
ATOM   8386  C  CG2  . ILE A 1 60  ? 9.221   60.439 4.917   1.00 0.00  ? 60  ILE A CG2  3  
ATOM   8387  C  CD1  . ILE A 1 60  ? 8.309   60.892 7.802   1.00 0.00  ? 60  ILE A CD1  3  
ATOM   8388  H  H    . ILE A 1 60  ? 7.061   57.400 6.606   1.00 0.00  ? 60  ILE A H    3  
ATOM   8389  H  HA   . ILE A 1 60  ? 7.069   59.097 4.178   1.00 0.00  ? 60  ILE A HA   3  
ATOM   8390  H  HB   . ILE A 1 60  ? 9.201   58.802 6.312   1.00 0.00  ? 60  ILE A HB   3  
ATOM   8391  H  HG12 . ILE A 1 60  ? 6.901   60.783 6.196   1.00 0.00  ? 60  ILE A HG12 3  
ATOM   8392  H  HG13 . ILE A 1 60  ? 6.916   59.378 7.247   1.00 0.00  ? 60  ILE A HG13 3  
ATOM   8393  H  HG21 . ILE A 1 60  ? 9.959   59.948 4.301   1.00 0.00  ? 60  ILE A HG21 3  
ATOM   8394  H  HG22 . ILE A 1 60  ? 9.710   61.150 5.566   1.00 0.00  ? 60  ILE A HG22 3  
ATOM   8395  H  HG23 . ILE A 1 60  ? 8.512   60.956 4.288   1.00 0.00  ? 60  ILE A HG23 3  
ATOM   8396  H  HD11 . ILE A 1 60  ? 7.773   60.829 8.739   1.00 0.00  ? 60  ILE A HD11 3  
ATOM   8397  H  HD12 . ILE A 1 60  ? 8.382   61.922 7.498   1.00 0.00  ? 60  ILE A HD12 3  
ATOM   8398  H  HD13 . ILE A 1 60  ? 9.298   60.480 7.927   1.00 0.00  ? 60  ILE A HD13 3  
ATOM   8399  N  N    . ASN A 1 61  ? 8.348   56.245 4.275   1.00 0.00  ? 61  ASN A N    3  
ATOM   8400  C  CA   . ASN A 1 61  ? 9.158   55.225 3.541   1.00 0.00  ? 61  ASN A CA   3  
ATOM   8401  C  C    . ASN A 1 61  ? 8.401   54.767 2.290   1.00 0.00  ? 61  ASN A C    3  
ATOM   8402  O  O    . ASN A 1 61  ? 8.858   53.916 1.553   1.00 0.00  ? 61  ASN A O    3  
ATOM   8403  C  CB   . ASN A 1 61  ? 9.400   54.020 4.453   1.00 0.00  ? 61  ASN A CB   3  
ATOM   8404  C  CG   . ASN A 1 61  ? 10.250  54.447 5.651   1.00 0.00  ? 61  ASN A CG   3  
ATOM   8405  O  OD1  . ASN A 1 61  ? 11.306  53.895 5.888   1.00 0.00  ? 61  ASN A OD1  3  
ATOM   8406  N  ND2  . ASN A 1 61  ? 9.831   55.413 6.422   1.00 0.00  ? 61  ASN A ND2  3  
ATOM   8407  H  H    . ASN A 1 61  ? 7.671   55.954 4.923   1.00 0.00  ? 61  ASN A H    3  
ATOM   8408  H  HA   . ASN A 1 61  ? 10.109  55.651 3.251   1.00 0.00  ? 61  ASN A HA   3  
ATOM   8409  H  HB2  . ASN A 1 61  ? 8.451   53.638 4.802   1.00 0.00  ? 61  ASN A HB2  3  
ATOM   8410  H  HB3  . ASN A 1 61  ? 9.918   53.249 3.903   1.00 0.00  ? 61  ASN A HB3  3  
ATOM   8411  H  HD21 . ASN A 1 61  ? 8.979   55.858 6.231   1.00 0.00  ? 61  ASN A HD21 3  
ATOM   8412  H  HD22 . ASN A 1 61  ? 10.369  55.694 7.191   1.00 0.00  ? 61  ASN A HD22 3  
ATOM   8413  N  N    . VAL A 1 62  ? 7.253   55.334 2.039   1.00 0.00  ? 62  VAL A N    3  
ATOM   8414  C  CA   . VAL A 1 62  ? 6.476   54.938 0.827   1.00 0.00  ? 62  VAL A CA   3  
ATOM   8415  C  C    . VAL A 1 62  ? 7.356   55.131 -0.412  1.00 0.00  ? 62  VAL A C    3  
ATOM   8416  O  O    . VAL A 1 62  ? 8.444   55.660 -0.329  1.00 0.00  ? 62  VAL A O    3  
ATOM   8417  C  CB   . VAL A 1 62  ? 5.215   55.802 0.708   1.00 0.00  ? 62  VAL A CB   3  
ATOM   8418  C  CG1  . VAL A 1 62  ? 4.150   55.293 1.684   1.00 0.00  ? 62  VAL A CG1  3  
ATOM   8419  C  CG2  . VAL A 1 62  ? 5.558   57.255 1.043   1.00 0.00  ? 62  VAL A CG2  3  
ATOM   8420  H  H    . VAL A 1 62  ? 6.913   56.028 2.641   1.00 0.00  ? 62  VAL A H    3  
ATOM   8421  H  HA   . VAL A 1 62  ? 6.196   53.897 0.905   1.00 0.00  ? 62  VAL A HA   3  
ATOM   8422  H  HB   . VAL A 1 62  ? 4.831   55.745 -0.301  1.00 0.00  ? 62  VAL A HB   3  
ATOM   8423  H  HG11 . VAL A 1 62  ? 4.608   55.085 2.639   1.00 0.00  ? 62  VAL A HG11 3  
ATOM   8424  H  HG12 . VAL A 1 62  ? 3.707   54.389 1.294   1.00 0.00  ? 62  VAL A HG12 3  
ATOM   8425  H  HG13 . VAL A 1 62  ? 3.383   56.044 1.808   1.00 0.00  ? 62  VAL A HG13 3  
ATOM   8426  H  HG21 . VAL A 1 62  ? 6.408   57.569 0.456   1.00 0.00  ? 62  VAL A HG21 3  
ATOM   8427  H  HG22 . VAL A 1 62  ? 5.797   57.334 2.092   1.00 0.00  ? 62  VAL A HG22 3  
ATOM   8428  H  HG23 . VAL A 1 62  ? 4.711   57.886 0.819   1.00 0.00  ? 62  VAL A HG23 3  
ATOM   8429  N  N    . MET A 1 63  ? 6.897   54.704 -1.560  1.00 0.00  ? 63  MET A N    3  
ATOM   8430  C  CA   . MET A 1 63  ? 7.713   54.864 -2.802  1.00 0.00  ? 63  MET A CA   3  
ATOM   8431  C  C    . MET A 1 63  ? 6.783   55.036 -4.006  1.00 0.00  ? 63  MET A C    3  
ATOM   8432  O  O    . MET A 1 63  ? 5.749   54.405 -4.100  1.00 0.00  ? 63  MET A O    3  
ATOM   8433  C  CB   . MET A 1 63  ? 8.584   53.622 -3.003  1.00 0.00  ? 63  MET A CB   3  
ATOM   8434  C  CG   . MET A 1 63  ? 7.691   52.389 -3.150  1.00 0.00  ? 63  MET A CG   3  
ATOM   8435  S  SD   . MET A 1 63  ? 8.718   50.899 -3.139  1.00 0.00  ? 63  MET A SD   3  
ATOM   8436  C  CE   . MET A 1 63  ? 7.394   49.711 -2.806  1.00 0.00  ? 63  MET A CE   3  
ATOM   8437  H  H    . MET A 1 63  ? 6.015   54.281 -1.606  1.00 0.00  ? 63  MET A H    3  
ATOM   8438  H  HA   . MET A 1 63  ? 8.346   55.736 -2.714  1.00 0.00  ? 63  MET A HA   3  
ATOM   8439  H  HB2  . MET A 1 63  ? 9.181   53.743 -3.895  1.00 0.00  ? 63  MET A HB2  3  
ATOM   8440  H  HB3  . MET A 1 63  ? 9.232   53.495 -2.150  1.00 0.00  ? 63  MET A HB3  3  
ATOM   8441  H  HG2  . MET A 1 63  ? 6.992   52.351 -2.327  1.00 0.00  ? 63  MET A HG2  3  
ATOM   8442  H  HG3  . MET A 1 63  ? 7.148   52.446 -4.082  1.00 0.00  ? 63  MET A HG3  3  
ATOM   8443  H  HE1  . MET A 1 63  ? 7.809   48.714 -2.760  1.00 0.00  ? 63  MET A HE1  3  
ATOM   8444  H  HE2  . MET A 1 63  ? 6.661   49.757 -3.595  1.00 0.00  ? 63  MET A HE2  3  
ATOM   8445  H  HE3  . MET A 1 63  ? 6.922   49.955 -1.864  1.00 0.00  ? 63  MET A HE3  3  
ATOM   8446  N  N    . ASN A 1 64  ? 7.143   55.889 -4.927  1.00 0.00  ? 64  ASN A N    3  
ATOM   8447  C  CA   . ASN A 1 64  ? 6.281   56.105 -6.124  1.00 0.00  ? 64  ASN A CA   3  
ATOM   8448  C  C    . ASN A 1 64  ? 6.376   54.898 -7.057  1.00 0.00  ? 64  ASN A C    3  
ATOM   8449  O  O    . ASN A 1 64  ? 7.123   53.969 -6.820  1.00 0.00  ? 64  ASN A O    3  
ATOM   8450  C  CB   . ASN A 1 64  ? 6.745   57.354 -6.876  1.00 0.00  ? 64  ASN A CB   3  
ATOM   8451  C  CG   . ASN A 1 64  ? 6.456   58.600 -6.038  1.00 0.00  ? 64  ASN A CG   3  
ATOM   8452  O  OD1  . ASN A 1 64  ? 7.362   59.218 -5.516  1.00 0.00  ? 64  ASN A OD1  3  
ATOM   8453  N  ND2  . ASN A 1 64  ? 5.223   58.999 -5.888  1.00 0.00  ? 64  ASN A ND2  3  
ATOM   8454  H  H    . ASN A 1 64  ? 7.980   56.389 -4.830  1.00 0.00  ? 64  ASN A H    3  
ATOM   8455  H  HA   . ASN A 1 64  ? 5.256   56.237 -5.809  1.00 0.00  ? 64  ASN A HA   3  
ATOM   8456  H  HB2  . ASN A 1 64  ? 7.806   57.285 -7.066  1.00 0.00  ? 64  ASN A HB2  3  
ATOM   8457  H  HB3  . ASN A 1 64  ? 6.216   57.425 -7.815  1.00 0.00  ? 64  ASN A HB3  3  
ATOM   8458  H  HD21 . ASN A 1 64  ? 4.492   58.501 -6.312  1.00 0.00  ? 64  ASN A HD21 3  
ATOM   8459  H  HD22 . ASN A 1 64  ? 5.027   59.796 -5.353  1.00 0.00  ? 64  ASN A HD22 3  
ATOM   8460  N  N    . ARG A 1 65  ? 5.622   54.910 -8.121  1.00 0.00  ? 65  ARG A N    3  
ATOM   8461  C  CA   . ARG A 1 65  ? 5.658   53.773 -9.081  1.00 0.00  ? 65  ARG A CA   3  
ATOM   8462  C  C    . ARG A 1 65  ? 7.085   53.585 -9.605  1.00 0.00  ? 65  ARG A C    3  
ATOM   8463  O  O    . ARG A 1 65  ? 7.454   52.517 -10.052 1.00 0.00  ? 65  ARG A O    3  
ATOM   8464  C  CB   . ARG A 1 65  ? 4.723   54.080 -10.256 1.00 0.00  ? 65  ARG A CB   3  
ATOM   8465  C  CG   . ARG A 1 65  ? 5.042   55.474 -10.808 1.00 0.00  ? 65  ARG A CG   3  
ATOM   8466  C  CD   . ARG A 1 65  ? 4.306   55.688 -12.132 1.00 0.00  ? 65  ARG A CD   3  
ATOM   8467  N  NE   . ARG A 1 65  ? 4.653   54.591 -13.079 1.00 0.00  ? 65  ARG A NE   3  
ATOM   8468  C  CZ   . ARG A 1 65  ? 3.923   54.394 -14.143 1.00 0.00  ? 65  ARG A CZ   3  
ATOM   8469  N  NH1  . ARG A 1 65  ? 2.892   55.160 -14.377 1.00 0.00  ? 65  ARG A NH1  3  
ATOM   8470  N  NH2  . ARG A 1 65  ? 4.223   53.432 -14.971 1.00 0.00  ? 65  ARG A NH2  3  
ATOM   8471  H  H    . ARG A 1 65  ? 5.030   55.673 -8.290  1.00 0.00  ? 65  ARG A H    3  
ATOM   8472  H  HA   . ARG A 1 65  ? 5.331   52.871 -8.586  1.00 0.00  ? 65  ARG A HA   3  
ATOM   8473  H  HB2  . ARG A 1 65  ? 4.867   53.341 -11.032 1.00 0.00  ? 65  ARG A HB2  3  
ATOM   8474  H  HB3  . ARG A 1 65  ? 3.696   54.054 -9.918  1.00 0.00  ? 65  ARG A HB3  3  
ATOM   8475  H  HG2  . ARG A 1 65  ? 4.725   56.222 -10.096 1.00 0.00  ? 65  ARG A HG2  3  
ATOM   8476  H  HG3  . ARG A 1 65  ? 6.105   55.563 -10.973 1.00 0.00  ? 65  ARG A HG3  3  
ATOM   8477  H  HD2  . ARG A 1 65  ? 3.241   55.688 -11.956 1.00 0.00  ? 65  ARG A HD2  3  
ATOM   8478  H  HD3  . ARG A 1 65  ? 4.600   56.636 -12.557 1.00 0.00  ? 65  ARG A HD3  3  
ATOM   8479  H  HE   . ARG A 1 65  ? 5.427   54.018 -12.903 1.00 0.00  ? 65  ARG A HE   3  
ATOM   8480  H  HH11 . ARG A 1 65  ? 2.662   55.897 -13.742 1.00 0.00  ? 65  ARG A HH11 3  
ATOM   8481  H  HH12 . ARG A 1 65  ? 2.332   55.009 -15.191 1.00 0.00  ? 65  ARG A HH12 3  
ATOM   8482  H  HH21 . ARG A 1 65  ? 5.013   52.846 -14.792 1.00 0.00  ? 65  ARG A HH21 3  
ATOM   8483  H  HH22 . ARG A 1 65  ? 3.663   53.281 -15.786 1.00 0.00  ? 65  ARG A HH22 3  
ATOM   8484  N  N    . GLY A 1 66  ? 7.886   54.622 -9.566  1.00 0.00  ? 66  GLY A N    3  
ATOM   8485  C  CA   . GLY A 1 66  ? 9.290   54.520 -10.077 1.00 0.00  ? 66  GLY A CA   3  
ATOM   8486  C  C    . GLY A 1 66  ? 10.277  54.382 -8.914  1.00 0.00  ? 66  GLY A C    3  
ATOM   8487  O  O    . GLY A 1 66  ? 11.353  54.944 -8.945  1.00 0.00  ? 66  GLY A O    3  
ATOM   8488  H  H    . GLY A 1 66  ? 7.560   55.475 -9.211  1.00 0.00  ? 66  GLY A H    3  
ATOM   8489  H  HA2  . GLY A 1 66  ? 9.384   53.661 -10.730 1.00 0.00  ? 66  GLY A HA2  3  
ATOM   8490  H  HA3  . GLY A 1 66  ? 9.529   55.413 -10.634 1.00 0.00  ? 66  GLY A HA3  3  
ATOM   8491  N  N    . ASP A 1 67  ? 9.920   53.646 -7.888  1.00 0.00  ? 67  ASP A N    3  
ATOM   8492  C  CA   . ASP A 1 67  ? 10.836  53.469 -6.722  1.00 0.00  ? 67  ASP A CA   3  
ATOM   8493  C  C    . ASP A 1 67  ? 11.450  54.815 -6.342  1.00 0.00  ? 67  ASP A C    3  
ATOM   8494  O  O    . ASP A 1 67  ? 12.533  55.170 -6.763  1.00 0.00  ? 67  ASP A O    3  
ATOM   8495  C  CB   . ASP A 1 67  ? 11.939  52.453 -7.059  1.00 0.00  ? 67  ASP A CB   3  
ATOM   8496  C  CG   . ASP A 1 67  ? 12.844  52.994 -8.166  1.00 0.00  ? 67  ASP A CG   3  
ATOM   8497  O  OD1  . ASP A 1 67  ? 12.474  52.867 -9.322  1.00 0.00  ? 67  ASP A OD1  3  
ATOM   8498  O  OD2  . ASP A 1 67  ? 13.892  53.527 -7.841  1.00 0.00  ? 67  ASP A OD2  3  
ATOM   8499  H  H    . ASP A 1 67  ? 9.044   53.213 -7.880  1.00 0.00  ? 67  ASP A H    3  
ATOM   8500  H  HA   . ASP A 1 67  ? 10.263  53.099 -5.883  1.00 0.00  ? 67  ASP A HA   3  
ATOM   8501  H  HB2  . ASP A 1 67  ? 12.531  52.263 -6.175  1.00 0.00  ? 67  ASP A HB2  3  
ATOM   8502  H  HB3  . ASP A 1 67  ? 11.485  51.530 -7.389  1.00 0.00  ? 67  ASP A HB3  3  
ATOM   8503  N  N    . ASP A 1 68  ? 10.752  55.561 -5.538  1.00 0.00  ? 68  ASP A N    3  
ATOM   8504  C  CA   . ASP A 1 68  ? 11.270  56.889 -5.106  1.00 0.00  ? 68  ASP A CA   3  
ATOM   8505  C  C    . ASP A 1 68  ? 10.617  57.279 -3.784  1.00 0.00  ? 68  ASP A C    3  
ATOM   8506  O  O    . ASP A 1 68  ? 9.462   57.655 -3.738  1.00 0.00  ? 68  ASP A O    3  
ATOM   8507  C  CB   . ASP A 1 68  ? 10.943  57.940 -6.169  1.00 0.00  ? 68  ASP A CB   3  
ATOM   8508  C  CG   . ASP A 1 68  ? 11.544  57.514 -7.509  1.00 0.00  ? 68  ASP A CG   3  
ATOM   8509  O  OD1  . ASP A 1 68  ? 12.756  57.389 -7.579  1.00 0.00  ? 68  ASP A OD1  3  
ATOM   8510  O  OD2  . ASP A 1 68  ? 10.783  57.320 -8.443  1.00 0.00  ? 68  ASP A OD2  3  
ATOM   8511  H  H    . ASP A 1 68  ? 9.888   55.229 -5.212  1.00 0.00  ? 68  ASP A H    3  
ATOM   8512  H  HA   . ASP A 1 68  ? 12.341  56.834 -4.973  1.00 0.00  ? 68  ASP A HA   3  
ATOM   8513  H  HB2  . ASP A 1 68  ? 9.871   58.032 -6.266  1.00 0.00  ? 68  ASP A HB2  3  
ATOM   8514  H  HB3  . ASP A 1 68  ? 11.361  58.891 -5.875  1.00 0.00  ? 68  ASP A HB3  3  
ATOM   8515  N  N    . THR A 1 69  ? 11.347  57.204 -2.705  1.00 37.95 ? 69  THR A N    3  
ATOM   8516  C  CA   . THR A 1 69  ? 10.772  57.580 -1.390  1.00 36.30 ? 69  THR A CA   3  
ATOM   8517  C  C    . THR A 1 69  ? 10.952  59.095 -1.228  1.00 38.10 ? 69  THR A C    3  
ATOM   8518  O  O    . THR A 1 69  ? 11.883  59.644 -1.780  1.00 39.86 ? 69  THR A O    3  
ATOM   8519  C  CB   . THR A 1 69  ? 11.538  56.831 -0.288  1.00 38.07 ? 69  THR A CB   3  
ATOM   8520  O  OG1  . THR A 1 69  ? 12.820  57.419 -0.122  1.00 39.54 ? 69  THR A OG1  3  
ATOM   8521  C  CG2  . THR A 1 69  ? 11.699  55.361 -0.684  1.00 41.20 ? 69  THR A CG2  3  
ATOM   8522  H  H    . THR A 1 69  ? 12.280  56.910 -2.759  1.00 0.00  ? 69  THR A H    3  
ATOM   8523  H  HA   . THR A 1 69  ? 9.728   57.311 -1.367  1.00 0.00  ? 69  THR A HA   3  
ATOM   8524  H  HB   . THR A 1 69  ? 10.999  56.886 0.641   1.00 0.00  ? 69  THR A HB   3  
ATOM   8525  H  HG1  . THR A 1 69  ? 12.891  58.155 -0.734  1.00 0.00  ? 69  THR A HG1  3  
ATOM   8526  H  HG21 . THR A 1 69  ? 12.276  55.293 -1.594  1.00 0.00  ? 69  THR A HG21 3  
ATOM   8527  H  HG22 . THR A 1 69  ? 10.724  54.924 -0.843  1.00 0.00  ? 69  THR A HG22 3  
ATOM   8528  H  HG23 . THR A 1 69  ? 12.207  54.829 0.106   1.00 0.00  ? 69  THR A HG23 3  
ATOM   8529  N  N    . PRO A 1 70  ? 10.082  59.749 -0.492  1.00 40.33 ? 70  PRO A N    3  
ATOM   8530  C  CA   . PRO A 1 70  ? 10.209  61.201 -0.302  1.00 40.65 ? 70  PRO A CA   3  
ATOM   8531  C  C    . PRO A 1 70  ? 11.636  61.529 0.151   1.00 38.76 ? 70  PRO A C    3  
ATOM   8532  O  O    . PRO A 1 70  ? 12.221  62.504 -0.271  1.00 37.74 ? 70  PRO A O    3  
ATOM   8533  C  CB   . PRO A 1 70  ? 9.160   61.555 0.779   1.00 43.22 ? 70  PRO A CB   3  
ATOM   8534  C  CG   . PRO A 1 70  ? 8.391   60.245 1.123   1.00 40.01 ? 70  PRO A CG   3  
ATOM   8535  C  CD   . PRO A 1 70  ? 8.933   59.131 0.202   1.00 42.85 ? 70  PRO A CD   3  
ATOM   8536  H  HA   . PRO A 1 70  ? 9.983   61.717 -1.223  1.00 0.00  ? 70  PRO A HA   3  
ATOM   8537  H  HB2  . PRO A 1 70  ? 9.649   61.944 1.665   1.00 0.00  ? 70  PRO A HB2  3  
ATOM   8538  H  HB3  . PRO A 1 70  ? 8.467   62.291 0.396   1.00 0.00  ? 70  PRO A HB3  3  
ATOM   8539  H  HG2  . PRO A 1 70  ? 8.564   59.982 2.160   1.00 0.00  ? 70  PRO A HG2  3  
ATOM   8540  H  HG3  . PRO A 1 70  ? 7.330   60.378 0.953   1.00 0.00  ? 70  PRO A HG3  3  
ATOM   8541  H  HD2  . PRO A 1 70  ? 9.248   58.283 0.786   1.00 0.00  ? 70  PRO A HD2  3  
ATOM   8542  H  HD3  . PRO A 1 70  ? 8.184   58.835 -0.518  1.00 0.00  ? 70  PRO A HD3  3  
ATOM   8543  N  N    . LEU A 1 71  ? 12.198  60.720 1.008   1.00 38.12 ? 71  LEU A N    3  
ATOM   8544  C  CA   . LEU A 1 71  ? 13.581  60.988 1.491   1.00 34.17 ? 71  LEU A CA   3  
ATOM   8545  C  C    . LEU A 1 71  ? 14.481  61.256 0.291   1.00 31.24 ? 71  LEU A C    3  
ATOM   8546  O  O    . LEU A 1 71  ? 15.131  62.279 0.200   1.00 28.70 ? 71  LEU A O    3  
ATOM   8547  C  CB   . LEU A 1 71  ? 14.096  59.767 2.255   1.00 31.35 ? 71  LEU A CB   3  
ATOM   8548  C  CG   . LEU A 1 71  ? 15.427  60.100 2.960   1.00 36.03 ? 71  LEU A CG   3  
ATOM   8549  C  CD1  . LEU A 1 71  ? 15.163  60.820 4.292   1.00 30.93 ? 71  LEU A CD1  3  
ATOM   8550  C  CD2  . LEU A 1 71  ? 16.196  58.800 3.230   1.00 33.08 ? 71  LEU A CD2  3  
ATOM   8551  H  H    . LEU A 1 71  ? 11.708  59.938 1.338   1.00 0.00  ? 71  LEU A H    3  
ATOM   8552  H  HA   . LEU A 1 71  ? 13.576  61.850 2.139   1.00 0.00  ? 71  LEU A HA   3  
ATOM   8553  H  HB2  . LEU A 1 71  ? 13.359  59.468 2.986   1.00 0.00  ? 71  LEU A HB2  3  
ATOM   8554  H  HB3  . LEU A 1 71  ? 14.252  58.957 1.556   1.00 0.00  ? 71  LEU A HB3  3  
ATOM   8555  H  HG   . LEU A 1 71  ? 16.022  60.740 2.324   1.00 0.00  ? 71  LEU A HG   3  
ATOM   8556  H  HD11 . LEU A 1 71  ? 14.804  61.819 4.099   1.00 0.00  ? 71  LEU A HD11 3  
ATOM   8557  H  HD12 . LEU A 1 71  ? 16.082  60.874 4.856   1.00 0.00  ? 71  LEU A HD12 3  
ATOM   8558  H  HD13 . LEU A 1 71  ? 14.426  60.275 4.862   1.00 0.00  ? 71  LEU A HD13 3  
ATOM   8559  H  HD21 . LEU A 1 71  ? 16.678  58.473 2.321   1.00 0.00  ? 71  LEU A HD21 3  
ATOM   8560  H  HD22 . LEU A 1 71  ? 15.507  58.039 3.563   1.00 0.00  ? 71  LEU A HD22 3  
ATOM   8561  H  HD23 . LEU A 1 71  ? 16.944  58.969 3.993   1.00 0.00  ? 71  LEU A HD23 3  
ATOM   8562  N  N    . HIS A 1 72  ? 14.507  60.350 -0.640  1.00 31.23 ? 72  HIS A N    3  
ATOM   8563  C  CA   . HIS A 1 72  ? 15.345  60.555 -1.847  1.00 33.99 ? 72  HIS A CA   3  
ATOM   8564  C  C    . HIS A 1 72  ? 14.930  61.873 -2.506  1.00 33.71 ? 72  HIS A C    3  
ATOM   8565  O  O    . HIS A 1 72  ? 15.698  62.810 -2.589  1.00 34.60 ? 72  HIS A O    3  
ATOM   8566  C  CB   . HIS A 1 72  ? 15.121  59.394 -2.821  1.00 37.54 ? 72  HIS A CB   3  
ATOM   8567  C  CG   . HIS A 1 72  ? 15.419  58.088 -2.129  1.00 39.41 ? 72  HIS A CG   3  
ATOM   8568  N  ND1  . HIS A 1 72  ? 14.442  57.131 -1.889  1.00 37.82 ? 72  HIS A ND1  3  
ATOM   8569  C  CD2  . HIS A 1 72  ? 16.585  57.565 -1.629  1.00 43.02 ? 72  HIS A CD2  3  
ATOM   8570  C  CE1  . HIS A 1 72  ? 15.037  56.091 -1.269  1.00 38.43 ? 72  HIS A CE1  3  
ATOM   8571  N  NE2  . HIS A 1 72  ? 16.342  56.303 -1.092  1.00 38.41 ? 72  HIS A NE2  3  
ATOM   8572  H  H    . HIS A 1 72  ? 13.961  59.540 -0.551  1.00 0.00  ? 72  HIS A H    3  
ATOM   8573  H  HA   . HIS A 1 72  ? 16.387  60.600 -1.565  1.00 0.00  ? 72  HIS A HA   3  
ATOM   8574  H  HB2  . HIS A 1 72  ? 14.094  59.398 -3.155  1.00 0.00  ? 72  HIS A HB2  3  
ATOM   8575  H  HB3  . HIS A 1 72  ? 15.776  59.507 -3.672  1.00 0.00  ? 72  HIS A HB3  3  
ATOM   8576  H  HD2  . HIS A 1 72  ? 17.537  58.067 -1.629  1.00 0.00  ? 72  HIS A HD2  3  
ATOM   8577  H  HE1  . HIS A 1 72  ? 14.518  55.206 -0.934  1.00 0.00  ? 72  HIS A HE1  3  
ATOM   8578  H  HE2  . HIS A 1 72  ? 16.988  55.692 -0.680  1.00 0.00  ? 72  HIS A HE2  3  
ATOM   8579  N  N    . LEU A 1 73  ? 13.712  61.947 -2.967  1.00 29.46 ? 73  LEU A N    3  
ATOM   8580  C  CA   . LEU A 1 73  ? 13.223  63.195 -3.620  1.00 30.94 ? 73  LEU A CA   3  
ATOM   8581  C  C    . LEU A 1 73  ? 13.585  64.409 -2.757  1.00 31.79 ? 73  LEU A C    3  
ATOM   8582  O  O    . LEU A 1 73  ? 14.137  65.382 -3.234  1.00 30.31 ? 73  LEU A O    3  
ATOM   8583  C  CB   . LEU A 1 73  ? 11.700  63.113 -3.776  1.00 29.19 ? 73  LEU A CB   3  
ATOM   8584  C  CG   . LEU A 1 73  ? 11.327  61.914 -4.676  1.00 29.25 ? 73  LEU A CG   3  
ATOM   8585  C  CD1  . LEU A 1 73  ? 9.904   61.444 -4.352  1.00 30.59 ? 73  LEU A CD1  3  
ATOM   8586  C  CD2  . LEU A 1 73  ? 11.399  62.324 -6.154  1.00 29.01 ? 73  LEU A CD2  3  
ATOM   8587  H  H    . LEU A 1 73  ? 13.115  61.174 -2.882  1.00 0.00  ? 73  LEU A H    3  
ATOM   8588  H  HA   . LEU A 1 73  ? 13.679  63.294 -4.592  1.00 0.00  ? 73  LEU A HA   3  
ATOM   8589  H  HB2  . LEU A 1 73  ? 11.253  62.987 -2.799  1.00 0.00  ? 73  LEU A HB2  3  
ATOM   8590  H  HB3  . LEU A 1 73  ? 11.335  64.028 -4.219  1.00 0.00  ? 73  LEU A HB3  3  
ATOM   8591  H  HG   . LEU A 1 73  ? 12.015  61.099 -4.496  1.00 0.00  ? 73  LEU A HG   3  
ATOM   8592  H  HD11 . LEU A 1 73  ? 9.912   60.895 -3.422  1.00 0.00  ? 73  LEU A HD11 3  
ATOM   8593  H  HD12 . LEU A 1 73  ? 9.544   60.803 -5.144  1.00 0.00  ? 73  LEU A HD12 3  
ATOM   8594  H  HD13 . LEU A 1 73  ? 9.253   62.301 -4.259  1.00 0.00  ? 73  LEU A HD13 3  
ATOM   8595  H  HD21 . LEU A 1 73  ? 11.059  61.504 -6.770  1.00 0.00  ? 73  LEU A HD21 3  
ATOM   8596  H  HD22 . LEU A 1 73  ? 12.417  62.569 -6.413  1.00 0.00  ? 73  LEU A HD22 3  
ATOM   8597  H  HD23 . LEU A 1 73  ? 10.767  63.184 -6.322  1.00 0.00  ? 73  LEU A HD23 3  
ATOM   8598  N  N    . ALA A 1 74  ? 13.274  64.361 -1.492  1.00 33.77 ? 74  ALA A N    3  
ATOM   8599  C  CA   . ALA A 1 74  ? 13.590  65.508 -0.595  1.00 31.56 ? 74  ALA A CA   3  
ATOM   8600  C  C    . ALA A 1 74  ? 15.090  65.808 -0.641  1.00 32.36 ? 74  ALA A C    3  
ATOM   8601  O  O    . ALA A 1 74  ? 15.510  66.861 -1.076  1.00 33.38 ? 74  ALA A O    3  
ATOM   8602  C  CB   . ALA A 1 74  ? 13.191  65.154 0.839   1.00 31.99 ? 74  ALA A CB   3  
ATOM   8603  H  H    . ALA A 1 74  ? 12.826  63.568 -1.130  1.00 0.00  ? 74  ALA A H    3  
ATOM   8604  H  HA   . ALA A 1 74  ? 13.039  66.379 -0.916  1.00 0.00  ? 74  ALA A HA   3  
ATOM   8605  H  HB1  . ALA A 1 74  ? 13.816  64.349 1.198   1.00 0.00  ? 74  ALA A HB1  3  
ATOM   8606  H  HB2  . ALA A 1 74  ? 12.157  64.844 0.860   1.00 0.00  ? 74  ALA A HB2  3  
ATOM   8607  H  HB3  . ALA A 1 74  ? 13.320  66.018 1.472   1.00 0.00  ? 74  ALA A HB3  3  
ATOM   8608  N  N    . ALA A 1 75  ? 15.898  64.890 -0.189  1.00 0.00  ? 75  ALA A N    3  
ATOM   8609  C  CA   . ALA A 1 75  ? 17.371  65.117 -0.198  1.00 0.00  ? 75  ALA A CA   3  
ATOM   8610  C  C    . ALA A 1 75  ? 17.848  65.364 -1.629  1.00 0.00  ? 75  ALA A C    3  
ATOM   8611  O  O    . ALA A 1 75  ? 18.890  65.948 -1.852  1.00 0.00  ? 75  ALA A O    3  
ATOM   8612  C  CB   . ALA A 1 75  ? 18.078  63.884 0.369   1.00 0.00  ? 75  ALA A CB   3  
ATOM   8613  H  H    . ALA A 1 75  ? 15.536  64.049 0.160   1.00 0.00  ? 75  ALA A H    3  
ATOM   8614  H  HA   . ALA A 1 75  ? 17.606  65.977 0.411   1.00 0.00  ? 75  ALA A HA   3  
ATOM   8615  H  HB1  . ALA A 1 75  ? 17.854  63.026 -0.246  1.00 0.00  ? 75  ALA A HB1  3  
ATOM   8616  H  HB2  . ALA A 1 75  ? 17.734  63.704 1.377   1.00 0.00  ? 75  ALA A HB2  3  
ATOM   8617  H  HB3  . ALA A 1 75  ? 19.144  64.054 0.378   1.00 0.00  ? 75  ALA A HB3  3  
ATOM   8618  N  N    . SER A 1 76  ? 17.109  64.908 -2.601  1.00 0.00  ? 76  SER A N    3  
ATOM   8619  C  CA   . SER A 1 76  ? 17.542  65.103 -4.012  1.00 0.00  ? 76  SER A CA   3  
ATOM   8620  C  C    . SER A 1 76  ? 17.431  66.569 -4.416  1.00 0.00  ? 76  SER A C    3  
ATOM   8621  O  O    . SER A 1 76  ? 18.186  67.048 -5.239  1.00 0.00  ? 76  SER A O    3  
ATOM   8622  C  CB   . SER A 1 76  ? 16.680  64.254 -4.944  1.00 0.00  ? 76  SER A CB   3  
ATOM   8623  O  OG   . SER A 1 76  ? 16.868  62.879 -4.635  1.00 0.00  ? 76  SER A OG   3  
ATOM   8624  H  H    . SER A 1 76  ? 16.278  64.426 -2.404  1.00 0.00  ? 76  SER A H    3  
ATOM   8625  H  HA   . SER A 1 76  ? 18.563  64.801 -4.104  1.00 0.00  ? 76  SER A HA   3  
ATOM   8626  H  HB2  . SER A 1 76  ? 15.645  64.510 -4.811  1.00 0.00  ? 76  SER A HB2  3  
ATOM   8627  H  HB3  . SER A 1 76  ? 16.967  64.445 -5.970  1.00 0.00  ? 76  SER A HB3  3  
ATOM   8628  H  HG   . SER A 1 76  ? 16.621  62.745 -3.717  1.00 0.00  ? 76  SER A HG   3  
ATOM   8629  N  N    . HIS A 1 77  ? 16.499  67.292 -3.869  1.00 0.00  ? 77  HIS A N    3  
ATOM   8630  C  CA   . HIS A 1 77  ? 16.350  68.727 -4.250  1.00 0.00  ? 77  HIS A CA   3  
ATOM   8631  C  C    . HIS A 1 77  ? 17.566  69.526 -3.778  1.00 0.00  ? 77  HIS A C    3  
ATOM   8632  O  O    . HIS A 1 77  ? 18.288  70.093 -4.574  1.00 0.00  ? 77  HIS A O    3  
ATOM   8633  C  CB   . HIS A 1 77  ? 15.087  69.282 -3.585  1.00 0.00  ? 77  HIS A CB   3  
ATOM   8634  C  CG   . HIS A 1 77  ? 14.808  70.673 -4.084  1.00 0.00  ? 77  HIS A CG   3  
ATOM   8635  N  ND1  . HIS A 1 77  ? 13.722  70.962 -4.898  1.00 0.00  ? 77  HIS A ND1  3  
ATOM   8636  C  CD2  . HIS A 1 77  ? 15.451  71.869 -3.879  1.00 0.00  ? 77  HIS A CD2  3  
ATOM   8637  C  CE1  . HIS A 1 77  ? 13.743  72.283 -5.150  1.00 0.00  ? 77  HIS A CE1  3  
ATOM   8638  N  NE2  . HIS A 1 77  ? 14.776  72.882 -4.553  1.00 0.00  ? 77  HIS A NE2  3  
ATOM   8639  H  H    . HIS A 1 77  ? 15.878  66.919 -3.216  1.00 0.00  ? 77  HIS A H    3  
ATOM   8640  H  HA   . HIS A 1 77  ? 16.257  68.810 -5.323  1.00 0.00  ? 77  HIS A HA   3  
ATOM   8641  H  HB2  . HIS A 1 77  ? 14.248  68.643 -3.820  1.00 0.00  ? 77  HIS A HB2  3  
ATOM   8642  H  HB3  . HIS A 1 77  ? 15.228  69.308 -2.514  1.00 0.00  ? 77  HIS A HB3  3  
ATOM   8643  H  HD2  . HIS A 1 77  ? 16.343  72.003 -3.285  1.00 0.00  ? 77  HIS A HD2  3  
ATOM   8644  H  HE1  . HIS A 1 77  ? 13.013  72.796 -5.758  1.00 0.00  ? 77  HIS A HE1  3  
ATOM   8645  H  HE2  . HIS A 1 77  ? 15.001  73.835 -4.586  1.00 0.00  ? 77  HIS A HE2  3  
ATOM   8646  N  N    . GLY A 1 78  ? 17.805  69.569 -2.488  1.00 46.01 ? 78  GLY A N    3  
ATOM   8647  C  CA   . GLY A 1 78  ? 18.984  70.326 -1.958  1.00 42.98 ? 78  GLY A CA   3  
ATOM   8648  C  C    . GLY A 1 78  ? 18.565  71.201 -0.771  1.00 44.14 ? 78  GLY A C    3  
ATOM   8649  O  O    . GLY A 1 78  ? 19.266  72.121 -0.398  1.00 46.10 ? 78  GLY A O    3  
ATOM   8650  H  H    . GLY A 1 78  ? 17.211  69.099 -1.867  1.00 0.00  ? 78  GLY A H    3  
ATOM   8651  H  HA2  . GLY A 1 78  ? 19.733  69.624 -1.632  1.00 0.00  ? 78  GLY A HA2  3  
ATOM   8652  H  HA3  . GLY A 1 78  ? 19.400  70.959 -2.730  1.00 0.00  ? 78  GLY A HA3  3  
ATOM   8653  N  N    . HIS A 1 79  ? 17.437  70.931 -0.169  1.00 0.00  ? 79  HIS A N    3  
ATOM   8654  C  CA   . HIS A 1 79  ? 17.003  71.763 0.994   1.00 0.00  ? 79  HIS A CA   3  
ATOM   8655  C  C    . HIS A 1 79  ? 17.645  71.222 2.275   1.00 0.00  ? 79  HIS A C    3  
ATOM   8656  O  O    . HIS A 1 79  ? 17.067  70.422 2.978   1.00 0.00  ? 79  HIS A O    3  
ATOM   8657  C  CB   . HIS A 1 79  ? 15.478  71.700 1.126   1.00 0.00  ? 79  HIS A CB   3  
ATOM   8658  C  CG   . HIS A 1 79  ? 14.843  72.534 0.047   1.00 0.00  ? 79  HIS A CG   3  
ATOM   8659  N  ND1  . HIS A 1 79  ? 15.591  73.190 -0.919  1.00 0.00  ? 79  HIS A ND1  3  
ATOM   8660  C  CD2  . HIS A 1 79  ? 13.530  72.829 -0.231  1.00 0.00  ? 79  HIS A CD2  3  
ATOM   8661  C  CE1  . HIS A 1 79  ? 14.732  73.841 -1.725  1.00 0.00  ? 79  HIS A CE1  3  
ATOM   8662  N  NE2  . HIS A 1 79  ? 13.465  73.653 -1.349  1.00 0.00  ? 79  HIS A NE2  3  
ATOM   8663  H  H    . HIS A 1 79  ? 16.880  70.185 -0.476  1.00 0.00  ? 79  HIS A H    3  
ATOM   8664  H  HA   . HIS A 1 79  ? 17.310  72.789 0.844   1.00 0.00  ? 79  HIS A HA   3  
ATOM   8665  H  HB2  . HIS A 1 79  ? 15.151  70.675 1.028   1.00 0.00  ? 79  HIS A HB2  3  
ATOM   8666  H  HB3  . HIS A 1 79  ? 15.185  72.080 2.094   1.00 0.00  ? 79  HIS A HB3  3  
ATOM   8667  H  HD2  . HIS A 1 79  ? 12.680  72.474 0.332   1.00 0.00  ? 79  HIS A HD2  3  
ATOM   8668  H  HE1  . HIS A 1 79  ? 15.031  74.441 -2.572  1.00 0.00  ? 79  HIS A HE1  3  
ATOM   8669  H  HE2  . HIS A 1 79  ? 12.665  74.023 -1.777  1.00 0.00  ? 79  HIS A HE2  3  
ATOM   8670  N  N    . ARG A 1 80  ? 18.847  71.645 2.568   1.00 0.00  ? 80  ARG A N    3  
ATOM   8671  C  CA   . ARG A 1 80  ? 19.556  71.154 3.791   1.00 0.00  ? 80  ARG A CA   3  
ATOM   8672  C  C    . ARG A 1 80  ? 18.590  71.042 4.979   1.00 0.00  ? 80  ARG A C    3  
ATOM   8673  O  O    . ARG A 1 80  ? 18.569  70.049 5.677   1.00 0.00  ? 80  ARG A O    3  
ATOM   8674  C  CB   . ARG A 1 80  ? 20.684  72.129 4.144   1.00 0.00  ? 80  ARG A CB   3  
ATOM   8675  C  CG   . ARG A 1 80  ? 20.110  73.535 4.386   1.00 0.00  ? 80  ARG A CG   3  
ATOM   8676  C  CD   . ARG A 1 80  ? 21.229  74.597 4.289   1.00 0.00  ? 80  ARG A CD   3  
ATOM   8677  N  NE   . ARG A 1 80  ? 21.100  75.580 5.413   1.00 0.00  ? 80  ARG A NE   3  
ATOM   8678  C  CZ   . ARG A 1 80  ? 19.949  76.123 5.712   1.00 0.00  ? 80  ARG A CZ   3  
ATOM   8679  N  NH1  . ARG A 1 80  ? 18.902  75.909 4.965   1.00 0.00  ? 80  ARG A NH1  3  
ATOM   8680  N  NH2  . ARG A 1 80  ? 19.856  76.914 6.746   1.00 0.00  ? 80  ARG A NH2  3  
ATOM   8681  H  H    . ARG A 1 80  ? 19.298  72.272 1.965   1.00 0.00  ? 80  ARG A H    3  
ATOM   8682  H  HA   . ARG A 1 80  ? 19.981  70.183 3.587   1.00 0.00  ? 80  ARG A HA   3  
ATOM   8683  H  HB2  . ARG A 1 80  ? 21.186  71.787 5.039   1.00 0.00  ? 80  ARG A HB2  3  
ATOM   8684  H  HB3  . ARG A 1 80  ? 21.392  72.168 3.330   1.00 0.00  ? 80  ARG A HB3  3  
ATOM   8685  H  HG2  . ARG A 1 80  ? 19.349  73.738 3.644   1.00 0.00  ? 80  ARG A HG2  3  
ATOM   8686  H  HG3  . ARG A 1 80  ? 19.668  73.572 5.370   1.00 0.00  ? 80  ARG A HG3  3  
ATOM   8687  H  HD2  . ARG A 1 80  ? 22.194  74.126 4.373   1.00 0.00  ? 80  ARG A HD2  3  
ATOM   8688  H  HD3  . ARG A 1 80  ? 21.168  75.103 3.329   1.00 0.00  ? 80  ARG A HD3  3  
ATOM   8689  H  HE   . ARG A 1 80  ? 21.888  75.796 5.954   1.00 0.00  ? 80  ARG A HE   3  
ATOM   8690  H  HH11 . ARG A 1 80  ? 18.975  75.331 4.157   1.00 0.00  ? 80  ARG A HH11 3  
ATOM   8691  H  HH12 . ARG A 1 80  ? 18.024  76.325 5.203   1.00 0.00  ? 80  ARG A HH12 3  
ATOM   8692  H  HH21 . ARG A 1 80  ? 20.663  77.103 7.305   1.00 0.00  ? 80  ARG A HH21 3  
ATOM   8693  H  HH22 . ARG A 1 80  ? 18.978  77.332 6.978   1.00 0.00  ? 80  ARG A HH22 3  
ATOM   8694  N  N    . ASP A 1 81  ? 17.812  72.055 5.231   1.00 0.00  ? 81  ASP A N    3  
ATOM   8695  C  CA   . ASP A 1 81  ? 16.872  72.005 6.391   1.00 0.00  ? 81  ASP A CA   3  
ATOM   8696  C  C    . ASP A 1 81  ? 16.010  70.737 6.342   1.00 0.00  ? 81  ASP A C    3  
ATOM   8697  O  O    . ASP A 1 81  ? 15.956  69.981 7.291   1.00 0.00  ? 81  ASP A O    3  
ATOM   8698  C  CB   . ASP A 1 81  ? 15.965  73.237 6.361   1.00 0.00  ? 81  ASP A CB   3  
ATOM   8699  C  CG   . ASP A 1 81  ? 15.200  73.276 5.037   1.00 0.00  ? 81  ASP A CG   3  
ATOM   8700  O  OD1  . ASP A 1 81  ? 15.776  73.714 4.055   1.00 0.00  ? 81  ASP A OD1  3  
ATOM   8701  O  OD2  . ASP A 1 81  ? 14.050  72.868 5.028   1.00 0.00  ? 81  ASP A OD2  3  
ATOM   8702  H  H    . ASP A 1 81  ? 17.860  72.862 4.677   1.00 0.00  ? 81  ASP A H    3  
ATOM   8703  H  HA   . ASP A 1 81  ? 17.443  72.008 7.307   1.00 0.00  ? 81  ASP A HA   3  
ATOM   8704  H  HB2  . ASP A 1 81  ? 15.264  73.188 7.181   1.00 0.00  ? 81  ASP A HB2  3  
ATOM   8705  H  HB3  . ASP A 1 81  ? 16.566  74.129 6.453   1.00 0.00  ? 81  ASP A HB3  3  
ATOM   8706  N  N    . ILE A 1 82  ? 15.316  70.508 5.260   1.00 0.00  ? 82  ILE A N    3  
ATOM   8707  C  CA   . ILE A 1 82  ? 14.445  69.296 5.183   1.00 0.00  ? 82  ILE A CA   3  
ATOM   8708  C  C    . ILE A 1 82  ? 15.289  68.035 5.449   1.00 0.00  ? 82  ILE A C    3  
ATOM   8709  O  O    . ILE A 1 82  ? 14.833  67.091 6.064   1.00 0.00  ? 82  ILE A O    3  
ATOM   8710  C  CB   . ILE A 1 82  ? 13.759  69.242 3.789   1.00 0.00  ? 82  ILE A CB   3  
ATOM   8711  C  CG1  . ILE A 1 82  ? 12.340  68.669 3.920   1.00 0.00  ? 82  ILE A CG1  3  
ATOM   8712  C  CG2  . ILE A 1 82  ? 14.552  68.370 2.805   1.00 0.00  ? 82  ILE A CG2  3  
ATOM   8713  C  CD1  . ILE A 1 82  ? 11.649  68.702 2.556   1.00 0.00  ? 82  ILE A CD1  3  
ATOM   8714  H  H    . ILE A 1 82  ? 15.358  71.141 4.514   1.00 0.00  ? 82  ILE A H    3  
ATOM   8715  H  HA   . ILE A 1 82  ? 13.688  69.372 5.953   1.00 0.00  ? 82  ILE A HA   3  
ATOM   8716  H  HB   . ILE A 1 82  ? 13.697  70.246 3.392   1.00 0.00  ? 82  ILE A HB   3  
ATOM   8717  H  HG12 . ILE A 1 82  ? 12.395  67.650 4.272   1.00 0.00  ? 82  ILE A HG12 3  
ATOM   8718  H  HG13 . ILE A 1 82  ? 11.774  69.263 4.621   1.00 0.00  ? 82  ILE A HG13 3  
ATOM   8719  H  HG21 . ILE A 1 82  ? 14.187  68.535 1.802   1.00 0.00  ? 82  ILE A HG21 3  
ATOM   8720  H  HG22 . ILE A 1 82  ? 14.427  67.330 3.067   1.00 0.00  ? 82  ILE A HG22 3  
ATOM   8721  H  HG23 . ILE A 1 82  ? 15.597  68.628 2.854   1.00 0.00  ? 82  ILE A HG23 3  
ATOM   8722  H  HD11 . ILE A 1 82  ? 11.741  69.690 2.129   1.00 0.00  ? 82  ILE A HD11 3  
ATOM   8723  H  HD12 . ILE A 1 82  ? 10.604  68.458 2.676   1.00 0.00  ? 82  ILE A HD12 3  
ATOM   8724  H  HD13 . ILE A 1 82  ? 12.113  67.981 1.899   1.00 0.00  ? 82  ILE A HD13 3  
ATOM   8725  N  N    . VAL A 1 83  ? 16.512  68.018 4.991   1.00 45.62 ? 83  VAL A N    3  
ATOM   8726  C  CA   . VAL A 1 83  ? 17.385  66.825 5.213   1.00 41.66 ? 83  VAL A CA   3  
ATOM   8727  C  C    . VAL A 1 83  ? 17.609  66.612 6.711   1.00 43.89 ? 83  VAL A C    3  
ATOM   8728  O  O    . VAL A 1 83  ? 17.592  65.501 7.200   1.00 46.97 ? 83  VAL A O    3  
ATOM   8729  C  CB   . VAL A 1 83  ? 18.735  67.056 4.532   1.00 38.08 ? 83  VAL A CB   3  
ATOM   8730  C  CG1  . VAL A 1 83  ? 19.614  65.815 4.705   1.00 28.61 ? 83  VAL A CG1  3  
ATOM   8731  C  CG2  . VAL A 1 83  ? 18.515  67.320 3.040   1.00 33.67 ? 83  VAL A CG2  3  
ATOM   8732  H  H    . VAL A 1 83  ? 16.859  68.791 4.499   1.00 0.00  ? 83  VAL A H    3  
ATOM   8733  H  HA   . VAL A 1 83  ? 16.916  65.949 4.792   1.00 0.00  ? 83  VAL A HA   3  
ATOM   8734  H  HB   . VAL A 1 83  ? 19.224  67.908 4.983   1.00 0.00  ? 83  VAL A HB   3  
ATOM   8735  H  HG11 . VAL A 1 83  ? 20.495  65.909 4.087   1.00 0.00  ? 83  VAL A HG11 3  
ATOM   8736  H  HG12 . VAL A 1 83  ? 19.060  64.937 4.411   1.00 0.00  ? 83  VAL A HG12 3  
ATOM   8737  H  HG13 . VAL A 1 83  ? 19.909  65.725 5.740   1.00 0.00  ? 83  VAL A HG13 3  
ATOM   8738  H  HG21 . VAL A 1 83  ? 17.807  66.606 2.649   1.00 0.00  ? 83  VAL A HG21 3  
ATOM   8739  H  HG22 . VAL A 1 83  ? 19.453  67.223 2.514   1.00 0.00  ? 83  VAL A HG22 3  
ATOM   8740  H  HG23 . VAL A 1 83  ? 18.128  68.320 2.906   1.00 0.00  ? 83  VAL A HG23 3  
ATOM   8741  N  N    . GLN A 1 84  ? 17.809  67.669 7.444   1.00 0.00  ? 84  GLN A N    3  
ATOM   8742  C  CA   . GLN A 1 84  ? 18.027  67.527 8.910   1.00 0.00  ? 84  GLN A CA   3  
ATOM   8743  C  C    . GLN A 1 84  ? 16.717  67.101 9.564   1.00 0.00  ? 84  GLN A C    3  
ATOM   8744  O  O    . GLN A 1 84  ? 16.674  66.191 10.368  1.00 0.00  ? 84  GLN A O    3  
ATOM   8745  C  CB   . GLN A 1 84  ? 18.476  68.867 9.495   1.00 0.00  ? 84  GLN A CB   3  
ATOM   8746  C  CG   . GLN A 1 84  ? 19.767  69.318 8.810   1.00 0.00  ? 84  GLN A CG   3  
ATOM   8747  C  CD   . GLN A 1 84  ? 20.920  68.411 9.243   1.00 0.00  ? 84  GLN A CD   3  
ATOM   8748  O  OE1  . GLN A 1 84  ? 21.568  67.797 8.419   1.00 0.00  ? 84  GLN A OE1  3  
ATOM   8749  N  NE2  . GLN A 1 84  ? 21.204  68.299 10.512  1.00 0.00  ? 84  GLN A NE2  3  
ATOM   8750  H  H    . GLN A 1 84  ? 17.804  68.554 7.025   1.00 0.00  ? 84  GLN A H    3  
ATOM   8751  H  HA   . GLN A 1 84  ? 18.783  66.778 9.096   1.00 0.00  ? 84  GLN A HA   3  
ATOM   8752  H  HB2  . GLN A 1 84  ? 17.705  69.606 9.334   1.00 0.00  ? 84  GLN A HB2  3  
ATOM   8753  H  HB3  . GLN A 1 84  ? 18.653  68.757 10.555  1.00 0.00  ? 84  GLN A HB3  3  
ATOM   8754  H  HG2  . GLN A 1 84  ? 19.645  69.260 7.738   1.00 0.00  ? 84  GLN A HG2  3  
ATOM   8755  H  HG3  . GLN A 1 84  ? 19.987  70.336 9.093   1.00 0.00  ? 84  GLN A HG3  3  
ATOM   8756  H  HE21 . GLN A 1 84  ? 20.681  68.793 11.177  1.00 0.00  ? 84  GLN A HE21 3  
ATOM   8757  H  HE22 . GLN A 1 84  ? 21.941  67.720 10.800  1.00 0.00  ? 84  GLN A HE22 3  
ATOM   8758  N  N    . LYS A 1 85  ? 15.649  67.763 9.229   1.00 0.00  ? 85  LYS A N    3  
ATOM   8759  C  CA   . LYS A 1 85  ? 14.337  67.418 9.828   1.00 0.00  ? 85  LYS A CA   3  
ATOM   8760  C  C    . LYS A 1 85  ? 13.966  65.967 9.502   1.00 0.00  ? 85  LYS A C    3  
ATOM   8761  O  O    . LYS A 1 85  ? 13.446  65.256 10.336  1.00 0.00  ? 85  LYS A O    3  
ATOM   8762  C  CB   . LYS A 1 85  ? 13.278  68.371 9.282   1.00 0.00  ? 85  LYS A CB   3  
ATOM   8763  C  CG   . LYS A 1 85  ? 11.866  67.979 9.788   1.00 0.00  ? 85  LYS A CG   3  
ATOM   8764  C  CD   . LYS A 1 85  ? 11.098  67.224 8.695   1.00 0.00  ? 85  LYS A CD   3  
ATOM   8765  C  CE   . LYS A 1 85  ? 9.832   66.601 9.289   1.00 0.00  ? 85  LYS A CE   3  
ATOM   8766  N  NZ   . LYS A 1 85  ? 10.191  65.356 10.023  1.00 0.00  ? 85  LYS A NZ   3  
ATOM   8767  H  H    . LYS A 1 85  ? 15.715  68.501 8.587   1.00 0.00  ? 85  LYS A H    3  
ATOM   8768  H  HA   . LYS A 1 85  ? 14.392  67.540 10.888  1.00 0.00  ? 85  LYS A HA   3  
ATOM   8769  H  HB2  . LYS A 1 85  ? 13.512  69.377 9.608   1.00 0.00  ? 85  LYS A HB2  3  
ATOM   8770  H  HB3  . LYS A 1 85  ? 13.309  68.335 8.215   1.00 0.00  ? 85  LYS A HB3  3  
ATOM   8771  H  HG2  . LYS A 1 85  ? 11.947  67.350 10.665  1.00 0.00  ? 85  LYS A HG2  3  
ATOM   8772  H  HG3  . LYS A 1 85  ? 11.315  68.873 10.048  1.00 0.00  ? 85  LYS A HG3  3  
ATOM   8773  H  HD2  . LYS A 1 85  ? 10.826  67.912 7.908   1.00 0.00  ? 85  LYS A HD2  3  
ATOM   8774  H  HD3  . LYS A 1 85  ? 11.723  66.446 8.290   1.00 0.00  ? 85  LYS A HD3  3  
ATOM   8775  H  HE2  . LYS A 1 85  ? 9.368   67.300 9.969   1.00 0.00  ? 85  LYS A HE2  3  
ATOM   8776  H  HE3  . LYS A 1 85  ? 9.144   66.363 8.494   1.00 0.00  ? 85  LYS A HE3  3  
ATOM   8777  H  HZ1  . LYS A 1 85  ? 10.592  65.603 10.950  1.00 0.00  ? 85  LYS A HZ1  3  
ATOM   8778  H  HZ2  . LYS A 1 85  ? 10.892  64.819 9.473   1.00 0.00  ? 85  LYS A HZ2  3  
ATOM   8779  H  HZ3  . LYS A 1 85  ? 9.339   64.776 10.161  1.00 0.00  ? 85  LYS A HZ3  3  
ATOM   8780  N  N    . LEU A 1 86  ? 14.237  65.507 8.306   1.00 51.35 ? 86  LEU A N    3  
ATOM   8781  C  CA   . LEU A 1 86  ? 13.895  64.094 7.958   1.00 49.20 ? 86  LEU A CA   3  
ATOM   8782  C  C    . LEU A 1 86  ? 14.942  63.154 8.565   1.00 50.55 ? 86  LEU A C    3  
ATOM   8783  O  O    . LEU A 1 86  ? 14.630  62.078 9.036   1.00 53.46 ? 86  LEU A O    3  
ATOM   8784  C  CB   . LEU A 1 86  ? 13.895  63.931 6.424   1.00 45.52 ? 86  LEU A CB   3  
ATOM   8785  C  CG   . LEU A 1 86  ? 12.528  64.339 5.834   1.00 42.66 ? 86  LEU A CG   3  
ATOM   8786  C  CD1  . LEU A 1 86  ? 12.697  64.745 4.366   1.00 46.99 ? 86  LEU A CD1  3  
ATOM   8787  C  CD2  . LEU A 1 86  ? 11.546  63.161 5.911   1.00 42.69 ? 86  LEU A CD2  3  
ATOM   8788  H  H    . LEU A 1 86  ? 14.674  66.073 7.636   1.00 0.00  ? 86  LEU A H    3  
ATOM   8789  H  HA   . LEU A 1 86  ? 12.921  63.851 8.354   1.00 0.00  ? 86  LEU A HA   3  
ATOM   8790  H  HB2  . LEU A 1 86  ? 14.669  64.561 6.008   1.00 0.00  ? 86  LEU A HB2  3  
ATOM   8791  H  HB3  . LEU A 1 86  ? 14.103  62.901 6.166   1.00 0.00  ? 86  LEU A HB3  3  
ATOM   8792  H  HG   . LEU A 1 86  ? 12.131  65.175 6.389   1.00 0.00  ? 86  LEU A HG   3  
ATOM   8793  H  HD11 . LEU A 1 86  ? 13.421  65.543 4.293   1.00 0.00  ? 86  LEU A HD11 3  
ATOM   8794  H  HD12 . LEU A 1 86  ? 11.749  65.082 3.975   1.00 0.00  ? 86  LEU A HD12 3  
ATOM   8795  H  HD13 . LEU A 1 86  ? 13.040  63.895 3.795   1.00 0.00  ? 86  LEU A HD13 3  
ATOM   8796  H  HD21 . LEU A 1 86  ? 11.344  62.921 6.943   1.00 0.00  ? 86  LEU A HD21 3  
ATOM   8797  H  HD22 . LEU A 1 86  ? 11.976  62.300 5.419   1.00 0.00  ? 86  LEU A HD22 3  
ATOM   8798  H  HD23 . LEU A 1 86  ? 10.624  63.430 5.418   1.00 0.00  ? 86  LEU A HD23 3  
ATOM   8799  N  N    . LEU A 1 87  ? 16.182  63.552 8.545   1.00 0.00  ? 87  LEU A N    3  
ATOM   8800  C  CA   . LEU A 1 87  ? 17.257  62.696 9.100   1.00 0.00  ? 87  LEU A CA   3  
ATOM   8801  C  C    . LEU A 1 87  ? 17.151  62.667 10.626  1.00 0.00  ? 87  LEU A C    3  
ATOM   8802  O  O    . LEU A 1 87  ? 17.526  61.705 11.267  1.00 0.00  ? 87  LEU A O    3  
ATOM   8803  C  CB   . LEU A 1 87  ? 18.608  63.297 8.684   1.00 0.00  ? 87  LEU A CB   3  
ATOM   8804  C  CG   . LEU A 1 87  ? 19.770  62.371 9.095   1.00 0.00  ? 87  LEU A CG   3  
ATOM   8805  C  CD1  . LEU A 1 87  ? 20.034  61.333 7.998   1.00 0.00  ? 87  LEU A CD1  3  
ATOM   8806  C  CD2  . LEU A 1 87  ? 21.042  63.203 9.304   1.00 0.00  ? 87  LEU A CD2  3  
ATOM   8807  H  H    . LEU A 1 87  ? 16.411  64.418 8.157   1.00 0.00  ? 87  LEU A H    3  
ATOM   8808  H  HA   . LEU A 1 87  ? 17.167  61.695 8.708   1.00 0.00  ? 87  LEU A HA   3  
ATOM   8809  H  HB2  . LEU A 1 87  ? 18.618  63.436 7.612   1.00 0.00  ? 87  LEU A HB2  3  
ATOM   8810  H  HB3  . LEU A 1 87  ? 18.724  64.258 9.166   1.00 0.00  ? 87  LEU A HB3  3  
ATOM   8811  H  HG   . LEU A 1 87  ? 19.519  61.864 10.013  1.00 0.00  ? 87  LEU A HG   3  
ATOM   8812  H  HD11 . LEU A 1 87  ? 20.685  60.562 8.383   1.00 0.00  ? 87  LEU A HD11 3  
ATOM   8813  H  HD12 . LEU A 1 87  ? 20.508  61.815 7.155   1.00 0.00  ? 87  LEU A HD12 3  
ATOM   8814  H  HD13 . LEU A 1 87  ? 19.100  60.893 7.683   1.00 0.00  ? 87  LEU A HD13 3  
ATOM   8815  H  HD21 . LEU A 1 87  ? 21.168  63.880 8.471   1.00 0.00  ? 87  LEU A HD21 3  
ATOM   8816  H  HD22 . LEU A 1 87  ? 21.897  62.546 9.367   1.00 0.00  ? 87  LEU A HD22 3  
ATOM   8817  H  HD23 . LEU A 1 87  ? 20.955  63.770 10.219  1.00 0.00  ? 87  LEU A HD23 3  
ATOM   8818  N  N    . GLN A 1 88  ? 16.673  63.728 11.216  1.00 0.00  ? 88  GLN A N    3  
ATOM   8819  C  CA   . GLN A 1 88  ? 16.576  63.784 12.701  1.00 0.00  ? 88  GLN A CA   3  
ATOM   8820  C  C    . GLN A 1 88  ? 15.260  63.167 13.179  1.00 0.00  ? 88  GLN A C    3  
ATOM   8821  O  O    . GLN A 1 88  ? 14.989  63.115 14.362  1.00 0.00  ? 88  GLN A O    3  
ATOM   8822  C  CB   . GLN A 1 88  ? 16.654  65.254 13.130  1.00 0.00  ? 88  GLN A CB   3  
ATOM   8823  C  CG   . GLN A 1 88  ? 16.380  65.387 14.633  1.00 0.00  ? 88  GLN A CG   3  
ATOM   8824  C  CD   . GLN A 1 88  ? 16.947  66.713 15.146  1.00 0.00  ? 88  GLN A CD   3  
ATOM   8825  O  OE1  . GLN A 1 88  ? 16.955  66.967 16.334  1.00 0.00  ? 88  GLN A OE1  3  
ATOM   8826  N  NE2  . GLN A 1 88  ? 17.424  67.572 14.291  1.00 0.00  ? 88  GLN A NE2  3  
ATOM   8827  H  H    . GLN A 1 88  ? 16.404  64.508 10.687  1.00 0.00  ? 88  GLN A H    3  
ATOM   8828  H  HA   . GLN A 1 88  ? 17.403  63.244 13.138  1.00 0.00  ? 88  GLN A HA   3  
ATOM   8829  H  HB2  . GLN A 1 88  ? 17.641  65.631 12.905  1.00 0.00  ? 88  GLN A HB2  3  
ATOM   8830  H  HB3  . GLN A 1 88  ? 15.920  65.825 12.581  1.00 0.00  ? 88  GLN A HB3  3  
ATOM   8831  H  HG2  . GLN A 1 88  ? 15.316  65.367 14.807  1.00 0.00  ? 88  GLN A HG2  3  
ATOM   8832  H  HG3  . GLN A 1 88  ? 16.849  64.573 15.159  1.00 0.00  ? 88  GLN A HG3  3  
ATOM   8833  H  HE21 . GLN A 1 88  ? 17.415  67.361 13.334  1.00 0.00  ? 88  GLN A HE21 3  
ATOM   8834  H  HE22 . GLN A 1 88  ? 17.790  68.425 14.603  1.00 0.00  ? 88  GLN A HE22 3  
ATOM   8835  N  N    . TYR A 1 89  ? 14.439  62.686 12.280  1.00 0.00  ? 89  TYR A N    3  
ATOM   8836  C  CA   . TYR A 1 89  ? 13.144  62.070 12.706  1.00 0.00  ? 89  TYR A CA   3  
ATOM   8837  C  C    . TYR A 1 89  ? 13.319  60.550 12.850  1.00 0.00  ? 89  TYR A C    3  
ATOM   8838  O  O    . TYR A 1 89  ? 13.203  60.009 13.932  1.00 0.00  ? 89  TYR A O    3  
ATOM   8839  C  CB   . TYR A 1 89  ? 12.056  62.382 11.650  1.00 0.00  ? 89  TYR A CB   3  
ATOM   8840  C  CG   . TYR A 1 89  ? 11.255  63.602 12.069  1.00 0.00  ? 89  TYR A CG   3  
ATOM   8841  C  CD1  . TYR A 1 89  ? 11.916  64.745 12.533  1.00 0.00  ? 89  TYR A CD1  3  
ATOM   8842  C  CD2  . TYR A 1 89  ? 9.854   63.584 11.997  1.00 0.00  ? 89  TYR A CD2  3  
ATOM   8843  C  CE1  . TYR A 1 89  ? 11.180  65.870 12.924  1.00 0.00  ? 89  TYR A CE1  3  
ATOM   8844  C  CE2  . TYR A 1 89  ? 9.119   64.710 12.389  1.00 0.00  ? 89  TYR A CE2  3  
ATOM   8845  C  CZ   . TYR A 1 89  ? 9.782   65.853 12.852  1.00 0.00  ? 89  TYR A CZ   3  
ATOM   8846  O  OH   . TYR A 1 89  ? 9.057   66.961 13.238  1.00 0.00  ? 89  TYR A OH   3  
ATOM   8847  H  H    . TYR A 1 89  ? 14.671  62.719 11.329  1.00 0.00  ? 89  TYR A H    3  
ATOM   8848  H  HA   . TYR A 1 89  ? 12.848  62.478 13.663  1.00 0.00  ? 89  TYR A HA   3  
ATOM   8849  H  HB2  . TYR A 1 89  ? 12.530  62.579 10.700  1.00 0.00  ? 89  TYR A HB2  3  
ATOM   8850  H  HB3  . TYR A 1 89  ? 11.388  61.537 11.545  1.00 0.00  ? 89  TYR A HB3  3  
ATOM   8851  H  HD1  . TYR A 1 89  ? 12.994  64.760 12.590  1.00 0.00  ? 89  TYR A HD1  3  
ATOM   8852  H  HD2  . TYR A 1 89  ? 9.341   62.704 11.639  1.00 0.00  ? 89  TYR A HD2  3  
ATOM   8853  H  HE1  . TYR A 1 89  ? 11.691  66.752 13.281  1.00 0.00  ? 89  TYR A HE1  3  
ATOM   8854  H  HE2  . TYR A 1 89  ? 8.041   64.696 12.334  1.00 0.00  ? 89  TYR A HE2  3  
ATOM   8855  H  HH   . TYR A 1 89  ? 9.424   67.727 12.790  1.00 0.00  ? 89  TYR A HH   3  
ATOM   8856  N  N    . LYS A 1 90  ? 13.576  59.858 11.764  1.00 0.00  ? 90  LYS A N    3  
ATOM   8857  C  CA   . LYS A 1 90  ? 13.737  58.365 11.823  1.00 0.00  ? 90  LYS A CA   3  
ATOM   8858  C  C    . LYS A 1 90  ? 15.059  57.944 11.181  1.00 0.00  ? 90  LYS A C    3  
ATOM   8859  O  O    . LYS A 1 90  ? 15.336  56.771 11.030  1.00 0.00  ? 90  LYS A O    3  
ATOM   8860  C  CB   . LYS A 1 90  ? 12.588  57.704 11.055  1.00 0.00  ? 90  LYS A CB   3  
ATOM   8861  C  CG   . LYS A 1 90  ? 11.211  58.210 11.582  1.00 0.00  ? 90  LYS A CG   3  
ATOM   8862  C  CD   . LYS A 1 90  ? 10.412  58.896 10.460  1.00 0.00  ? 90  LYS A CD   3  
ATOM   8863  C  CE   . LYS A 1 90  ? 9.799   57.834 9.538   1.00 0.00  ? 90  LYS A CE   3  
ATOM   8864  N  NZ   . LYS A 1 90  ? 10.722  56.668 9.439   1.00 0.00  ? 90  LYS A NZ   3  
ATOM   8865  H  H    . LYS A 1 90  ? 13.648  60.319 10.903  1.00 0.00  ? 90  LYS A H    3  
ATOM   8866  H  HA   . LYS A 1 90  ? 13.720  58.027 12.847  1.00 0.00  ? 90  LYS A HA   3  
ATOM   8867  H  HB2  . LYS A 1 90  ? 12.697  57.928 10.003  1.00 0.00  ? 90  LYS A HB2  3  
ATOM   8868  H  HB3  . LYS A 1 90  ? 12.656  56.635 11.191  1.00 0.00  ? 90  LYS A HB3  3  
ATOM   8869  H  HG2  . LYS A 1 90  ? 10.640  57.372 11.955  1.00 0.00  ? 90  LYS A HG2  3  
ATOM   8870  H  HG3  . LYS A 1 90  ? 11.357  58.915 12.388  1.00 0.00  ? 90  LYS A HG3  3  
ATOM   8871  H  HD2  . LYS A 1 90  ? 9.625   59.491 10.899  1.00 0.00  ? 90  LYS A HD2  3  
ATOM   8872  H  HD3  . LYS A 1 90  ? 11.064  59.538 9.887   1.00 0.00  ? 90  LYS A HD3  3  
ATOM   8873  H  HE2  . LYS A 1 90  ? 8.852   57.507 9.944   1.00 0.00  ? 90  LYS A HE2  3  
ATOM   8874  H  HE3  . LYS A 1 90  ? 9.642   58.253 8.556   1.00 0.00  ? 90  LYS A HE3  3  
ATOM   8875  H  HZ1  . LYS A 1 90  ? 10.258  55.902 8.912   1.00 0.00  ? 90  LYS A HZ1  3  
ATOM   8876  H  HZ2  . LYS A 1 90  ? 10.965  56.336 10.395  1.00 0.00  ? 90  LYS A HZ2  3  
ATOM   8877  H  HZ3  . LYS A 1 90  ? 11.588  56.953 8.939   1.00 0.00  ? 90  LYS A HZ3  3  
ATOM   8878  N  N    . ALA A 1 91  ? 15.878  58.879 10.807  1.00 0.00  ? 91  ALA A N    3  
ATOM   8879  C  CA   . ALA A 1 91  ? 17.182  58.516 10.181  1.00 0.00  ? 91  ALA A CA   3  
ATOM   8880  C  C    . ALA A 1 91  ? 16.952  57.492 9.065   1.00 0.00  ? 91  ALA A C    3  
ATOM   8881  O  O    . ALA A 1 91  ? 17.578  56.451 9.024   1.00 0.00  ? 91  ALA A O    3  
ATOM   8882  C  CB   . ALA A 1 91  ? 18.107  57.915 11.241  1.00 0.00  ? 91  ALA A CB   3  
ATOM   8883  H  H    . ALA A 1 91  ? 15.646  59.820 10.943  1.00 0.00  ? 91  ALA A H    3  
ATOM   8884  H  HA   . ALA A 1 91  ? 17.640  59.401 9.766   1.00 0.00  ? 91  ALA A HA   3  
ATOM   8885  H  HB1  . ALA A 1 91  ? 17.670  57.005 11.626  1.00 0.00  ? 91  ALA A HB1  3  
ATOM   8886  H  HB2  . ALA A 1 91  ? 18.237  58.621 12.047  1.00 0.00  ? 91  ALA A HB2  3  
ATOM   8887  H  HB3  . ALA A 1 91  ? 19.067  57.694 10.798  1.00 0.00  ? 91  ALA A HB3  3  
ATOM   8888  N  N    . ASP A 1 92  ? 16.065  57.786 8.155   1.00 0.00  ? 92  ASP A N    3  
ATOM   8889  C  CA   . ASP A 1 92  ? 15.796  56.840 7.033   1.00 0.00  ? 92  ASP A CA   3  
ATOM   8890  C  C    . ASP A 1 92  ? 16.952  56.907 6.028   1.00 0.00  ? 92  ASP A C    3  
ATOM   8891  O  O    . ASP A 1 92  ? 16.792  56.626 4.859   1.00 0.00  ? 92  ASP A O    3  
ATOM   8892  C  CB   . ASP A 1 92  ? 14.488  57.234 6.341   1.00 0.00  ? 92  ASP A CB   3  
ATOM   8893  C  CG   . ASP A 1 92  ? 14.018  56.088 5.443   1.00 0.00  ? 92  ASP A CG   3  
ATOM   8894  O  OD1  . ASP A 1 92  ? 13.367  55.191 5.952   1.00 0.00  ? 92  ASP A OD1  3  
ATOM   8895  O  OD2  . ASP A 1 92  ? 14.316  56.128 4.260   1.00 0.00  ? 92  ASP A OD2  3  
ATOM   8896  H  H    . ASP A 1 92  ? 15.579  58.635 8.208   1.00 0.00  ? 92  ASP A H    3  
ATOM   8897  H  HA   . ASP A 1 92  ? 15.712  55.835 7.420   1.00 0.00  ? 92  ASP A HA   3  
ATOM   8898  H  HB2  . ASP A 1 92  ? 13.735  57.439 7.088   1.00 0.00  ? 92  ASP A HB2  3  
ATOM   8899  H  HB3  . ASP A 1 92  ? 14.650  58.116 5.741   1.00 0.00  ? 92  ASP A HB3  3  
ATOM   8900  N  N    . ILE A 1 93  ? 18.127  57.217 6.494   1.00 0.00  ? 93  ILE A N    3  
ATOM   8901  C  CA   . ILE A 1 93  ? 19.315  57.243 5.592   1.00 0.00  ? 93  ILE A CA   3  
ATOM   8902  C  C    . ILE A 1 93  ? 19.775  55.805 5.370   1.00 0.00  ? 93  ILE A C    3  
ATOM   8903  O  O    . ILE A 1 93  ? 20.321  55.465 4.339   1.00 0.00  ? 93  ILE A O    3  
ATOM   8904  C  CB   . ILE A 1 93  ? 20.429  58.091 6.239   1.00 0.00  ? 93  ILE A CB   3  
ATOM   8905  C  CG1  . ILE A 1 93  ? 21.818  57.764 5.611   1.00 0.00  ? 93  ILE A CG1  3  
ATOM   8906  C  CG2  . ILE A 1 93  ? 20.440  57.853 7.756   1.00 0.00  ? 93  ILE A CG2  3  
ATOM   8907  C  CD1  . ILE A 1 93  ? 22.584  56.701 6.425   1.00 0.00  ? 93  ILE A CD1  3  
ATOM   8908  H  H    . ILE A 1 93  ? 18.241  57.344 7.458   1.00 0.00  ? 93  ILE A H    3  
ATOM   8909  H  HA   . ILE A 1 93  ? 19.039  57.674 4.633   1.00 0.00  ? 93  ILE A HA   3  
ATOM   8910  H  HB   . ILE A 1 93  ? 20.201  59.136 6.064   1.00 0.00  ? 93  ILE A HB   3  
ATOM   8911  H  HG12 . ILE A 1 93  ? 21.682  57.402 4.602   1.00 0.00  ? 93  ILE A HG12 3  
ATOM   8912  H  HG13 . ILE A 1 93  ? 22.411  58.669 5.576   1.00 0.00  ? 93  ILE A HG13 3  
ATOM   8913  H  HG21 . ILE A 1 93  ? 20.342  56.796 7.955   1.00 0.00  ? 93  ILE A HG21 3  
ATOM   8914  H  HG22 . ILE A 1 93  ? 19.616  58.383 8.210   1.00 0.00  ? 93  ILE A HG22 3  
ATOM   8915  H  HG23 . ILE A 1 93  ? 21.370  58.212 8.170   1.00 0.00  ? 93  ILE A HG23 3  
ATOM   8916  H  HD11 . ILE A 1 93  ? 23.080  57.178 7.259   1.00 0.00  ? 93  ILE A HD11 3  
ATOM   8917  H  HD12 . ILE A 1 93  ? 23.321  56.229 5.793   1.00 0.00  ? 93  ILE A HD12 3  
ATOM   8918  H  HD13 . ILE A 1 93  ? 21.901  55.953 6.794   1.00 0.00  ? 93  ILE A HD13 3  
ATOM   8919  N  N    . ASN A 1 94  ? 19.577  54.962 6.349   1.00 0.00  ? 94  ASN A N    3  
ATOM   8920  C  CA   . ASN A 1 94  ? 20.023  53.549 6.214   1.00 0.00  ? 94  ASN A CA   3  
ATOM   8921  C  C    . ASN A 1 94  ? 18.993  52.739 5.433   1.00 0.00  ? 94  ASN A C    3  
ATOM   8922  O  O    . ASN A 1 94  ? 19.228  51.595 5.099   1.00 0.00  ? 94  ASN A O    3  
ATOM   8923  C  CB   . ASN A 1 94  ? 20.197  52.936 7.606   1.00 0.00  ? 94  ASN A CB   3  
ATOM   8924  C  CG   . ASN A 1 94  ? 18.872  53.015 8.367   1.00 0.00  ? 94  ASN A CG   3  
ATOM   8925  O  OD1  . ASN A 1 94  ? 18.099  52.077 8.364   1.00 0.00  ? 94  ASN A OD1  3  
ATOM   8926  N  ND2  . ASN A 1 94  ? 18.575  54.102 9.026   1.00 0.00  ? 94  ASN A ND2  3  
ATOM   8927  H  H    . ASN A 1 94  ? 19.149  55.265 7.178   1.00 0.00  ? 94  ASN A H    3  
ATOM   8928  H  HA   . ASN A 1 94  ? 20.964  53.520 5.693   1.00 0.00  ? 94  ASN A HA   3  
ATOM   8929  H  HB2  . ASN A 1 94  ? 20.497  51.903 7.509   1.00 0.00  ? 94  ASN A HB2  3  
ATOM   8930  H  HB3  . ASN A 1 94  ? 20.954  53.483 8.148   1.00 0.00  ? 94  ASN A HB3  3  
ATOM   8931  H  HD21 . ASN A 1 94  ? 19.199  54.858 9.029   1.00 0.00  ? 94  ASN A HD21 3  
ATOM   8932  H  HD22 . ASN A 1 94  ? 17.729  54.162 9.517   1.00 0.00  ? 94  ASN A HD22 3  
ATOM   8933  N  N    . ALA A 1 95  ? 17.857  53.313 5.124   1.00 47.14 ? 95  ALA A N    3  
ATOM   8934  C  CA   . ALA A 1 95  ? 16.815  52.569 4.349   1.00 47.00 ? 95  ALA A CA   3  
ATOM   8935  C  C    . ALA A 1 95  ? 16.807  53.097 2.915   1.00 47.76 ? 95  ALA A C    3  
ATOM   8936  O  O    . ALA A 1 95  ? 16.232  54.126 2.621   1.00 52.93 ? 95  ALA A O    3  
ATOM   8937  C  CB   . ALA A 1 95  ? 15.444  52.803 4.988   1.00 42.03 ? 95  ALA A CB   3  
ATOM   8938  H  H    . ALA A 1 95  ? 17.663  54.234 5.391   1.00 0.00  ? 95  ALA A H    3  
ATOM   8939  H  HA   . ALA A 1 95  ? 17.033  51.509 4.342   1.00 0.00  ? 95  ALA A HA   3  
ATOM   8940  H  HB1  . ALA A 1 95  ? 15.361  52.213 5.889   1.00 0.00  ? 95  ALA A HB1  3  
ATOM   8941  H  HB2  . ALA A 1 95  ? 14.669  52.512 4.294   1.00 0.00  ? 95  ALA A HB2  3  
ATOM   8942  H  HB3  . ALA A 1 95  ? 15.336  53.849 5.232   1.00 0.00  ? 95  ALA A HB3  3  
ATOM   8943  N  N    . VAL A 1 96  ? 17.450  52.400 2.027   1.00 0.00  ? 96  VAL A N    3  
ATOM   8944  C  CA   . VAL A 1 96  ? 17.507  52.841 0.605   1.00 0.00  ? 96  VAL A CA   3  
ATOM   8945  C  C    . VAL A 1 96  ? 16.204  52.436 -0.097  1.00 0.00  ? 96  VAL A C    3  
ATOM   8946  O  O    . VAL A 1 96  ? 15.298  51.908 0.517   1.00 0.00  ? 96  VAL A O    3  
ATOM   8947  C  CB   . VAL A 1 96  ? 18.731  52.185 -0.085  1.00 0.00  ? 96  VAL A CB   3  
ATOM   8948  C  CG1  . VAL A 1 96  ? 19.350  53.139 -1.116  1.00 0.00  ? 96  VAL A CG1  3  
ATOM   8949  C  CG2  . VAL A 1 96  ? 19.793  51.840 0.966   1.00 0.00  ? 96  VAL A CG2  3  
ATOM   8950  H  H    . VAL A 1 96  ? 17.905  51.577 2.294   1.00 0.00  ? 96  VAL A H    3  
ATOM   8951  H  HA   . VAL A 1 96  ? 17.600  53.918 0.578   1.00 0.00  ? 96  VAL A HA   3  
ATOM   8952  H  HB   . VAL A 1 96  ? 18.423  51.276 -0.587  1.00 0.00  ? 96  VAL A HB   3  
ATOM   8953  H  HG11 . VAL A 1 96  ? 18.692  53.230 -1.965  1.00 0.00  ? 96  VAL A HG11 3  
ATOM   8954  H  HG12 . VAL A 1 96  ? 20.301  52.746 -1.437  1.00 0.00  ? 96  VAL A HG12 3  
ATOM   8955  H  HG13 . VAL A 1 96  ? 19.502  54.110 -0.670  1.00 0.00  ? 96  VAL A HG13 3  
ATOM   8956  H  HG21 . VAL A 1 96  ? 19.471  50.981 1.536   1.00 0.00  ? 96  VAL A HG21 3  
ATOM   8957  H  HG22 . VAL A 1 96  ? 19.929  52.681 1.630   1.00 0.00  ? 96  VAL A HG22 3  
ATOM   8958  H  HG23 . VAL A 1 96  ? 20.729  51.615 0.476   1.00 0.00  ? 96  VAL A HG23 3  
ATOM   8959  N  N    . ASN A 1 97  ? 16.120  52.637 -1.386  1.00 45.59 ? 97  ASN A N    3  
ATOM   8960  C  CA   . ASN A 1 97  ? 14.892  52.213 -2.129  1.00 43.57 ? 97  ASN A CA   3  
ATOM   8961  C  C    . ASN A 1 97  ? 15.121  50.787 -2.635  1.00 42.16 ? 97  ASN A C    3  
ATOM   8962  O  O    . ASN A 1 97  ? 15.404  49.892 -1.863  1.00 42.44 ? 97  ASN A O    3  
ATOM   8963  C  CB   . ASN A 1 97  ? 14.634  53.145 -3.318  1.00 45.87 ? 97  ASN A CB   3  
ATOM   8964  C  CG   . ASN A 1 97  ? 15.913  53.309 -4.136  1.00 46.86 ? 97  ASN A CG   3  
ATOM   8965  O  OD1  . ASN A 1 97  ? 15.938  53.012 -5.313  1.00 49.23 ? 97  ASN A OD1  3  
ATOM   8966  N  ND2  . ASN A 1 97  ? 16.983  53.772 -3.557  1.00 47.99 ? 97  ASN A ND2  3  
ATOM   8967  H  H    . ASN A 1 97  ? 16.888  53.003 -1.870  1.00 0.00  ? 97  ASN A H    3  
ATOM   8968  H  HA   . ASN A 1 97  ? 14.037  52.227 -1.465  1.00 0.00  ? 97  ASN A HA   3  
ATOM   8969  H  HB2  . ASN A 1 97  ? 13.859  52.724 -3.943  1.00 0.00  ? 97  ASN A HB2  3  
ATOM   8970  H  HB3  . ASN A 1 97  ? 14.315  54.110 -2.959  1.00 0.00  ? 97  ASN A HB3  3  
ATOM   8971  H  HD21 . ASN A 1 97  ? 16.964  54.008 -2.604  1.00 0.00  ? 97  ASN A HD21 3  
ATOM   8972  H  HD22 . ASN A 1 97  ? 17.805  53.891 -4.073  1.00 0.00  ? 97  ASN A HD22 3  
ATOM   8973  N  N    . GLU A 1 98  ? 15.005  50.566 -3.922  1.00 0.00  ? 98  GLU A N    3  
ATOM   8974  C  CA   . GLU A 1 98  ? 15.220  49.196 -4.490  1.00 0.00  ? 98  GLU A CA   3  
ATOM   8975  C  C    . GLU A 1 98  ? 16.348  49.255 -5.524  1.00 0.00  ? 98  GLU A C    3  
ATOM   8976  O  O    . GLU A 1 98  ? 16.757  48.247 -6.068  1.00 0.00  ? 98  GLU A O    3  
ATOM   8977  C  CB   . GLU A 1 98  ? 13.928  48.724 -5.166  1.00 0.00  ? 98  GLU A CB   3  
ATOM   8978  C  CG   . GLU A 1 98  ? 12.730  49.102 -4.294  1.00 0.00  ? 98  GLU A CG   3  
ATOM   8979  C  CD   . GLU A 1 98  ? 11.491  48.339 -4.767  1.00 0.00  ? 98  GLU A CD   3  
ATOM   8980  O  OE1  . GLU A 1 98  ? 11.554  47.122 -4.821  1.00 0.00  ? 98  GLU A OE1  3  
ATOM   8981  O  OE2  . GLU A 1 98  ? 10.501  48.985 -5.069  1.00 0.00  ? 98  GLU A OE2  3  
ATOM   8982  H  H    . GLU A 1 98  ? 14.771  51.300 -4.525  1.00 0.00  ? 98  GLU A H    3  
ATOM   8983  H  HA   . GLU A 1 98  ? 15.490  48.500 -3.708  1.00 0.00  ? 98  GLU A HA   3  
ATOM   8984  H  HB2  . GLU A 1 98  ? 13.831  49.197 -6.134  1.00 0.00  ? 98  GLU A HB2  3  
ATOM   8985  H  HB3  . GLU A 1 98  ? 13.957  47.652 -5.289  1.00 0.00  ? 98  GLU A HB3  3  
ATOM   8986  H  HG2  . GLU A 1 98  ? 12.939  48.848 -3.265  1.00 0.00  ? 98  GLU A HG2  3  
ATOM   8987  H  HG3  . GLU A 1 98  ? 12.547  50.163 -4.372  1.00 0.00  ? 98  GLU A HG3  3  
ATOM   8988  N  N    . HIS A 1 99  ? 16.854  50.433 -5.798  1.00 0.00  ? 99  HIS A N    3  
ATOM   8989  C  CA   . HIS A 1 99  ? 17.960  50.582 -6.796  1.00 0.00  ? 99  HIS A CA   3  
ATOM   8990  C  C    . HIS A 1 99  ? 19.277  50.859 -6.067  1.00 0.00  ? 99  HIS A C    3  
ATOM   8991  O  O    . HIS A 1 99  ? 20.338  50.850 -6.660  1.00 0.00  ? 99  HIS A O    3  
ATOM   8992  C  CB   . HIS A 1 99  ? 17.643  51.755 -7.726  1.00 0.00  ? 99  HIS A CB   3  
ATOM   8993  C  CG   . HIS A 1 99  ? 16.396  51.449 -8.509  1.00 0.00  ? 99  HIS A CG   3  
ATOM   8994  N  ND1  . HIS A 1 99  ? 15.439  50.555 -8.053  1.00 0.00  ? 99  HIS A ND1  3  
ATOM   8995  C  CD2  . HIS A 1 99  ? 15.935  51.908 -9.718  1.00 0.00  ? 99  HIS A CD2  3  
ATOM   8996  C  CE1  . HIS A 1 99  ? 14.459  50.504 -8.974  1.00 0.00  ? 99  HIS A CE1  3  
ATOM   8997  N  NE2  . HIS A 1 99  ? 14.714  51.310 -10.008 1.00 0.00  ? 99  HIS A NE2  3  
ATOM   8998  H  H    . HIS A 1 99  ? 16.508  51.228 -5.341  1.00 0.00  ? 99  HIS A H    3  
ATOM   8999  H  HA   . HIS A 1 99  ? 18.058  49.678 -7.383  1.00 0.00  ? 99  HIS A HA   3  
ATOM   9000  H  HB2  . HIS A 1 99  ? 17.491  52.648 -7.138  1.00 0.00  ? 99  HIS A HB2  3  
ATOM   9001  H  HB3  . HIS A 1 99  ? 18.467  51.908 -8.407  1.00 0.00  ? 99  HIS A HB3  3  
ATOM   9002  H  HD2  . HIS A 1 99  ? 16.443  52.624 -10.347 1.00 0.00  ? 99  HIS A HD2  3  
ATOM   9003  H  HE1  . HIS A 1 99  ? 13.577  49.888 -8.888  1.00 0.00  ? 99  HIS A HE1  3  
ATOM   9004  H  HE2  . HIS A 1 99  ? 14.152  51.444 -10.800 1.00 0.00  ? 99  HIS A HE2  3  
ATOM   9005  N  N    . GLY A 1 100 ? 19.221  51.110 -4.785  1.00 45.39 ? 100 GLY A N    3  
ATOM   9006  C  CA   . GLY A 1 100 ? 20.471  51.393 -4.016  1.00 47.70 ? 100 GLY A CA   3  
ATOM   9007  C  C    . GLY A 1 100 ? 20.726  52.904 -3.993  1.00 45.14 ? 100 GLY A C    3  
ATOM   9008  O  O    . GLY A 1 100 ? 21.849  53.356 -3.881  1.00 48.55 ? 100 GLY A O    3  
ATOM   9009  H  H    . GLY A 1 100 ? 18.355  51.115 -4.325  1.00 0.00  ? 100 GLY A H    3  
ATOM   9010  H  HA2  . GLY A 1 100 ? 20.360  51.029 -3.005  1.00 0.00  ? 100 GLY A HA2  3  
ATOM   9011  H  HA3  . GLY A 1 100 ? 21.307  50.898 -4.485  1.00 0.00  ? 100 GLY A HA3  3  
ATOM   9012  N  N    . ASN A 1 101 ? 19.688  53.686 -4.116  1.00 0.00  ? 101 ASN A N    3  
ATOM   9013  C  CA   . ASN A 1 101 ? 19.857  55.172 -4.120  1.00 0.00  ? 101 ASN A CA   3  
ATOM   9014  C  C    . ASN A 1 101 ? 19.884  55.724 -2.686  1.00 0.00  ? 101 ASN A C    3  
ATOM   9015  O  O    . ASN A 1 101 ? 18.859  55.908 -2.057  1.00 0.00  ? 101 ASN A O    3  
ATOM   9016  C  CB   . ASN A 1 101 ? 18.703  55.818 -4.895  1.00 0.00  ? 101 ASN A CB   3  
ATOM   9017  C  CG   . ASN A 1 101 ? 18.367  54.962 -6.118  1.00 0.00  ? 101 ASN A CG   3  
ATOM   9018  O  OD1  . ASN A 1 101 ? 17.234  54.923 -6.554  1.00 0.00  ? 101 ASN A OD1  3  
ATOM   9019  N  ND2  . ASN A 1 101 ? 19.312  54.269 -6.693  1.00 0.00  ? 101 ASN A ND2  3  
ATOM   9020  H  H    . ASN A 1 101 ? 18.801  53.284 -4.222  1.00 0.00  ? 101 ASN A H    3  
ATOM   9021  H  HA   . ASN A 1 101 ? 20.789  55.421 -4.609  1.00 0.00  ? 101 ASN A HA   3  
ATOM   9022  H  HB2  . ASN A 1 101 ? 17.833  55.895 -4.259  1.00 0.00  ? 101 ASN A HB2  3  
ATOM   9023  H  HB3  . ASN A 1 101 ? 18.998  56.803 -5.221  1.00 0.00  ? 101 ASN A HB3  3  
ATOM   9024  H  HD21 . ASN A 1 101 ? 20.226  54.301 -6.342  1.00 0.00  ? 101 ASN A HD21 3  
ATOM   9025  H  HD22 . ASN A 1 101 ? 19.107  53.718 -7.477  1.00 0.00  ? 101 ASN A HD22 3  
ATOM   9026  N  N    . VAL A 1 102 ? 21.057  56.008 -2.179  1.00 0.00  ? 102 VAL A N    3  
ATOM   9027  C  CA   . VAL A 1 102 ? 21.184  56.575 -0.799  1.00 0.00  ? 102 VAL A CA   3  
ATOM   9028  C  C    . VAL A 1 102 ? 21.132  58.119 -0.936  1.00 0.00  ? 102 VAL A C    3  
ATOM   9029  O  O    . VAL A 1 102 ? 21.558  58.646 -1.947  1.00 0.00  ? 102 VAL A O    3  
ATOM   9030  C  CB   . VAL A 1 102 ? 22.546  56.068 -0.215  1.00 0.00  ? 102 VAL A CB   3  
ATOM   9031  C  CG1  . VAL A 1 102 ? 23.422  57.204 0.338   1.00 0.00  ? 102 VAL A CG1  3  
ATOM   9032  C  CG2  . VAL A 1 102 ? 22.296  55.043 0.900   1.00 0.00  ? 102 VAL A CG2  3  
ATOM   9033  H  H    . VAL A 1 102 ? 21.867  55.861 -2.716  1.00 0.00  ? 102 VAL A H    3  
ATOM   9034  H  HA   . VAL A 1 102 ? 20.357  56.231 -0.185  1.00 0.00  ? 102 VAL A HA   3  
ATOM   9035  H  HB   . VAL A 1 102 ? 23.094  55.579 -1.009  1.00 0.00  ? 102 VAL A HB   3  
ATOM   9036  H  HG11 . VAL A 1 102 ? 24.332  56.786 0.743   1.00 0.00  ? 102 VAL A HG11 3  
ATOM   9037  H  HG12 . VAL A 1 102 ? 22.898  57.729 1.115   1.00 0.00  ? 102 VAL A HG12 3  
ATOM   9038  H  HG13 . VAL A 1 102 ? 23.670  57.887 -0.456  1.00 0.00  ? 102 VAL A HG13 3  
ATOM   9039  H  HG21 . VAL A 1 102 ? 21.987  55.554 1.799   1.00 0.00  ? 102 VAL A HG21 3  
ATOM   9040  H  HG22 . VAL A 1 102 ? 23.206  54.495 1.094   1.00 0.00  ? 102 VAL A HG22 3  
ATOM   9041  H  HG23 . VAL A 1 102 ? 21.522  54.357 0.590   1.00 0.00  ? 102 VAL A HG23 3  
ATOM   9042  N  N    . PRO A 1 103 ? 20.608  58.814 0.055   1.00 0.00  ? 103 PRO A N    3  
ATOM   9043  C  CA   . PRO A 1 103 ? 20.526  60.286 -0.010  1.00 0.00  ? 103 PRO A CA   3  
ATOM   9044  C  C    . PRO A 1 103 ? 21.867  60.889 -0.465  1.00 0.00  ? 103 PRO A C    3  
ATOM   9045  O  O    . PRO A 1 103 ? 21.900  61.885 -1.161  1.00 0.00  ? 103 PRO A O    3  
ATOM   9046  C  CB   . PRO A 1 103 ? 20.153  60.723 1.427   1.00 0.00  ? 103 PRO A CB   3  
ATOM   9047  C  CG   . PRO A 1 103 ? 19.828  59.430 2.236   1.00 0.00  ? 103 PRO A CG   3  
ATOM   9048  C  CD   . PRO A 1 103 ? 20.054  58.224 1.296   1.00 0.00  ? 103 PRO A CD   3  
ATOM   9049  H  HA   . PRO A 1 103 ? 19.743  60.577 -0.695  1.00 0.00  ? 103 PRO A HA   3  
ATOM   9050  H  HB2  . PRO A 1 103 ? 20.982  61.249 1.886   1.00 0.00  ? 103 PRO A HB2  3  
ATOM   9051  H  HB3  . PRO A 1 103 ? 19.283  61.366 1.406   1.00 0.00  ? 103 PRO A HB3  3  
ATOM   9052  H  HG2  . PRO A 1 103 ? 20.483  59.360 3.096   1.00 0.00  ? 103 PRO A HG2  3  
ATOM   9053  H  HG3  . PRO A 1 103 ? 18.798  59.448 2.566   1.00 0.00  ? 103 PRO A HG3  3  
ATOM   9054  H  HD2  . PRO A 1 103 ? 20.745  57.524 1.736   1.00 0.00  ? 103 PRO A HD2  3  
ATOM   9055  H  HD3  . PRO A 1 103 ? 19.116  57.734 1.081   1.00 0.00  ? 103 PRO A HD3  3  
ATOM   9056  N  N    . LEU A 1 104 ? 22.969  60.307 -0.074  1.00 29.14 ? 104 LEU A N    3  
ATOM   9057  C  CA   . LEU A 1 104 ? 24.292  60.868 -0.483  1.00 27.06 ? 104 LEU A CA   3  
ATOM   9058  C  C    . LEU A 1 104 ? 24.486  60.704 -1.995  1.00 26.37 ? 104 LEU A C    3  
ATOM   9059  O  O    . LEU A 1 104 ? 24.893  61.622 -2.678  1.00 28.34 ? 104 LEU A O    3  
ATOM   9060  C  CB   . LEU A 1 104 ? 25.417  60.141 0.272   1.00 25.36 ? 104 LEU A CB   3  
ATOM   9061  C  CG   . LEU A 1 104 ? 26.697  60.999 0.283   1.00 26.22 ? 104 LEU A CG   3  
ATOM   9062  C  CD1  . LEU A 1 104 ? 26.468  62.306 1.053   1.00 35.25 ? 104 LEU A CD1  3  
ATOM   9063  C  CD2  . LEU A 1 104 ? 27.829  60.211 0.950   1.00 24.97 ? 104 LEU A CD2  3  
ATOM   9064  H  H    . LEU A 1 104 ? 22.928  59.513 0.495   1.00 0.00  ? 104 LEU A H    3  
ATOM   9065  H  HA   . LEU A 1 104 ? 24.309  61.915 -0.240  1.00 0.00  ? 104 LEU A HA   3  
ATOM   9066  H  HB2  . LEU A 1 104 ? 25.102  59.956 1.289   1.00 0.00  ? 104 LEU A HB2  3  
ATOM   9067  H  HB3  . LEU A 1 104 ? 25.625  59.198 -0.213  1.00 0.00  ? 104 LEU A HB3  3  
ATOM   9068  H  HG   . LEU A 1 104 ? 26.976  61.240 -0.729  1.00 0.00  ? 104 LEU A HG   3  
ATOM   9069  H  HD11 . LEU A 1 104 ? 27.367  62.588 1.585   1.00 0.00  ? 104 LEU A HD11 3  
ATOM   9070  H  HD12 . LEU A 1 104 ? 25.661  62.181 1.759   1.00 0.00  ? 104 LEU A HD12 3  
ATOM   9071  H  HD13 . LEU A 1 104 ? 26.212  63.090 0.355   1.00 0.00  ? 104 LEU A HD13 3  
ATOM   9072  H  HD21 . LEU A 1 104 ? 28.653  60.882 1.155   1.00 0.00  ? 104 LEU A HD21 3  
ATOM   9073  H  HD22 . LEU A 1 104 ? 28.158  59.421 0.293   1.00 0.00  ? 104 LEU A HD22 3  
ATOM   9074  H  HD23 . LEU A 1 104 ? 27.472  59.789 1.876   1.00 0.00  ? 104 LEU A HD23 3  
ATOM   9075  N  N    . HIS A 1 105 ? 24.192  59.550 -2.524  1.00 24.64 ? 105 HIS A N    3  
ATOM   9076  C  CA   . HIS A 1 105 ? 24.348  59.335 -3.989  1.00 27.54 ? 105 HIS A CA   3  
ATOM   9077  C  C    . HIS A 1 105 ? 23.691  60.491 -4.737  1.00 26.02 ? 105 HIS A C    3  
ATOM   9078  O  O    . HIS A 1 105 ? 24.241  61.038 -5.671  1.00 25.72 ? 105 HIS A O    3  
ATOM   9079  C  CB   . HIS A 1 105 ? 23.667  58.015 -4.391  1.00 30.63 ? 105 HIS A CB   3  
ATOM   9080  C  CG   . HIS A 1 105 ? 24.577  56.853 -4.101  1.00 44.65 ? 105 HIS A CG   3  
ATOM   9081  N  ND1  . HIS A 1 105 ? 24.169  55.761 -3.346  1.00 53.08 ? 105 HIS A ND1  3  
ATOM   9082  C  CD2  . HIS A 1 105 ? 25.871  56.589 -4.477  1.00 49.05 ? 105 HIS A CD2  3  
ATOM   9083  C  CE1  . HIS A 1 105 ? 25.203  54.897 -3.295  1.00 56.72 ? 105 HIS A CE1  3  
ATOM   9084  N  NE2  . HIS A 1 105 ? 26.263  55.355 -3.969  1.00 50.00 ? 105 HIS A NE2  3  
ATOM   9085  H  H    . HIS A 1 105 ? 23.859  58.825 -1.959  1.00 0.00  ? 105 HIS A H    3  
ATOM   9086  H  HA   . HIS A 1 105 ? 25.388  59.300 -4.238  1.00 0.00  ? 105 HIS A HA   3  
ATOM   9087  H  HB2  . HIS A 1 105 ? 22.752  57.899 -3.830  1.00 0.00  ? 105 HIS A HB2  3  
ATOM   9088  H  HB3  . HIS A 1 105 ? 23.438  58.031 -5.447  1.00 0.00  ? 105 HIS A HB3  3  
ATOM   9089  H  HD2  . HIS A 1 105 ? 26.491  57.243 -5.072  1.00 0.00  ? 105 HIS A HD2  3  
ATOM   9090  H  HE1  . HIS A 1 105 ? 25.178  53.952 -2.774  1.00 0.00  ? 105 HIS A HE1  3  
ATOM   9091  H  HE2  . HIS A 1 105 ? 27.126  54.905 -4.087  1.00 0.00  ? 105 HIS A HE2  3  
ATOM   9092  N  N    . TYR A 1 106 ? 22.521  60.864 -4.324  1.00 0.00  ? 106 TYR A N    3  
ATOM   9093  C  CA   . TYR A 1 106 ? 21.811  61.990 -5.004  1.00 0.00  ? 106 TYR A CA   3  
ATOM   9094  C  C    . TYR A 1 106 ? 22.411  63.324 -4.537  1.00 0.00  ? 106 TYR A C    3  
ATOM   9095  O  O    . TYR A 1 106 ? 22.657  64.216 -5.327  1.00 0.00  ? 106 TYR A O    3  
ATOM   9096  C  CB   . TYR A 1 106 ? 20.305  61.932 -4.655  1.00 0.00  ? 106 TYR A CB   3  
ATOM   9097  C  CG   . TYR A 1 106 ? 19.543  61.185 -5.735  1.00 0.00  ? 106 TYR A CG   3  
ATOM   9098  C  CD1  . TYR A 1 106 ? 19.530  61.679 -7.045  1.00 0.00  ? 106 TYR A CD1  3  
ATOM   9099  C  CD2  . TYR A 1 106 ? 18.849  60.006 -5.427  1.00 0.00  ? 106 TYR A CD2  3  
ATOM   9100  C  CE1  . TYR A 1 106 ? 18.828  60.998 -8.046  1.00 0.00  ? 106 TYR A CE1  3  
ATOM   9101  C  CE2  . TYR A 1 106 ? 18.146  59.325 -6.429  1.00 0.00  ? 106 TYR A CE2  3  
ATOM   9102  C  CZ   . TYR A 1 106 ? 18.136  59.821 -7.738  1.00 0.00  ? 106 TYR A CZ   3  
ATOM   9103  O  OH   . TYR A 1 106 ? 17.443  59.150 -8.725  1.00 0.00  ? 106 TYR A OH   3  
ATOM   9104  H  H    . TYR A 1 106 ? 22.107  60.407 -3.558  1.00 0.00  ? 106 TYR A H    3  
ATOM   9105  H  HA   . TYR A 1 106 ? 21.946  61.900 -6.073  1.00 0.00  ? 106 TYR A HA   3  
ATOM   9106  H  HB2  . TYR A 1 106 ? 20.179  61.424 -3.711  1.00 0.00  ? 106 TYR A HB2  3  
ATOM   9107  H  HB3  . TYR A 1 106 ? 19.907  62.935 -4.574  1.00 0.00  ? 106 TYR A HB3  3  
ATOM   9108  H  HD1  . TYR A 1 106 ? 20.064  62.588 -7.284  1.00 0.00  ? 106 TYR A HD1  3  
ATOM   9109  H  HD2  . TYR A 1 106 ? 18.857  59.622 -4.417  1.00 0.00  ? 106 TYR A HD2  3  
ATOM   9110  H  HE1  . TYR A 1 106 ? 18.820  61.381 -9.056  1.00 0.00  ? 106 TYR A HE1  3  
ATOM   9111  H  HE2  . TYR A 1 106 ? 17.610  58.418 -6.192  1.00 0.00  ? 106 TYR A HE2  3  
ATOM   9112  H  HH   . TYR A 1 106 ? 18.059  58.571 -9.178  1.00 0.00  ? 106 TYR A HH   3  
ATOM   9113  N  N    . ALA A 1 107 ? 22.644  63.470 -3.264  1.00 29.64 ? 107 ALA A N    3  
ATOM   9114  C  CA   . ALA A 1 107 ? 23.221  64.744 -2.756  1.00 30.31 ? 107 ALA A CA   3  
ATOM   9115  C  C    . ALA A 1 107 ? 24.530  65.046 -3.495  1.00 31.78 ? 107 ALA A C    3  
ATOM   9116  O  O    . ALA A 1 107 ? 24.851  66.185 -3.766  1.00 33.04 ? 107 ALA A O    3  
ATOM   9117  C  CB   . ALA A 1 107 ? 23.492  64.619 -1.253  1.00 25.67 ? 107 ALA A CB   3  
ATOM   9118  H  H    . ALA A 1 107 ? 22.437  62.742 -2.640  1.00 0.00  ? 107 ALA A H    3  
ATOM   9119  H  HA   . ALA A 1 107 ? 22.520  65.548 -2.928  1.00 0.00  ? 107 ALA A HA   3  
ATOM   9120  H  HB1  . ALA A 1 107 ? 24.420  64.090 -1.093  1.00 0.00  ? 107 ALA A HB1  3  
ATOM   9121  H  HB2  . ALA A 1 107 ? 22.683  64.076 -0.787  1.00 0.00  ? 107 ALA A HB2  3  
ATOM   9122  H  HB3  . ALA A 1 107 ? 23.559  65.604 -0.817  1.00 0.00  ? 107 ALA A HB3  3  
ATOM   9123  N  N    . CYS A 1 108 ? 25.292  64.037 -3.821  1.00 0.00  ? 108 CYS A N    3  
ATOM   9124  C  CA   . CYS A 1 108 ? 26.579  64.278 -4.538  1.00 0.00  ? 108 CYS A CA   3  
ATOM   9125  C  C    . CYS A 1 108 ? 26.323  64.371 -6.043  1.00 0.00  ? 108 CYS A C    3  
ATOM   9126  O  O    . CYS A 1 108 ? 27.033  65.045 -6.763  1.00 0.00  ? 108 CYS A O    3  
ATOM   9127  C  CB   . CYS A 1 108 ? 27.545  63.129 -4.252  1.00 0.00  ? 108 CYS A CB   3  
ATOM   9128  S  SG   . CYS A 1 108 ? 29.031  63.327 -5.267  1.00 0.00  ? 108 CYS A SG   3  
ATOM   9129  H  H    . CYS A 1 108 ? 25.020  63.122 -3.595  1.00 0.00  ? 108 CYS A H    3  
ATOM   9130  H  HA   . CYS A 1 108 ? 27.017  65.205 -4.193  1.00 0.00  ? 108 CYS A HA   3  
ATOM   9131  H  HB2  . CYS A 1 108 ? 27.817  63.142 -3.207  1.00 0.00  ? 108 CYS A HB2  3  
ATOM   9132  H  HB3  . CYS A 1 108 ? 27.069  62.189 -4.488  1.00 0.00  ? 108 CYS A HB3  3  
ATOM   9133  H  HG   . CYS A 1 108 ? 29.777  62.983 -4.770  1.00 0.00  ? 108 CYS A HG   3  
ATOM   9134  N  N    . PHE A 1 109 ? 25.312  63.703 -6.526  1.00 0.00  ? 109 PHE A N    3  
ATOM   9135  C  CA   . PHE A 1 109 ? 25.012  63.758 -7.984  1.00 0.00  ? 109 PHE A CA   3  
ATOM   9136  C  C    . PHE A 1 109 ? 24.713  65.205 -8.384  1.00 0.00  ? 109 PHE A C    3  
ATOM   9137  O  O    . PHE A 1 109 ? 24.931  65.604 -9.511  1.00 0.00  ? 109 PHE A O    3  
ATOM   9138  C  CB   . PHE A 1 109 ? 23.797  62.879 -8.290  1.00 0.00  ? 109 PHE A CB   3  
ATOM   9139  C  CG   . PHE A 1 109 ? 23.642  62.732 -9.788  1.00 0.00  ? 109 PHE A CG   3  
ATOM   9140  C  CD1  . PHE A 1 109 ? 24.614  62.046 -10.527 1.00 0.00  ? 109 PHE A CD1  3  
ATOM   9141  C  CD2  . PHE A 1 109 ? 22.528  63.280 -10.439 1.00 0.00  ? 109 PHE A CD2  3  
ATOM   9142  C  CE1  . PHE A 1 109 ? 24.473  61.907 -11.913 1.00 0.00  ? 109 PHE A CE1  3  
ATOM   9143  C  CE2  . PHE A 1 109 ? 22.388  63.141 -11.825 1.00 0.00  ? 109 PHE A CE2  3  
ATOM   9144  C  CZ   . PHE A 1 109 ? 23.360  62.455 -12.562 1.00 0.00  ? 109 PHE A CZ   3  
ATOM   9145  H  H    . PHE A 1 109 ? 24.749  63.167 -5.930  1.00 0.00  ? 109 PHE A H    3  
ATOM   9146  H  HA   . PHE A 1 109 ? 25.865  63.400 -8.541  1.00 0.00  ? 109 PHE A HA   3  
ATOM   9147  H  HB2  . PHE A 1 109 ? 23.939  61.905 -7.845  1.00 0.00  ? 109 PHE A HB2  3  
ATOM   9148  H  HB3  . PHE A 1 109 ? 22.910  63.337 -7.877  1.00 0.00  ? 109 PHE A HB3  3  
ATOM   9149  H  HD1  . PHE A 1 109 ? 25.473  61.624 -10.027 1.00 0.00  ? 109 PHE A HD1  3  
ATOM   9150  H  HD2  . PHE A 1 109 ? 21.777  63.810 -9.872  1.00 0.00  ? 109 PHE A HD2  3  
ATOM   9151  H  HE1  . PHE A 1 109 ? 25.223  61.378 -12.482 1.00 0.00  ? 109 PHE A HE1  3  
ATOM   9152  H  HE2  . PHE A 1 109 ? 21.529  63.564 -12.326 1.00 0.00  ? 109 PHE A HE2  3  
ATOM   9153  H  HZ   . PHE A 1 109 ? 23.252  62.348 -13.631 1.00 0.00  ? 109 PHE A HZ   3  
ATOM   9154  N  N    . TRP A 1 110 ? 24.220  65.997 -7.466  1.00 0.00  ? 110 TRP A N    3  
ATOM   9155  C  CA   . TRP A 1 110 ? 23.912  67.424 -7.787  1.00 0.00  ? 110 TRP A CA   3  
ATOM   9156  C  C    . TRP A 1 110 ? 25.101  68.295 -7.377  1.00 0.00  ? 110 TRP A C    3  
ATOM   9157  O  O    . TRP A 1 110 ? 25.696  68.973 -8.190  1.00 0.00  ? 110 TRP A O    3  
ATOM   9158  C  CB   . TRP A 1 110 ? 22.664  67.863 -7.011  1.00 0.00  ? 110 TRP A CB   3  
ATOM   9159  C  CG   . TRP A 1 110 ? 21.440  67.304 -7.665  1.00 0.00  ? 110 TRP A CG   3  
ATOM   9160  C  CD1  . TRP A 1 110 ? 21.090  65.997 -7.673  1.00 0.00  ? 110 TRP A CD1  3  
ATOM   9161  C  CD2  . TRP A 1 110 ? 20.400  68.009 -8.404  1.00 0.00  ? 110 TRP A CD2  3  
ATOM   9162  N  NE1  . TRP A 1 110 ? 19.903  65.855 -8.369  1.00 0.00  ? 110 TRP A NE1  3  
ATOM   9163  C  CE2  . TRP A 1 110 ? 19.438  67.067 -8.838  1.00 0.00  ? 110 TRP A CE2  3  
ATOM   9164  C  CE3  . TRP A 1 110 ? 20.200  69.362 -8.734  1.00 0.00  ? 110 TRP A CE3  3  
ATOM   9165  C  CZ2  . TRP A 1 110 ? 18.318  67.453 -9.576  1.00 0.00  ? 110 TRP A CZ2  3  
ATOM   9166  C  CZ3  . TRP A 1 110 ? 19.074  69.753 -9.476  1.00 0.00  ? 110 TRP A CZ3  3  
ATOM   9167  C  CH2  . TRP A 1 110 ? 18.135  68.800 -9.896  1.00 0.00  ? 110 TRP A CH2  3  
ATOM   9168  H  H    . TRP A 1 110 ? 24.058  65.655 -6.561  1.00 0.00  ? 110 TRP A H    3  
ATOM   9169  H  HA   . TRP A 1 110 ? 23.736  67.534 -8.849  1.00 0.00  ? 110 TRP A HA   3  
ATOM   9170  H  HB2  . TRP A 1 110 ? 22.726  67.500 -5.996  1.00 0.00  ? 110 TRP A HB2  3  
ATOM   9171  H  HB3  . TRP A 1 110 ? 22.606  68.942 -7.003  1.00 0.00  ? 110 TRP A HB3  3  
ATOM   9172  H  HD1  . TRP A 1 110 ? 21.647  65.196 -7.212  1.00 0.00  ? 110 TRP A HD1  3  
ATOM   9173  H  HE1  . TRP A 1 110 ? 19.435  65.008 -8.521  1.00 0.00  ? 110 TRP A HE1  3  
ATOM   9174  H  HE3  . TRP A 1 110 ? 20.918  70.104 -8.416  1.00 0.00  ? 110 TRP A HE3  3  
ATOM   9175  H  HZ2  . TRP A 1 110 ? 17.597  66.715 -9.896  1.00 0.00  ? 110 TRP A HZ2  3  
ATOM   9176  H  HZ3  . TRP A 1 110 ? 18.930  70.794 -9.725  1.00 0.00  ? 110 TRP A HZ3  3  
ATOM   9177  H  HH2  . TRP A 1 110 ? 17.270  69.108 -10.466 1.00 0.00  ? 110 TRP A HH2  3  
ATOM   9178  N  N    . GLY A 1 111 ? 25.451  68.280 -6.116  1.00 25.81 ? 111 GLY A N    3  
ATOM   9179  C  CA   . GLY A 1 111 ? 26.603  69.106 -5.640  1.00 25.30 ? 111 GLY A CA   3  
ATOM   9180  C  C    . GLY A 1 111 ? 26.285  69.674 -4.270  1.00 24.23 ? 111 GLY A C    3  
ATOM   9181  O  O    . GLY A 1 111 ? 26.159  70.870 -4.096  1.00 32.41 ? 111 GLY A O    3  
ATOM   9182  H  H    . GLY A 1 111 ? 24.954  67.726 -5.479  1.00 0.00  ? 111 GLY A H    3  
ATOM   9183  H  HA2  . GLY A 1 111 ? 27.484  68.489 -5.561  1.00 0.00  ? 111 GLY A HA2  3  
ATOM   9184  H  HA3  . GLY A 1 111 ? 26.786  69.917 -6.325  1.00 0.00  ? 111 GLY A HA3  3  
ATOM   9185  N  N    . GLN A 1 112 ? 26.167  68.817 -3.292  1.00 0.00  ? 112 GLN A N    3  
ATOM   9186  C  CA   . GLN A 1 112 ? 25.870  69.274 -1.907  1.00 0.00  ? 112 GLN A CA   3  
ATOM   9187  C  C    . GLN A 1 112 ? 27.028  68.871 -0.993  1.00 0.00  ? 112 GLN A C    3  
ATOM   9188  O  O    . GLN A 1 112 ? 27.485  67.745 -0.984  1.00 0.00  ? 112 GLN A O    3  
ATOM   9189  C  CB   . GLN A 1 112 ? 24.566  68.644 -1.434  1.00 0.00  ? 112 GLN A CB   3  
ATOM   9190  C  CG   . GLN A 1 112 ? 23.494  68.830 -2.510  1.00 0.00  ? 112 GLN A CG   3  
ATOM   9191  C  CD   . GLN A 1 112 ? 22.122  68.521 -1.916  1.00 0.00  ? 112 GLN A CD   3  
ATOM   9192  O  OE1  . GLN A 1 112 ? 21.807  68.963 -0.830  1.00 0.00  ? 112 GLN A OE1  3  
ATOM   9193  N  NE2  . GLN A 1 112 ? 21.288  67.774 -2.586  1.00 0.00  ? 112 GLN A NE2  3  
ATOM   9194  H  H    . GLN A 1 112 ? 26.284  67.860 -3.469  1.00 0.00  ? 112 GLN A H    3  
ATOM   9195  H  HA   . GLN A 1 112 ? 25.769  70.352 -1.883  1.00 0.00  ? 112 GLN A HA   3  
ATOM   9196  H  HB2  . GLN A 1 112 ? 24.717  67.592 -1.250  1.00 0.00  ? 112 GLN A HB2  3  
ATOM   9197  H  HB3  . GLN A 1 112 ? 24.244  69.134 -0.529  1.00 0.00  ? 112 GLN A HB3  3  
ATOM   9198  H  HG2  . GLN A 1 112 ? 23.512  69.851 -2.864  1.00 0.00  ? 112 GLN A HG2  3  
ATOM   9199  H  HG3  . GLN A 1 112 ? 23.687  68.161 -3.333  1.00 0.00  ? 112 GLN A HG3  3  
ATOM   9200  H  HE21 . GLN A 1 112 ? 21.545  67.417 -3.462  1.00 0.00  ? 112 GLN A HE21 3  
ATOM   9201  H  HE22 . GLN A 1 112 ? 20.406  67.569 -2.213  1.00 0.00  ? 112 GLN A HE22 3  
ATOM   9202  N  N    . ASP A 1 113 ? 27.501  69.816 -0.242  1.00 0.00  ? 113 ASP A N    3  
ATOM   9203  C  CA   . ASP A 1 113 ? 28.653  69.569 0.691   1.00 0.00  ? 113 ASP A CA   3  
ATOM   9204  C  C    . ASP A 1 113 ? 28.173  69.407 2.139   1.00 0.00  ? 113 ASP A C    3  
ATOM   9205  O  O    . ASP A 1 113 ? 28.312  68.355 2.732   1.00 0.00  ? 113 ASP A O    3  
ATOM   9206  C  CB   . ASP A 1 113 ? 29.621  70.749 0.611   1.00 0.00  ? 113 ASP A CB   3  
ATOM   9207  C  CG   . ASP A 1 113 ? 30.302  70.758 -0.759  1.00 0.00  ? 113 ASP A CG   3  
ATOM   9208  O  OD1  . ASP A 1 113 ? 29.610  70.551 -1.743  1.00 0.00  ? 113 ASP A OD1  3  
ATOM   9209  O  OD2  . ASP A 1 113 ? 31.502  70.971 -0.801  1.00 0.00  ? 113 ASP A OD2  3  
ATOM   9210  H  H    . ASP A 1 113 ? 27.078  70.693 -0.317  1.00 0.00  ? 113 ASP A H    3  
ATOM   9211  H  HA   . ASP A 1 113 ? 29.172  68.667 0.396   1.00 0.00  ? 113 ASP A HA   3  
ATOM   9212  H  HB2  . ASP A 1 113 ? 29.076  71.672 0.750   1.00 0.00  ? 113 ASP A HB2  3  
ATOM   9213  H  HB3  . ASP A 1 113 ? 30.371  70.654 1.382   1.00 0.00  ? 113 ASP A HB3  3  
ATOM   9214  N  N    . GLN A 1 114 ? 27.634  70.440 2.722   1.00 0.00  ? 114 GLN A N    3  
ATOM   9215  C  CA   . GLN A 1 114 ? 27.175  70.345 4.140   1.00 0.00  ? 114 GLN A CA   3  
ATOM   9216  C  C    . GLN A 1 114 ? 26.253  69.133 4.325   1.00 0.00  ? 114 GLN A C    3  
ATOM   9217  O  O    . GLN A 1 114 ? 26.454  68.319 5.202   1.00 0.00  ? 114 GLN A O    3  
ATOM   9218  C  CB   . GLN A 1 114 ? 26.430  71.630 4.520   1.00 0.00  ? 114 GLN A CB   3  
ATOM   9219  C  CG   . GLN A 1 114 ? 25.241  71.849 3.572   1.00 0.00  ? 114 GLN A CG   3  
ATOM   9220  C  CD   . GLN A 1 114 ? 24.834  73.325 3.586   1.00 0.00  ? 114 GLN A CD   3  
ATOM   9221  O  OE1  . GLN A 1 114 ? 24.758  73.957 2.551   1.00 0.00  ? 114 GLN A OE1  3  
ATOM   9222  N  NE2  . GLN A 1 114 ? 24.567  73.903 4.725   1.00 0.00  ? 114 GLN A NE2  3  
ATOM   9223  H  H    . GLN A 1 114 ? 27.542  71.283 2.232   1.00 0.00  ? 114 GLN A H    3  
ATOM   9224  H  HA   . GLN A 1 114 ? 28.036  70.234 4.782   1.00 0.00  ? 114 GLN A HA   3  
ATOM   9225  H  HB2  . GLN A 1 114 ? 26.069  71.546 5.535   1.00 0.00  ? 114 GLN A HB2  3  
ATOM   9226  H  HB3  . GLN A 1 114 ? 27.108  72.468 4.448   1.00 0.00  ? 114 GLN A HB3  3  
ATOM   9227  H  HG2  . GLN A 1 114 ? 25.516  71.563 2.567   1.00 0.00  ? 114 GLN A HG2  3  
ATOM   9228  H  HG3  . GLN A 1 114 ? 24.407  71.249 3.901   1.00 0.00  ? 114 GLN A HG3  3  
ATOM   9229  H  HE21 . GLN A 1 114 ? 24.628  73.392 5.558   1.00 0.00  ? 114 GLN A HE21 3  
ATOM   9230  H  HE22 . GLN A 1 114 ? 24.306  74.847 4.746   1.00 0.00  ? 114 GLN A HE22 3  
ATOM   9231  N  N    . VAL A 1 115 ? 25.233  69.023 3.523   1.00 0.00  ? 115 VAL A N    3  
ATOM   9232  C  CA   . VAL A 1 115 ? 24.297  67.871 3.683   1.00 0.00  ? 115 VAL A CA   3  
ATOM   9233  C  C    . VAL A 1 115 ? 25.081  66.555 3.610   1.00 0.00  ? 115 VAL A C    3  
ATOM   9234  O  O    . VAL A 1 115 ? 24.853  65.636 4.371   1.00 0.00  ? 115 VAL A O    3  
ATOM   9235  C  CB   . VAL A 1 115 ? 23.191  67.908 2.604   1.00 0.00  ? 115 VAL A CB   3  
ATOM   9236  C  CG1  . VAL A 1 115 ? 22.821  69.359 2.293   1.00 0.00  ? 115 VAL A CG1  3  
ATOM   9237  C  CG2  . VAL A 1 115 ? 23.664  67.222 1.315   1.00 0.00  ? 115 VAL A CG2  3  
ATOM   9238  H  H    . VAL A 1 115 ? 25.094  69.717 2.847   1.00 0.00  ? 115 VAL A H    3  
ATOM   9239  H  HA   . VAL A 1 115 ? 23.844  67.936 4.651   1.00 0.00  ? 115 VAL A HA   3  
ATOM   9240  H  HB   . VAL A 1 115 ? 22.315  67.395 2.978   1.00 0.00  ? 115 VAL A HB   3  
ATOM   9241  H  HG11 . VAL A 1 115 ? 22.630  69.888 3.215   1.00 0.00  ? 115 VAL A HG11 3  
ATOM   9242  H  HG12 . VAL A 1 115 ? 21.933  69.379 1.677   1.00 0.00  ? 115 VAL A HG12 3  
ATOM   9243  H  HG13 . VAL A 1 115 ? 23.634  69.835 1.766   1.00 0.00  ? 115 VAL A HG13 3  
ATOM   9244  H  HG21 . VAL A 1 115 ? 23.676  66.151 1.460   1.00 0.00  ? 115 VAL A HG21 3  
ATOM   9245  H  HG22 . VAL A 1 115 ? 24.656  67.561 1.072   1.00 0.00  ? 115 VAL A HG22 3  
ATOM   9246  H  HG23 . VAL A 1 115 ? 22.991  67.464 0.509   1.00 0.00  ? 115 VAL A HG23 3  
ATOM   9247  N  N    . ALA A 1 116 ? 25.982  66.458 2.680   1.00 0.00  ? 116 ALA A N    3  
ATOM   9248  C  CA   . ALA A 1 116 ? 26.768  65.209 2.517   1.00 0.00  ? 116 ALA A CA   3  
ATOM   9249  C  C    . ALA A 1 116 ? 27.515  64.894 3.804   1.00 0.00  ? 116 ALA A C    3  
ATOM   9250  O  O    . ALA A 1 116 ? 27.659  63.752 4.193   1.00 0.00  ? 116 ALA A O    3  
ATOM   9251  C  CB   . ALA A 1 116 ? 27.763  65.380 1.366   1.00 0.00  ? 116 ALA A CB   3  
ATOM   9252  H  H    . ALA A 1 116 ? 26.125  67.200 2.070   1.00 0.00  ? 116 ALA A H    3  
ATOM   9253  H  HA   . ALA A 1 116 ? 26.097  64.412 2.296   1.00 0.00  ? 116 ALA A HA   3  
ATOM   9254  H  HB1  . ALA A 1 116 ? 28.224  66.355 1.431   1.00 0.00  ? 116 ALA A HB1  3  
ATOM   9255  H  HB2  . ALA A 1 116 ? 27.242  65.291 0.424   1.00 0.00  ? 116 ALA A HB2  3  
ATOM   9256  H  HB3  . ALA A 1 116 ? 28.526  64.617 1.428   1.00 0.00  ? 116 ALA A HB3  3  
ATOM   9257  N  N    . GLU A 1 117 ? 27.980  65.899 4.465   1.00 35.87 ? 117 GLU A N    3  
ATOM   9258  C  CA   . GLU A 1 117 ? 28.715  65.682 5.736   1.00 39.73 ? 117 GLU A CA   3  
ATOM   9259  C  C    . GLU A 1 117 ? 27.770  65.035 6.747   1.00 39.65 ? 117 GLU A C    3  
ATOM   9260  O  O    . GLU A 1 117 ? 28.038  63.979 7.280   1.00 38.68 ? 117 GLU A O    3  
ATOM   9261  C  CB   . GLU A 1 117 ? 29.197  67.030 6.275   1.00 40.98 ? 117 GLU A CB   3  
ATOM   9262  C  CG   . GLU A 1 117 ? 30.081  66.805 7.503   1.00 45.91 ? 117 GLU A CG   3  
ATOM   9263  C  CD   . GLU A 1 117 ? 30.704  68.134 7.933   1.00 48.33 ? 117 GLU A CD   3  
ATOM   9264  O  OE1  . GLU A 1 117 ? 30.001  69.131 7.911   1.00 49.21 ? 117 GLU A OE1  3  
ATOM   9265  O  OE2  . GLU A 1 117 ? 31.875  68.133 8.277   1.00 42.84 ? 117 GLU A OE2  3  
ATOM   9266  H  H    . GLU A 1 117 ? 27.836  66.804 4.126   1.00 0.00  ? 117 GLU A H    3  
ATOM   9267  H  HA   . GLU A 1 117 ? 29.562  65.037 5.562   1.00 0.00  ? 117 GLU A HA   3  
ATOM   9268  H  HB2  . GLU A 1 117 ? 29.764  67.540 5.509   1.00 0.00  ? 117 GLU A HB2  3  
ATOM   9269  H  HB3  . GLU A 1 117 ? 28.344  67.631 6.552   1.00 0.00  ? 117 GLU A HB3  3  
ATOM   9270  H  HG2  . GLU A 1 117 ? 29.481  66.410 8.310   1.00 0.00  ? 117 GLU A HG2  3  
ATOM   9271  H  HG3  . GLU A 1 117 ? 30.865  66.104 7.260   1.00 0.00  ? 117 GLU A HG3  3  
ATOM   9272  N  N    . ASP A 1 118 ? 26.668  65.674 7.016   1.00 0.00  ? 118 ASP A N    3  
ATOM   9273  C  CA   . ASP A 1 118 ? 25.693  65.118 8.003   1.00 0.00  ? 118 ASP A CA   3  
ATOM   9274  C  C    . ASP A 1 118 ? 25.390  63.649 7.694   1.00 0.00  ? 118 ASP A C    3  
ATOM   9275  O  O    . ASP A 1 118 ? 25.259  62.834 8.585   1.00 0.00  ? 118 ASP A O    3  
ATOM   9276  C  CB   . ASP A 1 118 ? 24.390  65.917 7.940   1.00 0.00  ? 118 ASP A CB   3  
ATOM   9277  C  CG   . ASP A 1 118 ? 23.523  65.572 9.152   1.00 0.00  ? 118 ASP A CG   3  
ATOM   9278  O  OD1  . ASP A 1 118 ? 23.386  64.394 9.442   1.00 0.00  ? 118 ASP A OD1  3  
ATOM   9279  O  OD2  . ASP A 1 118 ? 23.011  66.490 9.771   1.00 0.00  ? 118 ASP A OD2  3  
ATOM   9280  H  H    . ASP A 1 118 ? 26.489  66.533 6.576   1.00 0.00  ? 118 ASP A H    3  
ATOM   9281  H  HA   . ASP A 1 118 ? 26.108  65.196 8.995   1.00 0.00  ? 118 ASP A HA   3  
ATOM   9282  H  HB2  . ASP A 1 118 ? 24.613  66.972 7.945   1.00 0.00  ? 118 ASP A HB2  3  
ATOM   9283  H  HB3  . ASP A 1 118 ? 23.857  65.665 7.036   1.00 0.00  ? 118 ASP A HB3  3  
ATOM   9284  N  N    . LEU A 1 119 ? 25.253  63.309 6.444   1.00 35.74 ? 119 LEU A N    3  
ATOM   9285  C  CA   . LEU A 1 119 ? 24.929  61.898 6.084   1.00 32.73 ? 119 LEU A CA   3  
ATOM   9286  C  C    . LEU A 1 119 ? 26.110  60.972 6.407   1.00 33.43 ? 119 LEU A C    3  
ATOM   9287  O  O    . LEU A 1 119 ? 25.966  60.005 7.129   1.00 35.67 ? 119 LEU A O    3  
ATOM   9288  C  CB   . LEU A 1 119 ? 24.614  61.826 4.585   1.00 28.12 ? 119 LEU A CB   3  
ATOM   9289  C  CG   . LEU A 1 119 ? 23.210  62.409 4.307   1.00 28.79 ? 119 LEU A CG   3  
ATOM   9290  C  CD1  . LEU A 1 119 ? 23.129  62.903 2.859   1.00 27.73 ? 119 LEU A CD1  3  
ATOM   9291  C  CD2  . LEU A 1 119 ? 22.135  61.333 4.523   1.00 19.25 ? 119 LEU A CD2  3  
ATOM   9292  H  H    . LEU A 1 119 ? 25.345  63.985 5.741   1.00 0.00  ? 119 LEU A H    3  
ATOM   9293  H  HA   . LEU A 1 119 ? 24.067  61.579 6.646   1.00 0.00  ? 119 LEU A HA   3  
ATOM   9294  H  HB2  . LEU A 1 119 ? 25.356  62.399 4.048   1.00 0.00  ? 119 LEU A HB2  3  
ATOM   9295  H  HB3  . LEU A 1 119 ? 24.653  60.798 4.257   1.00 0.00  ? 119 LEU A HB3  3  
ATOM   9296  H  HG   . LEU A 1 119 ? 23.025  63.240 4.974   1.00 0.00  ? 119 LEU A HG   3  
ATOM   9297  H  HD11 . LEU A 1 119 ? 22.139  63.292 2.666   1.00 0.00  ? 119 LEU A HD11 3  
ATOM   9298  H  HD12 . LEU A 1 119 ? 23.330  62.083 2.186   1.00 0.00  ? 119 LEU A HD12 3  
ATOM   9299  H  HD13 . LEU A 1 119 ? 23.859  63.684 2.704   1.00 0.00  ? 119 LEU A HD13 3  
ATOM   9300  H  HD21 . LEU A 1 119 ? 22.377  60.457 3.939   1.00 0.00  ? 119 LEU A HD21 3  
ATOM   9301  H  HD22 . LEU A 1 119 ? 21.176  61.718 4.209   1.00 0.00  ? 119 LEU A HD22 3  
ATOM   9302  H  HD23 . LEU A 1 119 ? 22.089  61.068 5.568   1.00 0.00  ? 119 LEU A HD23 3  
ATOM   9303  N  N    . VAL A 1 120 ? 27.269  61.246 5.874   1.00 31.62 ? 120 VAL A N    3  
ATOM   9304  C  CA   . VAL A 1 120 ? 28.442  60.363 6.149   1.00 34.22 ? 120 VAL A CA   3  
ATOM   9305  C  C    . VAL A 1 120 ? 28.990  60.651 7.548   1.00 36.23 ? 120 VAL A C    3  
ATOM   9306  O  O    . VAL A 1 120 ? 29.781  59.899 8.082   1.00 37.37 ? 120 VAL A O    3  
ATOM   9307  C  CB   . VAL A 1 120 ? 29.534  60.621 5.106   1.00 31.31 ? 120 VAL A CB   3  
ATOM   9308  C  CG1  . VAL A 1 120 ? 30.126  62.018 5.309   1.00 19.57 ? 120 VAL A CG1  3  
ATOM   9309  C  CG2  . VAL A 1 120 ? 30.638  59.572 5.255   1.00 27.86 ? 120 VAL A CG2  3  
ATOM   9310  H  H    . VAL A 1 120 ? 27.367  62.026 5.288   1.00 0.00  ? 120 VAL A H    3  
ATOM   9311  H  HA   . VAL A 1 120 ? 28.133  59.329 6.093   1.00 0.00  ? 120 VAL A HA   3  
ATOM   9312  H  HB   . VAL A 1 120 ? 29.105  60.556 4.116   1.00 0.00  ? 120 VAL A HB   3  
ATOM   9313  H  HG11 . VAL A 1 120 ? 29.329  62.723 5.488   1.00 0.00  ? 120 VAL A HG11 3  
ATOM   9314  H  HG12 . VAL A 1 120 ? 30.673  62.310 4.425   1.00 0.00  ? 120 VAL A HG12 3  
ATOM   9315  H  HG13 . VAL A 1 120 ? 30.794  62.008 6.159   1.00 0.00  ? 120 VAL A HG13 3  
ATOM   9316  H  HG21 . VAL A 1 120 ? 30.199  58.585 5.263   1.00 0.00  ? 120 VAL A HG21 3  
ATOM   9317  H  HG22 . VAL A 1 120 ? 31.170  59.737 6.180   1.00 0.00  ? 120 VAL A HG22 3  
ATOM   9318  H  HG23 . VAL A 1 120 ? 31.326  59.653 4.426   1.00 0.00  ? 120 VAL A HG23 3  
ATOM   9319  N  N    . ALA A 1 121 ? 28.579  61.734 8.147   1.00 0.00  ? 121 ALA A N    3  
ATOM   9320  C  CA   . ALA A 1 121 ? 29.079  62.068 9.510   1.00 0.00  ? 121 ALA A CA   3  
ATOM   9321  C  C    . ALA A 1 121 ? 28.281  61.287 10.552  1.00 0.00  ? 121 ALA A C    3  
ATOM   9322  O  O    . ALA A 1 121 ? 28.599  61.303 11.725  1.00 0.00  ? 121 ALA A O    3  
ATOM   9323  C  CB   . ALA A 1 121 ? 28.920  63.567 9.766   1.00 0.00  ? 121 ALA A CB   3  
ATOM   9324  H  H    . ALA A 1 121 ? 27.941  62.328 7.699   1.00 0.00  ? 121 ALA A H    3  
ATOM   9325  H  HA   . ALA A 1 121 ? 30.124  61.802 9.585   1.00 0.00  ? 121 ALA A HA   3  
ATOM   9326  H  HB1  . ALA A 1 121 ? 29.215  63.792 10.780  1.00 0.00  ? 121 ALA A HB1  3  
ATOM   9327  H  HB2  . ALA A 1 121 ? 27.890  63.848 9.621   1.00 0.00  ? 121 ALA A HB2  3  
ATOM   9328  H  HB3  . ALA A 1 121 ? 29.545  64.119 9.079   1.00 0.00  ? 121 ALA A HB3  3  
ATOM   9329  N  N    . ASN A 1 122 ? 27.256  60.583 10.137  1.00 0.00  ? 122 ASN A N    3  
ATOM   9330  C  CA   . ASN A 1 122 ? 26.457  59.783 11.113  1.00 0.00  ? 122 ASN A CA   3  
ATOM   9331  C  C    . ASN A 1 122 ? 26.959  58.344 11.065  1.00 0.00  ? 122 ASN A C    3  
ATOM   9332  O  O    . ASN A 1 122 ? 27.101  57.684 12.076  1.00 0.00  ? 122 ASN A O    3  
ATOM   9333  C  CB   . ASN A 1 122 ? 24.979  59.819 10.707  1.00 0.00  ? 122 ASN A CB   3  
ATOM   9334  C  CG   . ASN A 1 122 ? 24.371  61.167 11.100  1.00 0.00  ? 122 ASN A CG   3  
ATOM   9335  O  OD1  . ASN A 1 122 ? 25.071  62.155 11.207  1.00 0.00  ? 122 ASN A OD1  3  
ATOM   9336  N  ND2  . ASN A 1 122 ? 23.087  61.250 11.320  1.00 0.00  ? 122 ASN A ND2  3  
ATOM   9337  H  H    . ASN A 1 122 ? 27.025  60.562 9.184   1.00 0.00  ? 122 ASN A H    3  
ATOM   9338  H  HA   . ASN A 1 122 ? 26.572  60.180 12.112  1.00 0.00  ? 122 ASN A HA   3  
ATOM   9339  H  HB2  . ASN A 1 122 ? 24.899  59.687 9.637   1.00 0.00  ? 122 ASN A HB2  3  
ATOM   9340  H  HB3  . ASN A 1 122 ? 24.446  59.025 11.207  1.00 0.00  ? 122 ASN A HB3  3  
ATOM   9341  H  HD21 . ASN A 1 122 ? 22.523  60.454 11.233  1.00 0.00  ? 122 ASN A HD21 3  
ATOM   9342  H  HD22 . ASN A 1 122 ? 22.687  62.109 11.571  1.00 0.00  ? 122 ASN A HD22 3  
ATOM   9343  N  N    . GLY A 1 123 ? 27.220  57.852 9.885   1.00 0.00  ? 123 GLY A N    3  
ATOM   9344  C  CA   . GLY A 1 123 ? 27.706  56.450 9.740   1.00 0.00  ? 123 GLY A CA   3  
ATOM   9345  C  C    . GLY A 1 123 ? 27.309  55.898 8.365   1.00 0.00  ? 123 GLY A C    3  
ATOM   9346  O  O    . GLY A 1 123 ? 27.634  54.778 8.024   1.00 0.00  ? 123 GLY A O    3  
ATOM   9347  H  H    . GLY A 1 123 ? 27.058  58.395 9.088   1.00 0.00  ? 123 GLY A H    3  
ATOM   9348  H  HA2  . GLY A 1 123 ? 28.781  56.433 9.836   1.00 0.00  ? 123 GLY A HA2  3  
ATOM   9349  H  HA3  . GLY A 1 123 ? 27.267  55.832 10.510  1.00 0.00  ? 123 GLY A HA3  3  
ATOM   9350  N  N    . ALA A 1 124 ? 26.614  56.669 7.566   1.00 30.80 ? 124 ALA A N    3  
ATOM   9351  C  CA   . ALA A 1 124 ? 26.212  56.174 6.218   1.00 27.84 ? 124 ALA A CA   3  
ATOM   9352  C  C    . ALA A 1 124 ? 27.439  55.594 5.516   1.00 28.26 ? 124 ALA A C    3  
ATOM   9353  O  O    . ALA A 1 124 ? 27.330  54.798 4.605   1.00 31.12 ? 124 ALA A O    3  
ATOM   9354  C  CB   . ALA A 1 124 ? 25.656  57.336 5.391   1.00 24.33 ? 124 ALA A CB   3  
ATOM   9355  H  H    . ALA A 1 124 ? 26.360  57.569 7.847   1.00 0.00  ? 124 ALA A H    3  
ATOM   9356  H  HA   . ALA A 1 124 ? 25.458  55.409 6.322   1.00 0.00  ? 124 ALA A HA   3  
ATOM   9357  H  HB1  . ALA A 1 124 ? 26.466  57.981 5.084   1.00 0.00  ? 124 ALA A HB1  3  
ATOM   9358  H  HB2  . ALA A 1 124 ? 24.954  57.899 5.987   1.00 0.00  ? 124 ALA A HB2  3  
ATOM   9359  H  HB3  . ALA A 1 124 ? 25.154  56.947 4.516   1.00 0.00  ? 124 ALA A HB3  3  
ATOM   9360  N  N    . LEU A 1 125 ? 28.605  55.990 5.946   1.00 0.00  ? 125 LEU A N    3  
ATOM   9361  C  CA   . LEU A 1 125 ? 29.855  55.472 5.323   1.00 0.00  ? 125 LEU A CA   3  
ATOM   9362  C  C    . LEU A 1 125 ? 29.896  55.855 3.841   1.00 0.00  ? 125 LEU A C    3  
ATOM   9363  O  O    . LEU A 1 125 ? 28.941  55.680 3.114   1.00 0.00  ? 125 LEU A O    3  
ATOM   9364  C  CB   . LEU A 1 125 ? 29.906  53.941 5.464   1.00 0.00  ? 125 LEU A CB   3  
ATOM   9365  C  CG   . LEU A 1 125 ? 31.355  53.438 5.279   1.00 0.00  ? 125 LEU A CG   3  
ATOM   9366  C  CD1  . LEU A 1 125 ? 32.126  53.529 6.603   1.00 0.00  ? 125 LEU A CD1  3  
ATOM   9367  C  CD2  . LEU A 1 125 ? 31.339  51.976 4.817   1.00 0.00  ? 125 LEU A CD2  3  
ATOM   9368  H  H    . LEU A 1 125 ? 28.657  56.632 6.686   1.00 0.00  ? 125 LEU A H    3  
ATOM   9369  H  HA   . LEU A 1 125 ? 30.705  55.907 5.824   1.00 0.00  ? 125 LEU A HA   3  
ATOM   9370  H  HB2  . LEU A 1 125 ? 29.544  53.662 6.442   1.00 0.00  ? 125 LEU A HB2  3  
ATOM   9371  H  HB3  . LEU A 1 125 ? 29.273  53.494 4.711   1.00 0.00  ? 125 LEU A HB3  3  
ATOM   9372  H  HG   . LEU A 1 125 ? 31.855  54.041 4.535   1.00 0.00  ? 125 LEU A HG   3  
ATOM   9373  H  HD11 . LEU A 1 125 ? 33.092  53.059 6.487   1.00 0.00  ? 125 LEU A HD11 3  
ATOM   9374  H  HD12 . LEU A 1 125 ? 31.573  53.023 7.381   1.00 0.00  ? 125 LEU A HD12 3  
ATOM   9375  H  HD13 . LEU A 1 125 ? 32.264  54.564 6.875   1.00 0.00  ? 125 LEU A HD13 3  
ATOM   9376  H  HD21 . LEU A 1 125 ? 30.756  51.386 5.509   1.00 0.00  ? 125 LEU A HD21 3  
ATOM   9377  H  HD22 . LEU A 1 125 ? 32.350  51.598 4.785   1.00 0.00  ? 125 LEU A HD22 3  
ATOM   9378  H  HD23 . LEU A 1 125 ? 30.899  51.914 3.833   1.00 0.00  ? 125 LEU A HD23 3  
ATOM   9379  N  N    . VAL A 1 126 ? 31.000  56.383 3.393   1.00 21.92 ? 126 VAL A N    3  
ATOM   9380  C  CA   . VAL A 1 126 ? 31.123  56.782 1.961   1.00 22.67 ? 126 VAL A CA   3  
ATOM   9381  C  C    . VAL A 1 126 ? 31.642  55.587 1.152   1.00 19.37 ? 126 VAL A C    3  
ATOM   9382  O  O    . VAL A 1 126 ? 31.707  55.627 -0.061  1.00 18.80 ? 126 VAL A O    3  
ATOM   9383  C  CB   . VAL A 1 126 ? 32.108  57.956 1.853   1.00 22.73 ? 126 VAL A CB   3  
ATOM   9384  C  CG1  . VAL A 1 126 ? 33.328  57.680 2.736   1.00 31.25 ? 126 VAL A CG1  3  
ATOM   9385  C  CG2  . VAL A 1 126 ? 32.561  58.136 0.397   1.00 14.06 ? 126 VAL A CG2  3  
ATOM   9386  H  H    . VAL A 1 126 ? 31.753  56.521 4.002   1.00 0.00  ? 126 VAL A H    3  
ATOM   9387  H  HA   . VAL A 1 126 ? 30.158  57.084 1.580   1.00 0.00  ? 126 VAL A HA   3  
ATOM   9388  H  HB   . VAL A 1 126 ? 31.622  58.859 2.193   1.00 0.00  ? 126 VAL A HB   3  
ATOM   9389  H  HG11 . VAL A 1 126 ? 34.128  58.355 2.469   1.00 0.00  ? 126 VAL A HG11 3  
ATOM   9390  H  HG12 . VAL A 1 126 ? 33.655  56.660 2.592   1.00 0.00  ? 126 VAL A HG12 3  
ATOM   9391  H  HG13 . VAL A 1 126 ? 33.063  57.829 3.773   1.00 0.00  ? 126 VAL A HG13 3  
ATOM   9392  H  HG21 . VAL A 1 126 ? 33.300  57.386 0.154   1.00 0.00  ? 126 VAL A HG21 3  
ATOM   9393  H  HG22 . VAL A 1 126 ? 32.989  59.118 0.271   1.00 0.00  ? 126 VAL A HG22 3  
ATOM   9394  H  HG23 . VAL A 1 126 ? 31.710  58.027 -0.259  1.00 0.00  ? 126 VAL A HG23 3  
ATOM   9395  N  N    . SER A 1 127 ? 32.023  54.527 1.817   1.00 0.00  ? 127 SER A N    3  
ATOM   9396  C  CA   . SER A 1 127 ? 32.552  53.330 1.095   1.00 0.00  ? 127 SER A CA   3  
ATOM   9397  C  C    . SER A 1 127 ? 31.442  52.289 0.916   1.00 0.00  ? 127 SER A C    3  
ATOM   9398  O  O    . SER A 1 127 ? 31.702  51.107 0.815   1.00 0.00  ? 127 SER A O    3  
ATOM   9399  C  CB   . SER A 1 127 ? 33.693  52.723 1.914   1.00 0.00  ? 127 SER A CB   3  
ATOM   9400  O  OG   . SER A 1 127 ? 33.939  51.393 1.474   1.00 0.00  ? 127 SER A OG   3  
ATOM   9401  H  H    . SER A 1 127 ? 31.969  54.522 2.795   1.00 0.00  ? 127 SER A H    3  
ATOM   9402  H  HA   . SER A 1 127 ? 32.929  53.622 0.125   1.00 0.00  ? 127 SER A HA   3  
ATOM   9403  H  HB2  . SER A 1 127 ? 34.586  53.309 1.778   1.00 0.00  ? 127 SER A HB2  3  
ATOM   9404  H  HB3  . SER A 1 127 ? 33.421  52.724 2.960   1.00 0.00  ? 127 SER A HB3  3  
ATOM   9405  H  HG   . SER A 1 127 ? 34.133  51.422 0.535   1.00 0.00  ? 127 SER A HG   3  
ATOM   9406  N  N    . ILE A 1 128 ? 30.205  52.707 0.864   1.00 0.00  ? 128 ILE A N    3  
ATOM   9407  C  CA   . ILE A 1 128 ? 29.104  51.715 0.679   1.00 0.00  ? 128 ILE A CA   3  
ATOM   9408  C  C    . ILE A 1 128 ? 29.229  51.087 -0.713  1.00 0.00  ? 128 ILE A C    3  
ATOM   9409  O  O    . ILE A 1 128 ? 29.286  49.884 -0.847  1.00 0.00  ? 128 ILE A O    3  
ATOM   9410  C  CB   . ILE A 1 128 ? 27.743  52.418 0.816   1.00 0.00  ? 128 ILE A CB   3  
ATOM   9411  C  CG1  . ILE A 1 128 ? 27.503  52.834 2.281   1.00 0.00  ? 128 ILE A CG1  3  
ATOM   9412  C  CG2  . ILE A 1 128 ? 26.616  51.489 0.348   1.00 0.00  ? 128 ILE A CG2  3  
ATOM   9413  C  CD1  . ILE A 1 128 ? 27.524  51.621 3.229   1.00 0.00  ? 128 ILE A CD1  3  
ATOM   9414  H  H    . ILE A 1 128 ? 30.000  53.667 0.935   1.00 0.00  ? 128 ILE A H    3  
ATOM   9415  H  HA   . ILE A 1 128 ? 29.193  50.939 1.423   1.00 0.00  ? 128 ILE A HA   3  
ATOM   9416  H  HB   . ILE A 1 128 ? 27.745  53.302 0.195   1.00 0.00  ? 128 ILE A HB   3  
ATOM   9417  H  HG12 . ILE A 1 128 ? 28.275  53.522 2.579   1.00 0.00  ? 128 ILE A HG12 3  
ATOM   9418  H  HG13 . ILE A 1 128 ? 26.544  53.325 2.356   1.00 0.00  ? 128 ILE A HG13 3  
ATOM   9419  H  HG21 . ILE A 1 128 ? 26.633  51.417 -0.729  1.00 0.00  ? 128 ILE A HG21 3  
ATOM   9420  H  HG22 . ILE A 1 128 ? 25.665  51.888 0.668   1.00 0.00  ? 128 ILE A HG22 3  
ATOM   9421  H  HG23 . ILE A 1 128 ? 26.757  50.508 0.777   1.00 0.00  ? 128 ILE A HG23 3  
ATOM   9422  H  HD11 . ILE A 1 128 ? 26.858  51.806 4.059   1.00 0.00  ? 128 ILE A HD11 3  
ATOM   9423  H  HD12 . ILE A 1 128 ? 28.526  51.476 3.603   1.00 0.00  ? 128 ILE A HD12 3  
ATOM   9424  H  HD13 . ILE A 1 128 ? 27.206  50.731 2.708   1.00 0.00  ? 128 ILE A HD13 3  
ATOM   9425  N  N    . CYS A 1 129 ? 29.247  51.907 -1.738  1.00 0.00  ? 129 CYS A N    3  
ATOM   9426  C  CA   . CYS A 1 129 ? 29.349  51.418 -3.143  1.00 0.00  ? 129 CYS A CA   3  
ATOM   9427  C  C    . CYS A 1 129 ? 27.934  51.179 -3.657  1.00 0.00  ? 129 CYS A C    3  
ATOM   9428  O  O    . CYS A 1 129 ? 27.219  50.313 -3.192  1.00 0.00  ? 129 CYS A O    3  
ATOM   9429  C  CB   . CYS A 1 129 ? 30.236  50.147 -3.246  1.00 0.00  ? 129 CYS A CB   3  
ATOM   9430  S  SG   . CYS A 1 129 ? 29.248  48.624 -3.186  1.00 0.00  ? 129 CYS A SG   3  
ATOM   9431  H  H    . CYS A 1 129 ? 29.167  52.867 -1.582  1.00 0.00  ? 129 CYS A H    3  
ATOM   9432  H  HA   . CYS A 1 129 ? 29.793  52.205 -3.740  1.00 0.00  ? 129 CYS A HA   3  
ATOM   9433  H  HB2  . CYS A 1 129 ? 30.778  50.168 -4.180  1.00 0.00  ? 129 CYS A HB2  3  
ATOM   9434  H  HB3  . CYS A 1 129 ? 30.948  50.144 -2.434  1.00 0.00  ? 129 CYS A HB3  3  
ATOM   9435  H  HG   . CYS A 1 129 ? 28.661  48.680 -2.428  1.00 0.00  ? 129 CYS A HG   3  
ATOM   9436  N  N    . ASN A 1 130 ? 27.503  51.976 -4.589  1.00 0.00  ? 130 ASN A N    3  
ATOM   9437  C  CA   . ASN A 1 130 ? 26.125  51.815 -5.100  1.00 0.00  ? 130 ASN A CA   3  
ATOM   9438  C  C    . ASN A 1 130 ? 25.971  50.436 -5.721  1.00 0.00  ? 130 ASN A C    3  
ATOM   9439  O  O    . ASN A 1 130 ? 26.913  49.680 -5.854  1.00 0.00  ? 130 ASN A O    3  
ATOM   9440  C  CB   . ASN A 1 130 ? 25.829  52.883 -6.155  1.00 0.00  ? 130 ASN A CB   3  
ATOM   9441  C  CG   . ASN A 1 130 ? 24.317  52.988 -6.371  1.00 0.00  ? 130 ASN A CG   3  
ATOM   9442  O  OD1  . ASN A 1 130 ? 23.542  52.488 -5.580  1.00 0.00  ? 130 ASN A OD1  3  
ATOM   9443  N  ND2  . ASN A 1 130 ? 23.861  53.622 -7.417  1.00 0.00  ? 130 ASN A ND2  3  
ATOM   9444  H  H    . ASN A 1 130 ? 28.078  52.692 -4.933  1.00 0.00  ? 130 ASN A H    3  
ATOM   9445  H  HA   . ASN A 1 130 ? 25.428  51.918 -4.281  1.00 0.00  ? 130 ASN A HA   3  
ATOM   9446  H  HB2  . ASN A 1 130 ? 26.211  53.833 -5.822  1.00 0.00  ? 130 ASN A HB2  3  
ATOM   9447  H  HB3  . ASN A 1 130 ? 26.302  52.610 -7.085  1.00 0.00  ? 130 ASN A HB3  3  
ATOM   9448  H  HD21 . ASN A 1 130 ? 24.485  54.026 -8.055  1.00 0.00  ? 130 ASN A HD21 3  
ATOM   9449  H  HD22 . ASN A 1 130 ? 22.895  53.695 -7.563  1.00 0.00  ? 130 ASN A HD22 3  
ATOM   9450  N  N    . LYS A 1 131 ? 24.782  50.123 -6.108  1.00 0.00  ? 131 LYS A N    3  
ATOM   9451  C  CA   . LYS A 1 131 ? 24.516  48.802 -6.741  1.00 0.00  ? 131 LYS A CA   3  
ATOM   9452  C  C    . LYS A 1 131 ? 25.491  48.607 -7.901  1.00 0.00  ? 131 LYS A C    3  
ATOM   9453  O  O    . LYS A 1 131 ? 25.744  47.501 -8.334  1.00 0.00  ? 131 LYS A O    3  
ATOM   9454  C  CB   . LYS A 1 131 ? 23.078  48.765 -7.266  1.00 0.00  ? 131 LYS A CB   3  
ATOM   9455  C  CG   . LYS A 1 131 ? 22.794  50.039 -8.074  1.00 0.00  ? 131 LYS A CG   3  
ATOM   9456  C  CD   . LYS A 1 131 ? 21.507  49.868 -8.905  1.00 0.00  ? 131 LYS A CD   3  
ATOM   9457  C  CE   . LYS A 1 131 ? 21.830  49.223 -10.259 1.00 0.00  ? 131 LYS A CE   3  
ATOM   9458  N  NZ   . LYS A 1 131 ? 22.413  50.249 -11.170 1.00 0.00  ? 131 LYS A NZ   3  
ATOM   9459  H  H    . LYS A 1 131 ? 24.063  50.768 -5.987  1.00 0.00  ? 131 LYS A H    3  
ATOM   9460  H  HA   . LYS A 1 131 ? 24.657  48.017 -6.013  1.00 0.00  ? 131 LYS A HA   3  
ATOM   9461  H  HB2  . LYS A 1 131 ? 22.948  47.898 -7.895  1.00 0.00  ? 131 LYS A HB2  3  
ATOM   9462  H  HB3  . LYS A 1 131 ? 22.393  48.711 -6.433  1.00 0.00  ? 131 LYS A HB3  3  
ATOM   9463  H  HG2  . LYS A 1 131 ? 22.673  50.869 -7.392  1.00 0.00  ? 131 LYS A HG2  3  
ATOM   9464  H  HG3  . LYS A 1 131 ? 23.627  50.239 -8.732  1.00 0.00  ? 131 LYS A HG3  3  
ATOM   9465  H  HD2  . LYS A 1 131 ? 20.806  49.243 -8.369  1.00 0.00  ? 131 LYS A HD2  3  
ATOM   9466  H  HD3  . LYS A 1 131 ? 21.060  50.837 -9.074  1.00 0.00  ? 131 LYS A HD3  3  
ATOM   9467  H  HE2  . LYS A 1 131 ? 22.540  48.422 -10.120 1.00 0.00  ? 131 LYS A HE2  3  
ATOM   9468  H  HE3  . LYS A 1 131 ? 20.924  48.829 -10.695 1.00 0.00  ? 131 LYS A HE3  3  
ATOM   9469  H  HZ1  . LYS A 1 131 ? 22.157  50.026 -12.152 1.00 0.00  ? 131 LYS A HZ1  3  
ATOM   9470  H  HZ2  . LYS A 1 131 ? 23.449  50.250 -11.072 1.00 0.00  ? 131 LYS A HZ2  3  
ATOM   9471  H  HZ3  . LYS A 1 131 ? 22.039  51.186 -10.921 1.00 0.00  ? 131 LYS A HZ3  3  
ATOM   9472  N  N    . TYR A 1 132 ? 26.047  49.686 -8.398  1.00 0.00  ? 132 TYR A N    3  
ATOM   9473  C  CA   . TYR A 1 132 ? 27.024  49.604 -9.528  1.00 0.00  ? 132 TYR A CA   3  
ATOM   9474  C  C    . TYR A 1 132 ? 28.351  50.220 -9.078  1.00 0.00  ? 132 TYR A C    3  
ATOM   9475  O  O    . TYR A 1 132 ? 29.226  50.490 -9.876  1.00 0.00  ? 132 TYR A O    3  
ATOM   9476  C  CB   . TYR A 1 132 ? 26.479  50.383 -10.730 1.00 0.00  ? 132 TYR A CB   3  
ATOM   9477  C  CG   . TYR A 1 132 ? 27.262  50.017 -11.970 1.00 0.00  ? 132 TYR A CG   3  
ATOM   9478  C  CD1  . TYR A 1 132 ? 26.911  48.880 -12.708 1.00 0.00  ? 132 TYR A CD1  3  
ATOM   9479  C  CD2  . TYR A 1 132 ? 28.339  50.812 -12.380 1.00 0.00  ? 132 TYR A CD2  3  
ATOM   9480  C  CE1  . TYR A 1 132 ? 27.635  48.539 -13.856 1.00 0.00  ? 132 TYR A CE1  3  
ATOM   9481  C  CE2  . TYR A 1 132 ? 29.063  50.471 -13.529 1.00 0.00  ? 132 TYR A CE2  3  
ATOM   9482  C  CZ   . TYR A 1 132 ? 28.711  49.335 -14.267 1.00 0.00  ? 132 TYR A CZ   3  
ATOM   9483  O  OH   . TYR A 1 132 ? 29.426  48.999 -15.399 1.00 0.00  ? 132 TYR A OH   3  
ATOM   9484  H  H    . TYR A 1 132 ? 25.825  50.562 -8.016  1.00 0.00  ? 132 TYR A H    3  
ATOM   9485  H  HA   . TYR A 1 132 ? 27.187  48.572 -9.810  1.00 0.00  ? 132 TYR A HA   3  
ATOM   9486  H  HB2  . TYR A 1 132 ? 25.438  50.136 -10.876 1.00 0.00  ? 132 TYR A HB2  3  
ATOM   9487  H  HB3  . TYR A 1 132 ? 26.574  51.443 -10.546 1.00 0.00  ? 132 TYR A HB3  3  
ATOM   9488  H  HD1  . TYR A 1 132 ? 26.080  48.266 -12.392 1.00 0.00  ? 132 TYR A HD1  3  
ATOM   9489  H  HD2  . TYR A 1 132 ? 28.610  51.689 -11.812 1.00 0.00  ? 132 TYR A HD2  3  
ATOM   9490  H  HE1  . TYR A 1 132 ? 27.364  47.663 -14.426 1.00 0.00  ? 132 TYR A HE1  3  
ATOM   9491  H  HE2  . TYR A 1 132 ? 29.893  51.085 -13.846 1.00 0.00  ? 132 TYR A HE2  3  
ATOM   9492  H  HH   . TYR A 1 132 ? 29.345  49.722 -16.025 1.00 0.00  ? 132 TYR A HH   3  
ATOM   9493  N  N    . GLY A 1 133 ? 28.508  50.428 -7.798  1.00 0.00  ? 133 GLY A N    3  
ATOM   9494  C  CA   . GLY A 1 133 ? 29.776  51.008 -7.281  1.00 0.00  ? 133 GLY A CA   3  
ATOM   9495  C  C    . GLY A 1 133 ? 29.806  52.502 -7.557  1.00 0.00  ? 133 GLY A C    3  
ATOM   9496  O  O    . GLY A 1 133 ? 30.838  53.139 -7.476  1.00 0.00  ? 133 GLY A O    3  
ATOM   9497  H  H    . GLY A 1 133 ? 27.798  50.190 -7.173  1.00 0.00  ? 133 GLY A H    3  
ATOM   9498  H  HA2  . GLY A 1 133 ? 29.843  50.836 -6.217  1.00 0.00  ? 133 GLY A HA2  3  
ATOM   9499  H  HA3  . GLY A 1 133 ? 30.607  50.542 -7.772  1.00 0.00  ? 133 GLY A HA3  3  
ATOM   9500  N  N    . GLU A 1 134 ? 28.685  53.072 -7.885  1.00 0.00  ? 134 GLU A N    3  
ATOM   9501  C  CA   . GLU A 1 134 ? 28.665  54.533 -8.167  1.00 0.00  ? 134 GLU A CA   3  
ATOM   9502  C  C    . GLU A 1 134 ? 28.702  55.303 -6.847  1.00 0.00  ? 134 GLU A C    3  
ATOM   9503  O  O    . GLU A 1 134 ? 27.677  55.599 -6.265  1.00 0.00  ? 134 GLU A O    3  
ATOM   9504  C  CB   . GLU A 1 134 ? 27.396  54.904 -8.941  1.00 0.00  ? 134 GLU A CB   3  
ATOM   9505  C  CG   . GLU A 1 134 ? 27.509  54.396 -10.379 1.00 0.00  ? 134 GLU A CG   3  
ATOM   9506  C  CD   . GLU A 1 134 ? 28.477  55.286 -11.163 1.00 0.00  ? 134 GLU A CD   3  
ATOM   9507  O  OE1  . GLU A 1 134 ? 28.138  56.434 -11.398 1.00 0.00  ? 134 GLU A OE1  3  
ATOM   9508  O  OE2  . GLU A 1 134 ? 29.541  54.803 -11.514 1.00 0.00  ? 134 GLU A OE2  3  
ATOM   9509  H  H    . GLU A 1 134 ? 27.862  52.539 -7.945  1.00 0.00  ? 134 GLU A H    3  
ATOM   9510  H  HA   . GLU A 1 134 ? 29.529  54.786 -8.755  1.00 0.00  ? 134 GLU A HA   3  
ATOM   9511  H  HB2  . GLU A 1 134 ? 26.538  54.454 -8.466  1.00 0.00  ? 134 GLU A HB2  3  
ATOM   9512  H  HB3  . GLU A 1 134 ? 27.281  55.977 -8.949  1.00 0.00  ? 134 GLU A HB3  3  
ATOM   9513  H  HG2  . GLU A 1 134 ? 27.876  53.381 -10.374 1.00 0.00  ? 134 GLU A HG2  3  
ATOM   9514  H  HG3  . GLU A 1 134 ? 26.537  54.425 -10.849 1.00 0.00  ? 134 GLU A HG3  3  
ATOM   9515  N  N    . MET A 1 135 ? 29.875  55.631 -6.359  1.00 0.00  ? 135 MET A N    3  
ATOM   9516  C  CA   . MET A 1 135 ? 29.990  56.382 -5.066  1.00 0.00  ? 135 MET A CA   3  
ATOM   9517  C  C    . MET A 1 135 ? 30.298  57.858 -5.385  1.00 0.00  ? 135 MET A C    3  
ATOM   9518  O  O    . MET A 1 135 ? 30.675  58.173 -6.499  1.00 0.00  ? 135 MET A O    3  
ATOM   9519  C  CB   . MET A 1 135 ? 31.146  55.768 -4.218  1.00 0.00  ? 135 MET A CB   3  
ATOM   9520  C  CG   . MET A 1 135 ? 31.949  54.756 -5.049  1.00 0.00  ? 135 MET A CG   3  
ATOM   9521  S  SD   . MET A 1 135 ? 33.462  54.303 -4.161  1.00 0.00  ? 135 MET A SD   3  
ATOM   9522  C  CE   . MET A 1 135 ? 32.675  53.681 -2.656  1.00 0.00  ? 135 MET A CE   3  
ATOM   9523  H  H    . MET A 1 135 ? 30.703  55.392 -6.821  1.00 0.00  ? 135 MET A H    3  
ATOM   9524  H  HA   . MET A 1 135 ? 29.060  56.313 -4.520  1.00 0.00  ? 135 MET A HA   3  
ATOM   9525  H  HB2  . MET A 1 135 ? 31.821  56.544 -3.884  1.00 0.00  ? 135 MET A HB2  3  
ATOM   9526  H  HB3  . MET A 1 135 ? 30.732  55.264 -3.356  1.00 0.00  ? 135 MET A HB3  3  
ATOM   9527  H  HG2  . MET A 1 135 ? 31.353  53.872 -5.219  1.00 0.00  ? 135 MET A HG2  3  
ATOM   9528  H  HG3  . MET A 1 135 ? 32.216  55.199 -5.997  1.00 0.00  ? 135 MET A HG3  3  
ATOM   9529  H  HE1  . MET A 1 135 ? 33.334  52.972 -2.173  1.00 0.00  ? 135 MET A HE1  3  
ATOM   9530  H  HE2  . MET A 1 135 ? 31.748  53.192 -2.908  1.00 0.00  ? 135 MET A HE2  3  
ATOM   9531  H  HE3  . MET A 1 135 ? 32.475  54.508 -1.989  1.00 0.00  ? 135 MET A HE3  3  
ATOM   9532  N  N    . PRO A 1 136 ? 30.153  58.728 -4.405  1.00 0.00  ? 136 PRO A N    3  
ATOM   9533  C  CA   . PRO A 1 136 ? 30.452  60.156 -4.614  1.00 0.00  ? 136 PRO A CA   3  
ATOM   9534  C  C    . PRO A 1 136 ? 31.887  60.306 -5.147  1.00 0.00  ? 136 PRO A C    3  
ATOM   9535  O  O    . PRO A 1 136 ? 32.174  61.164 -5.952  1.00 0.00  ? 136 PRO A O    3  
ATOM   9536  C  CB   . PRO A 1 136 ? 30.290  60.805 -3.219  1.00 0.00  ? 136 PRO A CB   3  
ATOM   9537  C  CG   . PRO A 1 136 ? 29.759  59.708 -2.250  1.00 0.00  ? 136 PRO A CG   3  
ATOM   9538  C  CD   . PRO A 1 136 ? 29.685  58.381 -3.040  1.00 0.00  ? 136 PRO A CD   3  
ATOM   9539  H  HA   . PRO A 1 136 ? 29.748  60.585 -5.309  1.00 0.00  ? 136 PRO A HA   3  
ATOM   9540  H  HB2  . PRO A 1 136 ? 31.245  61.181 -2.865  1.00 0.00  ? 136 PRO A HB2  3  
ATOM   9541  H  HB3  . PRO A 1 136 ? 29.581  61.618 -3.269  1.00 0.00  ? 136 PRO A HB3  3  
ATOM   9542  H  HG2  . PRO A 1 136 ? 30.431  59.605 -1.407  1.00 0.00  ? 136 PRO A HG2  3  
ATOM   9543  H  HG3  . PRO A 1 136 ? 28.772  59.976 -1.895  1.00 0.00  ? 136 PRO A HG3  3  
ATOM   9544  H  HD2  . PRO A 1 136 ? 30.328  57.640 -2.588  1.00 0.00  ? 136 PRO A HD2  3  
ATOM   9545  H  HD3  . PRO A 1 136 ? 28.667  58.022 -3.073  1.00 0.00  ? 136 PRO A HD3  3  
ATOM   9546  N  N    . VAL A 1 137 ? 32.784  59.478 -4.687  1.00 0.00  ? 137 VAL A N    3  
ATOM   9547  C  CA   . VAL A 1 137 ? 34.205  59.559 -5.144  1.00 0.00  ? 137 VAL A CA   3  
ATOM   9548  C  C    . VAL A 1 137 ? 34.280  59.651 -6.673  1.00 0.00  ? 137 VAL A C    3  
ATOM   9549  O  O    . VAL A 1 137 ? 35.141  60.310 -7.223  1.00 0.00  ? 137 VAL A O    3  
ATOM   9550  C  CB   . VAL A 1 137 ? 34.938  58.299 -4.692  1.00 0.00  ? 137 VAL A CB   3  
ATOM   9551  C  CG1  . VAL A 1 137 ? 36.399  58.366 -5.139  1.00 0.00  ? 137 VAL A CG1  3  
ATOM   9552  C  CG2  . VAL A 1 137 ? 34.875  58.191 -3.167  1.00 0.00  ? 137 VAL A CG2  3  
ATOM   9553  H  H    . VAL A 1 137 ? 32.525  58.803 -4.026  1.00 0.00  ? 137 VAL A H    3  
ATOM   9554  H  HA   . VAL A 1 137 ? 34.677  60.425 -4.706  1.00 0.00  ? 137 VAL A HA   3  
ATOM   9555  H  HB   . VAL A 1 137 ? 34.464  57.436 -5.137  1.00 0.00  ? 137 VAL A HB   3  
ATOM   9556  H  HG11 . VAL A 1 137 ? 36.961  57.584 -4.649  1.00 0.00  ? 137 VAL A HG11 3  
ATOM   9557  H  HG12 . VAL A 1 137 ? 36.813  59.328 -4.873  1.00 0.00  ? 137 VAL A HG12 3  
ATOM   9558  H  HG13 . VAL A 1 137 ? 36.455  58.233 -6.209  1.00 0.00  ? 137 VAL A HG13 3  
ATOM   9559  H  HG21 . VAL A 1 137 ? 35.301  59.080 -2.725  1.00 0.00  ? 137 VAL A HG21 3  
ATOM   9560  H  HG22 . VAL A 1 137 ? 35.434  57.325 -2.844  1.00 0.00  ? 137 VAL A HG22 3  
ATOM   9561  H  HG23 . VAL A 1 137 ? 33.846  58.092 -2.855  1.00 0.00  ? 137 VAL A HG23 3  
ATOM   9562  N  N    . ASP A 1 138 ? 33.385  59.002 -7.364  1.00 0.00  ? 138 ASP A N    3  
ATOM   9563  C  CA   . ASP A 1 138 ? 33.404  59.054 -8.854  1.00 0.00  ? 138 ASP A CA   3  
ATOM   9564  C  C    . ASP A 1 138 ? 32.662  60.304 -9.303  1.00 0.00  ? 138 ASP A C    3  
ATOM   9565  O  O    . ASP A 1 138 ? 33.137  61.073 -10.118 1.00 0.00  ? 138 ASP A O    3  
ATOM   9566  C  CB   . ASP A 1 138 ? 32.709  57.814 -9.421  1.00 0.00  ? 138 ASP A CB   3  
ATOM   9567  C  CG   . ASP A 1 138 ? 32.812  57.823 -10.947 1.00 0.00  ? 138 ASP A CG   3  
ATOM   9568  O  OD1  . ASP A 1 138 ? 33.841  58.243 -11.448 1.00 0.00  ? 138 ASP A OD1  3  
ATOM   9569  O  OD2  . ASP A 1 138 ? 31.860  57.410 -11.588 1.00 0.00  ? 138 ASP A OD2  3  
ATOM   9570  H  H    . ASP A 1 138 ? 32.692  58.492 -6.901  1.00 0.00  ? 138 ASP A H    3  
ATOM   9571  H  HA   . ASP A 1 138 ? 34.426  59.091 -9.206  1.00 0.00  ? 138 ASP A HA   3  
ATOM   9572  H  HB2  . ASP A 1 138 ? 33.185  56.925 -9.032  1.00 0.00  ? 138 ASP A HB2  3  
ATOM   9573  H  HB3  . ASP A 1 138 ? 31.668  57.821 -9.132  1.00 0.00  ? 138 ASP A HB3  3  
ATOM   9574  N  N    . LYS A 1 139 ? 31.500  60.520 -8.762  1.00 0.00  ? 139 LYS A N    3  
ATOM   9575  C  CA   . LYS A 1 139 ? 30.727  61.732 -9.137  1.00 0.00  ? 139 LYS A CA   3  
ATOM   9576  C  C    . LYS A 1 139 ? 31.506  62.961 -8.662  1.00 0.00  ? 139 LYS A C    3  
ATOM   9577  O  O    . LYS A 1 139 ? 31.268  64.070 -9.089  1.00 0.00  ? 139 LYS A O    3  
ATOM   9578  C  CB   . LYS A 1 139 ? 29.349  61.682 -8.462  1.00 0.00  ? 139 LYS A CB   3  
ATOM   9579  C  CG   . LYS A 1 139 ? 28.533  60.467 -8.997  1.00 0.00  ? 139 LYS A CG   3  
ATOM   9580  C  CD   . LYS A 1 139 ? 27.898  59.669 -7.843  1.00 0.00  ? 139 LYS A CD   3  
ATOM   9581  C  CE   . LYS A 1 139 ? 26.713  60.445 -7.264  1.00 0.00  ? 139 LYS A CE   3  
ATOM   9582  N  NZ   . LYS A 1 139 ? 27.158  61.806 -6.859  1.00 0.00  ? 139 LYS A NZ   3  
ATOM   9583  H  H    . LYS A 1 139 ? 31.144  59.885 -8.097  1.00 0.00  ? 139 LYS A H    3  
ATOM   9584  H  HA   . LYS A 1 139 ? 30.607  61.770 -10.210 1.00 0.00  ? 139 LYS A HA   3  
ATOM   9585  H  HB2  . LYS A 1 139 ? 29.490  61.601 -7.394  1.00 0.00  ? 139 LYS A HB2  3  
ATOM   9586  H  HB3  . LYS A 1 139 ? 28.816  62.598 -8.678  1.00 0.00  ? 139 LYS A HB3  3  
ATOM   9587  H  HG2  . LYS A 1 139 ? 27.746  60.821 -9.649  1.00 0.00  ? 139 LYS A HG2  3  
ATOM   9588  H  HG3  . LYS A 1 139 ? 29.180  59.806 -9.560  1.00 0.00  ? 139 LYS A HG3  3  
ATOM   9589  H  HD2  . LYS A 1 139 ? 27.550  58.718 -8.219  1.00 0.00  ? 139 LYS A HD2  3  
ATOM   9590  H  HD3  . LYS A 1 139 ? 28.630  59.500 -7.069  1.00 0.00  ? 139 LYS A HD3  3  
ATOM   9591  H  HE2  . LYS A 1 139 ? 25.937  60.528 -8.011  1.00 0.00  ? 139 LYS A HE2  3  
ATOM   9592  H  HE3  . LYS A 1 139 ? 26.328  59.921 -6.402  1.00 0.00  ? 139 LYS A HE3  3  
ATOM   9593  H  HZ1  . LYS A 1 139 ? 26.435  62.242 -6.254  1.00 0.00  ? 139 LYS A HZ1  3  
ATOM   9594  H  HZ2  . LYS A 1 139 ? 27.302  62.391 -7.707  1.00 0.00  ? 139 LYS A HZ2  3  
ATOM   9595  H  HZ3  . LYS A 1 139 ? 28.050  61.735 -6.330  1.00 0.00  ? 139 LYS A HZ3  3  
ATOM   9596  N  N    . ALA A 1 140 ? 32.454  62.756 -7.786  1.00 16.48 ? 140 ALA A N    3  
ATOM   9597  C  CA   . ALA A 1 140 ? 33.278  63.893 -7.276  1.00 12.13 ? 140 ALA A CA   3  
ATOM   9598  C  C    . ALA A 1 140 ? 34.548  63.991 -8.108  1.00 16.12 ? 140 ALA A C    3  
ATOM   9599  O  O    . ALA A 1 140 ? 35.156  65.036 -8.225  1.00 20.15 ? 140 ALA A O    3  
ATOM   9600  C  CB   . ALA A 1 140 ? 33.650  63.643 -5.814  1.00 8.08  ? 140 ALA A CB   3  
ATOM   9601  H  H    . ALA A 1 140 ? 32.628  61.842 -7.475  1.00 0.00  ? 140 ALA A H    3  
ATOM   9602  H  HA   . ALA A 1 140 ? 32.725  64.811 -7.358  1.00 0.00  ? 140 ALA A HA   3  
ATOM   9603  H  HB1  . ALA A 1 140 ? 33.989  62.624 -5.698  1.00 0.00  ? 140 ALA A HB1  3  
ATOM   9604  H  HB2  . ALA A 1 140 ? 32.786  63.809 -5.188  1.00 0.00  ? 140 ALA A HB2  3  
ATOM   9605  H  HB3  . ALA A 1 140 ? 34.441  64.318 -5.525  1.00 0.00  ? 140 ALA A HB3  3  
ATOM   9606  N  N    . LYS A 1 141 ? 34.947  62.900 -8.687  1.00 0.00  ? 141 LYS A N    3  
ATOM   9607  C  CA   . LYS A 1 141 ? 36.179  62.892 -9.524  1.00 0.00  ? 141 LYS A CA   3  
ATOM   9608  C  C    . LYS A 1 141 ? 35.819  63.210 -10.980 1.00 0.00  ? 141 LYS A C    3  
ATOM   9609  O  O    . LYS A 1 141 ? 36.692  63.331 -11.817 1.00 0.00  ? 141 LYS A O    3  
ATOM   9610  C  CB   . LYS A 1 141 ? 36.838  61.503 -9.442  1.00 0.00  ? 141 LYS A CB   3  
ATOM   9611  C  CG   . LYS A 1 141 ? 37.893  61.345 -10.552 1.00 0.00  ? 141 LYS A CG   3  
ATOM   9612  C  CD   . LYS A 1 141 ? 38.872  60.206 -10.204 1.00 0.00  ? 141 LYS A CD   3  
ATOM   9613  C  CE   . LYS A 1 141 ? 40.034  60.749 -9.365  1.00 0.00  ? 141 LYS A CE   3  
ATOM   9614  N  NZ   . LYS A 1 141 ? 40.748  59.616 -8.710  1.00 0.00  ? 141 LYS A NZ   3  
ATOM   9615  H  H    . LYS A 1 141 ? 34.430  62.078 -8.570  1.00 0.00  ? 141 LYS A H    3  
ATOM   9616  H  HA   . LYS A 1 141 ? 36.873  63.636 -9.158  1.00 0.00  ? 141 LYS A HA   3  
ATOM   9617  H  HB2  . LYS A 1 141 ? 37.312  61.390 -8.478  1.00 0.00  ? 141 LYS A HB2  3  
ATOM   9618  H  HB3  . LYS A 1 141 ? 36.081  60.742 -9.559  1.00 0.00  ? 141 LYS A HB3  3  
ATOM   9619  H  HG2  . LYS A 1 141 ? 37.393  61.113 -11.482 1.00 0.00  ? 141 LYS A HG2  3  
ATOM   9620  H  HG3  . LYS A 1 141 ? 38.439  62.271 -10.664 1.00 0.00  ? 141 LYS A HG3  3  
ATOM   9621  H  HD2  . LYS A 1 141 ? 38.356  59.437 -9.646  1.00 0.00  ? 141 LYS A HD2  3  
ATOM   9622  H  HD3  . LYS A 1 141 ? 39.265  59.780 -11.116 1.00 0.00  ? 141 LYS A HD3  3  
ATOM   9623  H  HE2  . LYS A 1 141 ? 40.720  61.284 -10.005 1.00 0.00  ? 141 LYS A HE2  3  
ATOM   9624  H  HE3  . LYS A 1 141 ? 39.652  61.418 -8.610  1.00 0.00  ? 141 LYS A HE3  3  
ATOM   9625  H  HZ1  . LYS A 1 141 ? 40.065  58.873 -8.461  1.00 0.00  ? 141 LYS A HZ1  3  
ATOM   9626  H  HZ2  . LYS A 1 141 ? 41.222  59.957 -7.849  1.00 0.00  ? 141 LYS A HZ2  3  
ATOM   9627  H  HZ3  . LYS A 1 141 ? 41.456  59.227 -9.365  1.00 0.00  ? 141 LYS A HZ3  3  
ATOM   9628  N  N    . ALA A 1 142 ? 34.555  63.353 -11.311 1.00 0.00  ? 142 ALA A N    3  
ATOM   9629  C  CA   . ALA A 1 142 ? 34.187  63.664 -12.728 1.00 0.00  ? 142 ALA A CA   3  
ATOM   9630  C  C    . ALA A 1 142 ? 34.085  65.193 -12.946 1.00 0.00  ? 142 ALA A C    3  
ATOM   9631  O  O    . ALA A 1 142 ? 34.658  65.699 -13.891 1.00 0.00  ? 142 ALA A O    3  
ATOM   9632  C  CB   . ALA A 1 142 ? 32.845  62.970 -13.066 1.00 0.00  ? 142 ALA A CB   3  
ATOM   9633  H  H    . ALA A 1 142 ? 33.829  63.269 -10.650 1.00 0.00  ? 142 ALA A H    3  
ATOM   9634  H  HA   . ALA A 1 142 ? 34.957  63.278 -13.386 1.00 0.00  ? 142 ALA A HA   3  
ATOM   9635  H  HB1  . ALA A 1 142 ? 32.122  63.696 -13.415 1.00 0.00  ? 142 ALA A HB1  3  
ATOM   9636  H  HB2  . ALA A 1 142 ? 32.463  62.486 -12.181 1.00 0.00  ? 142 ALA A HB2  3  
ATOM   9637  H  HB3  . ALA A 1 142 ? 33.001  62.225 -13.837 1.00 0.00  ? 142 ALA A HB3  3  
ATOM   9638  N  N    . PRO A 1 143 ? 33.356  65.898 -12.096 1.00 0.00  ? 143 PRO A N    3  
ATOM   9639  C  CA   . PRO A 1 143 ? 33.204  67.356 -12.262 1.00 0.00  ? 143 PRO A CA   3  
ATOM   9640  C  C    . PRO A 1 143 ? 34.577  68.034 -12.196 1.00 0.00  ? 143 PRO A C    3  
ATOM   9641  O  O    . PRO A 1 143 ? 34.971  68.712 -13.119 1.00 0.00  ? 143 PRO A O    3  
ATOM   9642  C  CB   . PRO A 1 143 ? 32.289  67.802 -11.095 1.00 0.00  ? 143 PRO A CB   3  
ATOM   9643  C  CG   . PRO A 1 143 ? 31.881  66.523 -10.307 1.00 0.00  ? 143 PRO A CG   3  
ATOM   9644  C  CD   . PRO A 1 143 ? 32.642  65.330 -10.931 1.00 0.00  ? 143 PRO A CD   3  
ATOM   9645  H  HA   . PRO A 1 143 ? 32.730  67.573 -13.208 1.00 0.00  ? 143 PRO A HA   3  
ATOM   9646  H  HB2  . PRO A 1 143 ? 32.819  68.486 -10.441 1.00 0.00  ? 143 PRO A HB2  3  
ATOM   9647  H  HB3  . PRO A 1 143 ? 31.403  68.286 -11.482 1.00 0.00  ? 143 PRO A HB3  3  
ATOM   9648  H  HG2  . PRO A 1 143 ? 32.149  66.632 -9.257  1.00 0.00  ? 143 PRO A HG2  3  
ATOM   9649  H  HG3  . PRO A 1 143 ? 30.814  66.360 -10.392 1.00 0.00  ? 143 PRO A HG3  3  
ATOM   9650  H  HD2  . PRO A 1 143 ? 33.342  64.934 -10.213 1.00 0.00  ? 143 PRO A HD2  3  
ATOM   9651  H  HD3  . PRO A 1 143 ? 31.953  64.566 -11.252 1.00 0.00  ? 143 PRO A HD3  3  
ATOM   9652  N  N    . LEU A 1 144 ? 35.292  67.819 -11.111 1.00 0.00  ? 144 LEU A N    3  
ATOM   9653  C  CA   . LEU A 1 144 ? 36.669  68.407 -10.912 1.00 0.00  ? 144 LEU A CA   3  
ATOM   9654  C  C    . LEU A 1 144 ? 36.910  68.636 -9.408  1.00 0.00  ? 144 LEU A C    3  
ATOM   9655  O  O    . LEU A 1 144 ? 37.911  69.208 -9.024  1.00 0.00  ? 144 LEU A O    3  
ATOM   9656  C  CB   . LEU A 1 144 ? 36.838  69.763 -11.656 1.00 0.00  ? 144 LEU A CB   3  
ATOM   9657  C  CG   . LEU A 1 144 ? 37.493  69.542 -13.045 1.00 0.00  ? 144 LEU A CG   3  
ATOM   9658  C  CD1  . LEU A 1 144 ? 37.039  70.634 -14.019 1.00 0.00  ? 144 LEU A CD1  3  
ATOM   9659  C  CD2  . LEU A 1 144 ? 39.021  69.598 -12.915 1.00 0.00  ? 144 LEU A CD2  3  
ATOM   9660  H  H    . LEU A 1 144 ? 34.921  67.237 -10.419 1.00 0.00  ? 144 LEU A H    3  
ATOM   9661  H  HA   . LEU A 1 144 ? 37.404  67.701 -11.274 1.00 0.00  ? 144 LEU A HA   3  
ATOM   9662  H  HB2  . LEU A 1 144 ? 35.874  70.236 -11.768 1.00 0.00  ? 144 LEU A HB2  3  
ATOM   9663  H  HB3  . LEU A 1 144 ? 37.471  70.421 -11.072 1.00 0.00  ? 144 LEU A HB3  3  
ATOM   9664  H  HG   . LEU A 1 144 ? 37.210  68.575 -13.437 1.00 0.00  ? 144 LEU A HG   3  
ATOM   9665  H  HD11 . LEU A 1 144 ? 35.967  70.584 -14.142 1.00 0.00  ? 144 LEU A HD11 3  
ATOM   9666  H  HD12 . LEU A 1 144 ? 37.519  70.486 -14.975 1.00 0.00  ? 144 LEU A HD12 3  
ATOM   9667  H  HD13 . LEU A 1 144 ? 37.311  71.602 -13.626 1.00 0.00  ? 144 LEU A HD13 3  
ATOM   9668  H  HD21 . LEU A 1 144 ? 39.320  70.588 -12.602 1.00 0.00  ? 144 LEU A HD21 3  
ATOM   9669  H  HD22 . LEU A 1 144 ? 39.473  69.371 -13.869 1.00 0.00  ? 144 LEU A HD22 3  
ATOM   9670  H  HD23 . LEU A 1 144 ? 39.347  68.875 -12.182 1.00 0.00  ? 144 LEU A HD23 3  
ATOM   9671  N  N    . ARG A 1 145 ? 36.014  68.215 -8.551  1.00 0.00  ? 145 ARG A N    3  
ATOM   9672  C  CA   . ARG A 1 145 ? 36.237  68.445 -7.096  1.00 0.00  ? 145 ARG A CA   3  
ATOM   9673  C  C    . ARG A 1 145 ? 37.557  67.797 -6.681  1.00 0.00  ? 145 ARG A C    3  
ATOM   9674  O  O    . ARG A 1 145 ? 38.563  68.459 -6.520  1.00 0.00  ? 145 ARG A O    3  
ATOM   9675  C  CB   . ARG A 1 145 ? 35.086  67.825 -6.300  1.00 0.00  ? 145 ARG A CB   3  
ATOM   9676  C  CG   . ARG A 1 145 ? 33.759  68.422 -6.774  1.00 0.00  ? 145 ARG A CG   3  
ATOM   9677  C  CD   . ARG A 1 145 ? 32.608  67.811 -5.972  1.00 0.00  ? 145 ARG A CD   3  
ATOM   9678  N  NE   . ARG A 1 145 ? 32.644  68.333 -4.577  1.00 0.00  ? 145 ARG A NE   3  
ATOM   9679  C  CZ   . ARG A 1 145 ? 31.605  68.189 -3.799  1.00 0.00  ? 145 ARG A CZ   3  
ATOM   9680  N  NH1  . ARG A 1 145 ? 30.536  67.587 -4.243  1.00 0.00  ? 145 ARG A NH1  3  
ATOM   9681  N  NH2  . ARG A 1 145 ? 31.635  68.649 -2.578  1.00 0.00  ? 145 ARG A NH2  3  
ATOM   9682  H  H    . ARG A 1 145 ? 35.202  67.758 -8.856  1.00 0.00  ? 145 ARG A H    3  
ATOM   9683  H  HA   . ARG A 1 145 ? 36.280  69.506 -6.901  1.00 0.00  ? 145 ARG A HA   3  
ATOM   9684  H  HB2  . ARG A 1 145 ? 35.077  66.756 -6.455  1.00 0.00  ? 145 ARG A HB2  3  
ATOM   9685  H  HB3  . ARG A 1 145 ? 35.219  68.037 -5.250  1.00 0.00  ? 145 ARG A HB3  3  
ATOM   9686  H  HG2  . ARG A 1 145 ? 33.774  69.492 -6.628  1.00 0.00  ? 145 ARG A HG2  3  
ATOM   9687  H  HG3  . ARG A 1 145 ? 33.621  68.203 -7.822  1.00 0.00  ? 145 ARG A HG3  3  
ATOM   9688  H  HD2  . ARG A 1 145 ? 31.668  68.078 -6.432  1.00 0.00  ? 145 ARG A HD2  3  
ATOM   9689  H  HD3  . ARG A 1 145 ? 32.710  66.736 -5.958  1.00 0.00  ? 145 ARG A HD3  3  
ATOM   9690  H  HE   . ARG A 1 145 ? 33.447  68.784 -4.243  1.00 0.00  ? 145 ARG A HE   3  
ATOM   9691  H  HH11 . ARG A 1 145 ? 30.512  67.234 -5.178  1.00 0.00  ? 145 ARG A HH11 3  
ATOM   9692  H  HH12 . ARG A 1 145 ? 29.740  67.477 -3.647  1.00 0.00  ? 145 ARG A HH12 3  
ATOM   9693  H  HH21 . ARG A 1 145 ? 32.455  69.110 -2.238  1.00 0.00  ? 145 ARG A HH21 3  
ATOM   9694  H  HH22 . ARG A 1 145 ? 30.840  68.539 -1.983  1.00 0.00  ? 145 ARG A HH22 3  
ATOM   9695  N  N    . GLU A 1 146 ? 37.554  66.506 -6.502  1.00 0.00  ? 146 GLU A N    3  
ATOM   9696  C  CA   . GLU A 1 146 ? 38.798  65.793 -6.093  1.00 0.00  ? 146 GLU A CA   3  
ATOM   9697  C  C    . GLU A 1 146 ? 39.274  66.305 -4.727  1.00 0.00  ? 146 GLU A C    3  
ATOM   9698  O  O    . GLU A 1 146 ? 40.178  65.757 -4.133  1.00 0.00  ? 146 GLU A O    3  
ATOM   9699  C  CB   . GLU A 1 146 ? 39.899  66.022 -7.137  1.00 0.00  ? 146 GLU A CB   3  
ATOM   9700  C  CG   . GLU A 1 146 ? 39.309  65.892 -8.543  1.00 0.00  ? 146 GLU A CG   3  
ATOM   9701  C  CD   . GLU A 1 146 ? 40.443  65.765 -9.563  1.00 0.00  ? 146 GLU A CD   3  
ATOM   9702  O  OE1  . GLU A 1 146 ? 40.867  64.649 -9.813  1.00 0.00  ? 146 GLU A OE1  3  
ATOM   9703  O  OE2  . GLU A 1 146 ? 40.867  66.787 -10.078 1.00 0.00  ? 146 GLU A OE2  3  
ATOM   9704  H  H    . GLU A 1 146 ? 36.720  66.008 -6.631  1.00 0.00  ? 146 GLU A H    3  
ATOM   9705  H  HA   . GLU A 1 146 ? 38.591  64.737 -6.024  1.00 0.00  ? 146 GLU A HA   3  
ATOM   9706  H  HB2  . GLU A 1 146 ? 40.320  67.008 -7.011  1.00 0.00  ? 146 GLU A HB2  3  
ATOM   9707  H  HB3  . GLU A 1 146 ? 40.674  65.282 -7.006  1.00 0.00  ? 146 GLU A HB3  3  
ATOM   9708  H  HG2  . GLU A 1 146 ? 38.682  65.014 -8.590  1.00 0.00  ? 146 GLU A HG2  3  
ATOM   9709  H  HG3  . GLU A 1 146 ? 38.721  66.768 -8.771  1.00 0.00  ? 146 GLU A HG3  3  
ATOM   9710  N  N    . LEU A 1 147 ? 38.670  67.342 -4.213  1.00 0.00  ? 147 LEU A N    3  
ATOM   9711  C  CA   . LEU A 1 147 ? 39.094  67.864 -2.883  1.00 0.00  ? 147 LEU A CA   3  
ATOM   9712  C  C    . LEU A 1 147 ? 38.577  66.906 -1.813  1.00 0.00  ? 147 LEU A C    3  
ATOM   9713  O  O    . LEU A 1 147 ? 39.330  66.343 -1.036  1.00 0.00  ? 147 LEU A O    3  
ATOM   9714  C  CB   . LEU A 1 147 ? 38.502  69.268 -2.674  1.00 0.00  ? 147 LEU A CB   3  
ATOM   9715  C  CG   . LEU A 1 147 ? 39.346  70.055 -1.665  1.00 0.00  ? 147 LEU A CG   3  
ATOM   9716  C  CD1  . LEU A 1 147 ? 38.696  71.418 -1.414  1.00 0.00  ? 147 LEU A CD1  3  
ATOM   9717  C  CD2  . LEU A 1 147 ? 39.432  69.280 -0.345  1.00 0.00  ? 147 LEU A CD2  3  
ATOM   9718  H  H    . LEU A 1 147 ? 37.933  67.766 -4.690  1.00 0.00  ? 147 LEU A H    3  
ATOM   9719  H  HA   . LEU A 1 147 ? 40.174  67.908 -2.841  1.00 0.00  ? 147 LEU A HA   3  
ATOM   9720  H  HB2  . LEU A 1 147 ? 38.495  69.794 -3.618  1.00 0.00  ? 147 LEU A HB2  3  
ATOM   9721  H  HB3  . LEU A 1 147 ? 37.489  69.186 -2.307  1.00 0.00  ? 147 LEU A HB3  3  
ATOM   9722  H  HG   . LEU A 1 147 ? 40.339  70.201 -2.065  1.00 0.00  ? 147 LEU A HG   3  
ATOM   9723  H  HD11 . LEU A 1 147 ? 39.314  71.994 -0.742  1.00 0.00  ? 147 LEU A HD11 3  
ATOM   9724  H  HD12 . LEU A 1 147 ? 37.720  71.275 -0.972  1.00 0.00  ? 147 LEU A HD12 3  
ATOM   9725  H  HD13 . LEU A 1 147 ? 38.593  71.946 -2.350  1.00 0.00  ? 147 LEU A HD13 3  
ATOM   9726  H  HD21 . LEU A 1 147 ? 38.461  68.875 -0.099  1.00 0.00  ? 147 LEU A HD21 3  
ATOM   9727  H  HD22 . LEU A 1 147 ? 39.755  69.944 0.444   1.00 0.00  ? 147 LEU A HD22 3  
ATOM   9728  H  HD23 . LEU A 1 147 ? 40.143  68.474 -0.447  1.00 0.00  ? 147 LEU A HD23 3  
ATOM   9729  N  N    . LEU A 1 148 ? 37.293  66.696 -1.787  1.00 25.11 ? 148 LEU A N    3  
ATOM   9730  C  CA   . LEU A 1 148 ? 36.723  65.753 -0.798  1.00 22.71 ? 148 LEU A CA   3  
ATOM   9731  C  C    . LEU A 1 148 ? 37.342  64.382 -1.054  1.00 23.41 ? 148 LEU A C    3  
ATOM   9732  O  O    . LEU A 1 148 ? 37.388  63.533 -0.185  1.00 25.25 ? 148 LEU A O    3  
ATOM   9733  C  CB   . LEU A 1 148 ? 35.196  65.690 -0.975  1.00 23.35 ? 148 LEU A CB   3  
ATOM   9734  C  CG   . LEU A 1 148 ? 34.832  65.211 -2.411  1.00 23.72 ? 148 LEU A CG   3  
ATOM   9735  C  CD1  . LEU A 1 148 ? 34.471  63.717 -2.398  1.00 9.66  ? 148 LEU A CD1  3  
ATOM   9736  C  CD2  . LEU A 1 148 ? 33.629  66.011 -2.949  1.00 17.82 ? 148 LEU A CD2  3  
ATOM   9737  H  H    . LEU A 1 148 ? 36.708  67.143 -2.434  1.00 0.00  ? 148 LEU A H    3  
ATOM   9738  H  HA   . LEU A 1 148 ? 36.963  66.083 0.202   1.00 0.00  ? 148 LEU A HA   3  
ATOM   9739  H  HB2  . LEU A 1 148 ? 34.783  65.009 -0.241  1.00 0.00  ? 148 LEU A HB2  3  
ATOM   9740  H  HB3  . LEU A 1 148 ? 34.787  66.677 -0.805  1.00 0.00  ? 148 LEU A HB3  3  
ATOM   9741  H  HG   . LEU A 1 148 ? 35.677  65.361 -3.072  1.00 0.00  ? 148 LEU A HG   3  
ATOM   9742  H  HD11 . LEU A 1 148 ? 35.144  63.189 -1.740  1.00 0.00  ? 148 LEU A HD11 3  
ATOM   9743  H  HD12 . LEU A 1 148 ? 34.560  63.317 -3.396  1.00 0.00  ? 148 LEU A HD12 3  
ATOM   9744  H  HD13 . LEU A 1 148 ? 33.456  63.591 -2.049  1.00 0.00  ? 148 LEU A HD13 3  
ATOM   9745  H  HD21 . LEU A 1 148 ? 33.856  67.066 -2.919  1.00 0.00  ? 148 LEU A HD21 3  
ATOM   9746  H  HD22 . LEU A 1 148 ? 32.762  65.812 -2.338  1.00 0.00  ? 148 LEU A HD22 3  
ATOM   9747  H  HD23 . LEU A 1 148 ? 33.425  65.717 -3.970  1.00 0.00  ? 148 LEU A HD23 3  
ATOM   9748  N  N    . ARG A 1 149 ? 37.833  64.166 -2.249  1.00 0.00  ? 149 ARG A N    3  
ATOM   9749  C  CA   . ARG A 1 149 ? 38.459  62.852 -2.571  1.00 0.00  ? 149 ARG A CA   3  
ATOM   9750  C  C    . ARG A 1 149 ? 39.738  62.682 -1.753  1.00 0.00  ? 149 ARG A C    3  
ATOM   9751  O  O    . ARG A 1 149 ? 39.995  61.627 -1.213  1.00 0.00  ? 149 ARG A O    3  
ATOM   9752  C  CB   . ARG A 1 149 ? 38.796  62.785 -4.059  1.00 0.00  ? 149 ARG A CB   3  
ATOM   9753  C  CG   . ARG A 1 149 ? 39.328  61.386 -4.400  1.00 0.00  ? 149 ARG A CG   3  
ATOM   9754  C  CD   . ARG A 1 149 ? 39.584  61.262 -5.918  1.00 0.00  ? 149 ARG A CD   3  
ATOM   9755  N  NE   . ARG A 1 149 ? 39.107  59.928 -6.405  1.00 0.00  ? 149 ARG A NE   3  
ATOM   9756  C  CZ   . ARG A 1 149 ? 39.412  58.825 -5.770  1.00 0.00  ? 149 ARG A CZ   3  
ATOM   9757  N  NH1  . ARG A 1 149 ? 40.254  58.846 -4.773  1.00 0.00  ? 149 ARG A NH1  3  
ATOM   9758  N  NH2  . ARG A 1 149 ? 38.903  57.690 -6.162  1.00 0.00  ? 149 ARG A NH2  3  
ATOM   9759  H  H    . ARG A 1 149 ? 37.792  64.873 -2.932  1.00 0.00  ? 149 ARG A H    3  
ATOM   9760  H  HA   . ARG A 1 149 ? 37.769  62.059 -2.324  1.00 0.00  ? 149 ARG A HA   3  
ATOM   9761  H  HB2  . ARG A 1 149 ? 37.906  62.985 -4.638  1.00 0.00  ? 149 ARG A HB2  3  
ATOM   9762  H  HB3  . ARG A 1 149 ? 39.551  63.517 -4.290  1.00 0.00  ? 149 ARG A HB3  3  
ATOM   9763  H  HG2  . ARG A 1 149 ? 40.249  61.223 -3.859  1.00 0.00  ? 149 ARG A HG2  3  
ATOM   9764  H  HG3  . ARG A 1 149 ? 38.601  60.646 -4.098  1.00 0.00  ? 149 ARG A HG3  3  
ATOM   9765  H  HD2  . ARG A 1 149 ? 39.034  62.023 -6.448  1.00 0.00  ? 149 ARG A HD2  3  
ATOM   9766  H  HD3  . ARG A 1 149 ? 40.644  61.388 -6.120  1.00 0.00  ? 149 ARG A HD3  3  
ATOM   9767  H  HE   . ARG A 1 149 ? 38.526  59.884 -7.192  1.00 0.00  ? 149 ARG A HE   3  
ATOM   9768  H  HH11 . ARG A 1 149 ? 40.675  59.704 -4.492  1.00 0.00  ? 149 ARG A HH11 3  
ATOM   9769  H  HH12 . ARG A 1 149 ? 40.477  57.999 -4.291  1.00 0.00  ? 149 ARG A HH12 3  
ATOM   9770  H  HH21 . ARG A 1 149 ? 38.282  57.665 -6.946  1.00 0.00  ? 149 ARG A HH21 3  
ATOM   9771  H  HH22 . ARG A 1 149 ? 39.134  56.845 -5.680  1.00 0.00  ? 149 ARG A HH22 3  
ATOM   9772  N  N    . GLU A 1 150 ? 40.546  63.704 -1.646  1.00 0.00  ? 150 GLU A N    3  
ATOM   9773  C  CA   . GLU A 1 150 ? 41.793  63.567 -0.843  1.00 0.00  ? 150 GLU A CA   3  
ATOM   9774  C  C    . GLU A 1 150 ? 41.414  63.269 0.604   1.00 0.00  ? 150 GLU A C    3  
ATOM   9775  O  O    . GLU A 1 150 ? 41.941  62.367 1.225   1.00 0.00  ? 150 GLU A O    3  
ATOM   9776  C  CB   . GLU A 1 150 ? 42.591  64.871 -0.887  1.00 0.00  ? 150 GLU A CB   3  
ATOM   9777  C  CG   . GLU A 1 150 ? 42.964  65.188 -2.330  1.00 0.00  ? 150 GLU A CG   3  
ATOM   9778  C  CD   . GLU A 1 150 ? 43.721  66.516 -2.385  1.00 0.00  ? 150 GLU A CD   3  
ATOM   9779  O  OE1  . GLU A 1 150 ? 43.387  67.398 -1.611  1.00 0.00  ? 150 GLU A OE1  3  
ATOM   9780  O  OE2  . GLU A 1 150 ? 44.621  66.629 -3.201  1.00 0.00  ? 150 GLU A OE2  3  
ATOM   9781  H  H    . GLU A 1 150 ? 40.336  64.560 -2.082  1.00 0.00  ? 150 GLU A H    3  
ATOM   9782  H  HA   . GLU A 1 150 ? 42.391  62.763 -1.238  1.00 0.00  ? 150 GLU A HA   3  
ATOM   9783  H  HB2  . GLU A 1 150 ? 41.992  65.674 -0.484  1.00 0.00  ? 150 GLU A HB2  3  
ATOM   9784  H  HB3  . GLU A 1 150 ? 43.491  64.763 -0.300  1.00 0.00  ? 150 GLU A HB3  3  
ATOM   9785  H  HG2  . GLU A 1 150 ? 43.587  64.398 -2.723  1.00 0.00  ? 150 GLU A HG2  3  
ATOM   9786  H  HG3  . GLU A 1 150 ? 42.067  65.263 -2.916  1.00 0.00  ? 150 GLU A HG3  3  
ATOM   9787  N  N    . ARG A 1 151 ? 40.492  64.018 1.139   1.00 0.00  ? 151 ARG A N    3  
ATOM   9788  C  CA   . ARG A 1 151 ? 40.065  63.781 2.550   1.00 0.00  ? 151 ARG A CA   3  
ATOM   9789  C  C    . ARG A 1 151 ? 39.473  62.377 2.647   1.00 0.00  ? 151 ARG A C    3  
ATOM   9790  O  O    . ARG A 1 151 ? 39.479  61.747 3.686   1.00 0.00  ? 151 ARG A O    3  
ATOM   9791  C  CB   . ARG A 1 151 ? 39.004  64.815 2.949   1.00 0.00  ? 151 ARG A CB   3  
ATOM   9792  C  CG   . ARG A 1 151 ? 39.556  66.240 2.769   1.00 0.00  ? 151 ARG A CG   3  
ATOM   9793  C  CD   . ARG A 1 151 ? 40.385  66.647 3.993   1.00 0.00  ? 151 ARG A CD   3  
ATOM   9794  N  NE   . ARG A 1 151 ? 39.540  66.559 5.217   1.00 0.00  ? 151 ARG A NE   3  
ATOM   9795  C  CZ   . ARG A 1 151 ? 40.097  66.567 6.398   1.00 0.00  ? 151 ARG A CZ   3  
ATOM   9796  N  NH1  . ARG A 1 151 ? 41.395  66.654 6.507   1.00 0.00  ? 151 ARG A NH1  3  
ATOM   9797  N  NH2  . ARG A 1 151 ? 39.356  66.489 7.469   1.00 0.00  ? 151 ARG A NH2  3  
ATOM   9798  H  H    . ARG A 1 151 ? 40.073  64.733 0.605   1.00 0.00  ? 151 ARG A H    3  
ATOM   9799  H  HA   . ARG A 1 151 ? 40.918  63.859 3.206   1.00 0.00  ? 151 ARG A HA   3  
ATOM   9800  H  HB2  . ARG A 1 151 ? 38.132  64.687 2.324   1.00 0.00  ? 151 ARG A HB2  3  
ATOM   9801  H  HB3  . ARG A 1 151 ? 38.727  64.663 3.982   1.00 0.00  ? 151 ARG A HB3  3  
ATOM   9802  H  HG2  . ARG A 1 151 ? 40.178  66.280 1.886   1.00 0.00  ? 151 ARG A HG2  3  
ATOM   9803  H  HG3  . ARG A 1 151 ? 38.732  66.929 2.655   1.00 0.00  ? 151 ARG A HG3  3  
ATOM   9804  H  HD2  . ARG A 1 151 ? 41.233  65.986 4.092   1.00 0.00  ? 151 ARG A HD2  3  
ATOM   9805  H  HD3  . ARG A 1 151 ? 40.733  67.662 3.869   1.00 0.00  ? 151 ARG A HD3  3  
ATOM   9806  H  HE   . ARG A 1 151 ? 38.566  66.495 5.136   1.00 0.00  ? 151 ARG A HE   3  
ATOM   9807  H  HH11 . ARG A 1 151 ? 41.963  66.714 5.686   1.00 0.00  ? 151 ARG A HH11 3  
ATOM   9808  H  HH12 . ARG A 1 151 ? 41.821  66.661 7.411   1.00 0.00  ? 151 ARG A HH12 3  
ATOM   9809  H  HH21 . ARG A 1 151 ? 38.362  66.423 7.385   1.00 0.00  ? 151 ARG A HH21 3  
ATOM   9810  H  HH22 . ARG A 1 151 ? 39.783  66.495 8.373   1.00 0.00  ? 151 ARG A HH22 3  
ATOM   9811  N  N    . ALA A 1 152 ? 38.980  61.886 1.550   1.00 0.00  ? 152 ALA A N    3  
ATOM   9812  C  CA   . ALA A 1 152 ? 38.395  60.518 1.530   1.00 0.00  ? 152 ALA A CA   3  
ATOM   9813  C  C    . ALA A 1 152 ? 39.517  59.501 1.315   1.00 0.00  ? 152 ALA A C    3  
ATOM   9814  O  O    . ALA A 1 152 ? 39.662  58.551 2.057   1.00 0.00  ? 152 ALA A O    3  
ATOM   9815  C  CB   . ALA A 1 152 ? 37.384  60.411 0.387   1.00 0.00  ? 152 ALA A CB   3  
ATOM   9816  H  H    . ALA A 1 152 ? 39.019  62.431 0.736   1.00 0.00  ? 152 ALA A H    3  
ATOM   9817  H  HA   . ALA A 1 152 ? 37.901  60.318 2.470   1.00 0.00  ? 152 ALA A HA   3  
ATOM   9818  H  HB1  . ALA A 1 152 ? 36.642  61.189 0.489   1.00 0.00  ? 152 ALA A HB1  3  
ATOM   9819  H  HB2  . ALA A 1 152 ? 36.901  59.445 0.424   1.00 0.00  ? 152 ALA A HB2  3  
ATOM   9820  H  HB3  . ALA A 1 152 ? 37.895  60.522 -0.557  1.00 0.00  ? 152 ALA A HB3  3  
ATOM   9821  N  N    . GLU A 1 153 ? 40.300  59.687 0.287   1.00 0.00  ? 153 GLU A N    3  
ATOM   9822  C  CA   . GLU A 1 153 ? 41.401  58.724 0.001   1.00 0.00  ? 153 GLU A CA   3  
ATOM   9823  C  C    . GLU A 1 153 ? 42.383  58.684 1.180   1.00 0.00  ? 153 GLU A C    3  
ATOM   9824  O  O    . GLU A 1 153 ? 43.262  57.848 1.239   1.00 0.00  ? 153 GLU A O    3  
ATOM   9825  C  CB   . GLU A 1 153 ? 42.114  59.143 -1.307  1.00 0.00  ? 153 GLU A CB   3  
ATOM   9826  C  CG   . GLU A 1 153 ? 43.317  60.056 -1.017  1.00 0.00  ? 153 GLU A CG   3  
ATOM   9827  C  CD   . GLU A 1 153 ? 43.724  60.797 -2.294  1.00 0.00  ? 153 GLU A CD   3  
ATOM   9828  O  OE1  . GLU A 1 153 ? 42.839  61.253 -2.998  1.00 0.00  ? 153 GLU A OE1  3  
ATOM   9829  O  OE2  . GLU A 1 153 ? 44.914  60.894 -2.545  1.00 0.00  ? 153 GLU A OE2  3  
ATOM   9830  H  H    . GLU A 1 153 ? 40.145  60.450 -0.311  1.00 0.00  ? 153 GLU A H    3  
ATOM   9831  H  HA   . GLU A 1 153 ? 40.974  57.742 -0.127  1.00 0.00  ? 153 GLU A HA   3  
ATOM   9832  H  HB2  . GLU A 1 153 ? 42.459  58.263 -1.828  1.00 0.00  ? 153 GLU A HB2  3  
ATOM   9833  H  HB3  . GLU A 1 153 ? 41.412  59.671 -1.935  1.00 0.00  ? 153 GLU A HB3  3  
ATOM   9834  H  HG2  . GLU A 1 153 ? 43.049  60.770 -0.253  1.00 0.00  ? 153 GLU A HG2  3  
ATOM   9835  H  HG3  . GLU A 1 153 ? 44.146  59.457 -0.673  1.00 0.00  ? 153 GLU A HG3  3  
ATOM   9836  N  N    . LYS A 1 154 ? 42.241  59.588 2.112   1.00 21.61 ? 154 LYS A N    3  
ATOM   9837  C  CA   . LYS A 1 154 ? 43.164  59.621 3.292   1.00 20.81 ? 154 LYS A CA   3  
ATOM   9838  C  C    . LYS A 1 154 ? 42.446  59.012 4.497   1.00 21.70 ? 154 LYS A C    3  
ATOM   9839  O  O    . LYS A 1 154 ? 43.021  58.795 5.544   1.00 20.17 ? 154 LYS A O    3  
ATOM   9840  C  CB   . LYS A 1 154 ? 43.545  61.088 3.562   1.00 18.21 ? 154 LYS A CB   3  
ATOM   9841  C  CG   . LYS A 1 154 ? 44.260  61.260 4.917   1.00 23.64 ? 154 LYS A CG   3  
ATOM   9842  C  CD   . LYS A 1 154 ? 45.516  60.376 5.003   1.00 23.42 ? 154 LYS A CD   3  
ATOM   9843  C  CE   . LYS A 1 154 ? 46.447  60.659 3.816   1.00 31.30 ? 154 LYS A CE   3  
ATOM   9844  N  NZ   . LYS A 1 154 ? 47.834  60.239 4.165   1.00 37.57 ? 154 LYS A NZ   3  
ATOM   9845  H  H    . LYS A 1 154 ? 41.525  60.252 2.036   1.00 0.00  ? 154 LYS A H    3  
ATOM   9846  H  HA   . LYS A 1 154 ? 44.048  59.048 3.077   1.00 0.00  ? 154 LYS A HA   3  
ATOM   9847  H  HB2  . LYS A 1 154 ? 44.195  61.433 2.773   1.00 0.00  ? 154 LYS A HB2  3  
ATOM   9848  H  HB3  . LYS A 1 154 ? 42.646  61.686 3.561   1.00 0.00  ? 154 LYS A HB3  3  
ATOM   9849  H  HG2  . LYS A 1 154 ? 44.554  62.294 5.025   1.00 0.00  ? 154 LYS A HG2  3  
ATOM   9850  H  HG3  . LYS A 1 154 ? 43.586  61.006 5.718   1.00 0.00  ? 154 LYS A HG3  3  
ATOM   9851  H  HD2  . LYS A 1 154 ? 46.040  60.597 5.922   1.00 0.00  ? 154 LYS A HD2  3  
ATOM   9852  H  HD3  . LYS A 1 154 ? 45.234  59.337 5.000   1.00 0.00  ? 154 LYS A HD3  3  
ATOM   9853  H  HE2  . LYS A 1 154 ? 46.113  60.105 2.953   1.00 0.00  ? 154 LYS A HE2  3  
ATOM   9854  H  HE3  . LYS A 1 154 ? 46.439  61.716 3.591   1.00 0.00  ? 154 LYS A HE3  3  
ATOM   9855  H  HZ1  . LYS A 1 154 ? 47.799  59.384 4.756   1.00 0.00  ? 154 LYS A HZ1  3  
ATOM   9856  H  HZ2  . LYS A 1 154 ? 48.306  61.005 4.688   1.00 0.00  ? 154 LYS A HZ2  3  
ATOM   9857  H  HZ3  . LYS A 1 154 ? 48.364  60.034 3.295   1.00 0.00  ? 154 LYS A HZ3  3  
ATOM   9858  N  N    . MET A 1 155 ? 41.192  58.712 4.342   1.00 0.00  ? 155 MET A N    3  
ATOM   9859  C  CA   . MET A 1 155 ? 40.424  58.103 5.462   1.00 0.00  ? 155 MET A CA   3  
ATOM   9860  C  C    . MET A 1 155 ? 40.712  56.604 5.504   1.00 0.00  ? 155 MET A C    3  
ATOM   9861  O  O    . MET A 1 155 ? 40.398  55.924 6.462   1.00 0.00  ? 155 MET A O    3  
ATOM   9862  C  CB   . MET A 1 155 ? 38.932  58.340 5.226   1.00 0.00  ? 155 MET A CB   3  
ATOM   9863  C  CG   . MET A 1 155 ? 38.110  57.533 6.235   1.00 0.00  ? 155 MET A CG   3  
ATOM   9864  S  SD   . MET A 1 155 ? 36.398  58.123 6.228   1.00 0.00  ? 155 MET A SD   3  
ATOM   9865  C  CE   . MET A 1 155 ? 35.827  57.173 7.659   1.00 0.00  ? 155 MET A CE   3  
ATOM   9866  H  H    . MET A 1 155 ? 40.754  58.874 3.480   1.00 0.00  ? 155 MET A H    3  
ATOM   9867  H  HA   . MET A 1 155 ? 40.722  58.553 6.393   1.00 0.00  ? 155 MET A HA   3  
ATOM   9868  H  HB2  . MET A 1 155 ? 38.714  59.392 5.344   1.00 0.00  ? 155 MET A HB2  3  
ATOM   9869  H  HB3  . MET A 1 155 ? 38.679  58.031 4.224   1.00 0.00  ? 155 MET A HB3  3  
ATOM   9870  H  HG2  . MET A 1 155 ? 38.131  56.488 5.963   1.00 0.00  ? 155 MET A HG2  3  
ATOM   9871  H  HG3  . MET A 1 155 ? 38.529  57.657 7.222   1.00 0.00  ? 155 MET A HG3  3  
ATOM   9872  H  HE1  . MET A 1 155 ? 36.348  57.510 8.544   1.00 0.00  ? 155 MET A HE1  3  
ATOM   9873  H  HE2  . MET A 1 155 ? 36.031  56.126 7.502   1.00 0.00  ? 155 MET A HE2  3  
ATOM   9874  H  HE3  . MET A 1 155 ? 34.763  57.316 7.783   1.00 0.00  ? 155 MET A HE3  3  
ATOM   9875  N  N    . GLY A 1 156 ? 41.300  56.090 4.459   1.00 20.89 ? 156 GLY A N    3  
ATOM   9876  C  CA   . GLY A 1 156 ? 41.619  54.629 4.388   1.00 17.19 ? 156 GLY A CA   3  
ATOM   9877  C  C    . GLY A 1 156 ? 40.799  54.007 3.261   1.00 17.35 ? 156 GLY A C    3  
ATOM   9878  O  O    . GLY A 1 156 ? 40.848  52.817 3.022   1.00 17.97 ? 156 GLY A O    3  
ATOM   9879  H  H    . GLY A 1 156 ? 41.530  56.672 3.707   1.00 0.00  ? 156 GLY A H    3  
ATOM   9880  H  HA2  . GLY A 1 156 ? 42.673  54.502 4.182   1.00 0.00  ? 156 GLY A HA2  3  
ATOM   9881  H  HA3  . GLY A 1 156 ? 41.372  54.141 5.320   1.00 0.00  ? 156 GLY A HA3  3  
ATOM   9882  N  N    . GLN A 1 157 ? 40.043  54.812 2.565   1.00 0.00  ? 157 GLN A N    3  
ATOM   9883  C  CA   . GLN A 1 157 ? 39.213  54.282 1.450   1.00 0.00  ? 157 GLN A CA   3  
ATOM   9884  C  C    . GLN A 1 157 ? 40.114  53.584 0.435   1.00 0.00  ? 157 GLN A C    3  
ATOM   9885  O  O    . GLN A 1 157 ? 39.782  52.537 -0.087  1.00 0.00  ? 157 GLN A O    3  
ATOM   9886  C  CB   . GLN A 1 157 ? 38.477  55.438 0.768   1.00 0.00  ? 157 GLN A CB   3  
ATOM   9887  C  CG   . GLN A 1 157 ? 37.600  56.166 1.790   1.00 0.00  ? 157 GLN A CG   3  
ATOM   9888  C  CD   . GLN A 1 157 ? 36.341  55.342 2.068   1.00 0.00  ? 157 GLN A CD   3  
ATOM   9889  O  OE1  . GLN A 1 157 ? 35.336  55.508 1.407   1.00 0.00  ? 157 GLN A OE1  3  
ATOM   9890  N  NE2  . GLN A 1 157 ? 36.354  54.455 3.025   1.00 0.00  ? 157 GLN A NE2  3  
ATOM   9891  H  H    . GLN A 1 157 ? 40.021  55.768 2.778   1.00 0.00  ? 157 GLN A H    3  
ATOM   9892  H  HA   . GLN A 1 157 ? 38.498  53.577 1.839   1.00 0.00  ? 157 GLN A HA   3  
ATOM   9893  H  HB2  . GLN A 1 157 ? 39.199  56.129 0.356   1.00 0.00  ? 157 GLN A HB2  3  
ATOM   9894  H  HB3  . GLN A 1 157 ? 37.857  55.051 -0.027  1.00 0.00  ? 157 GLN A HB3  3  
ATOM   9895  H  HG2  . GLN A 1 157 ? 38.152  56.302 2.709   1.00 0.00  ? 157 GLN A HG2  3  
ATOM   9896  H  HG3  . GLN A 1 157 ? 37.315  57.131 1.397   1.00 0.00  ? 157 GLN A HG3  3  
ATOM   9897  H  HE21 . GLN A 1 157 ? 37.166  54.321 3.559   1.00 0.00  ? 157 GLN A HE21 3  
ATOM   9898  H  HE22 . GLN A 1 157 ? 35.553  53.922 3.211   1.00 0.00  ? 157 GLN A HE22 3  
ATOM   9899  N  N    . ASN A 1 158 ? 41.258  54.157 0.158   1.00 0.00  ? 158 ASN A N    3  
ATOM   9900  C  CA   . ASN A 1 158 ? 42.211  53.539 -0.821  1.00 0.00  ? 158 ASN A CA   3  
ATOM   9901  C  C    . ASN A 1 158 ? 43.577  53.394 -0.154  1.00 0.00  ? 158 ASN A C    3  
ATOM   9902  O  O    . ASN A 1 158 ? 44.318  52.470 -0.425  1.00 0.00  ? 158 ASN A O    3  
ATOM   9903  C  CB   . ASN A 1 158 ? 42.328  54.429 -2.063  1.00 0.00  ? 158 ASN A CB   3  
ATOM   9904  C  CG   . ASN A 1 158 ? 43.036  55.735 -1.703  1.00 0.00  ? 158 ASN A CG   3  
ATOM   9905  O  OD1  . ASN A 1 158 ? 43.782  56.274 -2.496  1.00 0.00  ? 158 ASN A OD1  3  
ATOM   9906  N  ND2  . ASN A 1 158 ? 42.833  56.269 -0.532  1.00 0.00  ? 158 ASN A ND2  3  
ATOM   9907  H  H    . ASN A 1 158 ? 41.498  54.997 0.607   1.00 0.00  ? 158 ASN A H    3  
ATOM   9908  H  HA   . ASN A 1 158 ? 41.860  52.559 -1.117  1.00 0.00  ? 158 ASN A HA   3  
ATOM   9909  H  HB2  . ASN A 1 158 ? 42.895  53.911 -2.823  1.00 0.00  ? 158 ASN A HB2  3  
ATOM   9910  H  HB3  . ASN A 1 158 ? 41.341  54.650 -2.441  1.00 0.00  ? 158 ASN A HB3  3  
ATOM   9911  H  HD21 . ASN A 1 158 ? 42.233  55.834 0.108   1.00 0.00  ? 158 ASN A HD21 3  
ATOM   9912  H  HD22 . ASN A 1 158 ? 43.280  57.107 -0.292  1.00 0.00  ? 158 ASN A HD22 3  
ATOM   9913  N  N    . LEU A 1 159 ? 43.910  54.294 0.734   1.00 0.00  ? 159 LEU A N    3  
ATOM   9914  C  CA   . LEU A 1 159 ? 45.224  54.198 1.437   1.00 0.00  ? 159 LEU A CA   3  
ATOM   9915  C  C    . LEU A 1 159 ? 45.031  53.312 2.669   1.00 0.00  ? 159 LEU A C    3  
ATOM   9916  O  O    . LEU A 1 159 ? 45.010  53.779 3.790   1.00 0.00  ? 159 LEU A O    3  
ATOM   9917  C  CB   . LEU A 1 159 ? 45.691  55.609 1.861   1.00 0.00  ? 159 LEU A CB   3  
ATOM   9918  C  CG   . LEU A 1 159 ? 46.637  56.200 0.805   1.00 0.00  ? 159 LEU A CG   3  
ATOM   9919  C  CD1  . LEU A 1 159 ? 45.887  56.390 -0.515  1.00 0.00  ? 159 LEU A CD1  3  
ATOM   9920  C  CD2  . LEU A 1 159 ? 47.156  57.555 1.291   1.00 0.00  ? 159 LEU A CD2  3  
ATOM   9921  H  H    . LEU A 1 159 ? 43.288  55.022 0.949   1.00 0.00  ? 159 LEU A H    3  
ATOM   9922  H  HA   . LEU A 1 159 ? 45.957  53.744 0.783   1.00 0.00  ? 159 LEU A HA   3  
ATOM   9923  H  HB2  . LEU A 1 159 ? 44.830  56.252 1.966   1.00 0.00  ? 159 LEU A HB2  3  
ATOM   9924  H  HB3  . LEU A 1 159 ? 46.213  55.556 2.808   1.00 0.00  ? 159 LEU A HB3  3  
ATOM   9925  H  HG   . LEU A 1 159 ? 47.469  55.528 0.651   1.00 0.00  ? 159 LEU A HG   3  
ATOM   9926  H  HD11 . LEU A 1 159 ? 45.480  55.443 -0.838  1.00 0.00  ? 159 LEU A HD11 3  
ATOM   9927  H  HD12 . LEU A 1 159 ? 46.569  56.763 -1.265  1.00 0.00  ? 159 LEU A HD12 3  
ATOM   9928  H  HD13 . LEU A 1 159 ? 45.085  57.098 -0.374  1.00 0.00  ? 159 LEU A HD13 3  
ATOM   9929  H  HD21 . LEU A 1 159 ? 46.340  58.260 1.331   1.00 0.00  ? 159 LEU A HD21 3  
ATOM   9930  H  HD22 . LEU A 1 159 ? 47.911  57.917 0.608   1.00 0.00  ? 159 LEU A HD22 3  
ATOM   9931  H  HD23 . LEU A 1 159 ? 47.585  57.443 2.276   1.00 0.00  ? 159 LEU A HD23 3  
ATOM   9932  N  N    . ASN A 1 160 ? 44.883  52.033 2.458   1.00 0.00  ? 160 ASN A N    3  
ATOM   9933  C  CA   . ASN A 1 160 ? 44.681  51.088 3.594   1.00 0.00  ? 160 ASN A CA   3  
ATOM   9934  C  C    . ASN A 1 160 ? 45.989  50.353 3.883   1.00 0.00  ? 160 ASN A C    3  
ATOM   9935  O  O    . ASN A 1 160 ? 46.438  49.534 3.106   1.00 0.00  ? 160 ASN A O    3  
ATOM   9936  C  CB   . ASN A 1 160 ? 43.592  50.086 3.206   1.00 0.00  ? 160 ASN A CB   3  
ATOM   9937  C  CG   . ASN A 1 160 ? 44.077  49.223 2.038   1.00 0.00  ? 160 ASN A CG   3  
ATOM   9938  O  OD1  . ASN A 1 160 ? 44.049  49.649 0.901   1.00 0.00  ? 160 ASN A OD1  3  
ATOM   9939  N  ND2  . ASN A 1 160 ? 44.523  48.019 2.274   1.00 0.00  ? 160 ASN A ND2  3  
ATOM   9940  H  H    . ASN A 1 160 ? 44.900  51.690 1.540   1.00 0.00  ? 160 ASN A H    3  
ATOM   9941  H  HA   . ASN A 1 160 ? 44.369  51.623 4.479   1.00 0.00  ? 160 ASN A HA   3  
ATOM   9942  H  HB2  . ASN A 1 160 ? 43.364  49.455 4.052   1.00 0.00  ? 160 ASN A HB2  3  
ATOM   9943  H  HB3  . ASN A 1 160 ? 42.702  50.625 2.905   1.00 0.00  ? 160 ASN A HB3  3  
ATOM   9944  H  HD21 . ASN A 1 160 ? 44.545  47.676 3.191   1.00 0.00  ? 160 ASN A HD21 3  
ATOM   9945  H  HD22 . ASN A 1 160 ? 44.836  47.459 1.533   1.00 0.00  ? 160 ASN A HD22 3  
ATOM   9946  N  N    . ARG A 1 161 ? 46.606  50.628 5.003   1.00 0.00  ? 161 ARG A N    3  
ATOM   9947  C  CA   . ARG A 1 161 ? 47.879  49.928 5.335   1.00 0.00  ? 161 ARG A CA   3  
ATOM   9948  C  C    . ARG A 1 161 ? 47.645  48.426 5.185   1.00 0.00  ? 161 ARG A C    3  
ATOM   9949  O  O    . ARG A 1 161 ? 46.526  47.974 5.259   1.00 0.00  ? 161 ARG A O    3  
ATOM   9950  C  CB   . ARG A 1 161 ? 48.283  50.251 6.782   1.00 0.00  ? 161 ARG A CB   3  
ATOM   9951  C  CG   . ARG A 1 161 ? 49.767  49.903 7.010   1.00 0.00  ? 161 ARG A CG   3  
ATOM   9952  C  CD   . ARG A 1 161 ? 50.657  51.085 6.605   1.00 0.00  ? 161 ARG A CD   3  
ATOM   9953  N  NE   . ARG A 1 161 ? 50.277  52.289 7.398   1.00 0.00  ? 161 ARG A NE   3  
ATOM   9954  C  CZ   . ARG A 1 161 ? 51.077  53.320 7.445   1.00 0.00  ? 161 ARG A CZ   3  
ATOM   9955  N  NH1  . ARG A 1 161 ? 52.209  53.297 6.797   1.00 0.00  ? 161 ARG A NH1  3  
ATOM   9956  N  NH2  . ARG A 1 161 ? 50.744  54.373 8.140   1.00 0.00  ? 161 ARG A NH2  3  
ATOM   9957  H  H    . ARG A 1 161 ? 46.229  51.286 5.624   1.00 0.00  ? 161 ARG A H    3  
ATOM   9958  H  HA   . ARG A 1 161 ? 48.656  50.244 4.656   1.00 0.00  ? 161 ARG A HA   3  
ATOM   9959  H  HB2  . ARG A 1 161 ? 48.120  51.303 6.971   1.00 0.00  ? 161 ARG A HB2  3  
ATOM   9960  H  HB3  . ARG A 1 161 ? 47.672  49.671 7.460   1.00 0.00  ? 161 ARG A HB3  3  
ATOM   9961  H  HG2  . ARG A 1 161 ? 49.925  49.684 8.057   1.00 0.00  ? 161 ARG A HG2  3  
ATOM   9962  H  HG3  . ARG A 1 161 ? 50.034  49.037 6.422   1.00 0.00  ? 161 ARG A HG3  3  
ATOM   9963  H  HD2  . ARG A 1 161 ? 51.691  50.839 6.799   1.00 0.00  ? 161 ARG A HD2  3  
ATOM   9964  H  HD3  . ARG A 1 161 ? 50.529  51.292 5.553   1.00 0.00  ? 161 ARG A HD3  3  
ATOM   9965  H  HE   . ARG A 1 161 ? 49.426  52.306 7.884   1.00 0.00  ? 161 ARG A HE   3  
ATOM   9966  H  HH11 . ARG A 1 161 ? 52.465  52.491 6.264   1.00 0.00  ? 161 ARG A HH11 3  
ATOM   9967  H  HH12 . ARG A 1 161 ? 52.821  54.087 6.833   1.00 0.00  ? 161 ARG A HH12 3  
ATOM   9968  H  HH21 . ARG A 1 161 ? 49.876  54.390 8.637   1.00 0.00  ? 161 ARG A HH21 3  
ATOM   9969  H  HH22 . ARG A 1 161 ? 51.356  55.162 8.176   1.00 0.00  ? 161 ARG A HH22 3  
ATOM   9970  N  N    . ILE A 1 162 ? 48.674  47.654 4.970   1.00 0.00  ? 162 ILE A N    3  
ATOM   9971  C  CA   . ILE A 1 162 ? 48.476  46.183 4.800   1.00 0.00  ? 162 ILE A CA   3  
ATOM   9972  C  C    . ILE A 1 162 ? 47.786  45.616 6.061   1.00 0.00  ? 162 ILE A C    3  
ATOM   9973  O  O    . ILE A 1 162 ? 48.397  45.593 7.110   1.00 0.00  ? 162 ILE A O    3  
ATOM   9974  C  CB   . ILE A 1 162 ? 49.851  45.514 4.635   1.00 0.00  ? 162 ILE A CB   3  
ATOM   9975  C  CG1  . ILE A 1 162 ? 50.808  45.926 5.801   1.00 0.00  ? 162 ILE A CG1  3  
ATOM   9976  C  CG2  . ILE A 1 162 ? 50.443  45.946 3.285   1.00 0.00  ? 162 ILE A CG2  3  
ATOM   9977  C  CD1  . ILE A 1 162 ? 51.128  44.713 6.691   1.00 0.00  ? 162 ILE A CD1  3  
ATOM   9978  H  H    . ILE A 1 162 ? 49.573  48.039 4.908   1.00 0.00  ? 162 ILE A H    3  
ATOM   9979  H  HA   . ILE A 1 162 ? 47.895  46.000 3.917   1.00 0.00  ? 162 ILE A HA   3  
ATOM   9980  H  HB   . ILE A 1 162 ? 49.717  44.441 4.624   1.00 0.00  ? 162 ILE A HB   3  
ATOM   9981  H  HG12 . ILE A 1 162 ? 51.736  46.312 5.399   1.00 0.00  ? 162 ILE A HG12 3  
ATOM   9982  H  HG13 . ILE A 1 162 ? 50.347  46.693 6.408   1.00 0.00  ? 162 ILE A HG13 3  
ATOM   9983  H  HG21 . ILE A 1 162 ? 50.554  47.021 3.268   1.00 0.00  ? 162 ILE A HG21 3  
ATOM   9984  H  HG22 . ILE A 1 162 ? 49.782  45.640 2.488   1.00 0.00  ? 162 ILE A HG22 3  
ATOM   9985  H  HG23 . ILE A 1 162 ? 51.409  45.482 3.150   1.00 0.00  ? 162 ILE A HG23 3  
ATOM   9986  H  HD11 . ILE A 1 162 ? 51.543  45.055 7.628   1.00 0.00  ? 162 ILE A HD11 3  
ATOM   9987  H  HD12 . ILE A 1 162 ? 51.845  44.080 6.191   1.00 0.00  ? 162 ILE A HD12 3  
ATOM   9988  H  HD13 . ILE A 1 162 ? 50.225  44.152 6.881   1.00 0.00  ? 162 ILE A HD13 3  
ATOM   9989  N  N    . PRO A 1 163 ? 46.534  45.176 5.962   1.00 0.00  ? 163 PRO A N    3  
ATOM   9990  C  CA   . PRO A 1 163 ? 45.839  44.634 7.146   1.00 0.00  ? 163 PRO A CA   3  
ATOM   9991  C  C    . PRO A 1 163 ? 46.552  43.358 7.616   1.00 0.00  ? 163 PRO A C    3  
ATOM   9992  O  O    . PRO A 1 163 ? 46.990  42.552 6.818   1.00 0.00  ? 163 PRO A O    3  
ATOM   9993  C  CB   . PRO A 1 163 ? 44.395  44.337 6.669   1.00 0.00  ? 163 PRO A CB   3  
ATOM   9994  C  CG   . PRO A 1 163 ? 44.303  44.752 5.172   1.00 0.00  ? 163 PRO A CG   3  
ATOM   9995  C  CD   . PRO A 1 163 ? 45.718  45.171 4.719   1.00 0.00  ? 163 PRO A CD   3  
ATOM   9996  H  HA   . PRO A 1 163 ? 45.826  45.367 7.939   1.00 0.00  ? 163 PRO A HA   3  
ATOM   9997  H  HB2  . PRO A 1 163 ? 44.172  43.280 6.776   1.00 0.00  ? 163 PRO A HB2  3  
ATOM   9998  H  HB3  . PRO A 1 163 ? 43.687  44.914 7.249   1.00 0.00  ? 163 PRO A HB3  3  
ATOM   9999  H  HG2  . PRO A 1 163 ? 43.951  43.917 4.576   1.00 0.00  ? 163 PRO A HG2  3  
ATOM   10000 H  HG3  . PRO A 1 163 ? 43.624  45.592 5.061   1.00 0.00  ? 163 PRO A HG3  3  
ATOM   10001 H  HD2  . PRO A 1 163 ? 46.116  44.454 4.011   1.00 0.00  ? 163 PRO A HD2  3  
ATOM   10002 H  HD3  . PRO A 1 163 ? 45.688  46.151 4.280   1.00 0.00  ? 163 PRO A HD3  3  
ATOM   10003 N  N    . TYR A 1 164 ? 46.676  43.170 8.901   1.00 21.59 ? 164 TYR A N    3  
ATOM   10004 C  CA   . TYR A 1 164 ? 47.362  41.951 9.407   1.00 23.23 ? 164 TYR A CA   3  
ATOM   10005 C  C    . TYR A 1 164 ? 46.568  40.712 8.975   1.00 28.07 ? 164 TYR A C    3  
ATOM   10006 O  O    . TYR A 1 164 ? 46.009  40.685 7.898   1.00 28.03 ? 164 TYR A O    3  
ATOM   10007 C  CB   . TYR A 1 164 ? 47.478  42.020 10.937  1.00 21.58 ? 164 TYR A CB   3  
ATOM   10008 C  CG   . TYR A 1 164 ? 46.111  42.189 11.563  1.00 24.37 ? 164 TYR A CG   3  
ATOM   10009 C  CD1  . TYR A 1 164 ? 45.511  43.454 11.608  1.00 21.98 ? 164 TYR A CD1  3  
ATOM   10010 C  CD2  . TYR A 1 164 ? 45.447  41.082 12.105  1.00 21.25 ? 164 TYR A CD2  3  
ATOM   10011 C  CE1  . TYR A 1 164 ? 44.247  43.610 12.191  1.00 26.65 ? 164 TYR A CE1  3  
ATOM   10012 C  CE2  . TYR A 1 164 ? 44.184  41.238 12.687  1.00 20.80 ? 164 TYR A CE2  3  
ATOM   10013 C  CZ   . TYR A 1 164 ? 43.584  42.502 12.730  1.00 27.39 ? 164 TYR A CZ   3  
ATOM   10014 O  OH   . TYR A 1 164 ? 42.338  42.655 13.304  1.00 29.41 ? 164 TYR A OH   3  
ATOM   10015 H  H    . TYR A 1 164 ? 46.319  43.829 9.529   1.00 0.00  ? 164 TYR A H    3  
ATOM   10016 H  HA   . TYR A 1 164 ? 48.353  41.901 8.977   1.00 0.00  ? 164 TYR A HA   3  
ATOM   10017 H  HB2  . TYR A 1 164 ? 47.932  41.113 11.303  1.00 0.00  ? 164 TYR A HB2  3  
ATOM   10018 H  HB3  . TYR A 1 164 ? 48.099  42.861 11.208  1.00 0.00  ? 164 TYR A HB3  3  
ATOM   10019 H  HD1  . TYR A 1 164 ? 46.022  44.311 11.196  1.00 0.00  ? 164 TYR A HD1  3  
ATOM   10020 H  HD2  . TYR A 1 164 ? 45.909  40.108 12.074  1.00 0.00  ? 164 TYR A HD2  3  
ATOM   10021 H  HE1  . TYR A 1 164 ? 43.784  44.585 12.223  1.00 0.00  ? 164 TYR A HE1  3  
ATOM   10022 H  HE2  . TYR A 1 164 ? 43.673  40.383 13.105  1.00 0.00  ? 164 TYR A HE2  3  
ATOM   10023 H  HH   . TYR A 1 164 ? 42.040  43.551 13.132  1.00 0.00  ? 164 TYR A HH   3  
ATOM   10024 N  N    . LYS A 1 165 ? 46.521  39.693 9.803   1.00 0.00  ? 165 LYS A N    3  
ATOM   10025 C  CA   . LYS A 1 165 ? 45.774  38.434 9.462   1.00 0.00  ? 165 LYS A CA   3  
ATOM   10026 C  C    . LYS A 1 165 ? 45.869  38.138 7.959   1.00 0.00  ? 165 LYS A C    3  
ATOM   10027 O  O    . LYS A 1 165 ? 46.946  38.017 7.411   1.00 0.00  ? 165 LYS A O    3  
ATOM   10028 C  CB   . LYS A 1 165 ? 44.300  38.558 9.889   1.00 0.00  ? 165 LYS A CB   3  
ATOM   10029 C  CG   . LYS A 1 165 ? 43.687  39.870 9.381   1.00 0.00  ? 165 LYS A CG   3  
ATOM   10030 C  CD   . LYS A 1 165 ? 42.186  39.871 9.673   1.00 0.00  ? 165 LYS A CD   3  
ATOM   10031 C  CE   . LYS A 1 165 ? 41.554  41.137 9.093   1.00 0.00  ? 165 LYS A CE   3  
ATOM   10032 N  NZ   . LYS A 1 165 ? 40.091  41.138 9.378   1.00 0.00  ? 165 LYS A NZ   3  
ATOM   10033 H  H    . LYS A 1 165 ? 46.987  39.751 10.660  1.00 0.00  ? 165 LYS A H    3  
ATOM   10034 H  HA   . LYS A 1 165 ? 46.221  37.612 10.002  1.00 0.00  ? 165 LYS A HA   3  
ATOM   10035 H  HB2  . LYS A 1 165 ? 43.742  37.726 9.487   1.00 0.00  ? 165 LYS A HB2  3  
ATOM   10036 H  HB3  . LYS A 1 165 ? 44.242  38.535 10.967  1.00 0.00  ? 165 LYS A HB3  3  
ATOM   10037 H  HG2  . LYS A 1 165 ? 44.148  40.705 9.886   1.00 0.00  ? 165 LYS A HG2  3  
ATOM   10038 H  HG3  . LYS A 1 165 ? 43.841  39.961 8.319   1.00 0.00  ? 165 LYS A HG3  3  
ATOM   10039 H  HD2  . LYS A 1 165 ? 41.731  39.001 9.222   1.00 0.00  ? 165 LYS A HD2  3  
ATOM   10040 H  HD3  . LYS A 1 165 ? 42.026  39.848 10.740  1.00 0.00  ? 165 LYS A HD3  3  
ATOM   10041 H  HE2  . LYS A 1 165 ? 42.009  42.006 9.544   1.00 0.00  ? 165 LYS A HE2  3  
ATOM   10042 H  HE3  . LYS A 1 165 ? 41.712  41.162 8.025   1.00 0.00  ? 165 LYS A HE3  3  
ATOM   10043 H  HZ1  . LYS A 1 165 ? 39.906  41.692 10.238  1.00 0.00  ? 165 LYS A HZ1  3  
ATOM   10044 H  HZ2  . LYS A 1 165 ? 39.765  40.160 9.517   1.00 0.00  ? 165 LYS A HZ2  3  
ATOM   10045 H  HZ3  . LYS A 1 165 ? 39.582  41.564 8.578   1.00 0.00  ? 165 LYS A HZ3  3  
ATOM   10046 N  N    . ASP A 1 166 ? 44.754  38.028 7.293   1.00 0.00  ? 166 ASP A N    3  
ATOM   10047 C  CA   . ASP A 1 166 ? 44.771  37.753 5.828   1.00 0.00  ? 166 ASP A CA   3  
ATOM   10048 C  C    . ASP A 1 166 ? 45.434  36.400 5.547   1.00 0.00  ? 166 ASP A C    3  
ATOM   10049 O  O    . ASP A 1 166 ? 44.761  35.431 5.257   1.00 0.00  ? 166 ASP A O    3  
ATOM   10050 C  CB   . ASP A 1 166 ? 45.533  38.866 5.105   1.00 0.00  ? 166 ASP A CB   3  
ATOM   10051 C  CG   . ASP A 1 166 ? 45.164  38.864 3.618   1.00 0.00  ? 166 ASP A CG   3  
ATOM   10052 O  OD1  . ASP A 1 166 ? 44.001  39.075 3.316   1.00 0.00  ? 166 ASP A OD1  3  
ATOM   10053 O  OD2  . ASP A 1 166 ? 46.051  38.652 2.808   1.00 0.00  ? 166 ASP A OD2  3  
ATOM   10054 H  H    . ASP A 1 166 ? 43.897  38.136 7.756   1.00 0.00  ? 166 ASP A H    3  
ATOM   10055 H  HA   . ASP A 1 166 ? 43.752  37.727 5.467   1.00 0.00  ? 166 ASP A HA   3  
ATOM   10056 H  HB2  . ASP A 1 166 ? 45.273  39.820 5.539   1.00 0.00  ? 166 ASP A HB2  3  
ATOM   10057 H  HB3  . ASP A 1 166 ? 46.590  38.701 5.209   1.00 0.00  ? 166 ASP A HB3  3  
ATOM   10058 N  N    . THR A 1 167 ? 46.741  36.308 5.618   1.00 0.00  ? 167 THR A N    3  
ATOM   10059 C  CA   . THR A 1 167 ? 47.382  34.996 5.335   1.00 0.00  ? 167 THR A CA   3  
ATOM   10060 C  C    . THR A 1 167 ? 48.873  35.036 5.680   1.00 0.00  ? 167 THR A C    3  
ATOM   10061 O  O    . THR A 1 167 ? 49.631  34.189 5.248   1.00 0.00  ? 167 THR A O    3  
ATOM   10062 C  CB   . THR A 1 167 ? 47.187  34.641 3.847   1.00 0.00  ? 167 THR A CB   3  
ATOM   10063 O  OG1  . THR A 1 167 ? 48.278  33.852 3.395   1.00 0.00  ? 167 THR A OG1  3  
ATOM   10064 C  CG2  . THR A 1 167 ? 47.102  35.919 3.003   1.00 0.00  ? 167 THR A CG2  3  
ATOM   10065 H  H    . THR A 1 167 ? 47.292  37.087 5.848   1.00 0.00  ? 167 THR A H    3  
ATOM   10066 H  HA   . THR A 1 167 ? 46.911  34.244 5.942   1.00 0.00  ? 167 THR A HA   3  
ATOM   10067 H  HB   . THR A 1 167 ? 46.271  34.080 3.727   1.00 0.00  ? 167 THR A HB   3  
ATOM   10068 H  HG1  . THR A 1 167 ? 48.147  32.956 3.713   1.00 0.00  ? 167 THR A HG1  3  
ATOM   10069 H  HG21 . THR A 1 167 ? 47.776  36.662 3.399   1.00 0.00  ? 167 THR A HG21 3  
ATOM   10070 H  HG22 . THR A 1 167 ? 46.092  36.301 3.026   1.00 0.00  ? 167 THR A HG22 3  
ATOM   10071 H  HG23 . THR A 1 167 ? 47.376  35.693 1.983   1.00 0.00  ? 167 THR A HG23 3  
ATOM   10072 N  N    . PHE A 1 168 ? 49.307  35.985 6.483   1.00 0.00  ? 168 PHE A N    3  
ATOM   10073 C  CA   . PHE A 1 168 ? 50.757  36.034 6.874   1.00 0.00  ? 168 PHE A CA   3  
ATOM   10074 C  C    . PHE A 1 168 ? 50.875  36.167 8.384   1.00 0.00  ? 168 PHE A C    3  
ATOM   10075 O  O    . PHE A 1 168 ? 50.794  37.237 8.952   1.00 0.00  ? 168 PHE A O    3  
ATOM   10076 C  CB   . PHE A 1 168 ? 51.493  37.188 6.168   1.00 0.00  ? 168 PHE A CB   3  
ATOM   10077 C  CG   . PHE A 1 168 ? 50.508  38.241 5.733   1.00 0.00  ? 168 PHE A CG   3  
ATOM   10078 C  CD1  . PHE A 1 168 ? 49.814  38.078 4.532   1.00 0.00  ? 168 PHE A CD1  3  
ATOM   10079 C  CD2  . PHE A 1 168 ? 50.295  39.380 6.518   1.00 0.00  ? 168 PHE A CD2  3  
ATOM   10080 C  CE1  . PHE A 1 168 ? 48.904  39.049 4.113   1.00 0.00  ? 168 PHE A CE1  3  
ATOM   10081 C  CE2  . PHE A 1 168 ? 49.384  40.357 6.099   1.00 0.00  ? 168 PHE A CE2  3  
ATOM   10082 C  CZ   . PHE A 1 168 ? 48.687  40.191 4.896   1.00 0.00  ? 168 PHE A CZ   3  
ATOM   10083 H  H    . PHE A 1 168 ? 48.680  36.645 6.845   1.00 0.00  ? 168 PHE A H    3  
ATOM   10084 H  HA   . PHE A 1 168 ? 51.218  35.102 6.610   1.00 0.00  ? 168 PHE A HA   3  
ATOM   10085 H  HB2  . PHE A 1 168 ? 52.215  37.625 6.841   1.00 0.00  ? 168 PHE A HB2  3  
ATOM   10086 H  HB3  . PHE A 1 168 ? 52.009  36.807 5.297   1.00 0.00  ? 168 PHE A HB3  3  
ATOM   10087 H  HD1  . PHE A 1 168 ? 49.983  37.199 3.928   1.00 0.00  ? 168 PHE A HD1  3  
ATOM   10088 H  HD2  . PHE A 1 168 ? 50.832  39.505 7.448   1.00 0.00  ? 168 PHE A HD2  3  
ATOM   10089 H  HE1  . PHE A 1 168 ? 48.363  38.915 3.189   1.00 0.00  ? 168 PHE A HE1  3  
ATOM   10090 H  HE2  . PHE A 1 168 ? 49.218  41.236 6.703   1.00 0.00  ? 168 PHE A HE2  3  
ATOM   10091 H  HZ   . PHE A 1 168 ? 47.984  40.943 4.571   1.00 0.00  ? 168 PHE A HZ   3  
ATOM   10092 N  N    . TRP A 1 169 ? 51.073  35.055 9.012   1.00 0.00  ? 169 TRP A N    3  
ATOM   10093 C  CA   . TRP A 1 169 ? 51.201  35.005 10.486  1.00 0.00  ? 169 TRP A CA   3  
ATOM   10094 C  C    . TRP A 1 169 ? 51.939  33.725 10.852  1.00 0.00  ? 169 TRP A C    3  
ATOM   10095 O  O    . TRP A 1 169 ? 52.715  33.674 11.785  1.00 0.00  ? 169 TRP A O    3  
ATOM   10096 C  CB   . TRP A 1 169 ? 49.787  34.968 11.071  1.00 0.00  ? 169 TRP A CB   3  
ATOM   10097 C  CG   . TRP A 1 169 ? 49.324  36.351 11.403  1.00 0.00  ? 169 TRP A CG   3  
ATOM   10098 C  CD1  . TRP A 1 169 ? 48.738  37.197 10.532  1.00 0.00  ? 169 TRP A CD1  3  
ATOM   10099 C  CD2  . TRP A 1 169 ? 49.400  37.053 12.676  1.00 0.00  ? 169 TRP A CD2  3  
ATOM   10100 N  NE1  . TRP A 1 169 ? 48.454  38.383 11.186  1.00 0.00  ? 169 TRP A NE1  3  
ATOM   10101 C  CE2  . TRP A 1 169 ? 48.840  38.341 12.513  1.00 0.00  ? 169 TRP A CE2  3  
ATOM   10102 C  CE3  . TRP A 1 169 ? 49.896  36.701 13.944  1.00 0.00  ? 169 TRP A CE3  3  
ATOM   10103 C  CZ2  . TRP A 1 169 ? 48.775  39.250 13.571  1.00 0.00  ? 169 TRP A CZ2  3  
ATOM   10104 C  CZ3  . TRP A 1 169 ? 49.832  37.611 15.011  1.00 0.00  ? 169 TRP A CZ3  3  
ATOM   10105 C  CH2  . TRP A 1 169 ? 49.272  38.883 14.825  1.00 0.00  ? 169 TRP A CH2  3  
ATOM   10106 H  H    . TRP A 1 169 ? 51.129  34.232 8.498   1.00 0.00  ? 169 TRP A H    3  
ATOM   10107 H  HA   . TRP A 1 169 ? 51.745  35.857 10.844  1.00 0.00  ? 169 TRP A HA   3  
ATOM   10108 H  HB2  . TRP A 1 169 ? 49.133  34.542 10.323  1.00 0.00  ? 169 TRP A HB2  3  
ATOM   10109 H  HB3  . TRP A 1 169 ? 49.763  34.356 11.964  1.00 0.00  ? 169 TRP A HB3  3  
ATOM   10110 H  HD1  . TRP A 1 169 ? 48.534  36.982 9.492   1.00 0.00  ? 169 TRP A HD1  3  
ATOM   10111 H  HE1  . TRP A 1 169 ? 48.031  39.166 10.778  1.00 0.00  ? 169 TRP A HE1  3  
ATOM   10112 H  HE3  . TRP A 1 169 ? 50.329  35.723 14.098  1.00 0.00  ? 169 TRP A HE3  3  
ATOM   10113 H  HZ2  . TRP A 1 169 ? 48.343  40.227 13.424  1.00 0.00  ? 169 TRP A HZ2  3  
ATOM   10114 H  HZ3  . TRP A 1 169 ? 50.215  37.330 15.981  1.00 0.00  ? 169 TRP A HZ3  3  
ATOM   10115 H  HH2  . TRP A 1 169 ? 49.225  39.579 15.649  1.00 0.00  ? 169 TRP A HH2  3  
ATOM   10116 N  N    . LYS A 1 170 ? 51.681  32.688 10.112  1.00 0.00  ? 170 LYS A N    3  
ATOM   10117 C  CA   . LYS A 1 170 ? 52.334  31.375 10.381  1.00 0.00  ? 170 LYS A CA   3  
ATOM   10118 C  C    . LYS A 1 170 ? 52.724  30.715 9.058   1.00 0.00  ? 170 LYS A C    3  
ATOM   10119 O  O    . LYS A 1 170 ? 53.179  29.589 9.026   1.00 0.00  ? 170 LYS A O    3  
ATOM   10120 C  CB   . LYS A 1 170 ? 51.362  30.475 11.130  1.00 0.00  ? 170 LYS A CB   3  
ATOM   10121 C  CG   . LYS A 1 170 ? 51.207  30.962 12.575  1.00 0.00  ? 170 LYS A CG   3  
ATOM   10122 C  CD   . LYS A 1 170 ? 50.408  29.934 13.382  1.00 0.00  ? 170 LYS A CD   3  
ATOM   10123 C  CE   . LYS A 1 170 ? 49.015  29.756 12.768  1.00 0.00  ? 170 LYS A CE   3  
ATOM   10124 N  NZ   . LYS A 1 170 ? 48.097  29.171 13.786  1.00 0.00  ? 170 LYS A NZ   3  
ATOM   10125 H  H    . LYS A 1 170 ? 51.042  32.777 9.374   1.00 0.00  ? 170 LYS A H    3  
ATOM   10126 H  HA   . LYS A 1 170 ? 53.206  31.520 10.979  1.00 0.00  ? 170 LYS A HA   3  
ATOM   10127 H  HB2  . LYS A 1 170 ? 50.416  30.515 10.637  1.00 0.00  ? 170 LYS A HB2  3  
ATOM   10128 H  HB3  . LYS A 1 170 ? 51.731  29.461 11.130  1.00 0.00  ? 170 LYS A HB3  3  
ATOM   10129 H  HG2  . LYS A 1 170 ? 52.183  31.088 13.021  1.00 0.00  ? 170 LYS A HG2  3  
ATOM   10130 H  HG3  . LYS A 1 170 ? 50.684  31.906 12.582  1.00 0.00  ? 170 LYS A HG3  3  
ATOM   10131 H  HD2  . LYS A 1 170 ? 50.928  28.987 13.371  1.00 0.00  ? 170 LYS A HD2  3  
ATOM   10132 H  HD3  . LYS A 1 170 ? 50.308  30.277 14.401  1.00 0.00  ? 170 LYS A HD3  3  
ATOM   10133 H  HE2  . LYS A 1 170 ? 48.631  30.715 12.449  1.00 0.00  ? 170 LYS A HE2  3  
ATOM   10134 H  HE3  . LYS A 1 170 ? 49.077  29.092 11.919  1.00 0.00  ? 170 LYS A HE3  3  
ATOM   10135 H  HZ1  . LYS A 1 170 ? 48.623  28.992 14.665  1.00 0.00  ? 170 LYS A HZ1  3  
ATOM   10136 H  HZ2  . LYS A 1 170 ? 47.706  28.276 13.427  1.00 0.00  ? 170 LYS A HZ2  3  
ATOM   10137 H  HZ3  . LYS A 1 170 ? 47.322  29.836 13.978  1.00 0.00  ? 170 LYS A HZ3  3  
ATOM   10138 N  N    . GLY A 1 171 ? 52.550  31.406 7.965   1.00 0.00  ? 171 GLY A N    3  
ATOM   10139 C  CA   . GLY A 1 171 ? 52.911  30.814 6.645   1.00 0.00  ? 171 GLY A CA   3  
ATOM   10140 C  C    . GLY A 1 171 ? 52.455  31.748 5.523   1.00 0.00  ? 171 GLY A C    3  
ATOM   10141 O  O    . GLY A 1 171 ? 51.766  31.278 4.632   1.00 0.00  ? 171 GLY A O    3  
ATOM   10142 O  OXT  . GLY A 1 171 ? 52.803  32.916 5.572   1.00 0.00  ? 171 GLY A OXT  3  
ATOM   10143 H  H    . GLY A 1 171 ? 52.181  32.312 8.011   1.00 0.00  ? 171 GLY A H    3  
ATOM   10144 H  HA2  . GLY A 1 171 ? 53.983  30.682 6.593   1.00 0.00  ? 171 GLY A HA2  3  
ATOM   10145 H  HA3  . GLY A 1 171 ? 52.424  29.858 6.533   1.00 0.00  ? 171 GLY A HA3  3  
ATOM   10146 N  N    . MET B 2 1   ? 51.802  74.363 -21.710 1.00 7.62  ? 1   MET B N    3  
ATOM   10147 C  CA   . MET B 2 1   ? 51.672  75.782 -22.149 1.00 7.57  ? 1   MET B CA   3  
ATOM   10148 C  C    . MET B 2 1   ? 50.196  76.186 -22.131 1.00 6.87  ? 1   MET B C    3  
ATOM   10149 O  O    . MET B 2 1   ? 49.788  77.045 -21.374 1.00 7.06  ? 1   MET B O    3  
ATOM   10150 C  CB   . MET B 2 1   ? 52.226  75.927 -23.569 1.00 8.22  ? 1   MET B CB   3  
ATOM   10151 C  CG   . MET B 2 1   ? 52.223  77.403 -23.973 1.00 8.89  ? 1   MET B CG   3  
ATOM   10152 S  SD   . MET B 2 1   ? 53.029  77.587 -25.583 1.00 9.69  ? 1   MET B SD   3  
ATOM   10153 C  CE   . MET B 2 1   ? 52.794  79.373 -25.754 1.00 10.47 ? 1   MET B CE   3  
ATOM   10154 H  H1   . MET B 2 1   ? 52.131  74.334 -20.725 1.00 7.70  ? 1   MET B H1   3  
ATOM   10155 H  H2   . MET B 2 1   ? 52.488  73.873 -22.321 1.00 7.68  ? 1   MET B H2   3  
ATOM   10156 H  H3   . MET B 2 1   ? 50.878  73.892 -21.779 1.00 7.83  ? 1   MET B H3   3  
ATOM   10157 H  HA   . MET B 2 1   ? 52.229  76.419 -21.478 1.00 7.86  ? 1   MET B HA   3  
ATOM   10158 H  HB2  . MET B 2 1   ? 53.236  75.547 -23.600 1.00 8.21  ? 1   MET B HB2  3  
ATOM   10159 H  HB3  . MET B 2 1   ? 51.609  75.367 -24.255 1.00 8.52  ? 1   MET B HB3  3  
ATOM   10160 H  HG2  . MET B 2 1   ? 51.204  77.757 -24.038 1.00 8.92  ? 1   MET B HG2  3  
ATOM   10161 H  HG3  . MET B 2 1   ? 52.758  77.980 -23.234 1.00 9.14  ? 1   MET B HG3  3  
ATOM   10162 H  HE1  . MET B 2 1   ? 53.401  79.887 -25.021 1.00 10.65 ? 1   MET B HE1  3  
ATOM   10163 H  HE2  . MET B 2 1   ? 51.756  79.618 -25.593 1.00 10.84 ? 1   MET B HE2  3  
ATOM   10164 H  HE3  . MET B 2 1   ? 53.084  79.680 -26.749 1.00 10.61 ? 1   MET B HE3  3  
ATOM   10165 N  N    . ALA B 2 2   ? 49.392  75.573 -22.956 1.00 6.37  ? 2   ALA B N    3  
ATOM   10166 C  CA   . ALA B 2 2   ? 47.944  75.922 -22.983 1.00 5.98  ? 2   ALA B CA   3  
ATOM   10167 C  C    . ALA B 2 2   ? 47.193  74.916 -23.857 1.00 5.18  ? 2   ALA B C    3  
ATOM   10168 O  O    . ALA B 2 2   ? 46.722  75.241 -24.929 1.00 5.33  ? 2   ALA B O    3  
ATOM   10169 C  CB   . ALA B 2 2   ? 47.768  77.329 -23.558 1.00 6.35  ? 2   ALA B CB   3  
ATOM   10170 H  H    . ALA B 2 2   ? 49.741  74.882 -23.557 1.00 6.49  ? 2   ALA B H    3  
ATOM   10171 H  HA   . ALA B 2 2   ? 47.548  75.892 -21.978 1.00 6.37  ? 2   ALA B HA   3  
ATOM   10172 H  HB1  . ALA B 2 2   ? 48.246  78.046 -22.907 1.00 6.56  ? 2   ALA B HB1  3  
ATOM   10173 H  HB2  . ALA B 2 2   ? 46.715  77.558 -23.634 1.00 6.56  ? 2   ALA B HB2  3  
ATOM   10174 H  HB3  . ALA B 2 2   ? 48.219  77.376 -24.538 1.00 6.56  ? 2   ALA B HB3  3  
ATOM   10175 N  N    . ASN B 2 3   ? 47.076  73.697 -23.407 1.00 4.74  ? 3   ASN B N    3  
ATOM   10176 C  CA   . ASN B 2 3   ? 46.354  72.672 -24.213 1.00 4.38  ? 3   ASN B CA   3  
ATOM   10177 C  C    . ASN B 2 3   ? 44.851  72.944 -24.153 1.00 3.55  ? 3   ASN B C    3  
ATOM   10178 O  O    . ASN B 2 3   ? 44.174  72.544 -23.227 1.00 3.87  ? 3   ASN B O    3  
ATOM   10179 C  CB   . ASN B 2 3   ? 46.642  71.280 -23.645 1.00 4.98  ? 3   ASN B CB   3  
ATOM   10180 C  CG   . ASN B 2 3   ? 46.329  71.265 -22.148 1.00 5.68  ? 3   ASN B CG   3  
ATOM   10181 O  OD1  . ASN B 2 3   ? 45.319  70.732 -21.732 1.00 6.06  ? 3   ASN B OD1  3  
ATOM   10182 N  ND2  . ASN B 2 3   ? 47.158  71.830 -21.314 1.00 6.21  ? 3   ASN B ND2  3  
ATOM   10183 H  H    . ASN B 2 3   ? 47.462  73.455 -22.540 1.00 4.97  ? 3   ASN B H    3  
ATOM   10184 H  HA   . ASN B 2 3   ? 46.688  72.719 -25.239 1.00 4.77  ? 3   ASN B HA   3  
ATOM   10185 H  HB2  . ASN B 2 3   ? 46.025  70.551 -24.151 1.00 5.11  ? 3   ASN B HB2  3  
ATOM   10186 H  HB3  . ASN B 2 3   ? 47.683  71.038 -23.796 1.00 5.25  ? 3   ASN B HB3  3  
ATOM   10187 H  HD21 . ASN B 2 3   ? 47.973  72.260 -21.649 1.00 6.18  ? 3   ASN B HD21 3  
ATOM   10188 H  HD22 . ASN B 2 3   ? 46.967  71.826 -20.353 1.00 6.83  ? 3   ASN B HD22 3  
ATOM   10189 N  N    . ALA B 2 4   ? 44.322  73.624 -25.133 1.00 2.99  ? 4   ALA B N    3  
ATOM   10190 C  CA   . ALA B 2 4   ? 42.863  73.921 -25.130 1.00 2.69  ? 4   ALA B CA   3  
ATOM   10191 C  C    . ALA B 2 4   ? 42.472  74.558 -26.465 1.00 1.96  ? 4   ALA B C    3  
ATOM   10192 O  O    . ALA B 2 4   ? 41.675  75.474 -26.517 1.00 2.51  ? 4   ALA B O    3  
ATOM   10193 C  CB   . ALA B 2 4   ? 42.541  74.888 -23.989 1.00 3.52  ? 4   ALA B CB   3  
ATOM   10194 H  H    . ALA B 2 4   ? 44.885  73.938 -25.871 1.00 3.25  ? 4   ALA B H    3  
ATOM   10195 H  HA   . ALA B 2 4   ? 42.308  73.005 -24.993 1.00 3.12  ? 4   ALA B HA   3  
ATOM   10196 H  HB1  . ALA B 2 4   ? 41.508  75.196 -24.058 1.00 3.91  ? 4   ALA B HB1  3  
ATOM   10197 H  HB2  . ALA B 2 4   ? 43.181  75.755 -24.060 1.00 3.98  ? 4   ALA B HB2  3  
ATOM   10198 H  HB3  . ALA B 2 4   ? 42.706  74.395 -23.042 1.00 3.83  ? 4   ALA B HB3  3  
ATOM   10199 N  N    . LEU B 2 5   ? 43.026  74.079 -27.545 1.00 1.63  ? 5   LEU B N    3  
ATOM   10200 C  CA   . LEU B 2 5   ? 42.685  74.655 -28.876 1.00 2.08  ? 5   LEU B CA   3  
ATOM   10201 C  C    . LEU B 2 5   ? 41.320  74.126 -29.323 1.00 1.73  ? 5   LEU B C    3  
ATOM   10202 O  O    . LEU B 2 5   ? 41.023  74.062 -30.500 1.00 2.53  ? 5   LEU B O    3  
ATOM   10203 C  CB   . LEU B 2 5   ? 43.753  74.249 -29.897 1.00 2.84  ? 5   LEU B CB   3  
ATOM   10204 C  CG   . LEU B 2 5   ? 45.142  74.378 -29.268 1.00 3.64  ? 5   LEU B CG   3  
ATOM   10205 C  CD1  . LEU B 2 5   ? 46.209  74.078 -30.322 1.00 4.30  ? 5   LEU B CD1  3  
ATOM   10206 C  CD2  . LEU B 2 5   ? 45.333  75.802 -28.739 1.00 4.44  ? 5   LEU B CD2  3  
ATOM   10207 H  H    . LEU B 2 5   ? 43.665  73.339 -27.481 1.00 1.95  ? 5   LEU B H    3  
ATOM   10208 H  HA   . LEU B 2 5   ? 42.647  75.733 -28.803 1.00 2.70  ? 5   LEU B HA   3  
ATOM   10209 H  HB2  . LEU B 2 5   ? 43.591  73.225 -30.202 1.00 3.04  ? 5   LEU B HB2  3  
ATOM   10210 H  HB3  . LEU B 2 5   ? 43.690  74.895 -30.760 1.00 3.24  ? 5   LEU B HB3  3  
ATOM   10211 H  HG   . LEU B 2 5   ? 45.234  73.673 -28.453 1.00 3.77  ? 5   LEU B HG   3  
ATOM   10212 H  HD11 . LEU B 2 5   ? 46.092  74.755 -31.156 1.00 4.94  ? 5   LEU B HD11 3  
ATOM   10213 H  HD12 . LEU B 2 5   ? 46.100  73.060 -30.667 1.00 4.44  ? 5   LEU B HD12 3  
ATOM   10214 H  HD13 . LEU B 2 5   ? 47.190  74.208 -29.889 1.00 4.47  ? 5   LEU B HD13 3  
ATOM   10215 H  HD21 . LEU B 2 5   ? 44.984  76.511 -29.476 1.00 4.77  ? 5   LEU B HD21 3  
ATOM   10216 H  HD22 . LEU B 2 5   ? 46.381  75.976 -28.541 1.00 4.82  ? 5   LEU B HD22 3  
ATOM   10217 H  HD23 . LEU B 2 5   ? 44.770  75.925 -27.825 1.00 4.75  ? 5   LEU B HD23 3  
ATOM   10218 N  N    . ALA B 2 6   ? 40.487  73.743 -28.393 1.00 0.89  ? 6   ALA B N    3  
ATOM   10219 C  CA   . ALA B 2 6   ? 39.143  73.213 -28.763 1.00 0.76  ? 6   ALA B CA   3  
ATOM   10220 C  C    . ALA B 2 6   ? 38.172  74.378 -28.976 1.00 0.73  ? 6   ALA B C    3  
ATOM   10221 O  O    . ALA B 2 6   ? 38.570  75.478 -29.303 1.00 0.79  ? 6   ALA B O    3  
ATOM   10222 C  CB   . ALA B 2 6   ? 38.625  72.315 -27.639 1.00 0.92  ? 6   ALA B CB   3  
ATOM   10223 H  H    . ALA B 2 6   ? 40.748  73.800 -27.450 1.00 1.04  ? 6   ALA B H    3  
ATOM   10224 H  HA   . ALA B 2 6   ? 39.219  72.639 -29.675 1.00 0.94  ? 6   ALA B HA   3  
ATOM   10225 H  HB1  . ALA B 2 6   ? 38.472  72.905 -26.748 1.00 1.37  ? 6   ALA B HB1  3  
ATOM   10226 H  HB2  . ALA B 2 6   ? 39.348  71.538 -27.437 1.00 1.41  ? 6   ALA B HB2  3  
ATOM   10227 H  HB3  . ALA B 2 6   ? 37.690  71.865 -27.939 1.00 1.46  ? 6   ALA B HB3  3  
ATOM   10228 N  N    . SER B 2 7   ? 36.900  74.143 -28.795 1.00 0.71  ? 7   SER B N    3  
ATOM   10229 C  CA   . SER B 2 7   ? 35.901  75.235 -28.990 1.00 0.75  ? 7   SER B CA   3  
ATOM   10230 C  C    . SER B 2 7   ? 34.643  74.925 -28.176 1.00 0.81  ? 7   SER B C    3  
ATOM   10231 O  O    . SER B 2 7   ? 34.668  74.901 -26.962 1.00 1.38  ? 7   SER B O    3  
ATOM   10232 C  CB   . SER B 2 7   ? 35.542  75.333 -30.473 1.00 0.79  ? 7   SER B CB   3  
ATOM   10233 O  OG   . SER B 2 7   ? 34.599  76.380 -30.659 1.00 1.36  ? 7   SER B OG   3  
ATOM   10234 H  H    . SER B 2 7   ? 36.600  73.247 -28.533 1.00 0.71  ? 7   SER B H    3  
ATOM   10235 H  HA   . SER B 2 7   ? 36.318  76.173 -28.659 1.00 0.80  ? 7   SER B HA   3  
ATOM   10236 H  HB2  . SER B 2 7   ? 36.427  75.548 -31.047 1.00 1.25  ? 7   SER B HB2  3  
ATOM   10237 H  HB3  . SER B 2 7   ? 35.121  74.392 -30.804 1.00 1.20  ? 7   SER B HB3  3  
ATOM   10238 H  HG   . SER B 2 7   ? 35.043  77.213 -30.486 1.00 1.90  ? 7   SER B HG   3  
ATOM   10239 N  N    . ALA B 2 8   ? 33.542  74.684 -28.836 1.00 0.67  ? 8   ALA B N    3  
ATOM   10240 C  CA   . ALA B 2 8   ? 32.285  74.371 -28.107 1.00 0.62  ? 8   ALA B CA   3  
ATOM   10241 C  C    . ALA B 2 8   ? 32.570  73.315 -27.043 1.00 0.60  ? 8   ALA B C    3  
ATOM   10242 O  O    . ALA B 2 8   ? 33.434  72.480 -27.203 1.00 0.69  ? 8   ALA B O    3  
ATOM   10243 C  CB   . ALA B 2 8   ? 31.243  73.835 -29.091 1.00 0.62  ? 8   ALA B CB   3  
ATOM   10244 H  H    . ALA B 2 8   ? 33.544  74.705 -29.809 1.00 1.03  ? 8   ALA B H    3  
ATOM   10245 H  HA   . ALA B 2 8   ? 31.908  75.267 -27.635 1.00 0.64  ? 8   ALA B HA   3  
ATOM   10246 H  HB1  . ALA B 2 8   ? 31.163  74.508 -29.932 1.00 1.12  ? 8   ALA B HB1  3  
ATOM   10247 H  HB2  . ALA B 2 8   ? 30.286  73.760 -28.597 1.00 1.20  ? 8   ALA B HB2  3  
ATOM   10248 H  HB3  . ALA B 2 8   ? 31.546  72.859 -29.440 1.00 1.22  ? 8   ALA B HB3  3  
ATOM   10249 N  N    . THR B 2 9   ? 31.896  73.401 -25.927 1.00 0.54  ? 9   THR B N    3  
ATOM   10250 C  CA   . THR B 2 9   ? 32.146  72.467 -24.786 1.00 0.54  ? 9   THR B CA   3  
ATOM   10251 C  C    . THR B 2 9   ? 30.871  71.737 -24.375 1.00 0.50  ? 9   THR B C    3  
ATOM   10252 O  O    . THR B 2 9   ? 29.769  72.193 -24.605 1.00 0.50  ? 9   THR B O    3  
ATOM   10253 C  CB   . THR B 2 9   ? 32.669  73.279 -23.579 1.00 0.59  ? 9   THR B CB   3  
ATOM   10254 O  OG1  . THR B 2 9   ? 31.985  74.522 -23.526 1.00 0.63  ? 9   THR B OG1  3  
ATOM   10255 C  CG2  . THR B 2 9   ? 34.179  73.539 -23.704 1.00 0.62  ? 9   THR B CG2  3  
ATOM   10256 H  H    . THR B 2 9   ? 31.292  74.142 -25.806 1.00 0.56  ? 9   THR B H    3  
ATOM   10257 H  HA   . THR B 2 9   ? 32.881  71.730 -25.071 1.00 0.54  ? 9   THR B HA   3  
ATOM   10258 H  HB   . THR B 2 9   ? 32.482  72.732 -22.664 1.00 0.58  ? 9   THR B HB   3  
ATOM   10259 H  HG1  . THR B 2 9   ? 32.636  75.222 -23.620 1.00 1.08  ? 9   THR B HG1  3  
ATOM   10260 H  HG21 . THR B 2 9   ? 34.465  73.560 -24.745 1.00 1.15  ? 9   THR B HG21 3  
ATOM   10261 H  HG22 . THR B 2 9   ? 34.728  72.759 -23.193 1.00 1.15  ? 9   THR B HG22 3  
ATOM   10262 H  HG23 . THR B 2 9   ? 34.412  74.490 -23.251 1.00 1.28  ? 9   THR B HG23 3  
ATOM   10263 N  N    . CYS B 2 10  ? 31.029  70.597 -23.751 1.00 0.49  ? 10  CYS B N    3  
ATOM   10264 C  CA   . CYS B 2 10  ? 29.861  69.828 -23.306 1.00 0.47  ? 10  CYS B CA   3  
ATOM   10265 C  C    . CYS B 2 10  ? 29.031  70.643 -22.382 1.00 0.49  ? 10  CYS B C    3  
ATOM   10266 O  O    . CYS B 2 10  ? 29.520  71.349 -21.521 1.00 0.55  ? 10  CYS B O    3  
ATOM   10267 C  CB   . CYS B 2 10  ? 30.258  68.594 -22.566 1.00 0.50  ? 10  CYS B CB   3  
ATOM   10268 S  SG   . CYS B 2 10  ? 28.750  67.680 -22.211 1.00 0.61  ? 10  CYS B SG   3  
ATOM   10269 H  H    . CYS B 2 10  ? 31.917  70.261 -23.566 1.00 0.50  ? 10  CYS B H    3  
ATOM   10270 H  HA   . CYS B 2 10  ? 29.273  69.540 -24.136 1.00 0.45  ? 10  CYS B HA   3  
ATOM   10271 H  HB2  . CYS B 2 10  ? 30.904  68.020 -23.162 1.00 0.47  ? 10  CYS B HB2  3  
ATOM   10272 H  HB3  . CYS B 2 10  ? 30.743  68.852 -21.661 1.00 0.65  ? 10  CYS B HB3  3  
ATOM   10273 N  N    . GLU B 2 11  ? 27.774  70.506 -22.528 1.00 0.49  ? 11  GLU B N    3  
ATOM   10274 C  CA   . GLU B 2 11  ? 26.871  71.260 -21.617 1.00 0.53  ? 11  GLU B CA   3  
ATOM   10275 C  C    . GLU B 2 11  ? 26.970  70.643 -20.221 1.00 0.57  ? 11  GLU B C    3  
ATOM   10276 O  O    . GLU B 2 11  ? 26.496  71.201 -19.251 1.00 0.65  ? 11  GLU B O    3  
ATOM   10277 C  CB   . GLU B 2 11  ? 25.417  71.194 -22.105 1.00 0.55  ? 11  GLU B CB   3  
ATOM   10278 C  CG   . GLU B 2 11  ? 24.460  71.706 -21.009 1.00 1.08  ? 11  GLU B CG   3  
ATOM   10279 C  CD   . GLU B 2 11  ? 24.972  73.032 -20.440 1.00 1.61  ? 11  GLU B CD   3  
ATOM   10280 O  OE1  . GLU B 2 11  ? 25.310  73.900 -21.228 1.00 2.09  ? 11  GLU B OE1  3  
ATOM   10281 O  OE2  . GLU B 2 11  ? 25.016  73.157 -19.228 1.00 2.31  ? 11  GLU B OE2  3  
ATOM   10282 H  H    . GLU B 2 11  ? 27.437  69.876 -23.228 1.00 0.47  ? 11  GLU B H    3  
ATOM   10283 H  HA   . GLU B 2 11  ? 27.197  72.291 -21.582 1.00 0.57  ? 11  GLU B HA   3  
ATOM   10284 H  HB2  . GLU B 2 11  ? 25.309  71.802 -22.989 1.00 0.91  ? 11  GLU B HB2  3  
ATOM   10285 H  HB3  . GLU B 2 11  ? 25.171  70.174 -22.338 1.00 0.90  ? 11  GLU B HB3  3  
ATOM   10286 H  HG2  . GLU B 2 11  ? 23.480  71.854 -21.428 1.00 1.51  ? 11  GLU B HG2  3  
ATOM   10287 H  HG3  . GLU B 2 11  ? 24.395  70.977 -20.216 1.00 1.55  ? 11  GLU B HG3  3  
ATOM   10288 N  N    . ARG B 2 12  ? 27.576  69.483 -20.119 1.00 0.57  ? 12  ARG B N    3  
ATOM   10289 C  CA   . ARG B 2 12  ? 27.697  68.796 -18.784 1.00 0.67  ? 12  ARG B CA   3  
ATOM   10290 C  C    . ARG B 2 12  ? 29.152  68.436 -18.481 1.00 0.69  ? 12  ARG B C    3  
ATOM   10291 O  O    . ARG B 2 12  ? 29.671  68.756 -17.431 1.00 0.79  ? 12  ARG B O    3  
ATOM   10292 C  CB   . ARG B 2 12  ? 26.846  67.521 -18.791 1.00 0.72  ? 12  ARG B CB   3  
ATOM   10293 C  CG   . ARG B 2 12  ? 25.366  67.893 -18.680 1.00 1.25  ? 12  ARG B CG   3  
ATOM   10294 C  CD   . ARG B 2 12  ? 24.514  66.622 -18.715 1.00 1.90  ? 12  ARG B CD   3  
ATOM   10295 N  NE   . ARG B 2 12  ? 24.987  65.680 -17.662 1.00 2.40  ? 12  ARG B NE   3  
ATOM   10296 C  CZ   . ARG B 2 12  ? 24.247  64.664 -17.313 1.00 3.03  ? 12  ARG B CZ   3  
ATOM   10297 N  NH1  . ARG B 2 12  ? 23.095  64.465 -17.893 1.00 3.43  ? 12  ARG B NH1  3  
ATOM   10298 N  NH2  . ARG B 2 12  ? 24.661  63.844 -16.386 1.00 3.74  ? 12  ARG B NH2  3  
ATOM   10299 H  H    . ARG B 2 12  ? 27.941  69.059 -20.928 1.00 0.52  ? 12  ARG B H    3  
ATOM   10300 H  HA   . ARG B 2 12  ? 27.346  69.443 -18.007 1.00 0.75  ? 12  ARG B HA   3  
ATOM   10301 H  HB2  . ARG B 2 12  ? 27.013  66.985 -19.711 1.00 1.21  ? 12  ARG B HB2  3  
ATOM   10302 H  HB3  . ARG B 2 12  ? 27.122  66.896 -17.955 1.00 1.16  ? 12  ARG B HB3  3  
ATOM   10303 H  HG2  . ARG B 2 12  ? 25.196  68.416 -17.750 1.00 1.73  ? 12  ARG B HG2  3  
ATOM   10304 H  HG3  . ARG B 2 12  ? 25.092  68.530 -19.507 1.00 1.74  ? 12  ARG B HG3  3  
ATOM   10305 H  HD2  . ARG B 2 12  ? 23.481  66.876 -18.532 1.00 2.39  ? 12  ARG B HD2  3  
ATOM   10306 H  HD3  . ARG B 2 12  ? 24.603  66.155 -19.685 1.00 2.32  ? 12  ARG B HD3  3  
ATOM   10307 H  HE   . ARG B 2 12  ? 25.854  65.826 -17.228 1.00 2.69  ? 12  ARG B HE   3  
ATOM   10308 H  HH11 . ARG B 2 12  ? 22.778  65.093 -18.604 1.00 3.27  ? 12  ARG B HH11 3  
ATOM   10309 H  HH12 . ARG B 2 12  ? 22.528  63.685 -17.626 1.00 4.16  ? 12  ARG B HH12 3  
ATOM   10310 H  HH21 . ARG B 2 12  ? 25.545  63.996 -15.943 1.00 3.93  ? 12  ARG B HH21 3  
ATOM   10311 H  HH22 . ARG B 2 12  ? 24.095  63.064 -16.119 1.00 4.33  ? 12  ARG B HH22 3  
ATOM   10312 N  N    . CYS B 2 13  ? 29.815  67.782 -19.382 1.00 0.64  ? 13  CYS B N    3  
ATOM   10313 C  CA   . CYS B 2 13  ? 31.239  67.418 -19.126 1.00 0.72  ? 13  CYS B CA   3  
ATOM   10314 C  C    . CYS B 2 13  ? 32.066  68.683 -19.231 1.00 0.69  ? 13  CYS B C    3  
ATOM   10315 O  O    . CYS B 2 13  ? 33.224  68.721 -18.866 1.00 0.73  ? 13  CYS B O    3  
ATOM   10316 C  CB   . CYS B 2 13  ? 31.754  66.410 -20.167 1.00 0.80  ? 13  CYS B CB   3  
ATOM   10317 S  SG   . CYS B 2 13  ? 30.784  64.890 -20.105 1.00 0.87  ? 13  CYS B SG   3  
ATOM   10318 H  H    . CYS B 2 13  ? 29.383  67.546 -20.218 1.00 0.60  ? 13  CYS B H    3  
ATOM   10319 H  HA   . CYS B 2 13  ? 31.334  67.004 -18.136 1.00 0.80  ? 13  CYS B HA   3  
ATOM   10320 H  HB2  . CYS B 2 13  ? 31.681  66.835 -21.153 1.00 1.29  ? 13  CYS B HB2  3  
ATOM   10321 H  HB3  . CYS B 2 13  ? 32.788  66.180 -19.956 1.00 1.32  ? 13  CYS B HB3  3  
ATOM   10322 N  N    . LYS B 2 14  ? 31.480  69.711 -19.769 1.00 0.64  ? 14  LYS B N    3  
ATOM   10323 C  CA   . LYS B 2 14  ? 32.219  70.969 -19.950 1.00 0.64  ? 14  LYS B CA   3  
ATOM   10324 C  C    . LYS B 2 14  ? 33.404  70.675 -20.829 1.00 0.67  ? 14  LYS B C    3  
ATOM   10325 O  O    . LYS B 2 14  ? 34.266  71.504 -21.044 1.00 0.79  ? 14  LYS B O    3  
ATOM   10326 C  CB   . LYS B 2 14  ? 32.663  71.510 -18.597 1.00 0.67  ? 14  LYS B CB   3  
ATOM   10327 C  CG   . LYS B 2 14  ? 31.518  71.364 -17.584 1.00 0.69  ? 14  LYS B CG   3  
ATOM   10328 C  CD   . LYS B 2 14  ? 30.197  71.862 -18.199 1.00 0.70  ? 14  LYS B CD   3  
ATOM   10329 C  CE   . LYS B 2 14  ? 29.216  72.244 -17.087 1.00 1.04  ? 14  LYS B CE   3  
ATOM   10330 N  NZ   . LYS B 2 14  ? 27.961  72.770 -17.693 1.00 1.55  ? 14  LYS B NZ   3  
ATOM   10331 H  H    . LYS B 2 14  ? 30.554  69.636 -20.091 1.00 0.62  ? 14  LYS B H    3  
ATOM   10332 H  HA   . LYS B 2 14  ? 31.588  71.685 -20.452 1.00 0.62  ? 14  LYS B HA   3  
ATOM   10333 H  HB2  . LYS B 2 14  ? 33.526  70.959 -18.249 1.00 0.70  ? 14  LYS B HB2  3  
ATOM   10334 H  HB3  . LYS B 2 14  ? 32.920  72.545 -18.704 1.00 0.69  ? 14  LYS B HB3  3  
ATOM   10335 H  HG2  . LYS B 2 14  ? 31.416  70.325 -17.309 1.00 0.71  ? 14  LYS B HG2  3  
ATOM   10336 H  HG3  . LYS B 2 14  ? 31.746  71.942 -16.706 1.00 0.71  ? 14  LYS B HG3  3  
ATOM   10337 H  HD2  . LYS B 2 14  ? 30.390  72.721 -18.822 1.00 0.71  ? 14  LYS B HD2  3  
ATOM   10338 H  HD3  . LYS B 2 14  ? 29.765  71.078 -18.800 1.00 0.71  ? 14  LYS B HD3  3  
ATOM   10339 H  HE2  . LYS B 2 14  ? 28.990  71.373 -16.490 1.00 1.46  ? 14  LYS B HE2  3  
ATOM   10340 H  HE3  . LYS B 2 14  ? 29.660  73.004 -16.461 1.00 1.42  ? 14  LYS B HE3  3  
ATOM   10341 H  HZ1  . LYS B 2 14  ? 27.671  72.156 -18.480 1.00 2.01  ? 14  LYS B HZ1  3  
ATOM   10342 H  HZ2  . LYS B 2 14  ? 28.125  73.735 -18.047 1.00 2.02  ? 14  LYS B HZ2  3  
ATOM   10343 H  HZ3  . LYS B 2 14  ? 27.210  72.787 -16.974 1.00 1.96  ? 14  LYS B HZ3  3  
ATOM   10344 N  N    . GLY B 2 15  ? 33.424  69.503 -21.383 1.00 0.61  ? 15  GLY B N    3  
ATOM   10345 C  CA   . GLY B 2 15  ? 34.458  69.088 -22.288 1.00 0.65  ? 15  GLY B CA   3  
ATOM   10346 C  C    . GLY B 2 15  ? 34.382  70.019 -23.432 1.00 0.64  ? 15  GLY B C    3  
ATOM   10347 O  O    . GLY B 2 15  ? 33.542  70.844 -23.487 1.00 0.71  ? 15  GLY B O    3  
ATOM   10348 H  H    . GLY B 2 15  ? 32.753  68.855 -21.268 1.00 0.58  ? 15  GLY B H    3  
ATOM   10349 H  HA2  . GLY B 2 15  ? 35.421  69.180 -21.802 1.00 0.71  ? 15  GLY B HA2  3  
ATOM   10350 H  HA3  . GLY B 2 15  ? 34.310  68.085 -22.608 1.00 0.63  ? 15  GLY B HA3  3  
ATOM   10351 N  N    . GLY B 2 16  ? 35.305  69.890 -24.254 1.00 0.59  ? 16  GLY B N    3  
ATOM   10352 C  CA   . GLY B 2 16  ? 35.516  70.730 -25.439 1.00 0.61  ? 16  GLY B CA   3  
ATOM   10353 C  C    . GLY B 2 16  ? 35.657  69.850 -26.654 1.00 0.59  ? 16  GLY B C    3  
ATOM   10354 O  O    . GLY B 2 16  ? 36.673  69.218 -26.866 1.00 0.62  ? 16  GLY B O    3  
ATOM   10355 H  H    . GLY B 2 16  ? 35.871  69.206 -24.091 1.00 0.54  ? 16  GLY B H    3  
ATOM   10356 H  HA2  . GLY B 2 16  ? 34.714  71.404 -25.580 1.00 0.61  ? 16  GLY B HA2  3  
ATOM   10357 H  HA3  . GLY B 2 16  ? 36.429  71.291 -25.314 1.00 0.66  ? 16  GLY B HA3  3  
ATOM   10358 N  N    . PHE B 2 17  ? 34.643  69.819 -27.459 1.00 0.57  ? 17  PHE B N    3  
ATOM   10359 C  CA   . PHE B 2 17  ? 34.675  69.002 -28.686 1.00 0.57  ? 17  PHE B CA   3  
ATOM   10360 C  C    . PHE B 2 17  ? 34.810  69.909 -29.900 1.00 0.62  ? 17  PHE B C    3  
ATOM   10361 O  O    . PHE B 2 17  ? 34.649  71.113 -29.891 1.00 0.66  ? 17  PHE B O    3  
ATOM   10362 C  CB   . PHE B 2 17  ? 33.414  68.125 -28.858 1.00 0.52  ? 17  PHE B CB   3  
ATOM   10363 C  CG   . PHE B 2 17  ? 32.203  68.721 -28.203 1.00 0.50  ? 17  PHE B CG   3  
ATOM   10364 C  CD1  . PHE B 2 17  ? 32.065  70.090 -28.101 1.00 0.52  ? 17  PHE B CD1  3  
ATOM   10365 C  CD2  . PHE B 2 17  ? 31.245  67.878 -27.642 1.00 0.46  ? 17  PHE B CD2  3  
ATOM   10366 C  CE1  . PHE B 2 17  ? 30.961  70.625 -27.441 1.00 0.51  ? 17  PHE B CE1  3  
ATOM   10367 C  CE2  . PHE B 2 17  ? 30.153  68.405 -26.957 1.00 0.45  ? 17  PHE B CE2  3  
ATOM   10368 C  CZ   . PHE B 2 17  ? 30.006  69.787 -26.856 1.00 0.46  ? 17  PHE B CZ   3  
ATOM   10369 H  H    . PHE B 2 17  ? 33.851  70.308 -27.232 1.00 0.57  ? 17  PHE B H    3  
ATOM   10370 H  HA   . PHE B 2 17  ? 35.543  68.351 -28.664 1.00 0.59  ? 17  PHE B HA   3  
ATOM   10371 H  HB2  . PHE B 2 17  ? 33.207  67.990 -29.898 1.00 0.54  ? 17  PHE B HB2  3  
ATOM   10372 H  HB3  . PHE B 2 17  ? 33.609  67.171 -28.415 1.00 0.51  ? 17  PHE B HB3  3  
ATOM   10373 H  HD1  . PHE B 2 17  ? 32.790  70.739 -28.570 1.00 0.57  ? 17  PHE B HD1  3  
ATOM   10374 H  HD2  . PHE B 2 17  ? 31.338  66.820 -27.768 1.00 0.46  ? 17  PHE B HD2  3  
ATOM   10375 H  HE1  . PHE B 2 17  ? 30.846  71.672 -27.386 1.00 0.54  ? 17  PHE B HE1  3  
ATOM   10376 H  HE2  . PHE B 2 17  ? 29.414  67.747 -26.531 1.00 0.43  ? 17  PHE B HE2  3  
ATOM   10377 H  HZ   . PHE B 2 17  ? 29.171  70.209 -26.307 1.00 0.46  ? 17  PHE B HZ   3  
ATOM   10378 N  N    . ALA B 2 18  ? 35.112  69.239 -30.917 1.00 0.63  ? 18  ALA B N    3  
ATOM   10379 C  CA   . ALA B 2 18  ? 35.334  69.761 -32.324 1.00 0.70  ? 18  ALA B CA   3  
ATOM   10380 C  C    . ALA B 2 18  ? 34.053  69.268 -32.881 1.00 0.70  ? 18  ALA B C    3  
ATOM   10381 O  O    . ALA B 2 18  ? 33.836  68.072 -32.779 1.00 0.72  ? 18  ALA B O    3  
ATOM   10382 C  CB   . ALA B 2 18  ? 36.505  69.086 -33.000 1.00 0.76  ? 18  ALA B CB   3  
ATOM   10383 H  H    . ALA B 2 18  ? 35.121  68.368 -30.822 1.00 0.60  ? 18  ALA B H    3  
ATOM   10384 H  HA   . ALA B 2 18  ? 35.455  70.829 -32.312 1.00 0.71  ? 18  ALA B HA   3  
ATOM   10385 H  HB1  . ALA B 2 18  ? 36.314  69.036 -34.059 1.00 1.18  ? 18  ALA B HB1  3  
ATOM   10386 H  HB2  . ALA B 2 18  ? 36.627  68.100 -32.598 1.00 1.22  ? 18  ALA B HB2  3  
ATOM   10387 H  HB3  . ALA B 2 18  ? 37.394  69.667 -32.824 1.00 1.43  ? 18  ALA B HB3  3  
ATOM   10388 N  N    . PRO B 2 19  ? 33.121  70.115 -33.092 1.00 0.70  ? 19  PRO B N    3  
ATOM   10389 C  CA   . PRO B 2 19  ? 31.856  69.495 -33.158 1.00 0.72  ? 19  PRO B CA   3  
ATOM   10390 C  C    . PRO B 2 19  ? 30.946  68.902 -34.181 1.00 0.67  ? 19  PRO B C    3  
ATOM   10391 O  O    . PRO B 2 19  ? 29.748  69.052 -34.328 1.00 0.70  ? 19  PRO B O    3  
ATOM   10392 C  CB   . PRO B 2 19  ? 31.094  70.799 -32.762 1.00 0.73  ? 19  PRO B CB   3  
ATOM   10393 C  CG   . PRO B 2 19  ? 31.931  71.905 -33.401 1.00 0.72  ? 19  PRO B CG   3  
ATOM   10394 C  CD   . PRO B 2 19  ? 33.299  71.455 -33.094 1.00 0.70  ? 19  PRO B CD   3  
ATOM   10395 H  HA   . PRO B 2 19  ? 31.728  68.892 -32.272 1.00 0.77  ? 19  PRO B HA   3  
ATOM   10396 H  HB2  . PRO B 2 19  ? 30.081  70.847 -33.141 1.00 0.72  ? 19  PRO B HB2  3  
ATOM   10397 H  HB3  . PRO B 2 19  ? 31.108  70.924 -31.689 1.00 0.79  ? 19  PRO B HB3  3  
ATOM   10398 H  HG2  . PRO B 2 19  ? 31.777  71.887 -34.472 1.00 0.70  ? 19  PRO B HG2  3  
ATOM   10399 H  HG3  . PRO B 2 19  ? 31.741  72.865 -32.971 1.00 0.77  ? 19  PRO B HG3  3  
ATOM   10400 H  HD2  . PRO B 2 19  ? 34.048  71.703 -33.788 1.00 0.65  ? 19  PRO B HD2  3  
ATOM   10401 H  HD3  . PRO B 2 19  ? 33.583  71.681 -32.103 1.00 0.74  ? 19  PRO B HD3  3  
ATOM   10402 N  N    . ALA B 2 20  ? 31.663  68.124 -34.806 1.00 0.63  ? 20  ALA B N    3  
ATOM   10403 C  CA   . ALA B 2 20  ? 31.229  67.233 -35.842 1.00 0.60  ? 20  ALA B CA   3  
ATOM   10404 C  C    . ALA B 2 20  ? 31.962  65.970 -35.449 1.00 0.59  ? 20  ALA B C    3  
ATOM   10405 O  O    . ALA B 2 20  ? 32.012  65.002 -36.181 1.00 0.63  ? 20  ALA B O    3  
ATOM   10406 C  CB   . ALA B 2 20  ? 31.682  67.758 -37.203 1.00 0.66  ? 20  ALA B CB   3  
ATOM   10407 H  H    . ALA B 2 20  ? 32.597  68.085 -34.503 1.00 0.63  ? 20  ALA B H    3  
ATOM   10408 H  HA   . ALA B 2 20  ? 30.155  67.082 -35.811 1.00 0.57  ? 20  ALA B HA   3  
ATOM   10409 H  HB1  . ALA B 2 20  ? 32.743  67.598 -37.318 1.00 1.25  ? 20  ALA B HB1  3  
ATOM   10410 H  HB2  . ALA B 2 20  ? 31.469  68.818 -37.258 1.00 1.14  ? 20  ALA B HB2  3  
ATOM   10411 H  HB3  . ALA B 2 20  ? 31.149  67.241 -37.986 1.00 1.24  ? 20  ALA B HB3  3  
ATOM   10412 N  N    . GLU B 2 21  ? 32.517  65.965 -34.224 1.00 0.58  ? 21  GLU B N    3  
ATOM   10413 C  CA   . GLU B 2 21  ? 33.210  64.743 -33.758 1.00 0.61  ? 21  GLU B CA   3  
ATOM   10414 C  C    . GLU B 2 21  ? 32.180  64.048 -32.948 1.00 0.59  ? 21  GLU B C    3  
ATOM   10415 O  O    . GLU B 2 21  ? 31.381  63.290 -33.461 1.00 0.70  ? 21  GLU B O    3  
ATOM   10416 C  CB   . GLU B 2 21  ? 34.392  65.097 -32.877 1.00 0.66  ? 21  GLU B CB   3  
ATOM   10417 C  CG   . GLU B 2 21  ? 35.533  65.675 -33.732 1.00 0.76  ? 21  GLU B CG   3  
ATOM   10418 C  CD   . GLU B 2 21  ? 36.857  65.556 -32.970 1.00 1.09  ? 21  GLU B CD   3  
ATOM   10419 O  OE1  . GLU B 2 21  ? 36.874  65.889 -31.796 1.00 1.63  ? 21  GLU B OE1  3  
ATOM   10420 O  OE2  . GLU B 2 21  ? 37.829  65.132 -33.573 1.00 1.64  ? 21  GLU B OE2  3  
ATOM   10421 H  H    . GLU B 2 21  ? 32.425  66.775 -33.576 1.00 0.57  ? 21  GLU B H    3  
ATOM   10422 H  HA   . GLU B 2 21  ? 33.513  64.125 -34.582 1.00 0.67  ? 21  GLU B HA   3  
ATOM   10423 H  HB2  . GLU B 2 21  ? 34.066  65.824 -32.141 1.00 0.65  ? 21  GLU B HB2  3  
ATOM   10424 H  HB3  . GLU B 2 21  ? 34.736  64.203 -32.379 1.00 0.68  ? 21  GLU B HB3  3  
ATOM   10425 H  HG2  . GLU B 2 21  ? 35.607  65.126 -34.660 1.00 0.75  ? 21  GLU B HG2  3  
ATOM   10426 H  HG3  . GLU B 2 21  ? 35.335  66.712 -33.946 1.00 0.90  ? 21  GLU B HG3  3  
ATOM   10427 N  N    . LYS B 2 22  ? 32.090  64.401 -31.700 1.00 0.57  ? 22  LYS B N    3  
ATOM   10428 C  CA   . LYS B 2 22  ? 30.980  63.851 -30.916 1.00 0.63  ? 22  LYS B CA   3  
ATOM   10429 C  C    . LYS B 2 22  ? 30.543  64.872 -29.892 1.00 0.57  ? 22  LYS B C    3  
ATOM   10430 O  O    . LYS B 2 22  ? 30.909  64.905 -28.757 1.00 0.63  ? 22  LYS B O    3  
ATOM   10431 C  CB   . LYS B 2 22  ? 31.398  62.544 -30.218 1.00 0.74  ? 22  LYS B CB   3  
ATOM   10432 C  CG   . LYS B 2 22  ? 32.930  62.424 -30.164 1.00 0.96  ? 22  LYS B CG   3  
ATOM   10433 C  CD   . LYS B 2 22  ? 33.534  63.135 -28.929 1.00 1.04  ? 22  LYS B CD   3  
ATOM   10434 C  CE   . LYS B 2 22  ? 33.917  64.594 -29.243 1.00 0.74  ? 22  LYS B CE   3  
ATOM   10435 N  NZ   . LYS B 2 22  ? 34.777  65.117 -28.144 1.00 1.41  ? 22  LYS B NZ   3  
ATOM   10436 H  H    . LYS B 2 22  ? 32.667  65.102 -31.343 1.00 0.60  ? 22  LYS B H    3  
ATOM   10437 H  HA   . LYS B 2 22  ? 30.135  63.644 -31.569 1.00 0.70  ? 22  LYS B HA   3  
ATOM   10438 H  HB2  . LYS B 2 22  ? 30.989  62.505 -29.218 1.00 1.08  ? 22  LYS B HB2  3  
ATOM   10439 H  HB3  . LYS B 2 22  ? 31.003  61.705 -30.780 1.00 1.05  ? 22  LYS B HB3  3  
ATOM   10440 H  HG2  . LYS B 2 22  ? 33.164  61.392 -30.118 1.00 1.70  ? 22  LYS B HG2  3  
ATOM   10441 H  HG3  . LYS B 2 22  ? 33.360  62.825 -31.055 1.00 1.60  ? 22  LYS B HG3  3  
ATOM   10442 H  HD2  . LYS B 2 22  ? 32.824  63.126 -28.126 1.00 1.70  ? 22  LYS B HD2  3  
ATOM   10443 H  HD3  . LYS B 2 22  ? 34.422  62.604 -28.614 1.00 1.71  ? 22  LYS B HD3  3  
ATOM   10444 H  HE2  . LYS B 2 22  ? 34.453  64.655 -30.171 1.00 1.04  ? 22  LYS B HE2  3  
ATOM   10445 H  HE3  . LYS B 2 22  ? 33.035  65.189 -29.316 1.00 1.06  ? 22  LYS B HE3  3  
ATOM   10446 H  HZ1  . LYS B 2 22  ? 35.186  64.321 -27.614 1.00 1.95  ? 22  LYS B HZ1  3  
ATOM   10447 H  HZ2  . LYS B 2 22  ? 34.203  65.702 -27.503 1.00 1.89  ? 22  LYS B HZ2  3  
ATOM   10448 H  HZ3  . LYS B 2 22  ? 35.544  65.692 -28.546 1.00 1.86  ? 22  LYS B HZ3  3  
ATOM   10449 N  N    . ILE B 2 23  ? 29.648  65.578 -30.364 1.00 0.51  ? 23  ILE B N    3  
ATOM   10450 C  CA   . ILE B 2 23  ? 28.884  66.617 -29.670 1.00 0.52  ? 23  ILE B CA   3  
ATOM   10451 C  C    . ILE B 2 23  ? 27.402  66.387 -30.011 1.00 0.52  ? 23  ILE B C    3  
ATOM   10452 O  O    . ILE B 2 23  ? 27.081  65.942 -31.095 1.00 0.60  ? 23  ILE B O    3  
ATOM   10453 C  CB   . ILE B 2 23  ? 29.283  67.970 -30.251 1.00 0.55  ? 23  ILE B CB   3  
ATOM   10454 C  CG1  . ILE B 2 23  ? 28.356  69.044 -29.721 1.00 0.69  ? 23  ILE B CG1  3  
ATOM   10455 C  CG2  . ILE B 2 23  ? 29.161  67.944 -31.769 1.00 0.54  ? 23  ILE B CG2  3  
ATOM   10456 C  CD1  . ILE B 2 23  ? 28.892  70.410 -30.126 1.00 0.50  ? 23  ILE B CD1  3  
ATOM   10457 H  H    . ILE B 2 23  ? 29.490  65.421 -31.255 1.00 0.51  ? 23  ILE B H    3  
ATOM   10458 H  HA   . ILE B 2 23  ? 29.052  66.587 -28.604 1.00 0.58  ? 23  ILE B HA   3  
ATOM   10459 H  HB   . ILE B 2 23  ? 30.299  68.201 -29.982 1.00 0.61  ? 23  ILE B HB   3  
ATOM   10460 H  HG12 . ILE B 2 23  ? 27.366  68.915 -30.136 1.00 1.03  ? 23  ILE B HG12 3  
ATOM   10461 H  HG13 . ILE B 2 23  ? 28.315  68.960 -28.661 1.00 1.06  ? 23  ILE B HG13 3  
ATOM   10462 H  HG21 . ILE B 2 23  ? 29.414  68.908 -32.138 1.00 1.13  ? 23  ILE B HG21 3  
ATOM   10463 H  HG22 . ILE B 2 23  ? 28.148  67.716 -32.059 1.00 1.20  ? 23  ILE B HG22 3  
ATOM   10464 H  HG23 . ILE B 2 23  ? 29.835  67.208 -32.179 1.00 1.14  ? 23  ILE B HG23 3  
ATOM   10465 H  HD11 . ILE B 2 23  ? 28.270  71.175 -29.722 1.00 1.16  ? 23  ILE B HD11 3  
ATOM   10466 H  HD12 . ILE B 2 23  ? 28.887  70.485 -31.200 1.00 1.16  ? 23  ILE B HD12 3  
ATOM   10467 H  HD13 . ILE B 2 23  ? 29.897  70.528 -29.762 1.00 1.14  ? 23  ILE B HD13 3  
ATOM   10468 N  N    . VAL B 2 24  ? 26.500  66.684 -29.119 1.00 0.48  ? 24  VAL B N    3  
ATOM   10469 C  CA   . VAL B 2 24  ? 25.052  66.499 -29.427 1.00 0.51  ? 24  VAL B CA   3  
ATOM   10470 C  C    . VAL B 2 24  ? 24.303  67.749 -28.970 1.00 0.62  ? 24  VAL B C    3  
ATOM   10471 O  O    . VAL B 2 24  ? 24.399  68.182 -27.840 1.00 1.38  ? 24  VAL B O    3  
ATOM   10472 C  CB   . VAL B 2 24  ? 24.519  65.252 -28.723 1.00 0.48  ? 24  VAL B CB   3  
ATOM   10473 C  CG1  . VAL B 2 24  ? 23.127  64.912 -29.259 1.00 0.49  ? 24  VAL B CG1  3  
ATOM   10474 C  CG2  . VAL B 2 24  ? 25.465  64.078 -28.987 1.00 0.48  ? 24  VAL B CG2  3  
ATOM   10475 H  H    . VAL B 2 24  ? 26.771  67.013 -28.244 1.00 0.47  ? 24  VAL B H    3  
ATOM   10476 H  HA   . VAL B 2 24  ? 24.912  66.391 -30.495 1.00 0.54  ? 24  VAL B HA   3  
ATOM   10477 H  HB   . VAL B 2 24  ? 24.461  65.435 -27.672 1.00 0.51  ? 24  VAL B HB   3  
ATOM   10478 H  HG11 . VAL B 2 24  ? 22.817  63.953 -28.871 1.00 0.99  ? 24  VAL B HG11 3  
ATOM   10479 H  HG12 . VAL B 2 24  ? 23.155  64.870 -30.338 1.00 1.08  ? 24  VAL B HG12 3  
ATOM   10480 H  HG13 . VAL B 2 24  ? 22.425  65.671 -28.947 1.00 1.21  ? 24  VAL B HG13 3  
ATOM   10481 H  HG21 . VAL B 2 24  ? 26.435  64.295 -28.565 1.00 1.12  ? 24  VAL B HG21 3  
ATOM   10482 H  HG22 . VAL B 2 24  ? 25.561  63.925 -30.052 1.00 1.06  ? 24  VAL B HG22 3  
ATOM   10483 H  HG23 . VAL B 2 24  ? 25.065  63.185 -28.530 1.00 1.17  ? 24  VAL B HG23 3  
ATOM   10484 N  N    . ASN B 2 25  ? 23.557  68.323 -29.866 1.00 0.61  ? 25  ASN B N    3  
ATOM   10485 C  CA   . ASN B 2 25  ? 22.770  69.552 -29.560 1.00 0.55  ? 25  ASN B CA   3  
ATOM   10486 C  C    . ASN B 2 25  ? 21.328  69.142 -29.278 1.00 0.56  ? 25  ASN B C    3  
ATOM   10487 O  O    . ASN B 2 25  ? 20.697  68.474 -30.073 1.00 0.66  ? 25  ASN B O    3  
ATOM   10488 C  CB   . ASN B 2 25  ? 22.819  70.498 -30.761 1.00 0.58  ? 25  ASN B CB   3  
ATOM   10489 C  CG   . ASN B 2 25  ? 22.158  71.830 -30.407 1.00 0.57  ? 25  ASN B CG   3  
ATOM   10490 O  OD1  . ASN B 2 25  ? 21.917  72.651 -31.270 1.00 0.63  ? 25  ASN B OD1  3  
ATOM   10491 N  ND2  . ASN B 2 25  ? 21.853  72.078 -29.168 1.00 0.52  ? 25  ASN B ND2  3  
ATOM   10492 H  H    . ASN B 2 25  ? 23.506  67.921 -30.745 1.00 1.20  ? 25  ASN B H    3  
ATOM   10493 H  HA   . ASN B 2 25  ? 23.183  70.044 -28.694 1.00 0.51  ? 25  ASN B HA   3  
ATOM   10494 H  HB2  . ASN B 2 25  ? 23.849  70.672 -31.035 1.00 0.60  ? 25  ASN B HB2  3  
ATOM   10495 H  HB3  . ASN B 2 25  ? 22.295  70.051 -31.587 1.00 0.63  ? 25  ASN B HB3  3  
ATOM   10496 H  HD21 . ASN B 2 25  ? 22.048  71.415 -28.480 1.00 0.50  ? 25  ASN B HD21 3  
ATOM   10497 H  HD22 . ASN B 2 25  ? 21.430  72.928 -28.927 1.00 0.54  ? 25  ASN B HD22 3  
ATOM   10498 N  N    . SER B 2 26  ? 20.793  69.551 -28.161 1.00 0.49  ? 26  SER B N    3  
ATOM   10499 C  CA   . SER B 2 26  ? 19.418  69.229 -27.813 1.00 0.52  ? 26  SER B CA   3  
ATOM   10500 C  C    . SER B 2 26  ? 18.835  70.488 -27.226 1.00 0.56  ? 26  SER B C    3  
ATOM   10501 O  O    . SER B 2 26  ? 19.105  70.836 -26.096 1.00 1.08  ? 26  SER B O    3  
ATOM   10502 C  CB   . SER B 2 26  ? 19.400  68.100 -26.783 1.00 0.54  ? 26  SER B CB   3  
ATOM   10503 O  OG   . SER B 2 26  ? 18.082  67.576 -26.683 1.00 0.92  ? 26  SER B OG   3  
ATOM   10504 H  H    . SER B 2 26  ? 21.280  70.120 -27.564 1.00 0.48  ? 26  SER B H    3  
ATOM   10505 H  HA   . SER B 2 26  ? 18.856  68.939 -28.692 1.00 0.55  ? 26  SER B HA   3  
ATOM   10506 H  HB2  . SER B 2 26  ? 20.071  67.317 -27.098 1.00 0.63  ? 26  SER B HB2  3  
ATOM   10507 H  HB3  . SER B 2 26  ? 19.723  68.482 -25.823 1.00 0.68  ? 26  SER B HB3  3  
ATOM   10508 H  HG   . SER B 2 26  ? 17.654  67.685 -27.535 1.00 1.29  ? 26  SER B HG   3  
ATOM   10509 N  N    . ASN B 2 27  ? 18.057  71.153 -28.001 1.00 0.66  ? 27  ASN B N    3  
ATOM   10510 C  CA   . ASN B 2 27  ? 17.381  72.415 -27.587 1.00 0.67  ? 27  ASN B CA   3  
ATOM   10511 C  C    . ASN B 2 27  ? 18.228  73.633 -27.948 1.00 0.70  ? 27  ASN B C    3  
ATOM   10512 O  O    . ASN B 2 27  ? 17.724  74.643 -28.398 1.00 0.78  ? 27  ASN B O    3  
ATOM   10513 C  CB   . ASN B 2 27  ? 17.046  72.390 -26.075 1.00 0.66  ? 27  ASN B CB   3  
ATOM   10514 C  CG   . ASN B 2 27  ? 18.126  73.098 -25.239 1.00 0.83  ? 27  ASN B CG   3  
ATOM   10515 O  OD1  . ASN B 2 27  ? 18.387  74.270 -25.424 1.00 1.65  ? 27  ASN B OD1  3  
ATOM   10516 N  ND2  . ASN B 2 27  ? 18.761  72.428 -24.316 1.00 1.17  ? 27  ASN B ND2  3  
ATOM   10517 H  H    . ASN B 2 27  ? 17.921  70.817 -28.891 1.00 1.09  ? 27  ASN B H    3  
ATOM   10518 H  HA   . ASN B 2 27  ? 16.471  72.473 -28.140 1.00 0.71  ? 27  ASN B HA   3  
ATOM   10519 H  HB2  . ASN B 2 27  ? 16.100  72.880 -25.910 1.00 0.81  ? 27  ASN B HB2  3  
ATOM   10520 H  HB3  . ASN B 2 27  ? 16.971  71.366 -25.753 1.00 0.71  ? 27  ASN B HB3  3  
ATOM   10521 H  HD21 . ASN B 2 27  ? 18.547  71.485 -24.162 1.00 1.83  ? 27  ASN B HD21 3  
ATOM   10522 H  HD22 . ASN B 2 27  ? 19.450  72.870 -23.776 1.00 1.26  ? 27  ASN B HD22 3  
ATOM   10523 N  N    . GLY B 2 28  ? 19.501  73.552 -27.741 1.00 0.68  ? 28  GLY B N    3  
ATOM   10524 C  CA   . GLY B 2 28  ? 20.381  74.705 -28.053 1.00 0.75  ? 28  GLY B CA   3  
ATOM   10525 C  C    . GLY B 2 28  ? 21.644  74.593 -27.212 1.00 0.75  ? 28  GLY B C    3  
ATOM   10526 O  O    . GLY B 2 28  ? 22.550  75.395 -27.327 1.00 0.86  ? 28  GLY B O    3  
ATOM   10527 H  H    . GLY B 2 28  ? 19.881  72.733 -27.371 1.00 0.63  ? 28  GLY B H    3  
ATOM   10528 H  HA2  . GLY B 2 28  ? 20.636  74.694 -29.104 1.00 0.88  ? 28  GLY B HA2  3  
ATOM   10529 H  HA3  . GLY B 2 28  ? 19.873  75.626 -27.812 1.00 0.75  ? 28  GLY B HA3  3  
ATOM   10530 N  N    . GLU B 2 29  ? 21.719  73.582 -26.377 1.00 0.69  ? 29  GLU B N    3  
ATOM   10531 C  CA   . GLU B 2 29  ? 22.916  73.378 -25.535 1.00 0.75  ? 29  GLU B CA   3  
ATOM   10532 C  C    . GLU B 2 29  ? 23.617  72.175 -26.142 1.00 0.84  ? 29  GLU B C    3  
ATOM   10533 O  O    . GLU B 2 29  ? 22.998  71.383 -26.818 1.00 1.78  ? 29  GLU B O    3  
ATOM   10534 C  CB   . GLU B 2 29  ? 22.474  73.141 -24.078 1.00 0.67  ? 29  GLU B CB   3  
ATOM   10535 C  CG   . GLU B 2 29  ? 22.461  74.465 -23.301 1.00 0.73  ? 29  GLU B CG   3  
ATOM   10536 C  CD   . GLU B 2 29  ? 22.371  74.182 -21.800 1.00 1.58  ? 29  GLU B CD   3  
ATOM   10537 O  OE1  . GLU B 2 29  ? 21.556  73.357 -21.421 1.00 2.22  ? 29  GLU B OE1  3  
ATOM   10538 O  OE2  . GLU B 2 29  ? 23.117  74.797 -21.056 1.00 2.32  ? 29  GLU B OE2  3  
ATOM   10539 H  H    . GLU B 2 29  ? 20.985  72.934 -26.317 1.00 0.67  ? 29  GLU B H    3  
ATOM   10540 H  HA   . GLU B 2 29  ? 23.575  74.235 -25.601 1.00 0.86  ? 29  GLU B HA   3  
ATOM   10541 H  HB2  . GLU B 2 29  ? 21.474  72.739 -24.070 1.00 0.69  ? 29  GLU B HB2  3  
ATOM   10542 H  HB3  . GLU B 2 29  ? 23.148  72.451 -23.605 1.00 0.81  ? 29  GLU B HB3  3  
ATOM   10543 H  HG2  . GLU B 2 29  ? 23.360  75.016 -23.509 1.00 1.03  ? 29  GLU B HG2  3  
ATOM   10544 H  HG3  . GLU B 2 29  ? 21.605  75.049 -23.604 1.00 1.10  ? 29  GLU B HG3  3  
ATOM   10545 N  N    . LEU B 2 30  ? 24.894  72.040 -25.962 1.00 0.55  ? 30  LEU B N    3  
ATOM   10546 C  CA   . LEU B 2 30  ? 25.643  70.923 -26.571 1.00 0.48  ? 30  LEU B CA   3  
ATOM   10547 C  C    . LEU B 2 30  ? 25.906  69.849 -25.519 1.00 0.48  ? 30  LEU B C    3  
ATOM   10548 O  O    . LEU B 2 30  ? 26.231  70.144 -24.390 1.00 0.63  ? 30  LEU B O    3  
ATOM   10549 C  CB   . LEU B 2 30  ? 26.956  71.500 -27.113 1.00 0.51  ? 30  LEU B CB   3  
ATOM   10550 C  CG   . LEU B 2 30  ? 26.684  72.644 -28.120 1.00 0.51  ? 30  LEU B CG   3  
ATOM   10551 C  CD1  . LEU B 2 30  ? 25.739  72.150 -29.229 1.00 0.48  ? 30  LEU B CD1  3  
ATOM   10552 C  CD2  . LEU B 2 30  ? 26.082  73.883 -27.417 1.00 0.58  ? 30  LEU B CD2  3  
ATOM   10553 H  H    . LEU B 2 30  ? 25.409  72.647 -25.422 1.00 1.21  ? 30  LEU B H    3  
ATOM   10554 H  HA   . LEU B 2 30  ? 25.078  70.484 -27.383 1.00 0.45  ? 30  LEU B HA   3  
ATOM   10555 H  HB2  . LEU B 2 30  ? 27.555  71.878 -26.296 1.00 0.57  ? 30  LEU B HB2  3  
ATOM   10556 H  HB3  . LEU B 2 30  ? 27.484  70.723 -27.613 1.00 0.50  ? 30  LEU B HB3  3  
ATOM   10557 H  HG   . LEU B 2 30  ? 27.620  72.936 -28.571 1.00 0.53  ? 30  LEU B HG   3  
ATOM   10558 H  HD11 . LEU B 2 30  ? 25.954  71.111 -29.457 1.00 1.13  ? 30  LEU B HD11 3  
ATOM   10559 H  HD12 . LEU B 2 30  ? 25.883  72.749 -30.116 1.00 1.16  ? 30  LEU B HD12 3  
ATOM   10560 H  HD13 . LEU B 2 30  ? 24.715  72.240 -28.898 1.00 1.05  ? 30  LEU B HD13 3  
ATOM   10561 H  HD21 . LEU B 2 30  ? 26.367  73.890 -26.374 1.00 1.09  ? 30  LEU B HD21 3  
ATOM   10562 H  HD22 . LEU B 2 30  ? 25.006  73.872 -27.497 1.00 1.27  ? 30  LEU B HD22 3  
ATOM   10563 H  HD23 . LEU B 2 30  ? 26.461  74.776 -27.891 1.00 1.18  ? 30  LEU B HD23 3  
ATOM   10564 N  N    . TYR B 2 31  ? 25.747  68.606 -25.877 1.00 0.40  ? 31  TYR B N    3  
ATOM   10565 C  CA   . TYR B 2 31  ? 25.950  67.501 -24.913 1.00 0.40  ? 31  TYR B CA   3  
ATOM   10566 C  C    . TYR B 2 31  ? 26.680  66.337 -25.593 1.00 0.40  ? 31  TYR B C    3  
ATOM   10567 O  O    . TYR B 2 31  ? 26.343  65.929 -26.676 1.00 0.43  ? 31  TYR B O    3  
ATOM   10568 C  CB   . TYR B 2 31  ? 24.575  67.017 -24.527 1.00 0.41  ? 31  TYR B CB   3  
ATOM   10569 C  CG   . TYR B 2 31  ? 23.767  68.118 -23.925 1.00 0.44  ? 31  TYR B CG   3  
ATOM   10570 C  CD1  . TYR B 2 31  ? 23.151  69.051 -24.756 1.00 0.49  ? 31  TYR B CD1  3  
ATOM   10571 C  CD2  . TYR B 2 31  ? 23.585  68.169 -22.547 1.00 0.47  ? 31  TYR B CD2  3  
ATOM   10572 C  CE1  . TYR B 2 31  ? 22.346  70.040 -24.211 1.00 0.55  ? 31  TYR B CE1  3  
ATOM   10573 C  CE2  . TYR B 2 31  ? 22.785  69.173 -21.988 1.00 0.52  ? 31  TYR B CE2  3  
ATOM   10574 C  CZ   . TYR B 2 31  ? 22.160  70.109 -22.824 1.00 0.56  ? 31  TYR B CZ   3  
ATOM   10575 O  OH   . TYR B 2 31  ? 21.359  71.094 -22.282 1.00 0.63  ? 31  TYR B OH   3  
ATOM   10576 H  H    . TYR B 2 31  ? 25.467  68.393 -26.779 1.00 0.44  ? 31  TYR B H    3  
ATOM   10577 H  HA   . TYR B 2 31  ? 26.489  67.833 -24.037 1.00 0.41  ? 31  TYR B HA   3  
ATOM   10578 H  HB2  . TYR B 2 31  ? 24.091  66.701 -25.415 1.00 0.42  ? 31  TYR B HB2  3  
ATOM   10579 H  HB3  . TYR B 2 31  ? 24.635  66.197 -23.841 1.00 0.42  ? 31  TYR B HB3  3  
ATOM   10580 H  HD1  . TYR B 2 31  ? 23.310  69.017 -25.823 1.00 0.49  ? 31  TYR B HD1  3  
ATOM   10581 H  HD2  . TYR B 2 31  ? 24.082  67.445 -21.917 1.00 0.46  ? 31  TYR B HD2  3  
ATOM   10582 H  HE1  . TYR B 2 31  ? 21.868  70.744 -24.862 1.00 0.60  ? 31  TYR B HE1  3  
ATOM   10583 H  HE2  . TYR B 2 31  ? 22.645  69.222 -20.918 1.00 0.56  ? 31  TYR B HE2  3  
ATOM   10584 H  HH   . TYR B 2 31  ? 21.773  71.942 -22.458 1.00 1.00  ? 31  TYR B HH   3  
ATOM   10585 N  N    . HIS B 2 32  ? 27.664  65.791 -24.960 1.00 0.40  ? 32  HIS B N    3  
ATOM   10586 C  CA   . HIS B 2 32  ? 28.355  64.652 -25.576 1.00 0.42  ? 32  HIS B CA   3  
ATOM   10587 C  C    . HIS B 2 32  ? 27.312  63.571 -25.600 1.00 0.43  ? 32  HIS B C    3  
ATOM   10588 O  O    . HIS B 2 32  ? 26.546  63.469 -24.675 1.00 0.46  ? 32  HIS B O    3  
ATOM   10589 C  CB   . HIS B 2 32  ? 29.503  64.142 -24.684 1.00 0.43  ? 32  HIS B CB   3  
ATOM   10590 C  CG   . HIS B 2 32  ? 30.743  64.953 -24.842 1.00 0.45  ? 32  HIS B CG   3  
ATOM   10591 N  ND1  . HIS B 2 32  ? 31.197  65.790 -23.850 1.00 0.46  ? 32  HIS B ND1  3  
ATOM   10592 C  CD2  . HIS B 2 32  ? 31.648  65.038 -25.858 1.00 0.48  ? 32  HIS B CD2  3  
ATOM   10593 C  CE1  . HIS B 2 32  ? 32.340  66.360 -24.306 1.00 0.50  ? 32  HIS B CE1  3  
ATOM   10594 N  NE2  . HIS B 2 32  ? 32.653  65.928 -25.522 1.00 0.51  ? 32  HIS B NE2  3  
ATOM   10595 H  H    . HIS B 2 32  ? 27.890  66.151 -24.093 1.00 0.41  ? 32  HIS B H    3  
ATOM   10596 H  HA   . HIS B 2 32  ? 28.709  64.888 -26.579 1.00 0.43  ? 32  HIS B HA   3  
ATOM   10597 H  HB2  . HIS B 2 32  ? 29.192  64.183 -23.659 1.00 0.43  ? 32  HIS B HB2  3  
ATOM   10598 H  HB3  . HIS B 2 32  ? 29.730  63.121 -24.946 1.00 0.45  ? 32  HIS B HB3  3  
ATOM   10599 H  HD2  . HIS B 2 32  ? 31.615  64.458 -26.750 1.00 0.49  ? 32  HIS B HD2  3  
ATOM   10600 H  HE1  . HIS B 2 32  ? 32.895  67.115 -23.780 1.00 0.53  ? 32  HIS B HE1  3  
ATOM   10601 H  HE2  . HIS B 2 32  ? 33.431  66.189 -26.058 1.00 0.55  ? 32  HIS B HE2  3  
ATOM   10602 N  N    . GLU B 2 33  ? 27.296  62.687 -26.529 1.00 0.43  ? 33  GLU B N    3  
ATOM   10603 C  CA   . GLU B 2 33  ? 26.332  61.570 -26.352 1.00 0.46  ? 33  GLU B CA   3  
ATOM   10604 C  C    . GLU B 2 33  ? 26.726  60.923 -24.989 1.00 0.49  ? 33  GLU B C    3  
ATOM   10605 O  O    . GLU B 2 33  ? 26.093  60.016 -24.488 1.00 0.55  ? 33  GLU B O    3  
ATOM   10606 C  CB   . GLU B 2 33  ? 26.485  60.554 -27.487 1.00 0.51  ? 33  GLU B CB   3  
ATOM   10607 C  CG   . GLU B 2 33  ? 27.968  60.246 -27.699 1.00 0.56  ? 33  GLU B CG   3  
ATOM   10608 C  CD   . GLU B 2 33  ? 28.116  59.171 -28.776 1.00 0.66  ? 33  GLU B CD   3  
ATOM   10609 O  OE1  . GLU B 2 33  ? 27.334  58.235 -28.763 1.00 1.33  ? 33  GLU B OE1  3  
ATOM   10610 O  OE2  . GLU B 2 33  ? 29.009  59.303 -29.597 1.00 1.24  ? 33  GLU B OE2  3  
ATOM   10611 H  H    . GLU B 2 33  ? 27.950  62.696 -27.253 1.00 0.43  ? 33  GLU B H    3  
ATOM   10612 H  HA   . GLU B 2 33  ? 25.320  61.951 -26.310 1.00 0.45  ? 33  GLU B HA   3  
ATOM   10613 H  HB2  . GLU B 2 33  ? 25.961  59.645 -27.229 1.00 0.63  ? 33  GLU B HB2  3  
ATOM   10614 H  HB3  . GLU B 2 33  ? 26.071  60.963 -28.396 1.00 0.56  ? 33  GLU B HB3  3  
ATOM   10615 H  HG2  . GLU B 2 33  ? 28.481  61.144 -28.011 1.00 0.61  ? 33  GLU B HG2  3  
ATOM   10616 H  HG3  . GLU B 2 33  ? 28.397  59.889 -26.775 1.00 0.62  ? 33  GLU B HG3  3  
ATOM   10617 N  N    . GLN B 2 34  ? 27.782  61.467 -24.382 1.00 0.48  ? 34  GLN B N    3  
ATOM   10618 C  CA   . GLN B 2 34  ? 28.263  61.025 -23.042 1.00 0.53  ? 34  GLN B CA   3  
ATOM   10619 C  C    . GLN B 2 34  ? 27.523  61.829 -22.003 1.00 0.53  ? 34  GLN B C    3  
ATOM   10620 O  O    . GLN B 2 34  ? 27.562  61.559 -20.819 1.00 0.59  ? 34  GLN B O    3  
ATOM   10621 C  CB   . GLN B 2 34  ? 29.781  61.198 -22.891 1.00 0.58  ? 34  GLN B CB   3  
ATOM   10622 C  CG   . GLN B 2 34  ? 30.495  60.542 -24.079 1.00 1.14  ? 34  GLN B CG   3  
ATOM   10623 C  CD   . GLN B 2 34  ? 30.427  59.021 -23.937 1.00 2.23  ? 34  GLN B CD   3  
ATOM   10624 O  OE1  . GLN B 2 34  ? 31.343  58.404 -23.432 1.00 2.85  ? 34  GLN B OE1  3  
ATOM   10625 N  NE2  . GLN B 2 34  ? 29.371  58.387 -24.367 1.00 2.84  ? 34  GLN B NE2  3  
ATOM   10626 H  H    . GLN B 2 34  ? 28.180  62.283 -24.779 1.00 0.45  ? 34  GLN B H    3  
ATOM   10627 H  HA   . GLN B 2 34  ? 28.013  59.984 -22.917 1.00 0.55  ? 34  GLN B HA   3  
ATOM   10628 H  HB2  . GLN B 2 34  ? 30.031  62.242 -22.844 1.00 1.14  ? 34  GLN B HB2  3  
ATOM   10629 H  HB3  . GLN B 2 34  ? 30.102  60.717 -21.980 1.00 1.13  ? 34  GLN B HB3  3  
ATOM   10630 H  HG2  . GLN B 2 34  ? 30.014  60.836 -25.000 1.00 1.62  ? 34  GLN B HG2  3  
ATOM   10631 H  HG3  . GLN B 2 34  ? 31.528  60.854 -24.096 1.00 1.69  ? 34  GLN B HG3  3  
ATOM   10632 H  HE21 . GLN B 2 34  ? 28.633  58.886 -24.775 1.00 2.47  ? 34  GLN B HE21 3  
ATOM   10633 H  HE22 . GLN B 2 34  ? 29.316  57.414 -24.282 1.00 3.77  ? 34  GLN B HE22 3  
ATOM   10634 N  N    . CYS B 2 35  ? 26.873  62.860 -22.466 1.00 0.50  ? 35  CYS B N    3  
ATOM   10635 C  CA   . CYS B 2 35  ? 26.142  63.765 -21.607 1.00 0.53  ? 35  CYS B CA   3  
ATOM   10636 C  C    . CYS B 2 35  ? 24.704  63.304 -21.742 1.00 0.53  ? 35  CYS B C    3  
ATOM   10637 O  O    . CYS B 2 35  ? 23.829  63.616 -20.960 1.00 0.58  ? 35  CYS B O    3  
ATOM   10638 C  CB   . CYS B 2 35  ? 26.421  65.128 -22.171 1.00 0.58  ? 35  CYS B CB   3  
ATOM   10639 S  SG   . CYS B 2 35  ? 28.104  65.599 -21.707 1.00 0.64  ? 35  CYS B SG   3  
ATOM   10640 H  H    . CYS B 2 35  ? 26.882  63.071 -23.426 1.00 0.47  ? 35  CYS B H    3  
ATOM   10641 H  HA   . CYS B 2 35  ? 26.484  63.697 -20.589 1.00 0.56  ? 35  CYS B HA   3  
ATOM   10642 H  HB2  . CYS B 2 35  ? 26.366  65.068 -23.235 1.00 0.65  ? 35  CYS B HB2  3  
ATOM   10643 H  HB3  . CYS B 2 35  ? 25.724  65.834 -21.802 1.00 0.56  ? 35  CYS B HB3  3  
ATOM   10644 N  N    . PHE B 2 36  ? 24.530  62.426 -22.697 1.00 0.51  ? 36  PHE B N    3  
ATOM   10645 C  CA   . PHE B 2 36  ? 23.207  61.745 -22.884 1.00 0.53  ? 36  PHE B CA   3  
ATOM   10646 C  C    . PHE B 2 36  ? 23.248  60.579 -21.914 1.00 0.54  ? 36  PHE B C    3  
ATOM   10647 O  O    . PHE B 2 36  ? 23.543  59.444 -22.255 1.00 0.66  ? 36  PHE B O    3  
ATOM   10648 C  CB   . PHE B 2 36  ? 23.048  61.144 -24.294 1.00 0.51  ? 36  PHE B CB   3  
ATOM   10649 C  CG   . PHE B 2 36  ? 22.417  62.149 -25.177 1.00 0.52  ? 36  PHE B CG   3  
ATOM   10650 C  CD1  . PHE B 2 36  ? 23.003  63.388 -25.250 1.00 0.49  ? 36  PHE B CD1  3  
ATOM   10651 C  CD2  . PHE B 2 36  ? 21.250  61.856 -25.896 1.00 0.60  ? 36  PHE B CD2  3  
ATOM   10652 C  CE1  . PHE B 2 36  ? 22.428  64.366 -26.052 1.00 0.51  ? 36  PHE B CE1  3  
ATOM   10653 C  CE2  . PHE B 2 36  ? 20.673  62.835 -26.705 1.00 0.63  ? 36  PHE B CE2  3  
ATOM   10654 C  CZ   . PHE B 2 36  ? 21.264  64.096 -26.783 1.00 0.56  ? 36  PHE B CZ   3  
ATOM   10655 H  H    . PHE B 2 36  ? 25.308  62.201 -23.269 1.00 0.51  ? 36  PHE B H    3  
ATOM   10656 H  HA   . PHE B 2 36  ? 22.390  62.412 -22.640 1.00 0.56  ? 36  PHE B HA   3  
ATOM   10657 H  HB2  . PHE B 2 36  ? 24.012  60.885 -24.687 1.00 0.50  ? 36  PHE B HB2  3  
ATOM   10658 H  HB3  . PHE B 2 36  ? 22.425  60.258 -24.254 1.00 0.54  ? 36  PHE B HB3  3  
ATOM   10659 H  HD1  . PHE B 2 36  ? 23.920  63.586 -24.678 1.00 0.50  ? 36  PHE B HD1  3  
ATOM   10660 H  HD2  . PHE B 2 36  ? 20.802  60.876 -25.828 1.00 0.67  ? 36  PHE B HD2  3  
ATOM   10661 H  HE1  . PHE B 2 36  ? 22.872  65.318 -26.108 1.00 0.53  ? 36  PHE B HE1  3  
ATOM   10662 H  HE2  . PHE B 2 36  ? 19.775  62.619 -27.266 1.00 0.72  ? 36  PHE B HE2  3  
ATOM   10663 H  HZ   . PHE B 2 36  ? 20.824  64.863 -27.404 1.00 0.59  ? 36  PHE B HZ   3  
ATOM   10664 N  N    . VAL B 2 37  ? 22.942  60.888 -20.701 1.00 0.48  ? 37  VAL B N    3  
ATOM   10665 C  CA   . VAL B 2 37  ? 22.957  59.861 -19.610 1.00 0.51  ? 37  VAL B CA   3  
ATOM   10666 C  C    . VAL B 2 37  ? 21.788  60.089 -18.641 1.00 0.49  ? 37  VAL B C    3  
ATOM   10667 O  O    . VAL B 2 37  ? 21.532  61.188 -18.189 1.00 0.48  ? 37  VAL B O    3  
ATOM   10668 C  CB   . VAL B 2 37  ? 24.293  59.964 -18.867 1.00 0.55  ? 37  VAL B CB   3  
ATOM   10669 C  CG1  . VAL B 2 37  ? 25.416  60.162 -19.884 1.00 0.58  ? 37  VAL B CG1  3  
ATOM   10670 C  CG2  . VAL B 2 37  ? 24.278  61.154 -17.897 1.00 0.55  ? 37  VAL B CG2  3  
ATOM   10671 H  H    . VAL B 2 37  ? 22.696  61.819 -20.519 1.00 0.49  ? 37  VAL B H    3  
ATOM   10672 H  HA   . VAL B 2 37  ? 22.868  58.873 -20.040 1.00 0.53  ? 37  VAL B HA   3  
ATOM   10673 H  HB   . VAL B 2 37  ? 24.465  59.055 -18.324 1.00 0.57  ? 37  VAL B HB   3  
ATOM   10674 H  HG11 . VAL B 2 37  ? 25.358  59.392 -20.639 1.00 1.18  ? 37  VAL B HG11 3  
ATOM   10675 H  HG12 . VAL B 2 37  ? 26.371  60.105 -19.383 1.00 1.10  ? 37  VAL B HG12 3  
ATOM   10676 H  HG13 . VAL B 2 37  ? 25.310  61.131 -20.349 1.00 1.20  ? 37  VAL B HG13 3  
ATOM   10677 H  HG21 . VAL B 2 37  ? 23.867  62.019 -18.395 1.00 1.17  ? 37  VAL B HG21 3  
ATOM   10678 H  HG22 . VAL B 2 37  ? 25.285  61.368 -17.573 1.00 1.13  ? 37  VAL B HG22 3  
ATOM   10679 H  HG23 . VAL B 2 37  ? 23.668  60.909 -17.039 1.00 1.15  ? 37  VAL B HG23 3  
ATOM   10680 N  N    . CYS B 2 38  ? 21.097  59.024 -18.306 1.00 0.51  ? 38  CYS B N    3  
ATOM   10681 C  CA   . CYS B 2 38  ? 19.955  59.094 -17.350 1.00 0.51  ? 38  CYS B CA   3  
ATOM   10682 C  C    . CYS B 2 38  ? 20.435  59.322 -15.923 1.00 0.55  ? 38  CYS B C    3  
ATOM   10683 O  O    . CYS B 2 38  ? 21.359  58.687 -15.503 1.00 0.64  ? 38  CYS B O    3  
ATOM   10684 C  CB   . CYS B 2 38  ? 19.205  57.797 -17.478 1.00 0.52  ? 38  CYS B CB   3  
ATOM   10685 S  SG   . CYS B 2 38  ? 17.737  58.039 -18.483 1.00 0.55  ? 38  CYS B SG   3  
ATOM   10686 H  H    . CYS B 2 38  ? 21.386  58.120 -18.632 1.00 0.54  ? 38  CYS B H    3  
ATOM   10687 H  HA   . CYS B 2 38  ? 19.315  59.913 -17.630 1.00 0.51  ? 38  CYS B HA   3  
ATOM   10688 H  HB2  . CYS B 2 38  ? 19.848  57.103 -17.970 1.00 0.55  ? 38  CYS B HB2  3  
ATOM   10689 H  HB3  . CYS B 2 38  ? 18.928  57.421 -16.514 1.00 0.57  ? 38  CYS B HB3  3  
ATOM   10690 N  N    . ALA B 2 39  ? 19.768  60.148 -15.160 1.00 0.55  ? 39  ALA B N    3  
ATOM   10691 C  CA   . ALA B 2 39  ? 20.195  60.380 -13.736 1.00 0.60  ? 39  ALA B CA   3  
ATOM   10692 C  C    . ALA B 2 39  ? 20.138  59.069 -12.926 1.00 0.63  ? 39  ALA B C    3  
ATOM   10693 O  O    . ALA B 2 39  ? 20.866  58.870 -11.980 1.00 0.71  ? 39  ALA B O    3  
ATOM   10694 C  CB   . ALA B 2 39  ? 19.246  61.383 -13.087 1.00 0.63  ? 39  ALA B CB   3  
ATOM   10695 H  H    . ALA B 2 39  ? 18.972  60.596 -15.516 1.00 0.57  ? 39  ALA B H    3  
ATOM   10696 H  HA   . ALA B 2 39  ? 21.190  60.790 -13.722 1.00 0.66  ? 39  ALA B HA   3  
ATOM   10697 H  HB1  . ALA B 2 39  ? 18.236  61.170 -13.398 1.00 1.29  ? 39  ALA B HB1  3  
ATOM   10698 H  HB2  . ALA B 2 39  ? 19.516  62.380 -13.389 1.00 1.19  ? 39  ALA B HB2  3  
ATOM   10699 H  HB3  . ALA B 2 39  ? 19.317  61.305 -12.012 1.00 1.14  ? 39  ALA B HB3  3  
ATOM   10700 N  N    . GLN B 2 40  ? 19.272  58.186 -13.296 1.00 0.62  ? 40  GLN B N    3  
ATOM   10701 C  CA   . GLN B 2 40  ? 19.145  56.865 -12.594 1.00 0.71  ? 40  GLN B CA   3  
ATOM   10702 C  C    . GLN B 2 40  ? 19.891  55.849 -13.436 1.00 0.68  ? 40  GLN B C    3  
ATOM   10703 O  O    . GLN B 2 40  ? 20.569  54.946 -12.988 1.00 0.76  ? 40  GLN B O    3  
ATOM   10704 C  CB   . GLN B 2 40  ? 17.670  56.471 -12.491 1.00 0.84  ? 40  GLN B CB   3  
ATOM   10705 C  CG   . GLN B 2 40  ? 17.013  57.267 -11.365 1.00 1.12  ? 40  GLN B CG   3  
ATOM   10706 C  CD   . GLN B 2 40  ? 15.545  56.855 -11.231 1.00 1.82  ? 40  GLN B CD   3  
ATOM   10707 O  OE1  . GLN B 2 40  ? 15.059  56.645 -10.137 1.00 2.40  ? 40  GLN B OE1  3  
ATOM   10708 N  NE2  . GLN B 2 40  ? 14.814  56.730 -12.304 1.00 2.54  ? 40  GLN B NE2  3  
ATOM   10709 H  H    . GLN B 2 40  ? 18.707  58.372 -14.079 1.00 0.60  ? 40  GLN B H    3  
ATOM   10710 H  HA   . GLN B 2 40  ? 19.586  56.921 -11.610 1.00 0.82  ? 40  GLN B HA   3  
ATOM   10711 H  HB2  . GLN B 2 40  ? 17.173  56.688 -13.426 1.00 1.38  ? 40  GLN B HB2  3  
ATOM   10712 H  HB3  . GLN B 2 40  ? 17.592  55.416 -12.277 1.00 1.26  ? 40  GLN B HB3  3  
ATOM   10713 H  HG2  . GLN B 2 40  ? 17.530  57.068 -10.439 1.00 1.58  ? 40  GLN B HG2  3  
ATOM   10714 H  HG3  . GLN B 2 40  ? 17.071  58.321 -11.588 1.00 1.61  ? 40  GLN B HG3  3  
ATOM   10715 H  HE21 . GLN B 2 40  ? 15.206  56.899 -13.187 1.00 2.67  ? 40  GLN B HE21 3  
ATOM   10716 H  HE22 . GLN B 2 40  ? 13.873  56.467 -12.228 1.00 3.25  ? 40  GLN B HE22 3  
ATOM   10717 N  N    . CYS B 2 41  ? 19.658  56.033 -14.683 1.00 0.64  ? 41  CYS B N    3  
ATOM   10718 C  CA   . CYS B 2 41  ? 20.146  55.220 -15.805 1.00 0.71  ? 41  CYS B CA   3  
ATOM   10719 C  C    . CYS B 2 41  ? 21.397  55.868 -16.425 1.00 0.67  ? 41  CYS B C    3  
ATOM   10720 O  O    . CYS B 2 41  ? 21.726  55.523 -17.531 1.00 0.77  ? 41  CYS B O    3  
ATOM   10721 C  CB   . CYS B 2 41  ? 19.021  54.818 -16.803 1.00 0.79  ? 41  CYS B CB   3  
ATOM   10722 S  SG   . CYS B 2 41  ? 17.412  55.295 -16.129 1.00 0.67  ? 41  CYS B SG   3  
ATOM   10723 H  H    . CYS B 2 41  ? 19.072  56.779 -14.913 1.00 0.63  ? 41  CYS B H    3  
ATOM   10724 H  HA   . CYS B 2 41  ? 20.508  54.296 -15.357 1.00 0.77  ? 41  CYS B HA   3  
ATOM   10725 H  HB2  . CYS B 2 41  ? 19.168  55.259 -17.760 1.00 0.96  ? 41  CYS B HB2  3  
ATOM   10726 H  HB3  . CYS B 2 41  ? 19.029  53.741 -16.930 1.00 0.99  ? 41  CYS B HB3  3  
ATOM   10727 N  N    . PHE B 2 42  ? 21.994  56.936 -15.788 1.00 0.60  ? 42  PHE B N    3  
ATOM   10728 C  CA   . PHE B 2 42  ? 23.166  57.828 -16.321 1.00 0.60  ? 42  PHE B CA   3  
ATOM   10729 C  C    . PHE B 2 42  ? 24.192  56.995 -16.880 1.00 0.64  ? 42  PHE B C    3  
ATOM   10730 O  O    . PHE B 2 42  ? 25.333  57.335 -17.144 1.00 0.72  ? 42  PHE B O    3  
ATOM   10731 C  CB   . PHE B 2 42  ? 23.881  58.625 -15.224 1.00 0.67  ? 42  PHE B CB   3  
ATOM   10732 C  CG   . PHE B 2 42  ? 23.834  57.872 -13.904 1.00 1.00  ? 42  PHE B CG   3  
ATOM   10733 C  CD1  . PHE B 2 42  ? 24.365  56.584 -13.781 1.00 1.19  ? 42  PHE B CD1  3  
ATOM   10734 C  CD2  . PHE B 2 42  ? 23.269  58.482 -12.803 1.00 1.93  ? 42  PHE B CD2  3  
ATOM   10735 C  CE1  . PHE B 2 42  ? 24.320  55.916 -12.551 1.00 1.79  ? 42  PHE B CE1  3  
ATOM   10736 C  CE2  . PHE B 2 42  ? 23.220  57.826 -11.566 1.00 2.70  ? 42  PHE B CE2  3  
ATOM   10737 C  CZ   . PHE B 2 42  ? 23.747  56.539 -11.441 1.00 2.52  ? 42  PHE B CZ   3  
ATOM   10738 H  H    . PHE B 2 42  ? 21.569  57.250 -15.003 1.00 0.58  ? 42  PHE B H    3  
ATOM   10739 H  HA   . PHE B 2 42  ? 22.819  58.482 -17.066 1.00 0.56  ? 42  PHE B HA   3  
ATOM   10740 H  HB2  . PHE B 2 42  ? 24.921  58.765 -15.526 1.00 0.97  ? 42  PHE B HB2  3  
ATOM   10741 H  HB3  . PHE B 2 42  ? 23.417  59.595 -15.118 1.00 1.05  ? 42  PHE B HB3  3  
ATOM   10742 H  HD1  . PHE B 2 42  ? 24.801  56.106 -14.625 1.00 1.44  ? 42  PHE B HD1  3  
ATOM   10743 H  HD2  . PHE B 2 42  ? 22.863  59.458 -12.914 1.00 2.23  ? 42  PHE B HD2  3  
ATOM   10744 H  HE1  . PHE B 2 42  ? 24.729  54.921 -12.461 1.00 2.01  ? 42  PHE B HE1  3  
ATOM   10745 H  HE2  . PHE B 2 42  ? 22.775  58.315 -10.711 1.00 3.53  ? 42  PHE B HE2  3  
ATOM   10746 H  HZ   . PHE B 2 42  ? 23.712  56.029 -10.489 1.00 3.15  ? 42  PHE B HZ   3  
ATOM   10747 N  N    . GLN B 2 43  ? 23.657  56.021 -17.282 1.00 0.63  ? 43  GLN B N    3  
ATOM   10748 C  CA   . GLN B 2 43  ? 24.380  55.144 -18.138 1.00 0.71  ? 43  GLN B CA   3  
ATOM   10749 C  C    . GLN B 2 43  ? 23.807  55.699 -19.414 1.00 0.70  ? 43  GLN B C    3  
ATOM   10750 O  O    . GLN B 2 43  ? 22.721  56.267 -19.450 1.00 0.86  ? 43  GLN B O    3  
ATOM   10751 C  CB   . GLN B 2 43  ? 23.973  53.676 -17.940 1.00 0.75  ? 43  GLN B CB   3  
ATOM   10752 C  CG   . GLN B 2 43  ? 24.500  53.178 -16.592 1.00 1.44  ? 43  GLN B CG   3  
ATOM   10753 C  CD   . GLN B 2 43  ? 24.445  51.649 -16.553 1.00 2.08  ? 43  GLN B CD   3  
ATOM   10754 O  OE1  . GLN B 2 43  ? 24.085  51.068 -15.548 1.00 2.80  ? 43  GLN B OE1  3  
ATOM   10755 N  NE2  . GLN B 2 43  ? 24.791  50.968 -17.611 1.00 2.62  ? 43  GLN B NE2  3  
ATOM   10756 H  H    . GLN B 2 43  ? 22.672  56.016 -17.209 1.00 0.61  ? 43  GLN B H    3  
ATOM   10757 H  HA   . GLN B 2 43  ? 25.461  55.278 -18.093 1.00 0.78  ? 43  GLN B HA   3  
ATOM   10758 H  HB2  . GLN B 2 43  ? 22.899  53.587 -17.963 1.00 1.21  ? 43  GLN B HB2  3  
ATOM   10759 H  HB3  . GLN B 2 43  ? 24.399  53.078 -18.731 1.00 1.13  ? 43  GLN B HB3  3  
ATOM   10760 H  HG2  . GLN B 2 43  ? 25.522  53.504 -16.462 1.00 2.07  ? 43  GLN B HG2  3  
ATOM   10761 H  HG3  . GLN B 2 43  ? 23.889  53.578 -15.797 1.00 2.01  ? 43  GLN B HG3  3  
ATOM   10762 H  HE21 . GLN B 2 43  ? 25.083  51.436 -18.421 1.00 2.58  ? 43  GLN B HE21 3  
ATOM   10763 H  HE22 . GLN B 2 43  ? 24.758  49.990 -17.597 1.00 3.43  ? 43  GLN B HE22 3  
ATOM   10764 N  N    . GLN B 2 44  ? 24.539  55.658 -20.394 1.00 0.63  ? 44  GLN B N    3  
ATOM   10765 C  CA   . GLN B 2 44  ? 24.098  56.286 -21.645 1.00 0.64  ? 44  GLN B CA   3  
ATOM   10766 C  C    . GLN B 2 44  ? 22.806  55.641 -22.142 1.00 0.65  ? 44  GLN B C    3  
ATOM   10767 O  O    . GLN B 2 44  ? 22.600  54.447 -22.055 1.00 0.80  ? 44  GLN B O    3  
ATOM   10768 C  CB   . GLN B 2 44  ? 25.211  56.141 -22.704 1.00 0.72  ? 44  GLN B CB   3  
ATOM   10769 C  CG   . GLN B 2 44  ? 26.581  56.045 -22.016 1.00 1.12  ? 44  GLN B CG   3  
ATOM   10770 C  CD   . GLN B 2 44  ? 26.753  57.190 -21.014 1.00 1.75  ? 44  GLN B CD   3  
ATOM   10771 O  OE1  . GLN B 2 44  ? 26.349  57.092 -19.873 1.00 2.36  ? 44  GLN B OE1  3  
ATOM   10772 N  NE2  . GLN B 2 44  ? 27.358  58.276 -21.393 1.00 2.21  ? 44  GLN B NE2  3  
ATOM   10773 H  H    . GLN B 2 44  ? 25.410  55.347 -20.264 1.00 0.65  ? 44  GLN B H    3  
ATOM   10774 H  HA   . GLN B 2 44  ? 23.920  57.330 -21.462 1.00 0.61  ? 44  GLN B HA   3  
ATOM   10775 H  HB2  . GLN B 2 44  ? 25.047  55.245 -23.289 1.00 0.90  ? 44  GLN B HB2  3  
ATOM   10776 H  HB3  . GLN B 2 44  ? 25.202  57.000 -23.360 1.00 1.03  ? 44  GLN B HB3  3  
ATOM   10777 H  HG2  . GLN B 2 44  ? 26.658  55.103 -21.497 1.00 1.59  ? 44  GLN B HG2  3  
ATOM   10778 H  HG3  . GLN B 2 44  ? 27.359  56.106 -22.760 1.00 1.74  ? 44  GLN B HG3  3  
ATOM   10779 H  HE21 . GLN B 2 44  ? 27.697  58.351 -22.308 1.00 1.96  ? 44  GLN B HE21 3  
ATOM   10780 H  HE22 . GLN B 2 44  ? 27.473  59.019 -20.764 1.00 2.99  ? 44  GLN B HE22 3  
ATOM   10781 N  N    . PHE B 2 45  ? 21.961  56.452 -22.694 1.00 0.67  ? 45  PHE B N    3  
ATOM   10782 C  CA   . PHE B 2 45  ? 20.671  55.955 -23.260 1.00 0.71  ? 45  PHE B CA   3  
ATOM   10783 C  C    . PHE B 2 45  ? 20.949  55.238 -24.612 1.00 0.68  ? 45  PHE B C    3  
ATOM   10784 O  O    . PHE B 2 45  ? 21.543  55.835 -25.488 1.00 0.75  ? 45  PHE B O    3  
ATOM   10785 C  CB   . PHE B 2 45  ? 19.702  57.107 -23.534 1.00 0.80  ? 45  PHE B CB   3  
ATOM   10786 C  CG   . PHE B 2 45  ? 18.439  56.536 -24.159 1.00 1.19  ? 45  PHE B CG   3  
ATOM   10787 C  CD1  . PHE B 2 45  ? 18.354  56.366 -25.548 1.00 1.79  ? 45  PHE B CD1  3  
ATOM   10788 C  CD2  . PHE B 2 45  ? 17.362  56.159 -23.350 1.00 1.78  ? 45  PHE B CD2  3  
ATOM   10789 C  CE1  . PHE B 2 45  ? 17.191  55.827 -26.124 1.00 2.44  ? 45  PHE B CE1  3  
ATOM   10790 C  CE2  . PHE B 2 45  ? 16.203  55.617 -23.929 1.00 2.26  ? 45  PHE B CE2  3  
ATOM   10791 C  CZ   . PHE B 2 45  ? 16.119  55.455 -25.313 1.00 2.47  ? 45  PHE B CZ   3  
ATOM   10792 H  H    . PHE B 2 45  ? 22.179  57.391 -22.717 1.00 0.78  ? 45  PHE B H    3  
ATOM   10793 H  HA   . PHE B 2 45  ? 20.230  55.298 -22.541 1.00 0.72  ? 45  PHE B HA   3  
ATOM   10794 H  HB2  . PHE B 2 45  ? 19.458  57.603 -22.606 1.00 0.96  ? 45  PHE B HB2  3  
ATOM   10795 H  HB3  . PHE B 2 45  ? 20.156  57.810 -24.216 1.00 1.02  ? 45  PHE B HB3  3  
ATOM   10796 H  HD1  . PHE B 2 45  ? 19.183  56.649 -26.175 1.00 2.12  ? 45  PHE B HD1  3  
ATOM   10797 H  HD2  . PHE B 2 45  ? 17.421  56.288 -22.282 1.00 2.22  ? 45  PHE B HD2  3  
ATOM   10798 H  HE1  . PHE B 2 45  ? 17.121  55.707 -27.196 1.00 3.14  ? 45  PHE B HE1  3  
ATOM   10799 H  HE2  . PHE B 2 45  ? 15.375  55.326 -23.308 1.00 2.80  ? 45  PHE B HE2  3  
ATOM   10800 H  HZ   . PHE B 2 45  ? 15.225  55.038 -25.755 1.00 3.00  ? 45  PHE B HZ   3  
ATOM   10801 N  N    . PRO B 2 46  ? 20.536  53.992 -24.760 1.00 0.64  ? 46  PRO B N    3  
ATOM   10802 C  CA   . PRO B 2 46  ? 20.768  53.231 -26.008 1.00 0.66  ? 46  PRO B CA   3  
ATOM   10803 C  C    . PRO B 2 46  ? 20.020  53.857 -27.201 1.00 0.68  ? 46  PRO B C    3  
ATOM   10804 O  O    . PRO B 2 46  ? 18.880  54.224 -27.115 1.00 0.76  ? 46  PRO B O    3  
ATOM   10805 C  CB   . PRO B 2 46  ? 20.263  51.804 -25.717 1.00 0.72  ? 46  PRO B CB   3  
ATOM   10806 C  CG   . PRO B 2 46  ? 19.493  51.871 -24.379 1.00 0.74  ? 46  PRO B CG   3  
ATOM   10807 C  CD   . PRO B 2 46  ? 19.811  53.233 -23.725 1.00 0.66  ? 46  PRO B CD   3  
ATOM   10808 H  HA   . PRO B 2 46  ? 21.825  53.203 -26.224 1.00 0.70  ? 46  PRO B HA   3  
ATOM   10809 H  HB2  . PRO B 2 46  ? 19.610  51.461 -26.513 1.00 0.75  ? 46  PRO B HB2  3  
ATOM   10810 H  HB3  . PRO B 2 46  ? 21.101  51.126 -25.619 1.00 0.78  ? 46  PRO B HB3  3  
ATOM   10811 H  HG2  . PRO B 2 46  ? 18.435  51.800 -24.582 1.00 0.80  ? 46  PRO B HG2  3  
ATOM   10812 H  HG3  . PRO B 2 46  ? 19.799  51.066 -23.725 1.00 0.81  ? 46  PRO B HG3  3  
ATOM   10813 H  HD2  . PRO B 2 46  ? 18.892  53.740 -23.457 1.00 0.68  ? 46  PRO B HD2  3  
ATOM   10814 H  HD3  . PRO B 2 46  ? 20.446  53.108 -22.855 1.00 0.67  ? 46  PRO B HD3  3  
ATOM   10815 N  N    . GLU B 2 47  ? 20.714  53.984 -28.288 1.00 0.70  ? 47  GLU B N    3  
ATOM   10816 C  CA   . GLU B 2 47  ? 20.206  54.601 -29.553 1.00 0.77  ? 47  GLU B CA   3  
ATOM   10817 C  C    . GLU B 2 47  ? 20.022  56.084 -29.332 1.00 0.76  ? 47  GLU B C    3  
ATOM   10818 O  O    . GLU B 2 47  ? 19.668  56.836 -30.218 1.00 0.95  ? 47  GLU B O    3  
ATOM   10819 C  CB   . GLU B 2 47  ? 18.872  53.960 -29.949 1.00 0.79  ? 47  GLU B CB   3  
ATOM   10820 C  CG   . GLU B 2 47  ? 19.007  52.434 -29.900 1.00 1.60  ? 47  GLU B CG   3  
ATOM   10821 C  CD   . GLU B 2 47  ? 17.759  51.784 -30.498 1.00 1.99  ? 47  GLU B CD   3  
ATOM   10822 O  OE1  . GLU B 2 47  ? 17.599  51.852 -31.705 1.00 2.25  ? 47  GLU B OE1  3  
ATOM   10823 O  OE2  . GLU B 2 47  ? 16.986  51.224 -29.737 1.00 2.69  ? 47  GLU B OE2  3  
ATOM   10824 H  H    . GLU B 2 47  ? 21.637  53.714 -28.259 1.00 0.73  ? 47  GLU B H    3  
ATOM   10825 H  HA   . GLU B 2 47  ? 20.926  54.445 -30.342 1.00 0.88  ? 47  GLU B HA   3  
ATOM   10826 H  HB2  . GLU B 2 47  ? 18.096  54.280 -29.270 1.00 1.24  ? 47  GLU B HB2  3  
ATOM   10827 H  HB3  . GLU B 2 47  ? 18.616  54.262 -30.949 1.00 1.25  ? 47  GLU B HB3  3  
ATOM   10828 H  HG2  . GLU B 2 47  ? 19.876  52.134 -30.466 1.00 2.15  ? 47  GLU B HG2  3  
ATOM   10829 H  HG3  . GLU B 2 47  ? 19.118  52.114 -28.877 1.00 2.25  ? 47  GLU B HG3  3  
ATOM   10830 N  N    . GLY B 2 48  ? 20.474  56.511 -28.207 1.00 0.67  ? 48  GLY B N    3  
ATOM   10831 C  CA   . GLY B 2 48  ? 20.585  57.949 -27.926 1.00 0.75  ? 48  GLY B CA   3  
ATOM   10832 C  C    . GLY B 2 48  ? 19.264  58.729 -27.739 1.00 0.71  ? 48  GLY B C    3  
ATOM   10833 O  O    . GLY B 2 48  ? 19.322  59.934 -27.594 1.00 0.87  ? 48  GLY B O    3  
ATOM   10834 H  H    . GLY B 2 48  ? 20.886  55.873 -27.591 1.00 0.66  ? 48  GLY B H    3  
ATOM   10835 H  HA2  . GLY B 2 48  ? 21.170  58.052 -27.028 1.00 0.80  ? 48  GLY B HA2  3  
ATOM   10836 H  HA3  . GLY B 2 48  ? 21.138  58.378 -28.738 1.00 0.84  ? 48  GLY B HA3  3  
ATOM   10837 N  N    . LEU B 2 49  ? 18.086  58.131 -27.719 1.00 0.63  ? 49  LEU B N    3  
ATOM   10838 C  CA   . LEU B 2 49  ? 16.861  58.998 -27.518 1.00 0.73  ? 49  LEU B CA   3  
ATOM   10839 C  C    . LEU B 2 49  ? 16.548  59.036 -26.041 1.00 0.65  ? 49  LEU B C    3  
ATOM   10840 O  O    . LEU B 2 49  ? 16.302  58.048 -25.393 1.00 0.97  ? 49  LEU B O    3  
ATOM   10841 C  CB   . LEU B 2 49  ? 15.683  58.422 -28.315 1.00 1.02  ? 49  LEU B CB   3  
ATOM   10842 C  CG   . LEU B 2 49  ? 14.708  59.539 -28.706 1.00 0.77  ? 49  LEU B CG   3  
ATOM   10843 C  CD1  . LEU B 2 49  ? 13.516  58.937 -29.453 1.00 1.63  ? 49  LEU B CD1  3  
ATOM   10844 C  CD2  . LEU B 2 49  ? 14.217  60.260 -27.446 1.00 1.41  ? 49  LEU B CD2  3  
ATOM   10845 H  H    . LEU B 2 49  ? 18.008  57.162 -27.821 1.00 0.63  ? 49  LEU B H    3  
ATOM   10846 H  HA   . LEU B 2 49  ? 17.063  60.021 -27.838 1.00 0.82  ? 49  LEU B HA   3  
ATOM   10847 H  HB2  . LEU B 2 49  ? 16.064  57.958 -29.208 1.00 1.54  ? 49  LEU B HB2  3  
ATOM   10848 H  HB3  . LEU B 2 49  ? 15.164  57.684 -27.722 1.00 1.51  ? 49  LEU B HB3  3  
ATOM   10849 H  HG   . LEU B 2 49  ? 15.214  60.244 -29.351 1.00 1.54  ? 49  LEU B HG   3  
ATOM   10850 H  HD11 . LEU B 2 49  ? 13.874  58.306 -30.254 1.00 2.12  ? 49  LEU B HD11 3  
ATOM   10851 H  HD12 . LEU B 2 49  ? 12.911  59.732 -29.865 1.00 2.18  ? 49  LEU B HD12 3  
ATOM   10852 H  HD13 . LEU B 2 49  ? 12.922  58.349 -28.769 1.00 2.21  ? 49  LEU B HD13 3  
ATOM   10853 H  HD21 . LEU B 2 49  ? 14.008  59.536 -26.671 1.00 1.98  ? 49  LEU B HD21 3  
ATOM   10854 H  HD22 . LEU B 2 49  ? 13.317  60.813 -27.673 1.00 1.99  ? 49  LEU B HD22 3  
ATOM   10855 H  HD23 . LEU B 2 49  ? 14.979  60.943 -27.104 1.00 1.96  ? 49  LEU B HD23 3  
ATOM   10856 N  N    . PHE B 2 50  ? 16.616  60.195 -25.510 1.00 0.57  ? 50  PHE B N    3  
ATOM   10857 C  CA   . PHE B 2 50  ? 16.406  60.387 -24.064 1.00 0.66  ? 50  PHE B CA   3  
ATOM   10858 C  C    . PHE B 2 50  ? 15.505  61.661 -23.792 1.00 0.69  ? 50  PHE B C    3  
ATOM   10859 O  O    . PHE B 2 50  ? 15.363  62.489 -24.670 1.00 0.88  ? 50  PHE B O    3  
ATOM   10860 C  CB   . PHE B 2 50  ? 17.833  60.455 -23.501 1.00 0.82  ? 50  PHE B CB   3  
ATOM   10861 C  CG   . PHE B 2 50  ? 17.744  61.209 -22.274 1.00 1.20  ? 50  PHE B CG   3  
ATOM   10862 C  CD1  . PHE B 2 50  ? 17.597  62.568 -22.382 1.00 1.07  ? 50  PHE B CD1  3  
ATOM   10863 C  CD2  . PHE B 2 50  ? 17.664  60.550 -21.062 1.00 2.22  ? 50  PHE B CD2  3  
ATOM   10864 C  CE1  . PHE B 2 50  ? 17.340  63.297 -21.262 1.00 1.66  ? 50  PHE B CE1  3  
ATOM   10865 C  CE2  . PHE B 2 50  ? 17.446  61.279 -19.930 1.00 2.92  ? 50  PHE B CE2  3  
ATOM   10866 C  CZ   . PHE B 2 50  ? 17.268  62.655 -20.035 1.00 2.58  ? 50  PHE B CZ   3  
ATOM   10867 H  H    . PHE B 2 50  ? 16.855  60.959 -26.072 1.00 0.74  ? 50  PHE B H    3  
ATOM   10868 H  HA   . PHE B 2 50  ? 15.905  59.523 -23.645 1.00 0.76  ? 50  PHE B HA   3  
ATOM   10869 H  HB2  . PHE B 2 50  ? 18.207  59.457 -23.310 1.00 1.15  ? 50  PHE B HB2  3  
ATOM   10870 H  HB3  . PHE B 2 50  ? 18.483  60.961 -24.201 1.00 0.95  ? 50  PHE B HB3  3  
ATOM   10871 H  HD1  . PHE B 2 50  ? 17.662  63.040 -23.365 1.00 1.13  ? 50  PHE B HD1  3  
ATOM   10872 H  HD2  . PHE B 2 50  ? 17.806  59.481 -21.007 1.00 2.56  ? 50  PHE B HD2  3  
ATOM   10873 H  HE1  . PHE B 2 50  ? 17.222  64.352 -21.331 1.00 1.66  ? 50  PHE B HE1  3  
ATOM   10874 H  HE2  . PHE B 2 50  ? 17.404  60.788 -18.979 1.00 3.78  ? 50  PHE B HE2  3  
ATOM   10875 H  HZ   . PHE B 2 50  ? 17.030  63.204 -19.191 1.00 3.16  ? 50  PHE B HZ   3  
ATOM   10876 N  N    . TYR B 2 51  ? 14.955  61.880 -22.563 1.00 0.64  ? 51  TYR B N    3  
ATOM   10877 C  CA   . TYR B 2 51  ? 14.181  63.133 -22.292 1.00 0.70  ? 51  TYR B CA   3  
ATOM   10878 C  C    . TYR B 2 51  ? 14.544  63.719 -20.902 1.00 0.64  ? 51  TYR B C    3  
ATOM   10879 O  O    . TYR B 2 51  ? 14.473  63.060 -19.882 1.00 0.81  ? 51  TYR B O    3  
ATOM   10880 C  CB   . TYR B 2 51  ? 12.683  62.832 -22.343 1.00 0.88  ? 51  TYR B CB   3  
ATOM   10881 C  CG   . TYR B 2 51  ? 12.264  62.643 -23.784 1.00 1.43  ? 51  TYR B CG   3  
ATOM   10882 C  CD1  . TYR B 2 51  ? 12.338  63.716 -24.680 1.00 2.30  ? 51  TYR B CD1  3  
ATOM   10883 C  CD2  . TYR B 2 51  ? 11.814  61.396 -24.226 1.00 2.16  ? 51  TYR B CD2  3  
ATOM   10884 C  CE1  . TYR B 2 51  ? 11.961  63.540 -26.014 1.00 3.31  ? 51  TYR B CE1  3  
ATOM   10885 C  CE2  . TYR B 2 51  ? 11.438  61.218 -25.563 1.00 3.09  ? 51  TYR B CE2  3  
ATOM   10886 C  CZ   . TYR B 2 51  ? 11.512  62.291 -26.457 1.00 3.55  ? 51  TYR B CZ   3  
ATOM   10887 O  OH   . TYR B 2 51  ? 11.144  62.118 -27.776 1.00 4.66  ? 51  TYR B OH   3  
ATOM   10888 H  H    . TYR B 2 51  ? 15.133  61.295 -21.815 1.00 0.68  ? 51  TYR B H    3  
ATOM   10889 H  HA   . TYR B 2 51  ? 14.420  63.872 -23.045 1.00 0.74  ? 51  TYR B HA   3  
ATOM   10890 H  HB2  . TYR B 2 51  ? 12.478  61.933 -21.779 1.00 1.39  ? 51  TYR B HB2  3  
ATOM   10891 H  HB3  . TYR B 2 51  ? 12.136  63.657 -21.915 1.00 1.33  ? 51  TYR B HB3  3  
ATOM   10892 H  HD1  . TYR B 2 51  ? 12.681  64.682 -24.341 1.00 2.60  ? 51  TYR B HD1  3  
ATOM   10893 H  HD2  . TYR B 2 51  ? 11.757  60.574 -23.535 1.00 2.46  ? 51  TYR B HD2  3  
ATOM   10894 H  HE1  . TYR B 2 51  ? 12.021  64.367 -26.702 1.00 4.15  ? 51  TYR B HE1  3  
ATOM   10895 H  HE2  . TYR B 2 51  ? 11.090  60.253 -25.903 1.00 3.78  ? 51  TYR B HE2  3  
ATOM   10896 H  HH   . TYR B 2 51  ? 11.890  62.369 -28.327 1.00 4.93  ? 51  TYR B HH   3  
ATOM   10897 N  N    . GLU B 2 52  ? 14.898  64.968 -20.895 1.00 0.56  ? 52  GLU B N    3  
ATOM   10898 C  CA   . GLU B 2 52  ? 15.257  65.733 -19.621 1.00 0.59  ? 52  GLU B CA   3  
ATOM   10899 C  C    . GLU B 2 52  ? 14.050  66.515 -19.029 1.00 0.53  ? 52  GLU B C    3  
ATOM   10900 O  O    . GLU B 2 52  ? 13.327  67.175 -19.747 1.00 0.59  ? 52  GLU B O    3  
ATOM   10901 C  CB   . GLU B 2 52  ? 16.427  66.730 -19.874 1.00 0.66  ? 52  GLU B CB   3  
ATOM   10902 C  CG   . GLU B 2 52  ? 15.916  68.127 -20.297 1.00 0.70  ? 52  GLU B CG   3  
ATOM   10903 C  CD   . GLU B 2 52  ? 15.499  68.939 -19.065 1.00 1.52  ? 52  GLU B CD   3  
ATOM   10904 O  OE1  . GLU B 2 52  ? 16.273  68.991 -18.124 1.00 2.16  ? 52  GLU B OE1  3  
ATOM   10905 O  OE2  . GLU B 2 52  ? 14.413  69.494 -19.087 1.00 2.20  ? 52  GLU B OE2  3  
ATOM   10906 H  H    . GLU B 2 52  ? 14.929  65.405 -21.746 1.00 0.60  ? 52  GLU B H    3  
ATOM   10907 H  HA   . GLU B 2 52  ? 15.575  65.015 -18.887 1.00 0.68  ? 52  GLU B HA   3  
ATOM   10908 H  HB2  . GLU B 2 52  ? 17.005  66.827 -18.967 1.00 0.79  ? 52  GLU B HB2  3  
ATOM   10909 H  HB3  . GLU B 2 52  ? 17.063  66.353 -20.646 1.00 0.79  ? 52  GLU B HB3  3  
ATOM   10910 H  HG2  . GLU B 2 52  ? 16.704  68.652 -20.808 1.00 0.94  ? 52  GLU B HG2  3  
ATOM   10911 H  HG3  . GLU B 2 52  ? 15.075  68.021 -20.962 1.00 1.11  ? 52  GLU B HG3  3  
ATOM   10912 N  N    . PHE B 2 53  ? 13.884  66.529 -17.710 1.00 0.49  ? 53  PHE B N    3  
ATOM   10913 C  CA   . PHE B 2 53  ? 12.814  67.358 -17.094 1.00 0.48  ? 53  PHE B CA   3  
ATOM   10914 C  C    . PHE B 2 53  ? 13.288  67.953 -15.771 1.00 0.49  ? 53  PHE B C    3  
ATOM   10915 O  O    . PHE B 2 53  ? 13.916  67.307 -14.980 1.00 0.61  ? 53  PHE B O    3  
ATOM   10916 C  CB   . PHE B 2 53  ? 11.530  66.563 -16.889 1.00 0.57  ? 53  PHE B CB   3  
ATOM   10917 C  CG   . PHE B 2 53  ? 10.742  66.634 -18.192 1.00 0.73  ? 53  PHE B CG   3  
ATOM   10918 C  CD1  . PHE B 2 53  ? 11.121  65.872 -19.309 1.00 1.03  ? 53  PHE B CD1  3  
ATOM   10919 C  CD2  . PHE B 2 53  ? 9.679   67.541 -18.300 1.00 0.95  ? 53  PHE B CD2  3  
ATOM   10920 C  CE1  . PHE B 2 53  ? 10.430  66.016 -20.523 1.00 1.33  ? 53  PHE B CE1  3  
ATOM   10921 C  CE2  . PHE B 2 53  ? 8.998   67.688 -19.512 1.00 1.28  ? 53  PHE B CE2  3  
ATOM   10922 C  CZ   . PHE B 2 53  ? 9.372   66.926 -20.623 1.00 1.40  ? 53  PHE B CZ   3  
ATOM   10923 H  H    . PHE B 2 53  ? 14.531  66.084 -17.150 1.00 0.52  ? 53  PHE B H    3  
ATOM   10924 H  HA   . PHE B 2 53  ? 12.615  68.195 -17.759 1.00 0.48  ? 53  PHE B HA   3  
ATOM   10925 H  HB2  . PHE B 2 53  ? 11.779  65.553 -16.608 1.00 0.71  ? 53  PHE B HB2  3  
ATOM   10926 H  HB3  . PHE B 2 53  ? 10.949  67.019 -16.099 1.00 0.66  ? 53  PHE B HB3  3  
ATOM   10927 H  HD1  . PHE B 2 53  ? 11.926  65.160 -19.232 1.00 1.20  ? 53  PHE B HD1  3  
ATOM   10928 H  HD2  . PHE B 2 53  ? 9.384   68.128 -17.443 1.00 1.07  ? 53  PHE B HD2  3  
ATOM   10929 H  HE1  . PHE B 2 53  ? 10.718  65.429 -21.381 1.00 1.63  ? 53  PHE B HE1  3  
ATOM   10930 H  HE2  . PHE B 2 53  ? 8.182   68.389 -19.587 1.00 1.56  ? 53  PHE B HE2  3  
ATOM   10931 H  HZ   . PHE B 2 53  ? 8.845   67.041 -21.559 1.00 1.69  ? 53  PHE B HZ   3  
ATOM   10932 N  N    . GLU B 2 54  ? 12.941  69.178 -15.553 1.00 0.46  ? 54  GLU B N    3  
ATOM   10933 C  CA   . GLU B 2 54  ? 13.264  69.908 -14.290 1.00 0.49  ? 54  GLU B CA   3  
ATOM   10934 C  C    . GLU B 2 54  ? 14.720  69.755 -13.814 1.00 0.62  ? 54  GLU B C    3  
ATOM   10935 O  O    . GLU B 2 54  ? 15.019  69.941 -12.651 1.00 1.07  ? 54  GLU B O    3  
ATOM   10936 C  CB   . GLU B 2 54  ? 12.261  69.479 -13.196 1.00 0.61  ? 54  GLU B CB   3  
ATOM   10937 C  CG   . GLU B 2 54  ? 11.065  70.441 -13.175 1.00 1.62  ? 54  GLU B CG   3  
ATOM   10938 C  CD   . GLU B 2 54  ? 11.431  71.708 -12.397 1.00 1.85  ? 54  GLU B CD   3  
ATOM   10939 O  OE1  . GLU B 2 54  ? 11.424  71.653 -11.179 1.00 2.33  ? 54  GLU B OE1  3  
ATOM   10940 O  OE2  . GLU B 2 54  ? 11.712  72.710 -13.034 1.00 2.20  ? 54  GLU B OE2  3  
ATOM   10941 H  H    . GLU B 2 54  ? 12.413  69.635 -16.230 1.00 0.51  ? 54  GLU B H    3  
ATOM   10942 H  HA   . GLU B 2 54  ? 13.118  70.950 -14.495 1.00 0.55  ? 54  GLU B HA   3  
ATOM   10943 H  HB2  . GLU B 2 54  ? 11.900  68.485 -13.417 1.00 1.10  ? 54  GLU B HB2  3  
ATOM   10944 H  HB3  . GLU B 2 54  ? 12.741  69.481 -12.228 1.00 1.27  ? 54  GLU B HB3  3  
ATOM   10945 H  HG2  . GLU B 2 54  ? 10.808  70.705 -14.192 1.00 2.25  ? 54  GLU B HG2  3  
ATOM   10946 H  HG3  . GLU B 2 54  ? 10.221  69.960 -12.703 1.00 2.25  ? 54  GLU B HG3  3  
ATOM   10947 N  N    . GLY B 2 55  ? 15.628  69.502 -14.702 1.00 0.66  ? 55  GLY B N    3  
ATOM   10948 C  CA   . GLY B 2 55  ? 17.072  69.433 -14.317 1.00 0.81  ? 55  GLY B CA   3  
ATOM   10949 C  C    . GLY B 2 55  ? 17.497  68.030 -13.940 1.00 0.75  ? 55  GLY B C    3  
ATOM   10950 O  O    . GLY B 2 55  ? 18.649  67.801 -13.630 1.00 0.94  ? 55  GLY B O    3  
ATOM   10951 H  H    . GLY B 2 55  ? 15.368  69.378 -15.627 1.00 0.91  ? 55  GLY B H    3  
ATOM   10952 H  HA2  . GLY B 2 55  ? 17.671  69.765 -15.151 1.00 0.96  ? 55  GLY B HA2  3  
ATOM   10953 H  HA3  . GLY B 2 55  ? 17.249  70.090 -13.478 1.00 0.92  ? 55  GLY B HA3  3  
ATOM   10954 N  N    . ARG B 2 56  ? 16.621  67.077 -14.038 1.00 0.62  ? 56  ARG B N    3  
ATOM   10955 C  CA   . ARG B 2 56  ? 17.030  65.676 -13.769 1.00 0.66  ? 56  ARG B CA   3  
ATOM   10956 C  C    . ARG B 2 56  ? 16.836  64.980 -15.098 1.00 0.61  ? 56  ARG B C    3  
ATOM   10957 O  O    . ARG B 2 56  ? 15.997  65.392 -15.875 1.00 0.79  ? 56  ARG B O    3  
ATOM   10958 C  CB   . ARG B 2 56  ? 16.156  65.053 -12.670 1.00 0.79  ? 56  ARG B CB   3  
ATOM   10959 C  CG   . ARG B 2 56  ? 14.697  65.537 -12.695 1.00 1.09  ? 56  ARG B CG   3  
ATOM   10960 C  CD   . ARG B 2 56  ? 14.539  66.967 -12.154 1.00 1.33  ? 56  ARG B CD   3  
ATOM   10961 N  NE   . ARG B 2 56  ? 14.043  66.935 -10.734 1.00 1.90  ? 56  ARG B NE   3  
ATOM   10962 C  CZ   . ARG B 2 56  ? 12.904  66.380 -10.414 1.00 2.39  ? 56  ARG B CZ   3  
ATOM   10963 N  NH1  . ARG B 2 56  ? 12.117  65.915 -11.344 1.00 2.63  ? 56  ARG B NH1  3  
ATOM   10964 N  NH2  . ARG B 2 56  ? 12.539  66.318 -9.162  1.00 3.20  ? 56  ARG B NH2  3  
ATOM   10965 H  H    . ARG B 2 56  ? 15.713  67.270 -14.358 1.00 0.60  ? 56  ARG B H    3  
ATOM   10966 H  HA   . ARG B 2 56  ? 18.082  65.605 -13.488 1.00 0.73  ? 56  ARG B HA   3  
ATOM   10967 H  HB2  . ARG B 2 56  ? 16.148  64.008 -12.831 1.00 1.19  ? 56  ARG B HB2  3  
ATOM   10968 H  HB3  . ARG B 2 56  ? 16.587  65.265 -11.703 1.00 1.09  ? 56  ARG B HB3  3  
ATOM   10969 H  HG2  . ARG B 2 56  ? 14.334  65.489 -13.706 1.00 1.55  ? 56  ARG B HG2  3  
ATOM   10970 H  HG3  . ARG B 2 56  ? 14.116  64.872 -12.080 1.00 1.74  ? 56  ARG B HG3  3  
ATOM   10971 H  HD2  . ARG B 2 56  ? 15.474  67.471 -12.144 1.00 1.83  ? 56  ARG B HD2  3  
ATOM   10972 H  HD3  . ARG B 2 56  ? 13.855  67.503 -12.806 1.00 1.61  ? 56  ARG B HD3  3  
ATOM   10973 H  HE   . ARG B 2 56  ? 14.601  67.319 -10.025 1.00 2.41  ? 56  ARG B HE   3  
ATOM   10974 H  HH11 . ARG B 2 56  ? 12.386  65.983 -12.305 1.00 2.50  ? 56  ARG B HH11 3  
ATOM   10975 H  HH12 . ARG B 2 56  ? 11.246  65.490 -11.097 1.00 3.32  ? 56  ARG B HH12 3  
ATOM   10976 H  HH21 . ARG B 2 56  ? 13.131  66.695 -8.450  1.00 3.57  ? 56  ARG B HH21 3  
ATOM   10977 H  HH22 . ARG B 2 56  ? 11.667  65.895 -8.916  1.00 3.69  ? 56  ARG B HH22 3  
ATOM   10978 N  N    . LYS B 2 57  ? 17.611  63.968 -15.408 1.00 0.54  ? 57  LYS B N    3  
ATOM   10979 C  CA   . LYS B 2 57  ? 17.454  63.317 -16.744 1.00 0.57  ? 57  LYS B CA   3  
ATOM   10980 C  C    . LYS B 2 57  ? 16.977  61.860 -16.647 1.00 0.55  ? 57  LYS B C    3  
ATOM   10981 O  O    . LYS B 2 57  ? 17.532  61.077 -15.901 1.00 0.75  ? 57  LYS B O    3  
ATOM   10982 C  CB   . LYS B 2 57  ? 18.819  63.391 -17.488 1.00 0.66  ? 57  LYS B CB   3  
ATOM   10983 C  CG   . LYS B 2 57  ? 19.982  63.488 -16.483 1.00 1.05  ? 57  LYS B CG   3  
ATOM   10984 C  CD   . LYS B 2 57  ? 20.222  64.963 -16.087 1.00 1.19  ? 57  LYS B CD   3  
ATOM   10985 C  CE   . LYS B 2 57  ? 20.803  65.040 -14.673 1.00 1.49  ? 57  LYS B CE   3  
ATOM   10986 N  NZ   . LYS B 2 57  ? 22.131  64.364 -14.641 1.00 1.97  ? 57  LYS B NZ   3  
ATOM   10987 H  H    . LYS B 2 57  ? 18.296  63.665 -14.791 1.00 0.62  ? 57  LYS B H    3  
ATOM   10988 H  HA   . LYS B 2 57  ? 16.727  63.865 -17.303 1.00 0.60  ? 57  LYS B HA   3  
ATOM   10989 H  HB2  . LYS B 2 57  ? 18.952  62.510 -18.100 1.00 0.83  ? 57  LYS B HB2  3  
ATOM   10990 H  HB3  . LYS B 2 57  ? 18.831  64.263 -18.130 1.00 0.87  ? 57  LYS B HB3  3  
ATOM   10991 H  HG2  . LYS B 2 57  ? 19.745  62.905 -15.608 1.00 1.63  ? 57  LYS B HG2  3  
ATOM   10992 H  HG3  . LYS B 2 57  ? 20.880  63.093 -16.937 1.00 1.66  ? 57  LYS B HG3  3  
ATOM   10993 H  HD2  . LYS B 2 57  ? 20.917  65.413 -16.781 1.00 1.93  ? 57  LYS B HD2  3  
ATOM   10994 H  HD3  . LYS B 2 57  ? 19.290  65.508 -16.116 1.00 1.71  ? 57  LYS B HD3  3  
ATOM   10995 H  HE2  . LYS B 2 57  ? 20.918  66.075 -14.391 1.00 1.97  ? 57  LYS B HE2  3  
ATOM   10996 H  HE3  . LYS B 2 57  ? 20.134  64.553 -13.981 1.00 1.97  ? 57  LYS B HE3  3  
ATOM   10997 H  HZ1  . LYS B 2 57  ? 22.761  64.804 -15.341 1.00 2.46  ? 57  LYS B HZ1  3  
ATOM   10998 H  HZ2  . LYS B 2 57  ? 22.011  63.355 -14.866 1.00 2.28  ? 57  LYS B HZ2  3  
ATOM   10999 H  HZ3  . LYS B 2 57  ? 22.548  64.462 -13.694 1.00 2.28  ? 57  LYS B HZ3  3  
ATOM   11000 N  N    . TYR B 2 58  ? 15.951  61.474 -17.396 1.00 0.49  ? 58  TYR B N    3  
ATOM   11001 C  CA   . TYR B 2 58  ? 15.436  60.061 -17.352 1.00 0.49  ? 58  TYR B CA   3  
ATOM   11002 C  C    . TYR B 2 58  ? 15.167  59.497 -18.763 1.00 0.50  ? 58  TYR B C    3  
ATOM   11003 O  O    . TYR B 2 58  ? 14.842  60.229 -19.684 1.00 0.74  ? 58  TYR B O    3  
ATOM   11004 C  CB   . TYR B 2 58  ? 14.113  60.023 -16.646 1.00 0.51  ? 58  TYR B CB   3  
ATOM   11005 C  CG   . TYR B 2 58  ? 14.264  60.559 -15.275 1.00 0.51  ? 58  TYR B CG   3  
ATOM   11006 C  CD1  . TYR B 2 58  ? 14.772  59.758 -14.251 1.00 0.54  ? 58  TYR B CD1  3  
ATOM   11007 C  CD2  . TYR B 2 58  ? 13.856  61.847 -15.028 1.00 0.54  ? 58  TYR B CD2  3  
ATOM   11008 C  CE1  . TYR B 2 58  ? 14.872  60.276 -12.956 1.00 0.58  ? 58  TYR B CE1  3  
ATOM   11009 C  CE2  . TYR B 2 58  ? 13.941  62.363 -13.749 1.00 0.60  ? 58  TYR B CE2  3  
ATOM   11010 C  CZ   . TYR B 2 58  ? 14.450  61.585 -12.703 1.00 0.62  ? 58  TYR B CZ   3  
ATOM   11011 O  OH   . TYR B 2 58  ? 14.533  62.107 -11.428 1.00 0.70  ? 58  TYR B OH   3  
ATOM   11012 H  H    . TYR B 2 58  ? 15.440  62.082 -17.978 1.00 0.60  ? 58  TYR B H    3  
ATOM   11013 H  HA   . TYR B 2 58  ? 16.147  59.432 -16.826 1.00 0.50  ? 58  TYR B HA   3  
ATOM   11014 H  HB2  . TYR B 2 58  ? 13.405  60.612 -17.194 1.00 0.54  ? 58  TYR B HB2  3  
ATOM   11015 H  HB3  . TYR B 2 58  ? 13.757  59.024 -16.599 1.00 0.55  ? 58  TYR B HB3  3  
ATOM   11016 H  HD1  . TYR B 2 58  ? 15.098  58.749 -14.466 1.00 0.55  ? 58  TYR B HD1  3  
ATOM   11017 H  HD2  . TYR B 2 58  ? 13.473  62.453 -15.846 1.00 0.55  ? 58  TYR B HD2  3  
ATOM   11018 H  HE1  . TYR B 2 58  ? 15.263  59.668 -12.157 1.00 0.62  ? 58  TYR B HE1  3  
ATOM   11019 H  HE2  . TYR B 2 58  ? 13.603  63.352 -13.570 1.00 0.65  ? 58  TYR B HE2  3  
ATOM   11020 H  HH   . TYR B 2 58  ? 13.905  62.830 -11.362 1.00 1.08  ? 58  TYR B HH   3  
ATOM   11021 N  N    . CYS B 2 59  ? 15.240  58.197 -18.925 1.00 0.60  ? 59  CYS B N    3  
ATOM   11022 C  CA   . CYS B 2 59  ? 14.918  57.596 -20.246 1.00 0.60  ? 59  CYS B CA   3  
ATOM   11023 C  C    . CYS B 2 59  ? 13.474  57.958 -20.466 1.00 0.59  ? 59  CYS B C    3  
ATOM   11024 O  O    . CYS B 2 59  ? 12.800  58.360 -19.543 1.00 0.61  ? 59  CYS B O    3  
ATOM   11025 C  CB   . CYS B 2 59  ? 14.971  56.063 -20.226 1.00 0.62  ? 59  CYS B CB   3  
ATOM   11026 S  SG   . CYS B 2 59  ? 16.631  55.453 -19.873 1.00 0.59  ? 59  CYS B SG   3  
ATOM   11027 H  H    . CYS B 2 59  ? 15.466  57.633 -18.173 1.00 0.84  ? 59  CYS B H    3  
ATOM   11028 H  HA   . CYS B 2 59  ? 15.544  58.003 -21.026 1.00 0.63  ? 59  CYS B HA   3  
ATOM   11029 H  HB2  . CYS B 2 59  ? 14.293  55.702 -19.480 1.00 0.65  ? 59  CYS B HB2  3  
ATOM   11030 H  HB3  . CYS B 2 59  ? 14.653  55.692 -21.184 1.00 0.68  ? 59  CYS B HB3  3  
ATOM   11031 N  N    . GLU B 2 60  ? 12.975  57.832 -21.643 1.00 0.61  ? 60  GLU B N    3  
ATOM   11032 C  CA   . GLU B 2 60  ? 11.578  58.199 -21.852 1.00 0.64  ? 60  GLU B CA   3  
ATOM   11033 C  C    . GLU B 2 60  ? 10.742  57.415 -20.891 1.00 0.59  ? 60  GLU B C    3  
ATOM   11034 O  O    . GLU B 2 60  ? 9.780   57.869 -20.317 1.00 0.60  ? 60  GLU B O    3  
ATOM   11035 C  CB   . GLU B 2 60  ? 11.149  57.892 -23.279 1.00 0.74  ? 60  GLU B CB   3  
ATOM   11036 C  CG   . GLU B 2 60  ? 11.058  56.386 -23.481 1.00 0.74  ? 60  GLU B CG   3  
ATOM   11037 C  CD   . GLU B 2 60  ? 10.709  56.079 -24.939 1.00 0.90  ? 60  GLU B CD   3  
ATOM   11038 O  OE1  . GLU B 2 60  ? 11.116  56.842 -25.799 1.00 1.53  ? 60  GLU B OE1  3  
ATOM   11039 O  OE2  . GLU B 2 60  ? 10.042  55.084 -25.170 1.00 1.33  ? 60  GLU B OE2  3  
ATOM   11040 H  H    . GLU B 2 60  ? 13.503  57.480 -22.365 1.00 0.65  ? 60  GLU B H    3  
ATOM   11041 H  HA   . GLU B 2 60  ? 11.466  59.223 -21.657 1.00 0.68  ? 60  GLU B HA   3  
ATOM   11042 H  HB2  . GLU B 2 60  ? 10.182  58.323 -23.433 1.00 0.78  ? 60  GLU B HB2  3  
ATOM   11043 H  HB3  . GLU B 2 60  ? 11.858  58.309 -23.977 1.00 0.81  ? 60  GLU B HB3  3  
ATOM   11044 H  HG2  . GLU B 2 60  ? 12.004  55.928 -23.227 1.00 0.73  ? 60  GLU B HG2  3  
ATOM   11045 H  HG3  . GLU B 2 60  ? 10.285  56.006 -22.837 1.00 0.72  ? 60  GLU B HG3  3  
ATOM   11046 N  N    . HIS B 2 61  ? 11.116  56.202 -20.770 1.00 0.59  ? 61  HIS B N    3  
ATOM   11047 C  CA   . HIS B 2 61  ? 10.388  55.280 -19.929 1.00 0.60  ? 61  HIS B CA   3  
ATOM   11048 C  C    . HIS B 2 61  ? 10.247  55.862 -18.555 1.00 0.60  ? 61  HIS B C    3  
ATOM   11049 O  O    . HIS B 2 61  ? 9.161   56.055 -18.043 1.00 0.63  ? 61  HIS B O    3  
ATOM   11050 C  CB   . HIS B 2 61  ? 11.208  53.989 -19.874 1.00 0.63  ? 61  HIS B CB   3  
ATOM   11051 C  CG   . HIS B 2 61  ? 10.779  53.126 -18.722 1.00 0.61  ? 61  HIS B CG   3  
ATOM   11052 N  ND1  . HIS B 2 61  ? 9.552   53.274 -18.096 1.00 0.59  ? 61  HIS B ND1  3  
ATOM   11053 C  CD2  . HIS B 2 61  ? 11.422  52.117 -18.061 1.00 0.66  ? 61  HIS B CD2  3  
ATOM   11054 C  CE1  . HIS B 2 61  ? 9.498   52.372 -17.099 1.00 0.63  ? 61  HIS B CE1  3  
ATOM   11055 N  NE2  . HIS B 2 61  ? 10.613  51.640 -17.036 1.00 0.68  ? 61  HIS B NE2  3  
ATOM   11056 H  H    . HIS B 2 61  ? 11.888  55.881 -21.279 1.00 0.61  ? 61  HIS B H    3  
ATOM   11057 H  HA   . HIS B 2 61  ? 9.426   55.097 -20.348 1.00 0.64  ? 61  HIS B HA   3  
ATOM   11058 H  HB2  . HIS B 2 61  ? 11.084  53.448 -20.796 1.00 0.71  ? 61  HIS B HB2  3  
ATOM   11059 H  HB3  . HIS B 2 61  ? 12.256  54.250 -19.753 1.00 0.63  ? 61  HIS B HB3  3  
ATOM   11060 H  HD2  . HIS B 2 61  ? 12.409  51.754 -18.300 1.00 0.71  ? 61  HIS B HD2  3  
ATOM   11061 H  HE1  . HIS B 2 61  ? 8.660   52.261 -16.430 1.00 0.66  ? 61  HIS B HE1  3  
ATOM   11062 H  HE2  . HIS B 2 61  ? 10.810  50.924 -16.397 1.00 0.73  ? 61  HIS B HE2  3  
ATOM   11063 N  N    . ASP B 2 62  ? 11.339  56.159 -17.959 1.00 0.61  ? 62  ASP B N    3  
ATOM   11064 C  CA   . ASP B 2 62  ? 11.265  56.717 -16.609 1.00 0.68  ? 62  ASP B CA   3  
ATOM   11065 C  C    . ASP B 2 62  ? 10.805  58.138 -16.674 1.00 0.66  ? 62  ASP B C    3  
ATOM   11066 O  O    . ASP B 2 62  ? 10.094  58.612 -15.803 1.00 0.70  ? 62  ASP B O    3  
ATOM   11067 C  CB   . ASP B 2 62  ? 12.591  56.573 -15.868 1.00 0.79  ? 62  ASP B CB   3  
ATOM   11068 C  CG   . ASP B 2 62  ? 13.784  56.251 -16.792 1.00 0.92  ? 62  ASP B CG   3  
ATOM   11069 O  OD1  . ASP B 2 62  ? 13.852  55.134 -17.275 1.00 1.38  ? 62  ASP B OD1  3  
ATOM   11070 O  OD2  . ASP B 2 62  ? 14.672  57.095 -16.857 1.00 1.50  ? 62  ASP B OD2  3  
ATOM   11071 H  H    . ASP B 2 62  ? 12.193  56.043 -18.429 1.00 0.61  ? 62  ASP B H    3  
ATOM   11072 H  HA   . ASP B 2 62  ? 10.507  56.170 -16.066 1.00 0.72  ? 62  ASP B HA   3  
ATOM   11073 H  HB2  . ASP B 2 62  ? 12.803  57.465 -15.316 1.00 0.81  ? 62  ASP B HB2  3  
ATOM   11074 H  HB3  . ASP B 2 62  ? 12.468  55.780 -15.187 1.00 0.80  ? 62  ASP B HB3  3  
ATOM   11075 N  N    . PHE B 2 63  ? 11.171  58.830 -17.695 1.00 0.65  ? 63  PHE B N    3  
ATOM   11076 C  CA   . PHE B 2 63  ? 10.732  60.217 -17.758 1.00 0.69  ? 63  PHE B CA   3  
ATOM   11077 C  C    . PHE B 2 63  ? 9.231   60.200 -17.770 1.00 0.64  ? 63  PHE B C    3  
ATOM   11078 O  O    . PHE B 2 63  ? 8.580   60.929 -17.048 1.00 0.69  ? 63  PHE B O    3  
ATOM   11079 C  CB   . PHE B 2 63  ? 11.260  60.919 -19.041 1.00 0.76  ? 63  PHE B CB   3  
ATOM   11080 C  CG   . PHE B 2 63  ? 10.228  61.870 -19.627 1.00 1.13  ? 63  PHE B CG   3  
ATOM   11081 C  CD1  . PHE B 2 63  ? 9.924   63.043 -18.950 1.00 1.51  ? 63  PHE B CD1  3  
ATOM   11082 C  CD2  . PHE B 2 63  ? 9.582   61.577 -20.838 1.00 1.96  ? 63  PHE B CD2  3  
ATOM   11083 C  CE1  . PHE B 2 63  ? 8.977   63.929 -19.473 1.00 2.24  ? 63  PHE B CE1  3  
ATOM   11084 C  CE2  . PHE B 2 63  ? 8.638   62.463 -21.361 1.00 2.72  ? 63  PHE B CE2  3  
ATOM   11085 C  CZ   . PHE B 2 63  ? 8.336   63.641 -20.678 1.00 2.75  ? 63  PHE B CZ   3  
ATOM   11086 H  H    . PHE B 2 63  ? 11.728  58.442 -18.396 1.00 0.65  ? 63  PHE B H    3  
ATOM   11087 H  HA   . PHE B 2 63  ? 11.083  60.726 -16.894 1.00 0.76  ? 63  PHE B HA   3  
ATOM   11088 H  HB2  . PHE B 2 63  ? 12.146  61.484 -18.810 1.00 1.08  ? 63  PHE B HB2  3  
ATOM   11089 H  HB3  . PHE B 2 63  ? 11.501  60.182 -19.761 1.00 1.14  ? 63  PHE B HB3  3  
ATOM   11090 H  HD1  . PHE B 2 63  ? 10.421  63.265 -18.022 1.00 1.72  ? 63  PHE B HD1  3  
ATOM   11091 H  HD2  . PHE B 2 63  ? 9.806   60.670 -21.364 1.00 2.27  ? 63  PHE B HD2  3  
ATOM   11092 H  HE1  . PHE B 2 63  ? 8.746   64.841 -18.946 1.00 2.69  ? 63  PHE B HE1  3  
ATOM   11093 H  HE2  . PHE B 2 63  ? 8.143   62.237 -22.294 1.00 3.47  ? 63  PHE B HE2  3  
ATOM   11094 H  HZ   . PHE B 2 63  ? 7.606   64.327 -21.079 1.00 3.43  ? 63  PHE B HZ   3  
ATOM   11095 N  N    . GLN B 2 64  ? 8.631   59.336 -18.516 1.00 0.62  ? 64  GLN B N    3  
ATOM   11096 C  CA   . GLN B 2 64  ? 7.148   59.425 -18.481 1.00 0.68  ? 64  GLN B CA   3  
ATOM   11097 C  C    . GLN B 2 64  ? 6.698   59.134 -17.101 1.00 0.72  ? 64  GLN B C    3  
ATOM   11098 O  O    . GLN B 2 64  ? 5.737   59.666 -16.641 1.00 0.81  ? 64  GLN B O    3  
ATOM   11099 C  CB   . GLN B 2 64  ? 6.421   58.489 -19.428 1.00 0.77  ? 64  GLN B CB   3  
ATOM   11100 C  CG   . GLN B 2 64  ? 6.835   58.750 -20.883 1.00 0.86  ? 64  GLN B CG   3  
ATOM   11101 C  CD   . GLN B 2 64  ? 6.080   59.964 -21.420 1.00 1.65  ? 64  GLN B CD   3  
ATOM   11102 O  OE1  . GLN B 2 64  ? 5.215   59.836 -22.263 1.00 1.96  ? 64  GLN B OE1  3  
ATOM   11103 N  NE2  . GLN B 2 64  ? 6.377   61.144 -20.960 1.00 2.63  ? 64  GLN B NE2  3  
ATOM   11104 H  H    . GLN B 2 64  ? 9.145   58.650 -19.045 1.00 0.62  ? 64  GLN B H    3  
ATOM   11105 H  HA   . GLN B 2 64  ? 6.868   60.435 -18.708 1.00 0.70  ? 64  GLN B HA   3  
ATOM   11106 H  HB2  . GLN B 2 64  ? 6.622   57.476 -19.155 1.00 0.85  ? 64  GLN B HB2  3  
ATOM   11107 H  HB3  . GLN B 2 64  ? 5.363   58.679 -19.319 1.00 0.98  ? 64  GLN B HB3  3  
ATOM   11108 H  HG2  . GLN B 2 64  ? 7.891   58.944 -20.930 1.00 1.09  ? 64  GLN B HG2  3  
ATOM   11109 H  HG3  . GLN B 2 64  ? 6.599   57.886 -21.487 1.00 1.24  ? 64  GLN B HG3  3  
ATOM   11110 H  HE21 . GLN B 2 64  ? 7.076   61.244 -20.281 1.00 2.86  ? 64  GLN B HE21 3  
ATOM   11111 H  HE22 . GLN B 2 64  ? 5.906   61.929 -21.291 1.00 3.34  ? 64  GLN B HE22 3  
ATOM   11112 N  N    . MET B 2 65  ? 7.311   58.240 -16.451 1.00 0.74  ? 65  MET B N    3  
ATOM   11113 C  CA   . MET B 2 65  ? 6.723   57.876 -15.153 1.00 0.88  ? 65  MET B CA   3  
ATOM   11114 C  C    . MET B 2 65  ? 6.593   59.102 -14.249 1.00 0.92  ? 65  MET B C    3  
ATOM   11115 O  O    . MET B 2 65  ? 5.488   59.438 -13.861 1.00 1.04  ? 65  MET B O    3  
ATOM   11116 C  CB   . MET B 2 65  ? 7.612   56.834 -14.468 1.00 0.92  ? 65  MET B CB   3  
ATOM   11117 C  CG   . MET B 2 65  ? 7.523   55.508 -15.225 1.00 1.15  ? 65  MET B CG   3  
ATOM   11118 S  SD   . MET B 2 65  ? 8.858   54.409 -14.671 1.00 1.91  ? 65  MET B SD   3  
ATOM   11119 C  CE   . MET B 2 65  ? 7.837   53.143 -13.872 1.00 2.40  ? 65  MET B CE   3  
ATOM   11120 H  H    . MET B 2 65  ? 8.003   57.692 -16.901 1.00 0.71  ? 65  MET B H    3  
ATOM   11121 H  HA   . MET B 2 65  ? 5.744   57.449 -15.315 1.00 0.97  ? 65  MET B HA   3  
ATOM   11122 H  HB2  . MET B 2 65  ? 8.636   57.180 -14.467 1.00 1.21  ? 65  MET B HB2  3  
ATOM   11123 H  HB3  . MET B 2 65  ? 7.280   56.688 -13.451 1.00 1.30  ? 65  MET B HB3  3  
ATOM   11124 H  HG2  . MET B 2 65  ? 6.565   55.049 -15.034 1.00 1.77  ? 65  MET B HG2  3  
ATOM   11125 H  HG3  . MET B 2 65  ? 7.627   55.693 -16.284 1.00 1.49  ? 65  MET B HG3  3  
ATOM   11126 H  HE1  . MET B 2 65  ? 8.474   52.354 -13.496 1.00 2.73  ? 65  MET B HE1  3  
ATOM   11127 H  HE2  . MET B 2 65  ? 7.145   52.732 -14.589 1.00 2.78  ? 65  MET B HE2  3  
ATOM   11128 H  HE3  . MET B 2 65  ? 7.286   53.588 -13.055 1.00 2.92  ? 65  MET B HE3  3  
ATOM   11129 N  N    . LEU B 2 66  ? 7.615   59.838 -13.966 1.00 0.90  ? 66  LEU B N    3  
ATOM   11130 C  CA   . LEU B 2 66  ? 7.380   61.024 -13.067 1.00 1.01  ? 66  LEU B CA   3  
ATOM   11131 C  C    . LEU B 2 66  ? 6.640   62.082 -13.811 1.00 1.09  ? 66  LEU B C    3  
ATOM   11132 O  O    . LEU B 2 66  ? 5.907   62.874 -13.250 1.00 1.32  ? 66  LEU B O    3  
AT