data_2KSO
# 
_entry.id   2KSO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KSO         
RCSB  RCSB101525   
WWPDB D_1000101525 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KSO 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-01-10 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hota, P.K.'  1 
'Preeti, C.'  2 
'Stetzik, L.' 3 
'Kim, S.'     4 
'Wang, B.'    5 
'Lee, H.'     6 
'Buck, M.'    7 
# 
_citation.id                        primary 
_citation.title                     'Structure and function of the EphA2:SHIP2 SAM domain heterodimer' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, H.'    1 
primary 'Hota, P.'   2 
primary 'Preeti, C.' 3 
primary 'Wang, B.'   4 
primary 'Buck, M.'   5 
# 
_cell.entry_id           2KSO 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2KSO 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Ephrin type-A receptor 2'                                 9401.755 1 ? ? 'EphA2 SAM domain' ? 
2 polymer man 'Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2' 8671.604 1 ? ? 'SHIP2 SAM domain' ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Tyrosine-protein kinase receptor ECK, Epithelial cell kinase' 
2 
;SH2 domain-containing inositol-5'-phosphatase 2, SHIP-2, Inositol polyphosphate phosphatase-like protein 1, INPPL-1, Protein 51C
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;HHHHHHSSGLVPRGSHMTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVN
TV
;
;HHHHHHSSGLVPRGSHMTVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVN
TV
;
A ? 
2 'polypeptide(L)' no no HHHHHHSSGLVPRGSHMGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK          
HHHHHHSSGLVPRGSHMGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK          B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  HIS n 
1 2  HIS n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  SER n 
1 8  SER n 
1 9  GLY n 
1 10 LEU n 
1 11 VAL n 
1 12 PRO n 
1 13 ARG n 
1 14 GLY n 
1 15 SER n 
1 16 HIS n 
1 17 MET n 
1 18 THR n 
1 19 VAL n 
1 20 SER n 
1 21 GLU n 
1 22 TRP n 
1 23 LEU n 
1 24 GLU n 
1 25 SER n 
1 26 ILE n 
1 27 LYS n 
1 28 MET n 
1 29 GLN n 
1 30 GLN n 
1 31 TYR n 
1 32 THR n 
1 33 GLU n 
1 34 HIS n 
1 35 PHE n 
1 36 MET n 
1 37 ALA n 
1 38 ALA n 
1 39 GLY n 
1 40 TYR n 
1 41 THR n 
1 42 ALA n 
1 43 ILE n 
1 44 GLU n 
1 45 LYS n 
1 46 VAL n 
1 47 VAL n 
1 48 GLN n 
1 49 MET n 
1 50 THR n 
1 51 ASN n 
1 52 ASP n 
1 53 ASP n 
1 54 ILE n 
1 55 LYS n 
1 56 ARG n 
1 57 ILE n 
1 58 GLY n 
1 59 VAL n 
1 60 ARG n 
1 61 LEU n 
1 62 PRO n 
1 63 GLY n 
1 64 HIS n 
1 65 GLN n 
1 66 LYS n 
1 67 ARG n 
1 68 ILE n 
1 69 ALA n 
1 70 TYR n 
1 71 SER n 
1 72 LEU n 
1 73 LEU n 
1 74 GLY n 
1 75 LEU n 
1 76 LYS n 
1 77 ASP n 
1 78 GLN n 
1 79 VAL n 
1 80 ASN n 
1 81 THR n 
1 82 VAL n 
2 1  HIS n 
2 2  HIS n 
2 3  HIS n 
2 4  HIS n 
2 5  HIS n 
2 6  HIS n 
2 7  SER n 
2 8  SER n 
2 9  GLY n 
2 10 LEU n 
2 11 VAL n 
2 12 PRO n 
2 13 ARG n 
2 14 GLY n 
2 15 SER n 
2 16 HIS n 
2 17 MET n 
2 18 GLY n 
2 19 MET n 
2 20 SER n 
2 21 ALA n 
2 22 TRP n 
2 23 LEU n 
2 24 ARG n 
2 25 ALA n 
2 26 ILE n 
2 27 GLY n 
2 28 LEU n 
2 29 GLU n 
2 30 ARG n 
2 31 TYR n 
2 32 GLU n 
2 33 GLU n 
2 34 GLY n 
2 35 LEU n 
2 36 VAL n 
2 37 HIS n 
2 38 ASN n 
2 39 GLY n 
2 40 TRP n 
2 41 ASP n 
2 42 ASP n 
2 43 LEU n 
2 44 GLU n 
2 45 PHE n 
2 46 LEU n 
2 47 SER n 
2 48 ASP n 
2 49 ILE n 
2 50 THR n 
2 51 GLU n 
2 52 GLU n 
2 53 ASP n 
2 54 LEU n 
2 55 GLU n 
2 56 GLU n 
2 57 ALA n 
2 58 GLY n 
2 59 VAL n 
2 60 GLN n 
2 61 ASP n 
2 62 PRO n 
2 63 ALA n 
2 64 HIS n 
2 65 LYS n 
2 66 ARG n 
2 67 LEU n 
2 68 LEU n 
2 69 LEU n 
2 70 ASP n 
2 71 THR n 
2 72 LEU n 
2 73 GLN n 
2 74 LEU n 
2 75 SER n 
2 76 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? 'EPHA2, ECK'    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? plasmid ? ? ? pet28a ? ? 
2 1 sample ? ? ? human ? 'INPPL1, SHIP2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? 
? ? ? ? ? plasmid ? ? ? pet28a ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP EPHA2_HUMAN P29317 1 TVSEWLESIKMQQYTEHFMAAGYTAIEKVVQMTNDDIKRIGVRLPGHQKRIAYSLLGLKDQVNTV 908  ? 
2 UNP SHIP2_HUMAN O15357 2 GMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK       1200 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KSO A 18 ? 82 ? P29317 908  ? 972  ? 14 78 
2 2 2KSO B 18 ? 76 ? O15357 1200 ? 1258 ? 28 86 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2KSO HIS A 1  ? UNP P29317 ? ? 'EXPRESSION TAG' -3 1  
1 2KSO HIS A 2  ? UNP P29317 ? ? 'EXPRESSION TAG' -2 2  
1 2KSO HIS A 3  ? UNP P29317 ? ? 'EXPRESSION TAG' -1 3  
1 2KSO HIS A 4  ? UNP P29317 ? ? 'EXPRESSION TAG' 0  4  
1 2KSO HIS A 5  ? UNP P29317 ? ? 'EXPRESSION TAG' 1  5  
1 2KSO HIS A 6  ? UNP P29317 ? ? 'EXPRESSION TAG' 2  6  
1 2KSO SER A 7  ? UNP P29317 ? ? 'EXPRESSION TAG' 3  7  
1 2KSO SER A 8  ? UNP P29317 ? ? 'EXPRESSION TAG' 4  8  
1 2KSO GLY A 9  ? UNP P29317 ? ? 'EXPRESSION TAG' 5  9  
1 2KSO LEU A 10 ? UNP P29317 ? ? 'EXPRESSION TAG' 6  10 
1 2KSO VAL A 11 ? UNP P29317 ? ? 'EXPRESSION TAG' 7  11 
1 2KSO PRO A 12 ? UNP P29317 ? ? 'EXPRESSION TAG' 8  12 
1 2KSO ARG A 13 ? UNP P29317 ? ? 'EXPRESSION TAG' 9  13 
1 2KSO GLY A 14 ? UNP P29317 ? ? 'EXPRESSION TAG' 10 14 
1 2KSO SER A 15 ? UNP P29317 ? ? 'EXPRESSION TAG' 11 15 
1 2KSO HIS A 16 ? UNP P29317 ? ? 'EXPRESSION TAG' 12 16 
1 2KSO MET A 17 ? UNP P29317 ? ? 'EXPRESSION TAG' 13 17 
2 2KSO HIS B 1  ? UNP O15357 ? ? 'EXPRESSION TAG' 11 18 
2 2KSO HIS B 2  ? UNP O15357 ? ? 'EXPRESSION TAG' 12 19 
2 2KSO HIS B 3  ? UNP O15357 ? ? 'EXPRESSION TAG' 13 20 
2 2KSO HIS B 4  ? UNP O15357 ? ? 'EXPRESSION TAG' 14 21 
2 2KSO HIS B 5  ? UNP O15357 ? ? 'EXPRESSION TAG' 15 22 
2 2KSO HIS B 6  ? UNP O15357 ? ? 'EXPRESSION TAG' 16 23 
2 2KSO SER B 7  ? UNP O15357 ? ? 'EXPRESSION TAG' 17 24 
2 2KSO SER B 8  ? UNP O15357 ? ? 'EXPRESSION TAG' 18 25 
2 2KSO GLY B 9  ? UNP O15357 ? ? 'EXPRESSION TAG' 19 26 
2 2KSO LEU B 10 ? UNP O15357 ? ? 'EXPRESSION TAG' 20 27 
2 2KSO VAL B 11 ? UNP O15357 ? ? 'EXPRESSION TAG' 21 28 
2 2KSO PRO B 12 ? UNP O15357 ? ? 'EXPRESSION TAG' 22 29 
2 2KSO ARG B 13 ? UNP O15357 ? ? 'EXPRESSION TAG' 23 30 
2 2KSO GLY B 14 ? UNP O15357 ? ? 'EXPRESSION TAG' 24 31 
2 2KSO SER B 15 ? UNP O15357 ? ? 'EXPRESSION TAG' 25 32 
2 2KSO HIS B 16 ? UNP O15357 ? ? 'EXPRESSION TAG' 26 33 
2 2KSO MET B 17 ? UNP O15357 ? ? 'EXPRESSION TAG' 27 34 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '3D 1H-15N NOESY' 
1 2 2 '3D 1H-15N NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.1 
_pdbx_nmr_exptl_sample_conditions.pH                  6.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature         300 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.6 mM [U-100% 13C; U-100% 15N] entity_1-1, 0.9 mM entity_2-2, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' 
'0.9 mM entity_1-3, 0.6 mM [U-100% 13C; U-100% 15N] entity_2-4, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2KSO 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'standard protocol' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2KSO 
_pdbx_nmr_details.text       'full list to be completed' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             15 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KSO 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KSO 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
_pdbx_nmr_software.authors          'Schwieters, Kuszewski, Tjandra and Clore' 
_pdbx_nmr_software.classification   refinement 
_pdbx_nmr_software.name             X-PLOR_NIH 
_pdbx_nmr_software.version          ? 
_pdbx_nmr_software.ordinal          1 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'NMR Solution structure of SAM Domain Heterodimer' 
_exptl.entry_id                   2KSO 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KSO 
_struct.title                     'EphA2:SHIP2 SAM:SAM complex' 
_struct.pdbx_descriptor           
'Ephrin type-A receptor 2 (E.C.2.7.10.1), Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2 (E.C.3.1.3.-)' 
_struct.pdbx_model_details        'fewest violations, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KSO 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING' 
_struct_keywords.text            
;SAM domain, heterodimer, cell signaling, Angiogenesis, Apoptosis, ATP-binding, Cataract, Disulfide bond, Glycoprotein, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase, Actin-binding, Cell adhesion, Cytoskeleton, Diabetes mellitus, Hydrolase, Immune response, SH2 domain, SH3-binding, PROTEIN BINDING
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 18 ? ILE A 26 ? THR A 14 ILE A 22 1 ? 9  
HELX_P HELX_P2  2  GLN A 30 ? ALA A 38 ? GLN A 26 ALA A 34 1 ? 9  
HELX_P HELX_P3  3  ALA A 42 ? VAL A 47 ? ALA A 38 VAL A 43 1 ? 6  
HELX_P HELX_P4  4  THR A 50 ? VAL A 59 ? THR A 46 VAL A 55 1 ? 10 
HELX_P HELX_P5  5  GLY A 63 ? VAL A 79 ? GLY A 59 VAL A 75 1 ? 17 
HELX_P HELX_P6  6  MET B 19 ? GLY B 27 ? MET B 29 GLY B 37 1 ? 9  
HELX_P HELX_P7  7  TYR B 31 ? VAL B 36 ? TYR B 41 VAL B 46 5 ? 6  
HELX_P HELX_P8  8  PHE B 45 ? ILE B 49 ? PHE B 55 ILE B 59 5 ? 5  
HELX_P HELX_P9  9  GLU B 51 ? GLU B 56 ? GLU B 61 GLU B 66 1 ? 6  
HELX_P HELX_P10 10 ASP B 61 ? SER B 75 ? ASP B 71 SER B 85 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2KSO 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . THR A 1 18 ? -14.207 -7.379  7.461   1.00 0.00 ? 14 THR A N    1  
ATOM 2     C CA   . THR A 1 18 ? -14.710 -5.991  7.566   1.00 0.00 ? 14 THR A CA   1  
ATOM 3     C C    . THR A 1 18 ? -13.762 -5.005  6.892   1.00 0.00 ? 14 THR A C    1  
ATOM 4     O O    . THR A 1 18 ? -12.554 -5.233  6.825   1.00 0.00 ? 14 THR A O    1  
ATOM 5     C CB   . THR A 1 18 ? -14.897 -5.571  9.036   1.00 0.00 ? 14 THR A CB   1  
ATOM 6     O OG1  . THR A 1 18 ? -15.187 -6.720  9.837   1.00 0.00 ? 14 THR A OG1  1  
ATOM 7     C CG2  . THR A 1 18 ? -16.024 -4.554  9.172   1.00 0.00 ? 14 THR A CG2  1  
ATOM 8     H H    . THR A 1 18 ? -14.111 -7.651  6.462   1.00 0.00 ? 14 THR A H    1  
ATOM 9     H HA   . THR A 1 18 ? -15.670 -5.941  7.074   1.00 0.00 ? 14 THR A HA   1  
ATOM 10    H HB   . THR A 1 18 ? -13.980 -5.118  9.388   1.00 0.00 ? 14 THR A HB   1  
ATOM 11    H HG1  . THR A 1 18 ? -14.372 -7.022  10.274  1.00 0.00 ? 14 THR A HG1  1  
ATOM 12    H HG21 . THR A 1 18 ? -15.775 -3.664  8.613   1.00 0.00 ? 14 THR A HG21 1  
ATOM 13    H HG22 . THR A 1 18 ? -16.154 -4.299  10.214  1.00 0.00 ? 14 THR A HG22 1  
ATOM 14    H HG23 . THR A 1 18 ? -16.941 -4.976  8.788   1.00 0.00 ? 14 THR A HG23 1  
ATOM 15    N N    . VAL A 1 19 ? -14.345 -3.923  6.376   1.00 0.00 ? 15 VAL A N    1  
ATOM 16    C CA   . VAL A 1 19 ? -13.603 -2.850  5.706   1.00 0.00 ? 15 VAL A CA   1  
ATOM 17    C C    . VAL A 1 19 ? -12.404 -2.383  6.532   1.00 0.00 ? 15 VAL A C    1  
ATOM 18    O O    . VAL A 1 19 ? -11.355 -2.061  5.986   1.00 0.00 ? 15 VAL A O    1  
ATOM 19    C CB   . VAL A 1 19 ? -14.515 -1.629  5.438   1.00 0.00 ? 15 VAL A CB   1  
ATOM 20    C CG1  . VAL A 1 19 ? -13.969 -0.781  4.302   1.00 0.00 ? 15 VAL A CG1  1  
ATOM 21    C CG2  . VAL A 1 19 ? -15.940 -2.063  5.136   1.00 0.00 ? 15 VAL A CG2  1  
ATOM 22    H H    . VAL A 1 19 ? -15.325 -3.882  6.401   1.00 0.00 ? 15 VAL A H    1  
ATOM 23    H HA   . VAL A 1 19 ? -13.252 -3.230  4.758   1.00 0.00 ? 15 VAL A HA   1  
ATOM 24    H HB   . VAL A 1 19 ? -14.531 -1.021  6.331   1.00 0.00 ? 15 VAL A HB   1  
ATOM 25    H HG11 . VAL A 1 19 ? -12.962 -0.473  4.534   1.00 0.00 ? 15 VAL A HG11 1  
ATOM 26    H HG12 . VAL A 1 19 ? -14.592 0.092   4.173   1.00 0.00 ? 15 VAL A HG12 1  
ATOM 27    H HG13 . VAL A 1 19 ? -13.967 -1.360  3.389   1.00 0.00 ? 15 VAL A HG13 1  
ATOM 28    H HG21 . VAL A 1 19 ? -16.380 -2.502  6.019   1.00 0.00 ? 15 VAL A HG21 1  
ATOM 29    H HG22 . VAL A 1 19 ? -15.933 -2.788  4.338   1.00 0.00 ? 15 VAL A HG22 1  
ATOM 30    H HG23 . VAL A 1 19 ? -16.521 -1.204  4.835   1.00 0.00 ? 15 VAL A HG23 1  
ATOM 31    N N    . SER A 1 20 ? -12.562 -2.385  7.851   1.00 0.00 ? 16 SER A N    1  
ATOM 32    C CA   . SER A 1 20 ? -11.513 -1.947  8.753   1.00 0.00 ? 16 SER A CA   1  
ATOM 33    C C    . SER A 1 20 ? -10.266 -2.821  8.632   1.00 0.00 ? 16 SER A C    1  
ATOM 34    O O    . SER A 1 20 ? -9.159  -2.306  8.511   1.00 0.00 ? 16 SER A O    1  
ATOM 35    C CB   . SER A 1 20 ? -12.043 -1.966  10.186  1.00 0.00 ? 16 SER A CB   1  
ATOM 36    O OG   . SER A 1 20 ? -13.269 -2.680  10.251  1.00 0.00 ? 16 SER A OG   1  
ATOM 37    H H    . SER A 1 20 ? -13.407 -2.706  8.232   1.00 0.00 ? 16 SER A H    1  
ATOM 38    H HA   . SER A 1 20 ? -11.255 -0.932  8.490   1.00 0.00 ? 16 SER A HA   1  
ATOM 39    H HB2  . SER A 1 20 ? -11.319 -2.445  10.831  1.00 0.00 ? 16 SER A HB2  1  
ATOM 40    H HB3  . SER A 1 20 ? -12.212 -0.954  10.518  1.00 0.00 ? 16 SER A HB3  1  
ATOM 41    H HG   . SER A 1 20 ? -13.306 -3.170  11.081  1.00 0.00 ? 16 SER A HG   1  
ATOM 42    N N    . GLU A 1 21 ? -10.462 -4.140  8.649   1.00 0.00 ? 17 GLU A N    1  
ATOM 43    C CA   . GLU A 1 21 ? -9.354  -5.090  8.555   1.00 0.00 ? 17 GLU A CA   1  
ATOM 44    C C    . GLU A 1 21 ? -8.603  -4.933  7.239   1.00 0.00 ? 17 GLU A C    1  
ATOM 45    O O    . GLU A 1 21 ? -7.379  -5.030  7.197   1.00 0.00 ? 17 GLU A O    1  
ATOM 46    C CB   . GLU A 1 21 ? -9.861  -6.525  8.676   1.00 0.00 ? 17 GLU A CB   1  
ATOM 47    C CG   . GLU A 1 21 ? -10.518 -6.849  10.007  1.00 0.00 ? 17 GLU A CG   1  
ATOM 48    C CD   . GLU A 1 21 ? -11.880 -7.482  9.829   1.00 0.00 ? 17 GLU A CD   1  
ATOM 49    O OE1  . GLU A 1 21 ? -12.095 -8.169  8.808   1.00 0.00 ? 17 GLU A OE1  1  
ATOM 50    O OE2  . GLU A 1 21 ? -12.752 -7.273  10.688  1.00 0.00 ? 17 GLU A OE2  1  
ATOM 51    H H    . GLU A 1 21 ? -11.377 -4.480  8.713   1.00 0.00 ? 17 GLU A H    1  
ATOM 52    H HA   . GLU A 1 21 ? -8.671  -4.889  9.367   1.00 0.00 ? 17 GLU A HA   1  
ATOM 53    H HB2  . GLU A 1 21 ? -10.583 -6.703  7.897   1.00 0.00 ? 17 GLU A HB2  1  
ATOM 54    H HB3  . GLU A 1 21 ? -9.028  -7.198  8.540   1.00 0.00 ? 17 GLU A HB3  1  
ATOM 55    H HG2  . GLU A 1 21 ? -9.886  -7.538  10.550  1.00 0.00 ? 17 GLU A HG2  1  
ATOM 56    H HG3  . GLU A 1 21 ? -10.632 -5.939  10.576  1.00 0.00 ? 17 GLU A HG3  1  
ATOM 57    N N    . TRP A 1 22 ? -9.341  -4.688  6.168   1.00 0.00 ? 18 TRP A N    1  
ATOM 58    C CA   . TRP A 1 22 ? -8.740  -4.514  4.855   1.00 0.00 ? 18 TRP A CA   1  
ATOM 59    C C    . TRP A 1 22 ? -7.920  -3.226  4.824   1.00 0.00 ? 18 TRP A C    1  
ATOM 60    O O    . TRP A 1 22 ? -6.734  -3.234  4.508   1.00 0.00 ? 18 TRP A O    1  
ATOM 61    C CB   . TRP A 1 22 ? -9.834  -4.493  3.782   1.00 0.00 ? 18 TRP A CB   1  
ATOM 62    C CG   . TRP A 1 22 ? -9.411  -3.872  2.487   1.00 0.00 ? 18 TRP A CG   1  
ATOM 63    C CD1  . TRP A 1 22 ? -8.463  -4.338  1.627   1.00 0.00 ? 18 TRP A CD1  1  
ATOM 64    C CD2  . TRP A 1 22 ? -9.931  -2.670  1.900   1.00 0.00 ? 18 TRP A CD2  1  
ATOM 65    N NE1  . TRP A 1 22 ? -8.359  -3.501  0.544   1.00 0.00 ? 18 TRP A NE1  1  
ATOM 66    C CE2  . TRP A 1 22 ? -9.248  -2.473  0.686   1.00 0.00 ? 18 TRP A CE2  1  
ATOM 67    C CE3  . TRP A 1 22 ? -10.903 -1.742  2.281   1.00 0.00 ? 18 TRP A CE3  1  
ATOM 68    C CZ2  . TRP A 1 22 ? -9.509  -1.390  -0.151  1.00 0.00 ? 18 TRP A CZ2  1  
ATOM 69    C CZ3  . TRP A 1 22 ? -11.161 -0.667  1.451   1.00 0.00 ? 18 TRP A CZ3  1  
ATOM 70    C CH2  . TRP A 1 22 ? -10.466 -0.499  0.247   1.00 0.00 ? 18 TRP A CH2  1  
ATOM 71    H H    . TRP A 1 22 ? -10.312 -4.612  6.264   1.00 0.00 ? 18 TRP A H    1  
ATOM 72    H HA   . TRP A 1 22 ? -8.084  -5.353  4.677   1.00 0.00 ? 18 TRP A HA   1  
ATOM 73    H HB2  . TRP A 1 22 ? -10.139 -5.506  3.573   1.00 0.00 ? 18 TRP A HB2  1  
ATOM 74    H HB3  . TRP A 1 22 ? -10.684 -3.938  4.157   1.00 0.00 ? 18 TRP A HB3  1  
ATOM 75    H HD1  . TRP A 1 22 ? -7.881  -5.233  1.791   1.00 0.00 ? 18 TRP A HD1  1  
ATOM 76    H HE1  . TRP A 1 22 ? -7.747  -3.623  -0.207  1.00 0.00 ? 18 TRP A HE1  1  
ATOM 77    H HE3  . TRP A 1 22 ? -11.451 -1.854  3.207   1.00 0.00 ? 18 TRP A HE3  1  
ATOM 78    H HZ2  . TRP A 1 22 ? -8.983  -1.250  -1.082  1.00 0.00 ? 18 TRP A HZ2  1  
ATOM 79    H HZ3  . TRP A 1 22 ? -11.907 0.060   1.731   1.00 0.00 ? 18 TRP A HZ3  1  
ATOM 80    H HH2  . TRP A 1 22 ? -10.700 0.356   -0.369  1.00 0.00 ? 18 TRP A HH2  1  
ATOM 81    N N    . LEU A 1 23 ? -8.572  -2.133  5.184   1.00 0.00 ? 19 LEU A N    1  
ATOM 82    C CA   . LEU A 1 23 ? -7.940  -0.819  5.208   1.00 0.00 ? 19 LEU A CA   1  
ATOM 83    C C    . LEU A 1 23 ? -6.724  -0.777  6.137   1.00 0.00 ? 19 LEU A C    1  
ATOM 84    O O    . LEU A 1 23 ? -5.764  -0.068  5.857   1.00 0.00 ? 19 LEU A O    1  
ATOM 85    C CB   . LEU A 1 23 ? -8.954  0.250   5.613   1.00 0.00 ? 19 LEU A CB   1  
ATOM 86    C CG   . LEU A 1 23 ? -9.822  0.766   4.466   1.00 0.00 ? 19 LEU A CG   1  
ATOM 87    C CD1  . LEU A 1 23 ? -11.097 1.383   5.001   1.00 0.00 ? 19 LEU A CD1  1  
ATOM 88    C CD2  . LEU A 1 23 ? -9.052  1.769   3.619   1.00 0.00 ? 19 LEU A CD2  1  
ATOM 89    H H    . LEU A 1 23 ? -9.524  -2.227  5.403   1.00 0.00 ? 19 LEU A H    1  
ATOM 90    H HA   . LEU A 1 23 ? -7.605  -0.608  4.203   1.00 0.00 ? 19 LEU A HA   1  
ATOM 91    H HB2  . LEU A 1 23 ? -9.603  -0.166  6.371   1.00 0.00 ? 19 LEU A HB2  1  
ATOM 92    H HB3  . LEU A 1 23 ? -8.419  1.085   6.036   1.00 0.00 ? 19 LEU A HB3  1  
ATOM 93    H HG   . LEU A 1 23 ? -10.095 -0.066  3.830   1.00 0.00 ? 19 LEU A HG   1  
ATOM 94    H HD11 . LEU A 1 23 ? -11.661 1.809   4.185   1.00 0.00 ? 19 LEU A HD11 1  
ATOM 95    H HD12 . LEU A 1 23 ? -10.847 2.155   5.711   1.00 0.00 ? 19 LEU A HD12 1  
ATOM 96    H HD13 . LEU A 1 23 ? -11.687 0.624   5.490   1.00 0.00 ? 19 LEU A HD13 1  
ATOM 97    H HD21 . LEU A 1 23 ? -8.227  1.273   3.132   1.00 0.00 ? 19 LEU A HD21 1  
ATOM 98    H HD22 . LEU A 1 23 ? -8.674  2.561   4.251   1.00 0.00 ? 19 LEU A HD22 1  
ATOM 99    H HD23 . LEU A 1 23 ? -9.711  2.190   2.871   1.00 0.00 ? 19 LEU A HD23 1  
ATOM 100   N N    . GLU A 1 24 ? -6.742  -1.540  7.223   1.00 0.00 ? 20 GLU A N    1  
ATOM 101   C CA   . GLU A 1 24 ? -5.612  -1.534  8.154   1.00 0.00 ? 20 GLU A CA   1  
ATOM 102   C C    . GLU A 1 24 ? -4.493  -2.484  7.717   1.00 0.00 ? 20 GLU A C    1  
ATOM 103   O O    . GLU A 1 24 ? -3.317  -2.190  7.936   1.00 0.00 ? 20 GLU A O    1  
ATOM 104   C CB   . GLU A 1 24 ? -6.063  -1.853  9.587   1.00 0.00 ? 20 GLU A CB   1  
ATOM 105   C CG   . GLU A 1 24 ? -6.578  -3.270  9.783   1.00 0.00 ? 20 GLU A CG   1  
ATOM 106   C CD   . GLU A 1 24 ? -5.751  -4.061  10.776  1.00 0.00 ? 20 GLU A CD   1  
ATOM 107   O OE1  . GLU A 1 24 ? -5.936  -3.861  11.996  1.00 0.00 ? 20 GLU A OE1  1  
ATOM 108   O OE2  . GLU A 1 24 ? -4.925  -4.890  10.340  1.00 0.00 ? 20 GLU A OE2  1  
ATOM 109   H H    . GLU A 1 24 ? -7.537  -2.089  7.422   1.00 0.00 ? 20 GLU A H    1  
ATOM 110   H HA   . GLU A 1 24 ? -5.210  -0.532  8.148   1.00 0.00 ? 20 GLU A HA   1  
ATOM 111   H HB2  . GLU A 1 24 ? -5.227  -1.706  10.253  1.00 0.00 ? 20 GLU A HB2  1  
ATOM 112   H HB3  . GLU A 1 24 ? -6.854  -1.168  9.860   1.00 0.00 ? 20 GLU A HB3  1  
ATOM 113   H HG2  . GLU A 1 24 ? -7.595  -3.223  10.145  1.00 0.00 ? 20 GLU A HG2  1  
ATOM 114   H HG3  . GLU A 1 24 ? -6.561  -3.782  8.832   1.00 0.00 ? 20 GLU A HG3  1  
ATOM 115   N N    . SER A 1 25 ? -4.841  -3.606  7.086   1.00 0.00 ? 21 SER A N    1  
ATOM 116   C CA   . SER A 1 25 ? -3.831  -4.568  6.646   1.00 0.00 ? 21 SER A CA   1  
ATOM 117   C C    . SER A 1 25 ? -2.964  -3.983  5.530   1.00 0.00 ? 21 SER A C    1  
ATOM 118   O O    . SER A 1 25 ? -1.777  -4.294  5.425   1.00 0.00 ? 21 SER A O    1  
ATOM 119   C CB   . SER A 1 25 ? -4.476  -5.881  6.184   1.00 0.00 ? 21 SER A CB   1  
ATOM 120   O OG   . SER A 1 25 ? -5.563  -5.652  5.304   1.00 0.00 ? 21 SER A OG   1  
ATOM 121   H H    . SER A 1 25 ? -5.785  -3.789  6.909   1.00 0.00 ? 21 SER A H    1  
ATOM 122   H HA   . SER A 1 25 ? -3.195  -4.776  7.495   1.00 0.00 ? 21 SER A HA   1  
ATOM 123   H HB2  . SER A 1 25 ? -3.736  -6.479  5.670   1.00 0.00 ? 21 SER A HB2  1  
ATOM 124   H HB3  . SER A 1 25 ? -4.836  -6.420  7.046   1.00 0.00 ? 21 SER A HB3  1  
ATOM 125   H HG   . SER A 1 25 ? -6.333  -5.381  5.814   1.00 0.00 ? 21 SER A HG   1  
ATOM 126   N N    . ILE A 1 26 ? -3.564  -3.146  4.697   1.00 0.00 ? 22 ILE A N    1  
ATOM 127   C CA   . ILE A 1 26 ? -2.835  -2.504  3.604   1.00 0.00 ? 22 ILE A CA   1  
ATOM 128   C C    . ILE A 1 26 ? -2.220  -1.179  4.051   1.00 0.00 ? 22 ILE A C    1  
ATOM 129   O O    . ILE A 1 26 ? -1.732  -0.405  3.231   1.00 0.00 ? 22 ILE A O    1  
ATOM 130   C CB   . ILE A 1 26 ? -3.731  -2.282  2.369   1.00 0.00 ? 22 ILE A CB   1  
ATOM 131   C CG1  . ILE A 1 26 ? -5.008  -1.525  2.745   1.00 0.00 ? 22 ILE A CG1  1  
ATOM 132   C CG2  . ILE A 1 26 ? -4.064  -3.621  1.732   1.00 0.00 ? 22 ILE A CG2  1  
ATOM 133   C CD1  . ILE A 1 26 ? -5.897  -1.206  1.558   1.00 0.00 ? 22 ILE A CD1  1  
ATOM 134   H H    . ILE A 1 26 ? -4.528  -2.991  4.793   1.00 0.00 ? 22 ILE A H    1  
ATOM 135   H HA   . ILE A 1 26 ? -2.035  -3.167  3.318   1.00 0.00 ? 22 ILE A HA   1  
ATOM 136   H HB   . ILE A 1 26 ? -3.173  -1.700  1.654   1.00 0.00 ? 22 ILE A HB   1  
ATOM 137   H HG12 . ILE A 1 26 ? -5.583  -2.120  3.438   1.00 0.00 ? 22 ILE A HG12 1  
ATOM 138   H HG13 . ILE A 1 26 ? -4.739  -0.593  3.217   1.00 0.00 ? 22 ILE A HG13 1  
ATOM 139   H HG21 . ILE A 1 26 ? -4.623  -4.225  2.431   1.00 0.00 ? 22 ILE A HG21 1  
ATOM 140   H HG22 . ILE A 1 26 ? -3.148  -4.130  1.469   1.00 0.00 ? 22 ILE A HG22 1  
ATOM 141   H HG23 . ILE A 1 26 ? -4.654  -3.459  0.844   1.00 0.00 ? 22 ILE A HG23 1  
ATOM 142   H HD11 . ILE A 1 26 ? -5.350  -0.599  0.851   1.00 0.00 ? 22 ILE A HD11 1  
ATOM 143   H HD12 . ILE A 1 26 ? -6.769  -0.666  1.897   1.00 0.00 ? 22 ILE A HD12 1  
ATOM 144   H HD13 . ILE A 1 26 ? -6.206  -2.124  1.081   1.00 0.00 ? 22 ILE A HD13 1  
ATOM 145   N N    . LYS A 1 27 ? -2.282  -0.926  5.361   1.00 0.00 ? 23 LYS A N    1  
ATOM 146   C CA   . LYS A 1 27 ? -1.716  0.281   5.969   1.00 0.00 ? 23 LYS A CA   1  
ATOM 147   C C    . LYS A 1 27 ? -2.412  1.554   5.482   1.00 0.00 ? 23 LYS A C    1  
ATOM 148   O O    . LYS A 1 27 ? -1.811  2.626   5.458   1.00 0.00 ? 23 LYS A O    1  
ATOM 149   C CB   . LYS A 1 27 ? -0.211  0.370   5.691   1.00 0.00 ? 23 LYS A CB   1  
ATOM 150   C CG   . LYS A 1 27 ? 0.662   0.290   6.937   1.00 0.00 ? 23 LYS A CG   1  
ATOM 151   C CD   . LYS A 1 27 ? 0.638   1.592   7.734   1.00 0.00 ? 23 LYS A CD   1  
ATOM 152   C CE   . LYS A 1 27 ? 1.359   2.722   7.002   1.00 0.00 ? 23 LYS A CE   1  
ATOM 153   N NZ   . LYS A 1 27 ? 1.732   3.841   7.915   1.00 0.00 ? 23 LYS A NZ   1  
ATOM 154   H H    . LYS A 1 27 ? -2.739  -1.576  5.939   1.00 0.00 ? 23 LYS A H    1  
ATOM 155   H HA   . LYS A 1 27 ? -1.862  0.199   7.040   1.00 0.00 ? 23 LYS A HA   1  
ATOM 156   H HB2  . LYS A 1 27 ? 0.068   -0.440  5.033   1.00 0.00 ? 23 LYS A HB2  1  
ATOM 157   H HB3  . LYS A 1 27 ? -0.009  1.307   5.198   1.00 0.00 ? 23 LYS A HB3  1  
ATOM 158   H HG2  . LYS A 1 27 ? 0.300   -0.510  7.566   1.00 0.00 ? 23 LYS A HG2  1  
ATOM 159   H HG3  . LYS A 1 27 ? 1.679   0.081   6.638   1.00 0.00 ? 23 LYS A HG3  1  
ATOM 160   H HD2  . LYS A 1 27 ? -0.388  1.886   7.895   1.00 0.00 ? 23 LYS A HD2  1  
ATOM 161   H HD3  . LYS A 1 27 ? 1.121   1.429   8.687   1.00 0.00 ? 23 LYS A HD3  1  
ATOM 162   H HE2  . LYS A 1 27 ? 2.258   2.325   6.550   1.00 0.00 ? 23 LYS A HE2  1  
ATOM 163   H HE3  . LYS A 1 27 ? 0.710   3.103   6.228   1.00 0.00 ? 23 LYS A HE3  1  
ATOM 164   H HZ1  . LYS A 1 27 ? 2.236   3.468   8.754   1.00 0.00 ? 23 LYS A HZ1  1  
ATOM 165   H HZ2  . LYS A 1 27 ? 0.883   4.346   8.230   1.00 0.00 ? 23 LYS A HZ2  1  
ATOM 166   H HZ3  . LYS A 1 27 ? 2.364   4.518   7.422   1.00 0.00 ? 23 LYS A HZ3  1  
ATOM 167   N N    . MET A 1 28 ? -3.684  1.439   5.128   1.00 0.00 ? 24 MET A N    1  
ATOM 168   C CA   . MET A 1 28 ? -4.474  2.576   4.656   1.00 0.00 ? 24 MET A CA   1  
ATOM 169   C C    . MET A 1 28 ? -5.396  3.045   5.779   1.00 0.00 ? 24 MET A C    1  
ATOM 170   O O    . MET A 1 28 ? -6.420  3.682   5.537   1.00 0.00 ? 24 MET A O    1  
ATOM 171   C CB   . MET A 1 28 ? -5.320  2.165   3.448   1.00 0.00 ? 24 MET A CB   1  
ATOM 172   C CG   . MET A 1 28 ? -4.518  1.872   2.190   1.00 0.00 ? 24 MET A CG   1  
ATOM 173   S SD   . MET A 1 28 ? -3.626  3.298   1.552   1.00 0.00 ? 24 MET A SD   1  
ATOM 174   C CE   . MET A 1 28 ? -1.988  2.962   2.190   1.00 0.00 ? 24 MET A CE   1  
ATOM 175   H H    . MET A 1 28 ? -4.137  0.570   5.218   1.00 0.00 ? 24 MET A H    1  
ATOM 176   H HA   . MET A 1 28 ? -3.801  3.374   4.378   1.00 0.00 ? 24 MET A HA   1  
ATOM 177   H HB2  . MET A 1 28 ? -5.865  1.269   3.707   1.00 0.00 ? 24 MET A HB2  1  
ATOM 178   H HB3  . MET A 1 28 ? -6.026  2.948   3.229   1.00 0.00 ? 24 MET A HB3  1  
ATOM 179   H HG2  . MET A 1 28 ? -3.800  1.099   2.416   1.00 0.00 ? 24 MET A HG2  1  
ATOM 180   H HG3  . MET A 1 28 ? -5.193  1.518   1.427   1.00 0.00 ? 24 MET A HG3  1  
ATOM 181   H HE1  . MET A 1 28 ? -2.026  2.914   3.267   1.00 0.00 ? 24 MET A HE1  1  
ATOM 182   H HE2  . MET A 1 28 ? -1.315  3.747   1.885   1.00 0.00 ? 24 MET A HE2  1  
ATOM 183   H HE3  . MET A 1 28 ? -1.638  2.015   1.802   1.00 0.00 ? 24 MET A HE3  1  
ATOM 184   N N    . GLN A 1 29 ? -5.013  2.686   7.004   1.00 0.00 ? 25 GLN A N    1  
ATOM 185   C CA   . GLN A 1 29 ? -5.749  3.004   8.240   1.00 0.00 ? 25 GLN A CA   1  
ATOM 186   C C    . GLN A 1 29 ? -6.480  4.349   8.208   1.00 0.00 ? 25 GLN A C    1  
ATOM 187   O O    . GLN A 1 29 ? -7.698  4.404   8.423   1.00 0.00 ? 25 GLN A O    1  
ATOM 188   C CB   . GLN A 1 29 ? -4.781  2.975   9.423   1.00 0.00 ? 25 GLN A CB   1  
ATOM 189   C CG   . GLN A 1 29 ? -4.192  1.603   9.685   1.00 0.00 ? 25 GLN A CG   1  
ATOM 190   C CD   . GLN A 1 29 ? -3.047  1.659   10.663  1.00 0.00 ? 25 GLN A CD   1  
ATOM 191   O OE1  . GLN A 1 29 ? -1.892  1.839   10.275  1.00 0.00 ? 25 GLN A OE1  1  
ATOM 192   N NE2  . GLN A 1 29 ? -3.354  1.512   11.938  1.00 0.00 ? 25 GLN A NE2  1  
ATOM 193   H H    . GLN A 1 29 ? -4.198  2.155   7.082   1.00 0.00 ? 25 GLN A H    1  
ATOM 194   H HA   . GLN A 1 29 ? -6.484  2.227   8.382   1.00 0.00 ? 25 GLN A HA   1  
ATOM 195   H HB2  . GLN A 1 29 ? -3.966  3.660   9.228   1.00 0.00 ? 25 GLN A HB2  1  
ATOM 196   H HB3  . GLN A 1 29 ? -5.300  3.298   10.316  1.00 0.00 ? 25 GLN A HB3  1  
ATOM 197   H HG2  . GLN A 1 29 ? -4.964  0.964   10.093  1.00 0.00 ? 25 GLN A HG2  1  
ATOM 198   H HG3  . GLN A 1 29 ? -3.834  1.189   8.753   1.00 0.00 ? 25 GLN A HG3  1  
ATOM 199   H HE21 . GLN A 1 29 ? -4.295  1.377   12.179  1.00 0.00 ? 25 GLN A HE21 1  
ATOM 200   H HE22 . GLN A 1 29 ? -2.623  1.547   12.594  1.00 0.00 ? 25 GLN A HE22 1  
ATOM 201   N N    . GLN A 1 30 ? -5.733  5.431   7.989   1.00 0.00 ? 26 GLN A N    1  
ATOM 202   C CA   . GLN A 1 30 ? -6.280  6.792   7.934   1.00 0.00 ? 26 GLN A CA   1  
ATOM 203   C C    . GLN A 1 30 ? -7.352  7.012   6.853   1.00 0.00 ? 26 GLN A C    1  
ATOM 204   O O    . GLN A 1 30 ? -8.027  8.046   6.861   1.00 0.00 ? 26 GLN A O    1  
ATOM 205   C CB   . GLN A 1 30 ? -5.130  7.788   7.720   1.00 0.00 ? 26 GLN A CB   1  
ATOM 206   C CG   . GLN A 1 30 ? -4.407  7.658   6.378   1.00 0.00 ? 26 GLN A CG   1  
ATOM 207   C CD   . GLN A 1 30 ? -3.202  6.728   6.435   1.00 0.00 ? 26 GLN A CD   1  
ATOM 208   O OE1  . GLN A 1 30 ? -3.175  5.757   7.191   1.00 0.00 ? 26 GLN A OE1  1  
ATOM 209   N NE2  . GLN A 1 30 ? -2.188  7.029   5.637   1.00 0.00 ? 26 GLN A NE2  1  
ATOM 210   H H    . GLN A 1 30 ? -4.760  5.358   7.945   1.00 0.00 ? 26 GLN A H    1  
ATOM 211   H HA   . GLN A 1 30 ? -6.724  7.005   8.900   1.00 0.00 ? 26 GLN A HA   1  
ATOM 212   H HB2  . GLN A 1 30 ? -5.523  8.789   7.792   1.00 0.00 ? 26 GLN A HB2  1  
ATOM 213   H HB3  . GLN A 1 30 ? -4.402  7.645   8.508   1.00 0.00 ? 26 GLN A HB3  1  
ATOM 214   H HG2  . GLN A 1 30 ? -5.103  7.279   5.647   1.00 0.00 ? 26 GLN A HG2  1  
ATOM 215   H HG3  . GLN A 1 30 ? -4.066  8.638   6.076   1.00 0.00 ? 26 GLN A HG3  1  
ATOM 216   H HE21 . GLN A 1 30 ? -2.269  7.822   5.062   1.00 0.00 ? 26 GLN A HE21 1  
ATOM 217   H HE22 . GLN A 1 30 ? -1.395  6.450   5.652   1.00 0.00 ? 26 GLN A HE22 1  
ATOM 218   N N    . TYR A 1 31 ? -7.519  6.088   5.923   1.00 0.00 ? 27 TYR A N    1  
ATOM 219   C CA   . TYR A 1 31 ? -8.519  6.271   4.879   1.00 0.00 ? 27 TYR A CA   1  
ATOM 220   C C    . TYR A 1 31 ? -9.908  5.862   5.345   1.00 0.00 ? 27 TYR A C    1  
ATOM 221   O O    . TYR A 1 31 ? -10.897 6.436   4.899   1.00 0.00 ? 27 TYR A O    1  
ATOM 222   C CB   . TYR A 1 31 ? -8.132  5.517   3.615   1.00 0.00 ? 27 TYR A CB   1  
ATOM 223   C CG   . TYR A 1 31 ? -7.139  6.274   2.768   1.00 0.00 ? 27 TYR A CG   1  
ATOM 224   C CD1  . TYR A 1 31 ? -7.360  7.604   2.429   1.00 0.00 ? 27 TYR A CD1  1  
ATOM 225   C CD2  . TYR A 1 31 ? -5.984  5.669   2.309   1.00 0.00 ? 27 TYR A CD2  1  
ATOM 226   C CE1  . TYR A 1 31 ? -6.454  8.302   1.662   1.00 0.00 ? 27 TYR A CE1  1  
ATOM 227   C CE2  . TYR A 1 31 ? -5.074  6.359   1.540   1.00 0.00 ? 27 TYR A CE2  1  
ATOM 228   C CZ   . TYR A 1 31 ? -5.314  7.677   1.218   1.00 0.00 ? 27 TYR A CZ   1  
ATOM 229   O OH   . TYR A 1 31 ? -4.404  8.365   0.451   1.00 0.00 ? 27 TYR A OH   1  
ATOM 230   H H    . TYR A 1 31 ? -6.958  5.274   5.929   1.00 0.00 ? 27 TYR A H    1  
ATOM 231   H HA   . TYR A 1 31 ? -8.543  7.323   4.655   1.00 0.00 ? 27 TYR A HA   1  
ATOM 232   H HB2  . TYR A 1 31 ? -7.694  4.568   3.886   1.00 0.00 ? 27 TYR A HB2  1  
ATOM 233   H HB3  . TYR A 1 31 ? -9.018  5.346   3.024   1.00 0.00 ? 27 TYR A HB3  1  
ATOM 234   H HD1  . TYR A 1 31 ? -8.258  8.094   2.774   1.00 0.00 ? 27 TYR A HD1  1  
ATOM 235   H HD2  . TYR A 1 31 ? -5.798  4.640   2.558   1.00 0.00 ? 27 TYR A HD2  1  
ATOM 236   H HE1  . TYR A 1 31 ? -6.642  9.332   1.409   1.00 0.00 ? 27 TYR A HE1  1  
ATOM 237   H HE2  . TYR A 1 31 ? -4.176  5.861   1.195   1.00 0.00 ? 27 TYR A HE2  1  
ATOM 238   H HH   . TYR A 1 31 ? -4.164  7.831   -0.309  1.00 0.00 ? 27 TYR A HH   1  
ATOM 239   N N    . THR A 1 32 ? -9.972  4.852   6.210   1.00 0.00 ? 28 THR A N    1  
ATOM 240   C CA   . THR A 1 32 ? -11.234 4.367   6.782   1.00 0.00 ? 28 THR A CA   1  
ATOM 241   C C    . THR A 1 32 ? -12.184 5.512   7.154   1.00 0.00 ? 28 THR A C    1  
ATOM 242   O O    . THR A 1 32 ? -13.398 5.430   6.950   1.00 0.00 ? 28 THR A O    1  
ATOM 243   C CB   . THR A 1 32 ? -10.930 3.529   8.041   1.00 0.00 ? 28 THR A CB   1  
ATOM 244   O OG1  . THR A 1 32 ? -9.741  2.755   7.829   1.00 0.00 ? 28 THR A OG1  1  
ATOM 245   C CG2  . THR A 1 32 ? -12.083 2.599   8.396   1.00 0.00 ? 28 THR A CG2  1  
ATOM 246   H H    . THR A 1 32 ? -9.158  4.351   6.416   1.00 0.00 ? 28 THR A H    1  
ATOM 247   H HA   . THR A 1 32 ? -11.717 3.734   6.059   1.00 0.00 ? 28 THR A HA   1  
ATOM 248   H HB   . THR A 1 32 ? -10.763 4.203   8.867   1.00 0.00 ? 28 THR A HB   1  
ATOM 249   H HG1  . THR A 1 32 ? -9.008  3.177   8.288   1.00 0.00 ? 28 THR A HG1  1  
ATOM 250   H HG21 . THR A 1 32 ? -12.191 1.850   7.630   1.00 0.00 ? 28 THR A HG21 1  
ATOM 251   H HG22 . THR A 1 32 ? -12.997 3.170   8.472   1.00 0.00 ? 28 THR A HG22 1  
ATOM 252   H HG23 . THR A 1 32 ? -11.883 2.119   9.345   1.00 0.00 ? 28 THR A HG23 1  
ATOM 253   N N    . GLU A 1 33 ? -11.597 6.575   7.676   1.00 0.00 ? 29 GLU A N    1  
ATOM 254   C CA   . GLU A 1 33 ? -12.339 7.755   8.083   1.00 0.00 ? 29 GLU A CA   1  
ATOM 255   C C    . GLU A 1 33 ? -13.108 8.349   6.909   1.00 0.00 ? 29 GLU A C    1  
ATOM 256   O O    . GLU A 1 33 ? -14.322 8.558   6.983   1.00 0.00 ? 29 GLU A O    1  
ATOM 257   C CB   . GLU A 1 33 ? -11.373 8.788   8.658   1.00 0.00 ? 29 GLU A CB   1  
ATOM 258   C CG   . GLU A 1 33 ? -10.475 8.216   9.745   1.00 0.00 ? 29 GLU A CG   1  
ATOM 259   C CD   . GLU A 1 33 ? -9.191  8.991   9.926   1.00 0.00 ? 29 GLU A CD   1  
ATOM 260   O OE1  . GLU A 1 33 ? -9.183  10.209  9.662   1.00 0.00 ? 29 GLU A OE1  1  
ATOM 261   O OE2  . GLU A 1 33 ? -8.181  8.385   10.352  1.00 0.00 ? 29 GLU A OE2  1  
ATOM 262   H H    . GLU A 1 33 ? -10.625 6.546   7.781   1.00 0.00 ? 29 GLU A H    1  
ATOM 263   H HA   . GLU A 1 33 ? -13.037 7.458   8.848   1.00 0.00 ? 29 GLU A HA   1  
ATOM 264   H HB2  . GLU A 1 33 ? -10.750 9.167   7.858   1.00 0.00 ? 29 GLU A HB2  1  
ATOM 265   H HB3  . GLU A 1 33 ? -11.940 9.602   9.075   1.00 0.00 ? 29 GLU A HB3  1  
ATOM 266   H HG2  . GLU A 1 33 ? -11.018 8.225   10.678  1.00 0.00 ? 29 GLU A HG2  1  
ATOM 267   H HG3  . GLU A 1 33 ? -10.230 7.195   9.487   1.00 0.00 ? 29 GLU A HG3  1  
ATOM 268   N N    . HIS A 1 34 ? -12.399 8.596   5.819   1.00 0.00 ? 30 HIS A N    1  
ATOM 269   C CA   . HIS A 1 34 ? -13.005 9.181   4.622   1.00 0.00 ? 30 HIS A CA   1  
ATOM 270   C C    . HIS A 1 34 ? -13.896 8.177   3.908   1.00 0.00 ? 30 HIS A C    1  
ATOM 271   O O    . HIS A 1 34 ? -14.941 8.536   3.367   1.00 0.00 ? 30 HIS A O    1  
ATOM 272   C CB   . HIS A 1 34 ? -11.929 9.680   3.654   1.00 0.00 ? 30 HIS A CB   1  
ATOM 273   C CG   . HIS A 1 34 ? -10.968 10.665  4.263   1.00 0.00 ? 30 HIS A CG   1  
ATOM 274   N ND1  . HIS A 1 34 ? -9.720  10.318  4.740   1.00 0.00 ? 30 HIS A ND1  1  
ATOM 275   C CD2  . HIS A 1 34 ? -11.089 12.001  4.464   1.00 0.00 ? 30 HIS A CD2  1  
ATOM 276   C CE1  . HIS A 1 34 ? -9.137  11.425  5.210   1.00 0.00 ? 30 HIS A CE1  1  
ATOM 277   N NE2  . HIS A 1 34 ? -9.926  12.476  5.065   1.00 0.00 ? 30 HIS A NE2  1  
ATOM 278   H H    . HIS A 1 34 ? -11.442 8.393   5.819   1.00 0.00 ? 30 HIS A H    1  
ATOM 279   H HA   . HIS A 1 34 ? -13.607 10.019  4.934   1.00 0.00 ? 30 HIS A HA   1  
ATOM 280   H HB2  . HIS A 1 34 ? -11.361 8.834   3.289   1.00 0.00 ? 30 HIS A HB2  1  
ATOM 281   H HB3  . HIS A 1 34 ? -12.417 10.163  2.819   1.00 0.00 ? 30 HIS A HB3  1  
ATOM 282   H HD1  . HIS A 1 34 ? -9.331  9.417   4.738   1.00 0.00 ? 30 HIS A HD1  1  
ATOM 283   H HD2  . HIS A 1 34 ? -11.945 12.610  4.201   1.00 0.00 ? 30 HIS A HD2  1  
ATOM 284   H HE1  . HIS A 1 34 ? -8.146  11.456  5.643   1.00 0.00 ? 30 HIS A HE1  1  
ATOM 285   N N    . PHE A 1 35 ? -13.475 6.913   3.919   1.00 0.00 ? 31 PHE A N    1  
ATOM 286   C CA   . PHE A 1 35 ? -14.216 5.838   3.268   1.00 0.00 ? 31 PHE A CA   1  
ATOM 287   C C    . PHE A 1 35 ? -15.635 5.766   3.797   1.00 0.00 ? 31 PHE A C    1  
ATOM 288   O O    . PHE A 1 35 ? -16.594 5.958   3.050   1.00 0.00 ? 31 PHE A O    1  
ATOM 289   C CB   . PHE A 1 35 ? -13.518 4.502   3.494   1.00 0.00 ? 31 PHE A CB   1  
ATOM 290   C CG   . PHE A 1 35 ? -12.791 4.002   2.283   1.00 0.00 ? 31 PHE A CG   1  
ATOM 291   C CD1  . PHE A 1 35 ? -13.481 3.406   1.242   1.00 0.00 ? 31 PHE A CD1  1  
ATOM 292   C CD2  . PHE A 1 35 ? -11.416 4.130   2.184   1.00 0.00 ? 31 PHE A CD2  1  
ATOM 293   C CE1  . PHE A 1 35 ? -12.815 2.948   0.120   1.00 0.00 ? 31 PHE A CE1  1  
ATOM 294   C CE2  . PHE A 1 35 ? -10.742 3.676   1.067   1.00 0.00 ? 31 PHE A CE2  1  
ATOM 295   C CZ   . PHE A 1 35 ? -11.443 3.082   0.033   1.00 0.00 ? 31 PHE A CZ   1  
ATOM 296   H H    . PHE A 1 35 ? -12.642 6.693   4.386   1.00 0.00 ? 31 PHE A H    1  
ATOM 297   H HA   . PHE A 1 35 ? -14.245 6.041   2.204   1.00 0.00 ? 31 PHE A HA   1  
ATOM 298   H HB2  . PHE A 1 35 ? -12.800 4.614   4.292   1.00 0.00 ? 31 PHE A HB2  1  
ATOM 299   H HB3  . PHE A 1 35 ? -14.253 3.761   3.776   1.00 0.00 ? 31 PHE A HB3  1  
ATOM 300   H HD1  . PHE A 1 35 ? -14.554 3.302   1.311   1.00 0.00 ? 31 PHE A HD1  1  
ATOM 301   H HD2  . PHE A 1 35 ? -10.869 4.592   2.992   1.00 0.00 ? 31 PHE A HD2  1  
ATOM 302   H HE1  . PHE A 1 35 ? -13.365 2.488   -0.685  1.00 0.00 ? 31 PHE A HE1  1  
ATOM 303   H HE2  . PHE A 1 35 ? -9.670  3.785   1.001   1.00 0.00 ? 31 PHE A HE2  1  
ATOM 304   H HZ   . PHE A 1 35 ? -10.921 2.729   -0.842  1.00 0.00 ? 31 PHE A HZ   1  
ATOM 305   N N    . MET A 1 36 ? -15.758 5.484   5.091   1.00 0.00 ? 32 MET A N    1  
ATOM 306   C CA   . MET A 1 36 ? -17.061 5.390   5.743   1.00 0.00 ? 32 MET A CA   1  
ATOM 307   C C    . MET A 1 36 ? -17.869 6.677   5.584   1.00 0.00 ? 32 MET A C    1  
ATOM 308   O O    . MET A 1 36 ? -19.094 6.635   5.462   1.00 0.00 ? 32 MET A O    1  
ATOM 309   C CB   . MET A 1 36 ? -16.883 5.055   7.228   1.00 0.00 ? 32 MET A CB   1  
ATOM 310   C CG   . MET A 1 36 ? -16.265 3.685   7.466   1.00 0.00 ? 32 MET A CG   1  
ATOM 311   S SD   . MET A 1 36 ? -16.412 3.125   9.175   1.00 0.00 ? 32 MET A SD   1  
ATOM 312   C CE   . MET A 1 36 ? -15.678 1.495   9.050   1.00 0.00 ? 32 MET A CE   1  
ATOM 313   H H    . MET A 1 36 ? -14.953 5.274   5.615   1.00 0.00 ? 32 MET A H    1  
ATOM 314   H HA   . MET A 1 36 ? -17.605 4.588   5.270   1.00 0.00 ? 32 MET A HA   1  
ATOM 315   H HB2  . MET A 1 36 ? -16.241 5.797   7.676   1.00 0.00 ? 32 MET A HB2  1  
ATOM 316   H HB3  . MET A 1 36 ? -17.847 5.085   7.713   1.00 0.00 ? 32 MET A HB3  1  
ATOM 317   H HG2  . MET A 1 36 ? -16.758 2.968   6.829   1.00 0.00 ? 32 MET A HG2  1  
ATOM 318   H HG3  . MET A 1 36 ? -15.219 3.731   7.209   1.00 0.00 ? 32 MET A HG3  1  
ATOM 319   H HE1  . MET A 1 36 ? -14.686 1.577   8.632   1.00 0.00 ? 32 MET A HE1  1  
ATOM 320   H HE2  . MET A 1 36 ? -16.287 0.876   8.409   1.00 0.00 ? 32 MET A HE2  1  
ATOM 321   H HE3  . MET A 1 36 ? -15.620 1.049   10.031  1.00 0.00 ? 32 MET A HE3  1  
ATOM 322   N N    . ALA A 1 37 ? -17.183 7.820   5.566   1.00 0.00 ? 33 ALA A N    1  
ATOM 323   C CA   . ALA A 1 37 ? -17.847 9.110   5.420   1.00 0.00 ? 33 ALA A CA   1  
ATOM 324   C C    . ALA A 1 37 ? -18.449 9.271   4.030   1.00 0.00 ? 33 ALA A C    1  
ATOM 325   O O    . ALA A 1 37 ? -19.441 9.977   3.853   1.00 0.00 ? 33 ALA A O    1  
ATOM 326   C CB   . ALA A 1 37 ? -16.863 10.239  5.687   1.00 0.00 ? 33 ALA A CB   1  
ATOM 327   H H    . ALA A 1 37 ? -16.208 7.807   5.657   1.00 0.00 ? 33 ALA A H    1  
ATOM 328   H HA   . ALA A 1 37 ? -18.637 9.167   6.155   1.00 0.00 ? 33 ALA A HA   1  
ATOM 329   H HB1  . ALA A 1 37 ? -16.273 10.003  6.560   1.00 0.00 ? 33 ALA A HB1  1  
ATOM 330   H HB2  . ALA A 1 37 ? -17.404 11.157  5.855   1.00 0.00 ? 33 ALA A HB2  1  
ATOM 331   H HB3  . ALA A 1 37 ? -16.211 10.357  4.834   1.00 0.00 ? 33 ALA A HB3  1  
ATOM 332   N N    . ALA A 1 38 ? -17.853 8.600   3.053   1.00 0.00 ? 34 ALA A N    1  
ATOM 333   C CA   . ALA A 1 38 ? -18.315 8.680   1.676   1.00 0.00 ? 34 ALA A CA   1  
ATOM 334   C C    . ALA A 1 38 ? -19.402 7.646   1.375   1.00 0.00 ? 34 ALA A C    1  
ATOM 335   O O    . ALA A 1 38 ? -19.711 7.387   0.211   1.00 0.00 ? 34 ALA A O    1  
ATOM 336   C CB   . ALA A 1 38 ? -17.141 8.514   0.725   1.00 0.00 ? 34 ALA A CB   1  
ATOM 337   H H    . ALA A 1 38 ? -17.076 8.038   3.265   1.00 0.00 ? 34 ALA A H    1  
ATOM 338   H HA   . ALA A 1 38 ? -18.727 9.667   1.523   1.00 0.00 ? 34 ALA A HA   1  
ATOM 339   H HB1  . ALA A 1 38 ? -16.366 9.223   0.982   1.00 0.00 ? 34 ALA A HB1  1  
ATOM 340   H HB2  . ALA A 1 38 ? -17.469 8.692   -0.288  1.00 0.00 ? 34 ALA A HB2  1  
ATOM 341   H HB3  . ALA A 1 38 ? -16.751 7.510   0.807   1.00 0.00 ? 34 ALA A HB3  1  
ATOM 342   N N    . GLY A 1 39 ? -19.982 7.064   2.421   1.00 0.00 ? 35 GLY A N    1  
ATOM 343   C CA   . GLY A 1 39 ? -21.038 6.085   2.237   1.00 0.00 ? 35 GLY A CA   1  
ATOM 344   C C    . GLY A 1 39 ? -20.548 4.661   2.054   1.00 0.00 ? 35 GLY A C    1  
ATOM 345   O O    . GLY A 1 39 ? -21.339 3.718   2.134   1.00 0.00 ? 35 GLY A O    1  
ATOM 346   H H    . GLY A 1 39 ? -19.730 7.339   3.331   1.00 0.00 ? 35 GLY A H    1  
ATOM 347   H HA2  . GLY A 1 39 ? -21.687 6.115   3.097   1.00 0.00 ? 35 GLY A HA2  1  
ATOM 348   H HA3  . GLY A 1 39 ? -21.610 6.366   1.366   1.00 0.00 ? 35 GLY A HA3  1  
ATOM 349   N N    . TYR A 1 40 ? -19.256 4.477   1.826   1.00 0.00 ? 36 TYR A N    1  
ATOM 350   C CA   . TYR A 1 40 ? -18.708 3.143   1.622   1.00 0.00 ? 36 TYR A CA   1  
ATOM 351   C C    . TYR A 1 40 ? -18.310 2.517   2.957   1.00 0.00 ? 36 TYR A C    1  
ATOM 352   O O    . TYR A 1 40 ? -17.150 2.185   3.196   1.00 0.00 ? 36 TYR A O    1  
ATOM 353   C CB   . TYR A 1 40 ? -17.528 3.212   0.648   1.00 0.00 ? 36 TYR A CB   1  
ATOM 354   C CG   . TYR A 1 40 ? -17.896 3.887   -0.658  1.00 0.00 ? 36 TYR A CG   1  
ATOM 355   C CD1  . TYR A 1 40 ? -18.822 3.310   -1.520  1.00 0.00 ? 36 TYR A CD1  1  
ATOM 356   C CD2  . TYR A 1 40 ? -17.337 5.107   -1.019  1.00 0.00 ? 36 TYR A CD2  1  
ATOM 357   C CE1  . TYR A 1 40 ? -19.181 3.929   -2.702  1.00 0.00 ? 36 TYR A CE1  1  
ATOM 358   C CE2  . TYR A 1 40 ? -17.690 5.730   -2.204  1.00 0.00 ? 36 TYR A CE2  1  
ATOM 359   C CZ   . TYR A 1 40 ? -18.613 5.136   -3.041  1.00 0.00 ? 36 TYR A CZ   1  
ATOM 360   O OH   . TYR A 1 40 ? -18.978 5.755   -4.217  1.00 0.00 ? 36 TYR A OH   1  
ATOM 361   H H    . TYR A 1 40 ? -18.645 5.243   1.797   1.00 0.00 ? 36 TYR A H    1  
ATOM 362   H HA   . TYR A 1 40 ? -19.487 2.537   1.181   1.00 0.00 ? 36 TYR A HA   1  
ATOM 363   H HB2  . TYR A 1 40 ? -16.723 3.772   1.102   1.00 0.00 ? 36 TYR A HB2  1  
ATOM 364   H HB3  . TYR A 1 40 ? -17.188 2.211   0.426   1.00 0.00 ? 36 TYR A HB3  1  
ATOM 365   H HD1  . TYR A 1 40 ? -19.265 2.361   -1.254  1.00 0.00 ? 36 TYR A HD1  1  
ATOM 366   H HD2  . TYR A 1 40 ? -16.615 5.569   -0.364  1.00 0.00 ? 36 TYR A HD2  1  
ATOM 367   H HE1  . TYR A 1 40 ? -19.903 3.464   -3.358  1.00 0.00 ? 36 TYR A HE1  1  
ATOM 368   H HE2  . TYR A 1 40 ? -17.244 6.678   -2.469  1.00 0.00 ? 36 TYR A HE2  1  
ATOM 369   H HH   . TYR A 1 40 ? -18.185 5.974   -4.731  1.00 0.00 ? 36 TYR A HH   1  
ATOM 370   N N    . THR A 1 41 ? -19.305 2.379   3.824   1.00 0.00 ? 37 THR A N    1  
ATOM 371   C CA   . THR A 1 41 ? -19.126 1.811   5.152   1.00 0.00 ? 37 THR A CA   1  
ATOM 372   C C    . THR A 1 41 ? -19.111 0.282   5.130   1.00 0.00 ? 37 THR A C    1  
ATOM 373   O O    . THR A 1 41 ? -18.546 -0.355  6.021   1.00 0.00 ? 37 THR A O    1  
ATOM 374   C CB   . THR A 1 41 ? -20.265 2.283   6.071   1.00 0.00 ? 37 THR A CB   1  
ATOM 375   O OG1  . THR A 1 41 ? -20.971 3.363   5.441   1.00 0.00 ? 37 THR A OG1  1  
ATOM 376   C CG2  . THR A 1 41 ? -19.735 2.736   7.422   1.00 0.00 ? 37 THR A CG2  1  
ATOM 377   H H    . THR A 1 41 ? -20.197 2.706   3.572   1.00 0.00 ? 37 THR A H    1  
ATOM 378   H HA   . THR A 1 41 ? -18.192 2.172   5.555   1.00 0.00 ? 37 THR A HA   1  
ATOM 379   H HB   . THR A 1 41 ? -20.946 1.458   6.224   1.00 0.00 ? 37 THR A HB   1  
ATOM 380   H HG1  . THR A 1 41 ? -20.979 4.130   6.028   1.00 0.00 ? 37 THR A HG1  1  
ATOM 381   H HG21 . THR A 1 41 ? -20.561 3.023   8.055   1.00 0.00 ? 37 THR A HG21 1  
ATOM 382   H HG22 . THR A 1 41 ? -19.075 3.578   7.284   1.00 0.00 ? 37 THR A HG22 1  
ATOM 383   H HG23 . THR A 1 41 ? -19.192 1.925   7.886   1.00 0.00 ? 37 THR A HG23 1  
ATOM 384   N N    . ALA A 1 42 ? -19.747 -0.301  4.123   1.00 0.00 ? 38 ALA A N    1  
ATOM 385   C CA   . ALA A 1 42 ? -19.813 -1.754  4.008   1.00 0.00 ? 38 ALA A CA   1  
ATOM 386   C C    . ALA A 1 42 ? -19.157 -2.263  2.727   1.00 0.00 ? 38 ALA A C    1  
ATOM 387   O O    . ALA A 1 42 ? -19.210 -1.606  1.684   1.00 0.00 ? 38 ALA A O    1  
ATOM 388   C CB   . ALA A 1 42 ? -21.254 -2.220  4.101   1.00 0.00 ? 38 ALA A CB   1  
ATOM 389   H H    . ALA A 1 42 ? -20.196 0.261   3.462   1.00 0.00 ? 38 ALA A H    1  
ATOM 390   H HA   . ALA A 1 42 ? -19.279 -2.169  4.852   1.00 0.00 ? 38 ALA A HA   1  
ATOM 391   H HB1  . ALA A 1 42 ? -21.749 -2.048  3.157   1.00 0.00 ? 38 ALA A HB1  1  
ATOM 392   H HB2  . ALA A 1 42 ? -21.761 -1.668  4.878   1.00 0.00 ? 38 ALA A HB2  1  
ATOM 393   H HB3  . ALA A 1 42 ? -21.279 -3.275  4.333   1.00 0.00 ? 38 ALA A HB3  1  
ATOM 394   N N    . ILE A 1 43 ? -18.527 -3.436  2.842   1.00 0.00 ? 39 ILE A N    1  
ATOM 395   C CA   . ILE A 1 43 ? -17.820 -4.100  1.736   1.00 0.00 ? 39 ILE A CA   1  
ATOM 396   C C    . ILE A 1 43 ? -18.586 -4.069  0.412   1.00 0.00 ? 39 ILE A C    1  
ATOM 397   O O    . ILE A 1 43 ? -18.022 -3.684  -0.612  1.00 0.00 ? 39 ILE A O    1  
ATOM 398   C CB   . ILE A 1 43 ? -17.486 -5.571  2.088   1.00 0.00 ? 39 ILE A CB   1  
ATOM 399   C CG1  . ILE A 1 43 ? -16.500 -5.636  3.260   1.00 0.00 ? 39 ILE A CG1  1  
ATOM 400   C CG2  . ILE A 1 43 ? -16.920 -6.310  0.878   1.00 0.00 ? 39 ILE A CG2  1  
ATOM 401   C CD1  . ILE A 1 43 ? -15.143 -5.025  2.959   1.00 0.00 ? 39 ILE A CD1  1  
ATOM 402   H H    . ILE A 1 43 ? -18.497 -3.853  3.727   1.00 0.00 ? 39 ILE A H    1  
ATOM 403   H HA   . ILE A 1 43 ? -16.885 -3.580  1.596   1.00 0.00 ? 39 ILE A HA   1  
ATOM 404   H HB   . ILE A 1 43 ? -18.404 -6.063  2.376   1.00 0.00 ? 39 ILE A HB   1  
ATOM 405   H HG12 . ILE A 1 43 ? -16.919 -5.108  4.103   1.00 0.00 ? 39 ILE A HG12 1  
ATOM 406   H HG13 . ILE A 1 43 ? -16.344 -6.670  3.532   1.00 0.00 ? 39 ILE A HG13 1  
ATOM 407   H HG21 . ILE A 1 43 ? -16.667 -7.323  1.158   1.00 0.00 ? 39 ILE A HG21 1  
ATOM 408   H HG22 . ILE A 1 43 ? -16.032 -5.802  0.529   1.00 0.00 ? 39 ILE A HG22 1  
ATOM 409   H HG23 . ILE A 1 43 ? -17.656 -6.329  0.088   1.00 0.00 ? 39 ILE A HG23 1  
ATOM 410   H HD11 . ILE A 1 43 ? -15.243 -3.957  2.852   1.00 0.00 ? 39 ILE A HD11 1  
ATOM 411   H HD12 . ILE A 1 43 ? -14.755 -5.443  2.041   1.00 0.00 ? 39 ILE A HD12 1  
ATOM 412   H HD13 . ILE A 1 43 ? -14.462 -5.244  3.769   1.00 0.00 ? 39 ILE A HD13 1  
ATOM 413   N N    . GLU A 1 44 ? -19.856 -4.478  0.427   1.00 0.00 ? 40 GLU A N    1  
ATOM 414   C CA   . GLU A 1 44 ? -20.671 -4.504  -0.795  1.00 0.00 ? 40 GLU A CA   1  
ATOM 415   C C    . GLU A 1 44 ? -20.642 -3.168  -1.535  1.00 0.00 ? 40 GLU A C    1  
ATOM 416   O O    . GLU A 1 44 ? -20.743 -3.134  -2.757  1.00 0.00 ? 40 GLU A O    1  
ATOM 417   C CB   . GLU A 1 44 ? -22.127 -4.895  -0.503  1.00 0.00 ? 40 GLU A CB   1  
ATOM 418   C CG   . GLU A 1 44 ? -22.359 -5.490  0.876   1.00 0.00 ? 40 GLU A CG   1  
ATOM 419   C CD   . GLU A 1 44 ? -22.795 -4.447  1.880   1.00 0.00 ? 40 GLU A CD   1  
ATOM 420   O OE1  . GLU A 1 44 ? -22.712 -3.245  1.562   1.00 0.00 ? 40 GLU A OE1  1  
ATOM 421   O OE2  . GLU A 1 44 ? -23.224 -4.829  2.989   1.00 0.00 ? 40 GLU A OE2  1  
ATOM 422   H H    . GLU A 1 44 ? -20.245 -4.807  1.261   1.00 0.00 ? 40 GLU A H    1  
ATOM 423   H HA   . GLU A 1 44 ? -20.242 -5.254  -1.444  1.00 0.00 ? 40 GLU A HA   1  
ATOM 424   H HB2  . GLU A 1 44 ? -22.745 -4.016  -0.595  1.00 0.00 ? 40 GLU A HB2  1  
ATOM 425   H HB3  . GLU A 1 44 ? -22.444 -5.620  -1.239  1.00 0.00 ? 40 GLU A HB3  1  
ATOM 426   H HG2  . GLU A 1 44 ? -23.129 -6.244  0.805   1.00 0.00 ? 40 GLU A HG2  1  
ATOM 427   H HG3  . GLU A 1 44 ? -21.443 -5.942  1.222   1.00 0.00 ? 40 GLU A HG3  1  
ATOM 428   N N    . LYS A 1 45 ? -20.523 -2.069  -0.803  1.00 0.00 ? 41 LYS A N    1  
ATOM 429   C CA   . LYS A 1 45 ? -20.468 -0.750  -1.424  1.00 0.00 ? 41 LYS A CA   1  
ATOM 430   C C    . LYS A 1 45 ? -19.029 -0.389  -1.786  1.00 0.00 ? 41 LYS A C    1  
ATOM 431   O O    . LYS A 1 45 ? -18.778 0.296   -2.778  1.00 0.00 ? 41 LYS A O    1  
ATOM 432   C CB   . LYS A 1 45 ? -21.064 0.303   -0.489  1.00 0.00 ? 41 LYS A CB   1  
ATOM 433   C CG   . LYS A 1 45 ? -22.528 0.062   -0.168  1.00 0.00 ? 41 LYS A CG   1  
ATOM 434   C CD   . LYS A 1 45 ? -22.800 0.163   1.323   1.00 0.00 ? 41 LYS A CD   1  
ATOM 435   C CE   . LYS A 1 45 ? -24.236 -0.218  1.657   1.00 0.00 ? 41 LYS A CE   1  
ATOM 436   N NZ   . LYS A 1 45 ? -24.611 -1.540  1.088   1.00 0.00 ? 41 LYS A NZ   1  
ATOM 437   H H    . LYS A 1 45 ? -20.493 -2.136  0.176   1.00 0.00 ? 41 LYS A H    1  
ATOM 438   H HA   . LYS A 1 45 ? -21.055 -0.788  -2.331  1.00 0.00 ? 41 LYS A HA   1  
ATOM 439   H HB2  . LYS A 1 45 ? -20.507 0.303   0.437   1.00 0.00 ? 41 LYS A HB2  1  
ATOM 440   H HB3  . LYS A 1 45 ? -20.974 1.274   -0.953  1.00 0.00 ? 41 LYS A HB3  1  
ATOM 441   H HG2  . LYS A 1 45 ? -23.126 0.798   -0.683  1.00 0.00 ? 41 LYS A HG2  1  
ATOM 442   H HG3  . LYS A 1 45 ? -22.802 -0.927  -0.508  1.00 0.00 ? 41 LYS A HG3  1  
ATOM 443   H HD2  . LYS A 1 45 ? -22.131 -0.502  1.847   1.00 0.00 ? 41 LYS A HD2  1  
ATOM 444   H HD3  . LYS A 1 45 ? -22.624 1.180   1.642   1.00 0.00 ? 41 LYS A HD3  1  
ATOM 445   H HE2  . LYS A 1 45 ? -24.341 -0.258  2.731   1.00 0.00 ? 41 LYS A HE2  1  
ATOM 446   H HE3  . LYS A 1 45 ? -24.898 0.537   1.260   1.00 0.00 ? 41 LYS A HE3  1  
ATOM 447   H HZ1  . LYS A 1 45 ? -23.870 -2.248  1.305   1.00 0.00 ? 41 LYS A HZ1  1  
ATOM 448   H HZ2  . LYS A 1 45 ? -24.717 -1.471  0.057   1.00 0.00 ? 41 LYS A HZ2  1  
ATOM 449   H HZ3  . LYS A 1 45 ? -25.512 -1.866  1.495   1.00 0.00 ? 41 LYS A HZ3  1  
ATOM 450   N N    . VAL A 1 46 ? -18.091 -0.875  -0.983  1.00 0.00 ? 42 VAL A N    1  
ATOM 451   C CA   . VAL A 1 46 ? -16.670 -0.619  -1.199  1.00 0.00 ? 42 VAL A CA   1  
ATOM 452   C C    . VAL A 1 46 ? -16.194 -1.253  -2.504  1.00 0.00 ? 42 VAL A C    1  
ATOM 453   O O    . VAL A 1 46 ? -15.374 -0.687  -3.221  1.00 0.00 ? 42 VAL A O    1  
ATOM 454   C CB   . VAL A 1 46 ? -15.825 -1.163  -0.025  1.00 0.00 ? 42 VAL A CB   1  
ATOM 455   C CG1  . VAL A 1 46 ? -14.337 -0.984  -0.285  1.00 0.00 ? 42 VAL A CG1  1  
ATOM 456   C CG2  . VAL A 1 46 ? -16.220 -0.485  1.275   1.00 0.00 ? 42 VAL A CG2  1  
ATOM 457   H H    . VAL A 1 46 ? -18.362 -1.428  -0.219  1.00 0.00 ? 42 VAL A H    1  
ATOM 458   H HA   . VAL A 1 46 ? -16.527 0.451   -1.255  1.00 0.00 ? 42 VAL A HA   1  
ATOM 459   H HB   . VAL A 1 46 ? -16.025 -2.220  0.073   1.00 0.00 ? 42 VAL A HB   1  
ATOM 460   H HG11 . VAL A 1 46 ? -13.780 -1.271  0.594   1.00 0.00 ? 42 VAL A HG11 1  
ATOM 461   H HG12 . VAL A 1 46 ? -14.136 0.050   -0.519  1.00 0.00 ? 42 VAL A HG12 1  
ATOM 462   H HG13 . VAL A 1 46 ? -14.042 -1.605  -1.118  1.00 0.00 ? 42 VAL A HG13 1  
ATOM 463   H HG21 . VAL A 1 46 ? -17.294 -0.516  1.385   1.00 0.00 ? 42 VAL A HG21 1  
ATOM 464   H HG22 . VAL A 1 46 ? -15.889 0.543   1.260   1.00 0.00 ? 42 VAL A HG22 1  
ATOM 465   H HG23 . VAL A 1 46 ? -15.760 -1.000  2.104   1.00 0.00 ? 42 VAL A HG23 1  
ATOM 466   N N    . VAL A 1 47 ? -16.729 -2.422  -2.821  1.00 0.00 ? 43 VAL A N    1  
ATOM 467   C CA   . VAL A 1 47 ? -16.348 -3.119  -4.043  1.00 0.00 ? 43 VAL A CA   1  
ATOM 468   C C    . VAL A 1 47 ? -16.988 -2.475  -5.273  1.00 0.00 ? 43 VAL A C    1  
ATOM 469   O O    . VAL A 1 47 ? -16.638 -2.801  -6.408  1.00 0.00 ? 43 VAL A O    1  
ATOM 470   C CB   . VAL A 1 47 ? -16.720 -4.616  -3.993  1.00 0.00 ? 43 VAL A CB   1  
ATOM 471   C CG1  . VAL A 1 47 ? -16.020 -5.300  -2.830  1.00 0.00 ? 43 VAL A CG1  1  
ATOM 472   C CG2  . VAL A 1 47 ? -18.227 -4.803  -3.900  1.00 0.00 ? 43 VAL A CG2  1  
ATOM 473   H H    . VAL A 1 47 ? -17.387 -2.831  -2.215  1.00 0.00 ? 43 VAL A H    1  
ATOM 474   H HA   . VAL A 1 47 ? -15.275 -3.044  -4.138  1.00 0.00 ? 43 VAL A HA   1  
ATOM 475   H HB   . VAL A 1 47 ? -16.379 -5.077  -4.908  1.00 0.00 ? 43 VAL A HB   1  
ATOM 476   H HG11 . VAL A 1 47 ? -14.950 -5.191  -2.939  1.00 0.00 ? 43 VAL A HG11 1  
ATOM 477   H HG12 . VAL A 1 47 ? -16.276 -6.349  -2.820  1.00 0.00 ? 43 VAL A HG12 1  
ATOM 478   H HG13 . VAL A 1 47 ? -16.334 -4.844  -1.903  1.00 0.00 ? 43 VAL A HG13 1  
ATOM 479   H HG21 . VAL A 1 47 ? -18.592 -4.352  -2.989  1.00 0.00 ? 43 VAL A HG21 1  
ATOM 480   H HG22 . VAL A 1 47 ? -18.460 -5.859  -3.898  1.00 0.00 ? 43 VAL A HG22 1  
ATOM 481   H HG23 . VAL A 1 47 ? -18.701 -4.333  -4.749  1.00 0.00 ? 43 VAL A HG23 1  
ATOM 482   N N    . GLN A 1 48 ? -17.911 -1.551  -5.049  1.00 0.00 ? 44 GLN A N    1  
ATOM 483   C CA   . GLN A 1 48 ? -18.583 -0.877  -6.147  1.00 0.00 ? 44 GLN A CA   1  
ATOM 484   C C    . GLN A 1 48 ? -17.720 0.254   -6.686  1.00 0.00 ? 44 GLN A C    1  
ATOM 485   O O    . GLN A 1 48 ? -17.389 0.273   -7.872  1.00 0.00 ? 44 GLN A O    1  
ATOM 486   C CB   . GLN A 1 48 ? -19.941 -0.332  -5.703  1.00 0.00 ? 44 GLN A CB   1  
ATOM 487   C CG   . GLN A 1 48 ? -20.895 -1.412  -5.230  1.00 0.00 ? 44 GLN A CG   1  
ATOM 488   C CD   . GLN A 1 48 ? -22.286 -0.885  -4.950  1.00 0.00 ? 44 GLN A CD   1  
ATOM 489   O OE1  . GLN A 1 48 ? -22.747 0.062   -5.585  1.00 0.00 ? 44 GLN A OE1  1  
ATOM 490   N NE2  . GLN A 1 48 ? -22.960 -1.493  -3.989  1.00 0.00 ? 44 GLN A NE2  1  
ATOM 491   H H    . GLN A 1 48 ? -18.137 -1.312  -4.125  1.00 0.00 ? 44 GLN A H    1  
ATOM 492   H HA   . GLN A 1 48 ? -18.737 -1.601  -6.933  1.00 0.00 ? 44 GLN A HA   1  
ATOM 493   H HB2  . GLN A 1 48 ? -19.790 0.367   -4.892  1.00 0.00 ? 44 GLN A HB2  1  
ATOM 494   H HB3  . GLN A 1 48 ? -20.399 0.186   -6.533  1.00 0.00 ? 44 GLN A HB3  1  
ATOM 495   H HG2  . GLN A 1 48 ? -20.963 -2.174  -5.990  1.00 0.00 ? 44 GLN A HG2  1  
ATOM 496   H HG3  . GLN A 1 48 ? -20.502 -1.845  -4.322  1.00 0.00 ? 44 GLN A HG3  1  
ATOM 497   H HE21 . GLN A 1 48 ? -22.523 -2.240  -3.519  1.00 0.00 ? 44 GLN A HE21 1  
ATOM 498   H HE22 . GLN A 1 48 ? -23.865 -1.179  -3.789  1.00 0.00 ? 44 GLN A HE22 1  
ATOM 499   N N    . MET A 1 49 ? -17.373 1.196   -5.810  1.00 0.00 ? 45 MET A N    1  
ATOM 500   C CA   . MET A 1 49 ? -16.549 2.350   -6.167  1.00 0.00 ? 45 MET A CA   1  
ATOM 501   C C    . MET A 1 49 ? -15.313 1.986   -6.990  1.00 0.00 ? 45 MET A C    1  
ATOM 502   O O    . MET A 1 49 ? -14.460 1.205   -6.563  1.00 0.00 ? 45 MET A O    1  
ATOM 503   C CB   . MET A 1 49 ? -16.129 3.107   -4.898  1.00 0.00 ? 45 MET A CB   1  
ATOM 504   C CG   . MET A 1 49 ? -15.396 2.257   -3.871  1.00 0.00 ? 45 MET A CG   1  
ATOM 505   S SD   . MET A 1 49 ? -13.717 2.833   -3.545  1.00 0.00 ? 45 MET A SD   1  
ATOM 506   C CE   . MET A 1 49 ? -14.031 4.443   -2.828  1.00 0.00 ? 45 MET A CE   1  
ATOM 507   H H    . MET A 1 49 ? -17.725 1.167   -4.895  1.00 0.00 ? 45 MET A H    1  
ATOM 508   H HA   . MET A 1 49 ? -17.164 3.007   -6.761  1.00 0.00 ? 45 MET A HA   1  
ATOM 509   H HB2  . MET A 1 49 ? -15.482 3.920   -5.181  1.00 0.00 ? 45 MET A HB2  1  
ATOM 510   H HB3  . MET A 1 49 ? -17.014 3.514   -4.430  1.00 0.00 ? 45 MET A HB3  1  
ATOM 511   H HG2  . MET A 1 49 ? -15.952 2.276   -2.946  1.00 0.00 ? 45 MET A HG2  1  
ATOM 512   H HG3  . MET A 1 49 ? -15.348 1.242   -4.236  1.00 0.00 ? 45 MET A HG3  1  
ATOM 513   H HE1  . MET A 1 49 ? -13.124 4.817   -2.374  1.00 0.00 ? 45 MET A HE1  1  
ATOM 514   H HE2  . MET A 1 49 ? -14.802 4.359   -2.077  1.00 0.00 ? 45 MET A HE2  1  
ATOM 515   H HE3  . MET A 1 49 ? -14.354 5.124   -3.601  1.00 0.00 ? 45 MET A HE3  1  
ATOM 516   N N    . THR A 1 50 ? -15.292 2.488   -8.216  1.00 0.00 ? 46 THR A N    1  
ATOM 517   C CA   . THR A 1 50 ? -14.172 2.294   -9.127  1.00 0.00 ? 46 THR A CA   1  
ATOM 518   C C    . THR A 1 50 ? -12.921 3.086   -8.682  1.00 0.00 ? 46 THR A C    1  
ATOM 519   O O    . THR A 1 50 ? -12.747 3.391   -7.501  1.00 0.00 ? 46 THR A O    1  
ATOM 520   C CB   . THR A 1 50 ? -14.604 2.696   -10.560 1.00 0.00 ? 46 THR A CB   1  
ATOM 521   O OG1  . THR A 1 50 ? -13.570 2.417   -11.514 1.00 0.00 ? 46 THR A OG1  1  
ATOM 522   C CG2  . THR A 1 50 ? -14.980 4.170   -10.620 1.00 0.00 ? 46 THR A CG2  1  
ATOM 523   H H    . THR A 1 50 ? -16.112 2.888   -8.570  1.00 0.00 ? 46 THR A H    1  
ATOM 524   H HA   . THR A 1 50 ? -13.931 1.240   -9.133  1.00 0.00 ? 46 THR A HA   1  
ATOM 525   H HB   . THR A 1 50 ? -15.476 2.117   -10.823 1.00 0.00 ? 46 THR A HB   1  
ATOM 526   H HG1  . THR A 1 50 ? -13.696 1.529   -11.875 1.00 0.00 ? 46 THR A HG1  1  
ATOM 527   H HG21 . THR A 1 50 ? -14.099 4.772   -10.456 1.00 0.00 ? 46 THR A HG21 1  
ATOM 528   H HG22 . THR A 1 50 ? -15.710 4.385   -9.854  1.00 0.00 ? 46 THR A HG22 1  
ATOM 529   H HG23 . THR A 1 50 ? -15.398 4.396   -11.589 1.00 0.00 ? 46 THR A HG23 1  
ATOM 530   N N    . ASN A 1 51 ? -12.081 3.447   -9.645  1.00 0.00 ? 47 ASN A N    1  
ATOM 531   C CA   . ASN A 1 51 ? -10.836 4.163   -9.370  1.00 0.00 ? 47 ASN A CA   1  
ATOM 532   C C    . ASN A 1 51 ? -11.093 5.639   -9.085  1.00 0.00 ? 47 ASN A C    1  
ATOM 533   O O    . ASN A 1 51 ? -10.424 6.237   -8.239  1.00 0.00 ? 47 ASN A O    1  
ATOM 534   C CB   . ASN A 1 51 ? -9.862  4.027   -10.544 1.00 0.00 ? 47 ASN A CB   1  
ATOM 535   C CG   . ASN A 1 51 ? -9.068  2.735   -10.503 1.00 0.00 ? 47 ASN A CG   1  
ATOM 536   O OD1  . ASN A 1 51 ? -9.505  1.705   -11.017 1.00 0.00 ? 47 ASN A OD1  1  
ATOM 537   N ND2  . ASN A 1 51 ? -7.888  2.780   -9.901  1.00 0.00 ? 47 ASN A ND2  1  
ATOM 538   H H    . ASN A 1 51 ? -12.349 3.272   -10.577 1.00 0.00 ? 47 ASN A H    1  
ATOM 539   H HA   . ASN A 1 51 ? -10.390 3.717   -8.494  1.00 0.00 ? 47 ASN A HA   1  
ATOM 540   H HB2  . ASN A 1 51 ? -10.417 4.055   -11.470 1.00 0.00 ? 47 ASN A HB2  1  
ATOM 541   H HB3  . ASN A 1 51 ? -9.167  4.855   -10.523 1.00 0.00 ? 47 ASN A HB3  1  
ATOM 542   H HD21 . ASN A 1 51 ? -7.594  3.633   -9.519  1.00 0.00 ? 47 ASN A HD21 1  
ATOM 543   H HD22 . ASN A 1 51 ? -7.357  1.959   -9.864  1.00 0.00 ? 47 ASN A HD22 1  
ATOM 544   N N    . ASP A 1 52 ? -12.043 6.224   -9.811  1.00 0.00 ? 48 ASP A N    1  
ATOM 545   C CA   . ASP A 1 52 ? -12.388 7.637   -9.635  1.00 0.00 ? 48 ASP A CA   1  
ATOM 546   C C    . ASP A 1 52 ? -12.717 7.956   -8.180  1.00 0.00 ? 48 ASP A C    1  
ATOM 547   O O    . ASP A 1 52 ? -12.113 8.853   -7.584  1.00 0.00 ? 48 ASP A O    1  
ATOM 548   C CB   . ASP A 1 52 ? -13.574 8.025   -10.524 1.00 0.00 ? 48 ASP A CB   1  
ATOM 549   C CG   . ASP A 1 52 ? -14.173 9.366   -10.134 1.00 0.00 ? 48 ASP A CG   1  
ATOM 550   O OD1  . ASP A 1 52 ? -13.652 10.412  -10.574 1.00 0.00 ? 48 ASP A OD1  1  
ATOM 551   O OD2  . ASP A 1 52 ? -15.166 9.382   -9.376  1.00 0.00 ? 48 ASP A OD2  1  
ATOM 552   H H    . ASP A 1 52 ? -12.496 5.701   -10.502 1.00 0.00 ? 48 ASP A H    1  
ATOM 553   H HA   . ASP A 1 52 ? -11.530 8.221   -9.928  1.00 0.00 ? 48 ASP A HA   1  
ATOM 554   H HB2  . ASP A 1 52 ? -13.243 8.087   -11.550 1.00 0.00 ? 48 ASP A HB2  1  
ATOM 555   H HB3  . ASP A 1 52 ? -14.342 7.270   -10.441 1.00 0.00 ? 48 ASP A HB3  1  
ATOM 556   N N    . ASP A 1 53 ? -13.681 7.227   -7.626  1.00 0.00 ? 49 ASP A N    1  
ATOM 557   C CA   . ASP A 1 53 ? -14.112 7.409   -6.240  1.00 0.00 ? 49 ASP A CA   1  
ATOM 558   C C    . ASP A 1 53 ? -12.935 7.400   -5.281  1.00 0.00 ? 49 ASP A C    1  
ATOM 559   O O    . ASP A 1 53 ? -12.868 8.223   -4.365  1.00 0.00 ? 49 ASP A O    1  
ATOM 560   C CB   . ASP A 1 53 ? -15.082 6.302   -5.839  1.00 0.00 ? 49 ASP A CB   1  
ATOM 561   C CG   . ASP A 1 53 ? -16.301 6.234   -6.732  1.00 0.00 ? 49 ASP A CG   1  
ATOM 562   O OD1  . ASP A 1 53 ? -16.178 5.760   -7.881  1.00 0.00 ? 49 ASP A OD1  1  
ATOM 563   O OD2  . ASP A 1 53 ? -17.396 6.639   -6.286  1.00 0.00 ? 49 ASP A OD2  1  
ATOM 564   H H    . ASP A 1 53 ? -14.156 6.566   -8.175  1.00 0.00 ? 49 ASP A H    1  
ATOM 565   H HA   . ASP A 1 53 ? -14.613 8.359   -6.168  1.00 0.00 ? 49 ASP A HA   1  
ATOM 566   H HB2  . ASP A 1 53 ? -14.569 5.356   -5.893  1.00 0.00 ? 49 ASP A HB2  1  
ATOM 567   H HB3  . ASP A 1 53 ? -15.411 6.472   -4.825  1.00 0.00 ? 49 ASP A HB3  1  
ATOM 568   N N    . ILE A 1 54 ? -12.019 6.472   -5.494  1.00 0.00 ? 50 ILE A N    1  
ATOM 569   C CA   . ILE A 1 54 ? -10.813 6.346   -4.681  1.00 0.00 ? 50 ILE A CA   1  
ATOM 570   C C    . ILE A 1 54 ? -10.087 7.666   -4.582  1.00 0.00 ? 50 ILE A C    1  
ATOM 571   O O    . ILE A 1 54 ? -9.723  8.118   -3.515  1.00 0.00 ? 50 ILE A O    1  
ATOM 572   C CB   . ILE A 1 54 ? -9.871  5.195   -5.222  1.00 0.00 ? 50 ILE A CB   1  
ATOM 573   C CG1  . ILE A 1 54 ? -10.448 3.752   -5.061  1.00 0.00 ? 50 ILE A CG1  1  
ATOM 574   C CG2  . ILE A 1 54 ? -8.450  5.224   -4.579  1.00 0.00 ? 50 ILE A CG2  1  
ATOM 575   C CD1  . ILE A 1 54 ? -9.692  2.638   -5.815  1.00 0.00 ? 50 ILE A CD1  1  
ATOM 576   H H    . ILE A 1 54 ? -12.156 5.835   -6.238  1.00 0.00 ? 50 ILE A H    1  
ATOM 577   H HA   . ILE A 1 54 ? -11.128 6.084   -3.655  1.00 0.00 ? 50 ILE A HA   1  
ATOM 578   H HB   . ILE A 1 54 ? -9.748  5.370   -6.311  1.00 0.00 ? 50 ILE A HB   1  
ATOM 579   H HG12 . ILE A 1 54 ? -10.539 3.493   -3.988  1.00 0.00 ? 50 ILE A HG12 1  
ATOM 580   H HG13 . ILE A 1 54 ? -11.486 3.723   -5.442  1.00 0.00 ? 50 ILE A HG13 1  
ATOM 581   H HG21 . ILE A 1 54 ? -7.915  6.174   -4.748  1.00 0.00 ? 50 ILE A HG21 1  
ATOM 582   H HG22 . ILE A 1 54 ? -8.484  5.056   -3.485  1.00 0.00 ? 50 ILE A HG22 1  
ATOM 583   H HG23 . ILE A 1 54 ? -7.780  4.453   -5.002  1.00 0.00 ? 50 ILE A HG23 1  
ATOM 584   H HD11 . ILE A 1 54 ? -9.622  2.850   -6.899  1.00 0.00 ? 50 ILE A HD11 1  
ATOM 585   H HD12 . ILE A 1 54 ? -8.663  2.494   -5.438  1.00 0.00 ? 50 ILE A HD12 1  
ATOM 586   H HD13 . ILE A 1 54 ? -10.206 1.664   -5.708  1.00 0.00 ? 50 ILE A HD13 1  
ATOM 587   N N    . LYS A 1 55 ? -9.848  8.261   -5.742  1.00 0.00 ? 51 LYS A N    1  
ATOM 588   C CA   . LYS A 1 55 ? -9.117  9.516   -5.807  1.00 0.00 ? 51 LYS A CA   1  
ATOM 589   C C    . LYS A 1 55 ? -9.916  10.671  -5.210  1.00 0.00 ? 51 LYS A C    1  
ATOM 590   O O    . LYS A 1 55 ? -9.341  11.589  -4.622  1.00 0.00 ? 51 LYS A O    1  
ATOM 591   C CB   . LYS A 1 55 ? -8.755  9.840   -7.254  1.00 0.00 ? 51 LYS A CB   1  
ATOM 592   C CG   . LYS A 1 55 ? -7.800  8.840   -7.885  1.00 0.00 ? 51 LYS A CG   1  
ATOM 593   C CD   . LYS A 1 55 ? -7.567  9.139   -9.359  1.00 0.00 ? 51 LYS A CD   1  
ATOM 594   C CE   . LYS A 1 55 ? -6.844  10.464  -9.558  1.00 0.00 ? 51 LYS A CE   1  
ATOM 595   N NZ   . LYS A 1 55 ? -5.377  10.285  -9.744  1.00 0.00 ? 51 LYS A NZ   1  
ATOM 596   H H    . LYS A 1 55 ? -10.198 7.862   -6.569  1.00 0.00 ? 51 LYS A H    1  
ATOM 597   H HA   . LYS A 1 55 ? -8.206  9.397   -5.240  1.00 0.00 ? 51 LYS A HA   1  
ATOM 598   H HB2  . LYS A 1 55 ? -9.661  9.862   -7.842  1.00 0.00 ? 51 LYS A HB2  1  
ATOM 599   H HB3  . LYS A 1 55 ? -8.294  10.815  -7.285  1.00 0.00 ? 51 LYS A HB3  1  
ATOM 600   H HG2  . LYS A 1 55 ? -6.855  8.884   -7.367  1.00 0.00 ? 51 LYS A HG2  1  
ATOM 601   H HG3  . LYS A 1 55 ? -8.220  7.848   -7.790  1.00 0.00 ? 51 LYS A HG3  1  
ATOM 602   H HD2  . LYS A 1 55 ? -6.971  8.347   -9.785  1.00 0.00 ? 51 LYS A HD2  1  
ATOM 603   H HD3  . LYS A 1 55 ? -8.523  9.182   -9.862  1.00 0.00 ? 51 LYS A HD3  1  
ATOM 604   H HE2  . LYS A 1 55 ? -7.249  10.952  -10.431 1.00 0.00 ? 51 LYS A HE2  1  
ATOM 605   H HE3  . LYS A 1 55 ? -7.012  11.085  -8.692  1.00 0.00 ? 51 LYS A HE3  1  
ATOM 606   H HZ1  . LYS A 1 55 ? -5.001  9.612   -9.046  1.00 0.00 ? 51 LYS A HZ1  1  
ATOM 607   H HZ2  . LYS A 1 55 ? -4.891  11.198  -9.623  1.00 0.00 ? 51 LYS A HZ2  1  
ATOM 608   H HZ3  . LYS A 1 55 ? -5.179  9.926   -10.700 1.00 0.00 ? 51 LYS A HZ3  1  
ATOM 609   N N    . ARG A 1 56 ? -11.236 10.609  -5.329  1.00 0.00 ? 52 ARG A N    1  
ATOM 610   C CA   . ARG A 1 56 ? -12.096 11.680  -4.842  1.00 0.00 ? 52 ARG A CA   1  
ATOM 611   C C    . ARG A 1 56 ? -12.191 11.719  -3.317  1.00 0.00 ? 52 ARG A C    1  
ATOM 612   O O    . ARG A 1 56 ? -11.959 12.766  -2.719  1.00 0.00 ? 52 ARG A O    1  
ATOM 613   C CB   . ARG A 1 56 ? -13.495 11.557  -5.449  1.00 0.00 ? 52 ARG A CB   1  
ATOM 614   C CG   . ARG A 1 56 ? -14.160 12.900  -5.701  1.00 0.00 ? 52 ARG A CG   1  
ATOM 615   C CD   . ARG A 1 56 ? -15.565 12.738  -6.264  1.00 0.00 ? 52 ARG A CD   1  
ATOM 616   N NE   . ARG A 1 56 ? -16.422 11.940  -5.387  1.00 0.00 ? 52 ARG A NE   1  
ATOM 617   C CZ   . ARG A 1 56 ? -16.956 12.387  -4.248  1.00 0.00 ? 52 ARG A CZ   1  
ATOM 618   N NH1  . ARG A 1 56 ? -16.742 13.637  -3.847  1.00 0.00 ? 52 ARG A NH1  1  
ATOM 619   N NH2  . ARG A 1 56 ? -17.725 11.591  -3.518  1.00 0.00 ? 52 ARG A NH2  1  
ATOM 620   H H    . ARG A 1 56 ? -11.654 9.816   -5.734  1.00 0.00 ? 52 ARG A H    1  
ATOM 621   H HA   . ARG A 1 56 ? -11.663 12.612  -5.175  1.00 0.00 ? 52 ARG A HA   1  
ATOM 622   H HB2  . ARG A 1 56 ? -13.424 11.031  -6.390  1.00 0.00 ? 52 ARG A HB2  1  
ATOM 623   H HB3  . ARG A 1 56 ? -14.120 10.991  -4.774  1.00 0.00 ? 52 ARG A HB3  1  
ATOM 624   H HG2  . ARG A 1 56 ? -14.218 13.443  -4.770  1.00 0.00 ? 52 ARG A HG2  1  
ATOM 625   H HG3  . ARG A 1 56 ? -13.563 13.458  -6.407  1.00 0.00 ? 52 ARG A HG3  1  
ATOM 626   H HD2  . ARG A 1 56 ? -16.004 13.717  -6.387  1.00 0.00 ? 52 ARG A HD2  1  
ATOM 627   H HD3  . ARG A 1 56 ? -15.499 12.252  -7.225  1.00 0.00 ? 52 ARG A HD3  1  
ATOM 628   H HE   . ARG A 1 56 ? -16.615 11.014  -5.674  1.00 0.00 ? 52 ARG A HE   1  
ATOM 629   H HH11 . ARG A 1 56 ? -16.177 14.256  -4.397  1.00 0.00 ? 52 ARG A HH11 1  
ATOM 630   H HH12 . ARG A 1 56 ? -17.149 13.969  -2.990  1.00 0.00 ? 52 ARG A HH12 1  
ATOM 631   H HH21 . ARG A 1 56 ? -17.907 10.650  -3.818  1.00 0.00 ? 52 ARG A HH21 1  
ATOM 632   H HH22 . ARG A 1 56 ? -18.133 11.929  -2.664  1.00 0.00 ? 52 ARG A HH22 1  
ATOM 633   N N    . ILE A 1 57 ? -12.564 10.590  -2.697  1.00 0.00 ? 53 ILE A N    1  
ATOM 634   C CA   . ILE A 1 57 ? -12.708 10.499  -1.230  1.00 0.00 ? 53 ILE A CA   1  
ATOM 635   C C    . ILE A 1 57 ? -11.565 11.162  -0.449  1.00 0.00 ? 53 ILE A C    1  
ATOM 636   O O    . ILE A 1 57 ? -11.770 11.626  0.672   1.00 0.00 ? 53 ILE A O    1  
ATOM 637   C CB   . ILE A 1 57 ? -12.858 9.038   -0.746  1.00 0.00 ? 53 ILE A CB   1  
ATOM 638   C CG1  . ILE A 1 57 ? -11.626 8.216   -1.120  1.00 0.00 ? 53 ILE A CG1  1  
ATOM 639   C CG2  . ILE A 1 57 ? -14.117 8.409   -1.326  1.00 0.00 ? 53 ILE A CG2  1  
ATOM 640   C CD1  . ILE A 1 57 ? -11.532 6.895   -0.391  1.00 0.00 ? 53 ILE A CD1  1  
ATOM 641   H H    . ILE A 1 57 ? -12.839 9.816   -3.241  1.00 0.00 ? 53 ILE A H    1  
ATOM 642   H HA   . ILE A 1 57 ? -13.621 11.015  -0.976  1.00 0.00 ? 53 ILE A HA   1  
ATOM 643   H HB   . ILE A 1 57 ? -12.958 9.051   0.329   1.00 0.00 ? 53 ILE A HB   1  
ATOM 644   H HG12 . ILE A 1 57 ? -11.652 8.008   -2.179  1.00 0.00 ? 53 ILE A HG12 1  
ATOM 645   H HG13 . ILE A 1 57 ? -10.738 8.787   -0.892  1.00 0.00 ? 53 ILE A HG13 1  
ATOM 646   H HG21 . ILE A 1 57 ? -14.976 9.003   -1.052  1.00 0.00 ? 53 ILE A HG21 1  
ATOM 647   H HG22 . ILE A 1 57 ? -14.231 7.408   -0.935  1.00 0.00 ? 53 ILE A HG22 1  
ATOM 648   H HG23 . ILE A 1 57 ? -14.035 8.368   -2.402  1.00 0.00 ? 53 ILE A HG23 1  
ATOM 649   H HD11 . ILE A 1 57 ? -10.604 6.407   -0.650  1.00 0.00 ? 53 ILE A HD11 1  
ATOM 650   H HD12 . ILE A 1 57 ? -12.361 6.265   -0.677  1.00 0.00 ? 53 ILE A HD12 1  
ATOM 651   H HD13 . ILE A 1 57 ? -11.561 7.069   0.674   1.00 0.00 ? 53 ILE A HD13 1  
ATOM 652   N N    . GLY A 1 58 ? -10.379 11.228  -1.032  1.00 0.00 ? 54 GLY A N    1  
ATOM 653   C CA   . GLY A 1 58 ? -9.268  11.853  -0.342  1.00 0.00 ? 54 GLY A CA   1  
ATOM 654   C C    . GLY A 1 58 ? -7.955  11.143  -0.555  1.00 0.00 ? 54 GLY A C    1  
ATOM 655   O O    . GLY A 1 58 ? -7.150  11.022  0.366   1.00 0.00 ? 54 GLY A O    1  
ATOM 656   H H    . GLY A 1 58 ? -10.276 10.893  -1.946  1.00 0.00 ? 54 GLY A H    1  
ATOM 657   H HA2  . GLY A 1 58 ? -9.172  12.866  -0.699  1.00 0.00 ? 54 GLY A HA2  1  
ATOM 658   H HA3  . GLY A 1 58 ? -9.486  11.876  0.715   1.00 0.00 ? 54 GLY A HA3  1  
ATOM 659   N N    . VAL A 1 59 ? -7.734  10.680  -1.772  1.00 0.00 ? 55 VAL A N    1  
ATOM 660   C CA   . VAL A 1 59 ? -6.506  9.983   -2.108  1.00 0.00 ? 55 VAL A CA   1  
ATOM 661   C C    . VAL A 1 59 ? -5.778  10.725  -3.218  1.00 0.00 ? 55 VAL A C    1  
ATOM 662   O O    . VAL A 1 59 ? -6.157  10.644  -4.388  1.00 0.00 ? 55 VAL A O    1  
ATOM 663   C CB   . VAL A 1 59 ? -6.775  8.526   -2.546  1.00 0.00 ? 55 VAL A CB   1  
ATOM 664   C CG1  . VAL A 1 59 ? -5.477  7.820   -2.903  1.00 0.00 ? 55 VAL A CG1  1  
ATOM 665   C CG2  . VAL A 1 59 ? -7.511  7.763   -1.456  1.00 0.00 ? 55 VAL A CG2  1  
ATOM 666   H H    . VAL A 1 59 ? -8.408  10.820  -2.469  1.00 0.00 ? 55 VAL A H    1  
ATOM 667   H HA   . VAL A 1 59 ? -5.881  9.966   -1.226  1.00 0.00 ? 55 VAL A HA   1  
ATOM 668   H HB   . VAL A 1 59 ? -7.402  8.546   -3.425  1.00 0.00 ? 55 VAL A HB   1  
ATOM 669   H HG11 . VAL A 1 59 ? -4.853  7.750   -2.025  1.00 0.00 ? 55 VAL A HG11 1  
ATOM 670   H HG12 . VAL A 1 59 ? -4.964  8.381   -3.667  1.00 0.00 ? 55 VAL A HG12 1  
ATOM 671   H HG13 . VAL A 1 59 ? -5.698  6.828   -3.269  1.00 0.00 ? 55 VAL A HG13 1  
ATOM 672   H HG21 . VAL A 1 59 ? -7.612  6.727   -1.743  1.00 0.00 ? 55 VAL A HG21 1  
ATOM 673   H HG22 . VAL A 1 59 ? -8.490  8.195   -1.312  1.00 0.00 ? 55 VAL A HG22 1  
ATOM 674   H HG23 . VAL A 1 59 ? -6.953  7.827   -0.533  1.00 0.00 ? 55 VAL A HG23 1  
ATOM 675   N N    . ARG A 1 60 ? -4.738  11.460  -2.849  1.00 0.00 ? 56 ARG A N    1  
ATOM 676   C CA   . ARG A 1 60 ? -3.966  12.215  -3.829  1.00 0.00 ? 56 ARG A CA   1  
ATOM 677   C C    . ARG A 1 60 ? -2.620  11.556  -4.075  1.00 0.00 ? 56 ARG A C    1  
ATOM 678   O O    . ARG A 1 60 ? -1.916  11.897  -5.018  1.00 0.00 ? 56 ARG A O    1  
ATOM 679   C CB   . ARG A 1 60 ? -3.777  13.676  -3.398  1.00 0.00 ? 56 ARG A CB   1  
ATOM 680   C CG   . ARG A 1 60 ? -3.613  13.899  -1.897  1.00 0.00 ? 56 ARG A CG   1  
ATOM 681   C CD   . ARG A 1 60 ? -2.236  13.488  -1.384  1.00 0.00 ? 56 ARG A CD   1  
ATOM 682   N NE   . ARG A 1 60 ? -1.138  13.924  -2.256  1.00 0.00 ? 56 ARG A NE   1  
ATOM 683   C CZ   . ARG A 1 60 ? 0.078   14.264  -1.812  1.00 0.00 ? 56 ARG A CZ   1  
ATOM 684   N NH1  . ARG A 1 60 ? 0.320   14.340  -0.509  1.00 0.00 ? 56 ARG A NH1  1  
ATOM 685   N NH2  . ARG A 1 60 ? 1.052   14.533  -2.674  1.00 0.00 ? 56 ARG A NH2  1  
ATOM 686   H H    . ARG A 1 60 ? -4.473  11.485  -1.909  1.00 0.00 ? 56 ARG A H    1  
ATOM 687   H HA   . ARG A 1 60 ? -4.523  12.197  -4.754  1.00 0.00 ? 56 ARG A HA   1  
ATOM 688   H HB2  . ARG A 1 60 ? -2.901  14.065  -3.889  1.00 0.00 ? 56 ARG A HB2  1  
ATOM 689   H HB3  . ARG A 1 60 ? -4.636  14.244  -3.727  1.00 0.00 ? 56 ARG A HB3  1  
ATOM 690   H HG2  . ARG A 1 60 ? -3.762  14.946  -1.683  1.00 0.00 ? 56 ARG A HG2  1  
ATOM 691   H HG3  . ARG A 1 60 ? -4.363  13.317  -1.380  1.00 0.00 ? 56 ARG A HG3  1  
ATOM 692   H HD2  . ARG A 1 60 ? -2.091  13.921  -0.407  1.00 0.00 ? 56 ARG A HD2  1  
ATOM 693   H HD3  . ARG A 1 60 ? -2.207  12.411  -1.304  1.00 0.00 ? 56 ARG A HD3  1  
ATOM 694   H HE   . ARG A 1 60 ? -1.303  13.927  -3.228  1.00 0.00 ? 56 ARG A HE   1  
ATOM 695   H HH11 . ARG A 1 60 ? -0.408  14.144  0.155   1.00 0.00 ? 56 ARG A HH11 1  
ATOM 696   H HH12 . ARG A 1 60 ? 1.235   14.591  -0.181  1.00 0.00 ? 56 ARG A HH12 1  
ATOM 697   H HH21 . ARG A 1 60 ? 0.882   14.482  -3.661  1.00 0.00 ? 56 ARG A HH21 1  
ATOM 698   H HH22 . ARG A 1 60 ? 1.970   14.778  -2.337  1.00 0.00 ? 56 ARG A HH22 1  
ATOM 699   N N    . LEU A 1 61 ? -2.262  10.616  -3.212  1.00 0.00 ? 57 LEU A N    1  
ATOM 700   C CA   . LEU A 1 61 ? -1.003  9.908   -3.354  1.00 0.00 ? 57 LEU A CA   1  
ATOM 701   C C    . LEU A 1 61 ? -1.116  8.840   -4.432  1.00 0.00 ? 57 LEU A C    1  
ATOM 702   O O    . LEU A 1 61 ? -2.007  7.996   -4.368  1.00 0.00 ? 57 LEU A O    1  
ATOM 703   C CB   . LEU A 1 61 ? -0.595  9.245   -2.034  1.00 0.00 ? 57 LEU A CB   1  
ATOM 704   C CG   . LEU A 1 61 ? -0.185  10.195  -0.909  1.00 0.00 ? 57 LEU A CG   1  
ATOM 705   C CD1  . LEU A 1 61 ? 0.279   9.400   0.296   1.00 0.00 ? 57 LEU A CD1  1  
ATOM 706   C CD2  . LEU A 1 61 ? 0.911   11.134  -1.378  1.00 0.00 ? 57 LEU A CD2  1  
ATOM 707   H H    . LEU A 1 61 ? -2.856  10.396  -2.471  1.00 0.00 ? 57 LEU A H    1  
ATOM 708   H HA   . LEU A 1 61 ? -0.246  10.618  -3.643  1.00 0.00 ? 57 LEU A HA   1  
ATOM 709   H HB2  . LEU A 1 61 ? -1.421  8.645   -1.685  1.00 0.00 ? 57 LEU A HB2  1  
ATOM 710   H HB3  . LEU A 1 61 ? 0.239   8.590   -2.236  1.00 0.00 ? 57 LEU A HB3  1  
ATOM 711   H HG   . LEU A 1 61 ? -1.037  10.788  -0.613  1.00 0.00 ? 57 LEU A HG   1  
ATOM 712   H HD11 . LEU A 1 61 ? 1.032   9.960   0.833   1.00 0.00 ? 57 LEU A HD11 1  
ATOM 713   H HD12 . LEU A 1 61 ? 0.696   8.461   -0.033  1.00 0.00 ? 57 LEU A HD12 1  
ATOM 714   H HD13 . LEU A 1 61 ? -0.563  9.209   0.948   1.00 0.00 ? 57 LEU A HD13 1  
ATOM 715   H HD21 . LEU A 1 61 ? 1.723   10.558  -1.795  1.00 0.00 ? 57 LEU A HD21 1  
ATOM 716   H HD22 . LEU A 1 61 ? 1.274   11.713  -0.538  1.00 0.00 ? 57 LEU A HD22 1  
ATOM 717   H HD23 . LEU A 1 61 ? 0.518   11.798  -2.130  1.00 0.00 ? 57 LEU A HD23 1  
ATOM 718   N N    . PRO A 1 62 ? -0.215  8.854   -5.429  1.00 0.00 ? 58 PRO A N    1  
ATOM 719   C CA   . PRO A 1 62 ? -0.222  7.864   -6.508  1.00 0.00 ? 58 PRO A CA   1  
ATOM 720   C C    . PRO A 1 62 ? -0.071  6.456   -5.947  1.00 0.00 ? 58 PRO A C    1  
ATOM 721   O O    . PRO A 1 62 ? -0.739  5.519   -6.387  1.00 0.00 ? 58 PRO A O    1  
ATOM 722   C CB   . PRO A 1 62 ? 0.990   8.249   -7.372  1.00 0.00 ? 58 PRO A CB   1  
ATOM 723   C CG   . PRO A 1 62 ? 1.834   9.105   -6.491  1.00 0.00 ? 58 PRO A CG   1  
ATOM 724   C CD   . PRO A 1 62 ? 0.878   9.829   -5.591  1.00 0.00 ? 58 PRO A CD   1  
ATOM 725   H HA   . PRO A 1 62 ? -1.130  7.924   -7.092  1.00 0.00 ? 58 PRO A HA   1  
ATOM 726   H HB2  . PRO A 1 62 ? 1.523   7.358   -7.680  1.00 0.00 ? 58 PRO A HB2  1  
ATOM 727   H HB3  . PRO A 1 62 ? 0.657   8.796   -8.246  1.00 0.00 ? 58 PRO A HB3  1  
ATOM 728   H HG2  . PRO A 1 62 ? 2.500   8.484   -5.910  1.00 0.00 ? 58 PRO A HG2  1  
ATOM 729   H HG3  . PRO A 1 62 ? 2.394   9.809   -7.088  1.00 0.00 ? 58 PRO A HG3  1  
ATOM 730   H HD2  . PRO A 1 62 ? 1.345   10.051  -4.643  1.00 0.00 ? 58 PRO A HD2  1  
ATOM 731   H HD3  . PRO A 1 62 ? 0.520   10.737  -6.059  1.00 0.00 ? 58 PRO A HD3  1  
ATOM 732   N N    . GLY A 1 63 ? 0.793   6.324   -4.948  1.00 0.00 ? 59 GLY A N    1  
ATOM 733   C CA   . GLY A 1 63 ? 1.016   5.042   -4.309  1.00 0.00 ? 59 GLY A CA   1  
ATOM 734   C C    . GLY A 1 63 ? -0.216  4.475   -3.627  1.00 0.00 ? 59 GLY A C    1  
ATOM 735   O O    . GLY A 1 63 ? -0.498  3.277   -3.749  1.00 0.00 ? 59 GLY A O    1  
ATOM 736   H H    . GLY A 1 63 ? 1.335   7.092   -4.686  1.00 0.00 ? 59 GLY A H    1  
ATOM 737   H HA2  . GLY A 1 63 ? 1.350   4.337   -5.057  1.00 0.00 ? 59 GLY A HA2  1  
ATOM 738   H HA3  . GLY A 1 63 ? 1.791   5.161   -3.571  1.00 0.00 ? 59 GLY A HA3  1  
ATOM 739   N N    . HIS A 1 64 ? -0.976  5.312   -2.909  1.00 0.00 ? 60 HIS A N    1  
ATOM 740   C CA   . HIS A 1 64 ? -2.173  4.839   -2.239  1.00 0.00 ? 60 HIS A CA   1  
ATOM 741   C C    . HIS A 1 64 ? -3.249  4.535   -3.272  1.00 0.00 ? 60 HIS A C    1  
ATOM 742   O O    . HIS A 1 64 ? -4.182  3.774   -3.011  1.00 0.00 ? 60 HIS A O    1  
ATOM 743   C CB   . HIS A 1 64 ? -2.687  5.865   -1.229  1.00 0.00 ? 60 HIS A CB   1  
ATOM 744   C CG   . HIS A 1 64 ? -1.807  6.032   -0.023  1.00 0.00 ? 60 HIS A CG   1  
ATOM 745   N ND1  . HIS A 1 64 ? -2.054  6.930   0.986   1.00 0.00 ? 60 HIS A ND1  1  
ATOM 746   C CD2  . HIS A 1 64 ? -0.663  5.402   0.318   1.00 0.00 ? 60 HIS A CD2  1  
ATOM 747   C CE1  . HIS A 1 64 ? -1.077  6.824   1.888   1.00 0.00 ? 60 HIS A CE1  1  
ATOM 748   N NE2  . HIS A 1 64 ? -0.204  5.909   1.532   1.00 0.00 ? 60 HIS A NE2  1  
ATOM 749   H H    . HIS A 1 64 ? -0.725  6.252   -2.846  1.00 0.00 ? 60 HIS A H    1  
ATOM 750   H HA   . HIS A 1 64 ? -1.922  3.923   -1.720  1.00 0.00 ? 60 HIS A HA   1  
ATOM 751   H HB2  . HIS A 1 64 ? -2.779  6.825   -1.714  1.00 0.00 ? 60 HIS A HB2  1  
ATOM 752   H HB3  . HIS A 1 64 ? -3.661  5.544   -0.885  1.00 0.00 ? 60 HIS A HB3  1  
ATOM 753   H HD1  . HIS A 1 64 ? -2.818  7.540   1.037   1.00 0.00 ? 60 HIS A HD1  1  
ATOM 754   H HD2  . HIS A 1 64 ? -0.170  4.629   -0.260  1.00 0.00 ? 60 HIS A HD2  1  
ATOM 755   H HE1  . HIS A 1 64 ? -1.000  7.422   2.782   1.00 0.00 ? 60 HIS A HE1  1  
ATOM 756   N N    . GLN A 1 65 ? -3.078  5.108   -4.461  1.00 0.00 ? 61 GLN A N    1  
ATOM 757   C CA   . GLN A 1 65 ? -4.020  4.914   -5.563  1.00 0.00 ? 61 GLN A CA   1  
ATOM 758   C C    . GLN A 1 65 ? -3.829  3.539   -6.180  1.00 0.00 ? 61 GLN A C    1  
ATOM 759   O O    . GLN A 1 65 ? -4.585  3.117   -7.049  1.00 0.00 ? 61 GLN A O    1  
ATOM 760   C CB   . GLN A 1 65 ? -3.832  6.005   -6.610  1.00 0.00 ? 61 GLN A CB   1  
ATOM 761   C CG   . GLN A 1 65 ? -4.694  7.224   -6.356  1.00 0.00 ? 61 GLN A CG   1  
ATOM 762   C CD   . GLN A 1 65 ? -4.229  8.462   -7.103  1.00 0.00 ? 61 GLN A CD   1  
ATOM 763   O OE1  . GLN A 1 65 ? -3.788  8.400   -8.250  1.00 0.00 ? 61 GLN A OE1  1  
ATOM 764   N NE2  . GLN A 1 65 ? -4.323  9.603   -6.444  1.00 0.00 ? 61 GLN A NE2  1  
ATOM 765   H H    . GLN A 1 65 ? -2.272  5.660   -4.607  1.00 0.00 ? 61 GLN A H    1  
ATOM 766   H HA   . GLN A 1 65 ? -5.021  4.981   -5.163  1.00 0.00 ? 61 GLN A HA   1  
ATOM 767   H HB2  . GLN A 1 65 ? -2.796  6.313   -6.602  1.00 0.00 ? 61 GLN A HB2  1  
ATOM 768   H HB3  . GLN A 1 65 ? -4.074  5.607   -7.581  1.00 0.00 ? 61 GLN A HB3  1  
ATOM 769   H HG2  . GLN A 1 65 ? -5.703  6.999   -6.668  1.00 0.00 ? 61 GLN A HG2  1  
ATOM 770   H HG3  . GLN A 1 65 ? -4.686  7.438   -5.302  1.00 0.00 ? 61 GLN A HG3  1  
ATOM 771   H HE21 . GLN A 1 65 ? -4.689  9.583   -5.534  1.00 0.00 ? 61 GLN A HE21 1  
ATOM 772   H HE22 . GLN A 1 65 ? -4.026  10.427  -6.891  1.00 0.00 ? 61 GLN A HE22 1  
ATOM 773   N N    . LYS A 1 66 ? -2.814  2.834   -5.701  1.00 0.00 ? 62 LYS A N    1  
ATOM 774   C CA   . LYS A 1 66 ? -2.529  1.495   -6.185  1.00 0.00 ? 62 LYS A CA   1  
ATOM 775   C C    . LYS A 1 66 ? -2.805  0.495   -5.078  1.00 0.00 ? 62 LYS A C    1  
ATOM 776   O O    . LYS A 1 66 ? -3.375  -0.567  -5.315  1.00 0.00 ? 62 LYS A O    1  
ATOM 777   C CB   . LYS A 1 66 ? -1.081  1.358   -6.665  1.00 0.00 ? 62 LYS A CB   1  
ATOM 778   C CG   . LYS A 1 66 ? -0.840  0.104   -7.496  1.00 0.00 ? 62 LYS A CG   1  
ATOM 779   C CD   . LYS A 1 66 ? 0.625   -0.320  -7.473  1.00 0.00 ? 62 LYS A CD   1  
ATOM 780   C CE   . LYS A 1 66 ? 0.802   -1.768  -7.907  1.00 0.00 ? 62 LYS A CE   1  
ATOM 781   N NZ   . LYS A 1 66 ? 2.125   -2.320  -7.494  1.00 0.00 ? 62 LYS A NZ   1  
ATOM 782   H H    . LYS A 1 66 ? -2.281  3.209   -4.967  1.00 0.00 ? 62 LYS A H    1  
ATOM 783   H HA   . LYS A 1 66 ? -3.197  1.297   -7.005  1.00 0.00 ? 62 LYS A HA   1  
ATOM 784   H HB2  . LYS A 1 66 ? -0.832  2.216   -7.265  1.00 0.00 ? 62 LYS A HB2  1  
ATOM 785   H HB3  . LYS A 1 66 ? -0.426  1.324   -5.805  1.00 0.00 ? 62 LYS A HB3  1  
ATOM 786   H HG2  . LYS A 1 66 ? -1.444  -0.698  -7.098  1.00 0.00 ? 62 LYS A HG2  1  
ATOM 787   H HG3  . LYS A 1 66 ? -1.132  0.303   -8.515  1.00 0.00 ? 62 LYS A HG3  1  
ATOM 788   H HD2  . LYS A 1 66 ? 1.185   0.314   -8.146  1.00 0.00 ? 62 LYS A HD2  1  
ATOM 789   H HD3  . LYS A 1 66 ? 1.009   -0.206  -6.468  1.00 0.00 ? 62 LYS A HD3  1  
ATOM 790   H HE2  . LYS A 1 66 ? 0.019   -2.358  -7.456  1.00 0.00 ? 62 LYS A HE2  1  
ATOM 791   H HE3  . LYS A 1 66 ? 0.718   -1.822  -8.982  1.00 0.00 ? 62 LYS A HE3  1  
ATOM 792   H HZ1  . LYS A 1 66 ? 2.128   -3.354  -7.601  1.00 0.00 ? 62 LYS A HZ1  1  
ATOM 793   H HZ2  . LYS A 1 66 ? 2.322   -2.085  -6.493  1.00 0.00 ? 62 LYS A HZ2  1  
ATOM 794   H HZ3  . LYS A 1 66 ? 2.888   -1.920  -8.092  1.00 0.00 ? 62 LYS A HZ3  1  
ATOM 795   N N    . ARG A 1 67 ? -2.408  0.861   -3.861  1.00 0.00 ? 63 ARG A N    1  
ATOM 796   C CA   . ARG A 1 67 ? -2.619  0.022   -2.682  1.00 0.00 ? 63 ARG A CA   1  
ATOM 797   C C    . ARG A 1 67 ? -4.102  -0.301  -2.516  1.00 0.00 ? 63 ARG A C    1  
ATOM 798   O O    . ARG A 1 67 ? -4.474  -1.421  -2.172  1.00 0.00 ? 63 ARG A O    1  
ATOM 799   C CB   . ARG A 1 67 ? -2.106  0.728   -1.420  1.00 0.00 ? 63 ARG A CB   1  
ATOM 800   C CG   . ARG A 1 67 ? -2.155  -0.138  -0.163  1.00 0.00 ? 63 ARG A CG   1  
ATOM 801   C CD   . ARG A 1 67 ? -0.767  -0.604  0.257   1.00 0.00 ? 63 ARG A CD   1  
ATOM 802   N NE   . ARG A 1 67 ? -0.192  -1.535  -0.710  1.00 0.00 ? 63 ARG A NE   1  
ATOM 803   C CZ   . ARG A 1 67 ? 0.613   -1.170  -1.703  1.00 0.00 ? 63 ARG A CZ   1  
ATOM 804   N NH1  . ARG A 1 67 ? 1.019   0.090   -1.812  1.00 0.00 ? 63 ARG A NH1  1  
ATOM 805   N NH2  . ARG A 1 67 ? 1.045   -2.071  -2.575  1.00 0.00 ? 63 ARG A NH2  1  
ATOM 806   H H    . ARG A 1 67 ? -1.931  1.711   -3.754  1.00 0.00 ? 63 ARG A H    1  
ATOM 807   H HA   . ARG A 1 67 ? -2.069  -0.897  -2.822  1.00 0.00 ? 63 ARG A HA   1  
ATOM 808   H HB2  . ARG A 1 67 ? -1.082  1.026   -1.585  1.00 0.00 ? 63 ARG A HB2  1  
ATOM 809   H HB3  . ARG A 1 67 ? -2.705  1.610   -1.247  1.00 0.00 ? 63 ARG A HB3  1  
ATOM 810   H HG2  . ARG A 1 67 ? -2.589  0.434   0.639   1.00 0.00 ? 63 ARG A HG2  1  
ATOM 811   H HG3  . ARG A 1 67 ? -2.769  -1.007  -0.362  1.00 0.00 ? 63 ARG A HG3  1  
ATOM 812   H HD2  . ARG A 1 67 ? -0.120  0.256   0.344   1.00 0.00 ? 63 ARG A HD2  1  
ATOM 813   H HD3  . ARG A 1 67 ? -0.837  -1.097  1.218   1.00 0.00 ? 63 ARG A HD3  1  
ATOM 814   H HE   . ARG A 1 67 ? -0.437  -2.482  -0.624  1.00 0.00 ? 63 ARG A HE   1  
ATOM 815   H HH11 . ARG A 1 67 ? 0.725   0.782   -1.145  1.00 0.00 ? 63 ARG A HH11 1  
ATOM 816   H HH12 . ARG A 1 67 ? 1.633   0.358   -2.576  1.00 0.00 ? 63 ARG A HH12 1  
ATOM 817   H HH21 . ARG A 1 67 ? 0.777   -3.044  -2.494  1.00 0.00 ? 63 ARG A HH21 1  
ATOM 818   H HH22 . ARG A 1 67 ? 1.632   -1.787  -3.349  1.00 0.00 ? 63 ARG A HH22 1  
ATOM 819   N N    . ILE A 1 68 ? -4.942  0.693   -2.764  1.00 0.00 ? 64 ILE A N    1  
ATOM 820   C CA   . ILE A 1 68 ? -6.376  0.520   -2.648  1.00 0.00 ? 64 ILE A CA   1  
ATOM 821   C C    . ILE A 1 68 ? -6.951  -0.154  -3.893  1.00 0.00 ? 64 ILE A C    1  
ATOM 822   O O    . ILE A 1 68 ? -7.680  -1.134  -3.783  1.00 0.00 ? 64 ILE A O    1  
ATOM 823   C CB   . ILE A 1 68 ? -7.085  1.873   -2.413  1.00 0.00 ? 64 ILE A CB   1  
ATOM 824   C CG1  . ILE A 1 68 ? -6.558  2.523   -1.132  1.00 0.00 ? 64 ILE A CG1  1  
ATOM 825   C CG2  . ILE A 1 68 ? -8.593  1.683   -2.329  1.00 0.00 ? 64 ILE A CG2  1  
ATOM 826   C CD1  . ILE A 1 68 ? -7.015  3.953   -0.939  1.00 0.00 ? 64 ILE A CD1  1  
ATOM 827   H H    . ILE A 1 68 ? -4.586  1.572   -3.019  1.00 0.00 ? 64 ILE A H    1  
ATOM 828   H HA   . ILE A 1 68 ? -6.561  -0.113  -1.791  1.00 0.00 ? 64 ILE A HA   1  
ATOM 829   H HB   . ILE A 1 68 ? -6.873  2.520   -3.250  1.00 0.00 ? 64 ILE A HB   1  
ATOM 830   H HG12 . ILE A 1 68 ? -6.898  1.951   -0.283  1.00 0.00 ? 64 ILE A HG12 1  
ATOM 831   H HG13 . ILE A 1 68 ? -5.478  2.519   -1.154  1.00 0.00 ? 64 ILE A HG13 1  
ATOM 832   H HG21 . ILE A 1 68 ? -9.069  2.636   -2.141  1.00 0.00 ? 64 ILE A HG21 1  
ATOM 833   H HG22 . ILE A 1 68 ? -8.825  1.002   -1.524  1.00 0.00 ? 64 ILE A HG22 1  
ATOM 834   H HG23 . ILE A 1 68 ? -8.959  1.277   -3.261  1.00 0.00 ? 64 ILE A HG23 1  
ATOM 835   H HD11 . ILE A 1 68 ? -6.751  4.536   -1.807  1.00 0.00 ? 64 ILE A HD11 1  
ATOM 836   H HD12 . ILE A 1 68 ? -6.532  4.367   -0.065  1.00 0.00 ? 64 ILE A HD12 1  
ATOM 837   H HD13 . ILE A 1 68 ? -8.086  3.973   -0.800  1.00 0.00 ? 64 ILE A HD13 1  
ATOM 838   N N    . ALA A 1 69 ? -6.588  0.356   -5.070  1.00 0.00 ? 65 ALA A N    1  
ATOM 839   C CA   . ALA A 1 69 ? -7.084  -0.183  -6.339  1.00 0.00 ? 65 ALA A CA   1  
ATOM 840   C C    . ALA A 1 69 ? -6.767  -1.670  -6.503  1.00 0.00 ? 65 ALA A C    1  
ATOM 841   O O    . ALA A 1 69 ? -7.656  -2.469  -6.794  1.00 0.00 ? 65 ALA A O    1  
ATOM 842   C CB   . ALA A 1 69 ? -6.501  0.605   -7.501  1.00 0.00 ? 65 ALA A CB   1  
ATOM 843   H H    . ALA A 1 69 ? -5.965  1.112   -5.088  1.00 0.00 ? 65 ALA A H    1  
ATOM 844   H HA   . ALA A 1 69 ? -8.153  -0.055  -6.356  1.00 0.00 ? 65 ALA A HA   1  
ATOM 845   H HB1  . ALA A 1 69 ? -6.787  1.643   -7.408  1.00 0.00 ? 65 ALA A HB1  1  
ATOM 846   H HB2  . ALA A 1 69 ? -6.877  0.208   -8.431  1.00 0.00 ? 65 ALA A HB2  1  
ATOM 847   H HB3  . ALA A 1 69 ? -5.423  0.527   -7.485  1.00 0.00 ? 65 ALA A HB3  1  
ATOM 848   N N    . TYR A 1 70 ? -5.501  -2.031  -6.314  1.00 0.00 ? 66 TYR A N    1  
ATOM 849   C CA   . TYR A 1 70 ? -5.056  -3.420  -6.445  1.00 0.00 ? 66 TYR A CA   1  
ATOM 850   C C    . TYR A 1 70 ? -5.878  -4.331  -5.543  1.00 0.00 ? 66 TYR A C    1  
ATOM 851   O O    . TYR A 1 70 ? -6.461  -5.316  -5.994  1.00 0.00 ? 66 TYR A O    1  
ATOM 852   C CB   . TYR A 1 70 ? -3.571  -3.519  -6.078  1.00 0.00 ? 66 TYR A CB   1  
ATOM 853   C CG   . TYR A 1 70 ? -2.907  -4.830  -6.440  1.00 0.00 ? 66 TYR A CG   1  
ATOM 854   C CD1  . TYR A 1 70 ? -3.212  -5.490  -7.626  1.00 0.00 ? 66 TYR A CD1  1  
ATOM 855   C CD2  . TYR A 1 70 ? -1.952  -5.398  -5.602  1.00 0.00 ? 66 TYR A CD2  1  
ATOM 856   C CE1  . TYR A 1 70 ? -2.587  -6.675  -7.963  1.00 0.00 ? 66 TYR A CE1  1  
ATOM 857   C CE2  . TYR A 1 70 ? -1.326  -6.585  -5.933  1.00 0.00 ? 66 TYR A CE2  1  
ATOM 858   C CZ   . TYR A 1 70 ? -1.646  -7.217  -7.115  1.00 0.00 ? 66 TYR A CZ   1  
ATOM 859   O OH   . TYR A 1 70 ? -1.015  -8.392  -7.456  1.00 0.00 ? 66 TYR A OH   1  
ATOM 860   H H    . TYR A 1 70 ? -4.841  -1.344  -6.072  1.00 0.00 ? 66 TYR A H    1  
ATOM 861   H HA   . TYR A 1 70 ? -5.191  -3.720  -7.471  1.00 0.00 ? 66 TYR A HA   1  
ATOM 862   H HB2  . TYR A 1 70 ? -3.034  -2.732  -6.585  1.00 0.00 ? 66 TYR A HB2  1  
ATOM 863   H HB3  . TYR A 1 70 ? -3.468  -3.383  -5.012  1.00 0.00 ? 66 TYR A HB3  1  
ATOM 864   H HD1  . TYR A 1 70 ? -3.951  -5.064  -8.289  1.00 0.00 ? 66 TYR A HD1  1  
ATOM 865   H HD2  . TYR A 1 70 ? -1.703  -4.900  -4.677  1.00 0.00 ? 66 TYR A HD2  1  
ATOM 866   H HE1  . TYR A 1 70 ? -2.839  -7.172  -8.888  1.00 0.00 ? 66 TYR A HE1  1  
ATOM 867   H HE2  . TYR A 1 70 ? -0.589  -7.011  -5.269  1.00 0.00 ? 66 TYR A HE2  1  
ATOM 868   H HH   . TYR A 1 70 ? -0.764  -8.866  -6.655  1.00 0.00 ? 66 TYR A HH   1  
ATOM 869   N N    . SER A 1 71 ? -5.914  -3.981  -4.271  1.00 0.00 ? 67 SER A N    1  
ATOM 870   C CA   . SER A 1 71 ? -6.660  -4.740  -3.285  1.00 0.00 ? 67 SER A CA   1  
ATOM 871   C C    . SER A 1 71 ? -8.154  -4.764  -3.615  1.00 0.00 ? 67 SER A C    1  
ATOM 872   O O    . SER A 1 71 ? -8.819  -5.782  -3.413  1.00 0.00 ? 67 SER A O    1  
ATOM 873   C CB   . SER A 1 71 ? -6.417  -4.153  -1.902  1.00 0.00 ? 67 SER A CB   1  
ATOM 874   O OG   . SER A 1 71 ? -5.032  -3.971  -1.665  1.00 0.00 ? 67 SER A OG   1  
ATOM 875   H H    . SER A 1 71 ? -5.392  -3.205  -3.980  1.00 0.00 ? 67 SER A H    1  
ATOM 876   H HA   . SER A 1 71 ? -6.287  -5.752  -3.303  1.00 0.00 ? 67 SER A HA   1  
ATOM 877   H HB2  . SER A 1 71 ? -6.913  -3.195  -1.825  1.00 0.00 ? 67 SER A HB2  1  
ATOM 878   H HB3  . SER A 1 71 ? -6.813  -4.824  -1.155  1.00 0.00 ? 67 SER A HB3  1  
ATOM 879   H HG   . SER A 1 71 ? -4.805  -3.034  -1.757  1.00 0.00 ? 67 SER A HG   1  
ATOM 880   N N    . LEU A 1 72 ? -8.684  -3.646  -4.115  1.00 0.00 ? 68 LEU A N    1  
ATOM 881   C CA   . LEU A 1 72 ? -10.094 -3.565  -4.489  1.00 0.00 ? 68 LEU A CA   1  
ATOM 882   C C    . LEU A 1 72 ? -10.426 -4.593  -5.558  1.00 0.00 ? 68 LEU A C    1  
ATOM 883   O O    . LEU A 1 72 ? -11.482 -5.222  -5.511  1.00 0.00 ? 68 LEU A O    1  
ATOM 884   C CB   . LEU A 1 72 ? -10.445 -2.166  -5.005  1.00 0.00 ? 68 LEU A CB   1  
ATOM 885   C CG   . LEU A 1 72 ? -10.908 -1.166  -3.945  1.00 0.00 ? 68 LEU A CG   1  
ATOM 886   C CD1  . LEU A 1 72 ? -11.273 0.159   -4.597  1.00 0.00 ? 68 LEU A CD1  1  
ATOM 887   C CD2  . LEU A 1 72 ? -12.095 -1.716  -3.170  1.00 0.00 ? 68 LEU A CD2  1  
ATOM 888   H H    . LEU A 1 72 ? -8.128  -2.838  -4.209  1.00 0.00 ? 68 LEU A H    1  
ATOM 889   H HA   . LEU A 1 72 ? -10.682 -3.775  -3.609  1.00 0.00 ? 68 LEU A HA   1  
ATOM 890   H HB2  . LEU A 1 72 ? -9.571  -1.759  -5.493  1.00 0.00 ? 68 LEU A HB2  1  
ATOM 891   H HB3  . LEU A 1 72 ? -11.230 -2.265  -5.738  1.00 0.00 ? 68 LEU A HB3  1  
ATOM 892   H HG   . LEU A 1 72 ? -10.102 -0.985  -3.249  1.00 0.00 ? 68 LEU A HG   1  
ATOM 893   H HD11 . LEU A 1 72 ? -11.435 0.904   -3.832  1.00 0.00 ? 68 LEU A HD11 1  
ATOM 894   H HD12 . LEU A 1 72 ? -12.176 0.038   -5.176  1.00 0.00 ? 68 LEU A HD12 1  
ATOM 895   H HD13 . LEU A 1 72 ? -10.470 0.475   -5.244  1.00 0.00 ? 68 LEU A HD13 1  
ATOM 896   H HD21 . LEU A 1 72 ? -11.775 -2.553  -2.569  1.00 0.00 ? 68 LEU A HD21 1  
ATOM 897   H HD22 . LEU A 1 72 ? -12.857 -2.039  -3.862  1.00 0.00 ? 68 LEU A HD22 1  
ATOM 898   H HD23 . LEU A 1 72 ? -12.494 -0.944  -2.528  1.00 0.00 ? 68 LEU A HD23 1  
ATOM 899   N N    . LEU A 1 73 ? -9.519  -4.750  -6.521  1.00 0.00 ? 69 LEU A N    1  
ATOM 900   C CA   . LEU A 1 73 ? -9.700  -5.712  -7.605  1.00 0.00 ? 69 LEU A CA   1  
ATOM 901   C C    . LEU A 1 73 ? -9.917  -7.101  -7.028  1.00 0.00 ? 69 LEU A C    1  
ATOM 902   O O    . LEU A 1 73 ? -10.784 -7.847  -7.482  1.00 0.00 ? 69 LEU A O    1  
ATOM 903   C CB   . LEU A 1 73 ? -8.481  -5.719  -8.533  1.00 0.00 ? 69 LEU A CB   1  
ATOM 904   C CG   . LEU A 1 73 ? -8.114  -4.364  -9.143  1.00 0.00 ? 69 LEU A CG   1  
ATOM 905   C CD1  . LEU A 1 73 ? -6.887  -4.489  -10.031 1.00 0.00 ? 69 LEU A CD1  1  
ATOM 906   C CD2  . LEU A 1 73 ? -9.283  -3.796  -9.933  1.00 0.00 ? 69 LEU A CD2  1  
ATOM 907   H H    . LEU A 1 73 ? -8.704  -4.200  -6.501  1.00 0.00 ? 69 LEU A H    1  
ATOM 908   H HA   . LEU A 1 73 ? -10.576 -5.426  -8.166  1.00 0.00 ? 69 LEU A HA   1  
ATOM 909   H HB2  . LEU A 1 73 ? -7.631  -6.078  -7.969  1.00 0.00 ? 69 LEU A HB2  1  
ATOM 910   H HB3  . LEU A 1 73 ? -8.673  -6.412  -9.338  1.00 0.00 ? 69 LEU A HB3  1  
ATOM 911   H HG   . LEU A 1 73 ? -7.880  -3.671  -8.348  1.00 0.00 ? 69 LEU A HG   1  
ATOM 912   H HD11 . LEU A 1 73 ? -7.071  -5.224  -10.802 1.00 0.00 ? 69 LEU A HD11 1  
ATOM 913   H HD12 . LEU A 1 73 ? -6.041  -4.798  -9.435  1.00 0.00 ? 69 LEU A HD12 1  
ATOM 914   H HD13 . LEU A 1 73 ? -6.675  -3.534  -10.489 1.00 0.00 ? 69 LEU A HD13 1  
ATOM 915   H HD21 . LEU A 1 73 ? -10.142 -3.703  -9.287  1.00 0.00 ? 69 LEU A HD21 1  
ATOM 916   H HD22 . LEU A 1 73 ? -9.519  -4.458  -10.752 1.00 0.00 ? 69 LEU A HD22 1  
ATOM 917   H HD23 . LEU A 1 73 ? -9.015  -2.825  -10.320 1.00 0.00 ? 69 LEU A HD23 1  
ATOM 918   N N    . GLY A 1 74 ? -9.134  -7.426  -6.006  1.00 0.00 ? 70 GLY A N    1  
ATOM 919   C CA   . GLY A 1 74 ? -9.261  -8.709  -5.358  1.00 0.00 ? 70 GLY A CA   1  
ATOM 920   C C    . GLY A 1 74 ? -10.609 -8.858  -4.689  1.00 0.00 ? 70 GLY A C    1  
ATOM 921   O O    . GLY A 1 74 ? -11.285 -9.861  -4.870  1.00 0.00 ? 70 GLY A O    1  
ATOM 922   H H    . GLY A 1 74 ? -8.465  -6.783  -5.690  1.00 0.00 ? 70 GLY A H    1  
ATOM 923   H HA2  . GLY A 1 74 ? -9.145  -9.488  -6.100  1.00 0.00 ? 70 GLY A HA2  1  
ATOM 924   H HA3  . GLY A 1 74 ? -8.484  -8.809  -4.615  1.00 0.00 ? 70 GLY A HA3  1  
ATOM 925   N N    . LEU A 1 75 ? -11.012 -7.836  -3.938  1.00 0.00 ? 71 LEU A N    1  
ATOM 926   C CA   . LEU A 1 75 ? -12.299 -7.847  -3.238  1.00 0.00 ? 71 LEU A CA   1  
ATOM 927   C C    . LEU A 1 75 ? -13.461 -7.999  -4.219  1.00 0.00 ? 71 LEU A C    1  
ATOM 928   O O    . LEU A 1 75 ? -14.393 -8.771  -3.979  1.00 0.00 ? 71 LEU A O    1  
ATOM 929   C CB   . LEU A 1 75 ? -12.484 -6.561  -2.429  1.00 0.00 ? 71 LEU A CB   1  
ATOM 930   C CG   . LEU A 1 75 ? -11.414 -6.293  -1.368  1.00 0.00 ? 71 LEU A CG   1  
ATOM 931   C CD1  . LEU A 1 75 ? -11.729 -5.007  -0.619  1.00 0.00 ? 71 LEU A CD1  1  
ATOM 932   C CD2  . LEU A 1 75 ? -11.312 -7.464  -0.400  1.00 0.00 ? 71 LEU A CD2  1  
ATOM 933   H H    . LEU A 1 75 ? -10.427 -7.053  -3.843  1.00 0.00 ? 71 LEU A H    1  
ATOM 934   H HA   . LEU A 1 75 ? -12.302 -8.689  -2.564  1.00 0.00 ? 71 LEU A HA   1  
ATOM 935   H HB2  . LEU A 1 75 ? -12.495 -5.728  -3.116  1.00 0.00 ? 71 LEU A HB2  1  
ATOM 936   H HB3  . LEU A 1 75 ? -13.443 -6.609  -1.935  1.00 0.00 ? 71 LEU A HB3  1  
ATOM 937   H HG   . LEU A 1 75 ? -10.457 -6.172  -1.853  1.00 0.00 ? 71 LEU A HG   1  
ATOM 938   H HD11 . LEU A 1 75 ? -11.661 -4.170  -1.296  1.00 0.00 ? 71 LEU A HD11 1  
ATOM 939   H HD12 . LEU A 1 75 ? -11.021 -4.876  0.189   1.00 0.00 ? 71 LEU A HD12 1  
ATOM 940   H HD13 . LEU A 1 75 ? -12.730 -5.062  -0.214  1.00 0.00 ? 71 LEU A HD13 1  
ATOM 941   H HD21 . LEU A 1 75 ? -11.146 -8.376  -0.952  1.00 0.00 ? 71 LEU A HD21 1  
ATOM 942   H HD22 . LEU A 1 75 ? -12.230 -7.546  0.164   1.00 0.00 ? 71 LEU A HD22 1  
ATOM 943   H HD23 . LEU A 1 75 ? -10.488 -7.299  0.278   1.00 0.00 ? 71 LEU A HD23 1  
ATOM 944   N N    . LYS A 1 76 ? -13.394 -7.260  -5.323  1.00 0.00 ? 72 LYS A N    1  
ATOM 945   C CA   . LYS A 1 76 ? -14.431 -7.309  -6.348  1.00 0.00 ? 72 LYS A CA   1  
ATOM 946   C C    . LYS A 1 76 ? -14.534 -8.715  -6.943  1.00 0.00 ? 72 LYS A C    1  
ATOM 947   O O    . LYS A 1 76 ? -15.626 -9.194  -7.253  1.00 0.00 ? 72 LYS A O    1  
ATOM 948   C CB   . LYS A 1 76 ? -14.138 -6.276  -7.446  1.00 0.00 ? 72 LYS A CB   1  
ATOM 949   C CG   . LYS A 1 76 ? -14.196 -4.832  -6.957  1.00 0.00 ? 72 LYS A CG   1  
ATOM 950   C CD   . LYS A 1 76 ? -13.551 -3.866  -7.945  1.00 0.00 ? 72 LYS A CD   1  
ATOM 951   C CE   . LYS A 1 76 ? -13.384 -2.473  -7.345  1.00 0.00 ? 72 LYS A CE   1  
ATOM 952   N NZ   . LYS A 1 76 ? -14.499 -1.553  -7.714  1.00 0.00 ? 72 LYS A NZ   1  
ATOM 953   H H    . LYS A 1 76 ? -12.624 -6.659  -5.448  1.00 0.00 ? 72 LYS A H    1  
ATOM 954   H HA   . LYS A 1 76 ? -15.371 -7.062  -5.877  1.00 0.00 ? 72 LYS A HA   1  
ATOM 955   H HB2  . LYS A 1 76 ? -13.150 -6.461  -7.843  1.00 0.00 ? 72 LYS A HB2  1  
ATOM 956   H HB3  . LYS A 1 76 ? -14.863 -6.394  -8.239  1.00 0.00 ? 72 LYS A HB3  1  
ATOM 957   H HG2  . LYS A 1 76 ? -15.227 -4.550  -6.818  1.00 0.00 ? 72 LYS A HG2  1  
ATOM 958   H HG3  . LYS A 1 76 ? -13.674 -4.765  -6.012  1.00 0.00 ? 72 LYS A HG3  1  
ATOM 959   H HD2  . LYS A 1 76 ? -12.578 -4.247  -8.220  1.00 0.00 ? 72 LYS A HD2  1  
ATOM 960   H HD3  . LYS A 1 76 ? -14.174 -3.797  -8.825  1.00 0.00 ? 72 LYS A HD3  1  
ATOM 961   H HE2  . LYS A 1 76 ? -13.350 -2.561  -6.269  1.00 0.00 ? 72 LYS A HE2  1  
ATOM 962   H HE3  . LYS A 1 76 ? -12.453 -2.052  -7.697  1.00 0.00 ? 72 LYS A HE3  1  
ATOM 963   H HZ1  . LYS A 1 76 ? -14.470 -1.348  -8.735  1.00 0.00 ? 72 LYS A HZ1  1  
ATOM 964   H HZ2  . LYS A 1 76 ? -14.413 -0.656  -7.191  1.00 0.00 ? 72 LYS A HZ2  1  
ATOM 965   H HZ3  . LYS A 1 76 ? -15.417 -1.990  -7.483  1.00 0.00 ? 72 LYS A HZ3  1  
ATOM 966   N N    . ASP A 1 77 ? -13.392 -9.377  -7.084  1.00 0.00 ? 73 ASP A N    1  
ATOM 967   C CA   . ASP A 1 77 ? -13.350 -10.732 -7.628  1.00 0.00 ? 73 ASP A CA   1  
ATOM 968   C C    . ASP A 1 77 ? -13.747 -11.754 -6.564  1.00 0.00 ? 73 ASP A C    1  
ATOM 969   O O    . ASP A 1 77 ? -14.422 -12.743 -6.853  1.00 0.00 ? 73 ASP A O    1  
ATOM 970   C CB   . ASP A 1 77 ? -11.947 -11.052 -8.153  1.00 0.00 ? 73 ASP A CB   1  
ATOM 971   C CG   . ASP A 1 77 ? -11.876 -12.406 -8.832  1.00 0.00 ? 73 ASP A CG   1  
ATOM 972   O OD1  . ASP A 1 77 ? -12.703 -12.669 -9.729  1.00 0.00 ? 73 ASP A OD1  1  
ATOM 973   O OD2  . ASP A 1 77 ? -10.988 -13.210 -8.480  1.00 0.00 ? 73 ASP A OD2  1  
ATOM 974   H H    . ASP A 1 77 ? -12.549 -8.940  -6.827  1.00 0.00 ? 73 ASP A H    1  
ATOM 975   H HA   . ASP A 1 77 ? -14.052 -10.784 -8.444  1.00 0.00 ? 73 ASP A HA   1  
ATOM 976   H HB2  . ASP A 1 77 ? -11.656 -10.296 -8.867  1.00 0.00 ? 73 ASP A HB2  1  
ATOM 977   H HB3  . ASP A 1 77 ? -11.252 -11.047 -7.326  1.00 0.00 ? 73 ASP A HB3  1  
ATOM 978   N N    . GLN A 1 78 ? -13.334 -11.495 -5.329  1.00 0.00 ? 74 GLN A N    1  
ATOM 979   C CA   . GLN A 1 78 ? -13.630 -12.378 -4.204  1.00 0.00 ? 74 GLN A CA   1  
ATOM 980   C C    . GLN A 1 78 ? -15.135 -12.545 -4.013  1.00 0.00 ? 74 GLN A C    1  
ATOM 981   O O    . GLN A 1 78 ? -15.621 -13.659 -3.822  1.00 0.00 ? 74 GLN A O    1  
ATOM 982   C CB   . GLN A 1 78 ? -12.996 -11.837 -2.919  1.00 0.00 ? 74 GLN A CB   1  
ATOM 983   C CG   . GLN A 1 78 ? -11.508 -12.140 -2.800  1.00 0.00 ? 74 GLN A CG   1  
ATOM 984   C CD   . GLN A 1 78 ? -11.224 -13.590 -2.454  1.00 0.00 ? 74 GLN A CD   1  
ATOM 985   O OE1  . GLN A 1 78 ? -12.009 -14.485 -2.765  1.00 0.00 ? 74 GLN A OE1  1  
ATOM 986   N NE2  . GLN A 1 78 ? -10.095 -13.834 -1.806  1.00 0.00 ? 74 GLN A NE2  1  
ATOM 987   H H    . GLN A 1 78 ? -12.797 -10.685 -5.168  1.00 0.00 ? 74 GLN A H    1  
ATOM 988   H HA   . GLN A 1 78 ? -13.201 -13.343 -4.423  1.00 0.00 ? 74 GLN A HA   1  
ATOM 989   H HB2  . GLN A 1 78 ? -13.124 -10.764 -2.894  1.00 0.00 ? 74 GLN A HB2  1  
ATOM 990   H HB3  . GLN A 1 78 ? -13.501 -12.271 -2.070  1.00 0.00 ? 74 GLN A HB3  1  
ATOM 991   H HG2  . GLN A 1 78 ? -11.033 -11.914 -3.741  1.00 0.00 ? 74 GLN A HG2  1  
ATOM 992   H HG3  . GLN A 1 78 ? -11.087 -11.514 -2.026  1.00 0.00 ? 74 GLN A HG3  1  
ATOM 993   H HE21 . GLN A 1 78 ? -9.513  -13.074 -1.586  1.00 0.00 ? 74 GLN A HE21 1  
ATOM 994   H HE22 . GLN A 1 78 ? -9.888  -14.764 -1.572  1.00 0.00 ? 74 GLN A HE22 1  
ATOM 995   N N    . VAL A 1 79 ? -15.872 -11.444 -4.090  1.00 0.00 ? 75 VAL A N    1  
ATOM 996   C CA   . VAL A 1 79 ? -17.324 -11.495 -3.923  1.00 0.00 ? 75 VAL A CA   1  
ATOM 997   C C    . VAL A 1 79 ? -17.987 -12.147 -5.140  1.00 0.00 ? 75 VAL A C    1  
ATOM 998   O O    . VAL A 1 79 ? -19.137 -12.588 -5.080  1.00 0.00 ? 75 VAL A O    1  
ATOM 999   C CB   . VAL A 1 79 ? -17.921 -10.089 -3.682  1.00 0.00 ? 75 VAL A CB   1  
ATOM 1000  C CG1  . VAL A 1 79 ? -17.984 -9.283  -4.971  1.00 0.00 ? 75 VAL A CG1  1  
ATOM 1001  C CG2  . VAL A 1 79 ? -19.298 -10.192 -3.038  1.00 0.00 ? 75 VAL A CG2  1  
ATOM 1002  H H    . VAL A 1 79 ? -15.442 -10.575 -4.250  1.00 0.00 ? 75 VAL A H    1  
ATOM 1003  H HA   . VAL A 1 79 ? -17.530 -12.103 -3.053  1.00 0.00 ? 75 VAL A HA   1  
ATOM 1004  H HB   . VAL A 1 79 ? -17.272 -9.564  -2.996  1.00 0.00 ? 75 VAL A HB   1  
ATOM 1005  H HG11 . VAL A 1 79 ? -18.667 -9.761  -5.660  1.00 0.00 ? 75 VAL A HG11 1  
ATOM 1006  H HG12 . VAL A 1 79 ? -17.001 -9.238  -5.413  1.00 0.00 ? 75 VAL A HG12 1  
ATOM 1007  H HG13 . VAL A 1 79 ? -18.330 -8.283  -4.756  1.00 0.00 ? 75 VAL A HG13 1  
ATOM 1008  H HG21 . VAL A 1 79 ? -19.211 -10.702 -2.090  1.00 0.00 ? 75 VAL A HG21 1  
ATOM 1009  H HG22 . VAL A 1 79 ? -19.956 -10.749 -3.686  1.00 0.00 ? 75 VAL A HG22 1  
ATOM 1010  H HG23 . VAL A 1 79 ? -19.700 -9.202  -2.878  1.00 0.00 ? 75 VAL A HG23 1  
ATOM 1011  N N    . ASN A 1 80 ? -17.248 -12.220 -6.239  1.00 0.00 ? 76 ASN A N    1  
ATOM 1012  C CA   . ASN A 1 80 ? -17.758 -12.825 -7.464  1.00 0.00 ? 76 ASN A CA   1  
ATOM 1013  C C    . ASN A 1 80 ? -17.514 -14.325 -7.453  1.00 0.00 ? 76 ASN A C    1  
ATOM 1014  O O    . ASN A 1 80 ? -18.148 -15.075 -8.195  1.00 0.00 ? 76 ASN A O    1  
ATOM 1015  C CB   . ASN A 1 80 ? -17.103 -12.200 -8.695  1.00 0.00 ? 76 ASN A CB   1  
ATOM 1016  C CG   . ASN A 1 80 ? -17.963 -11.123 -9.320  1.00 0.00 ? 76 ASN A CG   1  
ATOM 1017  O OD1  . ASN A 1 80 ? -18.802 -11.401 -10.176 1.00 0.00 ? 76 ASN A OD1  1  
ATOM 1018  N ND2  . ASN A 1 80 ? -17.758 -9.885  -8.902  1.00 0.00 ? 76 ASN A ND2  1  
ATOM 1019  H H    . ASN A 1 80 ? -16.334 -11.866 -6.225  1.00 0.00 ? 76 ASN A H    1  
ATOM 1020  H HA   . ASN A 1 80 ? -18.823 -12.647 -7.504  1.00 0.00 ? 76 ASN A HA   1  
ATOM 1021  H HB2  . ASN A 1 80 ? -16.158 -11.762 -8.412  1.00 0.00 ? 76 ASN A HB2  1  
ATOM 1022  H HB3  . ASN A 1 80 ? -16.933 -12.969 -9.433  1.00 0.00 ? 76 ASN A HB3  1  
ATOM 1023  H HD21 . ASN A 1 80 ? -17.064 -9.732  -8.220  1.00 0.00 ? 76 ASN A HD21 1  
ATOM 1024  H HD22 . ASN A 1 80 ? -18.310 -9.170  -9.283  1.00 0.00 ? 76 ASN A HD22 1  
ATOM 1025  N N    . THR A 1 81 ? -16.588 -14.755 -6.610  1.00 0.00 ? 77 THR A N    1  
ATOM 1026  C CA   . THR A 1 81 ? -16.260 -16.163 -6.493  1.00 0.00 ? 77 THR A CA   1  
ATOM 1027  C C    . THR A 1 81 ? -17.264 -16.871 -5.584  1.00 0.00 ? 77 THR A C    1  
ATOM 1028  O O    . THR A 1 81 ? -17.040 -17.021 -4.382  1.00 0.00 ? 77 THR A O    1  
ATOM 1029  C CB   . THR A 1 81 ? -14.825 -16.349 -5.958  1.00 0.00 ? 77 THR A CB   1  
ATOM 1030  O OG1  . THR A 1 81 ? -13.920 -15.510 -6.696  1.00 0.00 ? 77 THR A OG1  1  
ATOM 1031  C CG2  . THR A 1 81 ? -14.381 -17.802 -6.075  1.00 0.00 ? 77 THR A CG2  1  
ATOM 1032  H H    . THR A 1 81 ? -16.113 -14.108 -6.048  1.00 0.00 ? 77 THR A H    1  
ATOM 1033  H HA   . THR A 1 81 ? -16.315 -16.601 -7.479  1.00 0.00 ? 77 THR A HA   1  
ATOM 1034  H HB   . THR A 1 81 ? -14.804 -16.063 -4.917  1.00 0.00 ? 77 THR A HB   1  
ATOM 1035  H HG1  . THR A 1 81 ? -14.166 -14.585 -6.577  1.00 0.00 ? 77 THR A HG1  1  
ATOM 1036  H HG21 . THR A 1 81 ? -14.957 -18.411 -5.391  1.00 0.00 ? 77 THR A HG21 1  
ATOM 1037  H HG22 . THR A 1 81 ? -13.332 -17.881 -5.831  1.00 0.00 ? 77 THR A HG22 1  
ATOM 1038  H HG23 . THR A 1 81 ? -14.543 -18.148 -7.084  1.00 0.00 ? 77 THR A HG23 1  
ATOM 1039  N N    . VAL A 1 82 ? -18.395 -17.248 -6.164  1.00 0.00 ? 78 VAL A N    1  
ATOM 1040  C CA   . VAL A 1 82 ? -19.449 -17.936 -5.432  1.00 0.00 ? 78 VAL A CA   1  
ATOM 1041  C C    . VAL A 1 82 ? -19.058 -19.376 -5.114  1.00 0.00 ? 78 VAL A C    1  
ATOM 1042  O O    . VAL A 1 82 ? -19.150 -19.762 -3.932  1.00 0.00 ? 78 VAL A O    1  
ATOM 1043  C CB   . VAL A 1 82 ? -20.786 -17.924 -6.207  1.00 0.00 ? 78 VAL A CB   1  
ATOM 1044  C CG1  . VAL A 1 82 ? -21.465 -16.572 -6.071  1.00 0.00 ? 78 VAL A CG1  1  
ATOM 1045  C CG2  . VAL A 1 82 ? -20.575 -18.268 -7.677  1.00 0.00 ? 78 VAL A CG2  1  
ATOM 1046  O OXT  . VAL A 1 82 ? -18.657 -20.114 -6.043  1.00 0.00 ? 78 VAL A OXT  1  
ATOM 1047  H H    . VAL A 1 82 ? -18.541 -17.027 -7.106  1.00 0.00 ? 78 VAL A H    1  
ATOM 1048  H HA   . VAL A 1 82 ? -19.597 -17.407 -4.502  1.00 0.00 ? 78 VAL A HA   1  
ATOM 1049  H HB   . VAL A 1 82 ? -21.434 -18.672 -5.775  1.00 0.00 ? 78 VAL A HB   1  
ATOM 1050  H HG11 . VAL A 1 82 ? -21.844 -16.459 -5.066  1.00 0.00 ? 78 VAL A HG11 1  
ATOM 1051  H HG12 . VAL A 1 82 ? -22.283 -16.506 -6.774  1.00 0.00 ? 78 VAL A HG12 1  
ATOM 1052  H HG13 . VAL A 1 82 ? -20.751 -15.788 -6.276  1.00 0.00 ? 78 VAL A HG13 1  
ATOM 1053  H HG21 . VAL A 1 82 ? -19.995 -17.489 -8.150  1.00 0.00 ? 78 VAL A HG21 1  
ATOM 1054  H HG22 . VAL A 1 82 ? -21.533 -18.351 -8.167  1.00 0.00 ? 78 VAL A HG22 1  
ATOM 1055  H HG23 . VAL A 1 82 ? -20.048 -19.207 -7.756  1.00 0.00 ? 78 VAL A HG23 1  
ATOM 1056  N N    . GLY B 2 18 ? 8.751   4.231   11.702  1.00 0.00 ? 28 GLY B N    1  
ATOM 1057  C CA   . GLY B 2 18 ? 8.912   3.951   10.256  1.00 0.00 ? 28 GLY B CA   1  
ATOM 1058  C C    . GLY B 2 18 ? 10.203  3.214   9.963   1.00 0.00 ? 28 GLY B C    1  
ATOM 1059  O O    . GLY B 2 18 ? 10.825  2.665   10.870  1.00 0.00 ? 28 GLY B O    1  
ATOM 1060  H H    . GLY B 2 18 ? 7.817   4.647   11.885  1.00 0.00 ? 28 GLY B H    1  
ATOM 1061  H HA2  . GLY B 2 18 ? 8.082   3.346   9.922   1.00 0.00 ? 28 GLY B HA2  1  
ATOM 1062  H HA3  . GLY B 2 18 ? 8.908   4.882   9.714   1.00 0.00 ? 28 GLY B HA3  1  
ATOM 1063  N N    . MET B 2 19 ? 10.623  3.221   8.705   1.00 0.00 ? 29 MET B N    1  
ATOM 1064  C CA   . MET B 2 19 ? 11.840  2.523   8.300   1.00 0.00 ? 29 MET B CA   1  
ATOM 1065  C C    . MET B 2 19 ? 13.003  3.492   8.070   1.00 0.00 ? 29 MET B C    1  
ATOM 1066  O O    . MET B 2 19 ? 13.830  3.288   7.178   1.00 0.00 ? 29 MET B O    1  
ATOM 1067  C CB   . MET B 2 19 ? 11.575  1.695   7.032   1.00 0.00 ? 29 MET B CB   1  
ATOM 1068  C CG   . MET B 2 19 ? 11.242  2.521   5.795   1.00 0.00 ? 29 MET B CG   1  
ATOM 1069  S SD   . MET B 2 19 ? 9.554   3.151   5.796   1.00 0.00 ? 29 MET B SD   1  
ATOM 1070  C CE   . MET B 2 19 ? 9.395   3.650   4.083   1.00 0.00 ? 29 MET B CE   1  
ATOM 1071  H H    . MET B 2 19 ? 10.105  3.711   8.026   1.00 0.00 ? 29 MET B H    1  
ATOM 1072  H HA   . MET B 2 19 ? 12.109  1.850   9.098   1.00 0.00 ? 29 MET B HA   1  
ATOM 1073  H HB2  . MET B 2 19 ? 12.453  1.107   6.814   1.00 0.00 ? 29 MET B HB2  1  
ATOM 1074  H HB3  . MET B 2 19 ? 10.747  1.026   7.221   1.00 0.00 ? 29 MET B HB3  1  
ATOM 1075  H HG2  . MET B 2 19 ? 11.921  3.360   5.749   1.00 0.00 ? 29 MET B HG2  1  
ATOM 1076  H HG3  . MET B 2 19 ? 11.380  1.902   4.920   1.00 0.00 ? 29 MET B HG3  1  
ATOM 1077  H HE1  . MET B 2 19 ? 10.252  4.240   3.799   1.00 0.00 ? 29 MET B HE1  1  
ATOM 1078  H HE2  . MET B 2 19 ? 8.497   4.237   3.959   1.00 0.00 ? 29 MET B HE2  1  
ATOM 1079  H HE3  . MET B 2 19 ? 9.340   2.772   3.456   1.00 0.00 ? 29 MET B HE3  1  
ATOM 1080  N N    . SER B 2 20 ? 13.089  4.511   8.913   1.00 0.00 ? 30 SER B N    1  
ATOM 1081  C CA   . SER B 2 20 ? 14.141  5.519   8.793   1.00 0.00 ? 30 SER B CA   1  
ATOM 1082  C C    . SER B 2 20 ? 15.519  4.921   9.087   1.00 0.00 ? 30 SER B C    1  
ATOM 1083  O O    . SER B 2 20 ? 16.405  4.924   8.228   1.00 0.00 ? 30 SER B O    1  
ATOM 1084  C CB   . SER B 2 20 ? 13.855  6.691   9.727   1.00 0.00 ? 30 SER B CB   1  
ATOM 1085  O OG   . SER B 2 20 ? 12.492  7.070   9.649   1.00 0.00 ? 30 SER B OG   1  
ATOM 1086  H H    . SER B 2 20 ? 12.437  4.568   9.642   1.00 0.00 ? 30 SER B H    1  
ATOM 1087  H HA   . SER B 2 20 ? 14.133  5.875   7.774   1.00 0.00 ? 30 SER B HA   1  
ATOM 1088  H HB2  . SER B 2 20 ? 14.080  6.405   10.744  1.00 0.00 ? 30 SER B HB2  1  
ATOM 1089  H HB3  . SER B 2 20 ? 14.468  7.533   9.444   1.00 0.00 ? 30 SER B HB3  1  
ATOM 1090  H HG   . SER B 2 20 ? 12.169  6.925   8.736   1.00 0.00 ? 30 SER B HG   1  
ATOM 1091  N N    . ALA B 2 21 ? 15.696  4.389   10.293  1.00 0.00 ? 31 ALA B N    1  
ATOM 1092  C CA   . ALA B 2 21 ? 16.967  3.786   10.678  1.00 0.00 ? 31 ALA B CA   1  
ATOM 1093  C C    . ALA B 2 21 ? 17.165  2.459   9.959   1.00 0.00 ? 31 ALA B C    1  
ATOM 1094  O O    . ALA B 2 21 ? 18.289  1.989   9.789   1.00 0.00 ? 31 ALA B O    1  
ATOM 1095  C CB   . ALA B 2 21 ? 17.033  3.588   12.180  1.00 0.00 ? 31 ALA B CB   1  
ATOM 1096  H H    . ALA B 2 21 ? 14.957  4.410   10.942  1.00 0.00 ? 31 ALA B H    1  
ATOM 1097  H HA   . ALA B 2 21 ? 17.760  4.462   10.390  1.00 0.00 ? 31 ALA B HA   1  
ATOM 1098  H HB1  . ALA B 2 21 ? 16.346  2.807   12.471  1.00 0.00 ? 31 ALA B HB1  1  
ATOM 1099  H HB2  . ALA B 2 21 ? 16.763  4.509   12.674  1.00 0.00 ? 31 ALA B HB2  1  
ATOM 1100  H HB3  . ALA B 2 21 ? 18.037  3.309   12.463  1.00 0.00 ? 31 ALA B HB3  1  
ATOM 1101  N N    . TRP B 2 22 ? 16.052  1.871   9.545   1.00 0.00 ? 32 TRP B N    1  
ATOM 1102  C CA   . TRP B 2 22 ? 16.052  0.609   8.824   1.00 0.00 ? 32 TRP B CA   1  
ATOM 1103  C C    . TRP B 2 22 ? 16.835  0.759   7.521   1.00 0.00 ? 32 TRP B C    1  
ATOM 1104  O O    . TRP B 2 22 ? 17.886  0.141   7.334   1.00 0.00 ? 32 TRP B O    1  
ATOM 1105  C CB   . TRP B 2 22 ? 14.603  0.208   8.535   1.00 0.00 ? 32 TRP B CB   1  
ATOM 1106  C CG   . TRP B 2 22 ? 14.364  -1.265  8.428   1.00 0.00 ? 32 TRP B CG   1  
ATOM 1107  C CD1  . TRP B 2 22 ? 14.405  -2.181  9.439   1.00 0.00 ? 32 TRP B CD1  1  
ATOM 1108  C CD2  . TRP B 2 22 ? 14.014  -1.987  7.244   1.00 0.00 ? 32 TRP B CD2  1  
ATOM 1109  N NE1  . TRP B 2 22 ? 14.103  -3.430  8.953   1.00 0.00 ? 32 TRP B NE1  1  
ATOM 1110  C CE2  . TRP B 2 22 ? 13.862  -3.337  7.607   1.00 0.00 ? 32 TRP B CE2  1  
ATOM 1111  C CE3  . TRP B 2 22 ? 13.815  -1.621  5.910   1.00 0.00 ? 32 TRP B CE3  1  
ATOM 1112  C CZ2  . TRP B 2 22 ? 13.519  -4.321  6.685   1.00 0.00 ? 32 TRP B CZ2  1  
ATOM 1113  C CZ3  . TRP B 2 22 ? 13.474  -2.598  4.996   1.00 0.00 ? 32 TRP B CZ3  1  
ATOM 1114  C CH2  . TRP B 2 22 ? 13.328  -3.934  5.387   1.00 0.00 ? 32 TRP B CH2  1  
ATOM 1115  H H    . TRP B 2 22 ? 15.196  2.306   9.736   1.00 0.00 ? 32 TRP B H    1  
ATOM 1116  H HA   . TRP B 2 22 ? 16.520  -0.142  9.443   1.00 0.00 ? 32 TRP B HA   1  
ATOM 1117  H HB2  . TRP B 2 22 ? 13.973  0.584   9.327   1.00 0.00 ? 32 TRP B HB2  1  
ATOM 1118  H HB3  . TRP B 2 22 ? 14.298  0.661   7.603   1.00 0.00 ? 32 TRP B HB3  1  
ATOM 1119  H HD1  . TRP B 2 22 ? 14.642  -1.945  10.466  1.00 0.00 ? 32 TRP B HD1  1  
ATOM 1120  H HE1  . TRP B 2 22 ? 14.063  -4.264  9.491   1.00 0.00 ? 32 TRP B HE1  1  
ATOM 1121  H HE3  . TRP B 2 22 ? 13.923  -0.596  5.590   1.00 0.00 ? 32 TRP B HE3  1  
ATOM 1122  H HZ2  . TRP B 2 22 ? 13.402  -5.357  6.971   1.00 0.00 ? 32 TRP B HZ2  1  
ATOM 1123  H HZ3  . TRP B 2 22 ? 13.315  -2.333  3.961   1.00 0.00 ? 32 TRP B HZ3  1  
ATOM 1124  H HH2  . TRP B 2 22 ? 13.064  -4.664  4.637   1.00 0.00 ? 32 TRP B HH2  1  
ATOM 1125  N N    . LEU B 2 23 ? 16.306  1.587   6.623   1.00 0.00 ? 33 LEU B N    1  
ATOM 1126  C CA   . LEU B 2 23 ? 16.942  1.858   5.335   1.00 0.00 ? 33 LEU B CA   1  
ATOM 1127  C C    . LEU B 2 23 ? 18.323  2.495   5.497   1.00 0.00 ? 33 LEU B C    1  
ATOM 1128  O O    . LEU B 2 23 ? 19.148  2.433   4.588   1.00 0.00 ? 33 LEU B O    1  
ATOM 1129  C CB   . LEU B 2 23 ? 16.057  2.776   4.488   1.00 0.00 ? 33 LEU B CB   1  
ATOM 1130  C CG   . LEU B 2 23 ? 14.692  2.206   4.094   1.00 0.00 ? 33 LEU B CG   1  
ATOM 1131  C CD1  . LEU B 2 23 ? 13.926  3.211   3.249   1.00 0.00 ? 33 LEU B CD1  1  
ATOM 1132  C CD2  . LEU B 2 23 ? 14.851  0.895   3.340   1.00 0.00 ? 33 LEU B CD2  1  
ATOM 1133  H H    . LEU B 2 23 ? 15.418  1.969   6.801   1.00 0.00 ? 33 LEU B H    1  
ATOM 1134  H HA   . LEU B 2 23 ? 17.058  0.917   4.823   1.00 0.00 ? 33 LEU B HA   1  
ATOM 1135  H HB2  . LEU B 2 23 ? 15.893  3.689   5.043   1.00 0.00 ? 33 LEU B HB2  1  
ATOM 1136  H HB3  . LEU B 2 23 ? 16.594  3.022   3.583   1.00 0.00 ? 33 LEU B HB3  1  
ATOM 1137  H HG   . LEU B 2 23 ? 14.118  2.013   4.990   1.00 0.00 ? 33 LEU B HG   1  
ATOM 1138  H HD11 . LEU B 2 23 ? 13.815  4.135   3.799   1.00 0.00 ? 33 LEU B HD11 1  
ATOM 1139  H HD12 . LEU B 2 23 ? 12.949  2.814   3.014   1.00 0.00 ? 33 LEU B HD12 1  
ATOM 1140  H HD13 . LEU B 2 23 ? 14.468  3.399   2.335   1.00 0.00 ? 33 LEU B HD13 1  
ATOM 1141  H HD21 . LEU B 2 23 ? 15.386  1.073   2.418   1.00 0.00 ? 33 LEU B HD21 1  
ATOM 1142  H HD22 . LEU B 2 23 ? 13.877  0.487   3.118   1.00 0.00 ? 33 LEU B HD22 1  
ATOM 1143  H HD23 . LEU B 2 23 ? 15.405  0.196   3.947   1.00 0.00 ? 33 LEU B HD23 1  
ATOM 1144  N N    . ARG B 2 24 ? 18.571  3.108   6.647   1.00 0.00 ? 34 ARG B N    1  
ATOM 1145  C CA   . ARG B 2 24 ? 19.854  3.755   6.912   1.00 0.00 ? 34 ARG B CA   1  
ATOM 1146  C C    . ARG B 2 24 ? 21.003  2.747   6.861   1.00 0.00 ? 34 ARG B C    1  
ATOM 1147  O O    . ARG B 2 24 ? 22.023  2.991   6.220   1.00 0.00 ? 34 ARG B O    1  
ATOM 1148  C CB   . ARG B 2 24 ? 19.831  4.439   8.282   1.00 0.00 ? 34 ARG B CB   1  
ATOM 1149  C CG   . ARG B 2 24 ? 21.139  5.118   8.657   1.00 0.00 ? 34 ARG B CG   1  
ATOM 1150  C CD   . ARG B 2 24 ? 21.293  6.453   7.950   1.00 0.00 ? 34 ARG B CD   1  
ATOM 1151  N NE   . ARG B 2 24 ? 20.207  7.376   8.285   1.00 0.00 ? 34 ARG B NE   1  
ATOM 1152  C CZ   . ARG B 2 24 ? 20.016  8.550   7.685   1.00 0.00 ? 34 ARG B CZ   1  
ATOM 1153  N NH1  . ARG B 2 24 ? 20.851  8.960   6.741   1.00 0.00 ? 34 ARG B NH1  1  
ATOM 1154  N NH2  . ARG B 2 24 ? 18.988  9.315   8.031   1.00 0.00 ? 34 ARG B NH2  1  
ATOM 1155  H H    . ARG B 2 24 ? 17.875  3.130   7.336   1.00 0.00 ? 34 ARG B H    1  
ATOM 1156  H HA   . ARG B 2 24 ? 20.013  4.503   6.149   1.00 0.00 ? 34 ARG B HA   1  
ATOM 1157  H HB2  . ARG B 2 24 ? 19.052  5.187   8.284   1.00 0.00 ? 34 ARG B HB2  1  
ATOM 1158  H HB3  . ARG B 2 24 ? 19.606  3.699   9.037   1.00 0.00 ? 34 ARG B HB3  1  
ATOM 1159  H HG2  . ARG B 2 24 ? 21.157  5.282   9.724   1.00 0.00 ? 34 ARG B HG2  1  
ATOM 1160  H HG3  . ARG B 2 24 ? 21.961  4.474   8.377   1.00 0.00 ? 34 ARG B HG3  1  
ATOM 1161  H HD2  . ARG B 2 24 ? 22.232  6.895   8.242   1.00 0.00 ? 34 ARG B HD2  1  
ATOM 1162  H HD3  . ARG B 2 24 ? 21.291  6.282   6.883   1.00 0.00 ? 34 ARG B HD3  1  
ATOM 1163  H HE   . ARG B 2 24 ? 19.582  7.098   8.994   1.00 0.00 ? 34 ARG B HE   1  
ATOM 1164  H HH11 . ARG B 2 24 ? 21.632  8.385   6.474   1.00 0.00 ? 34 ARG B HH11 1  
ATOM 1165  H HH12 . ARG B 2 24 ? 20.710  9.841   6.289   1.00 0.00 ? 34 ARG B HH12 1  
ATOM 1166  H HH21 . ARG B 2 24 ? 18.353  9.014   8.748   1.00 0.00 ? 34 ARG B HH21 1  
ATOM 1167  H HH22 . ARG B 2 24 ? 18.831  10.191  7.566   1.00 0.00 ? 34 ARG B HH22 1  
ATOM 1168  N N    . ALA B 2 25 ? 20.814  1.613   7.532   1.00 0.00 ? 35 ALA B N    1  
ATOM 1169  C CA   . ALA B 2 25 ? 21.830  0.564   7.596   1.00 0.00 ? 35 ALA B CA   1  
ATOM 1170  C C    . ALA B 2 25 ? 22.254  0.065   6.213   1.00 0.00 ? 35 ALA B C    1  
ATOM 1171  O O    . ALA B 2 25 ? 23.418  -0.287  6.007   1.00 0.00 ? 35 ALA B O    1  
ATOM 1172  C CB   . ALA B 2 25 ? 21.324  -0.599  8.434   1.00 0.00 ? 35 ALA B CB   1  
ATOM 1173  H H    . ALA B 2 25 ? 19.971  1.493   8.022   1.00 0.00 ? 35 ALA B H    1  
ATOM 1174  H HA   . ALA B 2 25 ? 22.694  0.974   8.090   1.00 0.00 ? 35 ALA B HA   1  
ATOM 1175  H HB1  . ALA B 2 25 ? 21.057  -0.245  9.417   1.00 0.00 ? 35 ALA B HB1  1  
ATOM 1176  H HB2  . ALA B 2 25 ? 22.100  -1.346  8.516   1.00 0.00 ? 35 ALA B HB2  1  
ATOM 1177  H HB3  . ALA B 2 25 ? 20.457  -1.034  7.960   1.00 0.00 ? 35 ALA B HB3  1  
ATOM 1178  N N    . ILE B 2 26 ? 21.324  0.040   5.268   1.00 0.00 ? 36 ILE B N    1  
ATOM 1179  C CA   . ILE B 2 26 ? 21.626  -0.443  3.923   1.00 0.00 ? 36 ILE B CA   1  
ATOM 1180  C C    . ILE B 2 26 ? 21.974  0.691   2.961   1.00 0.00 ? 36 ILE B C    1  
ATOM 1181  O O    . ILE B 2 26 ? 22.475  0.439   1.868   1.00 0.00 ? 36 ILE B O    1  
ATOM 1182  C CB   . ILE B 2 26 ? 20.459  -1.255  3.331   1.00 0.00 ? 36 ILE B CB   1  
ATOM 1183  C CG1  . ILE B 2 26 ? 19.139  -0.503  3.510   1.00 0.00 ? 36 ILE B CG1  1  
ATOM 1184  C CG2  . ILE B 2 26 ? 20.395  -2.630  3.980   1.00 0.00 ? 36 ILE B CG2  1  
ATOM 1185  C CD1  . ILE B 2 26 ? 18.027  -1.006  2.620   1.00 0.00 ? 36 ILE B CD1  1  
ATOM 1186  H H    . ILE B 2 26 ? 20.422  0.355   5.480   1.00 0.00 ? 36 ILE B H    1  
ATOM 1187  H HA   . ILE B 2 26 ? 22.480  -1.103  3.998   1.00 0.00 ? 36 ILE B HA   1  
ATOM 1188  H HB   . ILE B 2 26 ? 20.647  -1.394  2.278   1.00 0.00 ? 36 ILE B HB   1  
ATOM 1189  H HG12 . ILE B 2 26 ? 18.813  -0.604  4.534   1.00 0.00 ? 36 ILE B HG12 1  
ATOM 1190  H HG13 . ILE B 2 26 ? 19.296  0.542   3.288   1.00 0.00 ? 36 ILE B HG13 1  
ATOM 1191  H HG21 . ILE B 2 26 ? 20.218  -2.521  5.039   1.00 0.00 ? 36 ILE B HG21 1  
ATOM 1192  H HG22 . ILE B 2 26 ? 21.331  -3.147  3.823   1.00 0.00 ? 36 ILE B HG22 1  
ATOM 1193  H HG23 . ILE B 2 26 ? 19.591  -3.199  3.537   1.00 0.00 ? 36 ILE B HG23 1  
ATOM 1194  H HD11 . ILE B 2 26 ? 18.329  -0.925  1.588   1.00 0.00 ? 36 ILE B HD11 1  
ATOM 1195  H HD12 . ILE B 2 26 ? 17.139  -0.415  2.784   1.00 0.00 ? 36 ILE B HD12 1  
ATOM 1196  H HD13 . ILE B 2 26 ? 17.820  -2.041  2.853   1.00 0.00 ? 36 ILE B HD13 1  
ATOM 1197  N N    . GLY B 2 27 ? 21.709  1.926   3.365   1.00 0.00 ? 37 GLY B N    1  
ATOM 1198  C CA   . GLY B 2 27 ? 22.013  3.061   2.509   1.00 0.00 ? 37 GLY B CA   1  
ATOM 1199  C C    . GLY B 2 27 ? 20.886  3.381   1.545   1.00 0.00 ? 37 GLY B C    1  
ATOM 1200  O O    . GLY B 2 27 ? 21.128  3.786   0.407   1.00 0.00 ? 37 GLY B O    1  
ATOM 1201  H H    . GLY B 2 27 ? 21.301  2.081   4.243   1.00 0.00 ? 37 GLY B H    1  
ATOM 1202  H HA2  . GLY B 2 27 ? 22.197  3.925   3.128   1.00 0.00 ? 37 GLY B HA2  1  
ATOM 1203  H HA3  . GLY B 2 27 ? 22.906  2.839   1.942   1.00 0.00 ? 37 GLY B HA3  1  
ATOM 1204  N N    . LEU B 2 28 ? 19.652  3.236   2.008   1.00 0.00 ? 38 LEU B N    1  
ATOM 1205  C CA   . LEU B 2 28 ? 18.483  3.501   1.174   1.00 0.00 ? 38 LEU B CA   1  
ATOM 1206  C C    . LEU B 2 28 ? 17.588  4.553   1.825   1.00 0.00 ? 38 LEU B C    1  
ATOM 1207  O O    . LEU B 2 28 ? 16.485  4.821   1.353   1.00 0.00 ? 38 LEU B O    1  
ATOM 1208  C CB   . LEU B 2 28 ? 17.687  2.214   0.934   1.00 0.00 ? 38 LEU B CB   1  
ATOM 1209  C CG   . LEU B 2 28 ? 17.838  1.594   -0.461  1.00 0.00 ? 38 LEU B CG   1  
ATOM 1210  C CD1  . LEU B 2 28 ? 19.235  1.030   -0.659  1.00 0.00 ? 38 LEU B CD1  1  
ATOM 1211  C CD2  . LEU B 2 28 ? 16.790  0.514   -0.682  1.00 0.00 ? 38 LEU B CD2  1  
ATOM 1212  H H    . LEU B 2 28 ? 19.524  2.986   2.951   1.00 0.00 ? 38 LEU B H    1  
ATOM 1213  H HA   . LEU B 2 28 ? 18.834  3.879   0.225   1.00 0.00 ? 38 LEU B HA   1  
ATOM 1214  H HB2  . LEU B 2 28 ? 18.003  1.483   1.663   1.00 0.00 ? 38 LEU B HB2  1  
ATOM 1215  H HB3  . LEU B 2 28 ? 16.641  2.428   1.095   1.00 0.00 ? 38 LEU B HB3  1  
ATOM 1216  H HG   . LEU B 2 28 ? 17.684  2.362   -1.205  1.00 0.00 ? 38 LEU B HG   1  
ATOM 1217  H HD11 . LEU B 2 28 ? 19.953  1.836   -0.670  1.00 0.00 ? 38 LEU B HD11 1  
ATOM 1218  H HD12 . LEU B 2 28 ? 19.276  0.498   -1.599  1.00 0.00 ? 38 LEU B HD12 1  
ATOM 1219  H HD13 . LEU B 2 28 ? 19.466  0.352   0.148   1.00 0.00 ? 38 LEU B HD13 1  
ATOM 1220  H HD21 . LEU B 2 28 ? 16.875  0.132   -1.689  1.00 0.00 ? 38 LEU B HD21 1  
ATOM 1221  H HD22 . LEU B 2 28 ? 15.805  0.932   -0.538  1.00 0.00 ? 38 LEU B HD22 1  
ATOM 1222  H HD23 . LEU B 2 28 ? 16.945  -0.291  0.022   1.00 0.00 ? 38 LEU B HD23 1  
ATOM 1223  N N    . GLU B 2 29 ? 18.068  5.096   2.941   1.00 0.00 ? 39 GLU B N    1  
ATOM 1224  C CA   . GLU B 2 29 ? 17.351  6.131   3.698   1.00 0.00 ? 39 GLU B CA   1  
ATOM 1225  C C    . GLU B 2 29 ? 16.746  7.214   2.793   1.00 0.00 ? 39 GLU B C    1  
ATOM 1226  O O    . GLU B 2 29 ? 15.635  7.679   3.032   1.00 0.00 ? 39 GLU B O    1  
ATOM 1227  C CB   . GLU B 2 29 ? 18.268  6.781   4.738   1.00 0.00 ? 39 GLU B CB   1  
ATOM 1228  C CG   . GLU B 2 29 ? 19.511  7.429   4.148   1.00 0.00 ? 39 GLU B CG   1  
ATOM 1229  C CD   . GLU B 2 29 ? 20.740  6.558   4.276   1.00 0.00 ? 39 GLU B CD   1  
ATOM 1230  O OE1  . GLU B 2 29 ? 20.639  5.341   4.027   1.00 0.00 ? 39 GLU B OE1  1  
ATOM 1231  O OE2  . GLU B 2 29 ? 21.811  7.092   4.631   1.00 0.00 ? 39 GLU B OE2  1  
ATOM 1232  H H    . GLU B 2 29 ? 18.898  4.702   3.301   1.00 0.00 ? 39 GLU B H    1  
ATOM 1233  H HA   . GLU B 2 29 ? 16.543  5.639   4.218   1.00 0.00 ? 39 GLU B HA   1  
ATOM 1234  H HB2  . GLU B 2 29 ? 17.708  7.541   5.264   1.00 0.00 ? 39 GLU B HB2  1  
ATOM 1235  H HB3  . GLU B 2 29 ? 18.581  6.027   5.446   1.00 0.00 ? 39 GLU B HB3  1  
ATOM 1236  H HG2  . GLU B 2 29 ? 19.338  7.627   3.103   1.00 0.00 ? 39 GLU B HG2  1  
ATOM 1237  H HG3  . GLU B 2 29 ? 19.695  8.361   4.664   1.00 0.00 ? 39 GLU B HG3  1  
ATOM 1238  N N    . ARG B 2 30 ? 17.477  7.600   1.751   1.00 0.00 ? 40 ARG B N    1  
ATOM 1239  C CA   . ARG B 2 30 ? 17.022  8.636   0.818   1.00 0.00 ? 40 ARG B CA   1  
ATOM 1240  C C    . ARG B 2 30 ? 15.787  8.220   0.018   1.00 0.00 ? 40 ARG B C    1  
ATOM 1241  O O    . ARG B 2 30 ? 15.213  9.035   -0.707  1.00 0.00 ? 40 ARG B O    1  
ATOM 1242  C CB   . ARG B 2 30 ? 18.144  8.997   -0.157  1.00 0.00 ? 40 ARG B CB   1  
ATOM 1243  C CG   . ARG B 2 30 ? 19.449  9.376   0.518   1.00 0.00 ? 40 ARG B CG   1  
ATOM 1244  C CD   . ARG B 2 30 ? 20.354  10.142  -0.429  1.00 0.00 ? 40 ARG B CD   1  
ATOM 1245  N NE   . ARG B 2 30 ? 20.647  9.391   -1.651  1.00 0.00 ? 40 ARG B NE   1  
ATOM 1246  C CZ   . ARG B 2 30 ? 21.475  9.814   -2.603  1.00 0.00 ? 40 ARG B CZ   1  
ATOM 1247  N NH1  . ARG B 2 30 ? 22.101  10.978  -2.479  1.00 0.00 ? 40 ARG B NH1  1  
ATOM 1248  N NH2  . ARG B 2 30 ? 21.681  9.071   -3.683  1.00 0.00 ? 40 ARG B NH2  1  
ATOM 1249  H H    . ARG B 2 30 ? 18.366  7.209   1.627   1.00 0.00 ? 40 ARG B H    1  
ATOM 1250  H HA   . ARG B 2 30 ? 16.775  9.512   1.396   1.00 0.00 ? 40 ARG B HA   1  
ATOM 1251  H HB2  . ARG B 2 30 ? 18.328  8.152   -0.803  1.00 0.00 ? 40 ARG B HB2  1  
ATOM 1252  H HB3  . ARG B 2 30 ? 17.820  9.833   -0.760  1.00 0.00 ? 40 ARG B HB3  1  
ATOM 1253  H HG2  . ARG B 2 30 ? 19.235  9.996   1.376   1.00 0.00 ? 40 ARG B HG2  1  
ATOM 1254  H HG3  . ARG B 2 30 ? 19.955  8.476   0.836   1.00 0.00 ? 40 ARG B HG3  1  
ATOM 1255  H HD2  . ARG B 2 30 ? 19.869  11.070  -0.698  1.00 0.00 ? 40 ARG B HD2  1  
ATOM 1256  H HD3  . ARG B 2 30 ? 21.279  10.359  0.080   1.00 0.00 ? 40 ARG B HD3  1  
ATOM 1257  H HE   . ARG B 2 30 ? 20.196  8.523   -1.769  1.00 0.00 ? 40 ARG B HE   1  
ATOM 1258  H HH11 . ARG B 2 30 ? 21.957  11.545  -1.666  1.00 0.00 ? 40 ARG B HH11 1  
ATOM 1259  H HH12 . ARG B 2 30 ? 22.721  11.295  -3.203  1.00 0.00 ? 40 ARG B HH12 1  
ATOM 1260  H HH21 . ARG B 2 30 ? 21.214  8.187   -3.782  1.00 0.00 ? 40 ARG B HH21 1  
ATOM 1261  H HH22 . ARG B 2 30 ? 22.302  9.389   -4.407  1.00 0.00 ? 40 ARG B HH22 1  
ATOM 1262  N N    . TYR B 2 31 ? 15.376  6.965   0.130   1.00 0.00 ? 41 TYR B N    1  
ATOM 1263  C CA   . TYR B 2 31 ? 14.217  6.493   -0.606  1.00 0.00 ? 41 TYR B CA   1  
ATOM 1264  C C    . TYR B 2 31 ? 12.956  6.533   0.247   1.00 0.00 ? 41 TYR B C    1  
ATOM 1265  O O    . TYR B 2 31 ? 11.889  6.772   -0.295  1.00 0.00 ? 41 TYR B O    1  
ATOM 1266  C CB   . TYR B 2 31 ? 14.460  5.084   -1.154  1.00 0.00 ? 41 TYR B CB   1  
ATOM 1267  C CG   . TYR B 2 31 ? 15.546  5.041   -2.202  1.00 0.00 ? 41 TYR B CG   1  
ATOM 1268  C CD1  . TYR B 2 31 ? 15.291  5.439   -3.508  1.00 0.00 ? 41 TYR B CD1  1  
ATOM 1269  C CD2  . TYR B 2 31 ? 16.828  4.616   -1.885  1.00 0.00 ? 41 TYR B CD2  1  
ATOM 1270  C CE1  . TYR B 2 31 ? 16.283  5.414   -4.467  1.00 0.00 ? 41 TYR B CE1  1  
ATOM 1271  C CE2  . TYR B 2 31 ? 17.826  4.585   -2.840  1.00 0.00 ? 41 TYR B CE2  1  
ATOM 1272  C CZ   . TYR B 2 31 ? 17.548  4.986   -4.129  1.00 0.00 ? 41 TYR B CZ   1  
ATOM 1273  O OH   . TYR B 2 31 ? 18.541  4.963   -5.081  1.00 0.00 ? 41 TYR B OH   1  
ATOM 1274  H H    . TYR B 2 31 ? 15.858  6.345   0.723   1.00 0.00 ? 41 TYR B H    1  
ATOM 1275  H HA   . TYR B 2 31 ? 14.077  7.163   -1.442  1.00 0.00 ? 41 TYR B HA   1  
ATOM 1276  H HB2  . TYR B 2 31 ? 14.750  4.432   -0.345  1.00 0.00 ? 41 TYR B HB2  1  
ATOM 1277  H HB3  . TYR B 2 31 ? 13.549  4.715   -1.603  1.00 0.00 ? 41 TYR B HB3  1  
ATOM 1278  H HD1  . TYR B 2 31 ? 14.297  5.772   -3.770  1.00 0.00 ? 41 TYR B HD1  1  
ATOM 1279  H HD2  . TYR B 2 31 ? 17.041  4.302   -0.875  1.00 0.00 ? 41 TYR B HD2  1  
ATOM 1280  H HE1  . TYR B 2 31 ? 16.065  5.729   -5.478  1.00 0.00 ? 41 TYR B HE1  1  
ATOM 1281  H HE2  . TYR B 2 31 ? 18.818  4.251   -2.573  1.00 0.00 ? 41 TYR B HE2  1  
ATOM 1282  H HH   . TYR B 2 31 ? 18.530  4.105   -5.535  1.00 0.00 ? 41 TYR B HH   1  
ATOM 1283  N N    . GLU B 2 32 ? 13.102  6.250   1.561   1.00 0.00 ? 42 GLU B N    1  
ATOM 1284  C CA   . GLU B 2 32 ? 11.989  6.256   2.549   1.00 0.00 ? 42 GLU B CA   1  
ATOM 1285  C C    . GLU B 2 32 ? 10.706  6.905   2.018   1.00 0.00 ? 42 GLU B C    1  
ATOM 1286  O O    . GLU B 2 32 ? 9.796   6.190   1.612   1.00 0.00 ? 42 GLU B O    1  
ATOM 1287  C CB   . GLU B 2 32 ? 12.415  6.934   3.858   1.00 0.00 ? 42 GLU B CB   1  
ATOM 1288  C CG   . GLU B 2 32 ? 11.347  6.869   4.946   1.00 0.00 ? 42 GLU B CG   1  
ATOM 1289  C CD   . GLU B 2 32 ? 11.860  7.252   6.319   1.00 0.00 ? 42 GLU B CD   1  
ATOM 1290  O OE1  . GLU B 2 32 ? 12.700  8.169   6.414   1.00 0.00 ? 42 GLU B OE1  1  
ATOM 1291  O OE2  . GLU B 2 32 ? 11.412  6.645   7.315   1.00 0.00 ? 42 GLU B OE2  1  
ATOM 1292  H H    . GLU B 2 32 ? 13.979  5.931   1.861   1.00 0.00 ? 42 GLU B H    1  
ATOM 1293  H HA   . GLU B 2 32 ? 11.765  5.222   2.769   1.00 0.00 ? 42 GLU B HA   1  
ATOM 1294  H HB2  . GLU B 2 32 ? 13.307  6.451   4.228   1.00 0.00 ? 42 GLU B HB2  1  
ATOM 1295  H HB3  . GLU B 2 32 ? 12.635  7.973   3.659   1.00 0.00 ? 42 GLU B HB3  1  
ATOM 1296  H HG2  . GLU B 2 32 ? 10.547  7.545   4.684   1.00 0.00 ? 42 GLU B HG2  1  
ATOM 1297  H HG3  . GLU B 2 32 ? 10.962  5.862   4.991   1.00 0.00 ? 42 GLU B HG3  1  
ATOM 1298  N N    . GLU B 2 33 ? 10.615  8.241   2.116   1.00 0.00 ? 43 GLU B N    1  
ATOM 1299  C CA   . GLU B 2 33 ? 9.473   9.036   1.599   1.00 0.00 ? 43 GLU B CA   1  
ATOM 1300  C C    . GLU B 2 33 ? 8.774   8.463   0.348   1.00 0.00 ? 43 GLU B C    1  
ATOM 1301  O O    . GLU B 2 33 ? 7.560   8.632   0.191   1.00 0.00 ? 43 GLU B O    1  
ATOM 1302  C CB   . GLU B 2 33 ? 9.944   10.465  1.312   1.00 0.00 ? 43 GLU B CB   1  
ATOM 1303  C CG   . GLU B 2 33 ? 8.827   11.405  0.884   1.00 0.00 ? 43 GLU B CG   1  
ATOM 1304  C CD   . GLU B 2 33 ? 9.311   12.818  0.646   1.00 0.00 ? 43 GLU B CD   1  
ATOM 1305  O OE1  . GLU B 2 33 ? 10.288  12.998  -0.114  1.00 0.00 ? 43 GLU B OE1  1  
ATOM 1306  O OE2  . GLU B 2 33 ? 8.721   13.755  1.222   1.00 0.00 ? 43 GLU B OE2  1  
ATOM 1307  H H    . GLU B 2 33 ? 11.234  8.702   2.713   1.00 0.00 ? 43 GLU B H    1  
ATOM 1308  H HA   . GLU B 2 33 ? 8.741   9.087   2.390   1.00 0.00 ? 43 GLU B HA   1  
ATOM 1309  H HB2  . GLU B 2 33 ? 10.395  10.865  2.207   1.00 0.00 ? 43 GLU B HB2  1  
ATOM 1310  H HB3  . GLU B 2 33 ? 10.685  10.438  0.527   1.00 0.00 ? 43 GLU B HB3  1  
ATOM 1311  H HG2  . GLU B 2 33 ? 8.389   11.032  -0.030  1.00 0.00 ? 43 GLU B HG2  1  
ATOM 1312  H HG3  . GLU B 2 33 ? 8.076   11.424  1.660   1.00 0.00 ? 43 GLU B HG3  1  
ATOM 1313  N N    . GLY B 2 34 ? 9.503   7.766   -0.512  1.00 0.00 ? 44 GLY B N    1  
ATOM 1314  C CA   . GLY B 2 34 ? 8.906   7.211   -1.713  1.00 0.00 ? 44 GLY B CA   1  
ATOM 1315  C C    . GLY B 2 34 ? 7.982   6.055   -1.387  1.00 0.00 ? 44 GLY B C    1  
ATOM 1316  O O    . GLY B 2 34 ? 6.934   5.884   -2.006  1.00 0.00 ? 44 GLY B O    1  
ATOM 1317  H H    . GLY B 2 34 ? 10.430  7.530   -0.285  1.00 0.00 ? 44 GLY B H    1  
ATOM 1318  H HA2  . GLY B 2 34 ? 8.347   7.985   -2.219  1.00 0.00 ? 44 GLY B HA2  1  
ATOM 1319  H HA3  . GLY B 2 34 ? 9.691   6.858   -2.365  1.00 0.00 ? 44 GLY B HA3  1  
ATOM 1320  N N    . LEU B 2 35 ? 8.363   5.282   -0.379  1.00 0.00 ? 45 LEU B N    1  
ATOM 1321  C CA   . LEU B 2 35 ? 7.577   4.140   0.067   1.00 0.00 ? 45 LEU B CA   1  
ATOM 1322  C C    . LEU B 2 35 ? 6.615   4.585   1.162   1.00 0.00 ? 45 LEU B C    1  
ATOM 1323  O O    . LEU B 2 35 ? 6.030   3.769   1.865   1.00 0.00 ? 45 LEU B O    1  
ATOM 1324  C CB   . LEU B 2 35 ? 8.482   3.017   0.595   1.00 0.00 ? 45 LEU B CB   1  
ATOM 1325  C CG   . LEU B 2 35 ? 9.483   2.435   -0.407  1.00 0.00 ? 45 LEU B CG   1  
ATOM 1326  C CD1  . LEU B 2 35 ? 10.833  3.125   -0.279  1.00 0.00 ? 45 LEU B CD1  1  
ATOM 1327  C CD2  . LEU B 2 35 ? 9.633   0.937   -0.196  1.00 0.00 ? 45 LEU B CD2  1  
ATOM 1328  H H    . LEU B 2 35 ? 9.197   5.497   0.096   1.00 0.00 ? 45 LEU B H    1  
ATOM 1329  H HA   . LEU B 2 35 ? 7.008   3.773   -0.775  1.00 0.00 ? 45 LEU B HA   1  
ATOM 1330  H HB2  . LEU B 2 35 ? 9.037   3.401   1.438   1.00 0.00 ? 45 LEU B HB2  1  
ATOM 1331  H HB3  . LEU B 2 35 ? 7.851   2.212   0.942   1.00 0.00 ? 45 LEU B HB3  1  
ATOM 1332  H HG   . LEU B 2 35 ? 9.118   2.598   -1.409  1.00 0.00 ? 45 LEU B HG   1  
ATOM 1333  H HD11 . LEU B 2 35 ? 10.711  4.187   -0.440  1.00 0.00 ? 45 LEU B HD11 1  
ATOM 1334  H HD12 . LEU B 2 35 ? 11.513  2.724   -1.016  1.00 0.00 ? 45 LEU B HD12 1  
ATOM 1335  H HD13 . LEU B 2 35 ? 11.232  2.954   0.710   1.00 0.00 ? 45 LEU B HD13 1  
ATOM 1336  H HD21 . LEU B 2 35 ? 8.682   0.452   -0.355  1.00 0.00 ? 45 LEU B HD21 1  
ATOM 1337  H HD22 . LEU B 2 35 ? 9.968   0.747   0.814   1.00 0.00 ? 45 LEU B HD22 1  
ATOM 1338  H HD23 . LEU B 2 35 ? 10.359  0.545   -0.893  1.00 0.00 ? 45 LEU B HD23 1  
ATOM 1339  N N    . VAL B 2 36 ? 6.426   5.892   1.262   1.00 0.00 ? 46 VAL B N    1  
ATOM 1340  C CA   . VAL B 2 36 ? 5.538   6.462   2.264   1.00 0.00 ? 46 VAL B CA   1  
ATOM 1341  C C    . VAL B 2 36 ? 4.236   6.828   1.588   1.00 0.00 ? 46 VAL B C    1  
ATOM 1342  O O    . VAL B 2 36 ? 3.148   6.653   2.136   1.00 0.00 ? 46 VAL B O    1  
ATOM 1343  C CB   . VAL B 2 36 ? 6.140   7.719   2.934   1.00 0.00 ? 46 VAL B CB   1  
ATOM 1344  C CG1  . VAL B 2 36 ? 5.116   8.401   3.830   1.00 0.00 ? 46 VAL B CG1  1  
ATOM 1345  C CG2  . VAL B 2 36 ? 7.391   7.367   3.725   1.00 0.00 ? 46 VAL B CG2  1  
ATOM 1346  H H    . VAL B 2 36 ? 6.813   6.476   0.577   1.00 0.00 ? 46 VAL B H    1  
ATOM 1347  H HA   . VAL B 2 36 ? 5.351   5.714   3.017   1.00 0.00 ? 46 VAL B HA   1  
ATOM 1348  H HB   . VAL B 2 36 ? 6.419   8.415   2.155   1.00 0.00 ? 46 VAL B HB   1  
ATOM 1349  H HG11 . VAL B 2 36 ? 4.281   8.738   3.232   1.00 0.00 ? 46 VAL B HG11 1  
ATOM 1350  H HG12 . VAL B 2 36 ? 5.571   9.250   4.321   1.00 0.00 ? 46 VAL B HG12 1  
ATOM 1351  H HG13 . VAL B 2 36 ? 4.766   7.701   4.574   1.00 0.00 ? 46 VAL B HG13 1  
ATOM 1352  H HG21 . VAL B 2 36 ? 7.730   8.238   4.267   1.00 0.00 ? 46 VAL B HG21 1  
ATOM 1353  H HG22 . VAL B 2 36 ? 8.165   7.043   3.045   1.00 0.00 ? 46 VAL B HG22 1  
ATOM 1354  H HG23 . VAL B 2 36 ? 7.169   6.574   4.420   1.00 0.00 ? 46 VAL B HG23 1  
ATOM 1355  N N    . HIS B 2 37 ? 4.371   7.300   0.358   1.00 0.00 ? 47 HIS B N    1  
ATOM 1356  C CA   . HIS B 2 37 ? 3.233   7.697   -0.447  1.00 0.00 ? 47 HIS B CA   1  
ATOM 1357  C C    . HIS B 2 37 ? 2.438   6.480   -0.919  1.00 0.00 ? 47 HIS B C    1  
ATOM 1358  O O    . HIS B 2 37 ? 1.423   6.622   -1.599  1.00 0.00 ? 47 HIS B O    1  
ATOM 1359  C CB   . HIS B 2 37 ? 3.702   8.506   -1.661  1.00 0.00 ? 47 HIS B CB   1  
ATOM 1360  C CG   . HIS B 2 37 ? 4.062   9.929   -1.347  1.00 0.00 ? 47 HIS B CG   1  
ATOM 1361  N ND1  . HIS B 2 37 ? 4.098   10.933  -2.289  1.00 0.00 ? 47 HIS B ND1  1  
ATOM 1362  C CD2  . HIS B 2 37 ? 4.381   10.517  -0.163  1.00 0.00 ? 47 HIS B CD2  1  
ATOM 1363  C CE1  . HIS B 2 37 ? 4.424   12.071  -1.668  1.00 0.00 ? 47 HIS B CE1  1  
ATOM 1364  N NE2  . HIS B 2 37 ? 4.608   11.874  -0.376  1.00 0.00 ? 47 HIS B NE2  1  
ATOM 1365  H H    . HIS B 2 37 ? 5.270   7.394   -0.017  1.00 0.00 ? 47 HIS B H    1  
ATOM 1366  H HA   . HIS B 2 37 ? 2.597   8.317   0.162   1.00 0.00 ? 47 HIS B HA   1  
ATOM 1367  H HB2  . HIS B 2 37 ? 4.575   8.030   -2.084  1.00 0.00 ? 47 HIS B HB2  1  
ATOM 1368  H HB3  . HIS B 2 37 ? 2.913   8.517   -2.400  1.00 0.00 ? 47 HIS B HB3  1  
ATOM 1369  H HD1  . HIS B 2 37 ? 3.914   10.835  -3.249  1.00 0.00 ? 47 HIS B HD1  1  
ATOM 1370  H HD2  . HIS B 2 37 ? 4.450   10.022  0.794   1.00 0.00 ? 47 HIS B HD2  1  
ATOM 1371  H HE1  . HIS B 2 37 ? 4.509   13.029  -2.158  1.00 0.00 ? 47 HIS B HE1  1  
ATOM 1372  N N    . ASN B 2 38 ? 2.909   5.285   -0.565  1.00 0.00 ? 48 ASN B N    1  
ATOM 1373  C CA   . ASN B 2 38 ? 2.233   4.052   -0.966  1.00 0.00 ? 48 ASN B CA   1  
ATOM 1374  C C    . ASN B 2 38 ? 1.706   3.279   0.240   1.00 0.00 ? 48 ASN B C    1  
ATOM 1375  O O    . ASN B 2 38 ? 0.995   2.285   0.080   1.00 0.00 ? 48 ASN B O    1  
ATOM 1376  C CB   . ASN B 2 38 ? 3.157   3.140   -1.777  1.00 0.00 ? 48 ASN B CB   1  
ATOM 1377  C CG   . ASN B 2 38 ? 3.663   3.770   -3.062  1.00 0.00 ? 48 ASN B CG   1  
ATOM 1378  O OD1  . ASN B 2 38 ? 4.024   4.946   -3.105  1.00 0.00 ? 48 ASN B OD1  1  
ATOM 1379  N ND2  . ASN B 2 38 ? 3.677   2.989   -4.125  1.00 0.00 ? 48 ASN B ND2  1  
ATOM 1380  H H    . ASN B 2 38 ? 3.730   5.234   -0.036  1.00 0.00 ? 48 ASN B H    1  
ATOM 1381  H HA   . ASN B 2 38 ? 1.393   4.332   -1.585  1.00 0.00 ? 48 ASN B HA   1  
ATOM 1382  H HB2  . ASN B 2 38 ? 4.008   2.871   -1.174  1.00 0.00 ? 48 ASN B HB2  1  
ATOM 1383  H HB3  . ASN B 2 38 ? 2.610   2.245   -2.038  1.00 0.00 ? 48 ASN B HB3  1  
ATOM 1384  H HD21 . ASN B 2 38 ? 3.360   2.057   -4.022  1.00 0.00 ? 48 ASN B HD21 1  
ATOM 1385  H HD22 . ASN B 2 38 ? 4.000   3.363   -4.970  1.00 0.00 ? 48 ASN B HD22 1  
ATOM 1386  N N    . GLY B 2 39 ? 2.053   3.728   1.441   1.00 0.00 ? 49 GLY B N    1  
ATOM 1387  C CA   . GLY B 2 39 ? 1.580   3.061   2.643   1.00 0.00 ? 49 GLY B CA   1  
ATOM 1388  C C    . GLY B 2 39 ? 2.555   2.038   3.196   1.00 0.00 ? 49 GLY B C    1  
ATOM 1389  O O    . GLY B 2 39 ? 2.216   1.278   4.097   1.00 0.00 ? 49 GLY B O    1  
ATOM 1390  H H    . GLY B 2 39 ? 2.610   4.530   1.516   1.00 0.00 ? 49 GLY B H    1  
ATOM 1391  H HA2  . GLY B 2 39 ? 1.397   3.806   3.403   1.00 0.00 ? 49 GLY B HA2  1  
ATOM 1392  H HA3  . GLY B 2 39 ? 0.648   2.563   2.418   1.00 0.00 ? 49 GLY B HA3  1  
ATOM 1393  N N    . TRP B 2 40 ? 3.771   2.018   2.677   1.00 0.00 ? 50 TRP B N    1  
ATOM 1394  C CA   . TRP B 2 40 ? 4.777   1.071   3.144   1.00 0.00 ? 50 TRP B CA   1  
ATOM 1395  C C    . TRP B 2 40 ? 5.708   1.740   4.148   1.00 0.00 ? 50 TRP B C    1  
ATOM 1396  O O    . TRP B 2 40 ? 6.830   1.290   4.376   1.00 0.00 ? 50 TRP B O    1  
ATOM 1397  C CB   . TRP B 2 40 ? 5.571   0.512   1.963   1.00 0.00 ? 50 TRP B CB   1  
ATOM 1398  C CG   . TRP B 2 40 ? 4.749   -0.356  1.063   1.00 0.00 ? 50 TRP B CG   1  
ATOM 1399  C CD1  . TRP B 2 40 ? 4.487   -0.153  -0.261  1.00 0.00 ? 50 TRP B CD1  1  
ATOM 1400  C CD2  . TRP B 2 40 ? 4.070   -1.564  1.427   1.00 0.00 ? 50 TRP B CD2  1  
ATOM 1401  N NE1  . TRP B 2 40 ? 3.692   -1.162  -0.743  1.00 0.00 ? 50 TRP B NE1  1  
ATOM 1402  C CE2  . TRP B 2 40 ? 3.421   -2.041  0.274   1.00 0.00 ? 50 TRP B CE2  1  
ATOM 1403  C CE3  . TRP B 2 40 ? 3.951   -2.290  2.614   1.00 0.00 ? 50 TRP B CE3  1  
ATOM 1404  C CZ2  . TRP B 2 40 ? 2.663   -3.210  0.275   1.00 0.00 ? 50 TRP B CZ2  1  
ATOM 1405  C CZ3  . TRP B 2 40 ? 3.198   -3.449  2.614   1.00 0.00 ? 50 TRP B CZ3  1  
ATOM 1406  C CH2  . TRP B 2 40 ? 2.563   -3.899  1.451   1.00 0.00 ? 50 TRP B CH2  1  
ATOM 1407  H H    . TRP B 2 40 ? 4.005   2.653   1.971   1.00 0.00 ? 50 TRP B H    1  
ATOM 1408  H HA   . TRP B 2 40 ? 4.263   0.259   3.637   1.00 0.00 ? 50 TRP B HA   1  
ATOM 1409  H HB2  . TRP B 2 40 ? 5.956   1.333   1.377   1.00 0.00 ? 50 TRP B HB2  1  
ATOM 1410  H HB3  . TRP B 2 40 ? 6.395   -0.078  2.337   1.00 0.00 ? 50 TRP B HB3  1  
ATOM 1411  H HD1  . TRP B 2 40 ? 4.860   0.683   -0.833  1.00 0.00 ? 50 TRP B HD1  1  
ATOM 1412  H HE1  . TRP B 2 40 ? 3.372   -1.242  -1.668  1.00 0.00 ? 50 TRP B HE1  1  
ATOM 1413  H HE3  . TRP B 2 40 ? 4.433   -1.960  3.521   1.00 0.00 ? 50 TRP B HE3  1  
ATOM 1414  H HZ2  . TRP B 2 40 ? 2.166   -3.571  -0.614  1.00 0.00 ? 50 TRP B HZ2  1  
ATOM 1415  H HZ3  . TRP B 2 40 ? 3.095   -4.021  3.523   1.00 0.00 ? 50 TRP B HZ3  1  
ATOM 1416  H HH2  . TRP B 2 40 ? 1.984   -4.810  1.497   1.00 0.00 ? 50 TRP B HH2  1  
ATOM 1417  N N    . ASP B 2 41 ? 5.210   2.805   4.763   1.00 0.00 ? 51 ASP B N    1  
ATOM 1418  C CA   . ASP B 2 41 ? 5.967   3.577   5.745   1.00 0.00 ? 51 ASP B CA   1  
ATOM 1419  C C    . ASP B 2 41 ? 5.850   2.972   7.137   1.00 0.00 ? 51 ASP B C    1  
ATOM 1420  O O    . ASP B 2 41 ? 5.982   3.670   8.143   1.00 0.00 ? 51 ASP B O    1  
ATOM 1421  C CB   . ASP B 2 41 ? 5.463   5.022   5.777   1.00 0.00 ? 51 ASP B CB   1  
ATOM 1422  C CG   . ASP B 2 41 ? 3.982   5.118   6.090   1.00 0.00 ? 51 ASP B CG   1  
ATOM 1423  O OD1  . ASP B 2 41 ? 3.164   4.681   5.255   1.00 0.00 ? 51 ASP B OD1  1  
ATOM 1424  O OD2  . ASP B 2 41 ? 3.621   5.631   7.168   1.00 0.00 ? 51 ASP B OD2  1  
ATOM 1425  H H    . ASP B 2 41 ? 4.294   3.087   4.551   1.00 0.00 ? 51 ASP B H    1  
ATOM 1426  H HA   . ASP B 2 41 ? 7.003   3.573   5.446   1.00 0.00 ? 51 ASP B HA   1  
ATOM 1427  H HB2  . ASP B 2 41 ? 6.006   5.568   6.534   1.00 0.00 ? 51 ASP B HB2  1  
ATOM 1428  H HB3  . ASP B 2 41 ? 5.638   5.479   4.819   1.00 0.00 ? 51 ASP B HB3  1  
ATOM 1429  N N    . ASP B 2 42 ? 5.617   1.674   7.201   1.00 0.00 ? 52 ASP B N    1  
ATOM 1430  C CA   . ASP B 2 42 ? 5.477   1.004   8.481   1.00 0.00 ? 52 ASP B CA   1  
ATOM 1431  C C    . ASP B 2 42 ? 6.095   -0.380  8.446   1.00 0.00 ? 52 ASP B C    1  
ATOM 1432  O O    . ASP B 2 42 ? 5.784   -1.187  7.567   1.00 0.00 ? 52 ASP B O    1  
ATOM 1433  C CB   . ASP B 2 42 ? 4.004   0.896   8.874   1.00 0.00 ? 52 ASP B CB   1  
ATOM 1434  C CG   . ASP B 2 42 ? 3.667   1.713   10.104  1.00 0.00 ? 52 ASP B CG   1  
ATOM 1435  O OD1  . ASP B 2 42 ? 4.247   1.454   11.173  1.00 0.00 ? 52 ASP B OD1  1  
ATOM 1436  O OD2  . ASP B 2 42 ? 2.800   2.608   10.010  1.00 0.00 ? 52 ASP B OD2  1  
ATOM 1437  H H    . ASP B 2 42 ? 5.554   1.154   6.372   1.00 0.00 ? 52 ASP B H    1  
ATOM 1438  H HA   . ASP B 2 42 ? 5.993   1.596   9.221   1.00 0.00 ? 52 ASP B HA   1  
ATOM 1439  H HB2  . ASP B 2 42 ? 3.393   1.247   8.055   1.00 0.00 ? 52 ASP B HB2  1  
ATOM 1440  H HB3  . ASP B 2 42 ? 3.767   -0.139  9.074   1.00 0.00 ? 52 ASP B HB3  1  
ATOM 1441  N N    . LEU B 2 43 ? 6.939   -0.662  9.431   1.00 0.00 ? 53 LEU B N    1  
ATOM 1442  C CA   . LEU B 2 43 ? 7.605   -1.956  9.547   1.00 0.00 ? 53 LEU B CA   1  
ATOM 1443  C C    . LEU B 2 43 ? 6.627   -3.012  10.046  1.00 0.00 ? 53 LEU B C    1  
ATOM 1444  O O    . LEU B 2 43 ? 7.021   -4.053  10.570  1.00 0.00 ? 53 LEU B O    1  
ATOM 1445  C CB   . LEU B 2 43 ? 8.797   -1.852  10.501  1.00 0.00 ? 53 LEU B CB   1  
ATOM 1446  C CG   . LEU B 2 43 ? 9.955   -0.990  9.998   1.00 0.00 ? 53 LEU B CG   1  
ATOM 1447  C CD1  . LEU B 2 43 ? 10.960  -0.747  11.111  1.00 0.00 ? 53 LEU B CD1  1  
ATOM 1448  C CD2  . LEU B 2 43 ? 10.631  -1.651  8.808   1.00 0.00 ? 53 LEU B CD2  1  
ATOM 1449  H H    . LEU B 2 43 ? 7.118   0.025   10.112  1.00 0.00 ? 53 LEU B H    1  
ATOM 1450  H HA   . LEU B 2 43 ? 7.956   -2.240  8.565   1.00 0.00 ? 53 LEU B HA   1  
ATOM 1451  H HB2  . LEU B 2 43 ? 8.447   -1.438  11.435  1.00 0.00 ? 53 LEU B HB2  1  
ATOM 1452  H HB3  . LEU B 2 43 ? 9.172   -2.848  10.686  1.00 0.00 ? 53 LEU B HB3  1  
ATOM 1453  H HG   . LEU B 2 43 ? 9.571   -0.033  9.678   1.00 0.00 ? 53 LEU B HG   1  
ATOM 1454  H HD11 . LEU B 2 43 ? 10.497  -0.162  11.892  1.00 0.00 ? 53 LEU B HD11 1  
ATOM 1455  H HD12 . LEU B 2 43 ? 11.811  -0.213  10.717  1.00 0.00 ? 53 LEU B HD12 1  
ATOM 1456  H HD13 . LEU B 2 43 ? 11.285  -1.694  11.516  1.00 0.00 ? 53 LEU B HD13 1  
ATOM 1457  H HD21 . LEU B 2 43 ? 11.280  -0.937  8.321   1.00 0.00 ? 53 LEU B HD21 1  
ATOM 1458  H HD22 . LEU B 2 43 ? 9.883   -1.992  8.109   1.00 0.00 ? 53 LEU B HD22 1  
ATOM 1459  H HD23 . LEU B 2 43 ? 11.216  -2.493  9.148   1.00 0.00 ? 53 LEU B HD23 1  
ATOM 1460  N N    . GLU B 2 44 ? 5.346   -2.724  9.878   1.00 0.00 ? 54 GLU B N    1  
ATOM 1461  C CA   . GLU B 2 44 ? 4.287   -3.618  10.288  1.00 0.00 ? 54 GLU B CA   1  
ATOM 1462  C C    . GLU B 2 44 ? 3.944   -4.551  9.140   1.00 0.00 ? 54 GLU B C    1  
ATOM 1463  O O    . GLU B 2 44 ? 3.721   -5.741  9.333   1.00 0.00 ? 54 GLU B O    1  
ATOM 1464  C CB   . GLU B 2 44 ? 3.046   -2.816  10.699  1.00 0.00 ? 54 GLU B CB   1  
ATOM 1465  C CG   . GLU B 2 44 ? 3.336   -1.707  11.698  1.00 0.00 ? 54 GLU B CG   1  
ATOM 1466  C CD   . GLU B 2 44 ? 4.080   -2.202  12.923  1.00 0.00 ? 54 GLU B CD   1  
ATOM 1467  O OE1  . GLU B 2 44 ? 3.476   -2.926  13.739  1.00 0.00 ? 54 GLU B OE1  1  
ATOM 1468  O OE2  . GLU B 2 44 ? 5.274   -1.874  13.073  1.00 0.00 ? 54 GLU B OE2  1  
ATOM 1469  H H    . GLU B 2 44 ? 5.114   -1.876  9.446   1.00 0.00 ? 54 GLU B H    1  
ATOM 1470  H HA   . GLU B 2 44 ? 4.637   -4.197  11.129  1.00 0.00 ? 54 GLU B HA   1  
ATOM 1471  H HB2  . GLU B 2 44 ? 2.611   -2.369  9.814   1.00 0.00 ? 54 GLU B HB2  1  
ATOM 1472  H HB3  . GLU B 2 44 ? 2.328   -3.490  11.140  1.00 0.00 ? 54 GLU B HB3  1  
ATOM 1473  H HG2  . GLU B 2 44 ? 3.936   -0.950  11.214  1.00 0.00 ? 54 GLU B HG2  1  
ATOM 1474  H HG3  . GLU B 2 44 ? 2.400   -1.272  12.016  1.00 0.00 ? 54 GLU B HG3  1  
ATOM 1475  N N    . PHE B 2 45 ? 3.923   -3.994  7.934   1.00 0.00 ? 55 PHE B N    1  
ATOM 1476  C CA   . PHE B 2 45 ? 3.602   -4.769  6.746   1.00 0.00 ? 55 PHE B CA   1  
ATOM 1477  C C    . PHE B 2 45 ? 4.706   -4.662  5.693   1.00 0.00 ? 55 PHE B C    1  
ATOM 1478  O O    . PHE B 2 45 ? 4.738   -5.438  4.740   1.00 0.00 ? 55 PHE B O    1  
ATOM 1479  C CB   . PHE B 2 45 ? 2.256   -4.319  6.175   1.00 0.00 ? 55 PHE B CB   1  
ATOM 1480  C CG   . PHE B 2 45 ? 1.093   -4.725  7.038   1.00 0.00 ? 55 PHE B CG   1  
ATOM 1481  C CD1  . PHE B 2 45 ? 0.645   -6.037  7.043   1.00 0.00 ? 55 PHE B CD1  1  
ATOM 1482  C CD2  . PHE B 2 45 ? 0.452   -3.800  7.850   1.00 0.00 ? 55 PHE B CD2  1  
ATOM 1483  C CE1  . PHE B 2 45 ? -0.416  -6.420  7.842   1.00 0.00 ? 55 PHE B CE1  1  
ATOM 1484  C CE2  . PHE B 2 45 ? -0.611  -4.178  8.649   1.00 0.00 ? 55 PHE B CE2  1  
ATOM 1485  C CZ   . PHE B 2 45 ? -1.046  -5.489  8.644   1.00 0.00 ? 55 PHE B CZ   1  
ATOM 1486  H H    . PHE B 2 45 ? 4.116   -3.040  7.844   1.00 0.00 ? 55 PHE B H    1  
ATOM 1487  H HA   . PHE B 2 45 ? 3.520   -5.802  7.047   1.00 0.00 ? 55 PHE B HA   1  
ATOM 1488  H HB2  . PHE B 2 45 ? 2.248   -3.242  6.088   1.00 0.00 ? 55 PHE B HB2  1  
ATOM 1489  H HB3  . PHE B 2 45 ? 2.117   -4.758  5.198   1.00 0.00 ? 55 PHE B HB3  1  
ATOM 1490  H HD1  . PHE B 2 45 ? 1.138   -6.766  6.416   1.00 0.00 ? 55 PHE B HD1  1  
ATOM 1491  H HD2  . PHE B 2 45 ? 0.791   -2.775  7.854   1.00 0.00 ? 55 PHE B HD2  1  
ATOM 1492  H HE1  . PHE B 2 45 ? -0.754  -7.446  7.835   1.00 0.00 ? 55 PHE B HE1  1  
ATOM 1493  H HE2  . PHE B 2 45 ? -1.103  -3.448  9.275   1.00 0.00 ? 55 PHE B HE2  1  
ATOM 1494  H HZ   . PHE B 2 45 ? -1.875  -5.787  9.269   1.00 0.00 ? 55 PHE B HZ   1  
ATOM 1495  N N    . LEU B 2 46 ? 5.623   -3.711  5.877   1.00 0.00 ? 56 LEU B N    1  
ATOM 1496  C CA   . LEU B 2 46 ? 6.734   -3.534  4.940   1.00 0.00 ? 56 LEU B CA   1  
ATOM 1497  C C    . LEU B 2 46 ? 7.689   -4.718  5.040   1.00 0.00 ? 56 LEU B C    1  
ATOM 1498  O O    . LEU B 2 46 ? 8.408   -5.041  4.099   1.00 0.00 ? 56 LEU B O    1  
ATOM 1499  C CB   . LEU B 2 46 ? 7.488   -2.228  5.226   1.00 0.00 ? 56 LEU B CB   1  
ATOM 1500  C CG   . LEU B 2 46 ? 8.778   -2.026  4.421   1.00 0.00 ? 56 LEU B CG   1  
ATOM 1501  C CD1  . LEU B 2 46 ? 8.463   -1.712  2.966   1.00 0.00 ? 56 LEU B CD1  1  
ATOM 1502  C CD2  . LEU B 2 46 ? 9.623   -0.919  5.033   1.00 0.00 ? 56 LEU B CD2  1  
ATOM 1503  H H    . LEU B 2 46 ? 5.552   -3.117  6.653   1.00 0.00 ? 56 LEU B H    1  
ATOM 1504  H HA   . LEU B 2 46 ? 6.325   -3.496  3.941   1.00 0.00 ? 56 LEU B HA   1  
ATOM 1505  H HB2  . LEU B 2 46 ? 6.825   -1.402  5.017   1.00 0.00 ? 56 LEU B HB2  1  
ATOM 1506  H HB3  . LEU B 2 46 ? 7.740   -2.206  6.276   1.00 0.00 ? 56 LEU B HB3  1  
ATOM 1507  H HG   . LEU B 2 46 ? 9.354   -2.939  4.446   1.00 0.00 ? 56 LEU B HG   1  
ATOM 1508  H HD11 . LEU B 2 46 ? 7.599   -2.279  2.654   1.00 0.00 ? 56 LEU B HD11 1  
ATOM 1509  H HD12 . LEU B 2 46 ? 9.309   -1.981  2.349   1.00 0.00 ? 56 LEU B HD12 1  
ATOM 1510  H HD13 . LEU B 2 46 ? 8.261   -0.658  2.859   1.00 0.00 ? 56 LEU B HD13 1  
ATOM 1511  H HD21 . LEU B 2 46 ? 10.513  -0.776  4.438   1.00 0.00 ? 56 LEU B HD21 1  
ATOM 1512  H HD22 . LEU B 2 46 ? 9.904   -1.193  6.038   1.00 0.00 ? 56 LEU B HD22 1  
ATOM 1513  H HD23 . LEU B 2 46 ? 9.055   -0.001  5.056   1.00 0.00 ? 56 LEU B HD23 1  
ATOM 1514  N N    . SER B 2 47 ? 7.657   -5.376  6.189   1.00 0.00 ? 57 SER B N    1  
ATOM 1515  C CA   . SER B 2 47 ? 8.503   -6.527  6.459   1.00 0.00 ? 57 SER B CA   1  
ATOM 1516  C C    . SER B 2 47 ? 8.060   -7.748  5.651   1.00 0.00 ? 57 SER B C    1  
ATOM 1517  O O    . SER B 2 47 ? 8.761   -8.760  5.598   1.00 0.00 ? 57 SER B O    1  
ATOM 1518  C CB   . SER B 2 47 ? 8.444   -6.823  7.952   1.00 0.00 ? 57 SER B CB   1  
ATOM 1519  O OG   . SER B 2 47 ? 7.453   -6.010  8.569   1.00 0.00 ? 57 SER B OG   1  
ATOM 1520  H H    . SER B 2 47 ? 7.039   -5.079  6.891   1.00 0.00 ? 57 SER B H    1  
ATOM 1521  H HA   . SER B 2 47 ? 9.515   -6.271  6.189   1.00 0.00 ? 57 SER B HA   1  
ATOM 1522  H HB2  . SER B 2 47 ? 8.190   -7.862  8.104   1.00 0.00 ? 57 SER B HB2  1  
ATOM 1523  H HB3  . SER B 2 47 ? 9.401   -6.612  8.403   1.00 0.00 ? 57 SER B HB3  1  
ATOM 1524  H HG   . SER B 2 47 ? 7.566   -6.034  9.526   1.00 0.00 ? 57 SER B HG   1  
ATOM 1525  N N    . ASP B 2 48 ? 6.892   -7.650  5.027   1.00 0.00 ? 58 ASP B N    1  
ATOM 1526  C CA   . ASP B 2 48 ? 6.364   -8.741  4.220   1.00 0.00 ? 58 ASP B CA   1  
ATOM 1527  C C    . ASP B 2 48 ? 5.963   -8.223  2.845   1.00 0.00 ? 58 ASP B C    1  
ATOM 1528  O O    . ASP B 2 48 ? 5.051   -8.745  2.205   1.00 0.00 ? 58 ASP B O    1  
ATOM 1529  C CB   . ASP B 2 48 ? 5.167   -9.395  4.916   1.00 0.00 ? 58 ASP B CB   1  
ATOM 1530  C CG   . ASP B 2 48 ? 5.047   -10.869 4.581   1.00 0.00 ? 58 ASP B CG   1  
ATOM 1531  O OD1  . ASP B 2 48 ? 6.030   -11.612 4.797   1.00 0.00 ? 58 ASP B OD1  1  
ATOM 1532  O OD2  . ASP B 2 48 ? 3.975   -11.293 4.101   1.00 0.00 ? 58 ASP B OD2  1  
ATOM 1533  H H    . ASP B 2 48 ? 6.374   -6.820  5.106   1.00 0.00 ? 58 ASP B H    1  
ATOM 1534  H HA   . ASP B 2 48 ? 7.148   -9.474  4.101   1.00 0.00 ? 58 ASP B HA   1  
ATOM 1535  H HB2  . ASP B 2 48 ? 5.280   -9.294  5.985   1.00 0.00 ? 58 ASP B HB2  1  
ATOM 1536  H HB3  . ASP B 2 48 ? 4.260   -8.897  4.605   1.00 0.00 ? 58 ASP B HB3  1  
ATOM 1537  N N    . ILE B 2 49 ? 6.661   -7.186  2.400   1.00 0.00 ? 59 ILE B N    1  
ATOM 1538  C CA   . ILE B 2 49 ? 6.397   -6.579  1.103   1.00 0.00 ? 59 ILE B CA   1  
ATOM 1539  C C    . ILE B 2 49 ? 6.847   -7.507  -0.027  1.00 0.00 ? 59 ILE B C    1  
ATOM 1540  O O    . ILE B 2 49 ? 7.760   -8.320  0.147   1.00 0.00 ? 59 ILE B O    1  
ATOM 1541  C CB   . ILE B 2 49 ? 7.103   -5.206  0.978   1.00 0.00 ? 59 ILE B CB   1  
ATOM 1542  C CG1  . ILE B 2 49 ? 6.592   -4.439  -0.245  1.00 0.00 ? 59 ILE B CG1  1  
ATOM 1543  C CG2  . ILE B 2 49 ? 8.616   -5.381  0.907   1.00 0.00 ? 59 ILE B CG2  1  
ATOM 1544  C CD1  . ILE B 2 49 ? 7.156   -3.040  -0.359  1.00 0.00 ? 59 ILE B CD1  1  
ATOM 1545  H H    . ILE B 2 49 ? 7.379   -6.821  2.958   1.00 0.00 ? 59 ILE B H    1  
ATOM 1546  H HA   . ILE B 2 49 ? 5.331   -6.422  1.021   1.00 0.00 ? 59 ILE B HA   1  
ATOM 1547  H HB   . ILE B 2 49 ? 6.878   -4.635  1.866   1.00 0.00 ? 59 ILE B HB   1  
ATOM 1548  H HG12 . ILE B 2 49 ? 6.864   -4.980  -1.141  1.00 0.00 ? 59 ILE B HG12 1  
ATOM 1549  H HG13 . ILE B 2 49 ? 5.516   -4.362  -0.191  1.00 0.00 ? 59 ILE B HG13 1  
ATOM 1550  H HG21 . ILE B 2 49 ? 8.956   -5.918  1.780   1.00 0.00 ? 59 ILE B HG21 1  
ATOM 1551  H HG22 . ILE B 2 49 ? 9.088   -4.411  0.873   1.00 0.00 ? 59 ILE B HG22 1  
ATOM 1552  H HG23 . ILE B 2 49 ? 8.872   -5.938  0.019   1.00 0.00 ? 59 ILE B HG23 1  
ATOM 1553  H HD11 . ILE B 2 49 ? 8.233   -3.082  -0.306  1.00 0.00 ? 59 ILE B HD11 1  
ATOM 1554  H HD12 . ILE B 2 49 ? 6.779   -2.433  0.451   1.00 0.00 ? 59 ILE B HD12 1  
ATOM 1555  H HD13 . ILE B 2 49 ? 6.858   -2.607  -1.303  1.00 0.00 ? 59 ILE B HD13 1  
ATOM 1556  N N    . THR B 2 50 ? 6.191   -7.403  -1.172  1.00 0.00 ? 60 THR B N    1  
ATOM 1557  C CA   . THR B 2 50 ? 6.526   -8.232  -2.317  1.00 0.00 ? 60 THR B CA   1  
ATOM 1558  C C    . THR B 2 50 ? 7.272   -7.408  -3.360  1.00 0.00 ? 60 THR B C    1  
ATOM 1559  O O    . THR B 2 50 ? 7.317   -6.179  -3.270  1.00 0.00 ? 60 THR B O    1  
ATOM 1560  C CB   . THR B 2 50 ? 5.261   -8.843  -2.964  1.00 0.00 ? 60 THR B CB   1  
ATOM 1561  O OG1  . THR B 2 50 ? 4.704   -7.926  -3.917  1.00 0.00 ? 60 THR B OG1  1  
ATOM 1562  C CG2  . THR B 2 50 ? 4.213   -9.177  -1.910  1.00 0.00 ? 60 THR B CG2  1  
ATOM 1563  H H    . THR B 2 50 ? 5.469   -6.746  -1.253  1.00 0.00 ? 60 THR B H    1  
ATOM 1564  H HA   . THR B 2 50 ? 7.163   -9.035  -1.979  1.00 0.00 ? 60 THR B HA   1  
ATOM 1565  H HB   . THR B 2 50 ? 5.541   -9.753  -3.473  1.00 0.00 ? 60 THR B HB   1  
ATOM 1566  H HG1  . THR B 2 50 ? 3.917   -7.491  -3.534  1.00 0.00 ? 60 THR B HG1  1  
ATOM 1567  H HG21 . THR B 2 50 ? 3.926   -8.275  -1.391  1.00 0.00 ? 60 THR B HG21 1  
ATOM 1568  H HG22 . THR B 2 50 ? 4.624   -9.884  -1.203  1.00 0.00 ? 60 THR B HG22 1  
ATOM 1569  H HG23 . THR B 2 50 ? 3.347   -9.609  -2.389  1.00 0.00 ? 60 THR B HG23 1  
ATOM 1570  N N    . GLU B 2 51 ? 7.850   -8.078  -4.350  1.00 0.00 ? 61 GLU B N    1  
ATOM 1571  C CA   . GLU B 2 51 ? 8.573   -7.386  -5.409  1.00 0.00 ? 61 GLU B CA   1  
ATOM 1572  C C    . GLU B 2 51 ? 7.608   -6.584  -6.281  1.00 0.00 ? 61 GLU B C    1  
ATOM 1573  O O    . GLU B 2 51 ? 8.001   -5.612  -6.927  1.00 0.00 ? 61 GLU B O    1  
ATOM 1574  C CB   . GLU B 2 51 ? 9.363   -8.378  -6.265  1.00 0.00 ? 61 GLU B CB   1  
ATOM 1575  C CG   . GLU B 2 51 ? 10.527  -9.025  -5.531  1.00 0.00 ? 61 GLU B CG   1  
ATOM 1576  C CD   . GLU B 2 51 ? 11.323  -9.959  -6.417  1.00 0.00 ? 61 GLU B CD   1  
ATOM 1577  O OE1  . GLU B 2 51 ? 11.933  -9.482  -7.395  1.00 0.00 ? 61 GLU B OE1  1  
ATOM 1578  O OE2  . GLU B 2 51 ? 11.336  -11.176 -6.150  1.00 0.00 ? 61 GLU B OE2  1  
ATOM 1579  H H    . GLU B 2 51 ? 7.796   -9.058  -4.364  1.00 0.00 ? 61 GLU B H    1  
ATOM 1580  H HA   . GLU B 2 51 ? 9.262   -6.702  -4.941  1.00 0.00 ? 61 GLU B HA   1  
ATOM 1581  H HB2  . GLU B 2 51 ? 8.696   -9.158  -6.599  1.00 0.00 ? 61 GLU B HB2  1  
ATOM 1582  H HB3  . GLU B 2 51 ? 9.754   -7.857  -7.126  1.00 0.00 ? 61 GLU B HB3  1  
ATOM 1583  H HG2  . GLU B 2 51 ? 11.186  -8.250  -5.170  1.00 0.00 ? 61 GLU B HG2  1  
ATOM 1584  H HG3  . GLU B 2 51 ? 10.140  -9.588  -4.693  1.00 0.00 ? 61 GLU B HG3  1  
ATOM 1585  N N    . GLU B 2 52 ? 6.341   -6.992  -6.286  1.00 0.00 ? 62 GLU B N    1  
ATOM 1586  C CA   . GLU B 2 52 ? 5.318   -6.308  -7.066  1.00 0.00 ? 62 GLU B CA   1  
ATOM 1587  C C    . GLU B 2 52 ? 4.948   -4.993  -6.403  1.00 0.00 ? 62 GLU B C    1  
ATOM 1588  O O    . GLU B 2 52 ? 4.850   -3.957  -7.053  1.00 0.00 ? 62 GLU B O    1  
ATOM 1589  C CB   . GLU B 2 52 ? 4.060   -7.163  -7.192  1.00 0.00 ? 62 GLU B CB   1  
ATOM 1590  C CG   . GLU B 2 52 ? 4.220   -8.384  -8.074  1.00 0.00 ? 62 GLU B CG   1  
ATOM 1591  C CD   . GLU B 2 52 ? 2.886   -9.000  -8.432  1.00 0.00 ? 62 GLU B CD   1  
ATOM 1592  O OE1  . GLU B 2 52 ? 2.228   -9.578  -7.541  1.00 0.00 ? 62 GLU B OE1  1  
ATOM 1593  O OE2  . GLU B 2 52 ? 2.485   -8.907  -9.608  1.00 0.00 ? 62 GLU B OE2  1  
ATOM 1594  H H    . GLU B 2 52 ? 6.086   -7.766  -5.738  1.00 0.00 ? 62 GLU B H    1  
ATOM 1595  H HA   . GLU B 2 52 ? 5.718   -6.110  -8.049  1.00 0.00 ? 62 GLU B HA   1  
ATOM 1596  H HB2  . GLU B 2 52 ? 3.767   -7.495  -6.206  1.00 0.00 ? 62 GLU B HB2  1  
ATOM 1597  H HB3  . GLU B 2 52 ? 3.269   -6.552  -7.602  1.00 0.00 ? 62 GLU B HB3  1  
ATOM 1598  H HG2  . GLU B 2 52 ? 4.723   -8.092  -8.984  1.00 0.00 ? 62 GLU B HG2  1  
ATOM 1599  H HG3  . GLU B 2 52 ? 4.816   -9.118  -7.550  1.00 0.00 ? 62 GLU B HG3  1  
ATOM 1600  N N    . ASP B 2 53 ? 4.751   -5.051  -5.096  1.00 0.00 ? 63 ASP B N    1  
ATOM 1601  C CA   . ASP B 2 53 ? 4.375   -3.877  -4.313  1.00 0.00 ? 63 ASP B CA   1  
ATOM 1602  C C    . ASP B 2 53 ? 5.573   -2.958  -4.064  1.00 0.00 ? 63 ASP B C    1  
ATOM 1603  O O    . ASP B 2 53 ? 5.528   -2.087  -3.195  1.00 0.00 ? 63 ASP B O    1  
ATOM 1604  C CB   . ASP B 2 53 ? 3.763   -4.312  -2.973  1.00 0.00 ? 63 ASP B CB   1  
ATOM 1605  C CG   . ASP B 2 53 ? 2.536   -5.199  -3.128  1.00 0.00 ? 63 ASP B CG   1  
ATOM 1606  O OD1  . ASP B 2 53 ? 2.707   -6.422  -3.337  1.00 0.00 ? 63 ASP B OD1  1  
ATOM 1607  O OD2  . ASP B 2 53 ? 1.403   -4.681  -3.025  1.00 0.00 ? 63 ASP B OD2  1  
ATOM 1608  H H    . ASP B 2 53 ? 4.825   -5.917  -4.638  1.00 0.00 ? 63 ASP B H    1  
ATOM 1609  H HA   . ASP B 2 53 ? 3.631   -3.332  -4.873  1.00 0.00 ? 63 ASP B HA   1  
ATOM 1610  H HB2  . ASP B 2 53 ? 4.505   -4.857  -2.411  1.00 0.00 ? 63 ASP B HB2  1  
ATOM 1611  H HB3  . ASP B 2 53 ? 3.478   -3.429  -2.420  1.00 0.00 ? 63 ASP B HB3  1  
ATOM 1612  N N    . LEU B 2 54 ? 6.640   -3.145  -4.833  1.00 0.00 ? 64 LEU B N    1  
ATOM 1613  C CA   . LEU B 2 54 ? 7.838   -2.324  -4.696  1.00 0.00 ? 64 LEU B CA   1  
ATOM 1614  C C    . LEU B 2 54 ? 7.930   -1.282  -5.807  1.00 0.00 ? 64 LEU B C    1  
ATOM 1615  O O    . LEU B 2 54 ? 8.066   -0.089  -5.537  1.00 0.00 ? 64 LEU B O    1  
ATOM 1616  C CB   . LEU B 2 54 ? 9.097   -3.193  -4.717  1.00 0.00 ? 64 LEU B CB   1  
ATOM 1617  C CG   . LEU B 2 54 ? 9.585   -3.689  -3.352  1.00 0.00 ? 64 LEU B CG   1  
ATOM 1618  C CD1  . LEU B 2 54 ? 10.800  -4.587  -3.513  1.00 0.00 ? 64 LEU B CD1  1  
ATOM 1619  C CD2  . LEU B 2 54 ? 9.920   -2.519  -2.441  1.00 0.00 ? 64 LEU B CD2  1  
ATOM 1620  H H    . LEU B 2 54 ? 6.620   -3.854  -5.507  1.00 0.00 ? 64 LEU B H    1  
ATOM 1621  H HA   . LEU B 2 54 ? 7.780   -1.815  -3.746  1.00 0.00 ? 64 LEU B HA   1  
ATOM 1622  H HB2  . LEU B 2 54 ? 8.900   -4.054  -5.339  1.00 0.00 ? 64 LEU B HB2  1  
ATOM 1623  H HB3  . LEU B 2 54 ? 9.892   -2.621  -5.170  1.00 0.00 ? 64 LEU B HB3  1  
ATOM 1624  H HG   . LEU B 2 54 ? 8.801   -4.267  -2.884  1.00 0.00 ? 64 LEU B HG   1  
ATOM 1625  H HD11 . LEU B 2 54 ? 10.549  -5.428  -4.141  1.00 0.00 ? 64 LEU B HD11 1  
ATOM 1626  H HD12 . LEU B 2 54 ? 11.115  -4.944  -2.543  1.00 0.00 ? 64 LEU B HD12 1  
ATOM 1627  H HD13 . LEU B 2 54 ? 11.603  -4.026  -3.968  1.00 0.00 ? 64 LEU B HD13 1  
ATOM 1628  H HD21 . LEU B 2 54 ? 10.512  -1.797  -2.984  1.00 0.00 ? 64 LEU B HD21 1  
ATOM 1629  H HD22 . LEU B 2 54 ? 10.482  -2.877  -1.591  1.00 0.00 ? 64 LEU B HD22 1  
ATOM 1630  H HD23 . LEU B 2 54 ? 9.008   -2.054  -2.098  1.00 0.00 ? 64 LEU B HD23 1  
ATOM 1631  N N    . GLU B 2 55 ? 7.887   -1.752  -7.055  1.00 0.00 ? 65 GLU B N    1  
ATOM 1632  C CA   . GLU B 2 55 ? 7.975   -0.888  -8.244  1.00 0.00 ? 65 GLU B CA   1  
ATOM 1633  C C    . GLU B 2 55 ? 7.078   0.354   -8.172  1.00 0.00 ? 65 GLU B C    1  
ATOM 1634  O O    . GLU B 2 55 ? 7.430   1.413   -8.693  1.00 0.00 ? 65 GLU B O    1  
ATOM 1635  C CB   . GLU B 2 55 ? 7.650   -1.701  -9.506  1.00 0.00 ? 65 GLU B CB   1  
ATOM 1636  C CG   . GLU B 2 55 ? 6.332   -2.470  -9.447  1.00 0.00 ? 65 GLU B CG   1  
ATOM 1637  C CD   . GLU B 2 55 ? 5.131   -1.629  -9.845  1.00 0.00 ? 65 GLU B CD   1  
ATOM 1638  O OE1  . GLU B 2 55 ? 5.192   -0.971  -10.905 1.00 0.00 ? 65 GLU B OE1  1  
ATOM 1639  O OE2  . GLU B 2 55 ? 4.127   -1.625  -9.097  1.00 0.00 ? 65 GLU B OE2  1  
ATOM 1640  H H    . GLU B 2 55 ? 7.879   -2.722  -7.191  1.00 0.00 ? 65 GLU B H    1  
ATOM 1641  H HA   . GLU B 2 55 ? 9.000   -0.554  -8.318  1.00 0.00 ? 65 GLU B HA   1  
ATOM 1642  H HB2  . GLU B 2 55 ? 7.606   -1.026  -10.346 1.00 0.00 ? 65 GLU B HB2  1  
ATOM 1643  H HB3  . GLU B 2 55 ? 8.447   -2.410  -9.671  1.00 0.00 ? 65 GLU B HB3  1  
ATOM 1644  H HG2  . GLU B 2 55 ? 6.395   -3.314  -10.118 1.00 0.00 ? 65 GLU B HG2  1  
ATOM 1645  H HG3  . GLU B 2 55 ? 6.183   -2.828  -8.438  1.00 0.00 ? 65 GLU B HG3  1  
ATOM 1646  N N    . GLU B 2 56 ? 5.937   0.221   -7.522  1.00 0.00 ? 66 GLU B N    1  
ATOM 1647  C CA   . GLU B 2 56 ? 4.980   1.316   -7.386  1.00 0.00 ? 66 GLU B CA   1  
ATOM 1648  C C    . GLU B 2 56 ? 5.552   2.494   -6.601  1.00 0.00 ? 66 GLU B C    1  
ATOM 1649  O O    . GLU B 2 56 ? 5.151   3.639   -6.804  1.00 0.00 ? 66 GLU B O    1  
ATOM 1650  C CB   . GLU B 2 56 ? 3.731   0.803   -6.690  1.00 0.00 ? 66 GLU B CB   1  
ATOM 1651  C CG   . GLU B 2 56 ? 4.039   -0.195  -5.594  1.00 0.00 ? 66 GLU B CG   1  
ATOM 1652  C CD   . GLU B 2 56 ? 2.864   -0.429  -4.691  1.00 0.00 ? 66 GLU B CD   1  
ATOM 1653  O OE1  . GLU B 2 56 ? 2.628   0.406   -3.798  1.00 0.00 ? 66 GLU B OE1  1  
ATOM 1654  O OE2  . GLU B 2 56 ? 2.168   -1.446  -4.877  1.00 0.00 ? 66 GLU B OE2  1  
ATOM 1655  H H    . GLU B 2 56 ? 5.720   -0.649  -7.127  1.00 0.00 ? 66 GLU B H    1  
ATOM 1656  H HA   . GLU B 2 56 ? 4.714   1.651   -8.376  1.00 0.00 ? 66 GLU B HA   1  
ATOM 1657  H HB2  . GLU B 2 56 ? 3.204   1.639   -6.253  1.00 0.00 ? 66 GLU B HB2  1  
ATOM 1658  H HB3  . GLU B 2 56 ? 3.095   0.324   -7.418  1.00 0.00 ? 66 GLU B HB3  1  
ATOM 1659  H HG2  . GLU B 2 56 ? 4.318   -1.136  -6.047  1.00 0.00 ? 66 GLU B HG2  1  
ATOM 1660  H HG3  . GLU B 2 56 ? 4.862   0.179   -5.003  1.00 0.00 ? 66 GLU B HG3  1  
ATOM 1661  N N    . ALA B 2 57 ? 6.479   2.208   -5.697  1.00 0.00 ? 67 ALA B N    1  
ATOM 1662  C CA   . ALA B 2 57 ? 7.095   3.245   -4.881  1.00 0.00 ? 67 ALA B CA   1  
ATOM 1663  C C    . ALA B 2 57 ? 8.298   3.847   -5.597  1.00 0.00 ? 67 ALA B C    1  
ATOM 1664  O O    . ALA B 2 57 ? 9.019   4.678   -5.046  1.00 0.00 ? 67 ALA B O    1  
ATOM 1665  C CB   . ALA B 2 57 ? 7.508   2.670   -3.535  1.00 0.00 ? 67 ALA B CB   1  
ATOM 1666  H H    . ALA B 2 57 ? 6.762   1.274   -5.580  1.00 0.00 ? 67 ALA B H    1  
ATOM 1667  H HA   . ALA B 2 57 ? 6.361   4.019   -4.709  1.00 0.00 ? 67 ALA B HA   1  
ATOM 1668  H HB1  . ALA B 2 57 ? 6.644   2.245   -3.044  1.00 0.00 ? 67 ALA B HB1  1  
ATOM 1669  H HB2  . ALA B 2 57 ? 7.923   3.454   -2.920  1.00 0.00 ? 67 ALA B HB2  1  
ATOM 1670  H HB3  . ALA B 2 57 ? 8.251   1.899   -3.686  1.00 0.00 ? 67 ALA B HB3  1  
ATOM 1671  N N    . GLY B 2 58 ? 8.506   3.415   -6.833  1.00 0.00 ? 68 GLY B N    1  
ATOM 1672  C CA   . GLY B 2 58 ? 9.621   3.902   -7.615  1.00 0.00 ? 68 GLY B CA   1  
ATOM 1673  C C    . GLY B 2 58 ? 10.748  2.900   -7.647  1.00 0.00 ? 68 GLY B C    1  
ATOM 1674  O O    . GLY B 2 58 ? 11.670  3.003   -8.456  1.00 0.00 ? 68 GLY B O    1  
ATOM 1675  H H    . GLY B 2 58 ? 7.890   2.753   -7.221  1.00 0.00 ? 68 GLY B H    1  
ATOM 1676  H HA2  . GLY B 2 58 ? 9.287   4.092   -8.626  1.00 0.00 ? 68 GLY B HA2  1  
ATOM 1677  H HA3  . GLY B 2 58 ? 9.981   4.823   -7.182  1.00 0.00 ? 68 GLY B HA3  1  
ATOM 1678  N N    . VAL B 2 59 ? 10.656  1.911   -6.773  1.00 0.00 ? 69 VAL B N    1  
ATOM 1679  C CA   . VAL B 2 59 ? 11.664  0.869   -6.679  1.00 0.00 ? 69 VAL B CA   1  
ATOM 1680  C C    . VAL B 2 59 ? 11.409  -0.197  -7.741  1.00 0.00 ? 69 VAL B C    1  
ATOM 1681  O O    . VAL B 2 59 ? 11.086  -1.339  -7.429  1.00 0.00 ? 69 VAL B O    1  
ATOM 1682  C CB   . VAL B 2 59 ? 11.665  0.214   -5.277  1.00 0.00 ? 69 VAL B CB   1  
ATOM 1683  C CG1  . VAL B 2 59 ? 12.983  -0.494  -5.012  1.00 0.00 ? 69 VAL B CG1  1  
ATOM 1684  C CG2  . VAL B 2 59 ? 11.393  1.251   -4.194  1.00 0.00 ? 69 VAL B CG2  1  
ATOM 1685  H H    . VAL B 2 59 ? 9.877   1.875   -6.179  1.00 0.00 ? 69 VAL B H    1  
ATOM 1686  H HA   . VAL B 2 59 ? 12.632  1.317   -6.851  1.00 0.00 ? 69 VAL B HA   1  
ATOM 1687  H HB   . VAL B 2 59 ? 10.875  -0.521  -5.245  1.00 0.00 ? 69 VAL B HB   1  
ATOM 1688  H HG11 . VAL B 2 59 ? 12.931  -1.009  -4.064  1.00 0.00 ? 69 VAL B HG11 1  
ATOM 1689  H HG12 . VAL B 2 59 ? 13.779  0.233   -4.983  1.00 0.00 ? 69 VAL B HG12 1  
ATOM 1690  H HG13 . VAL B 2 59 ? 13.173  -1.207  -5.800  1.00 0.00 ? 69 VAL B HG13 1  
ATOM 1691  H HG21 . VAL B 2 59 ? 12.194  1.975   -4.180  1.00 0.00 ? 69 VAL B HG21 1  
ATOM 1692  H HG22 . VAL B 2 59 ? 11.335  0.761   -3.233  1.00 0.00 ? 69 VAL B HG22 1  
ATOM 1693  H HG23 . VAL B 2 59 ? 10.458  1.751   -4.399  1.00 0.00 ? 69 VAL B HG23 1  
ATOM 1694  N N    . GLN B 2 60 ? 11.528  0.195   -9.002  1.00 0.00 ? 70 GLN B N    1  
ATOM 1695  C CA   . GLN B 2 60 ? 11.294  -0.726  -10.111 1.00 0.00 ? 70 GLN B CA   1  
ATOM 1696  C C    . GLN B 2 60 ? 12.581  -1.437  -10.518 1.00 0.00 ? 70 GLN B C    1  
ATOM 1697  O O    . GLN B 2 60 ? 12.545  -2.569  -11.003 1.00 0.00 ? 70 GLN B O    1  
ATOM 1698  C CB   . GLN B 2 60 ? 10.711  0.025   -11.315 1.00 0.00 ? 70 GLN B CB   1  
ATOM 1699  C CG   . GLN B 2 60 ? 9.683   1.083   -10.944 1.00 0.00 ? 70 GLN B CG   1  
ATOM 1700  C CD   . GLN B 2 60 ? 8.934   1.618   -12.147 1.00 0.00 ? 70 GLN B CD   1  
ATOM 1701  O OE1  . GLN B 2 60 ? 9.408   2.524   -12.834 1.00 0.00 ? 70 GLN B OE1  1  
ATOM 1702  N NE2  . GLN B 2 60 ? 7.755   1.071   -12.407 1.00 0.00 ? 70 GLN B NE2  1  
ATOM 1703  H H    . GLN B 2 60 ? 11.770  1.130   -9.192  1.00 0.00 ? 70 GLN B H    1  
ATOM 1704  H HA   . GLN B 2 60 ? 10.580  -1.464  -9.781  1.00 0.00 ? 70 GLN B HA   1  
ATOM 1705  H HB2  . GLN B 2 60 ? 11.516  0.509   -11.847 1.00 0.00 ? 70 GLN B HB2  1  
ATOM 1706  H HB3  . GLN B 2 60 ? 10.237  -0.690  -11.972 1.00 0.00 ? 70 GLN B HB3  1  
ATOM 1707  H HG2  . GLN B 2 60 ? 8.968   0.649   -10.260 1.00 0.00 ? 70 GLN B HG2  1  
ATOM 1708  H HG3  . GLN B 2 60 ? 10.189  1.906   -10.459 1.00 0.00 ? 70 GLN B HG3  1  
ATOM 1709  H HE21 . GLN B 2 60 ? 7.430   0.358   -11.814 1.00 0.00 ? 70 GLN B HE21 1  
ATOM 1710  H HE22 . GLN B 2 60 ? 7.253   1.401   -13.181 1.00 0.00 ? 70 GLN B HE22 1  
ATOM 1711  N N    . ASP B 2 61 ? 13.708  -0.773  -10.292 1.00 0.00 ? 71 ASP B N    1  
ATOM 1712  C CA   . ASP B 2 61 ? 15.022  -1.310  -10.649 1.00 0.00 ? 71 ASP B CA   1  
ATOM 1713  C C    . ASP B 2 61 ? 15.303  -2.648  -9.954  1.00 0.00 ? 71 ASP B C    1  
ATOM 1714  O O    . ASP B 2 61 ? 15.010  -2.816  -8.768  1.00 0.00 ? 71 ASP B O    1  
ATOM 1715  C CB   . ASP B 2 61 ? 16.108  -0.286  -10.304 1.00 0.00 ? 71 ASP B CB   1  
ATOM 1716  C CG   . ASP B 2 61 ? 17.507  -0.858  -10.395 1.00 0.00 ? 71 ASP B CG   1  
ATOM 1717  O OD1  . ASP B 2 61 ? 18.057  -0.923  -11.512 1.00 0.00 ? 71 ASP B OD1  1  
ATOM 1718  O OD2  . ASP B 2 61 ? 18.061  -1.239  -9.345  1.00 0.00 ? 71 ASP B OD2  1  
ATOM 1719  H H    . ASP B 2 61 ? 13.659  0.105   -9.864  1.00 0.00 ? 71 ASP B H    1  
ATOM 1720  H HA   . ASP B 2 61 ? 15.024  -1.470  -11.716 1.00 0.00 ? 71 ASP B HA   1  
ATOM 1721  H HB2  . ASP B 2 61 ? 16.038  0.545   -10.991 1.00 0.00 ? 71 ASP B HB2  1  
ATOM 1722  H HB3  . ASP B 2 61 ? 15.950  0.073   -9.298  1.00 0.00 ? 71 ASP B HB3  1  
ATOM 1723  N N    . PRO B 2 62 ? 15.865  -3.620  -10.702 1.00 0.00 ? 72 PRO B N    1  
ATOM 1724  C CA   . PRO B 2 62 ? 16.188  -4.962  -10.188 1.00 0.00 ? 72 PRO B CA   1  
ATOM 1725  C C    . PRO B 2 62 ? 17.115  -4.948  -8.970  1.00 0.00 ? 72 PRO B C    1  
ATOM 1726  O O    . PRO B 2 62 ? 16.852  -5.632  -7.978  1.00 0.00 ? 72 PRO B O    1  
ATOM 1727  C CB   . PRO B 2 62 ? 16.884  -5.651  -11.372 1.00 0.00 ? 72 PRO B CB   1  
ATOM 1728  C CG   . PRO B 2 62 ? 17.263  -4.553  -12.305 1.00 0.00 ? 72 PRO B CG   1  
ATOM 1729  C CD   . PRO B 2 62 ? 16.221  -3.490  -12.125 1.00 0.00 ? 72 PRO B CD   1  
ATOM 1730  H HA   . PRO B 2 62 ? 15.291  -5.508  -9.938  1.00 0.00 ? 72 PRO B HA   1  
ATOM 1731  H HB2  . PRO B 2 62 ? 17.754  -6.184  -11.019 1.00 0.00 ? 72 PRO B HB2  1  
ATOM 1732  H HB3  . PRO B 2 62 ? 16.199  -6.344  -11.840 1.00 0.00 ? 72 PRO B HB3  1  
ATOM 1733  H HG2  . PRO B 2 62 ? 18.240  -4.168  -12.046 1.00 0.00 ? 72 PRO B HG2  1  
ATOM 1734  H HG3  . PRO B 2 62 ? 17.258  -4.914  -13.322 1.00 0.00 ? 72 PRO B HG3  1  
ATOM 1735  H HD2  . PRO B 2 62 ? 16.637  -2.515  -12.334 1.00 0.00 ? 72 PRO B HD2  1  
ATOM 1736  H HD3  . PRO B 2 62 ? 15.368  -3.685  -12.756 1.00 0.00 ? 72 PRO B HD3  1  
ATOM 1737  N N    . ALA B 2 63 ? 18.184  -4.158  -9.038  1.00 0.00 ? 73 ALA B N    1  
ATOM 1738  C CA   . ALA B 2 63 ? 19.153  -4.083  -7.946  1.00 0.00 ? 73 ALA B CA   1  
ATOM 1739  C C    . ALA B 2 63 ? 18.520  -3.511  -6.686  1.00 0.00 ? 73 ALA B C    1  
ATOM 1740  O O    . ALA B 2 63 ? 18.767  -3.992  -5.581  1.00 0.00 ? 73 ALA B O    1  
ATOM 1741  C CB   . ALA B 2 63 ? 20.359  -3.250  -8.357  1.00 0.00 ? 73 ALA B CB   1  
ATOM 1742  H H    . ALA B 2 63 ? 18.313  -3.594  -9.831  1.00 0.00 ? 73 ALA B H    1  
ATOM 1743  H HA   . ALA B 2 63 ? 19.492  -5.085  -7.738  1.00 0.00 ? 73 ALA B HA   1  
ATOM 1744  H HB1  . ALA B 2 63 ? 21.054  -3.193  -7.532  1.00 0.00 ? 73 ALA B HB1  1  
ATOM 1745  H HB2  . ALA B 2 63 ? 20.037  -2.255  -8.625  1.00 0.00 ? 73 ALA B HB2  1  
ATOM 1746  H HB3  . ALA B 2 63 ? 20.844  -3.711  -9.204  1.00 0.00 ? 73 ALA B HB3  1  
ATOM 1747  N N    . HIS B 2 64 ? 17.694  -2.494  -6.865  1.00 0.00 ? 74 HIS B N    1  
ATOM 1748  C CA   . HIS B 2 64 ? 17.023  -1.845  -5.749  1.00 0.00 ? 74 HIS B CA   1  
ATOM 1749  C C    . HIS B 2 64 ? 16.026  -2.789  -5.082  1.00 0.00 ? 74 HIS B C    1  
ATOM 1750  O O    . HIS B 2 64 ? 15.962  -2.865  -3.853  1.00 0.00 ? 74 HIS B O    1  
ATOM 1751  C CB   . HIS B 2 64 ? 16.324  -0.570  -6.216  1.00 0.00 ? 74 HIS B CB   1  
ATOM 1752  C CG   . HIS B 2 64 ? 17.265  0.575   -6.434  1.00 0.00 ? 74 HIS B CG   1  
ATOM 1753  N ND1  . HIS B 2 64 ? 18.152  0.653   -7.483  1.00 0.00 ? 74 HIS B ND1  1  
ATOM 1754  C CD2  . HIS B 2 64 ? 17.455  1.700   -5.701  1.00 0.00 ? 74 HIS B CD2  1  
ATOM 1755  C CE1  . HIS B 2 64 ? 18.838  1.793   -7.361  1.00 0.00 ? 74 HIS B CE1  1  
ATOM 1756  N NE2  . HIS B 2 64 ? 18.453  2.467   -6.294  1.00 0.00 ? 74 HIS B NE2  1  
ATOM 1757  H H    . HIS B 2 64 ? 17.537  -2.169  -7.783  1.00 0.00 ? 74 HIS B H    1  
ATOM 1758  H HA   . HIS B 2 64 ? 17.779  -1.580  -5.025  1.00 0.00 ? 74 HIS B HA   1  
ATOM 1759  H HB2  . HIS B 2 64 ? 15.815  -0.765  -7.148  1.00 0.00 ? 74 HIS B HB2  1  
ATOM 1760  H HB3  . HIS B 2 64 ? 15.603  -0.271  -5.472  1.00 0.00 ? 74 HIS B HB3  1  
ATOM 1761  H HD1  . HIS B 2 64 ? 18.259  -0.017  -8.208  1.00 0.00 ? 74 HIS B HD1  1  
ATOM 1762  H HD2  . HIS B 2 64 ? 16.922  1.968   -4.800  1.00 0.00 ? 74 HIS B HD2  1  
ATOM 1763  H HE1  . HIS B 2 64 ? 19.608  2.119   -8.045  1.00 0.00 ? 74 HIS B HE1  1  
ATOM 1764  N N    . LYS B 2 65 ? 15.255  -3.511  -5.890  1.00 0.00 ? 75 LYS B N    1  
ATOM 1765  C CA   . LYS B 2 65 ? 14.277  -4.458  -5.360  1.00 0.00 ? 75 LYS B CA   1  
ATOM 1766  C C    . LYS B 2 65 ? 14.988  -5.555  -4.576  1.00 0.00 ? 75 LYS B C    1  
ATOM 1767  O O    . LYS B 2 65 ? 14.590  -5.900  -3.463  1.00 0.00 ? 75 LYS B O    1  
ATOM 1768  C CB   . LYS B 2 65 ? 13.440  -5.075  -6.488  1.00 0.00 ? 75 LYS B CB   1  
ATOM 1769  C CG   . LYS B 2 65 ? 12.552  -4.071  -7.211  1.00 0.00 ? 75 LYS B CG   1  
ATOM 1770  C CD   . LYS B 2 65 ? 11.203  -4.666  -7.594  1.00 0.00 ? 75 LYS B CD   1  
ATOM 1771  C CE   . LYS B 2 65 ? 11.345  -5.841  -8.548  1.00 0.00 ? 75 LYS B CE   1  
ATOM 1772  N NZ   . LYS B 2 65 ? 11.881  -5.429  -9.876  1.00 0.00 ? 75 LYS B NZ   1  
ATOM 1773  H H    . LYS B 2 65 ? 15.342  -3.400  -6.863  1.00 0.00 ? 75 LYS B H    1  
ATOM 1774  H HA   . LYS B 2 65 ? 13.624  -3.919  -4.690  1.00 0.00 ? 75 LYS B HA   1  
ATOM 1775  H HB2  . LYS B 2 65 ? 14.107  -5.520  -7.212  1.00 0.00 ? 75 LYS B HB2  1  
ATOM 1776  H HB3  . LYS B 2 65 ? 12.810  -5.847  -6.071  1.00 0.00 ? 75 LYS B HB3  1  
ATOM 1777  H HG2  . LYS B 2 65 ? 12.385  -3.225  -6.562  1.00 0.00 ? 75 LYS B HG2  1  
ATOM 1778  H HG3  . LYS B 2 65 ? 13.058  -3.742  -8.107  1.00 0.00 ? 75 LYS B HG3  1  
ATOM 1779  H HD2  . LYS B 2 65 ? 10.703  -5.005  -6.699  1.00 0.00 ? 75 LYS B HD2  1  
ATOM 1780  H HD3  . LYS B 2 65 ? 10.608  -3.900  -8.071  1.00 0.00 ? 75 LYS B HD3  1  
ATOM 1781  H HE2  . LYS B 2 65 ? 12.017  -6.562  -8.108  1.00 0.00 ? 75 LYS B HE2  1  
ATOM 1782  H HE3  . LYS B 2 65 ? 10.374  -6.295  -8.686  1.00 0.00 ? 75 LYS B HE3  1  
ATOM 1783  H HZ1  . LYS B 2 65 ? 12.850  -5.073  -9.778  1.00 0.00 ? 75 LYS B HZ1  1  
ATOM 1784  H HZ2  . LYS B 2 65 ? 11.287  -4.683  -10.289 1.00 0.00 ? 75 LYS B HZ2  1  
ATOM 1785  H HZ3  . LYS B 2 65 ? 11.889  -6.245  -10.525 1.00 0.00 ? 75 LYS B HZ3  1  
ATOM 1786  N N    . ARG B 2 66 ? 16.048  -6.091  -5.170  1.00 0.00 ? 76 ARG B N    1  
ATOM 1787  C CA   . ARG B 2 66 ? 16.847  -7.136  -4.542  1.00 0.00 ? 76 ARG B CA   1  
ATOM 1788  C C    . ARG B 2 66 ? 17.477  -6.633  -3.243  1.00 0.00 ? 76 ARG B C    1  
ATOM 1789  O O    . ARG B 2 66 ? 17.596  -7.380  -2.271  1.00 0.00 ? 76 ARG B O    1  
ATOM 1790  C CB   . ARG B 2 66 ? 17.938  -7.599  -5.518  1.00 0.00 ? 76 ARG B CB   1  
ATOM 1791  C CG   . ARG B 2 66 ? 18.931  -8.590  -4.930  1.00 0.00 ? 76 ARG B CG   1  
ATOM 1792  C CD   . ARG B 2 66 ? 18.320  -9.972  -4.768  1.00 0.00 ? 76 ARG B CD   1  
ATOM 1793  N NE   . ARG B 2 66 ? 19.343  -10.998 -4.573  1.00 0.00 ? 76 ARG B NE   1  
ATOM 1794  C CZ   . ARG B 2 66 ? 19.166  -12.111 -3.864  1.00 0.00 ? 76 ARG B CZ   1  
ATOM 1795  N NH1  . ARG B 2 66 ? 18.000  -12.355 -3.278  1.00 0.00 ? 76 ARG B NH1  1  
ATOM 1796  N NH2  . ARG B 2 66 ? 20.160  -12.979 -3.747  1.00 0.00 ? 76 ARG B NH2  1  
ATOM 1797  H H    . ARG B 2 66 ? 16.285  -5.796  -6.079  1.00 0.00 ? 76 ARG B H    1  
ATOM 1798  H HA   . ARG B 2 66 ? 16.196  -7.968  -4.319  1.00 0.00 ? 76 ARG B HA   1  
ATOM 1799  H HB2  . ARG B 2 66 ? 17.464  -8.063  -6.369  1.00 0.00 ? 76 ARG B HB2  1  
ATOM 1800  H HB3  . ARG B 2 66 ? 18.486  -6.733  -5.855  1.00 0.00 ? 76 ARG B HB3  1  
ATOM 1801  H HG2  . ARG B 2 66 ? 19.784  -8.662  -5.587  1.00 0.00 ? 76 ARG B HG2  1  
ATOM 1802  H HG3  . ARG B 2 66 ? 19.250  -8.233  -3.961  1.00 0.00 ? 76 ARG B HG3  1  
ATOM 1803  H HD2  . ARG B 2 66 ? 17.662  -9.963  -3.911  1.00 0.00 ? 76 ARG B HD2  1  
ATOM 1804  H HD3  . ARG B 2 66 ? 17.751  -10.207 -5.656  1.00 0.00 ? 76 ARG B HD3  1  
ATOM 1805  H HE   . ARG B 2 66 ? 20.219  -10.847 -5.001  1.00 0.00 ? 76 ARG B HE   1  
ATOM 1806  H HH11 . ARG B 2 66 ? 17.249  -11.704 -3.364  1.00 0.00 ? 76 ARG B HH11 1  
ATOM 1807  H HH12 . ARG B 2 66 ? 17.864  -13.200 -2.750  1.00 0.00 ? 76 ARG B HH12 1  
ATOM 1808  H HH21 . ARG B 2 66 ? 21.043  -12.792 -4.185  1.00 0.00 ? 76 ARG B HH21 1  
ATOM 1809  H HH22 . ARG B 2 66 ? 20.037  -13.827 -3.221  1.00 0.00 ? 76 ARG B HH22 1  
ATOM 1810  N N    . LEU B 2 67 ? 17.858  -5.362  -3.231  1.00 0.00 ? 77 LEU B N    1  
ATOM 1811  C CA   . LEU B 2 67 ? 18.482  -4.754  -2.061  1.00 0.00 ? 77 LEU B CA   1  
ATOM 1812  C C    . LEU B 2 67 ? 17.505  -4.709  -0.891  1.00 0.00 ? 77 LEU B C    1  
ATOM 1813  O O    . LEU B 2 67 ? 17.848  -5.087  0.228   1.00 0.00 ? 77 LEU B O    1  
ATOM 1814  C CB   . LEU B 2 67 ? 18.968  -3.339  -2.398  1.00 0.00 ? 77 LEU B CB   1  
ATOM 1815  C CG   . LEU B 2 67 ? 20.236  -2.867  -1.670  1.00 0.00 ? 77 LEU B CG   1  
ATOM 1816  C CD1  . LEU B 2 67 ? 19.931  -2.480  -0.233  1.00 0.00 ? 77 LEU B CD1  1  
ATOM 1817  C CD2  . LEU B 2 67 ? 21.310  -3.942  -1.708  1.00 0.00 ? 77 LEU B CD2  1  
ATOM 1818  H H    . LEU B 2 67 ? 17.707  -4.809  -4.030  1.00 0.00 ? 77 LEU B H    1  
ATOM 1819  H HA   . LEU B 2 67 ? 19.329  -5.363  -1.785  1.00 0.00 ? 77 LEU B HA   1  
ATOM 1820  H HB2  . LEU B 2 67 ? 19.156  -3.294  -3.461  1.00 0.00 ? 77 LEU B HB2  1  
ATOM 1821  H HB3  . LEU B 2 67 ? 18.172  -2.648  -2.166  1.00 0.00 ? 77 LEU B HB3  1  
ATOM 1822  H HG   . LEU B 2 67 ? 20.625  -1.992  -2.172  1.00 0.00 ? 77 LEU B HG   1  
ATOM 1823  H HD11 . LEU B 2 67 ? 20.776  -1.952  0.186   1.00 0.00 ? 77 LEU B HD11 1  
ATOM 1824  H HD12 . LEU B 2 67 ? 19.742  -3.371  0.347   1.00 0.00 ? 77 LEU B HD12 1  
ATOM 1825  H HD13 . LEU B 2 67 ? 19.060  -1.842  -0.208  1.00 0.00 ? 77 LEU B HD13 1  
ATOM 1826  H HD21 . LEU B 2 67 ? 21.081  -4.704  -0.978  1.00 0.00 ? 77 LEU B HD21 1  
ATOM 1827  H HD22 . LEU B 2 67 ? 22.268  -3.500  -1.479  1.00 0.00 ? 77 LEU B HD22 1  
ATOM 1828  H HD23 . LEU B 2 67 ? 21.342  -4.385  -2.693  1.00 0.00 ? 77 LEU B HD23 1  
ATOM 1829  N N    . LEU B 2 68 ? 16.281  -4.265  -1.162  1.00 0.00 ? 78 LEU B N    1  
ATOM 1830  C CA   . LEU B 2 68 ? 15.261  -4.164  -0.124  1.00 0.00 ? 78 LEU B CA   1  
ATOM 1831  C C    . LEU B 2 68 ? 14.893  -5.545  0.412   1.00 0.00 ? 78 LEU B C    1  
ATOM 1832  O O    . LEU B 2 68 ? 14.655  -5.711  1.610   1.00 0.00 ? 78 LEU B O    1  
ATOM 1833  C CB   . LEU B 2 68 ? 14.018  -3.449  -0.657  1.00 0.00 ? 78 LEU B CB   1  
ATOM 1834  C CG   . LEU B 2 68 ? 13.158  -2.765  0.410   1.00 0.00 ? 78 LEU B CG   1  
ATOM 1835  C CD1  . LEU B 2 68 ? 12.661  -1.417  -0.088  1.00 0.00 ? 78 LEU B CD1  1  
ATOM 1836  C CD2  . LEU B 2 68 ? 11.987  -3.653  0.806   1.00 0.00 ? 78 LEU B CD2  1  
ATOM 1837  H H    . LEU B 2 68 ? 16.060  -3.998  -2.080  1.00 0.00 ? 78 LEU B H    1  
ATOM 1838  H HA   . LEU B 2 68 ? 15.677  -3.583  0.686   1.00 0.00 ? 78 LEU B HA   1  
ATOM 1839  H HB2  . LEU B 2 68 ? 14.336  -2.702  -1.370  1.00 0.00 ? 78 LEU B HB2  1  
ATOM 1840  H HB3  . LEU B 2 68 ? 13.404  -4.175  -1.171  1.00 0.00 ? 78 LEU B HB3  1  
ATOM 1841  H HG   . LEU B 2 68 ? 13.759  -2.592  1.291   1.00 0.00 ? 78 LEU B HG   1  
ATOM 1842  H HD11 . LEU B 2 68 ? 12.121  -1.552  -1.014  1.00 0.00 ? 78 LEU B HD11 1  
ATOM 1843  H HD12 . LEU B 2 68 ? 13.504  -0.763  -0.254  1.00 0.00 ? 78 LEU B HD12 1  
ATOM 1844  H HD13 . LEU B 2 68 ? 12.007  -0.980  0.651   1.00 0.00 ? 78 LEU B HD13 1  
ATOM 1845  H HD21 . LEU B 2 68 ? 12.349  -4.483  1.396   1.00 0.00 ? 78 LEU B HD21 1  
ATOM 1846  H HD22 . LEU B 2 68 ? 11.504  -4.029  -0.084  1.00 0.00 ? 78 LEU B HD22 1  
ATOM 1847  H HD23 . LEU B 2 68 ? 11.279  -3.079  1.386   1.00 0.00 ? 78 LEU B HD23 1  
ATOM 1848  N N    . LEU B 2 69 ? 14.857  -6.538  -0.472  1.00 0.00 ? 79 LEU B N    1  
ATOM 1849  C CA   . LEU B 2 69 ? 14.534  -7.903  -0.070  1.00 0.00 ? 79 LEU B CA   1  
ATOM 1850  C C    . LEU B 2 69 ? 15.626  -8.452  0.842   1.00 0.00 ? 79 LEU B C    1  
ATOM 1851  O O    . LEU B 2 69 ? 15.367  -9.274  1.722   1.00 0.00 ? 79 LEU B O    1  
ATOM 1852  C CB   . LEU B 2 69 ? 14.366  -8.800  -1.299  1.00 0.00 ? 79 LEU B CB   1  
ATOM 1853  C CG   . LEU B 2 69 ? 12.918  -9.134  -1.670  1.00 0.00 ? 79 LEU B CG   1  
ATOM 1854  C CD1  . LEU B 2 69 ? 12.128  -7.869  -1.971  1.00 0.00 ? 79 LEU B CD1  1  
ATOM 1855  C CD2  . LEU B 2 69 ? 12.882  -10.080 -2.859  1.00 0.00 ? 79 LEU B CD2  1  
ATOM 1856  H H    . LEU B 2 69 ? 15.046  -6.355  -1.418  1.00 0.00 ? 79 LEU B H    1  
ATOM 1857  H HA   . LEU B 2 69 ? 13.604  -7.876  0.478   1.00 0.00 ? 79 LEU B HA   1  
ATOM 1858  H HB2  . LEU B 2 69 ? 14.828  -8.307  -2.142  1.00 0.00 ? 79 LEU B HB2  1  
ATOM 1859  H HB3  . LEU B 2 69 ? 14.889  -9.727  -1.117  1.00 0.00 ? 79 LEU B HB3  1  
ATOM 1860  H HG   . LEU B 2 69 ? 12.446  -9.629  -0.834  1.00 0.00 ? 79 LEU B HG   1  
ATOM 1861  H HD11 . LEU B 2 69 ? 11.123  -8.132  -2.263  1.00 0.00 ? 79 LEU B HD11 1  
ATOM 1862  H HD12 . LEU B 2 69 ? 12.606  -7.325  -2.773  1.00 0.00 ? 79 LEU B HD12 1  
ATOM 1863  H HD13 . LEU B 2 69 ? 12.094  -7.248  -1.086  1.00 0.00 ? 79 LEU B HD13 1  
ATOM 1864  H HD21 . LEU B 2 69 ? 13.316  -11.028 -2.579  1.00 0.00 ? 79 LEU B HD21 1  
ATOM 1865  H HD22 . LEU B 2 69 ? 13.444  -9.653  -3.676  1.00 0.00 ? 79 LEU B HD22 1  
ATOM 1866  H HD23 . LEU B 2 69 ? 11.857  -10.231 -3.167  1.00 0.00 ? 79 LEU B HD23 1  
ATOM 1867  N N    . ASP B 2 70 ? 16.849  -7.983  0.624   1.00 0.00 ? 80 ASP B N    1  
ATOM 1868  C CA   . ASP B 2 70 ? 17.991  -8.393  1.430   1.00 0.00 ? 80 ASP B CA   1  
ATOM 1869  C C    . ASP B 2 70 ? 17.852  -7.834  2.841   1.00 0.00 ? 80 ASP B C    1  
ATOM 1870  O O    . ASP B 2 70 ? 18.124  -8.515  3.832   1.00 0.00 ? 80 ASP B O    1  
ATOM 1871  C CB   . ASP B 2 70 ? 19.290  -7.894  0.783   1.00 0.00 ? 80 ASP B CB   1  
ATOM 1872  C CG   . ASP B 2 70 ? 20.499  -8.017  1.690   1.00 0.00 ? 80 ASP B CG   1  
ATOM 1873  O OD1  . ASP B 2 70 ? 21.010  -9.144  1.856   1.00 0.00 ? 80 ASP B OD1  1  
ATOM 1874  O OD2  . ASP B 2 70 ? 20.964  -6.983  2.213   1.00 0.00 ? 80 ASP B OD2  1  
ATOM 1875  H H    . ASP B 2 70 ? 16.987  -7.339  -0.104  1.00 0.00 ? 80 ASP B H    1  
ATOM 1876  H HA   . ASP B 2 70 ? 18.005  -9.472  1.474   1.00 0.00 ? 80 ASP B HA   1  
ATOM 1877  H HB2  . ASP B 2 70 ? 19.480  -8.468  -0.111  1.00 0.00 ? 80 ASP B HB2  1  
ATOM 1878  H HB3  . ASP B 2 70 ? 19.172  -6.854  0.515   1.00 0.00 ? 80 ASP B HB3  1  
ATOM 1879  N N    . THR B 2 71 ? 17.372  -6.600  2.921   1.00 0.00 ? 81 THR B N    1  
ATOM 1880  C CA   . THR B 2 71 ? 17.182  -5.917  4.193   1.00 0.00 ? 81 THR B CA   1  
ATOM 1881  C C    . THR B 2 71 ? 16.123  -6.607  5.052   1.00 0.00 ? 81 THR B C    1  
ATOM 1882  O O    . THR B 2 71 ? 16.171  -6.544  6.282   1.00 0.00 ? 81 THR B O    1  
ATOM 1883  C CB   . THR B 2 71 ? 16.768  -4.458  3.962   1.00 0.00 ? 81 THR B CB   1  
ATOM 1884  O OG1  . THR B 2 71 ? 17.410  -3.963  2.784   1.00 0.00 ? 81 THR B OG1  1  
ATOM 1885  C CG2  . THR B 2 71 ? 17.139  -3.588  5.153   1.00 0.00 ? 81 THR B CG2  1  
ATOM 1886  H H    . THR B 2 71 ? 17.134  -6.129  2.089   1.00 0.00 ? 81 THR B H    1  
ATOM 1887  H HA   . THR B 2 71 ? 18.124  -5.924  4.720   1.00 0.00 ? 81 THR B HA   1  
ATOM 1888  H HB   . THR B 2 71 ? 15.697  -4.420  3.823   1.00 0.00 ? 81 THR B HB   1  
ATOM 1889  H HG1  . THR B 2 71 ? 18.117  -4.563  2.524   1.00 0.00 ? 81 THR B HG1  1  
ATOM 1890  H HG21 . THR B 2 71 ? 16.682  -2.616  5.045   1.00 0.00 ? 81 THR B HG21 1  
ATOM 1891  H HG22 . THR B 2 71 ? 18.212  -3.477  5.198   1.00 0.00 ? 81 THR B HG22 1  
ATOM 1892  H HG23 . THR B 2 71 ? 16.787  -4.053  6.063   1.00 0.00 ? 81 THR B HG23 1  
ATOM 1893  N N    . LEU B 2 72 ? 15.190  -7.293  4.397   1.00 0.00 ? 82 LEU B N    1  
ATOM 1894  C CA   . LEU B 2 72 ? 14.114  -7.989  5.097   1.00 0.00 ? 82 LEU B CA   1  
ATOM 1895  C C    . LEU B 2 72 ? 14.667  -9.096  5.983   1.00 0.00 ? 82 LEU B C    1  
ATOM 1896  O O    . LEU B 2 72 ? 14.056  -9.467  6.983   1.00 0.00 ? 82 LEU B O    1  
ATOM 1897  C CB   . LEU B 2 72 ? 13.116  -8.583  4.099   1.00 0.00 ? 82 LEU B CB   1  
ATOM 1898  C CG   . LEU B 2 72 ? 12.273  -7.570  3.322   1.00 0.00 ? 82 LEU B CG   1  
ATOM 1899  C CD1  . LEU B 2 72 ? 11.434  -8.274  2.269   1.00 0.00 ? 82 LEU B CD1  1  
ATOM 1900  C CD2  . LEU B 2 72 ? 11.379  -6.785  4.267   1.00 0.00 ? 82 LEU B CD2  1  
ATOM 1901  H H    . LEU B 2 72 ? 15.237  -7.346  3.418   1.00 0.00 ? 82 LEU B H    1  
ATOM 1902  H HA   . LEU B 2 72 ? 13.603  -7.268  5.717   1.00 0.00 ? 82 LEU B HA   1  
ATOM 1903  H HB2  . LEU B 2 72 ? 13.667  -9.181  3.387   1.00 0.00 ? 82 LEU B HB2  1  
ATOM 1904  H HB3  . LEU B 2 72 ? 12.445  -9.233  4.641   1.00 0.00 ? 82 LEU B HB3  1  
ATOM 1905  H HG   . LEU B 2 72 ? 12.928  -6.873  2.820   1.00 0.00 ? 82 LEU B HG   1  
ATOM 1906  H HD11 . LEU B 2 72 ? 10.893  -7.540  1.690   1.00 0.00 ? 82 LEU B HD11 1  
ATOM 1907  H HD12 . LEU B 2 72 ? 10.732  -8.937  2.754   1.00 0.00 ? 82 LEU B HD12 1  
ATOM 1908  H HD13 . LEU B 2 72 ? 12.078  -8.845  1.617   1.00 0.00 ? 82 LEU B HD13 1  
ATOM 1909  H HD21 . LEU B 2 72 ? 11.987  -6.275  4.998   1.00 0.00 ? 82 LEU B HD21 1  
ATOM 1910  H HD22 . LEU B 2 72 ? 10.704  -7.462  4.769   1.00 0.00 ? 82 LEU B HD22 1  
ATOM 1911  H HD23 . LEU B 2 72 ? 10.809  -6.060  3.704   1.00 0.00 ? 82 LEU B HD23 1  
ATOM 1912  N N    . GLN B 2 73 ? 15.824  -9.625  5.608   1.00 0.00 ? 83 GLN B N    1  
ATOM 1913  C CA   . GLN B 2 73 ? 16.456  -10.690 6.375   1.00 0.00 ? 83 GLN B CA   1  
ATOM 1914  C C    . GLN B 2 73 ? 17.675  -10.171 7.132   1.00 0.00 ? 83 GLN B C    1  
ATOM 1915  O O    . GLN B 2 73 ? 18.074  -10.742 8.149   1.00 0.00 ? 83 GLN B O    1  
ATOM 1916  C CB   . GLN B 2 73 ? 16.852  -11.839 5.452   1.00 0.00 ? 83 GLN B CB   1  
ATOM 1917  C CG   . GLN B 2 73 ? 15.675  -12.431 4.696   1.00 0.00 ? 83 GLN B CG   1  
ATOM 1918  C CD   . GLN B 2 73 ? 16.022  -13.719 3.979   1.00 0.00 ? 83 GLN B CD   1  
ATOM 1919  O OE1  . GLN B 2 73 ? 17.169  -13.948 3.596   1.00 0.00 ? 83 GLN B OE1  1  
ATOM 1920  N NE2  . GLN B 2 73 ? 15.026  -14.567 3.784   1.00 0.00 ? 83 GLN B NE2  1  
ATOM 1921  H H    . GLN B 2 73 ? 16.258  -9.298  4.790   1.00 0.00 ? 83 GLN B H    1  
ATOM 1922  H HA   . GLN B 2 73 ? 15.734  -11.050 7.093   1.00 0.00 ? 83 GLN B HA   1  
ATOM 1923  H HB2  . GLN B 2 73 ? 17.572  -11.477 4.732   1.00 0.00 ? 83 GLN B HB2  1  
ATOM 1924  H HB3  . GLN B 2 73 ? 17.305  -12.621 6.042   1.00 0.00 ? 83 GLN B HB3  1  
ATOM 1925  H HG2  . GLN B 2 73 ? 14.880  -12.633 5.398   1.00 0.00 ? 83 GLN B HG2  1  
ATOM 1926  H HG3  . GLN B 2 73 ? 15.333  -11.710 3.967   1.00 0.00 ? 83 GLN B HG3  1  
ATOM 1927  H HE21 . GLN B 2 73 ? 14.133  -14.316 4.109   1.00 0.00 ? 83 GLN B HE21 1  
ATOM 1928  H HE22 . GLN B 2 73 ? 15.218  -15.414 3.331   1.00 0.00 ? 83 GLN B HE22 1  
ATOM 1929  N N    . LEU B 2 74 ? 18.269  -9.097  6.627   1.00 0.00 ? 84 LEU B N    1  
ATOM 1930  C CA   . LEU B 2 74 ? 19.435  -8.500  7.264   1.00 0.00 ? 84 LEU B CA   1  
ATOM 1931  C C    . LEU B 2 74 ? 19.026  -7.769  8.538   1.00 0.00 ? 84 LEU B C    1  
ATOM 1932  O O    . LEU B 2 74 ? 19.536  -8.051  9.622   1.00 0.00 ? 84 LEU B O    1  
ATOM 1933  C CB   . LEU B 2 74 ? 20.131  -7.532  6.303   1.00 0.00 ? 84 LEU B CB   1  
ATOM 1934  C CG   . LEU B 2 74 ? 21.436  -6.926  6.824   1.00 0.00 ? 84 LEU B CG   1  
ATOM 1935  C CD1  . LEU B 2 74 ? 22.522  -7.986  6.921   1.00 0.00 ? 84 LEU B CD1  1  
ATOM 1936  C CD2  . LEU B 2 74 ? 21.879  -5.780  5.928   1.00 0.00 ? 84 LEU B CD2  1  
ATOM 1937  H H    . LEU B 2 74 ? 17.923  -8.703  5.798   1.00 0.00 ? 84 LEU B H    1  
ATOM 1938  H HA   . LEU B 2 74 ? 20.117  -9.295  7.522   1.00 0.00 ? 84 LEU B HA   1  
ATOM 1939  H HB2  . LEU B 2 74 ? 20.345  -8.061  5.386   1.00 0.00 ? 84 LEU B HB2  1  
ATOM 1940  H HB3  . LEU B 2 74 ? 19.449  -6.726  6.083   1.00 0.00 ? 84 LEU B HB3  1  
ATOM 1941  H HG   . LEU B 2 74 ? 21.267  -6.530  7.815   1.00 0.00 ? 84 LEU B HG   1  
ATOM 1942  H HD11 . LEU B 2 74 ? 23.423  -7.544  7.321   1.00 0.00 ? 84 LEU B HD11 1  
ATOM 1943  H HD12 . LEU B 2 74 ? 22.725  -8.387  5.939   1.00 0.00 ? 84 LEU B HD12 1  
ATOM 1944  H HD13 . LEU B 2 74 ? 22.194  -8.783  7.572   1.00 0.00 ? 84 LEU B HD13 1  
ATOM 1945  H HD21 . LEU B 2 74 ? 21.117  -5.014  5.919   1.00 0.00 ? 84 LEU B HD21 1  
ATOM 1946  H HD22 . LEU B 2 74 ? 22.032  -6.147  4.924   1.00 0.00 ? 84 LEU B HD22 1  
ATOM 1947  H HD23 . LEU B 2 74 ? 22.802  -5.365  6.303   1.00 0.00 ? 84 LEU B HD23 1  
ATOM 1948  N N    . SER B 2 75 ? 18.104  -6.830  8.399   1.00 0.00 ? 85 SER B N    1  
ATOM 1949  C CA   . SER B 2 75 ? 17.620  -6.067  9.537   1.00 0.00 ? 85 SER B CA   1  
ATOM 1950  C C    . SER B 2 75 ? 16.383  -6.739  10.125  1.00 0.00 ? 85 SER B C    1  
ATOM 1951  O O    . SER B 2 75 ? 16.263  -6.884  11.346  1.00 0.00 ? 85 SER B O    1  
ATOM 1952  C CB   . SER B 2 75 ? 17.296  -4.636  9.102   1.00 0.00 ? 85 SER B CB   1  
ATOM 1953  O OG   . SER B 2 75 ? 18.300  -4.130  8.235   1.00 0.00 ? 85 SER B OG   1  
ATOM 1954  H H    . SER B 2 75 ? 17.739  -6.642  7.509   1.00 0.00 ? 85 SER B H    1  
ATOM 1955  H HA   . SER B 2 75 ? 18.399  -6.044  10.283  1.00 0.00 ? 85 SER B HA   1  
ATOM 1956  H HB2  . SER B 2 75 ? 16.349  -4.625  8.582   1.00 0.00 ? 85 SER B HB2  1  
ATOM 1957  H HB3  . SER B 2 75 ? 17.235  -4.002  9.973   1.00 0.00 ? 85 SER B HB3  1  
ATOM 1958  H HG   . SER B 2 75 ? 18.299  -3.169  8.274   1.00 0.00 ? 85 SER B HG   1  
ATOM 1959  N N    . LYS B 2 76 ? 15.490  -7.164  9.228   1.00 0.00 ? 86 LYS B N    1  
ATOM 1960  C CA   . LYS B 2 76 ? 14.242  -7.837  9.588   1.00 0.00 ? 86 LYS B CA   1  
ATOM 1961  C C    . LYS B 2 76 ? 13.253  -6.864  10.224  1.00 0.00 ? 86 LYS B C    1  
ATOM 1962  O O    . LYS B 2 76 ? 12.129  -7.297  10.560  1.00 0.00 ? 86 LYS B O    1  
ATOM 1963  C CB   . LYS B 2 76 ? 14.496  -9.032  10.517  1.00 0.00 ? 86 LYS B CB   1  
ATOM 1964  C CG   . LYS B 2 76 ? 13.635  -10.242 10.191  1.00 0.00 ? 86 LYS B CG   1  
ATOM 1965  C CD   . LYS B 2 76 ? 13.867  -11.383 11.165  1.00 0.00 ? 86 LYS B CD   1  
ATOM 1966  C CE   . LYS B 2 76 ? 12.846  -12.493 10.970  1.00 0.00 ? 86 LYS B CE   1  
ATOM 1967  N NZ   . LYS B 2 76 ? 11.473  -12.058 11.341  1.00 0.00 ? 86 LYS B NZ   1  
ATOM 1968  O OXT  . LYS B 2 76 ? 13.597  -5.670  10.365  1.00 0.00 ? 86 LYS B OXT  1  
ATOM 1969  H H    . LYS B 2 76 ? 15.675  -7.005  8.279   1.00 0.00 ? 86 LYS B H    1  
ATOM 1970  H HA   . LYS B 2 76 ? 13.805  -8.205  8.670   1.00 0.00 ? 86 LYS B HA   1  
ATOM 1971  H HB2  . LYS B 2 76 ? 15.533  -9.322  10.441  1.00 0.00 ? 86 LYS B HB2  1  
ATOM 1972  H HB3  . LYS B 2 76 ? 14.288  -8.732  11.533  1.00 0.00 ? 86 LYS B HB3  1  
ATOM 1973  H HG2  . LYS B 2 76 ? 12.597  -9.954  10.235  1.00 0.00 ? 86 LYS B HG2  1  
ATOM 1974  H HG3  . LYS B 2 76 ? 13.873  -10.579 9.193   1.00 0.00 ? 86 LYS B HG3  1  
ATOM 1975  H HD2  . LYS B 2 76 ? 14.857  -11.786 11.005  1.00 0.00 ? 86 LYS B HD2  1  
ATOM 1976  H HD3  . LYS B 2 76 ? 13.789  -11.007 12.175  1.00 0.00 ? 86 LYS B HD3  1  
ATOM 1977  H HE2  . LYS B 2 76 ? 12.849  -12.787 9.931   1.00 0.00 ? 86 LYS B HE2  1  
ATOM 1978  H HE3  . LYS B 2 76 ? 13.126  -13.336 11.582  1.00 0.00 ? 86 LYS B HE3  1  
ATOM 1979  H HZ1  . LYS B 2 76 ? 11.507  -11.422 12.165  1.00 0.00 ? 86 LYS B HZ1  1  
ATOM 1980  H HZ2  . LYS B 2 76 ? 10.891  -12.884 11.586  1.00 0.00 ? 86 LYS B HZ2  1  
ATOM 1981  H HZ3  . LYS B 2 76 ? 11.024  -11.554 10.549  1.00 0.00 ? 86 LYS B HZ3  1  
ATOM 1982  N N    . THR A 1 18 ? -15.158 -6.726  8.722   1.00 0.00 ? 14 THR A N    2  
ATOM 1983  C CA   . THR A 1 18 ? -15.648 -5.333  8.636   1.00 0.00 ? 14 THR A CA   2  
ATOM 1984  C C    . THR A 1 18 ? -14.731 -4.490  7.757   1.00 0.00 ? 14 THR A C    2  
ATOM 1985  O O    . THR A 1 18 ? -13.632 -4.917  7.400   1.00 0.00 ? 14 THR A O    2  
ATOM 1986  C CB   . THR A 1 18 ? -15.735 -4.676  10.031  1.00 0.00 ? 14 THR A CB   2  
ATOM 1987  O OG1  . THR A 1 18 ? -14.449 -4.687  10.667  1.00 0.00 ? 14 THR A OG1  2  
ATOM 1988  C CG2  . THR A 1 18 ? -16.750 -5.388  10.913  1.00 0.00 ? 14 THR A CG2  2  
ATOM 1989  H H    . THR A 1 18 ? -14.595 -6.961  7.881   1.00 0.00 ? 14 THR A H    2  
ATOM 1990  H HA   . THR A 1 18 ? -16.637 -5.344  8.201   1.00 0.00 ? 14 THR A HA   2  
ATOM 1991  H HB   . THR A 1 18 ? -16.051 -3.649  9.905   1.00 0.00 ? 14 THR A HB   2  
ATOM 1992  H HG1  . THR A 1 18 ? -14.252 -5.588  10.983  1.00 0.00 ? 14 THR A HG1  2  
ATOM 1993  H HG21 . THR A 1 18 ? -17.744 -5.212  10.531  1.00 0.00 ? 14 THR A HG21 2  
ATOM 1994  H HG22 . THR A 1 18 ? -16.678 -5.008  11.921  1.00 0.00 ? 14 THR A HG22 2  
ATOM 1995  H HG23 . THR A 1 18 ? -16.545 -6.447  10.912  1.00 0.00 ? 14 THR A HG23 2  
ATOM 1996  N N    . VAL A 1 19 ? -15.198 -3.295  7.408   1.00 0.00 ? 15 VAL A N    2  
ATOM 1997  C CA   . VAL A 1 19 ? -14.426 -2.375  6.578   1.00 0.00 ? 15 VAL A CA   2  
ATOM 1998  C C    . VAL A 1 19 ? -13.137 -1.962  7.287   1.00 0.00 ? 15 VAL A C    2  
ATOM 1999  O O    . VAL A 1 19 ? -12.095 -1.799  6.656   1.00 0.00 ? 15 VAL A O    2  
ATOM 2000  C CB   . VAL A 1 19 ? -15.250 -1.125  6.209   1.00 0.00 ? 15 VAL A CB   2  
ATOM 2001  C CG1  . VAL A 1 19 ? -14.419 -0.135  5.406   1.00 0.00 ? 15 VAL A CG1  2  
ATOM 2002  C CG2  . VAL A 1 19 ? -16.488 -1.531  5.430   1.00 0.00 ? 15 VAL A CG2  2  
ATOM 2003  H H    . VAL A 1 19 ? -16.099 -3.039  7.708   1.00 0.00 ? 15 VAL A H    2  
ATOM 2004  H HA   . VAL A 1 19 ? -14.167 -2.893  5.665   1.00 0.00 ? 15 VAL A HA   2  
ATOM 2005  H HB   . VAL A 1 19 ? -15.568 -0.642  7.121   1.00 0.00 ? 15 VAL A HB   2  
ATOM 2006  H HG11 . VAL A 1 19 ? -13.564 0.172   5.991   1.00 0.00 ? 15 VAL A HG11 2  
ATOM 2007  H HG12 . VAL A 1 19 ? -15.019 0.730   5.166   1.00 0.00 ? 15 VAL A HG12 2  
ATOM 2008  H HG13 . VAL A 1 19 ? -14.082 -0.604  4.495   1.00 0.00 ? 15 VAL A HG13 2  
ATOM 2009  H HG21 . VAL A 1 19 ? -17.060 -2.244  6.006   1.00 0.00 ? 15 VAL A HG21 2  
ATOM 2010  H HG22 . VAL A 1 19 ? -16.192 -1.979  4.494   1.00 0.00 ? 15 VAL A HG22 2  
ATOM 2011  H HG23 . VAL A 1 19 ? -17.094 -0.658  5.235   1.00 0.00 ? 15 VAL A HG23 2  
ATOM 2012  N N    . SER A 1 20 ? -13.214 -1.822  8.605   1.00 0.00 ? 16 SER A N    2  
ATOM 2013  C CA   . SER A 1 20 ? -12.058 -1.444  9.402   1.00 0.00 ? 16 SER A CA   2  
ATOM 2014  C C    . SER A 1 20 ? -10.960 -2.493  9.269   1.00 0.00 ? 16 SER A C    2  
ATOM 2015  O O    . SER A 1 20 ? -9.796  -2.164  9.048   1.00 0.00 ? 16 SER A O    2  
ATOM 2016  C CB   . SER A 1 20 ? -12.478 -1.289  10.863  1.00 0.00 ? 16 SER A CB   2  
ATOM 2017  O OG   . SER A 1 20 ? -13.744 -1.897  11.086  1.00 0.00 ? 16 SER A OG   2  
ATOM 2018  H H    . SER A 1 20 ? -14.069 -1.978  9.057   1.00 0.00 ? 16 SER A H    2  
ATOM 2019  H HA   . SER A 1 20 ? -11.690 -0.498  9.034   1.00 0.00 ? 16 SER A HA   2  
ATOM 2020  H HB2  . SER A 1 20 ? -11.746 -1.762  11.499  1.00 0.00 ? 16 SER A HB2  2  
ATOM 2021  H HB3  . SER A 1 20 ? -12.547 -0.239  11.107  1.00 0.00 ? 16 SER A HB3  2  
ATOM 2022  H HG   . SER A 1 20 ? -13.616 -2.730  11.564  1.00 0.00 ? 16 SER A HG   2  
ATOM 2023  N N    . GLU A 1 21 ? -11.356 -3.760  9.367   1.00 0.00 ? 17 GLU A N    2  
ATOM 2024  C CA   . GLU A 1 21 ? -10.424 -4.875  9.249   1.00 0.00 ? 17 GLU A CA   2  
ATOM 2025  C C    . GLU A 1 21 ? -9.805  -4.912  7.859   1.00 0.00 ? 17 GLU A C    2  
ATOM 2026  O O    . GLU A 1 21 ? -8.650  -5.287  7.687   1.00 0.00 ? 17 GLU A O    2  
ATOM 2027  C CB   . GLU A 1 21 ? -11.143 -6.194  9.519   1.00 0.00 ? 17 GLU A CB   2  
ATOM 2028  C CG   . GLU A 1 21 ? -11.547 -6.389  10.969  1.00 0.00 ? 17 GLU A CG   2  
ATOM 2029  C CD   . GLU A 1 21 ? -12.590 -7.473  11.130  1.00 0.00 ? 17 GLU A CD   2  
ATOM 2030  O OE1  . GLU A 1 21 ? -13.782 -7.179  10.916  1.00 0.00 ? 17 GLU A OE1  2  
ATOM 2031  O OE2  . GLU A 1 21 ? -12.224 -8.618  11.468  1.00 0.00 ? 17 GLU A OE2  2  
ATOM 2032  H H    . GLU A 1 21 ? -12.303 -3.950  9.524   1.00 0.00 ? 17 GLU A H    2  
ATOM 2033  H HA   . GLU A 1 21 ? -9.642  -4.740  9.981   1.00 0.00 ? 17 GLU A HA   2  
ATOM 2034  H HB2  . GLU A 1 21 ? -12.035 -6.230  8.913   1.00 0.00 ? 17 GLU A HB2  2  
ATOM 2035  H HB3  . GLU A 1 21 ? -10.493 -7.007  9.236   1.00 0.00 ? 17 GLU A HB3  2  
ATOM 2036  H HG2  . GLU A 1 21 ? -10.674 -6.662  11.541  1.00 0.00 ? 17 GLU A HG2  2  
ATOM 2037  H HG3  . GLU A 1 21 ? -11.950 -5.460  11.346  1.00 0.00 ? 17 GLU A HG3  2  
ATOM 2038  N N    . TRP A 1 22 ? -10.582 -4.518  6.870   1.00 0.00 ? 18 TRP A N    2  
ATOM 2039  C CA   . TRP A 1 22 ? -10.117 -4.504  5.496   1.00 0.00 ? 18 TRP A CA   2  
ATOM 2040  C C    . TRP A 1 22 ? -9.103  -3.380  5.273   1.00 0.00 ? 18 TRP A C    2  
ATOM 2041  O O    . TRP A 1 22 ? -8.061  -3.585  4.654   1.00 0.00 ? 18 TRP A O    2  
ATOM 2042  C CB   . TRP A 1 22 ? -11.312 -4.354  4.548   1.00 0.00 ? 18 TRP A CB   2  
ATOM 2043  C CG   . TRP A 1 22 ? -10.932 -4.246  3.104   1.00 0.00 ? 18 TRP A CG   2  
ATOM 2044  C CD1  . TRP A 1 22 ? -10.522 -5.257  2.287   1.00 0.00 ? 18 TRP A CD1  2  
ATOM 2045  C CD2  . TRP A 1 22 ? -10.931 -3.057  2.309   1.00 0.00 ? 18 TRP A CD2  2  
ATOM 2046  N NE1  . TRP A 1 22 ? -10.264 -4.770  1.030   1.00 0.00 ? 18 TRP A NE1  2  
ATOM 2047  C CE2  . TRP A 1 22 ? -10.504 -3.419  1.020   1.00 0.00 ? 18 TRP A CE2  2  
ATOM 2048  C CE3  . TRP A 1 22 ? -11.247 -1.722  2.564   1.00 0.00 ? 18 TRP A CE3  2  
ATOM 2049  C CZ2  . TRP A 1 22 ? -10.386 -2.492  -0.012  1.00 0.00 ? 18 TRP A CZ2  2  
ATOM 2050  C CZ3  . TRP A 1 22 ? -11.130 -0.802  1.540   1.00 0.00 ? 18 TRP A CZ3  2  
ATOM 2051  C CH2  . TRP A 1 22 ? -10.702 -1.190  0.266   1.00 0.00 ? 18 TRP A CH2  2  
ATOM 2052  H H    . TRP A 1 22 ? -11.499 -4.230  7.069   1.00 0.00 ? 18 TRP A H    2  
ATOM 2053  H HA   . TRP A 1 22 ? -9.634  -5.448  5.302   1.00 0.00 ? 18 TRP A HA   2  
ATOM 2054  H HB2  . TRP A 1 22 ? -11.957 -5.213  4.657   1.00 0.00 ? 18 TRP A HB2  2  
ATOM 2055  H HB3  . TRP A 1 22 ? -11.863 -3.462  4.816   1.00 0.00 ? 18 TRP A HB3  2  
ATOM 2056  H HD1  . TRP A 1 22 ? -10.422 -6.287  2.596   1.00 0.00 ? 18 TRP A HD1  2  
ATOM 2057  H HE1  . TRP A 1 22 ? -9.956  -5.304  0.263   1.00 0.00 ? 18 TRP A HE1  2  
ATOM 2058  H HE3  . TRP A 1 22 ? -11.581 -1.404  3.541   1.00 0.00 ? 18 TRP A HE3  2  
ATOM 2059  H HZ2  . TRP A 1 22 ? -10.056 -2.777  -0.999  1.00 0.00 ? 18 TRP A HZ2  2  
ATOM 2060  H HZ3  . TRP A 1 22 ? -11.370 0.237   1.721   1.00 0.00 ? 18 TRP A HZ3  2  
ATOM 2061  H HH2  . TRP A 1 22 ? -10.624 -0.437  -0.504  1.00 0.00 ? 18 TRP A HH2  2  
ATOM 2062  N N    . LEU A 1 23 ? -9.402  -2.205  5.806   1.00 0.00 ? 19 LEU A N    2  
ATOM 2063  C CA   . LEU A 1 23 ? -8.527  -1.052  5.647   1.00 0.00 ? 19 LEU A CA   2  
ATOM 2064  C C    . LEU A 1 23 ? -7.229  -1.199  6.442   1.00 0.00 ? 19 LEU A C    2  
ATOM 2065  O O    . LEU A 1 23 ? -6.180  -0.704  6.016   1.00 0.00 ? 19 LEU A O    2  
ATOM 2066  C CB   . LEU A 1 23 ? -9.260  0.232   6.040   1.00 0.00 ? 19 LEU A CB   2  
ATOM 2067  C CG   . LEU A 1 23 ? -10.056 0.884   4.906   1.00 0.00 ? 19 LEU A CG   2  
ATOM 2068  C CD1  . LEU A 1 23 ? -11.023 1.927   5.442   1.00 0.00 ? 19 LEU A CD1  2  
ATOM 2069  C CD2  . LEU A 1 23 ? -9.113  1.504   3.887   1.00 0.00 ? 19 LEU A CD2  2  
ATOM 2070  H H    . LEU A 1 23 ? -10.240 -2.111  6.315   1.00 0.00 ? 19 LEU A H    2  
ATOM 2071  H HA   . LEU A 1 23 ? -8.273  -0.987  4.600   1.00 0.00 ? 19 LEU A HA   2  
ATOM 2072  H HB2  . LEU A 1 23 ? -9.941  0.001   6.848   1.00 0.00 ? 19 LEU A HB2  2  
ATOM 2073  H HB3  . LEU A 1 23 ? -8.532  0.944   6.394   1.00 0.00 ? 19 LEU A HB3  2  
ATOM 2074  H HG   . LEU A 1 23 ? -10.634 0.125   4.402   1.00 0.00 ? 19 LEU A HG   2  
ATOM 2075  H HD11 . LEU A 1 23 ? -11.592 2.342   4.623   1.00 0.00 ? 19 LEU A HD11 2  
ATOM 2076  H HD12 . LEU A 1 23 ? -10.472 2.716   5.932   1.00 0.00 ? 19 LEU A HD12 2  
ATOM 2077  H HD13 . LEU A 1 23 ? -11.697 1.465   6.148   1.00 0.00 ? 19 LEU A HD13 2  
ATOM 2078  H HD21 . LEU A 1 23 ? -8.467  0.739   3.482   1.00 0.00 ? 19 LEU A HD21 2  
ATOM 2079  H HD22 . LEU A 1 23 ? -8.513  2.265   4.365   1.00 0.00 ? 19 LEU A HD22 2  
ATOM 2080  H HD23 . LEU A 1 23 ? -9.688  1.949   3.088   1.00 0.00 ? 19 LEU A HD23 2  
ATOM 2081  N N    . GLU A 1 24 ? -7.284  -1.877  7.587   1.00 0.00 ? 20 GLU A N    2  
ATOM 2082  C CA   . GLU A 1 24 ? -6.086  -2.059  8.403   1.00 0.00 ? 20 GLU A CA   2  
ATOM 2083  C C    . GLU A 1 24 ? -5.112  -3.028  7.737   1.00 0.00 ? 20 GLU A C    2  
ATOM 2084  O O    . GLU A 1 24 ? -3.901  -2.914  7.931   1.00 0.00 ? 20 GLU A O    2  
ATOM 2085  C CB   . GLU A 1 24 ? -6.431  -2.515  9.830   1.00 0.00 ? 20 GLU A CB   2  
ATOM 2086  C CG   . GLU A 1 24 ? -7.193  -3.827  9.905   1.00 0.00 ? 20 GLU A CG   2  
ATOM 2087  C CD   . GLU A 1 24 ? -6.296  -5.036  10.091  1.00 0.00 ? 20 GLU A CD   2  
ATOM 2088  O OE1  . GLU A 1 24 ? -5.592  -5.105  11.121  1.00 0.00 ? 20 GLU A OE1  2  
ATOM 2089  O OE2  . GLU A 1 24 ? -6.300  -5.926  9.212   1.00 0.00 ? 20 GLU A OE2  2  
ATOM 2090  H H    . GLU A 1 24 ? -8.142  -2.244  7.898   1.00 0.00 ? 20 GLU A H    2  
ATOM 2091  H HA   . GLU A 1 24 ? -5.597  -1.096  8.467   1.00 0.00 ? 20 GLU A HA   2  
ATOM 2092  H HB2  . GLU A 1 24 ? -5.514  -2.627  10.388  1.00 0.00 ? 20 GLU A HB2  2  
ATOM 2093  H HB3  . GLU A 1 24 ? -7.031  -1.749  10.302  1.00 0.00 ? 20 GLU A HB3  2  
ATOM 2094  H HG2  . GLU A 1 24 ? -7.880  -3.780  10.733  1.00 0.00 ? 20 GLU A HG2  2  
ATOM 2095  H HG3  . GLU A 1 24 ? -7.748  -3.951  8.987   1.00 0.00 ? 20 GLU A HG3  2  
ATOM 2096  N N    . SER A 1 25 ? -5.641  -3.981  6.973   1.00 0.00 ? 21 SER A N    2  
ATOM 2097  C CA   . SER A 1 25 ? -4.806  -4.947  6.266   1.00 0.00 ? 21 SER A CA   2  
ATOM 2098  C C    . SER A 1 25 ? -3.791  -4.245  5.366   1.00 0.00 ? 21 SER A C    2  
ATOM 2099  O O    . SER A 1 25 ? -2.624  -4.626  5.321   1.00 0.00 ? 21 SER A O    2  
ATOM 2100  C CB   . SER A 1 25 ? -5.679  -5.889  5.439   1.00 0.00 ? 21 SER A CB   2  
ATOM 2101  O OG   . SER A 1 25 ? -6.680  -6.482  6.244   1.00 0.00 ? 21 SER A OG   2  
ATOM 2102  H H    . SER A 1 25 ? -6.615  -4.083  6.937   1.00 0.00 ? 21 SER A H    2  
ATOM 2103  H HA   . SER A 1 25 ? -4.272  -5.525  7.008   1.00 0.00 ? 21 SER A HA   2  
ATOM 2104  H HB2  . SER A 1 25 ? -6.153  -5.334  4.639   1.00 0.00 ? 21 SER A HB2  2  
ATOM 2105  H HB3  . SER A 1 25 ? -5.066  -6.673  5.020   1.00 0.00 ? 21 SER A HB3  2  
ATOM 2106  H HG   . SER A 1 25 ? -6.585  -6.163  7.154   1.00 0.00 ? 21 SER A HG   2  
ATOM 2107  N N    . ILE A 1 26 ? -4.236  -3.204  4.671   1.00 0.00 ? 22 ILE A N    2  
ATOM 2108  C CA   . ILE A 1 26 ? -3.362  -2.441  3.783   1.00 0.00 ? 22 ILE A CA   2  
ATOM 2109  C C    . ILE A 1 26 ? -2.686  -1.317  4.551   1.00 0.00 ? 22 ILE A C    2  
ATOM 2110  O O    . ILE A 1 26 ? -1.875  -0.572  4.002   1.00 0.00 ? 22 ILE A O    2  
ATOM 2111  C CB   . ILE A 1 26 ? -4.136  -1.833  2.596   1.00 0.00 ? 22 ILE A CB   2  
ATOM 2112  C CG1  . ILE A 1 26 ? -5.645  -2.009  2.801   1.00 0.00 ? 22 ILE A CG1  2  
ATOM 2113  C CG2  . ILE A 1 26 ? -3.684  -2.468  1.291   1.00 0.00 ? 22 ILE A CG2  2  
ATOM 2114  C CD1  . ILE A 1 26 ? -6.499  -1.282  1.787   1.00 0.00 ? 22 ILE A CD1  2  
ATOM 2115  H H    . ILE A 1 26 ? -5.172  -2.924  4.759   1.00 0.00 ? 22 ILE A H    2  
ATOM 2116  H HA   . ILE A 1 26 ? -2.604  -3.108  3.396   1.00 0.00 ? 22 ILE A HA   2  
ATOM 2117  H HB   . ILE A 1 26 ? -3.905  -0.778  2.548   1.00 0.00 ? 22 ILE A HB   2  
ATOM 2118  H HG12 . ILE A 1 26 ? -5.885  -3.058  2.742   1.00 0.00 ? 22 ILE A HG12 2  
ATOM 2119  H HG13 . ILE A 1 26 ? -5.909  -1.641  3.782   1.00 0.00 ? 22 ILE A HG13 2  
ATOM 2120  H HG21 . ILE A 1 26 ? -4.043  -3.485  1.245   1.00 0.00 ? 22 ILE A HG21 2  
ATOM 2121  H HG22 . ILE A 1 26 ? -2.605  -2.464  1.242   1.00 0.00 ? 22 ILE A HG22 2  
ATOM 2122  H HG23 . ILE A 1 26 ? -4.084  -1.907  0.459   1.00 0.00 ? 22 ILE A HG23 2  
ATOM 2123  H HD11 . ILE A 1 26 ? -6.278  -0.227  1.819   1.00 0.00 ? 22 ILE A HD11 2  
ATOM 2124  H HD12 . ILE A 1 26 ? -7.542  -1.439  2.019   1.00 0.00 ? 22 ILE A HD12 2  
ATOM 2125  H HD13 . ILE A 1 26 ? -6.286  -1.665  0.802   1.00 0.00 ? 22 ILE A HD13 2  
ATOM 2126  N N    . LYS A 1 27 ? -3.052  -1.203  5.825   1.00 0.00 ? 23 LYS A N    2  
ATOM 2127  C CA   . LYS A 1 27 ? -2.510  -0.191  6.723   1.00 0.00 ? 23 LYS A CA   2  
ATOM 2128  C C    . LYS A 1 27 ? -2.877  1.220   6.274   1.00 0.00 ? 23 LYS A C    2  
ATOM 2129  O O    . LYS A 1 27 ? -2.195  2.182   6.606   1.00 0.00 ? 23 LYS A O    2  
ATOM 2130  C CB   . LYS A 1 27 ? -0.993  -0.348  6.850   1.00 0.00 ? 23 LYS A CB   2  
ATOM 2131  C CG   . LYS A 1 27 ? -0.582  -1.630  7.554   1.00 0.00 ? 23 LYS A CG   2  
ATOM 2132  C CD   . LYS A 1 27 ? -1.040  -1.638  9.004   1.00 0.00 ? 23 LYS A CD   2  
ATOM 2133  C CE   . LYS A 1 27 ? -0.873  -3.008  9.634   1.00 0.00 ? 23 LYS A CE   2  
ATOM 2134  N NZ   . LYS A 1 27 ? 0.504   -3.228  10.148  1.00 0.00 ? 23 LYS A NZ   2  
ATOM 2135  H H    . LYS A 1 27 ? -3.708  -1.839  6.179   1.00 0.00 ? 23 LYS A H    2  
ATOM 2136  H HA   . LYS A 1 27 ? -2.954  -0.358  7.692   1.00 0.00 ? 23 LYS A HA   2  
ATOM 2137  H HB2  . LYS A 1 27 ? -0.559  -0.350  5.860   1.00 0.00 ? 23 LYS A HB2  2  
ATOM 2138  H HB3  . LYS A 1 27 ? -0.598  0.486   7.405   1.00 0.00 ? 23 LYS A HB3  2  
ATOM 2139  H HG2  . LYS A 1 27 ? -1.029  -2.470  7.041   1.00 0.00 ? 23 LYS A HG2  2  
ATOM 2140  H HG3  . LYS A 1 27 ? 0.494   -1.720  7.524   1.00 0.00 ? 23 LYS A HG3  2  
ATOM 2141  H HD2  . LYS A 1 27 ? -0.455  -0.921  9.561   1.00 0.00 ? 23 LYS A HD2  2  
ATOM 2142  H HD3  . LYS A 1 27 ? -2.082  -1.359  9.043   1.00 0.00 ? 23 LYS A HD3  2  
ATOM 2143  H HE2  . LYS A 1 27 ? -1.569  -3.100  10.453  1.00 0.00 ? 23 LYS A HE2  2  
ATOM 2144  H HE3  . LYS A 1 27 ? -1.095  -3.760  8.890   1.00 0.00 ? 23 LYS A HE3  2  
ATOM 2145  H HZ1  . LYS A 1 27 ? 0.640   -2.710  11.038  1.00 0.00 ? 23 LYS A HZ1  2  
ATOM 2146  H HZ2  . LYS A 1 27 ? 1.212   -2.893  9.456   1.00 0.00 ? 23 LYS A HZ2  2  
ATOM 2147  H HZ3  . LYS A 1 27 ? 0.660   -4.248  10.325  1.00 0.00 ? 23 LYS A HZ3  2  
ATOM 2148  N N    . MET A 1 28 ? -3.996  1.337   5.569   1.00 0.00 ? 24 MET A N    2  
ATOM 2149  C CA   . MET A 1 28 ? -4.475  2.627   5.084   1.00 0.00 ? 24 MET A CA   2  
ATOM 2150  C C    . MET A 1 28 ? -5.712  3.002   5.889   1.00 0.00 ? 24 MET A C    2  
ATOM 2151  O O    . MET A 1 28 ? -6.627  3.661   5.399   1.00 0.00 ? 24 MET A O    2  
ATOM 2152  C CB   . MET A 1 28 ? -4.822  2.549   3.589   1.00 0.00 ? 24 MET A CB   2  
ATOM 2153  C CG   . MET A 1 28 ? -3.820  1.765   2.747   1.00 0.00 ? 24 MET A CG   2  
ATOM 2154  S SD   . MET A 1 28 ? -2.544  2.800   2.004   1.00 0.00 ? 24 MET A SD   2  
ATOM 2155  C CE   . MET A 1 28 ? -1.358  2.899   3.344   1.00 0.00 ? 24 MET A CE   2  
ATOM 2156  H H    . MET A 1 28 ? -4.545  0.538   5.403   1.00 0.00 ? 24 MET A H    2  
ATOM 2157  H HA   . MET A 1 28 ? -3.702  3.362   5.246   1.00 0.00 ? 24 MET A HA   2  
ATOM 2158  H HB2  . MET A 1 28 ? -5.787  2.077   3.484   1.00 0.00 ? 24 MET A HB2  2  
ATOM 2159  H HB3  . MET A 1 28 ? -4.879  3.552   3.196   1.00 0.00 ? 24 MET A HB3  2  
ATOM 2160  H HG2  . MET A 1 28 ? -3.340  1.033   3.377   1.00 0.00 ? 24 MET A HG2  2  
ATOM 2161  H HG3  . MET A 1 28 ? -4.356  1.258   1.958   1.00 0.00 ? 24 MET A HG3  2  
ATOM 2162  H HE1  . MET A 1 28 ? -1.803  3.414   4.183   1.00 0.00 ? 24 MET A HE1  2  
ATOM 2163  H HE2  . MET A 1 28 ? -0.484  3.440   3.012   1.00 0.00 ? 24 MET A HE2  2  
ATOM 2164  H HE3  . MET A 1 28 ? -1.070  1.902   3.647   1.00 0.00 ? 24 MET A HE3  2  
ATOM 2165  N N    . GLN A 1 29 ? -5.702  2.577   7.148   1.00 0.00 ? 25 GLN A N    2  
ATOM 2166  C CA   . GLN A 1 29 ? -6.815  2.784   8.065   1.00 0.00 ? 25 GLN A CA   2  
ATOM 2167  C C    . GLN A 1 29 ? -7.107  4.252   8.339   1.00 0.00 ? 25 GLN A C    2  
ATOM 2168  O O    . GLN A 1 29 ? -8.217  4.587   8.744   1.00 0.00 ? 25 GLN A O    2  
ATOM 2169  C CB   . GLN A 1 29 ? -6.542  2.069   9.387   1.00 0.00 ? 25 GLN A CB   2  
ATOM 2170  C CG   . GLN A 1 29 ? -5.347  2.627   10.139  1.00 0.00 ? 25 GLN A CG   2  
ATOM 2171  C CD   . GLN A 1 29 ? -5.302  2.169   11.579  1.00 0.00 ? 25 GLN A CD   2  
ATOM 2172  O OE1  . GLN A 1 29 ? -6.335  1.954   12.210  1.00 0.00 ? 25 GLN A OE1  2  
ATOM 2173  N NE2  . GLN A 1 29 ? -4.101  2.023   12.108  1.00 0.00 ? 25 GLN A NE2  2  
ATOM 2174  H H    . GLN A 1 29 ? -4.906  2.107   7.474   1.00 0.00 ? 25 GLN A H    2  
ATOM 2175  H HA   . GLN A 1 29 ? -7.692  2.340   7.616   1.00 0.00 ? 25 GLN A HA   2  
ATOM 2176  H HB2  . GLN A 1 29 ? -7.415  2.157   10.018  1.00 0.00 ? 25 GLN A HB2  2  
ATOM 2177  H HB3  . GLN A 1 29 ? -6.359  1.024   9.187   1.00 0.00 ? 25 GLN A HB3  2  
ATOM 2178  H HG2  . GLN A 1 29 ? -4.444  2.299   9.646   1.00 0.00 ? 25 GLN A HG2  2  
ATOM 2179  H HG3  . GLN A 1 29 ? -5.393  3.708   10.119  1.00 0.00 ? 25 GLN A HG3  2  
ATOM 2180  H HE21 . GLN A 1 29 ? -3.320  2.224   11.550  1.00 0.00 ? 25 GLN A HE21 2  
ATOM 2181  H HE22 . GLN A 1 29 ? -4.038  1.708   13.035  1.00 0.00 ? 25 GLN A HE22 2  
ATOM 2182  N N    . GLN A 1 30 ? -6.147  5.140   8.124   1.00 0.00 ? 26 GLN A N    2  
ATOM 2183  C CA   . GLN A 1 30 ? -6.361  6.555   8.383   1.00 0.00 ? 26 GLN A CA   2  
ATOM 2184  C C    . GLN A 1 30 ? -7.170  7.219   7.265   1.00 0.00 ? 26 GLN A C    2  
ATOM 2185  O O    . GLN A 1 30 ? -7.199  8.446   7.153   1.00 0.00 ? 26 GLN A O    2  
ATOM 2186  C CB   . GLN A 1 30 ? -5.002  7.263   8.550   1.00 0.00 ? 26 GLN A CB   2  
ATOM 2187  C CG   . GLN A 1 30 ? -4.068  7.156   7.341   1.00 0.00 ? 26 GLN A CG   2  
ATOM 2188  C CD   . GLN A 1 30 ? -3.122  5.961   7.409   1.00 0.00 ? 26 GLN A CD   2  
ATOM 2189  O OE1  . GLN A 1 30 ? -3.470  4.908   7.943   1.00 0.00 ? 26 GLN A OE1  2  
ATOM 2190  N NE2  . GLN A 1 30 ? -1.924  6.121   6.865   1.00 0.00 ? 26 GLN A NE2  2  
ATOM 2191  H H    . GLN A 1 30 ? -5.249  4.892   7.804   1.00 0.00 ? 26 GLN A H    2  
ATOM 2192  H HA   . GLN A 1 30 ? -6.911  6.639   9.308   1.00 0.00 ? 26 GLN A HA   2  
ATOM 2193  H HB2  . GLN A 1 30 ? -5.181  8.310   8.741   1.00 0.00 ? 26 GLN A HB2  2  
ATOM 2194  H HB3  . GLN A 1 30 ? -4.496  6.836   9.403   1.00 0.00 ? 26 GLN A HB3  2  
ATOM 2195  H HG2  . GLN A 1 30 ? -4.670  7.061   6.449   1.00 0.00 ? 26 GLN A HG2  2  
ATOM 2196  H HG3  . GLN A 1 30 ? -3.479  8.059   7.279   1.00 0.00 ? 26 GLN A HG3  2  
ATOM 2197  H HE21 . GLN A 1 30 ? -1.714  6.986   6.449   1.00 0.00 ? 26 GLN A HE21 2  
ATOM 2198  H HE22 . GLN A 1 30 ? -1.287  5.368   6.901   1.00 0.00 ? 26 GLN A HE22 2  
ATOM 2199  N N    . TYR A 1 31 ? -7.813  6.409   6.433   1.00 0.00 ? 27 TYR A N    2  
ATOM 2200  C CA   . TYR A 1 31 ? -8.622  6.917   5.337   1.00 0.00 ? 27 TYR A CA   2  
ATOM 2201  C C    . TYR A 1 31 ? -10.073 6.481   5.486   1.00 0.00 ? 27 TYR A C    2  
ATOM 2202  O O    . TYR A 1 31 ? -10.911 6.784   4.632   1.00 0.00 ? 27 TYR A O    2  
ATOM 2203  C CB   . TYR A 1 31 ? -8.057  6.436   4.005   1.00 0.00 ? 27 TYR A CB   2  
ATOM 2204  C CG   . TYR A 1 31 ? -6.737  7.079   3.661   1.00 0.00 ? 27 TYR A CG   2  
ATOM 2205  C CD1  . TYR A 1 31 ? -6.693  8.348   3.103   1.00 0.00 ? 27 TYR A CD1  2  
ATOM 2206  C CD2  . TYR A 1 31 ? -5.536  6.427   3.907   1.00 0.00 ? 27 TYR A CD2  2  
ATOM 2207  C CE1  . TYR A 1 31 ? -5.489  8.951   2.797   1.00 0.00 ? 27 TYR A CE1  2  
ATOM 2208  C CE2  . TYR A 1 31 ? -4.329  7.020   3.604   1.00 0.00 ? 27 TYR A CE2  2  
ATOM 2209  C CZ   . TYR A 1 31 ? -4.309  8.283   3.049   1.00 0.00 ? 27 TYR A CZ   2  
ATOM 2210  O OH   . TYR A 1 31 ? -3.105  8.882   2.750   1.00 0.00 ? 27 TYR A OH   2  
ATOM 2211  H H    . TYR A 1 31 ? -7.732  5.439   6.557   1.00 0.00 ? 27 TYR A H    2  
ATOM 2212  H HA   . TYR A 1 31 ? -8.580  7.997   5.367   1.00 0.00 ? 27 TYR A HA   2  
ATOM 2213  H HB2  . TYR A 1 31 ? -7.905  5.368   4.049   1.00 0.00 ? 27 TYR A HB2  2  
ATOM 2214  H HB3  . TYR A 1 31 ? -8.757  6.665   3.215   1.00 0.00 ? 27 TYR A HB3  2  
ATOM 2215  H HD1  . TYR A 1 31 ? -7.620  8.867   2.905   1.00 0.00 ? 27 TYR A HD1  2  
ATOM 2216  H HD2  . TYR A 1 31 ? -5.556  5.439   4.339   1.00 0.00 ? 27 TYR A HD2  2  
ATOM 2217  H HE1  . TYR A 1 31 ? -5.476  9.939   2.364   1.00 0.00 ? 27 TYR A HE1  2  
ATOM 2218  H HE2  . TYR A 1 31 ? -3.405  6.496   3.802   1.00 0.00 ? 27 TYR A HE2  2  
ATOM 2219  H HH   . TYR A 1 31 ? -2.442  8.199   2.575   1.00 0.00 ? 27 TYR A HH   2  
ATOM 2220  N N    . THR A 1 32 ? -10.367 5.792   6.583   1.00 0.00 ? 28 THR A N    2  
ATOM 2221  C CA   . THR A 1 32 ? -11.716 5.308   6.855   1.00 0.00 ? 28 THR A CA   2  
ATOM 2222  C C    . THR A 1 32 ? -12.684 6.479   6.988   1.00 0.00 ? 28 THR A C    2  
ATOM 2223  O O    . THR A 1 32 ? -13.861 6.381   6.627   1.00 0.00 ? 28 THR A O    2  
ATOM 2224  C CB   . THR A 1 32 ? -11.744 4.462   8.142   1.00 0.00 ? 28 THR A CB   2  
ATOM 2225  O OG1  . THR A 1 32 ? -10.617 3.575   8.163   1.00 0.00 ? 28 THR A OG1  2  
ATOM 2226  C CG2  . THR A 1 32 ? -13.026 3.653   8.231   1.00 0.00 ? 28 THR A CG2  2  
ATOM 2227  H H    . THR A 1 32 ? -9.659  5.609   7.237   1.00 0.00 ? 28 THR A H    2  
ATOM 2228  H HA   . THR A 1 32 ? -12.024 4.685   6.028   1.00 0.00 ? 28 THR A HA   2  
ATOM 2229  H HB   . THR A 1 32 ? -11.689 5.123   8.994   1.00 0.00 ? 28 THR A HB   2  
ATOM 2230  H HG1  . THR A 1 32 ? -9.931  3.936   8.740   1.00 0.00 ? 28 THR A HG1  2  
ATOM 2231  H HG21 . THR A 1 32 ? -13.080 2.971   7.395   1.00 0.00 ? 28 THR A HG21 2  
ATOM 2232  H HG22 . THR A 1 32 ? -13.876 4.320   8.205   1.00 0.00 ? 28 THR A HG22 2  
ATOM 2233  H HG23 . THR A 1 32 ? -13.037 3.092   9.153   1.00 0.00 ? 28 THR A HG23 2  
ATOM 2234  N N    . GLU A 1 33 ? -12.160 7.594   7.474   1.00 0.00 ? 29 GLU A N    2  
ATOM 2235  C CA   . GLU A 1 33 ? -12.946 8.803   7.660   1.00 0.00 ? 29 GLU A CA   2  
ATOM 2236  C C    . GLU A 1 33 ? -13.550 9.253   6.335   1.00 0.00 ? 29 GLU A C    2  
ATOM 2237  O O    . GLU A 1 33 ? -14.732 9.590   6.261   1.00 0.00 ? 29 GLU A O    2  
ATOM 2238  C CB   . GLU A 1 33 ? -12.080 9.921   8.245   1.00 0.00 ? 29 GLU A CB   2  
ATOM 2239  C CG   . GLU A 1 33 ? -11.533 9.605   9.627   1.00 0.00 ? 29 GLU A CG   2  
ATOM 2240  C CD   . GLU A 1 33 ? -10.137 9.013   9.591   1.00 0.00 ? 29 GLU A CD   2  
ATOM 2241  O OE1  . GLU A 1 33 ? -9.969  7.903   9.043   1.00 0.00 ? 29 GLU A OE1  2  
ATOM 2242  O OE2  . GLU A 1 33 ? -9.206  9.657   10.119  1.00 0.00 ? 29 GLU A OE2  2  
ATOM 2243  H H    . GLU A 1 33 ? -11.200 7.599   7.701   1.00 0.00 ? 29 GLU A H    2  
ATOM 2244  H HA   . GLU A 1 33 ? -13.745 8.581   8.350   1.00 0.00 ? 29 GLU A HA   2  
ATOM 2245  H HB2  . GLU A 1 33 ? -11.247 10.099  7.582   1.00 0.00 ? 29 GLU A HB2  2  
ATOM 2246  H HB3  . GLU A 1 33 ? -12.674 10.820  8.313   1.00 0.00 ? 29 GLU A HB3  2  
ATOM 2247  H HG2  . GLU A 1 33 ? -11.504 10.517  10.204  1.00 0.00 ? 29 GLU A HG2  2  
ATOM 2248  H HG3  . GLU A 1 33 ? -12.194 8.900   10.108  1.00 0.00 ? 29 GLU A HG3  2  
ATOM 2249  N N    . HIS A 1 34 ? -12.730 9.245   5.289   1.00 0.00 ? 30 HIS A N    2  
ATOM 2250  C CA   . HIS A 1 34 ? -13.167 9.647   3.959   1.00 0.00 ? 30 HIS A CA   2  
ATOM 2251  C C    . HIS A 1 34 ? -14.110 8.607   3.359   1.00 0.00 ? 30 HIS A C    2  
ATOM 2252  O O    . HIS A 1 34 ? -15.084 8.953   2.690   1.00 0.00 ? 30 HIS A O    2  
ATOM 2253  C CB   . HIS A 1 34 ? -11.957 9.838   3.044   1.00 0.00 ? 30 HIS A CB   2  
ATOM 2254  C CG   . HIS A 1 34 ? -10.957 10.823  3.565   1.00 0.00 ? 30 HIS A CG   2  
ATOM 2255  N ND1  . HIS A 1 34 ? -9.712  10.478  4.046   1.00 0.00 ? 30 HIS A ND1  2  
ATOM 2256  C CD2  . HIS A 1 34 ? -11.037 12.173  3.675   1.00 0.00 ? 30 HIS A CD2  2  
ATOM 2257  C CE1  . HIS A 1 34 ? -9.090  11.600  4.427   1.00 0.00 ? 30 HIS A CE1  2  
ATOM 2258  N NE2  . HIS A 1 34 ? -9.851  12.658  4.224   1.00 0.00 ? 30 HIS A NE2  2  
ATOM 2259  H H    . HIS A 1 34 ? -11.796 8.976   5.411   1.00 0.00 ? 30 HIS A H    2  
ATOM 2260  H HA   . HIS A 1 34 ? -13.692 10.586  4.047   1.00 0.00 ? 30 HIS A HA   2  
ATOM 2261  H HB2  . HIS A 1 34 ? -11.455 8.888   2.923   1.00 0.00 ? 30 HIS A HB2  2  
ATOM 2262  H HB3  . HIS A 1 34 ? -12.295 10.186  2.078   1.00 0.00 ? 30 HIS A HB3  2  
ATOM 2263  H HD1  . HIS A 1 34 ? -9.344  9.572   4.095   1.00 0.00 ? 30 HIS A HD1  2  
ATOM 2264  H HD2  . HIS A 1 34 ? -11.879 12.783  3.385   1.00 0.00 ? 30 HIS A HD2  2  
ATOM 2265  H HE1  . HIS A 1 34 ? -8.093  11.637  4.840   1.00 0.00 ? 30 HIS A HE1  2  
ATOM 2266  N N    . PHE A 1 35 ? -13.811 7.331   3.606   1.00 0.00 ? 31 PHE A N    2  
ATOM 2267  C CA   . PHE A 1 35 ? -14.635 6.232   3.105   1.00 0.00 ? 31 PHE A CA   2  
ATOM 2268  C C    . PHE A 1 35 ? -16.076 6.396   3.570   1.00 0.00 ? 31 PHE A C    2  
ATOM 2269  O O    . PHE A 1 35 ? -17.014 6.322   2.772   1.00 0.00 ? 31 PHE A O    2  
ATOM 2270  C CB   . PHE A 1 35 ? -14.092 4.887   3.599   1.00 0.00 ? 31 PHE A CB   2  
ATOM 2271  C CG   . PHE A 1 35 ? -13.115 4.223   2.670   1.00 0.00 ? 31 PHE A CG   2  
ATOM 2272  C CD1  . PHE A 1 35 ? -11.804 4.661   2.584   1.00 0.00 ? 31 PHE A CD1  2  
ATOM 2273  C CD2  . PHE A 1 35 ? -13.508 3.143   1.897   1.00 0.00 ? 31 PHE A CD2  2  
ATOM 2274  C CE1  . PHE A 1 35 ? -10.903 4.034   1.745   1.00 0.00 ? 31 PHE A CE1  2  
ATOM 2275  C CE2  . PHE A 1 35 ? -12.612 2.514   1.053   1.00 0.00 ? 31 PHE A CE2  2  
ATOM 2276  C CZ   . PHE A 1 35 ? -11.308 2.960   0.978   1.00 0.00 ? 31 PHE A CZ   2  
ATOM 2277  H H    . PHE A 1 35 ? -13.013 7.124   4.136   1.00 0.00 ? 31 PHE A H    2  
ATOM 2278  H HA   . PHE A 1 35 ? -14.608 6.253   2.025   1.00 0.00 ? 31 PHE A HA   2  
ATOM 2279  H HB2  . PHE A 1 35 ? -13.592 5.036   4.544   1.00 0.00 ? 31 PHE A HB2  2  
ATOM 2280  H HB3  . PHE A 1 35 ? -14.920 4.207   3.745   1.00 0.00 ? 31 PHE A HB3  2  
ATOM 2281  H HD1  . PHE A 1 35 ? -11.487 5.503   3.181   1.00 0.00 ? 31 PHE A HD1  2  
ATOM 2282  H HD2  . PHE A 1 35 ? -14.529 2.794   1.954   1.00 0.00 ? 31 PHE A HD2  2  
ATOM 2283  H HE1  . PHE A 1 35 ? -9.883  4.385   1.687   1.00 0.00 ? 31 PHE A HE1  2  
ATOM 2284  H HE2  . PHE A 1 35 ? -12.932 1.674   0.455   1.00 0.00 ? 31 PHE A HE2  2  
ATOM 2285  H HZ   . PHE A 1 35 ? -10.605 2.467   0.323   1.00 0.00 ? 31 PHE A HZ   2  
ATOM 2286  N N    . MET A 1 36 ? -16.239 6.658   4.861   1.00 0.00 ? 32 MET A N    2  
ATOM 2287  C CA   . MET A 1 36 ? -17.558 6.825   5.452   1.00 0.00 ? 32 MET A CA   2  
ATOM 2288  C C    . MET A 1 36 ? -18.277 8.045   4.889   1.00 0.00 ? 32 MET A C    2  
ATOM 2289  O O    . MET A 1 36 ? -19.495 8.020   4.709   1.00 0.00 ? 32 MET A O    2  
ATOM 2290  C CB   . MET A 1 36 ? -17.455 6.957   6.974   1.00 0.00 ? 32 MET A CB   2  
ATOM 2291  C CG   . MET A 1 36 ? -16.776 5.782   7.665   1.00 0.00 ? 32 MET A CG   2  
ATOM 2292  S SD   . MET A 1 36 ? -17.584 4.200   7.345   1.00 0.00 ? 32 MET A SD   2  
ATOM 2293  C CE   . MET A 1 36 ? -16.379 3.425   6.267   1.00 0.00 ? 32 MET A CE   2  
ATOM 2294  H H    . MET A 1 36 ? -15.446 6.738   5.439   1.00 0.00 ? 32 MET A H    2  
ATOM 2295  H HA   . MET A 1 36 ? -18.136 5.943   5.219   1.00 0.00 ? 32 MET A HA   2  
ATOM 2296  H HB2  . MET A 1 36 ? -16.891 7.849   7.201   1.00 0.00 ? 32 MET A HB2  2  
ATOM 2297  H HB3  . MET A 1 36 ? -18.450 7.061   7.380   1.00 0.00 ? 32 MET A HB3  2  
ATOM 2298  H HG2  . MET A 1 36 ? -15.757 5.722   7.317   1.00 0.00 ? 32 MET A HG2  2  
ATOM 2299  H HG3  . MET A 1 36 ? -16.780 5.963   8.729   1.00 0.00 ? 32 MET A HG3  2  
ATOM 2300  H HE1  . MET A 1 36 ? -15.464 3.251   6.813   1.00 0.00 ? 32 MET A HE1  2  
ATOM 2301  H HE2  . MET A 1 36 ? -16.180 4.073   5.427   1.00 0.00 ? 32 MET A HE2  2  
ATOM 2302  H HE3  . MET A 1 36 ? -16.769 2.483   5.908   1.00 0.00 ? 32 MET A HE3  2  
ATOM 2303  N N    . ALA A 1 37 ? -17.532 9.104   4.583   1.00 0.00 ? 33 ALA A N    2  
ATOM 2304  C CA   . ALA A 1 37 ? -18.128 10.329  4.064   1.00 0.00 ? 33 ALA A CA   2  
ATOM 2305  C C    . ALA A 1 37 ? -18.627 10.145  2.639   1.00 0.00 ? 33 ALA A C    2  
ATOM 2306  O O    . ALA A 1 37 ? -19.684 10.661  2.271   1.00 0.00 ? 33 ALA A O    2  
ATOM 2307  C CB   . ALA A 1 37 ? -17.123 11.465  4.118   1.00 0.00 ? 33 ALA A CB   2  
ATOM 2308  H H    . ALA A 1 37 ? -16.555 9.067   4.670   1.00 0.00 ? 33 ALA A H    2  
ATOM 2309  H HA   . ALA A 1 37 ? -18.963 10.591  4.699   1.00 0.00 ? 33 ALA A HA   2  
ATOM 2310  H HB1  . ALA A 1 37 ? -16.665 11.494  5.093   1.00 0.00 ? 33 ALA A HB1  2  
ATOM 2311  H HB2  . ALA A 1 37 ? -17.627 12.401  3.930   1.00 0.00 ? 33 ALA A HB2  2  
ATOM 2312  H HB3  . ALA A 1 37 ? -16.364 11.306  3.367   1.00 0.00 ? 33 ALA A HB3  2  
ATOM 2313  N N    . ALA A 1 38 ? -17.867 9.398   1.848   1.00 0.00 ? 34 ALA A N    2  
ATOM 2314  C CA   . ALA A 1 38 ? -18.222 9.142   0.457   1.00 0.00 ? 34 ALA A CA   2  
ATOM 2315  C C    . ALA A 1 38 ? -19.457 8.248   0.352   1.00 0.00 ? 34 ALA A C    2  
ATOM 2316  O O    . ALA A 1 38 ? -20.010 8.059   -0.730  1.00 0.00 ? 34 ALA A O    2  
ATOM 2317  C CB   . ALA A 1 38 ? -17.046 8.523   -0.288  1.00 0.00 ? 34 ALA A CB   2  
ATOM 2318  H H    . ALA A 1 38 ? -17.036 9.017   2.209   1.00 0.00 ? 34 ALA A H    2  
ATOM 2319  H HA   . ALA A 1 38 ? -18.444 10.094  -0.005  1.00 0.00 ? 34 ALA A HA   2  
ATOM 2320  H HB1  . ALA A 1 38 ? -16.139 9.053   -0.034  1.00 0.00 ? 34 ALA A HB1  2  
ATOM 2321  H HB2  . ALA A 1 38 ? -17.216 8.595   -1.351  1.00 0.00 ? 34 ALA A HB2  2  
ATOM 2322  H HB3  . ALA A 1 38 ? -16.947 7.484   -0.009  1.00 0.00 ? 34 ALA A HB3  2  
ATOM 2323  N N    . GLY A 1 39 ? -19.885 7.703   1.484   1.00 0.00 ? 35 GLY A N    2  
ATOM 2324  C CA   . GLY A 1 39 ? -21.059 6.855   1.503   1.00 0.00 ? 35 GLY A CA   2  
ATOM 2325  C C    . GLY A 1 39 ? -20.714 5.386   1.460   1.00 0.00 ? 35 GLY A C    2  
ATOM 2326  O O    . GLY A 1 39 ? -21.601 4.532   1.415   1.00 0.00 ? 35 GLY A O    2  
ATOM 2327  H H    . GLY A 1 39 ? -19.399 7.883   2.317   1.00 0.00 ? 35 GLY A H    2  
ATOM 2328  H HA2  . GLY A 1 39 ? -21.618 7.054   2.405   1.00 0.00 ? 35 GLY A HA2  2  
ATOM 2329  H HA3  . GLY A 1 39 ? -21.677 7.093   0.652   1.00 0.00 ? 35 GLY A HA3  2  
ATOM 2330  N N    . TYR A 1 40 ? -19.427 5.081   1.470   1.00 0.00 ? 36 TYR A N    2  
ATOM 2331  C CA   . TYR A 1 40 ? -18.977 3.702   1.438   1.00 0.00 ? 36 TYR A CA   2  
ATOM 2332  C C    . TYR A 1 40 ? -18.704 3.234   2.853   1.00 0.00 ? 36 TYR A C    2  
ATOM 2333  O O    . TYR A 1 40 ? -17.559 3.047   3.261   1.00 0.00 ? 36 TYR A O    2  
ATOM 2334  C CB   . TYR A 1 40 ? -17.734 3.568   0.553   1.00 0.00 ? 36 TYR A CB   2  
ATOM 2335  C CG   . TYR A 1 40 ? -17.919 4.210   -0.803  1.00 0.00 ? 36 TYR A CG   2  
ATOM 2336  C CD1  . TYR A 1 40 ? -19.029 3.911   -1.580  1.00 0.00 ? 36 TYR A CD1  2  
ATOM 2337  C CD2  . TYR A 1 40 ? -17.005 5.134   -1.293  1.00 0.00 ? 36 TYR A CD2  2  
ATOM 2338  C CE1  . TYR A 1 40 ? -19.227 4.514   -2.803  1.00 0.00 ? 36 TYR A CE1  2  
ATOM 2339  C CE2  . TYR A 1 40 ? -17.195 5.737   -2.522  1.00 0.00 ? 36 TYR A CE2  2  
ATOM 2340  C CZ   . TYR A 1 40 ? -18.310 5.424   -3.270  1.00 0.00 ? 36 TYR A CZ   2  
ATOM 2341  O OH   . TYR A 1 40 ? -18.522 6.038   -4.483  1.00 0.00 ? 36 TYR A OH   2  
ATOM 2342  H H    . TYR A 1 40 ? -18.753 5.793   1.507   1.00 0.00 ? 36 TYR A H    2  
ATOM 2343  H HA   . TYR A 1 40 ? -19.774 3.105   1.024   1.00 0.00 ? 36 TYR A HA   2  
ATOM 2344  H HB2  . TYR A 1 40 ? -16.896 4.047   1.039   1.00 0.00 ? 36 TYR A HB2  2  
ATOM 2345  H HB3  . TYR A 1 40 ? -17.514 2.522   0.402   1.00 0.00 ? 36 TYR A HB3  2  
ATOM 2346  H HD1  . TYR A 1 40 ? -19.747 3.194   -1.214  1.00 0.00 ? 36 TYR A HD1  2  
ATOM 2347  H HD2  . TYR A 1 40 ? -16.133 5.374   -0.705  1.00 0.00 ? 36 TYR A HD2  2  
ATOM 2348  H HE1  . TYR A 1 40 ? -20.097 4.267   -3.390  1.00 0.00 ? 36 TYR A HE1  2  
ATOM 2349  H HE2  . TYR A 1 40 ? -16.473 6.453   -2.890  1.00 0.00 ? 36 TYR A HE2  2  
ATOM 2350  H HH   . TYR A 1 40 ? -17.669 6.194   -4.928  1.00 0.00 ? 36 TYR A HH   2  
ATOM 2351  N N    . THR A 1 41 ? -19.783 3.081   3.605   1.00 0.00 ? 37 THR A N    2  
ATOM 2352  C CA   . THR A 1 41 ? -19.714 2.666   4.990   1.00 0.00 ? 37 THR A CA   2  
ATOM 2353  C C    . THR A 1 41 ? -19.473 1.166   5.122   1.00 0.00 ? 37 THR A C    2  
ATOM 2354  O O    . THR A 1 41 ? -18.413 0.741   5.565   1.00 0.00 ? 37 THR A O    2  
ATOM 2355  C CB   . THR A 1 41 ? -21.018 3.040   5.710   1.00 0.00 ? 37 THR A CB   2  
ATOM 2356  O OG1  . THR A 1 41 ? -22.131 2.829   4.827   1.00 0.00 ? 37 THR A OG1  2  
ATOM 2357  C CG2  . THR A 1 41 ? -20.991 4.494   6.158   1.00 0.00 ? 37 THR A CG2  2  
ATOM 2358  H H    . THR A 1 41 ? -20.664 3.253   3.210   1.00 0.00 ? 37 THR A H    2  
ATOM 2359  H HA   . THR A 1 41 ? -18.902 3.199   5.461   1.00 0.00 ? 37 THR A HA   2  
ATOM 2360  H HB   . THR A 1 41 ? -21.129 2.409   6.579   1.00 0.00 ? 37 THR A HB   2  
ATOM 2361  H HG1  . THR A 1 41 ? -22.765 3.552   4.927   1.00 0.00 ? 37 THR A HG1  2  
ATOM 2362  H HG21 . THR A 1 41 ? -21.995 4.818   6.390   1.00 0.00 ? 37 THR A HG21 2  
ATOM 2363  H HG22 . THR A 1 41 ? -20.588 5.108   5.367   1.00 0.00 ? 37 THR A HG22 2  
ATOM 2364  H HG23 . THR A 1 41 ? -20.371 4.589   7.038   1.00 0.00 ? 37 THR A HG23 2  
ATOM 2365  N N    . ALA A 1 42 ? -20.467 0.378   4.744   1.00 0.00 ? 38 ALA A N    2  
ATOM 2366  C CA   . ALA A 1 42 ? -20.370 -1.073  4.823   1.00 0.00 ? 38 ALA A CA   2  
ATOM 2367  C C    . ALA A 1 42 ? -19.707 -1.676  3.582   1.00 0.00 ? 38 ALA A C    2  
ATOM 2368  O O    . ALA A 1 42 ? -19.522 -1.002  2.565   1.00 0.00 ? 38 ALA A O    2  
ATOM 2369  C CB   . ALA A 1 42 ? -21.746 -1.676  5.041   1.00 0.00 ? 38 ALA A CB   2  
ATOM 2370  H H    . ALA A 1 42 ? -21.309 0.776   4.443   1.00 0.00 ? 38 ALA A H    2  
ATOM 2371  H HA   . ALA A 1 42 ? -19.764 -1.312  5.685   1.00 0.00 ? 38 ALA A HA   2  
ATOM 2372  H HB1  . ALA A 1 42 ? -22.270 -1.110  5.796   1.00 0.00 ? 38 ALA A HB1  2  
ATOM 2373  H HB2  . ALA A 1 42 ? -21.641 -2.701  5.367   1.00 0.00 ? 38 ALA A HB2  2  
ATOM 2374  H HB3  . ALA A 1 42 ? -22.303 -1.648  4.116   1.00 0.00 ? 38 ALA A HB3  2  
ATOM 2375  N N    . ILE A 1 43 ? -19.385 -2.964  3.686   1.00 0.00 ? 39 ILE A N    2  
ATOM 2376  C CA   . ILE A 1 43 ? -18.713 -3.723  2.627   1.00 0.00 ? 39 ILE A CA   2  
ATOM 2377  C C    . ILE A 1 43 ? -19.389 -3.584  1.259   1.00 0.00 ? 39 ILE A C    2  
ATOM 2378  O O    . ILE A 1 43 ? -18.715 -3.322  0.263   1.00 0.00 ? 39 ILE A O    2  
ATOM 2379  C CB   . ILE A 1 43 ? -18.635 -5.221  2.999   1.00 0.00 ? 39 ILE A CB   2  
ATOM 2380  C CG1  . ILE A 1 43 ? -17.865 -5.416  4.312   1.00 0.00 ? 39 ILE A CG1  2  
ATOM 2381  C CG2  . ILE A 1 43 ? -17.995 -6.031  1.877   1.00 0.00 ? 39 ILE A CG2  2  
ATOM 2382  C CD1  . ILE A 1 43 ? -16.381 -5.120  4.210   1.00 0.00 ? 39 ILE A CD1  2  
ATOM 2383  H H    . ILE A 1 43 ? -19.615 -3.431  4.516   1.00 0.00 ? 39 ILE A H    2  
ATOM 2384  H HA   . ILE A 1 43 ? -17.704 -3.348  2.551   1.00 0.00 ? 39 ILE A HA   2  
ATOM 2385  H HB   . ILE A 1 43 ? -19.644 -5.582  3.132   1.00 0.00 ? 39 ILE A HB   2  
ATOM 2386  H HG12 . ILE A 1 43 ? -18.279 -4.762  5.064   1.00 0.00 ? 39 ILE A HG12 2  
ATOM 2387  H HG13 . ILE A 1 43 ? -17.976 -6.442  4.635   1.00 0.00 ? 39 ILE A HG13 2  
ATOM 2388  H HG21 . ILE A 1 43 ? -17.906 -7.063  2.184   1.00 0.00 ? 39 ILE A HG21 2  
ATOM 2389  H HG22 . ILE A 1 43 ? -17.015 -5.634  1.660   1.00 0.00 ? 39 ILE A HG22 2  
ATOM 2390  H HG23 . ILE A 1 43 ? -18.612 -5.971  0.993   1.00 0.00 ? 39 ILE A HG23 2  
ATOM 2391  H HD11 . ILE A 1 43 ? -16.238 -4.089  3.924   1.00 0.00 ? 39 ILE A HD11 2  
ATOM 2392  H HD12 . ILE A 1 43 ? -15.936 -5.765  3.467   1.00 0.00 ? 39 ILE A HD12 2  
ATOM 2393  H HD13 . ILE A 1 43 ? -15.913 -5.295  5.167   1.00 0.00 ? 39 ILE A HD13 2  
ATOM 2394  N N    . GLU A 1 44 ? -20.710 -3.755  1.215   1.00 0.00 ? 40 GLU A N    2  
ATOM 2395  C CA   . GLU A 1 44 ? -21.458 -3.676  -0.050  1.00 0.00 ? 40 GLU A CA   2  
ATOM 2396  C C    . GLU A 1 44 ? -21.183 -2.372  -0.790  1.00 0.00 ? 40 GLU A C    2  
ATOM 2397  O O    . GLU A 1 44 ? -21.048 -2.358  -2.010  1.00 0.00 ? 40 GLU A O    2  
ATOM 2398  C CB   . GLU A 1 44 ? -22.971 -3.800  0.174   1.00 0.00 ? 40 GLU A CB   2  
ATOM 2399  C CG   . GLU A 1 44 ? -23.370 -4.716  1.315   1.00 0.00 ? 40 GLU A CG   2  
ATOM 2400  C CD   . GLU A 1 44 ? -23.309 -4.017  2.651   1.00 0.00 ? 40 GLU A CD   2  
ATOM 2401  O OE1  . GLU A 1 44 ? -24.140 -3.116  2.896   1.00 0.00 ? 40 GLU A OE1  2  
ATOM 2402  O OE2  . GLU A 1 44 ? -22.419 -4.354  3.454   1.00 0.00 ? 40 GLU A OE2  2  
ATOM 2403  H H    . GLU A 1 44 ? -21.196 -3.945  2.049   1.00 0.00 ? 40 GLU A H    2  
ATOM 2404  H HA   . GLU A 1 44 ? -21.133 -4.498  -0.670  1.00 0.00 ? 40 GLU A HA   2  
ATOM 2405  H HB2  . GLU A 1 44 ? -23.369 -2.818  0.380   1.00 0.00 ? 40 GLU A HB2  2  
ATOM 2406  H HB3  . GLU A 1 44 ? -23.424 -4.174  -0.733  1.00 0.00 ? 40 GLU A HB3  2  
ATOM 2407  H HG2  . GLU A 1 44 ? -24.380 -5.060  1.150   1.00 0.00 ? 40 GLU A HG2  2  
ATOM 2408  H HG3  . GLU A 1 44 ? -22.699 -5.562  1.335   1.00 0.00 ? 40 GLU A HG3  2  
ATOM 2409  N N    . LYS A 1 45 ? -21.085 -1.281  -0.051  1.00 0.00 ? 41 LYS A N    2  
ATOM 2410  C CA   . LYS A 1 45 ? -20.843 0.019   -0.655  1.00 0.00 ? 41 LYS A CA   2  
ATOM 2411  C C    . LYS A 1 45 ? -19.394 0.138   -1.113  1.00 0.00 ? 41 LYS A C    2  
ATOM 2412  O O    . LYS A 1 45 ? -19.102 0.763   -2.131  1.00 0.00 ? 41 LYS A O    2  
ATOM 2413  C CB   . LYS A 1 45 ? -21.188 1.138   0.328   1.00 0.00 ? 41 LYS A CB   2  
ATOM 2414  C CG   . LYS A 1 45 ? -22.615 1.070   0.852   1.00 0.00 ? 41 LYS A CG   2  
ATOM 2415  C CD   . LYS A 1 45 ? -22.668 0.489   2.255   1.00 0.00 ? 41 LYS A CD   2  
ATOM 2416  C CE   . LYS A 1 45 ? -24.095 0.383   2.768   1.00 0.00 ? 41 LYS A CE   2  
ATOM 2417  N NZ   . LYS A 1 45 ? -24.878 -0.653  2.044   1.00 0.00 ? 41 LYS A NZ   2  
ATOM 2418  H H    . LYS A 1 45 ? -21.157 -1.353  0.924   1.00 0.00 ? 41 LYS A H    2  
ATOM 2419  H HA   . LYS A 1 45 ? -21.485 0.103   -1.520  1.00 0.00 ? 41 LYS A HA   2  
ATOM 2420  H HB2  . LYS A 1 45 ? -20.515 1.083   1.171   1.00 0.00 ? 41 LYS A HB2  2  
ATOM 2421  H HB3  . LYS A 1 45 ? -21.056 2.089   -0.166  1.00 0.00 ? 41 LYS A HB3  2  
ATOM 2422  H HG2  . LYS A 1 45 ? -23.028 2.066   0.872   1.00 0.00 ? 41 LYS A HG2  2  
ATOM 2423  H HG3  . LYS A 1 45 ? -23.201 0.449   0.191   1.00 0.00 ? 41 LYS A HG3  2  
ATOM 2424  H HD2  . LYS A 1 45 ? -22.227 -0.496  2.241   1.00 0.00 ? 41 LYS A HD2  2  
ATOM 2425  H HD3  . LYS A 1 45 ? -22.104 1.129   2.917   1.00 0.00 ? 41 LYS A HD3  2  
ATOM 2426  H HE2  . LYS A 1 45 ? -24.067 0.129   3.817   1.00 0.00 ? 41 LYS A HE2  2  
ATOM 2427  H HE3  . LYS A 1 45 ? -24.579 1.340   2.645   1.00 0.00 ? 41 LYS A HE3  2  
ATOM 2428  H HZ1  . LYS A 1 45 ? -24.564 -1.610  2.325   1.00 0.00 ? 41 LYS A HZ1  2  
ATOM 2429  H HZ2  . LYS A 1 45 ? -24.753 -0.547  1.016   1.00 0.00 ? 41 LYS A HZ2  2  
ATOM 2430  H HZ3  . LYS A 1 45 ? -25.887 -0.554  2.263   1.00 0.00 ? 41 LYS A HZ3  2  
ATOM 2431  N N    . VAL A 1 46 ? -18.493 -0.487  -0.368  1.00 0.00 ? 42 VAL A N    2  
ATOM 2432  C CA   . VAL A 1 46 ? -17.074 -0.455  -0.693  1.00 0.00 ? 42 VAL A CA   2  
ATOM 2433  C C    . VAL A 1 46 ? -16.790 -1.240  -1.975  1.00 0.00 ? 42 VAL A C    2  
ATOM 2434  O O    . VAL A 1 46 ? -16.025 -0.794  -2.826  1.00 0.00 ? 42 VAL A O    2  
ATOM 2435  C CB   . VAL A 1 46 ? -16.217 -1.021  0.463   1.00 0.00 ? 42 VAL A CB   2  
ATOM 2436  C CG1  . VAL A 1 46 ? -14.739 -1.018  0.102   1.00 0.00 ? 42 VAL A CG1  2  
ATOM 2437  C CG2  . VAL A 1 46 ? -16.453 -0.224  1.737   1.00 0.00 ? 42 VAL A CG2  2  
ATOM 2438  H H    . VAL A 1 46 ? -18.791 -0.985  0.425   1.00 0.00 ? 42 VAL A H    2  
ATOM 2439  H HA   . VAL A 1 46 ? -16.794 0.576   -0.848  1.00 0.00 ? 42 VAL A HA   2  
ATOM 2440  H HB   . VAL A 1 46 ? -16.520 -2.042  0.642   1.00 0.00 ? 42 VAL A HB   2  
ATOM 2441  H HG11 . VAL A 1 46 ? -14.169 -1.447  0.913   1.00 0.00 ? 42 VAL A HG11 2  
ATOM 2442  H HG12 . VAL A 1 46 ? -14.412 -0.003  -0.069  1.00 0.00 ? 42 VAL A HG12 2  
ATOM 2443  H HG13 . VAL A 1 46 ? -14.586 -1.601  -0.793  1.00 0.00 ? 42 VAL A HG13 2  
ATOM 2444  H HG21 . VAL A 1 46 ? -17.487 -0.317  2.034   1.00 0.00 ? 42 VAL A HG21 2  
ATOM 2445  H HG22 . VAL A 1 46 ? -16.222 0.816   1.559   1.00 0.00 ? 42 VAL A HG22 2  
ATOM 2446  H HG23 . VAL A 1 46 ? -15.816 -0.605  2.523   1.00 0.00 ? 42 VAL A HG23 2  
ATOM 2447  N N    . VAL A 1 47 ? -17.430 -2.394  -2.126  1.00 0.00 ? 43 VAL A N    2  
ATOM 2448  C CA   . VAL A 1 47 ? -17.222 -3.227  -3.308  1.00 0.00 ? 43 VAL A CA   2  
ATOM 2449  C C    . VAL A 1 47 ? -17.968 -2.678  -4.526  1.00 0.00 ? 43 VAL A C    2  
ATOM 2450  O O    . VAL A 1 47 ? -17.794 -3.170  -5.643  1.00 0.00 ? 43 VAL A O    2  
ATOM 2451  C CB   . VAL A 1 47 ? -17.648 -4.694  -3.068  1.00 0.00 ? 43 VAL A CB   2  
ATOM 2452  C CG1  . VAL A 1 47 ? -16.895 -5.283  -1.888  1.00 0.00 ? 43 VAL A CG1  2  
ATOM 2453  C CG2  . VAL A 1 47 ? -19.150 -4.804  -2.853  1.00 0.00 ? 43 VAL A CG2  2  
ATOM 2454  H H    . VAL A 1 47 ? -18.050 -2.696  -1.424  1.00 0.00 ? 43 VAL A H    2  
ATOM 2455  H HA   . VAL A 1 47 ? -16.164 -3.220  -3.526  1.00 0.00 ? 43 VAL A HA   2  
ATOM 2456  H HB   . VAL A 1 47 ? -17.391 -5.266  -3.949  1.00 0.00 ? 43 VAL A HB   2  
ATOM 2457  H HG11 . VAL A 1 47 ? -15.882 -4.910  -1.885  1.00 0.00 ? 43 VAL A HG11 2  
ATOM 2458  H HG12 . VAL A 1 47 ? -16.880 -6.360  -1.971  1.00 0.00 ? 43 VAL A HG12 2  
ATOM 2459  H HG13 . VAL A 1 47 ? -17.386 -5.000  -0.969  1.00 0.00 ? 43 VAL A HG13 2  
ATOM 2460  H HG21 . VAL A 1 47 ? -19.440 -4.185  -2.016  1.00 0.00 ? 43 VAL A HG21 2  
ATOM 2461  H HG22 . VAL A 1 47 ? -19.410 -5.831  -2.648  1.00 0.00 ? 43 VAL A HG22 2  
ATOM 2462  H HG23 . VAL A 1 47 ? -19.668 -4.472  -3.742  1.00 0.00 ? 43 VAL A HG23 2  
ATOM 2463  N N    . GLN A 1 48 ? -18.793 -1.663  -4.310  1.00 0.00 ? 44 GLN A N    2  
ATOM 2464  C CA   . GLN A 1 48 ? -19.556 -1.060  -5.396  1.00 0.00 ? 44 GLN A CA   2  
ATOM 2465  C C    . GLN A 1 48 ? -18.777 0.069   -6.055  1.00 0.00 ? 44 GLN A C    2  
ATOM 2466  O O    . GLN A 1 48 ? -19.065 0.445   -7.193  1.00 0.00 ? 44 GLN A O    2  
ATOM 2467  C CB   . GLN A 1 48 ? -20.899 -0.542  -4.891  1.00 0.00 ? 44 GLN A CB   2  
ATOM 2468  C CG   . GLN A 1 48 ? -22.000 -1.587  -4.932  1.00 0.00 ? 44 GLN A CG   2  
ATOM 2469  C CD   . GLN A 1 48 ? -23.323 -1.055  -4.427  1.00 0.00 ? 44 GLN A CD   2  
ATOM 2470  O OE1  . GLN A 1 48 ? -23.628 0.130   -4.569  1.00 0.00 ? 44 GLN A OE1  2  
ATOM 2471  N NE2  . GLN A 1 48 ? -24.117 -1.926  -3.831  1.00 0.00 ? 44 GLN A NE2  2  
ATOM 2472  H H    . GLN A 1 48 ? -18.896 -1.315  -3.399  1.00 0.00 ? 44 GLN A H    2  
ATOM 2473  H HA   . GLN A 1 48 ? -19.734 -1.827  -6.132  1.00 0.00 ? 44 GLN A HA   2  
ATOM 2474  H HB2  . GLN A 1 48 ? -20.784 -0.209  -3.869  1.00 0.00 ? 44 GLN A HB2  2  
ATOM 2475  H HB3  . GLN A 1 48 ? -21.202 0.295   -5.501  1.00 0.00 ? 44 GLN A HB3  2  
ATOM 2476  H HG2  . GLN A 1 48 ? -22.127 -1.916  -5.952  1.00 0.00 ? 44 GLN A HG2  2  
ATOM 2477  H HG3  . GLN A 1 48 ? -21.706 -2.425  -4.317  1.00 0.00 ? 44 GLN A HG3  2  
ATOM 2478  H HE21 . GLN A 1 48 ? -23.809 -2.858  -3.753  1.00 0.00 ? 44 GLN A HE21 2  
ATOM 2479  H HE22 . GLN A 1 48 ? -24.977 -1.609  -3.487  1.00 0.00 ? 44 GLN A HE22 2  
ATOM 2480  N N    . MET A 1 49 ? -17.815 0.628   -5.330  1.00 0.00 ? 45 MET A N    2  
ATOM 2481  C CA   . MET A 1 49 ? -16.991 1.711   -5.859  1.00 0.00 ? 45 MET A CA   2  
ATOM 2482  C C    . MET A 1 49 ? -16.118 1.232   -7.022  1.00 0.00 ? 45 MET A C    2  
ATOM 2483  O O    . MET A 1 49 ? -16.128 0.053   -7.390  1.00 0.00 ? 45 MET A O    2  
ATOM 2484  C CB   . MET A 1 49 ? -16.113 2.311   -4.754  1.00 0.00 ? 45 MET A CB   2  
ATOM 2485  C CG   . MET A 1 49 ? -14.840 1.523   -4.474  1.00 0.00 ? 45 MET A CG   2  
ATOM 2486  S SD   . MET A 1 49 ? -13.715 2.391   -3.364  1.00 0.00 ? 45 MET A SD   2  
ATOM 2487  C CE   . MET A 1 49 ? -14.663 2.374   -1.846  1.00 0.00 ? 45 MET A CE   2  
ATOM 2488  H H    . MET A 1 49 ? -17.690 0.340   -4.403  1.00 0.00 ? 45 MET A H    2  
ATOM 2489  H HA   . MET A 1 49 ? -17.659 2.478   -6.226  1.00 0.00 ? 45 MET A HA   2  
ATOM 2490  H HB2  . MET A 1 49 ? -15.830 3.313   -5.042  1.00 0.00 ? 45 MET A HB2  2  
ATOM 2491  H HB3  . MET A 1 49 ? -16.689 2.360   -3.842  1.00 0.00 ? 45 MET A HB3  2  
ATOM 2492  H HG2  . MET A 1 49 ? -15.110 0.579   -4.023  1.00 0.00 ? 45 MET A HG2  2  
ATOM 2493  H HG3  . MET A 1 49 ? -14.332 1.340   -5.409  1.00 0.00 ? 45 MET A HG3  2  
ATOM 2494  H HE1  . MET A 1 49 ? -14.052 2.746   -1.038  1.00 0.00 ? 45 MET A HE1  2  
ATOM 2495  H HE2  . MET A 1 49 ? -14.974 1.364   -1.629  1.00 0.00 ? 45 MET A HE2  2  
ATOM 2496  H HE3  . MET A 1 49 ? -15.533 3.003   -1.959  1.00 0.00 ? 45 MET A HE3  2  
ATOM 2497  N N    . THR A 1 50 ? -15.340 2.147   -7.578  1.00 0.00 ? 46 THR A N    2  
ATOM 2498  C CA   . THR A 1 50 ? -14.470 1.835   -8.694  1.00 0.00 ? 46 THR A CA   2  
ATOM 2499  C C    . THR A 1 50 ? -13.100 2.475   -8.471  1.00 0.00 ? 46 THR A C    2  
ATOM 2500  O O    . THR A 1 50 ? -12.896 3.160   -7.470  1.00 0.00 ? 46 THR A O    2  
ATOM 2501  C CB   . THR A 1 50 ? -15.086 2.318   -10.029 1.00 0.00 ? 46 THR A CB   2  
ATOM 2502  O OG1  . THR A 1 50 ? -14.379 1.749   -11.140 1.00 0.00 ? 46 THR A OG1  2  
ATOM 2503  C CG2  . THR A 1 50 ? -15.065 3.839   -10.132 1.00 0.00 ? 46 THR A CG2  2  
ATOM 2504  H H    . THR A 1 50 ? -15.306 3.048   -7.191  1.00 0.00 ? 46 THR A H    2  
ATOM 2505  H HA   . THR A 1 50 ? -14.354 0.761   -8.738  1.00 0.00 ? 46 THR A HA   2  
ATOM 2506  H HB   . THR A 1 50 ? -16.115 1.988   -10.068 1.00 0.00 ? 46 THR A HB   2  
ATOM 2507  H HG1  . THR A 1 50 ? -14.787 2.052   -11.965 1.00 0.00 ? 46 THR A HG1  2  
ATOM 2508  H HG21 . THR A 1 50 ? -14.054 4.195   -9.997  1.00 0.00 ? 46 THR A HG21 2  
ATOM 2509  H HG22 . THR A 1 50 ? -15.700 4.260   -9.367  1.00 0.00 ? 46 THR A HG22 2  
ATOM 2510  H HG23 . THR A 1 50 ? -15.426 4.139   -11.104 1.00 0.00 ? 46 THR A HG23 2  
ATOM 2511  N N    . ASN A 1 51 ? -12.171 2.246   -9.394  1.00 0.00 ? 47 ASN A N    2  
ATOM 2512  C CA   . ASN A 1 51 ? -10.823 2.805   -9.284  1.00 0.00 ? 47 ASN A CA   2  
ATOM 2513  C C    . ASN A 1 51 ? -10.873 4.323   -9.160  1.00 0.00 ? 47 ASN A C    2  
ATOM 2514  O O    . ASN A 1 51 ? -10.166 4.907   -8.341  1.00 0.00 ? 47 ASN A O    2  
ATOM 2515  C CB   . ASN A 1 51 ? -9.967  2.403   -10.487 1.00 0.00 ? 47 ASN A CB   2  
ATOM 2516  C CG   . ASN A 1 51 ? -9.306  1.048   -10.305 1.00 0.00 ? 47 ASN A CG   2  
ATOM 2517  O OD1  . ASN A 1 51 ? -9.930  0.008   -10.517 1.00 0.00 ? 47 ASN A OD1  2  
ATOM 2518  N ND2  . ASN A 1 51 ? -8.037  1.051   -9.922  1.00 0.00 ? 47 ASN A ND2  2  
ATOM 2519  H H    . ASN A 1 51 ? -12.397 1.680   -10.163 1.00 0.00 ? 47 ASN A H    2  
ATOM 2520  H HA   . ASN A 1 51 ? -10.375 2.402   -8.388  1.00 0.00 ? 47 ASN A HA   2  
ATOM 2521  H HB2  . ASN A 1 51 ? -10.591 2.362   -11.368 1.00 0.00 ? 47 ASN A HB2  2  
ATOM 2522  H HB3  . ASN A 1 51 ? -9.194  3.143   -10.634 1.00 0.00 ? 47 ASN A HB3  2  
ATOM 2523  H HD21 . ASN A 1 51 ? -7.597  1.916   -9.781  1.00 0.00 ? 47 ASN A HD21 2  
ATOM 2524  H HD22 . ASN A 1 51 ? -7.587  0.188   -9.799  1.00 0.00 ? 47 ASN A HD22 2  
ATOM 2525  N N    . ASP A 1 52 ? -11.708 4.955   -9.982  1.00 0.00 ? 48 ASP A N    2  
ATOM 2526  C CA   . ASP A 1 52 ? -11.871 6.410   -9.957  1.00 0.00 ? 48 ASP A CA   2  
ATOM 2527  C C    . ASP A 1 52 ? -12.314 6.890   -8.578  1.00 0.00 ? 48 ASP A C    2  
ATOM 2528  O O    . ASP A 1 52 ? -11.868 7.933   -8.103  1.00 0.00 ? 48 ASP A O    2  
ATOM 2529  C CB   . ASP A 1 52 ? -12.893 6.854   -11.005 1.00 0.00 ? 48 ASP A CB   2  
ATOM 2530  C CG   . ASP A 1 52 ? -13.004 8.364   -11.100 1.00 0.00 ? 48 ASP A CG   2  
ATOM 2531  O OD1  . ASP A 1 52 ? -12.072 8.995   -11.640 1.00 0.00 ? 48 ASP A OD1  2  
ATOM 2532  O OD2  . ASP A 1 52 ? -14.027 8.926   -10.650 1.00 0.00 ? 48 ASP A OD2  2  
ATOM 2533  H H    . ASP A 1 52 ? -12.198 4.440   -10.656 1.00 0.00 ? 48 ASP A H    2  
ATOM 2534  H HA   . ASP A 1 52 ? -10.914 6.854   -10.189 1.00 0.00 ? 48 ASP A HA   2  
ATOM 2535  H HB2  . ASP A 1 52 ? -12.600 6.470   -11.971 1.00 0.00 ? 48 ASP A HB2  2  
ATOM 2536  H HB3  . ASP A 1 52 ? -13.863 6.457   -10.742 1.00 0.00 ? 48 ASP A HB3  2  
ATOM 2537  N N    . ASP A 1 53 ? -13.179 6.112   -7.936  1.00 0.00 ? 49 ASP A N    2  
ATOM 2538  C CA   . ASP A 1 53 ? -13.680 6.451   -6.607  1.00 0.00 ? 49 ASP A CA   2  
ATOM 2539  C C    . ASP A 1 53 ? -12.538 6.541   -5.613  1.00 0.00 ? 49 ASP A C    2  
ATOM 2540  O O    . ASP A 1 53 ? -12.489 7.450   -4.791  1.00 0.00 ? 49 ASP A O    2  
ATOM 2541  C CB   . ASP A 1 53 ? -14.680 5.409   -6.119  1.00 0.00 ? 49 ASP A CB   2  
ATOM 2542  C CG   . ASP A 1 53 ? -16.088 5.698   -6.571  1.00 0.00 ? 49 ASP A CG   2  
ATOM 2543  O OD1  . ASP A 1 53 ? -16.661 6.716   -6.126  1.00 0.00 ? 49 ASP A OD1  2  
ATOM 2544  O OD2  . ASP A 1 53 ? -16.638 4.905   -7.360  1.00 0.00 ? 49 ASP A OD2  2  
ATOM 2545  H H    . ASP A 1 53 ? -13.486 5.288   -8.364  1.00 0.00 ? 49 ASP A H    2  
ATOM 2546  H HA   . ASP A 1 53 ? -14.171 7.412   -6.671  1.00 0.00 ? 49 ASP A HA   2  
ATOM 2547  H HB2  . ASP A 1 53 ? -14.392 4.441   -6.498  1.00 0.00 ? 49 ASP A HB2  2  
ATOM 2548  H HB3  . ASP A 1 53 ? -14.666 5.387   -5.040  1.00 0.00 ? 49 ASP A HB3  2  
ATOM 2549  N N    . ILE A 1 54 ? -11.612 5.610   -5.712  1.00 0.00 ? 50 ILE A N    2  
ATOM 2550  C CA   . ILE A 1 54 ? -10.438 5.562   -4.845  1.00 0.00 ? 50 ILE A CA   2  
ATOM 2551  C C    . ILE A 1 54 ? -9.603  6.810   -4.996  1.00 0.00 ? 50 ILE A C    2  
ATOM 2552  O O    . ILE A 1 54 ? -8.848  7.192   -4.092  1.00 0.00 ? 50 ILE A O    2  
ATOM 2553  C CB   . ILE A 1 54 ? -9.589  4.250   -5.098  1.00 0.00 ? 50 ILE A CB   2  
ATOM 2554  C CG1  . ILE A 1 54 ? -10.356 2.916   -4.831  1.00 0.00 ? 50 ILE A CG1  2  
ATOM 2555  C CG2  . ILE A 1 54 ? -8.263  4.220   -4.276  1.00 0.00 ? 50 ILE A CG2  2  
ATOM 2556  C CD1  . ILE A 1 54 ? -10.935 2.745   -3.411  1.00 0.00 ? 50 ILE A CD1  2  
ATOM 2557  H H    . ILE A 1 54 ? -11.716 4.911   -6.407  1.00 0.00 ? 50 ILE A H    2  
ATOM 2558  H HA   . ILE A 1 54 ? -10.796 5.548   -3.799  1.00 0.00 ? 50 ILE A HA   2  
ATOM 2559  H HB   . ILE A 1 54 ? -9.315  4.251   -6.174  1.00 0.00 ? 50 ILE A HB   2  
ATOM 2560  H HG12 . ILE A 1 54 ? -11.152 2.773   -5.587  1.00 0.00 ? 50 ILE A HG12 2  
ATOM 2561  H HG13 . ILE A 1 54 ? -9.673  2.059   -4.983  1.00 0.00 ? 50 ILE A HG13 2  
ATOM 2562  H HG21 . ILE A 1 54 ? -7.597  5.073   -4.493  1.00 0.00 ? 50 ILE A HG21 2  
ATOM 2563  H HG22 . ILE A 1 54 ? -8.450  4.218   -3.185  1.00 0.00 ? 50 ILE A HG22 2  
ATOM 2564  H HG23 . ILE A 1 54 ? -7.649  3.329   -4.499  1.00 0.00 ? 50 ILE A HG23 2  
ATOM 2565  H HD11 . ILE A 1 54 ? -10.153 2.840   -2.634  1.00 0.00 ? 50 ILE A HD11 2  
ATOM 2566  H HD12 . ILE A 1 54 ? -11.722 3.486   -3.182  1.00 0.00 ? 50 ILE A HD12 2  
ATOM 2567  H HD13 . ILE A 1 54 ? -11.396 1.748   -3.285  1.00 0.00 ? 50 ILE A HD13 2  
ATOM 2568  N N    . LYS A 1 55 ? -9.700  7.441   -6.153  1.00 0.00 ? 51 LYS A N    2  
ATOM 2569  C CA   . LYS A 1 55 ? -8.936  8.645   -6.437  1.00 0.00 ? 51 LYS A CA   2  
ATOM 2570  C C    . LYS A 1 55 ? -9.719  9.891   -6.044  1.00 0.00 ? 51 LYS A C    2  
ATOM 2571  O O    . LYS A 1 55 ? -9.153  10.979  -5.937  1.00 0.00 ? 51 LYS A O    2  
ATOM 2572  C CB   . LYS A 1 55 ? -8.591  8.708   -7.929  1.00 0.00 ? 51 LYS A CB   2  
ATOM 2573  C CG   . LYS A 1 55 ? -8.099  7.387   -8.505  1.00 0.00 ? 51 LYS A CG   2  
ATOM 2574  C CD   . LYS A 1 55 ? -7.973  7.449   -10.018 1.00 0.00 ? 51 LYS A CD   2  
ATOM 2575  C CE   . LYS A 1 55 ? -6.788  8.298   -10.449 1.00 0.00 ? 51 LYS A CE   2  
ATOM 2576  N NZ   . LYS A 1 55 ? -5.499  7.565   -10.326 1.00 0.00 ? 51 LYS A NZ   2  
ATOM 2577  H H    . LYS A 1 55 ? -10.321 7.104   -6.832  1.00 0.00 ? 51 LYS A H    2  
ATOM 2578  H HA   . LYS A 1 55 ? -8.023  8.607   -5.867  1.00 0.00 ? 51 LYS A HA   2  
ATOM 2579  H HB2  . LYS A 1 55 ? -9.473  9.006   -8.476  1.00 0.00 ? 51 LYS A HB2  2  
ATOM 2580  H HB3  . LYS A 1 55 ? -7.820  9.449   -8.074  1.00 0.00 ? 51 LYS A HB3  2  
ATOM 2581  H HG2  . LYS A 1 55 ? -7.132  7.158   -8.083  1.00 0.00 ? 51 LYS A HG2  2  
ATOM 2582  H HG3  . LYS A 1 55 ? -8.801  6.608   -8.244  1.00 0.00 ? 51 LYS A HG3  2  
ATOM 2583  H HD2  . LYS A 1 55 ? -7.841  6.448   -10.400 1.00 0.00 ? 51 LYS A HD2  2  
ATOM 2584  H HD3  . LYS A 1 55 ? -8.877  7.877   -10.428 1.00 0.00 ? 51 LYS A HD3  2  
ATOM 2585  H HE2  . LYS A 1 55 ? -6.927  8.589   -11.478 1.00 0.00 ? 51 LYS A HE2  2  
ATOM 2586  H HE3  . LYS A 1 55 ? -6.750  9.182   -9.829  1.00 0.00 ? 51 LYS A HE3  2  
ATOM 2587  H HZ1  . LYS A 1 55 ? -5.408  7.146   -9.373  1.00 0.00 ? 51 LYS A HZ1  2  
ATOM 2588  H HZ2  . LYS A 1 55 ? -4.703  8.216   -10.479 1.00 0.00 ? 51 LYS A HZ2  2  
ATOM 2589  H HZ3  . LYS A 1 55 ? -5.450  6.806   -11.033 1.00 0.00 ? 51 LYS A HZ3  2  
ATOM 2590  N N    . ARG A 1 56 ? -11.025 9.739   -5.825  1.00 0.00 ? 52 ARG A N    2  
ATOM 2591  C CA   . ARG A 1 56 ? -11.873 10.869  -5.475  1.00 0.00 ? 52 ARG A CA   2  
ATOM 2592  C C    . ARG A 1 56 ? -12.122 10.935  -3.971  1.00 0.00 ? 52 ARG A C    2  
ATOM 2593  O O    . ARG A 1 56 ? -12.421 12.001  -3.433  1.00 0.00 ? 52 ARG A O    2  
ATOM 2594  C CB   . ARG A 1 56 ? -13.206 10.777  -6.221  1.00 0.00 ? 52 ARG A CB   2  
ATOM 2595  C CG   . ARG A 1 56 ? -14.079 12.011  -6.065  1.00 0.00 ? 52 ARG A CG   2  
ATOM 2596  C CD   . ARG A 1 56 ? -15.230 12.006  -7.054  1.00 0.00 ? 52 ARG A CD   2  
ATOM 2597  N NE   . ARG A 1 56 ? -16.458 11.484  -6.462  1.00 0.00 ? 52 ARG A NE   2  
ATOM 2598  C CZ   . ARG A 1 56 ? -17.671 11.970  -6.716  1.00 0.00 ? 52 ARG A CZ   2  
ATOM 2599  N NH1  . ARG A 1 56 ? -17.823 12.983  -7.565  1.00 0.00 ? 52 ARG A NH1  2  
ATOM 2600  N NH2  . ARG A 1 56 ? -18.734 11.432  -6.130  1.00 0.00 ? 52 ARG A NH2  2  
ATOM 2601  H H    . ARG A 1 56 ? -11.436 8.849   -5.892  1.00 0.00 ? 52 ARG A H    2  
ATOM 2602  H HA   . ARG A 1 56 ? -11.361 11.771  -5.783  1.00 0.00 ? 52 ARG A HA   2  
ATOM 2603  H HB2  . ARG A 1 56 ? -13.005 10.636  -7.272  1.00 0.00 ? 52 ARG A HB2  2  
ATOM 2604  H HB3  . ARG A 1 56 ? -13.754 9.923   -5.850  1.00 0.00 ? 52 ARG A HB3  2  
ATOM 2605  H HG2  . ARG A 1 56 ? -14.480 12.033  -5.062  1.00 0.00 ? 52 ARG A HG2  2  
ATOM 2606  H HG3  . ARG A 1 56 ? -13.476 12.891  -6.232  1.00 0.00 ? 52 ARG A HG3  2  
ATOM 2607  H HD2  . ARG A 1 56 ? -15.406 13.017  -7.386  1.00 0.00 ? 52 ARG A HD2  2  
ATOM 2608  H HD3  . ARG A 1 56 ? -14.959 11.392  -7.898  1.00 0.00 ? 52 ARG A HD3  2  
ATOM 2609  H HE   . ARG A 1 56 ? -16.372 10.726  -5.838  1.00 0.00 ? 52 ARG A HE   2  
ATOM 2610  H HH11 . ARG A 1 56 ? -17.025 13.386  -8.016  1.00 0.00 ? 52 ARG A HH11 2  
ATOM 2611  H HH12 . ARG A 1 56 ? -18.737 13.347  -7.756  1.00 0.00 ? 52 ARG A HH12 2  
ATOM 2612  H HH21 . ARG A 1 56 ? -18.623 10.660  -5.497  1.00 0.00 ? 52 ARG A HH21 2  
ATOM 2613  H HH22 . ARG A 1 56 ? -19.652 11.794  -6.317  1.00 0.00 ? 52 ARG A HH22 2  
ATOM 2614  N N    . ILE A 1 57 ? -11.989 9.796   -3.295  1.00 0.00 ? 53 ILE A N    2  
ATOM 2615  C CA   . ILE A 1 57 ? -12.192 9.726   -1.844  1.00 0.00 ? 53 ILE A CA   2  
ATOM 2616  C C    . ILE A 1 57 ? -11.049 10.390  -1.075  1.00 0.00 ? 53 ILE A C    2  
ATOM 2617  O O    . ILE A 1 57 ? -10.950 10.259  0.142   1.00 0.00 ? 53 ILE A O    2  
ATOM 2618  C CB   . ILE A 1 57 ? -12.326 8.268   -1.348  1.00 0.00 ? 53 ILE A CB   2  
ATOM 2619  C CG1  . ILE A 1 57 ? -11.094 7.453   -1.750  1.00 0.00 ? 53 ILE A CG1  2  
ATOM 2620  C CG2  . ILE A 1 57 ? -13.598 7.634   -1.892  1.00 0.00 ? 53 ILE A CG2  2  
ATOM 2621  C CD1  . ILE A 1 57 ? -10.995 6.114   -1.055  1.00 0.00 ? 53 ILE A CD1  2  
ATOM 2622  H H    . ILE A 1 57 ? -11.780 8.975   -3.794  1.00 0.00 ? 53 ILE A H    2  
ATOM 2623  H HA   . ILE A 1 57 ? -13.109 10.246  -1.616  1.00 0.00 ? 53 ILE A HA   2  
ATOM 2624  H HB   . ILE A 1 57 ? -12.398 8.286   -0.270  1.00 0.00 ? 53 ILE A HB   2  
ATOM 2625  H HG12 . ILE A 1 57 ? -11.125 7.270   -2.813  1.00 0.00 ? 53 ILE A HG12 2  
ATOM 2626  H HG13 . ILE A 1 57 ? -10.203 8.017   -1.513  1.00 0.00 ? 53 ILE A HG13 2  
ATOM 2627  H HG21 . ILE A 1 57 ? -14.454 8.203   -1.561  1.00 0.00 ? 53 ILE A HG21 2  
ATOM 2628  H HG22 . ILE A 1 57 ? -13.679 6.618   -1.531  1.00 0.00 ? 53 ILE A HG22 2  
ATOM 2629  H HG23 . ILE A 1 57 ? -13.564 7.630   -2.971  1.00 0.00 ? 53 ILE A HG23 2  
ATOM 2630  H HD11 . ILE A 1 57 ? -10.141 5.572   -1.437  1.00 0.00 ? 53 ILE A HD11 2  
ATOM 2631  H HD12 . ILE A 1 57 ? -11.894 5.545   -1.240  1.00 0.00 ? 53 ILE A HD12 2  
ATOM 2632  H HD13 . ILE A 1 57 ? -10.877 6.267   0.007   1.00 0.00 ? 53 ILE A HD13 2  
ATOM 2633  N N    . GLY A 1 58 ? -10.182 11.088  -1.788  1.00 0.00 ? 54 GLY A N    2  
ATOM 2634  C CA   . GLY A 1 58 ? -9.070  11.753  -1.155  1.00 0.00 ? 54 GLY A CA   2  
ATOM 2635  C C    . GLY A 1 58 ? -7.749  11.306  -1.734  1.00 0.00 ? 54 GLY A C    2  
ATOM 2636  O O    . GLY A 1 58 ? -7.081  12.080  -2.418  1.00 0.00 ? 54 GLY A O    2  
ATOM 2637  H H    . GLY A 1 58 ? -10.295 11.147  -2.759  1.00 0.00 ? 54 GLY A H    2  
ATOM 2638  H HA2  . GLY A 1 58 ? -9.170  12.820  -1.293  1.00 0.00 ? 54 GLY A HA2  2  
ATOM 2639  H HA3  . GLY A 1 58 ? -9.082  11.532  -0.097  1.00 0.00 ? 54 GLY A HA3  2  
ATOM 2640  N N    . VAL A 1 59 ? -7.363  10.070  -1.418  1.00 0.00 ? 55 VAL A N    2  
ATOM 2641  C CA   . VAL A 1 59 ? -6.120  9.468   -1.901  1.00 0.00 ? 55 VAL A CA   2  
ATOM 2642  C C    . VAL A 1 59 ? -5.803  9.821   -3.355  1.00 0.00 ? 55 VAL A C    2  
ATOM 2643  O O    . VAL A 1 59 ? -6.451  9.340   -4.282  1.00 0.00 ? 55 VAL A O    2  
ATOM 2644  C CB   . VAL A 1 59 ? -6.171  7.931   -1.779  1.00 0.00 ? 55 VAL A CB   2  
ATOM 2645  C CG1  . VAL A 1 59 ? -4.833  7.323   -2.157  1.00 0.00 ? 55 VAL A CG1  2  
ATOM 2646  C CG2  . VAL A 1 59 ? -6.574  7.508   -0.374  1.00 0.00 ? 55 VAL A CG2  2  
ATOM 2647  H H    . VAL A 1 59 ? -7.894  9.555   -0.776  1.00 0.00 ? 55 VAL A H    2  
ATOM 2648  H HA   . VAL A 1 59 ? -5.318  9.821   -1.274  1.00 0.00 ? 55 VAL A HA   2  
ATOM 2649  H HB   . VAL A 1 59 ? -6.915  7.561   -2.468  1.00 0.00 ? 55 VAL A HB   2  
ATOM 2650  H HG11 . VAL A 1 59 ? -4.081  7.652   -1.458  1.00 0.00 ? 55 VAL A HG11 2  
ATOM 2651  H HG12 . VAL A 1 59 ? -4.564  7.640   -3.153  1.00 0.00 ? 55 VAL A HG12 2  
ATOM 2652  H HG13 . VAL A 1 59 ? -4.907  6.245   -2.129  1.00 0.00 ? 55 VAL A HG13 2  
ATOM 2653  H HG21 . VAL A 1 59 ? -6.545  6.431   -0.302  1.00 0.00 ? 55 VAL A HG21 2  
ATOM 2654  H HG22 . VAL A 1 59 ? -7.574  7.856   -0.166  1.00 0.00 ? 55 VAL A HG22 2  
ATOM 2655  H HG23 . VAL A 1 59 ? -5.887  7.935   0.342   1.00 0.00 ? 55 VAL A HG23 2  
ATOM 2656  N N    . ARG A 1 60 ? -4.793  10.657  -3.539  1.00 0.00 ? 56 ARG A N    2  
ATOM 2657  C CA   . ARG A 1 60 ? -4.367  11.060  -4.870  1.00 0.00 ? 56 ARG A CA   2  
ATOM 2658  C C    . ARG A 1 60 ? -3.026  10.418  -5.208  1.00 0.00 ? 56 ARG A C    2  
ATOM 2659  O O    . ARG A 1 60 ? -2.545  10.508  -6.338  1.00 0.00 ? 56 ARG A O    2  
ATOM 2660  C CB   . ARG A 1 60 ? -4.270  12.590  -4.970  1.00 0.00 ? 56 ARG A CB   2  
ATOM 2661  C CG   . ARG A 1 60 ? -3.666  13.264  -3.742  1.00 0.00 ? 56 ARG A CG   2  
ATOM 2662  C CD   . ARG A 1 60 ? -2.144  13.219  -3.753  1.00 0.00 ? 56 ARG A CD   2  
ATOM 2663  N NE   . ARG A 1 60 ? -1.570  13.672  -2.483  1.00 0.00 ? 56 ARG A NE   2  
ATOM 2664  C CZ   . ARG A 1 60 ? -0.309  14.088  -2.338  1.00 0.00 ? 56 ARG A CZ   2  
ATOM 2665  N NH1  . ARG A 1 60 ? 0.521   14.089  -3.378  1.00 0.00 ? 56 ARG A NH1  2  
ATOM 2666  N NH2  . ARG A 1 60 ? 0.125   14.492  -1.149  1.00 0.00 ? 56 ARG A NH2  2  
ATOM 2667  H H    . ARG A 1 60 ? -4.328  11.028  -2.761  1.00 0.00 ? 56 ARG A H    2  
ATOM 2668  H HA   . ARG A 1 60 ? -5.106  10.707  -5.574  1.00 0.00 ? 56 ARG A HA   2  
ATOM 2669  H HB2  . ARG A 1 60 ? -3.660  12.842  -5.824  1.00 0.00 ? 56 ARG A HB2  2  
ATOM 2670  H HB3  . ARG A 1 60 ? -5.263  12.989  -5.121  1.00 0.00 ? 56 ARG A HB3  2  
ATOM 2671  H HG2  . ARG A 1 60 ? -3.983  14.295  -3.719  1.00 0.00 ? 56 ARG A HG2  2  
ATOM 2672  H HG3  . ARG A 1 60 ? -4.025  12.760  -2.856  1.00 0.00 ? 56 ARG A HG3  2  
ATOM 2673  H HD2  . ARG A 1 60 ? -1.830  12.202  -3.935  1.00 0.00 ? 56 ARG A HD2  2  
ATOM 2674  H HD3  . ARG A 1 60 ? -1.785  13.855  -4.547  1.00 0.00 ? 56 ARG A HD3  2  
ATOM 2675  H HE   . ARG A 1 60 ? -2.161  13.668  -1.694  1.00 0.00 ? 56 ARG A HE   2  
ATOM 2676  H HH11 . ARG A 1 60 ? 0.203   13.775  -4.279  1.00 0.00 ? 56 ARG A HH11 2  
ATOM 2677  H HH12 . ARG A 1 60 ? 1.467   14.408  -3.270  1.00 0.00 ? 56 ARG A HH12 2  
ATOM 2678  H HH21 . ARG A 1 60 ? -0.491  14.484  -0.354  1.00 0.00 ? 56 ARG A HH21 2  
ATOM 2679  H HH22 . ARG A 1 60 ? 1.070   14.817  -1.038  1.00 0.00 ? 56 ARG A HH22 2  
ATOM 2680  N N    . LEU A 1 61 ? -2.429  9.776   -4.211  1.00 0.00 ? 57 LEU A N    2  
ATOM 2681  C CA   . LEU A 1 61 ? -1.143  9.114   -4.380  1.00 0.00 ? 57 LEU A CA   2  
ATOM 2682  C C    . LEU A 1 61 ? -1.328  7.764   -5.063  1.00 0.00 ? 57 LEU A C    2  
ATOM 2683  O O    . LEU A 1 61 ? -2.136  6.946   -4.623  1.00 0.00 ? 57 LEU A O    2  
ATOM 2684  C CB   . LEU A 1 61 ? -0.458  8.947   -3.021  1.00 0.00 ? 57 LEU A CB   2  
ATOM 2685  C CG   . LEU A 1 61 ? 0.135   10.233  -2.440  1.00 0.00 ? 57 LEU A CG   2  
ATOM 2686  C CD1  . LEU A 1 61 ? 0.310   10.118  -0.933  1.00 0.00 ? 57 LEU A CD1  2  
ATOM 2687  C CD2  . LEU A 1 61 ? 1.463   10.550  -3.109  1.00 0.00 ? 57 LEU A CD2  2  
ATOM 2688  H H    . LEU A 1 61 ? -2.871  9.741   -3.339  1.00 0.00 ? 57 LEU A H    2  
ATOM 2689  H HA   . LEU A 1 61 ? -0.530  9.744   -5.010  1.00 0.00 ? 57 LEU A HA   2  
ATOM 2690  H HB2  . LEU A 1 61 ? -1.185  8.561   -2.321  1.00 0.00 ? 57 LEU A HB2  2  
ATOM 2691  H HB3  . LEU A 1 61 ? 0.337   8.224   -3.127  1.00 0.00 ? 57 LEU A HB3  2  
ATOM 2692  H HG   . LEU A 1 61 ? -0.541  11.053  -2.635  1.00 0.00 ? 57 LEU A HG   2  
ATOM 2693  H HD11 . LEU A 1 61 ? 1.044   9.356   -0.713  1.00 0.00 ? 57 LEU A HD11 2  
ATOM 2694  H HD12 . LEU A 1 61 ? -0.633  9.850   -0.480  1.00 0.00 ? 57 LEU A HD12 2  
ATOM 2695  H HD13 . LEU A 1 61 ? 0.644   11.065  -0.536  1.00 0.00 ? 57 LEU A HD13 2  
ATOM 2696  H HD21 . LEU A 1 61 ? 2.177   9.771   -2.881  1.00 0.00 ? 57 LEU A HD21 2  
ATOM 2697  H HD22 . LEU A 1 61 ? 1.834   11.496  -2.744  1.00 0.00 ? 57 LEU A HD22 2  
ATOM 2698  H HD23 . LEU A 1 61 ? 1.324   10.608  -4.178  1.00 0.00 ? 57 LEU A HD23 2  
ATOM 2699  N N    . PRO A 1 62 ? -0.572  7.515   -6.144  1.00 0.00 ? 58 PRO A N    2  
ATOM 2700  C CA   . PRO A 1 62 ? -0.666  6.269   -6.918  1.00 0.00 ? 58 PRO A CA   2  
ATOM 2701  C C    . PRO A 1 62 ? -0.402  5.019   -6.082  1.00 0.00 ? 58 PRO A C    2  
ATOM 2702  O O    . PRO A 1 62 ? -1.161  4.056   -6.144  1.00 0.00 ? 58 PRO A O    2  
ATOM 2703  C CB   . PRO A 1 62 ? 0.408   6.425   -8.004  1.00 0.00 ? 58 PRO A CB   2  
ATOM 2704  C CG   . PRO A 1 62 ? 1.301   7.517   -7.523  1.00 0.00 ? 58 PRO A CG   2  
ATOM 2705  C CD   . PRO A 1 62 ? 0.439   8.428   -6.702  1.00 0.00 ? 58 PRO A CD   2  
ATOM 2706  H HA   . PRO A 1 62 ? -1.634  6.177   -7.386  1.00 0.00 ? 58 PRO A HA   2  
ATOM 2707  H HB2  . PRO A 1 62 ? 0.946   5.496   -8.114  1.00 0.00 ? 58 PRO A HB2  2  
ATOM 2708  H HB3  . PRO A 1 62 ? -0.060  6.685   -8.942  1.00 0.00 ? 58 PRO A HB3  2  
ATOM 2709  H HG2  . PRO A 1 62 ? 2.093   7.102   -6.915  1.00 0.00 ? 58 PRO A HG2  2  
ATOM 2710  H HG3  . PRO A 1 62 ? 1.715   8.050   -8.365  1.00 0.00 ? 58 PRO A HG3  2  
ATOM 2711  H HD2  . PRO A 1 62 ? 1.018   8.891   -5.916  1.00 0.00 ? 58 PRO A HD2  2  
ATOM 2712  H HD3  . PRO A 1 62 ? -0.022  9.179   -7.326  1.00 0.00 ? 58 PRO A HD3  2  
ATOM 2713  N N    . GLY A 1 63 ? 0.674   5.036   -5.302  1.00 0.00 ? 59 GLY A N    2  
ATOM 2714  C CA   . GLY A 1 63 ? 1.009   3.887   -4.478  1.00 0.00 ? 59 GLY A CA   2  
ATOM 2715  C C    . GLY A 1 63 ? -0.052  3.583   -3.438  1.00 0.00 ? 59 GLY A C    2  
ATOM 2716  O O    . GLY A 1 63 ? -0.361  2.417   -3.173  1.00 0.00 ? 59 GLY A O    2  
ATOM 2717  H H    . GLY A 1 63 ? 1.247   5.830   -5.292  1.00 0.00 ? 59 GLY A H    2  
ATOM 2718  H HA2  . GLY A 1 63 ? 1.128   3.023   -5.117  1.00 0.00 ? 59 GLY A HA2  2  
ATOM 2719  H HA3  . GLY A 1 63 ? 1.943   4.081   -3.975  1.00 0.00 ? 59 GLY A HA3  2  
ATOM 2720  N N    . HIS A 1 64 ? -0.600  4.637   -2.850  1.00 0.00 ? 60 HIS A N    2  
ATOM 2721  C CA   . HIS A 1 64 ? -1.644  4.502   -1.839  1.00 0.00 ? 60 HIS A CA   2  
ATOM 2722  C C    . HIS A 1 64 ? -2.898  3.931   -2.482  1.00 0.00 ? 60 HIS A C    2  
ATOM 2723  O O    . HIS A 1 64 ? -3.648  3.174   -1.867  1.00 0.00 ? 60 HIS A O    2  
ATOM 2724  C CB   . HIS A 1 64 ? -1.949  5.861   -1.208  1.00 0.00 ? 60 HIS A CB   2  
ATOM 2725  C CG   . HIS A 1 64 ? -1.418  6.047   0.180   1.00 0.00 ? 60 HIS A CG   2  
ATOM 2726  N ND1  . HIS A 1 64 ? -0.087  6.226   0.483   1.00 0.00 ? 60 HIS A ND1  2  
ATOM 2727  C CD2  . HIS A 1 64 ? -2.077  6.108   1.362   1.00 0.00 ? 60 HIS A CD2  2  
ATOM 2728  C CE1  . HIS A 1 64 ? 0.020   6.389   1.806   1.00 0.00 ? 60 HIS A CE1  2  
ATOM 2729  N NE2  . HIS A 1 64 ? -1.163  6.328   2.387   1.00 0.00 ? 60 HIS A NE2  2  
ATOM 2730  H H    . HIS A 1 64 ? -0.294  5.539   -3.108  1.00 0.00 ? 60 HIS A H    2  
ATOM 2731  H HA   . HIS A 1 64 ? -1.290  3.820   -1.076  1.00 0.00 ? 60 HIS A HA   2  
ATOM 2732  H HB2  . HIS A 1 64 ? -1.523  6.635   -1.827  1.00 0.00 ? 60 HIS A HB2  2  
ATOM 2733  H HB3  . HIS A 1 64 ? -3.021  5.993   -1.174  1.00 0.00 ? 60 HIS A HB3  2  
ATOM 2734  H HD1  . HIS A 1 64 ? 0.659   6.223   -0.163  1.00 0.00 ? 60 HIS A HD1  2  
ATOM 2735  H HD2  . HIS A 1 64 ? -3.144  6.005   1.499   1.00 0.00 ? 60 HIS A HD2  2  
ATOM 2736  H HE1  . HIS A 1 64 ? 0.952   6.544   2.331   1.00 0.00 ? 60 HIS A HE1  2  
ATOM 2737  N N    . GLN A 1 65 ? -3.089  4.280   -3.746  1.00 0.00 ? 61 GLN A N    2  
ATOM 2738  C CA   . GLN A 1 65 ? -4.241  3.806   -4.506  1.00 0.00 ? 61 GLN A CA   2  
ATOM 2739  C C    . GLN A 1 65 ? -4.056  2.328   -4.819  1.00 0.00 ? 61 GLN A C    2  
ATOM 2740  O O    . GLN A 1 65 ? -4.908  1.504   -4.486  1.00 0.00 ? 61 GLN A O    2  
ATOM 2741  C CB   . GLN A 1 65 ? -4.410  4.613   -5.797  1.00 0.00 ? 61 GLN A CB   2  
ATOM 2742  C CG   . GLN A 1 65 ? -5.262  5.860   -5.629  1.00 0.00 ? 61 GLN A CG   2  
ATOM 2743  C CD   . GLN A 1 65 ? -5.117  6.831   -6.786  1.00 0.00 ? 61 GLN A CD   2  
ATOM 2744  O OE1  . GLN A 1 65 ? -4.838  6.436   -7.919  1.00 0.00 ? 61 GLN A OE1  2  
ATOM 2745  N NE2  . GLN A 1 65 ? -5.322  8.110   -6.516  1.00 0.00 ? 61 GLN A NE2  2  
ATOM 2746  H H    . GLN A 1 65 ? -2.405  4.837   -4.183  1.00 0.00 ? 61 GLN A H    2  
ATOM 2747  H HA   . GLN A 1 65 ? -5.120  3.927   -3.891  1.00 0.00 ? 61 GLN A HA   2  
ATOM 2748  H HB2  . GLN A 1 65 ? -3.434  4.916   -6.149  1.00 0.00 ? 61 GLN A HB2  2  
ATOM 2749  H HB3  . GLN A 1 65 ? -4.872  3.984   -6.544  1.00 0.00 ? 61 GLN A HB3  2  
ATOM 2750  H HG2  . GLN A 1 65 ? -6.298  5.565   -5.556  1.00 0.00 ? 61 GLN A HG2  2  
ATOM 2751  H HG3  . GLN A 1 65 ? -4.968  6.360   -4.720  1.00 0.00 ? 61 GLN A HG3  2  
ATOM 2752  H HE21 . GLN A 1 65 ? -5.559  8.358   -5.591  1.00 0.00 ? 61 GLN A HE21 2  
ATOM 2753  H HE22 . GLN A 1 65 ? -5.231  8.759   -7.241  1.00 0.00 ? 61 GLN A HE22 2  
ATOM 2754  N N    . LYS A 1 66 ? -2.955  2.032   -5.509  1.00 0.00 ? 62 LYS A N    2  
ATOM 2755  C CA   . LYS A 1 66 ? -2.567  0.663   -5.859  1.00 0.00 ? 62 LYS A CA   2  
ATOM 2756  C C    . LYS A 1 66 ? -2.864  -0.312  -4.715  1.00 0.00 ? 62 LYS A C    2  
ATOM 2757  O O    . LYS A 1 66 ? -3.432  -1.379  -4.935  1.00 0.00 ? 62 LYS A O    2  
ATOM 2758  C CB   . LYS A 1 66 ? -1.075  0.622   -6.206  1.00 0.00 ? 62 LYS A CB   2  
ATOM 2759  C CG   . LYS A 1 66 ? -0.642  -0.644  -6.932  1.00 0.00 ? 62 LYS A CG   2  
ATOM 2760  C CD   . LYS A 1 66 ? 0.866   -0.677  -7.149  1.00 0.00 ? 62 LYS A CD   2  
ATOM 2761  C CE   . LYS A 1 66 ? 1.294   -1.892  -7.962  1.00 0.00 ? 62 LYS A CE   2  
ATOM 2762  N NZ   . LYS A 1 66 ? 2.771   -2.065  -7.977  1.00 0.00 ? 62 LYS A NZ   2  
ATOM 2763  H H    . LYS A 1 66 ? -2.448  2.785   -5.888  1.00 0.00 ? 62 LYS A H    2  
ATOM 2764  H HA   . LYS A 1 66 ? -3.138  0.368   -6.726  1.00 0.00 ? 62 LYS A HA   2  
ATOM 2765  H HB2  . LYS A 1 66 ? -0.842  1.469   -6.835  1.00 0.00 ? 62 LYS A HB2  2  
ATOM 2766  H HB3  . LYS A 1 66 ? -0.504  0.698   -5.292  1.00 0.00 ? 62 LYS A HB3  2  
ATOM 2767  H HG2  . LYS A 1 66 ? -0.931  -1.501  -6.342  1.00 0.00 ? 62 LYS A HG2  2  
ATOM 2768  H HG3  . LYS A 1 66 ? -1.137  -0.683  -7.892  1.00 0.00 ? 62 LYS A HG3  2  
ATOM 2769  H HD2  . LYS A 1 66 ? 1.164   0.217   -7.676  1.00 0.00 ? 62 LYS A HD2  2  
ATOM 2770  H HD3  . LYS A 1 66 ? 1.356   -0.710  -6.186  1.00 0.00 ? 62 LYS A HD3  2  
ATOM 2771  H HE2  . LYS A 1 66 ? 0.844   -2.775  -7.532  1.00 0.00 ? 62 LYS A HE2  2  
ATOM 2772  H HE3  . LYS A 1 66 ? 0.945   -1.770  -8.977  1.00 0.00 ? 62 LYS A HE3  2  
ATOM 2773  H HZ1  . LYS A 1 66 ? 3.023   -2.970  -8.420  1.00 0.00 ? 62 LYS A HZ1  2  
ATOM 2774  H HZ2  . LYS A 1 66 ? 3.149   -2.048  -7.005  1.00 0.00 ? 62 LYS A HZ2  2  
ATOM 2775  H HZ3  . LYS A 1 66 ? 3.221   -1.289  -8.521  1.00 0.00 ? 62 LYS A HZ3  2  
ATOM 2776  N N    . ARG A 1 67 ? -2.466  0.062   -3.500  1.00 0.00 ? 63 ARG A N    2  
ATOM 2777  C CA   . ARG A 1 67 ? -2.700  -0.765  -2.317  1.00 0.00 ? 63 ARG A CA   2  
ATOM 2778  C C    . ARG A 1 67 ? -4.192  -1.014  -2.101  1.00 0.00 ? 63 ARG A C    2  
ATOM 2779  O O    . ARG A 1 67 ? -4.633  -2.159  -2.009  1.00 0.00 ? 63 ARG A O    2  
ATOM 2780  C CB   . ARG A 1 67 ? -2.101  -0.099  -1.077  1.00 0.00 ? 63 ARG A CB   2  
ATOM 2781  C CG   . ARG A 1 67 ? -0.856  -0.794  -0.553  1.00 0.00 ? 63 ARG A CG   2  
ATOM 2782  C CD   . ARG A 1 67 ? 0.313   -0.638  -1.511  1.00 0.00 ? 63 ARG A CD   2  
ATOM 2783  N NE   . ARG A 1 67 ? 0.689   -1.908  -2.137  1.00 0.00 ? 63 ARG A NE   2  
ATOM 2784  C CZ   . ARG A 1 67 ? 1.534   -2.009  -3.165  1.00 0.00 ? 63 ARG A CZ   2  
ATOM 2785  N NH1  . ARG A 1 67 ? 2.052   -0.917  -3.709  1.00 0.00 ? 63 ARG A NH1  2  
ATOM 2786  N NH2  . ARG A 1 67 ? 1.859   -3.200  -3.655  1.00 0.00 ? 63 ARG A NH2  2  
ATOM 2787  H H    . ARG A 1 67 ? -1.973  0.906   -3.401  1.00 0.00 ? 63 ARG A H    2  
ATOM 2788  H HA   . ARG A 1 67 ? -2.210  -1.714  -2.476  1.00 0.00 ? 63 ARG A HA   2  
ATOM 2789  H HB2  . ARG A 1 67 ? -1.842  0.921   -1.322  1.00 0.00 ? 63 ARG A HB2  2  
ATOM 2790  H HB3  . ARG A 1 67 ? -2.842  -0.093  -0.292  1.00 0.00 ? 63 ARG A HB3  2  
ATOM 2791  H HG2  . ARG A 1 67 ? -0.587  -0.364  0.401   1.00 0.00 ? 63 ARG A HG2  2  
ATOM 2792  H HG3  . ARG A 1 67 ? -1.069  -1.845  -0.428  1.00 0.00 ? 63 ARG A HG3  2  
ATOM 2793  H HD2  . ARG A 1 67 ? 0.036   0.063   -2.284  1.00 0.00 ? 63 ARG A HD2  2  
ATOM 2794  H HD3  . ARG A 1 67 ? 1.161   -0.253  -0.965  1.00 0.00 ? 63 ARG A HD3  2  
ATOM 2795  H HE   . ARG A 1 67 ? 0.304   -2.728  -1.758  1.00 0.00 ? 63 ARG A HE   2  
ATOM 2796  H HH11 . ARG A 1 67 ? 1.813   -0.013  -3.357  1.00 0.00 ? 63 ARG A HH11 2  
ATOM 2797  H HH12 . ARG A 1 67 ? 2.706   -1.000  -4.481  1.00 0.00 ? 63 ARG A HH12 2  
ATOM 2798  H HH21 . ARG A 1 67 ? 1.469   -4.038  -3.258  1.00 0.00 ? 63 ARG A HH21 2  
ATOM 2799  H HH22 . ARG A 1 67 ? 2.519   -3.273  -4.415  1.00 0.00 ? 63 ARG A HH22 2  
ATOM 2800  N N    . ILE A 1 68 ? -4.955  0.068   -2.016  1.00 0.00 ? 64 ILE A N    2  
ATOM 2801  C CA   . ILE A 1 68 ? -6.401  -0.015  -1.812  1.00 0.00 ? 64 ILE A CA   2  
ATOM 2802  C C    . ILE A 1 68 ? -7.077  -0.853  -2.901  1.00 0.00 ? 64 ILE A C    2  
ATOM 2803  O O    . ILE A 1 68 ? -7.923  -1.698  -2.609  1.00 0.00 ? 64 ILE A O    2  
ATOM 2804  C CB   . ILE A 1 68 ? -7.044  1.388   -1.768  1.00 0.00 ? 64 ILE A CB   2  
ATOM 2805  C CG1  . ILE A 1 68 ? -6.387  2.234   -0.673  1.00 0.00 ? 64 ILE A CG1  2  
ATOM 2806  C CG2  . ILE A 1 68 ? -8.549  1.289   -1.539  1.00 0.00 ? 64 ILE A CG2  2  
ATOM 2807  C CD1  . ILE A 1 68 ? -6.817  3.686   -0.685  1.00 0.00 ? 64 ILE A CD1  2  
ATOM 2808  H H    . ILE A 1 68 ? -4.520  0.948   -2.072  1.00 0.00 ? 64 ILE A H    2  
ATOM 2809  H HA   . ILE A 1 68 ? -6.570  -0.490  -0.856  1.00 0.00 ? 64 ILE A HA   2  
ATOM 2810  H HB   . ILE A 1 68 ? -6.882  1.862   -2.723  1.00 0.00 ? 64 ILE A HB   2  
ATOM 2811  H HG12 . ILE A 1 68 ? -6.640  1.823   0.293   1.00 0.00 ? 64 ILE A HG12 2  
ATOM 2812  H HG13 . ILE A 1 68 ? -5.316  2.204   -0.802  1.00 0.00 ? 64 ILE A HG13 2  
ATOM 2813  H HG21 . ILE A 1 68 ? -8.978  2.281   -1.528  1.00 0.00 ? 64 ILE A HG21 2  
ATOM 2814  H HG22 . ILE A 1 68 ? -8.740  0.802   -0.595  1.00 0.00 ? 64 ILE A HG22 2  
ATOM 2815  H HG23 . ILE A 1 68 ? -8.997  0.713   -2.338  1.00 0.00 ? 64 ILE A HG23 2  
ATOM 2816  H HD11 . ILE A 1 68 ? -6.652  4.101   -1.668  1.00 0.00 ? 64 ILE A HD11 2  
ATOM 2817  H HD12 . ILE A 1 68 ? -6.236  4.238   0.040   1.00 0.00 ? 64 ILE A HD12 2  
ATOM 2818  H HD13 . ILE A 1 68 ? -7.865  3.755   -0.436  1.00 0.00 ? 64 ILE A HD13 2  
ATOM 2819  N N    . ALA A 1 69 ? -6.688  -0.627  -4.152  1.00 0.00 ? 65 ALA A N    2  
ATOM 2820  C CA   . ALA A 1 69 ? -7.256  -1.365  -5.279  1.00 0.00 ? 65 ALA A CA   2  
ATOM 2821  C C    . ALA A 1 69 ? -6.919  -2.850  -5.181  1.00 0.00 ? 65 ALA A C    2  
ATOM 2822  O O    . ALA A 1 69 ? -7.743  -3.710  -5.495  1.00 0.00 ? 65 ALA A O    2  
ATOM 2823  C CB   . ALA A 1 69 ? -6.750  -0.786  -6.591  1.00 0.00 ? 65 ALA A CB   2  
ATOM 2824  H H    . ALA A 1 69 ? -6.000  0.056   -4.324  1.00 0.00 ? 65 ALA A H    2  
ATOM 2825  H HA   . ALA A 1 69 ? -8.327  -1.246  -5.251  1.00 0.00 ? 65 ALA A HA   2  
ATOM 2826  H HB1  . ALA A 1 69 ? -7.010  0.259   -6.646  1.00 0.00 ? 65 ALA A HB1  2  
ATOM 2827  H HB2  . ALA A 1 69 ? -7.200  -1.316  -7.417  1.00 0.00 ? 65 ALA A HB2  2  
ATOM 2828  H HB3  . ALA A 1 69 ? -5.674  -0.892  -6.638  1.00 0.00 ? 65 ALA A HB3  2  
ATOM 2829  N N    . TYR A 1 70 ? -5.701  -3.133  -4.737  1.00 0.00 ? 66 TYR A N    2  
ATOM 2830  C CA   . TYR A 1 70 ? -5.222  -4.501  -4.565  1.00 0.00 ? 66 TYR A CA   2  
ATOM 2831  C C    . TYR A 1 70 ? -6.142  -5.261  -3.610  1.00 0.00 ? 66 TYR A C    2  
ATOM 2832  O O    . TYR A 1 70 ? -6.616  -6.356  -3.921  1.00 0.00 ? 66 TYR A O    2  
ATOM 2833  C CB   . TYR A 1 70 ? -3.772  -4.454  -4.047  1.00 0.00 ? 66 TYR A CB   2  
ATOM 2834  C CG   . TYR A 1 70 ? -3.263  -5.711  -3.369  1.00 0.00 ? 66 TYR A CG   2  
ATOM 2835  C CD1  . TYR A 1 70 ? -2.802  -6.793  -4.109  1.00 0.00 ? 66 TYR A CD1  2  
ATOM 2836  C CD2  . TYR A 1 70 ? -3.208  -5.793  -1.983  1.00 0.00 ? 66 TYR A CD2  2  
ATOM 2837  C CE1  . TYR A 1 70 ? -2.302  -7.921  -3.484  1.00 0.00 ? 66 TYR A CE1  2  
ATOM 2838  C CE2  . TYR A 1 70 ? -2.717  -6.917  -1.354  1.00 0.00 ? 66 TYR A CE2  2  
ATOM 2839  C CZ   . TYR A 1 70 ? -2.263  -7.978  -2.107  1.00 0.00 ? 66 TYR A CZ   2  
ATOM 2840  O OH   . TYR A 1 70 ? -1.752  -9.090  -1.481  1.00 0.00 ? 66 TYR A OH   2  
ATOM 2841  H H    . TYR A 1 70 ? -5.097  -2.389  -4.517  1.00 0.00 ? 66 TYR A H    2  
ATOM 2842  H HA   . TYR A 1 70 ? -5.238  -4.984  -5.531  1.00 0.00 ? 66 TYR A HA   2  
ATOM 2843  H HB2  . TYR A 1 70 ? -3.115  -4.254  -4.878  1.00 0.00 ? 66 TYR A HB2  2  
ATOM 2844  H HB3  . TYR A 1 70 ? -3.687  -3.643  -3.338  1.00 0.00 ? 66 TYR A HB3  2  
ATOM 2845  H HD1  . TYR A 1 70 ? -2.837  -6.746  -5.187  1.00 0.00 ? 66 TYR A HD1  2  
ATOM 2846  H HD2  . TYR A 1 70 ? -3.566  -4.962  -1.394  1.00 0.00 ? 66 TYR A HD2  2  
ATOM 2847  H HE1  . TYR A 1 70 ? -1.949  -8.754  -4.073  1.00 0.00 ? 66 TYR A HE1  2  
ATOM 2848  H HE2  . TYR A 1 70 ? -2.688  -6.962  -0.276  1.00 0.00 ? 66 TYR A HE2  2  
ATOM 2849  H HH   . TYR A 1 70 ? -0.788  -9.097  -1.586  1.00 0.00 ? 66 TYR A HH   2  
ATOM 2850  N N    . SER A 1 71 ? -6.398  -4.667  -2.454  1.00 0.00 ? 67 SER A N    2  
ATOM 2851  C CA   . SER A 1 71 ? -7.274  -5.265  -1.456  1.00 0.00 ? 67 SER A CA   2  
ATOM 2852  C C    . SER A 1 71 ? -8.728  -5.317  -1.934  1.00 0.00 ? 67 SER A C    2  
ATOM 2853  O O    . SER A 1 71 ? -9.496  -6.180  -1.502  1.00 0.00 ? 67 SER A O    2  
ATOM 2854  C CB   . SER A 1 71 ? -7.164  -4.497  -0.141  1.00 0.00 ? 67 SER A CB   2  
ATOM 2855  O OG   . SER A 1 71 ? -5.813  -4.411  0.266   1.00 0.00 ? 67 SER A OG   2  
ATOM 2856  H H    . SER A 1 71 ? -5.935  -3.823  -2.245  1.00 0.00 ? 67 SER A H    2  
ATOM 2857  H HA   . SER A 1 71 ? -6.934  -6.276  -1.291  1.00 0.00 ? 67 SER A HA   2  
ATOM 2858  H HB2  . SER A 1 71 ? -7.556  -3.499  -0.271  1.00 0.00 ? 67 SER A HB2  2  
ATOM 2859  H HB3  . SER A 1 71 ? -7.725  -5.011  0.626   1.00 0.00 ? 67 SER A HB3  2  
ATOM 2860  H HG   . SER A 1 71 ? -5.463  -5.300  0.400   1.00 0.00 ? 67 SER A HG   2  
ATOM 2861  N N    . LEU A 1 72 ? -9.107  -4.401  -2.820  1.00 0.00 ? 68 LEU A N    2  
ATOM 2862  C CA   . LEU A 1 72 ? -10.467 -4.371  -3.348  1.00 0.00 ? 68 LEU A CA   2  
ATOM 2863  C C    . LEU A 1 72 ? -10.752 -5.610  -4.184  1.00 0.00 ? 68 LEU A C    2  
ATOM 2864  O O    . LEU A 1 72 ? -11.879 -6.112  -4.201  1.00 0.00 ? 68 LEU A O    2  
ATOM 2865  C CB   . LEU A 1 72 ? -10.695 -3.117  -4.196  1.00 0.00 ? 68 LEU A CB   2  
ATOM 2866  C CG   . LEU A 1 72 ? -11.226 -1.901  -3.437  1.00 0.00 ? 68 LEU A CG   2  
ATOM 2867  C CD1  . LEU A 1 72 ? -11.170 -0.659  -4.314  1.00 0.00 ? 68 LEU A CD1  2  
ATOM 2868  C CD2  . LEU A 1 72 ? -12.648 -2.153  -2.962  1.00 0.00 ? 68 LEU A CD2  2  
ATOM 2869  H H    . LEU A 1 72 ? -8.468  -3.716  -3.121  1.00 0.00 ? 68 LEU A H    2  
ATOM 2870  H HA   . LEU A 1 72 ? -11.148 -4.354  -2.509  1.00 0.00 ? 68 LEU A HA   2  
ATOM 2871  H HB2  . LEU A 1 72 ? -9.756  -2.848  -4.658  1.00 0.00 ? 68 LEU A HB2  2  
ATOM 2872  H HB3  . LEU A 1 72 ? -11.401 -3.362  -4.974  1.00 0.00 ? 68 LEU A HB3  2  
ATOM 2873  H HG   . LEU A 1 72 ? -10.608 -1.725  -2.570  1.00 0.00 ? 68 LEU A HG   2  
ATOM 2874  H HD11 . LEU A 1 72 ? -11.597 0.178   -3.781  1.00 0.00 ? 68 LEU A HD11 2  
ATOM 2875  H HD12 . LEU A 1 72 ? -11.729 -0.833  -5.220  1.00 0.00 ? 68 LEU A HD12 2  
ATOM 2876  H HD13 . LEU A 1 72 ? -10.142 -0.439  -4.562  1.00 0.00 ? 68 LEU A HD13 2  
ATOM 2877  H HD21 . LEU A 1 72 ? -12.656 -2.989  -2.278  1.00 0.00 ? 68 LEU A HD21 2  
ATOM 2878  H HD22 . LEU A 1 72 ? -13.276 -2.379  -3.812  1.00 0.00 ? 68 LEU A HD22 2  
ATOM 2879  H HD23 . LEU A 1 72 ? -13.023 -1.274  -2.460  1.00 0.00 ? 68 LEU A HD23 2  
ATOM 2880  N N    . LEU A 1 73 ? -9.726  -6.098  -4.876  1.00 0.00 ? 69 LEU A N    2  
ATOM 2881  C CA   . LEU A 1 73 ? -9.860  -7.285  -5.710  1.00 0.00 ? 69 LEU A CA   2  
ATOM 2882  C C    . LEU A 1 73 ? -10.305 -8.469  -4.861  1.00 0.00 ? 69 LEU A C    2  
ATOM 2883  O O    . LEU A 1 73 ? -11.170 -9.246  -5.265  1.00 0.00 ? 69 LEU A O    2  
ATOM 2884  C CB   . LEU A 1 73 ? -8.533  -7.612  -6.405  1.00 0.00 ? 69 LEU A CB   2  
ATOM 2885  C CG   . LEU A 1 73 ? -7.930  -6.477  -7.238  1.00 0.00 ? 69 LEU A CG   2  
ATOM 2886  C CD1  . LEU A 1 73 ? -6.543  -6.862  -7.732  1.00 0.00 ? 69 LEU A CD1  2  
ATOM 2887  C CD2  . LEU A 1 73 ? -8.833  -6.130  -8.414  1.00 0.00 ? 69 LEU A CD2  2  
ATOM 2888  H H    . LEU A 1 73 ? -8.855  -5.643  -4.825  1.00 0.00 ? 69 LEU A H    2  
ATOM 2889  H HA   . LEU A 1 73 ? -10.613 -7.086  -6.457  1.00 0.00 ? 69 LEU A HA   2  
ATOM 2890  H HB2  . LEU A 1 73 ? -7.817  -7.893  -5.647  1.00 0.00 ? 69 LEU A HB2  2  
ATOM 2891  H HB3  . LEU A 1 73 ? -8.693  -8.459  -7.055  1.00 0.00 ? 69 LEU A HB3  2  
ATOM 2892  H HG   . LEU A 1 73 ? -7.831  -5.597  -6.619  1.00 0.00 ? 69 LEU A HG   2  
ATOM 2893  H HD11 . LEU A 1 73 ? -6.611  -7.753  -8.339  1.00 0.00 ? 69 LEU A HD11 2  
ATOM 2894  H HD12 . LEU A 1 73 ? -5.899  -7.052  -6.886  1.00 0.00 ? 69 LEU A HD12 2  
ATOM 2895  H HD13 . LEU A 1 73 ? -6.133  -6.054  -8.321  1.00 0.00 ? 69 LEU A HD13 2  
ATOM 2896  H HD21 . LEU A 1 73 ? -9.795  -5.804  -8.047  1.00 0.00 ? 69 LEU A HD21 2  
ATOM 2897  H HD22 . LEU A 1 73 ? -8.963  -7.002  -9.038  1.00 0.00 ? 69 LEU A HD22 2  
ATOM 2898  H HD23 . LEU A 1 73 ? -8.382  -5.338  -8.994  1.00 0.00 ? 69 LEU A HD23 2  
ATOM 2899  N N    . GLY A 1 74 ? -9.725  -8.579  -3.669  1.00 0.00 ? 70 GLY A N    2  
ATOM 2900  C CA   . GLY A 1 74 ? -10.070 -9.660  -2.770  1.00 0.00 ? 70 GLY A CA   2  
ATOM 2901  C C    . GLY A 1 74 ? -11.511 -9.575  -2.313  1.00 0.00 ? 70 GLY A C    2  
ATOM 2902  O O    . GLY A 1 74 ? -12.205 -10.583 -2.250  1.00 0.00 ? 70 GLY A O    2  
ATOM 2903  H H    . GLY A 1 74 ? -9.055  -7.913  -3.398  1.00 0.00 ? 70 GLY A H    2  
ATOM 2904  H HA2  . GLY A 1 74 ? -9.919  -10.601 -3.279  1.00 0.00 ? 70 GLY A HA2  2  
ATOM 2905  H HA3  . GLY A 1 74 ? -9.425  -9.620  -1.906  1.00 0.00 ? 70 GLY A HA3  2  
ATOM 2906  N N    . LEU A 1 75 ? -11.962 -8.363  -2.006  1.00 0.00 ? 71 LEU A N    2  
ATOM 2907  C CA   . LEU A 1 75 ? -13.333 -8.143  -1.556  1.00 0.00 ? 71 LEU A CA   2  
ATOM 2908  C C    . LEU A 1 75 ? -14.344 -8.585  -2.610  1.00 0.00 ? 71 LEU A C    2  
ATOM 2909  O O    . LEU A 1 75 ? -15.343 -9.235  -2.291  1.00 0.00 ? 71 LEU A O    2  
ATOM 2910  C CB   . LEU A 1 75 ? -13.559 -6.668  -1.216  1.00 0.00 ? 71 LEU A CB   2  
ATOM 2911  C CG   . LEU A 1 75 ? -13.396 -6.298  0.262   1.00 0.00 ? 71 LEU A CG   2  
ATOM 2912  C CD1  . LEU A 1 75 ? -13.939 -4.902  0.521   1.00 0.00 ? 71 LEU A CD1  2  
ATOM 2913  C CD2  . LEU A 1 75 ? -14.090 -7.316  1.160   1.00 0.00 ? 71 LEU A CD2  2  
ATOM 2914  H H    . LEU A 1 75 ? -11.351 -7.599  -2.072  1.00 0.00 ? 71 LEU A H    2  
ATOM 2915  H HA   . LEU A 1 75 ? -13.484 -8.732  -0.665  1.00 0.00 ? 71 LEU A HA   2  
ATOM 2916  H HB2  . LEU A 1 75 ? -12.860 -6.079  -1.790  1.00 0.00 ? 71 LEU A HB2  2  
ATOM 2917  H HB3  . LEU A 1 75 ? -14.560 -6.403  -1.519  1.00 0.00 ? 71 LEU A HB3  2  
ATOM 2918  H HG   . LEU A 1 75 ? -12.344 -6.296  0.511   1.00 0.00 ? 71 LEU A HG   2  
ATOM 2919  H HD11 . LEU A 1 75 ? -13.343 -4.178  -0.016  1.00 0.00 ? 71 LEU A HD11 2  
ATOM 2920  H HD12 . LEU A 1 75 ? -13.898 -4.688  1.578   1.00 0.00 ? 71 LEU A HD12 2  
ATOM 2921  H HD13 . LEU A 1 75 ? -14.963 -4.844  0.182   1.00 0.00 ? 71 LEU A HD13 2  
ATOM 2922  H HD21 . LEU A 1 75 ? -13.427 -8.149  1.342   1.00 0.00 ? 71 LEU A HD21 2  
ATOM 2923  H HD22 . LEU A 1 75 ? -14.988 -7.669  0.677   1.00 0.00 ? 71 LEU A HD22 2  
ATOM 2924  H HD23 . LEU A 1 75 ? -14.348 -6.850  2.100   1.00 0.00 ? 71 LEU A HD23 2  
ATOM 2925  N N    . LYS A 1 76 ? -14.084 -8.241  -3.867  1.00 0.00 ? 72 LYS A N    2  
ATOM 2926  C CA   . LYS A 1 76 ? -14.983 -8.613  -4.950  1.00 0.00 ? 72 LYS A CA   2  
ATOM 2927  C C    . LYS A 1 76 ? -14.953 -10.123 -5.165  1.00 0.00 ? 72 LYS A C    2  
ATOM 2928  O O    . LYS A 1 76 ? -15.988 -10.748 -5.389  1.00 0.00 ? 72 LYS A O    2  
ATOM 2929  C CB   . LYS A 1 76 ? -14.619 -7.869  -6.238  1.00 0.00 ? 72 LYS A CB   2  
ATOM 2930  C CG   . LYS A 1 76 ? -14.790 -6.360  -6.124  1.00 0.00 ? 72 LYS A CG   2  
ATOM 2931  C CD   . LYS A 1 76 ? -14.854 -5.693  -7.489  1.00 0.00 ? 72 LYS A CD   2  
ATOM 2932  C CE   . LYS A 1 76 ? -14.982 -4.179  -7.361  1.00 0.00 ? 72 LYS A CE   2  
ATOM 2933  N NZ   . LYS A 1 76 ? -15.140 -3.513  -8.683  1.00 0.00 ? 72 LYS A NZ   2  
ATOM 2934  H H    . LYS A 1 76 ? -13.269 -7.728  -4.067  1.00 0.00 ? 72 LYS A H    2  
ATOM 2935  H HA   . LYS A 1 76 ? -15.983 -8.331  -4.654  1.00 0.00 ? 72 LYS A HA   2  
ATOM 2936  H HB2  . LYS A 1 76 ? -13.588 -8.079  -6.483  1.00 0.00 ? 72 LYS A HB2  2  
ATOM 2937  H HB3  . LYS A 1 76 ? -15.251 -8.225  -7.039  1.00 0.00 ? 72 LYS A HB3  2  
ATOM 2938  H HG2  . LYS A 1 76 ? -15.705 -6.153  -5.591  1.00 0.00 ? 72 LYS A HG2  2  
ATOM 2939  H HG3  . LYS A 1 76 ? -13.952 -5.956  -5.574  1.00 0.00 ? 72 LYS A HG3  2  
ATOM 2940  H HD2  . LYS A 1 76 ? -13.952 -5.925  -8.034  1.00 0.00 ? 72 LYS A HD2  2  
ATOM 2941  H HD3  . LYS A 1 76 ? -15.710 -6.074  -8.026  1.00 0.00 ? 72 LYS A HD3  2  
ATOM 2942  H HE2  . LYS A 1 76 ? -15.846 -3.955  -6.753  1.00 0.00 ? 72 LYS A HE2  2  
ATOM 2943  H HE3  . LYS A 1 76 ? -14.095 -3.796  -6.879  1.00 0.00 ? 72 LYS A HE3  2  
ATOM 2944  H HZ1  . LYS A 1 76 ? -14.346 -3.761  -9.308  1.00 0.00 ? 72 LYS A HZ1  2  
ATOM 2945  H HZ2  . LYS A 1 76 ? -15.161 -2.480  -8.565  1.00 0.00 ? 72 LYS A HZ2  2  
ATOM 2946  H HZ3  . LYS A 1 76 ? -16.028 -3.814  -9.134  1.00 0.00 ? 72 LYS A HZ3  2  
ATOM 2947  N N    . ASP A 1 77 ? -13.765 -10.707 -5.092  1.00 0.00 ? 73 ASP A N    2  
ATOM 2948  C CA   . ASP A 1 77 ? -13.612 -12.150 -5.247  1.00 0.00 ? 73 ASP A CA   2  
ATOM 2949  C C    . ASP A 1 77 ? -14.326 -12.880 -4.108  1.00 0.00 ? 73 ASP A C    2  
ATOM 2950  O O    . ASP A 1 77 ? -15.022 -13.872 -4.328  1.00 0.00 ? 73 ASP A O    2  
ATOM 2951  C CB   . ASP A 1 77 ? -12.125 -12.521 -5.272  1.00 0.00 ? 73 ASP A CB   2  
ATOM 2952  C CG   . ASP A 1 77 ? -11.887 -14.015 -5.164  1.00 0.00 ? 73 ASP A CG   2  
ATOM 2953  O OD1  . ASP A 1 77 ? -12.280 -14.756 -6.087  1.00 0.00 ? 73 ASP A OD1  2  
ATOM 2954  O OD2  . ASP A 1 77 ? -11.293 -14.452 -4.158  1.00 0.00 ? 73 ASP A OD2  2  
ATOM 2955  H H    . ASP A 1 77 ? -12.964 -10.153 -4.957  1.00 0.00 ? 73 ASP A H    2  
ATOM 2956  H HA   . ASP A 1 77 ? -14.065 -12.433 -6.185  1.00 0.00 ? 73 ASP A HA   2  
ATOM 2957  H HB2  . ASP A 1 77 ? -11.691 -12.176 -6.199  1.00 0.00 ? 73 ASP A HB2  2  
ATOM 2958  H HB3  . ASP A 1 77 ? -11.627 -12.035 -4.446  1.00 0.00 ? 73 ASP A HB3  2  
ATOM 2959  N N    . GLN A 1 78 ? -14.174 -12.351 -2.897  1.00 0.00 ? 74 GLN A N    2  
ATOM 2960  C CA   . GLN A 1 78 ? -14.797 -12.922 -1.706  1.00 0.00 ? 74 GLN A CA   2  
ATOM 2961  C C    . GLN A 1 78 ? -16.317 -12.980 -1.839  1.00 0.00 ? 74 GLN A C    2  
ATOM 2962  O O    . GLN A 1 78 ? -16.932 -14.002 -1.536  1.00 0.00 ? 74 GLN A O    2  
ATOM 2963  C CB   . GLN A 1 78 ? -14.434 -12.107 -0.462  1.00 0.00 ? 74 GLN A CB   2  
ATOM 2964  C CG   . GLN A 1 78 ? -13.084 -12.466 0.141   1.00 0.00 ? 74 GLN A CG   2  
ATOM 2965  C CD   . GLN A 1 78 ? -13.096 -13.797 0.865   1.00 0.00 ? 74 GLN A CD   2  
ATOM 2966  O OE1  . GLN A 1 78 ? -13.725 -14.760 0.425   1.00 0.00 ? 74 GLN A OE1  2  
ATOM 2967  N NE2  . GLN A 1 78 ? -12.415 -13.855 1.997   1.00 0.00 ? 74 GLN A NE2  2  
ATOM 2968  H H    . GLN A 1 78 ? -13.608 -11.552 -2.798  1.00 0.00 ? 74 GLN A H    2  
ATOM 2969  H HA   . GLN A 1 78 ? -14.421 -13.926 -1.587  1.00 0.00 ? 74 GLN A HA   2  
ATOM 2970  H HB2  . GLN A 1 78 ? -14.416 -11.059 -0.726  1.00 0.00 ? 74 GLN A HB2  2  
ATOM 2971  H HB3  . GLN A 1 78 ? -15.192 -12.263 0.291   1.00 0.00 ? 74 GLN A HB3  2  
ATOM 2972  H HG2  . GLN A 1 78 ? -12.354 -12.514 -0.652  1.00 0.00 ? 74 GLN A HG2  2  
ATOM 2973  H HG3  . GLN A 1 78 ? -12.800 -11.693 0.842   1.00 0.00 ? 74 GLN A HG3  2  
ATOM 2974  H HE21 . GLN A 1 78 ? -11.948 -13.045 2.300   1.00 0.00 ? 74 GLN A HE21 2  
ATOM 2975  H HE22 . GLN A 1 78 ? -12.404 -14.703 2.489   1.00 0.00 ? 74 GLN A HE22 2  
ATOM 2976  N N    . VAL A 1 79 ? -16.916 -11.893 -2.316  1.00 0.00 ? 75 VAL A N    2  
ATOM 2977  C CA   . VAL A 1 79 ? -18.371 -11.833 -2.469  1.00 0.00 ? 75 VAL A CA   2  
ATOM 2978  C C    . VAL A 1 79 ? -18.846 -12.727 -3.620  1.00 0.00 ? 75 VAL A C    2  
ATOM 2979  O O    . VAL A 1 79 ? -20.043 -12.959 -3.789  1.00 0.00 ? 75 VAL A O    2  
ATOM 2980  C CB   . VAL A 1 79 ? -18.867 -10.379 -2.677  1.00 0.00 ? 75 VAL A CB   2  
ATOM 2981  C CG1  . VAL A 1 79 ? -18.735 -9.939  -4.130  1.00 0.00 ? 75 VAL A CG1  2  
ATOM 2982  C CG2  . VAL A 1 79 ? -20.303 -10.232 -2.195  1.00 0.00 ? 75 VAL A CG2  2  
ATOM 2983  H H    . VAL A 1 79 ? -16.377 -11.112 -2.568  1.00 0.00 ? 75 VAL A H    2  
ATOM 2984  H HA   . VAL A 1 79 ? -18.804 -12.203 -1.552  1.00 0.00 ? 75 VAL A HA   2  
ATOM 2985  H HB   . VAL A 1 79 ? -18.247 -9.728  -2.077  1.00 0.00 ? 75 VAL A HB   2  
ATOM 2986  H HG11 . VAL A 1 79 ? -19.312 -10.602 -4.759  1.00 0.00 ? 75 VAL A HG11 2  
ATOM 2987  H HG12 . VAL A 1 79 ? -17.697 -9.976  -4.426  1.00 0.00 ? 75 VAL A HG12 2  
ATOM 2988  H HG13 . VAL A 1 79 ? -19.105 -8.930  -4.236  1.00 0.00 ? 75 VAL A HG13 2  
ATOM 2989  H HG21 . VAL A 1 79 ? -20.371 -10.540 -1.160  1.00 0.00 ? 75 VAL A HG21 2  
ATOM 2990  H HG22 . VAL A 1 79 ? -20.950 -10.853 -2.797  1.00 0.00 ? 75 VAL A HG22 2  
ATOM 2991  H HG23 . VAL A 1 79 ? -20.609 -9.200  -2.284  1.00 0.00 ? 75 VAL A HG23 2  
ATOM 2992  N N    . ASN A 1 80 ? -17.904 -13.225 -4.411  1.00 0.00 ? 76 ASN A N    2  
ATOM 2993  C CA   . ASN A 1 80 ? -18.235 -14.102 -5.526  1.00 0.00 ? 76 ASN A CA   2  
ATOM 2994  C C    . ASN A 1 80 ? -17.986 -15.552 -5.149  1.00 0.00 ? 76 ASN A C    2  
ATOM 2995  O O    . ASN A 1 80 ? -18.321 -16.467 -5.899  1.00 0.00 ? 76 ASN A O    2  
ATOM 2996  C CB   . ASN A 1 80 ? -17.436 -13.735 -6.777  1.00 0.00 ? 76 ASN A CB   2  
ATOM 2997  C CG   . ASN A 1 80 ? -18.114 -12.645 -7.583  1.00 0.00 ? 76 ASN A CG   2  
ATOM 2998  O OD1  . ASN A 1 80 ? -19.012 -12.914 -8.379  1.00 0.00 ? 76 ASN A OD1  2  
ATOM 2999  N ND2  . ASN A 1 80 ? -17.703 -11.407 -7.373  1.00 0.00 ? 76 ASN A ND2  2  
ATOM 3000  H H    . ASN A 1 80 ? -16.964 -12.996 -4.241  1.00 0.00 ? 76 ASN A H    2  
ATOM 3001  H HA   . ASN A 1 80 ? -19.285 -13.981 -5.736  1.00 0.00 ? 76 ASN A HA   2  
ATOM 3002  H HB2  . ASN A 1 80 ? -16.455 -13.388 -6.487  1.00 0.00 ? 76 ASN A HB2  2  
ATOM 3003  H HB3  . ASN A 1 80 ? -17.335 -14.610 -7.403  1.00 0.00 ? 76 ASN A HB3  2  
ATOM 3004  H HD21 . ASN A 1 80 ? -16.986 -11.259 -6.712  1.00 0.00 ? 76 ASN A HD21 2  
ATOM 3005  H HD22 . ASN A 1 80 ? -18.130 -10.684 -7.879  1.00 0.00 ? 76 ASN A HD22 2  
ATOM 3006  N N    . THR A 1 81 ? -17.399 -15.754 -3.982  1.00 0.00 ? 77 THR A N    2  
ATOM 3007  C CA   . THR A 1 81 ? -17.119 -17.090 -3.498  1.00 0.00 ? 77 THR A CA   2  
ATOM 3008  C C    . THR A 1 81 ? -18.292 -17.594 -2.661  1.00 0.00 ? 77 THR A C    2  
ATOM 3009  O O    . THR A 1 81 ? -18.745 -16.917 -1.732  1.00 0.00 ? 77 THR A O    2  
ATOM 3010  C CB   . THR A 1 81 ? -15.820 -17.126 -2.665  1.00 0.00 ? 77 THR A CB   2  
ATOM 3011  O OG1  . THR A 1 81 ? -14.779 -16.403 -3.346  1.00 0.00 ? 77 THR A OG1  2  
ATOM 3012  C CG2  . THR A 1 81 ? -15.368 -18.561 -2.429  1.00 0.00 ? 77 THR A CG2  2  
ATOM 3013  H H    . THR A 1 81 ? -17.147 -14.983 -3.430  1.00 0.00 ? 77 THR A H    2  
ATOM 3014  H HA   . THR A 1 81 ? -16.995 -17.736 -4.355  1.00 0.00 ? 77 THR A HA   2  
ATOM 3015  H HB   . THR A 1 81 ? -16.007 -16.659 -1.708  1.00 0.00 ? 77 THR A HB   2  
ATOM 3016  H HG1  . THR A 1 81 ? -15.146 -15.594 -3.734  1.00 0.00 ? 77 THR A HG1  2  
ATOM 3017  H HG21 . THR A 1 81 ? -16.130 -19.091 -1.876  1.00 0.00 ? 77 THR A HG21 2  
ATOM 3018  H HG22 . THR A 1 81 ? -14.447 -18.561 -1.864  1.00 0.00 ? 77 THR A HG22 2  
ATOM 3019  H HG23 . THR A 1 81 ? -15.207 -19.049 -3.380  1.00 0.00 ? 77 THR A HG23 2  
ATOM 3020  N N    . VAL A 1 82 ? -18.800 -18.761 -3.020  1.00 0.00 ? 78 VAL A N    2  
ATOM 3021  C CA   . VAL A 1 82 ? -19.918 -19.369 -2.313  1.00 0.00 ? 78 VAL A CA   2  
ATOM 3022  C C    . VAL A 1 82 ? -19.542 -20.772 -1.866  1.00 0.00 ? 78 VAL A C    2  
ATOM 3023  O O    . VAL A 1 82 ? -20.447 -21.574 -1.556  1.00 0.00 ? 78 VAL A O    2  
ATOM 3024  C CB   . VAL A 1 82 ? -21.196 -19.434 -3.184  1.00 0.00 ? 78 VAL A CB   2  
ATOM 3025  C CG1  . VAL A 1 82 ? -21.823 -18.057 -3.336  1.00 0.00 ? 78 VAL A CG1  2  
ATOM 3026  C CG2  . VAL A 1 82 ? -20.891 -20.034 -4.547  1.00 0.00 ? 78 VAL A CG2  2  
ATOM 3027  O OXT  . VAL A 1 82 ? -18.334 -21.071 -1.839  1.00 0.00 ? 78 VAL A OXT  2  
ATOM 3028  H H    . VAL A 1 82 ? -18.397 -19.239 -3.776  1.00 0.00 ? 78 VAL A H    2  
ATOM 3029  H HA   . VAL A 1 82 ? -20.129 -18.767 -1.442  1.00 0.00 ? 78 VAL A HA   2  
ATOM 3030  H HB   . VAL A 1 82 ? -21.911 -20.073 -2.689  1.00 0.00 ? 78 VAL A HB   2  
ATOM 3031  H HG11 . VAL A 1 82 ? -22.137 -17.695 -2.368  1.00 0.00 ? 78 VAL A HG11 2  
ATOM 3032  H HG12 . VAL A 1 82 ? -22.680 -18.122 -3.991  1.00 0.00 ? 78 VAL A HG12 2  
ATOM 3033  H HG13 . VAL A 1 82 ? -21.098 -17.375 -3.758  1.00 0.00 ? 78 VAL A HG13 2  
ATOM 3034  H HG21 . VAL A 1 82 ? -20.158 -19.424 -5.053  1.00 0.00 ? 78 VAL A HG21 2  
ATOM 3035  H HG22 . VAL A 1 82 ? -21.796 -20.071 -5.134  1.00 0.00 ? 78 VAL A HG22 2  
ATOM 3036  H HG23 . VAL A 1 82 ? -20.502 -21.034 -4.421  1.00 0.00 ? 78 VAL A HG23 2  
ATOM 3037  N N    . GLY B 2 18 ? 9.364   6.403   9.834   1.00 0.00 ? 28 GLY B N    2  
ATOM 3038  C CA   . GLY B 2 18 ? 8.495   5.209   9.980   1.00 0.00 ? 28 GLY B CA   2  
ATOM 3039  C C    . GLY B 2 18 ? 9.288   3.921   9.941   1.00 0.00 ? 28 GLY B C    2  
ATOM 3040  O O    . GLY B 2 18 ? 8.986   2.975   10.671  1.00 0.00 ? 28 GLY B O    2  
ATOM 3041  H H    . GLY B 2 18 ? 8.790   7.269   9.868   1.00 0.00 ? 28 GLY B H    2  
ATOM 3042  H HA2  . GLY B 2 18 ? 7.975   5.268   10.924  1.00 0.00 ? 28 GLY B HA2  2  
ATOM 3043  H HA3  . GLY B 2 18 ? 7.771   5.199   9.179   1.00 0.00 ? 28 GLY B HA3  2  
ATOM 3044  N N    . MET B 2 19 ? 10.306  3.880   9.092   1.00 0.00 ? 29 MET B N    2  
ATOM 3045  C CA   . MET B 2 19 ? 11.146  2.703   8.963   1.00 0.00 ? 29 MET B CA   2  
ATOM 3046  C C    . MET B 2 19 ? 12.590  3.100   8.674   1.00 0.00 ? 29 MET B C    2  
ATOM 3047  O O    . MET B 2 19 ? 13.339  2.344   8.057   1.00 0.00 ? 29 MET B O    2  
ATOM 3048  C CB   . MET B 2 19 ? 10.615  1.783   7.859   1.00 0.00 ? 29 MET B CB   2  
ATOM 3049  C CG   . MET B 2 19 ? 10.444  2.467   6.515   1.00 0.00 ? 29 MET B CG   2  
ATOM 3050  S SD   . MET B 2 19 ? 9.764   1.367   5.261   1.00 0.00 ? 29 MET B SD   2  
ATOM 3051  C CE   . MET B 2 19 ? 9.572   2.504   3.892   1.00 0.00 ? 29 MET B CE   2  
ATOM 3052  H H    . MET B 2 19 ? 10.499  4.671   8.529   1.00 0.00 ? 29 MET B H    2  
ATOM 3053  H HA   . MET B 2 19 ? 11.116  2.173   9.903   1.00 0.00 ? 29 MET B HA   2  
ATOM 3054  H HB2  . MET B 2 19 ? 11.303  0.961   7.733   1.00 0.00 ? 29 MET B HB2  2  
ATOM 3055  H HB3  . MET B 2 19 ? 9.655   1.393   8.164   1.00 0.00 ? 29 MET B HB3  2  
ATOM 3056  H HG2  . MET B 2 19 ? 9.777   3.308   6.635   1.00 0.00 ? 29 MET B HG2  2  
ATOM 3057  H HG3  . MET B 2 19 ? 11.409  2.821   6.179   1.00 0.00 ? 29 MET B HG3  2  
ATOM 3058  H HE1  . MET B 2 19 ? 8.935   3.323   4.192   1.00 0.00 ? 29 MET B HE1  2  
ATOM 3059  H HE2  . MET B 2 19 ? 9.126   1.989   3.056   1.00 0.00 ? 29 MET B HE2  2  
ATOM 3060  H HE3  . MET B 2 19 ? 10.541  2.887   3.606   1.00 0.00 ? 29 MET B HE3  2  
ATOM 3061  N N    . SER B 2 20 ? 12.975  4.293   9.114   1.00 0.00 ? 30 SER B N    2  
ATOM 3062  C CA   . SER B 2 20 ? 14.332  4.779   8.919   1.00 0.00 ? 30 SER B CA   2  
ATOM 3063  C C    . SER B 2 20 ? 15.326  3.830   9.585   1.00 0.00 ? 30 SER B C    2  
ATOM 3064  O O    . SER B 2 20 ? 16.281  3.381   8.955   1.00 0.00 ? 30 SER B O    2  
ATOM 3065  C CB   . SER B 2 20 ? 14.460  6.188   9.498   1.00 0.00 ? 30 SER B CB   2  
ATOM 3066  O OG   . SER B 2 20 ? 13.219  6.868   9.428   1.00 0.00 ? 30 SER B OG   2  
ATOM 3067  H H    . SER B 2 20 ? 12.324  4.878   9.563   1.00 0.00 ? 30 SER B H    2  
ATOM 3068  H HA   . SER B 2 20 ? 14.528  4.810   7.857   1.00 0.00 ? 30 SER B HA   2  
ATOM 3069  H HB2  . SER B 2 20 ? 14.766  6.126   10.532  1.00 0.00 ? 30 SER B HB2  2  
ATOM 3070  H HB3  . SER B 2 20 ? 15.195  6.743   8.934   1.00 0.00 ? 30 SER B HB3  2  
ATOM 3071  H HG   . SER B 2 20 ? 12.938  6.939   8.498   1.00 0.00 ? 30 SER B HG   2  
ATOM 3072  N N    . ALA B 2 21 ? 15.097  3.558   10.871  1.00 0.00 ? 31 ALA B N    2  
ATOM 3073  C CA   . ALA B 2 21 ? 15.935  2.629   11.633  1.00 0.00 ? 31 ALA B CA   2  
ATOM 3074  C C    . ALA B 2 21 ? 16.038  1.282   10.918  1.00 0.00 ? 31 ALA B C    2  
ATOM 3075  O O    . ALA B 2 21 ? 17.085  0.635   10.931  1.00 0.00 ? 31 ALA B O    2  
ATOM 3076  C CB   . ALA B 2 21 ? 15.384  2.443   13.040  1.00 0.00 ? 31 ALA B CB   2  
ATOM 3077  H H    . ALA B 2 21 ? 14.392  4.065   11.327  1.00 0.00 ? 31 ALA B H    2  
ATOM 3078  H HA   . ALA B 2 21 ? 16.924  3.058   11.711  1.00 0.00 ? 31 ALA B HA   2  
ATOM 3079  H HB1  . ALA B 2 21 ? 14.389  2.031   12.984  1.00 0.00 ? 31 ALA B HB1  2  
ATOM 3080  H HB2  . ALA B 2 21 ? 15.350  3.398   13.542  1.00 0.00 ? 31 ALA B HB2  2  
ATOM 3081  H HB3  . ALA B 2 21 ? 16.023  1.769   13.591  1.00 0.00 ? 31 ALA B HB3  2  
ATOM 3082  N N    . TRP B 2 22 ? 14.941  0.880   10.291  1.00 0.00 ? 32 TRP B N    2  
ATOM 3083  C CA   . TRP B 2 22 ? 14.883  -0.368  9.544   1.00 0.00 ? 32 TRP B CA   2  
ATOM 3084  C C    . TRP B 2 22 ? 15.800  -0.277  8.327   1.00 0.00 ? 32 TRP B C    2  
ATOM 3085  O O    . TRP B 2 22 ? 16.661  -1.129  8.106   1.00 0.00 ? 32 TRP B O    2  
ATOM 3086  C CB   . TRP B 2 22 ? 13.440  -0.624  9.105   1.00 0.00 ? 32 TRP B CB   2  
ATOM 3087  C CG   . TRP B 2 22 ? 13.148  -2.041  8.718   1.00 0.00 ? 32 TRP B CG   2  
ATOM 3088  C CD1  . TRP B 2 22 ? 12.738  -3.044  9.544   1.00 0.00 ? 32 TRP B CD1  2  
ATOM 3089  C CD2  . TRP B 2 22 ? 13.224  -2.607  7.403   1.00 0.00 ? 32 TRP B CD2  2  
ATOM 3090  N NE1  . TRP B 2 22 ? 12.549  -4.198  8.826   1.00 0.00 ? 32 TRP B NE1  2  
ATOM 3091  C CE2  . TRP B 2 22 ? 12.844  -3.957  7.509   1.00 0.00 ? 32 TRP B CE2  2  
ATOM 3092  C CE3  . TRP B 2 22 ? 13.576  -2.104  6.149   1.00 0.00 ? 32 TRP B CE3  2  
ATOM 3093  C CZ2  . TRP B 2 22 ? 12.804  -4.808  6.408   1.00 0.00 ? 32 TRP B CZ2  2  
ATOM 3094  C CZ3  . TRP B 2 22 ? 13.537  -2.950  5.056   1.00 0.00 ? 32 TRP B CZ3  2  
ATOM 3095  C CH2  . TRP B 2 22 ? 13.154  -4.290  5.192   1.00 0.00 ? 32 TRP B CH2  2  
ATOM 3096  H H    . TRP B 2 22 ? 14.144  1.445   10.330  1.00 0.00 ? 32 TRP B H    2  
ATOM 3097  H HA   . TRP B 2 22 ? 15.215  -1.169  10.187  1.00 0.00 ? 32 TRP B HA   2  
ATOM 3098  H HB2  . TRP B 2 22 ? 12.777  -0.364  9.916   1.00 0.00 ? 32 TRP B HB2  2  
ATOM 3099  H HB3  . TRP B 2 22 ? 13.218  0.004   8.255   1.00 0.00 ? 32 TRP B HB3  2  
ATOM 3100  H HD1  . TRP B 2 22 ? 12.585  -2.932  10.608  1.00 0.00 ? 32 TRP B HD1  2  
ATOM 3101  H HE1  . TRP B 2 22 ? 12.251  -5.057  9.198   1.00 0.00 ? 32 TRP B HE1  2  
ATOM 3102  H HE3  . TRP B 2 22 ? 13.874  -1.076  6.024   1.00 0.00 ? 32 TRP B HE3  2  
ATOM 3103  H HZ2  . TRP B 2 22 ? 12.509  -5.844  6.495   1.00 0.00 ? 32 TRP B HZ2  2  
ATOM 3104  H HZ3  . TRP B 2 22 ? 13.806  -2.579  4.079   1.00 0.00 ? 32 TRP B HZ3  2  
ATOM 3105  H HH2  . TRP B 2 22 ? 13.139  -4.914  4.312   1.00 0.00 ? 32 TRP B HH2  2  
ATOM 3106  N N    . LEU B 2 23 ? 15.631  0.794   7.561   1.00 0.00 ? 33 LEU B N    2  
ATOM 3107  C CA   . LEU B 2 23 ? 16.436  1.037   6.371   1.00 0.00 ? 33 LEU B CA   2  
ATOM 3108  C C    . LEU B 2 23 ? 17.757  1.700   6.743   1.00 0.00 ? 33 LEU B C    2  
ATOM 3109  O O    . LEU B 2 23 ? 18.331  2.449   5.951   1.00 0.00 ? 33 LEU B O    2  
ATOM 3110  C CB   . LEU B 2 23 ? 15.681  1.943   5.394   1.00 0.00 ? 33 LEU B CB   2  
ATOM 3111  C CG   . LEU B 2 23 ? 14.520  1.293   4.643   1.00 0.00 ? 33 LEU B CG   2  
ATOM 3112  C CD1  . LEU B 2 23 ? 13.738  2.344   3.873   1.00 0.00 ? 33 LEU B CD1  2  
ATOM 3113  C CD2  . LEU B 2 23 ? 15.034  0.219   3.695   1.00 0.00 ? 33 LEU B CD2  2  
ATOM 3114  H H    . LEU B 2 23 ? 14.939  1.447   7.806   1.00 0.00 ? 33 LEU B H    2  
ATOM 3115  H HA   . LEU B 2 23 ? 16.635  0.088   5.897   1.00 0.00 ? 33 LEU B HA   2  
ATOM 3116  H HB2  . LEU B 2 23 ? 15.293  2.785   5.949   1.00 0.00 ? 33 LEU B HB2  2  
ATOM 3117  H HB3  . LEU B 2 23 ? 16.387  2.314   4.666   1.00 0.00 ? 33 LEU B HB3  2  
ATOM 3118  H HG   . LEU B 2 23 ? 13.851  0.829   5.352   1.00 0.00 ? 33 LEU B HG   2  
ATOM 3119  H HD11 . LEU B 2 23 ? 13.423  3.126   4.549   1.00 0.00 ? 33 LEU B HD11 2  
ATOM 3120  H HD12 . LEU B 2 23 ? 12.870  1.888   3.421   1.00 0.00 ? 33 LEU B HD12 2  
ATOM 3121  H HD13 . LEU B 2 23 ? 14.365  2.767   3.102   1.00 0.00 ? 33 LEU B HD13 2  
ATOM 3122  H HD21 . LEU B 2 23 ? 15.677  0.670   2.954   1.00 0.00 ? 33 LEU B HD21 2  
ATOM 3123  H HD22 . LEU B 2 23 ? 14.197  -0.257  3.204   1.00 0.00 ? 33 LEU B HD22 2  
ATOM 3124  H HD23 . LEU B 2 23 ? 15.590  -0.520  4.253   1.00 0.00 ? 33 LEU B HD23 2  
ATOM 3125  N N    . ARG B 2 24 ? 18.268  1.392   7.927   1.00 0.00 ? 34 ARG B N    2  
ATOM 3126  C CA   . ARG B 2 24 ? 19.506  1.983   8.399   1.00 0.00 ? 34 ARG B CA   2  
ATOM 3127  C C    . ARG B 2 24 ? 20.584  0.916   8.446   1.00 0.00 ? 34 ARG B C    2  
ATOM 3128  O O    . ARG B 2 24 ? 21.723  1.176   8.826   1.00 0.00 ? 34 ARG B O    2  
ATOM 3129  C CB   . ARG B 2 24 ? 19.307  2.585   9.793   1.00 0.00 ? 34 ARG B CB   2  
ATOM 3130  C CG   . ARG B 2 24 ? 20.221  3.759   10.093  1.00 0.00 ? 34 ARG B CG   2  
ATOM 3131  C CD   . ARG B 2 24 ? 19.712  5.034   9.446   1.00 0.00 ? 34 ARG B CD   2  
ATOM 3132  N NE   . ARG B 2 24 ? 18.776  5.751   10.310  1.00 0.00 ? 34 ARG B NE   2  
ATOM 3133  C CZ   . ARG B 2 24 ? 18.546  7.062   10.228  1.00 0.00 ? 34 ARG B CZ   2  
ATOM 3134  N NH1  . ARG B 2 24 ? 19.138  7.783   9.285   1.00 0.00 ? 34 ARG B NH1  2  
ATOM 3135  N NH2  . ARG B 2 24 ? 17.712  7.646   11.079  1.00 0.00 ? 34 ARG B NH2  2  
ATOM 3136  H H    . ARG B 2 24 ? 17.852  0.698   8.487   1.00 0.00 ? 34 ARG B H    2  
ATOM 3137  H HA   . ARG B 2 24 ? 19.799  2.759   7.709   1.00 0.00 ? 34 ARG B HA   2  
ATOM 3138  H HB2  . ARG B 2 24 ? 18.284  2.921   9.884   1.00 0.00 ? 34 ARG B HB2  2  
ATOM 3139  H HB3  . ARG B 2 24 ? 19.489  1.818   10.532  1.00 0.00 ? 34 ARG B HB3  2  
ATOM 3140  H HG2  . ARG B 2 24 ? 20.267  3.904   11.161  1.00 0.00 ? 34 ARG B HG2  2  
ATOM 3141  H HG3  . ARG B 2 24 ? 21.207  3.541   9.714   1.00 0.00 ? 34 ARG B HG3  2  
ATOM 3142  H HD2  . ARG B 2 24 ? 20.554  5.675   9.234   1.00 0.00 ? 34 ARG B HD2  2  
ATOM 3143  H HD3  . ARG B 2 24 ? 19.212  4.780   8.524   1.00 0.00 ? 34 ARG B HD3  2  
ATOM 3144  H HE   . ARG B 2 24 ? 18.308  5.231   11.002  1.00 0.00 ? 34 ARG B HE   2  
ATOM 3145  H HH11 . ARG B 2 24 ? 19.763  7.342   8.624   1.00 0.00 ? 34 ARG B HH11 2  
ATOM 3146  H HH12 . ARG B 2 24 ? 18.975  8.770   9.228   1.00 0.00 ? 34 ARG B HH12 2  
ATOM 3147  H HH21 . ARG B 2 24 ? 17.251  7.104   11.788  1.00 0.00 ? 34 ARG B HH21 2  
ATOM 3148  H HH22 . ARG B 2 24 ? 17.546  8.634   11.022  1.00 0.00 ? 34 ARG B HH22 2  
ATOM 3149  N N    . ALA B 2 25 ? 20.218  -0.287  8.019   1.00 0.00 ? 35 ALA B N    2  
ATOM 3150  C CA   . ALA B 2 25 ? 21.137  -1.413  8.016   1.00 0.00 ? 35 ALA B CA   2  
ATOM 3151  C C    . ALA B 2 25 ? 21.855  -1.497  6.681   1.00 0.00 ? 35 ALA B C    2  
ATOM 3152  O O    . ALA B 2 25 ? 22.880  -2.165  6.547   1.00 0.00 ? 35 ALA B O    2  
ATOM 3153  C CB   . ALA B 2 25 ? 20.387  -2.709  8.304   1.00 0.00 ? 35 ALA B CB   2  
ATOM 3154  H H    . ALA B 2 25 ? 19.316  -0.405  7.652   1.00 0.00 ? 35 ALA B H    2  
ATOM 3155  H HA   . ALA B 2 25 ? 21.862  -1.259  8.802   1.00 0.00 ? 35 ALA B HA   2  
ATOM 3156  H HB1  . ALA B 2 25 ? 19.893  -2.635  9.261   1.00 0.00 ? 35 ALA B HB1  2  
ATOM 3157  H HB2  . ALA B 2 25 ? 21.086  -3.533  8.322   1.00 0.00 ? 35 ALA B HB2  2  
ATOM 3158  H HB3  . ALA B 2 25 ? 19.652  -2.879  7.531   1.00 0.00 ? 35 ALA B HB3  2  
ATOM 3159  N N    . ILE B 2 26 ? 21.316  -0.791  5.695   1.00 0.00 ? 36 ILE B N    2  
ATOM 3160  C CA   . ILE B 2 26 ? 21.891  -0.768  4.358   1.00 0.00 ? 36 ILE B CA   2  
ATOM 3161  C C    . ILE B 2 26 ? 22.017  0.670   3.865   1.00 0.00 ? 36 ILE B C    2  
ATOM 3162  O O    . ILE B 2 26 ? 22.222  0.912   2.678   1.00 0.00 ? 36 ILE B O    2  
ATOM 3163  C CB   . ILE B 2 26 ? 21.035  -1.569  3.354   1.00 0.00 ? 36 ILE B CB   2  
ATOM 3164  C CG1  . ILE B 2 26 ? 19.558  -1.175  3.471   1.00 0.00 ? 36 ILE B CG1  2  
ATOM 3165  C CG2  . ILE B 2 26 ? 21.212  -3.063  3.585   1.00 0.00 ? 36 ILE B CG2  2  
ATOM 3166  C CD1  . ILE B 2 26 ? 18.709  -1.643  2.307   1.00 0.00 ? 36 ILE B CD1  2  
ATOM 3167  H H    . ILE B 2 26 ? 20.516  -0.258  5.871   1.00 0.00 ? 36 ILE B H    2  
ATOM 3168  H HA   . ILE B 2 26 ? 22.875  -1.213  4.406   1.00 0.00 ? 36 ILE B HA   2  
ATOM 3169  H HB   . ILE B 2 26 ? 21.383  -1.342  2.358   1.00 0.00 ? 36 ILE B HB   2  
ATOM 3170  H HG12 . ILE B 2 26 ? 19.149  -1.608  4.372   1.00 0.00 ? 36 ILE B HG12 2  
ATOM 3171  H HG13 . ILE B 2 26 ? 19.482  -0.100  3.528   1.00 0.00 ? 36 ILE B HG13 2  
ATOM 3172  H HG21 . ILE B 2 26 ? 20.951  -3.302  4.604   1.00 0.00 ? 36 ILE B HG21 2  
ATOM 3173  H HG22 . ILE B 2 26 ? 22.240  -3.335  3.401   1.00 0.00 ? 36 ILE B HG22 2  
ATOM 3174  H HG23 . ILE B 2 26 ? 20.569  -3.609  2.911   1.00 0.00 ? 36 ILE B HG23 2  
ATOM 3175  H HD11 . ILE B 2 26 ? 19.106  -1.240  1.388   1.00 0.00 ? 36 ILE B HD11 2  
ATOM 3176  H HD12 . ILE B 2 26 ? 17.693  -1.301  2.443   1.00 0.00 ? 36 ILE B HD12 2  
ATOM 3177  H HD13 . ILE B 2 26 ? 18.722  -2.723  2.263   1.00 0.00 ? 36 ILE B HD13 2  
ATOM 3178  N N    . GLY B 2 27 ? 21.915  1.608   4.810   1.00 0.00 ? 37 GLY B N    2  
ATOM 3179  C CA   . GLY B 2 27 ? 22.002  3.027   4.494   1.00 0.00 ? 37 GLY B CA   2  
ATOM 3180  C C    . GLY B 2 27 ? 21.096  3.446   3.348   1.00 0.00 ? 37 GLY B C    2  
ATOM 3181  O O    . GLY B 2 27 ? 21.553  4.072   2.392   1.00 0.00 ? 37 GLY B O    2  
ATOM 3182  H H    . GLY B 2 27 ? 21.842  1.326   5.741   1.00 0.00 ? 37 GLY B H    2  
ATOM 3183  H HA2  . GLY B 2 27 ? 21.728  3.594   5.373   1.00 0.00 ? 37 GLY B HA2  2  
ATOM 3184  H HA3  . GLY B 2 27 ? 23.022  3.263   4.235   1.00 0.00 ? 37 GLY B HA3  2  
ATOM 3185  N N    . LEU B 2 28 ? 19.814  3.121   3.443   1.00 0.00 ? 38 LEU B N    2  
ATOM 3186  C CA   . LEU B 2 28 ? 18.872  3.466   2.385   1.00 0.00 ? 38 LEU B CA   2  
ATOM 3187  C C    . LEU B 2 28 ? 17.721  4.308   2.927   1.00 0.00 ? 38 LEU B C    2  
ATOM 3188  O O    . LEU B 2 28 ? 16.687  4.454   2.274   1.00 0.00 ? 38 LEU B O    2  
ATOM 3189  C CB   . LEU B 2 28 ? 18.329  2.199   1.718   1.00 0.00 ? 38 LEU B CB   2  
ATOM 3190  C CG   . LEU B 2 28 ? 18.611  2.087   0.217   1.00 0.00 ? 38 LEU B CG   2  
ATOM 3191  C CD1  . LEU B 2 28 ? 20.067  1.720   -0.028  1.00 0.00 ? 38 LEU B CD1  2  
ATOM 3192  C CD2  . LEU B 2 28 ? 17.687  1.065   -0.426  1.00 0.00 ? 38 LEU B CD2  2  
ATOM 3193  H H    . LEU B 2 28 ? 19.492  2.651   4.242   1.00 0.00 ? 38 LEU B H    2  
ATOM 3194  H HA   . LEU B 2 28 ? 19.406  4.045   1.647   1.00 0.00 ? 38 LEU B HA   2  
ATOM 3195  H HB2  . LEU B 2 28 ? 18.766  1.343   2.211   1.00 0.00 ? 38 LEU B HB2  2  
ATOM 3196  H HB3  . LEU B 2 28 ? 17.260  2.170   1.864   1.00 0.00 ? 38 LEU B HB3  2  
ATOM 3197  H HG   . LEU B 2 28 ? 18.427  3.044   -0.248  1.00 0.00 ? 38 LEU B HG   2  
ATOM 3198  H HD11 . LEU B 2 28 ? 20.708  2.459   0.431   1.00 0.00 ? 38 LEU B HD11 2  
ATOM 3199  H HD12 . LEU B 2 28 ? 20.256  1.691   -1.091  1.00 0.00 ? 38 LEU B HD12 2  
ATOM 3200  H HD13 . LEU B 2 28 ? 20.272  0.751   0.400   1.00 0.00 ? 38 LEU B HD13 2  
ATOM 3201  H HD21 . LEU B 2 28 ? 18.065  0.070   -0.239  1.00 0.00 ? 38 LEU B HD21 2  
ATOM 3202  H HD22 . LEU B 2 28 ? 17.643  1.239   -1.491  1.00 0.00 ? 38 LEU B HD22 2  
ATOM 3203  H HD23 . LEU B 2 28 ? 16.697  1.159   -0.005  1.00 0.00 ? 38 LEU B HD23 2  
ATOM 3204  N N    . GLU B 2 29 ? 17.912  4.864   4.121   1.00 0.00 ? 39 GLU B N    2  
ATOM 3205  C CA   . GLU B 2 29 ? 16.900  5.702   4.766   1.00 0.00 ? 39 GLU B CA   2  
ATOM 3206  C C    . GLU B 2 29 ? 16.510  6.897   3.889   1.00 0.00 ? 39 GLU B C    2  
ATOM 3207  O O    . GLU B 2 29 ? 15.438  7.478   4.059   1.00 0.00 ? 39 GLU B O    2  
ATOM 3208  C CB   . GLU B 2 29 ? 17.405  6.201   6.124   1.00 0.00 ? 39 GLU B CB   2  
ATOM 3209  C CG   . GLU B 2 29 ? 18.547  7.204   6.031   1.00 0.00 ? 39 GLU B CG   2  
ATOM 3210  C CD   . GLU B 2 29 ? 19.913  6.562   6.148   1.00 0.00 ? 39 GLU B CD   2  
ATOM 3211  O OE1  . GLU B 2 29 ? 20.304  5.810   5.234   1.00 0.00 ? 39 GLU B OE1  2  
ATOM 3212  O OE2  . GLU B 2 29 ? 20.607  6.816   7.155   1.00 0.00 ? 39 GLU B OE2  2  
ATOM 3213  H H    . GLU B 2 29 ? 18.741  4.665   4.611   1.00 0.00 ? 39 GLU B H    2  
ATOM 3214  H HA   . GLU B 2 29 ? 16.025  5.095   4.923   1.00 0.00 ? 39 GLU B HA   2  
ATOM 3215  H HB2  . GLU B 2 29 ? 16.587  6.670   6.650   1.00 0.00 ? 39 GLU B HB2  2  
ATOM 3216  H HB3  . GLU B 2 29 ? 17.748  5.352   6.699   1.00 0.00 ? 39 GLU B HB3  2  
ATOM 3217  H HG2  . GLU B 2 29 ? 18.487  7.709   5.077   1.00 0.00 ? 39 GLU B HG2  2  
ATOM 3218  H HG3  . GLU B 2 29 ? 18.438  7.931   6.825   1.00 0.00 ? 39 GLU B HG3  2  
ATOM 3219  N N    . ARG B 2 30 ? 17.374  7.240   2.942   1.00 0.00 ? 40 ARG B N    2  
ATOM 3220  C CA   . ARG B 2 30 ? 17.126  8.365   2.040   1.00 0.00 ? 40 ARG B CA   2  
ATOM 3221  C C    . ARG B 2 30 ? 15.996  8.045   1.065   1.00 0.00 ? 40 ARG B C    2  
ATOM 3222  O O    . ARG B 2 30 ? 15.468  8.935   0.402   1.00 0.00 ? 40 ARG B O    2  
ATOM 3223  C CB   . ARG B 2 30 ? 18.389  8.720   1.252   1.00 0.00 ? 40 ARG B CB   2  
ATOM 3224  C CG   . ARG B 2 30 ? 19.645  8.810   2.103   1.00 0.00 ? 40 ARG B CG   2  
ATOM 3225  C CD   . ARG B 2 30 ? 20.789  9.460   1.341   1.00 0.00 ? 40 ARG B CD   2  
ATOM 3226  N NE   . ARG B 2 30 ? 20.901  8.953   -0.029  1.00 0.00 ? 40 ARG B NE   2  
ATOM 3227  C CZ   . ARG B 2 30 ? 22.032  8.499   -0.573  1.00 0.00 ? 40 ARG B CZ   2  
ATOM 3228  N NH1  . ARG B 2 30 ? 23.157  8.474   0.134   1.00 0.00 ? 40 ARG B NH1  2  
ATOM 3229  N NH2  . ARG B 2 30 ? 22.032  8.074   -1.832  1.00 0.00 ? 40 ARG B NH2  2  
ATOM 3230  H H    . ARG B 2 30 ? 18.195  6.717   2.844   1.00 0.00 ? 40 ARG B H    2  
ATOM 3231  H HA   . ARG B 2 30 ? 16.837  9.214   2.643   1.00 0.00 ? 40 ARG B HA   2  
ATOM 3232  H HB2  . ARG B 2 30 ? 18.548  7.965   0.496   1.00 0.00 ? 40 ARG B HB2  2  
ATOM 3233  H HB3  . ARG B 2 30 ? 18.239  9.674   0.769   1.00 0.00 ? 40 ARG B HB3  2  
ATOM 3234  H HG2  . ARG B 2 30 ? 19.430  9.399   2.983   1.00 0.00 ? 40 ARG B HG2  2  
ATOM 3235  H HG3  . ARG B 2 30 ? 19.939  7.814   2.399   1.00 0.00 ? 40 ARG B HG3  2  
ATOM 3236  H HD2  . ARG B 2 30 ? 20.619  10.525  1.304   1.00 0.00 ? 40 ARG B HD2  2  
ATOM 3237  H HD3  . ARG B 2 30 ? 21.711  9.261   1.866   1.00 0.00 ? 40 ARG B HD3  2  
ATOM 3238  H HE   . ARG B 2 30 ? 20.083  8.960   -0.580  1.00 0.00 ? 40 ARG B HE   2  
ATOM 3239  H HH11 . ARG B 2 30 ? 23.165  8.799   1.083   1.00 0.00 ? 40 ARG B HH11 2  
ATOM 3240  H HH12 . ARG B 2 30 ? 24.005  8.123   -0.274  1.00 0.00 ? 40 ARG B HH12 2  
ATOM 3241  H HH21 . ARG B 2 30 ? 21.183  8.094   -2.370  1.00 0.00 ? 40 ARG B HH21 2  
ATOM 3242  H HH22 . ARG B 2 30 ? 22.878  7.738   -2.252  1.00 0.00 ? 40 ARG B HH22 2  
ATOM 3243  N N    . TYR B 2 31 ? 15.630  6.772   0.978   1.00 0.00 ? 41 TYR B N    2  
ATOM 3244  C CA   . TYR B 2 31 ? 14.573  6.351   0.071   1.00 0.00 ? 41 TYR B CA   2  
ATOM 3245  C C    . TYR B 2 31 ? 13.234  6.198   0.786   1.00 0.00 ? 41 TYR B C    2  
ATOM 3246  O O    . TYR B 2 31 ? 12.195  6.145   0.132   1.00 0.00 ? 41 TYR B O    2  
ATOM 3247  C CB   . TYR B 2 31 ? 14.958  5.043   -0.624  1.00 0.00 ? 41 TYR B CB   2  
ATOM 3248  C CG   . TYR B 2 31 ? 16.035  5.216   -1.672  1.00 0.00 ? 41 TYR B CG   2  
ATOM 3249  C CD1  . TYR B 2 31 ? 17.379  5.185   -1.324  1.00 0.00 ? 41 TYR B CD1  2  
ATOM 3250  C CD2  . TYR B 2 31 ? 15.707  5.416   -3.007  1.00 0.00 ? 41 TYR B CD2  2  
ATOM 3251  C CE1  . TYR B 2 31 ? 18.366  5.346   -2.276  1.00 0.00 ? 41 TYR B CE1  2  
ATOM 3252  C CE2  . TYR B 2 31 ? 16.689  5.579   -3.966  1.00 0.00 ? 41 TYR B CE2  2  
ATOM 3253  C CZ   . TYR B 2 31 ? 18.016  5.543   -3.595  1.00 0.00 ? 41 TYR B CZ   2  
ATOM 3254  O OH   . TYR B 2 31 ? 18.998  5.706   -4.546  1.00 0.00 ? 41 TYR B OH   2  
ATOM 3255  H H    . TYR B 2 31 ? 16.083  6.100   1.535   1.00 0.00 ? 41 TYR B H    2  
ATOM 3256  H HA   . TYR B 2 31 ? 14.470  7.120   -0.681  1.00 0.00 ? 41 TYR B HA   2  
ATOM 3257  H HB2  . TYR B 2 31 ? 15.321  4.344   0.113   1.00 0.00 ? 41 TYR B HB2  2  
ATOM 3258  H HB3  . TYR B 2 31 ? 14.085  4.631   -1.108  1.00 0.00 ? 41 TYR B HB3  2  
ATOM 3259  H HD1  . TYR B 2 31 ? 17.650  5.031   -0.289  1.00 0.00 ? 41 TYR B HD1  2  
ATOM 3260  H HD2  . TYR B 2 31 ? 14.666  5.443   -3.293  1.00 0.00 ? 41 TYR B HD2  2  
ATOM 3261  H HE1  . TYR B 2 31 ? 19.405  5.318   -1.985  1.00 0.00 ? 41 TYR B HE1  2  
ATOM 3262  H HE2  . TYR B 2 31 ? 16.414  5.733   -4.998  1.00 0.00 ? 41 TYR B HE2  2  
ATOM 3263  H HH   . TYR B 2 31 ? 19.703  5.066   -4.392  1.00 0.00 ? 41 TYR B HH   2  
ATOM 3264  N N    . GLU B 2 32 ? 13.266  6.095   2.121   1.00 0.00 ? 42 GLU B N    2  
ATOM 3265  C CA   . GLU B 2 32 ? 12.048  5.963   2.935   1.00 0.00 ? 42 GLU B CA   2  
ATOM 3266  C C    . GLU B 2 32 ? 10.927  6.884   2.447   1.00 0.00 ? 42 GLU B C    2  
ATOM 3267  O O    . GLU B 2 32 ? 9.876   6.409   2.024   1.00 0.00 ? 42 GLU B O    2  
ATOM 3268  C CB   . GLU B 2 32 ? 12.367  6.261   4.406   1.00 0.00 ? 42 GLU B CB   2  
ATOM 3269  C CG   . GLU B 2 32 ? 11.152  6.215   5.321   1.00 0.00 ? 42 GLU B CG   2  
ATOM 3270  C CD   . GLU B 2 32 ? 11.469  6.618   6.749   1.00 0.00 ? 42 GLU B CD   2  
ATOM 3271  O OE1  . GLU B 2 32 ? 12.328  7.502   6.953   1.00 0.00 ? 42 GLU B OE1  2  
ATOM 3272  O OE2  . GLU B 2 32 ? 10.853  6.052   7.677   1.00 0.00 ? 42 GLU B OE2  2  
ATOM 3273  H H    . GLU B 2 32 ? 14.131  6.037   2.577   1.00 0.00 ? 42 GLU B H    2  
ATOM 3274  H HA   . GLU B 2 32 ? 11.712  4.940   2.855   1.00 0.00 ? 42 GLU B HA   2  
ATOM 3275  H HB2  . GLU B 2 32 ? 13.084  5.535   4.760   1.00 0.00 ? 42 GLU B HB2  2  
ATOM 3276  H HB3  . GLU B 2 32 ? 12.806  7.246   4.473   1.00 0.00 ? 42 GLU B HB3  2  
ATOM 3277  H HG2  . GLU B 2 32 ? 10.402  6.888   4.935   1.00 0.00 ? 42 GLU B HG2  2  
ATOM 3278  H HG3  . GLU B 2 32 ? 10.761  5.208   5.326   1.00 0.00 ? 42 GLU B HG3  2  
ATOM 3279  N N    . GLU B 2 33 ? 11.150  8.191   2.567   1.00 0.00 ? 43 GLU B N    2  
ATOM 3280  C CA   . GLU B 2 33 ? 10.191  9.212   2.118   1.00 0.00 ? 43 GLU B CA   2  
ATOM 3281  C C    . GLU B 2 33 ? 9.567   8.880   0.751   1.00 0.00 ? 43 GLU B C    2  
ATOM 3282  O O    . GLU B 2 33 ? 8.368   9.084   0.546   1.00 0.00 ? 43 GLU B O    2  
ATOM 3283  C CB   . GLU B 2 33 ? 10.879  10.574  2.050   1.00 0.00 ? 43 GLU B CB   2  
ATOM 3284  C CG   . GLU B 2 33 ? 9.955   11.702  1.625   1.00 0.00 ? 43 GLU B CG   2  
ATOM 3285  C CD   . GLU B 2 33 ? 10.702  12.984  1.347   1.00 0.00 ? 43 GLU B CD   2  
ATOM 3286  O OE1  . GLU B 2 33 ? 11.344  13.086  0.284   1.00 0.00 ? 43 GLU B OE1  2  
ATOM 3287  O OE2  . GLU B 2 33 ? 10.660  13.896  2.198   1.00 0.00 ? 43 GLU B OE2  2  
ATOM 3288  H H    . GLU B 2 33 ? 11.943  8.467   3.069   1.00 0.00 ? 43 GLU B H    2  
ATOM 3289  H HA   . GLU B 2 33 ? 9.401   9.261   2.851   1.00 0.00 ? 43 GLU B HA   2  
ATOM 3290  H HB2  . GLU B 2 33 ? 11.278  10.813  3.025   1.00 0.00 ? 43 GLU B HB2  2  
ATOM 3291  H HB3  . GLU B 2 33 ? 11.693  10.518  1.343   1.00 0.00 ? 43 GLU B HB3  2  
ATOM 3292  H HG2  . GLU B 2 33 ? 9.436   11.404  0.726   1.00 0.00 ? 43 GLU B HG2  2  
ATOM 3293  H HG3  . GLU B 2 33 ? 9.239   11.881  2.412   1.00 0.00 ? 43 GLU B HG3  2  
ATOM 3294  N N    . GLY B 2 34 ? 10.378  8.347   -0.160  1.00 0.00 ? 44 GLY B N    2  
ATOM 3295  C CA   . GLY B 2 34 ? 9.887   8.007   -1.485  1.00 0.00 ? 44 GLY B CA   2  
ATOM 3296  C C    . GLY B 2 34 ? 8.913   6.846   -1.444  1.00 0.00 ? 44 GLY B C    2  
ATOM 3297  O O    . GLY B 2 34 ? 7.898   6.839   -2.146  1.00 0.00 ? 44 GLY B O    2  
ATOM 3298  H H    . GLY B 2 34 ? 11.299  8.132   0.093   1.00 0.00 ? 44 GLY B H    2  
ATOM 3299  H HA2  . GLY B 2 34 ? 9.391   8.869   -1.909  1.00 0.00 ? 44 GLY B HA2  2  
ATOM 3300  H HA3  . GLY B 2 34 ? 10.725  7.740   -2.112  1.00 0.00 ? 44 GLY B HA3  2  
ATOM 3301  N N    . LEU B 2 35 ? 9.220   5.872   -0.601  1.00 0.00 ? 45 LEU B N    2  
ATOM 3302  C CA   . LEU B 2 35 ? 8.379   4.699   -0.436  1.00 0.00 ? 45 LEU B CA   2  
ATOM 3303  C C    . LEU B 2 35 ? 7.091   5.077   0.290   1.00 0.00 ? 45 LEU B C    2  
ATOM 3304  O O    . LEU B 2 35 ? 5.992   4.807   -0.202  1.00 0.00 ? 45 LEU B O    2  
ATOM 3305  C CB   . LEU B 2 35 ? 9.132   3.618   0.346   1.00 0.00 ? 45 LEU B CB   2  
ATOM 3306  C CG   . LEU B 2 35 ? 10.375  3.057   -0.350  1.00 0.00 ? 45 LEU B CG   2  
ATOM 3307  C CD1  . LEU B 2 35 ? 11.430  2.664   0.672   1.00 0.00 ? 45 LEU B CD1  2  
ATOM 3308  C CD2  . LEU B 2 35 ? 10.005  1.860   -1.213  1.00 0.00 ? 45 LEU B CD2  2  
ATOM 3309  H H    . LEU B 2 35 ? 10.040  5.952   -0.063  1.00 0.00 ? 45 LEU B H    2  
ATOM 3310  H HA   . LEU B 2 35 ? 8.133   4.323   -1.417  1.00 0.00 ? 45 LEU B HA   2  
ATOM 3311  H HB2  . LEU B 2 35 ? 9.433   4.034   1.295   1.00 0.00 ? 45 LEU B HB2  2  
ATOM 3312  H HB3  . LEU B 2 35 ? 8.453   2.800   0.530   1.00 0.00 ? 45 LEU B HB3  2  
ATOM 3313  H HG   . LEU B 2 35 ? 10.797  3.816   -0.991  1.00 0.00 ? 45 LEU B HG   2  
ATOM 3314  H HD11 . LEU B 2 35 ? 11.769  3.546   1.196   1.00 0.00 ? 45 LEU B HD11 2  
ATOM 3315  H HD12 . LEU B 2 35 ? 12.265  2.200   0.169   1.00 0.00 ? 45 LEU B HD12 2  
ATOM 3316  H HD13 . LEU B 2 35 ? 11.005  1.967   1.379   1.00 0.00 ? 45 LEU B HD13 2  
ATOM 3317  H HD21 . LEU B 2 35 ? 9.330   2.175   -1.995  1.00 0.00 ? 45 LEU B HD21 2  
ATOM 3318  H HD22 . LEU B 2 35 ? 9.524   1.111   -0.602  1.00 0.00 ? 45 LEU B HD22 2  
ATOM 3319  H HD23 . LEU B 2 35 ? 10.899  1.445   -1.655  1.00 0.00 ? 45 LEU B HD23 2  
ATOM 3320  N N    . VAL B 2 36 ? 7.242   5.671   1.477   1.00 0.00 ? 46 VAL B N    2  
ATOM 3321  C CA   . VAL B 2 36 ? 6.111   6.116   2.296   1.00 0.00 ? 46 VAL B CA   2  
ATOM 3322  C C    . VAL B 2 36 ? 5.060   6.877   1.486   1.00 0.00 ? 46 VAL B C    2  
ATOM 3323  O O    . VAL B 2 36 ? 3.872   6.567   1.579   1.00 0.00 ? 46 VAL B O    2  
ATOM 3324  C CB   . VAL B 2 36 ? 6.585   7.011   3.466   1.00 0.00 ? 46 VAL B CB   2  
ATOM 3325  C CG1  . VAL B 2 36 ? 5.405   7.473   4.312   1.00 0.00 ? 46 VAL B CG1  2  
ATOM 3326  C CG2  . VAL B 2 36 ? 7.599   6.274   4.327   1.00 0.00 ? 46 VAL B CG2  2  
ATOM 3327  H H    . VAL B 2 36 ? 8.143   5.743   1.864   1.00 0.00 ? 46 VAL B H    2  
ATOM 3328  H HA   . VAL B 2 36 ? 5.648   5.238   2.718   1.00 0.00 ? 46 VAL B HA   2  
ATOM 3329  H HB   . VAL B 2 36 ? 7.065   7.885   3.053   1.00 0.00 ? 46 VAL B HB   2  
ATOM 3330  H HG11 . VAL B 2 36 ? 4.633   7.867   3.667   1.00 0.00 ? 46 VAL B HG11 2  
ATOM 3331  H HG12 . VAL B 2 36 ? 5.731   8.243   4.995   1.00 0.00 ? 46 VAL B HG12 2  
ATOM 3332  H HG13 . VAL B 2 36 ? 5.015   6.637   4.872   1.00 0.00 ? 46 VAL B HG13 2  
ATOM 3333  H HG21 . VAL B 2 36 ? 7.777   6.834   5.235   1.00 0.00 ? 46 VAL B HG21 2  
ATOM 3334  H HG22 . VAL B 2 36 ? 8.525   6.170   3.783   1.00 0.00 ? 46 VAL B HG22 2  
ATOM 3335  H HG23 . VAL B 2 36 ? 7.216   5.296   4.577   1.00 0.00 ? 46 VAL B HG23 2  
ATOM 3336  N N    . HIS B 2 37 ? 5.497   7.859   0.693   1.00 0.00 ? 47 HIS B N    2  
ATOM 3337  C CA   . HIS B 2 37 ? 4.569   8.652   -0.115  1.00 0.00 ? 47 HIS B CA   2  
ATOM 3338  C C    . HIS B 2 37 ? 3.684   7.768   -0.960  1.00 0.00 ? 47 HIS B C    2  
ATOM 3339  O O    . HIS B 2 37 ? 2.477   7.974   -1.027  1.00 0.00 ? 47 HIS B O    2  
ATOM 3340  C CB   . HIS B 2 37 ? 5.292   9.598   -1.056  1.00 0.00 ? 47 HIS B CB   2  
ATOM 3341  C CG   . HIS B 2 37 ? 5.109   11.040  -0.705  1.00 0.00 ? 47 HIS B CG   2  
ATOM 3342  N ND1  . HIS B 2 37 ? 3.959   11.752  -0.971  1.00 0.00 ? 47 HIS B ND1  2  
ATOM 3343  C CD2  . HIS B 2 37 ? 5.949   11.905  -0.083  1.00 0.00 ? 47 HIS B CD2  2  
ATOM 3344  C CE1  . HIS B 2 37 ? 4.130   12.998  -0.514  1.00 0.00 ? 47 HIS B CE1  2  
ATOM 3345  N NE2  . HIS B 2 37 ? 5.324   13.143  0.034   1.00 0.00 ? 47 HIS B NE2  2  
ATOM 3346  H H    . HIS B 2 37 ? 6.459   8.054   0.652   1.00 0.00 ? 47 HIS B H    2  
ATOM 3347  H HA   . HIS B 2 37 ? 3.951   9.228   0.556   1.00 0.00 ? 47 HIS B HA   2  
ATOM 3348  H HB2  . HIS B 2 37 ? 6.345   9.374   -1.049  1.00 0.00 ? 47 HIS B HB2  2  
ATOM 3349  H HB3  . HIS B 2 37 ? 4.895   9.443   -2.056  1.00 0.00 ? 47 HIS B HB3  2  
ATOM 3350  H HD1  . HIS B 2 37 ? 3.158   11.407  -1.418  1.00 0.00 ? 47 HIS B HD1  2  
ATOM 3351  H HD2  . HIS B 2 37 ? 6.944   11.679  0.270   1.00 0.00 ? 47 HIS B HD2  2  
ATOM 3352  H HE1  . HIS B 2 37 ? 3.386   13.780  -0.581  1.00 0.00 ? 47 HIS B HE1  2  
ATOM 3353  N N    . ASN B 2 38 ? 4.296   6.800   -1.628  1.00 0.00 ? 48 ASN B N    2  
ATOM 3354  C CA   . ASN B 2 38 ? 3.547   5.892   -2.466  1.00 0.00 ? 48 ASN B CA   2  
ATOM 3355  C C    . ASN B 2 38 ? 2.564   5.120   -1.615  1.00 0.00 ? 48 ASN B C    2  
ATOM 3356  O O    . ASN B 2 38 ? 1.411   5.491   -1.534  1.00 0.00 ? 48 ASN B O    2  
ATOM 3357  C CB   . ASN B 2 38 ? 4.458   4.932   -3.231  1.00 0.00 ? 48 ASN B CB   2  
ATOM 3358  C CG   . ASN B 2 38 ? 4.957   5.532   -4.531  1.00 0.00 ? 48 ASN B CG   2  
ATOM 3359  O OD1  . ASN B 2 38 ? 4.279   5.460   -5.554  1.00 0.00 ? 48 ASN B OD1  2  
ATOM 3360  N ND2  . ASN B 2 38 ? 6.140   6.130   -4.500  1.00 0.00 ? 48 ASN B ND2  2  
ATOM 3361  H H    . ASN B 2 38 ? 5.268   6.692   -1.540  1.00 0.00 ? 48 ASN B H    2  
ATOM 3362  H HA   . ASN B 2 38 ? 2.990   6.487   -3.176  1.00 0.00 ? 48 ASN B HA   2  
ATOM 3363  H HB2  . ASN B 2 38 ? 5.309   4.681   -2.618  1.00 0.00 ? 48 ASN B HB2  2  
ATOM 3364  H HB3  . ASN B 2 38 ? 3.903   4.032   -3.462  1.00 0.00 ? 48 ASN B HB3  2  
ATOM 3365  H HD21 . ASN B 2 38 ? 6.632   6.155   -3.648  1.00 0.00 ? 48 ASN B HD21 2  
ATOM 3366  H HD22 . ASN B 2 38 ? 6.479   6.524   -5.333  1.00 0.00 ? 48 ASN B HD22 2  
ATOM 3367  N N    . GLY B 2 39 ? 3.030   4.084   -0.946  1.00 0.00 ? 49 GLY B N    2  
ATOM 3368  C CA   . GLY B 2 39 ? 2.146   3.294   -0.115  1.00 0.00 ? 49 GLY B CA   2  
ATOM 3369  C C    . GLY B 2 39 ? 2.906   2.319   0.745   1.00 0.00 ? 49 GLY B C    2  
ATOM 3370  O O    . GLY B 2 39 ? 2.554   1.144   0.822   1.00 0.00 ? 49 GLY B O    2  
ATOM 3371  H H    . GLY B 2 39 ? 3.983   3.859   -1.001  1.00 0.00 ? 49 GLY B H    2  
ATOM 3372  H HA2  . GLY B 2 39 ? 1.576   3.956   0.520   1.00 0.00 ? 49 GLY B HA2  2  
ATOM 3373  H HA3  . GLY B 2 39 ? 1.465   2.745   -0.750  1.00 0.00 ? 49 GLY B HA3  2  
ATOM 3374  N N    . TRP B 2 40 ? 3.962   2.808   1.378   1.00 0.00 ? 50 TRP B N    2  
ATOM 3375  C CA   . TRP B 2 40 ? 4.794   1.977   2.234   1.00 0.00 ? 50 TRP B CA   2  
ATOM 3376  C C    . TRP B 2 40 ? 5.113   2.706   3.530   1.00 0.00 ? 50 TRP B C    2  
ATOM 3377  O O    . TRP B 2 40 ? 6.267   3.030   3.808   1.00 0.00 ? 50 TRP B O    2  
ATOM 3378  C CB   . TRP B 2 40 ? 6.089   1.591   1.512   1.00 0.00 ? 50 TRP B CB   2  
ATOM 3379  C CG   . TRP B 2 40 ? 5.856   0.951   0.177   1.00 0.00 ? 50 TRP B CG   2  
ATOM 3380  C CD1  . TRP B 2 40 ? 6.075   1.506   -1.052  1.00 0.00 ? 50 TRP B CD1  2  
ATOM 3381  C CD2  . TRP B 2 40 ? 5.341   -0.365  -0.063  1.00 0.00 ? 50 TRP B CD2  2  
ATOM 3382  N NE1  . TRP B 2 40 ? 5.729   0.616   -2.040  1.00 0.00 ? 50 TRP B NE1  2  
ATOM 3383  C CE2  . TRP B 2 40 ? 5.278   -0.539  -1.457  1.00 0.00 ? 50 TRP B CE2  2  
ATOM 3384  C CE3  . TRP B 2 40 ? 4.931   -1.410  0.768   1.00 0.00 ? 50 TRP B CE3  2  
ATOM 3385  C CZ2  . TRP B 2 40 ? 4.819   -1.719  -2.036  1.00 0.00 ? 50 TRP B CZ2  2  
ATOM 3386  C CZ3  . TRP B 2 40 ? 4.477   -2.580  0.190   1.00 0.00 ? 50 TRP B CZ3  2  
ATOM 3387  C CH2  . TRP B 2 40 ? 4.423   -2.725  -1.200  1.00 0.00 ? 50 TRP B CH2  2  
ATOM 3388  H H    . TRP B 2 40 ? 4.184   3.759   1.277   1.00 0.00 ? 50 TRP B H    2  
ATOM 3389  H HA   . TRP B 2 40 ? 4.239   1.080   2.466   1.00 0.00 ? 50 TRP B HA   2  
ATOM 3390  H HB2  . TRP B 2 40 ? 6.682   2.480   1.356   1.00 0.00 ? 50 TRP B HB2  2  
ATOM 3391  H HB3  . TRP B 2 40 ? 6.644   0.897   2.125   1.00 0.00 ? 50 TRP B HB3  2  
ATOM 3392  H HD1  . TRP B 2 40 ? 6.461   2.502   -1.208  1.00 0.00 ? 50 TRP B HD1  2  
ATOM 3393  H HE1  . TRP B 2 40 ? 5.798   0.780   -3.005  1.00 0.00 ? 50 TRP B HE1  2  
ATOM 3394  H HE3  . TRP B 2 40 ? 4.964   -1.317  1.843   1.00 0.00 ? 50 TRP B HE3  2  
ATOM 3395  H HZ2  . TRP B 2 40 ? 4.771   -1.849  -3.107  1.00 0.00 ? 50 TRP B HZ2  2  
ATOM 3396  H HZ3  . TRP B 2 40 ? 4.155   -3.398  0.817   1.00 0.00 ? 50 TRP B HZ3  2  
ATOM 3397  H HH2  . TRP B 2 40 ? 4.059   -3.658  -1.607  1.00 0.00 ? 50 TRP B HH2  2  
ATOM 3398  N N    . ASP B 2 41 ? 4.082   2.987   4.310   1.00 0.00 ? 51 ASP B N    2  
ATOM 3399  C CA   . ASP B 2 41 ? 4.258   3.673   5.580   1.00 0.00 ? 51 ASP B CA   2  
ATOM 3400  C C    . ASP B 2 41 ? 4.306   2.664   6.721   1.00 0.00 ? 51 ASP B C    2  
ATOM 3401  O O    . ASP B 2 41 ? 4.558   3.020   7.875   1.00 0.00 ? 51 ASP B O    2  
ATOM 3402  C CB   . ASP B 2 41 ? 3.139   4.701   5.808   1.00 0.00 ? 51 ASP B CB   2  
ATOM 3403  C CG   . ASP B 2 41 ? 1.778   4.071   6.052   1.00 0.00 ? 51 ASP B CG   2  
ATOM 3404  O OD1  . ASP B 2 41 ? 1.472   3.042   5.419   1.00 0.00 ? 51 ASP B OD1  2  
ATOM 3405  O OD2  . ASP B 2 41 ? 1.008   4.616   6.878   1.00 0.00 ? 51 ASP B OD2  2  
ATOM 3406  H H    . ASP B 2 41 ? 3.174   2.729   4.028   1.00 0.00 ? 51 ASP B H    2  
ATOM 3407  H HA   . ASP B 2 41 ? 5.205   4.192   5.542   1.00 0.00 ? 51 ASP B HA   2  
ATOM 3408  H HB2  . ASP B 2 41 ? 3.388   5.306   6.666   1.00 0.00 ? 51 ASP B HB2  2  
ATOM 3409  H HB3  . ASP B 2 41 ? 3.067   5.338   4.938   1.00 0.00 ? 51 ASP B HB3  2  
ATOM 3410  N N    . ASP B 2 42 ? 4.083   1.398   6.385   1.00 0.00 ? 52 ASP B N    2  
ATOM 3411  C CA   . ASP B 2 42 ? 4.106   0.325   7.370   1.00 0.00 ? 52 ASP B CA   2  
ATOM 3412  C C    . ASP B 2 42 ? 5.016   -0.806  6.904   1.00 0.00 ? 52 ASP B C    2  
ATOM 3413  O O    . ASP B 2 42 ? 5.134   -1.067  5.706   1.00 0.00 ? 52 ASP B O    2  
ATOM 3414  C CB   . ASP B 2 42 ? 2.698   -0.207  7.621   1.00 0.00 ? 52 ASP B CB   2  
ATOM 3415  C CG   . ASP B 2 42 ? 2.623   -1.043  8.879   1.00 0.00 ? 52 ASP B CG   2  
ATOM 3416  O OD1  . ASP B 2 42 ? 2.551   -0.461  9.977   1.00 0.00 ? 52 ASP B OD1  2  
ATOM 3417  O OD2  . ASP B 2 42 ? 2.635   -2.286  8.773   1.00 0.00 ? 52 ASP B OD2  2  
ATOM 3418  H H    . ASP B 2 42 ? 3.897   1.180   5.448   1.00 0.00 ? 52 ASP B H    2  
ATOM 3419  H HA   . ASP B 2 42 ? 4.498   0.730   8.291   1.00 0.00 ? 52 ASP B HA   2  
ATOM 3420  H HB2  . ASP B 2 42 ? 2.017   0.625   7.721   1.00 0.00 ? 52 ASP B HB2  2  
ATOM 3421  H HB3  . ASP B 2 42 ? 2.395   -0.819  6.783   1.00 0.00 ? 52 ASP B HB3  2  
ATOM 3422  N N    . LEU B 2 43 ? 5.637   -1.492  7.855   1.00 0.00 ? 53 LEU B N    2  
ATOM 3423  C CA   . LEU B 2 43 ? 6.566   -2.575  7.546   1.00 0.00 ? 53 LEU B CA   2  
ATOM 3424  C C    . LEU B 2 43 ? 5.868   -3.922  7.387   1.00 0.00 ? 53 LEU B C    2  
ATOM 3425  O O    . LEU B 2 43 ? 6.424   -4.839  6.785   1.00 0.00 ? 53 LEU B O    2  
ATOM 3426  C CB   . LEU B 2 43 ? 7.628   -2.677  8.640   1.00 0.00 ? 53 LEU B CB   2  
ATOM 3427  C CG   . LEU B 2 43 ? 8.639   -1.532  8.666   1.00 0.00 ? 53 LEU B CG   2  
ATOM 3428  C CD1  . LEU B 2 43 ? 9.307   -1.441  10.030  1.00 0.00 ? 53 LEU B CD1  2  
ATOM 3429  C CD2  . LEU B 2 43 ? 9.677   -1.724  7.572   1.00 0.00 ? 53 LEU B CD2  2  
ATOM 3430  H H    . LEU B 2 43 ? 5.467   -1.262  8.793   1.00 0.00 ? 53 LEU B H    2  
ATOM 3431  H HA   . LEU B 2 43 ? 7.054   -2.331  6.615   1.00 0.00 ? 53 LEU B HA   2  
ATOM 3432  H HB2  . LEU B 2 43 ? 7.126   -2.710  9.596   1.00 0.00 ? 53 LEU B HB2  2  
ATOM 3433  H HB3  . LEU B 2 43 ? 8.167   -3.601  8.503   1.00 0.00 ? 53 LEU B HB3  2  
ATOM 3434  H HG   . LEU B 2 43 ? 8.125   -0.600  8.482   1.00 0.00 ? 53 LEU B HG   2  
ATOM 3435  H HD11 . LEU B 2 43 ? 8.579   -1.136  10.767  1.00 0.00 ? 53 LEU B HD11 2  
ATOM 3436  H HD12 . LEU B 2 43 ? 10.107  -0.716  9.991   1.00 0.00 ? 53 LEU B HD12 2  
ATOM 3437  H HD13 . LEU B 2 43 ? 9.709   -2.406  10.299  1.00 0.00 ? 53 LEU B HD13 2  
ATOM 3438  H HD21 . LEU B 2 43 ? 9.182   -1.837  6.621   1.00 0.00 ? 53 LEU B HD21 2  
ATOM 3439  H HD22 . LEU B 2 43 ? 10.262  -2.608  7.782   1.00 0.00 ? 53 LEU B HD22 2  
ATOM 3440  H HD23 . LEU B 2 43 ? 10.328  -0.863  7.540   1.00 0.00 ? 53 LEU B HD23 2  
ATOM 3441  N N    . GLU B 2 44 ? 4.650   -4.046  7.899   1.00 0.00 ? 54 GLU B N    2  
ATOM 3442  C CA   . GLU B 2 44 ? 3.924   -5.308  7.812   1.00 0.00 ? 54 GLU B CA   2  
ATOM 3443  C C    . GLU B 2 44 ? 3.434   -5.564  6.390   1.00 0.00 ? 54 GLU B C    2  
ATOM 3444  O O    . GLU B 2 44 ? 3.153   -6.701  6.014   1.00 0.00 ? 54 GLU B O    2  
ATOM 3445  C CB   . GLU B 2 44 ? 2.753   -5.314  8.796   1.00 0.00 ? 54 GLU B CB   2  
ATOM 3446  C CG   . GLU B 2 44 ? 2.207   -6.700  9.093   1.00 0.00 ? 54 GLU B CG   2  
ATOM 3447  C CD   . GLU B 2 44 ? 1.353   -6.729  10.340  1.00 0.00 ? 54 GLU B CD   2  
ATOM 3448  O OE1  . GLU B 2 44 ? 0.505   -5.830  10.506  1.00 0.00 ? 54 GLU B OE1  2  
ATOM 3449  O OE2  . GLU B 2 44 ? 1.525   -7.648  11.163  1.00 0.00 ? 54 GLU B OE2  2  
ATOM 3450  H H    . GLU B 2 44 ? 4.223   -3.272  8.336   1.00 0.00 ? 54 GLU B H    2  
ATOM 3451  H HA   . GLU B 2 44 ? 4.609   -6.097  8.084   1.00 0.00 ? 54 GLU B HA   2  
ATOM 3452  H HB2  . GLU B 2 44 ? 3.081   -4.874  9.727   1.00 0.00 ? 54 GLU B HB2  2  
ATOM 3453  H HB3  . GLU B 2 44 ? 1.953   -4.715  8.388   1.00 0.00 ? 54 GLU B HB3  2  
ATOM 3454  H HG2  . GLU B 2 44 ? 1.606   -7.024  8.255   1.00 0.00 ? 54 GLU B HG2  2  
ATOM 3455  H HG3  . GLU B 2 44 ? 3.036   -7.380  9.224   1.00 0.00 ? 54 GLU B HG3  2  
ATOM 3456  N N    . PHE B 2 45 ? 3.334   -4.507  5.595   1.00 0.00 ? 55 PHE B N    2  
ATOM 3457  C CA   . PHE B 2 45 ? 2.888   -4.647  4.217   1.00 0.00 ? 55 PHE B CA   2  
ATOM 3458  C C    . PHE B 2 45 ? 4.079   -4.607  3.264   1.00 0.00 ? 55 PHE B C    2  
ATOM 3459  O O    . PHE B 2 45 ? 3.978   -5.014  2.108   1.00 0.00 ? 55 PHE B O    2  
ATOM 3460  C CB   . PHE B 2 45 ? 1.882   -3.552  3.855   1.00 0.00 ? 55 PHE B CB   2  
ATOM 3461  C CG   . PHE B 2 45 ? 0.865   -3.995  2.842   1.00 0.00 ? 55 PHE B CG   2  
ATOM 3462  C CD1  . PHE B 2 45 ? -0.270  -4.684  3.240   1.00 0.00 ? 55 PHE B CD1  2  
ATOM 3463  C CD2  . PHE B 2 45 ? 1.047   -3.736  1.493   1.00 0.00 ? 55 PHE B CD2  2  
ATOM 3464  C CE1  . PHE B 2 45 ? -1.205  -5.101  2.313   1.00 0.00 ? 55 PHE B CE1  2  
ATOM 3465  C CE2  . PHE B 2 45 ? 0.117   -4.153  0.561   1.00 0.00 ? 55 PHE B CE2  2  
ATOM 3466  C CZ   . PHE B 2 45 ? -1.011  -4.836  0.972   1.00 0.00 ? 55 PHE B CZ   2  
ATOM 3467  H H    . PHE B 2 45 ? 3.554   -3.619  5.945   1.00 0.00 ? 55 PHE B H    2  
ATOM 3468  H HA   . PHE B 2 45 ? 2.406   -5.609  4.124   1.00 0.00 ? 55 PHE B HA   2  
ATOM 3469  H HB2  . PHE B 2 45 ? 1.354   -3.247  4.748   1.00 0.00 ? 55 PHE B HB2  2  
ATOM 3470  H HB3  . PHE B 2 45 ? 2.412   -2.704  3.449   1.00 0.00 ? 55 PHE B HB3  2  
ATOM 3471  H HD1  . PHE B 2 45 ? -0.424  -4.891  4.288   1.00 0.00 ? 55 PHE B HD1  2  
ATOM 3472  H HD2  . PHE B 2 45 ? 1.928   -3.201  1.171   1.00 0.00 ? 55 PHE B HD2  2  
ATOM 3473  H HE1  . PHE B 2 45 ? -2.086  -5.635  2.636   1.00 0.00 ? 55 PHE B HE1  2  
ATOM 3474  H HE2  . PHE B 2 45 ? 0.269   -3.944  -0.486  1.00 0.00 ? 55 PHE B HE2  2  
ATOM 3475  H HZ   . PHE B 2 45 ? -1.739  -5.161  0.244   1.00 0.00 ? 55 PHE B HZ   2  
ATOM 3476  N N    . LEU B 2 46 ? 5.219   -4.141  3.769   1.00 0.00 ? 56 LEU B N    2  
ATOM 3477  C CA   . LEU B 2 46 ? 6.437   -4.041  2.968   1.00 0.00 ? 56 LEU B CA   2  
ATOM 3478  C C    . LEU B 2 46 ? 6.933   -5.425  2.550   1.00 0.00 ? 56 LEU B C    2  
ATOM 3479  O O    . LEU B 2 46 ? 7.688   -5.562  1.592   1.00 0.00 ? 56 LEU B O    2  
ATOM 3480  C CB   . LEU B 2 46 ? 7.529   -3.303  3.751   1.00 0.00 ? 56 LEU B CB   2  
ATOM 3481  C CG   . LEU B 2 46 ? 8.742   -2.858  2.927   1.00 0.00 ? 56 LEU B CG   2  
ATOM 3482  C CD1  . LEU B 2 46 ? 8.401   -1.641  2.081   1.00 0.00 ? 56 LEU B CD1  2  
ATOM 3483  C CD2  . LEU B 2 46 ? 9.923   -2.558  3.836   1.00 0.00 ? 56 LEU B CD2  2  
ATOM 3484  H H    . LEU B 2 46 ? 5.242   -3.855  4.706   1.00 0.00 ? 56 LEU B H    2  
ATOM 3485  H HA   . LEU B 2 46 ? 6.200   -3.474  2.079   1.00 0.00 ? 56 LEU B HA   2  
ATOM 3486  H HB2  . LEU B 2 46 ? 7.087   -2.428  4.203   1.00 0.00 ? 56 LEU B HB2  2  
ATOM 3487  H HB3  . LEU B 2 46 ? 7.877   -3.955  4.539   1.00 0.00 ? 56 LEU B HB3  2  
ATOM 3488  H HG   . LEU B 2 46 ? 9.028   -3.659  2.259   1.00 0.00 ? 56 LEU B HG   2  
ATOM 3489  H HD11 . LEU B 2 46 ? 7.619   -1.895  1.381   1.00 0.00 ? 56 LEU B HD11 2  
ATOM 3490  H HD12 . LEU B 2 46 ? 9.279   -1.323  1.539   1.00 0.00 ? 56 LEU B HD12 2  
ATOM 3491  H HD13 . LEU B 2 46 ? 8.064   -0.840  2.723   1.00 0.00 ? 56 LEU B HD13 2  
ATOM 3492  H HD21 . LEU B 2 46 ? 10.783  -2.300  3.236   1.00 0.00 ? 56 LEU B HD21 2  
ATOM 3493  H HD22 . LEU B 2 46 ? 10.149  -3.429  4.433   1.00 0.00 ? 56 LEU B HD22 2  
ATOM 3494  H HD23 . LEU B 2 46 ? 9.676   -1.732  4.486   1.00 0.00 ? 56 LEU B HD23 2  
ATOM 3495  N N    . SER B 2 47 ? 6.491   -6.450  3.266   1.00 0.00 ? 57 SER B N    2  
ATOM 3496  C CA   . SER B 2 47 ? 6.883   -7.820  2.969   1.00 0.00 ? 57 SER B CA   2  
ATOM 3497  C C    . SER B 2 47 ? 6.198   -8.330  1.698   1.00 0.00 ? 57 SER B C    2  
ATOM 3498  O O    . SER B 2 47 ? 6.552   -9.386  1.174   1.00 0.00 ? 57 SER B O    2  
ATOM 3499  C CB   . SER B 2 47 ? 6.537   -8.716  4.158   1.00 0.00 ? 57 SER B CB   2  
ATOM 3500  O OG   . SER B 2 47 ? 5.505   -8.133  4.940   1.00 0.00 ? 57 SER B OG   2  
ATOM 3501  H H    . SER B 2 47 ? 5.886   -6.284  4.019   1.00 0.00 ? 57 SER B H    2  
ATOM 3502  H HA   . SER B 2 47 ? 7.952   -7.834  2.820   1.00 0.00 ? 57 SER B HA   2  
ATOM 3503  H HB2  . SER B 2 47 ? 6.200   -9.676  3.797   1.00 0.00 ? 57 SER B HB2  2  
ATOM 3504  H HB3  . SER B 2 47 ? 7.411   -8.848  4.778   1.00 0.00 ? 57 SER B HB3  2  
ATOM 3505  H HG   . SER B 2 47 ? 5.613   -8.395  5.865   1.00 0.00 ? 57 SER B HG   2  
ATOM 3506  N N    . ASP B 2 48 ? 5.222   -7.570  1.206   1.00 0.00 ? 58 ASP B N    2  
ATOM 3507  C CA   . ASP B 2 48 ? 4.489   -7.941  -0.001  1.00 0.00 ? 58 ASP B CA   2  
ATOM 3508  C C    . ASP B 2 48 ? 4.894   -7.036  -1.163  1.00 0.00 ? 58 ASP B C    2  
ATOM 3509  O O    . ASP B 2 48 ? 4.155   -6.879  -2.136  1.00 0.00 ? 58 ASP B O    2  
ATOM 3510  C CB   . ASP B 2 48 ? 2.975   -7.842  0.244   1.00 0.00 ? 58 ASP B CB   2  
ATOM 3511  C CG   . ASP B 2 48 ? 2.167   -8.779  -0.641  1.00 0.00 ? 58 ASP B CG   2  
ATOM 3512  O OD1  . ASP B 2 48 ? 2.315   -10.010 -0.495  1.00 0.00 ? 58 ASP B OD1  2  
ATOM 3513  O OD2  . ASP B 2 48 ? 1.362   -8.294  -1.464  1.00 0.00 ? 58 ASP B OD2  2  
ATOM 3514  H H    . ASP B 2 48 ? 4.989   -6.734  1.667   1.00 0.00 ? 58 ASP B H    2  
ATOM 3515  H HA   . ASP B 2 48 ? 4.742   -8.961  -0.246  1.00 0.00 ? 58 ASP B HA   2  
ATOM 3516  H HB2  . ASP B 2 48 ? 2.770   -8.091  1.275   1.00 0.00 ? 58 ASP B HB2  2  
ATOM 3517  H HB3  . ASP B 2 48 ? 2.652   -6.829  0.054   1.00 0.00 ? 58 ASP B HB3  2  
ATOM 3518  N N    . ILE B 2 49 ? 6.076   -6.437  -1.054  1.00 0.00 ? 59 ILE B N    2  
ATOM 3519  C CA   . ILE B 2 49 ? 6.579   -5.543  -2.090  1.00 0.00 ? 59 ILE B CA   2  
ATOM 3520  C C    . ILE B 2 49 ? 7.166   -6.331  -3.262  1.00 0.00 ? 59 ILE B C    2  
ATOM 3521  O O    . ILE B 2 49 ? 7.627   -7.462  -3.098  1.00 0.00 ? 59 ILE B O    2  
ATOM 3522  C CB   . ILE B 2 49 ? 7.649   -4.566  -1.536  1.00 0.00 ? 59 ILE B CB   2  
ATOM 3523  C CG1  . ILE B 2 49 ? 7.848   -3.390  -2.495  1.00 0.00 ? 59 ILE B CG1  2  
ATOM 3524  C CG2  . ILE B 2 49 ? 8.972   -5.285  -1.300  1.00 0.00 ? 59 ILE B CG2  2  
ATOM 3525  C CD1  . ILE B 2 49 ? 8.683   -2.265  -1.922  1.00 0.00 ? 59 ILE B CD1  2  
ATOM 3526  H H    . ILE B 2 49 ? 6.625   -6.604  -0.259  1.00 0.00 ? 59 ILE B H    2  
ATOM 3527  H HA   . ILE B 2 49 ? 5.746   -4.958  -2.451  1.00 0.00 ? 59 ILE B HA   2  
ATOM 3528  H HB   . ILE B 2 49 ? 7.301   -4.190  -0.585  1.00 0.00 ? 59 ILE B HB   2  
ATOM 3529  H HG12 . ILE B 2 49 ? 8.341   -3.744  -3.389  1.00 0.00 ? 59 ILE B HG12 2  
ATOM 3530  H HG13 . ILE B 2 49 ? 6.882   -2.985  -2.760  1.00 0.00 ? 59 ILE B HG13 2  
ATOM 3531  H HG21 . ILE B 2 49 ? 8.841   -6.039  -0.538  1.00 0.00 ? 59 ILE B HG21 2  
ATOM 3532  H HG22 . ILE B 2 49 ? 9.717   -4.572  -0.980  1.00 0.00 ? 59 ILE B HG22 2  
ATOM 3533  H HG23 . ILE B 2 49 ? 9.295   -5.754  -2.218  1.00 0.00 ? 59 ILE B HG23 2  
ATOM 3534  H HD11 . ILE B 2 49 ? 9.663   -2.638  -1.667  1.00 0.00 ? 59 ILE B HD11 2  
ATOM 3535  H HD12 . ILE B 2 49 ? 8.203   -1.875  -1.037  1.00 0.00 ? 59 ILE B HD12 2  
ATOM 3536  H HD13 . ILE B 2 49 ? 8.778   -1.478  -2.657  1.00 0.00 ? 59 ILE B HD13 2  
ATOM 3537  N N    . THR B 2 50 ? 7.124   -5.731  -4.442  1.00 0.00 ? 60 THR B N    2  
ATOM 3538  C CA   . THR B 2 50 ? 7.655   -6.351  -5.643  1.00 0.00 ? 60 THR B CA   2  
ATOM 3539  C C    . THR B 2 50 ? 8.728   -5.457  -6.260  1.00 0.00 ? 60 THR B C    2  
ATOM 3540  O O    . THR B 2 50 ? 8.933   -4.325  -5.809  1.00 0.00 ? 60 THR B O    2  
ATOM 3541  C CB   . THR B 2 50 ? 6.538   -6.583  -6.681  1.00 0.00 ? 60 THR B CB   2  
ATOM 3542  O OG1  . THR B 2 50 ? 5.942   -5.329  -7.047  1.00 0.00 ? 60 THR B OG1  2  
ATOM 3543  C CG2  . THR B 2 50 ? 5.469   -7.516  -6.132  1.00 0.00 ? 60 THR B CG2  2  
ATOM 3544  H H    . THR B 2 50 ? 6.717   -4.844  -4.509  1.00 0.00 ? 60 THR B H    2  
ATOM 3545  H HA   . THR B 2 50 ? 8.088   -7.303  -5.377  1.00 0.00 ? 60 THR B HA   2  
ATOM 3546  H HB   . THR B 2 50 ? 6.972   -7.036  -7.560  1.00 0.00 ? 60 THR B HB   2  
ATOM 3547  H HG1  . THR B 2 50 ? 5.227   -5.112  -6.422  1.00 0.00 ? 60 THR B HG1  2  
ATOM 3548  H HG21 . THR B 2 50 ? 5.085   -7.116  -5.204  1.00 0.00 ? 60 THR B HG21 2  
ATOM 3549  H HG22 . THR B 2 50 ? 5.899   -8.490  -5.952  1.00 0.00 ? 60 THR B HG22 2  
ATOM 3550  H HG23 . THR B 2 50 ? 4.665   -7.603  -6.845  1.00 0.00 ? 60 THR B HG23 2  
ATOM 3551  N N    . GLU B 2 51 ? 9.411   -5.959  -7.284  1.00 0.00 ? 61 GLU B N    2  
ATOM 3552  C CA   . GLU B 2 51 ? 10.439  -5.179  -7.961  1.00 0.00 ? 61 GLU B CA   2  
ATOM 3553  C C    . GLU B 2 51 ? 9.794   -4.002  -8.680  1.00 0.00 ? 61 GLU B C    2  
ATOM 3554  O O    . GLU B 2 51 ? 10.384  -2.926  -8.800  1.00 0.00 ? 61 GLU B O    2  
ATOM 3555  C CB   . GLU B 2 51 ? 11.214  -6.047  -8.956  1.00 0.00 ? 61 GLU B CB   2  
ATOM 3556  C CG   . GLU B 2 51 ? 12.181  -7.014  -8.291  1.00 0.00 ? 61 GLU B CG   2  
ATOM 3557  C CD   . GLU B 2 51 ? 13.620  -6.767  -8.696  1.00 0.00 ? 61 GLU B CD   2  
ATOM 3558  O OE1  . GLU B 2 51 ? 13.910  -5.699  -9.275  1.00 0.00 ? 61 GLU B OE1  2  
ATOM 3559  O OE2  . GLU B 2 51 ? 14.470  -7.647  -8.448  1.00 0.00 ? 61 GLU B OE2  2  
ATOM 3560  H H    . GLU B 2 51 ? 9.218   -6.872  -7.592  1.00 0.00 ? 61 GLU B H    2  
ATOM 3561  H HA   . GLU B 2 51 ? 11.120  -4.802  -7.212  1.00 0.00 ? 61 GLU B HA   2  
ATOM 3562  H HB2  . GLU B 2 51 ? 10.510  -6.619  -9.541  1.00 0.00 ? 61 GLU B HB2  2  
ATOM 3563  H HB3  . GLU B 2 51 ? 11.778  -5.404  -9.615  1.00 0.00 ? 61 GLU B HB3  2  
ATOM 3564  H HG2  . GLU B 2 51 ? 12.101  -6.906  -7.220  1.00 0.00 ? 61 GLU B HG2  2  
ATOM 3565  H HG3  . GLU B 2 51 ? 11.912  -8.022  -8.571  1.00 0.00 ? 61 GLU B HG3  2  
ATOM 3566  N N    . GLU B 2 52 ? 8.568   -4.222  -9.148  1.00 0.00 ? 62 GLU B N    2  
ATOM 3567  C CA   . GLU B 2 52 ? 7.808   -3.192  -9.837  1.00 0.00 ? 62 GLU B CA   2  
ATOM 3568  C C    . GLU B 2 52 ? 7.449   -2.081  -8.858  1.00 0.00 ? 62 GLU B C    2  
ATOM 3569  O O    . GLU B 2 52 ? 7.619   -0.898  -9.154  1.00 0.00 ? 62 GLU B O    2  
ATOM 3570  C CB   . GLU B 2 52 ? 6.530   -3.783  -10.436 1.00 0.00 ? 62 GLU B CB   2  
ATOM 3571  C CG   . GLU B 2 52 ? 6.768   -4.980  -11.343 1.00 0.00 ? 62 GLU B CG   2  
ATOM 3572  C CD   . GLU B 2 52 ? 5.531   -5.840  -11.501 1.00 0.00 ? 62 GLU B CD   2  
ATOM 3573  O OE1  . GLU B 2 52 ? 4.420   -5.281  -11.596 1.00 0.00 ? 62 GLU B OE1  2  
ATOM 3574  O OE2  . GLU B 2 52 ? 5.659   -7.083  -11.518 1.00 0.00 ? 62 GLU B OE2  2  
ATOM 3575  H H    . GLU B 2 52 ? 8.166   -5.106  -9.022  1.00 0.00 ? 62 GLU B H    2  
ATOM 3576  H HA   . GLU B 2 52 ? 8.422   -2.787  -10.627 1.00 0.00 ? 62 GLU B HA   2  
ATOM 3577  H HB2  . GLU B 2 52 ? 5.882   -4.095  -9.630  1.00 0.00 ? 62 GLU B HB2  2  
ATOM 3578  H HB3  . GLU B 2 52 ? 6.030   -3.017  -11.011 1.00 0.00 ? 62 GLU B HB3  2  
ATOM 3579  H HG2  . GLU B 2 52 ? 7.067   -4.624  -12.318 1.00 0.00 ? 62 GLU B HG2  2  
ATOM 3580  H HG3  . GLU B 2 52 ? 7.559   -5.584  -10.922 1.00 0.00 ? 62 GLU B HG3  2  
ATOM 3581  N N    . ASP B 2 53 ? 6.938   -2.486  -7.696  1.00 0.00 ? 63 ASP B N    2  
ATOM 3582  C CA   . ASP B 2 53 ? 6.556   -1.551  -6.641  1.00 0.00 ? 63 ASP B CA   2  
ATOM 3583  C C    . ASP B 2 53 ? 7.704   -0.614  -6.292  1.00 0.00 ? 63 ASP B C    2  
ATOM 3584  O O    . ASP B 2 53 ? 7.507   0.597   -6.196  1.00 0.00 ? 63 ASP B O    2  
ATOM 3585  C CB   . ASP B 2 53 ? 6.094   -2.300  -5.391  1.00 0.00 ? 63 ASP B CB   2  
ATOM 3586  C CG   . ASP B 2 53 ? 4.629   -2.677  -5.453  1.00 0.00 ? 63 ASP B CG   2  
ATOM 3587  O OD1  . ASP B 2 53 ? 3.773   -1.767  -5.506  1.00 0.00 ? 63 ASP B OD1  2  
ATOM 3588  O OD2  . ASP B 2 53 ? 4.319   -3.882  -5.450  1.00 0.00 ? 63 ASP B OD2  2  
ATOM 3589  H H    . ASP B 2 53 ? 6.768   -3.446  -7.566  1.00 0.00 ? 63 ASP B H    2  
ATOM 3590  H HA   . ASP B 2 53 ? 5.732   -0.959  -7.013  1.00 0.00 ? 63 ASP B HA   2  
ATOM 3591  H HB2  . ASP B 2 53 ? 6.674   -3.204  -5.286  1.00 0.00 ? 63 ASP B HB2  2  
ATOM 3592  H HB3  . ASP B 2 53 ? 6.251   -1.674  -4.525  1.00 0.00 ? 63 ASP B HB3  2  
ATOM 3593  N N    . LEU B 2 54 ? 8.897   -1.173  -6.068  1.00 0.00 ? 64 LEU B N    2  
ATOM 3594  C CA   . LEU B 2 54 ? 10.077  -0.368  -5.764  1.00 0.00 ? 64 LEU B CA   2  
ATOM 3595  C C    . LEU B 2 54 ? 10.286  0.684   -6.845  1.00 0.00 ? 64 LEU B C    2  
ATOM 3596  O O    . LEU B 2 54 ? 10.439  1.868   -6.547  1.00 0.00 ? 64 LEU B O    2  
ATOM 3597  C CB   . LEU B 2 54 ? 11.311  -1.267  -5.657  1.00 0.00 ? 64 LEU B CB   2  
ATOM 3598  C CG   . LEU B 2 54 ? 11.461  -2.006  -4.328  1.00 0.00 ? 64 LEU B CG   2  
ATOM 3599  C CD1  . LEU B 2 54 ? 12.330  -3.239  -4.502  1.00 0.00 ? 64 LEU B CD1  2  
ATOM 3600  C CD2  . LEU B 2 54 ? 12.054  -1.085  -3.274  1.00 0.00 ? 64 LEU B CD2  2  
ATOM 3601  H H    . LEU B 2 54 ? 8.991   -2.151  -6.061  1.00 0.00 ? 64 LEU B H    2  
ATOM 3602  H HA   . LEU B 2 54 ? 9.913   0.126   -4.818  1.00 0.00 ? 64 LEU B HA   2  
ATOM 3603  H HB2  . LEU B 2 54 ? 11.264  -1.999  -6.449  1.00 0.00 ? 64 LEU B HB2  2  
ATOM 3604  H HB3  . LEU B 2 54 ? 12.188  -0.658  -5.805  1.00 0.00 ? 64 LEU B HB3  2  
ATOM 3605  H HG   . LEU B 2 54 ? 10.487  -2.327  -3.987  1.00 0.00 ? 64 LEU B HG   2  
ATOM 3606  H HD11 . LEU B 2 54 ? 11.850  -3.924  -5.184  1.00 0.00 ? 64 LEU B HD11 2  
ATOM 3607  H HD12 . LEU B 2 54 ? 12.469  -3.720  -3.546  1.00 0.00 ? 64 LEU B HD12 2  
ATOM 3608  H HD13 . LEU B 2 54 ? 13.290  -2.949  -4.902  1.00 0.00 ? 64 LEU B HD13 2  
ATOM 3609  H HD21 . LEU B 2 54 ? 13.071  -0.838  -3.544  1.00 0.00 ? 64 LEU B HD21 2  
ATOM 3610  H HD22 . LEU B 2 54 ? 12.045  -1.581  -2.316  1.00 0.00 ? 64 LEU B HD22 2  
ATOM 3611  H HD23 . LEU B 2 54 ? 11.468  -0.179  -3.216  1.00 0.00 ? 64 LEU B HD23 2  
ATOM 3612  N N    . GLU B 2 55 ? 10.354  0.218   -8.088  1.00 0.00 ? 65 GLU B N    2  
ATOM 3613  C CA   . GLU B 2 55 ? 10.495  1.093   -9.253  1.00 0.00 ? 65 GLU B CA   2  
ATOM 3614  C C    . GLU B 2 55 ? 9.543   2.295   -9.169  1.00 0.00 ? 65 GLU B C    2  
ATOM 3615  O O    . GLU B 2 55 ? 9.962   3.440   -9.351  1.00 0.00 ? 65 GLU B O    2  
ATOM 3616  C CB   . GLU B 2 55 ? 10.237  0.276   -10.529 1.00 0.00 ? 65 GLU B CB   2  
ATOM 3617  C CG   . GLU B 2 55 ? 9.642   1.067   -11.688 1.00 0.00 ? 65 GLU B CG   2  
ATOM 3618  C CD   . GLU B 2 55 ? 10.690  1.741   -12.546 1.00 0.00 ? 65 GLU B CD   2  
ATOM 3619  O OE1  . GLU B 2 55 ? 11.783  1.167   -12.716 1.00 0.00 ? 65 GLU B OE1  2  
ATOM 3620  O OE2  . GLU B 2 55 ? 10.411  2.840   -13.074 1.00 0.00 ? 65 GLU B OE2  2  
ATOM 3621  H H    . GLU B 2 55 ? 10.414  -0.752  -8.210  1.00 0.00 ? 65 GLU B H    2  
ATOM 3622  H HA   . GLU B 2 55 ? 11.511  1.456   -9.271  1.00 0.00 ? 65 GLU B HA   2  
ATOM 3623  H HB2  . GLU B 2 55 ? 11.172  -0.147  -10.862 1.00 0.00 ? 65 GLU B HB2  2  
ATOM 3624  H HB3  . GLU B 2 55 ? 9.557   -0.530  -10.291 1.00 0.00 ? 65 GLU B HB3  2  
ATOM 3625  H HG2  . GLU B 2 55 ? 9.073   0.394   -12.309 1.00 0.00 ? 65 GLU B HG2  2  
ATOM 3626  H HG3  . GLU B 2 55 ? 8.985   1.826   -11.286 1.00 0.00 ? 65 GLU B HG3  2  
ATOM 3627  N N    . GLU B 2 56 ? 8.271   2.034   -8.875  1.00 0.00 ? 66 GLU B N    2  
ATOM 3628  C CA   . GLU B 2 56 ? 7.265   3.089   -8.767  1.00 0.00 ? 66 GLU B CA   2  
ATOM 3629  C C    . GLU B 2 56 ? 7.538   4.018   -7.586  1.00 0.00 ? 66 GLU B C    2  
ATOM 3630  O O    . GLU B 2 56 ? 7.130   5.179   -7.590  1.00 0.00 ? 66 GLU B O    2  
ATOM 3631  C CB   . GLU B 2 56 ? 5.877   2.468   -8.631  1.00 0.00 ? 66 GLU B CB   2  
ATOM 3632  C CG   . GLU B 2 56 ? 5.490   1.604   -9.816  1.00 0.00 ? 66 GLU B CG   2  
ATOM 3633  C CD   . GLU B 2 56 ? 4.201   0.848   -9.593  1.00 0.00 ? 66 GLU B CD   2  
ATOM 3634  O OE1  . GLU B 2 56 ? 3.126   1.392   -9.911  1.00 0.00 ? 66 GLU B OE1  2  
ATOM 3635  O OE2  . GLU B 2 56 ? 4.259   -0.300  -9.116  1.00 0.00 ? 66 GLU B OE2  2  
ATOM 3636  H H    . GLU B 2 56 ? 7.988   1.099   -8.752  1.00 0.00 ? 66 GLU B H    2  
ATOM 3637  H HA   . GLU B 2 56 ? 7.298   3.669   -9.677  1.00 0.00 ? 66 GLU B HA   2  
ATOM 3638  H HB2  . GLU B 2 56 ? 5.853   1.855   -7.741  1.00 0.00 ? 66 GLU B HB2  2  
ATOM 3639  H HB3  . GLU B 2 56 ? 5.145   3.258   -8.534  1.00 0.00 ? 66 GLU B HB3  2  
ATOM 3640  H HG2  . GLU B 2 56 ? 5.371   2.236   -10.682 1.00 0.00 ? 66 GLU B HG2  2  
ATOM 3641  H HG3  . GLU B 2 56 ? 6.281   0.892   -9.997  1.00 0.00 ? 66 GLU B HG3  2  
ATOM 3642  N N    . ALA B 2 57 ? 8.237   3.507   -6.584  1.00 0.00 ? 67 ALA B N    2  
ATOM 3643  C CA   . ALA B 2 57 ? 8.561   4.293   -5.402  1.00 0.00 ? 67 ALA B CA   2  
ATOM 3644  C C    . ALA B 2 57 ? 9.816   5.130   -5.627  1.00 0.00 ? 67 ALA B C    2  
ATOM 3645  O O    . ALA B 2 57 ? 10.184  5.952   -4.789  1.00 0.00 ? 67 ALA B O    2  
ATOM 3646  C CB   . ALA B 2 57 ? 8.737   3.386   -4.193  1.00 0.00 ? 67 ALA B CB   2  
ATOM 3647  H H    . ALA B 2 57 ? 8.546   2.576   -6.642  1.00 0.00 ? 67 ALA B H    2  
ATOM 3648  H HA   . ALA B 2 57 ? 7.730   4.954   -5.206  1.00 0.00 ? 67 ALA B HA   2  
ATOM 3649  H HB1  . ALA B 2 57 ? 7.831   2.824   -4.029  1.00 0.00 ? 67 ALA B HB1  2  
ATOM 3650  H HB2  . ALA B 2 57 ? 8.951   3.988   -3.323  1.00 0.00 ? 67 ALA B HB2  2  
ATOM 3651  H HB3  . ALA B 2 57 ? 9.557   2.705   -4.371  1.00 0.00 ? 67 ALA B HB3  2  
ATOM 3652  N N    . GLY B 2 58 ? 10.474  4.911   -6.760  1.00 0.00 ? 68 GLY B N    2  
ATOM 3653  C CA   . GLY B 2 58 ? 11.674  5.660   -7.079  1.00 0.00 ? 68 GLY B CA   2  
ATOM 3654  C C    . GLY B 2 58 ? 12.913  4.789   -7.107  1.00 0.00 ? 68 GLY B C    2  
ATOM 3655  O O    . GLY B 2 58 ? 13.950  5.183   -7.641  1.00 0.00 ? 68 GLY B O    2  
ATOM 3656  H H    . GLY B 2 58 ? 10.138  4.235   -7.388  1.00 0.00 ? 68 GLY B H    2  
ATOM 3657  H HA2  . GLY B 2 58 ? 11.551  6.121   -8.048  1.00 0.00 ? 68 GLY B HA2  2  
ATOM 3658  H HA3  . GLY B 2 58 ? 11.808  6.434   -6.338  1.00 0.00 ? 68 GLY B HA3  2  
ATOM 3659  N N    . VAL B 2 59 ? 12.811  3.599   -6.545  1.00 0.00 ? 69 VAL B N    2  
ATOM 3660  C CA   . VAL B 2 59 ? 13.936  2.682   -6.509  1.00 0.00 ? 69 VAL B CA   2  
ATOM 3661  C C    . VAL B 2 59 ? 13.977  1.856   -7.790  1.00 0.00 ? 69 VAL B C    2  
ATOM 3662  O O    . VAL B 2 59 ? 13.487  0.731   -7.836  1.00 0.00 ? 69 VAL B O    2  
ATOM 3663  C CB   . VAL B 2 59 ? 13.872  1.747   -5.282  1.00 0.00 ? 69 VAL B CB   2  
ATOM 3664  C CG1  . VAL B 2 59 ? 15.180  0.988   -5.117  1.00 0.00 ? 69 VAL B CG1  2  
ATOM 3665  C CG2  . VAL B 2 59 ? 13.548  2.534   -4.020  1.00 0.00 ? 69 VAL B CG2  2  
ATOM 3666  H H    . VAL B 2 59 ? 11.950  3.320   -6.164  1.00 0.00 ? 69 VAL B H    2  
ATOM 3667  H HA   . VAL B 2 59 ? 14.842  3.270   -6.444  1.00 0.00 ? 69 VAL B HA   2  
ATOM 3668  H HB   . VAL B 2 59 ? 13.084  1.029   -5.445  1.00 0.00 ? 69 VAL B HB   2  
ATOM 3669  H HG11 . VAL B 2 59 ? 15.090  0.291   -4.298  1.00 0.00 ? 69 VAL B HG11 2  
ATOM 3670  H HG12 . VAL B 2 59 ? 15.976  1.687   -4.911  1.00 0.00 ? 69 VAL B HG12 2  
ATOM 3671  H HG13 . VAL B 2 59 ? 15.400  0.449   -6.026  1.00 0.00 ? 69 VAL B HG13 2  
ATOM 3672  H HG21 . VAL B 2 59 ? 14.299  3.294   -3.868  1.00 0.00 ? 69 VAL B HG21 2  
ATOM 3673  H HG22 . VAL B 2 59 ? 13.537  1.866   -3.172  1.00 0.00 ? 69 VAL B HG22 2  
ATOM 3674  H HG23 . VAL B 2 59 ? 12.579  3.000   -4.124  1.00 0.00 ? 69 VAL B HG23 2  
ATOM 3675  N N    . GLN B 2 60 ? 14.540  2.441   -8.835  1.00 0.00 ? 70 GLN B N    2  
ATOM 3676  C CA   . GLN B 2 60 ? 14.640  1.773   -10.128 1.00 0.00 ? 70 GLN B CA   2  
ATOM 3677  C C    . GLN B 2 60 ? 16.004  1.114   -10.298 1.00 0.00 ? 70 GLN B C    2  
ATOM 3678  O O    . GLN B 2 60 ? 16.189  0.251   -11.158 1.00 0.00 ? 70 GLN B O    2  
ATOM 3679  C CB   . GLN B 2 60 ? 14.404  2.781   -11.253 1.00 0.00 ? 70 GLN B CB   2  
ATOM 3680  C CG   . GLN B 2 60 ? 13.252  3.735   -10.980 1.00 0.00 ? 70 GLN B CG   2  
ATOM 3681  C CD   . GLN B 2 60 ? 13.210  4.890   -11.955 1.00 0.00 ? 70 GLN B CD   2  
ATOM 3682  O OE1  . GLN B 2 60 ? 13.849  5.921   -11.742 1.00 0.00 ? 70 GLN B OE1  2  
ATOM 3683  N NE2  . GLN B 2 60 ? 12.448  4.735   -13.023 1.00 0.00 ? 70 GLN B NE2  2  
ATOM 3684  H H    . GLN B 2 60 ? 14.883  3.356   -8.741  1.00 0.00 ? 70 GLN B H    2  
ATOM 3685  H HA   . GLN B 2 60 ? 13.875  1.012   -10.171 1.00 0.00 ? 70 GLN B HA   2  
ATOM 3686  H HB2  . GLN B 2 60 ? 15.302  3.365   -11.392 1.00 0.00 ? 70 GLN B HB2  2  
ATOM 3687  H HB3  . GLN B 2 60 ? 14.190  2.243   -12.165 1.00 0.00 ? 70 GLN B HB3  2  
ATOM 3688  H HG2  . GLN B 2 60 ? 12.323  3.189   -11.053 1.00 0.00 ? 70 GLN B HG2  2  
ATOM 3689  H HG3  . GLN B 2 60 ? 13.358  4.130   -9.979  1.00 0.00 ? 70 GLN B HG3  2  
ATOM 3690  H HE21 . GLN B 2 60 ? 11.953  3.887   -13.122 1.00 0.00 ? 70 GLN B HE21 2  
ATOM 3691  H HE22 . GLN B 2 60 ? 12.411  5.466   -13.675 1.00 0.00 ? 70 GLN B HE22 2  
ATOM 3692  N N    . ASP B 2 61 ? 16.955  1.524   -9.469  1.00 0.00 ? 71 ASP B N    2  
ATOM 3693  C CA   . ASP B 2 61 ? 18.310  0.984   -9.522  1.00 0.00 ? 71 ASP B CA   2  
ATOM 3694  C C    . ASP B 2 61 ? 18.331  -0.483  -9.094  1.00 0.00 ? 71 ASP B C    2  
ATOM 3695  O O    . ASP B 2 61 ? 17.827  -0.826  -8.023  1.00 0.00 ? 71 ASP B O    2  
ATOM 3696  C CB   . ASP B 2 61 ? 19.239  1.813   -8.631  1.00 0.00 ? 71 ASP B CB   2  
ATOM 3697  C CG   . ASP B 2 61 ? 20.637  1.239   -8.550  1.00 0.00 ? 71 ASP B CG   2  
ATOM 3698  O OD1  . ASP B 2 61 ? 21.473  1.564   -9.415  1.00 0.00 ? 71 ASP B OD1  2  
ATOM 3699  O OD2  . ASP B 2 61 ? 20.912  0.467   -7.612  1.00 0.00 ? 71 ASP B OD2  2  
ATOM 3700  H H    . ASP B 2 61 ? 16.741  2.201   -8.797  1.00 0.00 ? 71 ASP B H    2  
ATOM 3701  H HA   . ASP B 2 61 ? 18.651  1.053   -10.544 1.00 0.00 ? 71 ASP B HA   2  
ATOM 3702  H HB2  . ASP B 2 61 ? 19.305  2.814   -9.028  1.00 0.00 ? 71 ASP B HB2  2  
ATOM 3703  H HB3  . ASP B 2 61 ? 18.826  1.852   -7.634  1.00 0.00 ? 71 ASP B HB3  2  
ATOM 3704  N N    . PRO B 2 62 ? 18.907  -1.365  -9.932  1.00 0.00 ? 72 PRO B N    2  
ATOM 3705  C CA   . PRO B 2 62 ? 18.986  -2.806  -9.657  1.00 0.00 ? 72 PRO B CA   2  
ATOM 3706  C C    . PRO B 2 62 ? 19.622  -3.128  -8.308  1.00 0.00 ? 72 PRO B C    2  
ATOM 3707  O O    . PRO B 2 62 ? 19.064  -3.905  -7.528  1.00 0.00 ? 72 PRO B O    2  
ATOM 3708  C CB   . PRO B 2 62 ? 19.845  -3.366  -10.800 1.00 0.00 ? 72 PRO B CB   2  
ATOM 3709  C CG   . PRO B 2 62 ? 20.455  -2.181  -11.469 1.00 0.00 ? 72 PRO B CG   2  
ATOM 3710  C CD   . PRO B 2 62 ? 19.525  -1.029  -11.225 1.00 0.00 ? 72 PRO B CD   2  
ATOM 3711  H HA   . PRO B 2 62 ? 18.005  -3.260  -9.697  1.00 0.00 ? 72 PRO B HA   2  
ATOM 3712  H HB2  . PRO B 2 62 ? 20.602  -4.019  -10.392 1.00 0.00 ? 72 PRO B HB2  2  
ATOM 3713  H HB3  . PRO B 2 62 ? 19.219  -3.922  -11.482 1.00 0.00 ? 72 PRO B HB3  2  
ATOM 3714  H HG2  . PRO B 2 62 ? 21.424  -1.976  -11.040 1.00 0.00 ? 72 PRO B HG2  2  
ATOM 3715  H HG3  . PRO B 2 62 ? 20.548  -2.367  -12.529 1.00 0.00 ? 72 PRO B HG3  2  
ATOM 3716  H HD2  . PRO B 2 62 ? 20.081  -0.106  -11.158 1.00 0.00 ? 72 PRO B HD2  2  
ATOM 3717  H HD3  . PRO B 2 62 ? 18.781  -0.970  -12.004 1.00 0.00 ? 72 PRO B HD3  2  
ATOM 3718  N N    . ALA B 2 63 ? 20.782  -2.538  -8.034  1.00 0.00 ? 73 ALA B N    2  
ATOM 3719  C CA   . ALA B 2 63 ? 21.485  -2.769  -6.779  1.00 0.00 ? 73 ALA B CA   2  
ATOM 3720  C C    . ALA B 2 63 ? 20.625  -2.392  -5.581  1.00 0.00 ? 73 ALA B C    2  
ATOM 3721  O O    . ALA B 2 63 ? 20.479  -3.174  -4.643  1.00 0.00 ? 73 ALA B O    2  
ATOM 3722  C CB   . ALA B 2 63 ? 22.791  -1.987  -6.751  1.00 0.00 ? 73 ALA B CB   2  
ATOM 3723  H H    . ALA B 2 63 ? 21.187  -1.938  -8.697  1.00 0.00 ? 73 ALA B H    2  
ATOM 3724  H HA   . ALA B 2 63 ? 21.724  -3.820  -6.721  1.00 0.00 ? 73 ALA B HA   2  
ATOM 3725  H HB1  . ALA B 2 63 ? 23.363  -2.270  -5.880  1.00 0.00 ? 73 ALA B HB1  2  
ATOM 3726  H HB2  . ALA B 2 63 ? 22.575  -0.929  -6.711  1.00 0.00 ? 73 ALA B HB2  2  
ATOM 3727  H HB3  . ALA B 2 63 ? 23.358  -2.203  -7.642  1.00 0.00 ? 73 ALA B HB3  2  
ATOM 3728  N N    . HIS B 2 64 ? 20.048  -1.198  -5.626  1.00 0.00 ? 74 HIS B N    2  
ATOM 3729  C CA   . HIS B 2 64 ? 19.202  -0.711  -4.541  1.00 0.00 ? 74 HIS B CA   2  
ATOM 3730  C C    . HIS B 2 64 ? 17.994  -1.621  -4.338  1.00 0.00 ? 74 HIS B C    2  
ATOM 3731  O O    . HIS B 2 64 ? 17.620  -1.924  -3.203  1.00 0.00 ? 74 HIS B O    2  
ATOM 3732  C CB   . HIS B 2 64 ? 18.749  0.724   -4.815  1.00 0.00 ? 74 HIS B CB   2  
ATOM 3733  C CG   . HIS B 2 64 ? 19.814  1.749   -4.564  1.00 0.00 ? 74 HIS B CG   2  
ATOM 3734  N ND1  . HIS B 2 64 ? 20.891  1.961   -5.396  1.00 0.00 ? 74 HIS B ND1  2  
ATOM 3735  C CD2  . HIS B 2 64 ? 19.949  2.637   -3.550  1.00 0.00 ? 74 HIS B CD2  2  
ATOM 3736  C CE1  . HIS B 2 64 ? 21.628  2.949   -4.875  1.00 0.00 ? 74 HIS B CE1  2  
ATOM 3737  N NE2  . HIS B 2 64 ? 21.098  3.396   -3.752  1.00 0.00 ? 74 HIS B NE2  2  
ATOM 3738  H H    . HIS B 2 64 ? 20.203  -0.622  -6.413  1.00 0.00 ? 74 HIS B H    2  
ATOM 3739  H HA   . HIS B 2 64 ? 19.794  -0.722  -3.637  1.00 0.00 ? 74 HIS B HA   2  
ATOM 3740  H HB2  . HIS B 2 64 ? 18.444  0.807   -5.847  1.00 0.00 ? 74 HIS B HB2  2  
ATOM 3741  H HB3  . HIS B 2 64 ? 17.909  0.955   -4.177  1.00 0.00 ? 74 HIS B HB3  2  
ATOM 3742  H HD1  . HIS B 2 64 ? 21.089  1.465   -6.231  1.00 0.00 ? 74 HIS B HD1  2  
ATOM 3743  H HD2  . HIS B 2 64 ? 19.277  2.748   -2.712  1.00 0.00 ? 74 HIS B HD2  2  
ATOM 3744  H HE1  . HIS B 2 64 ? 22.539  3.328   -5.314  1.00 0.00 ? 74 HIS B HE1  2  
ATOM 3745  N N    . LYS B 2 65 ? 17.389  -2.060  -5.440  1.00 0.00 ? 75 LYS B N    2  
ATOM 3746  C CA   . LYS B 2 65 ? 16.235  -2.952  -5.372  1.00 0.00 ? 75 LYS B CA   2  
ATOM 3747  C C    . LYS B 2 65 ? 16.633  -4.272  -4.723  1.00 0.00 ? 75 LYS B C    2  
ATOM 3748  O O    . LYS B 2 65 ? 16.018  -4.713  -3.749  1.00 0.00 ? 75 LYS B O    2  
ATOM 3749  C CB   . LYS B 2 65 ? 15.663  -3.215  -6.769  1.00 0.00 ? 75 LYS B CB   2  
ATOM 3750  C CG   . LYS B 2 65 ? 14.874  -2.048  -7.342  1.00 0.00 ? 75 LYS B CG   2  
ATOM 3751  C CD   . LYS B 2 65 ? 14.077  -2.460  -8.573  1.00 0.00 ? 75 LYS B CD   2  
ATOM 3752  C CE   . LYS B 2 65 ? 14.979  -2.687  -9.775  1.00 0.00 ? 75 LYS B CE   2  
ATOM 3753  N NZ   . LYS B 2 65 ? 14.324  -3.534  -10.805 1.00 0.00 ? 75 LYS B NZ   2  
ATOM 3754  H H    . LYS B 2 65 ? 17.727  -1.775  -6.319  1.00 0.00 ? 75 LYS B H    2  
ATOM 3755  H HA   . LYS B 2 65 ? 15.481  -2.475  -4.763  1.00 0.00 ? 75 LYS B HA   2  
ATOM 3756  H HB2  . LYS B 2 65 ? 16.479  -3.434  -7.441  1.00 0.00 ? 75 LYS B HB2  2  
ATOM 3757  H HB3  . LYS B 2 65 ? 15.010  -4.075  -6.719  1.00 0.00 ? 75 LYS B HB3  2  
ATOM 3758  H HG2  . LYS B 2 65 ? 14.190  -1.685  -6.590  1.00 0.00 ? 75 LYS B HG2  2  
ATOM 3759  H HG3  . LYS B 2 65 ? 15.562  -1.262  -7.616  1.00 0.00 ? 75 LYS B HG3  2  
ATOM 3760  H HD2  . LYS B 2 65 ? 13.546  -3.375  -8.358  1.00 0.00 ? 75 LYS B HD2  2  
ATOM 3761  H HD3  . LYS B 2 65 ? 13.369  -1.679  -8.808  1.00 0.00 ? 75 LYS B HD3  2  
ATOM 3762  H HE2  . LYS B 2 65 ? 15.224  -1.730  -10.212 1.00 0.00 ? 75 LYS B HE2  2  
ATOM 3763  H HE3  . LYS B 2 65 ? 15.885  -3.173  -9.444  1.00 0.00 ? 75 LYS B HE3  2  
ATOM 3764  H HZ1  . LYS B 2 65 ? 13.469  -3.068  -11.167 1.00 0.00 ? 75 LYS B HZ1  2  
ATOM 3765  H HZ2  . LYS B 2 65 ? 14.054  -4.457  -10.391 1.00 0.00 ? 75 LYS B HZ2  2  
ATOM 3766  H HZ3  . LYS B 2 65 ? 14.975  -3.702  -11.599 1.00 0.00 ? 75 LYS B HZ3  2  
ATOM 3767  N N    . ARG B 2 66 ? 17.665  -4.897  -5.282  1.00 0.00 ? 76 ARG B N    2  
ATOM 3768  C CA   . ARG B 2 66 ? 18.175  -6.163  -4.769  1.00 0.00 ? 76 ARG B CA   2  
ATOM 3769  C C    . ARG B 2 66 ? 18.533  -6.046  -3.291  1.00 0.00 ? 76 ARG B C    2  
ATOM 3770  O O    . ARG B 2 66 ? 18.199  -6.924  -2.496  1.00 0.00 ? 76 ARG B O    2  
ATOM 3771  C CB   . ARG B 2 66 ? 19.401  -6.612  -5.571  1.00 0.00 ? 76 ARG B CB   2  
ATOM 3772  C CG   . ARG B 2 66 ? 19.907  -7.998  -5.197  1.00 0.00 ? 76 ARG B CG   2  
ATOM 3773  C CD   . ARG B 2 66 ? 18.862  -9.073  -5.467  1.00 0.00 ? 76 ARG B CD   2  
ATOM 3774  N NE   . ARG B 2 66 ? 19.272  -10.374 -4.942  1.00 0.00 ? 76 ARG B NE   2  
ATOM 3775  C CZ   . ARG B 2 66 ? 18.558  -11.493 -5.060  1.00 0.00 ? 76 ARG B CZ   2  
ATOM 3776  N NH1  . ARG B 2 66 ? 17.389  -11.486 -5.694  1.00 0.00 ? 76 ARG B NH1  2  
ATOM 3777  N NH2  . ARG B 2 66 ? 19.017  -12.625 -4.544  1.00 0.00 ? 76 ARG B NH2  2  
ATOM 3778  H H    . ARG B 2 66 ? 18.064  -4.507  -6.094  1.00 0.00 ? 76 ARG B H    2  
ATOM 3779  H HA   . ARG B 2 66 ? 17.395  -6.900  -4.880  1.00 0.00 ? 76 ARG B HA   2  
ATOM 3780  H HB2  . ARG B 2 66 ? 19.148  -6.615  -6.621  1.00 0.00 ? 76 ARG B HB2  2  
ATOM 3781  H HB3  . ARG B 2 66 ? 20.201  -5.905  -5.407  1.00 0.00 ? 76 ARG B HB3  2  
ATOM 3782  H HG2  . ARG B 2 66 ? 20.789  -8.218  -5.779  1.00 0.00 ? 76 ARG B HG2  2  
ATOM 3783  H HG3  . ARG B 2 66 ? 20.156  -8.007  -4.146  1.00 0.00 ? 76 ARG B HG3  2  
ATOM 3784  H HD2  . ARG B 2 66 ? 17.935  -8.784  -4.997  1.00 0.00 ? 76 ARG B HD2  2  
ATOM 3785  H HD3  . ARG B 2 66 ? 18.715  -9.156  -6.533  1.00 0.00 ? 76 ARG B HD3  2  
ATOM 3786  H HE   . ARG B 2 66 ? 20.136  -10.414 -4.469  1.00 0.00 ? 76 ARG B HE   2  
ATOM 3787  H HH11 . ARG B 2 66 ? 17.034  -10.633 -6.090  1.00 0.00 ? 76 ARG B HH11 2  
ATOM 3788  H HH12 . ARG B 2 66 ? 16.856  -12.334 -5.778  1.00 0.00 ? 76 ARG B HH12 2  
ATOM 3789  H HH21 . ARG B 2 66 ? 19.900  -12.639 -4.066  1.00 0.00 ? 76 ARG B HH21 2  
ATOM 3790  H HH22 . ARG B 2 66 ? 18.488  -13.473 -4.633  1.00 0.00 ? 76 ARG B HH22 2  
ATOM 3791  N N    . LEU B 2 67 ? 19.221  -4.964  -2.935  1.00 0.00 ? 77 LEU B N    2  
ATOM 3792  C CA   . LEU B 2 67 ? 19.616  -4.718  -1.553  1.00 0.00 ? 77 LEU B CA   2  
ATOM 3793  C C    . LEU B 2 67 ? 18.409  -4.752  -0.620  1.00 0.00 ? 77 LEU B C    2  
ATOM 3794  O O    . LEU B 2 67 ? 18.434  -5.428  0.410   1.00 0.00 ? 77 LEU B O    2  
ATOM 3795  C CB   . LEU B 2 67 ? 20.325  -3.364  -1.436  1.00 0.00 ? 77 LEU B CB   2  
ATOM 3796  C CG   . LEU B 2 67 ? 21.837  -3.426  -1.183  1.00 0.00 ? 77 LEU B CG   2  
ATOM 3797  C CD1  . LEU B 2 67 ? 22.135  -4.102  0.146   1.00 0.00 ? 77 LEU B CD1  2  
ATOM 3798  C CD2  . LEU B 2 67 ? 22.549  -4.149  -2.319  1.00 0.00 ? 77 LEU B CD2  2  
ATOM 3799  H H    . LEU B 2 67 ? 19.509  -4.328  -3.630  1.00 0.00 ? 77 LEU B H    2  
ATOM 3800  H HA   . LEU B 2 67 ? 20.299  -5.498  -1.262  1.00 0.00 ? 77 LEU B HA   2  
ATOM 3801  H HB2  . LEU B 2 67 ? 20.159  -2.818  -2.353  1.00 0.00 ? 77 LEU B HB2  2  
ATOM 3802  H HB3  . LEU B 2 67 ? 19.871  -2.815  -0.625  1.00 0.00 ? 77 LEU B HB3  2  
ATOM 3803  H HG   . LEU B 2 67 ? 22.226  -2.419  -1.136  1.00 0.00 ? 77 LEU B HG   2  
ATOM 3804  H HD11 . LEU B 2 67 ? 23.202  -4.135  0.302   1.00 0.00 ? 77 LEU B HD11 2  
ATOM 3805  H HD12 . LEU B 2 67 ? 21.741  -5.108  0.136   1.00 0.00 ? 77 LEU B HD12 2  
ATOM 3806  H HD13 . LEU B 2 67 ? 21.671  -3.543  0.945   1.00 0.00 ? 77 LEU B HD13 2  
ATOM 3807  H HD21 . LEU B 2 67 ? 22.130  -5.137  -2.435  1.00 0.00 ? 77 LEU B HD21 2  
ATOM 3808  H HD22 . LEU B 2 67 ? 23.601  -4.228  -2.092  1.00 0.00 ? 77 LEU B HD22 2  
ATOM 3809  H HD23 . LEU B 2 67 ? 22.419  -3.593  -3.237  1.00 0.00 ? 77 LEU B HD23 2  
ATOM 3810  N N    . LEU B 2 68 ? 17.350  -4.035  -0.985  1.00 0.00 ? 78 LEU B N    2  
ATOM 3811  C CA   . LEU B 2 68 ? 16.142  -3.995  -0.168  1.00 0.00 ? 78 LEU B CA   2  
ATOM 3812  C C    . LEU B 2 68 ? 15.522  -5.384  -0.061  1.00 0.00 ? 78 LEU B C    2  
ATOM 3813  O O    . LEU B 2 68 ? 15.118  -5.809  1.021   1.00 0.00 ? 78 LEU B O    2  
ATOM 3814  C CB   . LEU B 2 68 ? 15.129  -3.001  -0.744  1.00 0.00 ? 78 LEU B CB   2  
ATOM 3815  C CG   . LEU B 2 68 ? 14.066  -2.513  0.247   1.00 0.00 ? 78 LEU B CG   2  
ATOM 3816  C CD1  . LEU B 2 68 ? 13.824  -1.021  0.077   1.00 0.00 ? 78 LEU B CD1  2  
ATOM 3817  C CD2  . LEU B 2 68 ? 12.766  -3.285  0.070   1.00 0.00 ? 78 LEU B CD2  2  
ATOM 3818  H H    . LEU B 2 68 ? 17.382  -3.521  -1.824  1.00 0.00 ? 78 LEU B H    2  
ATOM 3819  H HA   . LEU B 2 68 ? 16.428  -3.669  0.821   1.00 0.00 ? 78 LEU B HA   2  
ATOM 3820  H HB2  . LEU B 2 68 ? 15.669  -2.143  -1.114  1.00 0.00 ? 78 LEU B HB2  2  
ATOM 3821  H HB3  . LEU B 2 68 ? 14.624  -3.474  -1.573  1.00 0.00 ? 78 LEU B HB3  2  
ATOM 3822  H HG   . LEU B 2 68 ? 14.420  -2.679  1.255   1.00 0.00 ? 78 LEU B HG   2  
ATOM 3823  H HD11 . LEU B 2 68 ? 14.734  -0.481  0.296   1.00 0.00 ? 78 LEU B HD11 2  
ATOM 3824  H HD12 . LEU B 2 68 ? 13.044  -0.703  0.753   1.00 0.00 ? 78 LEU B HD12 2  
ATOM 3825  H HD13 . LEU B 2 68 ? 13.523  -0.819  -0.940  1.00 0.00 ? 78 LEU B HD13 2  
ATOM 3826  H HD21 . LEU B 2 68 ? 12.944  -4.334  0.256   1.00 0.00 ? 78 LEU B HD21 2  
ATOM 3827  H HD22 . LEU B 2 68 ? 12.405  -3.156  -0.939  1.00 0.00 ? 78 LEU B HD22 2  
ATOM 3828  H HD23 . LEU B 2 68 ? 12.029  -2.915  0.767   1.00 0.00 ? 78 LEU B HD23 2  
ATOM 3829  N N    . LEU B 2 69 ? 15.454  -6.088  -1.191  1.00 0.00 ? 79 LEU B N    2  
ATOM 3830  C CA   . LEU B 2 69 ? 14.901  -7.441  -1.230  1.00 0.00 ? 79 LEU B CA   2  
ATOM 3831  C C    . LEU B 2 69 ? 15.630  -8.355  -0.248  1.00 0.00 ? 79 LEU B C    2  
ATOM 3832  O O    . LEU B 2 69 ? 15.004  -9.119  0.489   1.00 0.00 ? 79 LEU B O    2  
ATOM 3833  C CB   . LEU B 2 69 ? 14.996  -8.015  -2.647  1.00 0.00 ? 79 LEU B CB   2  
ATOM 3834  C CG   . LEU B 2 69 ? 13.676  -8.067  -3.424  1.00 0.00 ? 79 LEU B CG   2  
ATOM 3835  C CD1  . LEU B 2 69 ? 13.132  -6.667  -3.659  1.00 0.00 ? 79 LEU B CD1  2  
ATOM 3836  C CD2  . LEU B 2 69 ? 13.868  -8.794  -4.745  1.00 0.00 ? 79 LEU B CD2  2  
ATOM 3837  H H    . LEU B 2 69 ? 15.756  -5.672  -2.030  1.00 0.00 ? 79 LEU B H    2  
ATOM 3838  H HA   . LEU B 2 69 ? 13.861  -7.383  -0.945  1.00 0.00 ? 79 LEU B HA   2  
ATOM 3839  H HB2  . LEU B 2 69 ? 15.695  -7.415  -3.209  1.00 0.00 ? 79 LEU B HB2  2  
ATOM 3840  H HB3  . LEU B 2 69 ? 15.385  -9.021  -2.578  1.00 0.00 ? 79 LEU B HB3  2  
ATOM 3841  H HG   . LEU B 2 69 ? 12.948  -8.615  -2.844  1.00 0.00 ? 79 LEU B HG   2  
ATOM 3842  H HD11 . LEU B 2 69 ? 12.181  -6.732  -4.164  1.00 0.00 ? 79 LEU B HD11 2  
ATOM 3843  H HD12 . LEU B 2 69 ? 13.827  -6.109  -4.268  1.00 0.00 ? 79 LEU B HD12 2  
ATOM 3844  H HD13 . LEU B 2 69 ? 13.004  -6.167  -2.711  1.00 0.00 ? 79 LEU B HD13 2  
ATOM 3845  H HD21 . LEU B 2 69 ? 14.159  -9.816  -4.556  1.00 0.00 ? 79 LEU B HD21 2  
ATOM 3846  H HD22 . LEU B 2 69 ? 14.640  -8.301  -5.318  1.00 0.00 ? 79 LEU B HD22 2  
ATOM 3847  H HD23 . LEU B 2 69 ? 12.942  -8.779  -5.301  1.00 0.00 ? 79 LEU B HD23 2  
ATOM 3848  N N    . ASP B 2 70 ? 16.954  -8.265  -0.241  1.00 0.00 ? 80 ASP B N    2  
ATOM 3849  C CA   . ASP B 2 70 ? 17.777  -9.073  0.655   1.00 0.00 ? 80 ASP B CA   2  
ATOM 3850  C C    . ASP B 2 70 ? 17.549  -8.660  2.106   1.00 0.00 ? 80 ASP B C    2  
ATOM 3851  O O    . ASP B 2 70 ? 17.405  -9.504  2.995   1.00 0.00 ? 80 ASP B O    2  
ATOM 3852  C CB   . ASP B 2 70 ? 19.258  -8.923  0.293   1.00 0.00 ? 80 ASP B CB   2  
ATOM 3853  C CG   . ASP B 2 70 ? 20.163  -9.733  1.199   1.00 0.00 ? 80 ASP B CG   2  
ATOM 3854  O OD1  . ASP B 2 70 ? 20.272  -10.961 0.991   1.00 0.00 ? 80 ASP B OD1  2  
ATOM 3855  O OD2  . ASP B 2 70 ? 20.777  -9.146  2.113   1.00 0.00 ? 80 ASP B OD2  2  
ATOM 3856  H H    . ASP B 2 70 ? 17.394  -7.642  -0.861  1.00 0.00 ? 80 ASP B H    2  
ATOM 3857  H HA   . ASP B 2 70 ? 17.486  -10.105 0.536   1.00 0.00 ? 80 ASP B HA   2  
ATOM 3858  H HB2  . ASP B 2 70 ? 19.407  -9.256  -0.724  1.00 0.00 ? 80 ASP B HB2  2  
ATOM 3859  H HB3  . ASP B 2 70 ? 19.536  -7.882  0.370   1.00 0.00 ? 80 ASP B HB3  2  
ATOM 3860  N N    . THR B 2 71 ? 17.484  -7.351  2.329   1.00 0.00 ? 81 THR B N    2  
ATOM 3861  C CA   . THR B 2 71 ? 17.269  -6.802  3.660   1.00 0.00 ? 81 THR B CA   2  
ATOM 3862  C C    . THR B 2 71 ? 15.917  -7.247  4.226   1.00 0.00 ? 81 THR B C    2  
ATOM 3863  O O    . THR B 2 71 ? 15.769  -7.409  5.438   1.00 0.00 ? 81 THR B O    2  
ATOM 3864  C CB   . THR B 2 71 ? 17.343  -5.262  3.641   1.00 0.00 ? 81 THR B CB   2  
ATOM 3865  O OG1  . THR B 2 71 ? 18.551  -4.847  2.994   1.00 0.00 ? 81 THR B OG1  2  
ATOM 3866  C CG2  . THR B 2 71 ? 17.306  -4.689  5.050   1.00 0.00 ? 81 THR B CG2  2  
ATOM 3867  H H    . THR B 2 71 ? 17.588  -6.736  1.571   1.00 0.00 ? 81 THR B H    2  
ATOM 3868  H HA   . THR B 2 71 ? 18.055  -7.172  4.302   1.00 0.00 ? 81 THR B HA   2  
ATOM 3869  H HB   . THR B 2 71 ? 16.497  -4.881  3.088   1.00 0.00 ? 81 THR B HB   2  
ATOM 3870  H HG1  . THR B 2 71 ? 18.597  -5.236  2.112   1.00 0.00 ? 81 THR B HG1  2  
ATOM 3871  H HG21 . THR B 2 71 ? 17.248  -3.611  4.999   1.00 0.00 ? 81 THR B HG21 2  
ATOM 3872  H HG22 . THR B 2 71 ? 18.204  -4.976  5.578   1.00 0.00 ? 81 THR B HG22 2  
ATOM 3873  H HG23 . THR B 2 71 ? 16.443  -5.072  5.572   1.00 0.00 ? 81 THR B HG23 2  
ATOM 3874  N N    . LEU B 2 72 ? 14.943  -7.450  3.342   1.00 0.00 ? 82 LEU B N    2  
ATOM 3875  C CA   . LEU B 2 72 ? 13.612  -7.893  3.752   1.00 0.00 ? 82 LEU B CA   2  
ATOM 3876  C C    . LEU B 2 72 ? 13.697  -9.232  4.473   1.00 0.00 ? 82 LEU B C    2  
ATOM 3877  O O    . LEU B 2 72 ? 13.087  -9.421  5.520   1.00 0.00 ? 82 LEU B O    2  
ATOM 3878  C CB   . LEU B 2 72 ? 12.689  -8.019  2.541   1.00 0.00 ? 82 LEU B CB   2  
ATOM 3879  C CG   . LEU B 2 72 ? 11.931  -6.750  2.157   1.00 0.00 ? 82 LEU B CG   2  
ATOM 3880  C CD1  . LEU B 2 72 ? 11.316  -6.902  0.777   1.00 0.00 ? 82 LEU B CD1  2  
ATOM 3881  C CD2  . LEU B 2 72 ? 10.854  -6.437  3.186   1.00 0.00 ? 82 LEU B CD2  2  
ATOM 3882  H H    . LEU B 2 72 ? 15.118  -7.291  2.389   1.00 0.00 ? 82 LEU B H    2  
ATOM 3883  H HA   . LEU B 2 72 ? 13.210  -7.155  4.431   1.00 0.00 ? 82 LEU B HA   2  
ATOM 3884  H HB2  . LEU B 2 72 ? 13.284  -8.328  1.694   1.00 0.00 ? 82 LEU B HB2  2  
ATOM 3885  H HB3  . LEU B 2 72 ? 11.965  -8.794  2.748   1.00 0.00 ? 82 LEU B HB3  2  
ATOM 3886  H HG   . LEU B 2 72 ? 12.621  -5.919  2.128   1.00 0.00 ? 82 LEU B HG   2  
ATOM 3887  H HD11 . LEU B 2 72 ? 10.815  -5.985  0.504   1.00 0.00 ? 82 LEU B HD11 2  
ATOM 3888  H HD12 . LEU B 2 72 ? 10.604  -7.713  0.788   1.00 0.00 ? 82 LEU B HD12 2  
ATOM 3889  H HD13 . LEU B 2 72 ? 12.093  -7.114  0.059   1.00 0.00 ? 82 LEU B HD13 2  
ATOM 3890  H HD21 . LEU B 2 72 ? 11.316  -6.182  4.127   1.00 0.00 ? 82 LEU B HD21 2  
ATOM 3891  H HD22 . LEU B 2 72 ? 10.220  -7.301  3.318   1.00 0.00 ? 82 LEU B HD22 2  
ATOM 3892  H HD23 . LEU B 2 72 ? 10.257  -5.604  2.841   1.00 0.00 ? 82 LEU B HD23 2  
ATOM 3893  N N    . GLN B 2 73 ? 14.463  -10.152 3.904   1.00 0.00 ? 83 GLN B N    2  
ATOM 3894  C CA   . GLN B 2 73 ? 14.634  -11.470 4.496   1.00 0.00 ? 83 GLN B CA   2  
ATOM 3895  C C    . GLN B 2 73 ? 15.412  -11.360 5.803   1.00 0.00 ? 83 GLN B C    2  
ATOM 3896  O O    . GLN B 2 73 ? 15.029  -11.936 6.821   1.00 0.00 ? 83 GLN B O    2  
ATOM 3897  C CB   . GLN B 2 73 ? 15.368  -12.402 3.530   1.00 0.00 ? 83 GLN B CB   2  
ATOM 3898  C CG   . GLN B 2 73 ? 14.679  -12.559 2.183   1.00 0.00 ? 83 GLN B CG   2  
ATOM 3899  C CD   . GLN B 2 73 ? 15.555  -13.255 1.159   1.00 0.00 ? 83 GLN B CD   2  
ATOM 3900  O OE1  . GLN B 2 73 ? 16.781  -13.156 1.199   1.00 0.00 ? 83 GLN B OE1  2  
ATOM 3901  N NE2  . GLN B 2 73 ? 14.933  -13.966 0.229   1.00 0.00 ? 83 GLN B NE2  2  
ATOM 3902  H H    . GLN B 2 73 ? 14.921  -9.939  3.062   1.00 0.00 ? 83 GLN B H    2  
ATOM 3903  H HA   . GLN B 2 73 ? 13.653  -11.875 4.704   1.00 0.00 ? 83 GLN B HA   2  
ATOM 3904  H HB2  . GLN B 2 73 ? 16.361  -12.013 3.359   1.00 0.00 ? 83 GLN B HB2  2  
ATOM 3905  H HB3  . GLN B 2 73 ? 15.450  -13.379 3.985   1.00 0.00 ? 83 GLN B HB3  2  
ATOM 3906  H HG2  . GLN B 2 73 ? 13.780  -13.140 2.319   1.00 0.00 ? 83 GLN B HG2  2  
ATOM 3907  H HG3  . GLN B 2 73 ? 14.422  -11.580 1.809   1.00 0.00 ? 83 GLN B HG3  2  
ATOM 3908  H HE21 . GLN B 2 73 ? 13.954  -14.004 0.253   1.00 0.00 ? 83 GLN B HE21 2  
ATOM 3909  H HE22 . GLN B 2 73 ? 15.477  -14.425 -0.445  1.00 0.00 ? 83 GLN B HE22 2  
ATOM 3910  N N    . LEU B 2 74 ? 16.514  -10.620 5.753   1.00 0.00 ? 84 LEU B N    2  
ATOM 3911  C CA   . LEU B 2 74 ? 17.372  -10.404 6.913   1.00 0.00 ? 84 LEU B CA   2  
ATOM 3912  C C    . LEU B 2 74 ? 16.623  -9.791  8.098   1.00 0.00 ? 84 LEU B C    2  
ATOM 3913  O O    . LEU B 2 74 ? 16.755  -10.252 9.230   1.00 0.00 ? 84 LEU B O    2  
ATOM 3914  C CB   . LEU B 2 74 ? 18.530  -9.488  6.515   1.00 0.00 ? 84 LEU B CB   2  
ATOM 3915  C CG   . LEU B 2 74 ? 19.643  -9.354  7.551   1.00 0.00 ? 84 LEU B CG   2  
ATOM 3916  C CD1  . LEU B 2 74 ? 20.474  -10.626 7.605   1.00 0.00 ? 84 LEU B CD1  2  
ATOM 3917  C CD2  . LEU B 2 74 ? 20.518  -8.156  7.232   1.00 0.00 ? 84 LEU B CD2  2  
ATOM 3918  H H    . LEU B 2 74 ? 16.803  -10.247 4.891   1.00 0.00 ? 84 LEU B H    2  
ATOM 3919  H HA   . LEU B 2 74 ? 17.774  -11.359 7.211   1.00 0.00 ? 84 LEU B HA   2  
ATOM 3920  H HB2  . LEU B 2 74 ? 18.962  -9.866  5.600   1.00 0.00 ? 84 LEU B HB2  2  
ATOM 3921  H HB3  . LEU B 2 74 ? 18.130  -8.504  6.322   1.00 0.00 ? 84 LEU B HB3  2  
ATOM 3922  H HG   . LEU B 2 74 ? 19.204  -9.201  8.525   1.00 0.00 ? 84 LEU B HG   2  
ATOM 3923  H HD11 . LEU B 2 74 ? 21.375  -10.442 8.171   1.00 0.00 ? 84 LEU B HD11 2  
ATOM 3924  H HD12 . LEU B 2 74 ? 20.732  -10.930 6.602   1.00 0.00 ? 84 LEU B HD12 2  
ATOM 3925  H HD13 . LEU B 2 74 ? 19.903  -11.408 8.082   1.00 0.00 ? 84 LEU B HD13 2  
ATOM 3926  H HD21 . LEU B 2 74 ? 19.911  -7.262  7.210   1.00 0.00 ? 84 LEU B HD21 2  
ATOM 3927  H HD22 . LEU B 2 74 ? 20.986  -8.296  6.269   1.00 0.00 ? 84 LEU B HD22 2  
ATOM 3928  H HD23 . LEU B 2 74 ? 21.279  -8.054  7.990   1.00 0.00 ? 84 LEU B HD23 2  
ATOM 3929  N N    . SER B 2 75 ? 15.852  -8.747  7.847   1.00 0.00 ? 85 SER B N    2  
ATOM 3930  C CA   . SER B 2 75 ? 15.120  -8.079  8.913   1.00 0.00 ? 85 SER B CA   2  
ATOM 3931  C C    . SER B 2 75 ? 13.855  -8.839  9.294   1.00 0.00 ? 85 SER B C    2  
ATOM 3932  O O    . SER B 2 75 ? 13.483  -8.876  10.470  1.00 0.00 ? 85 SER B O    2  
ATOM 3933  C CB   . SER B 2 75 ? 14.777  -6.655  8.490   1.00 0.00 ? 85 SER B CB   2  
ATOM 3934  O OG   . SER B 2 75 ? 15.886  -6.037  7.863   1.00 0.00 ? 85 SER B OG   2  
ATOM 3935  H H    . SER B 2 75 ? 15.776  -8.414  6.926   1.00 0.00 ? 85 SER B H    2  
ATOM 3936  H HA   . SER B 2 75 ? 15.767  -8.036  9.777   1.00 0.00 ? 85 SER B HA   2  
ATOM 3937  H HB2  . SER B 2 75 ? 13.951  -6.678  7.795   1.00 0.00 ? 85 SER B HB2  2  
ATOM 3938  H HB3  . SER B 2 75 ? 14.502  -6.078  9.361   1.00 0.00 ? 85 SER B HB3  2  
ATOM 3939  H HG   . SER B 2 75 ? 15.918  -6.303  6.937   1.00 0.00 ? 85 SER B HG   2  
ATOM 3940  N N    . LYS B 2 76 ? 13.213  -9.449  8.301   1.00 0.00 ? 86 LYS B N    2  
ATOM 3941  C CA   . LYS B 2 76 ? 11.981  -10.212 8.505   1.00 0.00 ? 86 LYS B CA   2  
ATOM 3942  C C    . LYS B 2 76 ? 10.858  -9.293  8.984   1.00 0.00 ? 86 LYS B C    2  
ATOM 3943  O O    . LYS B 2 76 ? 10.311  -9.531  10.083  1.00 0.00 ? 86 LYS B O    2  
ATOM 3944  C CB   . LYS B 2 76 ? 12.206  -11.357 9.502   1.00 0.00 ? 86 LYS B CB   2  
ATOM 3945  C CG   . LYS B 2 76 ? 11.642  -12.692 9.043   1.00 0.00 ? 86 LYS B CG   2  
ATOM 3946  C CD   . LYS B 2 76 ? 10.125  -12.662 8.952   1.00 0.00 ? 86 LYS B CD   2  
ATOM 3947  C CE   . LYS B 2 76 ? 9.562   -14.028 8.601   1.00 0.00 ? 86 LYS B CE   2  
ATOM 3948  N NZ   . LYS B 2 76 ? 10.051  -14.508 7.283   1.00 0.00 ? 86 LYS B NZ   2  
ATOM 3949  O OXT  . LYS B 2 76 ? 10.548  -8.325  8.268   1.00 0.00 ? 86 LYS B OXT  2  
ATOM 3950  H H    . LYS B 2 76 ? 13.571  -9.376  7.390   1.00 0.00 ? 86 LYS B H    2  
ATOM 3951  H HA   . LYS B 2 76 ? 11.698  -10.631 7.550   1.00 0.00 ? 86 LYS B HA   2  
ATOM 3952  H HB2  . LYS B 2 76 ? 13.266  -11.476 9.663   1.00 0.00 ? 86 LYS B HB2  2  
ATOM 3953  H HB3  . LYS B 2 76 ? 11.736  -11.097 10.440  1.00 0.00 ? 86 LYS B HB3  2  
ATOM 3954  H HG2  . LYS B 2 76 ? 12.044  -12.923 8.068   1.00 0.00 ? 86 LYS B HG2  2  
ATOM 3955  H HG3  . LYS B 2 76 ? 11.938  -13.458 9.745   1.00 0.00 ? 86 LYS B HG3  2  
ATOM 3956  H HD2  . LYS B 2 76 ? 9.722   -12.352 9.904   1.00 0.00 ? 86 LYS B HD2  2  
ATOM 3957  H HD3  . LYS B 2 76 ? 9.833   -11.956 8.189   1.00 0.00 ? 86 LYS B HD3  2  
ATOM 3958  H HE2  . LYS B 2 76 ? 9.860   -14.732 9.363   1.00 0.00 ? 86 LYS B HE2  2  
ATOM 3959  H HE3  . LYS B 2 76 ? 8.484   -13.963 8.574   1.00 0.00 ? 86 LYS B HE3  2  
ATOM 3960  H HZ1  . LYS B 2 76 ? 9.730   -13.865 6.529   1.00 0.00 ? 86 LYS B HZ1  2  
ATOM 3961  H HZ2  . LYS B 2 76 ? 9.681   -15.461 7.090   1.00 0.00 ? 86 LYS B HZ2  2  
ATOM 3962  H HZ3  . LYS B 2 76 ? 11.088  -14.542 7.276   1.00 0.00 ? 86 LYS B HZ3  2  
ATOM 3963  N N    . THR A 1 18 ? -14.687 -7.461  8.089   1.00 0.00 ? 14 THR A N    3  
ATOM 3964  C CA   . THR A 1 18 ? -15.283 -6.109  8.129   1.00 0.00 ? 14 THR A CA   3  
ATOM 3965  C C    . THR A 1 18 ? -14.469 -5.123  7.296   1.00 0.00 ? 14 THR A C    3  
ATOM 3966  O O    . THR A 1 18 ? -13.335 -5.409  6.912   1.00 0.00 ? 14 THR A O    3  
ATOM 3967  C CB   . THR A 1 18 ? -15.360 -5.591  9.574   1.00 0.00 ? 14 THR A CB   3  
ATOM 3968  O OG1  . THR A 1 18 ? -14.134 -5.885  10.252  1.00 0.00 ? 14 THR A OG1  3  
ATOM 3969  C CG2  . THR A 1 18 ? -16.526 -6.221  10.318  1.00 0.00 ? 14 THR A CG2  3  
ATOM 3970  H H    . THR A 1 18 ? -14.415 -7.704  7.117   1.00 0.00 ? 14 THR A H    3  
ATOM 3971  H HA   . THR A 1 18 ? -16.284 -6.161  7.730   1.00 0.00 ? 14 THR A HA   3  
ATOM 3972  H HB   . THR A 1 18 ? -15.502 -4.520  9.550   1.00 0.00 ? 14 THR A HB   3  
ATOM 3973  H HG1  . THR A 1 18 ? -14.276 -5.864  11.208  1.00 0.00 ? 14 THR A HG1  3  
ATOM 3974  H HG21 . THR A 1 18 ? -17.454 -5.931  9.845   1.00 0.00 ? 14 THR A HG21 3  
ATOM 3975  H HG22 . THR A 1 18 ? -16.524 -5.881  11.343  1.00 0.00 ? 14 THR A HG22 3  
ATOM 3976  H HG23 . THR A 1 18 ? -16.430 -7.295  10.294  1.00 0.00 ? 14 THR A HG23 3  
ATOM 3977  N N    . VAL A 1 19 ? -15.067 -3.966  7.019   1.00 0.00 ? 15 VAL A N    3  
ATOM 3978  C CA   . VAL A 1 19 ? -14.409 -2.915  6.240   1.00 0.00 ? 15 VAL A CA   3  
ATOM 3979  C C    . VAL A 1 19 ? -13.103 -2.480  6.908   1.00 0.00 ? 15 VAL A C    3  
ATOM 3980  O O    . VAL A 1 19 ? -12.099 -2.239  6.239   1.00 0.00 ? 15 VAL A O    3  
ATOM 3981  C CB   . VAL A 1 19 ? -15.323 -1.679  6.071   1.00 0.00 ? 15 VAL A CB   3  
ATOM 3982  C CG1  . VAL A 1 19 ? -14.730 -0.699  5.069   1.00 0.00 ? 15 VAL A CG1  3  
ATOM 3983  C CG2  . VAL A 1 19 ? -16.722 -2.099  5.646   1.00 0.00 ? 15 VAL A CG2  3  
ATOM 3984  H H    . VAL A 1 19 ? -15.985 -3.835  7.332   1.00 0.00 ? 15 VAL A H    3  
ATOM 3985  H HA   . VAL A 1 19 ? -14.188 -3.312  5.260   1.00 0.00 ? 15 VAL A HA   3  
ATOM 3986  H HB   . VAL A 1 19 ? -15.396 -1.179  7.026   1.00 0.00 ? 15 VAL A HB   3  
ATOM 3987  H HG11 . VAL A 1 19 ? -13.762 -0.371  5.416   1.00 0.00 ? 15 VAL A HG11 3  
ATOM 3988  H HG12 . VAL A 1 19 ? -15.385 0.154   4.968   1.00 0.00 ? 15 VAL A HG12 3  
ATOM 3989  H HG13 . VAL A 1 19 ? -14.623 -1.186  4.110   1.00 0.00 ? 15 VAL A HG13 3  
ATOM 3990  H HG21 . VAL A 1 19 ? -17.161 -2.719  6.413   1.00 0.00 ? 15 VAL A HG21 3  
ATOM 3991  H HG22 . VAL A 1 19 ? -16.666 -2.654  4.722   1.00 0.00 ? 15 VAL A HG22 3  
ATOM 3992  H HG23 . VAL A 1 19 ? -17.332 -1.219  5.501   1.00 0.00 ? 15 VAL A HG23 3  
ATOM 3993  N N    . SER A 1 20 ? -13.127 -2.410  8.232   1.00 0.00 ? 16 SER A N    3  
ATOM 3994  C CA   . SER A 1 20 ? -11.969 -2.007  9.013   1.00 0.00 ? 16 SER A CA   3  
ATOM 3995  C C    . SER A 1 20 ? -10.787 -2.950  8.794   1.00 0.00 ? 16 SER A C    3  
ATOM 3996  O O    . SER A 1 20 ? -9.660  -2.500  8.593   1.00 0.00 ? 16 SER A O    3  
ATOM 3997  C CB   . SER A 1 20 ? -12.360 -1.977  10.487  1.00 0.00 ? 16 SER A CB   3  
ATOM 3998  O OG   . SER A 1 20 ? -13.759 -2.189  10.626  1.00 0.00 ? 16 SER A OG   3  
ATOM 3999  H H    . SER A 1 20 ? -13.955 -2.631  8.708   1.00 0.00 ? 16 SER A H    3  
ATOM 4000  H HA   . SER A 1 20 ? -11.687 -1.013  8.704   1.00 0.00 ? 16 SER A HA   3  
ATOM 4001  H HB2  . SER A 1 20 ? -11.832 -2.756  11.015  1.00 0.00 ? 16 SER A HB2  3  
ATOM 4002  H HB3  . SER A 1 20 ? -12.108 -1.016  10.908  1.00 0.00 ? 16 SER A HB3  3  
ATOM 4003  H HG   . SER A 1 20 ? -14.010 -2.051  11.549  1.00 0.00 ? 16 SER A HG   3  
ATOM 4004  N N    . GLU A 1 21 ? -11.055 -4.254  8.803   1.00 0.00 ? 17 GLU A N    3  
ATOM 4005  C CA   . GLU A 1 21 ? -10.010 -5.257  8.610   1.00 0.00 ? 17 GLU A CA   3  
ATOM 4006  C C    . GLU A 1 21 ? -9.351  -5.119  7.246   1.00 0.00 ? 17 GLU A C    3  
ATOM 4007  O O    . GLU A 1 21 ? -8.163  -5.399  7.088   1.00 0.00 ? 17 GLU A O    3  
ATOM 4008  C CB   . GLU A 1 21 ? -10.586 -6.662  8.748   1.00 0.00 ? 17 GLU A CB   3  
ATOM 4009  C CG   . GLU A 1 21 ? -11.081 -6.985  10.142  1.00 0.00 ? 17 GLU A CG   3  
ATOM 4010  C CD   . GLU A 1 21 ? -11.654 -8.378  10.225  1.00 0.00 ? 17 GLU A CD   3  
ATOM 4011  O OE1  . GLU A 1 21 ? -12.709 -8.623  9.610   1.00 0.00 ? 17 GLU A OE1  3  
ATOM 4012  O OE2  . GLU A 1 21 ? -11.038 -9.239  10.885  1.00 0.00 ? 17 GLU A OE2  3  
ATOM 4013  H H    . GLU A 1 21 ? -11.976 -4.548  8.951   1.00 0.00 ? 17 GLU A H    3  
ATOM 4014  H HA   . GLU A 1 21 ? -9.264  -5.109  9.375   1.00 0.00 ? 17 GLU A HA   3  
ATOM 4015  H HB2  . GLU A 1 21 ? -11.412 -6.768  8.062   1.00 0.00 ? 17 GLU A HB2  3  
ATOM 4016  H HB3  . GLU A 1 21 ? -9.819  -7.377  8.488   1.00 0.00 ? 17 GLU A HB3  3  
ATOM 4017  H HG2  . GLU A 1 21 ? -10.257 -6.906  10.835  1.00 0.00 ? 17 GLU A HG2  3  
ATOM 4018  H HG3  . GLU A 1 21 ? -11.851 -6.276  10.412  1.00 0.00 ? 17 GLU A HG3  3  
ATOM 4019  N N    . TRP A 1 22 ? -10.132 -4.685  6.270   1.00 0.00 ? 18 TRP A N    3  
ATOM 4020  C CA   . TRP A 1 22 ? -9.647  -4.510  4.909   1.00 0.00 ? 18 TRP A CA   3  
ATOM 4021  C C    . TRP A 1 22 ? -8.758  -3.272  4.808   1.00 0.00 ? 18 TRP A C    3  
ATOM 4022  O O    . TRP A 1 22 ? -7.749  -3.268  4.110   1.00 0.00 ? 18 TRP A O    3  
ATOM 4023  C CB   . TRP A 1 22 ? -10.839 -4.396  3.951   1.00 0.00 ? 18 TRP A CB   3  
ATOM 4024  C CG   . TRP A 1 22 ? -10.455 -4.155  2.524   1.00 0.00 ? 18 TRP A CG   3  
ATOM 4025  C CD1  . TRP A 1 22 ? -9.898  -5.053  1.662   1.00 0.00 ? 18 TRP A CD1  3  
ATOM 4026  C CD2  . TRP A 1 22 ? -10.604 -2.933  1.792   1.00 0.00 ? 18 TRP A CD2  3  
ATOM 4027  N NE1  . TRP A 1 22 ? -9.693  -4.466  0.438   1.00 0.00 ? 18 TRP A NE1  3  
ATOM 4028  C CE2  . TRP A 1 22 ? -10.114 -3.163  0.495   1.00 0.00 ? 18 TRP A CE2  3  
ATOM 4029  C CE3  . TRP A 1 22 ? -11.104 -1.667  2.110   1.00 0.00 ? 18 TRP A CE3  3  
ATOM 4030  C CZ2  . TRP A 1 22 ? -10.110 -2.173  -0.485  1.00 0.00 ? 18 TRP A CZ2  3  
ATOM 4031  C CZ3  . TRP A 1 22 ? -11.097 -0.687  1.137   1.00 0.00 ? 18 TRP A CZ3  3  
ATOM 4032  C CH2  . TRP A 1 22 ? -10.604 -0.944  -0.146  1.00 0.00 ? 18 TRP A CH2  3  
ATOM 4033  H H    . TRP A 1 22 ? -11.063 -4.456  6.480   1.00 0.00 ? 18 TRP A H    3  
ATOM 4034  H HA   . TRP A 1 22 ? -9.065  -5.383  4.649   1.00 0.00 ? 18 TRP A HA   3  
ATOM 4035  H HB2  . TRP A 1 22 ? -11.409 -5.312  3.989   1.00 0.00 ? 18 TRP A HB2  3  
ATOM 4036  H HB3  . TRP A 1 22 ? -11.466 -3.576  4.270   1.00 0.00 ? 18 TRP A HB3  3  
ATOM 4037  H HD1  . TRP A 1 22 ? -9.660  -6.075  1.917   1.00 0.00 ? 18 TRP A HD1  3  
ATOM 4038  H HE1  . TRP A 1 22 ? -9.306  -4.908  -0.348  1.00 0.00 ? 18 TRP A HE1  3  
ATOM 4039  H HE3  . TRP A 1 22 ? -11.490 -1.452  3.094   1.00 0.00 ? 18 TRP A HE3  3  
ATOM 4040  H HZ2  . TRP A 1 22 ? -9.731  -2.356  -1.480  1.00 0.00 ? 18 TRP A HZ2  3  
ATOM 4041  H HZ3  . TRP A 1 22 ? -11.478 0.298   1.365   1.00 0.00 ? 18 TRP A HZ3  3  
ATOM 4042  H HH2  . TRP A 1 22 ? -10.617 -0.147  -0.875  1.00 0.00 ? 18 TRP A HH2  3  
ATOM 4043  N N    . LEU A 1 23 ? -9.136  -2.231  5.528   1.00 0.00 ? 19 LEU A N    3  
ATOM 4044  C CA   . LEU A 1 23 ? -8.385  -0.987  5.514   1.00 0.00 ? 19 LEU A CA   3  
ATOM 4045  C C    . LEU A 1 23 ? -7.155  -1.049  6.416   1.00 0.00 ? 19 LEU A C    3  
ATOM 4046  O O    . LEU A 1 23 ? -6.135  -0.422  6.126   1.00 0.00 ? 19 LEU A O    3  
ATOM 4047  C CB   . LEU A 1 23 ? -9.288  0.175   5.925   1.00 0.00 ? 19 LEU A CB   3  
ATOM 4048  C CG   . LEU A 1 23 ? -10.224 0.677   4.823   1.00 0.00 ? 19 LEU A CG   3  
ATOM 4049  C CD1  . LEU A 1 23 ? -11.396 1.437   5.417   1.00 0.00 ? 19 LEU A CD1  3  
ATOM 4050  C CD2  . LEU A 1 23 ? -9.466  1.556   3.839   1.00 0.00 ? 19 LEU A CD2  3  
ATOM 4051  H H    . LEU A 1 23 ? -9.956  -2.300  6.067   1.00 0.00 ? 19 LEU A H    3  
ATOM 4052  H HA   . LEU A 1 23 ? -8.055  -0.821  4.499   1.00 0.00 ? 19 LEU A HA   3  
ATOM 4053  H HB2  . LEU A 1 23 ? -9.890  -0.141  6.765   1.00 0.00 ? 19 LEU A HB2  3  
ATOM 4054  H HB3  . LEU A 1 23 ? -8.665  0.998   6.238   1.00 0.00 ? 19 LEU A HB3  3  
ATOM 4055  H HG   . LEU A 1 23 ? -10.616 -0.170  4.281   1.00 0.00 ? 19 LEU A HG   3  
ATOM 4056  H HD11 . LEU A 1 23 ? -12.028 1.805   4.623   1.00 0.00 ? 19 LEU A HD11 3  
ATOM 4057  H HD12 . LEU A 1 23 ? -11.027 2.268   5.998   1.00 0.00 ? 19 LEU A HD12 3  
ATOM 4058  H HD13 . LEU A 1 23 ? -11.966 0.778   6.055   1.00 0.00 ? 19 LEU A HD13 3  
ATOM 4059  H HD21 . LEU A 1 23 ? -8.680  0.981   3.372   1.00 0.00 ? 19 LEU A HD21 3  
ATOM 4060  H HD22 . LEU A 1 23 ? -9.035  2.396   4.365   1.00 0.00 ? 19 LEU A HD22 3  
ATOM 4061  H HD23 . LEU A 1 23 ? -10.145 1.918   3.082   1.00 0.00 ? 19 LEU A HD23 3  
ATOM 4062  N N    . GLU A 1 24 ? -7.231  -1.805  7.506   1.00 0.00 ? 20 GLU A N    3  
ATOM 4063  C CA   . GLU A 1 24 ? -6.104  -1.900  8.429   1.00 0.00 ? 20 GLU A CA   3  
ATOM 4064  C C    . GLU A 1 24 ? -4.988  -2.781  7.875   1.00 0.00 ? 20 GLU A C    3  
ATOM 4065  O O    . GLU A 1 24 ? -3.811  -2.485  8.074   1.00 0.00 ? 20 GLU A O    3  
ATOM 4066  C CB   . GLU A 1 24 ? -6.553  -2.397  9.808   1.00 0.00 ? 20 GLU A CB   3  
ATOM 4067  C CG   . GLU A 1 24 ? -6.955  -3.859  9.851   1.00 0.00 ? 20 GLU A CG   3  
ATOM 4068  C CD   . GLU A 1 24 ? -7.486  -4.266  11.209  1.00 0.00 ? 20 GLU A CD   3  
ATOM 4069  O OE1  . GLU A 1 24 ? -6.669  -4.515  12.119  1.00 0.00 ? 20 GLU A OE1  3  
ATOM 4070  O OE2  . GLU A 1 24 ? -8.719  -4.326  11.379  1.00 0.00 ? 20 GLU A OE2  3  
ATOM 4071  H H    . GLU A 1 24 ? -8.066  -2.293  7.704   1.00 0.00 ? 20 GLU A H    3  
ATOM 4072  H HA   . GLU A 1 24 ? -5.708  -0.902  8.543   1.00 0.00 ? 20 GLU A HA   3  
ATOM 4073  H HB2  . GLU A 1 24 ? -5.740  -2.255  10.506  1.00 0.00 ? 20 GLU A HB2  3  
ATOM 4074  H HB3  . GLU A 1 24 ? -7.396  -1.806  10.133  1.00 0.00 ? 20 GLU A HB3  3  
ATOM 4075  H HG2  . GLU A 1 24 ? -7.719  -4.032  9.111   1.00 0.00 ? 20 GLU A HG2  3  
ATOM 4076  H HG3  . GLU A 1 24 ? -6.088  -4.463  9.623   1.00 0.00 ? 20 GLU A HG3  3  
ATOM 4077  N N    . SER A 1 25 ? -5.350  -3.853  7.185   1.00 0.00 ? 21 SER A N    3  
ATOM 4078  C CA   . SER A 1 25 ? -4.353  -4.754  6.606   1.00 0.00 ? 21 SER A CA   3  
ATOM 4079  C C    . SER A 1 25 ? -3.389  -4.018  5.675   1.00 0.00 ? 21 SER A C    3  
ATOM 4080  O O    . SER A 1 25 ? -2.192  -4.296  5.662   1.00 0.00 ? 21 SER A O    3  
ATOM 4081  C CB   . SER A 1 25 ? -5.034  -5.894  5.858   1.00 0.00 ? 21 SER A CB   3  
ATOM 4082  O OG   . SER A 1 25 ? -6.252  -5.473  5.279   1.00 0.00 ? 21 SER A OG   3  
ATOM 4083  H H    . SER A 1 25 ? -6.304  -4.069  7.095   1.00 0.00 ? 21 SER A H    3  
ATOM 4084  H HA   . SER A 1 25 ? -3.780  -5.175  7.420   1.00 0.00 ? 21 SER A HA   3  
ATOM 4085  H HB2  . SER A 1 25 ? -4.378  -6.247  5.074   1.00 0.00 ? 21 SER A HB2  3  
ATOM 4086  H HB3  . SER A 1 25 ? -5.233  -6.699  6.549   1.00 0.00 ? 21 SER A HB3  3  
ATOM 4087  H HG   . SER A 1 25 ? -6.979  -5.652  5.887   1.00 0.00 ? 21 SER A HG   3  
ATOM 4088  N N    . ILE A 1 26 ? -3.913  -3.058  4.919   1.00 0.00 ? 22 ILE A N    3  
ATOM 4089  C CA   . ILE A 1 26 ? -3.100  -2.286  3.985   1.00 0.00 ? 22 ILE A CA   3  
ATOM 4090  C C    . ILE A 1 26 ? -2.578  -1.013  4.632   1.00 0.00 ? 22 ILE A C    3  
ATOM 4091  O O    . ILE A 1 26 ? -1.865  -0.240  3.994   1.00 0.00 ? 22 ILE A O    3  
ATOM 4092  C CB   . ILE A 1 26 ? -3.879  -1.938  2.699   1.00 0.00 ? 22 ILE A CB   3  
ATOM 4093  C CG1  . ILE A 1 26 ? -5.272  -1.415  3.043   1.00 0.00 ? 22 ILE A CG1  3  
ATOM 4094  C CG2  . ILE A 1 26 ? -3.955  -3.161  1.813   1.00 0.00 ? 22 ILE A CG2  3  
ATOM 4095  C CD1  . ILE A 1 26 ? -6.048  -0.901  1.850   1.00 0.00 ? 22 ILE A CD1  3  
ATOM 4096  H H    . ILE A 1 26 ? -4.871  -2.872  4.978   1.00 0.00 ? 22 ILE A H    3  
ATOM 4097  H HA   . ILE A 1 26 ? -2.252  -2.896  3.701   1.00 0.00 ? 22 ILE A HA   3  
ATOM 4098  H HB   . ILE A 1 26 ? -3.338  -1.173  2.162   1.00 0.00 ? 22 ILE A HB   3  
ATOM 4099  H HG12 . ILE A 1 26 ? -5.842  -2.210  3.493   1.00 0.00 ? 22 ILE A HG12 3  
ATOM 4100  H HG13 . ILE A 1 26 ? -5.175  -0.602  3.748   1.00 0.00 ? 22 ILE A HG13 3  
ATOM 4101  H HG21 . ILE A 1 26 ? -4.389  -3.975  2.371   1.00 0.00 ? 22 ILE A HG21 3  
ATOM 4102  H HG22 . ILE A 1 26 ? -2.960  -3.432  1.493   1.00 0.00 ? 22 ILE A HG22 3  
ATOM 4103  H HG23 . ILE A 1 26 ? -4.569  -2.946  0.946   1.00 0.00 ? 22 ILE A HG23 3  
ATOM 4104  H HD11 . ILE A 1 26 ? -5.555  -0.029  1.449   1.00 0.00 ? 22 ILE A HD11 3  
ATOM 4105  H HD12 . ILE A 1 26 ? -7.050  -0.638  2.160   1.00 0.00 ? 22 ILE A HD12 3  
ATOM 4106  H HD13 . ILE A 1 26 ? -6.094  -1.668  1.091   1.00 0.00 ? 22 ILE A HD13 3  
ATOM 4107  N N    . LYS A 1 27 ? -2.937  -0.804  5.902   1.00 0.00 ? 23 LYS A N    3  
ATOM 4108  C CA   . LYS A 1 27 ? -2.495  0.371   6.662   1.00 0.00 ? 23 LYS A CA   3  
ATOM 4109  C C    . LYS A 1 27 ? -3.082  1.671   6.107   1.00 0.00 ? 23 LYS A C    3  
ATOM 4110  O O    . LYS A 1 27 ? -2.392  2.678   5.974   1.00 0.00 ? 23 LYS A O    3  
ATOM 4111  C CB   . LYS A 1 27 ? -0.960  0.444   6.725   1.00 0.00 ? 23 LYS A CB   3  
ATOM 4112  C CG   . LYS A 1 27 ? -0.365  -0.447  7.806   1.00 0.00 ? 23 LYS A CG   3  
ATOM 4113  C CD   . LYS A 1 27 ? -0.645  0.101   9.201   1.00 0.00 ? 23 LYS A CD   3  
ATOM 4114  C CE   . LYS A 1 27 ? -0.485  -0.968  10.274  1.00 0.00 ? 23 LYS A CE   3  
ATOM 4115  N NZ   . LYS A 1 27 ? 0.893   -1.520  10.314  1.00 0.00 ? 23 LYS A NZ   3  
ATOM 4116  H H    . LYS A 1 27 ? -3.519  -1.465  6.347   1.00 0.00 ? 23 LYS A H    3  
ATOM 4117  H HA   . LYS A 1 27 ? -2.867  0.248   7.671   1.00 0.00 ? 23 LYS A HA   3  
ATOM 4118  H HB2  . LYS A 1 27 ? -0.554  0.139   5.770   1.00 0.00 ? 23 LYS A HB2  3  
ATOM 4119  H HB3  . LYS A 1 27 ? -0.661  1.466   6.924   1.00 0.00 ? 23 LYS A HB3  3  
ATOM 4120  H HG2  . LYS A 1 27 ? -0.802  -1.430  7.722   1.00 0.00 ? 23 LYS A HG2  3  
ATOM 4121  H HG3  . LYS A 1 27 ? 0.703   -0.513  7.660   1.00 0.00 ? 23 LYS A HG3  3  
ATOM 4122  H HD2  . LYS A 1 27 ? 0.044   0.906   9.407   1.00 0.00 ? 23 LYS A HD2  3  
ATOM 4123  H HD3  . LYS A 1 27 ? -1.656  0.478   9.231   1.00 0.00 ? 23 LYS A HD3  3  
ATOM 4124  H HE2  . LYS A 1 27 ? -0.715  -0.534  11.235  1.00 0.00 ? 23 LYS A HE2  3  
ATOM 4125  H HE3  . LYS A 1 27 ? -1.178  -1.770  10.069  1.00 0.00 ? 23 LYS A HE3  3  
ATOM 4126  H HZ1  . LYS A 1 27 ? 1.595   -0.749  10.264  1.00 0.00 ? 23 LYS A HZ1  3  
ATOM 4127  H HZ2  . LYS A 1 27 ? 1.051   -2.159  9.511   1.00 0.00 ? 23 LYS A HZ2  3  
ATOM 4128  H HZ3  . LYS A 1 27 ? 1.048   -2.051  11.203  1.00 0.00 ? 23 LYS A HZ3  3  
ATOM 4129  N N    . MET A 1 28 ? -4.373  1.634   5.817   1.00 0.00 ? 24 MET A N    3  
ATOM 4130  C CA   . MET A 1 28 ? -5.099  2.795   5.318   1.00 0.00 ? 24 MET A CA   3  
ATOM 4131  C C    . MET A 1 28 ? -6.328  3.000   6.192   1.00 0.00 ? 24 MET A C    3  
ATOM 4132  O O    . MET A 1 28 ? -7.338  3.569   5.774   1.00 0.00 ? 24 MET A O    3  
ATOM 4133  C CB   . MET A 1 28 ? -5.523  2.569   3.865   1.00 0.00 ? 24 MET A CB   3  
ATOM 4134  C CG   . MET A 1 28 ? -4.359  2.361   2.914   1.00 0.00 ? 24 MET A CG   3  
ATOM 4135  S SD   . MET A 1 28 ? -3.411  3.865   2.635   1.00 0.00 ? 24 MET A SD   3  
ATOM 4136  C CE   . MET A 1 28 ? -1.991  3.203   1.771   1.00 0.00 ? 24 MET A CE   3  
ATOM 4137  H H    . MET A 1 28 ? -4.864  0.789   5.937   1.00 0.00 ? 24 MET A H    3  
ATOM 4138  H HA   . MET A 1 28 ? -4.459  3.664   5.387   1.00 0.00 ? 24 MET A HA   3  
ATOM 4139  H HB2  . MET A 1 28 ? -6.154  1.691   3.821   1.00 0.00 ? 24 MET A HB2  3  
ATOM 4140  H HB3  . MET A 1 28 ? -6.087  3.426   3.529   1.00 0.00 ? 24 MET A HB3  3  
ATOM 4141  H HG2  . MET A 1 28 ? -3.701  1.610   3.330   1.00 0.00 ? 24 MET A HG2  3  
ATOM 4142  H HG3  . MET A 1 28 ? -4.744  2.012   1.968   1.00 0.00 ? 24 MET A HG3  3  
ATOM 4143  H HE1  . MET A 1 28 ? -1.494  2.475   2.396   1.00 0.00 ? 24 MET A HE1  3  
ATOM 4144  H HE2  . MET A 1 28 ? -1.306  4.006   1.540   1.00 0.00 ? 24 MET A HE2  3  
ATOM 4145  H HE3  . MET A 1 28 ? -2.314  2.731   0.854   1.00 0.00 ? 24 MET A HE3  3  
ATOM 4146  N N    . GLN A 1 29 ? -6.202  2.540   7.429   1.00 0.00 ? 25 GLN A N    3  
ATOM 4147  C CA   . GLN A 1 29 ? -7.280  2.584   8.408   1.00 0.00 ? 25 GLN A CA   3  
ATOM 4148  C C    . GLN A 1 29 ? -7.710  3.999   8.782   1.00 0.00 ? 25 GLN A C    3  
ATOM 4149  O O    . GLN A 1 29 ? -8.804  4.178   9.314   1.00 0.00 ? 25 GLN A O    3  
ATOM 4150  C CB   . GLN A 1 29 ? -6.880  1.812   9.666   1.00 0.00 ? 25 GLN A CB   3  
ATOM 4151  C CG   . GLN A 1 29 ? -5.419  1.978   10.050  1.00 0.00 ? 25 GLN A CG   3  
ATOM 4152  C CD   . GLN A 1 29 ? -5.083  1.339   11.384  1.00 0.00 ? 25 GLN A CD   3  
ATOM 4153  O OE1  . GLN A 1 29 ? -4.158  1.765   12.070  1.00 0.00 ? 25 GLN A OE1  3  
ATOM 4154  N NE2  . GLN A 1 29 ? -5.831  0.314   11.760  1.00 0.00 ? 25 GLN A NE2  3  
ATOM 4155  H H    . GLN A 1 29 ? -5.343  2.158   7.697   1.00 0.00 ? 25 GLN A H    3  
ATOM 4156  H HA   . GLN A 1 29 ? -8.129  2.083   7.964   1.00 0.00 ? 25 GLN A HA   3  
ATOM 4157  H HB2  . GLN A 1 29 ? -7.489  2.152   10.491  1.00 0.00 ? 25 GLN A HB2  3  
ATOM 4158  H HB3  . GLN A 1 29 ? -7.069  0.760   9.502   1.00 0.00 ? 25 GLN A HB3  3  
ATOM 4159  H HG2  . GLN A 1 29 ? -4.808  1.517   9.287   1.00 0.00 ? 25 GLN A HG2  3  
ATOM 4160  H HG3  . GLN A 1 29 ? -5.192  3.032   10.102  1.00 0.00 ? 25 GLN A HG3  3  
ATOM 4161  H HE21 . GLN A 1 29 ? -6.553  0.022   11.169  1.00 0.00 ? 25 GLN A HE21 3  
ATOM 4162  H HE22 . GLN A 1 29 ? -5.634  -0.112  12.624  1.00 0.00 ? 25 GLN A HE22 3  
ATOM 4163  N N    . GLN A 1 30 ? -6.895  5.012   8.512   1.00 0.00 ? 26 GLN A N    3  
ATOM 4164  C CA   . GLN A 1 30 ? -7.271  6.378   8.851   1.00 0.00 ? 26 GLN A CA   3  
ATOM 4165  C C    . GLN A 1 30 ? -8.122  6.988   7.743   1.00 0.00 ? 26 GLN A C    3  
ATOM 4166  O O    . GLN A 1 30 ? -8.595  8.118   7.854   1.00 0.00 ? 26 GLN A O    3  
ATOM 4167  C CB   . GLN A 1 30 ? -6.016  7.232   9.091   1.00 0.00 ? 26 GLN A CB   3  
ATOM 4168  C CG   . GLN A 1 30 ? -5.207  7.540   7.833   1.00 0.00 ? 26 GLN A CG   3  
ATOM 4169  C CD   . GLN A 1 30 ? -4.165  6.480   7.510   1.00 0.00 ? 26 GLN A CD   3  
ATOM 4170  O OE1  . GLN A 1 30 ? -4.372  5.289   7.735   1.00 0.00 ? 26 GLN A OE1  3  
ATOM 4171  N NE2  . GLN A 1 30 ? -3.033  6.909   6.977   1.00 0.00 ? 26 GLN A NE2  3  
ATOM 4172  H H    . GLN A 1 30 ? -6.017  4.890   8.083   1.00 0.00 ? 26 GLN A H    3  
ATOM 4173  H HA   . GLN A 1 30 ? -7.854  6.347   9.760   1.00 0.00 ? 26 GLN A HA   3  
ATOM 4174  H HB2  . GLN A 1 30 ? -6.316  8.170   9.534   1.00 0.00 ? 26 GLN A HB2  3  
ATOM 4175  H HB3  . GLN A 1 30 ? -5.371  6.710   9.784   1.00 0.00 ? 26 GLN A HB3  3  
ATOM 4176  H HG2  . GLN A 1 30 ? -5.886  7.618   6.997   1.00 0.00 ? 26 GLN A HG2  3  
ATOM 4177  H HG3  . GLN A 1 30 ? -4.703  8.487   7.971   1.00 0.00 ? 26 GLN A HG3  3  
ATOM 4178  H HE21 . GLN A 1 30 ? -2.929  7.875   6.820   1.00 0.00 ? 26 GLN A HE21 3  
ATOM 4179  H HE22 . GLN A 1 30 ? -2.340  6.249   6.768   1.00 0.00 ? 26 GLN A HE22 3  
ATOM 4180  N N    . TYR A 1 31 ? -8.304  6.243   6.662   1.00 0.00 ? 27 TYR A N    3  
ATOM 4181  C CA   . TYR A 1 31 ? -9.110  6.714   5.549   1.00 0.00 ? 27 TYR A CA   3  
ATOM 4182  C C    . TYR A 1 31 ? -10.531 6.180   5.669   1.00 0.00 ? 27 TYR A C    3  
ATOM 4183  O O    . TYR A 1 31 ? -11.406 6.544   4.886   1.00 0.00 ? 27 TYR A O    3  
ATOM 4184  C CB   . TYR A 1 31 ? -8.501  6.282   4.212   1.00 0.00 ? 27 TYR A CB   3  
ATOM 4185  C CG   . TYR A 1 31 ? -7.199  6.974   3.869   1.00 0.00 ? 27 TYR A CG   3  
ATOM 4186  C CD1  . TYR A 1 31 ? -7.190  8.240   3.299   1.00 0.00 ? 27 TYR A CD1  3  
ATOM 4187  C CD2  . TYR A 1 31 ? -5.978  6.353   4.105   1.00 0.00 ? 27 TYR A CD2  3  
ATOM 4188  C CE1  . TYR A 1 31 ? -6.002  8.868   2.973   1.00 0.00 ? 27 TYR A CE1  3  
ATOM 4189  C CE2  . TYR A 1 31 ? -4.788  6.974   3.785   1.00 0.00 ? 27 TYR A CE2  3  
ATOM 4190  C CZ   . TYR A 1 31 ? -4.804  8.231   3.217   1.00 0.00 ? 27 TYR A CZ   3  
ATOM 4191  O OH   . TYR A 1 31 ? -3.616  8.851   2.893   1.00 0.00 ? 27 TYR A OH   3  
ATOM 4192  H H    . TYR A 1 31 ? -7.883  5.355   6.611   1.00 0.00 ? 27 TYR A H    3  
ATOM 4193  H HA   . TYR A 1 31 ? -9.137  7.792   5.592   1.00 0.00 ? 27 TYR A HA   3  
ATOM 4194  H HB2  . TYR A 1 31 ? -8.310  5.221   4.240   1.00 0.00 ? 27 TYR A HB2  3  
ATOM 4195  H HB3  . TYR A 1 31 ? -9.205  6.494   3.420   1.00 0.00 ? 27 TYR A HB3  3  
ATOM 4196  H HD1  . TYR A 1 31 ? -8.130  8.737   3.110   1.00 0.00 ? 27 TYR A HD1  3  
ATOM 4197  H HD2  . TYR A 1 31 ? -5.968  5.368   4.549   1.00 0.00 ? 27 TYR A HD2  3  
ATOM 4198  H HE1  . TYR A 1 31 ? -6.015  9.851   2.529   1.00 0.00 ? 27 TYR A HE1  3  
ATOM 4199  H HE2  . TYR A 1 31 ? -3.850  6.473   3.975   1.00 0.00 ? 27 TYR A HE2  3  
ATOM 4200  H HH   . TYR A 1 31 ? -3.034  8.221   2.453   1.00 0.00 ? 27 TYR A HH   3  
ATOM 4201  N N    . THR A 1 32 ? -10.749 5.332   6.672   1.00 0.00 ? 28 THR A N    3  
ATOM 4202  C CA   . THR A 1 32 ? -12.051 4.718   6.914   1.00 0.00 ? 28 THR A CA   3  
ATOM 4203  C C    . THR A 1 32 ? -13.152 5.762   7.036   1.00 0.00 ? 28 THR A C    3  
ATOM 4204  O O    . THR A 1 32 ? -14.242 5.597   6.479   1.00 0.00 ? 28 THR A O    3  
ATOM 4205  C CB   . THR A 1 32 ? -12.023 3.866   8.198   1.00 0.00 ? 28 THR A CB   3  
ATOM 4206  O OG1  . THR A 1 32 ? -10.886 2.993   8.177   1.00 0.00 ? 28 THR A OG1  3  
ATOM 4207  C CG2  . THR A 1 32 ? -13.293 3.041   8.343   1.00 0.00 ? 28 THR A CG2  3  
ATOM 4208  H H    . THR A 1 32 ? -10.009 5.114   7.275   1.00 0.00 ? 28 THR A H    3  
ATOM 4209  H HA   . THR A 1 32 ? -12.273 4.069   6.080   1.00 0.00 ? 28 THR A HA   3  
ATOM 4210  H HB   . THR A 1 32 ? -11.941 4.527   9.047   1.00 0.00 ? 28 THR A HB   3  
ATOM 4211  H HG1  . THR A 1 32 ? -10.266 3.259   8.868   1.00 0.00 ? 28 THR A HG1  3  
ATOM 4212  H HG21 . THR A 1 32 ? -13.385 2.369   7.502   1.00 0.00 ? 28 THR A HG21 3  
ATOM 4213  H HG22 . THR A 1 32 ? -14.148 3.699   8.371   1.00 0.00 ? 28 THR A HG22 3  
ATOM 4214  H HG23 . THR A 1 32 ? -13.248 2.468   9.257   1.00 0.00 ? 28 THR A HG23 3  
ATOM 4215  N N    . GLU A 1 33 ? -12.866 6.837   7.761   1.00 0.00 ? 29 GLU A N    3  
ATOM 4216  C CA   . GLU A 1 33 ? -13.828 7.908   7.963   1.00 0.00 ? 29 GLU A CA   3  
ATOM 4217  C C    . GLU A 1 33 ? -14.336 8.464   6.633   1.00 0.00 ? 29 GLU A C    3  
ATOM 4218  O O    . GLU A 1 33 ? -15.538 8.675   6.467   1.00 0.00 ? 29 GLU A O    3  
ATOM 4219  C CB   . GLU A 1 33 ? -13.197 9.024   8.805   1.00 0.00 ? 29 GLU A CB   3  
ATOM 4220  C CG   . GLU A 1 33 ? -13.068 8.677   10.287  1.00 0.00 ? 29 GLU A CG   3  
ATOM 4221  C CD   . GLU A 1 33 ? -12.203 7.457   10.548  1.00 0.00 ? 29 GLU A CD   3  
ATOM 4222  O OE1  . GLU A 1 33 ? -11.145 7.320   9.902   1.00 0.00 ? 29 GLU A OE1  3  
ATOM 4223  O OE2  . GLU A 1 33 ? -12.583 6.625   11.396  1.00 0.00 ? 29 GLU A OE2  3  
ATOM 4224  H H    . GLU A 1 33 ? -11.989 6.916   8.209   1.00 0.00 ? 29 GLU A H    3  
ATOM 4225  H HA   . GLU A 1 33 ? -14.664 7.499   8.502   1.00 0.00 ? 29 GLU A HA   3  
ATOM 4226  H HB2  . GLU A 1 33 ? -12.208 9.236   8.420   1.00 0.00 ? 29 GLU A HB2  3  
ATOM 4227  H HB3  . GLU A 1 33 ? -13.803 9.913   8.718   1.00 0.00 ? 29 GLU A HB3  3  
ATOM 4228  H HG2  . GLU A 1 33 ? -12.634 9.519   10.801  1.00 0.00 ? 29 GLU A HG2  3  
ATOM 4229  H HG3  . GLU A 1 33 ? -14.056 8.487   10.684  1.00 0.00 ? 29 GLU A HG3  3  
ATOM 4230  N N    . HIS A 1 34 ? -13.431 8.693   5.685   1.00 0.00 ? 30 HIS A N    3  
ATOM 4231  C CA   . HIS A 1 34 ? -13.818 9.219   4.379   1.00 0.00 ? 30 HIS A CA   3  
ATOM 4232  C C    . HIS A 1 34 ? -14.659 8.198   3.623   1.00 0.00 ? 30 HIS A C    3  
ATOM 4233  O O    . HIS A 1 34 ? -15.688 8.540   3.038   1.00 0.00 ? 30 HIS A O    3  
ATOM 4234  C CB   . HIS A 1 34 ? -12.580 9.579   3.548   1.00 0.00 ? 30 HIS A CB   3  
ATOM 4235  C CG   . HIS A 1 34 ? -11.503 10.277  4.323   1.00 0.00 ? 30 HIS A CG   3  
ATOM 4236  N ND1  . HIS A 1 34 ? -10.253 9.744   4.539   1.00 0.00 ? 30 HIS A ND1  3  
ATOM 4237  C CD2  . HIS A 1 34 ? -11.509 11.485  4.940   1.00 0.00 ? 30 HIS A CD2  3  
ATOM 4238  C CE1  . HIS A 1 34 ? -9.553  10.620  5.267   1.00 0.00 ? 30 HIS A CE1  3  
ATOM 4239  N NE2  . HIS A 1 34 ? -10.269 11.696  5.537   1.00 0.00 ? 30 HIS A NE2  3  
ATOM 4240  H H    . HIS A 1 34 ? -12.481 8.532   5.859   1.00 0.00 ? 30 HIS A H    3  
ATOM 4241  H HA   . HIS A 1 34 ? -14.407 10.111  4.539   1.00 0.00 ? 30 HIS A HA   3  
ATOM 4242  H HB2  . HIS A 1 34 ? -12.155 8.676   3.141   1.00 0.00 ? 30 HIS A HB2  3  
ATOM 4243  H HB3  . HIS A 1 34 ? -12.876 10.226  2.736   1.00 0.00 ? 30 HIS A HB3  3  
ATOM 4244  H HD1  . HIS A 1 34 ? -9.931  8.879   4.212   1.00 0.00 ? 30 HIS A HD1  3  
ATOM 4245  H HD2  . HIS A 1 34 ? -12.338 12.177  4.973   1.00 0.00 ? 30 HIS A HD2  3  
ATOM 4246  H HE1  . HIS A 1 34 ? -8.535  10.468  5.593   1.00 0.00 ? 30 HIS A HE1  3  
ATOM 4247  N N    . PHE A 1 35 ? -14.216 6.944   3.654   1.00 0.00 ? 31 PHE A N    3  
ATOM 4248  C CA   . PHE A 1 35 ? -14.916 5.854   2.981   1.00 0.00 ? 31 PHE A CA   3  
ATOM 4249  C C    . PHE A 1 35 ? -16.356 5.759   3.467   1.00 0.00 ? 31 PHE A C    3  
ATOM 4250  O O    . PHE A 1 35 ? -17.299 5.745   2.671   1.00 0.00 ? 31 PHE A O    3  
ATOM 4251  C CB   . PHE A 1 35 ? -14.211 4.519   3.251   1.00 0.00 ? 31 PHE A CB   3  
ATOM 4252  C CG   . PHE A 1 35 ? -13.071 4.212   2.321   1.00 0.00 ? 31 PHE A CG   3  
ATOM 4253  C CD1  . PHE A 1 35 ? -11.898 4.946   2.370   1.00 0.00 ? 31 PHE A CD1  3  
ATOM 4254  C CD2  . PHE A 1 35 ? -13.169 3.175   1.408   1.00 0.00 ? 31 PHE A CD2  3  
ATOM 4255  C CE1  . PHE A 1 35 ? -10.844 4.654   1.527   1.00 0.00 ? 31 PHE A CE1  3  
ATOM 4256  C CE2  . PHE A 1 35 ? -12.120 2.880   0.559   1.00 0.00 ? 31 PHE A CE2  3  
ATOM 4257  C CZ   . PHE A 1 35 ? -10.957 3.620   0.620   1.00 0.00 ? 31 PHE A CZ   3  
ATOM 4258  H H    . PHE A 1 35 ? -13.394 6.744   4.154   1.00 0.00 ? 31 PHE A H    3  
ATOM 4259  H HA   . PHE A 1 35 ? -14.911 6.049   1.919   1.00 0.00 ? 31 PHE A HA   3  
ATOM 4260  H HB2  . PHE A 1 35 ? -13.817 4.528   4.255   1.00 0.00 ? 31 PHE A HB2  3  
ATOM 4261  H HB3  . PHE A 1 35 ? -14.932 3.718   3.164   1.00 0.00 ? 31 PHE A HB3  3  
ATOM 4262  H HD1  . PHE A 1 35 ? -11.811 5.756   3.080   1.00 0.00 ? 31 PHE A HD1  3  
ATOM 4263  H HD2  . PHE A 1 35 ? -14.080 2.597   1.360   1.00 0.00 ? 31 PHE A HD2  3  
ATOM 4264  H HE1  . PHE A 1 35 ? -9.936  5.235   1.576   1.00 0.00 ? 31 PHE A HE1  3  
ATOM 4265  H HE2  . PHE A 1 35 ? -12.209 2.070   -0.150  1.00 0.00 ? 31 PHE A HE2  3  
ATOM 4266  H HZ   . PHE A 1 35 ? -10.134 3.388   -0.041  1.00 0.00 ? 31 PHE A HZ   3  
ATOM 4267  N N    . MET A 1 36 ? -16.512 5.720   4.782   1.00 0.00 ? 32 MET A N    3  
ATOM 4268  C CA   . MET A 1 36 ? -17.822 5.599   5.399   1.00 0.00 ? 32 MET A CA   3  
ATOM 4269  C C    . MET A 1 36 ? -18.686 6.831   5.158   1.00 0.00 ? 32 MET A C    3  
ATOM 4270  O O    . MET A 1 36 ? -19.909 6.721   5.061   1.00 0.00 ? 32 MET A O    3  
ATOM 4271  C CB   . MET A 1 36 ? -17.679 5.330   6.896   1.00 0.00 ? 32 MET A CB   3  
ATOM 4272  C CG   . MET A 1 36 ? -17.163 3.935   7.206   1.00 0.00 ? 32 MET A CG   3  
ATOM 4273  S SD   . MET A 1 36 ? -17.501 3.423   8.903   1.00 0.00 ? 32 MET A SD   3  
ATOM 4274  C CE   . MET A 1 36 ? -16.870 1.746   8.882   1.00 0.00 ? 32 MET A CE   3  
ATOM 4275  H H    . MET A 1 36 ? -15.714 5.775   5.361   1.00 0.00 ? 32 MET A H    3  
ATOM 4276  H HA   . MET A 1 36 ? -18.312 4.750   4.945   1.00 0.00 ? 32 MET A HA   3  
ATOM 4277  H HB2  . MET A 1 36 ? -16.988 6.048   7.315   1.00 0.00 ? 32 MET A HB2  3  
ATOM 4278  H HB3  . MET A 1 36 ? -18.642 5.449   7.369   1.00 0.00 ? 32 MET A HB3  3  
ATOM 4279  H HG2  . MET A 1 36 ? -17.635 3.234   6.535   1.00 0.00 ? 32 MET A HG2  3  
ATOM 4280  H HG3  . MET A 1 36 ? -16.095 3.918   7.046   1.00 0.00 ? 32 MET A HG3  3  
ATOM 4281  H HE1  . MET A 1 36 ? -15.834 1.755   8.574   1.00 0.00 ? 32 MET A HE1  3  
ATOM 4282  H HE2  . MET A 1 36 ? -17.446 1.153   8.189   1.00 0.00 ? 32 MET A HE2  3  
ATOM 4283  H HE3  . MET A 1 36 ? -16.947 1.320   9.872   1.00 0.00 ? 32 MET A HE3  3  
ATOM 4284  N N    . ALA A 1 37 ? -18.068 8.002   5.045   1.00 0.00 ? 33 ALA A N    3  
ATOM 4285  C CA   . ALA A 1 37 ? -18.821 9.228   4.809   1.00 0.00 ? 33 ALA A CA   3  
ATOM 4286  C C    . ALA A 1 37 ? -19.312 9.285   3.367   1.00 0.00 ? 33 ALA A C    3  
ATOM 4287  O O    . ALA A 1 37 ? -20.382 9.820   3.081   1.00 0.00 ? 33 ALA A O    3  
ATOM 4288  C CB   . ALA A 1 37 ? -17.971 10.449  5.132   1.00 0.00 ? 33 ALA A CB   3  
ATOM 4289  H H    . ALA A 1 37 ? -17.089 8.057   5.110   1.00 0.00 ? 33 ALA A H    3  
ATOM 4290  H HA   . ALA A 1 37 ? -19.676 9.227   5.470   1.00 0.00 ? 33 ALA A HA   3  
ATOM 4291  H HB1  . ALA A 1 37 ? -17.646 10.399  6.160   1.00 0.00 ? 33 ALA A HB1  3  
ATOM 4292  H HB2  . ALA A 1 37 ? -18.556 11.346  4.983   1.00 0.00 ? 33 ALA A HB2  3  
ATOM 4293  H HB3  . ALA A 1 37 ? -17.109 10.470  4.483   1.00 0.00 ? 33 ALA A HB3  3  
ATOM 4294  N N    . ALA A 1 38 ? -18.526 8.707   2.465   1.00 0.00 ? 34 ALA A N    3  
ATOM 4295  C CA   . ALA A 1 38 ? -18.873 8.677   1.051   1.00 0.00 ? 34 ALA A CA   3  
ATOM 4296  C C    . ALA A 1 38 ? -20.000 7.688   0.790   1.00 0.00 ? 34 ALA A C    3  
ATOM 4297  O O    . ALA A 1 38 ? -20.626 7.711   -0.269  1.00 0.00 ? 34 ALA A O    3  
ATOM 4298  C CB   . ALA A 1 38 ? -17.654 8.328   0.212   1.00 0.00 ? 34 ALA A CB   3  
ATOM 4299  H H    . ALA A 1 38 ? -17.685 8.294   2.760   1.00 0.00 ? 34 ALA A H    3  
ATOM 4300  H HA   . ALA A 1 38 ? -19.203 9.667   0.768   1.00 0.00 ? 34 ALA A HA   3  
ATOM 4301  H HB1  . ALA A 1 38 ? -16.863 9.035   0.415   1.00 0.00 ? 34 ALA A HB1  3  
ATOM 4302  H HB2  . ALA A 1 38 ? -17.914 8.369   -0.835  1.00 0.00 ? 34 ALA A HB2  3  
ATOM 4303  H HB3  . ALA A 1 38 ? -17.319 7.332   0.461   1.00 0.00 ? 34 ALA A HB3  3  
ATOM 4304  N N    . GLY A 1 39 ? -20.253 6.816   1.760   1.00 0.00 ? 35 GLY A N    3  
ATOM 4305  C CA   . GLY A 1 39 ? -21.319 5.846   1.619   1.00 0.00 ? 35 GLY A CA   3  
ATOM 4306  C C    . GLY A 1 39 ? -20.834 4.412   1.664   1.00 0.00 ? 35 GLY A C    3  
ATOM 4307  O O    . GLY A 1 39 ? -21.637 3.482   1.671   1.00 0.00 ? 35 GLY A O    3  
ATOM 4308  H H    . GLY A 1 39 ? -19.714 6.839   2.578   1.00 0.00 ? 35 GLY A H    3  
ATOM 4309  H HA2  . GLY A 1 39 ? -22.030 5.996   2.418   1.00 0.00 ? 35 GLY A HA2  3  
ATOM 4310  H HA3  . GLY A 1 39 ? -21.816 6.016   0.676   1.00 0.00 ? 35 GLY A HA3  3  
ATOM 4311  N N    . TYR A 1 40 ? -19.524 4.222   1.705   1.00 0.00 ? 36 TYR A N    3  
ATOM 4312  C CA   . TYR A 1 40 ? -18.963 2.882   1.744   1.00 0.00 ? 36 TYR A CA   3  
ATOM 4313  C C    . TYR A 1 40 ? -18.803 2.424   3.187   1.00 0.00 ? 36 TYR A C    3  
ATOM 4314  O O    . TYR A 1 40 ? -17.693 2.336   3.710   1.00 0.00 ? 36 TYR A O    3  
ATOM 4315  C CB   . TYR A 1 40 ? -17.621 2.844   1.010   1.00 0.00 ? 36 TYR A CB   3  
ATOM 4316  C CG   . TYR A 1 40 ? -17.663 3.524   -0.339  1.00 0.00 ? 36 TYR A CG   3  
ATOM 4317  C CD1  . TYR A 1 40 ? -18.416 2.995   -1.377  1.00 0.00 ? 36 TYR A CD1  3  
ATOM 4318  C CD2  . TYR A 1 40 ? -16.960 4.698   -0.571  1.00 0.00 ? 36 TYR A CD2  3  
ATOM 4319  C CE1  . TYR A 1 40 ? -18.467 3.615   -2.610  1.00 0.00 ? 36 TYR A CE1  3  
ATOM 4320  C CE2  . TYR A 1 40 ? -17.006 5.324   -1.800  1.00 0.00 ? 36 TYR A CE2  3  
ATOM 4321  C CZ   . TYR A 1 40 ? -17.761 4.779   -2.815  1.00 0.00 ? 36 TYR A CZ   3  
ATOM 4322  O OH   . TYR A 1 40 ? -17.809 5.401   -4.039  1.00 0.00 ? 36 TYR A OH   3  
ATOM 4323  H H    . TYR A 1 40 ? -18.912 4.989   1.723   1.00 0.00 ? 36 TYR A H    3  
ATOM 4324  H HA   . TYR A 1 40 ? -19.655 2.220   1.246   1.00 0.00 ? 36 TYR A HA   3  
ATOM 4325  H HB2  . TYR A 1 40 ? -16.873 3.340   1.611   1.00 0.00 ? 36 TYR A HB2  3  
ATOM 4326  H HB3  . TYR A 1 40 ? -17.331 1.815   0.856   1.00 0.00 ? 36 TYR A HB3  3  
ATOM 4327  H HD1  . TYR A 1 40 ? -18.968 2.081   -1.213  1.00 0.00 ? 36 TYR A HD1  3  
ATOM 4328  H HD2  . TYR A 1 40 ? -16.367 5.122   0.228   1.00 0.00 ? 36 TYR A HD2  3  
ATOM 4329  H HE1  . TYR A 1 40 ? -19.060 3.187   -3.406  1.00 0.00 ? 36 TYR A HE1  3  
ATOM 4330  H HE2  . TYR A 1 40 ? -16.452 6.237   -1.962  1.00 0.00 ? 36 TYR A HE2  3  
ATOM 4331  H HH   . TYR A 1 40 ? -16.955 5.850   -4.200  1.00 0.00 ? 36 TYR A HH   3  
ATOM 4332  N N    . THR A 1 41 ? -19.928 2.140   3.823   1.00 0.00 ? 37 THR A N    3  
ATOM 4333  C CA   . THR A 1 41 ? -19.945 1.697   5.204   1.00 0.00 ? 37 THR A CA   3  
ATOM 4334  C C    . THR A 1 41 ? -19.957 0.175   5.290   1.00 0.00 ? 37 THR A C    3  
ATOM 4335  O O    . THR A 1 41 ? -19.969 -0.398  6.380   1.00 0.00 ? 37 THR A O    3  
ATOM 4336  C CB   . THR A 1 41 ? -21.183 2.258   5.924   1.00 0.00 ? 37 THR A CB   3  
ATOM 4337  O OG1  . THR A 1 41 ? -22.055 2.872   4.962   1.00 0.00 ? 37 THR A OG1  3  
ATOM 4338  C CG2  . THR A 1 41 ? -20.786 3.278   6.980   1.00 0.00 ? 37 THR A CG2  3  
ATOM 4339  H H    . THR A 1 41 ? -20.785 2.238   3.350   1.00 0.00 ? 37 THR A H    3  
ATOM 4340  H HA   . THR A 1 41 ? -19.062 2.074   5.695   1.00 0.00 ? 37 THR A HA   3  
ATOM 4341  H HB   . THR A 1 41 ? -21.704 1.442   6.405   1.00 0.00 ? 37 THR A HB   3  
ATOM 4342  H HG1  . THR A 1 41 ? -22.902 3.067   5.378   1.00 0.00 ? 37 THR A HG1  3  
ATOM 4343  H HG21 . THR A 1 41 ? -21.668 3.607   7.511   1.00 0.00 ? 37 THR A HG21 3  
ATOM 4344  H HG22 . THR A 1 41 ? -20.316 4.126   6.504   1.00 0.00 ? 37 THR A HG22 3  
ATOM 4345  H HG23 . THR A 1 41 ? -20.095 2.826   7.675   1.00 0.00 ? 37 THR A HG23 3  
ATOM 4346  N N    . ALA A 1 42 ? -19.931 -0.474  4.132   1.00 0.00 ? 38 ALA A N    3  
ATOM 4347  C CA   . ALA A 1 42 ? -19.956 -1.927  4.068   1.00 0.00 ? 38 ALA A CA   3  
ATOM 4348  C C    . ALA A 1 42 ? -19.232 -2.415  2.816   1.00 0.00 ? 38 ALA A C    3  
ATOM 4349  O O    . ALA A 1 42 ? -19.106 -1.672  1.839   1.00 0.00 ? 38 ALA A O    3  
ATOM 4350  C CB   . ALA A 1 42 ? -21.390 -2.433  4.106   1.00 0.00 ? 38 ALA A CB   3  
ATOM 4351  H H    . ALA A 1 42 ? -19.855 0.036   3.301   1.00 0.00 ? 38 ALA A H    3  
ATOM 4352  H HA   . ALA A 1 42 ? -19.441 -2.308  4.938   1.00 0.00 ? 38 ALA A HA   3  
ATOM 4353  H HB1  . ALA A 1 42 ? -21.858 -2.117  5.026   1.00 0.00 ? 38 ALA A HB1  3  
ATOM 4354  H HB2  . ALA A 1 42 ? -21.392 -3.512  4.053   1.00 0.00 ? 38 ALA A HB2  3  
ATOM 4355  H HB3  . ALA A 1 42 ? -21.937 -2.032  3.267   1.00 0.00 ? 38 ALA A HB3  3  
ATOM 4356  N N    . ILE A 1 43 ? -18.784 -3.664  2.850   1.00 0.00 ? 39 ILE A N    3  
ATOM 4357  C CA   . ILE A 1 43 ? -18.031 -4.266  1.746   1.00 0.00 ? 39 ILE A CA   3  
ATOM 4358  C C    . ILE A 1 43 ? -18.778 -4.212  0.410   1.00 0.00 ? 39 ILE A C    3  
ATOM 4359  O O    . ILE A 1 43 ? -18.171 -3.908  -0.620  1.00 0.00 ? 39 ILE A O    3  
ATOM 4360  C CB   . ILE A 1 43 ? -17.654 -5.731  2.066   1.00 0.00 ? 39 ILE A CB   3  
ATOM 4361  C CG1  . ILE A 1 43 ? -16.724 -5.785  3.284   1.00 0.00 ? 39 ILE A CG1  3  
ATOM 4362  C CG2  . ILE A 1 43 ? -16.998 -6.406  0.866   1.00 0.00 ? 39 ILE A CG2  3  
ATOM 4363  C CD1  . ILE A 1 43 ? -15.417 -5.038  3.097   1.00 0.00 ? 39 ILE A CD1  3  
ATOM 4364  H H    . ILE A 1 43 ? -18.961 -4.208  3.647   1.00 0.00 ? 39 ILE A H    3  
ATOM 4365  H HA   . ILE A 1 43 ? -17.114 -3.708  1.642   1.00 0.00 ? 39 ILE A HA   3  
ATOM 4366  H HB   . ILE A 1 43 ? -18.561 -6.268  2.295   1.00 0.00 ? 39 ILE A HB   3  
ATOM 4367  H HG12 . ILE A 1 43 ? -17.231 -5.353  4.134   1.00 0.00 ? 39 ILE A HG12 3  
ATOM 4368  H HG13 . ILE A 1 43 ? -16.488 -6.817  3.500   1.00 0.00 ? 39 ILE A HG13 3  
ATOM 4369  H HG21 . ILE A 1 43 ? -16.760 -7.430  1.112   1.00 0.00 ? 39 ILE A HG21 3  
ATOM 4370  H HG22 . ILE A 1 43 ? -16.091 -5.879  0.606   1.00 0.00 ? 39 ILE A HG22 3  
ATOM 4371  H HG23 . ILE A 1 43 ? -17.677 -6.387  0.026   1.00 0.00 ? 39 ILE A HG23 3  
ATOM 4372  H HD11 . ILE A 1 43 ? -15.612 -3.977  3.050   1.00 0.00 ? 39 ILE A HD11 3  
ATOM 4373  H HD12 . ILE A 1 43 ? -14.948 -5.359  2.179   1.00 0.00 ? 39 ILE A HD12 3  
ATOM 4374  H HD13 . ILE A 1 43 ? -14.761 -5.248  3.928   1.00 0.00 ? 39 ILE A HD13 3  
ATOM 4375  N N    . GLU A 1 44 ? -20.083 -4.482  0.418   1.00 0.00 ? 40 GLU A N    3  
ATOM 4376  C CA   . GLU A 1 44 ? -20.871 -4.470  -0.821  1.00 0.00 ? 40 GLU A CA   3  
ATOM 4377  C C    . GLU A 1 44 ? -20.778 -3.120  -1.516  1.00 0.00 ? 40 GLU A C    3  
ATOM 4378  O O    . GLU A 1 44 ? -20.782 -3.043  -2.738  1.00 0.00 ? 40 GLU A O    3  
ATOM 4379  C CB   . GLU A 1 44 ? -22.348 -4.794  -0.564  1.00 0.00 ? 40 GLU A CB   3  
ATOM 4380  C CG   . GLU A 1 44 ? -22.595 -5.724  0.608   1.00 0.00 ? 40 GLU A CG   3  
ATOM 4381  C CD   . GLU A 1 44 ? -22.583 -4.988  1.924   1.00 0.00 ? 40 GLU A CD   3  
ATOM 4382  O OE1  . GLU A 1 44 ? -23.497 -4.172  2.164   1.00 0.00 ? 40 GLU A OE1  3  
ATOM 4383  O OE2  . GLU A 1 44 ? -21.640 -5.200  2.710   1.00 0.00 ? 40 GLU A OE2  3  
ATOM 4384  H H    . GLU A 1 44 ? -20.536 -4.694  1.268   1.00 0.00 ? 40 GLU A H    3  
ATOM 4385  H HA   . GLU A 1 44 ? -20.458 -5.224  -1.476  1.00 0.00 ? 40 GLU A HA   3  
ATOM 4386  H HB2  . GLU A 1 44 ? -22.874 -3.870  -0.372  1.00 0.00 ? 40 GLU A HB2  3  
ATOM 4387  H HB3  . GLU A 1 44 ? -22.761 -5.251  -1.451  1.00 0.00 ? 40 GLU A HB3  3  
ATOM 4388  H HG2  . GLU A 1 44 ? -23.558 -6.195  0.482   1.00 0.00 ? 40 GLU A HG2  3  
ATOM 4389  H HG3  . GLU A 1 44 ? -21.823 -6.479  0.623   1.00 0.00 ? 40 GLU A HG3  3  
ATOM 4390  N N    . LYS A 1 45 ? -20.690 -2.058  -0.731  1.00 0.00 ? 41 LYS A N    3  
ATOM 4391  C CA   . LYS A 1 45 ? -20.600 -0.716  -1.283  1.00 0.00 ? 41 LYS A CA   3  
ATOM 4392  C C    . LYS A 1 45 ? -19.169 -0.427  -1.724  1.00 0.00 ? 41 LYS A C    3  
ATOM 4393  O O    . LYS A 1 45 ? -18.941 0.241   -2.730  1.00 0.00 ? 41 LYS A O    3  
ATOM 4394  C CB   . LYS A 1 45 ? -21.064 0.321   -0.256  1.00 0.00 ? 41 LYS A CB   3  
ATOM 4395  C CG   . LYS A 1 45 ? -22.527 0.175   0.146   1.00 0.00 ? 41 LYS A CG   3  
ATOM 4396  C CD   . LYS A 1 45 ? -22.681 -0.629  1.428   1.00 0.00 ? 41 LYS A CD   3  
ATOM 4397  C CE   . LYS A 1 45 ? -24.143 -0.804  1.814   1.00 0.00 ? 41 LYS A CE   3  
ATOM 4398  N NZ   . LYS A 1 45 ? -24.741 -2.021  1.202   1.00 0.00 ? 41 LYS A NZ   3  
ATOM 4399  H H    . LYS A 1 45 ? -20.671 -2.181  0.241   1.00 0.00 ? 41 LYS A H    3  
ATOM 4400  H HA   . LYS A 1 45 ? -21.245 -0.671  -2.147  1.00 0.00 ? 41 LYS A HA   3  
ATOM 4401  H HB2  . LYS A 1 45 ? -20.459 0.226   0.633   1.00 0.00 ? 41 LYS A HB2  3  
ATOM 4402  H HB3  . LYS A 1 45 ? -20.925 1.308   -0.672  1.00 0.00 ? 41 LYS A HB3  3  
ATOM 4403  H HG2  . LYS A 1 45 ? -22.947 1.158   0.300   1.00 0.00 ? 41 LYS A HG2  3  
ATOM 4404  H HG3  . LYS A 1 45 ? -23.060 -0.326  -0.649  1.00 0.00 ? 41 LYS A HG3  3  
ATOM 4405  H HD2  . LYS A 1 45 ? -22.239 -1.602  1.283   1.00 0.00 ? 41 LYS A HD2  3  
ATOM 4406  H HD3  . LYS A 1 45 ? -22.166 -0.114  2.226   1.00 0.00 ? 41 LYS A HD3  3  
ATOM 4407  H HE2  . LYS A 1 45 ? -24.211 -0.885  2.888   1.00 0.00 ? 41 LYS A HE2  3  
ATOM 4408  H HE3  . LYS A 1 45 ? -24.696 0.063   1.484   1.00 0.00 ? 41 LYS A HE3  3  
ATOM 4409  H HZ1  . LYS A 1 45 ? -24.301 -2.883  1.603   1.00 0.00 ? 41 LYS A HZ1  3  
ATOM 4410  H HZ2  . LYS A 1 45 ? -24.593 -2.016  0.173   1.00 0.00 ? 41 LYS A HZ2  3  
ATOM 4411  H HZ3  . LYS A 1 45 ? -25.762 -2.049  1.391   1.00 0.00 ? 41 LYS A HZ3  3  
ATOM 4412  N N    . VAL A 1 46 ? -18.213 -0.959  -0.972  1.00 0.00 ? 42 VAL A N    3  
ATOM 4413  C CA   . VAL A 1 46 ? -16.798 -0.769  -1.268  1.00 0.00 ? 42 VAL A CA   3  
ATOM 4414  C C    . VAL A 1 46 ? -16.442 -1.329  -2.644  1.00 0.00 ? 42 VAL A C    3  
ATOM 4415  O O    . VAL A 1 46 ? -15.703 -0.707  -3.402  1.00 0.00 ? 42 VAL A O    3  
ATOM 4416  C CB   . VAL A 1 46 ? -15.907 -1.433  -0.190  1.00 0.00 ? 42 VAL A CB   3  
ATOM 4417  C CG1  . VAL A 1 46 ? -14.435 -1.364  -0.572  1.00 0.00 ? 42 VAL A CG1  3  
ATOM 4418  C CG2  . VAL A 1 46 ? -16.129 -0.778  1.164   1.00 0.00 ? 42 VAL A CG2  3  
ATOM 4419  H H    . VAL A 1 46 ? -18.468 -1.500  -0.194  1.00 0.00 ? 42 VAL A H    3  
ATOM 4420  H HA   . VAL A 1 46 ? -16.599 0.293   -1.262  1.00 0.00 ? 42 VAL A HA   3  
ATOM 4421  H HB   . VAL A 1 46 ? -16.186 -2.473  -0.112  1.00 0.00 ? 42 VAL A HB   3  
ATOM 4422  H HG11 . VAL A 1 46 ? -13.847 -1.897  0.161   1.00 0.00 ? 42 VAL A HG11 3  
ATOM 4423  H HG12 . VAL A 1 46 ? -14.119 -0.332  -0.605  1.00 0.00 ? 42 VAL A HG12 3  
ATOM 4424  H HG13 . VAL A 1 46 ? -14.293 -1.815  -1.543  1.00 0.00 ? 42 VAL A HG13 3  
ATOM 4425  H HG21 . VAL A 1 46 ? -17.180 -0.806  1.409   1.00 0.00 ? 42 VAL A HG21 3  
ATOM 4426  H HG22 . VAL A 1 46 ? -15.795 0.248   1.127   1.00 0.00 ? 42 VAL A HG22 3  
ATOM 4427  H HG23 . VAL A 1 46 ? -15.570 -1.312  1.918   1.00 0.00 ? 42 VAL A HG23 3  
ATOM 4428  N N    . VAL A 1 47 ? -16.992 -2.491  -2.980  1.00 0.00 ? 43 VAL A N    3  
ATOM 4429  C CA   . VAL A 1 47 ? -16.707 -3.115  -4.270  1.00 0.00 ? 43 VAL A CA   3  
ATOM 4430  C C    . VAL A 1 47 ? -17.453 -2.425  -5.413  1.00 0.00 ? 43 VAL A C    3  
ATOM 4431  O O    . VAL A 1 47 ? -17.186 -2.694  -6.585  1.00 0.00 ? 43 VAL A O    3  
ATOM 4432  C CB   . VAL A 1 47 ? -17.049 -4.623  -4.273  1.00 0.00 ? 43 VAL A CB   3  
ATOM 4433  C CG1  . VAL A 1 47 ? -16.237 -5.360  -3.222  1.00 0.00 ? 43 VAL A CG1  3  
ATOM 4434  C CG2  . VAL A 1 47 ? -18.538 -4.849  -4.057  1.00 0.00 ? 43 VAL A CG2  3  
ATOM 4435  H H    . VAL A 1 47 ? -17.596 -2.940  -2.348  1.00 0.00 ? 43 VAL A H    3  
ATOM 4436  H HA   . VAL A 1 47 ? -15.646 -3.017  -4.448  1.00 0.00 ? 43 VAL A HA   3  
ATOM 4437  H HB   . VAL A 1 47 ? -16.785 -5.025  -5.241  1.00 0.00 ? 43 VAL A HB   3  
ATOM 4438  H HG11 . VAL A 1 47 ? -15.184 -5.221  -3.418  1.00 0.00 ? 43 VAL A HG11 3  
ATOM 4439  H HG12 . VAL A 1 47 ? -16.475 -6.413  -3.256  1.00 0.00 ? 43 VAL A HG12 3  
ATOM 4440  H HG13 . VAL A 1 47 ? -16.474 -4.969  -2.243  1.00 0.00 ? 43 VAL A HG13 3  
ATOM 4441  H HG21 . VAL A 1 47 ? -18.839 -4.394  -3.125  1.00 0.00 ? 43 VAL A HG21 3  
ATOM 4442  H HG22 . VAL A 1 47 ? -18.740 -5.909  -4.022  1.00 0.00 ? 43 VAL A HG22 3  
ATOM 4443  H HG23 . VAL A 1 47 ? -19.092 -4.403  -4.871  1.00 0.00 ? 43 VAL A HG23 3  
ATOM 4444  N N    . GLN A 1 48 ? -18.372 -1.529  -5.071  1.00 0.00 ? 44 GLN A N    3  
ATOM 4445  C CA   . GLN A 1 48 ? -19.146 -0.811  -6.077  1.00 0.00 ? 44 GLN A CA   3  
ATOM 4446  C C    . GLN A 1 48 ? -18.387 0.408   -6.585  1.00 0.00 ? 44 GLN A C    3  
ATOM 4447  O O    . GLN A 1 48 ? -18.642 0.886   -7.691  1.00 0.00 ? 44 GLN A O    3  
ATOM 4448  C CB   . GLN A 1 48 ? -20.500 -0.381  -5.514  1.00 0.00 ? 44 GLN A CB   3  
ATOM 4449  C CG   . GLN A 1 48 ? -21.479 -1.529  -5.345  1.00 0.00 ? 44 GLN A CG   3  
ATOM 4450  C CD   . GLN A 1 48 ? -22.746 -1.116  -4.624  1.00 0.00 ? 44 GLN A CD   3  
ATOM 4451  O OE1  . GLN A 1 48 ? -23.194 0.025   -4.731  1.00 0.00 ? 44 GLN A OE1  3  
ATOM 4452  N NE2  . GLN A 1 48 ? -23.328 -2.041  -3.879  1.00 0.00 ? 44 GLN A NE2  3  
ATOM 4453  H H    . GLN A 1 48 ? -18.534 -1.345  -4.121  1.00 0.00 ? 44 GLN A H    3  
ATOM 4454  H HA   . GLN A 1 48 ? -19.311 -1.484  -6.905  1.00 0.00 ? 44 GLN A HA   3  
ATOM 4455  H HB2  . GLN A 1 48 ? -20.346 0.078   -4.549  1.00 0.00 ? 44 GLN A HB2  3  
ATOM 4456  H HB3  . GLN A 1 48 ? -20.941 0.344   -6.181  1.00 0.00 ? 44 GLN A HB3  3  
ATOM 4457  H HG2  . GLN A 1 48 ? -21.746 -1.904  -6.321  1.00 0.00 ? 44 GLN A HG2  3  
ATOM 4458  H HG3  . GLN A 1 48 ? -20.999 -2.313  -4.778  1.00 0.00 ? 44 GLN A HG3  3  
ATOM 4459  H HE21 . GLN A 1 48 ? -22.912 -2.928  -3.836  1.00 0.00 ? 44 GLN A HE21 3  
ATOM 4460  H HE22 . GLN A 1 48 ? -24.151 -1.803  -3.403  1.00 0.00 ? 44 GLN A HE22 3  
ATOM 4461  N N    . MET A 1 49 ? -17.469 0.916   -5.769  1.00 0.00 ? 45 MET A N    3  
ATOM 4462  C CA   . MET A 1 49 ? -16.670 2.080   -6.143  1.00 0.00 ? 45 MET A CA   3  
ATOM 4463  C C    . MET A 1 49 ? -15.784 1.780   -7.350  1.00 0.00 ? 45 MET A C    3  
ATOM 4464  O O    . MET A 1 49 ? -15.706 0.640   -7.817  1.00 0.00 ? 45 MET A O    3  
ATOM 4465  C CB   . MET A 1 49 ? -15.805 2.550   -4.966  1.00 0.00 ? 45 MET A CB   3  
ATOM 4466  C CG   . MET A 1 49 ? -14.520 1.754   -4.779  1.00 0.00 ? 45 MET A CG   3  
ATOM 4467  S SD   . MET A 1 49 ? -13.453 2.438   -3.497  1.00 0.00 ? 45 MET A SD   3  
ATOM 4468  C CE   . MET A 1 49 ? -14.521 2.315   -2.067  1.00 0.00 ? 45 MET A CE   3  
ATOM 4469  H H    . MET A 1 49 ? -17.349 0.516   -4.882  1.00 0.00 ? 45 MET A H    3  
ATOM 4470  H HA   . MET A 1 49 ? -17.354 2.873   -6.408  1.00 0.00 ? 45 MET A HA   3  
ATOM 4471  H HB2  . MET A 1 49 ? -15.540 3.586   -5.121  1.00 0.00 ? 45 MET A HB2  3  
ATOM 4472  H HB3  . MET A 1 49 ? -16.385 2.473   -4.058  1.00 0.00 ? 45 MET A HB3  3  
ATOM 4473  H HG2  . MET A 1 49 ? -14.776 0.740   -4.511  1.00 0.00 ? 45 MET A HG2  3  
ATOM 4474  H HG3  . MET A 1 49 ? -13.978 1.750   -5.714  1.00 0.00 ? 45 MET A HG3  3  
ATOM 4475  H HE1  . MET A 1 49 ? -13.986 2.640   -1.188  1.00 0.00 ? 45 MET A HE1  3  
ATOM 4476  H HE2  . MET A 1 49 ? -14.833 1.289   -1.939  1.00 0.00 ? 45 MET A HE2  3  
ATOM 4477  H HE3  . MET A 1 49 ? -15.390 2.939   -2.212  1.00 0.00 ? 45 MET A HE3  3  
ATOM 4478  N N    . THR A 1 50 ? -15.080 2.798   -7.819  1.00 0.00 ? 46 THR A N    3  
ATOM 4479  C CA   . THR A 1 50 ? -14.210 2.654   -8.966  1.00 0.00 ? 46 THR A CA   3  
ATOM 4480  C C    . THR A 1 50 ? -12.830 3.208   -8.622  1.00 0.00 ? 46 THR A C    3  
ATOM 4481  O O    . THR A 1 50 ? -12.664 3.860   -7.591  1.00 0.00 ? 46 THR A O    3  
ATOM 4482  C CB   . THR A 1 50 ? -14.792 3.361   -10.215 1.00 0.00 ? 46 THR A CB   3  
ATOM 4483  O OG1  . THR A 1 50 ? -14.006 3.054   -11.375 1.00 0.00 ? 46 THR A OG1  3  
ATOM 4484  C CG2  . THR A 1 50 ? -14.852 4.869   -10.026 1.00 0.00 ? 46 THR A CG2  3  
ATOM 4485  H H    . THR A 1 50 ? -15.091 3.651   -7.338  1.00 0.00 ? 46 THR A H    3  
ATOM 4486  H HA   . THR A 1 50 ? -14.117 1.598   -9.182  1.00 0.00 ? 46 THR A HA   3  
ATOM 4487  H HB   . THR A 1 50 ? -15.798 2.998   -10.372 1.00 0.00 ? 46 THR A HB   3  
ATOM 4488  H HG1  . THR A 1 50 ? -14.533 2.523   -11.984 1.00 0.00 ? 46 THR A HG1  3  
ATOM 4489  H HG21 . THR A 1 50 ? -13.862 5.244   -9.814  1.00 0.00 ? 46 THR A HG21 3  
ATOM 4490  H HG22 . THR A 1 50 ? -15.510 5.102   -9.202  1.00 0.00 ? 46 THR A HG22 3  
ATOM 4491  H HG23 . THR A 1 50 ? -15.226 5.331   -10.927 1.00 0.00 ? 46 THR A HG23 3  
ATOM 4492  N N    . ASN A 1 51 ? -11.854 2.953   -9.484  1.00 0.00 ? 47 ASN A N    3  
ATOM 4493  C CA   . ASN A 1 51 ? -10.479 3.400   -9.260  1.00 0.00 ? 47 ASN A CA   3  
ATOM 4494  C C    . ASN A 1 51 ? -10.406 4.914   -9.070  1.00 0.00 ? 47 ASN A C    3  
ATOM 4495  O O    . ASN A 1 51 ? -9.761  5.402   -8.144  1.00 0.00 ? 47 ASN A O    3  
ATOM 4496  C CB   . ASN A 1 51 ? -9.590  2.978   -10.432 1.00 0.00 ? 47 ASN A CB   3  
ATOM 4497  C CG   . ASN A 1 51 ? -8.140  2.784   -10.028 1.00 0.00 ? 47 ASN A CG   3  
ATOM 4498  O OD1  . ASN A 1 51 ? -7.754  1.715   -9.562  1.00 0.00 ? 47 ASN A OD1  3  
ATOM 4499  N ND2  . ASN A 1 51 ? -7.323  3.810   -10.219 1.00 0.00 ? 47 ASN A ND2  3  
ATOM 4500  H H    . ASN A 1 51 ? -12.064 2.453   -10.302 1.00 0.00 ? 47 ASN A H    3  
ATOM 4501  H HA   . ASN A 1 51 ? -10.121 2.923   -8.360  1.00 0.00 ? 47 ASN A HA   3  
ATOM 4502  H HB2  . ASN A 1 51 ? -9.957  2.049   -10.836 1.00 0.00 ? 47 ASN A HB2  3  
ATOM 4503  H HB3  . ASN A 1 51 ? -9.631  3.739   -11.195 1.00 0.00 ? 47 ASN A HB3  3  
ATOM 4504  H HD21 . ASN A 1 51 ? -7.691  4.631   -10.603 1.00 0.00 ? 47 ASN A HD21 3  
ATOM 4505  H HD22 . ASN A 1 51 ? -6.378  3.702   -9.969  1.00 0.00 ? 47 ASN A HD22 3  
ATOM 4506  N N    . ASP A 1 52 ? -11.066 5.655   -9.955  1.00 0.00 ? 48 ASP A N    3  
ATOM 4507  C CA   . ASP A 1 52 ? -11.074 7.118   -9.889  1.00 0.00 ? 48 ASP A CA   3  
ATOM 4508  C C    . ASP A 1 52 ? -11.725 7.640   -8.607  1.00 0.00 ? 48 ASP A C    3  
ATOM 4509  O O    . ASP A 1 52 ? -11.337 8.687   -8.091  1.00 0.00 ? 48 ASP A O    3  
ATOM 4510  C CB   . ASP A 1 52 ? -11.805 7.697   -11.102 1.00 0.00 ? 48 ASP A CB   3  
ATOM 4511  C CG   . ASP A 1 52 ? -11.593 9.192   -11.245 1.00 0.00 ? 48 ASP A CG   3  
ATOM 4512  O OD1  . ASP A 1 52 ? -10.514 9.596   -11.728 1.00 0.00 ? 48 ASP A OD1  3  
ATOM 4513  O OD2  . ASP A 1 52 ? -12.501 9.967   -10.877 1.00 0.00 ? 48 ASP A OD2  3  
ATOM 4514  H H    . ASP A 1 52 ? -11.525 5.217   -10.703 1.00 0.00 ? 48 ASP A H    3  
ATOM 4515  H HA   . ASP A 1 52 ? -10.049 7.452   -9.914  1.00 0.00 ? 48 ASP A HA   3  
ATOM 4516  H HB2  . ASP A 1 52 ? -11.444 7.214   -11.998 1.00 0.00 ? 48 ASP A HB2  3  
ATOM 4517  H HB3  . ASP A 1 52 ? -12.865 7.510   -10.999 1.00 0.00 ? 48 ASP A HB3  3  
ATOM 4518  N N    . ASP A 1 53 ? -12.691 6.898   -8.081  1.00 0.00 ? 49 ASP A N    3  
ATOM 4519  C CA   . ASP A 1 53 ? -13.401 7.314   -6.872  1.00 0.00 ? 49 ASP A CA   3  
ATOM 4520  C C    . ASP A 1 53 ? -12.487 7.286   -5.652  1.00 0.00 ? 49 ASP A C    3  
ATOM 4521  O O    . ASP A 1 53 ? -12.663 8.069   -4.718  1.00 0.00 ? 49 ASP A O    3  
ATOM 4522  C CB   . ASP A 1 53 ? -14.623 6.432   -6.626  1.00 0.00 ? 49 ASP A CB   3  
ATOM 4523  C CG   . ASP A 1 53 ? -15.596 7.064   -5.654  1.00 0.00 ? 49 ASP A CG   3  
ATOM 4524  O OD1  . ASP A 1 53 ? -16.364 7.956   -6.070  1.00 0.00 ? 49 ASP A OD1  3  
ATOM 4525  O OD2  . ASP A 1 53 ? -15.611 6.666   -4.478  1.00 0.00 ? 49 ASP A OD2  3  
ATOM 4526  H H    . ASP A 1 53 ? -12.925 6.047   -8.504  1.00 0.00 ? 49 ASP A H    3  
ATOM 4527  H HA   . ASP A 1 53 ? -13.734 8.330   -7.024  1.00 0.00 ? 49 ASP A HA   3  
ATOM 4528  H HB2  . ASP A 1 53 ? -15.133 6.265   -7.561  1.00 0.00 ? 49 ASP A HB2  3  
ATOM 4529  H HB3  . ASP A 1 53 ? -14.299 5.485   -6.220  1.00 0.00 ? 49 ASP A HB3  3  
ATOM 4530  N N    . ILE A 1 54 ? -11.503 6.405   -5.670  1.00 0.00 ? 50 ILE A N    3  
ATOM 4531  C CA   . ILE A 1 54 ? -10.531 6.303   -4.585  1.00 0.00 ? 50 ILE A CA   3  
ATOM 4532  C C    . ILE A 1 54 ? -9.751  7.587   -4.436  1.00 0.00 ? 50 ILE A C    3  
ATOM 4533  O O    . ILE A 1 54 ? -9.251  7.920   -3.366  1.00 0.00 ? 50 ILE A O    3  
ATOM 4534  C CB   . ILE A 1 54 ? -9.578  5.054   -4.780  1.00 0.00 ? 50 ILE A CB   3  
ATOM 4535  C CG1  . ILE A 1 54 ? -10.281 3.668   -4.621  1.00 0.00 ? 50 ILE A CG1  3  
ATOM 4536  C CG2  . ILE A 1 54 ? -8.341  5.083   -3.829  1.00 0.00 ? 50 ILE A CG2  3  
ATOM 4537  C CD1  . ILE A 1 54 ? -9.454  2.441   -5.057  1.00 0.00 ? 50 ILE A CD1  3  
ATOM 4538  H H    . ILE A 1 54 ? -11.422 5.795   -6.442  1.00 0.00 ? 50 ILE A H    3  
ATOM 4539  H HA   . ILE A 1 54 ? -11.094 6.167   -3.644  1.00 0.00 ? 50 ILE A HA   3  
ATOM 4540  H HB   . ILE A 1 54 ? -9.200  5.103   -5.822  1.00 0.00 ? 50 ILE A HB   3  
ATOM 4541  H HG12 . ILE A 1 54 ? -10.640 3.536   -3.582  1.00 0.00 ? 50 ILE A HG12 3  
ATOM 4542  H HG13 . ILE A 1 54 ? -11.200 3.646   -5.235  1.00 0.00 ? 50 ILE A HG13 3  
ATOM 4543  H HG21 . ILE A 1 54 ? -7.713  5.981   -3.959  1.00 0.00 ? 50 ILE A HG21 3  
ATOM 4544  H HG22 . ILE A 1 54 ? -8.635  5.038   -2.763  1.00 0.00 ? 50 ILE A HG22 3  
ATOM 4545  H HG23 . ILE A 1 54 ? -7.652  4.238   -4.009  1.00 0.00 ? 50 ILE A HG23 3  
ATOM 4546  H HD11 . ILE A 1 54 ? -9.117  2.525   -6.108  1.00 0.00 ? 50 ILE A HD11 3  
ATOM 4547  H HD12 . ILE A 1 54 ? -8.555  2.291   -4.432  1.00 0.00 ? 50 ILE A HD12 3  
ATOM 4548  H HD13 . ILE A 1 54 ? -10.048 1.511   -4.982  1.00 0.00 ? 50 ILE A HD13 3  
ATOM 4549  N N    . LYS A 1 55 ? -9.613  8.285   -5.554  1.00 0.00 ? 51 LYS A N    3  
ATOM 4550  C CA   . LYS A 1 55 ? -8.870  9.535   -5.589  1.00 0.00 ? 51 LYS A CA   3  
ATOM 4551  C C    . LYS A 1 55 ? -9.797  10.709  -5.297  1.00 0.00 ? 51 LYS A C    3  
ATOM 4552  O O    . LYS A 1 55 ? -9.346  11.843  -5.118  1.00 0.00 ? 51 LYS A O    3  
ATOM 4553  C CB   . LYS A 1 55 ? -8.221  9.717   -6.962  1.00 0.00 ? 51 LYS A CB   3  
ATOM 4554  C CG   . LYS A 1 55 ? -7.698  8.422   -7.571  1.00 0.00 ? 51 LYS A CG   3  
ATOM 4555  C CD   . LYS A 1 55 ? -7.666  8.494   -9.089  1.00 0.00 ? 51 LYS A CD   3  
ATOM 4556  C CE   . LYS A 1 55 ? -6.540  9.384   -9.590  1.00 0.00 ? 51 LYS A CE   3  
ATOM 4557  N NZ   . LYS A 1 55 ? -5.240  8.664   -9.634  1.00 0.00 ? 51 LYS A NZ   3  
ATOM 4558  H H    . LYS A 1 55 ? -10.042 7.964   -6.374  1.00 0.00 ? 51 LYS A H    3  
ATOM 4559  H HA   . LYS A 1 55 ? -8.102  9.494   -4.832  1.00 0.00 ? 51 LYS A HA   3  
ATOM 4560  H HB2  . LYS A 1 55 ? -8.950  10.139  -7.638  1.00 0.00 ? 51 LYS A HB2  3  
ATOM 4561  H HB3  . LYS A 1 55 ? -7.394  10.405  -6.865  1.00 0.00 ? 51 LYS A HB3  3  
ATOM 4562  H HG2  . LYS A 1 55 ? -6.697  8.244   -7.208  1.00 0.00 ? 51 LYS A HG2  3  
ATOM 4563  H HG3  . LYS A 1 55 ? -8.343  7.607   -7.271  1.00 0.00 ? 51 LYS A HG3  3  
ATOM 4564  H HD2  . LYS A 1 55 ? -7.524  7.497   -9.484  1.00 0.00 ? 51 LYS A HD2  3  
ATOM 4565  H HD3  . LYS A 1 55 ? -8.609  8.889   -9.440  1.00 0.00 ? 51 LYS A HD3  3  
ATOM 4566  H HE2  . LYS A 1 55 ? -6.784  9.729   -10.584 1.00 0.00 ? 51 LYS A HE2  3  
ATOM 4567  H HE3  . LYS A 1 55 ? -6.450  10.232  -8.928  1.00 0.00 ? 51 LYS A HE3  3  
ATOM 4568  H HZ1  . LYS A 1 55 ? -4.914  8.444   -8.668  1.00 0.00 ? 51 LYS A HZ1  3  
ATOM 4569  H HZ2  . LYS A 1 55 ? -4.523  9.250   -10.108 1.00 0.00 ? 51 LYS A HZ2  3  
ATOM 4570  H HZ3  . LYS A 1 55 ? -5.345  7.776   -10.163 1.00 0.00 ? 51 LYS A HZ3  3  
ATOM 4571  N N    . ARG A 1 56 ? -11.095 10.430  -5.230  1.00 0.00 ? 52 ARG A N    3  
ATOM 4572  C CA   . ARG A 1 56 ? -12.093 11.456  -4.973  1.00 0.00 ? 52 ARG A CA   3  
ATOM 4573  C C    . ARG A 1 56 ? -12.371 11.565  -3.478  1.00 0.00 ? 52 ARG A C    3  
ATOM 4574  O O    . ARG A 1 56 ? -12.566 12.658  -2.952  1.00 0.00 ? 52 ARG A O    3  
ATOM 4575  C CB   . ARG A 1 56 ? -13.390 11.119  -5.726  1.00 0.00 ? 52 ARG A CB   3  
ATOM 4576  C CG   . ARG A 1 56 ? -14.479 12.175  -5.592  1.00 0.00 ? 52 ARG A CG   3  
ATOM 4577  C CD   . ARG A 1 56 ? -15.757 11.757  -6.306  1.00 0.00 ? 52 ARG A CD   3  
ATOM 4578  N NE   . ARG A 1 56 ? -16.403 10.612  -5.663  1.00 0.00 ? 52 ARG A NE   3  
ATOM 4579  C CZ   . ARG A 1 56 ? -17.381 10.709  -4.763  1.00 0.00 ? 52 ARG A CZ   3  
ATOM 4580  N NH1  . ARG A 1 56 ? -17.848 11.901  -4.402  1.00 0.00 ? 52 ARG A NH1  3  
ATOM 4581  N NH2  . ARG A 1 56 ? -17.893 9.606   -4.232  1.00 0.00 ? 52 ARG A NH2  3  
ATOM 4582  H H    . ARG A 1 56 ? -11.412 9.506   -5.328  1.00 0.00 ? 52 ARG A H    3  
ATOM 4583  H HA   . ARG A 1 56 ? -11.710 12.398  -5.331  1.00 0.00 ? 52 ARG A HA   3  
ATOM 4584  H HB2  . ARG A 1 56 ? -13.165 11.003  -6.775  1.00 0.00 ? 52 ARG A HB2  3  
ATOM 4585  H HB3  . ARG A 1 56 ? -13.779 10.183  -5.348  1.00 0.00 ? 52 ARG A HB3  3  
ATOM 4586  H HG2  . ARG A 1 56 ? -14.695 12.324  -4.545  1.00 0.00 ? 52 ARG A HG2  3  
ATOM 4587  H HG3  . ARG A 1 56 ? -14.123 13.101  -6.023  1.00 0.00 ? 52 ARG A HG3  3  
ATOM 4588  H HD2  . ARG A 1 56 ? -16.444 12.588  -6.308  1.00 0.00 ? 52 ARG A HD2  3  
ATOM 4589  H HD3  . ARG A 1 56 ? -15.513 11.494  -7.323  1.00 0.00 ? 52 ARG A HD3  3  
ATOM 4590  H HE   . ARG A 1 56 ? -16.090 9.705   -5.925  1.00 0.00 ? 52 ARG A HE   3  
ATOM 4591  H HH11 . ARG A 1 56 ? -17.465 12.737  -4.807  1.00 0.00 ? 52 ARG A HH11 3  
ATOM 4592  H HH12 . ARG A 1 56 ? -18.590 11.973  -3.727  1.00 0.00 ? 52 ARG A HH12 3  
ATOM 4593  H HH21 . ARG A 1 56 ? -17.540 8.703   -4.512  1.00 0.00 ? 52 ARG A HH21 3  
ATOM 4594  H HH22 . ARG A 1 56 ? -18.629 9.663   -3.556  1.00 0.00 ? 52 ARG A HH22 3  
ATOM 4595  N N    . ILE A 1 57 ? -12.392 10.421  -2.803  1.00 0.00 ? 53 ILE A N    3  
ATOM 4596  C CA   . ILE A 1 57 ? -12.653 10.370  -1.364  1.00 0.00 ? 53 ILE A CA   3  
ATOM 4597  C C    . ILE A 1 57 ? -11.467 10.859  -0.521  1.00 0.00 ? 53 ILE A C    3  
ATOM 4598  O O    . ILE A 1 57 ? -11.341 10.501  0.652   1.00 0.00 ? 53 ILE A O    3  
ATOM 4599  C CB   . ILE A 1 57 ? -13.040 8.942   -0.922  1.00 0.00 ? 53 ILE A CB   3  
ATOM 4600  C CG1  . ILE A 1 57 ? -11.994 7.926   -1.388  1.00 0.00 ? 53 ILE A CG1  3  
ATOM 4601  C CG2  . ILE A 1 57 ? -14.415 8.582   -1.465  1.00 0.00 ? 53 ILE A CG2  3  
ATOM 4602  C CD1  . ILE A 1 57 ? -12.346 6.492   -1.056  1.00 0.00 ? 53 ILE A CD1  3  
ATOM 4603  H H    . ILE A 1 57 ? -12.279 9.579   -3.296  1.00 0.00 ? 53 ILE A H    3  
ATOM 4604  H HA   . ILE A 1 57 ? -13.498 11.013  -1.166  1.00 0.00 ? 53 ILE A HA   3  
ATOM 4605  H HB   . ILE A 1 57 ? -13.093 8.926   0.158   1.00 0.00 ? 53 ILE A HB   3  
ATOM 4606  H HG12 . ILE A 1 57 ? -11.884 7.997   -2.459  1.00 0.00 ? 53 ILE A HG12 3  
ATOM 4607  H HG13 . ILE A 1 57 ? -11.049 8.153   -0.918  1.00 0.00 ? 53 ILE A HG13 3  
ATOM 4608  H HG21 . ILE A 1 57 ? -15.144 9.285   -1.092  1.00 0.00 ? 53 ILE A HG21 3  
ATOM 4609  H HG22 . ILE A 1 57 ? -14.677 7.585   -1.142  1.00 0.00 ? 53 ILE A HG22 3  
ATOM 4610  H HG23 . ILE A 1 57 ? -14.396 8.619   -2.544  1.00 0.00 ? 53 ILE A HG23 3  
ATOM 4611  H HD11 . ILE A 1 57 ? -11.559 5.837   -1.402  1.00 0.00 ? 53 ILE A HD11 3  
ATOM 4612  H HD12 . ILE A 1 57 ? -13.275 6.226   -1.541  1.00 0.00 ? 53 ILE A HD12 3  
ATOM 4613  H HD13 . ILE A 1 57 ? -12.456 6.386   0.014   1.00 0.00 ? 53 ILE A HD13 3  
ATOM 4614  N N    . GLY A 1 58 ? -10.601 11.671  -1.111  1.00 0.00 ? 54 GLY A N    3  
ATOM 4615  C CA   . GLY A 1 58 ? -9.468  12.201  -0.381  1.00 0.00 ? 54 GLY A CA   3  
ATOM 4616  C C    . GLY A 1 58 ? -8.147  11.800  -0.998  1.00 0.00 ? 54 GLY A C    3  
ATOM 4617  O O    . GLY A 1 58 ? -7.603  12.541  -1.816  1.00 0.00 ? 54 GLY A O    3  
ATOM 4618  H H    . GLY A 1 58 ? -10.721 11.897  -2.057  1.00 0.00 ? 54 GLY A H    3  
ATOM 4619  H HA2  . GLY A 1 58 ? -9.535  13.277  -0.366  1.00 0.00 ? 54 GLY A HA2  3  
ATOM 4620  H HA3  . GLY A 1 58 ? -9.505  11.832  0.634   1.00 0.00 ? 54 GLY A HA3  3  
ATOM 4621  N N    . VAL A 1 59 ? -7.646  10.641  -0.551  1.00 0.00 ? 55 VAL A N    3  
ATOM 4622  C CA   . VAL A 1 59 ? -6.382  10.019  -0.998  1.00 0.00 ? 55 VAL A CA   3  
ATOM 4623  C C    . VAL A 1 59 ? -5.761  10.652  -2.247  1.00 0.00 ? 55 VAL A C    3  
ATOM 4624  O O    . VAL A 1 59 ? -6.065  10.255  -3.372  1.00 0.00 ? 55 VAL A O    3  
ATOM 4625  C CB   . VAL A 1 59 ? -6.592  8.516   -1.282  1.00 0.00 ? 55 VAL A CB   3  
ATOM 4626  C CG1  . VAL A 1 59 ? -5.261  7.786   -1.302  1.00 0.00 ? 55 VAL A CG1  3  
ATOM 4627  C CG2  . VAL A 1 59 ? -7.533  7.891   -0.261  1.00 0.00 ? 55 VAL A CG2  3  
ATOM 4628  H H    . VAL A 1 59 ? -8.133  10.180  0.161   1.00 0.00 ? 55 VAL A H    3  
ATOM 4629  H HA   . VAL A 1 59 ? -5.677  10.101  -0.187  1.00 0.00 ? 55 VAL A HA   3  
ATOM 4630  H HB   . VAL A 1 59 ? -7.042  8.417   -2.260  1.00 0.00 ? 55 VAL A HB   3  
ATOM 4631  H HG11 . VAL A 1 59 ? -4.823  7.812   -0.315  1.00 0.00 ? 55 VAL A HG11 3  
ATOM 4632  H HG12 . VAL A 1 59 ? -4.597  8.270   -2.003  1.00 0.00 ? 55 VAL A HG12 3  
ATOM 4633  H HG13 . VAL A 1 59 ? -5.417  6.761   -1.602  1.00 0.00 ? 55 VAL A HG13 3  
ATOM 4634  H HG21 . VAL A 1 59 ? -7.675  6.845   -0.495  1.00 0.00 ? 55 VAL A HG21 3  
ATOM 4635  H HG22 . VAL A 1 59 ? -8.486  8.398   -0.290  1.00 0.00 ? 55 VAL A HG22 3  
ATOM 4636  H HG23 . VAL A 1 59 ? -7.105  7.983   0.726   1.00 0.00 ? 55 VAL A HG23 3  
ATOM 4637  N N    . ARG A 1 60 ? -4.876  11.625  -2.046  1.00 0.00 ? 56 ARG A N    3  
ATOM 4638  C CA   . ARG A 1 60 ? -4.218  12.282  -3.170  1.00 0.00 ? 56 ARG A CA   3  
ATOM 4639  C C    . ARG A 1 60 ? -2.890  11.609  -3.519  1.00 0.00 ? 56 ARG A C    3  
ATOM 4640  O O    . ARG A 1 60 ? -2.359  11.812  -4.607  1.00 0.00 ? 56 ARG A O    3  
ATOM 4641  C CB   . ARG A 1 60 ? -4.004  13.779  -2.888  1.00 0.00 ? 56 ARG A CB   3  
ATOM 4642  C CG   . ARG A 1 60 ? -3.228  14.095  -1.609  1.00 0.00 ? 56 ARG A CG   3  
ATOM 4643  C CD   . ARG A 1 60 ? -1.714  14.033  -1.807  1.00 0.00 ? 56 ARG A CD   3  
ATOM 4644  N NE   . ARG A 1 60 ? -1.275  14.710  -3.029  1.00 0.00 ? 56 ARG A NE   3  
ATOM 4645  C CZ   . ARG A 1 60 ? 0.002   14.958  -3.331  1.00 0.00 ? 56 ARG A CZ   3  
ATOM 4646  N NH1  . ARG A 1 60 ? 0.970   14.638  -2.478  1.00 0.00 ? 56 ARG A NH1  3  
ATOM 4647  N NH2  . ARG A 1 60 ? 0.311   15.538  -4.482  1.00 0.00 ? 56 ARG A NH2  3  
ATOM 4648  H H    . ARG A 1 60 ? -4.698  11.939  -1.135  1.00 0.00 ? 56 ARG A H    3  
ATOM 4649  H HA   . ARG A 1 60 ? -4.877  12.187  -4.023  1.00 0.00 ? 56 ARG A HA   3  
ATOM 4650  H HB2  . ARG A 1 60 ? -3.467  14.210  -3.718  1.00 0.00 ? 56 ARG A HB2  3  
ATOM 4651  H HB3  . ARG A 1 60 ? -4.971  14.255  -2.819  1.00 0.00 ? 56 ARG A HB3  3  
ATOM 4652  H HG2  . ARG A 1 60 ? -3.493  15.088  -1.279  1.00 0.00 ? 56 ARG A HG2  3  
ATOM 4653  H HG3  . ARG A 1 60 ? -3.509  13.379  -0.849  1.00 0.00 ? 56 ARG A HG3  3  
ATOM 4654  H HD2  . ARG A 1 60 ? -1.237  14.502  -0.960  1.00 0.00 ? 56 ARG A HD2  3  
ATOM 4655  H HD3  . ARG A 1 60 ? -1.416  12.996  -1.857  1.00 0.00 ? 56 ARG A HD3  3  
ATOM 4656  H HE   . ARG A 1 60 ? -1.972  14.985  -3.670  1.00 0.00 ? 56 ARG A HE   3  
ATOM 4657  H HH11 . ARG A 1 60 ? 0.750   14.210  -1.604  1.00 0.00 ? 56 ARG A HH11 3  
ATOM 4658  H HH12 . ARG A 1 60 ? 1.929   14.833  -2.711  1.00 0.00 ? 56 ARG A HH12 3  
ATOM 4659  H HH21 . ARG A 1 60 ? -0.412  15.795  -5.129  1.00 0.00 ? 56 ARG A HH21 3  
ATOM 4660  H HH22 . ARG A 1 60 ? 1.271   15.714  -4.718  1.00 0.00 ? 56 ARG A HH22 3  
ATOM 4661  N N    . LEU A 1 61 ? -2.359  10.807  -2.599  1.00 0.00 ? 57 LEU A N    3  
ATOM 4662  C CA   . LEU A 1 61 ? -1.089  10.127  -2.838  1.00 0.00 ? 57 LEU A CA   3  
ATOM 4663  C C    . LEU A 1 61 ? -1.293  8.932   -3.768  1.00 0.00 ? 57 LEU A C    3  
ATOM 4664  O O    . LEU A 1 61 ? -2.095  8.042   -3.480  1.00 0.00 ? 57 LEU A O    3  
ATOM 4665  C CB   . LEU A 1 61 ? -0.435  9.694   -1.515  1.00 0.00 ? 57 LEU A CB   3  
ATOM 4666  C CG   . LEU A 1 61 ? 0.284   10.814  -0.743  1.00 0.00 ? 57 LEU A CG   3  
ATOM 4667  C CD1  . LEU A 1 61 ? 0.967   10.273  0.508   1.00 0.00 ? 57 LEU A CD1  3  
ATOM 4668  C CD2  . LEU A 1 61 ? 1.303   11.505  -1.634  1.00 0.00 ? 57 LEU A CD2  3  
ATOM 4669  H H    . LEU A 1 61 ? -2.838  10.656  -1.759  1.00 0.00 ? 57 LEU A H    3  
ATOM 4670  H HA   . LEU A 1 61 ? -0.439  10.833  -3.332  1.00 0.00 ? 57 LEU A HA   3  
ATOM 4671  H HB2  . LEU A 1 61 ? -1.205  9.282   -0.877  1.00 0.00 ? 57 LEU A HB2  3  
ATOM 4672  H HB3  . LEU A 1 61 ? 0.283   8.918   -1.731  1.00 0.00 ? 57 LEU A HB3  3  
ATOM 4673  H HG   . LEU A 1 61 ? -0.443  11.551  -0.435  1.00 0.00 ? 57 LEU A HG   3  
ATOM 4674  H HD11 . LEU A 1 61 ? 1.764   9.597   0.227   1.00 0.00 ? 57 LEU A HD11 3  
ATOM 4675  H HD12 . LEU A 1 61 ? 0.244   9.746   1.114   1.00 0.00 ? 57 LEU A HD12 3  
ATOM 4676  H HD13 . LEU A 1 61 ? 1.381   11.094  1.076   1.00 0.00 ? 57 LEU A HD13 3  
ATOM 4677  H HD21 . LEU A 1 61 ? 1.936   10.764  -2.101  1.00 0.00 ? 57 LEU A HD21 3  
ATOM 4678  H HD22 . LEU A 1 61 ? 1.910   12.169  -1.037  1.00 0.00 ? 57 LEU A HD22 3  
ATOM 4679  H HD23 . LEU A 1 61 ? 0.791   12.075  -2.395  1.00 0.00 ? 57 LEU A HD23 3  
ATOM 4680  N N    . PRO A 1 62 ? -0.559  8.904   -4.895  1.00 0.00 ? 58 PRO A N    3  
ATOM 4681  C CA   . PRO A 1 62 ? -0.670  7.843   -5.907  1.00 0.00 ? 58 PRO A CA   3  
ATOM 4682  C C    . PRO A 1 62 ? -0.415  6.444   -5.354  1.00 0.00 ? 58 PRO A C    3  
ATOM 4683  O O    . PRO A 1 62 ? -1.119  5.497   -5.710  1.00 0.00 ? 58 PRO A O    3  
ATOM 4684  C CB   . PRO A 1 62 ? 0.396   8.211   -6.949  1.00 0.00 ? 58 PRO A CB   3  
ATOM 4685  C CG   . PRO A 1 62 ? 1.306   9.164   -6.257  1.00 0.00 ? 58 PRO A CG   3  
ATOM 4686  C CD   . PRO A 1 62 ? 0.453   9.906   -5.273  1.00 0.00 ? 58 PRO A CD   3  
ATOM 4687  H HA   . PRO A 1 62 ? -1.644  7.859   -6.377  1.00 0.00 ? 58 PRO A HA   3  
ATOM 4688  H HB2  . PRO A 1 62 ? 0.920   7.319   -7.257  1.00 0.00 ? 58 PRO A HB2  3  
ATOM 4689  H HB3  . PRO A 1 62 ? -0.079  8.670   -7.804  1.00 0.00 ? 58 PRO A HB3  3  
ATOM 4690  H HG2  . PRO A 1 62 ? 2.085   8.620   -5.742  1.00 0.00 ? 58 PRO A HG2  3  
ATOM 4691  H HG3  . PRO A 1 62 ? 1.736   9.850   -6.973  1.00 0.00 ? 58 PRO A HG3  3  
ATOM 4692  H HD2  . PRO A 1 62 ? 1.040   10.206  -4.417  1.00 0.00 ? 58 PRO A HD2  3  
ATOM 4693  H HD3  . PRO A 1 62 ? -0.008  10.764  -5.740  1.00 0.00 ? 58 PRO A HD3  3  
ATOM 4694  N N    . GLY A 1 63 ? 0.584   6.311   -4.492  1.00 0.00 ? 59 GLY A N    3  
ATOM 4695  C CA   . GLY A 1 63 ? 0.894   5.012   -3.924  1.00 0.00 ? 59 GLY A CA   3  
ATOM 4696  C C    . GLY A 1 63 ? -0.176  4.547   -2.964  1.00 0.00 ? 59 GLY A C    3  
ATOM 4697  O O    . GLY A 1 63 ? -0.455  3.350   -2.864  1.00 0.00 ? 59 GLY A O    3  
ATOM 4698  H H    . GLY A 1 63 ? 1.117   7.096   -4.241  1.00 0.00 ? 59 GLY A H    3  
ATOM 4699  H HA2  . GLY A 1 63 ? 0.980   4.290   -4.726  1.00 0.00 ? 59 GLY A HA2  3  
ATOM 4700  H HA3  . GLY A 1 63 ? 1.836   5.068   -3.401  1.00 0.00 ? 59 GLY A HA3  3  
ATOM 4701  N N    . HIS A 1 64 ? -0.792  5.499   -2.267  1.00 0.00 ? 60 HIS A N    3  
ATOM 4702  C CA   . HIS A 1 64 ? -1.857  5.180   -1.327  1.00 0.00 ? 60 HIS A CA   3  
ATOM 4703  C C    . HIS A 1 64 ? -3.058  4.667   -2.105  1.00 0.00 ? 60 HIS A C    3  
ATOM 4704  O O    . HIS A 1 64 ? -3.797  3.798   -1.642  1.00 0.00 ? 60 HIS A O    3  
ATOM 4705  C CB   . HIS A 1 64 ? -2.248  6.412   -0.503  1.00 0.00 ? 60 HIS A CB   3  
ATOM 4706  C CG   . HIS A 1 64 ? -1.383  6.654   0.697   1.00 0.00 ? 60 HIS A CG   3  
ATOM 4707  N ND1  . HIS A 1 64 ? -1.779  6.404   1.994   1.00 0.00 ? 60 HIS A ND1  3  
ATOM 4708  C CD2  . HIS A 1 64 ? -0.131  7.162   0.784   1.00 0.00 ? 60 HIS A CD2  3  
ATOM 4709  C CE1  . HIS A 1 64 ? -0.779  6.767   2.806   1.00 0.00 ? 60 HIS A CE1  3  
ATOM 4710  N NE2  . HIS A 1 64 ? 0.242   7.234   2.121   1.00 0.00 ? 60 HIS A NE2  3  
ATOM 4711  H H    . HIS A 1 64 ? -0.552  6.438   -2.413  1.00 0.00 ? 60 HIS A H    3  
ATOM 4712  H HA   . HIS A 1 64 ? -1.504  4.401   -0.668  1.00 0.00 ? 60 HIS A HA   3  
ATOM 4713  H HB2  . HIS A 1 64 ? -2.183  7.287   -1.134  1.00 0.00 ? 60 HIS A HB2  3  
ATOM 4714  H HB3  . HIS A 1 64 ? -3.266  6.298   -0.161  1.00 0.00 ? 60 HIS A HB3  3  
ATOM 4715  H HD1  . HIS A 1 64 ? -2.630  5.994   2.272   1.00 0.00 ? 60 HIS A HD1  3  
ATOM 4716  H HD2  . HIS A 1 64 ? 0.490   7.463   -0.048  1.00 0.00 ? 60 HIS A HD2  3  
ATOM 4717  H HE1  . HIS A 1 64 ? -0.804  6.681   3.883   1.00 0.00 ? 60 HIS A HE1  3  
ATOM 4718  N N    . GLN A 1 65 ? -3.221  5.205   -3.306  1.00 0.00 ? 61 GLN A N    3  
ATOM 4719  C CA   . GLN A 1 65 ? -4.312  4.805   -4.184  1.00 0.00 ? 61 GLN A CA   3  
ATOM 4720  C C    . GLN A 1 65 ? -4.051  3.385   -4.665  1.00 0.00 ? 61 GLN A C    3  
ATOM 4721  O O    . GLN A 1 65 ? -4.850  2.483   -4.421  1.00 0.00 ? 61 GLN A O    3  
ATOM 4722  C CB   . GLN A 1 65 ? -4.428  5.756   -5.384  1.00 0.00 ? 61 GLN A CB   3  
ATOM 4723  C CG   . GLN A 1 65 ? -5.030  7.113   -5.048  1.00 0.00 ? 61 GLN A CG   3  
ATOM 4724  C CD   . GLN A 1 65 ? -4.621  8.197   -6.034  1.00 0.00 ? 61 GLN A CD   3  
ATOM 4725  O OE1  . GLN A 1 65 ? -4.276  7.918   -7.184  1.00 0.00 ? 61 GLN A OE1  3  
ATOM 4726  N NE2  . GLN A 1 65 ? -4.682  9.445   -5.602  1.00 0.00 ? 61 GLN A NE2  3  
ATOM 4727  H H    . GLN A 1 65 ? -2.569  5.879   -3.616  1.00 0.00 ? 61 GLN A H    3  
ATOM 4728  H HA   . GLN A 1 65 ? -5.232  4.825   -3.613  1.00 0.00 ? 61 GLN A HA   3  
ATOM 4729  H HB2  . GLN A 1 65 ? -3.442  5.920   -5.794  1.00 0.00 ? 61 GLN A HB2  3  
ATOM 4730  H HB3  . GLN A 1 65 ? -5.046  5.290   -6.134  1.00 0.00 ? 61 GLN A HB3  3  
ATOM 4731  H HG2  . GLN A 1 65 ? -6.107  7.028   -5.054  1.00 0.00 ? 61 GLN A HG2  3  
ATOM 4732  H HG3  . GLN A 1 65 ? -4.700  7.402   -4.062  1.00 0.00 ? 61 GLN A HG3  3  
ATOM 4733  H HE21 . GLN A 1 65 ? -4.990  9.602   -4.679  1.00 0.00 ? 61 GLN A HE21 3  
ATOM 4734  H HE22 . GLN A 1 65 ? -4.413  10.163  -6.211  1.00 0.00 ? 61 GLN A HE22 3  
ATOM 4735  N N    . LYS A 1 66 ? -2.940  3.232   -5.391  1.00 0.00 ? 62 LYS A N    3  
ATOM 4736  C CA   . LYS A 1 66 ? -2.483  1.935   -5.902  1.00 0.00 ? 62 LYS A CA   3  
ATOM 4737  C C    . LYS A 1 66 ? -2.753  0.798   -4.916  1.00 0.00 ? 62 LYS A C    3  
ATOM 4738  O O    . LYS A 1 66 ? -3.328  -0.225  -5.287  1.00 0.00 ? 62 LYS A O    3  
ATOM 4739  C CB   . LYS A 1 66 ? -0.980  1.995   -6.212  1.00 0.00 ? 62 LYS A CB   3  
ATOM 4740  C CG   . LYS A 1 66 ? -0.515  0.979   -7.249  1.00 0.00 ? 62 LYS A CG   3  
ATOM 4741  C CD   . LYS A 1 66 ? -0.330  -0.413  -6.654  1.00 0.00 ? 62 LYS A CD   3  
ATOM 4742  C CE   . LYS A 1 66 ? 1.123   -0.698  -6.290  1.00 0.00 ? 62 LYS A CE   3  
ATOM 4743  N NZ   . LYS A 1 66 ? 1.599   0.143   -5.159  1.00 0.00 ? 62 LYS A NZ   3  
ATOM 4744  H H    . LYS A 1 66 ? -2.486  4.049   -5.691  1.00 0.00 ? 62 LYS A H    3  
ATOM 4745  H HA   . LYS A 1 66 ? -3.020  1.735   -6.816  1.00 0.00 ? 62 LYS A HA   3  
ATOM 4746  H HB2  . LYS A 1 66 ? -0.740  2.981   -6.577  1.00 0.00 ? 62 LYS A HB2  3  
ATOM 4747  H HB3  . LYS A 1 66 ? -0.428  1.819   -5.298  1.00 0.00 ? 62 LYS A HB3  3  
ATOM 4748  H HG2  . LYS A 1 66 ? -1.251  0.925   -8.037  1.00 0.00 ? 62 LYS A HG2  3  
ATOM 4749  H HG3  . LYS A 1 66 ? 0.428   1.312   -7.660  1.00 0.00 ? 62 LYS A HG3  3  
ATOM 4750  H HD2  . LYS A 1 66 ? -0.932  -0.490  -5.760  1.00 0.00 ? 62 LYS A HD2  3  
ATOM 4751  H HD3  . LYS A 1 66 ? -0.663  -1.145  -7.375  1.00 0.00 ? 62 LYS A HD3  3  
ATOM 4752  H HE2  . LYS A 1 66 ? 1.212   -1.738  -6.012  1.00 0.00 ? 62 LYS A HE2  3  
ATOM 4753  H HE3  . LYS A 1 66 ? 1.740   -0.506  -7.156  1.00 0.00 ? 62 LYS A HE3  3  
ATOM 4754  H HZ1  . LYS A 1 66 ? 2.394   -0.330  -4.666  1.00 0.00 ? 62 LYS A HZ1  3  
ATOM 4755  H HZ2  . LYS A 1 66 ? 0.835   0.299   -4.481  1.00 0.00 ? 62 LYS A HZ2  3  
ATOM 4756  H HZ3  . LYS A 1 66 ? 1.933   1.070   -5.514  1.00 0.00 ? 62 LYS A HZ3  3  
ATOM 4757  N N    . ARG A 1 67 ? -2.339  0.981   -3.666  1.00 0.00 ? 63 ARG A N    3  
ATOM 4758  C CA   . ARG A 1 67 ? -2.533  -0.046  -2.649  1.00 0.00 ? 63 ARG A CA   3  
ATOM 4759  C C    . ARG A 1 67 ? -4.012  -0.379  -2.480  1.00 0.00 ? 63 ARG A C    3  
ATOM 4760  O O    . ARG A 1 67 ? -4.397  -1.543  -2.569  1.00 0.00 ? 63 ARG A O    3  
ATOM 4761  C CB   . ARG A 1 67 ? -1.941  0.382   -1.309  1.00 0.00 ? 63 ARG A CB   3  
ATOM 4762  C CG   . ARG A 1 67 ? -1.850  -0.765  -0.314  1.00 0.00 ? 63 ARG A CG   3  
ATOM 4763  C CD   . ARG A 1 67 ? -1.193  -0.337  0.985   1.00 0.00 ? 63 ARG A CD   3  
ATOM 4764  N NE   . ARG A 1 67 ? 0.170   0.142   0.779   1.00 0.00 ? 63 ARG A NE   3  
ATOM 4765  C CZ   . ARG A 1 67 ? 0.897   0.748   1.718   1.00 0.00 ? 63 ARG A CZ   3  
ATOM 4766  N NH1  . ARG A 1 67 ? 0.421   0.908   2.948   1.00 0.00 ? 63 ARG A NH1  3  
ATOM 4767  N NH2  . ARG A 1 67 ? 2.113   1.182   1.433   1.00 0.00 ? 63 ARG A NH2  3  
ATOM 4768  H H    . ARG A 1 67 ? -1.890  1.821   -3.430  1.00 0.00 ? 63 ARG A H    3  
ATOM 4769  H HA   . ARG A 1 67 ? -2.019  -0.934  -2.985  1.00 0.00 ? 63 ARG A HA   3  
ATOM 4770  H HB2  . ARG A 1 67 ? -0.948  0.780   -1.469  1.00 0.00 ? 63 ARG A HB2  3  
ATOM 4771  H HB3  . ARG A 1 67 ? -2.566  1.151   -0.882  1.00 0.00 ? 63 ARG A HB3  3  
ATOM 4772  H HG2  . ARG A 1 67 ? -2.846  -1.119  -0.099  1.00 0.00 ? 63 ARG A HG2  3  
ATOM 4773  H HG3  . ARG A 1 67 ? -1.270  -1.564  -0.753  1.00 0.00 ? 63 ARG A HG3  3  
ATOM 4774  H HD2  . ARG A 1 67 ? -1.780  0.456   1.426   1.00 0.00 ? 63 ARG A HD2  3  
ATOM 4775  H HD3  . ARG A 1 67 ? -1.170  -1.183  1.657   1.00 0.00 ? 63 ARG A HD3  3  
ATOM 4776  H HE   . ARG A 1 67 ? 0.560   0.015   -0.114  1.00 0.00 ? 63 ARG A HE   3  
ATOM 4777  H HH11 . ARG A 1 67 ? -0.498  0.568   3.188   1.00 0.00 ? 63 ARG A HH11 3  
ATOM 4778  H HH12 . ARG A 1 67 ? 0.973   1.379   3.645   1.00 0.00 ? 63 ARG A HH12 3  
ATOM 4779  H HH21 . ARG A 1 67 ? 2.495   1.059   0.514   1.00 0.00 ? 63 ARG A HH21 3  
ATOM 4780  H HH22 . ARG A 1 67 ? 2.658   1.650   2.142   1.00 0.00 ? 63 ARG A HH22 3  
ATOM 4781  N N    . ILE A 1 68 ? -4.834  0.648   -2.258  1.00 0.00 ? 64 ILE A N    3  
ATOM 4782  C CA   . ILE A 1 68 ? -6.272  0.455   -2.081  1.00 0.00 ? 64 ILE A CA   3  
ATOM 4783  C C    . ILE A 1 68 ? -6.869  -0.244  -3.304  1.00 0.00 ? 64 ILE A C    3  
ATOM 4784  O O    . ILE A 1 68 ? -7.661  -1.174  -3.166  1.00 0.00 ? 64 ILE A O    3  
ATOM 4785  C CB   . ILE A 1 68 ? -6.999  1.798   -1.834  1.00 0.00 ? 64 ILE A CB   3  
ATOM 4786  C CG1  . ILE A 1 68 ? -6.506  2.433   -0.528  1.00 0.00 ? 64 ILE A CG1  3  
ATOM 4787  C CG2  . ILE A 1 68 ? -8.508  1.595   -1.788  1.00 0.00 ? 64 ILE A CG2  3  
ATOM 4788  C CD1  . ILE A 1 68 ? -7.018  3.839   -0.297  1.00 0.00 ? 64 ILE A CD1  3  
ATOM 4789  H H    . ILE A 1 68 ? -4.461  1.557   -2.221  1.00 0.00 ? 64 ILE A H    3  
ATOM 4790  H HA   . ILE A 1 68 ? -6.419  -0.175  -1.213  1.00 0.00 ? 64 ILE A HA   3  
ATOM 4791  H HB   . ILE A 1 68 ? -6.772  2.461   -2.656  1.00 0.00 ? 64 ILE A HB   3  
ATOM 4792  H HG12 . ILE A 1 68 ? -6.830  1.824   0.303   1.00 0.00 ? 64 ILE A HG12 3  
ATOM 4793  H HG13 . ILE A 1 68 ? -5.427  2.470   -0.541  1.00 0.00 ? 64 ILE A HG13 3  
ATOM 4794  H HG21 . ILE A 1 68 ? -9.002  2.555   -1.764  1.00 0.00 ? 64 ILE A HG21 3  
ATOM 4795  H HG22 . ILE A 1 68 ? -8.771  1.035   -0.904  1.00 0.00 ? 64 ILE A HG22 3  
ATOM 4796  H HG23 . ILE A 1 68 ? -8.826  1.050   -2.665  1.00 0.00 ? 64 ILE A HG23 3  
ATOM 4797  H HD11 . ILE A 1 68 ? -6.690  4.480   -1.101  1.00 0.00 ? 64 ILE A HD11 3  
ATOM 4798  H HD12 . ILE A 1 68 ? -6.632  4.212   0.641   1.00 0.00 ? 64 ILE A HD12 3  
ATOM 4799  H HD13 . ILE A 1 68 ? -8.098  3.829   -0.262  1.00 0.00 ? 64 ILE A HD13 3  
ATOM 4800  N N    . ALA A 1 69 ? -6.476  0.200   -4.495  1.00 0.00 ? 65 ALA A N    3  
ATOM 4801  C CA   . ALA A 1 69 ? -6.959  -0.402  -5.740  1.00 0.00 ? 65 ALA A CA   3  
ATOM 4802  C C    . ALA A 1 69 ? -6.603  -1.888  -5.793  1.00 0.00 ? 65 ALA A C    3  
ATOM 4803  O O    . ALA A 1 69 ? -7.409  -2.726  -6.204  1.00 0.00 ? 65 ALA A O    3  
ATOM 4804  C CB   . ALA A 1 69 ? -6.370  0.330   -6.938  1.00 0.00 ? 65 ALA A CB   3  
ATOM 4805  H H    . ALA A 1 69 ? -5.861  0.970   -4.541  1.00 0.00 ? 65 ALA A H    3  
ATOM 4806  H HA   . ALA A 1 69 ? -8.034  -0.297  -5.770  1.00 0.00 ? 65 ALA A HA   3  
ATOM 4807  H HB1  . ALA A 1 69 ? -6.647  1.375   -6.892  1.00 0.00 ? 65 ALA A HB1  3  
ATOM 4808  H HB2  . ALA A 1 69 ? -6.751  -0.102  -7.851  1.00 0.00 ? 65 ALA A HB2  3  
ATOM 4809  H HB3  . ALA A 1 69 ? -5.294  0.243   -6.922  1.00 0.00 ? 65 ALA A HB3  3  
ATOM 4810  N N    . TYR A 1 70 ? -5.389  -2.191  -5.362  1.00 0.00 ? 66 TYR A N    3  
ATOM 4811  C CA   . TYR A 1 70 ? -4.887  -3.558  -5.320  1.00 0.00 ? 66 TYR A CA   3  
ATOM 4812  C C    . TYR A 1 70 ? -5.747  -4.394  -4.377  1.00 0.00 ? 66 TYR A C    3  
ATOM 4813  O O    . TYR A 1 70 ? -6.145  -5.515  -4.697  1.00 0.00 ? 66 TYR A O    3  
ATOM 4814  C CB   . TYR A 1 70 ? -3.412  -3.534  -4.877  1.00 0.00 ? 66 TYR A CB   3  
ATOM 4815  C CG   . TYR A 1 70 ? -2.869  -4.834  -4.317  1.00 0.00 ? 66 TYR A CG   3  
ATOM 4816  C CD1  . TYR A 1 70 ? -2.742  -5.971  -5.112  1.00 0.00 ? 66 TYR A CD1  3  
ATOM 4817  C CD2  . TYR A 1 70 ? -2.453  -4.913  -2.991  1.00 0.00 ? 66 TYR A CD2  3  
ATOM 4818  C CE1  . TYR A 1 70 ? -2.219  -7.144  -4.598  1.00 0.00 ? 66 TYR A CE1  3  
ATOM 4819  C CE2  . TYR A 1 70 ? -1.933  -6.084  -2.472  1.00 0.00 ? 66 TYR A CE2  3  
ATOM 4820  C CZ   . TYR A 1 70 ? -1.817  -7.195  -3.279  1.00 0.00 ? 66 TYR A CZ   3  
ATOM 4821  O OH   . TYR A 1 70 ? -1.291  -8.362  -2.772  1.00 0.00 ? 66 TYR A OH   3  
ATOM 4822  H H    . TYR A 1 70 ? -4.803  -1.461  -5.064  1.00 0.00 ? 66 TYR A H    3  
ATOM 4823  H HA   . TYR A 1 70 ? -4.956  -3.973  -6.314  1.00 0.00 ? 66 TYR A HA   3  
ATOM 4824  H HB2  . TYR A 1 70 ? -2.801  -3.272  -5.726  1.00 0.00 ? 66 TYR A HB2  3  
ATOM 4825  H HB3  . TYR A 1 70 ? -3.293  -2.774  -4.116  1.00 0.00 ? 66 TYR A HB3  3  
ATOM 4826  H HD1  . TYR A 1 70 ? -3.060  -5.930  -6.144  1.00 0.00 ? 66 TYR A HD1  3  
ATOM 4827  H HD2  . TYR A 1 70 ? -2.544  -4.041  -2.361  1.00 0.00 ? 66 TYR A HD2  3  
ATOM 4828  H HE1  . TYR A 1 70 ? -2.129  -8.016  -5.228  1.00 0.00 ? 66 TYR A HE1  3  
ATOM 4829  H HE2  . TYR A 1 70 ? -1.619  -6.122  -1.437  1.00 0.00 ? 66 TYR A HE2  3  
ATOM 4830  H HH   . TYR A 1 70 ? -1.648  -8.519  -1.892  1.00 0.00 ? 66 TYR A HH   3  
ATOM 4831  N N    . SER A 1 71 ? -6.045  -3.819  -3.223  1.00 0.00 ? 67 SER A N    3  
ATOM 4832  C CA   . SER A 1 71 ? -6.867  -4.477  -2.222  1.00 0.00 ? 67 SER A CA   3  
ATOM 4833  C C    . SER A 1 71 ? -8.311  -4.649  -2.701  1.00 0.00 ? 67 SER A C    3  
ATOM 4834  O O    . SER A 1 71 ? -9.005  -5.581  -2.283  1.00 0.00 ? 67 SER A O    3  
ATOM 4835  C CB   . SER A 1 71 ? -6.816  -3.663  -0.937  1.00 0.00 ? 67 SER A CB   3  
ATOM 4836  O OG   . SER A 1 71 ? -5.489  -3.249  -0.682  1.00 0.00 ? 67 SER A OG   3  
ATOM 4837  H H    . SER A 1 71 ? -5.660  -2.933  -3.023  1.00 0.00 ? 67 SER A H    3  
ATOM 4838  H HA   . SER A 1 71 ? -6.446  -5.453  -2.035  1.00 0.00 ? 67 SER A HA   3  
ATOM 4839  H HB2  . SER A 1 71 ? -7.447  -2.789  -1.034  1.00 0.00 ? 67 SER A HB2  3  
ATOM 4840  H HB3  . SER A 1 71 ? -7.159  -4.268  -0.114  1.00 0.00 ? 67 SER A HB3  3  
ATOM 4841  H HG   . SER A 1 71 ? -4.894  -3.694  -1.292  1.00 0.00 ? 67 SER A HG   3  
ATOM 4842  N N    . LEU A 1 72 ? -8.755  -3.757  -3.575  1.00 0.00 ? 68 LEU A N    3  
ATOM 4843  C CA   . LEU A 1 72 ? -10.105 -3.809  -4.116  1.00 0.00 ? 68 LEU A CA   3  
ATOM 4844  C C    . LEU A 1 72 ? -10.275 -4.994  -5.050  1.00 0.00 ? 68 LEU A C    3  
ATOM 4845  O O    . LEU A 1 72 ? -11.313 -5.656  -5.034  1.00 0.00 ? 68 LEU A O    3  
ATOM 4846  C CB   . LEU A 1 72 ? -10.416 -2.518  -4.871  1.00 0.00 ? 68 LEU A CB   3  
ATOM 4847  C CG   . LEU A 1 72 ? -10.946 -1.373  -4.010  1.00 0.00 ? 68 LEU A CG   3  
ATOM 4848  C CD1  . LEU A 1 72 ? -10.933 -0.070  -4.792  1.00 0.00 ? 68 LEU A CD1  3  
ATOM 4849  C CD2  . LEU A 1 72 ? -12.353 -1.692  -3.524  1.00 0.00 ? 68 LEU A CD2  3  
ATOM 4850  H H    . LEU A 1 72 ? -8.167  -3.024  -3.862  1.00 0.00 ? 68 LEU A H    3  
ATOM 4851  H HA   . LEU A 1 72 ? -10.794 -3.909  -3.292  1.00 0.00 ? 68 LEU A HA   3  
ATOM 4852  H HB2  . LEU A 1 72 ? -9.512  -2.188  -5.362  1.00 0.00 ? 68 LEU A HB2  3  
ATOM 4853  H HB3  . LEU A 1 72 ? -11.155 -2.740  -5.626  1.00 0.00 ? 68 LEU A HB3  3  
ATOM 4854  H HG   . LEU A 1 72 ? -10.308 -1.254  -3.146  1.00 0.00 ? 68 LEU A HG   3  
ATOM 4855  H HD11 . LEU A 1 72 ? -11.470 0.687   -4.238  1.00 0.00 ? 68 LEU A HD11 3  
ATOM 4856  H HD12 . LEU A 1 72 ? -11.410 -0.219  -5.750  1.00 0.00 ? 68 LEU A HD12 3  
ATOM 4857  H HD13 . LEU A 1 72 ? -9.914  0.252   -4.944  1.00 0.00 ? 68 LEU A HD13 3  
ATOM 4858  H HD21 . LEU A 1 72 ? -12.314 -2.505  -2.814  1.00 0.00 ? 68 LEU A HD21 3  
ATOM 4859  H HD22 . LEU A 1 72 ? -12.966 -1.980  -4.365  1.00 0.00 ? 68 LEU A HD22 3  
ATOM 4860  H HD23 . LEU A 1 72 ? -12.779 -0.820  -3.051  1.00 0.00 ? 68 LEU A HD23 3  
ATOM 4861  N N    . LEU A 1 73 ? -9.252  -5.258  -5.858  1.00 0.00 ? 69 LEU A N    3  
ATOM 4862  C CA   . LEU A 1 73 ? -9.285  -6.366  -6.810  1.00 0.00 ? 69 LEU A CA   3  
ATOM 4863  C C    . LEU A 1 73 ? -9.572  -7.685  -6.101  1.00 0.00 ? 69 LEU A C    3  
ATOM 4864  O O    . LEU A 1 73 ? -10.283 -8.545  -6.624  1.00 0.00 ? 69 LEU A O    3  
ATOM 4865  C CB   . LEU A 1 73 ? -7.959  -6.462  -7.566  1.00 0.00 ? 69 LEU A CB   3  
ATOM 4866  C CG   . LEU A 1 73 ? -7.554  -5.204  -8.341  1.00 0.00 ? 69 LEU A CG   3  
ATOM 4867  C CD1  . LEU A 1 73 ? -6.137  -5.344  -8.873  1.00 0.00 ? 69 LEU A CD1  3  
ATOM 4868  C CD2  . LEU A 1 73 ? -8.527  -4.939  -9.482  1.00 0.00 ? 69 LEU A CD2  3  
ATOM 4869  H H    . LEU A 1 73 ? -8.448  -4.691  -5.813  1.00 0.00 ? 69 LEU A H    3  
ATOM 4870  H HA   . LEU A 1 73 ? -10.077 -6.172  -7.516  1.00 0.00 ? 69 LEU A HA   3  
ATOM 4871  H HB2  . LEU A 1 73 ? -7.180  -6.689  -6.854  1.00 0.00 ? 69 LEU A HB2  3  
ATOM 4872  H HB3  . LEU A 1 73 ? -8.031  -7.280  -8.268  1.00 0.00 ? 69 LEU A HB3  3  
ATOM 4873  H HG   . LEU A 1 73 ? -7.577  -4.354  -7.674  1.00 0.00 ? 69 LEU A HG   3  
ATOM 4874  H HD11 . LEU A 1 73 ? -6.095  -6.169  -9.569  1.00 0.00 ? 69 LEU A HD11 3  
ATOM 4875  H HD12 . LEU A 1 73 ? -5.460  -5.532  -8.054  1.00 0.00 ? 69 LEU A HD12 3  
ATOM 4876  H HD13 . LEU A 1 73 ? -5.849  -4.434  -9.376  1.00 0.00 ? 69 LEU A HD13 3  
ATOM 4877  H HD21 . LEU A 1 73 ? -9.515  -4.760  -9.080  1.00 0.00 ? 69 LEU A HD21 3  
ATOM 4878  H HD22 . LEU A 1 73 ? -8.557  -5.798  -10.136 1.00 0.00 ? 69 LEU A HD22 3  
ATOM 4879  H HD23 . LEU A 1 73 ? -8.203  -4.074  -10.040 1.00 0.00 ? 69 LEU A HD23 3  
ATOM 4880  N N    . GLY A 1 74 ? -9.025  -7.828  -4.900  1.00 0.00 ? 70 GLY A N    3  
ATOM 4881  C CA   . GLY A 1 74 ? -9.227  -9.037  -4.131  1.00 0.00 ? 70 GLY A CA   3  
ATOM 4882  C C    . GLY A 1 74 ? -10.664 -9.184  -3.676  1.00 0.00 ? 70 GLY A C    3  
ATOM 4883  O O    . GLY A 1 74 ? -11.233 -10.269 -3.745  1.00 0.00 ? 70 GLY A O    3  
ATOM 4884  H H    . GLY A 1 74 ? -8.482  -7.100  -4.532  1.00 0.00 ? 70 GLY A H    3  
ATOM 4885  H HA2  . GLY A 1 74 ? -8.960  -9.888  -4.741  1.00 0.00 ? 70 GLY A HA2  3  
ATOM 4886  H HA3  . GLY A 1 74 ? -8.585  -9.012  -3.263  1.00 0.00 ? 70 GLY A HA3  3  
ATOM 4887  N N    . LEU A 1 75 ? -11.252 -8.082  -3.223  1.00 0.00 ? 71 LEU A N    3  
ATOM 4888  C CA   . LEU A 1 75 ? -12.636 -8.086  -2.755  1.00 0.00 ? 71 LEU A CA   3  
ATOM 4889  C C    . LEU A 1 75 ? -13.599 -8.512  -3.861  1.00 0.00 ? 71 LEU A C    3  
ATOM 4890  O O    . LEU A 1 75 ? -14.524 -9.288  -3.621  1.00 0.00 ? 71 LEU A O    3  
ATOM 4891  C CB   . LEU A 1 75 ? -13.033 -6.707  -2.218  1.00 0.00 ? 71 LEU A CB   3  
ATOM 4892  C CG   . LEU A 1 75 ? -12.502 -6.370  -0.823  1.00 0.00 ? 71 LEU A CG   3  
ATOM 4893  C CD1  . LEU A 1 75 ? -13.058 -5.036  -0.353  1.00 0.00 ? 71 LEU A CD1  3  
ATOM 4894  C CD2  . LEU A 1 75 ? -12.852 -7.474  0.165   1.00 0.00 ? 71 LEU A CD2  3  
ATOM 4895  H H    . LEU A 1 75 ? -10.731 -7.251  -3.185  1.00 0.00 ? 71 LEU A H    3  
ATOM 4896  H HA   . LEU A 1 75 ? -12.704 -8.803  -1.951  1.00 0.00 ? 71 LEU A HA   3  
ATOM 4897  H HB2  . LEU A 1 75 ? -12.672 -5.958  -2.907  1.00 0.00 ? 71 LEU A HB2  3  
ATOM 4898  H HB3  . LEU A 1 75 ? -14.111 -6.654  -2.188  1.00 0.00 ? 71 LEU A HB3  3  
ATOM 4899  H HG   . LEU A 1 75 ? -11.426 -6.286  -0.865  1.00 0.00 ? 71 LEU A HG   3  
ATOM 4900  H HD11 . LEU A 1 75 ? -12.714 -4.251  -1.010  1.00 0.00 ? 71 LEU A HD11 3  
ATOM 4901  H HD12 . LEU A 1 75 ? -12.716 -4.838  0.652   1.00 0.00 ? 71 LEU A HD12 3  
ATOM 4902  H HD13 . LEU A 1 75 ? -14.138 -5.068  -0.366  1.00 0.00 ? 71 LEU A HD13 3  
ATOM 4903  H HD21 . LEU A 1 75 ? -12.187 -8.311  0.018   1.00 0.00 ? 71 LEU A HD21 3  
ATOM 4904  H HD22 . LEU A 1 75 ? -13.872 -7.793  0.001   1.00 0.00 ? 71 LEU A HD22 3  
ATOM 4905  H HD23 . LEU A 1 75 ? -12.749 -7.103  1.173   1.00 0.00 ? 71 LEU A HD23 3  
ATOM 4906  N N    . LYS A 1 76 ? -13.375 -8.014  -5.072  1.00 0.00 ? 72 LYS A N    3  
ATOM 4907  C CA   . LYS A 1 76 ? -14.232 -8.353  -6.205  1.00 0.00 ? 72 LYS A CA   3  
ATOM 4908  C C    . LYS A 1 76 ? -14.119 -9.841  -6.532  1.00 0.00 ? 72 LYS A C    3  
ATOM 4909  O O    . LYS A 1 76 ? -15.113 -10.496 -6.849  1.00 0.00 ? 72 LYS A O    3  
ATOM 4910  C CB   . LYS A 1 76 ? -13.865 -7.521  -7.438  1.00 0.00 ? 72 LYS A CB   3  
ATOM 4911  C CG   . LYS A 1 76 ? -13.567 -6.060  -7.134  1.00 0.00 ? 72 LYS A CG   3  
ATOM 4912  C CD   . LYS A 1 76 ? -14.612 -5.128  -7.731  1.00 0.00 ? 72 LYS A CD   3  
ATOM 4913  C CE   . LYS A 1 76 ? -14.179 -3.671  -7.624  1.00 0.00 ? 72 LYS A CE   3  
ATOM 4914  N NZ   . LYS A 1 76 ? -15.101 -2.761  -8.354  1.00 0.00 ? 72 LYS A NZ   3  
ATOM 4915  H H    . LYS A 1 76 ? -12.615 -7.406  -5.207  1.00 0.00 ? 72 LYS A H    3  
ATOM 4916  H HA   . LYS A 1 76 ? -15.251 -8.134  -5.924  1.00 0.00 ? 72 LYS A HA   3  
ATOM 4917  H HB2  . LYS A 1 76 ? -12.991 -7.954  -7.901  1.00 0.00 ? 72 LYS A HB2  3  
ATOM 4918  H HB3  . LYS A 1 76 ? -14.687 -7.559  -8.138  1.00 0.00 ? 72 LYS A HB3  3  
ATOM 4919  H HG2  . LYS A 1 76 ? -13.550 -5.922  -6.063  1.00 0.00 ? 72 LYS A HG2  3  
ATOM 4920  H HG3  . LYS A 1 76 ? -12.600 -5.809  -7.544  1.00 0.00 ? 72 LYS A HG3  3  
ATOM 4921  H HD2  . LYS A 1 76 ? -14.750 -5.376  -8.772  1.00 0.00 ? 72 LYS A HD2  3  
ATOM 4922  H HD3  . LYS A 1 76 ? -15.544 -5.258  -7.201  1.00 0.00 ? 72 LYS A HD3  3  
ATOM 4923  H HE2  . LYS A 1 76 ? -14.162 -3.391  -6.581  1.00 0.00 ? 72 LYS A HE2  3  
ATOM 4924  H HE3  . LYS A 1 76 ? -13.186 -3.574  -8.037  1.00 0.00 ? 72 LYS A HE3  3  
ATOM 4925  H HZ1  . LYS A 1 76 ? -15.259 -3.112  -9.320  1.00 0.00 ? 72 LYS A HZ1  3  
ATOM 4926  H HZ2  . LYS A 1 76 ? -14.694 -1.804  -8.412  1.00 0.00 ? 72 LYS A HZ2  3  
ATOM 4927  H HZ3  . LYS A 1 76 ? -16.018 -2.706  -7.862  1.00 0.00 ? 72 LYS A HZ3  3  
ATOM 4928  N N    . ASP A 1 77 ? -12.903 -10.366 -6.453  1.00 0.00 ? 73 ASP A N    3  
ATOM 4929  C CA   . ASP A 1 77 ? -12.653 -11.780 -6.730  1.00 0.00 ? 73 ASP A CA   3  
ATOM 4930  C C    . ASP A 1 77 ? -13.209 -12.670 -5.617  1.00 0.00 ? 73 ASP A C    3  
ATOM 4931  O O    . ASP A 1 77 ? -13.819 -13.705 -5.887  1.00 0.00 ? 73 ASP A O    3  
ATOM 4932  C CB   . ASP A 1 77 ? -11.151 -12.023 -6.905  1.00 0.00 ? 73 ASP A CB   3  
ATOM 4933  C CG   . ASP A 1 77 ? -10.814 -13.478 -7.174  1.00 0.00 ? 73 ASP A CG   3  
ATOM 4934  O OD1  . ASP A 1 77 ? -11.102 -13.971 -8.285  1.00 0.00 ? 73 ASP A OD1  3  
ATOM 4935  O OD2  . ASP A 1 77 ? -10.228 -14.130 -6.288  1.00 0.00 ? 73 ASP A OD2  3  
ATOM 4936  H H    . ASP A 1 77 ? -12.145 -9.785  -6.226  1.00 0.00 ? 73 ASP A H    3  
ATOM 4937  H HA   . ASP A 1 77 ? -13.156 -12.027 -7.655  1.00 0.00 ? 73 ASP A HA   3  
ATOM 4938  H HB2  . ASP A 1 77 ? -10.793 -11.433 -7.735  1.00 0.00 ? 73 ASP A HB2  3  
ATOM 4939  H HB3  . ASP A 1 77 ? -10.638 -11.715 -6.006  1.00 0.00 ? 73 ASP A HB3  3  
ATOM 4940  N N    . GLN A 1 78 ? -13.023 -12.247 -4.367  1.00 0.00 ? 74 GLN A N    3  
ATOM 4941  C CA   . GLN A 1 78 ? -13.503 -13.010 -3.213  1.00 0.00 ? 74 GLN A CA   3  
ATOM 4942  C C    . GLN A 1 78 ? -15.028 -13.074 -3.177  1.00 0.00 ? 74 GLN A C    3  
ATOM 4943  O O    . GLN A 1 78 ? -15.605 -14.043 -2.686  1.00 0.00 ? 74 GLN A O    3  
ATOM 4944  C CB   . GLN A 1 78 ? -12.968 -12.409 -1.907  1.00 0.00 ? 74 GLN A CB   3  
ATOM 4945  C CG   . GLN A 1 78 ? -11.505 -12.738 -1.644  1.00 0.00 ? 74 GLN A CG   3  
ATOM 4946  C CD   . GLN A 1 78 ? -11.287 -14.177 -1.205  1.00 0.00 ? 74 GLN A CD   3  
ATOM 4947  O OE1  . GLN A 1 78 ? -12.117 -15.052 -1.451  1.00 0.00 ? 74 GLN A OE1  3  
ATOM 4948  N NE2  . GLN A 1 78 ? -10.156 -14.435 -0.568  1.00 0.00 ? 74 GLN A NE2  3  
ATOM 4949  H H    . GLN A 1 78 ? -12.539 -11.404 -4.213  1.00 0.00 ? 74 GLN A H    3  
ATOM 4950  H HA   . GLN A 1 78 ? -13.122 -14.017 -3.310  1.00 0.00 ? 74 GLN A HA   3  
ATOM 4951  H HB2  . GLN A 1 78 ? -13.072 -11.335 -1.950  1.00 0.00 ? 74 GLN A HB2  3  
ATOM 4952  H HB3  . GLN A 1 78 ? -13.555 -12.786 -1.082  1.00 0.00 ? 74 GLN A HB3  3  
ATOM 4953  H HG2  . GLN A 1 78 ? -10.945 -12.567 -2.551  1.00 0.00 ? 74 GLN A HG2  3  
ATOM 4954  H HG3  . GLN A 1 78 ? -11.138 -12.082 -0.866  1.00 0.00 ? 74 GLN A HG3  3  
ATOM 4955  H HE21 . GLN A 1 78 ? -9.527  -13.694 -0.418  1.00 0.00 ? 74 GLN A HE21 3  
ATOM 4956  H HE22 . GLN A 1 78 ? -9.988  -15.357 -0.276  1.00 0.00 ? 74 GLN A HE22 3  
ATOM 4957  N N    . VAL A 1 79 ? -15.686 -12.046 -3.702  1.00 0.00 ? 75 VAL A N    3  
ATOM 4958  C CA   . VAL A 1 79 ? -17.144 -12.030 -3.728  1.00 0.00 ? 75 VAL A CA   3  
ATOM 4959  C C    . VAL A 1 79 ? -17.647 -12.761 -4.974  1.00 0.00 ? 75 VAL A C    3  
ATOM 4960  O O    . VAL A 1 79 ? -18.828 -13.090 -5.095  1.00 0.00 ? 75 VAL A O    3  
ATOM 4961  C CB   . VAL A 1 79 ? -17.712 -10.590 -3.671  1.00 0.00 ? 75 VAL A CB   3  
ATOM 4962  C CG1  . VAL A 1 79 ? -17.609 -9.894  -5.020  1.00 0.00 ? 75 VAL A CG1  3  
ATOM 4963  C CG2  . VAL A 1 79 ? -19.150 -10.598 -3.173  1.00 0.00 ? 75 VAL A CG2  3  
ATOM 4964  H H    . VAL A 1 79 ? -15.182 -11.286 -4.072  1.00 0.00 ? 75 VAL A H    3  
ATOM 4965  H HA   . VAL A 1 79 ? -17.491 -12.565 -2.855  1.00 0.00 ? 75 VAL A HA   3  
ATOM 4966  H HB   . VAL A 1 79 ? -17.120 -10.026 -2.965  1.00 0.00 ? 75 VAL A HB   3  
ATOM 4967  H HG11 . VAL A 1 79 ? -18.112 -10.488 -5.770  1.00 0.00 ? 75 VAL A HG11 3  
ATOM 4968  H HG12 . VAL A 1 79 ? -16.571 -9.781  -5.288  1.00 0.00 ? 75 VAL A HG12 3  
ATOM 4969  H HG13 . VAL A 1 79 ? -18.074 -8.922  -4.960  1.00 0.00 ? 75 VAL A HG13 3  
ATOM 4970  H HG21 . VAL A 1 79 ? -19.181 -10.999 -2.171  1.00 0.00 ? 75 VAL A HG21 3  
ATOM 4971  H HG22 . VAL A 1 79 ? -19.753 -11.215 -3.825  1.00 0.00 ? 75 VAL A HG22 3  
ATOM 4972  H HG23 . VAL A 1 79 ? -19.538 -9.591  -3.170  1.00 0.00 ? 75 VAL A HG23 3  
ATOM 4973  N N    . ASN A 1 80 ? -16.725 -13.031 -5.889  1.00 0.00 ? 76 ASN A N    3  
ATOM 4974  C CA   . ASN A 1 80 ? -17.047 -13.734 -7.121  1.00 0.00 ? 76 ASN A CA   3  
ATOM 4975  C C    . ASN A 1 80 ? -16.837 -15.227 -6.936  1.00 0.00 ? 76 ASN A C    3  
ATOM 4976  O O    . ASN A 1 80 ? -17.200 -16.032 -7.796  1.00 0.00 ? 76 ASN A O    3  
ATOM 4977  C CB   . ASN A 1 80 ? -16.187 -13.228 -8.278  1.00 0.00 ? 76 ASN A CB   3  
ATOM 4978  C CG   . ASN A 1 80 ? -16.965 -12.339 -9.226  1.00 0.00 ? 76 ASN A CG   3  
ATOM 4979  O OD1  . ASN A 1 80 ? -17.683 -12.824 -10.101 1.00 0.00 ? 76 ASN A OD1  3  
ATOM 4980  N ND2  . ASN A 1 80 ? -16.821 -11.034 -9.065  1.00 0.00 ? 76 ASN A ND2  3  
ATOM 4981  H H    . ASN A 1 80 ? -15.799 -12.753 -5.726  1.00 0.00 ? 76 ASN A H    3  
ATOM 4982  H HA   . ASN A 1 80 ? -18.087 -13.553 -7.348  1.00 0.00 ? 76 ASN A HA   3  
ATOM 4983  H HB2  . ASN A 1 80 ? -15.359 -12.662 -7.883  1.00 0.00 ? 76 ASN A HB2  3  
ATOM 4984  H HB3  . ASN A 1 80 ? -15.809 -14.073 -8.834  1.00 0.00 ? 76 ASN A HB3  3  
ATOM 4985  H HD21 . ASN A 1 80 ? -16.224 -10.716 -8.348  1.00 0.00 ? 76 ASN A HD21 3  
ATOM 4986  H HD22 . ASN A 1 80 ? -17.316 -10.435 -9.666  1.00 0.00 ? 76 ASN A HD22 3  
ATOM 4987  N N    . THR A 1 81 ? -16.243 -15.583 -5.804  1.00 0.00 ? 77 THR A N    3  
ATOM 4988  C CA   . THR A 1 81 ? -15.978 -16.970 -5.478  1.00 0.00 ? 77 THR A CA   3  
ATOM 4989  C C    . THR A 1 81 ? -17.262 -17.656 -5.024  1.00 0.00 ? 77 THR A C    3  
ATOM 4990  O O    . THR A 1 81 ? -17.840 -17.295 -3.999  1.00 0.00 ? 77 THR A O    3  
ATOM 4991  C CB   . THR A 1 81 ? -14.914 -17.079 -4.367  1.00 0.00 ? 77 THR A CB   3  
ATOM 4992  O OG1  . THR A 1 81 ? -13.777 -16.269 -4.700  1.00 0.00 ? 77 THR A OG1  3  
ATOM 4993  C CG2  . THR A 1 81 ? -14.470 -18.522 -4.174  1.00 0.00 ? 77 THR A CG2  3  
ATOM 4994  H H    . THR A 1 81 ? -15.992 -14.889 -5.160  1.00 0.00 ? 77 THR A H    3  
ATOM 4995  H HA   . THR A 1 81 ? -15.604 -17.463 -6.363  1.00 0.00 ? 77 THR A HA   3  
ATOM 4996  H HB   . THR A 1 81 ? -15.342 -16.722 -3.442  1.00 0.00 ? 77 THR A HB   3  
ATOM 4997  H HG1  . THR A 1 81 ? -14.052 -15.549 -5.282  1.00 0.00 ? 77 THR A HG1  3  
ATOM 4998  H HG21 . THR A 1 81 ? -15.320 -19.126 -3.893  1.00 0.00 ? 77 THR A HG21 3  
ATOM 4999  H HG22 . THR A 1 81 ? -13.722 -18.567 -3.396  1.00 0.00 ? 77 THR A HG22 3  
ATOM 5000  H HG23 . THR A 1 81 ? -14.052 -18.895 -5.097  1.00 0.00 ? 77 THR A HG23 3  
ATOM 5001  N N    . VAL A 1 82 ? -17.711 -18.622 -5.808  1.00 0.00 ? 78 VAL A N    3  
ATOM 5002  C CA   . VAL A 1 82 ? -18.926 -19.356 -5.496  1.00 0.00 ? 78 VAL A CA   3  
ATOM 5003  C C    . VAL A 1 82 ? -18.681 -20.352 -4.371  1.00 0.00 ? 78 VAL A C    3  
ATOM 5004  O O    . VAL A 1 82 ? -19.425 -20.309 -3.371  1.00 0.00 ? 78 VAL A O    3  
ATOM 5005  C CB   . VAL A 1 82 ? -19.488 -20.092 -6.731  1.00 0.00 ? 78 VAL A CB   3  
ATOM 5006  C CG1  . VAL A 1 82 ? -20.303 -19.141 -7.591  1.00 0.00 ? 78 VAL A CG1  3  
ATOM 5007  C CG2  . VAL A 1 82 ? -18.371 -20.723 -7.551  1.00 0.00 ? 78 VAL A CG2  3  
ATOM 5008  O OXT  . VAL A 1 82 ? -17.727 -21.153 -4.477  1.00 0.00 ? 78 VAL A OXT  3  
ATOM 5009  H H    . VAL A 1 82 ? -17.206 -18.852 -6.613  1.00 0.00 ? 78 VAL A H    3  
ATOM 5010  H HA   . VAL A 1 82 ? -19.665 -18.639 -5.167  1.00 0.00 ? 78 VAL A HA   3  
ATOM 5011  H HB   . VAL A 1 82 ? -20.142 -20.878 -6.386  1.00 0.00 ? 78 VAL A HB   3  
ATOM 5012  H HG11 . VAL A 1 82 ? -21.208 -18.871 -7.068  1.00 0.00 ? 78 VAL A HG11 3  
ATOM 5013  H HG12 . VAL A 1 82 ? -20.554 -19.624 -8.522  1.00 0.00 ? 78 VAL A HG12 3  
ATOM 5014  H HG13 . VAL A 1 82 ? -19.725 -18.251 -7.792  1.00 0.00 ? 78 VAL A HG13 3  
ATOM 5015  H HG21 . VAL A 1 82 ? -17.683 -19.958 -7.876  1.00 0.00 ? 78 VAL A HG21 3  
ATOM 5016  H HG22 . VAL A 1 82 ? -18.795 -21.215 -8.414  1.00 0.00 ? 78 VAL A HG22 3  
ATOM 5017  H HG23 . VAL A 1 82 ? -17.845 -21.448 -6.947  1.00 0.00 ? 78 VAL A HG23 3  
ATOM 5018  N N    . GLY B 2 18 ? 9.559   6.402   11.665  1.00 0.00 ? 28 GLY B N    3  
ATOM 5019  C CA   . GLY B 2 18 ? 9.873   6.000   10.272  1.00 0.00 ? 28 GLY B CA   3  
ATOM 5020  C C    . GLY B 2 18 ? 10.764  4.780   10.234  1.00 0.00 ? 28 GLY B C    3  
ATOM 5021  O O    . GLY B 2 18 ? 10.771  3.988   11.176  1.00 0.00 ? 28 GLY B O    3  
ATOM 5022  H H    . GLY B 2 18 ? 8.845   7.155   11.670  1.00 0.00 ? 28 GLY B H    3  
ATOM 5023  H HA2  . GLY B 2 18 ? 8.953   5.778   9.753   1.00 0.00 ? 28 GLY B HA2  3  
ATOM 5024  H HA3  . GLY B 2 18 ? 10.372  6.816   9.773   1.00 0.00 ? 28 GLY B HA3  3  
ATOM 5025  N N    . MET B 2 19 ? 11.530  4.628   9.163   1.00 0.00 ? 29 MET B N    3  
ATOM 5026  C CA   . MET B 2 19 ? 12.416  3.481   9.028   1.00 0.00 ? 29 MET B CA   3  
ATOM 5027  C C    . MET B 2 19 ? 13.738  3.875   8.376   1.00 0.00 ? 29 MET B C    3  
ATOM 5028  O O    . MET B 2 19 ? 14.381  3.061   7.712   1.00 0.00 ? 29 MET B O    3  
ATOM 5029  C CB   . MET B 2 19 ? 11.731  2.372   8.225   1.00 0.00 ? 29 MET B CB   3  
ATOM 5030  C CG   . MET B 2 19 ? 11.330  2.781   6.820   1.00 0.00 ? 29 MET B CG   3  
ATOM 5031  S SD   . MET B 2 19 ? 10.493  1.456   5.937   1.00 0.00 ? 29 MET B SD   3  
ATOM 5032  C CE   . MET B 2 19 ? 10.307  2.202   4.325   1.00 0.00 ? 29 MET B CE   3  
ATOM 5033  H H    . MET B 2 19 ? 11.501  5.308   8.439   1.00 0.00 ? 29 MET B H    3  
ATOM 5034  H HA   . MET B 2 19 ? 12.622  3.112   10.020  1.00 0.00 ? 29 MET B HA   3  
ATOM 5035  H HB2  . MET B 2 19 ? 12.403  1.531   8.151   1.00 0.00 ? 29 MET B HB2  3  
ATOM 5036  H HB3  . MET B 2 19 ? 10.841  2.060   8.753   1.00 0.00 ? 29 MET B HB3  3  
ATOM 5037  H HG2  . MET B 2 19 ? 10.667  3.630   6.882   1.00 0.00 ? 29 MET B HG2  3  
ATOM 5038  H HG3  . MET B 2 19 ? 12.219  3.057   6.271   1.00 0.00 ? 29 MET B HG3  3  
ATOM 5039  H HE1  . MET B 2 19 ? 9.737   3.115   4.414   1.00 0.00 ? 29 MET B HE1  3  
ATOM 5040  H HE2  . MET B 2 19 ? 9.791   1.517   3.669   1.00 0.00 ? 29 MET B HE2  3  
ATOM 5041  H HE3  . MET B 2 19 ? 11.282  2.424   3.917   1.00 0.00 ? 29 MET B HE3  3  
ATOM 5042  N N    . SER B 2 20 ? 14.150  5.119   8.582   1.00 0.00 ? 30 SER B N    3  
ATOM 5043  C CA   . SER B 2 20 ? 15.401  5.611   8.028   1.00 0.00 ? 30 SER B CA   3  
ATOM 5044  C C    . SER B 2 20 ? 16.565  4.765   8.543   1.00 0.00 ? 30 SER B C    3  
ATOM 5045  O O    . SER B 2 20 ? 17.402  4.292   7.773   1.00 0.00 ? 30 SER B O    3  
ATOM 5046  C CB   . SER B 2 20 ? 15.596  7.079   8.416   1.00 0.00 ? 30 SER B CB   3  
ATOM 5047  O OG   . SER B 2 20 ? 14.343  7.732   8.560   1.00 0.00 ? 30 SER B OG   3  
ATOM 5048  H H    . SER B 2 20 ? 13.594  5.726   9.115   1.00 0.00 ? 30 SER B H    3  
ATOM 5049  H HA   . SER B 2 20 ? 15.351  5.527   6.953   1.00 0.00 ? 30 SER B HA   3  
ATOM 5050  H HB2  . SER B 2 20 ? 16.127  7.134   9.355   1.00 0.00 ? 30 SER B HB2  3  
ATOM 5051  H HB3  . SER B 2 20 ? 16.165  7.580   7.649   1.00 0.00 ? 30 SER B HB3  3  
ATOM 5052  H HG   . SER B 2 20 ? 13.845  7.658   7.720   1.00 0.00 ? 30 SER B HG   3  
ATOM 5053  N N    . ALA B 2 21 ? 16.591  4.571   9.857   1.00 0.00 ? 31 ALA B N    3  
ATOM 5054  C CA   . ALA B 2 21 ? 17.623  3.771   10.506  1.00 0.00 ? 31 ALA B CA   3  
ATOM 5055  C C    . ALA B 2 21 ? 17.568  2.316   10.042  1.00 0.00 ? 31 ALA B C    3  
ATOM 5056  O O    . ALA B 2 21 ? 18.581  1.618   10.029  1.00 0.00 ? 31 ALA B O    3  
ATOM 5057  C CB   . ALA B 2 21 ? 17.475  3.850   12.016  1.00 0.00 ? 31 ALA B CB   3  
ATOM 5058  H H    . ALA B 2 21 ? 15.912  5.021   10.409  1.00 0.00 ? 31 ALA B H    3  
ATOM 5059  H HA   . ALA B 2 21 ? 18.584  4.187   10.240  1.00 0.00 ? 31 ALA B HA   3  
ATOM 5060  H HB1  . ALA B 2 21 ? 16.580  3.327   12.318  1.00 0.00 ? 31 ALA B HB1  3  
ATOM 5061  H HB2  . ALA B 2 21 ? 17.406  4.884   12.316  1.00 0.00 ? 31 ALA B HB2  3  
ATOM 5062  H HB3  . ALA B 2 21 ? 18.334  3.396   12.486  1.00 0.00 ? 31 ALA B HB3  3  
ATOM 5063  N N    . TRP B 2 22 ? 16.381  1.877   9.653   1.00 0.00 ? 32 TRP B N    3  
ATOM 5064  C CA   . TRP B 2 22 ? 16.173  0.514   9.178   1.00 0.00 ? 32 TRP B CA   3  
ATOM 5065  C C    . TRP B 2 22 ? 16.778  0.355   7.784   1.00 0.00 ? 32 TRP B C    3  
ATOM 5066  O O    . TRP B 2 22 ? 17.433  -0.643  7.482   1.00 0.00 ? 32 TRP B O    3  
ATOM 5067  C CB   . TRP B 2 22 ? 14.671  0.213   9.149   1.00 0.00 ? 32 TRP B CB   3  
ATOM 5068  C CG   . TRP B 2 22 ? 14.321  -1.234  8.960   1.00 0.00 ? 32 TRP B CG   3  
ATOM 5069  C CD1  . TRP B 2 22 ? 14.070  -2.151  9.941   1.00 0.00 ? 32 TRP B CD1  3  
ATOM 5070  C CD2  . TRP B 2 22 ? 14.162  -1.925  7.715   1.00 0.00 ? 32 TRP B CD2  3  
ATOM 5071  N NE1  . TRP B 2 22 ? 13.762  -3.367  9.382   1.00 0.00 ? 32 TRP B NE1  3  
ATOM 5072  C CE2  . TRP B 2 22 ? 13.817  -3.255  8.017   1.00 0.00 ? 32 TRP B CE2  3  
ATOM 5073  C CE3  . TRP B 2 22 ? 14.279  -1.547  6.374   1.00 0.00 ? 32 TRP B CE3  3  
ATOM 5074  C CZ2  . TRP B 2 22 ? 13.586  -4.207  7.028   1.00 0.00 ? 32 TRP B CZ2  3  
ATOM 5075  C CZ3  . TRP B 2 22 ? 14.051  -2.493  5.393   1.00 0.00 ? 32 TRP B CZ3  3  
ATOM 5076  C CH2  . TRP B 2 22 ? 13.708  -3.808  5.725   1.00 0.00 ? 32 TRP B CH2  3  
ATOM 5077  H H    . TRP B 2 22 ? 15.618  2.490   9.682   1.00 0.00 ? 32 TRP B H    3  
ATOM 5078  H HA   . TRP B 2 22 ? 16.664  -0.163  9.860   1.00 0.00 ? 32 TRP B HA   3  
ATOM 5079  H HB2  . TRP B 2 22 ? 14.233  0.536   10.080  1.00 0.00 ? 32 TRP B HB2  3  
ATOM 5080  H HB3  . TRP B 2 22 ? 14.223  0.770   8.340   1.00 0.00 ? 32 TRP B HB3  3  
ATOM 5081  H HD1  . TRP B 2 22 ? 14.108  -1.936  10.999  1.00 0.00 ? 32 TRP B HD1  3  
ATOM 5082  H HE1  . TRP B 2 22 ? 13.537  -4.189  9.883   1.00 0.00 ? 32 TRP B HE1  3  
ATOM 5083  H HE3  . TRP B 2 22 ? 14.544  -0.536  6.100   1.00 0.00 ? 32 TRP B HE3  3  
ATOM 5084  H HZ2  . TRP B 2 22 ? 13.321  -5.226  7.266   1.00 0.00 ? 32 TRP B HZ2  3  
ATOM 5085  H HZ3  . TRP B 2 22 ? 14.139  -2.219  4.352   1.00 0.00 ? 32 TRP B HZ3  3  
ATOM 5086  H HH2  . TRP B 2 22 ? 13.541  -4.514  4.925   1.00 0.00 ? 32 TRP B HH2  3  
ATOM 5087  N N    . LEU B 2 23 ? 16.581  1.371   6.954   1.00 0.00 ? 33 LEU B N    3  
ATOM 5088  C CA   . LEU B 2 23 ? 17.096  1.359   5.590   1.00 0.00 ? 33 LEU B CA   3  
ATOM 5089  C C    . LEU B 2 23 ? 18.601  1.596   5.582   1.00 0.00 ? 33 LEU B C    3  
ATOM 5090  O O    . LEU B 2 23 ? 19.287  1.252   4.619   1.00 0.00 ? 33 LEU B O    3  
ATOM 5091  C CB   . LEU B 2 23 ? 16.385  2.404   4.733   1.00 0.00 ? 33 LEU B CB   3  
ATOM 5092  C CG   . LEU B 2 23 ? 14.993  2.000   4.245   1.00 0.00 ? 33 LEU B CG   3  
ATOM 5093  C CD1  . LEU B 2 23 ? 14.287  3.189   3.622   1.00 0.00 ? 33 LEU B CD1  3  
ATOM 5094  C CD2  . LEU B 2 23 ? 15.083  0.854   3.247   1.00 0.00 ? 33 LEU B CD2  3  
ATOM 5095  H H    . LEU B 2 23 ? 16.085  2.153   7.285   1.00 0.00 ? 33 LEU B H    3  
ATOM 5096  H HA   . LEU B 2 23 ? 16.902  0.380   5.179   1.00 0.00 ? 33 LEU B HA   3  
ATOM 5097  H HB2  . LEU B 2 23 ? 16.294  3.312   5.312   1.00 0.00 ? 33 LEU B HB2  3  
ATOM 5098  H HB3  . LEU B 2 23 ? 17.000  2.609   3.869   1.00 0.00 ? 33 LEU B HB3  3  
ATOM 5099  H HG   . LEU B 2 23 ? 14.405  1.668   5.087   1.00 0.00 ? 33 LEU B HG   3  
ATOM 5100  H HD11 . LEU B 2 23 ? 14.130  3.946   4.375   1.00 0.00 ? 33 LEU B HD11 3  
ATOM 5101  H HD12 . LEU B 2 23 ? 13.334  2.874   3.222   1.00 0.00 ? 33 LEU B HD12 3  
ATOM 5102  H HD13 . LEU B 2 23 ? 14.896  3.594   2.826   1.00 0.00 ? 33 LEU B HD13 3  
ATOM 5103  H HD21 . LEU B 2 23 ? 15.710  1.147   2.419   1.00 0.00 ? 33 LEU B HD21 3  
ATOM 5104  H HD22 . LEU B 2 23 ? 14.095  0.615   2.884   1.00 0.00 ? 33 LEU B HD22 3  
ATOM 5105  H HD23 . LEU B 2 23 ? 15.508  -0.012  3.730   1.00 0.00 ? 33 LEU B HD23 3  
ATOM 5106  N N    . ARG B 2 24 ? 19.102  2.203   6.659   1.00 0.00 ? 34 ARG B N    3  
ATOM 5107  C CA   . ARG B 2 24 ? 20.533  2.468   6.817   1.00 0.00 ? 34 ARG B CA   3  
ATOM 5108  C C    . ARG B 2 24 ? 21.343  1.173   6.744   1.00 0.00 ? 34 ARG B C    3  
ATOM 5109  O O    . ARG B 2 24 ? 22.543  1.200   6.476   1.00 0.00 ? 34 ARG B O    3  
ATOM 5110  C CB   . ARG B 2 24 ? 20.796  3.153   8.163   1.00 0.00 ? 34 ARG B CB   3  
ATOM 5111  C CG   . ARG B 2 24 ? 21.386  4.548   8.046   1.00 0.00 ? 34 ARG B CG   3  
ATOM 5112  C CD   . ARG B 2 24 ? 20.342  5.570   7.634   1.00 0.00 ? 34 ARG B CD   3  
ATOM 5113  N NE   . ARG B 2 24 ? 20.222  6.660   8.603   1.00 0.00 ? 34 ARG B NE   3  
ATOM 5114  C CZ   . ARG B 2 24 ? 20.485  7.941   8.334   1.00 0.00 ? 34 ARG B CZ   3  
ATOM 5115  N NH1  . ARG B 2 24 ? 20.943  8.303   7.143   1.00 0.00 ? 34 ARG B NH1  3  
ATOM 5116  N NH2  . ARG B 2 24 ? 20.305  8.861   9.273   1.00 0.00 ? 34 ARG B NH2  3  
ATOM 5117  H H    . ARG B 2 24 ? 18.486  2.538   7.345   1.00 0.00 ? 34 ARG B H    3  
ATOM 5118  H HA   . ARG B 2 24 ? 20.843  3.125   6.019   1.00 0.00 ? 34 ARG B HA   3  
ATOM 5119  H HB2  . ARG B 2 24 ? 19.863  3.226   8.701   1.00 0.00 ? 34 ARG B HB2  3  
ATOM 5120  H HB3  . ARG B 2 24 ? 21.481  2.543   8.734   1.00 0.00 ? 34 ARG B HB3  3  
ATOM 5121  H HG2  . ARG B 2 24 ? 21.794  4.836   9.002   1.00 0.00 ? 34 ARG B HG2  3  
ATOM 5122  H HG3  . ARG B 2 24 ? 22.174  4.533   7.308   1.00 0.00 ? 34 ARG B HG3  3  
ATOM 5123  H HD2  . ARG B 2 24 ? 20.621  5.983   6.676   1.00 0.00 ? 34 ARG B HD2  3  
ATOM 5124  H HD3  . ARG B 2 24 ? 19.387  5.073   7.545   1.00 0.00 ? 34 ARG B HD3  3  
ATOM 5125  H HE   . ARG B 2 24 ? 19.911  6.423   9.506   1.00 0.00 ? 34 ARG B HE   3  
ATOM 5126  H HH11 . ARG B 2 24 ? 21.100  7.611   6.421   1.00 0.00 ? 34 ARG B HH11 3  
ATOM 5127  H HH12 . ARG B 2 24 ? 21.141  9.266   6.951   1.00 0.00 ? 34 ARG B HH12 3  
ATOM 5128  H HH21 . ARG B 2 24 ? 19.974  8.593   10.182  1.00 0.00 ? 34 ARG B HH21 3  
ATOM 5129  H HH22 . ARG B 2 24 ? 20.494  9.827   9.077   1.00 0.00 ? 34 ARG B HH22 3  
ATOM 5130  N N    . ALA B 2 25 ? 20.667  0.049   6.970   1.00 0.00 ? 35 ALA B N    3  
ATOM 5131  C CA   . ALA B 2 25 ? 21.303  -1.266  6.934   1.00 0.00 ? 35 ALA B CA   3  
ATOM 5132  C C    . ALA B 2 25 ? 21.970  -1.518  5.581   1.00 0.00 ? 35 ALA B C    3  
ATOM 5133  O O    . ALA B 2 25 ? 23.056  -2.088  5.506   1.00 0.00 ? 35 ALA B O    3  
ATOM 5134  C CB   . ALA B 2 25 ? 20.284  -2.355  7.233   1.00 0.00 ? 35 ALA B CB   3  
ATOM 5135  H H    . ALA B 2 25 ? 19.705  0.119   7.150   1.00 0.00 ? 35 ALA B H    3  
ATOM 5136  H HA   . ALA B 2 25 ? 22.058  -1.291  7.705   1.00 0.00 ? 35 ALA B HA   3  
ATOM 5137  H HB1  . ALA B 2 25 ? 19.794  -2.144  8.172   1.00 0.00 ? 35 ALA B HB1  3  
ATOM 5138  H HB2  . ALA B 2 25 ? 20.784  -3.310  7.296   1.00 0.00 ? 35 ALA B HB2  3  
ATOM 5139  H HB3  . ALA B 2 25 ? 19.547  -2.387  6.443   1.00 0.00 ? 35 ALA B HB3  3  
ATOM 5140  N N    . ILE B 2 26 ? 21.311  -1.079  4.517   1.00 0.00 ? 36 ILE B N    3  
ATOM 5141  C CA   . ILE B 2 26 ? 21.839  -1.240  3.169   1.00 0.00 ? 36 ILE B CA   3  
ATOM 5142  C C    . ILE B 2 26 ? 22.036  0.123   2.520   1.00 0.00 ? 36 ILE B C    3  
ATOM 5143  O O    . ILE B 2 26 ? 22.110  0.236   1.296   1.00 0.00 ? 36 ILE B O    3  
ATOM 5144  C CB   . ILE B 2 26 ? 20.909  -2.092  2.281   1.00 0.00 ? 36 ILE B CB   3  
ATOM 5145  C CG1  . ILE B 2 26 ? 19.467  -1.582  2.365   1.00 0.00 ? 36 ILE B CG1  3  
ATOM 5146  C CG2  . ILE B 2 26 ? 20.990  -3.556  2.683   1.00 0.00 ? 36 ILE B CG2  3  
ATOM 5147  C CD1  . ILE B 2 26 ? 18.591  -2.048  1.222   1.00 0.00 ? 36 ILE B CD1  3  
ATOM 5148  H H    . ILE B 2 26 ? 20.448  -0.628  4.641   1.00 0.00 ? 36 ILE B H    3  
ATOM 5149  H HA   . ILE B 2 26 ? 22.795  -1.737  3.241   1.00 0.00 ? 36 ILE B HA   3  
ATOM 5150  H HB   . ILE B 2 26 ? 21.253  -2.008  1.260   1.00 0.00 ? 36 ILE B HB   3  
ATOM 5151  H HG12 . ILE B 2 26 ? 19.023  -1.930  3.285   1.00 0.00 ? 36 ILE B HG12 3  
ATOM 5152  H HG13 . ILE B 2 26 ? 19.474  -0.501  2.360   1.00 0.00 ? 36 ILE B HG13 3  
ATOM 5153  H HG21 . ILE B 2 26 ? 20.706  -3.661  3.720   1.00 0.00 ? 36 ILE B HG21 3  
ATOM 5154  H HG22 . ILE B 2 26 ? 22.002  -3.911  2.550   1.00 0.00 ? 36 ILE B HG22 3  
ATOM 5155  H HG23 . ILE B 2 26 ? 20.321  -4.138  2.066   1.00 0.00 ? 36 ILE B HG23 3  
ATOM 5156  H HD11 . ILE B 2 26 ? 18.999  -1.693  0.287   1.00 0.00 ? 36 ILE B HD11 3  
ATOM 5157  H HD12 . ILE B 2 26 ? 17.592  -1.656  1.350   1.00 0.00 ? 36 ILE B HD12 3  
ATOM 5158  H HD13 . ILE B 2 26 ? 18.555  -3.127  1.212   1.00 0.00 ? 36 ILE B HD13 3  
ATOM 5159  N N    . GLY B 2 27 ? 22.151  1.144   3.369   1.00 0.00 ? 37 GLY B N    3  
ATOM 5160  C CA   . GLY B 2 27 ? 22.330  2.511   2.907   1.00 0.00 ? 37 GLY B CA   3  
ATOM 5161  C C    . GLY B 2 27 ? 21.343  2.920   1.830   1.00 0.00 ? 37 GLY B C    3  
ATOM 5162  O O    . GLY B 2 27 ? 21.730  3.520   0.825   1.00 0.00 ? 37 GLY B O    3  
ATOM 5163  H H    . GLY B 2 27 ? 22.176  0.950   4.329   1.00 0.00 ? 37 GLY B H    3  
ATOM 5164  H HA2  . GLY B 2 27 ? 22.217  3.179   3.748   1.00 0.00 ? 37 GLY B HA2  3  
ATOM 5165  H HA3  . GLY B 2 27 ? 23.331  2.614   2.516   1.00 0.00 ? 37 GLY B HA3  3  
ATOM 5166  N N    . LEU B 2 28 ? 20.071  2.607   2.034   1.00 0.00 ? 38 LEU B N    3  
ATOM 5167  C CA   . LEU B 2 28 ? 19.047  2.937   1.054   1.00 0.00 ? 38 LEU B CA   3  
ATOM 5168  C C    . LEU B 2 28 ? 18.006  3.887   1.640   1.00 0.00 ? 38 LEU B C    3  
ATOM 5169  O O    . LEU B 2 28 ? 16.912  4.036   1.095   1.00 0.00 ? 38 LEU B O    3  
ATOM 5170  C CB   . LEU B 2 28 ? 18.374  1.659   0.546   1.00 0.00 ? 38 LEU B CB   3  
ATOM 5171  C CG   . LEU B 2 28 ? 17.845  1.723   -0.888  1.00 0.00 ? 38 LEU B CG   3  
ATOM 5172  C CD1  . LEU B 2 28 ? 18.993  1.832   -1.881  1.00 0.00 ? 38 LEU B CD1  3  
ATOM 5173  C CD2  . LEU B 2 28 ? 16.988  0.504   -1.195  1.00 0.00 ? 38 LEU B CD2  3  
ATOM 5174  H H    . LEU B 2 28 ? 19.817  2.144   2.863   1.00 0.00 ? 38 LEU B H    3  
ATOM 5175  H HA   . LEU B 2 28 ? 19.533  3.429   0.224   1.00 0.00 ? 38 LEU B HA   3  
ATOM 5176  H HB2  . LEU B 2 28 ? 19.091  0.853   0.607   1.00 0.00 ? 38 LEU B HB2  3  
ATOM 5177  H HB3  . LEU B 2 28 ? 17.547  1.430   1.201   1.00 0.00 ? 38 LEU B HB3  3  
ATOM 5178  H HG   . LEU B 2 28 ? 17.227  2.601   -0.997  1.00 0.00 ? 38 LEU B HG   3  
ATOM 5179  H HD11 . LEU B 2 28 ? 18.596  1.907   -2.883  1.00 0.00 ? 38 LEU B HD11 3  
ATOM 5180  H HD12 . LEU B 2 28 ? 19.618  0.954   -1.806  1.00 0.00 ? 38 LEU B HD12 3  
ATOM 5181  H HD13 . LEU B 2 28 ? 19.580  2.711   -1.660  1.00 0.00 ? 38 LEU B HD13 3  
ATOM 5182  H HD21 . LEU B 2 28 ? 16.609  0.575   -2.203  1.00 0.00 ? 38 LEU B HD21 3  
ATOM 5183  H HD22 . LEU B 2 28 ? 16.162  0.460   -0.501  1.00 0.00 ? 38 LEU B HD22 3  
ATOM 5184  H HD23 . LEU B 2 28 ? 17.588  -0.389  -1.099  1.00 0.00 ? 38 LEU B HD23 3  
ATOM 5185  N N    . GLU B 2 29 ? 18.351  4.518   2.759   1.00 0.00 ? 39 GLU B N    3  
ATOM 5186  C CA   . GLU B 2 29 ? 17.460  5.469   3.434   1.00 0.00 ? 39 GLU B CA   3  
ATOM 5187  C C    . GLU B 2 29 ? 16.912  6.539   2.488   1.00 0.00 ? 39 GLU B C    3  
ATOM 5188  O O    . GLU B 2 29 ? 15.816  7.053   2.700   1.00 0.00 ? 39 GLU B O    3  
ATOM 5189  C CB   . GLU B 2 29 ? 18.185  6.149   4.598   1.00 0.00 ? 39 GLU B CB   3  
ATOM 5190  C CG   . GLU B 2 29 ? 19.397  6.959   4.170   1.00 0.00 ? 39 GLU B CG   3  
ATOM 5191  C CD   . GLU B 2 29 ? 20.697  6.235   4.430   1.00 0.00 ? 39 GLU B CD   3  
ATOM 5192  O OE1  . GLU B 2 29 ? 20.826  5.066   4.023   1.00 0.00 ? 39 GLU B OE1  3  
ATOM 5193  O OE2  . GLU B 2 29 ? 21.591  6.831   5.063   1.00 0.00 ? 39 GLU B OE2  3  
ATOM 5194  H H    . GLU B 2 29 ? 19.221  4.304   3.174   1.00 0.00 ? 39 GLU B H    3  
ATOM 5195  H HA   . GLU B 2 29 ? 16.631  4.907   3.830   1.00 0.00 ? 39 GLU B HA   3  
ATOM 5196  H HB2  . GLU B 2 29 ? 17.494  6.811   5.098   1.00 0.00 ? 39 GLU B HB2  3  
ATOM 5197  H HB3  . GLU B 2 29 ? 18.512  5.391   5.294   1.00 0.00 ? 39 GLU B HB3  3  
ATOM 5198  H HG2  . GLU B 2 29 ? 19.322  7.164   3.112   1.00 0.00 ? 39 GLU B HG2  3  
ATOM 5199  H HG3  . GLU B 2 29 ? 19.403  7.891   4.718   1.00 0.00 ? 39 GLU B HG3  3  
ATOM 5200  N N    . ARG B 2 30 ? 17.664  6.857   1.440   1.00 0.00 ? 40 ARG B N    3  
ATOM 5201  C CA   . ARG B 2 30 ? 17.251  7.873   0.475   1.00 0.00 ? 40 ARG B CA   3  
ATOM 5202  C C    . ARG B 2 30 ? 15.950  7.487   -0.232  1.00 0.00 ? 40 ARG B C    3  
ATOM 5203  O O    . ARG B 2 30 ? 15.261  8.340   -0.793  1.00 0.00 ? 40 ARG B O    3  
ATOM 5204  C CB   . ARG B 2 30 ? 18.350  8.099   -0.566  1.00 0.00 ? 40 ARG B CB   3  
ATOM 5205  C CG   . ARG B 2 30 ? 19.719  8.385   0.032   1.00 0.00 ? 40 ARG B CG   3  
ATOM 5206  C CD   . ARG B 2 30 ? 20.760  8.632   -1.051  1.00 0.00 ? 40 ARG B CD   3  
ATOM 5207  N NE   . ARG B 2 30 ? 20.731  7.601   -2.090  1.00 0.00 ? 40 ARG B NE   3  
ATOM 5208  C CZ   . ARG B 2 30 ? 21.642  6.635   -2.214  1.00 0.00 ? 40 ARG B CZ   3  
ATOM 5209  N NH1  . ARG B 2 30 ? 22.656  6.553   -1.361  1.00 0.00 ? 40 ARG B NH1  3  
ATOM 5210  N NH2  . ARG B 2 30 ? 21.532  5.747   -3.192  1.00 0.00 ? 40 ARG B NH2  3  
ATOM 5211  H H    . ARG B 2 30 ? 18.519  6.397   1.313   1.00 0.00 ? 40 ARG B H    3  
ATOM 5212  H HA   . ARG B 2 30 ? 17.091  8.793   1.016   1.00 0.00 ? 40 ARG B HA   3  
ATOM 5213  H HB2  . ARG B 2 30 ? 18.429  7.215   -1.184  1.00 0.00 ? 40 ARG B HB2  3  
ATOM 5214  H HB3  . ARG B 2 30 ? 18.072  8.935   -1.188  1.00 0.00 ? 40 ARG B HB3  3  
ATOM 5215  H HG2  . ARG B 2 30 ? 19.650  9.261   0.658   1.00 0.00 ? 40 ARG B HG2  3  
ATOM 5216  H HG3  . ARG B 2 30 ? 20.025  7.538   0.627   1.00 0.00 ? 40 ARG B HG3  3  
ATOM 5217  H HD2  . ARG B 2 30 ? 20.566  9.592   -1.505  1.00 0.00 ? 40 ARG B HD2  3  
ATOM 5218  H HD3  . ARG B 2 30 ? 21.738  8.643   -0.594  1.00 0.00 ? 40 ARG B HD3  3  
ATOM 5219  H HE   . ARG B 2 30 ? 19.989  7.640   -2.740  1.00 0.00 ? 40 ARG B HE   3  
ATOM 5220  H HH11 . ARG B 2 30 ? 22.743  7.216   -0.614  1.00 0.00 ? 40 ARG B HH11 3  
ATOM 5221  H HH12 . ARG B 2 30 ? 23.344  5.828   -1.461  1.00 0.00 ? 40 ARG B HH12 3  
ATOM 5222  H HH21 . ARG B 2 30 ? 20.763  5.800   -3.837  1.00 0.00 ? 40 ARG B HH21 3  
ATOM 5223  H HH22 . ARG B 2 30 ? 22.219  5.022   -3.296  1.00 0.00 ? 40 ARG B HH22 3  
ATOM 5224  N N    . TYR B 2 31 ? 15.608  6.204   -0.195  1.00 0.00 ? 41 TYR B N    3  
ATOM 5225  C CA   . TYR B 2 31 ? 14.397  5.722   -0.847  1.00 0.00 ? 41 TYR B CA   3  
ATOM 5226  C C    . TYR B 2 31 ? 13.160  5.923   0.022   1.00 0.00 ? 41 TYR B C    3  
ATOM 5227  O O    . TYR B 2 31 ? 12.046  5.983   -0.497  1.00 0.00 ? 41 TYR B O    3  
ATOM 5228  C CB   . TYR B 2 31 ? 14.542  4.247   -1.213  1.00 0.00 ? 41 TYR B CB   3  
ATOM 5229  C CG   . TYR B 2 31 ? 14.770  4.017   -2.687  1.00 0.00 ? 41 TYR B CG   3  
ATOM 5230  C CD1  . TYR B 2 31 ? 13.699  3.912   -3.564  1.00 0.00 ? 41 TYR B CD1  3  
ATOM 5231  C CD2  . TYR B 2 31 ? 16.054  3.905   -3.204  1.00 0.00 ? 41 TYR B CD2  3  
ATOM 5232  C CE1  . TYR B 2 31 ? 13.900  3.700   -4.912  1.00 0.00 ? 41 TYR B CE1  3  
ATOM 5233  C CE2  . TYR B 2 31 ? 16.262  3.693   -4.553  1.00 0.00 ? 41 TYR B CE2  3  
ATOM 5234  C CZ   . TYR B 2 31 ? 15.182  3.590   -5.402  1.00 0.00 ? 41 TYR B CZ   3  
ATOM 5235  O OH   . TYR B 2 31 ? 15.385  3.371   -6.748  1.00 0.00 ? 41 TYR B OH   3  
ATOM 5236  H H    . TYR B 2 31 ? 16.181  5.567   0.288   1.00 0.00 ? 41 TYR B H    3  
ATOM 5237  H HA   . TYR B 2 31 ? 14.272  6.290   -1.757  1.00 0.00 ? 41 TYR B HA   3  
ATOM 5238  H HB2  . TYR B 2 31 ? 15.381  3.829   -0.677  1.00 0.00 ? 41 TYR B HB2  3  
ATOM 5239  H HB3  . TYR B 2 31 ? 13.641  3.723   -0.929  1.00 0.00 ? 41 TYR B HB3  3  
ATOM 5240  H HD1  . TYR B 2 31 ? 12.695  3.997   -3.177  1.00 0.00 ? 41 TYR B HD1  3  
ATOM 5241  H HD2  . TYR B 2 31 ? 16.898  3.987   -2.536  1.00 0.00 ? 41 TYR B HD2  3  
ATOM 5242  H HE1  . TYR B 2 31 ? 13.054  3.621   -5.578  1.00 0.00 ? 41 TYR B HE1  3  
ATOM 5243  H HE2  . TYR B 2 31 ? 17.268  3.608   -4.936  1.00 0.00 ? 41 TYR B HE2  3  
ATOM 5244  H HH   . TYR B 2 31 ? 14.717  3.852   -7.253  1.00 0.00 ? 41 TYR B HH   3  
ATOM 5245  N N    . GLU B 2 32 ? 13.355  6.010   1.339   1.00 0.00 ? 42 GLU B N    3  
ATOM 5246  C CA   . GLU B 2 32 ? 12.247  6.215   2.281   1.00 0.00 ? 42 GLU B CA   3  
ATOM 5247  C C    . GLU B 2 32 ? 11.380  7.400   1.866   1.00 0.00 ? 42 GLU B C    3  
ATOM 5248  O O    . GLU B 2 32 ? 10.158  7.374   2.020   1.00 0.00 ? 42 GLU B O    3  
ATOM 5249  C CB   . GLU B 2 32 ? 12.783  6.451   3.693   1.00 0.00 ? 42 GLU B CB   3  
ATOM 5250  C CG   . GLU B 2 32 ? 11.708  6.409   4.767   1.00 0.00 ? 42 GLU B CG   3  
ATOM 5251  C CD   . GLU B 2 32 ? 12.230  6.796   6.134   1.00 0.00 ? 42 GLU B CD   3  
ATOM 5252  O OE1  . GLU B 2 32 ? 13.229  7.540   6.205   1.00 0.00 ? 42 GLU B OE1  3  
ATOM 5253  O OE2  . GLU B 2 32 ? 11.632  6.367   7.146   1.00 0.00 ? 42 GLU B OE2  3  
ATOM 5254  H H    . GLU B 2 32 ? 14.263  5.901   1.695   1.00 0.00 ? 42 GLU B H    3  
ATOM 5255  H HA   . GLU B 2 32 ? 11.642  5.324   2.279   1.00 0.00 ? 42 GLU B HA   3  
ATOM 5256  H HB2  . GLU B 2 32 ? 13.516  5.693   3.917   1.00 0.00 ? 42 GLU B HB2  3  
ATOM 5257  H HB3  . GLU B 2 32 ? 13.259  7.420   3.728   1.00 0.00 ? 42 GLU B HB3  3  
ATOM 5258  H HG2  . GLU B 2 32 ? 10.918  7.094   4.494   1.00 0.00 ? 42 GLU B HG2  3  
ATOM 5259  H HG3  . GLU B 2 32 ? 11.309  5.407   4.819   1.00 0.00 ? 42 GLU B HG3  3  
ATOM 5260  N N    . GLU B 2 33 ? 12.032  8.411   1.309   1.00 0.00 ? 43 GLU B N    3  
ATOM 5261  C CA   . GLU B 2 33 ? 11.356  9.619   0.861   1.00 0.00 ? 43 GLU B CA   3  
ATOM 5262  C C    . GLU B 2 33 ? 10.252  9.272   -0.136  1.00 0.00 ? 43 GLU B C    3  
ATOM 5263  O O    . GLU B 2 33 ? 9.105   9.694   0.012   1.00 0.00 ? 43 GLU B O    3  
ATOM 5264  C CB   . GLU B 2 33 ? 12.360  10.574  0.219   1.00 0.00 ? 43 GLU B CB   3  
ATOM 5265  C CG   . GLU B 2 33 ? 12.027  12.040  0.431   1.00 0.00 ? 43 GLU B CG   3  
ATOM 5266  C CD   . GLU B 2 33 ? 12.374  12.515  1.827   1.00 0.00 ? 43 GLU B CD   3  
ATOM 5267  O OE1  . GLU B 2 33 ? 13.559  12.831  2.071   1.00 0.00 ? 43 GLU B OE1  3  
ATOM 5268  O OE2  . GLU B 2 33 ? 11.470  12.578  2.681   1.00 0.00 ? 43 GLU B OE2  3  
ATOM 5269  H H    . GLU B 2 33 ? 12.997  8.312   1.186   1.00 0.00 ? 43 GLU B H    3  
ATOM 5270  H HA   . GLU B 2 33 ? 10.914  10.096  1.723   1.00 0.00 ? 43 GLU B HA   3  
ATOM 5271  H HB2  . GLU B 2 33 ? 13.336  10.384  0.640   1.00 0.00 ? 43 GLU B HB2  3  
ATOM 5272  H HB3  . GLU B 2 33 ? 12.392  10.383  -0.843  1.00 0.00 ? 43 GLU B HB3  3  
ATOM 5273  H HG2  . GLU B 2 33 ? 12.583  12.628  -0.283  1.00 0.00 ? 43 GLU B HG2  3  
ATOM 5274  H HG3  . GLU B 2 33 ? 10.970  12.182  0.268   1.00 0.00 ? 43 GLU B HG3  3  
ATOM 5275  N N    . GLY B 2 34 ? 10.608  8.481   -1.146  1.00 0.00 ? 44 GLY B N    3  
ATOM 5276  C CA   . GLY B 2 34 ? 9.653   8.083   -2.158  1.00 0.00 ? 44 GLY B CA   3  
ATOM 5277  C C    . GLY B 2 34 ? 8.667   7.043   -1.656  1.00 0.00 ? 44 GLY B C    3  
ATOM 5278  O O    . GLY B 2 34 ? 7.535   6.975   -2.138  1.00 0.00 ? 44 GLY B O    3  
ATOM 5279  H H    . GLY B 2 34 ? 11.537  8.181   -1.213  1.00 0.00 ? 44 GLY B H    3  
ATOM 5280  H HA2  . GLY B 2 34 ? 9.105   8.953   -2.484  1.00 0.00 ? 44 GLY B HA2  3  
ATOM 5281  H HA3  . GLY B 2 34 ? 10.190  7.670   -2.999  1.00 0.00 ? 44 GLY B HA3  3  
ATOM 5282  N N    . LEU B 2 35 ? 9.088   6.238   -0.687  1.00 0.00 ? 45 LEU B N    3  
ATOM 5283  C CA   . LEU B 2 35 ? 8.226   5.203   -0.132  1.00 0.00 ? 45 LEU B CA   3  
ATOM 5284  C C    . LEU B 2 35 ? 7.058   5.832   0.630   1.00 0.00 ? 45 LEU B C    3  
ATOM 5285  O O    . LEU B 2 35 ? 5.906   5.467   0.405   1.00 0.00 ? 45 LEU B O    3  
ATOM 5286  C CB   . LEU B 2 35 ? 9.032   4.259   0.767   1.00 0.00 ? 45 LEU B CB   3  
ATOM 5287  C CG   . LEU B 2 35 ? 10.118  3.452   0.039   1.00 0.00 ? 45 LEU B CG   3  
ATOM 5288  C CD1  . LEU B 2 35 ? 10.953  2.652   1.023   1.00 0.00 ? 45 LEU B CD1  3  
ATOM 5289  C CD2  . LEU B 2 35 ? 9.497   2.527   -0.995  1.00 0.00 ? 45 LEU B CD2  3  
ATOM 5290  H H    . LEU B 2 35 ? 10.003  6.343   -0.341  1.00 0.00 ? 45 LEU B H    3  
ATOM 5291  H HA   . LEU B 2 35 ? 7.825   4.638   -0.960  1.00 0.00 ? 45 LEU B HA   3  
ATOM 5292  H HB2  . LEU B 2 35 ? 9.501   4.845   1.542   1.00 0.00 ? 45 LEU B HB2  3  
ATOM 5293  H HB3  . LEU B 2 35 ? 8.347   3.563   1.228   1.00 0.00 ? 45 LEU B HB3  3  
ATOM 5294  H HG   . LEU B 2 35 ? 10.777  4.136   -0.477  1.00 0.00 ? 45 LEU B HG   3  
ATOM 5295  H HD11 . LEU B 2 35 ? 11.359  3.314   1.773   1.00 0.00 ? 45 LEU B HD11 3  
ATOM 5296  H HD12 . LEU B 2 35 ? 11.762  2.167   0.497   1.00 0.00 ? 45 LEU B HD12 3  
ATOM 5297  H HD13 . LEU B 2 35 ? 10.333  1.906   1.498   1.00 0.00 ? 45 LEU B HD13 3  
ATOM 5298  H HD21 . LEU B 2 35 ? 9.059   3.114   -1.787  1.00 0.00 ? 45 LEU B HD21 3  
ATOM 5299  H HD22 . LEU B 2 35 ? 8.732   1.925   -0.526  1.00 0.00 ? 45 LEU B HD22 3  
ATOM 5300  H HD23 . LEU B 2 35 ? 10.261  1.883   -1.405  1.00 0.00 ? 45 LEU B HD23 3  
ATOM 5301  N N    . VAL B 2 36 ? 7.370   6.719   1.575   1.00 0.00 ? 46 VAL B N    3  
ATOM 5302  C CA   . VAL B 2 36 ? 6.341   7.444   2.343   1.00 0.00 ? 46 VAL B CA   3  
ATOM 5303  C C    . VAL B 2 36 ? 5.228   8.006   1.444   1.00 0.00 ? 46 VAL B C    3  
ATOM 5304  O O    . VAL B 2 36 ? 4.049   7.974   1.807   1.00 0.00 ? 46 VAL B O    3  
ATOM 5305  C CB   . VAL B 2 36 ? 6.955   8.608   3.158   1.00 0.00 ? 46 VAL B CB   3  
ATOM 5306  C CG1  . VAL B 2 36 ? 5.873   9.385   3.898   1.00 0.00 ? 46 VAL B CG1  3  
ATOM 5307  C CG2  . VAL B 2 36 ? 7.996   8.089   4.138   1.00 0.00 ? 46 VAL B CG2  3  
ATOM 5308  H H    . VAL B 2 36 ? 8.308   6.782   1.861   1.00 0.00 ? 46 VAL B H    3  
ATOM 5309  H HA   . VAL B 2 36 ? 5.901   6.746   3.041   1.00 0.00 ? 46 VAL B HA   3  
ATOM 5310  H HB   . VAL B 2 36 ? 7.445   9.283   2.471   1.00 0.00 ? 46 VAL B HB   3  
ATOM 5311  H HG11 . VAL B 2 36 ? 5.158   9.772   3.186   1.00 0.00 ? 46 VAL B HG11 3  
ATOM 5312  H HG12 . VAL B 2 36 ? 6.323   10.205  4.438   1.00 0.00 ? 46 VAL B HG12 3  
ATOM 5313  H HG13 . VAL B 2 36 ? 5.370   8.728   4.593   1.00 0.00 ? 46 VAL B HG13 3  
ATOM 5314  H HG21 . VAL B 2 36 ? 8.525   8.922   4.576   1.00 0.00 ? 46 VAL B HG21 3  
ATOM 5315  H HG22 . VAL B 2 36 ? 8.695   7.452   3.617   1.00 0.00 ? 46 VAL B HG22 3  
ATOM 5316  H HG23 . VAL B 2 36 ? 7.508   7.524   4.918   1.00 0.00 ? 46 VAL B HG23 3  
ATOM 5317  N N    . HIS B 2 37 ? 5.594   8.496   0.263   1.00 0.00 ? 47 HIS B N    3  
ATOM 5318  C CA   . HIS B 2 37 ? 4.614   9.057   -0.668  1.00 0.00 ? 47 HIS B CA   3  
ATOM 5319  C C    . HIS B 2 37 ? 3.629   7.994   -1.151  1.00 0.00 ? 47 HIS B C    3  
ATOM 5320  O O    . HIS B 2 37 ? 2.564   8.310   -1.682  1.00 0.00 ? 47 HIS B O    3  
ATOM 5321  C CB   . HIS B 2 37 ? 5.310   9.697   -1.868  1.00 0.00 ? 47 HIS B CB   3  
ATOM 5322  C CG   . HIS B 2 37 ? 5.126   11.182  -1.939  1.00 0.00 ? 47 HIS B CG   3  
ATOM 5323  N ND1  . HIS B 2 37 ? 4.472   11.825  -2.965  1.00 0.00 ? 47 HIS B ND1  3  
ATOM 5324  C CD2  . HIS B 2 37 ? 5.516   12.155  -1.078  1.00 0.00 ? 47 HIS B CD2  3  
ATOM 5325  C CE1  . HIS B 2 37 ? 4.482   13.136  -2.703  1.00 0.00 ? 47 HIS B CE1  3  
ATOM 5326  N NE2  . HIS B 2 37 ? 5.104   13.391  -1.569  1.00 0.00 ? 47 HIS B NE2  3  
ATOM 5327  H H    . HIS B 2 37 ? 6.542   8.482   0.013   1.00 0.00 ? 47 HIS B H    3  
ATOM 5328  H HA   . HIS B 2 37 ? 4.063   9.821   -0.139  1.00 0.00 ? 47 HIS B HA   3  
ATOM 5329  H HB2  . HIS B 2 37 ? 6.368   9.493   -1.814  1.00 0.00 ? 47 HIS B HB2  3  
ATOM 5330  H HB3  . HIS B 2 37 ? 4.907   9.267   -2.774  1.00 0.00 ? 47 HIS B HB3  3  
ATOM 5331  H HD1  . HIS B 2 37 ? 4.073   11.397  -3.754  1.00 0.00 ? 47 HIS B HD1  3  
ATOM 5332  H HD2  . HIS B 2 37 ? 6.060   12.007  -0.156  1.00 0.00 ? 47 HIS B HD2  3  
ATOM 5333  H HE1  . HIS B 2 37 ? 4.034   13.887  -3.337  1.00 0.00 ? 47 HIS B HE1  3  
ATOM 5334  N N    . ASN B 2 38 ? 3.991   6.734   -0.972  1.00 0.00 ? 48 ASN B N    3  
ATOM 5335  C CA   . ASN B 2 38 ? 3.134   5.633   -1.378  1.00 0.00 ? 48 ASN B CA   3  
ATOM 5336  C C    . ASN B 2 38 ? 2.592   4.907   -0.153  1.00 0.00 ? 48 ASN B C    3  
ATOM 5337  O O    . ASN B 2 38 ? 1.990   3.837   -0.265  1.00 0.00 ? 48 ASN B O    3  
ATOM 5338  C CB   . ASN B 2 38 ? 3.888   4.647   -2.279  1.00 0.00 ? 48 ASN B CB   3  
ATOM 5339  C CG   . ASN B 2 38 ? 4.109   5.173   -3.688  1.00 0.00 ? 48 ASN B CG   3  
ATOM 5340  O OD1  . ASN B 2 38 ? 4.246   6.377   -3.909  1.00 0.00 ? 48 ASN B OD1  3  
ATOM 5341  N ND2  . ASN B 2 38 ? 4.130   4.271   -4.656  1.00 0.00 ? 48 ASN B ND2  3  
ATOM 5342  H H    . ASN B 2 38 ? 4.860   6.538   -0.557  1.00 0.00 ? 48 ASN B H    3  
ATOM 5343  H HA   . ASN B 2 38 ? 2.305   6.051   -1.924  1.00 0.00 ? 48 ASN B HA   3  
ATOM 5344  H HB2  . ASN B 2 38 ? 4.851   4.431   -1.842  1.00 0.00 ? 48 ASN B HB2  3  
ATOM 5345  H HB3  . ASN B 2 38 ? 3.314   3.733   -2.345  1.00 0.00 ? 48 ASN B HB3  3  
ATOM 5346  H HD21 . ASN B 2 38 ? 4.005   3.328   -4.417  1.00 0.00 ? 48 ASN B HD21 3  
ATOM 5347  H HD22 . ASN B 2 38 ? 4.261   4.581   -5.579  1.00 0.00 ? 48 ASN B HD22 3  
ATOM 5348  N N    . GLY B 2 39 ? 2.814   5.496   1.017   1.00 0.00 ? 49 GLY B N    3  
ATOM 5349  C CA   . GLY B 2 39 ? 2.344   4.908   2.256   1.00 0.00 ? 49 GLY B CA   3  
ATOM 5350  C C    . GLY B 2 39 ? 3.163   3.712   2.683   1.00 0.00 ? 49 GLY B C    3  
ATOM 5351  O O    . GLY B 2 39 ? 2.709   2.887   3.475   1.00 0.00 ? 49 GLY B O    3  
ATOM 5352  H H    . GLY B 2 39 ? 3.294   6.355   1.040   1.00 0.00 ? 49 GLY B H    3  
ATOM 5353  H HA2  . GLY B 2 39 ? 2.387   5.655   3.035   1.00 0.00 ? 49 GLY B HA2  3  
ATOM 5354  H HA3  . GLY B 2 39 ? 1.318   4.598   2.127   1.00 0.00 ? 49 GLY B HA3  3  
ATOM 5355  N N    . TRP B 2 40 ? 4.367   3.594   2.146   1.00 0.00 ? 50 TRP B N    3  
ATOM 5356  C CA   . TRP B 2 40 ? 5.240   2.481   2.490   1.00 0.00 ? 50 TRP B CA   3  
ATOM 5357  C C    . TRP B 2 40 ? 6.145   2.865   3.648   1.00 0.00 ? 50 TRP B C    3  
ATOM 5358  O O    . TRP B 2 40 ? 7.319   2.515   3.679   1.00 0.00 ? 50 TRP B O    3  
ATOM 5359  C CB   . TRP B 2 40 ? 6.066   2.043   1.280   1.00 0.00 ? 50 TRP B CB   3  
ATOM 5360  C CG   . TRP B 2 40 ? 5.356   1.049   0.412   1.00 0.00 ? 50 TRP B CG   3  
ATOM 5361  C CD1  . TRP B 2 40 ? 5.072   1.173   -0.917  1.00 0.00 ? 50 TRP B CD1  3  
ATOM 5362  C CD2  . TRP B 2 40 ? 4.831   -0.221  0.818   1.00 0.00 ? 50 TRP B CD2  3  
ATOM 5363  N NE1  . TRP B 2 40 ? 4.405   0.056   -1.359  1.00 0.00 ? 50 TRP B NE1  3  
ATOM 5364  C CE2  . TRP B 2 40 ? 4.247   -0.812  -0.315  1.00 0.00 ? 50 TRP B CE2  3  
ATOM 5365  C CE3  . TRP B 2 40 ? 4.800   -0.919  2.029   1.00 0.00 ? 50 TRP B CE3  3  
ATOM 5366  C CZ2  . TRP B 2 40 ? 3.639   -2.064  -0.275  1.00 0.00 ? 50 TRP B CZ2  3  
ATOM 5367  C CZ3  . TRP B 2 40 ? 4.197   -2.161  2.068   1.00 0.00 ? 50 TRP B CZ3  3  
ATOM 5368  C CH2  . TRP B 2 40 ? 3.624   -2.722  0.922   1.00 0.00 ? 50 TRP B CH2  3  
ATOM 5369  H H    . TRP B 2 40 ? 4.682   4.275   1.512   1.00 0.00 ? 50 TRP B H    3  
ATOM 5370  H HA   . TRP B 2 40 ? 4.612   1.659   2.801   1.00 0.00 ? 50 TRP B HA   3  
ATOM 5371  H HB2  . TRP B 2 40 ? 6.298   2.908   0.677   1.00 0.00 ? 50 TRP B HB2  3  
ATOM 5372  H HB3  . TRP B 2 40 ? 6.985   1.592   1.624   1.00 0.00 ? 50 TRP B HB3  3  
ATOM 5373  H HD1  . TRP B 2 40 ? 5.338   2.028   -1.519  1.00 0.00 ? 50 TRP B HD1  3  
ATOM 5374  H HE1  . TRP B 2 40 ? 4.093   -0.102  -2.290  1.00 0.00 ? 50 TRP B HE1  3  
ATOM 5375  H HE3  . TRP B 2 40 ? 5.237   -0.503  2.925   1.00 0.00 ? 50 TRP B HE3  3  
ATOM 5376  H HZ2  . TRP B 2 40 ? 3.192   -2.511  -1.152  1.00 0.00 ? 50 TRP B HZ2  3  
ATOM 5377  H HZ3  . TRP B 2 40 ? 4.163   -2.713  2.994   1.00 0.00 ? 50 TRP B HZ3  3  
ATOM 5378  H HH2  . TRP B 2 40 ? 3.162   -3.695  0.998   1.00 0.00 ? 50 TRP B HH2  3  
ATOM 5379  N N    . ASP B 2 41 ? 5.575   3.582   4.601   1.00 0.00 ? 51 ASP B N    3  
ATOM 5380  C CA   . ASP B 2 41 ? 6.308   4.029   5.777   1.00 0.00 ? 51 ASP B CA   3  
ATOM 5381  C C    . ASP B 2 41 ? 6.036   3.102   6.954   1.00 0.00 ? 51 ASP B C    3  
ATOM 5382  O O    . ASP B 2 41 ? 6.466   3.357   8.081   1.00 0.00 ? 51 ASP B O    3  
ATOM 5383  C CB   . ASP B 2 41 ? 5.922   5.470   6.131   1.00 0.00 ? 51 ASP B CB   3  
ATOM 5384  C CG   . ASP B 2 41 ? 4.448   5.630   6.456   1.00 0.00 ? 51 ASP B CG   3  
ATOM 5385  O OD1  . ASP B 2 41 ? 3.606   5.323   5.588   1.00 0.00 ? 51 ASP B OD1  3  
ATOM 5386  O OD2  . ASP B 2 41 ? 4.129   6.092   7.574   1.00 0.00 ? 51 ASP B OD2  3  
ATOM 5387  H H    . ASP B 2 41 ? 4.622   3.820   4.517   1.00 0.00 ? 51 ASP B H    3  
ATOM 5388  H HA   . ASP B 2 41 ? 7.361   3.994   5.544   1.00 0.00 ? 51 ASP B HA   3  
ATOM 5389  H HB2  . ASP B 2 41 ? 6.494   5.786   6.990   1.00 0.00 ? 51 ASP B HB2  3  
ATOM 5390  H HB3  . ASP B 2 41 ? 6.157   6.110   5.294   1.00 0.00 ? 51 ASP B HB3  3  
ATOM 5391  N N    . ASP B 2 42 ? 5.324   2.020   6.676   1.00 0.00 ? 52 ASP B N    3  
ATOM 5392  C CA   . ASP B 2 42 ? 4.990   1.034   7.691   1.00 0.00 ? 52 ASP B CA   3  
ATOM 5393  C C    . ASP B 2 42 ? 5.782   -0.245  7.461   1.00 0.00 ? 52 ASP B C    3  
ATOM 5394  O O    . ASP B 2 42 ? 5.659   -0.879  6.412   1.00 0.00 ? 52 ASP B O    3  
ATOM 5395  C CB   . ASP B 2 42 ? 3.493   0.730   7.670   1.00 0.00 ? 52 ASP B CB   3  
ATOM 5396  C CG   . ASP B 2 42 ? 3.120   -0.357  8.653   1.00 0.00 ? 52 ASP B CG   3  
ATOM 5397  O OD1  . ASP B 2 42 ? 3.136   -0.095  9.874   1.00 0.00 ? 52 ASP B OD1  3  
ATOM 5398  O OD2  . ASP B 2 42 ? 2.801   -1.479  8.215   1.00 0.00 ? 52 ASP B OD2  3  
ATOM 5399  H H    . ASP B 2 42 ? 5.021   1.877   5.756   1.00 0.00 ? 52 ASP B H    3  
ATOM 5400  H HA   . ASP B 2 42 ? 5.254   1.443   8.654   1.00 0.00 ? 52 ASP B HA   3  
ATOM 5401  H HB2  . ASP B 2 42 ? 2.945   1.624   7.923   1.00 0.00 ? 52 ASP B HB2  3  
ATOM 5402  H HB3  . ASP B 2 42 ? 3.212   0.406   6.678   1.00 0.00 ? 52 ASP B HB3  3  
ATOM 5403  N N    . LEU B 2 43 ? 6.579   -0.625  8.449   1.00 0.00 ? 53 LEU B N    3  
ATOM 5404  C CA   . LEU B 2 43 ? 7.415   -1.816  8.352   1.00 0.00 ? 53 LEU B CA   3  
ATOM 5405  C C    . LEU B 2 43 ? 6.591   -3.098  8.442   1.00 0.00 ? 53 LEU B C    3  
ATOM 5406  O O    . LEU B 2 43 ? 6.984   -4.133  7.900   1.00 0.00 ? 53 LEU B O    3  
ATOM 5407  C CB   . LEU B 2 43 ? 8.484   -1.798  9.447   1.00 0.00 ? 53 LEU B CB   3  
ATOM 5408  C CG   . LEU B 2 43 ? 9.614   -0.789  9.228   1.00 0.00 ? 53 LEU B CG   3  
ATOM 5409  C CD1  . LEU B 2 43 ? 10.401  -0.574  10.511  1.00 0.00 ? 53 LEU B CD1  3  
ATOM 5410  C CD2  . LEU B 2 43 ? 10.536  -1.259  8.115   1.00 0.00 ? 53 LEU B CD2  3  
ATOM 5411  H H    . LEU B 2 43 ? 6.602   -0.093  9.274   1.00 0.00 ? 53 LEU B H    3  
ATOM 5412  H HA   . LEU B 2 43 ? 7.905   -1.790  7.392   1.00 0.00 ? 53 LEU B HA   3  
ATOM 5413  H HB2  . LEU B 2 43 ? 8.004   -1.574  10.388  1.00 0.00 ? 53 LEU B HB2  3  
ATOM 5414  H HB3  . LEU B 2 43 ? 8.920   -2.784  9.510   1.00 0.00 ? 53 LEU B HB3  3  
ATOM 5415  H HG   . LEU B 2 43 ? 9.190   0.161   8.934   1.00 0.00 ? 53 LEU B HG   3  
ATOM 5416  H HD11 . LEU B 2 43 ? 9.743   -0.198  11.279  1.00 0.00 ? 53 LEU B HD11 3  
ATOM 5417  H HD12 . LEU B 2 43 ? 11.192  0.140   10.334  1.00 0.00 ? 53 LEU B HD12 3  
ATOM 5418  H HD13 . LEU B 2 43 ? 10.830  -1.513  10.833  1.00 0.00 ? 53 LEU B HD13 3  
ATOM 5419  H HD21 . LEU B 2 43 ? 11.319  -0.530  7.964   1.00 0.00 ? 53 LEU B HD21 3  
ATOM 5420  H HD22 . LEU B 2 43 ? 9.970   -1.372  7.202   1.00 0.00 ? 53 LEU B HD22 3  
ATOM 5421  H HD23 . LEU B 2 43 ? 10.975  -2.207  8.386   1.00 0.00 ? 53 LEU B HD23 3  
ATOM 5422  N N    . GLU B 2 44 ? 5.446   -3.025  9.109   1.00 0.00 ? 54 GLU B N    3  
ATOM 5423  C CA   . GLU B 2 44 ? 4.581   -4.190  9.271   1.00 0.00 ? 54 GLU B CA   3  
ATOM 5424  C C    . GLU B 2 44 ? 4.087   -4.708  7.923   1.00 0.00 ? 54 GLU B C    3  
ATOM 5425  O O    . GLU B 2 44 ? 4.223   -5.894  7.622   1.00 0.00 ? 54 GLU B O    3  
ATOM 5426  C CB   . GLU B 2 44 ? 3.401   -3.860  10.184  1.00 0.00 ? 54 GLU B CB   3  
ATOM 5427  C CG   . GLU B 2 44 ? 3.756   -3.875  11.661  1.00 0.00 ? 54 GLU B CG   3  
ATOM 5428  C CD   . GLU B 2 44 ? 3.094   -2.752  12.429  1.00 0.00 ? 54 GLU B CD   3  
ATOM 5429  O OE1  . GLU B 2 44 ? 1.847   -2.715  12.479  1.00 0.00 ? 54 GLU B OE1  3  
ATOM 5430  O OE2  . GLU B 2 44 ? 3.817   -1.895  12.979  1.00 0.00 ? 54 GLU B OE2  3  
ATOM 5431  H H    . GLU B 2 44 ? 5.176   -2.168  9.503   1.00 0.00 ? 54 GLU B H    3  
ATOM 5432  H HA   . GLU B 2 44 ? 5.172   -4.965  9.738   1.00 0.00 ? 54 GLU B HA   3  
ATOM 5433  H HB2  . GLU B 2 44 ? 3.030   -2.877  9.934   1.00 0.00 ? 54 GLU B HB2  3  
ATOM 5434  H HB3  . GLU B 2 44 ? 2.617   -4.584  10.017  1.00 0.00 ? 54 GLU B HB3  3  
ATOM 5435  H HG2  . GLU B 2 44 ? 3.440   -4.816  12.086  1.00 0.00 ? 54 GLU B HG2  3  
ATOM 5436  H HG3  . GLU B 2 44 ? 4.827   -3.778  11.762  1.00 0.00 ? 54 GLU B HG3  3  
ATOM 5437  N N    . PHE B 2 45 ? 3.519   -3.825  7.109   1.00 0.00 ? 55 PHE B N    3  
ATOM 5438  C CA   . PHE B 2 45 ? 3.028   -4.226  5.794   1.00 0.00 ? 55 PHE B CA   3  
ATOM 5439  C C    . PHE B 2 45 ? 4.191   -4.355  4.811   1.00 0.00 ? 55 PHE B C    3  
ATOM 5440  O O    . PHE B 2 45 ? 4.115   -5.111  3.844   1.00 0.00 ? 55 PHE B O    3  
ATOM 5441  C CB   . PHE B 2 45 ? 1.981   -3.236  5.268   1.00 0.00 ? 55 PHE B CB   3  
ATOM 5442  C CG   . PHE B 2 45 ? 1.135   -3.792  4.147   1.00 0.00 ? 55 PHE B CG   3  
ATOM 5443  C CD1  . PHE B 2 45 ? 0.535   -5.038  4.265   1.00 0.00 ? 55 PHE B CD1  3  
ATOM 5444  C CD2  . PHE B 2 45 ? 0.948   -3.074  2.977   1.00 0.00 ? 55 PHE B CD2  3  
ATOM 5445  C CE1  . PHE B 2 45 ? -0.235  -5.554  3.238   1.00 0.00 ? 55 PHE B CE1  3  
ATOM 5446  C CE2  . PHE B 2 45 ? 0.180   -3.586  1.946   1.00 0.00 ? 55 PHE B CE2  3  
ATOM 5447  C CZ   . PHE B 2 45 ? -0.412  -4.827  2.076   1.00 0.00 ? 55 PHE B CZ   3  
ATOM 5448  H H    . PHE B 2 45 ? 3.413   -2.887  7.405   1.00 0.00 ? 55 PHE B H    3  
ATOM 5449  H HA   . PHE B 2 45 ? 2.567   -5.197  5.904   1.00 0.00 ? 55 PHE B HA   3  
ATOM 5450  H HB2  . PHE B 2 45 ? 1.319   -2.959  6.075   1.00 0.00 ? 55 PHE B HB2  3  
ATOM 5451  H HB3  . PHE B 2 45 ? 2.482   -2.353  4.901   1.00 0.00 ? 55 PHE B HB3  3  
ATOM 5452  H HD1  . PHE B 2 45 ? 0.670   -5.607  5.172   1.00 0.00 ? 55 PHE B HD1  3  
ATOM 5453  H HD2  . PHE B 2 45 ? 1.409   -2.103  2.871   1.00 0.00 ? 55 PHE B HD2  3  
ATOM 5454  H HE1  . PHE B 2 45 ? -0.697  -6.524  3.344   1.00 0.00 ? 55 PHE B HE1  3  
ATOM 5455  H HE2  . PHE B 2 45 ? 0.042   -3.016  1.039   1.00 0.00 ? 55 PHE B HE2  3  
ATOM 5456  H HZ   . PHE B 2 45 ? -1.012  -5.230  1.270   1.00 0.00 ? 55 PHE B HZ   3  
ATOM 5457  N N    . LEU B 2 46 ? 5.278   -3.628  5.077   1.00 0.00 ? 56 LEU B N    3  
ATOM 5458  C CA   . LEU B 2 46 ? 6.461   -3.677  4.217   1.00 0.00 ? 56 LEU B CA   3  
ATOM 5459  C C    . LEU B 2 46 ? 7.101   -5.060  4.276   1.00 0.00 ? 56 LEU B C    3  
ATOM 5460  O O    . LEU B 2 46 ? 7.843   -5.453  3.381   1.00 0.00 ? 56 LEU B O    3  
ATOM 5461  C CB   . LEU B 2 46 ? 7.486   -2.617  4.633   1.00 0.00 ? 56 LEU B CB   3  
ATOM 5462  C CG   . LEU B 2 46 ? 8.661   -2.431  3.666   1.00 0.00 ? 56 LEU B CG   3  
ATOM 5463  C CD1  . LEU B 2 46 ? 8.287   -1.482  2.538   1.00 0.00 ? 56 LEU B CD1  3  
ATOM 5464  C CD2  . LEU B 2 46 ? 9.888   -1.921  4.407   1.00 0.00 ? 56 LEU B CD2  3  
ATOM 5465  H H    . LEU B 2 46 ? 5.281   -3.038  5.861   1.00 0.00 ? 56 LEU B H    3  
ATOM 5466  H HA   . LEU B 2 46 ? 6.145   -3.483  3.203   1.00 0.00 ? 56 LEU B HA   3  
ATOM 5467  H HB2  . LEU B 2 46 ? 6.974   -1.672  4.733   1.00 0.00 ? 56 LEU B HB2  3  
ATOM 5468  H HB3  . LEU B 2 46 ? 7.886   -2.894  5.598   1.00 0.00 ? 56 LEU B HB3  3  
ATOM 5469  H HG   . LEU B 2 46 ? 8.910   -3.386  3.227   1.00 0.00 ? 56 LEU B HG   3  
ATOM 5470  H HD11 . LEU B 2 46 ? 7.459   -1.895  1.981   1.00 0.00 ? 56 LEU B HD11 3  
ATOM 5471  H HD12 . LEU B 2 46 ? 9.135   -1.352  1.881   1.00 0.00 ? 56 LEU B HD12 3  
ATOM 5472  H HD13 . LEU B 2 46 ? 8.002   -0.526  2.952   1.00 0.00 ? 56 LEU B HD13 3  
ATOM 5473  H HD21 . LEU B 2 46 ? 10.700  -1.788  3.706   1.00 0.00 ? 56 LEU B HD21 3  
ATOM 5474  H HD22 . LEU B 2 46 ? 10.178  -2.639  5.159   1.00 0.00 ? 56 LEU B HD22 3  
ATOM 5475  H HD23 . LEU B 2 46 ? 9.659   -0.977  4.877   1.00 0.00 ? 56 LEU B HD23 3  
ATOM 5476  N N    . SER B 2 47 ? 6.792   -5.800  5.334   1.00 0.00 ? 57 SER B N    3  
ATOM 5477  C CA   . SER B 2 47 ? 7.326   -7.144  5.515   1.00 0.00 ? 57 SER B CA   3  
ATOM 5478  C C    . SER B 2 47 ? 6.785   -8.100  4.450   1.00 0.00 ? 57 SER B C    3  
ATOM 5479  O O    . SER B 2 47 ? 7.318   -9.195  4.260   1.00 0.00 ? 57 SER B O    3  
ATOM 5480  C CB   . SER B 2 47 ? 6.977   -7.664  6.911   1.00 0.00 ? 57 SER B CB   3  
ATOM 5481  O OG   . SER B 2 47 ? 7.498   -6.816  7.923   1.00 0.00 ? 57 SER B OG   3  
ATOM 5482  H H    . SER B 2 47 ? 6.187   -5.433  6.012   1.00 0.00 ? 57 SER B H    3  
ATOM 5483  H HA   . SER B 2 47 ? 8.400   -7.088  5.419   1.00 0.00 ? 57 SER B HA   3  
ATOM 5484  H HB2  . SER B 2 47 ? 5.903   -7.709  7.017   1.00 0.00 ? 57 SER B HB2  3  
ATOM 5485  H HB3  . SER B 2 47 ? 7.392   -8.653  7.038   1.00 0.00 ? 57 SER B HB3  3  
ATOM 5486  H HG   . SER B 2 47 ? 7.391   -5.892  7.662   1.00 0.00 ? 57 SER B HG   3  
ATOM 5487  N N    . ASP B 2 48 ? 5.731   -7.681  3.753   1.00 0.00 ? 58 ASP B N    3  
ATOM 5488  C CA   . ASP B 2 48 ? 5.126   -8.504  2.713   1.00 0.00 ? 58 ASP B CA   3  
ATOM 5489  C C    . ASP B 2 48 ? 4.979   -7.707  1.419   1.00 0.00 ? 58 ASP B C    3  
ATOM 5490  O O    . ASP B 2 48 ? 3.988   -7.831  0.700   1.00 0.00 ? 58 ASP B O    3  
ATOM 5491  C CB   . ASP B 2 48 ? 3.761   -9.027  3.175   1.00 0.00 ? 58 ASP B CB   3  
ATOM 5492  C CG   . ASP B 2 48 ? 3.295   -10.224 2.368   1.00 0.00 ? 58 ASP B CG   3  
ATOM 5493  O OD1  . ASP B 2 48 ? 4.078   -11.186 2.210   1.00 0.00 ? 58 ASP B OD1  3  
ATOM 5494  O OD2  . ASP B 2 48 ? 2.140   -10.217 1.900   1.00 0.00 ? 58 ASP B OD2  3  
ATOM 5495  H H    . ASP B 2 48 ? 5.355   -6.792  3.939   1.00 0.00 ? 58 ASP B H    3  
ATOM 5496  H HA   . ASP B 2 48 ? 5.781   -9.343  2.532   1.00 0.00 ? 58 ASP B HA   3  
ATOM 5497  H HB2  . ASP B 2 48 ? 3.827   -9.320  4.212   1.00 0.00 ? 58 ASP B HB2  3  
ATOM 5498  H HB3  . ASP B 2 48 ? 3.029   -8.239  3.074   1.00 0.00 ? 58 ASP B HB3  3  
ATOM 5499  N N    . ILE B 2 49 ? 5.973   -6.878  1.127   1.00 0.00 ? 59 ILE B N    3  
ATOM 5500  C CA   . ILE B 2 49 ? 5.953   -6.070  -0.083  1.00 0.00 ? 59 ILE B CA   3  
ATOM 5501  C C    . ILE B 2 49 ? 6.487   -6.871  -1.269  1.00 0.00 ? 59 ILE B C    3  
ATOM 5502  O O    . ILE B 2 49 ? 7.429   -7.654  -1.136  1.00 0.00 ? 59 ILE B O    3  
ATOM 5503  C CB   . ILE B 2 49 ? 6.768   -4.761  0.079   1.00 0.00 ? 59 ILE B CB   3  
ATOM 5504  C CG1  . ILE B 2 49 ? 6.591   -3.866  -1.151  1.00 0.00 ? 59 ILE B CG1  3  
ATOM 5505  C CG2  . ILE B 2 49 ? 8.245   -5.061  0.310   1.00 0.00 ? 59 ILE B CG2  3  
ATOM 5506  C CD1  . ILE B 2 49 ? 7.245   -2.508  -1.016  1.00 0.00 ? 59 ILE B CD1  3  
ATOM 5507  H H    . ILE B 2 49 ? 6.741   -6.816  1.735   1.00 0.00 ? 59 ILE B H    3  
ATOM 5508  H HA   . ILE B 2 49 ? 4.925   -5.804  -0.282  1.00 0.00 ? 59 ILE B HA   3  
ATOM 5509  H HB   . ILE B 2 49 ? 6.396   -4.240  0.947   1.00 0.00 ? 59 ILE B HB   3  
ATOM 5510  H HG12 . ILE B 2 49 ? 7.022   -4.356  -2.011  1.00 0.00 ? 59 ILE B HG12 3  
ATOM 5511  H HG13 . ILE B 2 49 ? 5.536   -3.710  -1.324  1.00 0.00 ? 59 ILE B HG13 3  
ATOM 5512  H HG21 . ILE B 2 49 ? 8.361   -5.603  1.237   1.00 0.00 ? 59 ILE B HG21 3  
ATOM 5513  H HG22 . ILE B 2 49 ? 8.796   -4.134  0.363   1.00 0.00 ? 59 ILE B HG22 3  
ATOM 5514  H HG23 . ILE B 2 49 ? 8.623   -5.659  -0.506  1.00 0.00 ? 59 ILE B HG23 3  
ATOM 5515  H HD11 . ILE B 2 49 ? 8.293   -2.635  -0.788  1.00 0.00 ? 59 ILE B HD11 3  
ATOM 5516  H HD12 . ILE B 2 49 ? 6.766   -1.956  -0.222  1.00 0.00 ? 59 ILE B HD12 3  
ATOM 5517  H HD13 . ILE B 2 49 ? 7.142   -1.966  -1.945  1.00 0.00 ? 59 ILE B HD13 3  
ATOM 5518  N N    . THR B 2 50 ? 5.869   -6.687  -2.423  1.00 0.00 ? 60 THR B N    3  
ATOM 5519  C CA   . THR B 2 50 ? 6.275   -7.384  -3.626  1.00 0.00 ? 60 THR B CA   3  
ATOM 5520  C C    . THR B 2 50 ? 7.234   -6.531  -4.451  1.00 0.00 ? 60 THR B C    3  
ATOM 5521  O O    . THR B 2 50 ? 7.343   -5.320  -4.235  1.00 0.00 ? 60 THR B O    3  
ATOM 5522  C CB   . THR B 2 50 ? 5.047   -7.742  -4.479  1.00 0.00 ? 60 THR B CB   3  
ATOM 5523  O OG1  . THR B 2 50 ? 4.095   -6.671  -4.427  1.00 0.00 ? 60 THR B OG1  3  
ATOM 5524  C CG2  . THR B 2 50 ? 4.400   -9.027  -3.983  1.00 0.00 ? 60 THR B CG2  3  
ATOM 5525  H H    . THR B 2 50 ? 5.118   -6.060  -2.469  1.00 0.00 ? 60 THR B H    3  
ATOM 5526  H HA   . THR B 2 50 ? 6.772   -8.300  -3.338  1.00 0.00 ? 60 THR B HA   3  
ATOM 5527  H HB   . THR B 2 50 ? 5.364   -7.885  -5.502  1.00 0.00 ? 60 THR B HB   3  
ATOM 5528  H HG1  . THR B 2 50 ? 3.286   -6.980  -4.009  1.00 0.00 ? 60 THR B HG1  3  
ATOM 5529  H HG21 . THR B 2 50 ? 4.033   -8.880  -2.978  1.00 0.00 ? 60 THR B HG21 3  
ATOM 5530  H HG22 . THR B 2 50 ? 5.130   -9.822  -3.988  1.00 0.00 ? 60 THR B HG22 3  
ATOM 5531  H HG23 . THR B 2 50 ? 3.577   -9.289  -4.632  1.00 0.00 ? 60 THR B HG23 3  
ATOM 5532  N N    . GLU B 2 51 ? 7.928   -7.159  -5.392  1.00 0.00 ? 61 GLU B N    3  
ATOM 5533  C CA   . GLU B 2 51 ? 8.865   -6.449  -6.251  1.00 0.00 ? 61 GLU B CA   3  
ATOM 5534  C C    . GLU B 2 51 ? 8.127   -5.449  -7.124  1.00 0.00 ? 61 GLU B C    3  
ATOM 5535  O O    . GLU B 2 51 ? 8.626   -4.356  -7.396  1.00 0.00 ? 61 GLU B O    3  
ATOM 5536  C CB   . GLU B 2 51 ? 9.629   -7.422  -7.141  1.00 0.00 ? 61 GLU B CB   3  
ATOM 5537  C CG   . GLU B 2 51 ? 10.740  -8.166  -6.431  1.00 0.00 ? 61 GLU B CG   3  
ATOM 5538  C CD   . GLU B 2 51 ? 11.703  -8.788  -7.410  1.00 0.00 ? 61 GLU B CD   3  
ATOM 5539  O OE1  . GLU B 2 51 ? 11.455  -9.931  -7.845  1.00 0.00 ? 61 GLU B OE1  3  
ATOM 5540  O OE2  . GLU B 2 51 ? 12.694  -8.125  -7.774  1.00 0.00 ? 61 GLU B OE2  3  
ATOM 5541  H H    . GLU B 2 51 ? 7.804   -8.126  -5.514  1.00 0.00 ? 61 GLU B H    3  
ATOM 5542  H HA   . GLU B 2 51 ? 9.563   -5.919  -5.621  1.00 0.00 ? 61 GLU B HA   3  
ATOM 5543  H HB2  . GLU B 2 51 ? 8.934   -8.148  -7.536  1.00 0.00 ? 61 GLU B HB2  3  
ATOM 5544  H HB3  . GLU B 2 51 ? 10.063  -6.872  -7.963  1.00 0.00 ? 61 GLU B HB3  3  
ATOM 5545  H HG2  . GLU B 2 51 ? 11.280  -7.475  -5.802  1.00 0.00 ? 61 GLU B HG2  3  
ATOM 5546  H HG3  . GLU B 2 51 ? 10.307  -8.947  -5.825  1.00 0.00 ? 61 GLU B HG3  3  
ATOM 5547  N N    . GLU B 2 52 ? 6.936   -5.843  -7.562  1.00 0.00 ? 62 GLU B N    3  
ATOM 5548  C CA   . GLU B 2 52 ? 6.112   -4.994  -8.407  1.00 0.00 ? 62 GLU B CA   3  
ATOM 5549  C C    . GLU B 2 52 ? 5.767   -3.700  -7.683  1.00 0.00 ? 62 GLU B C    3  
ATOM 5550  O O    . GLU B 2 52 ? 5.925   -2.611  -8.236  1.00 0.00 ? 62 GLU B O    3  
ATOM 5551  C CB   . GLU B 2 52 ? 4.832   -5.724  -8.818  1.00 0.00 ? 62 GLU B CB   3  
ATOM 5552  C CG   . GLU B 2 52 ? 5.082   -7.067  -9.485  1.00 0.00 ? 62 GLU B CG   3  
ATOM 5553  C CD   . GLU B 2 52 ? 3.911   -7.522  -10.330 1.00 0.00 ? 62 GLU B CD   3  
ATOM 5554  O OE1  . GLU B 2 52 ? 2.840   -7.819  -9.765  1.00 0.00 ? 62 GLU B OE1  3  
ATOM 5555  O OE2  . GLU B 2 52 ? 4.060   -7.582  -11.569 1.00 0.00 ? 62 GLU B OE2  3  
ATOM 5556  H H    . GLU B 2 52 ? 6.606   -6.730  -7.310  1.00 0.00 ? 62 GLU B H    3  
ATOM 5557  H HA   . GLU B 2 52 ? 6.682   -4.756  -9.292  1.00 0.00 ? 62 GLU B HA   3  
ATOM 5558  H HB2  . GLU B 2 52 ? 4.227   -5.890  -7.938  1.00 0.00 ? 62 GLU B HB2  3  
ATOM 5559  H HB3  . GLU B 2 52 ? 4.283   -5.102  -9.508  1.00 0.00 ? 62 GLU B HB3  3  
ATOM 5560  H HG2  . GLU B 2 52 ? 5.953   -6.985  -10.118 1.00 0.00 ? 62 GLU B HG2  3  
ATOM 5561  H HG3  . GLU B 2 52 ? 5.263   -7.808  -8.718  1.00 0.00 ? 62 GLU B HG3  3  
ATOM 5562  N N    . ASP B 2 53 ? 5.282   -3.825  -6.450  1.00 0.00 ? 63 ASP B N    3  
ATOM 5563  C CA   . ASP B 2 53 ? 4.930   -2.657  -5.653  1.00 0.00 ? 63 ASP B CA   3  
ATOM 5564  C C    . ASP B 2 53 ? 6.128   -1.732  -5.465  1.00 0.00 ? 63 ASP B C    3  
ATOM 5565  O O    . ASP B 2 53 ? 5.984   -0.512  -5.542  1.00 0.00 ? 63 ASP B O    3  
ATOM 5566  C CB   . ASP B 2 53 ? 4.355   -3.063  -4.296  1.00 0.00 ? 63 ASP B CB   3  
ATOM 5567  C CG   . ASP B 2 53 ? 3.230   -2.140  -3.866  1.00 0.00 ? 63 ASP B CG   3  
ATOM 5568  O OD1  . ASP B 2 53 ? 3.490   -0.940  -3.633  1.00 0.00 ? 63 ASP B OD1  3  
ATOM 5569  O OD2  . ASP B 2 53 ? 2.072   -2.596  -3.794  1.00 0.00 ? 63 ASP B OD2  3  
ATOM 5570  H H    . ASP B 2 53 ? 5.099   -4.718  -6.090  1.00 0.00 ? 63 ASP B H    3  
ATOM 5571  H HA   . ASP B 2 53 ? 4.171   -2.115  -6.199  1.00 0.00 ? 63 ASP B HA   3  
ATOM 5572  H HB2  . ASP B 2 53 ? 3.970   -4.070  -4.358  1.00 0.00 ? 63 ASP B HB2  3  
ATOM 5573  H HB3  . ASP B 2 53 ? 5.136   -3.024  -3.550  1.00 0.00 ? 63 ASP B HB3  3  
ATOM 5574  N N    . LEU B 2 54 ? 7.311   -2.304  -5.215  1.00 0.00 ? 64 LEU B N    3  
ATOM 5575  C CA   . LEU B 2 54 ? 8.526   -1.508  -5.048  1.00 0.00 ? 64 LEU B CA   3  
ATOM 5576  C C    . LEU B 2 54 ? 8.740   -0.590  -6.248  1.00 0.00 ? 64 LEU B C    3  
ATOM 5577  O O    . LEU B 2 54 ? 8.883   0.620   -6.092  1.00 0.00 ? 64 LEU B O    3  
ATOM 5578  C CB   . LEU B 2 54 ? 9.744   -2.423  -4.876  1.00 0.00 ? 64 LEU B CB   3  
ATOM 5579  C CG   . LEU B 2 54 ? 9.932   -3.018  -3.479  1.00 0.00 ? 64 LEU B CG   3  
ATOM 5580  C CD1  . LEU B 2 54 ? 10.979  -4.120  -3.510  1.00 0.00 ? 64 LEU B CD1  3  
ATOM 5581  C CD2  . LEU B 2 54 ? 10.338  -1.935  -2.493  1.00 0.00 ? 64 LEU B CD2  3  
ATOM 5582  H H    . LEU B 2 54 ? 7.386   -3.275  -5.102  1.00 0.00 ? 64 LEU B H    3  
ATOM 5583  H HA   . LEU B 2 54 ? 8.409   -0.902  -4.163  1.00 0.00 ? 64 LEU B HA   3  
ATOM 5584  H HB2  . LEU B 2 54 ? 9.657   -3.237  -5.580  1.00 0.00 ? 64 LEU B HB2  3  
ATOM 5585  H HB3  . LEU B 2 54 ? 10.628  -1.857  -5.120  1.00 0.00 ? 64 LEU B HB3  3  
ATOM 5586  H HG   . LEU B 2 54 ? 9.000   -3.448  -3.146  1.00 0.00 ? 64 LEU B HG   3  
ATOM 5587  H HD11 . LEU B 2 54 ? 10.670  -4.891  -4.200  1.00 0.00 ? 64 LEU B HD11 3  
ATOM 5588  H HD12 . LEU B 2 54 ? 11.087  -4.543  -2.523  1.00 0.00 ? 64 LEU B HD12 3  
ATOM 5589  H HD13 . LEU B 2 54 ? 11.925  -3.708  -3.831  1.00 0.00 ? 64 LEU B HD13 3  
ATOM 5590  H HD21 . LEU B 2 54 ? 11.292  -1.523  -2.783  1.00 0.00 ? 64 LEU B HD21 3  
ATOM 5591  H HD22 . LEU B 2 54 ? 10.415  -2.359  -1.503  1.00 0.00 ? 64 LEU B HD22 3  
ATOM 5592  H HD23 . LEU B 2 54 ? 9.594   -1.152  -2.491  1.00 0.00 ? 64 LEU B HD23 3  
ATOM 5593  N N    . GLU B 2 55 ? 8.831   -1.193  -7.433  1.00 0.00 ? 65 GLU B N    3  
ATOM 5594  C CA   . GLU B 2 55 ? 8.999   -0.443  -8.681  1.00 0.00 ? 65 GLU B CA   3  
ATOM 5595  C C    . GLU B 2 55 ? 8.043   0.759   -8.759  1.00 0.00 ? 65 GLU B C    3  
ATOM 5596  O O    . GLU B 2 55 ? 8.441   1.844   -9.188  1.00 0.00 ? 65 GLU B O    3  
ATOM 5597  C CB   . GLU B 2 55 ? 8.821   -1.388  -9.887  1.00 0.00 ? 65 GLU B CB   3  
ATOM 5598  C CG   . GLU B 2 55 ? 7.656   -1.050  -10.811 1.00 0.00 ? 65 GLU B CG   3  
ATOM 5599  C CD   . GLU B 2 55 ? 8.104   -0.445  -12.127 1.00 0.00 ? 65 GLU B CD   3  
ATOM 5600  O OE1  . GLU B 2 55 ? 8.813   -1.133  -12.890 1.00 0.00 ? 65 GLU B OE1  3  
ATOM 5601  O OE2  . GLU B 2 55 ? 7.734   0.712   -12.414 1.00 0.00 ? 65 GLU B OE2  3  
ATOM 5602  H H    . GLU B 2 55 ? 8.902   -2.170  -7.452  1.00 0.00 ? 65 GLU B H    3  
ATOM 5603  H HA   . GLU B 2 55 ? 10.012  -0.066  -8.690  1.00 0.00 ? 65 GLU B HA   3  
ATOM 5604  H HB2  . GLU B 2 55 ? 9.726   -1.366  -10.474 1.00 0.00 ? 65 GLU B HB2  3  
ATOM 5605  H HB3  . GLU B 2 55 ? 8.675   -2.392  -9.515  1.00 0.00 ? 65 GLU B HB3  3  
ATOM 5606  H HG2  . GLU B 2 55 ? 7.106   -1.955  -11.020 1.00 0.00 ? 65 GLU B HG2  3  
ATOM 5607  H HG3  . GLU B 2 55 ? 7.009   -0.346  -10.309 1.00 0.00 ? 65 GLU B HG3  3  
ATOM 5608  N N    . GLU B 2 56 ? 6.800   0.572   -8.318  1.00 0.00 ? 66 GLU B N    3  
ATOM 5609  C CA   . GLU B 2 56 ? 5.802   1.640   -8.339  1.00 0.00 ? 66 GLU B CA   3  
ATOM 5610  C C    . GLU B 2 56 ? 6.199   2.792   -7.413  1.00 0.00 ? 66 GLU B C    3  
ATOM 5611  O O    . GLU B 2 56 ? 5.847   3.945   -7.655  1.00 0.00 ? 66 GLU B O    3  
ATOM 5612  C CB   . GLU B 2 56 ? 4.436   1.078   -7.933  1.00 0.00 ? 66 GLU B CB   3  
ATOM 5613  C CG   . GLU B 2 56 ? 3.255   1.919   -8.396  1.00 0.00 ? 66 GLU B CG   3  
ATOM 5614  C CD   . GLU B 2 56 ? 2.744   2.858   -7.321  1.00 0.00 ? 66 GLU B CD   3  
ATOM 5615  O OE1  . GLU B 2 56 ? 2.347   2.372   -6.243  1.00 0.00 ? 66 GLU B OE1  3  
ATOM 5616  O OE2  . GLU B 2 56 ? 2.725   4.082   -7.557  1.00 0.00 ? 66 GLU B OE2  3  
ATOM 5617  H H    . GLU B 2 56 ? 6.528   -0.312  -7.987  1.00 0.00 ? 66 GLU B H    3  
ATOM 5618  H HA   . GLU B 2 56 ? 5.741   2.013   -9.349  1.00 0.00 ? 66 GLU B HA   3  
ATOM 5619  H HB2  . GLU B 2 56 ? 4.330   0.088   -8.351  1.00 0.00 ? 66 GLU B HB2  3  
ATOM 5620  H HB3  . GLU B 2 56 ? 4.398   1.009   -6.855  1.00 0.00 ? 66 GLU B HB3  3  
ATOM 5621  H HG2  . GLU B 2 56 ? 3.563   2.508   -9.247  1.00 0.00 ? 66 GLU B HG2  3  
ATOM 5622  H HG3  . GLU B 2 56 ? 2.452   1.259   -8.688  1.00 0.00 ? 66 GLU B HG3  3  
ATOM 5623  N N    . ALA B 2 57 ? 6.944   2.477   -6.364  1.00 0.00 ? 67 ALA B N    3  
ATOM 5624  C CA   . ALA B 2 57 ? 7.385   3.484   -5.408  1.00 0.00 ? 67 ALA B CA   3  
ATOM 5625  C C    . ALA B 2 57 ? 8.678   4.159   -5.865  1.00 0.00 ? 67 ALA B C    3  
ATOM 5626  O O    . ALA B 2 57 ? 9.227   5.008   -5.163  1.00 0.00 ? 67 ALA B O    3  
ATOM 5627  C CB   . ALA B 2 57 ? 7.566   2.861   -4.032  1.00 0.00 ? 67 ALA B CB   3  
ATOM 5628  H H    . ALA B 2 57 ? 7.210   1.540   -6.229  1.00 0.00 ? 67 ALA B H    3  
ATOM 5629  H HA   . ALA B 2 57 ? 6.610   4.233   -5.336  1.00 0.00 ? 67 ALA B HA   3  
ATOM 5630  H HB1  . ALA B 2 57 ? 6.653   2.368   -3.737  1.00 0.00 ? 67 ALA B HB1  3  
ATOM 5631  H HB2  . ALA B 2 57 ? 7.806   3.634   -3.317  1.00 0.00 ? 67 ALA B HB2  3  
ATOM 5632  H HB3  . ALA B 2 57 ? 8.371   2.140   -4.067  1.00 0.00 ? 67 ALA B HB3  3  
ATOM 5633  N N    . GLY B 2 58 ? 9.164   3.774   -7.039  1.00 0.00 ? 68 GLY B N    3  
ATOM 5634  C CA   . GLY B 2 58 ? 10.378  4.367   -7.566  1.00 0.00 ? 68 GLY B CA   3  
ATOM 5635  C C    . GLY B 2 58 ? 11.557  3.417   -7.547  1.00 0.00 ? 68 GLY B C    3  
ATOM 5636  O O    . GLY B 2 58 ? 12.640  3.747   -8.036  1.00 0.00 ? 68 GLY B O    3  
ATOM 5637  H H    . GLY B 2 58 ? 8.691   3.083   -7.555  1.00 0.00 ? 68 GLY B H    3  
ATOM 5638  H HA2  . GLY B 2 58 ? 10.199  4.677   -8.585  1.00 0.00 ? 68 GLY B HA2  3  
ATOM 5639  H HA3  . GLY B 2 58 ? 10.623  5.238   -6.977  1.00 0.00 ? 68 GLY B HA3  3  
ATOM 5640  N N    . VAL B 2 59 ? 11.359  2.231   -6.993  1.00 0.00 ? 69 VAL B N    3  
ATOM 5641  C CA   . VAL B 2 59 ? 12.426  1.241   -6.921  1.00 0.00 ? 69 VAL B CA   3  
ATOM 5642  C C    . VAL B 2 59 ? 12.496  0.452   -8.224  1.00 0.00 ? 69 VAL B C    3  
ATOM 5643  O O    . VAL B 2 59 ? 12.302  -0.763  -8.250  1.00 0.00 ? 69 VAL B O    3  
ATOM 5644  C CB   . VAL B 2 59 ? 12.234  0.271   -5.734  1.00 0.00 ? 69 VAL B CB   3  
ATOM 5645  C CG1  . VAL B 2 59 ? 13.543  -0.421  -5.385  1.00 0.00 ? 69 VAL B CG1  3  
ATOM 5646  C CG2  . VAL B 2 59 ? 11.677  0.999   -4.521  1.00 0.00 ? 69 VAL B CG2  3  
ATOM 5647  H H    . VAL B 2 59 ? 10.473  2.011   -6.630  1.00 0.00 ? 69 VAL B H    3  
ATOM 5648  H HA   . VAL B 2 59 ? 13.359  1.768   -6.783  1.00 0.00 ? 69 VAL B HA   3  
ATOM 5649  H HB   . VAL B 2 59 ? 11.524  -0.485  -6.032  1.00 0.00 ? 69 VAL B HB   3  
ATOM 5650  H HG11 . VAL B 2 59 ? 13.382  -1.103  -4.564  1.00 0.00 ? 69 VAL B HG11 3  
ATOM 5651  H HG12 . VAL B 2 59 ? 14.275  0.320   -5.100  1.00 0.00 ? 69 VAL B HG12 3  
ATOM 5652  H HG13 . VAL B 2 59 ? 13.902  -0.969  -6.244  1.00 0.00 ? 69 VAL B HG13 3  
ATOM 5653  H HG21 . VAL B 2 59 ? 12.379  1.754   -4.201  1.00 0.00 ? 69 VAL B HG21 3  
ATOM 5654  H HG22 . VAL B 2 59 ? 11.515  0.294   -3.719  1.00 0.00 ? 69 VAL B HG22 3  
ATOM 5655  H HG23 . VAL B 2 59 ? 10.739  1.468   -4.782  1.00 0.00 ? 69 VAL B HG23 3  
ATOM 5656  N N    . GLN B 2 60 ? 12.773  1.158   -9.309  1.00 0.00 ? 70 GLN B N    3  
ATOM 5657  C CA   . GLN B 2 60 ? 12.867  0.546   -10.626 1.00 0.00 ? 70 GLN B CA   3  
ATOM 5658  C C    . GLN B 2 60 ? 14.307  0.149   -10.926 1.00 0.00 ? 70 GLN B C    3  
ATOM 5659  O O    . GLN B 2 60 ? 14.828  0.415   -12.012 1.00 0.00 ? 70 GLN B O    3  
ATOM 5660  C CB   . GLN B 2 60 ? 12.346  1.510   -11.689 1.00 0.00 ? 70 GLN B CB   3  
ATOM 5661  C CG   . GLN B 2 60 ? 10.871  1.837   -11.531 1.00 0.00 ? 70 GLN B CG   3  
ATOM 5662  C CD   . GLN B 2 60 ? 10.435  3.003   -12.391 1.00 0.00 ? 70 GLN B CD   3  
ATOM 5663  O OE1  . GLN B 2 60 ? 11.201  3.941   -12.624 1.00 0.00 ? 70 GLN B OE1  3  
ATOM 5664  N NE2  . GLN B 2 60 ? 9.205   2.953   -12.870 1.00 0.00 ? 70 GLN B NE2  3  
ATOM 5665  H H    . GLN B 2 60 ? 12.920  2.126   -9.221  1.00 0.00 ? 70 GLN B H    3  
ATOM 5666  H HA   . GLN B 2 60 ? 12.254  -0.343  -10.624 1.00 0.00 ? 70 GLN B HA   3  
ATOM 5667  H HB2  . GLN B 2 60 ? 12.906  2.432   -11.631 1.00 0.00 ? 70 GLN B HB2  3  
ATOM 5668  H HB3  . GLN B 2 60 ? 12.493  1.070   -12.663 1.00 0.00 ? 70 GLN B HB3  3  
ATOM 5669  H HG2  . GLN B 2 60 ? 10.291  0.969   -11.810 1.00 0.00 ? 70 GLN B HG2  3  
ATOM 5670  H HG3  . GLN B 2 60 ? 10.679  2.079   -10.497 1.00 0.00 ? 70 GLN B HG3  3  
ATOM 5671  H HE21 . GLN B 2 60 ? 8.647   2.164   -12.644 1.00 0.00 ? 70 GLN B HE21 3  
ATOM 5672  H HE22 . GLN B 2 60 ? 8.895   3.692   -13.435 1.00 0.00 ? 70 GLN B HE22 3  
ATOM 5673  N N    . ASP B 2 61 ? 14.940  -0.488  -9.953  1.00 0.00 ? 71 ASP B N    3  
ATOM 5674  C CA   . ASP B 2 61 ? 16.318  -0.932  -10.090 1.00 0.00 ? 71 ASP B CA   3  
ATOM 5675  C C    . ASP B 2 61 ? 16.455  -2.356  -9.570  1.00 0.00 ? 71 ASP B C    3  
ATOM 5676  O O    . ASP B 2 61 ? 15.976  -2.670  -8.477  1.00 0.00 ? 71 ASP B O    3  
ATOM 5677  C CB   . ASP B 2 61 ? 17.264  0.001   -9.333  1.00 0.00 ? 71 ASP B CB   3  
ATOM 5678  C CG   . ASP B 2 61 ? 18.713  -0.437  -9.426  1.00 0.00 ? 71 ASP B CG   3  
ATOM 5679  O OD1  . ASP B 2 61 ? 19.378  -0.081  -10.419 1.00 0.00 ? 71 ASP B OD1  3  
ATOM 5680  O OD2  . ASP B 2 61 ? 19.193  -1.136  -8.510  1.00 0.00 ? 71 ASP B OD2  3  
ATOM 5681  H H    . ASP B 2 61 ? 14.461  -0.678  -9.119  1.00 0.00 ? 71 ASP B H    3  
ATOM 5682  H HA   . ASP B 2 61 ? 16.568  -0.915  -11.140 1.00 0.00 ? 71 ASP B HA   3  
ATOM 5683  H HB2  . ASP B 2 61 ? 17.183  0.996   -9.744  1.00 0.00 ? 71 ASP B HB2  3  
ATOM 5684  H HB3  . ASP B 2 61 ? 16.980  0.024   -8.292  1.00 0.00 ? 71 ASP B HB3  3  
ATOM 5685  N N    . PRO B 2 62 ? 17.089  -3.237  -10.357 1.00 0.00 ? 72 PRO B N    3  
ATOM 5686  C CA   . PRO B 2 62 ? 17.284  -4.646  -9.993  1.00 0.00 ? 72 PRO B CA   3  
ATOM 5687  C C    . PRO B 2 62 ? 17.969  -4.830  -8.638  1.00 0.00 ? 72 PRO B C    3  
ATOM 5688  O O    . PRO B 2 62 ? 17.431  -5.497  -7.752  1.00 0.00 ? 72 PRO B O    3  
ATOM 5689  C CB   . PRO B 2 62 ? 18.170  -5.202  -11.117 1.00 0.00 ? 72 PRO B CB   3  
ATOM 5690  C CG   . PRO B 2 62 ? 18.688  -4.012  -11.852 1.00 0.00 ? 72 PRO B CG   3  
ATOM 5691  C CD   . PRO B 2 62 ? 17.665  -2.933  -11.675 1.00 0.00 ? 72 PRO B CD   3  
ATOM 5692  H HA   . PRO B 2 62 ? 16.343  -5.178  -9.985  1.00 0.00 ? 72 PRO B HA   3  
ATOM 5693  H HB2  . PRO B 2 62 ? 18.977  -5.777  -10.686 1.00 0.00 ? 72 PRO B HB2  3  
ATOM 5694  H HB3  . PRO B 2 62 ? 17.578  -5.834  -11.762 1.00 0.00 ? 72 PRO B HB3  3  
ATOM 5695  H HG2  . PRO B 2 62 ? 19.633  -3.703  -11.431 1.00 0.00 ? 72 PRO B HG2  3  
ATOM 5696  H HG3  . PRO B 2 62 ? 18.804  -4.249  -12.900 1.00 0.00 ? 72 PRO B HG3  3  
ATOM 5697  H HD2  . PRO B 2 62 ? 18.138  -1.962  -11.676 1.00 0.00 ? 72 PRO B HD2  3  
ATOM 5698  H HD3  . PRO B 2 62 ? 16.914  -2.992  -12.448 1.00 0.00 ? 72 PRO B HD3  3  
ATOM 5699  N N    . ALA B 2 63 ? 19.145  -4.230  -8.481  1.00 0.00 ? 73 ALA B N    3  
ATOM 5700  C CA   . ALA B 2 63 ? 19.908  -4.344  -7.242  1.00 0.00 ? 73 ALA B CA   3  
ATOM 5701  C C    . ALA B 2 63 ? 19.132  -3.794  -6.050  1.00 0.00 ? 73 ALA B C    3  
ATOM 5702  O O    . ALA B 2 63 ? 19.100  -4.417  -4.988  1.00 0.00 ? 73 ALA B O    3  
ATOM 5703  C CB   . ALA B 2 63 ? 21.244  -3.631  -7.376  1.00 0.00 ? 73 ALA B CB   3  
ATOM 5704  H H    . ALA B 2 63 ? 19.521  -3.701  -9.216  1.00 0.00 ? 73 ALA B H    3  
ATOM 5705  H HA   . ALA B 2 63 ? 20.105  -5.392  -7.072  1.00 0.00 ? 73 ALA B HA   3  
ATOM 5706  H HB1  . ALA B 2 63 ? 21.856  -3.849  -6.514  1.00 0.00 ? 73 ALA B HB1  3  
ATOM 5707  H HB2  . ALA B 2 63 ? 21.078  -2.567  -7.438  1.00 0.00 ? 73 ALA B HB2  3  
ATOM 5708  H HB3  . ALA B 2 63 ? 21.746  -3.971  -8.269  1.00 0.00 ? 73 ALA B HB3  3  
ATOM 5709  N N    . HIS B 2 64 ? 18.508  -2.633  -6.231  1.00 0.00 ? 74 HIS B N    3  
ATOM 5710  C CA   . HIS B 2 64 ? 17.732  -2.003  -5.163  1.00 0.00 ? 74 HIS B CA   3  
ATOM 5711  C C    . HIS B 2 64 ? 16.634  -2.935  -4.659  1.00 0.00 ? 74 HIS B C    3  
ATOM 5712  O O    . HIS B 2 64 ? 16.475  -3.119  -3.451  1.00 0.00 ? 74 HIS B O    3  
ATOM 5713  C CB   . HIS B 2 64 ? 17.116  -0.684  -5.637  1.00 0.00 ? 74 HIS B CB   3  
ATOM 5714  C CG   . HIS B 2 64 ? 18.112  0.422   -5.822  1.00 0.00 ? 74 HIS B CG   3  
ATOM 5715  N ND1  . HIS B 2 64 ? 17.820  1.629   -6.423  1.00 0.00 ? 74 HIS B ND1  3  
ATOM 5716  C CD2  . HIS B 2 64 ? 19.422  0.486   -5.478  1.00 0.00 ? 74 HIS B CD2  3  
ATOM 5717  C CE1  . HIS B 2 64 ? 18.936  2.367   -6.426  1.00 0.00 ? 74 HIS B CE1  3  
ATOM 5718  N NE2  . HIS B 2 64 ? 19.938  1.720   -5.864  1.00 0.00 ? 74 HIS B NE2  3  
ATOM 5719  H H    . HIS B 2 64 ? 18.583  -2.180  -7.105  1.00 0.00 ? 74 HIS B H    3  
ATOM 5720  H HA   . HIS B 2 64 ? 18.409  -1.798  -4.347  1.00 0.00 ? 74 HIS B HA   3  
ATOM 5721  H HB2  . HIS B 2 64 ? 16.621  -0.846  -6.580  1.00 0.00 ? 74 HIS B HB2  3  
ATOM 5722  H HB3  . HIS B 2 64 ? 16.389  -0.356  -4.907  1.00 0.00 ? 74 HIS B HB3  3  
ATOM 5723  H HD1  . HIS B 2 64 ? 16.944  1.904   -6.777  1.00 0.00 ? 74 HIS B HD1  3  
ATOM 5724  H HD2  . HIS B 2 64 ? 19.986  -0.291  -4.984  1.00 0.00 ? 74 HIS B HD2  3  
ATOM 5725  H HE1  . HIS B 2 64 ? 19.006  3.365   -6.836  1.00 0.00 ? 74 HIS B HE1  3  
ATOM 5726  N N    . LYS B 2 65 ? 15.885  -3.526  -5.586  1.00 0.00 ? 75 LYS B N    3  
ATOM 5727  C CA   . LYS B 2 65 ? 14.806  -4.441  -5.224  1.00 0.00 ? 75 LYS B CA   3  
ATOM 5728  C C    . LYS B 2 65 ? 15.366  -5.670  -4.522  1.00 0.00 ? 75 LYS B C    3  
ATOM 5729  O O    . LYS B 2 65 ? 14.855  -6.097  -3.486  1.00 0.00 ? 75 LYS B O    3  
ATOM 5730  C CB   . LYS B 2 65 ? 14.022  -4.878  -6.464  1.00 0.00 ? 75 LYS B CB   3  
ATOM 5731  C CG   . LYS B 2 65 ? 13.191  -3.772  -7.093  1.00 0.00 ? 75 LYS B CG   3  
ATOM 5732  C CD   . LYS B 2 65 ? 12.267  -4.316  -8.176  1.00 0.00 ? 75 LYS B CD   3  
ATOM 5733  C CE   . LYS B 2 65 ? 13.048  -4.917  -9.335  1.00 0.00 ? 75 LYS B CE   3  
ATOM 5734  N NZ   . LYS B 2 65 ? 12.566  -6.279  -9.685  1.00 0.00 ? 75 LYS B NZ   3  
ATOM 5735  H H    . LYS B 2 65 ? 16.065  -3.345  -6.535  1.00 0.00 ? 75 LYS B H    3  
ATOM 5736  H HA   . LYS B 2 65 ? 14.141  -3.925  -4.549  1.00 0.00 ? 75 LYS B HA   3  
ATOM 5737  H HB2  . LYS B 2 65 ? 14.720  -5.238  -7.204  1.00 0.00 ? 75 LYS B HB2  3  
ATOM 5738  H HB3  . LYS B 2 65 ? 13.358  -5.684  -6.188  1.00 0.00 ? 75 LYS B HB3  3  
ATOM 5739  H HG2  . LYS B 2 65 ? 12.592  -3.302  -6.327  1.00 0.00 ? 75 LYS B HG2  3  
ATOM 5740  H HG3  . LYS B 2 65 ? 13.853  -3.041  -7.534  1.00 0.00 ? 75 LYS B HG3  3  
ATOM 5741  H HD2  . LYS B 2 65 ? 11.637  -5.081  -7.745  1.00 0.00 ? 75 LYS B HD2  3  
ATOM 5742  H HD3  . LYS B 2 65 ? 11.652  -3.509  -8.547  1.00 0.00 ? 75 LYS B HD3  3  
ATOM 5743  H HE2  . LYS B 2 65 ? 12.937  -4.275  -10.197 1.00 0.00 ? 75 LYS B HE2  3  
ATOM 5744  H HE3  . LYS B 2 65 ? 14.090  -4.971  -9.061  1.00 0.00 ? 75 LYS B HE3  3  
ATOM 5745  H HZ1  . LYS B 2 65 ? 11.564  -6.249  -9.954  1.00 0.00 ? 75 LYS B HZ1  3  
ATOM 5746  H HZ2  . LYS B 2 65 ? 12.675  -6.924  -8.868  1.00 0.00 ? 75 LYS B HZ2  3  
ATOM 5747  H HZ3  . LYS B 2 65 ? 13.115  -6.659  -10.481 1.00 0.00 ? 75 LYS B HZ3  3  
ATOM 5748  N N    . ARG B 2 66 ? 16.422  -6.229  -5.099  1.00 0.00 ? 76 ARG B N    3  
ATOM 5749  C CA   . ARG B 2 66 ? 17.067  -7.415  -4.552  1.00 0.00 ? 76 ARG B CA   3  
ATOM 5750  C C    . ARG B 2 66 ? 17.548  -7.173  -3.122  1.00 0.00 ? 76 ARG B C    3  
ATOM 5751  O O    . ARG B 2 66 ? 17.230  -7.944  -2.214  1.00 0.00 ? 76 ARG B O    3  
ATOM 5752  C CB   . ARG B 2 66 ? 18.242  -7.833  -5.440  1.00 0.00 ? 76 ARG B CB   3  
ATOM 5753  C CG   . ARG B 2 66 ? 19.035  -9.013  -4.899  1.00 0.00 ? 76 ARG B CG   3  
ATOM 5754  C CD   . ARG B 2 66 ? 18.203  -10.285 -4.883  1.00 0.00 ? 76 ARG B CD   3  
ATOM 5755  N NE   . ARG B 2 66 ? 18.743  -11.273 -3.953  1.00 0.00 ? 76 ARG B NE   3  
ATOM 5756  C CZ   . ARG B 2 66 ? 18.070  -11.777 -2.919  1.00 0.00 ? 76 ARG B CZ   3  
ATOM 5757  N NH1  . ARG B 2 66 ? 16.826  -11.382 -2.668  1.00 0.00 ? 76 ARG B NH1  3  
ATOM 5758  N NH2  . ARG B 2 66 ? 18.644  -12.678 -2.135  1.00 0.00 ? 76 ARG B NH2  3  
ATOM 5759  H H    . ARG B 2 66 ? 16.773  -5.834  -5.929  1.00 0.00 ? 76 ARG B H    3  
ATOM 5760  H HA   . ARG B 2 66 ? 16.336  -8.210  -4.542  1.00 0.00 ? 76 ARG B HA   3  
ATOM 5761  H HB2  . ARG B 2 66 ? 17.866  -8.099  -6.417  1.00 0.00 ? 76 ARG B HB2  3  
ATOM 5762  H HB3  . ARG B 2 66 ? 18.915  -6.993  -5.541  1.00 0.00 ? 76 ARG B HB3  3  
ATOM 5763  H HG2  . ARG B 2 66 ? 19.902  -9.170  -5.523  1.00 0.00 ? 76 ARG B HG2  3  
ATOM 5764  H HG3  . ARG B 2 66 ? 19.352  -8.788  -3.891  1.00 0.00 ? 76 ARG B HG3  3  
ATOM 5765  H HD2  . ARG B 2 66 ? 17.195  -10.038 -4.588  1.00 0.00 ? 76 ARG B HD2  3  
ATOM 5766  H HD3  . ARG B 2 66 ? 18.193  -10.706 -5.878  1.00 0.00 ? 76 ARG B HD3  3  
ATOM 5767  H HE   . ARG B 2 66 ? 19.667  -11.582 -4.112  1.00 0.00 ? 76 ARG B HE   3  
ATOM 5768  H HH11 . ARG B 2 66 ? 16.387  -10.700 -3.251  1.00 0.00 ? 76 ARG B HH11 3  
ATOM 5769  H HH12 . ARG B 2 66 ? 16.316  -11.779 -1.897  1.00 0.00 ? 76 ARG B HH12 3  
ATOM 5770  H HH21 . ARG B 2 66 ? 19.583  -12.979 -2.320  1.00 0.00 ? 76 ARG B HH21 3  
ATOM 5771  H HH22 . ARG B 2 66 ? 18.148  -13.057 -1.351  1.00 0.00 ? 76 ARG B HH22 3  
ATOM 5772  N N    . LEU B 2 67 ? 18.308  -6.101  -2.931  1.00 0.00 ? 77 LEU B N    3  
ATOM 5773  C CA   . LEU B 2 67 ? 18.837  -5.761  -1.614  1.00 0.00 ? 77 LEU B CA   3  
ATOM 5774  C C    . LEU B 2 67 ? 17.727  -5.501  -0.604  1.00 0.00 ? 77 LEU B C    3  
ATOM 5775  O O    . LEU B 2 67 ? 17.808  -5.957  0.537   1.00 0.00 ? 77 LEU B O    3  
ATOM 5776  C CB   . LEU B 2 67 ? 19.761  -4.544  -1.706  1.00 0.00 ? 77 LEU B CB   3  
ATOM 5777  C CG   . LEU B 2 67 ? 21.257  -4.864  -1.799  1.00 0.00 ? 77 LEU B CG   3  
ATOM 5778  C CD1  . LEU B 2 67 ? 21.745  -5.521  -0.518  1.00 0.00 ? 77 LEU B CD1  3  
ATOM 5779  C CD2  . LEU B 2 67 ? 21.547  -5.754  -2.999  1.00 0.00 ? 77 LEU B CD2  3  
ATOM 5780  H H    . LEU B 2 67 ? 18.548  -5.532  -3.700  1.00 0.00 ? 77 LEU B H    3  
ATOM 5781  H HA   . LEU B 2 67 ? 19.414  -6.605  -1.273  1.00 0.00 ? 77 LEU B HA   3  
ATOM 5782  H HB2  . LEU B 2 67 ? 19.481  -3.972  -2.579  1.00 0.00 ? 77 LEU B HB2  3  
ATOM 5783  H HB3  . LEU B 2 67 ? 19.602  -3.931  -0.830  1.00 0.00 ? 77 LEU B HB3  3  
ATOM 5784  H HG   . LEU B 2 67 ? 21.806  -3.942  -1.927  1.00 0.00 ? 77 LEU B HG   3  
ATOM 5785  H HD11 . LEU B 2 67 ? 22.764  -5.851  -0.649  1.00 0.00 ? 77 LEU B HD11 3  
ATOM 5786  H HD12 . LEU B 2 67 ? 21.119  -6.370  -0.286  1.00 0.00 ? 77 LEU B HD12 3  
ATOM 5787  H HD13 . LEU B 2 67 ? 21.700  -4.808  0.292   1.00 0.00 ? 77 LEU B HD13 3  
ATOM 5788  H HD21 . LEU B 2 67 ? 20.934  -6.643  -2.944  1.00 0.00 ? 77 LEU B HD21 3  
ATOM 5789  H HD22 . LEU B 2 67 ? 22.589  -6.036  -2.995  1.00 0.00 ? 77 LEU B HD22 3  
ATOM 5790  H HD23 . LEU B 2 67 ? 21.322  -5.218  -3.908  1.00 0.00 ? 77 LEU B HD23 3  
ATOM 5791  N N    . LEU B 2 68 ? 16.688  -4.783  -1.019  1.00 0.00 ? 78 LEU B N    3  
ATOM 5792  C CA   . LEU B 2 68 ? 15.573  -4.481  -0.126  1.00 0.00 ? 78 LEU B CA   3  
ATOM 5793  C C    . LEU B 2 68 ? 14.930  -5.773  0.370   1.00 0.00 ? 78 LEU B C    3  
ATOM 5794  O O    . LEU B 2 68 ? 14.645  -5.919  1.560   1.00 0.00 ? 78 LEU B O    3  
ATOM 5795  C CB   . LEU B 2 68 ? 14.537  -3.601  -0.833  1.00 0.00 ? 78 LEU B CB   3  
ATOM 5796  C CG   . LEU B 2 68 ? 13.709  -2.704  0.093   1.00 0.00 ? 78 LEU B CG   3  
ATOM 5797  C CD1  . LEU B 2 68 ? 13.436  -1.365  -0.571  1.00 0.00 ? 78 LEU B CD1  3  
ATOM 5798  C CD2  . LEU B 2 68 ? 12.401  -3.385  0.473   1.00 0.00 ? 78 LEU B CD2  3  
ATOM 5799  H H    . LEU B 2 68 ? 16.672  -4.444  -1.942  1.00 0.00 ? 78 LEU B H    3  
ATOM 5800  H HA   . LEU B 2 68 ? 15.968  -3.945  0.724   1.00 0.00 ? 78 LEU B HA   3  
ATOM 5801  H HB2  . LEU B 2 68 ? 15.056  -2.970  -1.541  1.00 0.00 ? 78 LEU B HB2  3  
ATOM 5802  H HB3  . LEU B 2 68 ? 13.860  -4.242  -1.375  1.00 0.00 ? 78 LEU B HB3  3  
ATOM 5803  H HG   . LEU B 2 68 ? 14.267  -2.519  0.999   1.00 0.00 ? 78 LEU B HG   3  
ATOM 5804  H HD11 . LEU B 2 68 ? 14.371  -0.860  -0.762  1.00 0.00 ? 78 LEU B HD11 3  
ATOM 5805  H HD12 . LEU B 2 68 ? 12.826  -0.757  0.082   1.00 0.00 ? 78 LEU B HD12 3  
ATOM 5806  H HD13 . LEU B 2 68 ? 12.916  -1.524  -1.503  1.00 0.00 ? 78 LEU B HD13 3  
ATOM 5807  H HD21 . LEU B 2 68 ? 12.614  -4.312  0.985   1.00 0.00 ? 78 LEU B HD21 3  
ATOM 5808  H HD22 . LEU B 2 68 ? 11.829  -3.589  -0.419  1.00 0.00 ? 78 LEU B HD22 3  
ATOM 5809  H HD23 . LEU B 2 68 ? 11.834  -2.737  1.124   1.00 0.00 ? 78 LEU B HD23 3  
ATOM 5810  N N    . LEU B 2 69 ? 14.712  -6.709  -0.549  1.00 0.00 ? 79 LEU B N    3  
ATOM 5811  C CA   . LEU B 2 69 ? 14.121  -8.001  -0.212  1.00 0.00 ? 79 LEU B CA   3  
ATOM 5812  C C    . LEU B 2 69 ? 14.975  -8.739  0.820   1.00 0.00 ? 79 LEU B C    3  
ATOM 5813  O O    . LEU B 2 69 ? 14.450  -9.365  1.740   1.00 0.00 ? 79 LEU B O    3  
ATOM 5814  C CB   . LEU B 2 69 ? 13.967  -8.861  -1.470  1.00 0.00 ? 79 LEU B CB   3  
ATOM 5815  C CG   . LEU B 2 69 ? 12.531  -9.032  -1.975  1.00 0.00 ? 79 LEU B CG   3  
ATOM 5816  C CD1  . LEU B 2 69 ? 11.918  -7.685  -2.331  1.00 0.00 ? 79 LEU B CD1  3  
ATOM 5817  C CD2  . LEU B 2 69 ? 12.499  -9.965  -3.176  1.00 0.00 ? 79 LEU B CD2  3  
ATOM 5818  H H    . LEU B 2 69 ? 14.931  -6.516  -1.488  1.00 0.00 ? 79 LEU B H    3  
ATOM 5819  H HA   . LEU B 2 69 ? 13.148  -7.818  0.211   1.00 0.00 ? 79 LEU B HA   3  
ATOM 5820  H HB2  . LEU B 2 69 ? 14.553  -8.411  -2.260  1.00 0.00 ? 79 LEU B HB2  3  
ATOM 5821  H HB3  . LEU B 2 69 ? 14.370  -9.841  -1.262  1.00 0.00 ? 79 LEU B HB3  3  
ATOM 5822  H HG   . LEU B 2 69 ? 11.932  -9.474  -1.193  1.00 0.00 ? 79 LEU B HG   3  
ATOM 5823  H HD11 . LEU B 2 69 ? 11.889  -7.060  -1.451  1.00 0.00 ? 79 LEU B HD11 3  
ATOM 5824  H HD12 . LEU B 2 69 ? 10.914  -7.833  -2.701  1.00 0.00 ? 79 LEU B HD12 3  
ATOM 5825  H HD13 . LEU B 2 69 ? 12.516  -7.208  -3.093  1.00 0.00 ? 79 LEU B HD13 3  
ATOM 5826  H HD21 . LEU B 2 69 ? 12.867  -10.939 -2.887  1.00 0.00 ? 79 LEU B HD21 3  
ATOM 5827  H HD22 . LEU B 2 69 ? 13.123  -9.563  -3.961  1.00 0.00 ? 79 LEU B HD22 3  
ATOM 5828  H HD23 . LEU B 2 69 ? 11.484  -10.056 -3.535  1.00 0.00 ? 79 LEU B HD23 3  
ATOM 5829  N N    . ASP B 2 70 ? 16.290  -8.645  0.668   1.00 0.00 ? 80 ASP B N    3  
ATOM 5830  C CA   . ASP B 2 70 ? 17.219  -9.299  1.586   1.00 0.00 ? 80 ASP B CA   3  
ATOM 5831  C C    . ASP B 2 70 ? 17.188  -8.619  2.952   1.00 0.00 ? 80 ASP B C    3  
ATOM 5832  O O    . ASP B 2 70 ? 17.278  -9.276  3.991   1.00 0.00 ? 80 ASP B O    3  
ATOM 5833  C CB   . ASP B 2 70 ? 18.639  -9.270  1.014   1.00 0.00 ? 80 ASP B CB   3  
ATOM 5834  C CG   . ASP B 2 70 ? 19.611  -10.107 1.823   1.00 0.00 ? 80 ASP B CG   3  
ATOM 5835  O OD1  . ASP B 2 70 ? 19.448  -11.346 1.862   1.00 0.00 ? 80 ASP B OD1  3  
ATOM 5836  O OD2  . ASP B 2 70 ? 20.551  -9.534  2.414   1.00 0.00 ? 80 ASP B OD2  3  
ATOM 5837  H H    . ASP B 2 70 ? 16.647  -8.122  -0.083  1.00 0.00 ? 80 ASP B H    3  
ATOM 5838  H HA   . ASP B 2 70 ? 16.905  -10.327 1.699   1.00 0.00 ? 80 ASP B HA   3  
ATOM 5839  H HB2  . ASP B 2 70 ? 18.622  -9.649  0.003   1.00 0.00 ? 80 ASP B HB2  3  
ATOM 5840  H HB3  . ASP B 2 70 ? 18.994  -8.249  1.004   1.00 0.00 ? 80 ASP B HB3  3  
ATOM 5841  N N    . THR B 2 71 ? 17.026  -7.300  2.941   1.00 0.00 ? 81 THR B N    3  
ATOM 5842  C CA   . THR B 2 71 ? 16.975  -6.520  4.172   1.00 0.00 ? 81 THR B CA   3  
ATOM 5843  C C    . THR B 2 71 ? 15.732  -6.876  4.984   1.00 0.00 ? 81 THR B C    3  
ATOM 5844  O O    . THR B 2 71 ? 15.759  -6.877  6.216   1.00 0.00 ? 81 THR B O    3  
ATOM 5845  C CB   . THR B 2 71 ? 16.983  -5.008  3.876   1.00 0.00 ? 81 THR B CB   3  
ATOM 5846  O OG1  . THR B 2 71 ? 17.972  -4.711  2.886   1.00 0.00 ? 81 THR B OG1  3  
ATOM 5847  C CG2  . THR B 2 71 ? 17.278  -4.203  5.133   1.00 0.00 ? 81 THR B CG2  3  
ATOM 5848  H H    . THR B 2 71 ? 16.937  -6.840  2.079   1.00 0.00 ? 81 THR B H    3  
ATOM 5849  H HA   . THR B 2 71 ? 17.854  -6.759  4.755   1.00 0.00 ? 81 THR B HA   3  
ATOM 5850  H HB   . THR B 2 71 ? 16.010  -4.722  3.502   1.00 0.00 ? 81 THR B HB   3  
ATOM 5851  H HG1  . THR B 2 71 ? 17.934  -5.366  2.178   1.00 0.00 ? 81 THR B HG1  3  
ATOM 5852  H HG21 . THR B 2 71 ? 17.277  -3.150  4.896   1.00 0.00 ? 81 THR B HG21 3  
ATOM 5853  H HG22 . THR B 2 71 ? 18.246  -4.484  5.521   1.00 0.00 ? 81 THR B HG22 3  
ATOM 5854  H HG23 . THR B 2 71 ? 16.521  -4.405  5.876   1.00 0.00 ? 81 THR B HG23 3  
ATOM 5855  N N    . LEU B 2 72 ? 14.643  -7.186  4.282   1.00 0.00 ? 82 LEU B N    3  
ATOM 5856  C CA   . LEU B 2 72 ? 13.391  -7.562  4.930   1.00 0.00 ? 82 LEU B CA   3  
ATOM 5857  C C    . LEU B 2 72 ? 13.578  -8.823  5.763   1.00 0.00 ? 82 LEU B C    3  
ATOM 5858  O O    . LEU B 2 72 ? 12.940  -8.996  6.796   1.00 0.00 ? 82 LEU B O    3  
ATOM 5859  C CB   . LEU B 2 72 ? 12.293  -7.796  3.889   1.00 0.00 ? 82 LEU B CB   3  
ATOM 5860  C CG   . LEU B 2 72 ? 11.821  -6.548  3.141   1.00 0.00 ? 82 LEU B CG   3  
ATOM 5861  C CD1  . LEU B 2 72 ? 10.947  -6.939  1.962   1.00 0.00 ? 82 LEU B CD1  3  
ATOM 5862  C CD2  . LEU B 2 72 ? 11.064  -5.620  4.077   1.00 0.00 ? 82 LEU B CD2  3  
ATOM 5863  H H    . LEU B 2 72 ? 14.676  -7.139  3.301   1.00 0.00 ? 82 LEU B H    3  
ATOM 5864  H HA   . LEU B 2 72 ? 13.096  -6.754  5.581   1.00 0.00 ? 82 LEU B HA   3  
ATOM 5865  H HB2  . LEU B 2 72 ? 12.661  -8.507  3.164   1.00 0.00 ? 82 LEU B HB2  3  
ATOM 5866  H HB3  . LEU B 2 72 ? 11.440  -8.229  4.391   1.00 0.00 ? 82 LEU B HB3  3  
ATOM 5867  H HG   . LEU B 2 72 ? 12.681  -6.016  2.761   1.00 0.00 ? 82 LEU B HG   3  
ATOM 5868  H HD11 . LEU B 2 72 ? 10.736  -6.064  1.364   1.00 0.00 ? 82 LEU B HD11 3  
ATOM 5869  H HD12 . LEU B 2 72 ? 10.019  -7.358  2.325   1.00 0.00 ? 82 LEU B HD12 3  
ATOM 5870  H HD13 . LEU B 2 72 ? 11.460  -7.672  1.358   1.00 0.00 ? 82 LEU B HD13 3  
ATOM 5871  H HD21 . LEU B 2 72 ? 11.663  -5.422  4.954   1.00 0.00 ? 82 LEU B HD21 3  
ATOM 5872  H HD22 . LEU B 2 72 ? 10.136  -6.086  4.372   1.00 0.00 ? 82 LEU B HD22 3  
ATOM 5873  H HD23 . LEU B 2 72 ? 10.854  -4.691  3.569   1.00 0.00 ? 82 LEU B HD23 3  
ATOM 5874  N N    . GLN B 2 73 ? 14.451  -9.702  5.298   1.00 0.00 ? 83 GLN B N    3  
ATOM 5875  C CA   . GLN B 2 73 ? 14.724  -10.945 6.002   1.00 0.00 ? 83 GLN B CA   3  
ATOM 5876  C C    . GLN B 2 73 ? 15.745  -10.732 7.118   1.00 0.00 ? 83 GLN B C    3  
ATOM 5877  O O    . GLN B 2 73 ? 15.539  -11.174 8.248   1.00 0.00 ? 83 GLN B O    3  
ATOM 5878  C CB   . GLN B 2 73 ? 15.212  -12.011 5.019   1.00 0.00 ? 83 GLN B CB   3  
ATOM 5879  C CG   . GLN B 2 73 ? 14.299  -12.174 3.814   1.00 0.00 ? 83 GLN B CG   3  
ATOM 5880  C CD   . GLN B 2 73 ? 14.632  -13.393 2.975   1.00 0.00 ? 83 GLN B CD   3  
ATOM 5881  O OE1  . GLN B 2 73 ? 15.778  -13.843 2.930   1.00 0.00 ? 83 GLN B OE1  3  
ATOM 5882  N NE2  . GLN B 2 73 ? 13.630  -13.932 2.297   1.00 0.00 ? 83 GLN B NE2  3  
ATOM 5883  H H    . GLN B 2 73 ? 14.905  -9.520  4.449   1.00 0.00 ? 83 GLN B H    3  
ATOM 5884  H HA   . GLN B 2 73 ? 13.797  -11.280 6.445   1.00 0.00 ? 83 GLN B HA   3  
ATOM 5885  H HB2  . GLN B 2 73 ? 16.197  -11.736 4.667   1.00 0.00 ? 83 GLN B HB2  3  
ATOM 5886  H HB3  . GLN B 2 73 ? 15.274  -12.960 5.531   1.00 0.00 ? 83 GLN B HB3  3  
ATOM 5887  H HG2  . GLN B 2 73 ? 13.282  -12.268 4.162   1.00 0.00 ? 83 GLN B HG2  3  
ATOM 5888  H HG3  . GLN B 2 73 ? 14.384  -11.294 3.193   1.00 0.00 ? 83 GLN B HG3  3  
ATOM 5889  H HE21 . GLN B 2 73 ? 12.742  -13.520 2.375   1.00 0.00 ? 83 GLN B HE21 3  
ATOM 5890  H HE22 . GLN B 2 73 ? 13.815  -14.720 1.744   1.00 0.00 ? 83 GLN B HE22 3  
ATOM 5891  N N    . LEU B 2 74 ? 16.861  -10.083 6.788   1.00 0.00 ? 84 LEU B N    3  
ATOM 5892  C CA   . LEU B 2 74 ? 17.918  -9.808  7.762   1.00 0.00 ? 84 LEU B CA   3  
ATOM 5893  C C    . LEU B 2 74 ? 17.421  -8.989  8.955   1.00 0.00 ? 84 LEU B C    3  
ATOM 5894  O O    . LEU B 2 74 ? 17.516  -9.430  10.103  1.00 0.00 ? 84 LEU B O    3  
ATOM 5895  C CB   . LEU B 2 74 ? 19.071  -9.067  7.076   1.00 0.00 ? 84 LEU B CB   3  
ATOM 5896  C CG   . LEU B 2 74 ? 20.283  -8.771  7.964   1.00 0.00 ? 84 LEU B CG   3  
ATOM 5897  C CD1  . LEU B 2 74 ? 21.008  -10.056 8.336   1.00 0.00 ? 84 LEU B CD1  3  
ATOM 5898  C CD2  . LEU B 2 74 ? 21.231  -7.808  7.264   1.00 0.00 ? 84 LEU B CD2  3  
ATOM 5899  H H    . LEU B 2 74 ? 17.019  -9.833  5.851   1.00 0.00 ? 84 LEU B H    3  
ATOM 5900  H HA   . LEU B 2 74 ? 18.284  -10.756 8.124   1.00 0.00 ? 84 LEU B HA   3  
ATOM 5901  H HB2  . LEU B 2 74 ? 19.402  -9.662  6.238   1.00 0.00 ? 84 LEU B HB2  3  
ATOM 5902  H HB3  . LEU B 2 74 ? 18.692  -8.128  6.701   1.00 0.00 ? 84 LEU B HB3  3  
ATOM 5903  H HG   . LEU B 2 74 ? 19.946  -8.303  8.877   1.00 0.00 ? 84 LEU B HG   3  
ATOM 5904  H HD11 . LEU B 2 74 ? 21.852  -9.823  8.968   1.00 0.00 ? 84 LEU B HD11 3  
ATOM 5905  H HD12 . LEU B 2 74 ? 21.354  -10.546 7.438   1.00 0.00 ? 84 LEU B HD12 3  
ATOM 5906  H HD13 . LEU B 2 74 ? 20.331  -10.710 8.866   1.00 0.00 ? 84 LEU B HD13 3  
ATOM 5907  H HD21 . LEU B 2 74 ? 20.718  -6.878  7.066   1.00 0.00 ? 84 LEU B HD21 3  
ATOM 5908  H HD22 . LEU B 2 74 ? 21.561  -8.243  6.331   1.00 0.00 ? 84 LEU B HD22 3  
ATOM 5909  H HD23 . LEU B 2 74 ? 22.085  -7.621  7.896   1.00 0.00 ? 84 LEU B HD23 3  
ATOM 5910  N N    . SER B 2 75 ? 16.903  -7.800  8.686   1.00 0.00 ? 85 SER B N    3  
ATOM 5911  C CA   . SER B 2 75 ? 16.425  -6.924  9.743   1.00 0.00 ? 85 SER B CA   3  
ATOM 5912  C C    . SER B 2 75 ? 15.031  -7.328  10.212  1.00 0.00 ? 85 SER B C    3  
ATOM 5913  O O    . SER B 2 75 ? 14.852  -7.724  11.368  1.00 0.00 ? 85 SER B O    3  
ATOM 5914  C CB   . SER B 2 75 ? 16.419  -5.475  9.257   1.00 0.00 ? 85 SER B CB   3  
ATOM 5915  O OG   . SER B 2 75 ? 17.542  -5.213  8.432   1.00 0.00 ? 85 SER B OG   3  
ATOM 5916  H H    . SER B 2 75 ? 16.834  -7.502  7.753   1.00 0.00 ? 85 SER B H    3  
ATOM 5917  H HA   . SER B 2 75 ? 17.106  -7.008  10.575  1.00 0.00 ? 85 SER B HA   3  
ATOM 5918  H HB2  . SER B 2 75 ? 15.519  -5.290  8.689   1.00 0.00 ? 85 SER B HB2  3  
ATOM 5919  H HB3  . SER B 2 75 ? 16.450  -4.811  10.108  1.00 0.00 ? 85 SER B HB3  3  
ATOM 5920  H HG   . SER B 2 75 ? 17.561  -4.278  8.207   1.00 0.00 ? 85 SER B HG   3  
ATOM 5921  N N    . LYS B 2 76 ? 14.061  -7.242  9.302   1.00 0.00 ? 86 LYS B N    3  
ATOM 5922  C CA   . LYS B 2 76 ? 12.673  -7.580  9.602   1.00 0.00 ? 86 LYS B CA   3  
ATOM 5923  C C    . LYS B 2 76 ? 12.145  -6.694  10.733  1.00 0.00 ? 86 LYS B C    3  
ATOM 5924  O O    . LYS B 2 76 ? 11.436  -7.212  11.625  1.00 0.00 ? 86 LYS B O    3  
ATOM 5925  C CB   . LYS B 2 76 ? 12.547  -9.066  9.968   1.00 0.00 ? 86 LYS B CB   3  
ATOM 5926  C CG   . LYS B 2 76 ? 11.142  -9.624  9.797   1.00 0.00 ? 86 LYS B CG   3  
ATOM 5927  C CD   . LYS B 2 76 ? 10.785  -10.581 10.923  1.00 0.00 ? 86 LYS B CD   3  
ATOM 5928  C CE   . LYS B 2 76 ? 9.417   -10.266 11.508  1.00 0.00 ? 86 LYS B CE   3  
ATOM 5929  N NZ   . LYS B 2 76 ? 9.299   -8.844  11.930  1.00 0.00 ? 86 LYS B NZ   3  
ATOM 5930  O OXT  . LYS B 2 76 ? 12.454  -5.481  10.729  1.00 0.00 ? 86 LYS B OXT  3  
ATOM 5931  H H    . LYS B 2 76 ? 14.288  -6.944  8.398   1.00 0.00 ? 86 LYS B H    3  
ATOM 5932  H HA   . LYS B 2 76 ? 12.090  -7.387  8.713   1.00 0.00 ? 86 LYS B HA   3  
ATOM 5933  H HB2  . LYS B 2 76 ? 13.215  -9.637  9.340   1.00 0.00 ? 86 LYS B HB2  3  
ATOM 5934  H HB3  . LYS B 2 76 ? 12.840  -9.194  10.999  1.00 0.00 ? 86 LYS B HB3  3  
ATOM 5935  H HG2  . LYS B 2 76 ? 10.437  -8.807  9.796   1.00 0.00 ? 86 LYS B HG2  3  
ATOM 5936  H HG3  . LYS B 2 76 ? 11.086  -10.152 8.857   1.00 0.00 ? 86 LYS B HG3  3  
ATOM 5937  H HD2  . LYS B 2 76 ? 10.777  -11.590 10.538  1.00 0.00 ? 86 LYS B HD2  3  
ATOM 5938  H HD3  . LYS B 2 76 ? 11.527  -10.499 11.702  1.00 0.00 ? 86 LYS B HD3  3  
ATOM 5939  H HE2  . LYS B 2 76 ? 8.666   -10.473 10.761  1.00 0.00 ? 86 LYS B HE2  3  
ATOM 5940  H HE3  . LYS B 2 76 ? 9.253   -10.902 12.366  1.00 0.00 ? 86 LYS B HE3  3  
ATOM 5941  H HZ1  . LYS B 2 76 ? 9.093   -8.786  12.949  1.00 0.00 ? 86 LYS B HZ1  3  
ATOM 5942  H HZ2  . LYS B 2 76 ? 8.526   -8.382  11.411  1.00 0.00 ? 86 LYS B HZ2  3  
ATOM 5943  H HZ3  . LYS B 2 76 ? 10.189  -8.327  11.737  1.00 0.00 ? 86 LYS B HZ3  3  
ATOM 5944  N N    . THR A 1 18 ? -14.970 -7.225  8.095   1.00 0.00 ? 14 THR A N    4  
ATOM 5945  C CA   . THR A 1 18 ? -15.469 -5.842  8.279   1.00 0.00 ? 14 THR A CA   4  
ATOM 5946  C C    . THR A 1 18 ? -14.588 -4.847  7.522   1.00 0.00 ? 14 THR A C    4  
ATOM 5947  O O    . THR A 1 18 ? -13.427 -5.131  7.224   1.00 0.00 ? 14 THR A O    4  
ATOM 5948  C CB   . THR A 1 18 ? -15.513 -5.465  9.778   1.00 0.00 ? 14 THR A CB   4  
ATOM 5949  O OG1  . THR A 1 18 ? -15.725 -6.644  10.568  1.00 0.00 ? 14 THR A OG1  4  
ATOM 5950  C CG2  . THR A 1 18 ? -16.626 -4.462  10.059  1.00 0.00 ? 14 THR A CG2  4  
ATOM 5951  H H    . THR A 1 18 ? -14.683 -7.373  7.107   1.00 0.00 ? 14 THR A H    4  
ATOM 5952  H HA   . THR A 1 18 ? -16.472 -5.787  7.883   1.00 0.00 ? 14 THR A HA   4  
ATOM 5953  H HB   . THR A 1 18 ? -14.567 -5.019  10.052  1.00 0.00 ? 14 THR A HB   4  
ATOM 5954  H HG1  . THR A 1 18 ? -14.870 -7.101  10.695  1.00 0.00 ? 14 THR A HG1  4  
ATOM 5955  H HG21 . THR A 1 18 ? -16.474 -3.577  9.459   1.00 0.00 ? 14 THR A HG21 4  
ATOM 5956  H HG22 . THR A 1 18 ? -16.614 -4.193  11.105  1.00 0.00 ? 14 THR A HG22 4  
ATOM 5957  H HG23 . THR A 1 18 ? -17.580 -4.903  9.814   1.00 0.00 ? 14 THR A HG23 4  
ATOM 5958  N N    . VAL A 1 19 ? -15.160 -3.683  7.214   1.00 0.00 ? 15 VAL A N    4  
ATOM 5959  C CA   . VAL A 1 19 ? -14.462 -2.622  6.481   1.00 0.00 ? 15 VAL A CA   4  
ATOM 5960  C C    . VAL A 1 19 ? -13.133 -2.245  7.143   1.00 0.00 ? 15 VAL A C    4  
ATOM 5961  O O    . VAL A 1 19 ? -12.114 -2.101  6.469   1.00 0.00 ? 15 VAL A O    4  
ATOM 5962  C CB   . VAL A 1 19 ? -15.341 -1.354  6.368   1.00 0.00 ? 15 VAL A CB   4  
ATOM 5963  C CG1  . VAL A 1 19 ? -14.706 -0.337  5.430   1.00 0.00 ? 15 VAL A CG1  4  
ATOM 5964  C CG2  . VAL A 1 19 ? -16.744 -1.709  5.894   1.00 0.00 ? 15 VAL A CG2  4  
ATOM 5965  H H    . VAL A 1 19 ? -16.091 -3.542  7.485   1.00 0.00 ? 15 VAL A H    4  
ATOM 5966  H HA   . VAL A 1 19 ? -14.264 -2.984  5.483   1.00 0.00 ? 15 VAL A HA   4  
ATOM 5967  H HB   . VAL A 1 19 ? -15.417 -0.907  7.348   1.00 0.00 ? 15 VAL A HB   4  
ATOM 5968  H HG11 . VAL A 1 19 ? -13.688 -0.149  5.738   1.00 0.00 ? 15 VAL A HG11 4  
ATOM 5969  H HG12 . VAL A 1 19 ? -15.269 0.584   5.466   1.00 0.00 ? 15 VAL A HG12 4  
ATOM 5970  H HG13 . VAL A 1 19 ? -14.712 -0.725  4.422   1.00 0.00 ? 15 VAL A HG13 4  
ATOM 5971  H HG21 . VAL A 1 19 ? -17.211 -2.368  6.611   1.00 0.00 ? 15 VAL A HG21 4  
ATOM 5972  H HG22 . VAL A 1 19 ? -16.685 -2.202  4.937   1.00 0.00 ? 15 VAL A HG22 4  
ATOM 5973  H HG23 . VAL A 1 19 ? -17.329 -0.806  5.800   1.00 0.00 ? 15 VAL A HG23 4  
ATOM 5974  N N    . SER A 1 20 ? -13.153 -2.114  8.461   1.00 0.00 ? 16 SER A N    4  
ATOM 5975  C CA   . SER A 1 20 ? -11.969 -1.743  9.229   1.00 0.00 ? 16 SER A CA   4  
ATOM 5976  C C    . SER A 1 20 ? -10.810 -2.725  9.018   1.00 0.00 ? 16 SER A C    4  
ATOM 5977  O O    . SER A 1 20 ? -9.668  -2.314  8.827   1.00 0.00 ? 16 SER A O    4  
ATOM 5978  C CB   . SER A 1 20 ? -12.355 -1.689  10.703  1.00 0.00 ? 16 SER A CB   4  
ATOM 5979  O OG   . SER A 1 20 ? -13.476 -2.528  10.938  1.00 0.00 ? 16 SER A OG   4  
ATOM 5980  H H    . SER A 1 20 ? -13.990 -2.274  8.944   1.00 0.00 ? 16 SER A H    4  
ATOM 5981  H HA   . SER A 1 20 ? -11.660 -0.759  8.911   1.00 0.00 ? 16 SER A HA   4  
ATOM 5982  H HB2  . SER A 1 20 ? -11.527 -2.026  11.308  1.00 0.00 ? 16 SER A HB2  4  
ATOM 5983  H HB3  . SER A 1 20 ? -12.615 -0.675  10.973  1.00 0.00 ? 16 SER A HB3  4  
ATOM 5984  H HG   . SER A 1 20 ? -13.676 -2.540  11.884  1.00 0.00 ? 16 SER A HG   4  
ATOM 5985  N N    . GLU A 1 21 ? -11.123 -4.021  9.024   1.00 0.00 ? 17 GLU A N    4  
ATOM 5986  C CA   . GLU A 1 21 ? -10.112 -5.063  8.859   1.00 0.00 ? 17 GLU A CA   4  
ATOM 5987  C C    . GLU A 1 21 ? -9.500  -5.026  7.463   1.00 0.00 ? 17 GLU A C    4  
ATOM 5988  O O    . GLU A 1 21 ? -8.299  -5.245  7.299   1.00 0.00 ? 17 GLU A O    4  
ATOM 5989  C CB   . GLU A 1 21 ? -10.719 -6.438  9.133   1.00 0.00 ? 17 GLU A CB   4  
ATOM 5990  C CG   . GLU A 1 21 ? -11.314 -6.574  10.525  1.00 0.00 ? 17 GLU A CG   4  
ATOM 5991  C CD   . GLU A 1 21 ? -12.262 -7.744  10.630  1.00 0.00 ? 17 GLU A CD   4  
ATOM 5992  O OE1  . GLU A 1 21 ? -13.396 -7.634  10.129  1.00 0.00 ? 17 GLU A OE1  4  
ATOM 5993  O OE2  . GLU A 1 21 ? -11.878 -8.783  11.203  1.00 0.00 ? 17 GLU A OE2  4  
ATOM 5994  H H    . GLU A 1 21 ? -12.060 -4.280  9.132   1.00 0.00 ? 17 GLU A H    4  
ATOM 5995  H HA   . GLU A 1 21 ? -9.330  -4.879  9.580   1.00 0.00 ? 17 GLU A HA   4  
ATOM 5996  H HB2  . GLU A 1 21 ? -11.500 -6.625  8.413   1.00 0.00 ? 17 GLU A HB2  4  
ATOM 5997  H HB3  . GLU A 1 21 ? -9.950  -7.189  9.021   1.00 0.00 ? 17 GLU A HB3  4  
ATOM 5998  H HG2  . GLU A 1 21 ? -10.515 -6.711  11.237  1.00 0.00 ? 17 GLU A HG2  4  
ATOM 5999  H HG3  . GLU A 1 21 ? -11.854 -5.668  10.762  1.00 0.00 ? 17 GLU A HG3  4  
ATOM 6000  N N    . TRP A 1 22 ? -10.322 -4.742  6.460   1.00 0.00 ? 18 TRP A N    4  
ATOM 6001  C CA   . TRP A 1 22 ? -9.837  -4.669  5.086   1.00 0.00 ? 18 TRP A CA   4  
ATOM 6002  C C    . TRP A 1 22 ? -8.877  -3.493  4.942   1.00 0.00 ? 18 TRP A C    4  
ATOM 6003  O O    . TRP A 1 22 ? -7.829  -3.599  4.311   1.00 0.00 ? 18 TRP A O    4  
ATOM 6004  C CB   . TRP A 1 22 ? -11.001 -4.539  4.101   1.00 0.00 ? 18 TRP A CB   4  
ATOM 6005  C CG   . TRP A 1 22 ? -10.550 -4.364  2.685   1.00 0.00 ? 18 TRP A CG   4  
ATOM 6006  C CD1  . TRP A 1 22 ? -9.917  -5.290  1.909   1.00 0.00 ? 18 TRP A CD1  4  
ATOM 6007  C CD2  . TRP A 1 22 ? -10.685 -3.188  1.881   1.00 0.00 ? 18 TRP A CD2  4  
ATOM 6008  N NE1  . TRP A 1 22 ? -9.645  -4.763  0.672   1.00 0.00 ? 18 TRP A NE1  4  
ATOM 6009  C CE2  . TRP A 1 22 ? -10.107 -3.473  0.629   1.00 0.00 ? 18 TRP A CE2  4  
ATOM 6010  C CE3  . TRP A 1 22 ? -11.238 -1.923  2.098   1.00 0.00 ? 18 TRP A CE3  4  
ATOM 6011  C CZ2  . TRP A 1 22 ? -10.067 -2.535  -0.400  1.00 0.00 ? 18 TRP A CZ2  4  
ATOM 6012  C CZ3  . TRP A 1 22 ? -11.198 -0.995  1.075   1.00 0.00 ? 18 TRP A CZ3  4  
ATOM 6013  C CH2  . TRP A 1 22 ? -10.616 -1.305  -0.159  1.00 0.00 ? 18 TRP A CH2  4  
ATOM 6014  H H    . TRP A 1 22 ? -11.269 -4.570  6.649   1.00 0.00 ? 18 TRP A H    4  
ATOM 6015  H HA   . TRP A 1 22 ? -9.298  -5.581  4.878   1.00 0.00 ? 18 TRP A HA   4  
ATOM 6016  H HB2  . TRP A 1 22 ? -11.607 -5.431  4.150   1.00 0.00 ? 18 TRP A HB2  4  
ATOM 6017  H HB3  . TRP A 1 22 ? -11.605 -3.683  4.370   1.00 0.00 ? 18 TRP A HB3  4  
ATOM 6018  H HD1  . TRP A 1 22 ? -9.668  -6.290  2.236   1.00 0.00 ? 18 TRP A HD1  4  
ATOM 6019  H HE1  . TRP A 1 22 ? -9.196  -5.233  -0.061  1.00 0.00 ? 18 TRP A HE1  4  
ATOM 6020  H HE3  . TRP A 1 22 ? -11.693 -1.667  3.044   1.00 0.00 ? 18 TRP A HE3  4  
ATOM 6021  H HZ2  . TRP A 1 22 ? -9.620  -2.758  -1.356  1.00 0.00 ? 18 TRP A HZ2  4  
ATOM 6022  H HZ3  . TRP A 1 22 ? -11.620 -0.011  1.225   1.00 0.00 ? 18 TRP A HZ3  4  
ATOM 6023  H HH2  . TRP A 1 22 ? -10.605 -0.549  -0.928  1.00 0.00 ? 18 TRP A HH2  4  
ATOM 6024  N N    . LEU A 1 23 ? -9.238  -2.384  5.566   1.00 0.00 ? 19 LEU A N    4  
ATOM 6025  C CA   . LEU A 1 23 ? -8.415  -1.188  5.531   1.00 0.00 ? 19 LEU A CA   4  
ATOM 6026  C C    . LEU A 1 23 ? -7.151  -1.406  6.359   1.00 0.00 ? 19 LEU A C    4  
ATOM 6027  O O    . LEU A 1 23 ? -6.135  -0.749  6.155   1.00 0.00 ? 19 LEU A O    4  
ATOM 6028  C CB   . LEU A 1 23 ? -9.200  0.016   6.061   1.00 0.00 ? 19 LEU A CB   4  
ATOM 6029  C CG   . LEU A 1 23 ? -10.340 0.496   5.154   1.00 0.00 ? 19 LEU A CG   4  
ATOM 6030  C CD1  . LEU A 1 23 ? -11.273 1.422   5.916   1.00 0.00 ? 19 LEU A CD1  4  
ATOM 6031  C CD2  . LEU A 1 23 ? -9.789  1.195   3.912   1.00 0.00 ? 19 LEU A CD2  4  
ATOM 6032  H H    . LEU A 1 23 ? -10.085 -2.391  6.062   1.00 0.00 ? 19 LEU A H    4  
ATOM 6033  H HA   . LEU A 1 23 ? -8.136  -1.005  4.504   1.00 0.00 ? 19 LEU A HA   4  
ATOM 6034  H HB2  . LEU A 1 23 ? -9.617  -0.249  7.023   1.00 0.00 ? 19 LEU A HB2  4  
ATOM 6035  H HB3  . LEU A 1 23 ? -8.511  0.836   6.202   1.00 0.00 ? 19 LEU A HB3  4  
ATOM 6036  H HG   . LEU A 1 23 ? -10.913 -0.360  4.829   1.00 0.00 ? 19 LEU A HG   4  
ATOM 6037  H HD11 . LEU A 1 23 ? -12.033 1.796   5.247   1.00 0.00 ? 19 LEU A HD11 4  
ATOM 6038  H HD12 . LEU A 1 23 ? -10.709 2.249   6.319   1.00 0.00 ? 19 LEU A HD12 4  
ATOM 6039  H HD13 . LEU A 1 23 ? -11.740 0.877   6.724   1.00 0.00 ? 19 LEU A HD13 4  
ATOM 6040  H HD21 . LEU A 1 23 ? -9.182  0.504   3.345   1.00 0.00 ? 19 LEU A HD21 4  
ATOM 6041  H HD22 . LEU A 1 23 ? -9.187  2.041   4.211   1.00 0.00 ? 19 LEU A HD22 4  
ATOM 6042  H HD23 . LEU A 1 23 ? -10.609 1.539   3.298   1.00 0.00 ? 19 LEU A HD23 4  
ATOM 6043  N N    . GLU A 1 24 ? -7.215  -2.379  7.258   1.00 0.00 ? 20 GLU A N    4  
ATOM 6044  C CA   . GLU A 1 24 ? -6.104  -2.691  8.146   1.00 0.00 ? 20 GLU A CA   4  
ATOM 6045  C C    . GLU A 1 24 ? -5.056  -3.559  7.452   1.00 0.00 ? 20 GLU A C    4  
ATOM 6046  O O    . GLU A 1 24 ? -3.862  -3.264  7.516   1.00 0.00 ? 20 GLU A O    4  
ATOM 6047  C CB   . GLU A 1 24 ? -6.633  -3.393  9.396   1.00 0.00 ? 20 GLU A CB   4  
ATOM 6048  C CG   . GLU A 1 24 ? -5.556  -3.769  10.396  1.00 0.00 ? 20 GLU A CG   4  
ATOM 6049  C CD   . GLU A 1 24 ? -6.123  -4.059  11.766  1.00 0.00 ? 20 GLU A CD   4  
ATOM 6050  O OE1  . GLU A 1 24 ? -6.305  -3.106  12.547  1.00 0.00 ? 20 GLU A OE1  4  
ATOM 6051  O OE2  . GLU A 1 24 ? -6.401  -5.241  12.064  1.00 0.00 ? 20 GLU A OE2  4  
ATOM 6052  H H    . GLU A 1 24 ? -8.035  -2.916  7.316   1.00 0.00 ? 20 GLU A H    4  
ATOM 6053  H HA   . GLU A 1 24 ? -5.647  -1.758  8.439   1.00 0.00 ? 20 GLU A HA   4  
ATOM 6054  H HB2  . GLU A 1 24 ? -7.336  -2.739  9.889   1.00 0.00 ? 20 GLU A HB2  4  
ATOM 6055  H HB3  . GLU A 1 24 ? -7.146  -4.295  9.096   1.00 0.00 ? 20 GLU A HB3  4  
ATOM 6056  H HG2  . GLU A 1 24 ? -5.045  -4.652  10.040  1.00 0.00 ? 20 GLU A HG2  4  
ATOM 6057  H HG3  . GLU A 1 24 ? -4.853  -2.953  10.476  1.00 0.00 ? 20 GLU A HG3  4  
ATOM 6058  N N    . SER A 1 25 ? -5.509  -4.613  6.781   1.00 0.00 ? 21 SER A N    4  
ATOM 6059  C CA   . SER A 1 25 ? -4.623  -5.548  6.075   1.00 0.00 ? 21 SER A CA   4  
ATOM 6060  C C    . SER A 1 25 ? -3.728  -4.849  5.037   1.00 0.00 ? 21 SER A C    4  
ATOM 6061  O O    . SER A 1 25 ? -2.712  -5.403  4.620   1.00 0.00 ? 21 SER A O    4  
ATOM 6062  C CB   . SER A 1 25 ? -5.463  -6.628  5.389   1.00 0.00 ? 21 SER A CB   4  
ATOM 6063  O OG   . SER A 1 25 ? -6.809  -6.206  5.239   1.00 0.00 ? 21 SER A OG   4  
ATOM 6064  H H    . SER A 1 25 ? -6.473  -4.794  6.776   1.00 0.00 ? 21 SER A H    4  
ATOM 6065  H HA   . SER A 1 25 ? -3.989  -6.020  6.813   1.00 0.00 ? 21 SER A HA   4  
ATOM 6066  H HB2  . SER A 1 25 ? -5.051  -6.829  4.412   1.00 0.00 ? 21 SER A HB2  4  
ATOM 6067  H HB3  . SER A 1 25 ? -5.445  -7.531  5.979   1.00 0.00 ? 21 SER A HB3  4  
ATOM 6068  H HG   . SER A 1 25 ? -7.227  -6.152  6.106   1.00 0.00 ? 21 SER A HG   4  
ATOM 6069  N N    . ILE A 1 26 ? -4.106  -3.645  4.617   1.00 0.00 ? 22 ILE A N    4  
ATOM 6070  C CA   . ILE A 1 26 ? -3.316  -2.899  3.637   1.00 0.00 ? 22 ILE A CA   4  
ATOM 6071  C C    . ILE A 1 26 ? -2.706  -1.642  4.252   1.00 0.00 ? 22 ILE A C    4  
ATOM 6072  O O    . ILE A 1 26 ? -2.070  -0.836  3.566   1.00 0.00 ? 22 ILE A O    4  
ATOM 6073  C CB   . ILE A 1 26 ? -4.176  -2.513  2.420   1.00 0.00 ? 22 ILE A CB   4  
ATOM 6074  C CG1  . ILE A 1 26 ? -5.567  -2.053  2.875   1.00 0.00 ? 22 ILE A CG1  4  
ATOM 6075  C CG2  . ILE A 1 26 ? -4.289  -3.686  1.452   1.00 0.00 ? 22 ILE A CG2  4  
ATOM 6076  C CD1  . ILE A 1 26 ? -6.523  -1.759  1.734   1.00 0.00 ? 22 ILE A CD1  4  
ATOM 6077  H H    . ILE A 1 26 ? -4.937  -3.257  4.963   1.00 0.00 ? 22 ILE A H    4  
ATOM 6078  H HA   . ILE A 1 26 ? -2.517  -3.538  3.298   1.00 0.00 ? 22 ILE A HA   4  
ATOM 6079  H HB   . ILE A 1 26 ? -3.685  -1.700  1.907   1.00 0.00 ? 22 ILE A HB   4  
ATOM 6080  H HG12 . ILE A 1 26 ? -6.013  -2.827  3.486   1.00 0.00 ? 22 ILE A HG12 4  
ATOM 6081  H HG13 . ILE A 1 26 ? -5.465  -1.154  3.466   1.00 0.00 ? 22 ILE A HG13 4  
ATOM 6082  H HG21 . ILE A 1 26 ? -4.609  -4.569  1.989   1.00 0.00 ? 22 ILE A HG21 4  
ATOM 6083  H HG22 . ILE A 1 26 ? -3.334  -3.868  0.989   1.00 0.00 ? 22 ILE A HG22 4  
ATOM 6084  H HG23 . ILE A 1 26 ? -5.018  -3.447  0.691   1.00 0.00 ? 22 ILE A HG23 4  
ATOM 6085  H HD11 . ILE A 1 26 ? -6.128  -0.956  1.130   1.00 0.00 ? 22 ILE A HD11 4  
ATOM 6086  H HD12 . ILE A 1 26 ? -7.483  -1.469  2.133   1.00 0.00 ? 22 ILE A HD12 4  
ATOM 6087  H HD13 . ILE A 1 26 ? -6.640  -2.645  1.126   1.00 0.00 ? 22 ILE A HD13 4  
ATOM 6088  N N    . LYS A 1 27 ? -2.931  -1.494  5.553   1.00 0.00 ? 23 LYS A N    4  
ATOM 6089  C CA   . LYS A 1 27 ? -2.444  -0.360  6.330   1.00 0.00 ? 23 LYS A CA   4  
ATOM 6090  C C    . LYS A 1 27 ? -2.952  0.943   5.732   1.00 0.00 ? 23 LYS A C    4  
ATOM 6091  O O    . LYS A 1 27 ? -2.209  1.903   5.562   1.00 0.00 ? 23 LYS A O    4  
ATOM 6092  C CB   . LYS A 1 27 ? -0.910  -0.349  6.432   1.00 0.00 ? 23 LYS A CB   4  
ATOM 6093  C CG   . LYS A 1 27 ? -0.344  -1.262  7.519   1.00 0.00 ? 23 LYS A CG   4  
ATOM 6094  C CD   . LYS A 1 27 ? -0.856  -0.889  8.910   1.00 0.00 ? 23 LYS A CD   4  
ATOM 6095  C CE   . LYS A 1 27 ? -0.496  -1.942  9.952   1.00 0.00 ? 23 LYS A CE   4  
ATOM 6096  N NZ   . LYS A 1 27 ? 0.845   -1.705  10.548  1.00 0.00 ? 23 LYS A NZ   4  
ATOM 6097  H H    . LYS A 1 27 ? -3.468  -2.171  6.007   1.00 0.00 ? 23 LYS A H    4  
ATOM 6098  H HA   . LYS A 1 27 ? -2.858  -0.459  7.321   1.00 0.00 ? 23 LYS A HA   4  
ATOM 6099  H HB2  . LYS A 1 27 ? -0.500  -0.663  5.484   1.00 0.00 ? 23 LYS A HB2  4  
ATOM 6100  H HB3  . LYS A 1 27 ? -0.584  0.660   6.636   1.00 0.00 ? 23 LYS A HB3  4  
ATOM 6101  H HG2  . LYS A 1 27 ? -0.627  -2.282  7.304   1.00 0.00 ? 23 LYS A HG2  4  
ATOM 6102  H HG3  . LYS A 1 27 ? 0.734   -1.179  7.511   1.00 0.00 ? 23 LYS A HG3  4  
ATOM 6103  H HD2  . LYS A 1 27 ? -0.418  0.053   9.203   1.00 0.00 ? 23 LYS A HD2  4  
ATOM 6104  H HD3  . LYS A 1 27 ? -1.929  -0.791  8.874   1.00 0.00 ? 23 LYS A HD3  4  
ATOM 6105  H HE2  . LYS A 1 27 ? -1.236  -1.917  10.737  1.00 0.00 ? 23 LYS A HE2  4  
ATOM 6106  H HE3  . LYS A 1 27 ? -0.506  -2.914  9.481   1.00 0.00 ? 23 LYS A HE3  4  
ATOM 6107  H HZ1  . LYS A 1 27 ? 0.918   -0.730  10.895  1.00 0.00 ? 23 LYS A HZ1  4  
ATOM 6108  H HZ2  . LYS A 1 27 ? 1.594   -1.857  9.833   1.00 0.00 ? 23 LYS A HZ2  4  
ATOM 6109  H HZ3  . LYS A 1 27 ? 1.013   -2.360  11.349  1.00 0.00 ? 23 LYS A HZ3  4  
ATOM 6110  N N    . MET A 1 28 ? -4.239  0.962   5.429   1.00 0.00 ? 24 MET A N    4  
ATOM 6111  C CA   . MET A 1 28 ? -4.889  2.127   4.861   1.00 0.00 ? 24 MET A CA   4  
ATOM 6112  C C    . MET A 1 28 ? -5.985  2.530   5.821   1.00 0.00 ? 24 MET A C    4  
ATOM 6113  O O    . MET A 1 28 ? -6.980  3.153   5.454   1.00 0.00 ? 24 MET A O    4  
ATOM 6114  C CB   . MET A 1 28 ? -5.473  1.813   3.477   1.00 0.00 ? 24 MET A CB   4  
ATOM 6115  C CG   . MET A 1 28 ? -4.429  1.387   2.457   1.00 0.00 ? 24 MET A CG   4  
ATOM 6116  S SD   . MET A 1 28 ? -3.387  2.753   1.923   1.00 0.00 ? 24 MET A SD   4  
ATOM 6117  C CE   . MET A 1 28 ? -1.913  1.873   1.410   1.00 0.00 ? 24 MET A CE   4  
ATOM 6118  H H    . MET A 1 28 ? -4.800  0.176   5.640   1.00 0.00 ? 24 MET A H    4  
ATOM 6119  H HA   . MET A 1 28 ? -4.162  2.921   4.784   1.00 0.00 ? 24 MET A HA   4  
ATOM 6120  H HB2  . MET A 1 28 ? -6.195  1.016   3.576   1.00 0.00 ? 24 MET A HB2  4  
ATOM 6121  H HB3  . MET A 1 28 ? -5.971  2.695   3.103   1.00 0.00 ? 24 MET A HB3  4  
ATOM 6122  H HG2  . MET A 1 28 ? -3.801  0.625   2.897   1.00 0.00 ? 24 MET A HG2  4  
ATOM 6123  H HG3  . MET A 1 28 ? -4.935  0.979   1.594   1.00 0.00 ? 24 MET A HG3  4  
ATOM 6124  H HE1  . MET A 1 28 ? -1.406  1.481   2.280   1.00 0.00 ? 24 MET A HE1  4  
ATOM 6125  H HE2  . MET A 1 28 ? -1.255  2.550   0.885   1.00 0.00 ? 24 MET A HE2  4  
ATOM 6126  H HE3  . MET A 1 28 ? -2.188  1.059   0.757   1.00 0.00 ? 24 MET A HE3  4  
ATOM 6127  N N    . GLN A 1 29 ? -5.766  2.161   7.076   1.00 0.00 ? 25 GLN A N    4  
ATOM 6128  C CA   . GLN A 1 29 ? -6.714  2.427   8.141   1.00 0.00 ? 25 GLN A CA   4  
ATOM 6129  C C    . GLN A 1 29 ? -6.767  3.905   8.485   1.00 0.00 ? 25 GLN A C    4  
ATOM 6130  O O    . GLN A 1 29 ? -7.652  4.337   9.219   1.00 0.00 ? 25 GLN A O    4  
ATOM 6131  C CB   . GLN A 1 29 ? -6.382  1.601   9.384   1.00 0.00 ? 25 GLN A CB   4  
ATOM 6132  C CG   . GLN A 1 29 ? -4.893  1.439   9.630   1.00 0.00 ? 25 GLN A CG   4  
ATOM 6133  C CD   . GLN A 1 29 ? -4.579  0.711   10.924  1.00 0.00 ? 25 GLN A CD   4  
ATOM 6134  O OE1  . GLN A 1 29 ? -3.525  0.920   11.523  1.00 0.00 ? 25 GLN A OE1  4  
ATOM 6135  N NE2  . GLN A 1 29 ? -5.487  -0.151  11.365  1.00 0.00 ? 25 GLN A NE2  4  
ATOM 6136  H H    . GLN A 1 29 ? -4.931  1.700   7.289   1.00 0.00 ? 25 GLN A H    4  
ATOM 6137  H HA   . GLN A 1 29 ? -7.687  2.130   7.781   1.00 0.00 ? 25 GLN A HA   4  
ATOM 6138  H HB2  . GLN A 1 29 ? -6.819  2.077   10.249  1.00 0.00 ? 25 GLN A HB2  4  
ATOM 6139  H HB3  . GLN A 1 29 ? -6.812  0.618   9.268   1.00 0.00 ? 25 GLN A HB3  4  
ATOM 6140  H HG2  . GLN A 1 29 ? -4.469  0.880   8.810   1.00 0.00 ? 25 GLN A HG2  4  
ATOM 6141  H HG3  . GLN A 1 29 ? -4.440  2.419   9.666   1.00 0.00 ? 25 GLN A HG3  4  
ATOM 6142  H HE21 . GLN A 1 29 ? -6.306  -0.273  10.841  1.00 0.00 ? 25 GLN A HE21 4  
ATOM 6143  H HE22 . GLN A 1 29 ? -5.303  -0.633  12.202  1.00 0.00 ? 25 GLN A HE22 4  
ATOM 6144  N N    . GLN A 1 30 ? -5.839  4.695   7.949   1.00 0.00 ? 26 GLN A N    4  
ATOM 6145  C CA   . GLN A 1 30 ? -5.843  6.123   8.204   1.00 0.00 ? 26 GLN A CA   4  
ATOM 6146  C C    . GLN A 1 30 ? -6.803  6.818   7.240   1.00 0.00 ? 26 GLN A C    4  
ATOM 6147  O O    . GLN A 1 30 ? -6.842  8.045   7.157   1.00 0.00 ? 26 GLN A O    4  
ATOM 6148  C CB   . GLN A 1 30 ? -4.426  6.715   8.087   1.00 0.00 ? 26 GLN A CB   4  
ATOM 6149  C CG   . GLN A 1 30 ? -3.584  6.156   6.939   1.00 0.00 ? 26 GLN A CG   4  
ATOM 6150  C CD   . GLN A 1 30 ? -2.495  5.204   7.422   1.00 0.00 ? 26 GLN A CD   4  
ATOM 6151  O OE1  . GLN A 1 30 ? -2.740  4.361   8.282   1.00 0.00 ? 26 GLN A OE1  4  
ATOM 6152  N NE2  . GLN A 1 30 ? -1.279  5.357   6.896   1.00 0.00 ? 26 GLN A NE2  4  
ATOM 6153  H H    . GLN A 1 30 ? -5.137  4.335   7.368   1.00 0.00 ? 26 GLN A H    4  
ATOM 6154  H HA   . GLN A 1 30 ? -6.204  6.272   9.211   1.00 0.00 ? 26 GLN A HA   4  
ATOM 6155  H HB2  . GLN A 1 30 ? -4.512  7.783   7.947   1.00 0.00 ? 26 GLN A HB2  4  
ATOM 6156  H HB3  . GLN A 1 30 ? -3.899  6.530   9.012   1.00 0.00 ? 26 GLN A HB3  4  
ATOM 6157  H HG2  . GLN A 1 30 ? -4.231  5.621   6.263   1.00 0.00 ? 26 GLN A HG2  4  
ATOM 6158  H HG3  . GLN A 1 30 ? -3.118  6.979   6.415   1.00 0.00 ? 26 GLN A HG3  4  
ATOM 6159  H HE21 . GLN A 1 30 ? -1.142  6.064   6.234   1.00 0.00 ? 26 GLN A HE21 4  
ATOM 6160  H HE22 . GLN A 1 30 ? -0.559  4.749   7.196   1.00 0.00 ? 26 GLN A HE22 4  
ATOM 6161  N N    . TYR A 1 31 ? -7.557  6.012   6.498   1.00 0.00 ? 27 TYR A N    4  
ATOM 6162  C CA   . TYR A 1 31 ? -8.531  6.521   5.544   1.00 0.00 ? 27 TYR A CA   4  
ATOM 6163  C C    . TYR A 1 31 ? -9.935  6.047   5.905   1.00 0.00 ? 27 TYR A C    4  
ATOM 6164  O O    . TYR A 1 31 ? -10.896 6.290   5.170   1.00 0.00 ? 27 TYR A O    4  
ATOM 6165  C CB   . TYR A 1 31 ? -8.176  6.066   4.129   1.00 0.00 ? 27 TYR A CB   4  
ATOM 6166  C CG   . TYR A 1 31 ? -6.958  6.758   3.568   1.00 0.00 ? 27 TYR A CG   4  
ATOM 6167  C CD1  . TYR A 1 31 ? -7.042  8.053   3.080   1.00 0.00 ? 27 TYR A CD1  4  
ATOM 6168  C CD2  . TYR A 1 31 ? -5.725  6.119   3.531   1.00 0.00 ? 27 TYR A CD2  4  
ATOM 6169  C CE1  . TYR A 1 31 ? -5.931  8.695   2.565   1.00 0.00 ? 27 TYR A CE1  4  
ATOM 6170  C CE2  . TYR A 1 31 ? -4.610  6.754   3.020   1.00 0.00 ? 27 TYR A CE2  4  
ATOM 6171  C CZ   . TYR A 1 31 ? -4.718  8.042   2.537   1.00 0.00 ? 27 TYR A CZ   4  
ATOM 6172  O OH   . TYR A 1 31 ? -3.611  8.683   2.027   1.00 0.00 ? 27 TYR A OH   4  
ATOM 6173  H H    . TYR A 1 31 ? -7.442  5.042   6.585   1.00 0.00 ? 27 TYR A H    4  
ATOM 6174  H HA   . TYR A 1 31 ? -8.504  7.600   5.582   1.00 0.00 ? 27 TYR A HA   4  
ATOM 6175  H HB2  . TYR A 1 31 ? -7.982  5.005   4.136   1.00 0.00 ? 27 TYR A HB2  4  
ATOM 6176  H HB3  . TYR A 1 31 ? -9.008  6.272   3.472   1.00 0.00 ? 27 TYR A HB3  4  
ATOM 6177  H HD1  . TYR A 1 31 ? -7.996  8.563   3.105   1.00 0.00 ? 27 TYR A HD1  4  
ATOM 6178  H HD2  . TYR A 1 31 ? -5.643  5.112   3.910   1.00 0.00 ? 27 TYR A HD2  4  
ATOM 6179  H HE1  . TYR A 1 31 ? -6.017  9.704   2.191   1.00 0.00 ? 27 TYR A HE1  4  
ATOM 6180  H HE2  . TYR A 1 31 ? -3.659  6.242   2.998   1.00 0.00 ? 27 TYR A HE2  4  
ATOM 6181  H HH   . TYR A 1 31 ? -2.905  8.047   1.884   1.00 0.00 ? 27 TYR A HH   4  
ATOM 6182  N N    . THR A 1 32 ? -10.047 5.371   7.044   1.00 0.00 ? 28 THR A N    4  
ATOM 6183  C CA   . THR A 1 32 ? -11.327 4.864   7.517   1.00 0.00 ? 28 THR A CA   4  
ATOM 6184  C C    . THR A 1 32 ? -12.307 6.011   7.743   1.00 0.00 ? 28 THR A C    4  
ATOM 6185  O O    . THR A 1 32 ? -13.489 5.915   7.403   1.00 0.00 ? 28 THR A O    4  
ATOM 6186  C CB   . THR A 1 32 ? -11.161 4.075   8.828   1.00 0.00 ? 28 THR A CB   4  
ATOM 6187  O OG1  . THR A 1 32 ? -10.000 3.240   8.741   1.00 0.00 ? 28 THR A OG1  4  
ATOM 6188  C CG2  . THR A 1 32 ? -12.389 3.214   9.105   1.00 0.00 ? 28 THR A CG2  4  
ATOM 6189  H H    . THR A 1 32 ? -9.247  5.217   7.588   1.00 0.00 ? 28 THR A H    4  
ATOM 6190  H HA   . THR A 1 32 ? -11.728 4.201   6.764   1.00 0.00 ? 28 THR A HA   4  
ATOM 6191  H HB   . THR A 1 32 ? -11.036 4.774   9.642   1.00 0.00 ? 28 THR A HB   4  
ATOM 6192  H HG1  . THR A 1 32 ? -9.251  3.691   9.155   1.00 0.00 ? 28 THR A HG1  4  
ATOM 6193  H HG21 . THR A 1 32 ? -12.517 2.499   8.306   1.00 0.00 ? 28 THR A HG21 4  
ATOM 6194  H HG22 . THR A 1 32 ? -13.264 3.844   9.169   1.00 0.00 ? 28 THR A HG22 4  
ATOM 6195  H HG23 . THR A 1 32 ? -12.256 2.687   10.040  1.00 0.00 ? 28 THR A HG23 4  
ATOM 6196  N N    . GLU A 1 33 ? -11.792 7.116   8.267   1.00 0.00 ? 29 GLU A N    4  
ATOM 6197  C CA   . GLU A 1 33 ? -12.609 8.289   8.548   1.00 0.00 ? 29 GLU A CA   4  
ATOM 6198  C C    . GLU A 1 33 ? -12.733 9.143   7.291   1.00 0.00 ? 29 GLU A C    4  
ATOM 6199  O O    . GLU A 1 33 ? -12.582 10.363  7.331   1.00 0.00 ? 29 GLU A O    4  
ATOM 6200  C CB   . GLU A 1 33 ? -12.015 9.119   9.694   1.00 0.00 ? 29 GLU A CB   4  
ATOM 6201  C CG   . GLU A 1 33 ? -11.150 8.321   10.654  1.00 0.00 ? 29 GLU A CG   4  
ATOM 6202  C CD   . GLU A 1 33 ? -9.704  8.257   10.203  1.00 0.00 ? 29 GLU A CD   4  
ATOM 6203  O OE1  . GLU A 1 33 ? -9.375  7.379   9.381   1.00 0.00 ? 29 GLU A OE1  4  
ATOM 6204  O OE2  . GLU A 1 33 ? -8.901  9.103   10.651  1.00 0.00 ? 29 GLU A OE2  4  
ATOM 6205  H H    . GLU A 1 33 ? -10.818 7.153   8.445   1.00 0.00 ? 29 GLU A H    4  
ATOM 6206  H HA   . GLU A 1 33 ? -13.592 7.944   8.835   1.00 0.00 ? 29 GLU A HA   4  
ATOM 6207  H HB2  . GLU A 1 33 ? -11.409 9.908   9.272   1.00 0.00 ? 29 GLU A HB2  4  
ATOM 6208  H HB3  . GLU A 1 33 ? -12.824 9.564   10.257  1.00 0.00 ? 29 GLU A HB3  4  
ATOM 6209  H HG2  . GLU A 1 33 ? -11.190 8.784   11.631  1.00 0.00 ? 29 GLU A HG2  4  
ATOM 6210  H HG3  . GLU A 1 33 ? -11.538 7.314   10.716  1.00 0.00 ? 29 GLU A HG3  4  
ATOM 6211  N N    . HIS A 1 34 ? -13.036 8.482   6.185   1.00 0.00 ? 30 HIS A N    4  
ATOM 6212  C CA   . HIS A 1 34 ? -13.186 9.125   4.884   1.00 0.00 ? 30 HIS A CA   4  
ATOM 6213  C C    . HIS A 1 34 ? -14.177 8.314   4.068   1.00 0.00 ? 30 HIS A C    4  
ATOM 6214  O O    . HIS A 1 34 ? -15.157 8.846   3.543   1.00 0.00 ? 30 HIS A O    4  
ATOM 6215  C CB   . HIS A 1 34 ? -11.843 9.209   4.145   1.00 0.00 ? 30 HIS A CB   4  
ATOM 6216  C CG   . HIS A 1 34 ? -11.032 10.421  4.484   1.00 0.00 ? 30 HIS A CG   4  
ATOM 6217  N ND1  . HIS A 1 34 ? -9.920  10.392  5.296   1.00 0.00 ? 30 HIS A ND1  4  
ATOM 6218  C CD2  . HIS A 1 34 ? -11.173 11.714  4.090   1.00 0.00 ? 30 HIS A CD2  4  
ATOM 6219  C CE1  . HIS A 1 34 ? -9.428  11.634  5.366   1.00 0.00 ? 30 HIS A CE1  4  
ATOM 6220  N NE2  . HIS A 1 34 ? -10.152 12.476  4.652   1.00 0.00 ? 30 HIS A NE2  4  
ATOM 6221  H H    . HIS A 1 34 ? -13.223 7.520   6.243   1.00 0.00 ? 30 HIS A H    4  
ATOM 6222  H HA   . HIS A 1 34 ? -13.579 10.121  5.037   1.00 0.00 ? 30 HIS A HA   4  
ATOM 6223  H HB2  . HIS A 1 34 ? -11.254 8.339   4.391   1.00 0.00 ? 30 HIS A HB2  4  
ATOM 6224  H HB3  . HIS A 1 34 ? -12.026 9.219   3.078   1.00 0.00 ? 30 HIS A HB3  4  
ATOM 6225  H HD1  . HIS A 1 34 ? -9.564  9.606   5.760   1.00 0.00 ? 30 HIS A HD1  4  
ATOM 6226  H HD2  . HIS A 1 34 ? -11.954 12.102  3.452   1.00 0.00 ? 30 HIS A HD2  4  
ATOM 6227  H HE1  . HIS A 1 34 ? -8.549  11.909  5.928   1.00 0.00 ? 30 HIS A HE1  4  
ATOM 6228  N N    . PHE A 1 35 ? -13.914 7.005   3.990   1.00 0.00 ? 31 PHE A N    4  
ATOM 6229  C CA   . PHE A 1 35 ? -14.788 6.071   3.279   1.00 0.00 ? 31 PHE A CA   4  
ATOM 6230  C C    . PHE A 1 35 ? -16.196 6.138   3.861   1.00 0.00 ? 31 PHE A C    4  
ATOM 6231  O O    . PHE A 1 35 ? -17.193 6.105   3.136   1.00 0.00 ? 31 PHE A O    4  
ATOM 6232  C CB   . PHE A 1 35 ? -14.284 4.626   3.425   1.00 0.00 ? 31 PHE A CB   4  
ATOM 6233  C CG   . PHE A 1 35 ? -13.112 4.243   2.558   1.00 0.00 ? 31 PHE A CG   4  
ATOM 6234  C CD1  . PHE A 1 35 ? -11.905 4.916   2.646   1.00 0.00 ? 31 PHE A CD1  4  
ATOM 6235  C CD2  . PHE A 1 35 ? -13.215 3.179   1.672   1.00 0.00 ? 31 PHE A CD2  4  
ATOM 6236  C CE1  . PHE A 1 35 ? -10.826 4.539   1.870   1.00 0.00 ? 31 PHE A CE1  4  
ATOM 6237  C CE2  . PHE A 1 35 ? -12.140 2.800   0.889   1.00 0.00 ? 31 PHE A CE2  4  
ATOM 6238  C CZ   . PHE A 1 35 ? -10.943 3.480   0.989   1.00 0.00 ? 31 PHE A CZ   4  
ATOM 6239  H H    . PHE A 1 35 ? -13.094 6.663   4.412   1.00 0.00 ? 31 PHE A H    4  
ATOM 6240  H HA   . PHE A 1 35 ? -14.814 6.346   2.236   1.00 0.00 ? 31 PHE A HA   4  
ATOM 6241  H HB2  . PHE A 1 35 ? -13.993 4.465   4.450   1.00 0.00 ? 31 PHE A HB2  4  
ATOM 6242  H HB3  . PHE A 1 35 ? -15.100 3.957   3.190   1.00 0.00 ? 31 PHE A HB3  4  
ATOM 6243  H HD1  . PHE A 1 35 ? -11.811 5.744   3.333   1.00 0.00 ? 31 PHE A HD1  4  
ATOM 6244  H HD2  . PHE A 1 35 ? -14.151 2.643   1.593   1.00 0.00 ? 31 PHE A HD2  4  
ATOM 6245  H HE1  . PHE A 1 35 ? -9.892  5.073   1.949   1.00 0.00 ? 31 PHE A HE1  4  
ATOM 6246  H HE2  . PHE A 1 35 ? -12.235 1.971   0.202   1.00 0.00 ? 31 PHE A HE2  4  
ATOM 6247  H HZ   . PHE A 1 35 ? -10.101 3.187   0.381   1.00 0.00 ? 31 PHE A HZ   4  
ATOM 6248  N N    . MET A 1 36 ? -16.249 6.244   5.186   1.00 0.00 ? 32 MET A N    4  
ATOM 6249  C CA   . MET A 1 36 ? -17.509 6.295   5.918   1.00 0.00 ? 32 MET A CA   4  
ATOM 6250  C C    . MET A 1 36 ? -18.336 7.516   5.532   1.00 0.00 ? 32 MET A C    4  
ATOM 6251  O O    . MET A 1 36 ? -19.555 7.419   5.377   1.00 0.00 ? 32 MET A O    4  
ATOM 6252  C CB   . MET A 1 36 ? -17.255 6.322   7.427   1.00 0.00 ? 32 MET A CB   4  
ATOM 6253  C CG   . MET A 1 36 ? -16.484 5.119   7.950   1.00 0.00 ? 32 MET A CG   4  
ATOM 6254  S SD   . MET A 1 36 ? -17.384 3.567   7.758   1.00 0.00 ? 32 MET A SD   4  
ATOM 6255  C CE   . MET A 1 36 ? -16.146 2.390   8.295   1.00 0.00 ? 32 MET A CE   4  
ATOM 6256  H H    . MET A 1 36 ? -15.411 6.300   5.689   1.00 0.00 ? 32 MET A H    4  
ATOM 6257  H HA   . MET A 1 36 ? -18.067 5.406   5.673   1.00 0.00 ? 32 MET A HA   4  
ATOM 6258  H HB2  . MET A 1 36 ? -16.693 7.214   7.670   1.00 0.00 ? 32 MET A HB2  4  
ATOM 6259  H HB3  . MET A 1 36 ? -18.207 6.360   7.934   1.00 0.00 ? 32 MET A HB3  4  
ATOM 6260  H HG2  . MET A 1 36 ? -15.550 5.043   7.414   1.00 0.00 ? 32 MET A HG2  4  
ATOM 6261  H HG3  . MET A 1 36 ? -16.281 5.273   9.000   1.00 0.00 ? 32 MET A HG3  4  
ATOM 6262  H HE1  . MET A 1 36 ? -15.768 2.682   9.264   1.00 0.00 ? 32 MET A HE1  4  
ATOM 6263  H HE2  . MET A 1 36 ? -15.334 2.370   7.583   1.00 0.00 ? 32 MET A HE2  4  
ATOM 6264  H HE3  . MET A 1 36 ? -16.590 1.407   8.362   1.00 0.00 ? 32 MET A HE3  4  
ATOM 6265  N N    . ALA A 1 37 ? -17.683 8.663   5.367   1.00 0.00 ? 33 ALA A N    4  
ATOM 6266  C CA   . ALA A 1 37 ? -18.382 9.890   5.015   1.00 0.00 ? 33 ALA A CA   4  
ATOM 6267  C C    . ALA A 1 37 ? -18.855 9.845   3.570   1.00 0.00 ? 33 ALA A C    4  
ATOM 6268  O O    . ALA A 1 37 ? -19.878 10.426  3.221   1.00 0.00 ? 33 ALA A O    4  
ATOM 6269  C CB   . ALA A 1 37 ? -17.474 11.093  5.233   1.00 0.00 ? 33 ALA A CB   4  
ATOM 6270  H H    . ALA A 1 37 ? -16.708 8.697   5.449   1.00 0.00 ? 33 ALA A H    4  
ATOM 6271  H HA   . ALA A 1 37 ? -19.239 9.990   5.666   1.00 0.00 ? 33 ALA A HA   4  
ATOM 6272  H HB1  . ALA A 1 37 ? -17.129 11.106  6.256   1.00 0.00 ? 33 ALA A HB1  4  
ATOM 6273  H HB2  . ALA A 1 37 ? -18.022 12.001  5.026   1.00 0.00 ? 33 ALA A HB2  4  
ATOM 6274  H HB3  . ALA A 1 37 ? -16.627 11.025  4.569   1.00 0.00 ? 33 ALA A HB3  4  
ATOM 6275  N N    . ALA A 1 38 ? -18.102 9.135   2.736   1.00 0.00 ? 34 ALA A N    4  
ATOM 6276  C CA   . ALA A 1 38 ? -18.433 9.000   1.322   1.00 0.00 ? 34 ALA A CA   4  
ATOM 6277  C C    . ALA A 1 38 ? -19.648 8.093   1.115   1.00 0.00 ? 34 ALA A C    4  
ATOM 6278  O O    . ALA A 1 38 ? -20.158 7.967   0.001   1.00 0.00 ? 34 ALA A O    4  
ATOM 6279  C CB   . ALA A 1 38 ? -17.233 8.467   0.559   1.00 0.00 ? 34 ALA A CB   4  
ATOM 6280  H H    . ALA A 1 38 ? -17.291 8.697   3.080   1.00 0.00 ? 34 ALA A H    4  
ATOM 6281  H HA   . ALA A 1 38 ? -18.663 9.983   0.939   1.00 0.00 ? 34 ALA A HA   4  
ATOM 6282  H HB1  . ALA A 1 38 ? -16.407 9.156   0.660   1.00 0.00 ? 34 ALA A HB1  4  
ATOM 6283  H HB2  . ALA A 1 38 ? -17.487 8.358   -0.486  1.00 0.00 ? 34 ALA A HB2  4  
ATOM 6284  H HB3  . ALA A 1 38 ? -16.949 7.506   0.962   1.00 0.00 ? 34 ALA A HB3  4  
ATOM 6285  N N    . GLY A 1 39 ? -20.101 7.455   2.191   1.00 0.00 ? 35 GLY A N    4  
ATOM 6286  C CA   . GLY A 1 39 ? -21.260 6.583   2.107   1.00 0.00 ? 35 GLY A CA   4  
ATOM 6287  C C    . GLY A 1 39 ? -20.897 5.114   2.079   1.00 0.00 ? 35 GLY A C    4  
ATOM 6288  O O    . GLY A 1 39 ? -21.774 4.249   2.115   1.00 0.00 ? 35 GLY A O    4  
ATOM 6289  H H    . GLY A 1 39 ? -19.651 7.589   3.052   1.00 0.00 ? 35 GLY A H    4  
ATOM 6290  H HA2  . GLY A 1 39 ? -21.895 6.765   2.959   1.00 0.00 ? 35 GLY A HA2  4  
ATOM 6291  H HA3  . GLY A 1 39 ? -21.809 6.820   1.207   1.00 0.00 ? 35 GLY A HA3  4  
ATOM 6292  N N    . TYR A 1 40 ? -19.609 4.824   2.021   1.00 0.00 ? 36 TYR A N    4  
ATOM 6293  C CA   . TYR A 1 40 ? -19.147 3.447   1.984   1.00 0.00 ? 36 TYR A CA   4  
ATOM 6294  C C    . TYR A 1 40 ? -18.937 2.934   3.400   1.00 0.00 ? 36 TYR A C    4  
ATOM 6295  O O    . TYR A 1 40 ? -17.813 2.877   3.897   1.00 0.00 ? 36 TYR A O    4  
ATOM 6296  C CB   . TYR A 1 40 ? -17.854 3.341   1.168   1.00 0.00 ? 36 TYR A CB   4  
ATOM 6297  C CG   . TYR A 1 40 ? -17.987 3.881   -0.240  1.00 0.00 ? 36 TYR A CG   4  
ATOM 6298  C CD1  . TYR A 1 40 ? -18.736 3.206   -1.189  1.00 0.00 ? 36 TYR A CD1  4  
ATOM 6299  C CD2  . TYR A 1 40 ? -17.370 5.068   -0.615  1.00 0.00 ? 36 TYR A CD2  4  
ATOM 6300  C CE1  . TYR A 1 40 ? -18.872 3.693   -2.474  1.00 0.00 ? 36 TYR A CE1  4  
ATOM 6301  C CE2  . TYR A 1 40 ? -17.499 5.562   -1.900  1.00 0.00 ? 36 TYR A CE2  4  
ATOM 6302  C CZ   . TYR A 1 40 ? -18.252 4.870   -2.826  1.00 0.00 ? 36 TYR A CZ   4  
ATOM 6303  O OH   . TYR A 1 40 ? -18.388 5.361   -4.105  1.00 0.00 ? 36 TYR A OH   4  
ATOM 6304  H H    . TYR A 1 40 ? -18.947 5.546   2.016   1.00 0.00 ? 36 TYR A H    4  
ATOM 6305  H HA   . TYR A 1 40 ? -19.914 2.853   1.510   1.00 0.00 ? 36 TYR A HA   4  
ATOM 6306  H HB2  . TYR A 1 40 ? -17.074 3.896   1.666   1.00 0.00 ? 36 TYR A HB2  4  
ATOM 6307  H HB3  . TYR A 1 40 ? -17.565 2.303   1.100   1.00 0.00 ? 36 TYR A HB3  4  
ATOM 6308  H HD1  . TYR A 1 40 ? -19.220 2.281   -0.913  1.00 0.00 ? 36 TYR A HD1  4  
ATOM 6309  H HD2  . TYR A 1 40 ? -16.781 5.606   0.112   1.00 0.00 ? 36 TYR A HD2  4  
ATOM 6310  H HE1  . TYR A 1 40 ? -19.461 3.148   -3.197  1.00 0.00 ? 36 TYR A HE1  4  
ATOM 6311  H HE2  . TYR A 1 40 ? -17.012 6.487   -2.174  1.00 0.00 ? 36 TYR A HE2  4  
ATOM 6312  H HH   . TYR A 1 40 ? -17.611 5.917   -4.320  1.00 0.00 ? 36 TYR A HH   4  
ATOM 6313  N N    . THR A 1 41 ? -20.035 2.569   4.048   1.00 0.00 ? 37 THR A N    4  
ATOM 6314  C CA   . THR A 1 41 ? -19.994 2.075   5.416   1.00 0.00 ? 37 THR A CA   4  
ATOM 6315  C C    . THR A 1 41 ? -20.152 0.557   5.468   1.00 0.00 ? 37 THR A C    4  
ATOM 6316  O O    . THR A 1 41 ? -20.183 -0.038  6.544   1.00 0.00 ? 37 THR A O    4  
ATOM 6317  C CB   . THR A 1 41 ? -21.106 2.728   6.253   1.00 0.00 ? 37 THR A CB   4  
ATOM 6318  O OG1  . THR A 1 41 ? -22.305 2.825   5.470   1.00 0.00 ? 37 THR A OG1  4  
ATOM 6319  C CG2  . THR A 1 41 ? -20.693 4.115   6.725   1.00 0.00 ? 37 THR A CG2  4  
ATOM 6320  H H    . THR A 1 41 ? -20.904 2.635   3.598   1.00 0.00 ? 37 THR A H    4  
ATOM 6321  H HA   . THR A 1 41 ? -19.041 2.346   5.844   1.00 0.00 ? 37 THR A HA   4  
ATOM 6322  H HB   . THR A 1 41 ? -21.297 2.110   7.119   1.00 0.00 ? 37 THR A HB   4  
ATOM 6323  H HG1  . THR A 1 41 ? -22.703 3.695   5.604   1.00 0.00 ? 37 THR A HG1  4  
ATOM 6324  H HG21 . THR A 1 41 ? -21.498 4.556   7.293   1.00 0.00 ? 37 THR A HG21 4  
ATOM 6325  H HG22 . THR A 1 41 ? -20.475 4.736   5.869   1.00 0.00 ? 37 THR A HG22 4  
ATOM 6326  H HG23 . THR A 1 41 ? -19.814 4.038   7.347   1.00 0.00 ? 37 THR A HG23 4  
ATOM 6327  N N    . ALA A 1 42 ? -20.236 -0.065  4.299   1.00 0.00 ? 38 ALA A N    4  
ATOM 6328  C CA   . ALA A 1 42 ? -20.396 -1.508  4.210   1.00 0.00 ? 38 ALA A CA   4  
ATOM 6329  C C    . ALA A 1 42 ? -19.657 -2.045  2.994   1.00 0.00 ? 38 ALA A C    4  
ATOM 6330  O O    . ALA A 1 42 ? -19.537 -1.351  1.981   1.00 0.00 ? 38 ALA A O    4  
ATOM 6331  C CB   . ALA A 1 42 ? -21.868 -1.886  4.160   1.00 0.00 ? 38 ALA A CB   4  
ATOM 6332  H H    . ALA A 1 42 ? -20.151 0.457   3.476   1.00 0.00 ? 38 ALA A H    4  
ATOM 6333  H HA   . ALA A 1 42 ? -19.966 -1.944  5.101   1.00 0.00 ? 38 ALA A HA   4  
ATOM 6334  H HB1  . ALA A 1 42 ? -22.376 -1.472  5.019   1.00 0.00 ? 38 ALA A HB1  4  
ATOM 6335  H HB2  . ALA A 1 42 ? -21.964 -2.961  4.169   1.00 0.00 ? 38 ALA A HB2  4  
ATOM 6336  H HB3  . ALA A 1 42 ? -22.310 -1.493  3.257   1.00 0.00 ? 38 ALA A HB3  4  
ATOM 6337  N N    . ILE A 1 43 ? -19.179 -3.282  3.099   1.00 0.00 ? 39 ILE A N    4  
ATOM 6338  C CA   . ILE A 1 43 ? -18.425 -3.936  2.028   1.00 0.00 ? 39 ILE A CA   4  
ATOM 6339  C C    . ILE A 1 43 ? -19.166 -3.898  0.692   1.00 0.00 ? 39 ILE A C    4  
ATOM 6340  O O    . ILE A 1 43 ? -18.552 -3.669  -0.351  1.00 0.00 ? 39 ILE A O    4  
ATOM 6341  C CB   . ILE A 1 43 ? -18.096 -5.403  2.394   1.00 0.00 ? 39 ILE A CB   4  
ATOM 6342  C CG1  . ILE A 1 43 ? -17.192 -5.460  3.631   1.00 0.00 ? 39 ILE A CG1  4  
ATOM 6343  C CG2  . ILE A 1 43 ? -17.439 -6.125  1.223   1.00 0.00 ? 39 ILE A CG2  4  
ATOM 6344  C CD1  . ILE A 1 43 ? -15.871 -4.735  3.466   1.00 0.00 ? 39 ILE A CD1  4  
ATOM 6345  H H    . ILE A 1 43 ? -19.338 -3.777  3.933   1.00 0.00 ? 39 ILE A H    4  
ATOM 6346  H HA   . ILE A 1 43 ? -17.492 -3.405  1.917   1.00 0.00 ? 39 ILE A HA   4  
ATOM 6347  H HB   . ILE A 1 43 ? -19.024 -5.909  2.616   1.00 0.00 ? 39 ILE A HB   4  
ATOM 6348  H HG12 . ILE A 1 43 ? -17.708 -5.013  4.466   1.00 0.00 ? 39 ILE A HG12 4  
ATOM 6349  H HG13 . ILE A 1 43 ? -16.975 -6.493  3.861   1.00 0.00 ? 39 ILE A HG13 4  
ATOM 6350  H HG21 . ILE A 1 43 ? -17.273 -7.160  1.485   1.00 0.00 ? 39 ILE A HG21 4  
ATOM 6351  H HG22 . ILE A 1 43 ? -16.493 -5.655  0.997   1.00 0.00 ? 39 ILE A HG22 4  
ATOM 6352  H HG23 . ILE A 1 43 ? -18.083 -6.071  0.359   1.00 0.00 ? 39 ILE A HG23 4  
ATOM 6353  H HD11 . ILE A 1 43 ? -16.053 -3.679  3.334   1.00 0.00 ? 39 ILE A HD11 4  
ATOM 6354  H HD12 . ILE A 1 43 ? -15.354 -5.121  2.601   1.00 0.00 ? 39 ILE A HD12 4  
ATOM 6355  H HD13 . ILE A 1 43 ? -15.263 -4.887  4.346   1.00 0.00 ? 39 ILE A HD13 4  
ATOM 6356  N N    . GLU A 1 44 ? -20.483 -4.098  0.725   1.00 0.00 ? 40 GLU A N    4  
ATOM 6357  C CA   . GLU A 1 44 ? -21.286 -4.090  -0.498  1.00 0.00 ? 40 GLU A CA   4  
ATOM 6358  C C    . GLU A 1 44 ? -21.116 -2.785  -1.267  1.00 0.00 ? 40 GLU A C    4  
ATOM 6359  O O    . GLU A 1 44 ? -21.048 -2.787  -2.492  1.00 0.00 ? 40 GLU A O    4  
ATOM 6360  C CB   . GLU A 1 44 ? -22.774 -4.310  -0.197  1.00 0.00 ? 40 GLU A CB   4  
ATOM 6361  C CG   . GLU A 1 44 ? -23.116 -4.393  1.281   1.00 0.00 ? 40 GLU A CG   4  
ATOM 6362  C CD   . GLU A 1 44 ? -24.606 -4.293  1.528   1.00 0.00 ? 40 GLU A CD   4  
ATOM 6363  O OE1  . GLU A 1 44 ? -25.290 -5.337  1.527   1.00 0.00 ? 40 GLU A OE1  4  
ATOM 6364  O OE2  . GLU A 1 44 ? -25.104 -3.164  1.709   1.00 0.00 ? 40 GLU A OE2  4  
ATOM 6365  H H    . GLU A 1 44 ? -20.929 -4.255  1.583   1.00 0.00 ? 40 GLU A H    4  
ATOM 6366  H HA   . GLU A 1 44 ? -20.936 -4.901  -1.120  1.00 0.00 ? 40 GLU A HA   4  
ATOM 6367  H HB2  . GLU A 1 44 ? -23.335 -3.492  -0.622  1.00 0.00 ? 40 GLU A HB2  4  
ATOM 6368  H HB3  . GLU A 1 44 ? -23.091 -5.230  -0.668  1.00 0.00 ? 40 GLU A HB3  4  
ATOM 6369  H HG2  . GLU A 1 44 ? -22.762 -5.338  1.669   1.00 0.00 ? 40 GLU A HG2  4  
ATOM 6370  H HG3  . GLU A 1 44 ? -22.624 -3.583  1.799   1.00 0.00 ? 40 GLU A HG3  4  
ATOM 6371  N N    . LYS A 1 45 ? -21.034 -1.675  -0.545  1.00 0.00 ? 41 LYS A N    4  
ATOM 6372  C CA   . LYS A 1 45 ? -20.872 -0.370  -1.175  1.00 0.00 ? 41 LYS A CA   4  
ATOM 6373  C C    . LYS A 1 45 ? -19.422 -0.156  -1.587  1.00 0.00 ? 41 LYS A C    4  
ATOM 6374  O O    . LYS A 1 45 ? -19.142 0.441   -2.625  1.00 0.00 ? 41 LYS A O    4  
ATOM 6375  C CB   . LYS A 1 45 ? -21.314 0.751   -0.230  1.00 0.00 ? 41 LYS A CB   4  
ATOM 6376  C CG   . LYS A 1 45 ? -22.795 0.725   0.113   1.00 0.00 ? 41 LYS A CG   4  
ATOM 6377  C CD   . LYS A 1 45 ? -23.053 0.014   1.430   1.00 0.00 ? 41 LYS A CD   4  
ATOM 6378  C CE   . LYS A 1 45 ? -24.494 0.180   1.884   1.00 0.00 ? 41 LYS A CE   4  
ATOM 6379  N NZ   . LYS A 1 45 ? -25.437 -0.626  1.065   1.00 0.00 ? 41 LYS A NZ   4  
ATOM 6380  H H    . LYS A 1 45 ? -21.069 -1.734  0.431   1.00 0.00 ? 41 LYS A H    4  
ATOM 6381  H HA   . LYS A 1 45 ? -21.492 -0.349  -2.059  1.00 0.00 ? 41 LYS A HA   4  
ATOM 6382  H HB2  . LYS A 1 45 ? -20.753 0.672   0.689   1.00 0.00 ? 41 LYS A HB2  4  
ATOM 6383  H HB3  . LYS A 1 45 ? -21.094 1.701   -0.692  1.00 0.00 ? 41 LYS A HB3  4  
ATOM 6384  H HG2  . LYS A 1 45 ? -23.153 1.740   0.189   1.00 0.00 ? 41 LYS A HG2  4  
ATOM 6385  H HG3  . LYS A 1 45 ? -23.327 0.211   -0.674  1.00 0.00 ? 41 LYS A HG3  4  
ATOM 6386  H HD2  . LYS A 1 45 ? -22.846 -1.038  1.305   1.00 0.00 ? 41 LYS A HD2  4  
ATOM 6387  H HD3  . LYS A 1 45 ? -22.398 0.425   2.184   1.00 0.00 ? 41 LYS A HD3  4  
ATOM 6388  H HE2  . LYS A 1 45 ? -24.572 -0.132  2.914   1.00 0.00 ? 41 LYS A HE2  4  
ATOM 6389  H HE3  . LYS A 1 45 ? -24.765 1.224   1.804   1.00 0.00 ? 41 LYS A HE3  4  
ATOM 6390  H HZ1  . LYS A 1 45 ? -25.311 -1.645  1.269   1.00 0.00 ? 41 LYS A HZ1  4  
ATOM 6391  H HZ2  . LYS A 1 45 ? -25.268 -0.464  0.053   1.00 0.00 ? 41 LYS A HZ2  4  
ATOM 6392  H HZ3  . LYS A 1 45 ? -26.419 -0.362  1.285   1.00 0.00 ? 41 LYS A HZ3  4  
ATOM 6393  N N    . VAL A 1 46 ? -18.504 -0.658  -0.769  1.00 0.00 ? 42 VAL A N    4  
ATOM 6394  C CA   . VAL A 1 46 ? -17.076 -0.523  -1.030  1.00 0.00 ? 42 VAL A CA   4  
ATOM 6395  C C    . VAL A 1 46 ? -16.698 -1.135  -2.379  1.00 0.00 ? 42 VAL A C    4  
ATOM 6396  O O    . VAL A 1 46 ? -15.940 -0.547  -3.145  1.00 0.00 ? 42 VAL A O    4  
ATOM 6397  C CB   . VAL A 1 46 ? -16.235 -1.183  0.089   1.00 0.00 ? 42 VAL A CB   4  
ATOM 6398  C CG1  . VAL A 1 46 ? -14.751 -1.165  -0.252  1.00 0.00 ? 42 VAL A CG1  4  
ATOM 6399  C CG2  . VAL A 1 46 ? -16.478 -0.489  1.421   1.00 0.00 ? 42 VAL A CG2  4  
ATOM 6400  H H    . VAL A 1 46 ? -18.798 -1.138  0.036   1.00 0.00 ? 42 VAL A H    4  
ATOM 6401  H HA   . VAL A 1 46 ? -16.842 0.532   -1.050  1.00 0.00 ? 42 VAL A HA   4  
ATOM 6402  H HB   . VAL A 1 46 ? -16.546 -2.213  0.184   1.00 0.00 ? 42 VAL A HB   4  
ATOM 6403  H HG11 . VAL A 1 46 ? -14.207 -1.743  0.480   1.00 0.00 ? 42 VAL A HG11 4  
ATOM 6404  H HG12 . VAL A 1 46 ? -14.393 -0.146  -0.244  1.00 0.00 ? 42 VAL A HG12 4  
ATOM 6405  H HG13 . VAL A 1 46 ? -14.602 -1.592  -1.232  1.00 0.00 ? 42 VAL A HG13 4  
ATOM 6406  H HG21 . VAL A 1 46 ? -17.527 -0.545  1.670   1.00 0.00 ? 42 VAL A HG21 4  
ATOM 6407  H HG22 . VAL A 1 46 ? -16.180 0.546   1.347   1.00 0.00 ? 42 VAL A HG22 4  
ATOM 6408  H HG23 . VAL A 1 46 ? -15.899 -0.977  2.192   1.00 0.00 ? 42 VAL A HG23 4  
ATOM 6409  N N    . VAL A 1 47 ? -17.255 -2.300  -2.678  1.00 0.00 ? 43 VAL A N    4  
ATOM 6410  C CA   . VAL A 1 47 ? -16.956 -2.979  -3.935  1.00 0.00 ? 43 VAL A CA   4  
ATOM 6411  C C    . VAL A 1 47 ? -17.685 -2.334  -5.113  1.00 0.00 ? 43 VAL A C    4  
ATOM 6412  O O    . VAL A 1 47 ? -17.412 -2.659  -6.269  1.00 0.00 ? 43 VAL A O    4  
ATOM 6413  C CB   . VAL A 1 47 ? -17.311 -4.482  -3.875  1.00 0.00 ? 43 VAL A CB   4  
ATOM 6414  C CG1  . VAL A 1 47 ? -16.597 -5.149  -2.711  1.00 0.00 ? 43 VAL A CG1  4  
ATOM 6415  C CG2  . VAL A 1 47 ? -18.815 -4.690  -3.772  1.00 0.00 ? 43 VAL A CG2  4  
ATOM 6416  H H    . VAL A 1 47 ? -17.875 -2.718  -2.040  1.00 0.00 ? 43 VAL A H    4  
ATOM 6417  H HA   . VAL A 1 47 ? -15.893 -2.895  -4.104  1.00 0.00 ? 43 VAL A HA   4  
ATOM 6418  H HB   . VAL A 1 47 ? -16.967 -4.946  -4.788  1.00 0.00 ? 43 VAL A HB   4  
ATOM 6419  H HG11 . VAL A 1 47 ? -15.546 -4.904  -2.746  1.00 0.00 ? 43 VAL A HG11 4  
ATOM 6420  H HG12 . VAL A 1 47 ? -16.720 -6.220  -2.779  1.00 0.00 ? 43 VAL A HG12 4  
ATOM 6421  H HG13 . VAL A 1 47 ? -17.019 -4.796  -1.781  1.00 0.00 ? 43 VAL A HG13 4  
ATOM 6422  H HG21 . VAL A 1 47 ? -19.187 -4.201  -2.884  1.00 0.00 ? 43 VAL A HG21 4  
ATOM 6423  H HG22 . VAL A 1 47 ? -19.029 -5.748  -3.716  1.00 0.00 ? 43 VAL A HG22 4  
ATOM 6424  H HG23 . VAL A 1 47 ? -19.297 -4.271  -4.643  1.00 0.00 ? 43 VAL A HG23 4  
ATOM 6425  N N    . GLN A 1 48 ? -18.595 -1.412  -4.821  1.00 0.00 ? 44 GLN A N    4  
ATOM 6426  C CA   . GLN A 1 48 ? -19.359 -0.736  -5.862  1.00 0.00 ? 44 GLN A CA   4  
ATOM 6427  C C    . GLN A 1 48 ? -18.587 0.447   -6.435  1.00 0.00 ? 44 GLN A C    4  
ATOM 6428  O O    . GLN A 1 48 ? -18.808 0.841   -7.581  1.00 0.00 ? 44 GLN A O    4  
ATOM 6429  C CB   . GLN A 1 48 ? -20.706 -0.261  -5.317  1.00 0.00 ? 44 GLN A CB   4  
ATOM 6430  C CG   . GLN A 1 48 ? -21.735 -1.371  -5.190  1.00 0.00 ? 44 GLN A CG   4  
ATOM 6431  C CD   . GLN A 1 48 ? -22.955 -0.950  -4.394  1.00 0.00 ? 44 GLN A CD   4  
ATOM 6432  O OE1  . GLN A 1 48 ? -23.334 0.221   -4.381  1.00 0.00 ? 44 GLN A OE1  4  
ATOM 6433  N NE2  . GLN A 1 48 ? -23.577 -1.903  -3.722  1.00 0.00 ? 44 GLN A NE2  4  
ATOM 6434  H H    . GLN A 1 48 ? -18.753 -1.177  -3.882  1.00 0.00 ? 44 GLN A H    4  
ATOM 6435  H HA   . GLN A 1 48 ? -19.535 -1.449  -6.655  1.00 0.00 ? 44 GLN A HA   4  
ATOM 6436  H HB2  . GLN A 1 48 ? -20.552 0.172   -4.339  1.00 0.00 ? 44 GLN A HB2  4  
ATOM 6437  H HB3  . GLN A 1 48 ? -21.102 0.497   -5.977  1.00 0.00 ? 44 GLN A HB3  4  
ATOM 6438  H HG2  . GLN A 1 48 ? -22.054 -1.663  -6.180  1.00 0.00 ? 44 GLN A HG2  4  
ATOM 6439  H HG3  . GLN A 1 48 ? -21.276 -2.214  -4.697  1.00 0.00 ? 44 GLN A HG3  4  
ATOM 6440  H HE21 . GLN A 1 48 ? -23.220 -2.813  -3.774  1.00 0.00 ? 44 GLN A HE21 4  
ATOM 6441  H HE22 . GLN A 1 48 ? -24.369 -1.659  -3.196  1.00 0.00 ? 44 GLN A HE22 4  
ATOM 6442  N N    . MET A 1 49 ? -17.683 1.008   -5.634  1.00 0.00 ? 45 MET A N    4  
ATOM 6443  C CA   . MET A 1 49 ? -16.878 2.150   -6.065  1.00 0.00 ? 45 MET A CA   4  
ATOM 6444  C C    . MET A 1 49 ? -15.959 1.782   -7.233  1.00 0.00 ? 45 MET A C    4  
ATOM 6445  O O    . MET A 1 49 ? -15.894 0.621   -7.652  1.00 0.00 ? 45 MET A O    4  
ATOM 6446  C CB   . MET A 1 49 ? -16.048 2.702   -4.898  1.00 0.00 ? 45 MET A CB   4  
ATOM 6447  C CG   . MET A 1 49 ? -14.792 1.901   -4.596  1.00 0.00 ? 45 MET A CG   4  
ATOM 6448  S SD   . MET A 1 49 ? -13.734 2.694   -3.370  1.00 0.00 ? 45 MET A SD   4  
ATOM 6449  C CE   . MET A 1 49 ? -14.759 2.573   -1.906  1.00 0.00 ? 45 MET A CE   4  
ATOM 6450  H H    . MET A 1 49 ? -17.578 0.663   -4.724  1.00 0.00 ? 45 MET A H    4  
ATOM 6451  H HA   . MET A 1 49 ? -17.559 2.919   -6.397  1.00 0.00 ? 45 MET A HA   4  
ATOM 6452  H HB2  . MET A 1 49 ? -15.755 3.716   -5.130  1.00 0.00 ? 45 MET A HB2  4  
ATOM 6453  H HB3  . MET A 1 49 ? -16.664 2.713   -4.009  1.00 0.00 ? 45 MET A HB3  4  
ATOM 6454  H HG2  . MET A 1 49 ? -15.082 0.930   -4.226  1.00 0.00 ? 45 MET A HG2  4  
ATOM 6455  H HG3  . MET A 1 49 ? -14.230 1.782   -5.512  1.00 0.00 ? 45 MET A HG3  4  
ATOM 6456  H HE1  . MET A 1 49 ? -14.241 3.013   -1.067  1.00 0.00 ? 45 MET A HE1  4  
ATOM 6457  H HE2  . MET A 1 49 ? -14.966 1.535   -1.698  1.00 0.00 ? 45 MET A HE2  4  
ATOM 6458  H HE3  . MET A 1 49 ? -15.688 3.100   -2.072  1.00 0.00 ? 45 MET A HE3  4  
ATOM 6459  N N    . THR A 1 50 ? -15.221 2.766   -7.722  1.00 0.00 ? 46 THR A N    4  
ATOM 6460  C CA   . THR A 1 50 ? -14.322 2.559   -8.842  1.00 0.00 ? 46 THR A CA   4  
ATOM 6461  C C    . THR A 1 50 ? -12.952 3.167   -8.530  1.00 0.00 ? 46 THR A C    4  
ATOM 6462  O O    . THR A 1 50 ? -12.781 3.815   -7.498  1.00 0.00 ? 46 THR A O    4  
ATOM 6463  C CB   . THR A 1 50 ? -14.899 3.165   -10.145 1.00 0.00 ? 46 THR A CB   4  
ATOM 6464  O OG1  . THR A 1 50 ? -14.156 2.700   -11.277 1.00 0.00 ? 46 THR A OG1  4  
ATOM 6465  C CG2  . THR A 1 50 ? -14.874 4.688   -10.110 1.00 0.00 ? 46 THR A CG2  4  
ATOM 6466  H H    . THR A 1 50 ? -15.232 3.641   -7.283  1.00 0.00 ? 46 THR A H    4  
ATOM 6467  H HA   . THR A 1 50 ? -14.206 1.495   -8.984  1.00 0.00 ? 46 THR A HA   4  
ATOM 6468  H HB   . THR A 1 50 ? -15.926 2.842   -10.246 1.00 0.00 ? 46 THR A HB   4  
ATOM 6469  H HG1  . THR A 1 50 ? -14.729 2.157   -11.836 1.00 0.00 ? 46 THR A HG1  4  
ATOM 6470  H HG21 . THR A 1 50 ? -13.862 5.027   -9.942  1.00 0.00 ? 46 THR A HG21 4  
ATOM 6471  H HG22 . THR A 1 50 ? -15.509 5.041   -9.312  1.00 0.00 ? 46 THR A HG22 4  
ATOM 6472  H HG23 . THR A 1 50 ? -15.231 5.076   -11.053 1.00 0.00 ? 46 THR A HG23 4  
ATOM 6473  N N    . ASN A 1 51 ? -11.991 2.955   -9.425  1.00 0.00 ? 47 ASN A N    4  
ATOM 6474  C CA   . ASN A 1 51 ? -10.627 3.461   -9.250  1.00 0.00 ? 47 ASN A CA   4  
ATOM 6475  C C    . ASN A 1 51 ? -10.601 4.968   -9.019  1.00 0.00 ? 47 ASN A C    4  
ATOM 6476  O O    . ASN A 1 51 ? -9.930  5.453   -8.110  1.00 0.00 ? 47 ASN A O    4  
ATOM 6477  C CB   . ASN A 1 51 ? -9.769  3.130   -10.475 1.00 0.00 ? 47 ASN A CB   4  
ATOM 6478  C CG   . ASN A 1 51 ? -9.657  1.641   -10.731 1.00 0.00 ? 47 ASN A CG   4  
ATOM 6479  O OD1  . ASN A 1 51 ? -10.529 1.043   -11.361 1.00 0.00 ? 47 ASN A OD1  4  
ATOM 6480  N ND2  . ASN A 1 51 ? -8.578  1.036   -10.261 1.00 0.00 ? 47 ASN A ND2  4  
ATOM 6481  H H    . ASN A 1 51 ? -12.206 2.429   -10.229 1.00 0.00 ? 47 ASN A H    4  
ATOM 6482  H HA   . ASN A 1 51 ? -10.202 2.971   -8.386  1.00 0.00 ? 47 ASN A HA   4  
ATOM 6483  H HB2  . ASN A 1 51 ? -10.207 3.591   -11.347 1.00 0.00 ? 47 ASN A HB2  4  
ATOM 6484  H HB3  . ASN A 1 51 ? -8.776  3.527   -10.328 1.00 0.00 ? 47 ASN A HB3  4  
ATOM 6485  H HD21 . ASN A 1 51 ? -7.917  1.573   -9.779  1.00 0.00 ? 47 ASN A HD21 4  
ATOM 6486  H HD22 . ASN A 1 51 ? -8.483  0.069   -10.417 1.00 0.00 ? 47 ASN A HD22 4  
ATOM 6487  N N    . ASP A 1 52 ? -11.343 5.700   -9.837  1.00 0.00 ? 48 ASP A N    4  
ATOM 6488  C CA   . ASP A 1 52 ? -11.386 7.157   -9.737  1.00 0.00 ? 48 ASP A CA   4  
ATOM 6489  C C    . ASP A 1 52 ? -12.026 7.618   -8.427  1.00 0.00 ? 48 ASP A C    4  
ATOM 6490  O O    . ASP A 1 52 ? -11.654 8.657   -7.879  1.00 0.00 ? 48 ASP A O    4  
ATOM 6491  C CB   . ASP A 1 52 ? -12.150 7.744   -10.923 1.00 0.00 ? 48 ASP A CB   4  
ATOM 6492  C CG   . ASP A 1 52 ? -11.706 9.154   -11.249 1.00 0.00 ? 48 ASP A CG   4  
ATOM 6493  O OD1  . ASP A 1 52 ? -10.597 9.315   -11.800 1.00 0.00 ? 48 ASP A OD1  4  
ATOM 6494  O OD2  . ASP A 1 52 ? -12.467 10.102  -10.965 1.00 0.00 ? 48 ASP A OD2  4  
ATOM 6495  H H    . ASP A 1 52 ? -11.863 5.257   -10.539 1.00 0.00 ? 48 ASP A H    4  
ATOM 6496  H HA   . ASP A 1 52 ? -10.369 7.518   -9.768  1.00 0.00 ? 48 ASP A HA   4  
ATOM 6497  H HB2  . ASP A 1 52 ? -11.987 7.124   -11.792 1.00 0.00 ? 48 ASP A HB2  4  
ATOM 6498  H HB3  . ASP A 1 52 ? -13.204 7.763   -10.690 1.00 0.00 ? 48 ASP A HB3  4  
ATOM 6499  N N    . ASP A 1 53 ? -12.970 6.832   -7.921  1.00 0.00 ? 49 ASP A N    4  
ATOM 6500  C CA   . ASP A 1 53 ? -13.670 7.158   -6.680  1.00 0.00 ? 49 ASP A CA   4  
ATOM 6501  C C    . ASP A 1 53 ? -12.697 7.230   -5.508  1.00 0.00 ? 49 ASP A C    4  
ATOM 6502  O O    . ASP A 1 53 ? -12.853 8.051   -4.602  1.00 0.00 ? 49 ASP A O    4  
ATOM 6503  C CB   . ASP A 1 53 ? -14.747 6.112   -6.393  1.00 0.00 ? 49 ASP A CB   4  
ATOM 6504  C CG   . ASP A 1 53 ? -16.091 6.734   -6.077  1.00 0.00 ? 49 ASP A CG   4  
ATOM 6505  O OD1  . ASP A 1 53 ? -16.835 7.059   -7.027  1.00 0.00 ? 49 ASP A OD1  4  
ATOM 6506  O OD2  . ASP A 1 53 ? -16.413 6.883   -4.884  1.00 0.00 ? 49 ASP A OD2  4  
ATOM 6507  H H    . ASP A 1 53 ? -13.209 6.010   -8.394  1.00 0.00 ? 49 ASP A H    4  
ATOM 6508  H HA   . ASP A 1 53 ? -14.140 8.123   -6.803  1.00 0.00 ? 49 ASP A HA   4  
ATOM 6509  H HB2  . ASP A 1 53 ? -14.862 5.476   -7.258  1.00 0.00 ? 49 ASP A HB2  4  
ATOM 6510  H HB3  . ASP A 1 53 ? -14.441 5.512   -5.548  1.00 0.00 ? 49 ASP A HB3  4  
ATOM 6511  N N    . ILE A 1 54 ? -11.679 6.391   -5.543  1.00 0.00 ? 50 ILE A N    4  
ATOM 6512  C CA   . ILE A 1 54 ? -10.649 6.350   -4.509  1.00 0.00 ? 50 ILE A CA   4  
ATOM 6513  C C    . ILE A 1 54 ? -9.963  7.688   -4.376  1.00 0.00 ? 50 ILE A C    4  
ATOM 6514  O O    . ILE A 1 54 ? -9.525  8.090   -3.291  1.00 0.00 ? 50 ILE A O    4  
ATOM 6515  C CB   . ILE A 1 54 ? -9.614  5.182   -4.773  1.00 0.00 ? 50 ILE A CB   4  
ATOM 6516  C CG1  . ILE A 1 54 ? -10.199 3.743   -4.605  1.00 0.00 ? 50 ILE A CG1  4  
ATOM 6517  C CG2  . ILE A 1 54 ? -8.336  5.292   -3.884  1.00 0.00 ? 50 ILE A CG2  4  
ATOM 6518  C CD1  . ILE A 1 54 ? -9.303  2.590   -5.103  1.00 0.00 ? 50 ILE A CD1  4  
ATOM 6519  H H    . ILE A 1 54 ? -11.611 5.760   -6.306  1.00 0.00 ? 50 ILE A H    4  
ATOM 6520  H HA   . ILE A 1 54 ? -11.152 6.158   -3.544  1.00 0.00 ? 50 ILE A HA   4  
ATOM 6521  H HB   . ILE A 1 54 ? -9.293  5.274   -5.832  1.00 0.00 ? 50 ILE A HB   4  
ATOM 6522  H HG12 . ILE A 1 54 ? -10.494 3.569   -3.551  1.00 0.00 ? 50 ILE A HG12 4  
ATOM 6523  H HG13 . ILE A 1 54 ? -11.144 3.659   -5.173  1.00 0.00 ? 50 ILE A HG13 4  
ATOM 6524  H HG21 . ILE A 1 54 ? -7.787  6.239   -4.028  1.00 0.00 ? 50 ILE A HG21 4  
ATOM 6525  H HG22 . ILE A 1 54 ? -8.572  5.210   -2.805  1.00 0.00 ? 50 ILE A HG22 4  
ATOM 6526  H HG23 . ILE A 1 54 ? -7.594  4.506   -4.113  1.00 0.00 ? 50 ILE A HG23 4  
ATOM 6527  H HD11 . ILE A 1 54 ? -9.027  2.715   -6.167  1.00 0.00 ? 50 ILE A HD11 4  
ATOM 6528  H HD12 . ILE A 1 54 ? -8.366  2.501   -4.526  1.00 0.00 ? 50 ILE A HD12 4  
ATOM 6529  H HD13 . ILE A 1 54 ? -9.820  1.616   -5.016  1.00 0.00 ? 50 ILE A HD13 4  
ATOM 6530  N N    . LYS A 1 55 ? -9.837  8.388   -5.490  1.00 0.00 ? 51 LYS A N    4  
ATOM 6531  C CA   . LYS A 1 55 ? -9.161  9.677   -5.515  1.00 0.00 ? 51 LYS A CA   4  
ATOM 6532  C C    . LYS A 1 55 ? -10.069 10.789  -4.992  1.00 0.00 ? 51 LYS A C    4  
ATOM 6533  O O    . LYS A 1 55 ? -9.599  11.868  -4.630  1.00 0.00 ? 51 LYS A O    4  
ATOM 6534  C CB   . LYS A 1 55 ? -8.705  10.007  -6.937  1.00 0.00 ? 51 LYS A CB   4  
ATOM 6535  C CG   . LYS A 1 55 ? -7.969  8.868   -7.624  1.00 0.00 ? 51 LYS A CG   4  
ATOM 6536  C CD   . LYS A 1 55 ? -7.479  9.271   -9.004  1.00 0.00 ? 51 LYS A CD   4  
ATOM 6537  C CE   . LYS A 1 55 ? -6.351  10.289  -8.924  1.00 0.00 ? 51 LYS A CE   4  
ATOM 6538  N NZ   . LYS A 1 55 ? -5.810  10.622  -10.268 1.00 0.00 ? 51 LYS A NZ   4  
ATOM 6539  H H    . LYS A 1 55 ? -10.238 8.041   -6.316  1.00 0.00 ? 51 LYS A H    4  
ATOM 6540  H HA   . LYS A 1 55 ? -8.294  9.608   -4.875  1.00 0.00 ? 51 LYS A HA   4  
ATOM 6541  H HB2  . LYS A 1 55 ? -9.572  10.255  -7.531  1.00 0.00 ? 51 LYS A HB2  4  
ATOM 6542  H HB3  . LYS A 1 55 ? -8.049  10.863  -6.901  1.00 0.00 ? 51 LYS A HB3  4  
ATOM 6543  H HG2  . LYS A 1 55 ? -7.119  8.583   -7.022  1.00 0.00 ? 51 LYS A HG2  4  
ATOM 6544  H HG3  . LYS A 1 55 ? -8.640  8.028   -7.722  1.00 0.00 ? 51 LYS A HG3  4  
ATOM 6545  H HD2  . LYS A 1 55 ? -7.120  8.391   -9.517  1.00 0.00 ? 51 LYS A HD2  4  
ATOM 6546  H HD3  . LYS A 1 55 ? -8.302  9.701   -9.556  1.00 0.00 ? 51 LYS A HD3  4  
ATOM 6547  H HE2  . LYS A 1 55 ? -6.727  11.190  -8.466  1.00 0.00 ? 51 LYS A HE2  4  
ATOM 6548  H HE3  . LYS A 1 55 ? -5.557  9.880   -8.317  1.00 0.00 ? 51 LYS A HE3  4  
ATOM 6549  H HZ1  . LYS A 1 55 ? -5.337  9.792   -10.680 1.00 0.00 ? 51 LYS A HZ1  4  
ATOM 6550  H HZ2  . LYS A 1 55 ? -5.120  11.397  -10.195 1.00 0.00 ? 51 LYS A HZ2  4  
ATOM 6551  H HZ3  . LYS A 1 55 ? -6.580  10.918  -10.900 1.00 0.00 ? 51 LYS A HZ3  4  
ATOM 6552  N N    . ARG A 1 56 ? -11.365 10.514  -4.930  1.00 0.00 ? 52 ARG A N    4  
ATOM 6553  C CA   . ARG A 1 56 ? -12.338 11.496  -4.468  1.00 0.00 ? 52 ARG A CA   4  
ATOM 6554  C C    . ARG A 1 56 ? -12.593 11.360  -2.965  1.00 0.00 ? 52 ARG A C    4  
ATOM 6555  O O    . ARG A 1 56 ? -12.879 12.343  -2.280  1.00 0.00 ? 52 ARG A O    4  
ATOM 6556  C CB   . ARG A 1 56 ? -13.646 11.331  -5.253  1.00 0.00 ? 52 ARG A CB   4  
ATOM 6557  C CG   . ARG A 1 56 ? -14.865 11.943  -4.581  1.00 0.00 ? 52 ARG A CG   4  
ATOM 6558  C CD   . ARG A 1 56 ? -15.840 12.508  -5.597  1.00 0.00 ? 52 ARG A CD   4  
ATOM 6559  N NE   . ARG A 1 56 ? -17.058 13.017  -4.963  1.00 0.00 ? 52 ARG A NE   4  
ATOM 6560  C CZ   . ARG A 1 56 ? -17.152 14.200  -4.349  1.00 0.00 ? 52 ARG A CZ   4  
ATOM 6561  N NH1  . ARG A 1 56 ? -16.094 14.997  -4.251  1.00 0.00 ? 52 ARG A NH1  4  
ATOM 6562  N NH2  . ARG A 1 56 ? -18.313 14.580  -3.825  1.00 0.00 ? 52 ARG A NH2  4  
ATOM 6563  H H    . ARG A 1 56 ? -11.680 9.621   -5.192  1.00 0.00 ? 52 ARG A H    4  
ATOM 6564  H HA   . ARG A 1 56 ? -11.937 12.480  -4.662  1.00 0.00 ? 52 ARG A HA   4  
ATOM 6565  H HB2  . ARG A 1 56 ? -13.529 11.795  -6.223  1.00 0.00 ? 52 ARG A HB2  4  
ATOM 6566  H HB3  . ARG A 1 56 ? -13.830 10.275  -5.393  1.00 0.00 ? 52 ARG A HB3  4  
ATOM 6567  H HG2  . ARG A 1 56 ? -15.365 11.180  -4.003  1.00 0.00 ? 52 ARG A HG2  4  
ATOM 6568  H HG3  . ARG A 1 56 ? -14.540 12.737  -3.927  1.00 0.00 ? 52 ARG A HG3  4  
ATOM 6569  H HD2  . ARG A 1 56 ? -15.359 13.315  -6.127  1.00 0.00 ? 52 ARG A HD2  4  
ATOM 6570  H HD3  . ARG A 1 56 ? -16.108 11.729  -6.296  1.00 0.00 ? 52 ARG A HD3  4  
ATOM 6571  H HE   . ARG A 1 56 ? -17.860 12.443  -5.008  1.00 0.00 ? 52 ARG A HE   4  
ATOM 6572  H HH11 . ARG A 1 56 ? -15.212 14.717  -4.637  1.00 0.00 ? 52 ARG A HH11 4  
ATOM 6573  H HH12 . ARG A 1 56 ? -16.174 15.886  -3.790  1.00 0.00 ? 52 ARG A HH12 4  
ATOM 6574  H HH21 . ARG A 1 56 ? -19.115 13.978  -3.889  1.00 0.00 ? 52 ARG A HH21 4  
ATOM 6575  H HH22 . ARG A 1 56 ? -18.394 15.467  -3.364  1.00 0.00 ? 52 ARG A HH22 4  
ATOM 6576  N N    . ILE A 1 57 ? -12.471 10.143  -2.451  1.00 0.00 ? 53 ILE A N    4  
ATOM 6577  C CA   . ILE A 1 57 ? -12.706 9.886   -1.032  1.00 0.00 ? 53 ILE A CA   4  
ATOM 6578  C C    . ILE A 1 57 ? -11.581 10.424  -0.140  1.00 0.00 ? 53 ILE A C    4  
ATOM 6579  O O    . ILE A 1 57 ? -11.638 10.290  1.080   1.00 0.00 ? 53 ILE A O    4  
ATOM 6580  C CB   . ILE A 1 57 ? -12.931 8.386   -0.751  1.00 0.00 ? 53 ILE A CB   4  
ATOM 6581  C CG1  . ILE A 1 57 ? -11.716 7.566   -1.187  1.00 0.00 ? 53 ILE A CG1  4  
ATOM 6582  C CG2  . ILE A 1 57 ? -14.193 7.905   -1.459  1.00 0.00 ? 53 ILE A CG2  4  
ATOM 6583  C CD1  . ILE A 1 57 ? -11.948 6.069   -1.176  1.00 0.00 ? 53 ILE A CD1  4  
ATOM 6584  H H    . ILE A 1 57 ? -12.244 9.393   -3.048  1.00 0.00 ? 53 ILE A H    4  
ATOM 6585  H HA   . ILE A 1 57 ? -13.614 10.406  -0.765  1.00 0.00 ? 53 ILE A HA   4  
ATOM 6586  H HB   . ILE A 1 57 ? -13.077 8.262   0.313   1.00 0.00 ? 53 ILE A HB   4  
ATOM 6587  H HG12 . ILE A 1 57 ? -11.441 7.852   -2.192  1.00 0.00 ? 53 ILE A HG12 4  
ATOM 6588  H HG13 . ILE A 1 57 ? -10.894 7.779   -0.521  1.00 0.00 ? 53 ILE A HG13 4  
ATOM 6589  H HG21 . ILE A 1 57 ? -15.041 8.475   -1.110  1.00 0.00 ? 53 ILE A HG21 4  
ATOM 6590  H HG22 . ILE A 1 57 ? -14.351 6.858   -1.243  1.00 0.00 ? 53 ILE A HG22 4  
ATOM 6591  H HG23 . ILE A 1 57 ? -14.082 8.042   -2.523  1.00 0.00 ? 53 ILE A HG23 4  
ATOM 6592  H HD11 . ILE A 1 57 ? -11.037 5.561   -1.454  1.00 0.00 ? 53 ILE A HD11 4  
ATOM 6593  H HD12 . ILE A 1 57 ? -12.728 5.821   -1.881  1.00 0.00 ? 53 ILE A HD12 4  
ATOM 6594  H HD13 . ILE A 1 57 ? -12.246 5.757   -0.186  1.00 0.00 ? 53 ILE A HD13 4  
ATOM 6595  N N    . GLY A 1 58 ? -10.563 11.031  -0.743  1.00 0.00 ? 54 GLY A N    4  
ATOM 6596  C CA   . GLY A 1 58 ? -9.482  11.603  0.044   1.00 0.00 ? 54 GLY A CA   4  
ATOM 6597  C C    . GLY A 1 58 ? -8.135  10.924  -0.140  1.00 0.00 ? 54 GLY A C    4  
ATOM 6598  O O    . GLY A 1 58 ? -7.159  11.301  0.511   1.00 0.00 ? 54 GLY A O    4  
ATOM 6599  H H    . GLY A 1 58 ? -10.553 11.102  -1.718  1.00 0.00 ? 54 GLY A H    4  
ATOM 6600  H HA2  . GLY A 1 58 ? -9.376  12.641  -0.230  1.00 0.00 ? 54 GLY A HA2  4  
ATOM 6601  H HA3  . GLY A 1 58 ? -9.753  11.550  1.088   1.00 0.00 ? 54 GLY A HA3  4  
ATOM 6602  N N    . VAL A 1 59 ? -8.057  9.933   -1.014  1.00 0.00 ? 55 VAL A N    4  
ATOM 6603  C CA   . VAL A 1 59 ? -6.792  9.242   -1.238  1.00 0.00 ? 55 VAL A CA   4  
ATOM 6604  C C    . VAL A 1 59 ? -6.048  9.863   -2.419  1.00 0.00 ? 55 VAL A C    4  
ATOM 6605  O O    . VAL A 1 59 ? -6.133  9.386   -3.550  1.00 0.00 ? 55 VAL A O    4  
ATOM 6606  C CB   . VAL A 1 59 ? -6.995  7.731   -1.478  1.00 0.00 ? 55 VAL A CB   4  
ATOM 6607  C CG1  . VAL A 1 59 ? -5.656  7.007   -1.535  1.00 0.00 ? 55 VAL A CG1  4  
ATOM 6608  C CG2  . VAL A 1 59 ? -7.888  7.133   -0.399  1.00 0.00 ? 55 VAL A CG2  4  
ATOM 6609  H H    . VAL A 1 59 ? -8.851  9.670   -1.524  1.00 0.00 ? 55 VAL A H    4  
ATOM 6610  H HA   . VAL A 1 59 ? -6.191  9.366   -0.349  1.00 0.00 ? 55 VAL A HA   4  
ATOM 6611  H HB   . VAL A 1 59 ? -7.487  7.603   -2.431  1.00 0.00 ? 55 VAL A HB   4  
ATOM 6612  H HG11 . VAL A 1 59 ? -5.139  7.128   -0.594  1.00 0.00 ? 55 VAL A HG11 4  
ATOM 6613  H HG12 . VAL A 1 59 ? -5.055  7.423   -2.330  1.00 0.00 ? 55 VAL A HG12 4  
ATOM 6614  H HG13 . VAL A 1 59 ? -5.821  5.955   -1.722  1.00 0.00 ? 55 VAL A HG13 4  
ATOM 6615  H HG21 . VAL A 1 59 ? -8.031  6.080   -0.589  1.00 0.00 ? 55 VAL A HG21 4  
ATOM 6616  H HG22 . VAL A 1 59 ? -8.845  7.634   -0.408  1.00 0.00 ? 55 VAL A HG22 4  
ATOM 6617  H HG23 . VAL A 1 59 ? -7.424  7.265   0.568   1.00 0.00 ? 55 VAL A HG23 4  
ATOM 6618  N N    . ARG A 1 60 ? -5.345  10.954  -2.149  1.00 0.00 ? 56 ARG A N    4  
ATOM 6619  C CA   . ARG A 1 60 ? -4.589  11.655  -3.181  1.00 0.00 ? 56 ARG A CA   4  
ATOM 6620  C C    . ARG A 1 60 ? -3.266  10.962  -3.517  1.00 0.00 ? 56 ARG A C    4  
ATOM 6621  O O    . ARG A 1 60 ? -2.669  11.242  -4.555  1.00 0.00 ? 56 ARG A O    4  
ATOM 6622  C CB   . ARG A 1 60 ? -4.329  13.108  -2.760  1.00 0.00 ? 56 ARG A CB   4  
ATOM 6623  C CG   . ARG A 1 60 ? -3.677  13.266  -1.389  1.00 0.00 ? 56 ARG A CG   4  
ATOM 6624  C CD   . ARG A 1 60 ? -2.156  13.343  -1.478  1.00 0.00 ? 56 ARG A CD   4  
ATOM 6625  N NE   . ARG A 1 60 ? -1.701  14.252  -2.536  1.00 0.00 ? 56 ARG A NE   4  
ATOM 6626  C CZ   . ARG A 1 60 ? -0.430  14.616  -2.720  1.00 0.00 ? 56 ARG A CZ   4  
ATOM 6627  N NH1  . ARG A 1 60 ? 0.522   14.218  -1.879  1.00 0.00 ? 56 ARG A NH1  4  
ATOM 6628  N NH2  . ARG A 1 60 ? -0.111  15.396  -3.744  1.00 0.00 ? 56 ARG A NH2  4  
ATOM 6629  H H    . ARG A 1 60 ? -5.373  11.326  -1.241  1.00 0.00 ? 56 ARG A H    4  
ATOM 6630  H HA   . ARG A 1 60 ? -5.200  11.666  -4.071  1.00 0.00 ? 56 ARG A HA   4  
ATOM 6631  H HB2  . ARG A 1 60 ? -3.683  13.567  -3.492  1.00 0.00 ? 56 ARG A HB2  4  
ATOM 6632  H HB3  . ARG A 1 60 ? -5.271  13.639  -2.748  1.00 0.00 ? 56 ARG A HB3  4  
ATOM 6633  H HG2  . ARG A 1 60 ? -4.043  14.173  -0.930  1.00 0.00 ? 56 ARG A HG2  4  
ATOM 6634  H HG3  . ARG A 1 60 ? -3.949  12.419  -0.775  1.00 0.00 ? 56 ARG A HG3  4  
ATOM 6635  H HD2  . ARG A 1 60 ? -1.770  13.688  -0.532  1.00 0.00 ? 56 ARG A HD2  4  
ATOM 6636  H HD3  . ARG A 1 60 ? -1.773  12.354  -1.681  1.00 0.00 ? 56 ARG A HD3  4  
ATOM 6637  H HE   . ARG A 1 60 ? -2.385  14.595  -3.157  1.00 0.00 ? 56 ARG A HE   4  
ATOM 6638  H HH11 . ARG A 1 60 ? 0.291   13.642  -1.088  1.00 0.00 ? 56 ARG A HH11 4  
ATOM 6639  H HH12 . ARG A 1 60 ? 1.478   14.489  -2.034  1.00 0.00 ? 56 ARG A HH12 4  
ATOM 6640  H HH21 . ARG A 1 60 ? -0.823  15.712  -4.382  1.00 0.00 ? 56 ARG A HH21 4  
ATOM 6641  H HH22 . ARG A 1 60 ? 0.843   15.675  -3.888  1.00 0.00 ? 56 ARG A HH22 4  
ATOM 6642  N N    . LEU A 1 61 ? -2.801  10.072  -2.648  1.00 0.00 ? 57 LEU A N    4  
ATOM 6643  C CA   . LEU A 1 61 ? -1.544  9.374   -2.890  1.00 0.00 ? 57 LEU A CA   4  
ATOM 6644  C C    . LEU A 1 61 ? -1.743  8.234   -3.894  1.00 0.00 ? 57 LEU A C    4  
ATOM 6645  O O    . LEU A 1 61 ? -2.490  7.293   -3.631  1.00 0.00 ? 57 LEU A O    4  
ATOM 6646  C CB   . LEU A 1 61 ? -0.962  8.849   -1.574  1.00 0.00 ? 57 LEU A CB   4  
ATOM 6647  C CG   . LEU A 1 61 ? -0.460  9.934   -0.618  1.00 0.00 ? 57 LEU A CG   4  
ATOM 6648  C CD1  . LEU A 1 61 ? 0.096   9.319   0.660   1.00 0.00 ? 57 LEU A CD1  4  
ATOM 6649  C CD2  . LEU A 1 61 ? 0.587   10.794  -1.302  1.00 0.00 ? 57 LEU A CD2  4  
ATOM 6650  H H    . LEU A 1 61 ? -3.312  9.875   -1.837  1.00 0.00 ? 57 LEU A H    4  
ATOM 6651  H HA   . LEU A 1 61 ? -0.854  10.086  -3.314  1.00 0.00 ? 57 LEU A HA   4  
ATOM 6652  H HB2  . LEU A 1 61 ? -1.728  8.280   -1.069  1.00 0.00 ? 57 LEU A HB2  4  
ATOM 6653  H HB3  . LEU A 1 61 ? -0.137  8.191   -1.802  1.00 0.00 ? 57 LEU A HB3  4  
ATOM 6654  H HG   . LEU A 1 61 ? -1.288  10.570  -0.345  1.00 0.00 ? 57 LEU A HG   4  
ATOM 6655  H HD11 . LEU A 1 61 ? 0.865   8.599   0.416   1.00 0.00 ? 57 LEU A HD11 4  
ATOM 6656  H HD12 . LEU A 1 61 ? -0.700  8.825   1.198   1.00 0.00 ? 57 LEU A HD12 4  
ATOM 6657  H HD13 . LEU A 1 61 ? 0.517   10.096  1.282   1.00 0.00 ? 57 LEU A HD13 4  
ATOM 6658  H HD21 . LEU A 1 61 ? 1.377   10.166  -1.683  1.00 0.00 ? 57 LEU A HD21 4  
ATOM 6659  H HD22 . LEU A 1 61 ? 0.999   11.498  -0.593  1.00 0.00 ? 57 LEU A HD22 4  
ATOM 6660  H HD23 . LEU A 1 61 ? 0.133   11.333  -2.120  1.00 0.00 ? 57 LEU A HD23 4  
ATOM 6661  N N    . PRO A 1 62 ? -1.061  8.307   -5.057  1.00 0.00 ? 58 PRO A N    4  
ATOM 6662  C CA   . PRO A 1 62 ? -1.175  7.295   -6.126  1.00 0.00 ? 58 PRO A CA   4  
ATOM 6663  C C    . PRO A 1 62 ? -0.760  5.894   -5.698  1.00 0.00 ? 58 PRO A C    4  
ATOM 6664  O O    . PRO A 1 62 ? -1.354  4.904   -6.133  1.00 0.00 ? 58 PRO A O    4  
ATOM 6665  C CB   . PRO A 1 62 ? -0.229  7.796   -7.213  1.00 0.00 ? 58 PRO A CB   4  
ATOM 6666  C CG   . PRO A 1 62 ? 0.672   8.770   -6.535  1.00 0.00 ? 58 PRO A CG   4  
ATOM 6667  C CD   . PRO A 1 62 ? -0.136  9.390   -5.433  1.00 0.00 ? 58 PRO A CD   4  
ATOM 6668  H HA   . PRO A 1 62 ? -2.180  7.257   -6.518  1.00 0.00 ? 58 PRO A HA   4  
ATOM 6669  H HB2  . PRO A 1 62 ? 0.326   6.960   -7.617  1.00 0.00 ? 58 PRO A HB2  4  
ATOM 6670  H HB3  . PRO A 1 62 ? -0.802  8.265   -7.996  1.00 0.00 ? 58 PRO A HB3  4  
ATOM 6671  H HG2  . PRO A 1 62 ? 1.528   8.256   -6.122  1.00 0.00 ? 58 PRO A HG2  4  
ATOM 6672  H HG3  . PRO A 1 62 ? 0.990   9.526   -7.238  1.00 0.00 ? 58 PRO A HG3  4  
ATOM 6673  H HD2  . PRO A 1 62 ? 0.505   9.660   -4.606  1.00 0.00 ? 58 PRO A HD2  4  
ATOM 6674  H HD3  . PRO A 1 62 ? -0.677  10.253  -5.795  1.00 0.00 ? 58 PRO A HD3  4  
ATOM 6675  N N    . GLY A 1 63 ? 0.254   5.809   -4.848  1.00 0.00 ? 59 GLY A N    4  
ATOM 6676  C CA   . GLY A 1 63 ? 0.709   4.516   -4.381  1.00 0.00 ? 59 GLY A CA   4  
ATOM 6677  C C    . GLY A 1 63 ? -0.317  3.885   -3.464  1.00 0.00 ? 59 GLY A C    4  
ATOM 6678  O O    . GLY A 1 63 ? -0.441  2.661   -3.396  1.00 0.00 ? 59 GLY A O    4  
ATOM 6679  H H    . GLY A 1 63 ? 0.681   6.628   -4.517  1.00 0.00 ? 59 GLY A H    4  
ATOM 6680  H HA2  . GLY A 1 63 ? 0.868   3.869   -5.233  1.00 0.00 ? 59 GLY A HA2  4  
ATOM 6681  H HA3  . GLY A 1 63 ? 1.638   4.639   -3.852  1.00 0.00 ? 59 GLY A HA3  4  
ATOM 6682  N N    . HIS A 1 64 ? -1.048  4.737   -2.752  1.00 0.00 ? 60 HIS A N    4  
ATOM 6683  C CA   . HIS A 1 64 ? -2.106  4.278   -1.863  1.00 0.00 ? 60 HIS A CA   4  
ATOM 6684  C C    . HIS A 1 64 ? -3.282  3.844   -2.715  1.00 0.00 ? 60 HIS A C    4  
ATOM 6685  O O    . HIS A 1 64 ? -4.012  2.909   -2.377  1.00 0.00 ? 60 HIS A O    4  
ATOM 6686  C CB   . HIS A 1 64 ? -2.552  5.381   -0.898  1.00 0.00 ? 60 HIS A CB   4  
ATOM 6687  C CG   . HIS A 1 64 ? -1.625  5.590   0.256   1.00 0.00 ? 60 HIS A CG   4  
ATOM 6688  N ND1  . HIS A 1 64 ? -1.958  5.351   1.568   1.00 0.00 ? 60 HIS A ND1  4  
ATOM 6689  C CD2  . HIS A 1 64 ? -0.358  6.052   0.271   1.00 0.00 ? 60 HIS A CD2  4  
ATOM 6690  C CE1  . HIS A 1 64 ? -0.904  5.676   2.326   1.00 0.00 ? 60 HIS A CE1  4  
ATOM 6691  N NE2  . HIS A 1 64 ? 0.095   6.108   1.584   1.00 0.00 ? 60 HIS A NE2  4  
ATOM 6692  H H    . HIS A 1 64 ? -0.861  5.695   -2.830  1.00 0.00 ? 60 HIS A H    4  
ATOM 6693  H HA   . HIS A 1 64 ? -1.737  3.431   -1.303  1.00 0.00 ? 60 HIS A HA   4  
ATOM 6694  H HB2  . HIS A 1 64 ? -2.618  6.314   -1.436  1.00 0.00 ? 60 HIS A HB2  4  
ATOM 6695  H HB3  . HIS A 1 64 ? -3.527  5.129   -0.504  1.00 0.00 ? 60 HIS A HB3  4  
ATOM 6696  H HD1  . HIS A 1 64 ? -2.807  4.975   1.888   1.00 0.00 ? 60 HIS A HD1  4  
ATOM 6697  H HD2  . HIS A 1 64 ? 0.226   6.324   -0.595  1.00 0.00 ? 60 HIS A HD2  4  
ATOM 6698  H HE1  . HIS A 1 64 ? -0.877  5.598   3.403   1.00 0.00 ? 60 HIS A HE1  4  
ATOM 6699  N N    . GLN A 1 65 ? -3.436  4.531   -3.840  1.00 0.00 ? 61 GLN A N    4  
ATOM 6700  C CA   . GLN A 1 65 ? -4.502  4.230   -4.783  1.00 0.00 ? 61 GLN A CA   4  
ATOM 6701  C C    . GLN A 1 65 ? -4.322  2.821   -5.328  1.00 0.00 ? 61 GLN A C    4  
ATOM 6702  O O    . GLN A 1 65 ? -5.116  1.937   -5.027  1.00 0.00 ? 61 GLN A O    4  
ATOM 6703  C CB   . GLN A 1 65 ? -4.504  5.238   -5.931  1.00 0.00 ? 61 GLN A CB   4  
ATOM 6704  C CG   . GLN A 1 65 ? -5.178  6.549   -5.592  1.00 0.00 ? 61 GLN A CG   4  
ATOM 6705  C CD   . GLN A 1 65 ? -4.723  7.680   -6.497  1.00 0.00 ? 61 GLN A CD   4  
ATOM 6706  O OE1  . GLN A 1 65 ? -4.323  7.460   -7.639  1.00 0.00 ? 61 GLN A OE1  4  
ATOM 6707  N NE2  . GLN A 1 65 ? -4.787  8.901   -5.994  1.00 0.00 ? 61 GLN A NE2  4  
ATOM 6708  H H    . GLN A 1 65 ? -2.800  5.262   -4.040  1.00 0.00 ? 61 GLN A H    4  
ATOM 6709  H HA   . GLN A 1 65 ? -5.440  4.289   -4.253  1.00 0.00 ? 61 GLN A HA   4  
ATOM 6710  H HB2  . GLN A 1 65 ? -3.483  5.451   -6.207  1.00 0.00 ? 61 GLN A HB2  4  
ATOM 6711  H HB3  . GLN A 1 65 ? -5.011  4.803   -6.778  1.00 0.00 ? 61 GLN A HB3  4  
ATOM 6712  H HG2  . GLN A 1 65 ? -6.249  6.426   -5.688  1.00 0.00 ? 61 GLN A HG2  4  
ATOM 6713  H HG3  . GLN A 1 65 ? -4.936  6.806   -4.572  1.00 0.00 ? 61 GLN A HG3  4  
ATOM 6714  H HE21 . GLN A 1 65 ? -5.126  9.007   -5.077  1.00 0.00 ? 61 GLN A HE21 4  
ATOM 6715  H HE22 . GLN A 1 65 ? -4.486  9.648   -6.551  1.00 0.00 ? 61 GLN A HE22 4  
ATOM 6716  N N    . LYS A 1 66 ? -3.301  2.652   -6.166  1.00 0.00 ? 62 LYS A N    4  
ATOM 6717  C CA   . LYS A 1 66 ? -2.956  1.348   -6.751  1.00 0.00 ? 62 LYS A CA   4  
ATOM 6718  C C    . LYS A 1 66 ? -3.085  0.198   -5.740  1.00 0.00 ? 62 LYS A C    4  
ATOM 6719  O O    . LYS A 1 66 ? -3.600  -0.871  -6.073  1.00 0.00 ? 62 LYS A O    4  
ATOM 6720  C CB   . LYS A 1 66 ? -1.533  1.388   -7.309  1.00 0.00 ? 62 LYS A CB   4  
ATOM 6721  C CG   . LYS A 1 66 ? -1.126  0.114   -8.029  1.00 0.00 ? 62 LYS A CG   4  
ATOM 6722  C CD   . LYS A 1 66 ? 0.318   0.174   -8.486  1.00 0.00 ? 62 LYS A CD   4  
ATOM 6723  C CE   . LYS A 1 66 ? 0.806   -1.178  -8.985  1.00 0.00 ? 62 LYS A CE   4  
ATOM 6724  N NZ   . LYS A 1 66 ? 2.290   -1.251  -9.019  1.00 0.00 ? 62 LYS A NZ   4  
ATOM 6725  H H    . LYS A 1 66 ? -2.848  3.458   -6.495  1.00 0.00 ? 62 LYS A H    4  
ATOM 6726  H HA   . LYS A 1 66 ? -3.639  1.165   -7.565  1.00 0.00 ? 62 LYS A HA   4  
ATOM 6727  H HB2  . LYS A 1 66 ? -1.453  2.211   -8.002  1.00 0.00 ? 62 LYS A HB2  4  
ATOM 6728  H HB3  . LYS A 1 66 ? -0.846  1.550   -6.491  1.00 0.00 ? 62 LYS A HB3  4  
ATOM 6729  H HG2  . LYS A 1 66 ? -1.245  -0.722  -7.355  1.00 0.00 ? 62 LYS A HG2  4  
ATOM 6730  H HG3  . LYS A 1 66 ? -1.763  -0.022  -8.890  1.00 0.00 ? 62 LYS A HG3  4  
ATOM 6731  H HD2  . LYS A 1 66 ? 0.402   0.893   -9.288  1.00 0.00 ? 62 LYS A HD2  4  
ATOM 6732  H HD3  . LYS A 1 66 ? 0.935   0.486   -7.656  1.00 0.00 ? 62 LYS A HD3  4  
ATOM 6733  H HE2  . LYS A 1 66 ? 0.433   -1.946  -8.324  1.00 0.00 ? 62 LYS A HE2  4  
ATOM 6734  H HE3  . LYS A 1 66 ? 0.423   -1.342  -9.981  1.00 0.00 ? 62 LYS A HE3  4  
ATOM 6735  H HZ1  . LYS A 1 66 ? 2.595   -2.216  -9.258  1.00 0.00 ? 62 LYS A HZ1  4  
ATOM 6736  H HZ2  . LYS A 1 66 ? 2.683   -0.994  -8.084  1.00 0.00 ? 62 LYS A HZ2  4  
ATOM 6737  H HZ3  . LYS A 1 66 ? 2.666   -0.595  -9.732  1.00 0.00 ? 62 LYS A HZ3  4  
ATOM 6738  N N    . ARG A 1 67 ? -2.642  0.433   -4.507  1.00 0.00 ? 63 ARG A N    4  
ATOM 6739  C CA   . ARG A 1 67 ? -2.710  -0.580  -3.458  1.00 0.00 ? 63 ARG A CA   4  
ATOM 6740  C C    . ARG A 1 67 ? -4.167  -0.958  -3.170  1.00 0.00 ? 63 ARG A C    4  
ATOM 6741  O O    . ARG A 1 67 ? -4.535  -2.136  -3.189  1.00 0.00 ? 63 ARG A O    4  
ATOM 6742  C CB   . ARG A 1 67 ? -2.036  -0.050  -2.190  1.00 0.00 ? 63 ARG A CB   4  
ATOM 6743  C CG   . ARG A 1 67 ? -1.256  -1.106  -1.419  1.00 0.00 ? 63 ARG A CG   4  
ATOM 6744  C CD   . ARG A 1 67 ? 0.234   -0.780  -1.364  1.00 0.00 ? 63 ARG A CD   4  
ATOM 6745  N NE   . ARG A 1 67 ? 0.997   -1.439  -2.430  1.00 0.00 ? 63 ARG A NE   4  
ATOM 6746  C CZ   . ARG A 1 67 ? 1.488   -0.815  -3.505  1.00 0.00 ? 63 ARG A CZ   4  
ATOM 6747  N NH1  . ARG A 1 67 ? 1.304   0.488   -3.673  1.00 0.00 ? 63 ARG A NH1  4  
ATOM 6748  N NH2  . ARG A 1 67 ? 2.181   -1.493  -4.407  1.00 0.00 ? 63 ARG A NH2  4  
ATOM 6749  H H    . ARG A 1 67 ? -2.283  1.320   -4.292  1.00 0.00 ? 63 ARG A H    4  
ATOM 6750  H HA   . ARG A 1 67 ? -2.179  -1.455  -3.804  1.00 0.00 ? 63 ARG A HA   4  
ATOM 6751  H HB2  . ARG A 1 67 ? -1.355  0.741   -2.467  1.00 0.00 ? 63 ARG A HB2  4  
ATOM 6752  H HB3  . ARG A 1 67 ? -2.795  0.357   -1.538  1.00 0.00 ? 63 ARG A HB3  4  
ATOM 6753  H HG2  . ARG A 1 67 ? -1.641  -1.158  -0.410  1.00 0.00 ? 63 ARG A HG2  4  
ATOM 6754  H HG3  . ARG A 1 67 ? -1.389  -2.061  -1.904  1.00 0.00 ? 63 ARG A HG3  4  
ATOM 6755  H HD2  . ARG A 1 67 ? 0.361   0.288   -1.456  1.00 0.00 ? 63 ARG A HD2  4  
ATOM 6756  H HD3  . ARG A 1 67 ? 0.624   -1.101  -0.410  1.00 0.00 ? 63 ARG A HD3  4  
ATOM 6757  H HE   . ARG A 1 67 ? 1.164   -2.406  -2.333  1.00 0.00 ? 63 ARG A HE   4  
ATOM 6758  H HH11 . ARG A 1 67 ? 0.794   1.020   -2.995  1.00 0.00 ? 63 ARG A HH11 4  
ATOM 6759  H HH12 . ARG A 1 67 ? 1.687   0.952   -4.491  1.00 0.00 ? 63 ARG A HH12 4  
ATOM 6760  H HH21 . ARG A 1 67 ? 2.351   -2.488  -4.284  1.00 0.00 ? 63 ARG A HH21 4  
ATOM 6761  H HH22 . ARG A 1 67 ? 2.538   -1.023  -5.230  1.00 0.00 ? 63 ARG A HH22 4  
ATOM 6762  N N    . ILE A 1 68 ? -4.988  0.059   -2.916  1.00 0.00 ? 64 ILE A N    4  
ATOM 6763  C CA   . ILE A 1 68 ? -6.408  -0.137  -2.643  1.00 0.00 ? 64 ILE A CA   4  
ATOM 6764  C C    . ILE A 1 68 ? -7.112  -0.721  -3.866  1.00 0.00 ? 64 ILE A C    4  
ATOM 6765  O O    . ILE A 1 68 ? -7.846  -1.701  -3.760  1.00 0.00 ? 64 ILE A O    4  
ATOM 6766  C CB   . ILE A 1 68 ? -7.095  1.191   -2.242  1.00 0.00 ? 64 ILE A CB   4  
ATOM 6767  C CG1  . ILE A 1 68 ? -6.550  1.685   -0.899  1.00 0.00 ? 64 ILE A CG1  4  
ATOM 6768  C CG2  . ILE A 1 68 ? -8.605  1.012   -2.168  1.00 0.00 ? 64 ILE A CG2  4  
ATOM 6769  C CD1  . ILE A 1 68 ? -7.029  3.069   -0.517  1.00 0.00 ? 64 ILE A CD1  4  
ATOM 6770  H H    . ILE A 1 68 ? -4.615  0.968   -2.906  1.00 0.00 ? 64 ILE A H    4  
ATOM 6771  H HA   . ILE A 1 68 ? -6.497  -0.834  -1.820  1.00 0.00 ? 64 ILE A HA   4  
ATOM 6772  H HB   . ILE A 1 68 ? -6.881  1.926   -3.004  1.00 0.00 ? 64 ILE A HB   4  
ATOM 6773  H HG12 . ILE A 1 68 ? -6.859  1.002   -0.122  1.00 0.00 ? 64 ILE A HG12 4  
ATOM 6774  H HG13 . ILE A 1 68 ? -5.471  1.705   -0.944  1.00 0.00 ? 64 ILE A HG13 4  
ATOM 6775  H HG21 . ILE A 1 68 ? -9.064  1.949   -1.888  1.00 0.00 ? 64 ILE A HG21 4  
ATOM 6776  H HG22 . ILE A 1 68 ? -8.840  0.259   -1.432  1.00 0.00 ? 64 ILE A HG22 4  
ATOM 6777  H HG23 . ILE A 1 68 ? -8.978  0.702   -3.133  1.00 0.00 ? 64 ILE A HG23 4  
ATOM 6778  H HD11 . ILE A 1 68 ? -6.686  3.784   -1.251  1.00 0.00 ? 64 ILE A HD11 4  
ATOM 6779  H HD12 . ILE A 1 68 ? -6.631  3.331   0.453   1.00 0.00 ? 64 ILE A HD12 4  
ATOM 6780  H HD13 . ILE A 1 68 ? -8.108  3.081   -0.480  1.00 0.00 ? 64 ILE A HD13 4  
ATOM 6781  N N    . ALA A 1 69 ? -6.837  -0.133  -5.025  1.00 0.00 ? 65 ALA A N    4  
ATOM 6782  C CA   . ALA A 1 69 ? -7.433  -0.563  -6.292  1.00 0.00 ? 65 ALA A CA   4  
ATOM 6783  C C    . ALA A 1 69 ? -7.267  -2.068  -6.515  1.00 0.00 ? 65 ALA A C    4  
ATOM 6784  O O    . ALA A 1 69 ? -8.235  -2.775  -6.808  1.00 0.00 ? 65 ALA A O    4  
ATOM 6785  C CB   . ALA A 1 69 ? -6.809  0.206   -7.445  1.00 0.00 ? 65 ALA A CB   4  
ATOM 6786  H H    . ALA A 1 69 ? -6.212  0.630   -5.027  1.00 0.00 ? 65 ALA A H    4  
ATOM 6787  H HA   . ALA A 1 69 ? -8.486  -0.326  -6.262  1.00 0.00 ? 65 ALA A HA   4  
ATOM 6788  H HB1  . ALA A 1 69 ? -6.978  1.263   -7.303  1.00 0.00 ? 65 ALA A HB1  4  
ATOM 6789  H HB2  . ALA A 1 69 ? -7.256  -0.112  -8.374  1.00 0.00 ? 65 ALA A HB2  4  
ATOM 6790  H HB3  . ALA A 1 69 ? -5.745  0.013   -7.472  1.00 0.00 ? 65 ALA A HB3  4  
ATOM 6791  N N    . TYR A 1 70 ? -6.041  -2.545  -6.348  1.00 0.00 ? 66 TYR A N    4  
ATOM 6792  C CA   . TYR A 1 70 ? -5.723  -3.957  -6.519  1.00 0.00 ? 66 TYR A CA   4  
ATOM 6793  C C    . TYR A 1 70 ? -6.537  -4.814  -5.558  1.00 0.00 ? 66 TYR A C    4  
ATOM 6794  O O    . TYR A 1 70 ? -7.028  -5.885  -5.920  1.00 0.00 ? 66 TYR A O    4  
ATOM 6795  C CB   . TYR A 1 70 ? -4.224  -4.170  -6.283  1.00 0.00 ? 66 TYR A CB   4  
ATOM 6796  C CG   . TYR A 1 70 ? -3.750  -5.594  -6.493  1.00 0.00 ? 66 TYR A CG   4  
ATOM 6797  C CD1  . TYR A 1 70 ? -3.706  -6.150  -7.764  1.00 0.00 ? 66 TYR A CD1  4  
ATOM 6798  C CD2  . TYR A 1 70 ? -3.333  -6.376  -5.419  1.00 0.00 ? 66 TYR A CD2  4  
ATOM 6799  C CE1  . TYR A 1 70 ? -3.260  -7.444  -7.962  1.00 0.00 ? 66 TYR A CE1  4  
ATOM 6800  C CE2  . TYR A 1 70 ? -2.890  -7.671  -5.609  1.00 0.00 ? 66 TYR A CE2  4  
ATOM 6801  C CZ   . TYR A 1 70 ? -2.853  -8.200  -6.880  1.00 0.00 ? 66 TYR A CZ   4  
ATOM 6802  O OH   . TYR A 1 70 ? -2.404  -9.489  -7.071  1.00 0.00 ? 66 TYR A OH   4  
ATOM 6803  H H    . TYR A 1 70 ? -5.318  -1.931  -6.101  1.00 0.00 ? 66 TYR A H    4  
ATOM 6804  H HA   . TYR A 1 70 ? -5.968  -4.233  -7.531  1.00 0.00 ? 66 TYR A HA   4  
ATOM 6805  H HB2  . TYR A 1 70 ? -3.671  -3.539  -6.959  1.00 0.00 ? 66 TYR A HB2  4  
ATOM 6806  H HB3  . TYR A 1 70 ? -3.984  -3.890  -5.266  1.00 0.00 ? 66 TYR A HB3  4  
ATOM 6807  H HD1  . TYR A 1 70 ? -4.025  -5.555  -8.606  1.00 0.00 ? 66 TYR A HD1  4  
ATOM 6808  H HD2  . TYR A 1 70 ? -3.363  -5.961  -4.422  1.00 0.00 ? 66 TYR A HD2  4  
ATOM 6809  H HE1  . TYR A 1 70 ? -3.235  -7.860  -8.961  1.00 0.00 ? 66 TYR A HE1  4  
ATOM 6810  H HE2  . TYR A 1 70 ? -2.572  -8.261  -4.764  1.00 0.00 ? 66 TYR A HE2  4  
ATOM 6811  H HH   . TYR A 1 70 ? -2.778  -10.062 -6.389  1.00 0.00 ? 66 TYR A HH   4  
ATOM 6812  N N    . SER A 1 71 ? -6.702  -4.314  -4.345  1.00 0.00 ? 67 SER A N    4  
ATOM 6813  C CA   . SER A 1 71 ? -7.441  -5.019  -3.309  1.00 0.00 ? 67 SER A CA   4  
ATOM 6814  C C    . SER A 1 71 ? -8.942  -5.073  -3.623  1.00 0.00 ? 67 SER A C    4  
ATOM 6815  O O    . SER A 1 71 ? -9.632  -6.005  -3.208  1.00 0.00 ? 67 SER A O    4  
ATOM 6816  C CB   . SER A 1 71 ? -7.204  -4.350  -1.952  1.00 0.00 ? 67 SER A CB   4  
ATOM 6817  O OG   . SER A 1 71 ? -5.813  -4.167  -1.703  1.00 0.00 ? 67 SER A OG   4  
ATOM 6818  H H    . SER A 1 71 ? -6.308  -3.444  -4.139  1.00 0.00 ? 67 SER A H    4  
ATOM 6819  H HA   . SER A 1 71 ? -7.060  -6.030  -3.268  1.00 0.00 ? 67 SER A HA   4  
ATOM 6820  H HB2  . SER A 1 71 ? -7.690  -3.388  -1.939  1.00 0.00 ? 67 SER A HB2  4  
ATOM 6821  H HB3  . SER A 1 71 ? -7.617  -4.972  -1.172  1.00 0.00 ? 67 SER A HB3  4  
ATOM 6822  H HG   . SER A 1 71 ? -5.457  -3.509  -2.314  1.00 0.00 ? 67 SER A HG   4  
ATOM 6823  N N    . LEU A 1 72 ? -9.452  -4.081  -4.352  1.00 0.00 ? 68 LEU A N    4  
ATOM 6824  C CA   . LEU A 1 72 ? -10.868 -4.053  -4.710  1.00 0.00 ? 68 LEU A CA   4  
ATOM 6825  C C    . LEU A 1 72 ? -11.189 -5.159  -5.708  1.00 0.00 ? 68 LEU A C    4  
ATOM 6826  O O    . LEU A 1 72 ? -12.302 -5.689  -5.735  1.00 0.00 ? 68 LEU A O    4  
ATOM 6827  C CB   . LEU A 1 72 ? -11.248 -2.691  -5.303  1.00 0.00 ? 68 LEU A CB   4  
ATOM 6828  C CG   . LEU A 1 72 ? -11.303 -1.534  -4.302  1.00 0.00 ? 68 LEU A CG   4  
ATOM 6829  C CD1  . LEU A 1 72 ? -11.404 -0.197  -5.024  1.00 0.00 ? 68 LEU A CD1  4  
ATOM 6830  C CD2  . LEU A 1 72 ? -12.469 -1.715  -3.342  1.00 0.00 ? 68 LEU A CD2  4  
ATOM 6831  H H    . LEU A 1 72 ? -8.875  -3.343  -4.650  1.00 0.00 ? 68 LEU A H    4  
ATOM 6832  H HA   . LEU A 1 72 ? -11.441 -4.220  -3.811  1.00 0.00 ? 68 LEU A HA   4  
ATOM 6833  H HB2  . LEU A 1 72 ? -10.524 -2.445  -6.065  1.00 0.00 ? 68 LEU A HB2  4  
ATOM 6834  H HB3  . LEU A 1 72 ? -12.217 -2.783  -5.769  1.00 0.00 ? 68 LEU A HB3  4  
ATOM 6835  H HG   . LEU A 1 72 ? -10.393 -1.530  -3.723  1.00 0.00 ? 68 LEU A HG   4  
ATOM 6836  H HD11 . LEU A 1 72 ? -11.396 0.603   -4.299  1.00 0.00 ? 68 LEU A HD11 4  
ATOM 6837  H HD12 . LEU A 1 72 ? -12.323 -0.159  -5.592  1.00 0.00 ? 68 LEU A HD12 4  
ATOM 6838  H HD13 . LEU A 1 72 ? -10.564 -0.085  -5.692  1.00 0.00 ? 68 LEU A HD13 4  
ATOM 6839  H HD21 . LEU A 1 72 ? -12.261 -2.537  -2.674  1.00 0.00 ? 68 LEU A HD21 4  
ATOM 6840  H HD22 . LEU A 1 72 ? -13.370 -1.926  -3.902  1.00 0.00 ? 68 LEU A HD22 4  
ATOM 6841  H HD23 . LEU A 1 72 ? -12.606 -0.811  -2.768  1.00 0.00 ? 68 LEU A HD23 4  
ATOM 6842  N N    . LEU A 1 73 ? -10.198 -5.498  -6.521  1.00 0.00 ? 69 LEU A N    4  
ATOM 6843  C CA   . LEU A 1 73 ? -10.339 -6.544  -7.523  1.00 0.00 ? 69 LEU A CA   4  
ATOM 6844  C C    . LEU A 1 73 ? -10.662 -7.873  -6.853  1.00 0.00 ? 69 LEU A C    4  
ATOM 6845  O O    . LEU A 1 73 ? -11.568 -8.592  -7.277  1.00 0.00 ? 69 LEU A O    4  
ATOM 6846  C CB   . LEU A 1 73 ? -9.051  -6.666  -8.344  1.00 0.00 ? 69 LEU A CB   4  
ATOM 6847  C CG   . LEU A 1 73 ? -8.625  -5.395  -9.086  1.00 0.00 ? 69 LEU A CG   4  
ATOM 6848  C CD1  . LEU A 1 73 ? -7.253  -5.573  -9.717  1.00 0.00 ? 69 LEU A CD1  4  
ATOM 6849  C CD2  . LEU A 1 73 ? -9.651  -5.023  -10.145 1.00 0.00 ? 69 LEU A CD2  4  
ATOM 6850  H H    . LEU A 1 73 ? -9.340  -5.029  -6.442  1.00 0.00 ? 69 LEU A H    4  
ATOM 6851  H HA   . LEU A 1 73 ? -11.154 -6.273  -8.179  1.00 0.00 ? 69 LEU A HA   4  
ATOM 6852  H HB2  . LEU A 1 73 ? -8.252  -6.950  -7.674  1.00 0.00 ? 69 LEU A HB2  4  
ATOM 6853  H HB3  . LEU A 1 73 ? -9.185  -7.452  -9.071  1.00 0.00 ? 69 LEU A HB3  4  
ATOM 6854  H HG   . LEU A 1 73 ? -8.562  -4.578  -8.381  1.00 0.00 ? 69 LEU A HG   4  
ATOM 6855  H HD11 . LEU A 1 73 ? -7.307  -6.317  -10.497 1.00 0.00 ? 69 LEU A HD11 4  
ATOM 6856  H HD12 . LEU A 1 73 ? -6.547  -5.892  -8.964  1.00 0.00 ? 69 LEU A HD12 4  
ATOM 6857  H HD13 . LEU A 1 73 ? -6.927  -4.633  -10.139 1.00 0.00 ? 69 LEU A HD13 4  
ATOM 6858  H HD21 . LEU A 1 73 ? -10.601 -4.822  -9.671  1.00 0.00 ? 69 LEU A HD21 4  
ATOM 6859  H HD22 . LEU A 1 73 ? -9.762  -5.841  -10.842 1.00 0.00 ? 69 LEU A HD22 4  
ATOM 6860  H HD23 . LEU A 1 73 ? -9.319  -4.141  -10.673 1.00 0.00 ? 69 LEU A HD23 4  
ATOM 6861  N N    . GLY A 1 74 ? -9.929  -8.178  -5.788  1.00 0.00 ? 70 GLY A N    4  
ATOM 6862  C CA   . GLY A 1 74 ? -10.152 -9.411  -5.063  1.00 0.00 ? 70 GLY A CA   4  
ATOM 6863  C C    . GLY A 1 74 ? -11.507 -9.433  -4.391  1.00 0.00 ? 70 GLY A C    4  
ATOM 6864  O O    . GLY A 1 74 ? -12.168 -10.465 -4.345  1.00 0.00 ? 70 GLY A O    4  
ATOM 6865  H H    . GLY A 1 74 ? -9.229  -7.558  -5.492  1.00 0.00 ? 70 GLY A H    4  
ATOM 6866  H HA2  . GLY A 1 74 ? -10.088 -10.240 -5.752  1.00 0.00 ? 70 GLY A HA2  4  
ATOM 6867  H HA3  . GLY A 1 74 ? -9.386  -9.519  -4.310  1.00 0.00 ? 70 GLY A HA3  4  
ATOM 6868  N N    . LEU A 1 75 ? -11.929 -8.276  -3.894  1.00 0.00 ? 71 LEU A N    4  
ATOM 6869  C CA   . LEU A 1 75 ? -13.220 -8.158  -3.220  1.00 0.00 ? 71 LEU A CA   4  
ATOM 6870  C C    . LEU A 1 75 ? -14.362 -8.453  -4.188  1.00 0.00 ? 71 LEU A C    4  
ATOM 6871  O O    . LEU A 1 75 ? -15.257 -9.244  -3.886  1.00 0.00 ? 71 LEU A O    4  
ATOM 6872  C CB   . LEU A 1 75 ? -13.416 -6.760  -2.625  1.00 0.00 ? 71 LEU A CB   4  
ATOM 6873  C CG   . LEU A 1 75 ? -12.520 -6.398  -1.441  1.00 0.00 ? 71 LEU A CG   4  
ATOM 6874  C CD1  . LEU A 1 75 ? -12.917 -5.040  -0.889  1.00 0.00 ? 71 LEU A CD1  4  
ATOM 6875  C CD2  . LEU A 1 75 ? -12.605 -7.460  -0.354  1.00 0.00 ? 71 LEU A CD2  4  
ATOM 6876  H H    . LEU A 1 75 ? -11.355 -7.488  -4.002  1.00 0.00 ? 71 LEU A H    4  
ATOM 6877  H HA   . LEU A 1 75 ? -13.246 -8.886  -2.422  1.00 0.00 ? 71 LEU A HA   4  
ATOM 6878  H HB2  . LEU A 1 75 ? -13.246 -6.036  -3.409  1.00 0.00 ? 71 LEU A HB2  4  
ATOM 6879  H HB3  . LEU A 1 75 ? -14.443 -6.678  -2.304  1.00 0.00 ? 71 LEU A HB3  4  
ATOM 6880  H HG   . LEU A 1 75 ? -11.494 -6.339  -1.776  1.00 0.00 ? 71 LEU A HG   4  
ATOM 6881  H HD11 . LEU A 1 75 ? -12.805 -4.293  -1.659  1.00 0.00 ? 71 LEU A HD11 4  
ATOM 6882  H HD12 . LEU A 1 75 ? -12.284 -4.790  -0.050  1.00 0.00 ? 71 LEU A HD12 4  
ATOM 6883  H HD13 . LEU A 1 75 ? -13.948 -5.070  -0.565  1.00 0.00 ? 71 LEU A HD13 4  
ATOM 6884  H HD21 . LEU A 1 75 ? -12.236 -8.399  -0.737  1.00 0.00 ? 71 LEU A HD21 4  
ATOM 6885  H HD22 . LEU A 1 75 ? -13.634 -7.578  -0.045  1.00 0.00 ? 71 LEU A HD22 4  
ATOM 6886  H HD23 . LEU A 1 75 ? -12.007 -7.157  0.492   1.00 0.00 ? 71 LEU A HD23 4  
ATOM 6887  N N    . LYS A 1 76 ? -14.313 -7.820  -5.355  1.00 0.00 ? 72 LYS A N    4  
ATOM 6888  C CA   . LYS A 1 76 ? -15.341 -7.997  -6.374  1.00 0.00 ? 72 LYS A CA   4  
ATOM 6889  C C    . LYS A 1 76 ? -15.423 -9.456  -6.819  1.00 0.00 ? 72 LYS A C    4  
ATOM 6890  O O    . LYS A 1 76 ? -16.514 -10.015 -6.950  1.00 0.00 ? 72 LYS A O    4  
ATOM 6891  C CB   . LYS A 1 76 ? -15.054 -7.091  -7.576  1.00 0.00 ? 72 LYS A CB   4  
ATOM 6892  C CG   . LYS A 1 76 ? -15.055 -5.605  -7.242  1.00 0.00 ? 72 LYS A CG   4  
ATOM 6893  C CD   . LYS A 1 76 ? -14.469 -4.781  -8.381  1.00 0.00 ? 72 LYS A CD   4  
ATOM 6894  C CE   . LYS A 1 76 ? -14.351 -3.307  -8.017  1.00 0.00 ? 72 LYS A CE   4  
ATOM 6895  N NZ   . LYS A 1 76 ? -15.603 -2.560  -8.305  1.00 0.00 ? 72 LYS A NZ   4  
ATOM 6896  H H    . LYS A 1 76 ? -13.559 -7.215  -5.539  1.00 0.00 ? 72 LYS A H    4  
ATOM 6897  H HA   . LYS A 1 76 ? -16.290 -7.714  -5.940  1.00 0.00 ? 72 LYS A HA   4  
ATOM 6898  H HB2  . LYS A 1 76 ? -14.085 -7.344  -7.977  1.00 0.00 ? 72 LYS A HB2  4  
ATOM 6899  H HB3  . LYS A 1 76 ? -15.804 -7.268  -8.334  1.00 0.00 ? 72 LYS A HB3  4  
ATOM 6900  H HG2  . LYS A 1 76 ? -16.072 -5.285  -7.062  1.00 0.00 ? 72 LYS A HG2  4  
ATOM 6901  H HG3  . LYS A 1 76 ? -14.464 -5.446  -6.352  1.00 0.00 ? 72 LYS A HG3  4  
ATOM 6902  H HD2  . LYS A 1 76 ? -13.487 -5.160  -8.616  1.00 0.00 ? 72 LYS A HD2  4  
ATOM 6903  H HD3  . LYS A 1 76 ? -15.109 -4.877  -9.245  1.00 0.00 ? 72 LYS A HD3  4  
ATOM 6904  H HE2  . LYS A 1 76 ? -14.129 -3.225  -6.963  1.00 0.00 ? 72 LYS A HE2  4  
ATOM 6905  H HE3  . LYS A 1 76 ? -13.543 -2.873  -8.588  1.00 0.00 ? 72 LYS A HE3  4  
ATOM 6906  H HZ1  . LYS A 1 76 ? -15.457 -1.540  -8.163  1.00 0.00 ? 72 LYS A HZ1  4  
ATOM 6907  H HZ2  . LYS A 1 76 ? -16.369 -2.881  -7.674  1.00 0.00 ? 72 LYS A HZ2  4  
ATOM 6908  H HZ3  . LYS A 1 76 ? -15.896 -2.722  -9.290  1.00 0.00 ? 72 LYS A HZ3  4  
ATOM 6909  N N    . ASP A 1 77 ? -14.269 -10.069 -7.043  1.00 0.00 ? 73 ASP A N    4  
ATOM 6910  C CA   . ASP A 1 77 ? -14.215 -11.464 -7.470  1.00 0.00 ? 73 ASP A CA   4  
ATOM 6911  C C    . ASP A 1 77 ? -14.676 -12.411 -6.365  1.00 0.00 ? 73 ASP A C    4  
ATOM 6912  O O    . ASP A 1 77 ? -15.345 -13.407 -6.635  1.00 0.00 ? 73 ASP A O    4  
ATOM 6913  C CB   . ASP A 1 77 ? -12.794 -11.833 -7.906  1.00 0.00 ? 73 ASP A CB   4  
ATOM 6914  C CG   . ASP A 1 77 ? -12.699 -13.253 -8.430  1.00 0.00 ? 73 ASP A CG   4  
ATOM 6915  O OD1  . ASP A 1 77 ? -13.303 -13.545 -9.487  1.00 0.00 ? 73 ASP A OD1  4  
ATOM 6916  O OD2  . ASP A 1 77 ? -12.013 -14.083 -7.794  1.00 0.00 ? 73 ASP A OD2  4  
ATOM 6917  H H    . ASP A 1 77 ? -13.429 -9.568  -6.948  1.00 0.00 ? 73 ASP A H    4  
ATOM 6918  H HA   . ASP A 1 77 ? -14.877 -11.572 -8.316  1.00 0.00 ? 73 ASP A HA   4  
ATOM 6919  H HB2  . ASP A 1 77 ? -12.476 -11.157 -8.685  1.00 0.00 ? 73 ASP A HB2  4  
ATOM 6920  H HB3  . ASP A 1 77 ? -12.129 -11.736 -7.058  1.00 0.00 ? 73 ASP A HB3  4  
ATOM 6921  N N    . GLN A 1 78 ? -14.357 -12.076 -5.118  1.00 0.00 ? 74 GLN A N    4  
ATOM 6922  C CA   . GLN A 1 78 ? -14.720 -12.914 -3.981  1.00 0.00 ? 74 GLN A CA   4  
ATOM 6923  C C    . GLN A 1 78 ? -16.226 -12.959 -3.771  1.00 0.00 ? 74 GLN A C    4  
ATOM 6924  O O    . GLN A 1 78 ? -16.790 -14.025 -3.522  1.00 0.00 ? 74 GLN A O    4  
ATOM 6925  C CB   . GLN A 1 78 ? -14.031 -12.416 -2.710  1.00 0.00 ? 74 GLN A CB   4  
ATOM 6926  C CG   . GLN A 1 78 ? -12.628 -12.974 -2.527  1.00 0.00 ? 74 GLN A CG   4  
ATOM 6927  C CD   . GLN A 1 78 ? -12.625 -14.420 -2.072  1.00 0.00 ? 74 GLN A CD   4  
ATOM 6928  O OE1  . GLN A 1 78 ? -13.521 -15.196 -2.405  1.00 0.00 ? 74 GLN A OE1  4  
ATOM 6929  N NE2  . GLN A 1 78 ? -11.620 -14.790 -1.300  1.00 0.00 ? 74 GLN A NE2  4  
ATOM 6930  H H    . GLN A 1 78 ? -13.893 -11.227 -4.950  1.00 0.00 ? 74 GLN A H    4  
ATOM 6931  H HA   . GLN A 1 78 ? -14.372 -13.913 -4.190  1.00 0.00 ? 74 GLN A HA   4  
ATOM 6932  H HB2  . GLN A 1 78 ? -13.964 -11.340 -2.753  1.00 0.00 ? 74 GLN A HB2  4  
ATOM 6933  H HB3  . GLN A 1 78 ? -14.625 -12.699 -1.854  1.00 0.00 ? 74 GLN A HB3  4  
ATOM 6934  H HG2  . GLN A 1 78 ? -12.106 -12.912 -3.470  1.00 0.00 ? 74 GLN A HG2  4  
ATOM 6935  H HG3  . GLN A 1 78 ? -12.110 -12.378 -1.790  1.00 0.00 ? 74 GLN A HG3  4  
ATOM 6936  H HE21 . GLN A 1 78 ? -10.943 -14.120 -1.066  1.00 0.00 ? 74 GLN A HE21 4  
ATOM 6937  H HE22 . GLN A 1 78 ? -11.588 -15.721 -0.996  1.00 0.00 ? 74 GLN A HE22 4  
ATOM 6938  N N    . VAL A 1 79 ? -16.890 -11.813 -3.895  1.00 0.00 ? 75 VAL A N    4  
ATOM 6939  C CA   . VAL A 1 79 ? -18.335 -11.761 -3.705  1.00 0.00 ? 75 VAL A CA   4  
ATOM 6940  C C    . VAL A 1 79 ? -19.051 -12.445 -4.874  1.00 0.00 ? 75 VAL A C    4  
ATOM 6941  O O    . VAL A 1 79 ? -20.241 -12.753 -4.802  1.00 0.00 ? 75 VAL A O    4  
ATOM 6942  C CB   . VAL A 1 79 ? -18.834 -10.304 -3.539  1.00 0.00 ? 75 VAL A CB   4  
ATOM 6943  C CG1  . VAL A 1 79 ? -18.958 -9.598  -4.881  1.00 0.00 ? 75 VAL A CG1  4  
ATOM 6944  C CG2  . VAL A 1 79 ? -20.155 -10.269 -2.780  1.00 0.00 ? 75 VAL A CG2  4  
ATOM 6945  H H    . VAL A 1 79 ? -16.408 -10.985 -4.123  1.00 0.00 ? 75 VAL A H    4  
ATOM 6946  H HA   . VAL A 1 79 ? -18.564 -12.300 -2.798  1.00 0.00 ? 75 VAL A HA   4  
ATOM 6947  H HB   . VAL A 1 79 ? -18.102 -9.768  -2.953  1.00 0.00 ? 75 VAL A HB   4  
ATOM 6948  H HG11 . VAL A 1 79 ? -19.681 -10.115 -5.495  1.00 0.00 ? 75 VAL A HG11 4  
ATOM 6949  H HG12 . VAL A 1 79 ? -17.998 -9.600  -5.375  1.00 0.00 ? 75 VAL A HG12 4  
ATOM 6950  H HG13 . VAL A 1 79 ? -19.281 -8.579  -4.724  1.00 0.00 ? 75 VAL A HG13 4  
ATOM 6951  H HG21 . VAL A 1 79 ? -19.994 -10.596 -1.763  1.00 0.00 ? 75 VAL A HG21 4  
ATOM 6952  H HG22 . VAL A 1 79 ? -20.865 -10.925 -3.261  1.00 0.00 ? 75 VAL A HG22 4  
ATOM 6953  H HG23 . VAL A 1 79 ? -20.539 -9.260  -2.777  1.00 0.00 ? 75 VAL A HG23 4  
ATOM 6954  N N    . ASN A 1 80 ? -18.301 -12.699 -5.939  1.00 0.00 ? 76 ASN A N    4  
ATOM 6955  C CA   . ASN A 1 80 ? -18.841 -13.358 -7.121  1.00 0.00 ? 76 ASN A CA   4  
ATOM 6956  C C    . ASN A 1 80 ? -18.485 -14.839 -7.113  1.00 0.00 ? 76 ASN A C    4  
ATOM 6957  O O    . ASN A 1 80 ? -18.908 -15.596 -7.986  1.00 0.00 ? 76 ASN A O    4  
ATOM 6958  C CB   . ASN A 1 80 ? -18.303 -12.706 -8.399  1.00 0.00 ? 76 ASN A CB   4  
ATOM 6959  C CG   . ASN A 1 80 ? -19.186 -11.579 -8.897  1.00 0.00 ? 76 ASN A CG   4  
ATOM 6960  O OD1  . ASN A 1 80 ? -20.146 -11.806 -9.633  1.00 0.00 ? 76 ASN A OD1  4  
ATOM 6961  N ND2  . ASN A 1 80 ? -18.862 -10.354 -8.516  1.00 0.00 ? 76 ASN A ND2  4  
ATOM 6962  H H    . ASN A 1 80 ? -17.355 -12.440 -5.928  1.00 0.00 ? 76 ASN A H    4  
ATOM 6963  H HA   . ASN A 1 80 ? -19.915 -13.255 -7.098  1.00 0.00 ? 76 ASN A HA   4  
ATOM 6964  H HB2  . ASN A 1 80 ? -17.320 -12.306 -8.204  1.00 0.00 ? 76 ASN A HB2  4  
ATOM 6965  H HB3  . ASN A 1 80 ? -18.235 -13.455 -9.174  1.00 0.00 ? 76 ASN A HB3  4  
ATOM 6966  H HD21 . ASN A 1 80 ? -18.072 -10.240 -7.937  1.00 0.00 ? 76 ASN A HD21 4  
ATOM 6967  H HD22 . ASN A 1 80 ? -19.421 -9.610  -8.823  1.00 0.00 ? 76 ASN A HD22 4  
ATOM 6968  N N    . THR A 1 81 ? -17.706 -15.247 -6.123  1.00 0.00 ? 77 THR A N    4  
ATOM 6969  C CA   . THR A 1 81 ? -17.290 -16.632 -6.004  1.00 0.00 ? 77 THR A CA   4  
ATOM 6970  C C    . THR A 1 81 ? -18.359 -17.451 -5.286  1.00 0.00 ? 77 THR A C    4  
ATOM 6971  O O    . THR A 1 81 ? -18.876 -17.038 -4.243  1.00 0.00 ? 77 THR A O    4  
ATOM 6972  C CB   . THR A 1 81 ? -15.946 -16.752 -5.250  1.00 0.00 ? 77 THR A CB   4  
ATOM 6973  O OG1  . THR A 1 81 ? -14.953 -15.922 -5.876  1.00 0.00 ? 77 THR A OG1  4  
ATOM 6974  C CG2  . THR A 1 81 ? -15.454 -18.192 -5.230  1.00 0.00 ? 77 THR A CG2  4  
ATOM 6975  H H    . THR A 1 81 ? -17.422 -14.604 -5.438  1.00 0.00 ? 77 THR A H    4  
ATOM 6976  H HA   . THR A 1 81 ? -17.157 -17.027 -7.001  1.00 0.00 ? 77 THR A HA   4  
ATOM 6977  H HB   . THR A 1 81 ? -16.090 -16.421 -4.231  1.00 0.00 ? 77 THR A HB   4  
ATOM 6978  H HG1  . THR A 1 81 ? -15.371 -15.119 -6.220  1.00 0.00 ? 77 THR A HG1  4  
ATOM 6979  H HG21 . THR A 1 81 ? -16.205 -18.822 -4.776  1.00 0.00 ? 77 THR A HG21 4  
ATOM 6980  H HG22 . THR A 1 81 ? -14.540 -18.253 -4.659  1.00 0.00 ? 77 THR A HG22 4  
ATOM 6981  H HG23 . THR A 1 81 ? -15.269 -18.524 -6.240  1.00 0.00 ? 77 THR A HG23 4  
ATOM 6982  N N    . VAL A 1 82 ? -18.697 -18.599 -5.855  1.00 0.00 ? 78 VAL A N    4  
ATOM 6983  C CA   . VAL A 1 82 ? -19.701 -19.473 -5.272  1.00 0.00 ? 78 VAL A CA   4  
ATOM 6984  C C    . VAL A 1 82 ? -19.034 -20.563 -4.441  1.00 0.00 ? 78 VAL A C    4  
ATOM 6985  O O    . VAL A 1 82 ? -19.699 -21.138 -3.559  1.00 0.00 ? 78 VAL A O    4  
ATOM 6986  C CB   . VAL A 1 82 ? -20.600 -20.123 -6.349  1.00 0.00 ? 78 VAL A CB   4  
ATOM 6987  C CG1  . VAL A 1 82 ? -21.466 -19.073 -7.028  1.00 0.00 ? 78 VAL A CG1  4  
ATOM 6988  C CG2  . VAL A 1 82 ? -19.764 -20.872 -7.377  1.00 0.00 ? 78 VAL A CG2  4  
ATOM 6989  O OXT  . VAL A 1 82 ? -17.832 -20.824 -4.664  1.00 0.00 ? 78 VAL A OXT  4  
ATOM 6990  H H    . VAL A 1 82 ? -18.241 -18.873 -6.678  1.00 0.00 ? 78 VAL A H    4  
ATOM 6991  H HA   . VAL A 1 82 ? -20.326 -18.876 -4.624  1.00 0.00 ? 78 VAL A HA   4  
ATOM 6992  H HB   . VAL A 1 82 ? -21.254 -20.834 -5.863  1.00 0.00 ? 78 VAL A HB   4  
ATOM 6993  H HG11 . VAL A 1 82 ? -22.121 -18.620 -6.300  1.00 0.00 ? 78 VAL A HG11 4  
ATOM 6994  H HG12 . VAL A 1 82 ? -22.057 -19.540 -7.803  1.00 0.00 ? 78 VAL A HG12 4  
ATOM 6995  H HG13 . VAL A 1 82 ? -20.834 -18.315 -7.466  1.00 0.00 ? 78 VAL A HG13 4  
ATOM 6996  H HG21 . VAL A 1 82 ? -19.145 -20.170 -7.916  1.00 0.00 ? 78 VAL A HG21 4  
ATOM 6997  H HG22 . VAL A 1 82 ? -20.416 -21.382 -8.069  1.00 0.00 ? 78 VAL A HG22 4  
ATOM 6998  H HG23 . VAL A 1 82 ? -19.137 -21.593 -6.874  1.00 0.00 ? 78 VAL A HG23 4  
ATOM 6999  N N    . GLY B 2 18 ? 10.717  7.062   10.997  1.00 0.00 ? 28 GLY B N    4  
ATOM 7000  C CA   . GLY B 2 18 ? 9.991   5.948   10.344  1.00 0.00 ? 28 GLY B CA   4  
ATOM 7001  C C    . GLY B 2 18 ? 10.865  4.727   10.170  1.00 0.00 ? 28 GLY B C    4  
ATOM 7002  O O    . GLY B 2 18 ? 10.960  3.892   11.067  1.00 0.00 ? 28 GLY B O    4  
ATOM 7003  H H    . GLY B 2 18 ? 10.136  7.926   10.978  1.00 0.00 ? 28 GLY B H    4  
ATOM 7004  H HA2  . GLY B 2 18 ? 9.138   5.682   10.952  1.00 0.00 ? 28 GLY B HA2  4  
ATOM 7005  H HA3  . GLY B 2 18 ? 9.644   6.272   9.375   1.00 0.00 ? 28 GLY B HA3  4  
ATOM 7006  N N    . MET B 2 19 ? 11.521  4.631   9.022   1.00 0.00 ? 29 MET B N    4  
ATOM 7007  C CA   . MET B 2 19 ? 12.391  3.501   8.735   1.00 0.00 ? 29 MET B CA   4  
ATOM 7008  C C    . MET B 2 19 ? 13.722  3.966   8.148   1.00 0.00 ? 29 MET B C    4  
ATOM 7009  O O    . MET B 2 19 ? 14.434  3.186   7.521   1.00 0.00 ? 29 MET B O    4  
ATOM 7010  C CB   . MET B 2 19 ? 11.706  2.515   7.780   1.00 0.00 ? 29 MET B CB   4  
ATOM 7011  C CG   . MET B 2 19 ? 11.317  3.115   6.438   1.00 0.00 ? 29 MET B CG   4  
ATOM 7012  S SD   . MET B 2 19 ? 10.726  1.869   5.274   1.00 0.00 ? 29 MET B SD   4  
ATOM 7013  C CE   . MET B 2 19 ? 10.080  2.906   3.965   1.00 0.00 ? 29 MET B CE   4  
ATOM 7014  H H    . MET B 2 19 ? 11.418  5.348   8.342   1.00 0.00 ? 29 MET B H    4  
ATOM 7015  H HA   . MET B 2 19 ? 12.587  2.997   9.670   1.00 0.00 ? 29 MET B HA   4  
ATOM 7016  H HB2  . MET B 2 19 ? 12.375  1.688   7.596   1.00 0.00 ? 29 MET B HB2  4  
ATOM 7017  H HB3  . MET B 2 19 ? 10.810  2.140   8.253   1.00 0.00 ? 29 MET B HB3  4  
ATOM 7018  H HG2  . MET B 2 19 ? 10.534  3.841   6.595   1.00 0.00 ? 29 MET B HG2  4  
ATOM 7019  H HG3  . MET B 2 19 ? 12.182  3.604   6.014   1.00 0.00 ? 29 MET B HG3  4  
ATOM 7020  H HE1  . MET B 2 19 ? 9.348   3.587   4.372   1.00 0.00 ? 29 MET B HE1  4  
ATOM 7021  H HE2  . MET B 2 19 ? 9.616   2.287   3.212   1.00 0.00 ? 29 MET B HE2  4  
ATOM 7022  H HE3  . MET B 2 19 ? 10.887  3.469   3.519   1.00 0.00 ? 29 MET B HE3  4  
ATOM 7023  N N    . SER B 2 20 ? 14.053  5.237   8.354   1.00 0.00 ? 30 SER B N    4  
ATOM 7024  C CA   . SER B 2 20 ? 15.308  5.796   7.864   1.00 0.00 ? 30 SER B CA   4  
ATOM 7025  C C    . SER B 2 20 ? 16.492  5.011   8.422   1.00 0.00 ? 30 SER B C    4  
ATOM 7026  O O    . SER B 2 20 ? 17.313  4.484   7.671   1.00 0.00 ? 30 SER B O    4  
ATOM 7027  C CB   . SER B 2 20 ? 15.404  7.265   8.272   1.00 0.00 ? 30 SER B CB   4  
ATOM 7028  O OG   . SER B 2 20 ? 14.119  7.782   8.579   1.00 0.00 ? 30 SER B OG   4  
ATOM 7029  H H    . SER B 2 20 ? 13.430  5.827   8.828   1.00 0.00 ? 30 SER B H    4  
ATOM 7030  H HA   . SER B 2 20 ? 15.312  5.724   6.786   1.00 0.00 ? 30 SER B HA   4  
ATOM 7031  H HB2  . SER B 2 20 ? 16.034  7.356   9.145   1.00 0.00 ? 30 SER B HB2  4  
ATOM 7032  H HB3  . SER B 2 20 ? 15.826  7.839   7.460   1.00 0.00 ? 30 SER B HB3  4  
ATOM 7033  H HG   . SER B 2 20 ? 13.615  7.907   7.746   1.00 0.00 ? 30 SER B HG   4  
ATOM 7034  N N    . ALA B 2 21 ? 16.574  4.946   9.749   1.00 0.00 ? 31 ALA B N    4  
ATOM 7035  C CA   . ALA B 2 21 ? 17.633  4.200   10.425  1.00 0.00 ? 31 ALA B CA   4  
ATOM 7036  C C    . ALA B 2 21 ? 17.634  2.738   9.982   1.00 0.00 ? 31 ALA B C    4  
ATOM 7037  O O    . ALA B 2 21 ? 18.684  2.099   9.898   1.00 0.00 ? 31 ALA B O    4  
ATOM 7038  C CB   . ALA B 2 21 ? 17.467  4.304   11.933  1.00 0.00 ? 31 ALA B CB   4  
ATOM 7039  H H    . ALA B 2 21 ? 15.935  5.470   10.281  1.00 0.00 ? 31 ALA B H    4  
ATOM 7040  H HA   . ALA B 2 21 ? 18.580  4.647   10.156  1.00 0.00 ? 31 ALA B HA   4  
ATOM 7041  H HB1  . ALA B 2 21 ? 16.554  3.809   12.230  1.00 0.00 ? 31 ALA B HB1  4  
ATOM 7042  H HB2  . ALA B 2 21 ? 17.419  5.344   12.219  1.00 0.00 ? 31 ALA B HB2  4  
ATOM 7043  H HB3  . ALA B 2 21 ? 18.306  3.835   12.423  1.00 0.00 ? 31 ALA B HB3  4  
ATOM 7044  N N    . TRP B 2 22 ? 16.448  2.228   9.684   1.00 0.00 ? 32 TRP B N    4  
ATOM 7045  C CA   . TRP B 2 22 ? 16.272  0.851   9.234   1.00 0.00 ? 32 TRP B CA   4  
ATOM 7046  C C    . TRP B 2 22 ? 16.865  0.675   7.833   1.00 0.00 ? 32 TRP B C    4  
ATOM 7047  O O    . TRP B 2 22 ? 17.445  -0.364  7.509   1.00 0.00 ? 32 TRP B O    4  
ATOM 7048  C CB   . TRP B 2 22 ? 14.773  0.520   9.238   1.00 0.00 ? 32 TRP B CB   4  
ATOM 7049  C CG   . TRP B 2 22 ? 14.434  -0.931  9.052   1.00 0.00 ? 32 TRP B CG   4  
ATOM 7050  C CD1  . TRP B 2 22 ? 14.191  -1.851  10.035  1.00 0.00 ? 32 TRP B CD1  4  
ATOM 7051  C CD2  . TRP B 2 22 ? 14.275  -1.622  7.808   1.00 0.00 ? 32 TRP B CD2  4  
ATOM 7052  N NE1  . TRP B 2 22 ? 13.889  -3.071  9.475   1.00 0.00 ? 32 TRP B NE1  4  
ATOM 7053  C CE2  . TRP B 2 22 ? 13.939  -2.956  8.109   1.00 0.00 ? 32 TRP B CE2  4  
ATOM 7054  C CE3  . TRP B 2 22 ? 14.386  -1.243  6.467   1.00 0.00 ? 32 TRP B CE3  4  
ATOM 7055  C CZ2  . TRP B 2 22 ? 13.713  -3.908  7.118   1.00 0.00 ? 32 TRP B CZ2  4  
ATOM 7056  C CZ3  . TRP B 2 22 ? 14.162  -2.189  5.486   1.00 0.00 ? 32 TRP B CZ3  4  
ATOM 7057  C CH2  . TRP B 2 22 ? 13.829  -3.507  5.816   1.00 0.00 ? 32 TRP B CH2  4  
ATOM 7058  H H    . TRP B 2 22 ? 15.658  2.800   9.768   1.00 0.00 ? 32 TRP B H    4  
ATOM 7059  H HA   . TRP B 2 22 ? 16.786  0.200   9.923   1.00 0.00 ? 32 TRP B HA   4  
ATOM 7060  H HB2  . TRP B 2 22 ? 14.352  0.833   10.181  1.00 0.00 ? 32 TRP B HB2  4  
ATOM 7061  H HB3  . TRP B 2 22 ? 14.295  1.075   8.443   1.00 0.00 ? 32 TRP B HB3  4  
ATOM 7062  H HD1  . TRP B 2 22 ? 14.231  -1.636  11.093  1.00 0.00 ? 32 TRP B HD1  4  
ATOM 7063  H HE1  . TRP B 2 22 ? 13.672  -3.896  9.976   1.00 0.00 ? 32 TRP B HE1  4  
ATOM 7064  H HE3  . TRP B 2 22 ? 14.642  -0.231  6.193   1.00 0.00 ? 32 TRP B HE3  4  
ATOM 7065  H HZ2  . TRP B 2 22 ? 13.454  -4.929  7.355   1.00 0.00 ? 32 TRP B HZ2  4  
ATOM 7066  H HZ3  . TRP B 2 22 ? 14.245  -1.913  4.445   1.00 0.00 ? 32 TRP B HZ3  4  
ATOM 7067  H HH2  . TRP B 2 22 ? 13.666  -4.212  5.015   1.00 0.00 ? 32 TRP B HH2  4  
ATOM 7068  N N    . LEU B 2 23 ? 16.741  1.717   7.018   1.00 0.00 ? 33 LEU B N    4  
ATOM 7069  C CA   . LEU B 2 23 ? 17.242  1.692   5.650   1.00 0.00 ? 33 LEU B CA   4  
ATOM 7070  C C    . LEU B 2 23 ? 18.722  2.046   5.587   1.00 0.00 ? 33 LEU B C    4  
ATOM 7071  O O    . LEU B 2 23 ? 19.384  1.778   4.583   1.00 0.00 ? 33 LEU B O    4  
ATOM 7072  C CB   . LEU B 2 23 ? 16.433  2.639   4.765   1.00 0.00 ? 33 LEU B CB   4  
ATOM 7073  C CG   . LEU B 2 23 ? 15.080  2.092   4.303   1.00 0.00 ? 33 LEU B CG   4  
ATOM 7074  C CD1  . LEU B 2 23 ? 14.288  3.168   3.586   1.00 0.00 ? 33 LEU B CD1  4  
ATOM 7075  C CD2  . LEU B 2 23 ? 15.265  0.884   3.397   1.00 0.00 ? 33 LEU B CD2  4  
ATOM 7076  H H    . LEU B 2 23 ? 16.303  2.529   7.355   1.00 0.00 ? 33 LEU B H    4  
ATOM 7077  H HA   . LEU B 2 23 ? 17.119  0.686   5.279   1.00 0.00 ? 33 LEU B HA   4  
ATOM 7078  H HB2  . LEU B 2 23 ? 16.262  3.554   5.314   1.00 0.00 ? 33 LEU B HB2  4  
ATOM 7079  H HB3  . LEU B 2 23 ? 17.021  2.869   3.889   1.00 0.00 ? 33 LEU B HB3  4  
ATOM 7080  H HG   . LEU B 2 23 ? 14.512  1.779   5.166   1.00 0.00 ? 33 LEU B HG   4  
ATOM 7081  H HD11 . LEU B 2 23 ? 13.994  3.927   4.293   1.00 0.00 ? 33 LEU B HD11 4  
ATOM 7082  H HD12 . LEU B 2 23 ? 13.407  2.728   3.140   1.00 0.00 ? 33 LEU B HD12 4  
ATOM 7083  H HD13 . LEU B 2 23 ? 14.900  3.610   2.813   1.00 0.00 ? 33 LEU B HD13 4  
ATOM 7084  H HD21 . LEU B 2 23 ? 15.998  1.111   2.637   1.00 0.00 ? 33 LEU B HD21 4  
ATOM 7085  H HD22 . LEU B 2 23 ? 14.323  0.642   2.927   1.00 0.00 ? 33 LEU B HD22 4  
ATOM 7086  H HD23 . LEU B 2 23 ? 15.602  0.041   3.982   1.00 0.00 ? 33 LEU B HD23 4  
ATOM 7087  N N    . ARG B 2 24 ? 19.249  2.648   6.655   1.00 0.00 ? 34 ARG B N    4  
ATOM 7088  C CA   . ARG B 2 24 ? 20.668  3.005   6.714   1.00 0.00 ? 34 ARG B CA   4  
ATOM 7089  C C    . ARG B 2 24 ? 21.525  1.739   6.706   1.00 0.00 ? 34 ARG B C    4  
ATOM 7090  O O    . ARG B 2 24 ? 22.737  1.787   6.494   1.00 0.00 ? 34 ARG B O    4  
ATOM 7091  C CB   . ARG B 2 24 ? 20.956  3.828   7.975   1.00 0.00 ? 34 ARG B CB   4  
ATOM 7092  C CG   . ARG B 2 24 ? 22.316  4.509   7.969   1.00 0.00 ? 34 ARG B CG   4  
ATOM 7093  C CD   . ARG B 2 24 ? 22.206  5.976   7.583   1.00 0.00 ? 34 ARG B CD   4  
ATOM 7094  N NE   . ARG B 2 24 ? 21.440  6.738   8.566   1.00 0.00 ? 34 ARG B NE   4  
ATOM 7095  C CZ   . ARG B 2 24 ? 20.962  7.963   8.364   1.00 0.00 ? 34 ARG B CZ   4  
ATOM 7096  N NH1  . ARG B 2 24 ? 21.127  8.566   7.193   1.00 0.00 ? 34 ARG B NH1  4  
ATOM 7097  N NH2  . ARG B 2 24 ? 20.296  8.576   9.334   1.00 0.00 ? 34 ARG B NH2  4  
ATOM 7098  H H    . ARG B 2 24 ? 18.677  2.898   7.413   1.00 0.00 ? 34 ARG B H    4  
ATOM 7099  H HA   . ARG B 2 24 ? 20.903  3.595   5.840   1.00 0.00 ? 34 ARG B HA   4  
ATOM 7100  H HB2  . ARG B 2 24 ? 20.197  4.590   8.074   1.00 0.00 ? 34 ARG B HB2  4  
ATOM 7101  H HB3  . ARG B 2 24 ? 20.909  3.175   8.834   1.00 0.00 ? 34 ARG B HB3  4  
ATOM 7102  H HG2  . ARG B 2 24 ? 22.747  4.440   8.956   1.00 0.00 ? 34 ARG B HG2  4  
ATOM 7103  H HG3  . ARG B 2 24 ? 22.955  4.006   7.258   1.00 0.00 ? 34 ARG B HG3  4  
ATOM 7104  H HD2  . ARG B 2 24 ? 23.200  6.393   7.515   1.00 0.00 ? 34 ARG B HD2  4  
ATOM 7105  H HD3  . ARG B 2 24 ? 21.717  6.049   6.623   1.00 0.00 ? 34 ARG B HD3  4  
ATOM 7106  H HE   . ARG B 2 24 ? 21.281  6.309   9.437   1.00 0.00 ? 34 ARG B HE   4  
ATOM 7107  H HH11 . ARG B 2 24 ? 21.613  8.093   6.442   1.00 0.00 ? 34 ARG B HH11 4  
ATOM 7108  H HH12 . ARG B 2 24 ? 20.774  9.491   7.046   1.00 0.00 ? 34 ARG B HH12 4  
ATOM 7109  H HH21 . ARG B 2 24 ? 20.154  8.115   10.215  1.00 0.00 ? 34 ARG B HH21 4  
ATOM 7110  H HH22 . ARG B 2 24 ? 19.936  9.502   9.196   1.00 0.00 ? 34 ARG B HH22 4  
ATOM 7111  N N    . ALA B 2 25 ? 20.859  0.606   6.912   1.00 0.00 ? 35 ALA B N    4  
ATOM 7112  C CA   . ALA B 2 25 ? 21.512  -0.696  6.926   1.00 0.00 ? 35 ALA B CA   4  
ATOM 7113  C C    . ALA B 2 25 ? 22.176  -0.964  5.578   1.00 0.00 ? 35 ALA B C    4  
ATOM 7114  O O    . ALA B 2 25 ? 23.180  -1.673  5.493   1.00 0.00 ? 35 ALA B O    4  
ATOM 7115  C CB   . ALA B 2 25 ? 20.504  -1.788  7.251   1.00 0.00 ? 35 ALA B CB   4  
ATOM 7116  H H    . ALA B 2 25 ? 19.889  0.671   7.037   1.00 0.00 ? 35 ALA B H    4  
ATOM 7117  H HA   . ALA B 2 25 ? 22.269  -0.686  7.700   1.00 0.00 ? 35 ALA B HA   4  
ATOM 7118  H HB1  . ALA B 2 25 ? 19.957  -1.518  8.142   1.00 0.00 ? 35 ALA B HB1  4  
ATOM 7119  H HB2  . ALA B 2 25 ? 21.021  -2.722  7.414   1.00 0.00 ? 35 ALA B HB2  4  
ATOM 7120  H HB3  . ALA B 2 25 ? 19.816  -1.897  6.426   1.00 0.00 ? 35 ALA B HB3  4  
ATOM 7121  N N    . ILE B 2 26 ? 21.591  -0.390  4.530   1.00 0.00 ? 36 ILE B N    4  
ATOM 7122  C CA   . ILE B 2 26 ? 22.102  -0.523  3.172   1.00 0.00 ? 36 ILE B CA   4  
ATOM 7123  C C    . ILE B 2 26 ? 22.258  0.854   2.534   1.00 0.00 ? 36 ILE B C    4  
ATOM 7124  O O    . ILE B 2 26 ? 22.348  0.979   1.315   1.00 0.00 ? 36 ILE B O    4  
ATOM 7125  C CB   . ILE B 2 26 ? 21.167  -1.381  2.295   1.00 0.00 ? 36 ILE B CB   4  
ATOM 7126  C CG1  . ILE B 2 26 ? 19.708  -0.950  2.485   1.00 0.00 ? 36 ILE B CG1  4  
ATOM 7127  C CG2  . ILE B 2 26 ? 21.342  -2.855  2.631   1.00 0.00 ? 36 ILE B CG2  4  
ATOM 7128  C CD1  . ILE B 2 26 ? 18.765  -1.522  1.449   1.00 0.00 ? 36 ILE B CD1  4  
ATOM 7129  H H    . ILE B 2 26 ? 20.773  0.133   4.680   1.00 0.00 ? 36 ILE B H    4  
ATOM 7130  H HA   . ILE B 2 26 ? 23.069  -1.005  3.219   1.00 0.00 ? 36 ILE B HA   4  
ATOM 7131  H HB   . ILE B 2 26 ? 21.446  -1.238  1.261   1.00 0.00 ? 36 ILE B HB   4  
ATOM 7132  H HG12 . ILE B 2 26 ? 19.369  -1.278  3.456   1.00 0.00 ? 36 ILE B HG12 4  
ATOM 7133  H HG13 . ILE B 2 26 ? 19.649  0.127   2.433   1.00 0.00 ? 36 ILE B HG13 4  
ATOM 7134  H HG21 . ILE B 2 26 ? 21.137  -3.008  3.680   1.00 0.00 ? 36 ILE B HG21 4  
ATOM 7135  H HG22 . ILE B 2 26 ? 22.355  -3.155  2.413   1.00 0.00 ? 36 ILE B HG22 4  
ATOM 7136  H HG23 . ILE B 2 26 ? 20.656  -3.443  2.040   1.00 0.00 ? 36 ILE B HG23 4  
ATOM 7137  H HD11 . ILE B 2 26 ? 19.115  -1.262  0.461   1.00 0.00 ? 36 ILE B HD11 4  
ATOM 7138  H HD12 . ILE B 2 26 ? 17.777  -1.113  1.599   1.00 0.00 ? 36 ILE B HD12 4  
ATOM 7139  H HD13 . ILE B 2 26 ? 18.730  -2.597  1.549   1.00 0.00 ? 36 ILE B HD13 4  
ATOM 7140  N N    . GLY B 2 27 ? 22.316  1.875   3.388   1.00 0.00 ? 37 GLY B N    4  
ATOM 7141  C CA   . GLY B 2 27 ? 22.448  3.255   2.932   1.00 0.00 ? 37 GLY B CA   4  
ATOM 7142  C C    . GLY B 2 27 ? 21.403  3.653   1.901   1.00 0.00 ? 37 GLY B C    4  
ATOM 7143  O O    . GLY B 2 27 ? 21.718  4.329   0.922   1.00 0.00 ? 37 GLY B O    4  
ATOM 7144  H H    . GLY B 2 27 ? 22.326  1.682   4.348   1.00 0.00 ? 37 GLY B H    4  
ATOM 7145  H HA2  . GLY B 2 27 ? 22.359  3.911   3.785   1.00 0.00 ? 37 GLY B HA2  4  
ATOM 7146  H HA3  . GLY B 2 27 ? 23.430  3.382   2.498   1.00 0.00 ? 37 GLY B HA3  4  
ATOM 7147  N N    . LEU B 2 28 ? 20.156  3.252   2.122   1.00 0.00 ? 38 LEU B N    4  
ATOM 7148  C CA   . LEU B 2 28 ? 19.088  3.570   1.183   1.00 0.00 ? 38 LEU B CA   4  
ATOM 7149  C C    . LEU B 2 28 ? 18.018  4.446   1.830   1.00 0.00 ? 38 LEU B C    4  
ATOM 7150  O O    . LEU B 2 28 ? 16.901  4.547   1.323   1.00 0.00 ? 38 LEU B O    4  
ATOM 7151  C CB   . LEU B 2 28 ? 18.456  2.286   0.640   1.00 0.00 ? 38 LEU B CB   4  
ATOM 7152  C CG   . LEU B 2 28 ? 18.443  2.164   -0.886  1.00 0.00 ? 38 LEU B CG   4  
ATOM 7153  C CD1  . LEU B 2 28 ? 19.849  1.927   -1.417  1.00 0.00 ? 38 LEU B CD1  4  
ATOM 7154  C CD2  . LEU B 2 28 ? 17.513  1.046   -1.326  1.00 0.00 ? 38 LEU B CD2  4  
ATOM 7155  H H    . LEU B 2 28 ? 19.951  2.735   2.931   1.00 0.00 ? 38 LEU B H    4  
ATOM 7156  H HA   . LEU B 2 28 ? 19.527  4.114   0.361   1.00 0.00 ? 38 LEU B HA   4  
ATOM 7157  H HB2  . LEU B 2 28 ? 19.000  1.445   1.043   1.00 0.00 ? 38 LEU B HB2  4  
ATOM 7158  H HB3  . LEU B 2 28 ? 17.436  2.234   0.990   1.00 0.00 ? 38 LEU B HB3  4  
ATOM 7159  H HG   . LEU B 2 28 ? 18.081  3.088   -1.309  1.00 0.00 ? 38 LEU B HG   4  
ATOM 7160  H HD11 . LEU B 2 28 ? 20.472  2.777   -1.181  1.00 0.00 ? 38 LEU B HD11 4  
ATOM 7161  H HD12 . LEU B 2 28 ? 19.811  1.794   -2.488  1.00 0.00 ? 38 LEU B HD12 4  
ATOM 7162  H HD13 . LEU B 2 28 ? 20.262  1.041   -0.958  1.00 0.00 ? 38 LEU B HD13 4  
ATOM 7163  H HD21 . LEU B 2 28 ? 17.533  0.964   -2.403  1.00 0.00 ? 38 LEU B HD21 4  
ATOM 7164  H HD22 . LEU B 2 28 ? 16.506  1.265   -1.001  1.00 0.00 ? 38 LEU B HD22 4  
ATOM 7165  H HD23 . LEU B 2 28 ? 17.837  0.113   -0.889  1.00 0.00 ? 38 LEU B HD23 4  
ATOM 7166  N N    . GLU B 2 29 ? 18.363  5.068   2.955   1.00 0.00 ? 39 GLU B N    4  
ATOM 7167  C CA   . GLU B 2 29 ? 17.440  5.953   3.676   1.00 0.00 ? 39 GLU B CA   4  
ATOM 7168  C C    . GLU B 2 29 ? 16.868  7.061   2.781   1.00 0.00 ? 39 GLU B C    4  
ATOM 7169  O O    . GLU B 2 29 ? 15.825  7.639   3.086   1.00 0.00 ? 39 GLU B O    4  
ATOM 7170  C CB   . GLU B 2 29 ? 18.140  6.578   4.887   1.00 0.00 ? 39 GLU B CB   4  
ATOM 7171  C CG   . GLU B 2 29 ? 19.324  7.459   4.523   1.00 0.00 ? 39 GLU B CG   4  
ATOM 7172  C CD   . GLU B 2 29 ? 20.647  6.723   4.579   1.00 0.00 ? 39 GLU B CD   4  
ATOM 7173  O OE1  . GLU B 2 29 ? 20.658  5.488   4.411   1.00 0.00 ? 39 GLU B OE1  4  
ATOM 7174  O OE2  . GLU B 2 29 ? 21.686  7.387   4.800   1.00 0.00 ? 39 GLU B OE2  4  
ATOM 7175  H H    . GLU B 2 29 ? 19.243  4.870   3.358   1.00 0.00 ? 39 GLU B H    4  
ATOM 7176  H HA   . GLU B 2 29 ? 16.621  5.346   4.030   1.00 0.00 ? 39 GLU B HA   4  
ATOM 7177  H HB2  . GLU B 2 29 ? 17.426  7.179   5.431   1.00 0.00 ? 39 GLU B HB2  4  
ATOM 7178  H HB3  . GLU B 2 29 ? 18.494  5.786   5.531   1.00 0.00 ? 39 GLU B HB3  4  
ATOM 7179  H HG2  . GLU B 2 29 ? 19.182  7.831   3.519   1.00 0.00 ? 39 GLU B HG2  4  
ATOM 7180  H HG3  . GLU B 2 29 ? 19.362  8.291   5.211   1.00 0.00 ? 39 GLU B HG3  4  
ATOM 7181  N N    . ARG B 2 30 ? 17.544  7.346   1.674   1.00 0.00 ? 40 ARG B N    4  
ATOM 7182  C CA   . ARG B 2 30 ? 17.090  8.378   0.745   1.00 0.00 ? 40 ARG B CA   4  
ATOM 7183  C C    . ARG B 2 30 ? 15.864  7.913   -0.039  1.00 0.00 ? 40 ARG B C    4  
ATOM 7184  O O    . ARG B 2 30 ? 15.223  8.701   -0.734  1.00 0.00 ? 40 ARG B O    4  
ATOM 7185  C CB   . ARG B 2 30 ? 18.209  8.755   -0.222  1.00 0.00 ? 40 ARG B CB   4  
ATOM 7186  C CG   . ARG B 2 30 ? 19.383  9.450   0.446   1.00 0.00 ? 40 ARG B CG   4  
ATOM 7187  C CD   . ARG B 2 30 ? 20.447  9.843   -0.565  1.00 0.00 ? 40 ARG B CD   4  
ATOM 7188  N NE   . ARG B 2 30 ? 20.883  8.707   -1.378  1.00 0.00 ? 40 ARG B NE   4  
ATOM 7189  C CZ   . ARG B 2 30 ? 22.159  8.393   -1.608  1.00 0.00 ? 40 ARG B CZ   4  
ATOM 7190  N NH1  . ARG B 2 30 ? 23.139  9.129   -1.093  1.00 0.00 ? 40 ARG B NH1  4  
ATOM 7191  N NH2  . ARG B 2 30 ? 22.449  7.342   -2.363  1.00 0.00 ? 40 ARG B NH2  4  
ATOM 7192  H H    . ARG B 2 30 ? 18.369  6.854   1.484   1.00 0.00 ? 40 ARG B H    4  
ATOM 7193  H HA   . ARG B 2 30 ? 16.820  9.247   1.323   1.00 0.00 ? 40 ARG B HA   4  
ATOM 7194  H HB2  . ARG B 2 30 ? 18.573  7.858   -0.701  1.00 0.00 ? 40 ARG B HB2  4  
ATOM 7195  H HB3  . ARG B 2 30 ? 17.809  9.417   -0.975  1.00 0.00 ? 40 ARG B HB3  4  
ATOM 7196  H HG2  . ARG B 2 30 ? 19.026  10.340  0.943   1.00 0.00 ? 40 ARG B HG2  4  
ATOM 7197  H HG3  . ARG B 2 30 ? 19.819  8.780   1.173   1.00 0.00 ? 40 ARG B HG3  4  
ATOM 7198  H HD2  . ARG B 2 30 ? 20.043  10.605  -1.216  1.00 0.00 ? 40 ARG B HD2  4  
ATOM 7199  H HD3  . ARG B 2 30 ? 21.296  10.240  -0.034  1.00 0.00 ? 40 ARG B HD3  4  
ATOM 7200  H HE   . ARG B 2 30 ? 20.179  8.146   -1.780  1.00 0.00 ? 40 ARG B HE   4  
ATOM 7201  H HH11 . ARG B 2 30 ? 22.926  9.931   -0.526  1.00 0.00 ? 40 ARG B HH11 4  
ATOM 7202  H HH12 . ARG B 2 30 ? 24.097  8.888   -1.266  1.00 0.00 ? 40 ARG B HH12 4  
ATOM 7203  H HH21 . ARG B 2 30 ? 21.712  6.787   -2.759  1.00 0.00 ? 40 ARG B HH21 4  
ATOM 7204  H HH22 . ARG B 2 30 ? 23.407  7.093   -2.536  1.00 0.00 ? 40 ARG B HH22 4  
ATOM 7205  N N    . TYR B 2 31 ? 15.542  6.632   0.075   1.00 0.00 ? 41 TYR B N    4  
ATOM 7206  C CA   . TYR B 2 31 ? 14.400  6.068   -0.627  1.00 0.00 ? 41 TYR B CA   4  
ATOM 7207  C C    . TYR B 2 31 ? 13.134  6.116   0.223   1.00 0.00 ? 41 TYR B C    4  
ATOM 7208  O O    . TYR B 2 31 ? 12.030  6.128   -0.320  1.00 0.00 ? 41 TYR B O    4  
ATOM 7209  C CB   . TYR B 2 31 ? 14.689  4.627   -1.040  1.00 0.00 ? 41 TYR B CB   4  
ATOM 7210  C CG   . TYR B 2 31 ? 15.095  4.477   -2.487  1.00 0.00 ? 41 TYR B CG   4  
ATOM 7211  C CD1  . TYR B 2 31 ? 16.428  4.556   -2.869  1.00 0.00 ? 41 TYR B CD1  4  
ATOM 7212  C CD2  . TYR B 2 31 ? 14.143  4.251   -3.472  1.00 0.00 ? 41 TYR B CD2  4  
ATOM 7213  C CE1  . TYR B 2 31 ? 16.799  4.412   -4.192  1.00 0.00 ? 41 TYR B CE1  4  
ATOM 7214  C CE2  . TYR B 2 31 ? 14.508  4.103   -4.796  1.00 0.00 ? 41 TYR B CE2  4  
ATOM 7215  C CZ   . TYR B 2 31 ? 15.836  4.185   -5.151  1.00 0.00 ? 41 TYR B CZ   4  
ATOM 7216  O OH   . TYR B 2 31 ? 16.202  4.030   -6.468  1.00 0.00 ? 41 TYR B OH   4  
ATOM 7217  H H    . TYR B 2 31 ? 16.094  6.048   0.643   1.00 0.00 ? 41 TYR B H    4  
ATOM 7218  H HA   . TYR B 2 31 ? 14.238  6.657   -1.518  1.00 0.00 ? 41 TYR B HA   4  
ATOM 7219  H HB2  . TYR B 2 31 ? 15.490  4.239   -0.430  1.00 0.00 ? 41 TYR B HB2  4  
ATOM 7220  H HB3  . TYR B 2 31 ? 13.802  4.030   -0.881  1.00 0.00 ? 41 TYR B HB3  4  
ATOM 7221  H HD1  . TYR B 2 31 ? 17.180  4.734   -2.118  1.00 0.00 ? 41 TYR B HD1  4  
ATOM 7222  H HD2  . TYR B 2 31 ? 13.102  4.186   -3.191  1.00 0.00 ? 41 TYR B HD2  4  
ATOM 7223  H HE1  . TYR B 2 31 ? 17.840  4.476   -4.471  1.00 0.00 ? 41 TYR B HE1  4  
ATOM 7224  H HE2  . TYR B 2 31 ? 13.752  3.928   -5.547  1.00 0.00 ? 41 TYR B HE2  4  
ATOM 7225  H HH   . TYR B 2 31 ? 15.589  4.519   -7.028  1.00 0.00 ? 41 TYR B HH   4  
ATOM 7226  N N    . GLU B 2 32 ? 13.299  6.124   1.551   1.00 0.00 ? 42 GLU B N    4  
ATOM 7227  C CA   . GLU B 2 32 ? 12.167  6.170   2.488   1.00 0.00 ? 42 GLU B CA   4  
ATOM 7228  C C    . GLU B 2 32 ? 11.095  7.164   2.046   1.00 0.00 ? 42 GLU B C    4  
ATOM 7229  O O    . GLU B 2 32 ? 9.956   6.781   1.797   1.00 0.00 ? 42 GLU B O    4  
ATOM 7230  C CB   . GLU B 2 32 ? 12.657  6.535   3.895   1.00 0.00 ? 42 GLU B CB   4  
ATOM 7231  C CG   . GLU B 2 32 ? 11.546  6.608   4.933   1.00 0.00 ? 42 GLU B CG   4  
ATOM 7232  C CD   . GLU B 2 32 ? 12.033  7.113   6.276   1.00 0.00 ? 42 GLU B CD   4  
ATOM 7233  O OE1  . GLU B 2 32 ? 12.873  8.033   6.301   1.00 0.00 ? 42 GLU B OE1  4  
ATOM 7234  O OE2  . GLU B 2 32 ? 11.580  6.588   7.314   1.00 0.00 ? 42 GLU B OE2  4  
ATOM 7235  H H    . GLU B 2 32 ? 14.205  6.054   1.919   1.00 0.00 ? 42 GLU B H    4  
ATOM 7236  H HA   . GLU B 2 32 ? 11.730  5.185   2.523   1.00 0.00 ? 42 GLU B HA   4  
ATOM 7237  H HB2  . GLU B 2 32 ? 13.370  5.795   4.216   1.00 0.00 ? 42 GLU B HB2  4  
ATOM 7238  H HB3  . GLU B 2 32 ? 13.146  7.499   3.854   1.00 0.00 ? 42 GLU B HB3  4  
ATOM 7239  H HG2  . GLU B 2 32 ? 10.774  7.275   4.574   1.00 0.00 ? 42 GLU B HG2  4  
ATOM 7240  H HG3  . GLU B 2 32 ? 11.132  5.620   5.066   1.00 0.00 ? 42 GLU B HG3  4  
ATOM 7241  N N    . GLU B 2 33 ? 11.472  8.441   2.010   1.00 0.00 ? 43 GLU B N    4  
ATOM 7242  C CA   . GLU B 2 33 ? 10.579  9.528   1.586   1.00 0.00 ? 43 GLU B CA   4  
ATOM 7243  C C    . GLU B 2 33 ? 9.715   9.149   0.370   1.00 0.00 ? 43 GLU B C    4  
ATOM 7244  O O    . GLU B 2 33 ? 8.529   9.477   0.321   1.00 0.00 ? 43 GLU B O    4  
ATOM 7245  C CB   . GLU B 2 33 ? 11.386  10.790  1.278   1.00 0.00 ? 43 GLU B CB   4  
ATOM 7246  C CG   . GLU B 2 33 ? 10.565  12.068  1.367   1.00 0.00 ? 43 GLU B CG   4  
ATOM 7247  C CD   . GLU B 2 33 ? 11.346  13.220  1.963   1.00 0.00 ? 43 GLU B CD   4  
ATOM 7248  O OE1  . GLU B 2 33 ? 11.667  13.164  3.169   1.00 0.00 ? 43 GLU B OE1  4  
ATOM 7249  O OE2  . GLU B 2 33 ? 11.647  14.184  1.234   1.00 0.00 ? 43 GLU B OE2  4  
ATOM 7250  H H    . GLU B 2 33 ? 12.347  8.653   2.392   1.00 0.00 ? 43 GLU B H    4  
ATOM 7251  H HA   . GLU B 2 33 ? 9.919   9.739   2.414   1.00 0.00 ? 43 GLU B HA   4  
ATOM 7252  H HB2  . GLU B 2 33 ? 12.204  10.861  1.979   1.00 0.00 ? 43 GLU B HB2  4  
ATOM 7253  H HB3  . GLU B 2 33 ? 11.786  10.712  0.277   1.00 0.00 ? 43 GLU B HB3  4  
ATOM 7254  H HG2  . GLU B 2 33 ? 10.244  12.346  0.375   1.00 0.00 ? 43 GLU B HG2  4  
ATOM 7255  H HG3  . GLU B 2 33 ? 9.700   11.881  1.985   1.00 0.00 ? 43 GLU B HG3  4  
ATOM 7256  N N    . GLY B 2 34 ? 10.303  8.455   -0.600  1.00 0.00 ? 44 GLY B N    4  
ATOM 7257  C CA   . GLY B 2 34 ? 9.556   8.053   -1.782  1.00 0.00 ? 44 GLY B CA   4  
ATOM 7258  C C    . GLY B 2 34 ? 8.549   6.952   -1.487  1.00 0.00 ? 44 GLY B C    4  
ATOM 7259  O O    . GLY B 2 34 ? 7.458   6.926   -2.055  1.00 0.00 ? 44 GLY B O    4  
ATOM 7260  H H    . GLY B 2 34 ? 11.249  8.214   -0.521  1.00 0.00 ? 44 GLY B H    4  
ATOM 7261  H HA2  . GLY B 2 34 ? 9.028   8.911   -2.171  1.00 0.00 ? 44 GLY B HA2  4  
ATOM 7262  H HA3  . GLY B 2 34 ? 10.248  7.699   -2.530  1.00 0.00 ? 44 GLY B HA3  4  
ATOM 7263  N N    . LEU B 2 35 ? 8.906   6.066   -0.565  1.00 0.00 ? 45 LEU B N    4  
ATOM 7264  C CA   . LEU B 2 35 ? 8.055   4.941   -0.181  1.00 0.00 ? 45 LEU B CA   4  
ATOM 7265  C C    . LEU B 2 35 ? 6.965   5.368   0.809   1.00 0.00 ? 45 LEU B C    4  
ATOM 7266  O O    . LEU B 2 35 ? 6.438   4.547   1.557   1.00 0.00 ? 45 LEU B O    4  
ATOM 7267  C CB   . LEU B 2 35 ? 8.915   3.834   0.444   1.00 0.00 ? 45 LEU B CB   4  
ATOM 7268  C CG   . LEU B 2 35 ? 9.771   3.028   -0.537  1.00 0.00 ? 45 LEU B CG   4  
ATOM 7269  C CD1  . LEU B 2 35 ? 11.044  2.540   0.138   1.00 0.00 ? 45 LEU B CD1  4  
ATOM 7270  C CD2  . LEU B 2 35 ? 8.981   1.851   -1.086  1.00 0.00 ? 45 LEU B CD2  4  
ATOM 7271  H H    . LEU B 2 35 ? 9.769   6.180   -0.110  1.00 0.00 ? 45 LEU B H    4  
ATOM 7272  H HA   . LEU B 2 35 ? 7.586   4.558   -1.074  1.00 0.00 ? 45 LEU B HA   4  
ATOM 7273  H HB2  . LEU B 2 35 ? 9.572   4.288   1.171   1.00 0.00 ? 45 LEU B HB2  4  
ATOM 7274  H HB3  . LEU B 2 35 ? 8.260   3.149   0.958   1.00 0.00 ? 45 LEU B HB3  4  
ATOM 7275  H HG   . LEU B 2 35 ? 10.052  3.660   -1.367  1.00 0.00 ? 45 LEU B HG   4  
ATOM 7276  H HD11 . LEU B 2 35 ? 11.617  3.389   0.483   1.00 0.00 ? 45 LEU B HD11 4  
ATOM 7277  H HD12 . LEU B 2 35 ? 11.631  1.974   -0.569  1.00 0.00 ? 45 LEU B HD12 4  
ATOM 7278  H HD13 . LEU B 2 35 ? 10.788  1.913   0.978   1.00 0.00 ? 45 LEU B HD13 4  
ATOM 7279  H HD21 . LEU B 2 35 ? 8.068   2.209   -1.537  1.00 0.00 ? 45 LEU B HD21 4  
ATOM 7280  H HD22 . LEU B 2 35 ? 8.741   1.172   -0.280  1.00 0.00 ? 45 LEU B HD22 4  
ATOM 7281  H HD23 . LEU B 2 35 ? 9.572   1.335   -1.828  1.00 0.00 ? 45 LEU B HD23 4  
ATOM 7282  N N    . VAL B 2 36 ? 6.603   6.642   0.790   1.00 0.00 ? 46 VAL B N    4  
ATOM 7283  C CA   . VAL B 2 36 ? 5.584   7.158   1.698   1.00 0.00 ? 46 VAL B CA   4  
ATOM 7284  C C    . VAL B 2 36 ? 4.276   7.405   0.946   1.00 0.00 ? 46 VAL B C    4  
ATOM 7285  O O    . VAL B 2 36 ? 3.193   7.418   1.533   1.00 0.00 ? 46 VAL B O    4  
ATOM 7286  C CB   . VAL B 2 36 ? 6.055   8.466   2.387   1.00 0.00 ? 46 VAL B CB   4  
ATOM 7287  C CG1  . VAL B 2 36 ? 4.979   9.032   3.305   1.00 0.00 ? 46 VAL B CG1  4  
ATOM 7288  C CG2  . VAL B 2 36 ? 7.338   8.227   3.170   1.00 0.00 ? 46 VAL B CG2  4  
ATOM 7289  H H    . VAL B 2 36 ? 6.996   7.247   0.125   1.00 0.00 ? 46 VAL B H    4  
ATOM 7290  H HA   . VAL B 2 36 ? 5.413   6.413   2.463   1.00 0.00 ? 46 VAL B HA   4  
ATOM 7291  H HB   . VAL B 2 36 ? 6.262   9.198   1.619   1.00 0.00 ? 46 VAL B HB   4  
ATOM 7292  H HG11 . VAL B 2 36 ? 4.083   9.227   2.732   1.00 0.00 ? 46 VAL B HG11 4  
ATOM 7293  H HG12 . VAL B 2 36 ? 5.331   9.952   3.747   1.00 0.00 ? 46 VAL B HG12 4  
ATOM 7294  H HG13 . VAL B 2 36 ? 4.760   8.318   4.085   1.00 0.00 ? 46 VAL B HG13 4  
ATOM 7295  H HG21 . VAL B 2 36 ? 7.576   9.107   3.749   1.00 0.00 ? 46 VAL B HG21 4  
ATOM 7296  H HG22 . VAL B 2 36 ? 8.145   8.019   2.483   1.00 0.00 ? 46 VAL B HG22 4  
ATOM 7297  H HG23 . VAL B 2 36 ? 7.204   7.385   3.833   1.00 0.00 ? 46 VAL B HG23 4  
ATOM 7298  N N    . HIS B 2 37 ? 4.373   7.546   -0.369  1.00 0.00 ? 47 HIS B N    4  
ATOM 7299  C CA   . HIS B 2 37 ? 3.195   7.808   -1.188  1.00 0.00 ? 47 HIS B CA   4  
ATOM 7300  C C    . HIS B 2 37 ? 2.482   6.522   -1.578  1.00 0.00 ? 47 HIS B C    4  
ATOM 7301  O O    . HIS B 2 37 ? 1.473   6.561   -2.281  1.00 0.00 ? 47 HIS B O    4  
ATOM 7302  C CB   . HIS B 2 37 ? 3.568   8.575   -2.460  1.00 0.00 ? 47 HIS B CB   4  
ATOM 7303  C CG   . HIS B 2 37 ? 4.065   9.971   -2.212  1.00 0.00 ? 47 HIS B CG   4  
ATOM 7304  N ND1  . HIS B 2 37 ? 3.409   11.107  -2.636  1.00 0.00 ? 47 HIS B ND1  4  
ATOM 7305  C CD2  . HIS B 2 37 ? 5.177   10.405  -1.562  1.00 0.00 ? 47 HIS B CD2  4  
ATOM 7306  C CE1  . HIS B 2 37 ? 4.121   12.167  -2.239  1.00 0.00 ? 47 HIS B CE1  4  
ATOM 7307  N NE2  . HIS B 2 37 ? 5.203   11.797  -1.584  1.00 0.00 ? 47 HIS B NE2  4  
ATOM 7308  H H    . HIS B 2 37 ? 5.251   7.465   -0.800  1.00 0.00 ? 47 HIS B H    4  
ATOM 7309  H HA   . HIS B 2 37 ? 2.520   8.414   -0.605  1.00 0.00 ? 47 HIS B HA   4  
ATOM 7310  H HB2  . HIS B 2 37 ? 4.340   8.034   -2.985  1.00 0.00 ? 47 HIS B HB2  4  
ATOM 7311  H HB3  . HIS B 2 37 ? 2.689   8.640   -3.094  1.00 0.00 ? 47 HIS B HB3  4  
ATOM 7312  H HD1  . HIS B 2 37 ? 2.572   11.134  -3.141  1.00 0.00 ? 47 HIS B HD1  4  
ATOM 7313  H HD2  . HIS B 2 37 ? 5.927   9.780   -1.100  1.00 0.00 ? 47 HIS B HD2  4  
ATOM 7314  H HE1  . HIS B 2 37 ? 3.836   13.194  -2.420  1.00 0.00 ? 47 HIS B HE1  4  
ATOM 7315  N N    . ASN B 2 38 ? 2.999   5.382   -1.131  1.00 0.00 ? 48 ASN B N    4  
ATOM 7316  C CA   . ASN B 2 38 ? 2.396   4.098   -1.477  1.00 0.00 ? 48 ASN B CA   4  
ATOM 7317  C C    . ASN B 2 38 ? 1.911   3.342   -0.249  1.00 0.00 ? 48 ASN B C    4  
ATOM 7318  O O    . ASN B 2 38 ? 1.375   2.239   -0.369  1.00 0.00 ? 48 ASN B O    4  
ATOM 7319  C CB   . ASN B 2 38 ? 3.378   3.227   -2.269  1.00 0.00 ? 48 ASN B CB   4  
ATOM 7320  C CG   . ASN B 2 38 ? 4.209   4.019   -3.266  1.00 0.00 ? 48 ASN B CG   4  
ATOM 7321  O OD1  . ASN B 2 38 ? 5.117   4.755   -2.888  1.00 0.00 ? 48 ASN B OD1  4  
ATOM 7322  N ND2  . ASN B 2 38 ? 3.921   3.852   -4.546  1.00 0.00 ? 48 ASN B ND2  4  
ATOM 7323  H H    . ASN B 2 38 ? 3.805   5.404   -0.574  1.00 0.00 ? 48 ASN B H    4  
ATOM 7324  H HA   . ASN B 2 38 ? 1.541   4.304   -2.098  1.00 0.00 ? 48 ASN B HA   4  
ATOM 7325  H HB2  . ASN B 2 38 ? 4.047   2.736   -1.581  1.00 0.00 ? 48 ASN B HB2  4  
ATOM 7326  H HB3  . ASN B 2 38 ? 2.816   2.481   -2.812  1.00 0.00 ? 48 ASN B HB3  4  
ATOM 7327  H HD21 . ASN B 2 38 ? 3.195   3.226   -4.789  1.00 0.00 ? 48 ASN B HD21 4  
ATOM 7328  H HD22 . ASN B 2 38 ? 4.444   4.352   -5.205  1.00 0.00 ? 48 ASN B HD22 4  
ATOM 7329  N N    . GLY B 2 39 ? 2.085   3.930   0.923   1.00 0.00 ? 49 GLY B N    4  
ATOM 7330  C CA   . GLY B 2 39 ? 1.637   3.284   2.143   1.00 0.00 ? 49 GLY B CA   4  
ATOM 7331  C C    . GLY B 2 39 ? 2.665   2.341   2.728   1.00 0.00 ? 49 GLY B C    4  
ATOM 7332  O O    . GLY B 2 39 ? 2.320   1.379   3.412   1.00 0.00 ? 49 GLY B O    4  
ATOM 7333  H H    . GLY B 2 39 ? 2.499   4.816   0.963   1.00 0.00 ? 49 GLY B H    4  
ATOM 7334  H HA2  . GLY B 2 39 ? 1.408   4.044   2.875   1.00 0.00 ? 49 GLY B HA2  4  
ATOM 7335  H HA3  . GLY B 2 39 ? 0.737   2.726   1.928   1.00 0.00 ? 49 GLY B HA3  4  
ATOM 7336  N N    . TRP B 2 40 ? 3.934   2.609   2.459   1.00 0.00 ? 50 TRP B N    4  
ATOM 7337  C CA   . TRP B 2 40 ? 5.006   1.781   2.987   1.00 0.00 ? 50 TRP B CA   4  
ATOM 7338  C C    . TRP B 2 40 ? 5.617   2.463   4.199   1.00 0.00 ? 50 TRP B C    4  
ATOM 7339  O O    . TRP B 2 40 ? 6.756   2.201   4.580   1.00 0.00 ? 50 TRP B O    4  
ATOM 7340  C CB   . TRP B 2 40 ? 6.061   1.497   1.916   1.00 0.00 ? 50 TRP B CB   4  
ATOM 7341  C CG   . TRP B 2 40 ? 5.526   0.697   0.767   1.00 0.00 ? 50 TRP B CG   4  
ATOM 7342  C CD1  . TRP B 2 40 ? 5.475   1.074   -0.542  1.00 0.00 ? 50 TRP B CD1  4  
ATOM 7343  C CD2  . TRP B 2 40 ? 4.953   -0.616  0.829   1.00 0.00 ? 50 TRP B CD2  4  
ATOM 7344  N NE1  . TRP B 2 40 ? 4.902   0.079   -1.297  1.00 0.00 ? 50 TRP B NE1  4  
ATOM 7345  C CE2  . TRP B 2 40 ? 4.574   -0.968  -0.478  1.00 0.00 ? 50 TRP B CE2  4  
ATOM 7346  C CE3  . TRP B 2 40 ? 4.725   -1.527  1.863   1.00 0.00 ? 50 TRP B CE3  4  
ATOM 7347  C CZ2  . TRP B 2 40 ? 3.979   -2.191  -0.775  1.00 0.00 ? 50 TRP B CZ2  4  
ATOM 7348  C CZ3  . TRP B 2 40 ? 4.136   -2.740  1.564   1.00 0.00 ? 50 TRP B CZ3  4  
ATOM 7349  C CH2  . TRP B 2 40 ? 3.768   -3.062  0.255   1.00 0.00 ? 50 TRP B CH2  4  
ATOM 7350  H H    . TRP B 2 40 ? 4.156   3.381   1.903   1.00 0.00 ? 50 TRP B H    4  
ATOM 7351  H HA   . TRP B 2 40 ? 4.567   0.845   3.304   1.00 0.00 ? 50 TRP B HA   4  
ATOM 7352  H HB2  . TRP B 2 40 ? 6.433   2.433   1.528   1.00 0.00 ? 50 TRP B HB2  4  
ATOM 7353  H HB3  . TRP B 2 40 ? 6.876   0.944   2.359   1.00 0.00 ? 50 TRP B HB3  4  
ATOM 7354  H HD1  . TRP B 2 40 ? 5.835   2.021   -0.915  1.00 0.00 ? 50 TRP B HD1  4  
ATOM 7355  H HE1  . TRP B 2 40 ? 4.754   0.113   -2.267  1.00 0.00 ? 50 TRP B HE1  4  
ATOM 7356  H HE3  . TRP B 2 40 ? 5.001   -1.296  2.882   1.00 0.00 ? 50 TRP B HE3  4  
ATOM 7357  H HZ2  . TRP B 2 40 ? 3.688   -2.456  -1.781  1.00 0.00 ? 50 TRP B HZ2  4  
ATOM 7358  H HZ3  . TRP B 2 40 ? 3.952   -3.456  2.352   1.00 0.00 ? 50 TRP B HZ3  4  
ATOM 7359  H HH2  . TRP B 2 40 ? 3.310   -4.023  0.067   1.00 0.00 ? 50 TRP B HH2  4  
ATOM 7360  N N    . ASP B 2 41 ? 4.820   3.335   4.809   1.00 0.00 ? 51 ASP B N    4  
ATOM 7361  C CA   . ASP B 2 41 ? 5.215   4.072   6.003   1.00 0.00 ? 51 ASP B CA   4  
ATOM 7362  C C    . ASP B 2 41 ? 5.002   3.200   7.234   1.00 0.00 ? 51 ASP B C    4  
ATOM 7363  O O    . ASP B 2 41 ? 4.785   3.690   8.345   1.00 0.00 ? 51 ASP B O    4  
ATOM 7364  C CB   . ASP B 2 41 ? 4.396   5.366   6.128   1.00 0.00 ? 51 ASP B CB   4  
ATOM 7365  C CG   . ASP B 2 41 ? 2.895   5.134   6.016   1.00 0.00 ? 51 ASP B CG   4  
ATOM 7366  O OD1  . ASP B 2 41 ? 2.411   4.935   4.884   1.00 0.00 ? 51 ASP B OD1  4  
ATOM 7367  O OD2  . ASP B 2 41 ? 2.195   5.162   7.055   1.00 0.00 ? 51 ASP B OD2  4  
ATOM 7368  H H    . ASP B 2 41 ? 3.921   3.487   4.442   1.00 0.00 ? 51 ASP B H    4  
ATOM 7369  H HA   . ASP B 2 41 ? 6.264   4.317   5.919   1.00 0.00 ? 51 ASP B HA   4  
ATOM 7370  H HB2  . ASP B 2 41 ? 4.599   5.820   7.085   1.00 0.00 ? 51 ASP B HB2  4  
ATOM 7371  H HB3  . ASP B 2 41 ? 4.694   6.047   5.343   1.00 0.00 ? 51 ASP B HB3  4  
ATOM 7372  N N    . ASP B 2 42 ? 5.076   1.898   7.017   1.00 0.00 ? 52 ASP B N    4  
ATOM 7373  C CA   . ASP B 2 42 ? 4.883   0.925   8.069   1.00 0.00 ? 52 ASP B CA   4  
ATOM 7374  C C    . ASP B 2 42 ? 5.747   -0.302  7.818   1.00 0.00 ? 52 ASP B C    4  
ATOM 7375  O O    . ASP B 2 42 ? 5.623   -0.956  6.780   1.00 0.00 ? 52 ASP B O    4  
ATOM 7376  C CB   . ASP B 2 42 ? 3.417   0.524   8.135   1.00 0.00 ? 52 ASP B CB   4  
ATOM 7377  C CG   . ASP B 2 42 ? 3.154   -0.474  9.227   1.00 0.00 ? 52 ASP B CG   4  
ATOM 7378  O OD1  . ASP B 2 42 ? 3.124   -0.076  10.407  1.00 0.00 ? 52 ASP B OD1  4  
ATOM 7379  O OD2  . ASP B 2 42 ? 2.959   -1.665  8.913   1.00 0.00 ? 52 ASP B OD2  4  
ATOM 7380  H H    . ASP B 2 42 ? 5.277   1.582   6.112   1.00 0.00 ? 52 ASP B H    4  
ATOM 7381  H HA   . ASP B 2 42 ? 5.172   1.378   9.007   1.00 0.00 ? 52 ASP B HA   4  
ATOM 7382  H HB2  . ASP B 2 42 ? 2.816   1.402   8.321   1.00 0.00 ? 52 ASP B HB2  4  
ATOM 7383  H HB3  . ASP B 2 42 ? 3.127   0.087   7.191   1.00 0.00 ? 52 ASP B HB3  4  
ATOM 7384  N N    . LEU B 2 43 ? 6.610   -0.617  8.772   1.00 0.00 ? 53 LEU B N    4  
ATOM 7385  C CA   . LEU B 2 43 ? 7.512   -1.755  8.647   1.00 0.00 ? 53 LEU B CA   4  
ATOM 7386  C C    . LEU B 2 43 ? 6.761   -3.085  8.622   1.00 0.00 ? 53 LEU B C    4  
ATOM 7387  O O    . LEU B 2 43 ? 7.179   -4.019  7.938   1.00 0.00 ? 53 LEU B O    4  
ATOM 7388  C CB   . LEU B 2 43 ? 8.535   -1.747  9.785   1.00 0.00 ? 53 LEU B CB   4  
ATOM 7389  C CG   . LEU B 2 43 ? 9.673   -0.736  9.620   1.00 0.00 ? 53 LEU B CG   4  
ATOM 7390  C CD1  . LEU B 2 43 ? 10.523  -0.679  10.878  1.00 0.00 ? 53 LEU B CD1  4  
ATOM 7391  C CD2  . LEU B 2 43 ? 10.529  -1.090  8.413   1.00 0.00 ? 53 LEU B CD2  4  
ATOM 7392  H H    . LEU B 2 43 ? 6.648   -0.063  9.583   1.00 0.00 ? 53 LEU B H    4  
ATOM 7393  H HA   . LEU B 2 43 ? 8.039   -1.647  7.713   1.00 0.00 ? 53 LEU B HA   4  
ATOM 7394  H HB2  . LEU B 2 43 ? 8.015   -1.527  10.706  1.00 0.00 ? 53 LEU B HB2  4  
ATOM 7395  H HB3  . LEU B 2 43 ? 8.967   -2.733  9.861   1.00 0.00 ? 53 LEU B HB3  4  
ATOM 7396  H HG   . LEU B 2 43 ? 9.253   0.245   9.457   1.00 0.00 ? 53 LEU B HG   4  
ATOM 7397  H HD11 . LEU B 2 43 ? 9.900   -0.421  11.721  1.00 0.00 ? 53 LEU B HD11 4  
ATOM 7398  H HD12 . LEU B 2 43 ? 11.293  0.068   10.757  1.00 0.00 ? 53 LEU B HD12 4  
ATOM 7399  H HD13 . LEU B 2 43 ? 10.979  -1.643  11.049  1.00 0.00 ? 53 LEU B HD13 4  
ATOM 7400  H HD21 . LEU B 2 43 ? 11.390  -0.438  8.380   1.00 0.00 ? 53 LEU B HD21 4  
ATOM 7401  H HD22 . LEU B 2 43 ? 9.950   -0.966  7.511   1.00 0.00 ? 53 LEU B HD22 4  
ATOM 7402  H HD23 . LEU B 2 43 ? 10.858  -2.116  8.492   1.00 0.00 ? 53 LEU B HD23 4  
ATOM 7403  N N    . GLU B 2 44 ? 5.648   -3.166  9.347   1.00 0.00 ? 54 GLU B N    4  
ATOM 7404  C CA   . GLU B 2 44 ? 4.859   -4.396  9.393   1.00 0.00 ? 54 GLU B CA   4  
ATOM 7405  C C    . GLU B 2 44 ? 4.339   -4.754  8.002   1.00 0.00 ? 54 GLU B C    4  
ATOM 7406  O O    . GLU B 2 44 ? 4.436   -5.902  7.566   1.00 0.00 ? 54 GLU B O    4  
ATOM 7407  C CB   . GLU B 2 44 ? 3.687   -4.255  10.367  1.00 0.00 ? 54 GLU B CB   4  
ATOM 7408  C CG   . GLU B 2 44 ? 4.103   -3.891  11.783  1.00 0.00 ? 54 GLU B CG   4  
ATOM 7409  C CD   . GLU B 2 44 ? 2.924   -3.809  12.733  1.00 0.00 ? 54 GLU B CD   4  
ATOM 7410  O OE1  . GLU B 2 44 ? 2.039   -2.954  12.514  1.00 0.00 ? 54 GLU B OE1  4  
ATOM 7411  O OE2  . GLU B 2 44 ? 2.878   -4.597  13.701  1.00 0.00 ? 54 GLU B OE2  4  
ATOM 7412  H H    . GLU B 2 44 ? 5.346   -2.383  9.853   1.00 0.00 ? 54 GLU B H    4  
ATOM 7413  H HA   . GLU B 2 44 ? 5.507   -5.190  9.735   1.00 0.00 ? 54 GLU B HA   4  
ATOM 7414  H HB2  . GLU B 2 44 ? 3.023   -3.485  10.003  1.00 0.00 ? 54 GLU B HB2  4  
ATOM 7415  H HB3  . GLU B 2 44 ? 3.150   -5.192  10.403  1.00 0.00 ? 54 GLU B HB3  4  
ATOM 7416  H HG2  . GLU B 2 44 ? 4.789   -4.640  12.148  1.00 0.00 ? 54 GLU B HG2  4  
ATOM 7417  H HG3  . GLU B 2 44 ? 4.598   -2.930  11.762  1.00 0.00 ? 54 GLU B HG3  4  
ATOM 7418  N N    . PHE B 2 45 ? 3.794   -3.761  7.311   1.00 0.00 ? 55 PHE B N    4  
ATOM 7419  C CA   . PHE B 2 45 ? 3.263   -3.961  5.969   1.00 0.00 ? 55 PHE B CA   4  
ATOM 7420  C C    . PHE B 2 45 ? 4.395   -4.116  4.956   1.00 0.00 ? 55 PHE B C    4  
ATOM 7421  O O    . PHE B 2 45 ? 4.328   -4.959  4.060   1.00 0.00 ? 55 PHE B O    4  
ATOM 7422  C CB   . PHE B 2 45 ? 2.359   -2.788  5.583   1.00 0.00 ? 55 PHE B CB   4  
ATOM 7423  C CG   . PHE B 2 45 ? 1.459   -3.073  4.415   1.00 0.00 ? 55 PHE B CG   4  
ATOM 7424  C CD1  . PHE B 2 45 ? 0.671   -4.213  4.391   1.00 0.00 ? 55 PHE B CD1  4  
ATOM 7425  C CD2  . PHE B 2 45 ? 1.401   -2.202  3.339   1.00 0.00 ? 55 PHE B CD2  4  
ATOM 7426  C CE1  . PHE B 2 45 ? -0.155  -4.478  3.317   1.00 0.00 ? 55 PHE B CE1  4  
ATOM 7427  C CE2  . PHE B 2 45 ? 0.576   -2.462  2.262   1.00 0.00 ? 55 PHE B CE2  4  
ATOM 7428  C CZ   . PHE B 2 45 ? -0.203  -3.602  2.250   1.00 0.00 ? 55 PHE B CZ   4  
ATOM 7429  H H    . PHE B 2 45 ? 3.731   -2.868  7.724   1.00 0.00 ? 55 PHE B H    4  
ATOM 7430  H HA   . PHE B 2 45 ? 2.677   -4.867  5.976   1.00 0.00 ? 55 PHE B HA   4  
ATOM 7431  H HB2  . PHE B 2 45 ? 1.735   -2.533  6.426   1.00 0.00 ? 55 PHE B HB2  4  
ATOM 7432  H HB3  . PHE B 2 45 ? 2.976   -1.938  5.328   1.00 0.00 ? 55 PHE B HB3  4  
ATOM 7433  H HD1  . PHE B 2 45 ? 0.706   -4.899  5.225   1.00 0.00 ? 55 PHE B HD1  4  
ATOM 7434  H HD2  . PHE B 2 45 ? 2.012   -1.312  3.346   1.00 0.00 ? 55 PHE B HD2  4  
ATOM 7435  H HE1  . PHE B 2 45 ? -0.767  -5.370  3.313   1.00 0.00 ? 55 PHE B HE1  4  
ATOM 7436  H HE2  . PHE B 2 45 ? 0.541   -1.775  1.432   1.00 0.00 ? 55 PHE B HE2  4  
ATOM 7437  H HZ   . PHE B 2 45 ? -0.849  -3.807  1.410   1.00 0.00 ? 55 PHE B HZ   4  
ATOM 7438  N N    . LEU B 2 46 ? 5.447   -3.315  5.120   1.00 0.00 ? 56 LEU B N    4  
ATOM 7439  C CA   . LEU B 2 46 ? 6.606   -3.355  4.226   1.00 0.00 ? 56 LEU B CA   4  
ATOM 7440  C C    . LEU B 2 46 ? 7.284   -4.723  4.264   1.00 0.00 ? 56 LEU B C    4  
ATOM 7441  O O    . LEU B 2 46 ? 8.001   -5.099  3.340   1.00 0.00 ? 56 LEU B O    4  
ATOM 7442  C CB   . LEU B 2 46 ? 7.617   -2.269  4.612   1.00 0.00 ? 56 LEU B CB   4  
ATOM 7443  C CG   . LEU B 2 46 ? 8.870   -2.199  3.734   1.00 0.00 ? 56 LEU B CG   4  
ATOM 7444  C CD1  . LEU B 2 46 ? 8.671   -1.220  2.588   1.00 0.00 ? 56 LEU B CD1  4  
ATOM 7445  C CD2  . LEU B 2 46 ? 10.084  -1.813  4.562   1.00 0.00 ? 56 LEU B CD2  4  
ATOM 7446  H H    . LEU B 2 46 ? 5.440   -2.667  5.860   1.00 0.00 ? 56 LEU B H    4  
ATOM 7447  H HA   . LEU B 2 46 ? 6.256   -3.167  3.222   1.00 0.00 ? 56 LEU B HA   4  
ATOM 7448  H HB2  . LEU B 2 46 ? 7.117   -1.311  4.568   1.00 0.00 ? 56 LEU B HB2  4  
ATOM 7449  H HB3  . LEU B 2 46 ? 7.929   -2.445  5.630   1.00 0.00 ? 56 LEU B HB3  4  
ATOM 7450  H HG   . LEU B 2 46 ? 9.054   -3.175  3.307   1.00 0.00 ? 56 LEU B HG   4  
ATOM 7451  H HD11 . LEU B 2 46 ? 7.811   -1.515  2.006   1.00 0.00 ? 56 LEU B HD11 4  
ATOM 7452  H HD12 . LEU B 2 46 ? 9.549   -1.221  1.958   1.00 0.00 ? 56 LEU B HD12 4  
ATOM 7453  H HD13 . LEU B 2 46 ? 8.516   -0.228  2.985   1.00 0.00 ? 56 LEU B HD13 4  
ATOM 7454  H HD21 . LEU B 2 46 ? 10.960  -1.789  3.929   1.00 0.00 ? 56 LEU B HD21 4  
ATOM 7455  H HD22 . LEU B 2 46 ? 10.229  -2.538  5.349   1.00 0.00 ? 56 LEU B HD22 4  
ATOM 7456  H HD23 . LEU B 2 46 ? 9.928   -0.836  4.997   1.00 0.00 ? 56 LEU B HD23 4  
ATOM 7457  N N    . SER B 2 47 ? 7.040   -5.469  5.331   1.00 0.00 ? 57 SER B N    4  
ATOM 7458  C CA   . SER B 2 47 ? 7.625   -6.791  5.496   1.00 0.00 ? 57 SER B CA   4  
ATOM 7459  C C    . SER B 2 47 ? 7.160   -7.762  4.410   1.00 0.00 ? 57 SER B C    4  
ATOM 7460  O O    . SER B 2 47 ? 7.832   -8.757  4.130   1.00 0.00 ? 57 SER B O    4  
ATOM 7461  C CB   . SER B 2 47 ? 7.263   -7.352  6.867   1.00 0.00 ? 57 SER B CB   4  
ATOM 7462  O OG   . SER B 2 47 ? 7.847   -6.589  7.911   1.00 0.00 ? 57 SER B OG   4  
ATOM 7463  H H    . SER B 2 47 ? 6.449   -5.119  6.031   1.00 0.00 ? 57 SER B H    4  
ATOM 7464  H HA   . SER B 2 47 ? 8.698   -6.688  5.433   1.00 0.00 ? 57 SER B HA   4  
ATOM 7465  H HB2  . SER B 2 47 ? 6.190   -7.336  6.986   1.00 0.00 ? 57 SER B HB2  4  
ATOM 7466  H HB3  . SER B 2 47 ? 7.617   -8.368  6.940   1.00 0.00 ? 57 SER B HB3  4  
ATOM 7467  H HG   . SER B 2 47 ? 7.700   -5.647  7.746   1.00 0.00 ? 57 SER B HG   4  
ATOM 7468  N N    . ASP B 2 48 ? 6.017   -7.478  3.797   1.00 0.00 ? 58 ASP B N    4  
ATOM 7469  C CA   . ASP B 2 48 ? 5.481   -8.353  2.762   1.00 0.00 ? 58 ASP B CA   4  
ATOM 7470  C C    . ASP B 2 48 ? 5.502   -7.676  1.398   1.00 0.00 ? 58 ASP B C    4  
ATOM 7471  O O    . ASP B 2 48 ? 4.728   -8.025  0.510   1.00 0.00 ? 58 ASP B O    4  
ATOM 7472  C CB   . ASP B 2 48 ? 4.054   -8.785  3.112   1.00 0.00 ? 58 ASP B CB   4  
ATOM 7473  C CG   . ASP B 2 48 ? 3.865   -10.281 2.973   1.00 0.00 ? 58 ASP B CG   4  
ATOM 7474  O OD1  . ASP B 2 48 ? 4.454   -11.035 3.780   1.00 0.00 ? 58 ASP B OD1  4  
ATOM 7475  O OD2  . ASP B 2 48 ? 3.132   -10.715 2.058   1.00 0.00 ? 58 ASP B OD2  4  
ATOM 7476  H H    . ASP B 2 48 ? 5.528   -6.659  4.038   1.00 0.00 ? 58 ASP B H    4  
ATOM 7477  H HA   . ASP B 2 48 ? 6.107   -9.232  2.720   1.00 0.00 ? 58 ASP B HA   4  
ATOM 7478  H HB2  . ASP B 2 48 ? 3.839   -8.504  4.133   1.00 0.00 ? 58 ASP B HB2  4  
ATOM 7479  H HB3  . ASP B 2 48 ? 3.361   -8.287  2.450   1.00 0.00 ? 58 ASP B HB3  4  
ATOM 7480  N N    . ILE B 2 49 ? 6.402   -6.714  1.236   1.00 0.00 ? 59 ILE B N    4  
ATOM 7481  C CA   . ILE B 2 49 ? 6.528   -5.989  -0.023  1.00 0.00 ? 59 ILE B CA   4  
ATOM 7482  C C    . ILE B 2 49 ? 7.104   -6.893  -1.117  1.00 0.00 ? 59 ILE B C    4  
ATOM 7483  O O    . ILE B 2 49 ? 8.003   -7.699  -0.863  1.00 0.00 ? 59 ILE B O    4  
ATOM 7484  C CB   . ILE B 2 49 ? 7.412   -4.724  0.139   1.00 0.00 ? 59 ILE B CB   4  
ATOM 7485  C CG1  . ILE B 2 49 ? 7.278   -3.817  -1.083  1.00 0.00 ? 59 ILE B CG1  4  
ATOM 7486  C CG2  . ILE B 2 49 ? 8.874   -5.097  0.364   1.00 0.00 ? 59 ILE B CG2  4  
ATOM 7487  C CD1  . ILE B 2 49 ? 7.872   -2.439  -0.888  1.00 0.00 ? 59 ILE B CD1  4  
ATOM 7488  H H    . ILE B 2 49 ? 7.000   -6.487  1.979   1.00 0.00 ? 59 ILE B H    4  
ATOM 7489  H HA   . ILE B 2 49 ? 5.539   -5.673  -0.320  1.00 0.00 ? 59 ILE B HA   4  
ATOM 7490  H HB   . ILE B 2 49 ? 7.070   -4.188  1.012   1.00 0.00 ? 59 ILE B HB   4  
ATOM 7491  H HG12 . ILE B 2 49 ? 7.779   -4.277  -1.921  1.00 0.00 ? 59 ILE B HG12 4  
ATOM 7492  H HG13 . ILE B 2 49 ? 6.230   -3.696  -1.317  1.00 0.00 ? 59 ILE B HG13 4  
ATOM 7493  H HG21 . ILE B 2 49 ? 8.955   -5.729  1.237   1.00 0.00 ? 59 ILE B HG21 4  
ATOM 7494  H HG22 . ILE B 2 49 ? 9.455   -4.200  0.514   1.00 0.00 ? 59 ILE B HG22 4  
ATOM 7495  H HG23 . ILE B 2 49 ? 9.246   -5.627  -0.500  1.00 0.00 ? 59 ILE B HG23 4  
ATOM 7496  H HD11 . ILE B 2 49 ? 8.909   -2.531  -0.600  1.00 0.00 ? 59 ILE B HD11 4  
ATOM 7497  H HD12 . ILE B 2 49 ? 7.327   -1.918  -0.115  1.00 0.00 ? 59 ILE B HD12 4  
ATOM 7498  H HD13 . ILE B 2 49 ? 7.803   -1.885  -1.812  1.00 0.00 ? 59 ILE B HD13 4  
ATOM 7499  N N    . THR B 2 50 ? 6.561   -6.785  -2.320  1.00 0.00 ? 60 THR B N    4  
ATOM 7500  C CA   . THR B 2 50 ? 7.033   -7.581  -3.441  1.00 0.00 ? 60 THR B CA   4  
ATOM 7501  C C    . THR B 2 50 ? 7.960   -6.749  -4.320  1.00 0.00 ? 60 THR B C    4  
ATOM 7502  O O    . THR B 2 50 ? 8.159   -5.555  -4.074  1.00 0.00 ? 60 THR B O    4  
ATOM 7503  C CB   . THR B 2 50 ? 5.862   -8.101  -4.304  1.00 0.00 ? 60 THR B CB   4  
ATOM 7504  O OG1  . THR B 2 50 ? 5.191   -7.005  -4.937  1.00 0.00 ? 60 THR B OG1  4  
ATOM 7505  C CG2  . THR B 2 50 ? 4.867   -8.892  -3.467  1.00 0.00 ? 60 THR B CG2  4  
ATOM 7506  H H    . THR B 2 50 ? 5.814   -6.152  -2.459  1.00 0.00 ? 60 THR B H    4  
ATOM 7507  H HA   . THR B 2 50 ? 7.577   -8.428  -3.050  1.00 0.00 ? 60 THR B HA   4  
ATOM 7508  H HB   . THR B 2 50 ? 6.262   -8.752  -5.067  1.00 0.00 ? 60 THR B HB   4  
ATOM 7509  H HG1  . THR B 2 50 ? 4.756   -6.455  -4.257  1.00 0.00 ? 60 THR B HG1  4  
ATOM 7510  H HG21 . THR B 2 50 ? 4.528   -8.284  -2.641  1.00 0.00 ? 60 THR B HG21 4  
ATOM 7511  H HG22 . THR B 2 50 ? 5.343   -9.784  -3.089  1.00 0.00 ? 60 THR B HG22 4  
ATOM 7512  H HG23 . THR B 2 50 ? 4.021   -9.167  -4.081  1.00 0.00 ? 60 THR B HG23 4  
ATOM 7513  N N    . GLU B 2 51 ? 8.522   -7.373  -5.347  1.00 0.00 ? 61 GLU B N    4  
ATOM 7514  C CA   . GLU B 2 51 ? 9.406   -6.672  -6.264  1.00 0.00 ? 61 GLU B CA   4  
ATOM 7515  C C    . GLU B 2 51 ? 8.603   -5.694  -7.116  1.00 0.00 ? 61 GLU B C    4  
ATOM 7516  O O    . GLU B 2 51 ? 9.145   -4.718  -7.639  1.00 0.00 ? 61 GLU B O    4  
ATOM 7517  C CB   . GLU B 2 51 ? 10.148  -7.656  -7.166  1.00 0.00 ? 61 GLU B CB   4  
ATOM 7518  C CG   . GLU B 2 51 ? 11.185  -8.493  -6.439  1.00 0.00 ? 61 GLU B CG   4  
ATOM 7519  C CD   . GLU B 2 51 ? 12.178  -9.120  -7.394  1.00 0.00 ? 61 GLU B CD   4  
ATOM 7520  O OE1  . GLU B 2 51 ? 12.776  -8.377  -8.202  1.00 0.00 ? 61 GLU B OE1  4  
ATOM 7521  O OE2  . GLU B 2 51 ? 12.360  -10.353 -7.349  1.00 0.00 ? 61 GLU B OE2  4  
ATOM 7522  H H    . GLU B 2 51 ? 8.341   -8.328  -5.488  1.00 0.00 ? 61 GLU B H    4  
ATOM 7523  H HA   . GLU B 2 51 ? 10.123  -6.119  -5.678  1.00 0.00 ? 61 GLU B HA   4  
ATOM 7524  H HB2  . GLU B 2 51 ? 9.429   -8.325  -7.615  1.00 0.00 ? 61 GLU B HB2  4  
ATOM 7525  H HB3  . GLU B 2 51 ? 10.648  -7.102  -7.947  1.00 0.00 ? 61 GLU B HB3  4  
ATOM 7526  H HG2  . GLU B 2 51 ? 11.721  -7.862  -5.746  1.00 0.00 ? 61 GLU B HG2  4  
ATOM 7527  H HG3  . GLU B 2 51 ? 10.682  -9.281  -5.897  1.00 0.00 ? 61 GLU B HG3  4  
ATOM 7528  N N    . GLU B 2 52 ? 7.310   -5.968  -7.248  1.00 0.00 ? 62 GLU B N    4  
ATOM 7529  C CA   . GLU B 2 52 ? 6.417   -5.117  -8.021  1.00 0.00 ? 62 GLU B CA   4  
ATOM 7530  C C    . GLU B 2 52 ? 6.200   -3.797  -7.297  1.00 0.00 ? 62 GLU B C    4  
ATOM 7531  O O    . GLU B 2 52 ? 6.359   -2.726  -7.877  1.00 0.00 ? 62 GLU B O    4  
ATOM 7532  C CB   . GLU B 2 52 ? 5.070   -5.813  -8.241  1.00 0.00 ? 62 GLU B CB   4  
ATOM 7533  C CG   . GLU B 2 52 ? 5.063   -6.790  -9.405  1.00 0.00 ? 62 GLU B CG   4  
ATOM 7534  C CD   . GLU B 2 52 ? 4.972   -6.098  -10.749 1.00 0.00 ? 62 GLU B CD   4  
ATOM 7535  O OE1  . GLU B 2 52 ? 3.880   -5.592  -11.088 1.00 0.00 ? 62 GLU B OE1  4  
ATOM 7536  O OE2  . GLU B 2 52 ? 5.984   -6.068  -11.478 1.00 0.00 ? 62 GLU B OE2  4  
ATOM 7537  H H    . GLU B 2 52 ? 6.943   -6.763  -6.804  1.00 0.00 ? 62 GLU B H    4  
ATOM 7538  H HA   . GLU B 2 52 ? 6.880   -4.924  -8.977  1.00 0.00 ? 62 GLU B HA   4  
ATOM 7539  H HB2  . GLU B 2 52 ? 4.808   -6.354  -7.344  1.00 0.00 ? 62 GLU B HB2  4  
ATOM 7540  H HB3  . GLU B 2 52 ? 4.318   -5.060  -8.428  1.00 0.00 ? 62 GLU B HB3  4  
ATOM 7541  H HG2  . GLU B 2 52 ? 5.974   -7.367  -9.377  1.00 0.00 ? 62 GLU B HG2  4  
ATOM 7542  H HG3  . GLU B 2 52 ? 4.215   -7.452  -9.299  1.00 0.00 ? 62 GLU B HG3  4  
ATOM 7543  N N    . ASP B 2 53 ? 5.820   -3.895  -6.030  1.00 0.00 ? 63 ASP B N    4  
ATOM 7544  C CA   . ASP B 2 53 ? 5.574   -2.724  -5.195  1.00 0.00 ? 63 ASP B CA   4  
ATOM 7545  C C    . ASP B 2 53 ? 6.755   -1.755  -5.192  1.00 0.00 ? 63 ASP B C    4  
ATOM 7546  O O    . ASP B 2 53 ? 6.561   -0.549  -5.333  1.00 0.00 ? 63 ASP B O    4  
ATOM 7547  C CB   . ASP B 2 53 ? 5.276   -3.141  -3.756  1.00 0.00 ? 63 ASP B CB   4  
ATOM 7548  C CG   . ASP B 2 53 ? 4.180   -4.181  -3.640  1.00 0.00 ? 63 ASP B CG   4  
ATOM 7549  O OD1  . ASP B 2 53 ? 3.027   -3.889  -4.017  1.00 0.00 ? 63 ASP B OD1  4  
ATOM 7550  O OD2  . ASP B 2 53 ? 4.475   -5.294  -3.164  1.00 0.00 ? 63 ASP B OD2  4  
ATOM 7551  H H    . ASP B 2 53 ? 5.641   -4.784  -5.654  1.00 0.00 ? 63 ASP B H    4  
ATOM 7552  H HA   . ASP B 2 53 ? 4.711   -2.213  -5.593  1.00 0.00 ? 63 ASP B HA   4  
ATOM 7553  H HB2  . ASP B 2 53 ? 6.173   -3.549  -3.318  1.00 0.00 ? 63 ASP B HB2  4  
ATOM 7554  H HB3  . ASP B 2 53 ? 4.977   -2.268  -3.195  1.00 0.00 ? 63 ASP B HB3  4  
ATOM 7555  N N    . LEU B 2 54 ? 7.969   -2.277  -5.004  1.00 0.00 ? 64 LEU B N    4  
ATOM 7556  C CA   . LEU B 2 54 ? 9.182   -1.454  -4.968  1.00 0.00 ? 64 LEU B CA   4  
ATOM 7557  C C    . LEU B 2 54 ? 9.258   -0.445  -6.116  1.00 0.00 ? 64 LEU B C    4  
ATOM 7558  O O    . LEU B 2 54 ? 9.341   0.760   -5.871  1.00 0.00 ? 64 LEU B O    4  
ATOM 7559  C CB   . LEU B 2 54 ? 10.419  -2.359  -4.986  1.00 0.00 ? 64 LEU B CB   4  
ATOM 7560  C CG   . LEU B 2 54 ? 10.690  -3.114  -3.684  1.00 0.00 ? 64 LEU B CG   4  
ATOM 7561  C CD1  . LEU B 2 54 ? 11.817  -4.117  -3.874  1.00 0.00 ? 64 LEU B CD1  4  
ATOM 7562  C CD2  . LEU B 2 54 ? 11.033  -2.138  -2.568  1.00 0.00 ? 64 LEU B CD2  4  
ATOM 7563  H H    . LEU B 2 54 ? 8.075   -3.238  -4.836  1.00 0.00 ? 64 LEU B H    4  
ATOM 7564  H HA   . LEU B 2 54 ? 9.174   -0.909  -4.037  1.00 0.00 ? 64 LEU B HA   4  
ATOM 7565  H HB2  . LEU B 2 54 ? 10.299  -3.083  -5.779  1.00 0.00 ? 64 LEU B HB2  4  
ATOM 7566  H HB3  . LEU B 2 54 ? 11.281  -1.754  -5.207  1.00 0.00 ? 64 LEU B HB3  4  
ATOM 7567  H HG   . LEU B 2 54 ? 9.802   -3.657  -3.396  1.00 0.00 ? 64 LEU B HG   4  
ATOM 7568  H HD11 . LEU B 2 54 ? 11.555  -4.808  -4.661  1.00 0.00 ? 64 LEU B HD11 4  
ATOM 7569  H HD12 . LEU B 2 54 ? 11.975  -4.661  -2.955  1.00 0.00 ? 64 LEU B HD12 4  
ATOM 7570  H HD13 . LEU B 2 54 ? 12.722  -3.593  -4.143  1.00 0.00 ? 64 LEU B HD13 4  
ATOM 7571  H HD21 . LEU B 2 54 ? 11.839  -1.494  -2.889  1.00 0.00 ? 64 LEU B HD21 4  
ATOM 7572  H HD22 . LEU B 2 54 ? 11.338  -2.687  -1.691  1.00 0.00 ? 64 LEU B HD22 4  
ATOM 7573  H HD23 . LEU B 2 54 ? 10.165  -1.539  -2.333  1.00 0.00 ? 64 LEU B HD23 4  
ATOM 7574  N N    . GLU B 2 55 ? 9.309   -0.956  -7.348  1.00 0.00 ? 65 GLU B N    4  
ATOM 7575  C CA   . GLU B 2 55 ? 9.368   -0.132  -8.570  1.00 0.00 ? 65 GLU B CA   4  
ATOM 7576  C C    . GLU B 2 55 ? 8.559   1.178   -8.473  1.00 0.00 ? 65 GLU B C    4  
ATOM 7577  O O    . GLU B 2 55 ? 8.994   2.212   -8.985  1.00 0.00 ? 65 GLU B O    4  
ATOM 7578  C CB   . GLU B 2 55 ? 8.924   -0.966  -9.788  1.00 0.00 ? 65 GLU B CB   4  
ATOM 7579  C CG   . GLU B 2 55 ? 7.447   -0.849  -10.147 1.00 0.00 ? 65 GLU B CG   4  
ATOM 7580  C CD   . GLU B 2 55 ? 7.207   -0.002  -11.384 1.00 0.00 ? 65 GLU B CD   4  
ATOM 7581  O OE1  . GLU B 2 55 ? 8.029   0.894   -11.669 1.00 0.00 ? 65 GLU B OE1  4  
ATOM 7582  O OE2  . GLU B 2 55 ? 6.193   -0.227  -12.077 1.00 0.00 ? 65 GLU B OE2  4  
ATOM 7583  H H    . GLU B 2 55 ? 9.438   -1.922  -7.435  1.00 0.00 ? 65 GLU B H    4  
ATOM 7584  H HA   . GLU B 2 55 ? 10.404  0.135   -8.711  1.00 0.00 ? 65 GLU B HA   4  
ATOM 7585  H HB2  . GLU B 2 55 ? 9.498   -0.656  -10.647 1.00 0.00 ? 65 GLU B HB2  4  
ATOM 7586  H HB3  . GLU B 2 55 ? 9.137   -2.006  -9.588  1.00 0.00 ? 65 GLU B HB3  4  
ATOM 7587  H HG2  . GLU B 2 55 ? 7.052   -1.838  -10.326 1.00 0.00 ? 65 GLU B HG2  4  
ATOM 7588  H HG3  . GLU B 2 55 ? 6.923   -0.399  -9.316  1.00 0.00 ? 65 GLU B HG3  4  
ATOM 7589  N N    . GLU B 2 56 ? 7.410   1.134   -7.803  1.00 0.00 ? 66 GLU B N    4  
ATOM 7590  C CA   . GLU B 2 56 ? 6.548   2.308   -7.641  1.00 0.00 ? 66 GLU B CA   4  
ATOM 7591  C C    . GLU B 2 56 ? 7.294   3.517   -7.066  1.00 0.00 ? 66 GLU B C    4  
ATOM 7592  O O    . GLU B 2 56 ? 7.104   4.642   -7.523  1.00 0.00 ? 66 GLU B O    4  
ATOM 7593  C CB   . GLU B 2 56 ? 5.382   1.969   -6.722  1.00 0.00 ? 66 GLU B CB   4  
ATOM 7594  C CG   . GLU B 2 56 ? 4.122   1.560   -7.455  1.00 0.00 ? 66 GLU B CG   4  
ATOM 7595  C CD   . GLU B 2 56 ? 3.083   0.982   -6.522  1.00 0.00 ? 66 GLU B CD   4  
ATOM 7596  O OE1  . GLU B 2 56 ? 2.515   1.740   -5.705  1.00 0.00 ? 66 GLU B OE1  4  
ATOM 7597  O OE2  . GLU B 2 56 ? 2.830   -0.237  -6.601  1.00 0.00 ? 66 GLU B OE2  4  
ATOM 7598  H H    . GLU B 2 56 ? 7.119   0.282   -7.406  1.00 0.00 ? 66 GLU B H    4  
ATOM 7599  H HA   . GLU B 2 56 ? 6.159   2.569   -8.611  1.00 0.00 ? 66 GLU B HA   4  
ATOM 7600  H HB2  . GLU B 2 56 ? 5.675   1.155   -6.075  1.00 0.00 ? 66 GLU B HB2  4  
ATOM 7601  H HB3  . GLU B 2 56 ? 5.155   2.833   -6.115  1.00 0.00 ? 66 GLU B HB3  4  
ATOM 7602  H HG2  . GLU B 2 56 ? 3.705   2.427   -7.943  1.00 0.00 ? 66 GLU B HG2  4  
ATOM 7603  H HG3  . GLU B 2 56 ? 4.376   0.814   -8.194  1.00 0.00 ? 66 GLU B HG3  4  
ATOM 7604  N N    . ALA B 2 57 ? 8.149   3.282   -6.077  1.00 0.00 ? 67 ALA B N    4  
ATOM 7605  C CA   . ALA B 2 57 ? 8.892   4.364   -5.433  1.00 0.00 ? 67 ALA B CA   4  
ATOM 7606  C C    . ALA B 2 57 ? 10.187  4.691   -6.173  1.00 0.00 ? 67 ALA B C    4  
ATOM 7607  O O    . ALA B 2 57 ? 11.038  5.417   -5.660  1.00 0.00 ? 67 ALA B O    4  
ATOM 7608  C CB   . ALA B 2 57 ? 9.190   4.009   -3.986  1.00 0.00 ? 67 ALA B CB   4  
ATOM 7609  H H    . ALA B 2 57 ? 8.292   2.355   -5.778  1.00 0.00 ? 67 ALA B H    4  
ATOM 7610  H HA   . ALA B 2 57 ? 8.262   5.242   -5.435  1.00 0.00 ? 67 ALA B HA   4  
ATOM 7611  H HB1  . ALA B 2 57 ? 8.268   3.788   -3.470  1.00 0.00 ? 67 ALA B HB1  4  
ATOM 7612  H HB2  . ALA B 2 57 ? 9.681   4.843   -3.504  1.00 0.00 ? 67 ALA B HB2  4  
ATOM 7613  H HB3  . ALA B 2 57 ? 9.837   3.144   -3.953  1.00 0.00 ? 67 ALA B HB3  4  
ATOM 7614  N N    . GLY B 2 58 ? 10.335  4.154   -7.374  1.00 0.00 ? 68 GLY B N    4  
ATOM 7615  C CA   . GLY B 2 58 ? 11.529  4.410   -8.155  1.00 0.00 ? 68 GLY B CA   4  
ATOM 7616  C C    . GLY B 2 58 ? 12.570  3.325   -7.980  1.00 0.00 ? 68 GLY B C    4  
ATOM 7617  O O    . GLY B 2 58 ? 13.672  3.413   -8.521  1.00 0.00 ? 68 GLY B O    4  
ATOM 7618  H H    . GLY B 2 58 ? 9.625   3.580   -7.736  1.00 0.00 ? 68 GLY B H    4  
ATOM 7619  H HA2  . GLY B 2 58 ? 11.258  4.470   -9.199  1.00 0.00 ? 68 GLY B HA2  4  
ATOM 7620  H HA3  . GLY B 2 58 ? 11.954  5.355   -7.848  1.00 0.00 ? 68 GLY B HA3  4  
ATOM 7621  N N    . VAL B 2 59 ? 12.218  2.297   -7.224  1.00 0.00 ? 69 VAL B N    4  
ATOM 7622  C CA   . VAL B 2 59 ? 13.123  1.185   -6.979  1.00 0.00 ? 69 VAL B CA   4  
ATOM 7623  C C    . VAL B 2 59 ? 13.061  0.197   -8.139  1.00 0.00 ? 69 VAL B C    4  
ATOM 7624  O O    . VAL B 2 59 ? 12.595  -0.932  -7.991  1.00 0.00 ? 69 VAL B O    4  
ATOM 7625  C CB   . VAL B 2 59 ? 12.783  0.447   -5.665  1.00 0.00 ? 69 VAL B CB   4  
ATOM 7626  C CG1  . VAL B 2 59 ? 13.952  -0.413  -5.208  1.00 0.00 ? 69 VAL B CG1  4  
ATOM 7627  C CG2  . VAL B 2 59 ? 12.383  1.425   -4.572  1.00 0.00 ? 69 VAL B CG2  4  
ATOM 7628  H H    . VAL B 2 59 ? 11.323  2.281   -6.825  1.00 0.00 ? 69 VAL B H    4  
ATOM 7629  H HA   . VAL B 2 59 ? 14.126  1.578   -6.903  1.00 0.00 ? 69 VAL B HA   4  
ATOM 7630  H HB   . VAL B 2 59 ? 11.945  -0.201  -5.858  1.00 0.00 ? 69 VAL B HB   4  
ATOM 7631  H HG11 . VAL B 2 59 ? 13.695  -0.910  -4.284  1.00 0.00 ? 69 VAL B HG11 4  
ATOM 7632  H HG12 . VAL B 2 59 ? 14.819  0.212   -5.051  1.00 0.00 ? 69 VAL B HG12 4  
ATOM 7633  H HG13 . VAL B 2 59 ? 14.174  -1.152  -5.964  1.00 0.00 ? 69 VAL B HG13 4  
ATOM 7634  H HG21 . VAL B 2 59 ? 13.227  2.050   -4.321  1.00 0.00 ? 69 VAL B HG21 4  
ATOM 7635  H HG22 . VAL B 2 59 ? 12.068  0.877   -3.696  1.00 0.00 ? 69 VAL B HG22 4  
ATOM 7636  H HG23 . VAL B 2 59 ? 11.569  2.043   -4.921  1.00 0.00 ? 69 VAL B HG23 4  
ATOM 7637  N N    . GLN B 2 60 ? 13.508  0.641   -9.304  1.00 0.00 ? 70 GLN B N    4  
ATOM 7638  C CA   . GLN B 2 60 ? 13.504  -0.198  -10.495 1.00 0.00 ? 70 GLN B CA   4  
ATOM 7639  C C    . GLN B 2 60 ? 14.890  -0.776  -10.739 1.00 0.00 ? 70 GLN B C    4  
ATOM 7640  O O    . GLN B 2 60 ? 15.102  -1.561  -11.668 1.00 0.00 ? 70 GLN B O    4  
ATOM 7641  C CB   . GLN B 2 60 ? 13.041  0.611   -11.707 1.00 0.00 ? 70 GLN B CB   4  
ATOM 7642  C CG   . GLN B 2 60 ? 11.635  1.169   -11.553 1.00 0.00 ? 70 GLN B CG   4  
ATOM 7643  C CD   . GLN B 2 60 ? 11.265  2.147   -12.650 1.00 0.00 ? 70 GLN B CD   4  
ATOM 7644  O OE1  . GLN B 2 60 ? 12.121  2.844   -13.194 1.00 0.00 ? 70 GLN B OE1  4  
ATOM 7645  N NE2  . GLN B 2 60 ? 9.985   2.215   -12.971 1.00 0.00 ? 70 GLN B NE2  4  
ATOM 7646  H H    . GLN B 2 60 ? 13.843  1.562   -9.366  1.00 0.00 ? 70 GLN B H    4  
ATOM 7647  H HA   . GLN B 2 60 ? 12.812  -1.010  -10.327 1.00 0.00 ? 70 GLN B HA   4  
ATOM 7648  H HB2  . GLN B 2 60 ? 13.721  1.437   -11.855 1.00 0.00 ? 70 GLN B HB2  4  
ATOM 7649  H HB3  . GLN B 2 60 ? 13.061  -0.024  -12.580 1.00 0.00 ? 70 GLN B HB3  4  
ATOM 7650  H HG2  . GLN B 2 60 ? 10.934  0.350   -11.575 1.00 0.00 ? 70 GLN B HG2  4  
ATOM 7651  H HG3  . GLN B 2 60 ? 11.565  1.675   -10.602 1.00 0.00 ? 70 GLN B HG3  4  
ATOM 7652  H HE21 . GLN B 2 60 ? 9.346   1.632   -12.485 1.00 0.00 ? 70 GLN B HE21 4  
ATOM 7653  H HE22 . GLN B 2 60 ? 9.717   2.834   -13.680 1.00 0.00 ? 70 GLN B HE22 4  
ATOM 7654  N N    . ASP B 2 61 ? 15.827  -0.384  -9.889  1.00 0.00 ? 71 ASP B N    4  
ATOM 7655  C CA   . ASP B 2 61 ? 17.201  -0.851  -9.990  1.00 0.00 ? 71 ASP B CA   4  
ATOM 7656  C C    . ASP B 2 61 ? 17.319  -2.266  -9.434  1.00 0.00 ? 71 ASP B C    4  
ATOM 7657  O O    . ASP B 2 61 ? 16.818  -2.553  -8.344  1.00 0.00 ? 71 ASP B O    4  
ATOM 7658  C CB   . ASP B 2 61 ? 18.140  0.097   -9.239  1.00 0.00 ? 71 ASP B CB   4  
ATOM 7659  C CG   . ASP B 2 61 ? 19.567  -0.407  -9.207  1.00 0.00 ? 71 ASP B CG   4  
ATOM 7660  O OD1  . ASP B 2 61 ? 20.272  -0.262  -10.223 1.00 0.00 ? 71 ASP B OD1  4  
ATOM 7661  O OD2  . ASP B 2 61 ? 19.987  -0.945  -8.162  1.00 0.00 ? 71 ASP B OD2  4  
ATOM 7662  H H    . ASP B 2 61 ? 15.586  0.227   -9.167  1.00 0.00 ? 71 ASP B H    4  
ATOM 7663  H HA   . ASP B 2 61 ? 17.472  -0.861  -11.035 1.00 0.00 ? 71 ASP B HA   4  
ATOM 7664  H HB2  . ASP B 2 61 ? 18.130  1.062   -9.724  1.00 0.00 ? 71 ASP B HB2  4  
ATOM 7665  H HB3  . ASP B 2 61 ? 17.792  0.206   -8.223  1.00 0.00 ? 71 ASP B HB3  4  
ATOM 7666  N N    . PRO B 2 62 ? 17.974  -3.169  -10.183 1.00 0.00 ? 72 PRO B N    4  
ATOM 7667  C CA   . PRO B 2 62 ? 18.146  -4.569  -9.780  1.00 0.00 ? 72 PRO B CA   4  
ATOM 7668  C C    . PRO B 2 62 ? 18.831  -4.718  -8.422  1.00 0.00 ? 72 PRO B C    4  
ATOM 7669  O O    . PRO B 2 62 ? 18.343  -5.444  -7.553  1.00 0.00 ? 72 PRO B O    4  
ATOM 7670  C CB   . PRO B 2 62 ? 19.020  -5.172  -10.890 1.00 0.00 ? 72 PRO B CB   4  
ATOM 7671  C CG   . PRO B 2 62 ? 19.604  -4.007  -11.614 1.00 0.00 ? 72 PRO B CG   4  
ATOM 7672  C CD   . PRO B 2 62 ? 18.604  -2.897  -11.486 1.00 0.00 ? 72 PRO B CD   4  
ATOM 7673  H HA   . PRO B 2 62 ? 17.197  -5.084  -9.752  1.00 0.00 ? 72 PRO B HA   4  
ATOM 7674  H HB2  . PRO B 2 62 ? 19.789  -5.787  -10.448 1.00 0.00 ? 72 PRO B HB2  4  
ATOM 7675  H HB3  . PRO B 2 62 ? 18.405  -5.771  -11.544 1.00 0.00 ? 72 PRO B HB3  4  
ATOM 7676  H HG2  . PRO B 2 62 ? 20.540  -3.722  -11.157 1.00 0.00 ? 72 PRO B HG2  4  
ATOM 7677  H HG3  . PRO B 2 62 ? 19.754  -4.257  -12.653 1.00 0.00 ? 72 PRO B HG3  4  
ATOM 7678  H HD2  . PRO B 2 62 ? 19.102  -1.938  -11.481 1.00 0.00 ? 72 PRO B HD2  4  
ATOM 7679  H HD3  . PRO B 2 62 ? 17.877  -2.945  -12.283 1.00 0.00 ? 72 PRO B HD3  4  
ATOM 7680  N N    . ALA B 2 63 ? 19.954  -4.027  -8.239  1.00 0.00 ? 73 ALA B N    4  
ATOM 7681  C CA   . ALA B 2 63 ? 20.700  -4.094  -6.989  1.00 0.00 ? 73 ALA B CA   4  
ATOM 7682  C C    . ALA B 2 63 ? 19.870  -3.589  -5.814  1.00 0.00 ? 73 ALA B C    4  
ATOM 7683  O O    . ALA B 2 63 ? 19.808  -4.239  -4.770  1.00 0.00 ? 73 ALA B O    4  
ATOM 7684  C CB   . ALA B 2 63 ? 21.998  -3.305  -7.104  1.00 0.00 ? 73 ALA B CB   4  
ATOM 7685  H H    . ALA B 2 63 ? 20.304  -3.464  -8.963  1.00 0.00 ? 73 ALA B H    4  
ATOM 7686  H HA   . ALA B 2 63 ? 20.955  -5.129  -6.814  1.00 0.00 ? 73 ALA B HA   4  
ATOM 7687  H HB1  . ALA B 2 63 ? 22.562  -3.404  -6.188  1.00 0.00 ? 73 ALA B HB1  4  
ATOM 7688  H HB2  . ALA B 2 63 ? 21.772  -2.263  -7.277  1.00 0.00 ? 73 ALA B HB2  4  
ATOM 7689  H HB3  . ALA B 2 63 ? 22.581  -3.688  -7.929  1.00 0.00 ? 73 ALA B HB3  4  
ATOM 7690  N N    . HIS B 2 64 ? 19.230  -2.435  -5.992  1.00 0.00 ? 74 HIS B N    4  
ATOM 7691  C CA   . HIS B 2 64 ? 18.399  -1.847  -4.943  1.00 0.00 ? 74 HIS B CA   4  
ATOM 7692  C C    . HIS B 2 64 ? 17.311  -2.820  -4.502  1.00 0.00 ? 74 HIS B C    4  
ATOM 7693  O O    . HIS B 2 64 ? 17.096  -3.022  -3.306  1.00 0.00 ? 74 HIS B O    4  
ATOM 7694  C CB   . HIS B 2 64 ? 17.764  -0.537  -5.422  1.00 0.00 ? 74 HIS B CB   4  
ATOM 7695  C CG   . HIS B 2 64 ? 18.719  0.619   -5.467  1.00 0.00 ? 74 HIS B CG   4  
ATOM 7696  N ND1  . HIS B 2 64 ? 18.399  1.864   -5.965  1.00 0.00 ? 74 HIS B ND1  4  
ATOM 7697  C CD2  . HIS B 2 64 ? 20.014  0.700   -5.066  1.00 0.00 ? 74 HIS B CD2  4  
ATOM 7698  C CE1  . HIS B 2 64 ? 19.483  2.643   -5.856  1.00 0.00 ? 74 HIS B CE1  4  
ATOM 7699  N NE2  . HIS B 2 64 ? 20.490  1.984   -5.315  1.00 0.00 ? 74 HIS B NE2  4  
ATOM 7700  H H    . HIS B 2 64 ? 19.333  -1.958  -6.851  1.00 0.00 ? 74 HIS B H    4  
ATOM 7701  H HA   . HIS B 2 64 ? 19.037  -1.637  -4.098  1.00 0.00 ? 74 HIS B HA   4  
ATOM 7702  H HB2  . HIS B 2 64 ? 17.369  -0.679  -6.415  1.00 0.00 ? 74 HIS B HB2  4  
ATOM 7703  H HB3  . HIS B 2 64 ? 16.957  -0.274  -4.754  1.00 0.00 ? 74 HIS B HB3  4  
ATOM 7704  H HD1  . HIS B 2 64 ? 17.530  2.137   -6.331  1.00 0.00 ? 74 HIS B HD1  4  
ATOM 7705  H HD2  . HIS B 2 64 ? 20.592  -0.098  -4.623  1.00 0.00 ? 74 HIS B HD2  4  
ATOM 7706  H HE1  . HIS B 2 64 ? 19.526  3.675   -6.167  1.00 0.00 ? 74 HIS B HE1  4  
ATOM 7707  N N    . LYS B 2 65 ? 16.636  -3.427  -5.472  1.00 0.00 ? 75 LYS B N    4  
ATOM 7708  C CA   . LYS B 2 65 ? 15.578  -4.388  -5.181  1.00 0.00 ? 75 LYS B CA   4  
ATOM 7709  C C    . LYS B 2 65 ? 16.138  -5.590  -4.434  1.00 0.00 ? 75 LYS B C    4  
ATOM 7710  O O    . LYS B 2 65 ? 15.623  -5.982  -3.384  1.00 0.00 ? 75 LYS B O    4  
ATOM 7711  C CB   . LYS B 2 65 ? 14.913  -4.869  -6.472  1.00 0.00 ? 75 LYS B CB   4  
ATOM 7712  C CG   . LYS B 2 65 ? 13.971  -3.858  -7.108  1.00 0.00 ? 75 LYS B CG   4  
ATOM 7713  C CD   . LYS B 2 65 ? 13.022  -4.532  -8.088  1.00 0.00 ? 75 LYS B CD   4  
ATOM 7714  C CE   . LYS B 2 65 ? 13.775  -5.210  -9.224  1.00 0.00 ? 75 LYS B CE   4  
ATOM 7715  N NZ   . LYS B 2 65 ? 12.967  -6.277  -9.867  1.00 0.00 ? 75 LYS B NZ   4  
ATOM 7716  H H    . LYS B 2 65 ? 16.855  -3.222  -6.408  1.00 0.00 ? 75 LYS B H    4  
ATOM 7717  H HA   . LYS B 2 65 ? 14.842  -3.900  -4.563  1.00 0.00 ? 75 LYS B HA   4  
ATOM 7718  H HB2  . LYS B 2 65 ? 15.685  -5.105  -7.189  1.00 0.00 ? 75 LYS B HB2  4  
ATOM 7719  H HB3  . LYS B 2 65 ? 14.350  -5.766  -6.258  1.00 0.00 ? 75 LYS B HB3  4  
ATOM 7720  H HG2  . LYS B 2 65 ? 13.393  -3.380  -6.332  1.00 0.00 ? 75 LYS B HG2  4  
ATOM 7721  H HG3  . LYS B 2 65 ? 14.554  -3.117  -7.635  1.00 0.00 ? 75 LYS B HG3  4  
ATOM 7722  H HD2  . LYS B 2 65 ? 12.442  -5.275  -7.561  1.00 0.00 ? 75 LYS B HD2  4  
ATOM 7723  H HD3  . LYS B 2 65 ? 12.360  -3.784  -8.503  1.00 0.00 ? 75 LYS B HD3  4  
ATOM 7724  H HE2  . LYS B 2 65 ? 14.029  -4.468  -9.964  1.00 0.00 ? 75 LYS B HE2  4  
ATOM 7725  H HE3  . LYS B 2 65 ? 14.680  -5.646  -8.829  1.00 0.00 ? 75 LYS B HE3  4  
ATOM 7726  H HZ1  . LYS B 2 65 ? 12.035  -5.907  -10.143 1.00 0.00 ? 75 LYS B HZ1  4  
ATOM 7727  H HZ2  . LYS B 2 65 ? 12.830  -7.077  -9.206  1.00 0.00 ? 75 LYS B HZ2  4  
ATOM 7728  H HZ3  . LYS B 2 65 ? 13.451  -6.630  -10.717 1.00 0.00 ? 75 LYS B HZ3  4  
ATOM 7729  N N    . ARG B 2 66 ? 17.197  -6.165  -4.989  1.00 0.00 ? 76 ARG B N    4  
ATOM 7730  C CA   . ARG B 2 66 ? 17.842  -7.330  -4.403  1.00 0.00 ? 76 ARG B CA   4  
ATOM 7731  C C    . ARG B 2 66 ? 18.279  -7.067  -2.964  1.00 0.00 ? 76 ARG B C    4  
ATOM 7732  O O    . ARG B 2 66 ? 18.014  -7.878  -2.071  1.00 0.00 ? 76 ARG B O    4  
ATOM 7733  C CB   . ARG B 2 66 ? 19.044  -7.753  -5.252  1.00 0.00 ? 76 ARG B CB   4  
ATOM 7734  C CG   . ARG B 2 66 ? 19.610  -9.111  -4.872  1.00 0.00 ? 76 ARG B CG   4  
ATOM 7735  C CD   . ARG B 2 66 ? 18.534  -10.185 -4.899  1.00 0.00 ? 76 ARG B CD   4  
ATOM 7736  N NE   . ARG B 2 66 ? 19.020  -11.463 -4.396  1.00 0.00 ? 76 ARG B NE   4  
ATOM 7737  C CZ   . ARG B 2 66 ? 19.104  -11.766 -3.104  1.00 0.00 ? 76 ARG B CZ   4  
ATOM 7738  N NH1  . ARG B 2 66 ? 18.767  -10.870 -2.182  1.00 0.00 ? 76 ARG B NH1  4  
ATOM 7739  N NH2  . ARG B 2 66 ? 19.528  -12.966 -2.731  1.00 0.00 ? 76 ARG B NH2  4  
ATOM 7740  H H    . ARG B 2 66 ? 17.542  -5.801  -5.838  1.00 0.00 ? 76 ARG B H    4  
ATOM 7741  H HA   . ARG B 2 66 ? 17.119  -8.129  -4.401  1.00 0.00 ? 76 ARG B HA   4  
ATOM 7742  H HB2  . ARG B 2 66 ? 18.745  -7.790  -6.289  1.00 0.00 ? 76 ARG B HB2  4  
ATOM 7743  H HB3  . ARG B 2 66 ? 19.827  -7.016  -5.139  1.00 0.00 ? 76 ARG B HB3  4  
ATOM 7744  H HG2  . ARG B 2 66 ? 20.387  -9.377  -5.571  1.00 0.00 ? 76 ARG B HG2  4  
ATOM 7745  H HG3  . ARG B 2 66 ? 20.023  -9.052  -3.875  1.00 0.00 ? 76 ARG B HG3  4  
ATOM 7746  H HD2  . ARG B 2 66 ? 17.708  -9.865  -4.284  1.00 0.00 ? 76 ARG B HD2  4  
ATOM 7747  H HD3  . ARG B 2 66 ? 18.197  -10.311 -5.915  1.00 0.00 ? 76 ARG B HD3  4  
ATOM 7748  H HE   . ARG B 2 66 ? 19.286  -12.137 -5.066  1.00 0.00 ? 76 ARG B HE   4  
ATOM 7749  H HH11 . ARG B 2 66 ? 18.442  -9.962  -2.453  1.00 0.00 ? 76 ARG B HH11 4  
ATOM 7750  H HH12 . ARG B 2 66 ? 18.861  -11.093 -1.198  1.00 0.00 ? 76 ARG B HH12 4  
ATOM 7751  H HH21 . ARG B 2 66 ? 19.788  -13.646 -3.420  1.00 0.00 ? 76 ARG B HH21 4  
ATOM 7752  H HH22 . ARG B 2 66 ? 19.589  -13.200 -1.757  1.00 0.00 ? 76 ARG B HH22 4  
ATOM 7753  N N    . LEU B 2 67 ? 18.956  -5.943  -2.743  1.00 0.00 ? 77 LEU B N    4  
ATOM 7754  C CA   . LEU B 2 67 ? 19.429  -5.579  -1.412  1.00 0.00 ? 77 LEU B CA   4  
ATOM 7755  C C    . LEU B 2 67 ? 18.277  -5.350  -0.441  1.00 0.00 ? 77 LEU B C    4  
ATOM 7756  O O    . LEU B 2 67 ? 18.323  -5.819  0.694   1.00 0.00 ? 77 LEU B O    4  
ATOM 7757  C CB   . LEU B 2 67 ? 20.310  -4.326  -1.478  1.00 0.00 ? 77 LEU B CB   4  
ATOM 7758  C CG   . LEU B 2 67 ? 21.822  -4.584  -1.537  1.00 0.00 ? 77 LEU B CG   4  
ATOM 7759  C CD1  . LEU B 2 67 ? 22.300  -5.276  -0.268  1.00 0.00 ? 77 LEU B CD1  4  
ATOM 7760  C CD2  . LEU B 2 67 ? 22.181  -5.412  -2.763  1.00 0.00 ? 77 LEU B CD2  4  
ATOM 7761  H H    . LEU B 2 67 ? 19.183  -5.358  -3.503  1.00 0.00 ? 77 LEU B H    4  
ATOM 7762  H HA   . LEU B 2 67 ? 20.025  -6.399  -1.046  1.00 0.00 ? 77 LEU B HA   4  
ATOM 7763  H HB2  . LEU B 2 67 ? 20.029  -3.760  -2.353  1.00 0.00 ? 77 LEU B HB2  4  
ATOM 7764  H HB3  . LEU B 2 67 ? 20.107  -3.725  -0.603  1.00 0.00 ? 77 LEU B HB3  4  
ATOM 7765  H HG   . LEU B 2 67 ? 22.337  -3.637  -1.611  1.00 0.00 ? 77 LEU B HG   4  
ATOM 7766  H HD11 . LEU B 2 67 ? 23.379  -5.308  -0.262  1.00 0.00 ? 77 LEU B HD11 4  
ATOM 7767  H HD12 . LEU B 2 67 ? 21.909  -6.282  -0.237  1.00 0.00 ? 77 LEU B HD12 4  
ATOM 7768  H HD13 . LEU B 2 67 ? 21.952  -4.727  0.594   1.00 0.00 ? 77 LEU B HD13 4  
ATOM 7769  H HD21 . LEU B 2 67 ? 21.704  -6.379  -2.696  1.00 0.00 ? 77 LEU B HD21 4  
ATOM 7770  H HD22 . LEU B 2 67 ? 23.252  -5.543  -2.807  1.00 0.00 ? 77 LEU B HD22 4  
ATOM 7771  H HD23 . LEU B 2 67 ? 21.843  -4.904  -3.653  1.00 0.00 ? 77 LEU B HD23 4  
ATOM 7772  N N    . LEU B 2 68 ? 17.246  -4.638  -0.880  1.00 0.00 ? 78 LEU B N    4  
ATOM 7773  C CA   . LEU B 2 68 ? 16.097  -4.361  -0.020  1.00 0.00 ? 78 LEU B CA   4  
ATOM 7774  C C    . LEU B 2 68 ? 15.447  -5.662  0.446   1.00 0.00 ? 78 LEU B C    4  
ATOM 7775  O O    . LEU B 2 68 ? 15.145  -5.823  1.630   1.00 0.00 ? 78 LEU B O    4  
ATOM 7776  C CB   . LEU B 2 68 ? 15.076  -3.481  -0.746  1.00 0.00 ? 78 LEU B CB   4  
ATOM 7777  C CG   . LEU B 2 68 ? 14.378  -2.440  0.136   1.00 0.00 ? 78 LEU B CG   4  
ATOM 7778  C CD1  . LEU B 2 68 ? 14.029  -1.203  -0.675  1.00 0.00 ? 78 LEU B CD1  4  
ATOM 7779  C CD2  . LEU B 2 68 ? 13.127  -3.027  0.776   1.00 0.00 ? 78 LEU B CD2  4  
ATOM 7780  H H    . LEU B 2 68 ? 17.258  -4.281  -1.797  1.00 0.00 ? 78 LEU B H    4  
ATOM 7781  H HA   . LEU B 2 68 ? 16.461  -3.829  0.847   1.00 0.00 ? 78 LEU B HA   4  
ATOM 7782  H HB2  . LEU B 2 68 ? 15.584  -2.964  -1.546  1.00 0.00 ? 78 LEU B HB2  4  
ATOM 7783  H HB3  . LEU B 2 68 ? 14.321  -4.121  -1.175  1.00 0.00 ? 78 LEU B HB3  4  
ATOM 7784  H HG   . LEU B 2 68 ? 15.051  -2.140  0.928   1.00 0.00 ? 78 LEU B HG   4  
ATOM 7785  H HD11 . LEU B 2 68 ? 14.933  -0.767  -1.073  1.00 0.00 ? 78 LEU B HD11 4  
ATOM 7786  H HD12 . LEU B 2 68 ? 13.531  -0.485  -0.040  1.00 0.00 ? 78 LEU B HD12 4  
ATOM 7787  H HD13 . LEU B 2 68 ? 13.375  -1.480  -1.488  1.00 0.00 ? 78 LEU B HD13 4  
ATOM 7788  H HD21 . LEU B 2 68 ? 13.406  -3.841  1.430   1.00 0.00 ? 78 LEU B HD21 4  
ATOM 7789  H HD22 . LEU B 2 68 ? 12.467  -3.395  0.006   1.00 0.00 ? 78 LEU B HD22 4  
ATOM 7790  H HD23 . LEU B 2 68 ? 12.622  -2.262  1.348   1.00 0.00 ? 78 LEU B HD23 4  
ATOM 7791  N N    . LEU B 2 69 ? 15.256  -6.593  -0.486  1.00 0.00 ? 79 LEU B N    4  
ATOM 7792  C CA   . LEU B 2 69 ? 14.661  -7.891  -0.170  1.00 0.00 ? 79 LEU B CA   4  
ATOM 7793  C C    . LEU B 2 69 ? 15.486  -8.631  0.884   1.00 0.00 ? 79 LEU B C    4  
ATOM 7794  O O    . LEU B 2 69 ? 14.942  -9.354  1.720   1.00 0.00 ? 79 LEU B O    4  
ATOM 7795  C CB   . LEU B 2 69 ? 14.542  -8.743  -1.438  1.00 0.00 ? 79 LEU B CB   4  
ATOM 7796  C CG   . LEU B 2 69 ? 13.129  -8.860  -2.016  1.00 0.00 ? 79 LEU B CG   4  
ATOM 7797  C CD1  . LEU B 2 69 ? 12.604  -7.498  -2.446  1.00 0.00 ? 79 LEU B CD1  4  
ATOM 7798  C CD2  . LEU B 2 69 ? 13.114  -9.831  -3.187  1.00 0.00 ? 79 LEU B CD2  4  
ATOM 7799  H H    . LEU B 2 69 ? 15.484  -6.388  -1.421  1.00 0.00 ? 79 LEU B H    4  
ATOM 7800  H HA   . LEU B 2 69 ? 13.672  -7.714  0.225   1.00 0.00 ? 79 LEU B HA   4  
ATOM 7801  H HB2  . LEU B 2 69 ? 15.183  -8.314  -2.195  1.00 0.00 ? 79 LEU B HB2  4  
ATOM 7802  H HB3  . LEU B 2 69 ? 14.897  -9.737  -1.212  1.00 0.00 ? 79 LEU B HB3  4  
ATOM 7803  H HG   . LEU B 2 69 ? 12.466  -9.246  -1.255  1.00 0.00 ? 79 LEU B HG   4  
ATOM 7804  H HD11 . LEU B 2 69 ? 11.599  -7.605  -2.829  1.00 0.00 ? 79 LEU B HD11 4  
ATOM 7805  H HD12 . LEU B 2 69 ? 13.242  -7.093  -3.218  1.00 0.00 ? 79 LEU B HD12 4  
ATOM 7806  H HD13 . LEU B 2 69 ? 12.597  -6.830  -1.598  1.00 0.00 ? 79 LEU B HD13 4  
ATOM 7807  H HD21 . LEU B 2 69 ? 13.443  -10.803 -2.852  1.00 0.00 ? 79 LEU B HD21 4  
ATOM 7808  H HD22 . LEU B 2 69 ? 13.778  -9.472  -3.959  1.00 0.00 ? 79 LEU B HD22 4  
ATOM 7809  H HD23 . LEU B 2 69 ? 12.111  -9.905  -3.581  1.00 0.00 ? 79 LEU B HD23 4  
ATOM 7810  N N    . ASP B 2 70 ? 16.800  -8.441  0.841   1.00 0.00 ? 80 ASP B N    4  
ATOM 7811  C CA   . ASP B 2 70 ? 17.700  -9.080  1.797   1.00 0.00 ? 80 ASP B CA   4  
ATOM 7812  C C    . ASP B 2 70 ? 17.660  -8.347  3.130   1.00 0.00 ? 80 ASP B C    4  
ATOM 7813  O O    . ASP B 2 70 ? 17.724  -8.960  4.198   1.00 0.00 ? 80 ASP B O    4  
ATOM 7814  C CB   . ASP B 2 70 ? 19.131  -9.094  1.256   1.00 0.00 ? 80 ASP B CB   4  
ATOM 7815  C CG   . ASP B 2 70 ? 19.737  -10.481 1.262   1.00 0.00 ? 80 ASP B CG   4  
ATOM 7816  O OD1  . ASP B 2 70 ? 20.337  -10.875 2.278   1.00 0.00 ? 80 ASP B OD1  4  
ATOM 7817  O OD2  . ASP B 2 70 ? 19.618  -11.186 0.240   1.00 0.00 ? 80 ASP B OD2  4  
ATOM 7818  H H    . ASP B 2 70 ? 17.176  -7.858  0.146   1.00 0.00 ? 80 ASP B H    4  
ATOM 7819  H HA   . ASP B 2 70 ? 17.367  -10.097 1.944   1.00 0.00 ? 80 ASP B HA   4  
ATOM 7820  H HB2  . ASP B 2 70 ? 19.128  -8.728  0.241   1.00 0.00 ? 80 ASP B HB2  4  
ATOM 7821  H HB3  . ASP B 2 70 ? 19.746  -8.449  1.866   1.00 0.00 ? 80 ASP B HB3  4  
ATOM 7822  N N    . THR B 2 71 ? 17.539  -7.027  3.056   1.00 0.00 ? 81 THR B N    4  
ATOM 7823  C CA   . THR B 2 71 ? 17.478  -6.184  4.241   1.00 0.00 ? 81 THR B CA   4  
ATOM 7824  C C    . THR B 2 71 ? 16.254  -6.528  5.086   1.00 0.00 ? 81 THR B C    4  
ATOM 7825  O O    . THR B 2 71 ? 16.293  -6.440  6.313   1.00 0.00 ? 81 THR B O    4  
ATOM 7826  C CB   . THR B 2 71 ? 17.443  -4.691  3.854   1.00 0.00 ? 81 THR B CB   4  
ATOM 7827  O OG1  . THR B 2 71 ? 18.502  -4.409  2.935   1.00 0.00 ? 81 THR B OG1  4  
ATOM 7828  C CG2  . THR B 2 71 ? 17.590  -3.796  5.077   1.00 0.00 ? 81 THR B CG2  4  
ATOM 7829  H H    . THR B 2 71 ? 17.494  -6.605  2.170   1.00 0.00 ? 81 THR B H    4  
ATOM 7830  H HA   . THR B 2 71 ? 18.368  -6.362  4.824   1.00 0.00 ? 81 THR B HA   4  
ATOM 7831  H HB   . THR B 2 71 ? 16.495  -4.478  3.379   1.00 0.00 ? 81 THR B HB   4  
ATOM 7832  H HG1  . THR B 2 71 ? 18.414  -4.971  2.155   1.00 0.00 ? 81 THR B HG1  4  
ATOM 7833  H HG21 . THR B 2 71 ? 17.545  -2.761  4.773   1.00 0.00 ? 81 THR B HG21 4  
ATOM 7834  H HG22 . THR B 2 71 ? 18.540  -3.991  5.553   1.00 0.00 ? 81 THR B HG22 4  
ATOM 7835  H HG23 . THR B 2 71 ? 16.790  -4.002  5.773   1.00 0.00 ? 81 THR B HG23 4  
ATOM 7836  N N    . LEU B 2 72 ? 15.174  -6.933  4.419   1.00 0.00 ? 82 LEU B N    4  
ATOM 7837  C CA   . LEU B 2 72 ? 13.942  -7.311  5.105   1.00 0.00 ? 82 LEU B CA   4  
ATOM 7838  C C    . LEU B 2 72 ? 14.207  -8.451  6.082   1.00 0.00 ? 82 LEU B C    4  
ATOM 7839  O O    . LEU B 2 72 ? 13.625  -8.508  7.161   1.00 0.00 ? 82 LEU B O    4  
ATOM 7840  C CB   . LEU B 2 72 ? 12.873  -7.747  4.099   1.00 0.00 ? 82 LEU B CB   4  
ATOM 7841  C CG   . LEU B 2 72 ? 12.344  -6.649  3.177   1.00 0.00 ? 82 LEU B CG   4  
ATOM 7842  C CD1  . LEU B 2 72 ? 11.541  -7.262  2.043   1.00 0.00 ? 82 LEU B CD1  4  
ATOM 7843  C CD2  . LEU B 2 72 ? 11.489  -5.659  3.956   1.00 0.00 ? 82 LEU B CD2  4  
ATOM 7844  H H    . LEU B 2 72 ? 15.204  -6.966  3.438   1.00 0.00 ? 82 LEU B H    4  
ATOM 7845  H HA   . LEU B 2 72 ? 13.587  -6.454  5.655   1.00 0.00 ? 82 LEU B HA   4  
ATOM 7846  H HB2  . LEU B 2 72 ? 13.290  -8.532  3.485   1.00 0.00 ? 82 LEU B HB2  4  
ATOM 7847  H HB3  . LEU B 2 72 ? 12.039  -8.154  4.651   1.00 0.00 ? 82 LEU B HB3  4  
ATOM 7848  H HG   . LEU B 2 72 ? 13.178  -6.112  2.748   1.00 0.00 ? 82 LEU B HG   4  
ATOM 7849  H HD11 . LEU B 2 72 ? 11.305  -6.500  1.314   1.00 0.00 ? 82 LEU B HD11 4  
ATOM 7850  H HD12 . LEU B 2 72 ? 10.625  -7.679  2.435   1.00 0.00 ? 82 LEU B HD12 4  
ATOM 7851  H HD13 . LEU B 2 72 ? 12.119  -8.043  1.573   1.00 0.00 ? 82 LEU B HD13 4  
ATOM 7852  H HD21 . LEU B 2 72 ? 12.033  -5.317  4.824   1.00 0.00 ? 82 LEU B HD21 4  
ATOM 7853  H HD22 . LEU B 2 72 ? 10.576  -6.140  4.270   1.00 0.00 ? 82 LEU B HD22 4  
ATOM 7854  H HD23 . LEU B 2 72 ? 11.252  -4.814  3.325   1.00 0.00 ? 82 LEU B HD23 4  
ATOM 7855  N N    . GLN B 2 73 ? 15.098  -9.351  5.690   1.00 0.00 ? 83 GLN B N    4  
ATOM 7856  C CA   . GLN B 2 73 ? 15.448  -10.491 6.522   1.00 0.00 ? 83 GLN B CA   4  
ATOM 7857  C C    . GLN B 2 73 ? 16.437  -10.070 7.602   1.00 0.00 ? 83 GLN B C    4  
ATOM 7858  O O    . GLN B 2 73 ? 16.198  -10.274 8.793   1.00 0.00 ? 83 GLN B O    4  
ATOM 7859  C CB   . GLN B 2 73 ? 16.057  -11.610 5.667   1.00 0.00 ? 83 GLN B CB   4  
ATOM 7860  C CG   . GLN B 2 73 ? 15.376  -11.797 4.318   1.00 0.00 ? 83 GLN B CG   4  
ATOM 7861  C CD   . GLN B 2 73 ? 13.902  -12.137 4.440   1.00 0.00 ? 83 GLN B CD   4  
ATOM 7862  O OE1  . GLN B 2 73 ? 13.483  -12.819 5.372   1.00 0.00 ? 83 GLN B OE1  4  
ATOM 7863  N NE2  . GLN B 2 73 ? 13.105  -11.655 3.498   1.00 0.00 ? 83 GLN B NE2  4  
ATOM 7864  H H    . GLN B 2 73 ? 15.533  -9.241  4.820   1.00 0.00 ? 83 GLN B H    4  
ATOM 7865  H HA   . GLN B 2 73 ? 14.547  -10.853 6.992   1.00 0.00 ? 83 GLN B HA   4  
ATOM 7866  H HB2  . GLN B 2 73 ? 17.099  -11.384 5.490   1.00 0.00 ? 83 GLN B HB2  4  
ATOM 7867  H HB3  . GLN B 2 73 ? 15.988  -12.540 6.212   1.00 0.00 ? 83 GLN B HB3  4  
ATOM 7868  H HG2  . GLN B 2 73 ? 15.471  -10.882 3.753   1.00 0.00 ? 83 GLN B HG2  4  
ATOM 7869  H HG3  . GLN B 2 73 ? 15.872  -12.597 3.789   1.00 0.00 ? 83 GLN B HG3  4  
ATOM 7870  H HE21 . GLN B 2 73 ? 13.507  -11.113 2.784   1.00 0.00 ? 83 GLN B HE21 4  
ATOM 7871  H HE22 . GLN B 2 73 ? 12.148  -11.857 3.554   1.00 0.00 ? 83 GLN B HE22 4  
ATOM 7872  N N    . LEU B 2 74 ? 17.553  -9.489  7.167   1.00 0.00 ? 84 LEU B N    4  
ATOM 7873  C CA   . LEU B 2 74 ? 18.610  -9.028  8.066   1.00 0.00 ? 84 LEU B CA   4  
ATOM 7874  C C    . LEU B 2 74 ? 18.092  -8.116  9.183   1.00 0.00 ? 84 LEU B C    4  
ATOM 7875  O O    . LEU B 2 74 ? 18.316  -8.389  10.360  1.00 0.00 ? 84 LEU B O    4  
ATOM 7876  C CB   . LEU B 2 74 ? 19.683  -8.291  7.260   1.00 0.00 ? 84 LEU B CB   4  
ATOM 7877  C CG   . LEU B 2 74 ? 20.859  -7.754  8.078   1.00 0.00 ? 84 LEU B CG   4  
ATOM 7878  C CD1  . LEU B 2 74 ? 21.769  -8.888  8.521   1.00 0.00 ? 84 LEU B CD1  4  
ATOM 7879  C CD2  . LEU B 2 74 ? 21.636  -6.723  7.274   1.00 0.00 ? 84 LEU B CD2  4  
ATOM 7880  H H    . LEU B 2 74 ? 17.705  -9.412  6.199   1.00 0.00 ? 84 LEU B H    4  
ATOM 7881  H HA   . LEU B 2 74 ? 19.058  -9.899  8.516   1.00 0.00 ? 84 LEU B HA   4  
ATOM 7882  H HB2  . LEU B 2 74 ? 20.070  -8.969  6.514   1.00 0.00 ? 84 LEU B HB2  4  
ATOM 7883  H HB3  . LEU B 2 74 ? 19.215  -7.459  6.757   1.00 0.00 ? 84 LEU B HB3  4  
ATOM 7884  H HG   . LEU B 2 74 ? 20.478  -7.268  8.964   1.00 0.00 ? 84 LEU B HG   4  
ATOM 7885  H HD11 . LEU B 2 74 ? 22.602  -8.485  9.077   1.00 0.00 ? 84 LEU B HD11 4  
ATOM 7886  H HD12 . LEU B 2 74 ? 22.137  -9.416  7.654   1.00 0.00 ? 84 LEU B HD12 4  
ATOM 7887  H HD13 . LEU B 2 74 ? 21.214  -9.570  9.148   1.00 0.00 ? 84 LEU B HD13 4  
ATOM 7888  H HD21 . LEU B 2 74 ? 21.004  -5.870  7.076   1.00 0.00 ? 84 LEU B HD21 4  
ATOM 7889  H HD22 . LEU B 2 74 ? 21.953  -7.161  6.339   1.00 0.00 ? 84 LEU B HD22 4  
ATOM 7890  H HD23 . LEU B 2 74 ? 22.502  -6.407  7.835   1.00 0.00 ? 84 LEU B HD23 4  
ATOM 7891  N N    . SER B 2 75 ? 17.416  -7.035  8.819   1.00 0.00 ? 85 SER B N    4  
ATOM 7892  C CA   . SER B 2 75 ? 16.907  -6.099  9.813   1.00 0.00 ? 85 SER B CA   4  
ATOM 7893  C C    . SER B 2 75 ? 15.644  -6.629  10.489  1.00 0.00 ? 85 SER B C    4  
ATOM 7894  O O    . SER B 2 75 ? 15.419  -6.361  11.672  1.00 0.00 ? 85 SER B O    4  
ATOM 7895  C CB   . SER B 2 75 ? 16.636  -4.738  9.174   1.00 0.00 ? 85 SER B CB   4  
ATOM 7896  O OG   . SER B 2 75 ? 17.793  -4.234  8.523   1.00 0.00 ? 85 SER B OG   4  
ATOM 7897  H H    . SER B 2 75 ? 17.249  -6.863  7.866   1.00 0.00 ? 85 SER B H    4  
ATOM 7898  H HA   . SER B 2 75 ? 17.671  -5.979  10.567  1.00 0.00 ? 85 SER B HA   4  
ATOM 7899  H HB2  . SER B 2 75 ? 15.844  -4.836  8.447   1.00 0.00 ? 85 SER B HB2  4  
ATOM 7900  H HB3  . SER B 2 75 ? 16.336  -4.037  9.939   1.00 0.00 ? 85 SER B HB3  4  
ATOM 7901  H HG   . SER B 2 75 ? 17.535  -3.533  7.916   1.00 0.00 ? 85 SER B HG   4  
ATOM 7902  N N    . LYS B 2 76 ? 14.837  -7.377  9.730   1.00 0.00 ? 86 LYS B N    4  
ATOM 7903  C CA   . LYS B 2 76 ? 13.589  -7.966  10.228  1.00 0.00 ? 86 LYS B CA   4  
ATOM 7904  C C    . LYS B 2 76 ? 12.500  -6.899  10.394  1.00 0.00 ? 86 LYS B C    4  
ATOM 7905  O O    . LYS B 2 76 ? 11.300  -7.258  10.314  1.00 0.00 ? 86 LYS B O    4  
ATOM 7906  C CB   . LYS B 2 76 ? 13.828  -8.724  11.548  1.00 0.00 ? 86 LYS B CB   4  
ATOM 7907  C CG   . LYS B 2 76 ? 12.725  -9.707  11.912  1.00 0.00 ? 86 LYS B CG   4  
ATOM 7908  C CD   . LYS B 2 76 ? 11.694  -9.077  12.837  1.00 0.00 ? 86 LYS B CD   4  
ATOM 7909  C CE   . LYS B 2 76 ? 10.303  -9.627  12.572  1.00 0.00 ? 86 LYS B CE   4  
ATOM 7910  N NZ   . LYS B 2 76 ? 9.942   -9.539  11.132  1.00 0.00 ? 86 LYS B NZ   4  
ATOM 7911  O OXT  . LYS B 2 76 ? 12.842  -5.710  10.584  1.00 0.00 ? 86 LYS B OXT  4  
ATOM 7912  H H    . LYS B 2 76 ? 15.085  -7.535  8.797   1.00 0.00 ? 86 LYS B H    4  
ATOM 7913  H HA   . LYS B 2 76 ? 13.253  -8.673  9.483   1.00 0.00 ? 86 LYS B HA   4  
ATOM 7914  H HB2  . LYS B 2 76 ? 14.754  -9.274  11.468  1.00 0.00 ? 86 LYS B HB2  4  
ATOM 7915  H HB3  . LYS B 2 76 ? 13.917  -8.005  12.348  1.00 0.00 ? 86 LYS B HB3  4  
ATOM 7916  H HG2  . LYS B 2 76 ? 12.231  -10.030 11.008  1.00 0.00 ? 86 LYS B HG2  4  
ATOM 7917  H HG3  . LYS B 2 76 ? 13.165  -10.560 12.407  1.00 0.00 ? 86 LYS B HG3  4  
ATOM 7918  H HD2  . LYS B 2 76 ? 11.965  -9.288  13.860  1.00 0.00 ? 86 LYS B HD2  4  
ATOM 7919  H HD3  . LYS B 2 76 ? 11.686  -8.009  12.676  1.00 0.00 ? 86 LYS B HD3  4  
ATOM 7920  H HE2  . LYS B 2 76 ? 10.272  -10.662 12.879  1.00 0.00 ? 86 LYS B HE2  4  
ATOM 7921  H HE3  . LYS B 2 76 ? 9.589   -9.059  13.149  1.00 0.00 ? 86 LYS B HE3  4  
ATOM 7922  H HZ1  . LYS B 2 76 ? 10.187  -8.594  10.756  1.00 0.00 ? 86 LYS B HZ1  4  
ATOM 7923  H HZ2  . LYS B 2 76 ? 8.920   -9.695  11.009  1.00 0.00 ? 86 LYS B HZ2  4  
ATOM 7924  H HZ3  . LYS B 2 76 ? 10.454  -10.260 10.587  1.00 0.00 ? 86 LYS B HZ3  4  
ATOM 7925  N N    . THR A 1 18 ? -15.093 -6.050  8.815   1.00 0.00 ? 14 THR A N    5  
ATOM 7926  C CA   . THR A 1 18 ? -15.491 -4.631  8.828   1.00 0.00 ? 14 THR A CA   5  
ATOM 7927  C C    . THR A 1 18 ? -14.489 -3.782  8.058   1.00 0.00 ? 14 THR A C    5  
ATOM 7928  O O    . THR A 1 18 ? -13.404 -4.252  7.708   1.00 0.00 ? 14 THR A O    5  
ATOM 7929  C CB   . THR A 1 18 ? -15.594 -4.107  10.271  1.00 0.00 ? 14 THR A CB   5  
ATOM 7930  O OG1  . THR A 1 18 ? -14.432 -4.495  11.011  1.00 0.00 ? 14 THR A OG1  5  
ATOM 7931  C CG2  . THR A 1 18 ? -16.840 -4.646  10.952  1.00 0.00 ? 14 THR A CG2  5  
ATOM 7932  H H    . THR A 1 18 ? -14.709 -6.303  7.884   1.00 0.00 ? 14 THR A H    5  
ATOM 7933  H HA   . THR A 1 18 ? -16.462 -4.542  8.361   1.00 0.00 ? 14 THR A HA   5  
ATOM 7934  H HB   . THR A 1 18 ? -15.653 -3.029  10.244  1.00 0.00 ? 14 THR A HB   5  
ATOM 7935  H HG1  . THR A 1 18 ? -14.701 -4.854  11.868  1.00 0.00 ? 14 THR A HG1  5  
ATOM 7936  H HG21 . THR A 1 18 ? -17.717 -4.309  10.418  1.00 0.00 ? 14 THR A HG21 5  
ATOM 7937  H HG22 . THR A 1 18 ? -16.877 -4.287  11.969  1.00 0.00 ? 14 THR A HG22 5  
ATOM 7938  H HG23 . THR A 1 18 ? -16.813 -5.725  10.952  1.00 0.00 ? 14 THR A HG23 5  
ATOM 7939  N N    . VAL A 1 19 ? -14.863 -2.533  7.797   1.00 0.00 ? 15 VAL A N    5  
ATOM 7940  C CA   . VAL A 1 19 ? -14.009 -1.604  7.066   1.00 0.00 ? 15 VAL A CA   5  
ATOM 7941  C C    . VAL A 1 19 ? -12.687 -1.391  7.799   1.00 0.00 ? 15 VAL A C    5  
ATOM 7942  O O    . VAL A 1 19 ? -11.623 -1.368  7.183   1.00 0.00 ? 15 VAL A O    5  
ATOM 7943  C CB   . VAL A 1 19 ? -14.704 -0.241  6.857   1.00 0.00 ? 15 VAL A CB   5  
ATOM 7944  C CG1  . VAL A 1 19 ? -13.818 0.710   6.066   1.00 0.00 ? 15 VAL A CG1  5  
ATOM 7945  C CG2  . VAL A 1 19 ? -16.038 -0.428  6.156   1.00 0.00 ? 15 VAL A CG2  5  
ATOM 7946  H H    . VAL A 1 19 ? -15.747 -2.238  8.111   1.00 0.00 ? 15 VAL A H    5  
ATOM 7947  H HA   . VAL A 1 19 ? -13.805 -2.034  6.095   1.00 0.00 ? 15 VAL A HA   5  
ATOM 7948  H HB   . VAL A 1 19 ? -14.890 0.197   7.826   1.00 0.00 ? 15 VAL A HB   5  
ATOM 7949  H HG11 . VAL A 1 19 ? -12.879 0.841   6.584   1.00 0.00 ? 15 VAL A HG11 5  
ATOM 7950  H HG12 . VAL A 1 19 ? -14.313 1.665   5.970   1.00 0.00 ? 15 VAL A HG12 5  
ATOM 7951  H HG13 . VAL A 1 19 ? -13.634 0.299   5.085   1.00 0.00 ? 15 VAL A HG13 5  
ATOM 7952  H HG21 . VAL A 1 19 ? -16.646 -1.121  6.716   1.00 0.00 ? 15 VAL A HG21 5  
ATOM 7953  H HG22 . VAL A 1 19 ? -15.871 -0.818  5.163   1.00 0.00 ? 15 VAL A HG22 5  
ATOM 7954  H HG23 . VAL A 1 19 ? -16.546 0.523   6.088   1.00 0.00 ? 15 VAL A HG23 5  
ATOM 7955  N N    . SER A 1 20 ? -12.769 -1.261  9.117   1.00 0.00 ? 16 SER A N    5  
ATOM 7956  C CA   . SER A 1 20 ? -11.595 -1.052  9.951   1.00 0.00 ? 16 SER A CA   5  
ATOM 7957  C C    . SER A 1 20 ? -10.575 -2.176  9.765   1.00 0.00 ? 16 SER A C    5  
ATOM 7958  O O    . SER A 1 20 ? -9.406  -1.915  9.477   1.00 0.00 ? 16 SER A O    5  
ATOM 7959  C CB   . SER A 1 20 ? -12.036 -0.958  11.410  1.00 0.00 ? 16 SER A CB   5  
ATOM 7960  O OG   . SER A 1 20 ? -13.444 -1.122  11.509  1.00 0.00 ? 16 SER A OG   5  
ATOM 7961  H H    . SER A 1 20 ? -13.649 -1.305  9.550   1.00 0.00 ? 16 SER A H    5  
ATOM 7962  H HA   . SER A 1 20 ? -11.143 -0.115  9.660   1.00 0.00 ? 16 SER A HA   5  
ATOM 7963  H HB2  . SER A 1 20 ? -11.551 -1.735  11.984  1.00 0.00 ? 16 SER A HB2  5  
ATOM 7964  H HB3  . SER A 1 20 ? -11.768 0.009   11.808  1.00 0.00 ? 16 SER A HB3  5  
ATOM 7965  H HG   . SER A 1 20 ? -13.656 -1.563  12.343  1.00 0.00 ? 16 SER A HG   5  
ATOM 7966  N N    . GLU A 1 21 ? -11.035 -3.423  9.898   1.00 0.00 ? 17 GLU A N    5  
ATOM 7967  C CA   . GLU A 1 21 ? -10.167 -4.595  9.747   1.00 0.00 ? 17 GLU A CA   5  
ATOM 7968  C C    . GLU A 1 21 ? -9.516  -4.625  8.370   1.00 0.00 ? 17 GLU A C    5  
ATOM 7969  O O    . GLU A 1 21 ? -8.358  -5.007  8.228   1.00 0.00 ? 17 GLU A O    5  
ATOM 7970  C CB   . GLU A 1 21 ? -10.965 -5.889  9.911   1.00 0.00 ? 17 GLU A CB   5  
ATOM 7971  C CG   . GLU A 1 21 ? -11.644 -6.062  11.254  1.00 0.00 ? 17 GLU A CG   5  
ATOM 7972  C CD   . GLU A 1 21 ? -12.501 -7.310  11.282  1.00 0.00 ? 17 GLU A CD   5  
ATOM 7973  O OE1  . GLU A 1 21 ? -13.526 -7.344  10.571  1.00 0.00 ? 17 GLU A OE1  5  
ATOM 7974  O OE2  . GLU A 1 21 ? -12.142 -8.272  11.992  1.00 0.00 ? 17 GLU A OE2  5  
ATOM 7975  H H    . GLU A 1 21 ? -11.983 -3.559  10.105  1.00 0.00 ? 17 GLU A H    5  
ATOM 7976  H HA   . GLU A 1 21 ? -9.401  -4.551  10.504  1.00 0.00 ? 17 GLU A HA   5  
ATOM 7977  H HB2  . GLU A 1 21 ? -11.728 -5.920  9.148   1.00 0.00 ? 17 GLU A HB2  5  
ATOM 7978  H HB3  . GLU A 1 21 ? -10.295 -6.724  9.763   1.00 0.00 ? 17 GLU A HB3  5  
ATOM 7979  H HG2  . GLU A 1 21 ? -10.890 -6.138  12.024  1.00 0.00 ? 17 GLU A HG2  5  
ATOM 7980  H HG3  . GLU A 1 21 ? -12.272 -5.205  11.443  1.00 0.00 ? 17 GLU A HG3  5  
ATOM 7981  N N    . TRP A 1 22 ? -10.284 -4.233  7.364   1.00 0.00 ? 18 TRP A N    5  
ATOM 7982  C CA   . TRP A 1 22 ? -9.827  -4.233  5.982   1.00 0.00 ? 18 TRP A CA   5  
ATOM 7983  C C    . TRP A 1 22 ? -8.807  -3.124  5.705   1.00 0.00 ? 18 TRP A C    5  
ATOM 7984  O O    . TRP A 1 22 ? -7.751  -3.369  5.118   1.00 0.00 ? 18 TRP A O    5  
ATOM 7985  C CB   . TRP A 1 22 ? -11.038 -4.083  5.056   1.00 0.00 ? 18 TRP A CB   5  
ATOM 7986  C CG   . TRP A 1 22 ? -10.706 -4.181  3.603   1.00 0.00 ? 18 TRP A CG   5  
ATOM 7987  C CD1  . TRP A 1 22 ? -10.293 -5.295  2.932   1.00 0.00 ? 18 TRP A CD1  5  
ATOM 7988  C CD2  . TRP A 1 22 ? -10.766 -3.126  2.638   1.00 0.00 ? 18 TRP A CD2  5  
ATOM 7989  N NE1  . TRP A 1 22 ? -10.091 -4.995  1.607   1.00 0.00 ? 18 TRP A NE1  5  
ATOM 7990  C CE2  . TRP A 1 22 ? -10.374 -3.670  1.403   1.00 0.00 ? 18 TRP A CE2  5  
ATOM 7991  C CE3  . TRP A 1 22 ? -11.114 -1.773  2.701   1.00 0.00 ? 18 TRP A CE3  5  
ATOM 7992  C CZ2  . TRP A 1 22 ? -10.320 -2.908  0.241   1.00 0.00 ? 18 TRP A CZ2  5  
ATOM 7993  C CZ3  . TRP A 1 22 ? -11.058 -1.019  1.546   1.00 0.00 ? 18 TRP A CZ3  5  
ATOM 7994  C CH2  . TRP A 1 22 ? -10.665 -1.589  0.329   1.00 0.00 ? 18 TRP A CH2  5  
ATOM 7995  H H    . TRP A 1 22 ? -11.199 -3.934  7.560   1.00 0.00 ? 18 TRP A H    5  
ATOM 7996  H HA   . TRP A 1 22 ? -9.361  -5.187  5.789   1.00 0.00 ? 18 TRP A HA   5  
ATOM 7997  H HB2  . TRP A 1 22 ? -11.753 -4.860  5.284   1.00 0.00 ? 18 TRP A HB2  5  
ATOM 7998  H HB3  . TRP A 1 22 ? -11.497 -3.120  5.230   1.00 0.00 ? 18 TRP A HB3  5  
ATOM 7999  H HD1  . TRP A 1 22 ? -10.150 -6.263  3.388   1.00 0.00 ? 18 TRP A HD1  5  
ATOM 8000  H HE1  . TRP A 1 22 ? -9.795  -5.629  0.920   1.00 0.00 ? 18 TRP A HE1  5  
ATOM 8001  H HE3  . TRP A 1 22 ? -11.421 -1.318  3.631   1.00 0.00 ? 18 TRP A HE3  5  
ATOM 8002  H HZ2  . TRP A 1 22 ? -10.018 -3.334  -0.706  1.00 0.00 ? 18 TRP A HZ2  5  
ATOM 8003  H HZ3  . TRP A 1 22 ? -11.323 0.028   1.573   1.00 0.00 ? 18 TRP A HZ3  5  
ATOM 8004  H HH2  . TRP A 1 22 ? -10.636 -0.962  -0.548  1.00 0.00 ? 18 TRP A HH2  5  
ATOM 8005  N N    . LEU A 1 23 ? -9.119  -1.915  6.138   1.00 0.00 ? 19 LEU A N    5  
ATOM 8006  C CA   . LEU A 1 23 ? -8.243  -0.771  5.902   1.00 0.00 ? 19 LEU A CA   5  
ATOM 8007  C C    . LEU A 1 23 ? -6.968  -0.813  6.746   1.00 0.00 ? 19 LEU A C    5  
ATOM 8008  O O    . LEU A 1 23 ? -5.944  -0.250  6.347   1.00 0.00 ? 19 LEU A O    5  
ATOM 8009  C CB   . LEU A 1 23 ? -8.992  0.541   6.144   1.00 0.00 ? 19 LEU A CB   5  
ATOM 8010  C CG   . LEU A 1 23 ? -9.842  1.027   4.966   1.00 0.00 ? 19 LEU A CG   5  
ATOM 8011  C CD1  . LEU A 1 23 ? -10.587 2.297   5.334   1.00 0.00 ? 19 LEU A CD1  5  
ATOM 8012  C CD2  . LEU A 1 23 ? -8.974  1.259   3.737   1.00 0.00 ? 19 LEU A CD2  5  
ATOM 8013  H H    . LEU A 1 23 ? -9.966  -1.787  6.625   1.00 0.00 ? 19 LEU A H    5  
ATOM 8014  H HA   . LEU A 1 23 ? -7.955  -0.807  4.863   1.00 0.00 ? 19 LEU A HA   5  
ATOM 8015  H HB2  . LEU A 1 23 ? -9.640  0.409   6.998   1.00 0.00 ? 19 LEU A HB2  5  
ATOM 8016  H HB3  . LEU A 1 23 ? -8.268  1.306   6.376   1.00 0.00 ? 19 LEU A HB3  5  
ATOM 8017  H HG   . LEU A 1 23 ? -10.573 0.272   4.722   1.00 0.00 ? 19 LEU A HG   5  
ATOM 8018  H HD11 . LEU A 1 23 ? -11.232 2.586   4.517   1.00 0.00 ? 19 LEU A HD11 5  
ATOM 8019  H HD12 . LEU A 1 23 ? -9.878  3.088   5.529   1.00 0.00 ? 19 LEU A HD12 5  
ATOM 8020  H HD13 . LEU A 1 23 ? -11.182 2.122   6.218   1.00 0.00 ? 19 LEU A HD13 5  
ATOM 8021  H HD21 . LEU A 1 23 ? -8.570  0.318   3.398   1.00 0.00 ? 19 LEU A HD21 5  
ATOM 8022  H HD22 . LEU A 1 23 ? -8.165  1.929   3.988   1.00 0.00 ? 19 LEU A HD22 5  
ATOM 8023  H HD23 . LEU A 1 23 ? -9.572  1.698   2.951   1.00 0.00 ? 19 LEU A HD23 5  
ATOM 8024  N N    . GLU A 1 24 ? -7.009  -1.474  7.901   1.00 0.00 ? 20 GLU A N    5  
ATOM 8025  C CA   . GLU A 1 24 ? -5.830  -1.547  8.764   1.00 0.00 ? 20 GLU A CA   5  
ATOM 8026  C C    . GLU A 1 24 ? -4.794  -2.523  8.208   1.00 0.00 ? 20 GLU A C    5  
ATOM 8027  O O    . GLU A 1 24 ? -3.595  -2.272  8.313   1.00 0.00 ? 20 GLU A O    5  
ATOM 8028  C CB   . GLU A 1 24 ? -6.209  -1.928  10.202  1.00 0.00 ? 20 GLU A CB   5  
ATOM 8029  C CG   . GLU A 1 24 ? -6.762  -3.329  10.340  1.00 0.00 ? 20 GLU A CG   5  
ATOM 8030  C CD   . GLU A 1 24 ? -6.776  -3.808  11.772  1.00 0.00 ? 20 GLU A CD   5  
ATOM 8031  O OE1  . GLU A 1 24 ? -7.450  -3.176  12.608  1.00 0.00 ? 20 GLU A OE1  5  
ATOM 8032  O OE2  . GLU A 1 24 ? -6.104  -4.818  12.066  1.00 0.00 ? 20 GLU A OE2  5  
ATOM 8033  H H    . GLU A 1 24 ? -7.840  -1.918  8.182   1.00 0.00 ? 20 GLU A H    5  
ATOM 8034  H HA   . GLU A 1 24 ? -5.384  -0.564  8.779   1.00 0.00 ? 20 GLU A HA   5  
ATOM 8035  H HB2  . GLU A 1 24 ? -5.331  -1.852  10.827  1.00 0.00 ? 20 GLU A HB2  5  
ATOM 8036  H HB3  . GLU A 1 24 ? -6.955  -1.234  10.563  1.00 0.00 ? 20 GLU A HB3  5  
ATOM 8037  H HG2  . GLU A 1 24 ? -7.773  -3.339  9.961   1.00 0.00 ? 20 GLU A HG2  5  
ATOM 8038  H HG3  . GLU A 1 24 ? -6.153  -4.000  9.755   1.00 0.00 ? 20 GLU A HG3  5  
ATOM 8039  N N    . SER A 1 25 ? -5.251  -3.619  7.602   1.00 0.00 ? 21 SER A N    5  
ATOM 8040  C CA   . SER A 1 25 ? -4.344  -4.614  7.038   1.00 0.00 ? 21 SER A CA   5  
ATOM 8041  C C    . SER A 1 25 ? -3.426  -4.011  5.981   1.00 0.00 ? 21 SER A C    5  
ATOM 8042  O O    . SER A 1 25 ? -2.277  -4.429  5.838   1.00 0.00 ? 21 SER A O    5  
ATOM 8043  C CB   . SER A 1 25 ? -5.130  -5.770  6.432   1.00 0.00 ? 21 SER A CB   5  
ATOM 8044  O OG   . SER A 1 25 ? -6.506  -5.448  6.298   1.00 0.00 ? 21 SER A OG   5  
ATOM 8045  H H    . SER A 1 25 ? -6.219  -3.782  7.562   1.00 0.00 ? 21 SER A H    5  
ATOM 8046  H HA   . SER A 1 25 ? -3.736  -4.994  7.844   1.00 0.00 ? 21 SER A HA   5  
ATOM 8047  H HB2  . SER A 1 25 ? -4.728  -5.998  5.457   1.00 0.00 ? 21 SER A HB2  5  
ATOM 8048  H HB3  . SER A 1 25 ? -5.036  -6.636  7.071   1.00 0.00 ? 21 SER A HB3  5  
ATOM 8049  H HG   . SER A 1 25 ? -6.631  -4.828  5.566   1.00 0.00 ? 21 SER A HG   5  
ATOM 8050  N N    . ILE A 1 26 ? -3.924  -3.023  5.245   1.00 0.00 ? 22 ILE A N    5  
ATOM 8051  C CA   . ILE A 1 26 ? -3.128  -2.381  4.213   1.00 0.00 ? 22 ILE A CA   5  
ATOM 8052  C C    . ILE A 1 26 ? -2.482  -1.106  4.734   1.00 0.00 ? 22 ILE A C    5  
ATOM 8053  O O    . ILE A 1 26 ? -1.765  -0.428  3.999   1.00 0.00 ? 22 ILE A O    5  
ATOM 8054  C CB   . ILE A 1 26 ? -3.957  -2.051  2.955   1.00 0.00 ? 22 ILE A CB   5  
ATOM 8055  C CG1  . ILE A 1 26 ? -5.423  -1.789  3.316   1.00 0.00 ? 22 ILE A CG1  5  
ATOM 8056  C CG2  . ILE A 1 26 ? -3.844  -3.183  1.947   1.00 0.00 ? 22 ILE A CG2  5  
ATOM 8057  C CD1  . ILE A 1 26 ? -6.252  -1.281  2.156   1.00 0.00 ? 22 ILE A CD1  5  
ATOM 8058  H H    . ILE A 1 26 ? -4.832  -2.695  5.409   1.00 0.00 ? 22 ILE A H    5  
ATOM 8059  H HA   . ILE A 1 26 ? -2.345  -3.068  3.929   1.00 0.00 ? 22 ILE A HA   5  
ATOM 8060  H HB   . ILE A 1 26 ? -3.541  -1.162  2.504   1.00 0.00 ? 22 ILE A HB   5  
ATOM 8061  H HG12 . ILE A 1 26 ? -5.871  -2.709  3.664   1.00 0.00 ? 22 ILE A HG12 5  
ATOM 8062  H HG13 . ILE A 1 26 ? -5.466  -1.052  4.105   1.00 0.00 ? 22 ILE A HG13 5  
ATOM 8063  H HG21 . ILE A 1 26 ? -4.179  -4.103  2.400   1.00 0.00 ? 22 ILE A HG21 5  
ATOM 8064  H HG22 . ILE A 1 26 ? -2.816  -3.287  1.637   1.00 0.00 ? 22 ILE A HG22 5  
ATOM 8065  H HG23 . ILE A 1 26 ? -4.458  -2.960  1.086   1.00 0.00 ? 22 ILE A HG23 5  
ATOM 8066  H HD11 . ILE A 1 26 ? -5.966  -0.265  1.925   1.00 0.00 ? 22 ILE A HD11 5  
ATOM 8067  H HD12 . ILE A 1 26 ? -7.299  -1.309  2.422   1.00 0.00 ? 22 ILE A HD12 5  
ATOM 8068  H HD13 . ILE A 1 26 ? -6.082  -1.906  1.293   1.00 0.00 ? 22 ILE A HD13 5  
ATOM 8069  N N    . LYS A 1 27 ? -2.766  -0.777  5.997   1.00 0.00 ? 23 LYS A N    5  
ATOM 8070  C CA   . LYS A 1 27 ? -2.202  0.405   6.644   1.00 0.00 ? 23 LYS A CA   5  
ATOM 8071  C C    . LYS A 1 27 ? -2.734  1.700   6.031   1.00 0.00 ? 23 LYS A C    5  
ATOM 8072  O O    . LYS A 1 27 ? -2.040  2.711   5.997   1.00 0.00 ? 23 LYS A O    5  
ATOM 8073  C CB   . LYS A 1 27 ? -0.674  0.373   6.572   1.00 0.00 ? 23 LYS A CB   5  
ATOM 8074  C CG   . LYS A 1 27 ? -0.025  -0.100  7.854   1.00 0.00 ? 23 LYS A CG   5  
ATOM 8075  C CD   . LYS A 1 27 ? 0.330   1.075   8.744   1.00 0.00 ? 23 LYS A CD   5  
ATOM 8076  C CE   . LYS A 1 27 ? 1.145   0.632   9.942   1.00 0.00 ? 23 LYS A CE   5  
ATOM 8077  N NZ   . LYS A 1 27 ? 2.347   -0.137  9.530   1.00 0.00 ? 23 LYS A NZ   5  
ATOM 8078  H H    . LYS A 1 27 ? -3.389  -1.344  6.503   1.00 0.00 ? 23 LYS A H    5  
ATOM 8079  H HA   . LYS A 1 27 ? -2.497  0.377   7.683   1.00 0.00 ? 23 LYS A HA   5  
ATOM 8080  H HB2  . LYS A 1 27 ? -0.377  -0.293  5.772   1.00 0.00 ? 23 LYS A HB2  5  
ATOM 8081  H HB3  . LYS A 1 27 ? -0.313  1.367   6.354   1.00 0.00 ? 23 LYS A HB3  5  
ATOM 8082  H HG2  . LYS A 1 27 ? -0.713  -0.745  8.381   1.00 0.00 ? 23 LYS A HG2  5  
ATOM 8083  H HG3  . LYS A 1 27 ? 0.874   -0.648  7.615   1.00 0.00 ? 23 LYS A HG3  5  
ATOM 8084  H HD2  . LYS A 1 27 ? 0.908   1.785   8.172   1.00 0.00 ? 23 LYS A HD2  5  
ATOM 8085  H HD3  . LYS A 1 27 ? -0.580  1.541   9.090   1.00 0.00 ? 23 LYS A HD3  5  
ATOM 8086  H HE2  . LYS A 1 27 ? 1.458   1.508   10.492  1.00 0.00 ? 23 LYS A HE2  5  
ATOM 8087  H HE3  . LYS A 1 27 ? 0.528   0.010   10.573  1.00 0.00 ? 23 LYS A HE3  5  
ATOM 8088  H HZ1  . LYS A 1 27 ? 2.740   0.256   8.652   1.00 0.00 ? 23 LYS A HZ1  5  
ATOM 8089  H HZ2  . LYS A 1 27 ? 2.094   -1.140  9.368   1.00 0.00 ? 23 LYS A HZ2  5  
ATOM 8090  H HZ3  . LYS A 1 27 ? 3.072   -0.093  10.274  1.00 0.00 ? 23 LYS A HZ3  5  
ATOM 8091  N N    . MET A 1 28 ? -3.984  1.671   5.601   1.00 0.00 ? 24 MET A N    5  
ATOM 8092  C CA   . MET A 1 28 ? -4.619  2.838   4.995   1.00 0.00 ? 24 MET A CA   5  
ATOM 8093  C C    . MET A 1 28 ? -5.794  3.260   5.864   1.00 0.00 ? 24 MET A C    5  
ATOM 8094  O O    . MET A 1 28 ? -6.742  3.899   5.402   1.00 0.00 ? 24 MET A O    5  
ATOM 8095  C CB   . MET A 1 28 ? -5.102  2.504   3.581   1.00 0.00 ? 24 MET A CB   5  
ATOM 8096  C CG   . MET A 1 28 ? -4.023  1.921   2.683   1.00 0.00 ? 24 MET A CG   5  
ATOM 8097  S SD   . MET A 1 28 ? -2.967  3.186   1.957   1.00 0.00 ? 24 MET A SD   5  
ATOM 8098  C CE   . MET A 1 28 ? -1.371  2.729   2.631   1.00 0.00 ? 24 MET A CE   5  
ATOM 8099  H H    . MET A 1 28 ? -4.524  0.860   5.715   1.00 0.00 ? 24 MET A H    5  
ATOM 8100  H HA   . MET A 1 28 ? -3.892  3.639   4.954   1.00 0.00 ? 24 MET A HA   5  
ATOM 8101  H HB2  . MET A 1 28 ? -5.907  1.788   3.650   1.00 0.00 ? 24 MET A HB2  5  
ATOM 8102  H HB3  . MET A 1 28 ? -5.475  3.406   3.116   1.00 0.00 ? 24 MET A HB3  5  
ATOM 8103  H HG2  . MET A 1 28 ? -3.410  1.252   3.270   1.00 0.00 ? 24 MET A HG2  5  
ATOM 8104  H HG3  . MET A 1 28 ? -4.495  1.365   1.886   1.00 0.00 ? 24 MET A HG3  5  
ATOM 8105  H HE1  . MET A 1 28 ? -1.401  2.797   3.708   1.00 0.00 ? 24 MET A HE1  5  
ATOM 8106  H HE2  . MET A 1 28 ? -0.615  3.400   2.249   1.00 0.00 ? 24 MET A HE2  5  
ATOM 8107  H HE3  . MET A 1 28 ? -1.134  1.716   2.340   1.00 0.00 ? 24 MET A HE3  5  
ATOM 8108  N N    . GLN A 1 29 ? -5.709  2.892   7.138   1.00 0.00 ? 25 GLN A N    5  
ATOM 8109  C CA   . GLN A 1 29 ? -6.757  3.181   8.110   1.00 0.00 ? 25 GLN A CA   5  
ATOM 8110  C C    . GLN A 1 29 ? -7.018  4.675   8.282   1.00 0.00 ? 25 GLN A C    5  
ATOM 8111  O O    . GLN A 1 29 ? -8.082  5.063   8.762   1.00 0.00 ? 25 GLN A O    5  
ATOM 8112  C CB   . GLN A 1 29 ? -6.420  2.550   9.464   1.00 0.00 ? 25 GLN A CB   5  
ATOM 8113  C CG   . GLN A 1 29 ? -5.067  2.963   10.022  1.00 0.00 ? 25 GLN A CG   5  
ATOM 8114  C CD   . GLN A 1 29 ? -4.984  2.819   11.532  1.00 0.00 ? 25 GLN A CD   5  
ATOM 8115  O OE1  . GLN A 1 29 ? -4.224  3.526   12.191  1.00 0.00 ? 25 GLN A OE1  5  
ATOM 8116  N NE2  . GLN A 1 29 ? -5.768  1.909   12.091  1.00 0.00 ? 25 GLN A NE2  5  
ATOM 8117  H H    . GLN A 1 29 ? -4.913  2.405   7.433   1.00 0.00 ? 25 GLN A H    5  
ATOM 8118  H HA   . GLN A 1 29 ? -7.663  2.725   7.746   1.00 0.00 ? 25 GLN A HA   5  
ATOM 8119  H HB2  . GLN A 1 29 ? -7.179  2.832   10.177  1.00 0.00 ? 25 GLN A HB2  5  
ATOM 8120  H HB3  . GLN A 1 29 ? -6.425  1.475   9.356   1.00 0.00 ? 25 GLN A HB3  5  
ATOM 8121  H HG2  . GLN A 1 29 ? -4.305  2.342   9.576   1.00 0.00 ? 25 GLN A HG2  5  
ATOM 8122  H HG3  . GLN A 1 29 ? -4.884  3.997   9.764   1.00 0.00 ? 25 GLN A HG3  5  
ATOM 8123  H HE21 . GLN A 1 29 ? -6.355  1.378   11.512  1.00 0.00 ? 25 GLN A HE21 5  
ATOM 8124  H HE22 . GLN A 1 29 ? -5.734  1.805   13.066  1.00 0.00 ? 25 GLN A HE22 5  
ATOM 8125  N N    . GLN A 1 30 ? -6.075  5.530   7.900   1.00 0.00 ? 26 GLN A N    5  
ATOM 8126  C CA   . GLN A 1 30 ? -6.261  6.963   8.031   1.00 0.00 ? 26 GLN A CA   5  
ATOM 8127  C C    . GLN A 1 30 ? -7.155  7.527   6.924   1.00 0.00 ? 26 GLN A C    5  
ATOM 8128  O O    . GLN A 1 30 ? -7.370  8.734   6.854   1.00 0.00 ? 26 GLN A O    5  
ATOM 8129  C CB   . GLN A 1 30 ? -4.894  7.670   8.022   1.00 0.00 ? 26 GLN A CB   5  
ATOM 8130  C CG   . GLN A 1 30 ? -4.037  7.417   6.778   1.00 0.00 ? 26 GLN A CG   5  
ATOM 8131  C CD   . GLN A 1 30 ? -3.131  6.196   6.898   1.00 0.00 ? 26 GLN A CD   5  
ATOM 8132  O OE1  . GLN A 1 30 ? -3.472  5.214   7.558   1.00 0.00 ? 26 GLN A OE1  5  
ATOM 8133  N NE2  . GLN A 1 30 ? -1.967  6.254   6.266   1.00 0.00 ? 26 GLN A NE2  5  
ATOM 8134  H H    . GLN A 1 30 ? -5.200  5.231   7.555   1.00 0.00 ? 26 GLN A H    5  
ATOM 8135  H HA   . GLN A 1 30 ? -6.736  7.145   8.983   1.00 0.00 ? 26 GLN A HA   5  
ATOM 8136  H HB2  . GLN A 1 30 ? -5.059  8.732   8.098   1.00 0.00 ? 26 GLN A HB2  5  
ATOM 8137  H HB3  . GLN A 1 30 ? -4.333  7.343   8.885   1.00 0.00 ? 26 GLN A HB3  5  
ATOM 8138  H HG2  . GLN A 1 30 ? -4.690  7.272   5.930   1.00 0.00 ? 26 GLN A HG2  5  
ATOM 8139  H HG3  . GLN A 1 30 ? -3.417  8.287   6.605   1.00 0.00 ? 26 GLN A HG3  5  
ATOM 8140  H HE21 . GLN A 1 30 ? -1.750  7.069   5.766   1.00 0.00 ? 26 GLN A HE21 5  
ATOM 8141  H HE22 . GLN A 1 30 ? -1.367  5.472   6.308   1.00 0.00 ? 26 GLN A HE22 5  
ATOM 8142  N N    . TYR A 1 31 ? -7.670  6.661   6.059   1.00 0.00 ? 27 TYR A N    5  
ATOM 8143  C CA   . TYR A 1 31 ? -8.536  7.102   4.969   1.00 0.00 ? 27 TYR A CA   5  
ATOM 8144  C C    . TYR A 1 31 ? -9.991  6.735   5.234   1.00 0.00 ? 27 TYR A C    5  
ATOM 8145  O O    . TYR A 1 31 ? -10.881 7.095   4.461   1.00 0.00 ? 27 TYR A O    5  
ATOM 8146  C CB   . TYR A 1 31 ? -8.067  6.506   3.639   1.00 0.00 ? 27 TYR A CB   5  
ATOM 8147  C CG   . TYR A 1 31 ? -6.748  7.078   3.166   1.00 0.00 ? 27 TYR A CG   5  
ATOM 8148  C CD1  . TYR A 1 31 ? -6.711  8.242   2.406   1.00 0.00 ? 27 TYR A CD1  5  
ATOM 8149  C CD2  . TYR A 1 31 ? -5.541  6.472   3.494   1.00 0.00 ? 27 TYR A CD2  5  
ATOM 8150  C CE1  . TYR A 1 31 ? -5.510  8.781   1.986   1.00 0.00 ? 27 TYR A CE1  5  
ATOM 8151  C CE2  . TYR A 1 31 ? -4.338  7.006   3.075   1.00 0.00 ? 27 TYR A CE2  5  
ATOM 8152  C CZ   . TYR A 1 31 ? -4.328  8.159   2.324   1.00 0.00 ? 27 TYR A CZ   5  
ATOM 8153  O OH   . TYR A 1 31 ? -3.133  8.694   1.914   1.00 0.00 ? 27 TYR A OH   5  
ATOM 8154  H H    . TYR A 1 31 ? -7.450  5.707   6.144   1.00 0.00 ? 27 TYR A H    5  
ATOM 8155  H HA   . TYR A 1 31 ? -8.461  8.178   4.910   1.00 0.00 ? 27 TYR A HA   5  
ATOM 8156  H HB2  . TYR A 1 31 ? -7.952  5.437   3.750   1.00 0.00 ? 27 TYR A HB2  5  
ATOM 8157  H HB3  . TYR A 1 31 ? -8.811  6.707   2.881   1.00 0.00 ? 27 TYR A HB3  5  
ATOM 8158  H HD1  . TYR A 1 31 ? -7.638  8.726   2.140   1.00 0.00 ? 27 TYR A HD1  5  
ATOM 8159  H HD2  . TYR A 1 31 ? -5.549  5.566   4.081   1.00 0.00 ? 27 TYR A HD2  5  
ATOM 8160  H HE1  . TYR A 1 31 ? -5.500  9.687   1.397   1.00 0.00 ? 27 TYR A HE1  5  
ATOM 8161  H HE2  . TYR A 1 31 ? -3.410  6.521   3.341   1.00 0.00 ? 27 TYR A HE2  5  
ATOM 8162  H HH   . TYR A 1 31 ? -2.444  8.023   1.986   1.00 0.00 ? 27 TYR A HH   5  
ATOM 8163  N N    . THR A 1 32 ? -10.230 6.041   6.343   1.00 0.00 ? 28 THR A N    5  
ATOM 8164  C CA   . THR A 1 32 ? -11.579 5.632   6.725   1.00 0.00 ? 28 THR A CA   5  
ATOM 8165  C C    . THR A 1 32 ? -12.504 6.850   6.854   1.00 0.00 ? 28 THR A C    5  
ATOM 8166  O O    . THR A 1 32 ? -13.708 6.765   6.605   1.00 0.00 ? 28 THR A O    5  
ATOM 8167  C CB   . THR A 1 32 ? -11.548 4.863   8.059   1.00 0.00 ? 28 THR A CB   5  
ATOM 8168  O OG1  . THR A 1 32 ? -10.402 4.003   8.085   1.00 0.00 ? 28 THR A OG1  5  
ATOM 8169  C CG2  . THR A 1 32 ? -12.814 4.039   8.251   1.00 0.00 ? 28 THR A CG2  5  
ATOM 8170  H H    . THR A 1 32 ? -9.478  5.788   6.917   1.00 0.00 ? 28 THR A H    5  
ATOM 8171  H HA   . THR A 1 32 ? -11.962 4.974   5.958   1.00 0.00 ? 28 THR A HA   5  
ATOM 8172  H HB   . THR A 1 32 ? -11.472 5.576   8.868   1.00 0.00 ? 28 THR A HB   5  
ATOM 8173  H HG1  . THR A 1 32 ? -9.739  4.366   8.690   1.00 0.00 ? 28 THR A HG1  5  
ATOM 8174  H HG21 . THR A 1 32 ? -12.891 3.305   7.462   1.00 0.00 ? 28 THR A HG21 5  
ATOM 8175  H HG22 . THR A 1 32 ? -13.674 4.691   8.219   1.00 0.00 ? 28 THR A HG22 5  
ATOM 8176  H HG23 . THR A 1 32 ? -12.777 3.539   9.207   1.00 0.00 ? 28 THR A HG23 5  
ATOM 8177  N N    . GLU A 1 33 ? -11.909 7.983   7.220   1.00 0.00 ? 29 GLU A N    5  
ATOM 8178  C CA   . GLU A 1 33 ? -12.636 9.242   7.378   1.00 0.00 ? 29 GLU A CA   5  
ATOM 8179  C C    . GLU A 1 33 ? -13.339 9.613   6.076   1.00 0.00 ? 29 GLU A C    5  
ATOM 8180  O O    . GLU A 1 33 ? -14.528 9.934   6.062   1.00 0.00 ? 29 GLU A O    5  
ATOM 8181  C CB   . GLU A 1 33 ? -11.675 10.372  7.766   1.00 0.00 ? 29 GLU A CB   5  
ATOM 8182  C CG   . GLU A 1 33 ? -10.625 9.977   8.790   1.00 0.00 ? 29 GLU A CG   5  
ATOM 8183  C CD   . GLU A 1 33 ? -9.521  11.010  8.899   1.00 0.00 ? 29 GLU A CD   5  
ATOM 8184  O OE1  . GLU A 1 33 ? -9.043  11.490  7.847   1.00 0.00 ? 29 GLU A OE1  5  
ATOM 8185  O OE2  . GLU A 1 33 ? -9.127  11.350  10.032  1.00 0.00 ? 29 GLU A OE2  5  
ATOM 8186  H H    . GLU A 1 33 ? -10.949 7.958   7.392   1.00 0.00 ? 29 GLU A H    5  
ATOM 8187  H HA   . GLU A 1 33 ? -13.371 9.117   8.160   1.00 0.00 ? 29 GLU A HA   5  
ATOM 8188  H HB2  . GLU A 1 33 ? -11.164 10.709  6.878   1.00 0.00 ? 29 GLU A HB2  5  
ATOM 8189  H HB3  . GLU A 1 33 ? -12.250 11.192  8.172   1.00 0.00 ? 29 GLU A HB3  5  
ATOM 8190  H HG2  . GLU A 1 33 ? -11.098 9.873   9.757   1.00 0.00 ? 29 GLU A HG2  5  
ATOM 8191  H HG3  . GLU A 1 33 ? -10.192 9.033   8.498   1.00 0.00 ? 29 GLU A HG3  5  
ATOM 8192  N N    . HIS A 1 34 ? -12.594 9.537   4.980   1.00 0.00 ? 30 HIS A N    5  
ATOM 8193  C CA   . HIS A 1 34 ? -13.122 9.878   3.666   1.00 0.00 ? 30 HIS A CA   5  
ATOM 8194  C C    . HIS A 1 34 ? -13.976 8.748   3.115   1.00 0.00 ? 30 HIS A C    5  
ATOM 8195  O O    . HIS A 1 34 ? -14.983 8.992   2.452   1.00 0.00 ? 30 HIS A O    5  
ATOM 8196  C CB   . HIS A 1 34 ? -11.992 10.191  2.689   1.00 0.00 ? 30 HIS A CB   5  
ATOM 8197  C CG   . HIS A 1 34 ? -11.343 11.516  2.932   1.00 0.00 ? 30 HIS A CG   5  
ATOM 8198  N ND1  . HIS A 1 34 ? -10.298 11.712  3.809   1.00 0.00 ? 30 HIS A ND1  5  
ATOM 8199  C CD2  . HIS A 1 34 ? -11.619 12.735  2.399   1.00 0.00 ? 30 HIS A CD2  5  
ATOM 8200  C CE1  . HIS A 1 34 ? -9.980  13.012  3.784   1.00 0.00 ? 30 HIS A CE1  5  
ATOM 8201  N NE2  . HIS A 1 34 ? -10.751 13.678  2.944   1.00 0.00 ? 30 HIS A NE2  5  
ATOM 8202  H H    . HIS A 1 34 ? -11.671 9.226   5.054   1.00 0.00 ? 30 HIS A H    5  
ATOM 8203  H HA   . HIS A 1 34 ? -13.737 10.756  3.779   1.00 0.00 ? 30 HIS A HA   5  
ATOM 8204  H HB2  . HIS A 1 34 ? -11.234 9.427   2.765   1.00 0.00 ? 30 HIS A HB2  5  
ATOM 8205  H HB3  . HIS A 1 34 ? -12.389 10.198  1.684   1.00 0.00 ? 30 HIS A HB3  5  
ATOM 8206  H HD1  . HIS A 1 34 ? -9.872  11.027  4.365   1.00 0.00 ? 30 HIS A HD1  5  
ATOM 8207  H HD2  . HIS A 1 34 ? -12.386 12.949  1.670   1.00 0.00 ? 30 HIS A HD2  5  
ATOM 8208  H HE1  . HIS A 1 34 ? -9.198  13.460  4.379   1.00 0.00 ? 30 HIS A HE1  5  
ATOM 8209  N N    . PHE A 1 35 ? -13.569 7.515   3.399   1.00 0.00 ? 31 PHE A N    5  
ATOM 8210  C CA   . PHE A 1 35 ? -14.296 6.335   2.940   1.00 0.00 ? 31 PHE A CA   5  
ATOM 8211  C C    . PHE A 1 35 ? -15.759 6.402   3.363   1.00 0.00 ? 31 PHE A C    5  
ATOM 8212  O O    . PHE A 1 35 ? -16.665 6.226   2.547   1.00 0.00 ? 31 PHE A O    5  
ATOM 8213  C CB   . PHE A 1 35 ? -13.663 5.066   3.513   1.00 0.00 ? 31 PHE A CB   5  
ATOM 8214  C CG   . PHE A 1 35 ? -12.712 4.370   2.582   1.00 0.00 ? 31 PHE A CG   5  
ATOM 8215  C CD1  . PHE A 1 35 ? -11.382 4.752   2.512   1.00 0.00 ? 31 PHE A CD1  5  
ATOM 8216  C CD2  . PHE A 1 35 ? -13.147 3.323   1.788   1.00 0.00 ? 31 PHE A CD2  5  
ATOM 8217  C CE1  . PHE A 1 35 ? -10.504 4.102   1.667   1.00 0.00 ? 31 PHE A CE1  5  
ATOM 8218  C CE2  . PHE A 1 35 ? -12.274 2.671   0.939   1.00 0.00 ? 31 PHE A CE2  5  
ATOM 8219  C CZ   . PHE A 1 35 ? -10.950 3.060   0.879   1.00 0.00 ? 31 PHE A CZ   5  
ATOM 8220  H H    . PHE A 1 35 ? -12.752 7.394   3.929   1.00 0.00 ? 31 PHE A H    5  
ATOM 8221  H HA   . PHE A 1 35 ? -14.240 6.306   1.862   1.00 0.00 ? 31 PHE A HA   5  
ATOM 8222  H HB2  . PHE A 1 35 ? -13.118 5.323   4.406   1.00 0.00 ? 31 PHE A HB2  5  
ATOM 8223  H HB3  . PHE A 1 35 ? -14.448 4.368   3.767   1.00 0.00 ? 31 PHE A HB3  5  
ATOM 8224  H HD1  . PHE A 1 35 ? -11.032 5.567   3.128   1.00 0.00 ? 31 PHE A HD1  5  
ATOM 8225  H HD2  . PHE A 1 35 ? -14.182 3.017   1.834   1.00 0.00 ? 31 PHE A HD2  5  
ATOM 8226  H HE1  . PHE A 1 35 ? -9.470  4.410   1.623   1.00 0.00 ? 31 PHE A HE1  5  
ATOM 8227  H HE2  . PHE A 1 35 ? -12.627 1.856   0.324   1.00 0.00 ? 31 PHE A HE2  5  
ATOM 8228  H HZ   . PHE A 1 35 ? -10.267 2.550   0.218   1.00 0.00 ? 31 PHE A HZ   5  
ATOM 8229  N N    . MET A 1 36 ? -15.980 6.689   4.640   1.00 0.00 ? 32 MET A N    5  
ATOM 8230  C CA   . MET A 1 36 ? -17.327 6.770   5.186   1.00 0.00 ? 32 MET A CA   5  
ATOM 8231  C C    . MET A 1 36 ? -18.042 8.040   4.742   1.00 0.00 ? 32 MET A C    5  
ATOM 8232  O O    . MET A 1 36 ? -19.260 8.040   4.570   1.00 0.00 ? 32 MET A O    5  
ATOM 8233  C CB   . MET A 1 36 ? -17.283 6.716   6.715   1.00 0.00 ? 32 MET A CB   5  
ATOM 8234  C CG   . MET A 1 36 ? -16.969 5.339   7.275   1.00 0.00 ? 32 MET A CG   5  
ATOM 8235  S SD   . MET A 1 36 ? -17.019 5.305   9.075   1.00 0.00 ? 32 MET A SD   5  
ATOM 8236  C CE   . MET A 1 36 ? -16.664 3.577   9.379   1.00 0.00 ? 32 MET A CE   5  
ATOM 8237  H H    . MET A 1 36 ? -15.217 6.848   5.239   1.00 0.00 ? 32 MET A H    5  
ATOM 8238  H HA   . MET A 1 36 ? -17.881 5.918   4.824   1.00 0.00 ? 32 MET A HA   5  
ATOM 8239  H HB2  . MET A 1 36 ? -16.525 7.402   7.066   1.00 0.00 ? 32 MET A HB2  5  
ATOM 8240  H HB3  . MET A 1 36 ? -18.242 7.028   7.101   1.00 0.00 ? 32 MET A HB3  5  
ATOM 8241  H HG2  . MET A 1 36 ? -17.694 4.634   6.895   1.00 0.00 ? 32 MET A HG2  5  
ATOM 8242  H HG3  . MET A 1 36 ? -15.981 5.049   6.950   1.00 0.00 ? 32 MET A HG3  5  
ATOM 8243  H HE1  . MET A 1 36 ? -15.700 3.329   8.959   1.00 0.00 ? 32 MET A HE1  5  
ATOM 8244  H HE2  . MET A 1 36 ? -17.426 2.967   8.918   1.00 0.00 ? 32 MET A HE2  5  
ATOM 8245  H HE3  . MET A 1 36 ? -16.651 3.393   10.442  1.00 0.00 ? 32 MET A HE3  5  
ATOM 8246  N N    . ALA A 1 37 ? -17.291 9.112   4.522   1.00 0.00 ? 33 ALA A N    5  
ATOM 8247  C CA   . ALA A 1 37 ? -17.882 10.378  4.119   1.00 0.00 ? 33 ALA A CA   5  
ATOM 8248  C C    . ALA A 1 37 ? -18.388 10.304  2.686   1.00 0.00 ? 33 ALA A C    5  
ATOM 8249  O O    . ALA A 1 37 ? -19.335 10.995  2.312   1.00 0.00 ? 33 ALA A O    5  
ATOM 8250  C CB   . ALA A 1 37 ? -16.865 11.497  4.263   1.00 0.00 ? 33 ALA A CB   5  
ATOM 8251  H H    . ALA A 1 37 ? -16.314 9.054   4.590   1.00 0.00 ? 33 ALA A H    5  
ATOM 8252  H HA   . ALA A 1 37 ? -18.712 10.587  4.777   1.00 0.00 ? 33 ALA A HA   5  
ATOM 8253  H HB1  . ALA A 1 37 ? -16.561 11.575  5.295   1.00 0.00 ? 33 ALA A HB1  5  
ATOM 8254  H HB2  . ALA A 1 37 ? -17.307 12.430  3.944   1.00 0.00 ? 33 ALA A HB2  5  
ATOM 8255  H HB3  . ALA A 1 37 ? -16.005 11.277  3.650   1.00 0.00 ? 33 ALA A HB3  5  
ATOM 8256  N N    . ALA A 1 38 ? -17.750 9.449   1.893   1.00 0.00 ? 34 ALA A N    5  
ATOM 8257  C CA   . ALA A 1 38 ? -18.123 9.266   0.497   1.00 0.00 ? 34 ALA A CA   5  
ATOM 8258  C C    . ALA A 1 38 ? -19.371 8.399   0.364   1.00 0.00 ? 34 ALA A C    5  
ATOM 8259  O O    . ALA A 1 38 ? -19.893 8.211   -0.734  1.00 0.00 ? 34 ALA A O    5  
ATOM 8260  C CB   . ALA A 1 38 ? -16.967 8.656   -0.279  1.00 0.00 ? 34 ALA A CB   5  
ATOM 8261  H H    . ALA A 1 38 ? -16.997 8.935   2.257   1.00 0.00 ? 34 ALA A H    5  
ATOM 8262  H HA   . ALA A 1 38 ? -18.329 10.240  0.078   1.00 0.00 ? 34 ALA A HA   5  
ATOM 8263  H HB1  . ALA A 1 38 ? -16.123 9.327   -0.256  1.00 0.00 ? 34 ALA A HB1  5  
ATOM 8264  H HB2  . ALA A 1 38 ? -17.269 8.491   -1.304  1.00 0.00 ? 34 ALA A HB2  5  
ATOM 8265  H HB3  . ALA A 1 38 ? -16.690 7.712   0.170   1.00 0.00 ? 34 ALA A HB3  5  
ATOM 8266  N N    . GLY A 1 39 ? -19.838 7.864   1.485   1.00 0.00 ? 35 GLY A N    5  
ATOM 8267  C CA   . GLY A 1 39 ? -21.030 7.041   1.473   1.00 0.00 ? 35 GLY A CA   5  
ATOM 8268  C C    . GLY A 1 39 ? -20.732 5.558   1.536   1.00 0.00 ? 35 GLY A C    5  
ATOM 8269  O O    . GLY A 1 39 ? -21.650 4.737   1.555   1.00 0.00 ? 35 GLY A O    5  
ATOM 8270  H H    . GLY A 1 39 ? -19.374 8.038   2.331   1.00 0.00 ? 35 GLY A H    5  
ATOM 8271  H HA2  . GLY A 1 39 ? -21.641 7.306   2.322   1.00 0.00 ? 35 GLY A HA2  5  
ATOM 8272  H HA3  . GLY A 1 39 ? -21.584 7.246   0.569   1.00 0.00 ? 35 GLY A HA3  5  
ATOM 8273  N N    . TYR A 1 40 ? -19.459 5.200   1.575   1.00 0.00 ? 36 TYR A N    5  
ATOM 8274  C CA   . TYR A 1 40 ? -19.079 3.800   1.635   1.00 0.00 ? 36 TYR A CA   5  
ATOM 8275  C C    . TYR A 1 40 ? -18.870 3.371   3.080   1.00 0.00 ? 36 TYR A C    5  
ATOM 8276  O O    . TYR A 1 40 ? -17.742 3.227   3.549   1.00 0.00 ? 36 TYR A O    5  
ATOM 8277  C CB   . TYR A 1 40 ? -17.823 3.553   0.796   1.00 0.00 ? 36 TYR A CB   5  
ATOM 8278  C CG   . TYR A 1 40 ? -18.009 3.920   -0.660  1.00 0.00 ? 36 TYR A CG   5  
ATOM 8279  C CD1  . TYR A 1 40 ? -18.840 3.169   -1.478  1.00 0.00 ? 36 TYR A CD1  5  
ATOM 8280  C CD2  . TYR A 1 40 ? -17.369 5.023   -1.210  1.00 0.00 ? 36 TYR A CD2  5  
ATOM 8281  C CE1  . TYR A 1 40 ? -19.032 3.506   -2.803  1.00 0.00 ? 36 TYR A CE1  5  
ATOM 8282  C CE2  . TYR A 1 40 ? -17.552 5.364   -2.537  1.00 0.00 ? 36 TYR A CE2  5  
ATOM 8283  C CZ   . TYR A 1 40 ? -18.387 4.602   -3.329  1.00 0.00 ? 36 TYR A CZ   5  
ATOM 8284  O OH   . TYR A 1 40 ? -18.586 4.940   -4.647  1.00 0.00 ? 36 TYR A OH   5  
ATOM 8285  H H    . TYR A 1 40 ? -18.755 5.882   1.570   1.00 0.00 ? 36 TYR A H    5  
ATOM 8286  H HA   . TYR A 1 40 ? -19.893 3.223   1.222   1.00 0.00 ? 36 TYR A HA   5  
ATOM 8287  H HB2  . TYR A 1 40 ? -17.009 4.144   1.189   1.00 0.00 ? 36 TYR A HB2  5  
ATOM 8288  H HB3  . TYR A 1 40 ? -17.562 2.506   0.846   1.00 0.00 ? 36 TYR A HB3  5  
ATOM 8289  H HD1  . TYR A 1 40 ? -19.345 2.309   -1.064  1.00 0.00 ? 36 TYR A HD1  5  
ATOM 8290  H HD2  . TYR A 1 40 ? -16.715 5.616   -0.587  1.00 0.00 ? 36 TYR A HD2  5  
ATOM 8291  H HE1  . TYR A 1 40 ? -19.685 2.907   -3.421  1.00 0.00 ? 36 TYR A HE1  5  
ATOM 8292  H HE2  . TYR A 1 40 ? -17.045 6.225   -2.949  1.00 0.00 ? 36 TYR A HE2  5  
ATOM 8293  H HH   . TYR A 1 40 ? -17.726 5.094   -5.079  1.00 0.00 ? 36 TYR A HH   5  
ATOM 8294  N N    . THR A 1 41 ? -19.981 3.196   3.785   1.00 0.00 ? 37 THR A N    5  
ATOM 8295  C CA   . THR A 1 41 ? -19.954 2.786   5.175   1.00 0.00 ? 37 THR A CA   5  
ATOM 8296  C C    . THR A 1 41 ? -19.855 1.267   5.286   1.00 0.00 ? 37 THR A C    5  
ATOM 8297  O O    . THR A 1 41 ? -18.819 0.730   5.666   1.00 0.00 ? 37 THR A O    5  
ATOM 8298  C CB   . THR A 1 41 ? -21.218 3.273   5.904   1.00 0.00 ? 37 THR A CB   5  
ATOM 8299  O OG1  . THR A 1 41 ? -22.335 3.250   4.999   1.00 0.00 ? 37 THR A OG1  5  
ATOM 8300  C CG2  . THR A 1 41 ? -21.025 4.680   6.445   1.00 0.00 ? 37 THR A CG2  5  
ATOM 8301  H H    . THR A 1 41 ? -20.848 3.355   3.356   1.00 0.00 ? 37 THR A H    5  
ATOM 8302  H HA   . THR A 1 41 ? -19.091 3.233   5.645   1.00 0.00 ? 37 THR A HA   5  
ATOM 8303  H HB   . THR A 1 41 ? -21.420 2.606   6.731   1.00 0.00 ? 37 THR A HB   5  
ATOM 8304  H HG1  . THR A 1 41 ? -22.783 4.106   5.020   1.00 0.00 ? 37 THR A HG1  5  
ATOM 8305  H HG21 . THR A 1 41 ? -21.953 5.033   6.869   1.00 0.00 ? 37 THR A HG21 5  
ATOM 8306  H HG22 . THR A 1 41 ? -20.724 5.336   5.642   1.00 0.00 ? 37 THR A HG22 5  
ATOM 8307  H HG23 . THR A 1 41 ? -20.261 4.671   7.208   1.00 0.00 ? 37 THR A HG23 5  
ATOM 8308  N N    . ALA A 1 42 ? -20.947 0.583   4.970   1.00 0.00 ? 38 ALA A N    5  
ATOM 8309  C CA   . ALA A 1 42 ? -20.983 -0.872  5.025   1.00 0.00 ? 38 ALA A CA   5  
ATOM 8310  C C    . ALA A 1 42 ? -20.100 -1.495  3.946   1.00 0.00 ? 38 ALA A C    5  
ATOM 8311  O O    . ALA A 1 42 ? -19.898 -0.913  2.876   1.00 0.00 ? 38 ALA A O    5  
ATOM 8312  C CB   . ALA A 1 42 ? -22.414 -1.363  4.889   1.00 0.00 ? 38 ALA A CB   5  
ATOM 8313  H H    . ALA A 1 42 ? -21.768 1.065   4.739   1.00 0.00 ? 38 ALA A H    5  
ATOM 8314  H HA   . ALA A 1 42 ? -20.615 -1.176  5.994   1.00 0.00 ? 38 ALA A HA   5  
ATOM 8315  H HB1  . ALA A 1 42 ? -23.007 -0.978  5.706   1.00 0.00 ? 38 ALA A HB1  5  
ATOM 8316  H HB2  . ALA A 1 42 ? -22.428 -2.443  4.911   1.00 0.00 ? 38 ALA A HB2  5  
ATOM 8317  H HB3  . ALA A 1 42 ? -22.825 -1.018  3.951   1.00 0.00 ? 38 ALA A HB3  5  
ATOM 8318  N N    . ILE A 1 43 ? -19.607 -2.696  4.230   1.00 0.00 ? 39 ILE A N    5  
ATOM 8319  C CA   . ILE A 1 43 ? -18.730 -3.428  3.317   1.00 0.00 ? 39 ILE A CA   5  
ATOM 8320  C C    . ILE A 1 43 ? -19.381 -3.639  1.949   1.00 0.00 ? 39 ILE A C    5  
ATOM 8321  O O    . ILE A 1 43 ? -18.709 -3.567  0.919   1.00 0.00 ? 39 ILE A O    5  
ATOM 8322  C CB   . ILE A 1 43 ? -18.331 -4.798  3.921   1.00 0.00 ? 39 ILE A CB   5  
ATOM 8323  C CG1  . ILE A 1 43 ? -17.431 -4.601  5.146   1.00 0.00 ? 39 ILE A CG1  5  
ATOM 8324  C CG2  . ILE A 1 43 ? -17.637 -5.680  2.889   1.00 0.00 ? 39 ILE A CG2  5  
ATOM 8325  C CD1  . ILE A 1 43 ? -16.085 -3.982  4.824   1.00 0.00 ? 39 ILE A CD1  5  
ATOM 8326  H H    . ILE A 1 43 ? -19.846 -3.113  5.088   1.00 0.00 ? 39 ILE A H    5  
ATOM 8327  H HA   . ILE A 1 43 ? -17.831 -2.844  3.186   1.00 0.00 ? 39 ILE A HA   5  
ATOM 8328  H HB   . ILE A 1 43 ? -19.235 -5.301  4.231   1.00 0.00 ? 39 ILE A HB   5  
ATOM 8329  H HG12 . ILE A 1 43 ? -17.931 -3.952  5.850   1.00 0.00 ? 39 ILE A HG12 5  
ATOM 8330  H HG13 . ILE A 1 43 ? -17.253 -5.559  5.611   1.00 0.00 ? 39 ILE A HG13 5  
ATOM 8331  H HG21 . ILE A 1 43 ? -17.371 -6.624  3.343   1.00 0.00 ? 39 ILE A HG21 5  
ATOM 8332  H HG22 . ILE A 1 43 ? -16.743 -5.186  2.536   1.00 0.00 ? 39 ILE A HG22 5  
ATOM 8333  H HG23 . ILE A 1 43 ? -18.303 -5.856  2.059   1.00 0.00 ? 39 ILE A HG23 5  
ATOM 8334  H HD11 . ILE A 1 43 ? -16.226 -2.973  4.468   1.00 0.00 ? 39 ILE A HD11 5  
ATOM 8335  H HD12 . ILE A 1 43 ? -15.594 -4.568  4.060   1.00 0.00 ? 39 ILE A HD12 5  
ATOM 8336  H HD13 . ILE A 1 43 ? -15.473 -3.967  5.715   1.00 0.00 ? 39 ILE A HD13 5  
ATOM 8337  N N    . GLU A 1 44 ? -20.695 -3.855  1.938   1.00 0.00 ? 40 GLU A N    5  
ATOM 8338  C CA   . GLU A 1 44 ? -21.426 -4.087  0.692   1.00 0.00 ? 40 GLU A CA   5  
ATOM 8339  C C    . GLU A 1 44 ? -21.297 -2.897  -0.253  1.00 0.00 ? 40 GLU A C    5  
ATOM 8340  O O    . GLU A 1 44 ? -21.361 -3.051  -1.468  1.00 0.00 ? 40 GLU A O    5  
ATOM 8341  C CB   . GLU A 1 44 ? -22.909 -4.349  0.963   1.00 0.00 ? 40 GLU A CB   5  
ATOM 8342  C CG   . GLU A 1 44 ? -23.187 -5.063  2.273   1.00 0.00 ? 40 GLU A CG   5  
ATOM 8343  C CD   . GLU A 1 44 ? -24.225 -4.338  3.102   1.00 0.00 ? 40 GLU A CD   5  
ATOM 8344  O OE1  . GLU A 1 44 ? -24.381 -3.112  2.922   1.00 0.00 ? 40 GLU A OE1  5  
ATOM 8345  O OE2  . GLU A 1 44 ? -24.886 -4.988  3.935   1.00 0.00 ? 40 GLU A OE2  5  
ATOM 8346  H H    . GLU A 1 44 ? -21.192 -3.848  2.782   1.00 0.00 ? 40 GLU A H    5  
ATOM 8347  H HA   . GLU A 1 44 ? -20.998 -4.956  0.216   1.00 0.00 ? 40 GLU A HA   5  
ATOM 8348  H HB2  . GLU A 1 44 ? -23.429 -3.403  0.980   1.00 0.00 ? 40 GLU A HB2  5  
ATOM 8349  H HB3  . GLU A 1 44 ? -23.307 -4.951  0.160   1.00 0.00 ? 40 GLU A HB3  5  
ATOM 8350  H HG2  . GLU A 1 44 ? -23.549 -6.058  2.059   1.00 0.00 ? 40 GLU A HG2  5  
ATOM 8351  H HG3  . GLU A 1 44 ? -22.272 -5.127  2.841   1.00 0.00 ? 40 GLU A HG3  5  
ATOM 8352  N N    . LYS A 1 45 ? -21.124 -1.711  0.311   1.00 0.00 ? 41 LYS A N    5  
ATOM 8353  C CA   . LYS A 1 45 ? -20.984 -0.507  -0.491  1.00 0.00 ? 41 LYS A CA   5  
ATOM 8354  C C    . LYS A 1 45 ? -19.533 -0.334  -0.915  1.00 0.00 ? 41 LYS A C    5  
ATOM 8355  O O    . LYS A 1 45 ? -19.246 0.092   -2.035  1.00 0.00 ? 41 LYS A O    5  
ATOM 8356  C CB   . LYS A 1 45 ? -21.467 0.725   0.286   1.00 0.00 ? 41 LYS A CB   5  
ATOM 8357  C CG   . LYS A 1 45 ? -22.982 0.870   0.324   1.00 0.00 ? 41 LYS A CG   5  
ATOM 8358  C CD   . LYS A 1 45 ? -23.618 -0.051  1.355   1.00 0.00 ? 41 LYS A CD   5  
ATOM 8359  C CE   . LYS A 1 45 ? -25.100 -0.251  1.081   1.00 0.00 ? 41 LYS A CE   5  
ATOM 8360  N NZ   . LYS A 1 45 ? -25.773 -1.013  2.167   1.00 0.00 ? 41 LYS A NZ   5  
ATOM 8361  H H    . LYS A 1 45 ? -21.080 -1.644  1.289   1.00 0.00 ? 41 LYS A H    5  
ATOM 8362  H HA   . LYS A 1 45 ? -21.592 -0.628  -1.376  1.00 0.00 ? 41 LYS A HA   5  
ATOM 8363  H HB2  . LYS A 1 45 ? -21.108 0.658   1.302   1.00 0.00 ? 41 LYS A HB2  5  
ATOM 8364  H HB3  . LYS A 1 45 ? -21.054 1.609   -0.175  1.00 0.00 ? 41 LYS A HB3  5  
ATOM 8365  H HG2  . LYS A 1 45 ? -23.228 1.892   0.574   1.00 0.00 ? 41 LYS A HG2  5  
ATOM 8366  H HG3  . LYS A 1 45 ? -23.381 0.633   -0.651  1.00 0.00 ? 41 LYS A HG3  5  
ATOM 8367  H HD2  . LYS A 1 45 ? -23.123 -1.011  1.319   1.00 0.00 ? 41 LYS A HD2  5  
ATOM 8368  H HD3  . LYS A 1 45 ? -23.497 0.383   2.336   1.00 0.00 ? 41 LYS A HD3  5  
ATOM 8369  H HE2  . LYS A 1 45 ? -25.569 0.717   0.991   1.00 0.00 ? 41 LYS A HE2  5  
ATOM 8370  H HE3  . LYS A 1 45 ? -25.212 -0.791  0.152   1.00 0.00 ? 41 LYS A HE3  5  
ATOM 8371  H HZ1  . LYS A 1 45 ? -25.201 -1.850  2.431   1.00 0.00 ? 41 LYS A HZ1  5  
ATOM 8372  H HZ2  . LYS A 1 45 ? -26.707 -1.336  1.850   1.00 0.00 ? 41 LYS A HZ2  5  
ATOM 8373  H HZ3  . LYS A 1 45 ? -25.894 -0.413  3.006   1.00 0.00 ? 41 LYS A HZ3  5  
ATOM 8374  N N    . VAL A 1 46 ? -18.623 -0.694  -0.019  1.00 0.00 ? 42 VAL A N    5  
ATOM 8375  C CA   . VAL A 1 46 ? -17.193 -0.589  -0.279  1.00 0.00 ? 42 VAL A CA   5  
ATOM 8376  C C    . VAL A 1 46 ? -16.782 -1.486  -1.446  1.00 0.00 ? 42 VAL A C    5  
ATOM 8377  O O    . VAL A 1 46 ? -15.992 -1.087  -2.298  1.00 0.00 ? 42 VAL A O    5  
ATOM 8378  C CB   . VAL A 1 46 ? -16.366 -0.966  0.972   1.00 0.00 ? 42 VAL A CB   5  
ATOM 8379  C CG1  . VAL A 1 46 ? -14.872 -0.867  0.693   1.00 0.00 ? 42 VAL A CG1  5  
ATOM 8380  C CG2  . VAL A 1 46 ? -16.746 -0.084  2.151   1.00 0.00 ? 42 VAL A CG2  5  
ATOM 8381  H H    . VAL A 1 46 ? -18.924 -1.043  0.847   1.00 0.00 ? 42 VAL A H    5  
ATOM 8382  H HA   . VAL A 1 46 ? -16.976 0.438   -0.533  1.00 0.00 ? 42 VAL A HA   5  
ATOM 8383  H HB   . VAL A 1 46 ? -16.592 -1.991  1.231   1.00 0.00 ? 42 VAL A HB   5  
ATOM 8384  H HG11 . VAL A 1 46 ? -14.321 -1.181  1.568   1.00 0.00 ? 42 VAL A HG11 5  
ATOM 8385  H HG12 . VAL A 1 46 ? -14.617 0.155   0.455   1.00 0.00 ? 42 VAL A HG12 5  
ATOM 8386  H HG13 . VAL A 1 46 ? -14.618 -1.504  -0.141  1.00 0.00 ? 42 VAL A HG13 5  
ATOM 8387  H HG21 . VAL A 1 46 ? -17.805 -0.177  2.345   1.00 0.00 ? 42 VAL A HG21 5  
ATOM 8388  H HG22 . VAL A 1 46 ? -16.511 0.945   1.922   1.00 0.00 ? 42 VAL A HG22 5  
ATOM 8389  H HG23 . VAL A 1 46 ? -16.191 -0.393  3.024   1.00 0.00 ? 42 VAL A HG23 5  
ATOM 8390  N N    . VAL A 1 47 ? -17.347 -2.685  -1.501  1.00 0.00 ? 43 VAL A N    5  
ATOM 8391  C CA   . VAL A 1 47 ? -17.017 -3.631  -2.562  1.00 0.00 ? 43 VAL A CA   5  
ATOM 8392  C C    . VAL A 1 47 ? -17.626 -3.224  -3.904  1.00 0.00 ? 43 VAL A C    5  
ATOM 8393  O O    . VAL A 1 47 ? -17.254 -3.761  -4.945  1.00 0.00 ? 43 VAL A O    5  
ATOM 8394  C CB   . VAL A 1 47 ? -17.477 -5.067  -2.221  1.00 0.00 ? 43 VAL A CB   5  
ATOM 8395  C CG1  . VAL A 1 47 ? -16.895 -5.515  -0.892  1.00 0.00 ? 43 VAL A CG1  5  
ATOM 8396  C CG2  . VAL A 1 47 ? -18.996 -5.168  -2.201  1.00 0.00 ? 43 VAL A CG2  5  
ATOM 8397  H H    . VAL A 1 47 ? -17.997 -2.943  -0.809  1.00 0.00 ? 43 VAL A H    5  
ATOM 8398  H HA   . VAL A 1 47 ? -15.942 -3.644  -2.665  1.00 0.00 ? 43 VAL A HA   5  
ATOM 8399  H HB   . VAL A 1 47 ? -17.106 -5.731  -2.989  1.00 0.00 ? 43 VAL A HB   5  
ATOM 8400  H HG11 . VAL A 1 47 ? -15.855 -5.230  -0.842  1.00 0.00 ? 43 VAL A HG11 5  
ATOM 8401  H HG12 . VAL A 1 47 ? -16.979 -6.588  -0.803  1.00 0.00 ? 43 VAL A HG12 5  
ATOM 8402  H HG13 . VAL A 1 47 ? -17.436 -5.043  -0.085  1.00 0.00 ? 43 VAL A HG13 5  
ATOM 8403  H HG21 . VAL A 1 47 ? -19.386 -4.559  -1.399  1.00 0.00 ? 43 VAL A HG21 5  
ATOM 8404  H HG22 . VAL A 1 47 ? -19.288 -6.196  -2.048  1.00 0.00 ? 43 VAL A HG22 5  
ATOM 8405  H HG23 . VAL A 1 47 ? -19.392 -4.818  -3.143  1.00 0.00 ? 43 VAL A HG23 5  
ATOM 8406  N N    . GLN A 1 48 ? -18.546 -2.267  -3.883  1.00 0.00 ? 44 GLN A N    5  
ATOM 8407  C CA   . GLN A 1 48 ? -19.198 -1.824  -5.109  1.00 0.00 ? 44 GLN A CA   5  
ATOM 8408  C C    . GLN A 1 48 ? -18.392 -0.747  -5.824  1.00 0.00 ? 44 GLN A C    5  
ATOM 8409  O O    . GLN A 1 48 ? -18.602 -0.497  -7.011  1.00 0.00 ? 44 GLN A O    5  
ATOM 8410  C CB   . GLN A 1 48 ? -20.612 -1.316  -4.818  1.00 0.00 ? 44 GLN A CB   5  
ATOM 8411  C CG   . GLN A 1 48 ? -21.612 -2.426  -4.531  1.00 0.00 ? 44 GLN A CG   5  
ATOM 8412  C CD   . GLN A 1 48 ? -21.836 -3.353  -5.716  1.00 0.00 ? 44 GLN A CD   5  
ATOM 8413  O OE1  . GLN A 1 48 ? -20.943 -3.579  -6.533  1.00 0.00 ? 44 GLN A OE1  5  
ATOM 8414  N NE2  . GLN A 1 48 ? -23.032 -3.903  -5.814  1.00 0.00 ? 44 GLN A NE2  5  
ATOM 8415  H H    . GLN A 1 48 ? -18.790 -1.851  -3.029  1.00 0.00 ? 44 GLN A H    5  
ATOM 8416  H HA   . GLN A 1 48 ? -19.272 -2.681  -5.763  1.00 0.00 ? 44 GLN A HA   5  
ATOM 8417  H HB2  . GLN A 1 48 ? -20.576 -0.661  -3.960  1.00 0.00 ? 44 GLN A HB2  5  
ATOM 8418  H HB3  . GLN A 1 48 ? -20.963 -0.756  -5.672  1.00 0.00 ? 44 GLN A HB3  5  
ATOM 8419  H HG2  . GLN A 1 48 ? -21.247 -3.013  -3.702  1.00 0.00 ? 44 GLN A HG2  5  
ATOM 8420  H HG3  . GLN A 1 48 ? -22.558 -1.977  -4.262  1.00 0.00 ? 44 GLN A HG3  5  
ATOM 8421  H HE21 . GLN A 1 48 ? -23.700 -3.688  -5.127  1.00 0.00 ? 44 GLN A HE21 5  
ATOM 8422  H HE22 . GLN A 1 48 ? -23.204 -4.505  -6.568  1.00 0.00 ? 44 GLN A HE22 5  
ATOM 8423  N N    . MET A 1 49 ? -17.479 -0.105  -5.104  1.00 0.00 ? 45 MET A N    5  
ATOM 8424  C CA   . MET A 1 49 ? -16.645 0.943   -5.689  1.00 0.00 ? 45 MET A CA   5  
ATOM 8425  C C    . MET A 1 49 ? -15.687 0.372   -6.744  1.00 0.00 ? 45 MET A C    5  
ATOM 8426  O O    . MET A 1 49 ? -15.697 -0.830  -7.032  1.00 0.00 ? 45 MET A O    5  
ATOM 8427  C CB   . MET A 1 49 ? -15.857 1.679   -4.598  1.00 0.00 ? 45 MET A CB   5  
ATOM 8428  C CG   . MET A 1 49 ? -14.631 0.928   -4.100  1.00 0.00 ? 45 MET A CG   5  
ATOM 8429  S SD   . MET A 1 49 ? -13.609 1.917   -2.991  1.00 0.00 ? 45 MET A SD   5  
ATOM 8430  C CE   . MET A 1 49 ? -14.781 2.292   -1.690  1.00 0.00 ? 45 MET A CE   5  
ATOM 8431  H H    . MET A 1 49 ? -17.390 -0.314  -4.150  1.00 0.00 ? 45 MET A H    5  
ATOM 8432  H HA   . MET A 1 49 ? -17.304 1.648   -6.175  1.00 0.00 ? 45 MET A HA   5  
ATOM 8433  H HB2  . MET A 1 49 ? -15.534 2.632   -4.986  1.00 0.00 ? 45 MET A HB2  5  
ATOM 8434  H HB3  . MET A 1 49 ? -16.513 1.850   -3.755  1.00 0.00 ? 45 MET A HB3  5  
ATOM 8435  H HG2  . MET A 1 49 ? -14.957 0.043   -3.574  1.00 0.00 ? 45 MET A HG2  5  
ATOM 8436  H HG3  . MET A 1 49 ? -14.035 0.638   -4.954  1.00 0.00 ? 45 MET A HG3  5  
ATOM 8437  H HE1  . MET A 1 49 ? -14.276 2.815   -0.891  1.00 0.00 ? 45 MET A HE1  5  
ATOM 8438  H HE2  . MET A 1 49 ? -15.202 1.374   -1.309  1.00 0.00 ? 45 MET A HE2  5  
ATOM 8439  H HE3  . MET A 1 49 ? -15.570 2.914   -2.085  1.00 0.00 ? 45 MET A HE3  5  
ATOM 8440  N N    . THR A 1 50 ? -14.840 1.231   -7.288  1.00 0.00 ? 46 THR A N    5  
ATOM 8441  C CA   . THR A 1 50 ? -13.891 0.831   -8.310  1.00 0.00 ? 46 THR A CA   5  
ATOM 8442  C C    . THR A 1 50 ? -12.585 1.603   -8.130  1.00 0.00 ? 46 THR A C    5  
ATOM 8443  O O    . THR A 1 50 ? -12.440 2.360   -7.169  1.00 0.00 ? 46 THR A O    5  
ATOM 8444  C CB   . THR A 1 50 ? -14.461 1.067   -9.730  1.00 0.00 ? 46 THR A CB   5  
ATOM 8445  O OG1  . THR A 1 50 ? -13.615 0.455   -10.713 1.00 0.00 ? 46 THR A OG1  5  
ATOM 8446  C CG2  . THR A 1 50 ? -14.596 2.554   -10.032 1.00 0.00 ? 46 THR A CG2  5  
ATOM 8447  H H    . THR A 1 50 ? -14.805 2.152   -6.950  1.00 0.00 ? 46 THR A H    5  
ATOM 8448  H HA   . THR A 1 50 ? -13.696 -0.226  -8.189  1.00 0.00 ? 46 THR A HA   5  
ATOM 8449  H HB   . THR A 1 50 ? -15.441 0.616   -9.784  1.00 0.00 ? 46 THR A HB   5  
ATOM 8450  H HG1  . THR A 1 50 ? -14.139 0.239   -11.496 1.00 0.00 ? 46 THR A HG1  5  
ATOM 8451  H HG21 . THR A 1 50 ? -13.632 3.031   -9.933  1.00 0.00 ? 46 THR A HG21 5  
ATOM 8452  H HG22 . THR A 1 50 ? -15.292 3.002   -9.337  1.00 0.00 ? 46 THR A HG22 5  
ATOM 8453  H HG23 . THR A 1 50 ? -14.960 2.686   -11.040 1.00 0.00 ? 46 THR A HG23 5  
ATOM 8454  N N    . ASN A 1 51 ? -11.648 1.412   -9.053  1.00 0.00 ? 47 ASN A N    5  
ATOM 8455  C CA   . ASN A 1 51 ? -10.354 2.086   -9.001  1.00 0.00 ? 47 ASN A CA   5  
ATOM 8456  C C    . ASN A 1 51 ? -10.536 3.599   -8.961  1.00 0.00 ? 47 ASN A C    5  
ATOM 8457  O O    . ASN A 1 51 ? -9.895  4.292   -8.173  1.00 0.00 ? 47 ASN A O    5  
ATOM 8458  C CB   . ASN A 1 51 ? -9.505  1.703   -10.216 1.00 0.00 ? 47 ASN A CB   5  
ATOM 8459  C CG   . ASN A 1 51 ? -8.739  0.408   -10.015 1.00 0.00 ? 47 ASN A CG   5  
ATOM 8460  O OD1  . ASN A 1 51 ? -9.297  -0.682  -10.131 1.00 0.00 ? 47 ASN A OD1  5  
ATOM 8461  N ND2  . ASN A 1 51 ? -7.449  0.518   -9.731  1.00 0.00 ? 47 ASN A ND2  5  
ATOM 8462  H H    . ASN A 1 51 ? -11.841 0.799   -9.799  1.00 0.00 ? 47 ASN A H    5  
ATOM 8463  H HA   . ASN A 1 51 ? -9.847  1.770   -8.101  1.00 0.00 ? 47 ASN A HA   5  
ATOM 8464  H HB2  . ASN A 1 51 ? -10.151 1.584   -11.071 1.00 0.00 ? 47 ASN A HB2  5  
ATOM 8465  H HB3  . ASN A 1 51 ? -8.795  2.492   -10.413 1.00 0.00 ? 47 ASN A HB3  5  
ATOM 8466  H HD21 . ASN A 1 51 ? -7.064  1.416   -9.665  1.00 0.00 ? 47 ASN A HD21 5  
ATOM 8467  H HD22 . ASN A 1 51 ? -6.930  -0.305  -9.608  1.00 0.00 ? 47 ASN A HD22 5  
ATOM 8468  N N    . ASP A 1 52 ? -11.407 4.097   -9.834  1.00 0.00 ? 48 ASP A N    5  
ATOM 8469  C CA   . ASP A 1 52 ? -11.708 5.525   -9.917  1.00 0.00 ? 48 ASP A CA   5  
ATOM 8470  C C    . ASP A 1 52 ? -12.163 6.083   -8.572  1.00 0.00 ? 48 ASP A C    5  
ATOM 8471  O O    . ASP A 1 52 ? -11.739 7.166   -8.163  1.00 0.00 ? 48 ASP A O    5  
ATOM 8472  C CB   . ASP A 1 52 ? -12.799 5.766   -10.958 1.00 0.00 ? 48 ASP A CB   5  
ATOM 8473  C CG   . ASP A 1 52 ? -12.762 7.170   -11.522 1.00 0.00 ? 48 ASP A CG   5  
ATOM 8474  O OD1  . ASP A 1 52 ? -11.966 7.414   -12.451 1.00 0.00 ? 48 ASP A OD1  5  
ATOM 8475  O OD2  . ASP A 1 52 ? -13.540 8.027   -11.053 1.00 0.00 ? 48 ASP A OD2  5  
ATOM 8476  H H    . ASP A 1 52 ? -11.822 3.492   -10.483 1.00 0.00 ? 48 ASP A H    5  
ATOM 8477  H HA   . ASP A 1 52 ? -10.810 6.039   -10.223 1.00 0.00 ? 48 ASP A HA   5  
ATOM 8478  H HB2  . ASP A 1 52 ? -12.672 5.069   -11.773 1.00 0.00 ? 48 ASP A HB2  5  
ATOM 8479  H HB3  . ASP A 1 52 ? -13.765 5.608   -10.502 1.00 0.00 ? 48 ASP A HB3  5  
ATOM 8480  N N    . ASP A 1 53 ? -13.026 5.332   -7.891  1.00 0.00 ? 49 ASP A N    5  
ATOM 8481  C CA   . ASP A 1 53 ? -13.555 5.737   -6.591  1.00 0.00 ? 49 ASP A CA   5  
ATOM 8482  C C    . ASP A 1 53 ? -12.437 5.971   -5.590  1.00 0.00 ? 49 ASP A C    5  
ATOM 8483  O O    . ASP A 1 53 ? -12.485 6.920   -4.816  1.00 0.00 ? 49 ASP A O    5  
ATOM 8484  C CB   . ASP A 1 53 ? -14.509 4.678   -6.035  1.00 0.00 ? 49 ASP A CB   5  
ATOM 8485  C CG   . ASP A 1 53 ? -15.894 4.752   -6.641  1.00 0.00 ? 49 ASP A CG   5  
ATOM 8486  O OD1  . ASP A 1 53 ? -16.655 5.676   -6.283  1.00 0.00 ? 49 ASP A OD1  5  
ATOM 8487  O OD2  . ASP A 1 53 ? -16.233 3.880   -7.470  1.00 0.00 ? 49 ASP A OD2  5  
ATOM 8488  H H    . ASP A 1 53 ? -13.318 4.481   -8.276  1.00 0.00 ? 49 ASP A H    5  
ATOM 8489  H HA   . ASP A 1 53 ? -14.099 6.661   -6.726  1.00 0.00 ? 49 ASP A HA   5  
ATOM 8490  H HB2  . ASP A 1 53 ? -14.102 3.698   -6.238  1.00 0.00 ? 49 ASP A HB2  5  
ATOM 8491  H HB3  . ASP A 1 53 ? -14.597 4.809   -4.966  1.00 0.00 ? 49 ASP A HB3  5  
ATOM 8492  N N    . ILE A 1 54 ? -11.422 5.130   -5.629  1.00 0.00 ? 50 ILE A N    5  
ATOM 8493  C CA   . ILE A 1 54 ? -10.274 5.223   -4.731  1.00 0.00 ? 50 ILE A CA   5  
ATOM 8494  C C    . ILE A 1 54 ? -9.623  6.581   -4.825  1.00 0.00 ? 50 ILE A C    5  
ATOM 8495  O O    . ILE A 1 54 ? -9.049  7.077   -3.846  1.00 0.00 ? 50 ILE A O    5  
ATOM 8496  C CB   . ILE A 1 54 ? -9.240  4.054   -4.994  1.00 0.00 ? 50 ILE A CB   5  
ATOM 8497  C CG1  . ILE A 1 54 ? -9.752  2.630   -4.605  1.00 0.00 ? 50 ILE A CG1  5  
ATOM 8498  C CG2  . ILE A 1 54 ? -7.870  4.287   -4.286  1.00 0.00 ? 50 ILE A CG2  5  
ATOM 8499  C CD1  . ILE A 1 54 ? -8.885  1.448   -5.084  1.00 0.00 ? 50 ILE A CD1  5  
ATOM 8500  H H    . ILE A 1 54 ? -11.439 4.396   -6.302  1.00 0.00 ? 50 ILE A H    5  
ATOM 8501  H HA   . ILE A 1 54 ? -10.651 5.126   -3.696  1.00 0.00 ? 50 ILE A HA   5  
ATOM 8502  H HB   . ILE A 1 54 ? -9.052  4.037   -6.089  1.00 0.00 ? 50 ILE A HB   5  
ATOM 8503  H HG12 . ILE A 1 54 ? -9.913  2.566   -3.511  1.00 0.00 ? 50 ILE A HG12 5  
ATOM 8504  H HG13 . ILE A 1 54 ? -10.755 2.465   -5.041  1.00 0.00 ? 50 ILE A HG13 5  
ATOM 8505  H HG21 . ILE A 1 54 ? -7.373  5.223   -4.596  1.00 0.00 ? 50 ILE A HG21 5  
ATOM 8506  H HG22 . ILE A 1 54 ? -7.971  4.318   -3.184  1.00 0.00 ? 50 ILE A HG22 5  
ATOM 8507  H HG23 . ILE A 1 54 ? -7.134  3.496   -4.520  1.00 0.00 ? 50 ILE A HG23 5  
ATOM 8508  H HD11 . ILE A 1 54 ? -8.742  1.462   -6.182  1.00 0.00 ? 50 ILE A HD11 5  
ATOM 8509  H HD12 . ILE A 1 54 ? -7.882  1.442   -4.620  1.00 0.00 ? 50 ILE A HD12 5  
ATOM 8510  H HD13 . ILE A 1 54 ? -9.354  0.480   -4.832  1.00 0.00 ? 50 ILE A HD13 5  
ATOM 8511  N N    . LYS A 1 55 ? -9.645  7.169   -6.008  1.00 0.00 ? 51 LYS A N    5  
ATOM 8512  C CA   . LYS A 1 55 ? -9.032  8.474   -6.233  1.00 0.00 ? 51 LYS A CA   5  
ATOM 8513  C C    . LYS A 1 55 ? -10.027 9.580   -5.904  1.00 0.00 ? 51 LYS A C    5  
ATOM 8514  O O    . LYS A 1 55 ? -9.671  10.618  -5.350  1.00 0.00 ? 51 LYS A O    5  
ATOM 8515  C CB   . LYS A 1 55 ? -8.576  8.604   -7.686  1.00 0.00 ? 51 LYS A CB   5  
ATOM 8516  C CG   . LYS A 1 55 ? -7.942  7.341   -8.247  1.00 0.00 ? 51 LYS A CG   5  
ATOM 8517  C CD   . LYS A 1 55 ? -7.664  7.473   -9.735  1.00 0.00 ? 51 LYS A CD   5  
ATOM 8518  C CE   . LYS A 1 55 ? -6.437  8.328   -10.002 1.00 0.00 ? 51 LYS A CE   5  
ATOM 8519  N NZ   . LYS A 1 55 ? -6.227  8.555   -11.455 1.00 0.00 ? 51 LYS A NZ   5  
ATOM 8520  H H    . LYS A 1 55 ? -10.114 6.725   -6.745  1.00 0.00 ? 51 LYS A H    5  
ATOM 8521  H HA   . LYS A 1 55 ? -8.175  8.563   -5.579  1.00 0.00 ? 51 LYS A HA   5  
ATOM 8522  H HB2  . LYS A 1 55 ? -9.431  8.852   -8.299  1.00 0.00 ? 51 LYS A HB2  5  
ATOM 8523  H HB3  . LYS A 1 55 ? -7.853  9.404   -7.754  1.00 0.00 ? 51 LYS A HB3  5  
ATOM 8524  H HG2  . LYS A 1 55 ? -7.010  7.156   -7.732  1.00 0.00 ? 51 LYS A HG2  5  
ATOM 8525  H HG3  . LYS A 1 55 ? -8.615  6.510   -8.087  1.00 0.00 ? 51 LYS A HG3  5  
ATOM 8526  H HD2  . LYS A 1 55 ? -7.505  6.491   -10.151 1.00 0.00 ? 51 LYS A HD2  5  
ATOM 8527  H HD3  . LYS A 1 55 ? -8.520  7.932   -10.209 1.00 0.00 ? 51 LYS A HD3  5  
ATOM 8528  H HE2  . LYS A 1 55 ? -6.563  9.281   -9.513  1.00 0.00 ? 51 LYS A HE2  5  
ATOM 8529  H HE3  . LYS A 1 55 ? -5.570  7.827   -9.595  1.00 0.00 ? 51 LYS A HE3  5  
ATOM 8530  H HZ1  . LYS A 1 55 ? -6.008  7.658   -11.931 1.00 0.00 ? 51 LYS A HZ1  5  
ATOM 8531  H HZ2  . LYS A 1 55 ? -5.434  9.211   -11.602 1.00 0.00 ? 51 LYS A HZ2  5  
ATOM 8532  H HZ3  . LYS A 1 55 ? -7.082  8.963   -11.883 1.00 0.00 ? 51 LYS A HZ3  5  
ATOM 8533  N N    . ARG A 1 56 ? -11.282 9.344   -6.252  1.00 0.00 ? 52 ARG A N    5  
ATOM 8534  C CA   . ARG A 1 56 ? -12.351 10.304  -6.003  1.00 0.00 ? 52 ARG A CA   5  
ATOM 8535  C C    . ARG A 1 56 ? -12.539 10.546  -4.503  1.00 0.00 ? 52 ARG A C    5  
ATOM 8536  O O    . ARG A 1 56 ? -12.853 11.659  -4.079  1.00 0.00 ? 52 ARG A O    5  
ATOM 8537  C CB   . ARG A 1 56 ? -13.651 9.793   -6.633  1.00 0.00 ? 52 ARG A CB   5  
ATOM 8538  C CG   . ARG A 1 56 ? -14.826 10.755  -6.513  1.00 0.00 ? 52 ARG A CG   5  
ATOM 8539  C CD   . ARG A 1 56 ? -15.975 10.347  -7.426  1.00 0.00 ? 52 ARG A CD   5  
ATOM 8540  N NE   . ARG A 1 56 ? -17.240 10.953  -7.008  1.00 0.00 ? 52 ARG A NE   5  
ATOM 8541  C CZ   . ARG A 1 56 ? -17.665 12.153  -7.403  1.00 0.00 ? 52 ARG A CZ   5  
ATOM 8542  N NH1  . ARG A 1 56 ? -16.937 12.880  -8.240  1.00 0.00 ? 52 ARG A NH1  5  
ATOM 8543  N NH2  . ARG A 1 56 ? -18.827 12.624  -6.963  1.00 0.00 ? 52 ARG A NH2  5  
ATOM 8544  H H    . ARG A 1 56 ? -11.500 8.503   -6.705  1.00 0.00 ? 52 ARG A H    5  
ATOM 8545  H HA   . ARG A 1 56 ? -12.076 11.235  -6.475  1.00 0.00 ? 52 ARG A HA   5  
ATOM 8546  H HB2  . ARG A 1 56 ? -13.475 9.605   -7.681  1.00 0.00 ? 52 ARG A HB2  5  
ATOM 8547  H HB3  . ARG A 1 56 ? -13.923 8.864   -6.156  1.00 0.00 ? 52 ARG A HB3  5  
ATOM 8548  H HG2  . ARG A 1 56 ? -15.175 10.755  -5.490  1.00 0.00 ? 52 ARG A HG2  5  
ATOM 8549  H HG3  . ARG A 1 56 ? -14.498 11.750  -6.782  1.00 0.00 ? 52 ARG A HG3  5  
ATOM 8550  H HD2  . ARG A 1 56 ? -15.749 10.664  -8.435  1.00 0.00 ? 52 ARG A HD2  5  
ATOM 8551  H HD3  . ARG A 1 56 ? -16.076 9.271   -7.403  1.00 0.00 ? 52 ARG A HD3  5  
ATOM 8552  H HE   . ARG A 1 56 ? -17.803 10.434  -6.388  1.00 0.00 ? 52 ARG A HE   5  
ATOM 8553  H HH11 . ARG A 1 56 ? -16.063 12.531  -8.587  1.00 0.00 ? 52 ARG A HH11 5  
ATOM 8554  H HH12 . ARG A 1 56 ? -17.255 13.787  -8.522  1.00 0.00 ? 52 ARG A HH12 5  
ATOM 8555  H HH21 . ARG A 1 56 ? -19.390 12.075  -6.337  1.00 0.00 ? 52 ARG A HH21 5  
ATOM 8556  H HH22 . ARG A 1 56 ? -19.147 13.533  -7.249  1.00 0.00 ? 52 ARG A HH22 5  
ATOM 8557  N N    . ILE A 1 57 ? -12.337 9.501   -3.709  1.00 0.00 ? 53 ILE A N    5  
ATOM 8558  C CA   . ILE A 1 57 ? -12.480 9.598   -2.255  1.00 0.00 ? 53 ILE A CA   5  
ATOM 8559  C C    . ILE A 1 57 ? -11.285 10.306  -1.607  1.00 0.00 ? 53 ILE A C    5  
ATOM 8560  O O    . ILE A 1 57 ? -11.221 10.426  -0.385  1.00 0.00 ? 53 ILE A O    5  
ATOM 8561  C CB   . ILE A 1 57 ? -12.669 8.214   -1.595  1.00 0.00 ? 53 ILE A CB   5  
ATOM 8562  C CG1  . ILE A 1 57 ? -11.456 7.318   -1.856  1.00 0.00 ? 53 ILE A CG1  5  
ATOM 8563  C CG2  . ILE A 1 57 ? -13.947 7.554   -2.097  1.00 0.00 ? 53 ILE A CG2  5  
ATOM 8564  C CD1  . ILE A 1 57 ? -11.549 5.961   -1.192  1.00 0.00 ? 53 ILE A CD1  5  
ATOM 8565  H H    . ILE A 1 57 ? -12.121 8.632   -4.120  1.00 0.00 ? 53 ILE A H    5  
ATOM 8566  H HA   . ILE A 1 57 ? -13.368 10.182  -2.057  1.00 0.00 ? 53 ILE A HA   5  
ATOM 8567  H HB   . ILE A 1 57 ? -12.771 8.365   -0.532  1.00 0.00 ? 53 ILE A HB   5  
ATOM 8568  H HG12 . ILE A 1 57 ? -11.352 7.160   -2.919  1.00 0.00 ? 53 ILE A HG12 5  
ATOM 8569  H HG13 . ILE A 1 57 ? -10.570 7.810   -1.482  1.00 0.00 ? 53 ILE A HG13 5  
ATOM 8570  H HG21 . ILE A 1 57 ? -14.793 8.184   -1.864  1.00 0.00 ? 53 ILE A HG21 5  
ATOM 8571  H HG22 . ILE A 1 57 ? -14.069 6.595   -1.614  1.00 0.00 ? 53 ILE A HG22 5  
ATOM 8572  H HG23 . ILE A 1 57 ? -13.887 7.414   -3.166  1.00 0.00 ? 53 ILE A HG23 5  
ATOM 8573  H HD11 . ILE A 1 57 ? -10.673 5.378   -1.437  1.00 0.00 ? 53 ILE A HD11 5  
ATOM 8574  H HD12 . ILE A 1 57 ? -12.433 5.448   -1.542  1.00 0.00 ? 53 ILE A HD12 5  
ATOM 8575  H HD13 . ILE A 1 57 ? -11.607 6.089   -0.122  1.00 0.00 ? 53 ILE A HD13 5  
ATOM 8576  N N    . GLY A 1 58 ? -10.339 10.766  -2.418  1.00 0.00 ? 54 GLY A N    5  
ATOM 8577  C CA   . GLY A 1 58 ? -9.190  11.463  -1.879  1.00 0.00 ? 54 GLY A CA   5  
ATOM 8578  C C    . GLY A 1 58 ? -7.868  10.953  -2.417  1.00 0.00 ? 54 GLY A C    5  
ATOM 8579  O O    . GLY A 1 58 ? -7.230  11.628  -3.223  1.00 0.00 ? 54 GLY A O    5  
ATOM 8580  H H    . GLY A 1 58 ? -10.424 10.637  -3.388  1.00 0.00 ? 54 GLY A H    5  
ATOM 8581  H HA2  . GLY A 1 58 ? -9.278  12.512  -2.123  1.00 0.00 ? 54 GLY A HA2  5  
ATOM 8582  H HA3  . GLY A 1 58 ? -9.192  11.357  -0.805  1.00 0.00 ? 54 GLY A HA3  5  
ATOM 8583  N N    . VAL A 1 59 ? -7.456  9.780   -1.920  1.00 0.00 ? 55 VAL A N    5  
ATOM 8584  C CA   . VAL A 1 59 ? -6.201  9.109   -2.300  1.00 0.00 ? 55 VAL A CA   5  
ATOM 8585  C C    . VAL A 1 59 ? -5.723  9.425   -3.720  1.00 0.00 ? 55 VAL A C    5  
ATOM 8586  O O    . VAL A 1 59 ? -6.181  8.825   -4.691  1.00 0.00 ? 55 VAL A O    5  
ATOM 8587  C CB   . VAL A 1 59 ? -6.338  7.577   -2.176  1.00 0.00 ? 55 VAL A CB   5  
ATOM 8588  C CG1  . VAL A 1 59 ? -4.973  6.912   -2.220  1.00 0.00 ? 55 VAL A CG1  5  
ATOM 8589  C CG2  . VAL A 1 59 ? -7.080  7.195   -0.903  1.00 0.00 ? 55 VAL A CG2  5  
ATOM 8590  H H    . VAL A 1 59 ? -7.996  9.356   -1.224  1.00 0.00 ? 55 VAL A H    5  
ATOM 8591  H HA   . VAL A 1 59 ? -5.439  9.426   -1.605  1.00 0.00 ? 55 VAL A HA   5  
ATOM 8592  H HB   . VAL A 1 59 ? -6.912  7.220   -3.019  1.00 0.00 ? 55 VAL A HB   5  
ATOM 8593  H HG11 . VAL A 1 59 ? -4.398  7.214   -1.357  1.00 0.00 ? 55 VAL A HG11 5  
ATOM 8594  H HG12 . VAL A 1 59 ? -4.456  7.212   -3.119  1.00 0.00 ? 55 VAL A HG12 5  
ATOM 8595  H HG13 . VAL A 1 59 ? -5.094  5.839   -2.215  1.00 0.00 ? 55 VAL A HG13 5  
ATOM 8596  H HG21 . VAL A 1 59 ? -7.087  6.120   -0.801  1.00 0.00 ? 55 VAL A HG21 5  
ATOM 8597  H HG22 . VAL A 1 59 ? -8.095  7.558   -0.955  1.00 0.00 ? 55 VAL A HG22 5  
ATOM 8598  H HG23 . VAL A 1 59 ? -6.582  7.635   -0.051  1.00 0.00 ? 55 VAL A HG23 5  
ATOM 8599  N N    . ARG A 1 60 ? -4.786  10.361  -3.829  1.00 0.00 ? 56 ARG A N    5  
ATOM 8600  C CA   . ARG A 1 60 ? -4.232  10.740  -5.124  1.00 0.00 ? 56 ARG A CA   5  
ATOM 8601  C C    . ARG A 1 60 ? -2.857  10.104  -5.321  1.00 0.00 ? 56 ARG A C    5  
ATOM 8602  O O    . ARG A 1 60 ? -2.228  10.266  -6.366  1.00 0.00 ? 56 ARG A O    5  
ATOM 8603  C CB   . ARG A 1 60 ? -4.140  12.270  -5.252  1.00 0.00 ? 56 ARG A CB   5  
ATOM 8604  C CG   . ARG A 1 60 ? -3.340  12.956  -4.144  1.00 0.00 ? 56 ARG A CG   5  
ATOM 8605  C CD   . ARG A 1 60 ? -1.903  13.240  -4.567  1.00 0.00 ? 56 ARG A CD   5  
ATOM 8606  N NE   . ARG A 1 60 ? -1.484  14.601  -4.220  1.00 0.00 ? 56 ARG A NE   5  
ATOM 8607  C CZ   . ARG A 1 60 ? -0.220  14.961  -3.971  1.00 0.00 ? 56 ARG A CZ   5  
ATOM 8608  N NH1  . ARG A 1 60 ? 0.760   14.064  -4.019  1.00 0.00 ? 56 ARG A NH1  5  
ATOM 8609  N NH2  . ARG A 1 60 ? 0.060   16.226  -3.680  1.00 0.00 ? 56 ARG A NH2  5  
ATOM 8610  H H    . ARG A 1 60 ? -4.486  10.834  -3.027  1.00 0.00 ? 56 ARG A H    5  
ATOM 8611  H HA   . ARG A 1 60 ? -4.898  10.364  -5.887  1.00 0.00 ? 56 ARG A HA   5  
ATOM 8612  H HB2  . ARG A 1 60 ? -3.675  12.509  -6.196  1.00 0.00 ? 56 ARG A HB2  5  
ATOM 8613  H HB3  . ARG A 1 60 ? -5.140  12.678  -5.245  1.00 0.00 ? 56 ARG A HB3  5  
ATOM 8614  H HG2  . ARG A 1 60 ? -3.821  13.890  -3.895  1.00 0.00 ? 56 ARG A HG2  5  
ATOM 8615  H HG3  . ARG A 1 60 ? -3.329  12.314  -3.275  1.00 0.00 ? 56 ARG A HG3  5  
ATOM 8616  H HD2  . ARG A 1 60 ? -1.251  12.538  -4.071  1.00 0.00 ? 56 ARG A HD2  5  
ATOM 8617  H HD3  . ARG A 1 60 ? -1.822  13.112  -5.635  1.00 0.00 ? 56 ARG A HD3  5  
ATOM 8618  H HE   . ARG A 1 60 ? -2.187  15.292  -4.177  1.00 0.00 ? 56 ARG A HE   5  
ATOM 8619  H HH11 . ARG A 1 60 ? 0.559   13.111  -4.243  1.00 0.00 ? 56 ARG A HH11 5  
ATOM 8620  H HH12 . ARG A 1 60 ? 1.708   14.340  -3.829  1.00 0.00 ? 56 ARG A HH12 5  
ATOM 8621  H HH21 . ARG A 1 60 ? -0.676  16.911  -3.649  1.00 0.00 ? 56 ARG A HH21 5  
ATOM 8622  H HH22 . ARG A 1 60 ? 1.006   16.507  -3.493  1.00 0.00 ? 56 ARG A HH22 5  
ATOM 8623  N N    . LEU A 1 61 ? -2.404  9.376   -4.308  1.00 0.00 ? 57 LEU A N    5  
ATOM 8624  C CA   . LEU A 1 61 ? -1.105  8.716   -4.351  1.00 0.00 ? 57 LEU A CA   5  
ATOM 8625  C C    . LEU A 1 61 ? -1.246  7.305   -4.933  1.00 0.00 ? 57 LEU A C    5  
ATOM 8626  O O    . LEU A 1 61 ? -2.062  6.515   -4.462  1.00 0.00 ? 57 LEU A O    5  
ATOM 8627  C CB   . LEU A 1 61 ? -0.499  8.681   -2.942  1.00 0.00 ? 57 LEU A CB   5  
ATOM 8628  C CG   . LEU A 1 61 ? -0.342  10.054  -2.279  1.00 0.00 ? 57 LEU A CG   5  
ATOM 8629  C CD1  . LEU A 1 61 ? -0.079  9.910   -0.787  1.00 0.00 ? 57 LEU A CD1  5  
ATOM 8630  C CD2  . LEU A 1 61 ? 0.779   10.840  -2.939  1.00 0.00 ? 57 LEU A CD2  5  
ATOM 8631  H H    . LEU A 1 61 ? -2.964  9.266   -3.514  1.00 0.00 ? 57 LEU A H    5  
ATOM 8632  H HA   . LEU A 1 61 ? -0.462  9.295   -4.996  1.00 0.00 ? 57 LEU A HA   5  
ATOM 8633  H HB2  . LEU A 1 61 ? -1.132  8.073   -2.316  1.00 0.00 ? 57 LEU A HB2  5  
ATOM 8634  H HB3  . LEU A 1 61 ? 0.475   8.219   -2.999  1.00 0.00 ? 57 LEU A HB3  5  
ATOM 8635  H HG   . LEU A 1 61 ? -1.259  10.612  -2.402  1.00 0.00 ? 57 LEU A HG   5  
ATOM 8636  H HD11 . LEU A 1 61 ? 0.825   9.337   -0.634  1.00 0.00 ? 57 LEU A HD11 5  
ATOM 8637  H HD12 . LEU A 1 61 ? -0.910  9.402   -0.322  1.00 0.00 ? 57 LEU A HD12 5  
ATOM 8638  H HD13 . LEU A 1 61 ? 0.037   10.889  -0.346  1.00 0.00 ? 57 LEU A HD13 5  
ATOM 8639  H HD21 . LEU A 1 61 ? 1.705   10.290  -2.849  1.00 0.00 ? 57 LEU A HD21 5  
ATOM 8640  H HD22 . LEU A 1 61 ? 0.882   11.798  -2.451  1.00 0.00 ? 57 LEU A HD22 5  
ATOM 8641  H HD23 . LEU A 1 61 ? 0.548   10.990  -3.982  1.00 0.00 ? 57 LEU A HD23 5  
ATOM 8642  N N    . PRO A 1 62 ? -0.447  6.982   -5.968  1.00 0.00 ? 58 PRO A N    5  
ATOM 8643  C CA   . PRO A 1 62 ? -0.498  5.682   -6.663  1.00 0.00 ? 58 PRO A CA   5  
ATOM 8644  C C    . PRO A 1 62 ? -0.268  4.473   -5.756  1.00 0.00 ? 58 PRO A C    5  
ATOM 8645  O O    . PRO A 1 62 ? -1.049  3.524   -5.776  1.00 0.00 ? 58 PRO A O    5  
ATOM 8646  C CB   . PRO A 1 62 ? 0.621   5.778   -7.709  1.00 0.00 ? 58 PRO A CB   5  
ATOM 8647  C CG   . PRO A 1 62 ? 1.490   6.901   -7.253  1.00 0.00 ? 58 PRO A CG   5  
ATOM 8648  C CD   . PRO A 1 62 ? 0.580   7.863   -6.550  1.00 0.00 ? 58 PRO A CD   5  
ATOM 8649  H HA   . PRO A 1 62 ? -1.440  5.556   -7.172  1.00 0.00 ? 58 PRO A HA   5  
ATOM 8650  H HB2  . PRO A 1 62 ? 1.167   4.847   -7.743  1.00 0.00 ? 58 PRO A HB2  5  
ATOM 8651  H HB3  . PRO A 1 62 ? 0.192   5.983   -8.680  1.00 0.00 ? 58 PRO A HB3  5  
ATOM 8652  H HG2  . PRO A 1 62 ? 2.241   6.529   -6.572  1.00 0.00 ? 58 PRO A HG2  5  
ATOM 8653  H HG3  . PRO A 1 62 ? 1.954   7.376   -8.103  1.00 0.00 ? 58 PRO A HG3  5  
ATOM 8654  H HD2  . PRO A 1 62 ? 1.116   8.396   -5.779  1.00 0.00 ? 58 PRO A HD2  5  
ATOM 8655  H HD3  . PRO A 1 62 ? 0.140   8.552   -7.256  1.00 0.00 ? 58 PRO A HD3  5  
ATOM 8656  N N    . GLY A 1 63 ? 0.801   4.506   -4.972  1.00 0.00 ? 59 GLY A N    5  
ATOM 8657  C CA   . GLY A 1 63 ? 1.102   3.396   -4.080  1.00 0.00 ? 59 GLY A CA   5  
ATOM 8658  C C    . GLY A 1 63 ? 0.015   3.194   -3.039  1.00 0.00 ? 59 GLY A C    5  
ATOM 8659  O O    . GLY A 1 63 ? -0.331  2.062   -2.693  1.00 0.00 ? 59 GLY A O    5  
ATOM 8660  H H    . GLY A 1 63 ? 1.388   5.287   -4.999  1.00 0.00 ? 59 GLY A H    5  
ATOM 8661  H HA2  . GLY A 1 63 ? 1.195   2.494   -4.667  1.00 0.00 ? 59 GLY A HA2  5  
ATOM 8662  H HA3  . GLY A 1 63 ? 2.041   3.587   -3.579  1.00 0.00 ? 59 GLY A HA3  5  
ATOM 8663  N N    . HIS A 1 64 ? -0.524  4.305   -2.544  1.00 0.00 ? 60 HIS A N    5  
ATOM 8664  C CA   . HIS A 1 64 ? -1.596  4.270   -1.554  1.00 0.00 ? 60 HIS A CA   5  
ATOM 8665  C C    . HIS A 1 64 ? -2.840  3.670   -2.193  1.00 0.00 ? 60 HIS A C    5  
ATOM 8666  O O    . HIS A 1 64 ? -3.670  3.051   -1.530  1.00 0.00 ? 60 HIS A O    5  
ATOM 8667  C CB   . HIS A 1 64 ? -1.901  5.683   -1.046  1.00 0.00 ? 60 HIS A CB   5  
ATOM 8668  C CG   . HIS A 1 64 ? -1.056  6.123   0.112   1.00 0.00 ? 60 HIS A CG   5  
ATOM 8669  N ND1  . HIS A 1 64 ? 0.197   6.688   -0.008  1.00 0.00 ? 60 HIS A ND1  5  
ATOM 8670  C CD2  . HIS A 1 64 ? -1.323  6.096   1.440   1.00 0.00 ? 60 HIS A CD2  5  
ATOM 8671  C CE1  . HIS A 1 64 ? 0.635   6.982   1.224   1.00 0.00 ? 60 HIS A CE1  5  
ATOM 8672  N NE2  . HIS A 1 64 ? -0.250  6.642   2.137   1.00 0.00 ? 60 HIS A NE2  5  
ATOM 8673  H H    . HIS A 1 64 ? -0.194  5.178   -2.862  1.00 0.00 ? 60 HIS A H    5  
ATOM 8674  H HA   . HIS A 1 64 ? -1.283  3.649   -0.728  1.00 0.00 ? 60 HIS A HA   5  
ATOM 8675  H HB2  . HIS A 1 64 ? -1.743  6.380   -1.852  1.00 0.00 ? 60 HIS A HB2  5  
ATOM 8676  H HB3  . HIS A 1 64 ? -2.936  5.730   -0.737  1.00 0.00 ? 60 HIS A HB3  5  
ATOM 8677  H HD1  . HIS A 1 64 ? 0.687   6.846   -0.847  1.00 0.00 ? 60 HIS A HD1  5  
ATOM 8678  H HD2  . HIS A 1 64 ? -2.222  5.713   1.895   1.00 0.00 ? 60 HIS A HD2  5  
ATOM 8679  H HE1  . HIS A 1 64 ? 1.586   7.448   1.439   1.00 0.00 ? 60 HIS A HE1  5  
ATOM 8680  N N    . GLN A 1 65 ? -2.938  3.849   -3.506  1.00 0.00 ? 61 GLN A N    5  
ATOM 8681  C CA   . GLN A 1 65 ? -4.057  3.316   -4.270  1.00 0.00 ? 61 GLN A CA   5  
ATOM 8682  C C    . GLN A 1 65 ? -3.885  1.811   -4.419  1.00 0.00 ? 61 GLN A C    5  
ATOM 8683  O O    . GLN A 1 65 ? -4.765  1.040   -4.046  1.00 0.00 ? 61 GLN A O    5  
ATOM 8684  C CB   . GLN A 1 65 ? -4.145  3.974   -5.648  1.00 0.00 ? 61 GLN A CB   5  
ATOM 8685  C CG   . GLN A 1 65 ? -4.935  5.270   -5.662  1.00 0.00 ? 61 GLN A CG   5  
ATOM 8686  C CD   . GLN A 1 65 ? -4.581  6.153   -6.844  1.00 0.00 ? 61 GLN A CD   5  
ATOM 8687  O OE1  . GLN A 1 65 ? -4.169  5.669   -7.897  1.00 0.00 ? 61 GLN A OE1  5  
ATOM 8688  N NE2  . GLN A 1 65 ? -4.753  7.455   -6.685  1.00 0.00 ? 61 GLN A NE2  5  
ATOM 8689  H H    . GLN A 1 65 ? -2.210  4.330   -3.970  1.00 0.00 ? 61 GLN A H    5  
ATOM 8690  H HA   . GLN A 1 65 ? -4.963  3.516   -3.716  1.00 0.00 ? 61 GLN A HA   5  
ATOM 8691  H HB2  . GLN A 1 65 ? -3.144  4.186   -5.995  1.00 0.00 ? 61 GLN A HB2  5  
ATOM 8692  H HB3  . GLN A 1 65 ? -4.614  3.283   -6.334  1.00 0.00 ? 61 GLN A HB3  5  
ATOM 8693  H HG2  . GLN A 1 65 ? -5.989  5.036   -5.708  1.00 0.00 ? 61 GLN A HG2  5  
ATOM 8694  H HG3  . GLN A 1 65 ? -4.728  5.812   -4.751  1.00 0.00 ? 61 GLN A HG3  5  
ATOM 8695  H HE21 . GLN A 1 65 ? -5.104  7.774   -5.822  1.00 0.00 ? 61 GLN A HE21 5  
ATOM 8696  H HE22 . GLN A 1 65 ? -4.521  8.047   -7.427  1.00 0.00 ? 61 GLN A HE22 5  
ATOM 8697  N N    . LYS A 1 66 ? -2.758  1.434   -5.034  1.00 0.00 ? 62 LYS A N    5  
ATOM 8698  C CA   . LYS A 1 66 ? -2.369  0.030   -5.239  1.00 0.00 ? 62 LYS A CA   5  
ATOM 8699  C C    . LYS A 1 66 ? -2.815  -0.875  -4.092  1.00 0.00 ? 62 LYS A C    5  
ATOM 8700  O O    . LYS A 1 66 ? -3.443  -1.908  -4.322  1.00 0.00 ? 62 LYS A O    5  
ATOM 8701  C CB   . LYS A 1 66 ? -0.850  -0.081  -5.399  1.00 0.00 ? 62 LYS A CB   5  
ATOM 8702  C CG   . LYS A 1 66 ? -0.350  0.235   -6.796  1.00 0.00 ? 62 LYS A CG   5  
ATOM 8703  C CD   . LYS A 1 66 ? 1.154   0.043   -6.894  1.00 0.00 ? 62 LYS A CD   5  
ATOM 8704  C CE   . LYS A 1 66 ? 1.602   -0.111  -8.336  1.00 0.00 ? 62 LYS A CE   5  
ATOM 8705  N NZ   . LYS A 1 66 ? 3.075   -0.252  -8.442  1.00 0.00 ? 62 LYS A NZ   5  
ATOM 8706  H H    . LYS A 1 66 ? -2.230  2.144   -5.464  1.00 0.00 ? 62 LYS A H    5  
ATOM 8707  H HA   . LYS A 1 66 ? -2.838  -0.311  -6.148  1.00 0.00 ? 62 LYS A HA   5  
ATOM 8708  H HB2  . LYS A 1 66 ? -0.376  0.601   -4.709  1.00 0.00 ? 62 LYS A HB2  5  
ATOM 8709  H HB3  . LYS A 1 66 ? -0.550  -1.090  -5.155  1.00 0.00 ? 62 LYS A HB3  5  
ATOM 8710  H HG2  . LYS A 1 66 ? -0.834  -0.423  -7.501  1.00 0.00 ? 62 LYS A HG2  5  
ATOM 8711  H HG3  . LYS A 1 66 ? -0.591  1.260   -7.032  1.00 0.00 ? 62 LYS A HG3  5  
ATOM 8712  H HD2  . LYS A 1 66 ? 1.646   0.901   -6.464  1.00 0.00 ? 62 LYS A HD2  5  
ATOM 8713  H HD3  . LYS A 1 66 ? 1.430   -0.845  -6.344  1.00 0.00 ? 62 LYS A HD3  5  
ATOM 8714  H HE2  . LYS A 1 66 ? 1.133   -0.988  -8.755  1.00 0.00 ? 62 LYS A HE2  5  
ATOM 8715  H HE3  . LYS A 1 66 ? 1.293   0.762   -8.890  1.00 0.00 ? 62 LYS A HE3  5  
ATOM 8716  H HZ1  . LYS A 1 66 ? 3.338   -0.538  -9.404  1.00 0.00 ? 62 LYS A HZ1  5  
ATOM 8717  H HZ2  . LYS A 1 66 ? 3.421   -0.974  -7.767  1.00 0.00 ? 62 LYS A HZ2  5  
ATOM 8718  H HZ3  . LYS A 1 66 ? 3.535   0.664   -8.226  1.00 0.00 ? 62 LYS A HZ3  5  
ATOM 8719  N N    . ARG A 1 67 ? -2.472  -0.489  -2.866  1.00 0.00 ? 63 ARG A N    5  
ATOM 8720  C CA   . ARG A 1 67 ? -2.845  -1.262  -1.680  1.00 0.00 ? 63 ARG A CA   5  
ATOM 8721  C C    . ARG A 1 67 ? -4.353  -1.488  -1.623  1.00 0.00 ? 63 ARG A C    5  
ATOM 8722  O O    . ARG A 1 67 ? -4.819  -2.627  -1.554  1.00 0.00 ? 63 ARG A O    5  
ATOM 8723  C CB   . ARG A 1 67 ? -2.384  -0.547  -0.407  1.00 0.00 ? 63 ARG A CB   5  
ATOM 8724  C CG   . ARG A 1 67 ? -1.178  -1.194  0.254   1.00 0.00 ? 63 ARG A CG   5  
ATOM 8725  C CD   . ARG A 1 67 ? 0.110   -0.855  -0.477  1.00 0.00 ? 63 ARG A CD   5  
ATOM 8726  N NE   . ARG A 1 67 ? 1.248   -1.618  0.037   1.00 0.00 ? 63 ARG A NE   5  
ATOM 8727  C CZ   . ARG A 1 67 ? 1.873   -1.346  1.184   1.00 0.00 ? 63 ARG A CZ   5  
ATOM 8728  N NH1  . ARG A 1 67 ? 1.489   -0.331  1.944   1.00 0.00 ? 63 ARG A NH1  5  
ATOM 8729  N NH2  . ARG A 1 67 ? 2.897   -2.088  1.574   1.00 0.00 ? 63 ARG A NH2  5  
ATOM 8730  H H    . ARG A 1 67 ? -1.940  0.329   -2.761  1.00 0.00 ? 63 ARG A H    5  
ATOM 8731  H HA   . ARG A 1 67 ? -2.352  -2.221  -1.744  1.00 0.00 ? 63 ARG A HA   5  
ATOM 8732  H HB2  . ARG A 1 67 ? -2.129  0.473   -0.653  1.00 0.00 ? 63 ARG A HB2  5  
ATOM 8733  H HB3  . ARG A 1 67 ? -3.199  -0.544  0.303   1.00 0.00 ? 63 ARG A HB3  5  
ATOM 8734  H HG2  . ARG A 1 67 ? -1.106  -0.840  1.271   1.00 0.00 ? 63 ARG A HG2  5  
ATOM 8735  H HG3  . ARG A 1 67 ? -1.311  -2.266  0.255   1.00 0.00 ? 63 ARG A HG3  5  
ATOM 8736  H HD2  . ARG A 1 67 ? -0.016  -1.079  -1.525  1.00 0.00 ? 63 ARG A HD2  5  
ATOM 8737  H HD3  . ARG A 1 67 ? 0.312   0.200   -0.358  1.00 0.00 ? 63 ARG A HD3  5  
ATOM 8738  H HE   . ARG A 1 67 ? 1.562   -2.374  -0.505  1.00 0.00 ? 63 ARG A HE   5  
ATOM 8739  H HH11 . ARG A 1 67 ? 0.726   0.253   1.667   1.00 0.00 ? 63 ARG A HH11 5  
ATOM 8740  H HH12 . ARG A 1 67 ? 1.968   -0.148  2.816   1.00 0.00 ? 63 ARG A HH12 5  
ATOM 8741  H HH21 . ARG A 1 67 ? 3.214   -2.857  1.015   1.00 0.00 ? 63 ARG A HH21 5  
ATOM 8742  H HH22 . ARG A 1 67 ? 3.357   -1.880  2.454   1.00 0.00 ? 63 ARG A HH22 5  
ATOM 8743  N N    . ILE A 1 68 ? -5.099  -0.392  -1.658  1.00 0.00 ? 64 ILE A N    5  
ATOM 8744  C CA   . ILE A 1 68 ? -6.554  -0.442  -1.612  1.00 0.00 ? 64 ILE A CA   5  
ATOM 8745  C C    . ILE A 1 68 ? -7.110  -1.245  -2.790  1.00 0.00 ? 64 ILE A C    5  
ATOM 8746  O O    . ILE A 1 68 ? -7.991  -2.087  -2.614  1.00 0.00 ? 64 ILE A O    5  
ATOM 8747  C CB   . ILE A 1 68 ? -7.167  0.980   -1.611  1.00 0.00 ? 64 ILE A CB   5  
ATOM 8748  C CG1  . ILE A 1 68 ? -6.609  1.792   -0.438  1.00 0.00 ? 64 ILE A CG1  5  
ATOM 8749  C CG2  . ILE A 1 68 ? -8.690  0.914   -1.535  1.00 0.00 ? 64 ILE A CG2  5  
ATOM 8750  C CD1  . ILE A 1 68 ? -6.999  3.255   -0.465  1.00 0.00 ? 64 ILE A CD1  5  
ATOM 8751  H H    . ILE A 1 68 ? -4.648  0.477   -1.713  1.00 0.00 ? 64 ILE A H    5  
ATOM 8752  H HA   . ILE A 1 68 ? -6.838  -0.933  -0.693  1.00 0.00 ? 64 ILE A HA   5  
ATOM 8753  H HB   . ILE A 1 68 ? -6.897  1.466   -2.536  1.00 0.00 ? 64 ILE A HB   5  
ATOM 8754  H HG12 . ILE A 1 68 ? -6.973  1.371   0.487   1.00 0.00 ? 64 ILE A HG12 5  
ATOM 8755  H HG13 . ILE A 1 68 ? -5.530  1.737   -0.453  1.00 0.00 ? 64 ILE A HG13 5  
ATOM 8756  H HG21 . ILE A 1 68 ? -9.099  1.912   -1.620  1.00 0.00 ? 64 ILE A HG21 5  
ATOM 8757  H HG22 . ILE A 1 68 ? -8.985  0.485   -0.589  1.00 0.00 ? 64 ILE A HG22 5  
ATOM 8758  H HG23 . ILE A 1 68 ? -9.066  0.302   -2.342  1.00 0.00 ? 64 ILE A HG23 5  
ATOM 8759  H HD11 . ILE A 1 68 ? -6.637  3.708   -1.376  1.00 0.00 ? 64 ILE A HD11 5  
ATOM 8760  H HD12 . ILE A 1 68 ? -6.566  3.759   0.387   1.00 0.00 ? 64 ILE A HD12 5  
ATOM 8761  H HD13 . ILE A 1 68 ? -8.075  3.341   -0.424  1.00 0.00 ? 64 ILE A HD13 5  
ATOM 8762  N N    . ALA A 1 69 ? -6.571  -0.996  -3.980  1.00 0.00 ? 65 ALA A N    5  
ATOM 8763  C CA   . ALA A 1 69 ? -7.007  -1.685  -5.193  1.00 0.00 ? 65 ALA A CA   5  
ATOM 8764  C C    . ALA A 1 69 ? -6.806  -3.197  -5.082  1.00 0.00 ? 65 ALA A C    5  
ATOM 8765  O O    . ALA A 1 69 ? -7.720  -3.972  -5.366  1.00 0.00 ? 65 ALA A O    5  
ATOM 8766  C CB   . ALA A 1 69 ? -6.260  -1.139  -6.402  1.00 0.00 ? 65 ALA A CB   5  
ATOM 8767  H H    . ALA A 1 69 ? -5.864  -0.314  -4.047  1.00 0.00 ? 65 ALA A H    5  
ATOM 8768  H HA   . ALA A 1 69 ? -8.059  -1.482  -5.330  1.00 0.00 ? 65 ALA A HA   5  
ATOM 8769  H HB1  . ALA A 1 69 ? -6.366  -0.065  -6.437  1.00 0.00 ? 65 ALA A HB1  5  
ATOM 8770  H HB2  . ALA A 1 69 ? -6.666  -1.571  -7.303  1.00 0.00 ? 65 ALA A HB2  5  
ATOM 8771  H HB3  . ALA A 1 69 ? -5.214  -1.394  -6.321  1.00 0.00 ? 65 ALA A HB3  5  
ATOM 8772  N N    . TYR A 1 70 ? -5.612  -3.604  -4.663  1.00 0.00 ? 66 TYR A N    5  
ATOM 8773  C CA   . TYR A 1 70 ? -5.283  -5.019  -4.505  1.00 0.00 ? 66 TYR A CA   5  
ATOM 8774  C C    . TYR A 1 70 ? -6.256  -5.684  -3.531  1.00 0.00 ? 66 TYR A C    5  
ATOM 8775  O O    . TYR A 1 70 ? -6.837  -6.732  -3.825  1.00 0.00 ? 66 TYR A O    5  
ATOM 8776  C CB   . TYR A 1 70 ? -3.837  -5.160  -4.001  1.00 0.00 ? 66 TYR A CB   5  
ATOM 8777  C CG   . TYR A 1 70 ? -3.263  -6.562  -4.060  1.00 0.00 ? 66 TYR A CG   5  
ATOM 8778  C CD1  . TYR A 1 70 ? -3.695  -7.492  -4.999  1.00 0.00 ? 66 TYR A CD1  5  
ATOM 8779  C CD2  . TYR A 1 70 ? -2.271  -6.945  -3.167  1.00 0.00 ? 66 TYR A CD2  5  
ATOM 8780  C CE1  . TYR A 1 70 ? -3.153  -8.763  -5.043  1.00 0.00 ? 66 TYR A CE1  5  
ATOM 8781  C CE2  . TYR A 1 70 ? -1.724  -8.213  -3.204  1.00 0.00 ? 66 TYR A CE2  5  
ATOM 8782  C CZ   . TYR A 1 70 ? -2.170  -9.120  -4.144  1.00 0.00 ? 66 TYR A CZ   5  
ATOM 8783  O OH   . TYR A 1 70 ? -1.629  -10.385 -4.190  1.00 0.00 ? 66 TYR A OH   5  
ATOM 8784  H H    . TYR A 1 70 ? -4.925  -2.928  -4.455  1.00 0.00 ? 66 TYR A H    5  
ATOM 8785  H HA   . TYR A 1 70 ? -5.371  -5.491  -5.469  1.00 0.00 ? 66 TYR A HA   5  
ATOM 8786  H HB2  . TYR A 1 70 ? -3.197  -4.525  -4.592  1.00 0.00 ? 66 TYR A HB2  5  
ATOM 8787  H HB3  . TYR A 1 70 ? -3.797  -4.835  -2.971  1.00 0.00 ? 66 TYR A HB3  5  
ATOM 8788  H HD1  . TYR A 1 70 ? -4.464  -7.213  -5.702  1.00 0.00 ? 66 TYR A HD1  5  
ATOM 8789  H HD2  . TYR A 1 70 ? -1.925  -6.233  -2.432  1.00 0.00 ? 66 TYR A HD2  5  
ATOM 8790  H HE1  . TYR A 1 70 ? -3.500  -9.472  -5.781  1.00 0.00 ? 66 TYR A HE1  5  
ATOM 8791  H HE2  . TYR A 1 70 ? -0.952  -8.491  -2.498  1.00 0.00 ? 66 TYR A HE2  5  
ATOM 8792  H HH   . TYR A 1 70 ? -1.470  -10.699 -3.291  1.00 0.00 ? 66 TYR A HH   5  
ATOM 8793  N N    . SER A 1 71 ? -6.439  -5.052  -2.382  1.00 0.00 ? 67 SER A N    5  
ATOM 8794  C CA   . SER A 1 71 ? -7.343  -5.559  -1.359  1.00 0.00 ? 67 SER A CA   5  
ATOM 8795  C C    . SER A 1 71 ? -8.803  -5.553  -1.829  1.00 0.00 ? 67 SER A C    5  
ATOM 8796  O O    . SER A 1 71 ? -9.599  -6.387  -1.392  1.00 0.00 ? 67 SER A O    5  
ATOM 8797  C CB   . SER A 1 71 ? -7.186  -4.746  -0.077  1.00 0.00 ? 67 SER A CB   5  
ATOM 8798  O OG   . SER A 1 71 ? -5.930  -4.997  0.523   1.00 0.00 ? 67 SER A OG   5  
ATOM 8799  H H    . SER A 1 71 ? -5.927  -4.230  -2.204  1.00 0.00 ? 67 SER A H    5  
ATOM 8800  H HA   . SER A 1 71 ? -7.057  -6.580  -1.155  1.00 0.00 ? 67 SER A HA   5  
ATOM 8801  H HB2  . SER A 1 71 ? -7.255  -3.695  -0.308  1.00 0.00 ? 67 SER A HB2  5  
ATOM 8802  H HB3  . SER A 1 71 ? -7.966  -5.019  0.618   1.00 0.00 ? 67 SER A HB3  5  
ATOM 8803  H HG   . SER A 1 71 ? -6.033  -5.652  1.217   1.00 0.00 ? 67 SER A HG   5  
ATOM 8804  N N    . LEU A 1 72 ? -9.157  -4.620  -2.713  1.00 0.00 ? 68 LEU A N    5  
ATOM 8805  C CA   . LEU A 1 72 ? -10.518 -4.538  -3.238  1.00 0.00 ? 68 LEU A CA   5  
ATOM 8806  C C    . LEU A 1 72 ? -10.844 -5.762  -4.082  1.00 0.00 ? 68 LEU A C    5  
ATOM 8807  O O    . LEU A 1 72 ? -11.963 -6.277  -4.041  1.00 0.00 ? 68 LEU A O    5  
ATOM 8808  C CB   . LEU A 1 72 ? -10.696 -3.278  -4.090  1.00 0.00 ? 68 LEU A CB   5  
ATOM 8809  C CG   . LEU A 1 72 ? -11.269 -2.060  -3.361  1.00 0.00 ? 68 LEU A CG   5  
ATOM 8810  C CD1  . LEU A 1 72 ? -11.190 -0.829  -4.250  1.00 0.00 ? 68 LEU A CD1  5  
ATOM 8811  C CD2  . LEU A 1 72 ? -12.710 -2.318  -2.940  1.00 0.00 ? 68 LEU A CD2  5  
ATOM 8812  H H    . LEU A 1 72 ? -8.499  -3.954  -3.013  1.00 0.00 ? 68 LEU A H    5  
ATOM 8813  H HA   . LEU A 1 72 ? -11.198 -4.496  -2.399  1.00 0.00 ? 68 LEU A HA   5  
ATOM 8814  H HB2  . LEU A 1 72 ? -9.732  -3.006  -4.495  1.00 0.00 ? 68 LEU A HB2  5  
ATOM 8815  H HB3  . LEU A 1 72 ? -11.354 -3.517  -4.911  1.00 0.00 ? 68 LEU A HB3  5  
ATOM 8816  H HG   . LEU A 1 72 ? -10.685 -1.869  -2.471  1.00 0.00 ? 68 LEU A HG   5  
ATOM 8817  H HD11 . LEU A 1 72 ? -11.592 0.023   -3.722  1.00 0.00 ? 68 LEU A HD11 5  
ATOM 8818  H HD12 . LEU A 1 72 ? -11.762 -0.997  -5.150  1.00 0.00 ? 68 LEU A HD12 5  
ATOM 8819  H HD13 . LEU A 1 72 ? -10.158 -0.637  -4.510  1.00 0.00 ? 68 LEU A HD13 5  
ATOM 8820  H HD21 . LEU A 1 72 ? -12.729 -3.053  -2.148  1.00 0.00 ? 68 LEU A HD21 5  
ATOM 8821  H HD22 . LEU A 1 72 ? -13.271 -2.686  -3.786  1.00 0.00 ? 68 LEU A HD22 5  
ATOM 8822  H HD23 . LEU A 1 72 ? -13.152 -1.397  -2.588  1.00 0.00 ? 68 LEU A HD23 5  
ATOM 8823  N N    . LEU A 1 73 ? -9.851  -6.224  -4.841  1.00 0.00 ? 69 LEU A N    5  
ATOM 8824  C CA   . LEU A 1 73 ? -10.012 -7.392  -5.704  1.00 0.00 ? 69 LEU A CA   5  
ATOM 8825  C C    . LEU A 1 73 ? -10.391 -8.612  -4.876  1.00 0.00 ? 69 LEU A C    5  
ATOM 8826  O O    . LEU A 1 73 ? -11.199 -9.439  -5.298  1.00 0.00 ? 69 LEU A O    5  
ATOM 8827  C CB   . LEU A 1 73 ? -8.719  -7.667  -6.476  1.00 0.00 ? 69 LEU A CB   5  
ATOM 8828  C CG   . LEU A 1 73 ? -8.219  -6.515  -7.351  1.00 0.00 ? 69 LEU A CG   5  
ATOM 8829  C CD1  . LEU A 1 73 ? -6.818  -6.810  -7.861  1.00 0.00 ? 69 LEU A CD1  5  
ATOM 8830  C CD2  . LEU A 1 73 ? -9.168  -6.269  -8.516  1.00 0.00 ? 69 LEU A CD2  5  
ATOM 8831  H H    . LEU A 1 73 ? -8.983  -5.765  -4.818  1.00 0.00 ? 69 LEU A H    5  
ATOM 8832  H HA   . LEU A 1 73 ? -10.807 -7.183  -6.406  1.00 0.00 ? 69 LEU A HA   5  
ATOM 8833  H HB2  . LEU A 1 73 ? -7.945  -7.908  -5.762  1.00 0.00 ? 69 LEU A HB2  5  
ATOM 8834  H HB3  . LEU A 1 73 ? -8.879  -8.527  -7.110  1.00 0.00 ? 69 LEU A HB3  5  
ATOM 8835  H HG   . LEU A 1 73 ? -8.176  -5.614  -6.757  1.00 0.00 ? 69 LEU A HG   5  
ATOM 8836  H HD11 . LEU A 1 73 ? -6.822  -7.742  -8.405  1.00 0.00 ? 69 LEU A HD11 5  
ATOM 8837  H HD12 . LEU A 1 73 ? -6.140  -6.884  -7.026  1.00 0.00 ? 69 LEU A HD12 5  
ATOM 8838  H HD13 . LEU A 1 73 ? -6.499  -6.012  -8.517  1.00 0.00 ? 69 LEU A HD13 5  
ATOM 8839  H HD21 . LEU A 1 73 ? -10.127 -5.950  -8.137  1.00 0.00 ? 69 LEU A HD21 5  
ATOM 8840  H HD22 . LEU A 1 73 ? -9.288  -7.181  -9.082  1.00 0.00 ? 69 LEU A HD22 5  
ATOM 8841  H HD23 . LEU A 1 73 ? -8.760  -5.500  -9.156  1.00 0.00 ? 69 LEU A HD23 5  
ATOM 8842  N N    . GLY A 1 74 ? -9.806  -8.706  -3.688  1.00 0.00 ? 70 GLY A N    5  
ATOM 8843  C CA   . GLY A 1 74 ? -10.095 -9.815  -2.804  1.00 0.00 ? 70 GLY A CA   5  
ATOM 8844  C C    . GLY A 1 74 ? -11.508 -9.747  -2.262  1.00 0.00 ? 70 GLY A C    5  
ATOM 8845  O O    . GLY A 1 74 ? -12.204 -10.757 -2.199  1.00 0.00 ? 70 GLY A O    5  
ATOM 8846  H H    . GLY A 1 74 ? -9.171  -8.013  -3.411  1.00 0.00 ? 70 GLY A H    5  
ATOM 8847  H HA2  . GLY A 1 74 ? -9.972  -10.740 -3.347  1.00 0.00 ? 70 GLY A HA2  5  
ATOM 8848  H HA3  . GLY A 1 74 ? -9.401  -9.795  -1.977  1.00 0.00 ? 70 GLY A HA3  5  
ATOM 8849  N N    . LEU A 1 75 ? -11.933 -8.546  -1.881  1.00 0.00 ? 71 LEU A N    5  
ATOM 8850  C CA   . LEU A 1 75 ? -13.275 -8.339  -1.349  1.00 0.00 ? 71 LEU A CA   5  
ATOM 8851  C C    . LEU A 1 75 ? -14.335 -8.688  -2.387  1.00 0.00 ? 71 LEU A C    5  
ATOM 8852  O O    . LEU A 1 75 ? -15.332 -9.343  -2.074  1.00 0.00 ? 71 LEU A O    5  
ATOM 8853  C CB   . LEU A 1 75 ? -13.462 -6.889  -0.897  1.00 0.00 ? 71 LEU A CB   5  
ATOM 8854  C CG   . LEU A 1 75 ? -13.155 -6.610  0.576   1.00 0.00 ? 71 LEU A CG   5  
ATOM 8855  C CD1  . LEU A 1 75 ? -13.523 -5.178  0.929   1.00 0.00 ? 71 LEU A CD1  5  
ATOM 8856  C CD2  . LEU A 1 75 ? -13.901 -7.586  1.475   1.00 0.00 ? 71 LEU A CD2  5  
ATOM 8857  H H    . LEU A 1 75 ? -11.320 -7.781  -1.951  1.00 0.00 ? 71 LEU A H    5  
ATOM 8858  H HA   . LEU A 1 75 ? -13.397 -8.990  -0.497  1.00 0.00 ? 71 LEU A HA   5  
ATOM 8859  H HB2  . LEU A 1 75 ? -12.823 -6.262  -1.501  1.00 0.00 ? 71 LEU A HB2  5  
ATOM 8860  H HB3  . LEU A 1 75 ? -14.487 -6.610  -1.084  1.00 0.00 ? 71 LEU A HB3  5  
ATOM 8861  H HG   . LEU A 1 75 ? -12.096 -6.735  0.747   1.00 0.00 ? 71 LEU A HG   5  
ATOM 8862  H HD11 . LEU A 1 75 ? -13.028 -4.500  0.249   1.00 0.00 ? 71 LEU A HD11 5  
ATOM 8863  H HD12 . LEU A 1 75 ? -13.209 -4.964  1.940   1.00 0.00 ? 71 LEU A HD12 5  
ATOM 8864  H HD13 . LEU A 1 75 ? -14.593 -5.050  0.851   1.00 0.00 ? 71 LEU A HD13 5  
ATOM 8865  H HD21 . LEU A 1 75 ? -13.399 -8.543  1.461   1.00 0.00 ? 71 LEU A HD21 5  
ATOM 8866  H HD22 . LEU A 1 75 ? -14.912 -7.705  1.114   1.00 0.00 ? 71 LEU A HD22 5  
ATOM 8867  H HD23 . LEU A 1 75 ? -13.921 -7.203  2.484   1.00 0.00 ? 71 LEU A HD23 5  
ATOM 8868  N N    . LYS A 1 76 ? -14.113 -8.251  -3.622  1.00 0.00 ? 72 LYS A N    5  
ATOM 8869  C CA   . LYS A 1 76 ? -15.047 -8.521  -4.707  1.00 0.00 ? 72 LYS A CA   5  
ATOM 8870  C C    . LYS A 1 76 ? -15.148 -10.023 -4.960  1.00 0.00 ? 72 LYS A C    5  
ATOM 8871  O O    . LYS A 1 76 ? -16.238 -10.555 -5.173  1.00 0.00 ? 72 LYS A O    5  
ATOM 8872  C CB   . LYS A 1 76 ? -14.616 -7.786  -5.981  1.00 0.00 ? 72 LYS A CB   5  
ATOM 8873  C CG   . LYS A 1 76 ? -14.703 -6.270  -5.867  1.00 0.00 ? 72 LYS A CG   5  
ATOM 8874  C CD   . LYS A 1 76 ? -14.202 -5.584  -7.130  1.00 0.00 ? 72 LYS A CD   5  
ATOM 8875  C CE   . LYS A 1 76 ? -14.320 -4.069  -7.038  1.00 0.00 ? 72 LYS A CE   5  
ATOM 8876  N NZ   . LYS A 1 76 ? -15.728 -3.607  -7.165  1.00 0.00 ? 72 LYS A NZ   5  
ATOM 8877  H H    . LYS A 1 76 ? -13.296 -7.734  -3.809  1.00 0.00 ? 72 LYS A H    5  
ATOM 8878  H HA   . LYS A 1 76 ? -16.017 -8.157  -4.404  1.00 0.00 ? 72 LYS A HA   5  
ATOM 8879  H HB2  . LYS A 1 76 ? -13.594 -8.051  -6.207  1.00 0.00 ? 72 LYS A HB2  5  
ATOM 8880  H HB3  . LYS A 1 76 ? -15.249 -8.101  -6.797  1.00 0.00 ? 72 LYS A HB3  5  
ATOM 8881  H HG2  . LYS A 1 76 ? -15.732 -5.989  -5.702  1.00 0.00 ? 72 LYS A HG2  5  
ATOM 8882  H HG3  . LYS A 1 76 ? -14.102 -5.946  -5.030  1.00 0.00 ? 72 LYS A HG3  5  
ATOM 8883  H HD2  . LYS A 1 76 ? -13.165 -5.843  -7.281  1.00 0.00 ? 72 LYS A HD2  5  
ATOM 8884  H HD3  . LYS A 1 76 ? -14.786 -5.930  -7.970  1.00 0.00 ? 72 LYS A HD3  5  
ATOM 8885  H HE2  . LYS A 1 76 ? -13.932 -3.748  -6.083  1.00 0.00 ? 72 LYS A HE2  5  
ATOM 8886  H HE3  . LYS A 1 76 ? -13.732 -3.627  -7.830  1.00 0.00 ? 72 LYS A HE3  5  
ATOM 8887  H HZ1  . LYS A 1 76 ? -16.155 -3.990  -8.033  1.00 0.00 ? 72 LYS A HZ1  5  
ATOM 8888  H HZ2  . LYS A 1 76 ? -15.765 -2.567  -7.206  1.00 0.00 ? 72 LYS A HZ2  5  
ATOM 8889  H HZ3  . LYS A 1 76 ? -16.290 -3.930  -6.347  1.00 0.00 ? 72 LYS A HZ3  5  
ATOM 8890  N N    . ASP A 1 77 ? -14.009 -10.702 -4.928  1.00 0.00 ? 73 ASP A N    5  
ATOM 8891  C CA   . ASP A 1 77 ? -13.970 -12.146 -5.135  1.00 0.00 ? 73 ASP A CA   5  
ATOM 8892  C C    . ASP A 1 77 ? -14.617 -12.877 -3.960  1.00 0.00 ? 73 ASP A C    5  
ATOM 8893  O O    . ASP A 1 77 ? -15.332 -13.864 -4.143  1.00 0.00 ? 73 ASP A O    5  
ATOM 8894  C CB   . ASP A 1 77 ? -12.526 -12.620 -5.315  1.00 0.00 ? 73 ASP A CB   5  
ATOM 8895  C CG   . ASP A 1 77 ? -12.277 -13.215 -6.685  1.00 0.00 ? 73 ASP A CG   5  
ATOM 8896  O OD1  . ASP A 1 77 ? -12.346 -12.467 -7.687  1.00 0.00 ? 73 ASP A OD1  5  
ATOM 8897  O OD2  . ASP A 1 77 ? -12.003 -14.429 -6.770  1.00 0.00 ? 73 ASP A OD2  5  
ATOM 8898  H H    . ASP A 1 77 ? -13.167 -10.216 -4.796  1.00 0.00 ? 73 ASP A H    5  
ATOM 8899  H HA   . ASP A 1 77 ? -14.527 -12.368 -6.032  1.00 0.00 ? 73 ASP A HA   5  
ATOM 8900  H HB2  . ASP A 1 77 ? -11.860 -11.780 -5.182  1.00 0.00 ? 73 ASP A HB2  5  
ATOM 8901  H HB3  . ASP A 1 77 ? -12.306 -13.370 -4.570  1.00 0.00 ? 73 ASP A HB3  5  
ATOM 8902  N N    . GLN A 1 78 ? -14.374 -12.373 -2.755  1.00 0.00 ? 74 GLN A N    5  
ATOM 8903  C CA   . GLN A 1 78 ? -14.925 -12.971 -1.543  1.00 0.00 ? 74 GLN A CA   5  
ATOM 8904  C C    . GLN A 1 78 ? -16.448 -12.904 -1.525  1.00 0.00 ? 74 GLN A C    5  
ATOM 8905  O O    . GLN A 1 78 ? -17.109 -13.878 -1.178  1.00 0.00 ? 74 GLN A O    5  
ATOM 8906  C CB   . GLN A 1 78 ? -14.376 -12.275 -0.299  1.00 0.00 ? 74 GLN A CB   5  
ATOM 8907  C CG   . GLN A 1 78 ? -13.189 -12.988 0.331   1.00 0.00 ? 74 GLN A CG   5  
ATOM 8908  C CD   . GLN A 1 78 ? -12.828 -12.419 1.689   1.00 0.00 ? 74 GLN A CD   5  
ATOM 8909  O OE1  . GLN A 1 78 ? -13.686 -11.912 2.414   1.00 0.00 ? 74 GLN A OE1  5  
ATOM 8910  N NE2  . GLN A 1 78 ? -11.560 -12.511 2.050   1.00 0.00 ? 74 GLN A NE2  5  
ATOM 8911  H H    . GLN A 1 78 ? -13.795 -11.582 -2.677  1.00 0.00 ? 74 GLN A H    5  
ATOM 8912  H HA   . GLN A 1 78 ? -14.625 -14.008 -1.522  1.00 0.00 ? 74 GLN A HA   5  
ATOM 8913  H HB2  . GLN A 1 78 ? -14.066 -11.277 -0.568  1.00 0.00 ? 74 GLN A HB2  5  
ATOM 8914  H HB3  . GLN A 1 78 ? -15.162 -12.211 0.438   1.00 0.00 ? 74 GLN A HB3  5  
ATOM 8915  H HG2  . GLN A 1 78 ? -13.433 -14.033 0.448   1.00 0.00 ? 74 GLN A HG2  5  
ATOM 8916  H HG3  . GLN A 1 78 ? -12.337 -12.888 -0.325  1.00 0.00 ? 74 GLN A HG3  5  
ATOM 8917  H HE21 . GLN A 1 78 ? -10.930 -12.940 1.429   1.00 0.00 ? 74 GLN A HE21 5  
ATOM 8918  H HE22 . GLN A 1 78 ? -11.297 -12.139 2.919   1.00 0.00 ? 74 GLN A HE22 5  
ATOM 8919  N N    . VAL A 1 79 ? -17.008 -11.763 -1.922  1.00 0.00 ? 75 VAL A N    5  
ATOM 8920  C CA   . VAL A 1 79 ? -18.458 -11.593 -1.925  1.00 0.00 ? 75 VAL A CA   5  
ATOM 8921  C C    . VAL A 1 79 ? -19.105 -12.411 -3.045  1.00 0.00 ? 75 VAL A C    5  
ATOM 8922  O O    . VAL A 1 79 ? -20.324 -12.587 -3.083  1.00 0.00 ? 75 VAL A O    5  
ATOM 8923  C CB   . VAL A 1 79 ? -18.852 -10.098 -2.056  1.00 0.00 ? 75 VAL A CB   5  
ATOM 8924  C CG1  . VAL A 1 79 ? -18.749 -9.614  -3.495  1.00 0.00 ? 75 VAL A CG1  5  
ATOM 8925  C CG2  . VAL A 1 79 ? -20.251 -9.858  -1.505  1.00 0.00 ? 75 VAL A CG2  5  
ATOM 8926  H H    . VAL A 1 79 ? -16.442 -11.020 -2.230  1.00 0.00 ? 75 VAL A H    5  
ATOM 8927  H HA   . VAL A 1 79 ? -18.831 -11.955 -0.978  1.00 0.00 ? 75 VAL A HA   5  
ATOM 8928  H HB   . VAL A 1 79 ? -18.158 -9.519  -1.463  1.00 0.00 ? 75 VAL A HB   5  
ATOM 8929  H HG11 . VAL A 1 79 ? -19.431 -10.177 -4.115  1.00 0.00 ? 75 VAL A HG11 5  
ATOM 8930  H HG12 . VAL A 1 79 ? -17.739 -9.755  -3.851  1.00 0.00 ? 75 VAL A HG12 5  
ATOM 8931  H HG13 . VAL A 1 79 ? -19.003 -8.565  -3.541  1.00 0.00 ? 75 VAL A HG13 5  
ATOM 8932  H HG21 . VAL A 1 79 ? -20.267 -10.090 -0.450  1.00 0.00 ? 75 VAL A HG21 5  
ATOM 8933  H HG22 . VAL A 1 79 ? -20.955 -10.491 -2.024  1.00 0.00 ? 75 VAL A HG22 5  
ATOM 8934  H HG23 . VAL A 1 79 ? -20.523 -8.823  -1.650  1.00 0.00 ? 75 VAL A HG23 5  
ATOM 8935  N N    . ASN A 1 80 ? -18.278 -12.920 -3.950  1.00 0.00 ? 76 ASN A N    5  
ATOM 8936  C CA   . ASN A 1 80 ? -18.765 -13.729 -5.058  1.00 0.00 ? 76 ASN A CA   5  
ATOM 8937  C C    . ASN A 1 80 ? -18.677 -15.210 -4.715  1.00 0.00 ? 76 ASN A C    5  
ATOM 8938  O O    . ASN A 1 80 ? -19.132 -16.064 -5.477  1.00 0.00 ? 76 ASN A O    5  
ATOM 8939  C CB   . ASN A 1 80 ? -17.970 -13.441 -6.336  1.00 0.00 ? 76 ASN A CB   5  
ATOM 8940  C CG   . ASN A 1 80 ? -18.626 -12.382 -7.202  1.00 0.00 ? 76 ASN A CG   5  
ATOM 8941  O OD1  . ASN A 1 80 ? -19.508 -12.681 -8.006  1.00 0.00 ? 76 ASN A OD1  5  
ATOM 8942  N ND2  . ASN A 1 80 ? -18.196 -11.139 -7.052  1.00 0.00 ? 76 ASN A ND2  5  
ATOM 8943  H H    . ASN A 1 80 ? -17.316 -12.749 -3.868  1.00 0.00 ? 76 ASN A H    5  
ATOM 8944  H HA   . ASN A 1 80 ? -19.801 -13.472 -5.224  1.00 0.00 ? 76 ASN A HA   5  
ATOM 8945  H HB2  . ASN A 1 80 ? -16.982 -13.098 -6.068  1.00 0.00 ? 76 ASN A HB2  5  
ATOM 8946  H HB3  . ASN A 1 80 ? -17.887 -14.351 -6.912  1.00 0.00 ? 76 ASN A HB3  5  
ATOM 8947  H HD21 . ASN A 1 80 ? -17.482 -10.968 -6.393  1.00 0.00 ? 76 ASN A HD21 5  
ATOM 8948  H HD22 . ASN A 1 80 ? -18.603 -10.440 -7.602  1.00 0.00 ? 76 ASN A HD22 5  
ATOM 8949  N N    . THR A 1 81 ? -18.094 -15.509 -3.563  1.00 0.00 ? 77 THR A N    5  
ATOM 8950  C CA   . THR A 1 81 ? -17.951 -16.884 -3.120  1.00 0.00 ? 77 THR A CA   5  
ATOM 8951  C C    . THR A 1 81 ? -19.219 -17.349 -2.407  1.00 0.00 ? 77 THR A C    5  
ATOM 8952  O O    . THR A 1 81 ? -19.726 -16.668 -1.515  1.00 0.00 ? 77 THR A O    5  
ATOM 8953  C CB   . THR A 1 81 ? -16.736 -17.045 -2.181  1.00 0.00 ? 77 THR A CB   5  
ATOM 8954  O OG1  . THR A 1 81 ? -15.553 -16.543 -2.820  1.00 0.00 ? 77 THR A OG1  5  
ATOM 8955  C CG2  . THR A 1 81 ? -16.527 -18.505 -1.804  1.00 0.00 ? 77 THR A CG2  5  
ATOM 8956  H H    . THR A 1 81 ? -17.769 -14.785 -2.986  1.00 0.00 ? 77 THR A H    5  
ATOM 8957  H HA   . THR A 1 81 ? -17.792 -17.502 -3.992  1.00 0.00 ? 77 THR A HA   5  
ATOM 8958  H HB   . THR A 1 81 ? -16.919 -16.478 -1.279  1.00 0.00 ? 77 THR A HB   5  
ATOM 8959  H HG1  . THR A 1 81 ? -15.771 -15.752 -3.329  1.00 0.00 ? 77 THR A HG1  5  
ATOM 8960  H HG21 . THR A 1 81 ? -17.395 -18.869 -1.274  1.00 0.00 ? 77 THR A HG21 5  
ATOM 8961  H HG22 . THR A 1 81 ? -15.656 -18.591 -1.171  1.00 0.00 ? 77 THR A HG22 5  
ATOM 8962  H HG23 . THR A 1 81 ? -16.380 -19.091 -2.699  1.00 0.00 ? 77 THR A HG23 5  
ATOM 8963  N N    . VAL A 1 82 ? -19.736 -18.496 -2.822  1.00 0.00 ? 78 VAL A N    5  
ATOM 8964  C CA   . VAL A 1 82 ? -20.942 -19.052 -2.228  1.00 0.00 ? 78 VAL A CA   5  
ATOM 8965  C C    . VAL A 1 82 ? -20.614 -19.784 -0.931  1.00 0.00 ? 78 VAL A C    5  
ATOM 8966  O O    . VAL A 1 82 ? -21.411 -19.695 0.024   1.00 0.00 ? 78 VAL A O    5  
ATOM 8967  C CB   . VAL A 1 82 ? -21.676 -20.009 -3.197  1.00 0.00 ? 78 VAL A CB   5  
ATOM 8968  C CG1  . VAL A 1 82 ? -22.329 -19.225 -4.325  1.00 0.00 ? 78 VAL A CG1  5  
ATOM 8969  C CG2  . VAL A 1 82 ? -20.724 -21.059 -3.758  1.00 0.00 ? 78 VAL A CG2  5  
ATOM 8970  O OXT  . VAL A 1 82 ? -19.546 -20.431 -0.865  1.00 0.00 ? 78 VAL A OXT  5  
ATOM 8971  H H    . VAL A 1 82 ? -19.286 -18.986 -3.539  1.00 0.00 ? 78 VAL A H    5  
ATOM 8972  H HA   . VAL A 1 82 ? -21.606 -18.229 -2.001  1.00 0.00 ? 78 VAL A HA   5  
ATOM 8973  H HB   . VAL A 1 82 ? -22.454 -20.518 -2.646  1.00 0.00 ? 78 VAL A HB   5  
ATOM 8974  H HG11 . VAL A 1 82 ? -23.027 -18.514 -3.911  1.00 0.00 ? 78 VAL A HG11 5  
ATOM 8975  H HG12 . VAL A 1 82 ? -22.852 -19.906 -4.980  1.00 0.00 ? 78 VAL A HG12 5  
ATOM 8976  H HG13 . VAL A 1 82 ? -21.569 -18.700 -4.885  1.00 0.00 ? 78 VAL A HG13 5  
ATOM 8977  H HG21 . VAL A 1 82 ? -19.961 -20.575 -4.349  1.00 0.00 ? 78 VAL A HG21 5  
ATOM 8978  H HG22 . VAL A 1 82 ? -21.276 -21.750 -4.379  1.00 0.00 ? 78 VAL A HG22 5  
ATOM 8979  H HG23 . VAL A 1 82 ? -20.261 -21.597 -2.945  1.00 0.00 ? 78 VAL A HG23 5  
ATOM 8980  N N    . GLY B 2 18 ? 6.792   4.830   10.901  1.00 0.00 ? 28 GLY B N    5  
ATOM 8981  C CA   . GLY B 2 18 ? 7.991   4.988   10.047  1.00 0.00 ? 28 GLY B CA   5  
ATOM 8982  C C    . GLY B 2 18 ? 8.814   3.722   10.008  1.00 0.00 ? 28 GLY B C    5  
ATOM 8983  O O    . GLY B 2 18 ? 8.571   2.801   10.787  1.00 0.00 ? 28 GLY B O    5  
ATOM 8984  H H    . GLY B 2 18 ? 6.337   5.748   11.057  1.00 0.00 ? 28 GLY B H    5  
ATOM 8985  H HA2  . GLY B 2 18 ? 7.681   5.236   9.043   1.00 0.00 ? 28 GLY B HA2  5  
ATOM 8986  H HA3  . GLY B 2 18 ? 8.599   5.791   10.438  1.00 0.00 ? 28 GLY B HA3  5  
ATOM 8987  N N    . MET B 2 19 ? 9.785   3.672   9.111   1.00 0.00 ? 29 MET B N    5  
ATOM 8988  C CA   . MET B 2 19 ? 10.640  2.504   8.984   1.00 0.00 ? 29 MET B CA   5  
ATOM 8989  C C    . MET B 2 19 ? 12.091  2.921   8.766   1.00 0.00 ? 29 MET B C    5  
ATOM 8990  O O    . MET B 2 19 ? 12.912  2.132   8.297   1.00 0.00 ? 29 MET B O    5  
ATOM 8991  C CB   . MET B 2 19 ? 10.161  1.594   7.843   1.00 0.00 ? 29 MET B CB   5  
ATOM 8992  C CG   . MET B 2 19 ? 10.229  2.226   6.459   1.00 0.00 ? 29 MET B CG   5  
ATOM 8993  S SD   . MET B 2 19 ? 8.821   3.296   6.111   1.00 0.00 ? 29 MET B SD   5  
ATOM 8994  C CE   . MET B 2 19 ? 9.026   3.545   4.351   1.00 0.00 ? 29 MET B CE   5  
ATOM 8995  H H    . MET B 2 19 ? 9.935   4.449   8.515   1.00 0.00 ? 29 MET B H    5  
ATOM 8996  H HA   . MET B 2 19 ? 10.579  1.954   9.912   1.00 0.00 ? 29 MET B HA   5  
ATOM 8997  H HB2  . MET B 2 19 ? 10.768  0.702   7.833   1.00 0.00 ? 29 MET B HB2  5  
ATOM 8998  H HB3  . MET B 2 19 ? 9.135   1.313   8.034   1.00 0.00 ? 29 MET B HB3  5  
ATOM 8999  H HG2  . MET B 2 19 ? 11.133  2.812   6.391   1.00 0.00 ? 29 MET B HG2  5  
ATOM 9000  H HG3  . MET B 2 19 ? 10.256  1.438   5.720   1.00 0.00 ? 29 MET B HG3  5  
ATOM 9001  H HE1  . MET B 2 19 ? 10.019  3.920   4.154   1.00 0.00 ? 29 MET B HE1  5  
ATOM 9002  H HE2  . MET B 2 19 ? 8.296   4.260   4.001   1.00 0.00 ? 29 MET B HE2  5  
ATOM 9003  H HE3  . MET B 2 19 ? 8.887   2.607   3.835   1.00 0.00 ? 29 MET B HE3  5  
ATOM 9004  N N    . SER B 2 20 ? 12.401  4.167   9.110   1.00 0.00 ? 30 SER B N    5  
ATOM 9005  C CA   . SER B 2 20 ? 13.755  4.693   8.980   1.00 0.00 ? 30 SER B CA   5  
ATOM 9006  C C    . SER B 2 20 ? 14.720  3.855   9.806   1.00 0.00 ? 30 SER B C    5  
ATOM 9007  O O    . SER B 2 20 ? 15.747  3.399   9.308   1.00 0.00 ? 30 SER B O    5  
ATOM 9008  C CB   . SER B 2 20 ? 13.785  6.146   9.442   1.00 0.00 ? 30 SER B CB   5  
ATOM 9009  O OG   . SER B 2 20 ? 12.515  6.532   9.944   1.00 0.00 ? 30 SER B OG   5  
ATOM 9010  H H    . SER B 2 20 ? 11.695  4.764   9.441   1.00 0.00 ? 30 SER B H    5  
ATOM 9011  H HA   . SER B 2 20 ? 14.039  4.641   7.939   1.00 0.00 ? 30 SER B HA   5  
ATOM 9012  H HB2  . SER B 2 20 ? 14.519  6.259   10.227  1.00 0.00 ? 30 SER B HB2  5  
ATOM 9013  H HB3  . SER B 2 20 ? 14.041  6.784   8.611   1.00 0.00 ? 30 SER B HB3  5  
ATOM 9014  H HG   . SER B 2 20 ? 11.971  6.869   9.210   1.00 0.00 ? 30 SER B HG   5  
ATOM 9015  N N    . ALA B 2 21 ? 14.384  3.694   11.086  1.00 0.00 ? 31 ALA B N    5  
ATOM 9016  C CA   . ALA B 2 21 ? 15.177  2.876   12.003  1.00 0.00 ? 31 ALA B CA   5  
ATOM 9017  C C    . ALA B 2 21 ? 15.427  1.489   11.413  1.00 0.00 ? 31 ALA B C    5  
ATOM 9018  O O    . ALA B 2 21 ? 16.470  0.881   11.653  1.00 0.00 ? 31 ALA B O    5  
ATOM 9019  C CB   . ALA B 2 21 ? 14.480  2.760   13.350  1.00 0.00 ? 31 ALA B CB   5  
ATOM 9020  H H    . ALA B 2 21 ? 13.630  4.218   11.428  1.00 0.00 ? 31 ALA B H    5  
ATOM 9021  H HA   . ALA B 2 21 ? 16.126  3.370   12.155  1.00 0.00 ? 31 ALA B HA   5  
ATOM 9022  H HB1  . ALA B 2 21 ? 13.550  2.228   13.229  1.00 0.00 ? 31 ALA B HB1  5  
ATOM 9023  H HB2  . ALA B 2 21 ? 14.281  3.748   13.740  1.00 0.00 ? 31 ALA B HB2  5  
ATOM 9024  H HB3  . ALA B 2 21 ? 15.115  2.224   14.039  1.00 0.00 ? 31 ALA B HB3  5  
ATOM 9025  N N    . TRP B 2 22 ? 14.467  1.004   10.635  1.00 0.00 ? 32 TRP B N    5  
ATOM 9026  C CA   . TRP B 2 22 ? 14.584  -0.294  9.989   1.00 0.00 ? 32 TRP B CA   5  
ATOM 9027  C C    . TRP B 2 22 ? 15.544  -0.203  8.804   1.00 0.00 ? 32 TRP B C    5  
ATOM 9028  O O    . TRP B 2 22 ? 16.453  -1.019  8.666   1.00 0.00 ? 32 TRP B O    5  
ATOM 9029  C CB   . TRP B 2 22 ? 13.203  -0.781  9.531   1.00 0.00 ? 32 TRP B CB   5  
ATOM 9030  C CG   . TRP B 2 22 ? 13.259  -1.946  8.594   1.00 0.00 ? 32 TRP B CG   5  
ATOM 9031  C CD1  . TRP B 2 22 ? 13.650  -3.218  8.894   1.00 0.00 ? 32 TRP B CD1  5  
ATOM 9032  C CD2  . TRP B 2 22 ? 12.910  -1.948  7.203   1.00 0.00 ? 32 TRP B CD2  5  
ATOM 9033  N NE1  . TRP B 2 22 ? 13.571  -4.008  7.775   1.00 0.00 ? 32 TRP B NE1  5  
ATOM 9034  C CE2  . TRP B 2 22 ? 13.120  -3.254  6.725   1.00 0.00 ? 32 TRP B CE2  5  
ATOM 9035  C CE3  . TRP B 2 22 ? 12.444  -0.974  6.317   1.00 0.00 ? 32 TRP B CE3  5  
ATOM 9036  C CZ2  . TRP B 2 22 ? 12.878  -3.611  5.401   1.00 0.00 ? 32 TRP B CZ2  5  
ATOM 9037  C CZ3  . TRP B 2 22 ? 12.204  -1.330  5.002   1.00 0.00 ? 32 TRP B CZ3  5  
ATOM 9038  C CH2  . TRP B 2 22 ? 12.422  -2.638  4.556   1.00 0.00 ? 32 TRP B CH2  5  
ATOM 9039  H H    . TRP B 2 22 ? 13.659  1.537   10.488  1.00 0.00 ? 32 TRP B H    5  
ATOM 9040  H HA   . TRP B 2 22 ? 14.984  -0.991  10.711  1.00 0.00 ? 32 TRP B HA   5  
ATOM 9041  H HB2  . TRP B 2 22 ? 12.629  -1.077  10.395  1.00 0.00 ? 32 TRP B HB2  5  
ATOM 9042  H HB3  . TRP B 2 22 ? 12.694  0.029   9.028   1.00 0.00 ? 32 TRP B HB3  5  
ATOM 9043  H HD1  . TRP B 2 22 ? 13.976  -3.540  9.872   1.00 0.00 ? 32 TRP B HD1  5  
ATOM 9044  H HE1  . TRP B 2 22 ? 13.805  -4.967  7.734   1.00 0.00 ? 32 TRP B HE1  5  
ATOM 9045  H HE3  . TRP B 2 22 ? 12.271  0.040   6.643   1.00 0.00 ? 32 TRP B HE3  5  
ATOM 9046  H HZ2  . TRP B 2 22 ? 13.040  -4.616  5.042   1.00 0.00 ? 32 TRP B HZ2  5  
ATOM 9047  H HZ3  . TRP B 2 22 ? 11.843  -0.590  4.304   1.00 0.00 ? 32 TRP B HZ3  5  
ATOM 9048  H HH2  . TRP B 2 22 ? 12.221  -2.870  3.520   1.00 0.00 ? 32 TRP B HH2  5  
ATOM 9049  N N    . LEU B 2 23 ? 15.342  0.806   7.959   1.00 0.00 ? 33 LEU B N    5  
ATOM 9050  C CA   . LEU B 2 23 ? 16.193  1.019   6.794   1.00 0.00 ? 33 LEU B CA   5  
ATOM 9051  C C    . LEU B 2 23 ? 17.638  1.244   7.228   1.00 0.00 ? 33 LEU B C    5  
ATOM 9052  O O    . LEU B 2 23 ? 18.575  0.865   6.523   1.00 0.00 ? 33 LEU B O    5  
ATOM 9053  C CB   . LEU B 2 23 ? 15.692  2.210   5.978   1.00 0.00 ? 33 LEU B CB   5  
ATOM 9054  C CG   . LEU B 2 23 ? 14.401  1.964   5.195   1.00 0.00 ? 33 LEU B CG   5  
ATOM 9055  C CD1  . LEU B 2 23 ? 13.757  3.282   4.805   1.00 0.00 ? 33 LEU B CD1  5  
ATOM 9056  C CD2  . LEU B 2 23 ? 14.677  1.124   3.958   1.00 0.00 ? 33 LEU B CD2  5  
ATOM 9057  H H    . LEU B 2 23 ? 14.593  1.422   8.125   1.00 0.00 ? 33 LEU B H    5  
ATOM 9058  H HA   . LEU B 2 23 ? 16.148  0.129   6.185   1.00 0.00 ? 33 LEU B HA   5  
ATOM 9059  H HB2  . LEU B 2 23 ? 15.529  3.038   6.653   1.00 0.00 ? 33 LEU B HB2  5  
ATOM 9060  H HB3  . LEU B 2 23 ? 16.464  2.488   5.275   1.00 0.00 ? 33 LEU B HB3  5  
ATOM 9061  H HG   . LEU B 2 23 ? 13.706  1.423   5.820   1.00 0.00 ? 33 LEU B HG   5  
ATOM 9062  H HD11 . LEU B 2 23 ? 13.578  3.871   5.692   1.00 0.00 ? 33 LEU B HD11 5  
ATOM 9063  H HD12 . LEU B 2 23 ? 12.819  3.090   4.305   1.00 0.00 ? 33 LEU B HD12 5  
ATOM 9064  H HD13 . LEU B 2 23 ? 14.415  3.822   4.141   1.00 0.00 ? 33 LEU B HD13 5  
ATOM 9065  H HD21 . LEU B 2 23 ? 15.373  1.644   3.317   1.00 0.00 ? 33 LEU B HD21 5  
ATOM 9066  H HD22 . LEU B 2 23 ? 13.753  0.955   3.424   1.00 0.00 ? 33 LEU B HD22 5  
ATOM 9067  H HD23 . LEU B 2 23 ? 15.100  0.174   4.253   1.00 0.00 ? 33 LEU B HD23 5  
ATOM 9068  N N    . ARG B 2 24 ? 17.803  1.918   8.368   1.00 0.00 ? 34 ARG B N    5  
ATOM 9069  C CA   . ARG B 2 24 ? 19.119  2.180   8.968   1.00 0.00 ? 34 ARG B CA   5  
ATOM 9070  C C    . ARG B 2 24 ? 19.979  0.916   9.127   1.00 0.00 ? 34 ARG B C    5  
ATOM 9071  O O    . ARG B 2 24 ? 21.149  1.007   9.497   1.00 0.00 ? 34 ARG B O    5  
ATOM 9072  C CB   . ARG B 2 24 ? 18.933  2.832   10.341  1.00 0.00 ? 34 ARG B CB   5  
ATOM 9073  C CG   . ARG B 2 24 ? 19.807  4.053   10.566  1.00 0.00 ? 34 ARG B CG   5  
ATOM 9074  C CD   . ARG B 2 24 ? 19.262  5.268   9.838   1.00 0.00 ? 34 ARG B CD   5  
ATOM 9075  N NE   . ARG B 2 24 ? 18.581  6.197   10.738  1.00 0.00 ? 34 ARG B NE   5  
ATOM 9076  C CZ   . ARG B 2 24 ? 18.555  7.521   10.569  1.00 0.00 ? 34 ARG B CZ   5  
ATOM 9077  N NH1  . ARG B 2 24 ? 19.155  8.083   9.525   1.00 0.00 ? 34 ARG B NH1  5  
ATOM 9078  N NH2  . ARG B 2 24 ? 17.921  8.284   11.444  1.00 0.00 ? 34 ARG B NH2  5  
ATOM 9079  H H    . ARG B 2 24 ? 17.027  2.382   8.757   1.00 0.00 ? 34 ARG B H    5  
ATOM 9080  H HA   . ARG B 2 24 ? 19.639  2.873   8.326   1.00 0.00 ? 34 ARG B HA   5  
ATOM 9081  H HB2  . ARG B 2 24 ? 17.901  3.132   10.447  1.00 0.00 ? 34 ARG B HB2  5  
ATOM 9082  H HB3  . ARG B 2 24 ? 19.166  2.105   11.105  1.00 0.00 ? 34 ARG B HB3  5  
ATOM 9083  H HG2  . ARG B 2 24 ? 19.845  4.268   11.622  1.00 0.00 ? 34 ARG B HG2  5  
ATOM 9084  H HG3  . ARG B 2 24 ? 20.803  3.843   10.203  1.00 0.00 ? 34 ARG B HG3  5  
ATOM 9085  H HD2  . ARG B 2 24 ? 20.082  5.783   9.360   1.00 0.00 ? 34 ARG B HD2  5  
ATOM 9086  H HD3  . ARG B 2 24 ? 18.563  4.935   9.085   1.00 0.00 ? 34 ARG B HD3  5  
ATOM 9087  H HE   . ARG B 2 24 ? 18.118  5.810   11.516  1.00 0.00 ? 34 ARG B HE   5  
ATOM 9088  H HH11 . ARG B 2 24 ? 19.639  7.513   8.845   1.00 0.00 ? 34 ARG B HH11 5  
ATOM 9089  H HH12 . ARG B 2 24 ? 19.122  9.081   9.401   1.00 0.00 ? 34 ARG B HH12 5  
ATOM 9090  H HH21 . ARG B 2 24 ? 17.460  7.872   12.234  1.00 0.00 ? 34 ARG B HH21 5  
ATOM 9091  H HH22 . ARG B 2 24 ? 17.901  9.280   11.323  1.00 0.00 ? 34 ARG B HH22 5  
ATOM 9092  N N    . ALA B 2 25 ? 19.414  -0.254  8.855   1.00 0.00 ? 35 ALA B N    5  
ATOM 9093  C CA   . ALA B 2 25 ? 20.160  -1.500  8.965   1.00 0.00 ? 35 ALA B CA   5  
ATOM 9094  C C    . ALA B 2 25 ? 21.072  -1.670  7.755   1.00 0.00 ? 35 ALA B C    5  
ATOM 9095  O O    . ALA B 2 25 ? 22.065  -2.395  7.804   1.00 0.00 ? 35 ALA B O    5  
ATOM 9096  C CB   . ALA B 2 25 ? 19.209  -2.682  9.085   1.00 0.00 ? 35 ALA B CB   5  
ATOM 9097  H H    . ALA B 2 25 ? 18.486  -0.280  8.532   1.00 0.00 ? 35 ALA B H    5  
ATOM 9098  H HA   . ALA B 2 25 ? 20.762  -1.454  9.860   1.00 0.00 ? 35 ALA B HA   5  
ATOM 9099  H HB1  . ALA B 2 25 ? 18.559  -2.537  9.936   1.00 0.00 ? 35 ALA B HB1  5  
ATOM 9100  H HB2  . ALA B 2 25 ? 19.779  -3.591  9.216   1.00 0.00 ? 35 ALA B HB2  5  
ATOM 9101  H HB3  . ALA B 2 25 ? 18.613  -2.756  8.187   1.00 0.00 ? 35 ALA B HB3  5  
ATOM 9102  N N    . ILE B 2 26 ? 20.722  -0.987  6.669   1.00 0.00 ? 36 ILE B N    5  
ATOM 9103  C CA   . ILE B 2 26 ? 21.496  -1.040  5.432   1.00 0.00 ? 36 ILE B CA   5  
ATOM 9104  C C    . ILE B 2 26 ? 21.733  0.367   4.884   1.00 0.00 ? 36 ILE B C    5  
ATOM 9105  O O    . ILE B 2 26 ? 22.026  0.540   3.700   1.00 0.00 ? 36 ILE B O    5  
ATOM 9106  C CB   . ILE B 2 26 ? 20.781  -1.882  4.352   1.00 0.00 ? 36 ILE B CB   5  
ATOM 9107  C CG1  . ILE B 2 26 ? 19.347  -1.384  4.151   1.00 0.00 ? 36 ILE B CG1  5  
ATOM 9108  C CG2  . ILE B 2 26 ? 20.789  -3.357  4.731   1.00 0.00 ? 36 ILE B CG2  5  
ATOM 9109  C CD1  . ILE B 2 26 ? 18.790  -1.679  2.777   1.00 0.00 ? 36 ILE B CD1  5  
ATOM 9110  H H    . ILE B 2 26 ? 19.913  -0.429  6.700   1.00 0.00 ? 36 ILE B H    5  
ATOM 9111  H HA   . ILE B 2 26 ? 22.448  -1.498  5.649   1.00 0.00 ? 36 ILE B HA   5  
ATOM 9112  H HB   . ILE B 2 26 ? 21.325  -1.773  3.425   1.00 0.00 ? 36 ILE B HB   5  
ATOM 9113  H HG12 . ILE B 2 26 ? 18.704  -1.858  4.876   1.00 0.00 ? 36 ILE B HG12 5  
ATOM 9114  H HG13 . ILE B 2 26 ? 19.322  -0.314  4.298   1.00 0.00 ? 36 ILE B HG13 5  
ATOM 9115  H HG21 . ILE B 2 26 ? 20.281  -3.488  5.675   1.00 0.00 ? 36 ILE B HG21 5  
ATOM 9116  H HG22 . ILE B 2 26 ? 21.809  -3.699  4.822   1.00 0.00 ? 36 ILE B HG22 5  
ATOM 9117  H HG23 . ILE B 2 26 ? 20.284  -3.929  3.968   1.00 0.00 ? 36 ILE B HG23 5  
ATOM 9118  H HD11 . ILE B 2 26 ? 19.423  -1.228  2.026   1.00 0.00 ? 36 ILE B HD11 5  
ATOM 9119  H HD12 . ILE B 2 26 ? 17.793  -1.269  2.699   1.00 0.00 ? 36 ILE B HD12 5  
ATOM 9120  H HD13 . ILE B 2 26 ? 18.754  -2.747  2.623   1.00 0.00 ? 36 ILE B HD13 5  
ATOM 9121  N N    . GLY B 2 27 ? 21.647  1.357   5.771   1.00 0.00 ? 37 GLY B N    5  
ATOM 9122  C CA   . GLY B 2 27 ? 21.828  2.752   5.382   1.00 0.00 ? 37 GLY B CA   5  
ATOM 9123  C C    . GLY B 2 27 ? 20.990  3.159   4.179   1.00 0.00 ? 37 GLY B C    5  
ATOM 9124  O O    . GLY B 2 27 ? 21.507  3.749   3.228   1.00 0.00 ? 37 GLY B O    5  
ATOM 9125  H H    . GLY B 2 27 ? 21.528  1.130   6.715   1.00 0.00 ? 37 GLY B H    5  
ATOM 9126  H HA2  . GLY B 2 27 ? 21.561  3.381   6.217   1.00 0.00 ? 37 GLY B HA2  5  
ATOM 9127  H HA3  . GLY B 2 27 ? 22.870  2.912   5.149   1.00 0.00 ? 37 GLY B HA3  5  
ATOM 9128  N N    . LEU B 2 28 ? 19.702  2.842   4.213   1.00 0.00 ? 38 LEU B N    5  
ATOM 9129  C CA   . LEU B 2 28 ? 18.813  3.180   3.103   1.00 0.00 ? 38 LEU B CA   5  
ATOM 9130  C C    . LEU B 2 28 ? 17.645  4.052   3.566   1.00 0.00 ? 38 LEU B C    5  
ATOM 9131  O O    . LEU B 2 28 ? 16.633  4.175   2.872   1.00 0.00 ? 38 LEU B O    5  
ATOM 9132  C CB   . LEU B 2 28 ? 18.293  1.903   2.438   1.00 0.00 ? 38 LEU B CB   5  
ATOM 9133  C CG   . LEU B 2 28 ? 17.898  2.050   0.966   1.00 0.00 ? 38 LEU B CG   5  
ATOM 9134  C CD1  . LEU B 2 28 ? 19.132  2.243   0.096   1.00 0.00 ? 38 LEU B CD1  5  
ATOM 9135  C CD2  . LEU B 2 28 ? 17.102  0.840   0.504   1.00 0.00 ? 38 LEU B CD2  5  
ATOM 9136  H H    . LEU B 2 28 ? 19.348  2.367   4.994   1.00 0.00 ? 38 LEU B H    5  
ATOM 9137  H HA   . LEU B 2 28 ? 19.391  3.737   2.382   1.00 0.00 ? 38 LEU B HA   5  
ATOM 9138  H HB2  . LEU B 2 28 ? 19.063  1.148   2.506   1.00 0.00 ? 38 LEU B HB2  5  
ATOM 9139  H HB3  . LEU B 2 28 ? 17.429  1.562   2.987   1.00 0.00 ? 38 LEU B HB3  5  
ATOM 9140  H HG   . LEU B 2 28 ? 17.273  2.924   0.856   1.00 0.00 ? 38 LEU B HG   5  
ATOM 9141  H HD11 . LEU B 2 28 ? 19.642  3.149   0.389   1.00 0.00 ? 38 LEU B HD11 5  
ATOM 9142  H HD12 . LEU B 2 28 ? 18.834  2.317   -0.939  1.00 0.00 ? 38 LEU B HD12 5  
ATOM 9143  H HD13 . LEU B 2 28 ? 19.795  1.400   0.221   1.00 0.00 ? 38 LEU B HD13 5  
ATOM 9144  H HD21 . LEU B 2 28 ? 16.846  0.954   -0.538  1.00 0.00 ? 38 LEU B HD21 5  
ATOM 9145  H HD22 . LEU B 2 28 ? 16.199  0.758   1.091   1.00 0.00 ? 38 LEU B HD22 5  
ATOM 9146  H HD23 . LEU B 2 28 ? 17.697  -0.052  0.634   1.00 0.00 ? 38 LEU B HD23 5  
ATOM 9147  N N    . GLU B 2 29 ? 17.791  4.661   4.740   1.00 0.00 ? 39 GLU B N    5  
ATOM 9148  C CA   . GLU B 2 29 ? 16.757  5.532   5.310   1.00 0.00 ? 39 GLU B CA   5  
ATOM 9149  C C    . GLU B 2 29 ? 16.398  6.691   4.378   1.00 0.00 ? 39 GLU B C    5  
ATOM 9150  O O    . GLU B 2 29 ? 15.314  7.265   4.478   1.00 0.00 ? 39 GLU B O    5  
ATOM 9151  C CB   . GLU B 2 29 ? 17.224  6.094   6.653   1.00 0.00 ? 39 GLU B CB   5  
ATOM 9152  C CG   . GLU B 2 29 ? 18.440  7.003   6.539   1.00 0.00 ? 39 GLU B CG   5  
ATOM 9153  C CD   . GLU B 2 29 ? 19.741  6.279   6.810   1.00 0.00 ? 39 GLU B CD   5  
ATOM 9154  O OE1  . GLU B 2 29 ? 19.902  5.140   6.330   1.00 0.00 ? 39 GLU B OE1  5  
ATOM 9155  O OE2  . GLU B 2 29 ? 20.596  6.843   7.524   1.00 0.00 ? 39 GLU B OE2  5  
ATOM 9156  H H    . GLU B 2 29 ? 18.607  4.485   5.270   1.00 0.00 ? 39 GLU B H    5  
ATOM 9157  H HA   . GLU B 2 29 ? 15.875  4.934   5.473   1.00 0.00 ? 39 GLU B HA   5  
ATOM 9158  H HB2  . GLU B 2 29 ? 16.417  6.660   7.094   1.00 0.00 ? 39 GLU B HB2  5  
ATOM 9159  H HB3  . GLU B 2 29 ? 17.476  5.272   7.307   1.00 0.00 ? 39 GLU B HB3  5  
ATOM 9160  H HG2  . GLU B 2 29 ? 18.475  7.411   5.540   1.00 0.00 ? 39 GLU B HG2  5  
ATOM 9161  H HG3  . GLU B 2 29 ? 18.339  7.809   7.252   1.00 0.00 ? 39 GLU B HG3  5  
ATOM 9162  N N    . ARG B 2 30 ? 17.303  7.009   3.460   1.00 0.00 ? 40 ARG B N    5  
ATOM 9163  C CA   . ARG B 2 30 ? 17.097  8.104   2.517   1.00 0.00 ? 40 ARG B CA   5  
ATOM 9164  C C    . ARG B 2 30 ? 15.958  7.802   1.547   1.00 0.00 ? 40 ARG B C    5  
ATOM 9165  O O    . ARG B 2 30 ? 15.483  8.690   0.842   1.00 0.00 ? 40 ARG B O    5  
ATOM 9166  C CB   . ARG B 2 30 ? 18.385  8.382   1.736   1.00 0.00 ? 40 ARG B CB   5  
ATOM 9167  C CG   . ARG B 2 30 ? 19.580  8.684   2.623   1.00 0.00 ? 40 ARG B CG   5  
ATOM 9168  C CD   . ARG B 2 30 ? 20.601  9.562   1.918   1.00 0.00 ? 40 ARG B CD   5  
ATOM 9169  N NE   . ARG B 2 30 ? 21.322  8.848   0.863   1.00 0.00 ? 40 ARG B NE   5  
ATOM 9170  C CZ   . ARG B 2 30 ? 22.643  8.914   0.686   1.00 0.00 ? 40 ARG B CZ   5  
ATOM 9171  N NH1  . ARG B 2 30 ? 23.387  9.689   1.469   1.00 0.00 ? 40 ARG B NH1  5  
ATOM 9172  N NH2  . ARG B 2 30 ? 23.214  8.216   -0.289  1.00 0.00 ? 40 ARG B NH2  5  
ATOM 9173  H H    . ARG B 2 30 ? 18.129  6.485   3.414   1.00 0.00 ? 40 ARG B H    5  
ATOM 9174  H HA   . ARG B 2 30 ? 16.842  8.985   3.088   1.00 0.00 ? 40 ARG B HA   5  
ATOM 9175  H HB2  . ARG B 2 30 ? 18.620  7.515   1.134   1.00 0.00 ? 40 ARG B HB2  5  
ATOM 9176  H HB3  . ARG B 2 30 ? 18.223  9.228   1.084   1.00 0.00 ? 40 ARG B HB3  5  
ATOM 9177  H HG2  . ARG B 2 30 ? 19.237  9.193   3.510   1.00 0.00 ? 40 ARG B HG2  5  
ATOM 9178  H HG3  . ARG B 2 30 ? 20.052  7.753   2.902   1.00 0.00 ? 40 ARG B HG3  5  
ATOM 9179  H HD2  . ARG B 2 30 ? 20.089  10.406  1.480   1.00 0.00 ? 40 ARG B HD2  5  
ATOM 9180  H HD3  . ARG B 2 30 ? 21.313  9.915   2.648   1.00 0.00 ? 40 ARG B HD3  5  
ATOM 9181  H HE   . ARG B 2 30 ? 20.790  8.287   0.251   1.00 0.00 ? 40 ARG B HE   5  
ATOM 9182  H HH11 . ARG B 2 30 ? 22.959  10.230  2.196   1.00 0.00 ? 40 ARG B HH11 5  
ATOM 9183  H HH12 . ARG B 2 30 ? 24.382  9.734   1.338   1.00 0.00 ? 40 ARG B HH12 5  
ATOM 9184  H HH21 . ARG B 2 30 ? 22.652  7.642   -0.893  1.00 0.00 ? 40 ARG B HH21 5  
ATOM 9185  H HH22 . ARG B 2 30 ? 24.206  8.257   -0.432  1.00 0.00 ? 40 ARG B HH22 5  
ATOM 9186  N N    . TYR B 2 31 ? 15.515  6.551   1.516   1.00 0.00 ? 41 TYR B N    5  
ATOM 9187  C CA   . TYR B 2 31 ? 14.442  6.155   0.616   1.00 0.00 ? 41 TYR B CA   5  
ATOM 9188  C C    . TYR B 2 31 ? 13.069  6.187   1.289   1.00 0.00 ? 41 TYR B C    5  
ATOM 9189  O O    . TYR B 2 31 ? 12.051  6.200   0.599   1.00 0.00 ? 41 TYR B O    5  
ATOM 9190  C CB   . TYR B 2 31 ? 14.710  4.759   0.054   1.00 0.00 ? 41 TYR B CB   5  
ATOM 9191  C CG   . TYR B 2 31 ? 15.324  4.768   -1.327  1.00 0.00 ? 41 TYR B CG   5  
ATOM 9192  C CD1  . TYR B 2 31 ? 14.550  5.043   -2.449  1.00 0.00 ? 41 TYR B CD1  5  
ATOM 9193  C CD2  . TYR B 2 31 ? 16.671  4.493   -1.513  1.00 0.00 ? 41 TYR B CD2  5  
ATOM 9194  C CE1  . TYR B 2 31 ? 15.104  5.042   -3.715  1.00 0.00 ? 41 TYR B CE1  5  
ATOM 9195  C CE2  . TYR B 2 31 ? 17.232  4.493   -2.775  1.00 0.00 ? 41 TYR B CE2  5  
ATOM 9196  C CZ   . TYR B 2 31 ? 16.445  4.766   -3.873  1.00 0.00 ? 41 TYR B CZ   5  
ATOM 9197  O OH   . TYR B 2 31 ? 17.002  4.757   -5.133  1.00 0.00 ? 41 TYR B OH   5  
ATOM 9198  H H    . TYR B 2 31 ? 15.922  5.880   2.109   1.00 0.00 ? 41 TYR B H    5  
ATOM 9199  H HA   . TYR B 2 31 ? 14.434  6.857   -0.205  1.00 0.00 ? 41 TYR B HA   5  
ATOM 9200  H HB2  . TYR B 2 31 ? 15.388  4.238   0.714   1.00 0.00 ? 41 TYR B HB2  5  
ATOM 9201  H HB3  . TYR B 2 31 ? 13.779  4.216   0.002   1.00 0.00 ? 41 TYR B HB3  5  
ATOM 9202  H HD1  . TYR B 2 31 ? 13.500  5.260   -2.322  1.00 0.00 ? 41 TYR B HD1  5  
ATOM 9203  H HD2  . TYR B 2 31 ? 17.286  4.279   -0.653  1.00 0.00 ? 41 TYR B HD2  5  
ATOM 9204  H HE1  . TYR B 2 31 ? 14.487  5.260   -4.574  1.00 0.00 ? 41 TYR B HE1  5  
ATOM 9205  H HE2  . TYR B 2 31 ? 18.282  4.275   -2.898  1.00 0.00 ? 41 TYR B HE2  5  
ATOM 9206  H HH   . TYR B 2 31 ? 16.541  5.396   -5.691  1.00 0.00 ? 41 TYR B HH   5  
ATOM 9207  N N    . GLU B 2 32 ? 13.038  6.193   2.628   1.00 0.00 ? 42 GLU B N    5  
ATOM 9208  C CA   . GLU B 2 32 ? 11.774  6.213   3.376   1.00 0.00 ? 42 GLU B CA   5  
ATOM 9209  C C    . GLU B 2 32 ? 10.824  7.289   2.856   1.00 0.00 ? 42 GLU B C    5  
ATOM 9210  O O    . GLU B 2 32 ? 9.704   6.990   2.444   1.00 0.00 ? 42 GLU B O    5  
ATOM 9211  C CB   . GLU B 2 32 ? 12.031  6.437   4.871   1.00 0.00 ? 42 GLU B CB   5  
ATOM 9212  C CG   . GLU B 2 32 ? 10.754  6.575   5.690   1.00 0.00 ? 42 GLU B CG   5  
ATOM 9213  C CD   . GLU B 2 32 ? 11.015  6.765   7.169   1.00 0.00 ? 42 GLU B CD   5  
ATOM 9214  O OE1  . GLU B 2 32 ? 11.711  7.733   7.537   1.00 0.00 ? 42 GLU B OE1  5  
ATOM 9215  O OE2  . GLU B 2 32 ? 10.522  5.950   7.974   1.00 0.00 ? 42 GLU B OE2  5  
ATOM 9216  H H    . GLU B 2 32 ? 13.882  6.155   3.127   1.00 0.00 ? 42 GLU B H    5  
ATOM 9217  H HA   . GLU B 2 32 ? 11.304  5.250   3.247   1.00 0.00 ? 42 GLU B HA   5  
ATOM 9218  H HB2  . GLU B 2 32 ? 12.593  5.602   5.258   1.00 0.00 ? 42 GLU B HB2  5  
ATOM 9219  H HB3  . GLU B 2 32 ? 12.611  7.339   4.994   1.00 0.00 ? 42 GLU B HB3  5  
ATOM 9220  H HG2  . GLU B 2 32 ? 10.202  7.429   5.328   1.00 0.00 ? 42 GLU B HG2  5  
ATOM 9221  H HG3  . GLU B 2 32 ? 10.160  5.682   5.557   1.00 0.00 ? 42 GLU B HG3  5  
ATOM 9222  N N    . GLU B 2 33 ? 11.282  8.535   2.919   1.00 0.00 ? 43 GLU B N    5  
ATOM 9223  C CA   . GLU B 2 33 ? 10.508  9.688   2.452   1.00 0.00 ? 43 GLU B CA   5  
ATOM 9224  C C    . GLU B 2 33 ? 9.853   9.435   1.088   1.00 0.00 ? 43 GLU B C    5  
ATOM 9225  O O    . GLU B 2 33 ? 8.689   9.778   0.884   1.00 0.00 ? 43 GLU B O    5  
ATOM 9226  C CB   . GLU B 2 33 ? 11.401  10.923  2.385   1.00 0.00 ? 43 GLU B CB   5  
ATOM 9227  C CG   . GLU B 2 33 ? 11.898  11.379  3.747   1.00 0.00 ? 43 GLU B CG   5  
ATOM 9228  C CD   . GLU B 2 33 ? 12.610  12.712  3.694   1.00 0.00 ? 43 GLU B CD   5  
ATOM 9229  O OE1  . GLU B 2 33 ? 12.252  13.549  2.840   1.00 0.00 ? 43 GLU B OE1  5  
ATOM 9230  O OE2  . GLU B 2 33 ? 13.522  12.933  4.517   1.00 0.00 ? 43 GLU B OE2  5  
ATOM 9231  H H    . GLU B 2 33 ? 12.144  8.678   3.360   1.00 0.00 ? 43 GLU B H    5  
ATOM 9232  H HA   . GLU B 2 33 ? 9.728   9.866   3.176   1.00 0.00 ? 43 GLU B HA   5  
ATOM 9233  H HB2  . GLU B 2 33 ? 12.260  10.700  1.766   1.00 0.00 ? 43 GLU B HB2  5  
ATOM 9234  H HB3  . GLU B 2 33 ? 10.845  11.732  1.936   1.00 0.00 ? 43 GLU B HB3  5  
ATOM 9235  H HG2  . GLU B 2 33 ? 11.052  11.468  4.412   1.00 0.00 ? 43 GLU B HG2  5  
ATOM 9236  H HG3  . GLU B 2 33 ? 12.581  10.637  4.133   1.00 0.00 ? 43 GLU B HG3  5  
ATOM 9237  N N    . GLY B 2 34 ? 10.595  8.825   0.175   1.00 0.00 ? 44 GLY B N    5  
ATOM 9238  C CA   . GLY B 2 34 ? 10.059  8.541   -1.147  1.00 0.00 ? 44 GLY B CA   5  
ATOM 9239  C C    . GLY B 2 34 ? 9.023   7.430   -1.121  1.00 0.00 ? 44 GLY B C    5  
ATOM 9240  O O    . GLY B 2 34 ? 7.976   7.533   -1.761  1.00 0.00 ? 44 GLY B O    5  
ATOM 9241  H H    . GLY B 2 34 ? 11.513  8.567   0.394   1.00 0.00 ? 44 GLY B H    5  
ATOM 9242  H HA2  . GLY B 2 34 ? 9.602   9.436   -1.540  1.00 0.00 ? 44 GLY B HA2  5  
ATOM 9243  H HA3  . GLY B 2 34 ? 10.869  8.246   -1.798  1.00 0.00 ? 44 GLY B HA3  5  
ATOM 9244  N N    . LEU B 2 35 ? 9.313   6.378   -0.366  1.00 0.00 ? 45 LEU B N    5  
ATOM 9245  C CA   . LEU B 2 35 ? 8.414   5.233   -0.251  1.00 0.00 ? 45 LEU B CA   5  
ATOM 9246  C C    . LEU B 2 35 ? 7.064   5.651   0.336   1.00 0.00 ? 45 LEU B C    5  
ATOM 9247  O O    . LEU B 2 35 ? 6.009   5.338   -0.223  1.00 0.00 ? 45 LEU B O    5  
ATOM 9248  C CB   . LEU B 2 35 ? 9.057   4.147   0.619   1.00 0.00 ? 45 LEU B CB   5  
ATOM 9249  C CG   . LEU B 2 35 ? 10.336  3.523   0.050   1.00 0.00 ? 45 LEU B CG   5  
ATOM 9250  C CD1  . LEU B 2 35 ? 11.047  2.702   1.113   1.00 0.00 ? 45 LEU B CD1  5  
ATOM 9251  C CD2  . LEU B 2 35 ? 10.018  2.659   -1.161  1.00 0.00 ? 45 LEU B CD2  5  
ATOM 9252  H H    . LEU B 2 35 ? 10.160  6.370   0.133   1.00 0.00 ? 45 LEU B H    5  
ATOM 9253  H HA   . LEU B 2 35 ? 8.255   4.840   -1.243  1.00 0.00 ? 45 LEU B HA   5  
ATOM 9254  H HB2  . LEU B 2 35 ? 9.291   4.580   1.581   1.00 0.00 ? 45 LEU B HB2  5  
ATOM 9255  H HB3  . LEU B 2 35 ? 8.336   3.360   0.765   1.00 0.00 ? 45 LEU B HB3  5  
ATOM 9256  H HG   . LEU B 2 35 ? 11.004  4.312   -0.265  1.00 0.00 ? 45 LEU B HG   5  
ATOM 9257  H HD11 . LEU B 2 35 ? 11.311  3.338   1.945   1.00 0.00 ? 45 LEU B HD11 5  
ATOM 9258  H HD12 . LEU B 2 35 ? 11.943  2.268   0.693   1.00 0.00 ? 45 LEU B HD12 5  
ATOM 9259  H HD13 . LEU B 2 35 ? 10.393  1.914   1.457   1.00 0.00 ? 45 LEU B HD13 5  
ATOM 9260  H HD21 . LEU B 2 35 ? 9.541   3.262   -1.919  1.00 0.00 ? 45 LEU B HD21 5  
ATOM 9261  H HD22 . LEU B 2 35 ? 9.357   1.858   -0.868  1.00 0.00 ? 45 LEU B HD22 5  
ATOM 9262  H HD23 . LEU B 2 35 ? 10.933  2.243   -1.557  1.00 0.00 ? 45 LEU B HD23 5  
ATOM 9263  N N    . VAL B 2 36 ? 7.112   6.329   1.481   1.00 0.00 ? 46 VAL B N    5  
ATOM 9264  C CA   . VAL B 2 36 ? 5.907   6.814   2.161   1.00 0.00 ? 46 VAL B CA   5  
ATOM 9265  C C    . VAL B 2 36 ? 4.994   7.619   1.229   1.00 0.00 ? 46 VAL B C    5  
ATOM 9266  O O    . VAL B 2 36 ? 3.769   7.519   1.318   1.00 0.00 ? 46 VAL B O    5  
ATOM 9267  C CB   . VAL B 2 36 ? 6.274   7.681   3.389   1.00 0.00 ? 46 VAL B CB   5  
ATOM 9268  C CG1  . VAL B 2 36 ? 5.029   8.259   4.048   1.00 0.00 ? 46 VAL B CG1  5  
ATOM 9269  C CG2  . VAL B 2 36 ? 7.076   6.870   4.395   1.00 0.00 ? 46 VAL B CG2  5  
ATOM 9270  H H    . VAL B 2 36 ? 7.982   6.446   1.927   1.00 0.00 ? 46 VAL B H    5  
ATOM 9271  H HA   . VAL B 2 36 ? 5.362   5.950   2.515   1.00 0.00 ? 46 VAL B HA   5  
ATOM 9272  H HB   . VAL B 2 36 ? 6.890   8.503   3.052   1.00 0.00 ? 46 VAL B HB   5  
ATOM 9273  H HG11 . VAL B 2 36 ? 4.455   8.805   3.314   1.00 0.00 ? 46 VAL B HG11 5  
ATOM 9274  H HG12 . VAL B 2 36 ? 5.320   8.925   4.846   1.00 0.00 ? 46 VAL B HG12 5  
ATOM 9275  H HG13 . VAL B 2 36 ? 4.429   7.456   4.450   1.00 0.00 ? 46 VAL B HG13 5  
ATOM 9276  H HG21 . VAL B 2 36 ? 7.279   7.476   5.267   1.00 0.00 ? 46 VAL B HG21 5  
ATOM 9277  H HG22 . VAL B 2 36 ? 8.008   6.560   3.948   1.00 0.00 ? 46 VAL B HG22 5  
ATOM 9278  H HG23 . VAL B 2 36 ? 6.510   5.998   4.688   1.00 0.00 ? 46 VAL B HG23 5  
ATOM 9279  N N    . HIS B 2 37 ? 5.587   8.409   0.337   1.00 0.00 ? 47 HIS B N    5  
ATOM 9280  C CA   . HIS B 2 37 ? 4.807   9.222   -0.595  1.00 0.00 ? 47 HIS B CA   5  
ATOM 9281  C C    . HIS B 2 37 ? 3.923   8.347   -1.468  1.00 0.00 ? 47 HIS B C    5  
ATOM 9282  O O    . HIS B 2 37 ? 2.710   8.538   -1.523  1.00 0.00 ? 47 HIS B O    5  
ATOM 9283  C CB   . HIS B 2 37 ? 5.714   10.048  -1.497  1.00 0.00 ? 47 HIS B CB   5  
ATOM 9284  C CG   . HIS B 2 37 ? 5.018   11.213  -2.133  1.00 0.00 ? 47 HIS B CG   5  
ATOM 9285  N ND1  . HIS B 2 37 ? 4.727   11.296  -3.478  1.00 0.00 ? 47 HIS B ND1  5  
ATOM 9286  C CD2  . HIS B 2 37 ? 4.539   12.355  -1.577  1.00 0.00 ? 47 HIS B CD2  5  
ATOM 9287  C CE1  . HIS B 2 37 ? 4.100   12.457  -3.693  1.00 0.00 ? 47 HIS B CE1  5  
ATOM 9288  N NE2  . HIS B 2 37 ? 3.958   13.138  -2.572  1.00 0.00 ? 47 HIS B NE2  5  
ATOM 9289  H H    . HIS B 2 37 ? 6.567   8.445   0.302   1.00 0.00 ? 47 HIS B H    5  
ATOM 9290  H HA   . HIS B 2 37 ? 4.182   9.886   -0.017  1.00 0.00 ? 47 HIS B HA   5  
ATOM 9291  H HB2  . HIS B 2 37 ? 6.544   10.423  -0.921  1.00 0.00 ? 47 HIS B HB2  5  
ATOM 9292  H HB3  . HIS B 2 37 ? 6.083   9.411   -2.289  1.00 0.00 ? 47 HIS B HB3  5  
ATOM 9293  H HD1  . HIS B 2 37 ? 4.938   10.620  -4.158  1.00 0.00 ? 47 HIS B HD1  5  
ATOM 9294  H HD2  . HIS B 2 37 ? 4.596   12.625  -0.533  1.00 0.00 ? 47 HIS B HD2  5  
ATOM 9295  H HE1  . HIS B 2 37 ? 3.750   12.792  -4.658  1.00 0.00 ? 47 HIS B HE1  5  
ATOM 9296  N N    . ASN B 2 38 ? 4.545   7.394   -2.156  1.00 0.00 ? 48 ASN B N    5  
ATOM 9297  C CA   . ASN B 2 38 ? 3.818   6.488   -3.032  1.00 0.00 ? 48 ASN B CA   5  
ATOM 9298  C C    . ASN B 2 38 ? 2.714   5.792   -2.262  1.00 0.00 ? 48 ASN B C    5  
ATOM 9299  O O    . ASN B 2 38 ? 1.532   6.047   -2.495  1.00 0.00 ? 48 ASN B O    5  
ATOM 9300  C CB   . ASN B 2 38 ? 4.756   5.448   -3.648  1.00 0.00 ? 48 ASN B CB   5  
ATOM 9301  C CG   . ASN B 2 38 ? 5.659   6.035   -4.714  1.00 0.00 ? 48 ASN B CG   5  
ATOM 9302  O OD1  . ASN B 2 38 ? 6.599   6.766   -4.412  1.00 0.00 ? 48 ASN B OD1  5  
ATOM 9303  N ND2  . ASN B 2 38 ? 5.394   5.711   -5.967  1.00 0.00 ? 48 ASN B ND2  5  
ATOM 9304  H H    . ASN B 2 38 ? 5.520   7.300   -2.068  1.00 0.00 ? 48 ASN B H    5  
ATOM 9305  H HA   . ASN B 2 38 ? 3.374   7.075   -3.822  1.00 0.00 ? 48 ASN B HA   5  
ATOM 9306  H HB2  . ASN B 2 38 ? 5.374   5.026   -2.871  1.00 0.00 ? 48 ASN B HB2  5  
ATOM 9307  H HB3  . ASN B 2 38 ? 4.163   4.662   -4.096  1.00 0.00 ? 48 ASN B HB3  5  
ATOM 9308  H HD21 . ASN B 2 38 ? 4.628   5.109   -6.149  1.00 0.00 ? 48 ASN B HD21 5  
ATOM 9309  H HD22 . ASN B 2 38 ? 5.977   6.071   -6.670  1.00 0.00 ? 48 ASN B HD22 5  
ATOM 9310  N N    . GLY B 2 39 ? 3.104   4.939   -1.328  1.00 0.00 ? 49 GLY B N    5  
ATOM 9311  C CA   . GLY B 2 39 ? 2.134   4.217   -0.533  1.00 0.00 ? 49 GLY B CA   5  
ATOM 9312  C C    . GLY B 2 39 ? 2.742   3.034   0.175   1.00 0.00 ? 49 GLY B C    5  
ATOM 9313  O O    . GLY B 2 39 ? 2.111   1.987   0.303   1.00 0.00 ? 49 GLY B O    5  
ATOM 9314  H H    . GLY B 2 39 ? 4.064   4.799   -1.174  1.00 0.00 ? 49 GLY B H    5  
ATOM 9315  H HA2  . GLY B 2 39 ? 1.715   4.888   0.203   1.00 0.00 ? 49 GLY B HA2  5  
ATOM 9316  H HA3  . GLY B 2 39 ? 1.342   3.867   -1.179  1.00 0.00 ? 49 GLY B HA3  5  
ATOM 9317  N N    . TRP B 2 40 ? 3.979   3.196   0.619   1.00 0.00 ? 50 TRP B N    5  
ATOM 9318  C CA   . TRP B 2 40 ? 4.682   2.139   1.326   1.00 0.00 ? 50 TRP B CA   5  
ATOM 9319  C C    . TRP B 2 40 ? 5.092   2.650   2.701   1.00 0.00 ? 50 TRP B C    5  
ATOM 9320  O O    . TRP B 2 40 ? 6.272   2.680   3.041   1.00 0.00 ? 50 TRP B O    5  
ATOM 9321  C CB   . TRP B 2 40 ? 5.917   1.682   0.536   1.00 0.00 ? 50 TRP B CB   5  
ATOM 9322  C CG   . TRP B 2 40 ? 5.727   1.685   -0.955  1.00 0.00 ? 50 TRP B CG   5  
ATOM 9323  C CD1  . TRP B 2 40 ? 6.296   2.546   -1.849  1.00 0.00 ? 50 TRP B CD1  5  
ATOM 9324  C CD2  . TRP B 2 40 ? 4.916   0.789   -1.726  1.00 0.00 ? 50 TRP B CD2  5  
ATOM 9325  N NE1  . TRP B 2 40 ? 5.886   2.243   -3.123  1.00 0.00 ? 50 TRP B NE1  5  
ATOM 9326  C CE2  . TRP B 2 40 ? 5.039   1.169   -3.075  1.00 0.00 ? 50 TRP B CE2  5  
ATOM 9327  C CE3  . TRP B 2 40 ? 4.097   -0.298  -1.407  1.00 0.00 ? 50 TRP B CE3  5  
ATOM 9328  C CZ2  . TRP B 2 40 ? 4.376   0.504   -4.101  1.00 0.00 ? 50 TRP B CZ2  5  
ATOM 9329  C CZ3  . TRP B 2 40 ? 3.438   -0.958  -2.427  1.00 0.00 ? 50 TRP B CZ3  5  
ATOM 9330  C CH2  . TRP B 2 40 ? 3.581   -0.555  -3.760  1.00 0.00 ? 50 TRP B CH2  5  
ATOM 9331  H H    . TRP B 2 40 ? 4.430   4.055   0.479   1.00 0.00 ? 50 TRP B H    5  
ATOM 9332  H HA   . TRP B 2 40 ? 4.005   1.307   1.447   1.00 0.00 ? 50 TRP B HA   5  
ATOM 9333  H HB2  . TRP B 2 40 ? 6.740   2.338   0.765   1.00 0.00 ? 50 TRP B HB2  5  
ATOM 9334  H HB3  . TRP B 2 40 ? 6.173   0.677   0.836   1.00 0.00 ? 50 TRP B HB3  5  
ATOM 9335  H HD1  . TRP B 2 40 ? 6.966   3.346   -1.578  1.00 0.00 ? 50 TRP B HD1  5  
ATOM 9336  H HE1  . TRP B 2 40 ? 6.156   2.719   -3.939  1.00 0.00 ? 50 TRP B HE1  5  
ATOM 9337  H HE3  . TRP B 2 40 ? 3.974   -0.624  -0.385  1.00 0.00 ? 50 TRP B HE3  5  
ATOM 9338  H HZ2  . TRP B 2 40 ? 4.475   0.802   -5.135  1.00 0.00 ? 50 TRP B HZ2  5  
ATOM 9339  H HZ3  . TRP B 2 40 ? 2.801   -1.800  -2.199  1.00 0.00 ? 50 TRP B HZ3  5  
ATOM 9340  H HH2  . TRP B 2 40 ? 3.047   -1.100  -4.525  1.00 0.00 ? 50 TRP B HH2  5  
ATOM 9341  N N    . ASP B 2 41 ? 4.102   3.063   3.479   1.00 0.00 ? 51 ASP B N    5  
ATOM 9342  C CA   . ASP B 2 41 ? 4.329   3.600   4.816   1.00 0.00 ? 51 ASP B CA   5  
ATOM 9343  C C    . ASP B 2 41 ? 4.197   2.508   5.871   1.00 0.00 ? 51 ASP B C    5  
ATOM 9344  O O    . ASP B 2 41 ? 3.868   2.776   7.030   1.00 0.00 ? 51 ASP B O    5  
ATOM 9345  C CB   . ASP B 2 41 ? 3.343   4.747   5.104   1.00 0.00 ? 51 ASP B CB   5  
ATOM 9346  C CG   . ASP B 2 41 ? 1.878   4.318   5.087   1.00 0.00 ? 51 ASP B CG   5  
ATOM 9347  O OD1  . ASP B 2 41 ? 1.552   3.314   4.421   1.00 0.00 ? 51 ASP B OD1  5  
ATOM 9348  O OD2  . ASP B 2 41 ? 1.047   5.003   5.734   1.00 0.00 ? 51 ASP B OD2  5  
ATOM 9349  H H    . ASP B 2 41 ? 3.175   2.991   3.153   1.00 0.00 ? 51 ASP B H    5  
ATOM 9350  H HA   . ASP B 2 41 ? 5.336   3.989   4.846   1.00 0.00 ? 51 ASP B HA   5  
ATOM 9351  H HB2  . ASP B 2 41 ? 3.560   5.158   6.079   1.00 0.00 ? 51 ASP B HB2  5  
ATOM 9352  H HB3  . ASP B 2 41 ? 3.478   5.518   4.360   1.00 0.00 ? 51 ASP B HB3  5  
ATOM 9353  N N    . ASP B 2 42 ? 4.489   1.279   5.476   1.00 0.00 ? 52 ASP B N    5  
ATOM 9354  C CA   . ASP B 2 42 ? 4.391   0.143   6.378   1.00 0.00 ? 52 ASP B CA   5  
ATOM 9355  C C    . ASP B 2 42 ? 5.467   -0.892  6.072   1.00 0.00 ? 52 ASP B C    5  
ATOM 9356  O O    . ASP B 2 42 ? 6.355   -0.658  5.253   1.00 0.00 ? 52 ASP B O    5  
ATOM 9357  C CB   . ASP B 2 42 ? 3.010   -0.502  6.257   1.00 0.00 ? 52 ASP B CB   5  
ATOM 9358  C CG   . ASP B 2 42 ? 2.894   -1.403  5.046   1.00 0.00 ? 52 ASP B CG   5  
ATOM 9359  O OD1  . ASP B 2 42 ? 3.214   -0.950  3.928   1.00 0.00 ? 52 ASP B OD1  5  
ATOM 9360  O OD2  . ASP B 2 42 ? 2.494   -2.570  5.210   1.00 0.00 ? 52 ASP B OD2  5  
ATOM 9361  H H    . ASP B 2 42 ? 4.784   1.131   4.554   1.00 0.00 ? 52 ASP B H    5  
ATOM 9362  H HA   . ASP B 2 42 ? 4.525   0.504   7.386   1.00 0.00 ? 52 ASP B HA   5  
ATOM 9363  H HB2  . ASP B 2 42 ? 2.819   -1.093  7.140   1.00 0.00 ? 52 ASP B HB2  5  
ATOM 9364  H HB3  . ASP B 2 42 ? 2.263   0.274   6.180   1.00 0.00 ? 52 ASP B HB3  5  
ATOM 9365  N N    . LEU B 2 43 ? 5.377   -2.031  6.745   1.00 0.00 ? 53 LEU B N    5  
ATOM 9366  C CA   . LEU B 2 43 ? 6.323   -3.121  6.555   1.00 0.00 ? 53 LEU B CA   5  
ATOM 9367  C C    . LEU B 2 43 ? 5.570   -4.435  6.373   1.00 0.00 ? 53 LEU B C    5  
ATOM 9368  O O    . LEU B 2 43 ? 6.085   -5.392  5.791   1.00 0.00 ? 53 LEU B O    5  
ATOM 9369  C CB   . LEU B 2 43 ? 7.267   -3.216  7.754   1.00 0.00 ? 53 LEU B CB   5  
ATOM 9370  C CG   . LEU B 2 43 ? 8.734   -2.911  7.454   1.00 0.00 ? 53 LEU B CG   5  
ATOM 9371  C CD1  . LEU B 2 43 ? 9.505   -2.692  8.744   1.00 0.00 ? 53 LEU B CD1  5  
ATOM 9372  C CD2  . LEU B 2 43 ? 9.356   -4.041  6.646   1.00 0.00 ? 53 LEU B CD2  5  
ATOM 9373  H H    . LEU B 2 43 ? 4.641   -2.147  7.389   1.00 0.00 ? 53 LEU B H    5  
ATOM 9374  H HA   . LEU B 2 43 ? 6.897   -2.915  5.665   1.00 0.00 ? 53 LEU B HA   5  
ATOM 9375  H HB2  . LEU B 2 43 ? 6.924   -2.524  8.510   1.00 0.00 ? 53 LEU B HB2  5  
ATOM 9376  H HB3  . LEU B 2 43 ? 7.206   -4.218  8.154   1.00 0.00 ? 53 LEU B HB3  5  
ATOM 9377  H HG   . LEU B 2 43 ? 8.795   -2.005  6.868   1.00 0.00 ? 53 LEU B HG   5  
ATOM 9378  H HD11 . LEU B 2 43 ? 9.076   -1.860  9.283   1.00 0.00 ? 53 LEU B HD11 5  
ATOM 9379  H HD12 . LEU B 2 43 ? 10.539  -2.476  8.514   1.00 0.00 ? 53 LEU B HD12 5  
ATOM 9380  H HD13 . LEU B 2 43 ? 9.451   -3.582  9.353   1.00 0.00 ? 53 LEU B HD13 5  
ATOM 9381  H HD21 . LEU B 2 43 ? 10.384  -3.797  6.418   1.00 0.00 ? 53 LEU B HD21 5  
ATOM 9382  H HD22 . LEU B 2 43 ? 8.805   -4.173  5.727   1.00 0.00 ? 53 LEU B HD22 5  
ATOM 9383  H HD23 . LEU B 2 43 ? 9.322   -4.955  7.220   1.00 0.00 ? 53 LEU B HD23 5  
ATOM 9384  N N    . GLU B 2 44 ? 4.335   -4.448  6.858   1.00 0.00 ? 54 GLU B N    5  
ATOM 9385  C CA   . GLU B 2 44 ? 3.465   -5.611  6.794   1.00 0.00 ? 54 GLU B CA   5  
ATOM 9386  C C    . GLU B 2 44 ? 3.181   -6.007  5.349   1.00 0.00 ? 54 GLU B C    5  
ATOM 9387  O O    . GLU B 2 44 ? 3.488   -7.121  4.925   1.00 0.00 ? 54 GLU B O    5  
ATOM 9388  C CB   . GLU B 2 44 ? 2.150   -5.312  7.524   1.00 0.00 ? 54 GLU B CB   5  
ATOM 9389  C CG   . GLU B 2 44 ? 2.336   -4.840  8.964   1.00 0.00 ? 54 GLU B CG   5  
ATOM 9390  C CD   . GLU B 2 44 ? 2.455   -3.328  9.095   1.00 0.00 ? 54 GLU B CD   5  
ATOM 9391  O OE1  . GLU B 2 44 ? 3.455   -2.751  8.613   1.00 0.00 ? 54 GLU B OE1  5  
ATOM 9392  O OE2  . GLU B 2 44 ? 1.568   -2.706  9.711   1.00 0.00 ? 54 GLU B OE2  5  
ATOM 9393  H H    . GLU B 2 44 ? 3.988   -3.630  7.283   1.00 0.00 ? 54 GLU B H    5  
ATOM 9394  H HA   . GLU B 2 44 ? 3.964   -6.429  7.290   1.00 0.00 ? 54 GLU B HA   5  
ATOM 9395  H HB2  . GLU B 2 44 ? 1.621   -4.542  6.983   1.00 0.00 ? 54 GLU B HB2  5  
ATOM 9396  H HB3  . GLU B 2 44 ? 1.548   -6.208  7.537   1.00 0.00 ? 54 GLU B HB3  5  
ATOM 9397  H HG2  . GLU B 2 44 ? 1.487   -5.167  9.545   1.00 0.00 ? 54 GLU B HG2  5  
ATOM 9398  H HG3  . GLU B 2 44 ? 3.233   -5.292  9.361   1.00 0.00 ? 54 GLU B HG3  5  
ATOM 9399  N N    . PHE B 2 45 ? 2.616   -5.085  4.590   1.00 0.00 ? 55 PHE B N    5  
ATOM 9400  C CA   . PHE B 2 45 ? 2.295   -5.341  3.198   1.00 0.00 ? 55 PHE B CA   5  
ATOM 9401  C C    . PHE B 2 45 ? 3.488   -4.994  2.318   1.00 0.00 ? 55 PHE B C    5  
ATOM 9402  O O    . PHE B 2 45 ? 3.434   -5.122  1.096   1.00 0.00 ? 55 PHE B O    5  
ATOM 9403  C CB   . PHE B 2 45 ? 1.063   -4.539  2.770   1.00 0.00 ? 55 PHE B CB   5  
ATOM 9404  C CG   . PHE B 2 45 ? -0.065  -5.393  2.261   1.00 0.00 ? 55 PHE B CG   5  
ATOM 9405  C CD1  . PHE B 2 45 ? -0.061  -5.867  0.959   1.00 0.00 ? 55 PHE B CD1  5  
ATOM 9406  C CD2  . PHE B 2 45 ? -1.129  -5.720  3.085   1.00 0.00 ? 55 PHE B CD2  5  
ATOM 9407  C CE1  . PHE B 2 45 ? -1.097  -6.651  0.489   1.00 0.00 ? 55 PHE B CE1  5  
ATOM 9408  C CE2  . PHE B 2 45 ? -2.168  -6.504  2.621   1.00 0.00 ? 55 PHE B CE2  5  
ATOM 9409  C CZ   . PHE B 2 45 ? -2.152  -6.971  1.321   1.00 0.00 ? 55 PHE B CZ   5  
ATOM 9410  H H    . PHE B 2 45 ? 2.421   -4.190  4.975   1.00 0.00 ? 55 PHE B H    5  
ATOM 9411  H HA   . PHE B 2 45 ? 2.082   -6.395  3.096   1.00 0.00 ? 55 PHE B HA   5  
ATOM 9412  H HB2  . PHE B 2 45 ? 0.697   -3.975  3.615   1.00 0.00 ? 55 PHE B HB2  5  
ATOM 9413  H HB3  . PHE B 2 45 ? 1.344   -3.855  1.982   1.00 0.00 ? 55 PHE B HB3  5  
ATOM 9414  H HD1  . PHE B 2 45 ? 0.765   -5.619  0.307   1.00 0.00 ? 55 PHE B HD1  5  
ATOM 9415  H HD2  . PHE B 2 45 ? -1.143  -5.357  4.103   1.00 0.00 ? 55 PHE B HD2  5  
ATOM 9416  H HE1  . PHE B 2 45 ? -1.081  -7.014  -0.528  1.00 0.00 ? 55 PHE B HE1  5  
ATOM 9417  H HE2  . PHE B 2 45 ? -2.993  -6.753  3.274   1.00 0.00 ? 55 PHE B HE2  5  
ATOM 9418  H HZ   . PHE B 2 45 ? -2.963  -7.584  0.956   1.00 0.00 ? 55 PHE B HZ   5  
ATOM 9419  N N    . LEU B 2 46 ? 4.564   -4.539  2.951   1.00 0.00 ? 56 LEU B N    5  
ATOM 9420  C CA   . LEU B 2 46 ? 5.784   -4.189  2.235   1.00 0.00 ? 56 LEU B CA   5  
ATOM 9421  C C    . LEU B 2 46 ? 6.524   -5.458  1.834   1.00 0.00 ? 56 LEU B C    5  
ATOM 9422  O O    . LEU B 2 46 ? 7.420   -5.435  0.994   1.00 0.00 ? 56 LEU B O    5  
ATOM 9423  C CB   . LEU B 2 46 ? 6.686   -3.304  3.101   1.00 0.00 ? 56 LEU B CB   5  
ATOM 9424  C CG   . LEU B 2 46 ? 7.874   -2.665  2.374   1.00 0.00 ? 56 LEU B CG   5  
ATOM 9425  C CD1  . LEU B 2 46 ? 7.398   -1.606  1.395   1.00 0.00 ? 56 LEU B CD1  5  
ATOM 9426  C CD2  . LEU B 2 46 ? 8.850   -2.065  3.374   1.00 0.00 ? 56 LEU B CD2  5  
ATOM 9427  H H    . LEU B 2 46 ? 4.531   -4.429  3.926   1.00 0.00 ? 56 LEU B H    5  
ATOM 9428  H HA   . LEU B 2 46 ? 5.505   -3.648  1.342   1.00 0.00 ? 56 LEU B HA   5  
ATOM 9429  H HB2  . LEU B 2 46 ? 6.082   -2.514  3.521   1.00 0.00 ? 56 LEU B HB2  5  
ATOM 9430  H HB3  . LEU B 2 46 ? 7.071   -3.907  3.909   1.00 0.00 ? 56 LEU B HB3  5  
ATOM 9431  H HG   . LEU B 2 46 ? 8.396   -3.427  1.813   1.00 0.00 ? 56 LEU B HG   5  
ATOM 9432  H HD11 . LEU B 2 46 ? 6.816   -2.073  0.614   1.00 0.00 ? 56 LEU B HD11 5  
ATOM 9433  H HD12 . LEU B 2 46 ? 8.251   -1.107  0.960   1.00 0.00 ? 56 LEU B HD12 5  
ATOM 9434  H HD13 . LEU B 2 46 ? 6.786   -0.885  1.917   1.00 0.00 ? 56 LEU B HD13 5  
ATOM 9435  H HD21 . LEU B 2 46 ? 9.629   -1.536  2.844   1.00 0.00 ? 56 LEU B HD21 5  
ATOM 9436  H HD22 . LEU B 2 46 ? 9.290   -2.853  3.967   1.00 0.00 ? 56 LEU B HD22 5  
ATOM 9437  H HD23 . LEU B 2 46 ? 8.325   -1.378  4.022   1.00 0.00 ? 56 LEU B HD23 5  
ATOM 9438  N N    . SER B 2 47 ? 6.135   -6.570  2.448   1.00 0.00 ? 57 SER B N    5  
ATOM 9439  C CA   . SER B 2 47 ? 6.743   -7.857  2.152   1.00 0.00 ? 57 SER B CA   5  
ATOM 9440  C C    . SER B 2 47 ? 6.306   -8.333  0.768   1.00 0.00 ? 57 SER B C    5  
ATOM 9441  O O    . SER B 2 47 ? 7.046   -9.023  0.066   1.00 0.00 ? 57 SER B O    5  
ATOM 9442  C CB   . SER B 2 47 ? 6.352   -8.876  3.222   1.00 0.00 ? 57 SER B CB   5  
ATOM 9443  O OG   . SER B 2 47 ? 6.596   -8.362  4.522   1.00 0.00 ? 57 SER B OG   5  
ATOM 9444  H H    . SER B 2 47 ? 5.418   -6.521  3.116   1.00 0.00 ? 57 SER B H    5  
ATOM 9445  H HA   . SER B 2 47 ? 7.815   -7.729  2.157   1.00 0.00 ? 57 SER B HA   5  
ATOM 9446  H HB2  . SER B 2 47 ? 5.301   -9.106  3.131   1.00 0.00 ? 57 SER B HB2  5  
ATOM 9447  H HB3  . SER B 2 47 ? 6.932   -9.777  3.089   1.00 0.00 ? 57 SER B HB3  5  
ATOM 9448  H HG   . SER B 2 47 ? 6.763   -7.414  4.468   1.00 0.00 ? 57 SER B HG   5  
ATOM 9449  N N    . ASP B 2 48 ? 5.100   -7.940  0.376   1.00 0.00 ? 58 ASP B N    5  
ATOM 9450  C CA   . ASP B 2 48 ? 4.566   -8.305  -0.927  1.00 0.00 ? 58 ASP B CA   5  
ATOM 9451  C C    . ASP B 2 48 ? 4.775   -7.151  -1.892  1.00 0.00 ? 58 ASP B C    5  
ATOM 9452  O O    . ASP B 2 48 ? 3.851   -6.397  -2.194  1.00 0.00 ? 58 ASP B O    5  
ATOM 9453  C CB   . ASP B 2 48 ? 3.079   -8.653  -0.834  1.00 0.00 ? 58 ASP B CB   5  
ATOM 9454  C CG   . ASP B 2 48 ? 2.615   -9.548  -1.971  1.00 0.00 ? 58 ASP B CG   5  
ATOM 9455  O OD1  . ASP B 2 48 ? 3.424   -9.840  -2.881  1.00 0.00 ? 58 ASP B OD1  5  
ATOM 9456  O OD2  . ASP B 2 48 ? 1.447   -9.989  -1.936  1.00 0.00 ? 58 ASP B OD2  5  
ATOM 9457  H H    . ASP B 2 48 ? 4.564   -7.375  0.969   1.00 0.00 ? 58 ASP B H    5  
ATOM 9458  H HA   . ASP B 2 48 ? 5.113   -9.166  -1.284  1.00 0.00 ? 58 ASP B HA   5  
ATOM 9459  H HB2  . ASP B 2 48 ? 2.894   -9.164  0.100   1.00 0.00 ? 58 ASP B HB2  5  
ATOM 9460  H HB3  . ASP B 2 48 ? 2.501   -7.741  -0.860  1.00 0.00 ? 58 ASP B HB3  5  
ATOM 9461  N N    . ILE B 2 49 ? 6.008   -6.997  -2.339  1.00 0.00 ? 59 ILE B N    5  
ATOM 9462  C CA   . ILE B 2 49 ? 6.361   -5.927  -3.251  1.00 0.00 ? 59 ILE B CA   5  
ATOM 9463  C C    . ILE B 2 49 ? 7.205   -6.469  -4.403  1.00 0.00 ? 59 ILE B C    5  
ATOM 9464  O O    . ILE B 2 49 ? 7.934   -7.453  -4.242  1.00 0.00 ? 59 ILE B O    5  
ATOM 9465  C CB   . ILE B 2 49 ? 7.118   -4.803  -2.498  1.00 0.00 ? 59 ILE B CB   5  
ATOM 9466  C CG1  . ILE B 2 49 ? 7.105   -3.506  -3.303  1.00 0.00 ? 59 ILE B CG1  5  
ATOM 9467  C CG2  . ILE B 2 49 ? 8.549   -5.220  -2.184  1.00 0.00 ? 59 ILE B CG2  5  
ATOM 9468  C CD1  . ILE B 2 49 ? 7.380   -2.273  -2.472  1.00 0.00 ? 59 ILE B CD1  5  
ATOM 9469  H H    . ILE B 2 49 ? 6.704   -7.622  -2.047  1.00 0.00 ? 59 ILE B H    5  
ATOM 9470  H HA   . ILE B 2 49 ? 5.445   -5.515  -3.650  1.00 0.00 ? 59 ILE B HA   5  
ATOM 9471  H HB   . ILE B 2 49 ? 6.612   -4.635  -1.559  1.00 0.00 ? 59 ILE B HB   5  
ATOM 9472  H HG12 . ILE B 2 49 ? 7.860   -3.561  -4.073  1.00 0.00 ? 59 ILE B HG12 5  
ATOM 9473  H HG13 . ILE B 2 49 ? 6.136   -3.387  -3.766  1.00 0.00 ? 59 ILE B HG13 5  
ATOM 9474  H HG21 . ILE B 2 49 ? 8.539   -6.086  -1.538  1.00 0.00 ? 59 ILE B HG21 5  
ATOM 9475  H HG22 . ILE B 2 49 ? 9.062   -4.408  -1.690  1.00 0.00 ? 59 ILE B HG22 5  
ATOM 9476  H HG23 . ILE B 2 49 ? 9.063   -5.464  -3.102  1.00 0.00 ? 59 ILE B HG23 5  
ATOM 9477  H HD11 . ILE B 2 49 ? 8.344   -2.368  -1.995  1.00 0.00 ? 59 ILE B HD11 5  
ATOM 9478  H HD12 . ILE B 2 49 ? 6.614   -2.170  -1.717  1.00 0.00 ? 59 ILE B HD12 5  
ATOM 9479  H HD13 . ILE B 2 49 ? 7.377   -1.401  -3.109  1.00 0.00 ? 59 ILE B HD13 5  
ATOM 9480  N N    . THR B 2 50 ? 7.077   -5.857  -5.571  1.00 0.00 ? 60 THR B N    5  
ATOM 9481  C CA   . THR B 2 50 ? 7.838   -6.281  -6.733  1.00 0.00 ? 60 THR B CA   5  
ATOM 9482  C C    . THR B 2 50 ? 8.888   -5.238  -7.093  1.00 0.00 ? 60 THR B C    5  
ATOM 9483  O O    . THR B 2 50 ? 8.924   -4.150  -6.511  1.00 0.00 ? 60 THR B O    5  
ATOM 9484  C CB   . THR B 2 50 ? 6.921   -6.513  -7.953  1.00 0.00 ? 60 THR B CB   5  
ATOM 9485  O OG1  . THR B 2 50 ? 6.371   -5.267  -8.399  1.00 0.00 ? 60 THR B OG1  5  
ATOM 9486  C CG2  . THR B 2 50 ? 5.793   -7.478  -7.612  1.00 0.00 ? 60 THR B CG2  5  
ATOM 9487  H H    . THR B 2 50 ? 6.445   -5.107  -5.657  1.00 0.00 ? 60 THR B H    5  
ATOM 9488  H HA   . THR B 2 50 ? 8.331   -7.209  -6.493  1.00 0.00 ? 60 THR B HA   5  
ATOM 9489  H HB   . THR B 2 50 ? 7.510   -6.942  -8.750  1.00 0.00 ? 60 THR B HB   5  
ATOM 9490  H HG1  . THR B 2 50 ? 5.715   -4.952  -7.749  1.00 0.00 ? 60 THR B HG1  5  
ATOM 9491  H HG21 . THR B 2 50 ? 5.217   -7.080  -6.788  1.00 0.00 ? 60 THR B HG21 5  
ATOM 9492  H HG22 . THR B 2 50 ? 6.210   -8.434  -7.331  1.00 0.00 ? 60 THR B HG22 5  
ATOM 9493  H HG23 . THR B 2 50 ? 5.152   -7.601  -8.471  1.00 0.00 ? 60 THR B HG23 5  
ATOM 9494  N N    . GLU B 2 51 ? 9.746   -5.574  -8.050  1.00 0.00 ? 61 GLU B N    5  
ATOM 9495  C CA   . GLU B 2 51 ? 10.779  -4.654  -8.502  1.00 0.00 ? 61 GLU B CA   5  
ATOM 9496  C C    . GLU B 2 51 ? 10.145  -3.430  -9.152  1.00 0.00 ? 61 GLU B C    5  
ATOM 9497  O O    . GLU B 2 51 ? 10.683  -2.323  -9.076  1.00 0.00 ? 61 GLU B O    5  
ATOM 9498  C CB   . GLU B 2 51 ? 11.706  -5.339  -9.502  1.00 0.00 ? 61 GLU B CB   5  
ATOM 9499  C CG   . GLU B 2 51 ? 12.650  -6.349  -8.878  1.00 0.00 ? 61 GLU B CG   5  
ATOM 9500  C CD   . GLU B 2 51 ? 13.721  -6.784  -9.850  1.00 0.00 ? 61 GLU B CD   5  
ATOM 9501  O OE1  . GLU B 2 51 ? 14.594  -5.956  -10.177 1.00 0.00 ? 61 GLU B OE1  5  
ATOM 9502  O OE2  . GLU B 2 51 ? 13.679  -7.942  -10.317 1.00 0.00 ? 61 GLU B OE2  5  
ATOM 9503  H H    . GLU B 2 51 ? 9.686   -6.466  -8.454  1.00 0.00 ? 61 GLU B H    5  
ATOM 9504  H HA   . GLU B 2 51 ? 11.352  -4.342  -7.642  1.00 0.00 ? 61 GLU B HA   5  
ATOM 9505  H HB2  . GLU B 2 51 ? 11.104  -5.851  -10.238 1.00 0.00 ? 61 GLU B HB2  5  
ATOM 9506  H HB3  . GLU B 2 51 ? 12.298  -4.585  -9.999  1.00 0.00 ? 61 GLU B HB3  5  
ATOM 9507  H HG2  . GLU B 2 51 ? 13.124  -5.901  -8.018  1.00 0.00 ? 61 GLU B HG2  5  
ATOM 9508  H HG3  . GLU B 2 51 ? 12.085  -7.216  -8.571  1.00 0.00 ? 61 GLU B HG3  5  
ATOM 9509  N N    . GLU B 2 52 ? 8.995   -3.648  -9.783  1.00 0.00 ? 62 GLU B N    5  
ATOM 9510  C CA   . GLU B 2 52 ? 8.261   -2.580  -10.448 1.00 0.00 ? 62 GLU B CA   5  
ATOM 9511  C C    . GLU B 2 52 ? 7.804   -1.554  -9.422  1.00 0.00 ? 62 GLU B C    5  
ATOM 9512  O O    . GLU B 2 52 ? 7.959   -0.348  -9.612  1.00 0.00 ? 62 GLU B O    5  
ATOM 9513  C CB   . GLU B 2 52 ? 7.041   -3.145  -11.179 1.00 0.00 ? 62 GLU B CB   5  
ATOM 9514  C CG   . GLU B 2 52 ? 7.330   -4.386  -12.010 1.00 0.00 ? 62 GLU B CG   5  
ATOM 9515  C CD   . GLU B 2 52 ? 6.079   -5.199  -12.288 1.00 0.00 ? 62 GLU B CD   5  
ATOM 9516  O OE1  . GLU B 2 52 ? 4.966   -4.644  -12.189 1.00 0.00 ? 62 GLU B OE1  5  
ATOM 9517  O OE2  . GLU B 2 52 ? 6.205   -6.401  -12.602 1.00 0.00 ? 62 GLU B OE2  5  
ATOM 9518  H H    . GLU B 2 52 ? 8.622   -4.555  -9.792  1.00 0.00 ? 62 GLU B H    5  
ATOM 9519  H HA   . GLU B 2 52 ? 8.920   -2.105  -11.159 1.00 0.00 ? 62 GLU B HA   5  
ATOM 9520  H HB2  . GLU B 2 52 ? 6.285   -3.398  -10.451 1.00 0.00 ? 62 GLU B HB2  5  
ATOM 9521  H HB3  . GLU B 2 52 ? 6.647   -2.383  -11.837 1.00 0.00 ? 62 GLU B HB3  5  
ATOM 9522  H HG2  . GLU B 2 52 ? 7.760   -4.081  -12.953 1.00 0.00 ? 62 GLU B HG2  5  
ATOM 9523  H HG3  . GLU B 2 52 ? 8.034   -5.006  -11.477 1.00 0.00 ? 62 GLU B HG3  5  
ATOM 9524  N N    . ASP B 2 53 ? 7.229   -2.054  -8.335  1.00 0.00 ? 63 ASP B N    5  
ATOM 9525  C CA   . ASP B 2 53 ? 6.744   -1.206  -7.256  1.00 0.00 ? 63 ASP B CA   5  
ATOM 9526  C C    . ASP B 2 53 ? 7.849   -0.306  -6.729  1.00 0.00 ? 63 ASP B C    5  
ATOM 9527  O O    . ASP B 2 53 ? 7.644   0.897   -6.567  1.00 0.00 ? 63 ASP B O    5  
ATOM 9528  C CB   . ASP B 2 53 ? 6.176   -2.053  -6.121  1.00 0.00 ? 63 ASP B CB   5  
ATOM 9529  C CG   . ASP B 2 53 ? 4.980   -2.873  -6.549  1.00 0.00 ? 63 ASP B CG   5  
ATOM 9530  O OD1  . ASP B 2 53 ? 3.959   -2.278  -6.957  1.00 0.00 ? 63 ASP B OD1  5  
ATOM 9531  O OD2  . ASP B 2 53 ? 5.067   -4.116  -6.497  1.00 0.00 ? 63 ASP B OD2  5  
ATOM 9532  H H    . ASP B 2 53 ? 7.086   -3.023  -8.279  1.00 0.00 ? 63 ASP B H    5  
ATOM 9533  H HA   . ASP B 2 53 ? 5.955   -0.587  -7.657  1.00 0.00 ? 63 ASP B HA   5  
ATOM 9534  H HB2  . ASP B 2 53 ? 6.941   -2.727  -5.770  1.00 0.00 ? 63 ASP B HB2  5  
ATOM 9535  H HB3  . ASP B 2 53 ? 5.875   -1.403  -5.312  1.00 0.00 ? 63 ASP B HB3  5  
ATOM 9536  N N    . LEU B 2 54 ? 9.014   -0.883  -6.435  1.00 0.00 ? 64 LEU B N    5  
ATOM 9537  C CA   . LEU B 2 54 ? 10.149  -0.105  -5.948  1.00 0.00 ? 64 LEU B CA   5  
ATOM 9538  C C    . LEU B 2 54 ? 10.487  1.028   -6.911  1.00 0.00 ? 64 LEU B C    5  
ATOM 9539  O O    . LEU B 2 54 ? 10.534  2.189   -6.514  1.00 0.00 ? 64 LEU B O    5  
ATOM 9540  C CB   . LEU B 2 54 ? 11.374  -1.006  -5.760  1.00 0.00 ? 64 LEU B CB   5  
ATOM 9541  C CG   . LEU B 2 54 ? 11.184  -2.182  -4.801  1.00 0.00 ? 64 LEU B CG   5  
ATOM 9542  C CD1  . LEU B 2 54 ? 12.421  -3.065  -4.789  1.00 0.00 ? 64 LEU B CD1  5  
ATOM 9543  C CD2  . LEU B 2 54 ? 10.872  -1.682  -3.399  1.00 0.00 ? 64 LEU B CD2  5  
ATOM 9544  H H    . LEU B 2 54 ? 9.118   -1.858  -6.486  1.00 0.00 ? 64 LEU B H    5  
ATOM 9545  H HA   . LEU B 2 54 ? 9.875   0.319   -4.993  1.00 0.00 ? 64 LEU B HA   5  
ATOM 9546  H HB2  . LEU B 2 54 ? 11.656  -1.399  -6.727  1.00 0.00 ? 64 LEU B HB2  5  
ATOM 9547  H HB3  . LEU B 2 54 ? 12.184  -0.399  -5.388  1.00 0.00 ? 64 LEU B HB3  5  
ATOM 9548  H HG   . LEU B 2 54 ? 10.349  -2.782  -5.137  1.00 0.00 ? 64 LEU B HG   5  
ATOM 9549  H HD11 . LEU B 2 54 ? 12.602  -3.446  -5.785  1.00 0.00 ? 64 LEU B HD11 5  
ATOM 9550  H HD12 . LEU B 2 54 ? 12.269  -3.892  -4.112  1.00 0.00 ? 64 LEU B HD12 5  
ATOM 9551  H HD13 . LEU B 2 54 ? 13.274  -2.488  -4.465  1.00 0.00 ? 64 LEU B HD13 5  
ATOM 9552  H HD21 . LEU B 2 54 ? 11.614  -0.955  -3.104  1.00 0.00 ? 64 LEU B HD21 5  
ATOM 9553  H HD22 . LEU B 2 54 ? 10.888  -2.513  -2.710  1.00 0.00 ? 64 LEU B HD22 5  
ATOM 9554  H HD23 . LEU B 2 54 ? 9.895   -1.223  -3.388  1.00 0.00 ? 64 LEU B HD23 5  
ATOM 9555  N N    . GLU B 2 55 ? 10.778  0.671   -8.161  1.00 0.00 ? 65 GLU B N    5  
ATOM 9556  C CA   . GLU B 2 55 ? 11.098  1.658   -9.194  1.00 0.00 ? 65 GLU B CA   5  
ATOM 9557  C C    . GLU B 2 55 ? 10.100  2.828   -9.202  1.00 0.00 ? 65 GLU B C    5  
ATOM 9558  O O    . GLU B 2 55 ? 10.491  3.974   -9.418  1.00 0.00 ? 65 GLU B O    5  
ATOM 9559  C CB   . GLU B 2 55 ? 11.193  0.987   -10.576 1.00 0.00 ? 65 GLU B CB   5  
ATOM 9560  C CG   . GLU B 2 55 ? 9.959   1.145   -11.452 1.00 0.00 ? 65 GLU B CG   5  
ATOM 9561  C CD   . GLU B 2 55 ? 10.301  1.251   -12.924 1.00 0.00 ? 65 GLU B CD   5  
ATOM 9562  O OE1  . GLU B 2 55 ? 11.431  1.672   -13.250 1.00 0.00 ? 65 GLU B OE1  5  
ATOM 9563  O OE2  . GLU B 2 55 ? 9.439   0.925   -13.764 1.00 0.00 ? 65 GLU B OE2  5  
ATOM 9564  H H    . GLU B 2 55 ? 10.889  -0.284  -8.355  1.00 0.00 ? 65 GLU B H    5  
ATOM 9565  H HA   . GLU B 2 55 ? 12.072  2.059   -8.948  1.00 0.00 ? 65 GLU B HA   5  
ATOM 9566  H HB2  . GLU B 2 55 ? 12.034  1.408   -11.105 1.00 0.00 ? 65 GLU B HB2  5  
ATOM 9567  H HB3  . GLU B 2 55 ? 11.370  -0.070  -10.432 1.00 0.00 ? 65 GLU B HB3  5  
ATOM 9568  H HG2  . GLU B 2 55 ? 9.317   0.289   -11.308 1.00 0.00 ? 65 GLU B HG2  5  
ATOM 9569  H HG3  . GLU B 2 55 ? 9.434   2.041   -11.154 1.00 0.00 ? 65 GLU B HG3  5  
ATOM 9570  N N    . GLU B 2 56 ? 8.822   2.544   -8.944  1.00 0.00 ? 66 GLU B N    5  
ATOM 9571  C CA   . GLU B 2 56 ? 7.787   3.580   -8.904  1.00 0.00 ? 66 GLU B CA   5  
ATOM 9572  C C    . GLU B 2 56 ? 8.085   4.633   -7.829  1.00 0.00 ? 66 GLU B C    5  
ATOM 9573  O O    . GLU B 2 56 ? 7.679   5.791   -7.949  1.00 0.00 ? 66 GLU B O    5  
ATOM 9574  C CB   . GLU B 2 56 ? 6.424   2.936   -8.636  1.00 0.00 ? 66 GLU B CB   5  
ATOM 9575  C CG   . GLU B 2 56 ? 5.256   3.909   -8.690  1.00 0.00 ? 66 GLU B CG   5  
ATOM 9576  C CD   . GLU B 2 56 ? 4.033   3.381   -7.971  1.00 0.00 ? 66 GLU B CD   5  
ATOM 9577  O OE1  . GLU B 2 56 ? 3.550   2.295   -8.344  1.00 0.00 ? 66 GLU B OE1  5  
ATOM 9578  O OE2  . GLU B 2 56 ? 3.556   4.052   -7.029  1.00 0.00 ? 66 GLU B OE2  5  
ATOM 9579  H H    . GLU B 2 56 ? 8.552   1.607   -8.819  1.00 0.00 ? 66 GLU B H    5  
ATOM 9580  H HA   . GLU B 2 56 ? 7.763   4.063   -9.869  1.00 0.00 ? 66 GLU B HA   5  
ATOM 9581  H HB2  . GLU B 2 56 ? 6.254   2.165   -9.372  1.00 0.00 ? 66 GLU B HB2  5  
ATOM 9582  H HB3  . GLU B 2 56 ? 6.441   2.484   -7.655  1.00 0.00 ? 66 GLU B HB3  5  
ATOM 9583  H HG2  . GLU B 2 56 ? 5.555   4.837   -8.227  1.00 0.00 ? 66 GLU B HG2  5  
ATOM 9584  H HG3  . GLU B 2 56 ? 5.000   4.088   -9.725  1.00 0.00 ? 66 GLU B HG3  5  
ATOM 9585  N N    . ALA B 2 57 ? 8.800   4.230   -6.787  1.00 0.00 ? 67 ALA B N    5  
ATOM 9586  C CA   . ALA B 2 57 ? 9.147   5.136   -5.696  1.00 0.00 ? 67 ALA B CA   5  
ATOM 9587  C C    . ALA B 2 57 ? 10.490  5.817   -5.950  1.00 0.00 ? 67 ALA B C    5  
ATOM 9588  O O    . ALA B 2 57 ? 10.966  6.603   -5.130  1.00 0.00 ? 67 ALA B O    5  
ATOM 9589  C CB   . ALA B 2 57 ? 9.177   4.382   -4.375  1.00 0.00 ? 67 ALA B CB   5  
ATOM 9590  H H    . ALA B 2 57 ? 9.108   3.297   -6.751  1.00 0.00 ? 67 ALA B H    5  
ATOM 9591  H HA   . ALA B 2 57 ? 8.379   5.891   -5.635  1.00 0.00 ? 67 ALA B HA   5  
ATOM 9592  H HB1  . ALA B 2 57 ? 8.221   3.906   -4.209  1.00 0.00 ? 67 ALA B HB1  5  
ATOM 9593  H HB2  . ALA B 2 57 ? 9.378   5.075   -3.570  1.00 0.00 ? 67 ALA B HB2  5  
ATOM 9594  H HB3  . ALA B 2 57 ? 9.953   3.631   -4.405  1.00 0.00 ? 67 ALA B HB3  5  
ATOM 9595  N N    . GLY B 2 58 ? 11.099  5.514   -7.088  1.00 0.00 ? 68 GLY B N    5  
ATOM 9596  C CA   . GLY B 2 58 ? 12.376  6.114   -7.425  1.00 0.00 ? 68 GLY B CA   5  
ATOM 9597  C C    . GLY B 2 58 ? 13.539  5.161   -7.241  1.00 0.00 ? 68 GLY B C    5  
ATOM 9598  O O    . GLY B 2 58 ? 14.700  5.572   -7.255  1.00 0.00 ? 68 GLY B O    5  
ATOM 9599  H H    . GLY B 2 58 ? 10.673  4.887   -7.713  1.00 0.00 ? 68 GLY B H    5  
ATOM 9600  H HA2  . GLY B 2 58 ? 12.349  6.435   -8.456  1.00 0.00 ? 68 GLY B HA2  5  
ATOM 9601  H HA3  . GLY B 2 58 ? 12.530  6.977   -6.795  1.00 0.00 ? 68 GLY B HA3  5  
ATOM 9602  N N    . VAL B 2 59 ? 13.237  3.884   -7.058  1.00 0.00 ? 69 VAL B N    5  
ATOM 9603  C CA   . VAL B 2 59 ? 14.277  2.884   -6.880  1.00 0.00 ? 69 VAL B CA   5  
ATOM 9604  C C    . VAL B 2 59 ? 14.638  2.254   -8.224  1.00 0.00 ? 69 VAL B C    5  
ATOM 9605  O O    . VAL B 2 59 ? 14.373  1.077   -8.470  1.00 0.00 ? 69 VAL B O    5  
ATOM 9606  C CB   . VAL B 2 59 ? 13.857  1.778   -5.882  1.00 0.00 ? 69 VAL B CB   5  
ATOM 9607  C CG1  . VAL B 2 59 ? 15.065  0.968   -5.433  1.00 0.00 ? 69 VAL B CG1  5  
ATOM 9608  C CG2  . VAL B 2 59 ? 13.142  2.373   -4.677  1.00 0.00 ? 69 VAL B CG2  5  
ATOM 9609  H H    . VAL B 2 59 ? 12.296  3.609   -7.045  1.00 0.00 ? 69 VAL B H    5  
ATOM 9610  H HA   . VAL B 2 59 ? 15.152  3.383   -6.484  1.00 0.00 ? 69 VAL B HA   5  
ATOM 9611  H HB   . VAL B 2 59 ? 13.172  1.111   -6.386  1.00 0.00 ? 69 VAL B HB   5  
ATOM 9612  H HG11 . VAL B 2 59 ? 14.744  0.185   -4.761  1.00 0.00 ? 69 VAL B HG11 5  
ATOM 9613  H HG12 . VAL B 2 59 ? 15.764  1.615   -4.925  1.00 0.00 ? 69 VAL B HG12 5  
ATOM 9614  H HG13 . VAL B 2 59 ? 15.544  0.528   -6.296  1.00 0.00 ? 69 VAL B HG13 5  
ATOM 9615  H HG21 . VAL B 2 59 ? 13.808  3.049   -4.161  1.00 0.00 ? 69 VAL B HG21 5  
ATOM 9616  H HG22 . VAL B 2 59 ? 12.843  1.580   -4.007  1.00 0.00 ? 69 VAL B HG22 5  
ATOM 9617  H HG23 . VAL B 2 59 ? 12.266  2.913   -5.007  1.00 0.00 ? 69 VAL B HG23 5  
ATOM 9618  N N    . GLN B 2 60 ? 15.220  3.059   -9.105  1.00 0.00 ? 70 GLN B N    5  
ATOM 9619  C CA   . GLN B 2 60 ? 15.621  2.584   -10.424 1.00 0.00 ? 70 GLN B CA   5  
ATOM 9620  C C    . GLN B 2 60 ? 17.023  1.990   -10.380 1.00 0.00 ? 70 GLN B C    5  
ATOM 9621  O O    . GLN B 2 60 ? 17.483  1.376   -11.342 1.00 0.00 ? 70 GLN B O    5  
ATOM 9622  C CB   . GLN B 2 60 ? 15.574  3.720   -11.450 1.00 0.00 ? 70 GLN B CB   5  
ATOM 9623  C CG   . GLN B 2 60 ? 14.304  3.740   -12.287 1.00 0.00 ? 70 GLN B CG   5  
ATOM 9624  C CD   . GLN B 2 60 ? 13.158  4.452   -11.598 1.00 0.00 ? 70 GLN B CD   5  
ATOM 9625  O OE1  . GLN B 2 60 ? 13.362  5.396   -10.835 1.00 0.00 ? 70 GLN B OE1  5  
ATOM 9626  N NE2  . GLN B 2 60 ? 11.944  4.008   -11.862 1.00 0.00 ? 70 GLN B NE2  5  
ATOM 9627  H H    . GLN B 2 60 ? 15.375  3.999   -8.865  1.00 0.00 ? 70 GLN B H    5  
ATOM 9628  H HA   . GLN B 2 60 ? 14.927  1.812   -10.722 1.00 0.00 ? 70 GLN B HA   5  
ATOM 9629  H HB2  . GLN B 2 60 ? 15.649  4.663   -10.929 1.00 0.00 ? 70 GLN B HB2  5  
ATOM 9630  H HB3  . GLN B 2 60 ? 16.417  3.620   -12.118 1.00 0.00 ? 70 GLN B HB3  5  
ATOM 9631  H HG2  . GLN B 2 60 ? 14.509  4.245   -13.219 1.00 0.00 ? 70 GLN B HG2  5  
ATOM 9632  H HG3  . GLN B 2 60 ? 14.005  2.721   -12.488 1.00 0.00 ? 70 GLN B HG3  5  
ATOM 9633  H HE21 . GLN B 2 60 ? 11.847  3.245   -12.486 1.00 0.00 ? 70 GLN B HE21 5  
ATOM 9634  H HE22 . GLN B 2 60 ? 11.184  4.445   -11.421 1.00 0.00 ? 70 GLN B HE22 5  
ATOM 9635  N N    . ASP B 2 61 ? 17.694  2.171   -9.253  1.00 0.00 ? 71 ASP B N    5  
ATOM 9636  C CA   . ASP B 2 61 ? 19.048  1.660   -9.078  1.00 0.00 ? 71 ASP B CA   5  
ATOM 9637  C C    . ASP B 2 61 ? 19.031  0.147   -8.863  1.00 0.00 ? 71 ASP B C    5  
ATOM 9638  O O    . ASP B 2 61 ? 18.251  -0.366  -8.055  1.00 0.00 ? 71 ASP B O    5  
ATOM 9639  C CB   . ASP B 2 61 ? 19.726  2.359   -7.900  1.00 0.00 ? 71 ASP B CB   5  
ATOM 9640  C CG   . ASP B 2 61 ? 21.148  1.884   -7.690  1.00 0.00 ? 71 ASP B CG   5  
ATOM 9641  O OD1  . ASP B 2 61 ? 22.057  2.407   -8.364  1.00 0.00 ? 71 ASP B OD1  5  
ATOM 9642  O OD2  . ASP B 2 61 ? 21.359  0.990   -6.850  1.00 0.00 ? 71 ASP B OD2  5  
ATOM 9643  H H    . ASP B 2 61 ? 17.267  2.653   -8.518  1.00 0.00 ? 71 ASP B H    5  
ATOM 9644  H HA   . ASP B 2 61 ? 19.600  1.877   -9.980  1.00 0.00 ? 71 ASP B HA   5  
ATOM 9645  H HB2  . ASP B 2 61 ? 19.746  3.423   -8.083  1.00 0.00 ? 71 ASP B HB2  5  
ATOM 9646  H HB3  . ASP B 2 61 ? 19.163  2.164   -7.000  1.00 0.00 ? 71 ASP B HB3  5  
ATOM 9647  N N    . PRO B 2 62 ? 19.887  -0.588  -9.593  1.00 0.00 ? 72 PRO B N    5  
ATOM 9648  C CA   . PRO B 2 62 ? 19.964  -2.050  -9.497  1.00 0.00 ? 72 PRO B CA   5  
ATOM 9649  C C    . PRO B 2 62 ? 20.424  -2.538  -8.123  1.00 0.00 ? 72 PRO B C    5  
ATOM 9650  O O    . PRO B 2 62 ? 19.850  -3.478  -7.569  1.00 0.00 ? 72 PRO B O    5  
ATOM 9651  C CB   . PRO B 2 62 ? 20.992  -2.429  -10.570 1.00 0.00 ? 72 PRO B CB   5  
ATOM 9652  C CG   . PRO B 2 62 ? 21.796  -1.194  -10.789 1.00 0.00 ? 72 PRO B CG   5  
ATOM 9653  C CD   . PRO B 2 62 ? 20.854  -0.047  -10.566 1.00 0.00 ? 72 PRO B CD   5  
ATOM 9654  H HA   . PRO B 2 62 ? 19.015  -2.507  -9.735  1.00 0.00 ? 72 PRO B HA   5  
ATOM 9655  H HB2  . PRO B 2 62 ? 21.606  -3.242  -10.209 1.00 0.00 ? 72 PRO B HB2  5  
ATOM 9656  H HB3  . PRO B 2 62 ? 20.481  -2.731  -11.471 1.00 0.00 ? 72 PRO B HB3  5  
ATOM 9657  H HG2  . PRO B 2 62 ? 22.610  -1.155  -10.078 1.00 0.00 ? 72 PRO B HG2  5  
ATOM 9658  H HG3  . PRO B 2 62 ? 22.177  -1.177  -11.798 1.00 0.00 ? 72 PRO B HG3  5  
ATOM 9659  H HD2  . PRO B 2 62 ? 21.383  0.800   -10.154 1.00 0.00 ? 72 PRO B HD2  5  
ATOM 9660  H HD3  . PRO B 2 62 ? 20.362  0.224   -11.488 1.00 0.00 ? 72 PRO B HD3  5  
ATOM 9661  N N    . ALA B 2 63 ? 21.444  -1.887  -7.579  1.00 0.00 ? 73 ALA B N    5  
ATOM 9662  C CA   . ALA B 2 63 ? 21.989  -2.262  -6.282  1.00 0.00 ? 73 ALA B CA   5  
ATOM 9663  C C    . ALA B 2 63 ? 20.965  -2.038  -5.177  1.00 0.00 ? 73 ALA B C    5  
ATOM 9664  O O    . ALA B 2 63 ? 20.808  -2.875  -4.289  1.00 0.00 ? 73 ALA B O    5  
ATOM 9665  C CB   . ALA B 2 63 ? 23.263  -1.482  -5.998  1.00 0.00 ? 73 ALA B CB   5  
ATOM 9666  H H    . ALA B 2 63 ? 21.832  -1.121  -8.055  1.00 0.00 ? 73 ALA B H    5  
ATOM 9667  H HA   . ALA B 2 63 ? 22.239  -3.313  -6.319  1.00 0.00 ? 73 ALA B HA   5  
ATOM 9668  H HB1  . ALA B 2 63 ? 23.626  -1.733  -5.013  1.00 0.00 ? 73 ALA B HB1  5  
ATOM 9669  H HB2  . ALA B 2 63 ? 23.054  -0.424  -6.047  1.00 0.00 ? 73 ALA B HB2  5  
ATOM 9670  H HB3  . ALA B 2 63 ? 24.011  -1.736  -6.734  1.00 0.00 ? 73 ALA B HB3  5  
ATOM 9671  N N    . HIS B 2 64 ? 20.266  -0.912  -5.243  1.00 0.00 ? 74 HIS B N    5  
ATOM 9672  C CA   . HIS B 2 64 ? 19.252  -0.578  -4.248  1.00 0.00 ? 74 HIS B CA   5  
ATOM 9673  C C    . HIS B 2 64 ? 18.125  -1.605  -4.248  1.00 0.00 ? 74 HIS B C    5  
ATOM 9674  O O    . HIS B 2 64 ? 17.654  -2.010  -3.186  1.00 0.00 ? 74 HIS B O    5  
ATOM 9675  C CB   . HIS B 2 64 ? 18.695  0.828   -4.490  1.00 0.00 ? 74 HIS B CB   5  
ATOM 9676  C CG   . HIS B 2 64 ? 19.661  1.919   -4.139  1.00 0.00 ? 74 HIS B CG   5  
ATOM 9677  N ND1  . HIS B 2 64 ? 19.563  3.216   -4.593  1.00 0.00 ? 74 HIS B ND1  5  
ATOM 9678  C CD2  . HIS B 2 64 ? 20.771  1.881   -3.359  1.00 0.00 ? 74 HIS B CD2  5  
ATOM 9679  C CE1  . HIS B 2 64 ? 20.594  3.908   -4.092  1.00 0.00 ? 74 HIS B CE1  5  
ATOM 9680  N NE2  . HIS B 2 64 ? 21.358  3.143   -3.335  1.00 0.00 ? 74 HIS B NE2  5  
ATOM 9681  H H    . HIS B 2 64 ? 20.453  -0.274  -5.976  1.00 0.00 ? 74 HIS B H    5  
ATOM 9682  H HA   . HIS B 2 64 ? 19.731  -0.598  -3.280  1.00 0.00 ? 74 HIS B HA   5  
ATOM 9683  H HB2  . HIS B 2 64 ? 18.440  0.932   -5.535  1.00 0.00 ? 74 HIS B HB2  5  
ATOM 9684  H HB3  . HIS B 2 64 ? 17.806  0.964   -3.892  1.00 0.00 ? 74 HIS B HB3  5  
ATOM 9685  H HD1  . HIS B 2 64 ? 18.855  3.575   -5.174  1.00 0.00 ? 74 HIS B HD1  5  
ATOM 9686  H HD2  . HIS B 2 64 ? 21.151  1.015   -2.838  1.00 0.00 ? 74 HIS B HD2  5  
ATOM 9687  H HE1  . HIS B 2 64 ? 20.775  4.956   -4.279  1.00 0.00 ? 74 HIS B HE1  5  
ATOM 9688  N N    . LYS B 2 65 ? 17.700  -2.028  -5.434  1.00 0.00 ? 75 LYS B N    5  
ATOM 9689  C CA   . LYS B 2 65 ? 16.636  -3.024  -5.546  1.00 0.00 ? 75 LYS B CA   5  
ATOM 9690  C C    . LYS B 2 65 ? 17.098  -4.354  -4.959  1.00 0.00 ? 75 LYS B C    5  
ATOM 9691  O O    . LYS B 2 65 ? 16.435  -4.926  -4.091  1.00 0.00 ? 75 LYS B O    5  
ATOM 9692  C CB   . LYS B 2 65 ? 16.222  -3.219  -7.007  1.00 0.00 ? 75 LYS B CB   5  
ATOM 9693  C CG   . LYS B 2 65 ? 15.358  -2.096  -7.561  1.00 0.00 ? 75 LYS B CG   5  
ATOM 9694  C CD   . LYS B 2 65 ? 14.675  -2.506  -8.859  1.00 0.00 ? 75 LYS B CD   5  
ATOM 9695  C CE   . LYS B 2 65 ? 15.680  -2.730  -9.978  1.00 0.00 ? 75 LYS B CE   5  
ATOM 9696  N NZ   . LYS B 2 65 ? 15.110  -3.551  -11.078 1.00 0.00 ? 75 LYS B NZ   5  
ATOM 9697  H H    . LYS B 2 65 ? 18.106  -1.662  -6.249  1.00 0.00 ? 75 LYS B H    5  
ATOM 9698  H HA   . LYS B 2 65 ? 15.788  -2.668  -4.981  1.00 0.00 ? 75 LYS B HA   5  
ATOM 9699  H HB2  . LYS B 2 65 ? 17.113  -3.288  -7.613  1.00 0.00 ? 75 LYS B HB2  5  
ATOM 9700  H HB3  . LYS B 2 65 ? 15.669  -4.143  -7.091  1.00 0.00 ? 75 LYS B HB3  5  
ATOM 9701  H HG2  . LYS B 2 65 ? 14.602  -1.842  -6.833  1.00 0.00 ? 75 LYS B HG2  5  
ATOM 9702  H HG3  . LYS B 2 65 ? 15.981  -1.234  -7.750  1.00 0.00 ? 75 LYS B HG3  5  
ATOM 9703  H HD2  . LYS B 2 65 ? 14.128  -3.422  -8.693  1.00 0.00 ? 75 LYS B HD2  5  
ATOM 9704  H HD3  . LYS B 2 65 ? 13.988  -1.725  -9.154  1.00 0.00 ? 75 LYS B HD3  5  
ATOM 9705  H HE2  . LYS B 2 65 ? 15.977  -1.771  -10.374 1.00 0.00 ? 75 LYS B HE2  5  
ATOM 9706  H HE3  . LYS B 2 65 ? 16.544  -3.234  -9.573  1.00 0.00 ? 75 LYS B HE3  5  
ATOM 9707  H HZ1  . LYS B 2 65 ? 14.272  -3.088  -11.478 1.00 0.00 ? 75 LYS B HZ1  5  
ATOM 9708  H HZ2  . LYS B 2 65 ? 14.835  -4.494  -10.715 1.00 0.00 ? 75 LYS B HZ2  5  
ATOM 9709  H HZ3  . LYS B 2 65 ? 15.817  -3.679  -11.830 1.00 0.00 ? 75 LYS B HZ3  5  
ATOM 9710  N N    . ARG B 2 66 ? 18.234  -4.838  -5.454  1.00 0.00 ? 76 ARG B N    5  
ATOM 9711  C CA   . ARG B 2 66 ? 18.814  -6.094  -4.985  1.00 0.00 ? 76 ARG B CA   5  
ATOM 9712  C C    . ARG B 2 66 ? 18.984  -6.082  -3.465  1.00 0.00 ? 76 ARG B C    5  
ATOM 9713  O O    . ARG B 2 66 ? 18.613  -7.041  -2.784  1.00 0.00 ? 76 ARG B O    5  
ATOM 9714  C CB   . ARG B 2 66 ? 20.162  -6.346  -5.669  1.00 0.00 ? 76 ARG B CB   5  
ATOM 9715  C CG   . ARG B 2 66 ? 20.743  -7.729  -5.402  1.00 0.00 ? 76 ARG B CG   5  
ATOM 9716  C CD   . ARG B 2 66 ? 19.905  -8.831  -6.040  1.00 0.00 ? 76 ARG B CD   5  
ATOM 9717  N NE   . ARG B 2 66 ? 20.565  -10.135 -5.959  1.00 0.00 ? 76 ARG B NE   5  
ATOM 9718  C CZ   . ARG B 2 66 ? 19.928  -11.292 -5.758  1.00 0.00 ? 76 ARG B CZ   5  
ATOM 9719  N NH1  . ARG B 2 66 ? 18.602  -11.324 -5.693  1.00 0.00 ? 76 ARG B NH1  5  
ATOM 9720  N NH2  . ARG B 2 66 ? 20.614  -12.423 -5.655  1.00 0.00 ? 76 ARG B NH2  5  
ATOM 9721  H H    . ARG B 2 66 ? 18.663  -4.350  -6.191  1.00 0.00 ? 76 ARG B H    5  
ATOM 9722  H HA   . ARG B 2 66 ? 18.133  -6.888  -5.250  1.00 0.00 ? 76 ARG B HA   5  
ATOM 9723  H HB2  . ARG B 2 66 ? 20.037  -6.233  -6.736  1.00 0.00 ? 76 ARG B HB2  5  
ATOM 9724  H HB3  . ARG B 2 66 ? 20.872  -5.609  -5.321  1.00 0.00 ? 76 ARG B HB3  5  
ATOM 9725  H HG2  . ARG B 2 66 ? 21.742  -7.774  -5.809  1.00 0.00 ? 76 ARG B HG2  5  
ATOM 9726  H HG3  . ARG B 2 66 ? 20.781  -7.892  -4.335  1.00 0.00 ? 76 ARG B HG3  5  
ATOM 9727  H HD2  . ARG B 2 66 ? 18.956  -8.886  -5.527  1.00 0.00 ? 76 ARG B HD2  5  
ATOM 9728  H HD3  . ARG B 2 66 ? 19.739  -8.584  -7.079  1.00 0.00 ? 76 ARG B HD3  5  
ATOM 9729  H HE   . ARG B 2 66 ? 21.546  -10.145 -6.050  1.00 0.00 ? 76 ARG B HE   5  
ATOM 9730  H HH11 . ARG B 2 66 ? 18.071  -10.482 -5.799  1.00 0.00 ? 76 ARG B HH11 5  
ATOM 9731  H HH12 . ARG B 2 66 ? 18.127  -12.196 -5.539  1.00 0.00 ? 76 ARG B HH12 5  
ATOM 9732  H HH21 . ARG B 2 66 ? 21.614  -12.418 -5.731  1.00 0.00 ? 76 ARG B HH21 5  
ATOM 9733  H HH22 . ARG B 2 66 ? 20.134  -13.293 -5.498  1.00 0.00 ? 76 ARG B HH22 5  
ATOM 9734  N N    . LEU B 2 67 ? 19.535  -4.988  -2.940  1.00 0.00 ? 77 LEU B N    5  
ATOM 9735  C CA   . LEU B 2 67 ? 19.747  -4.850  -1.504  1.00 0.00 ? 77 LEU B CA   5  
ATOM 9736  C C    . LEU B 2 67 ? 18.420  -4.852  -0.749  1.00 0.00 ? 77 LEU B C    5  
ATOM 9737  O O    . LEU B 2 67 ? 18.288  -5.520  0.275   1.00 0.00 ? 77 LEU B O    5  
ATOM 9738  C CB   . LEU B 2 67 ? 20.519  -3.558  -1.200  1.00 0.00 ? 77 LEU B CB   5  
ATOM 9739  C CG   . LEU B 2 67 ? 21.751  -3.720  -0.301  1.00 0.00 ? 77 LEU B CG   5  
ATOM 9740  C CD1  . LEU B 2 67 ? 21.350  -4.187  1.090   1.00 0.00 ? 77 LEU B CD1  5  
ATOM 9741  C CD2  . LEU B 2 67 ? 22.743  -4.692  -0.922  1.00 0.00 ? 77 LEU B CD2  5  
ATOM 9742  H H    . LEU B 2 67 ? 19.827  -4.263  -3.538  1.00 0.00 ? 77 LEU B H    5  
ATOM 9743  H HA   . LEU B 2 67 ? 20.333  -5.692  -1.175  1.00 0.00 ? 77 LEU B HA   5  
ATOM 9744  H HB2  . LEU B 2 67 ? 20.838  -3.128  -2.137  1.00 0.00 ? 77 LEU B HB2  5  
ATOM 9745  H HB3  . LEU B 2 67 ? 19.841  -2.866  -0.721  1.00 0.00 ? 77 LEU B HB3  5  
ATOM 9746  H HG   . LEU B 2 67 ? 22.241  -2.762  -0.201  1.00 0.00 ? 77 LEU B HG   5  
ATOM 9747  H HD11 . LEU B 2 67 ? 22.237  -4.350  1.685   1.00 0.00 ? 77 LEU B HD11 5  
ATOM 9748  H HD12 . LEU B 2 67 ? 20.792  -5.108  1.014   1.00 0.00 ? 77 LEU B HD12 5  
ATOM 9749  H HD13 . LEU B 2 67 ? 20.737  -3.431  1.560   1.00 0.00 ? 77 LEU B HD13 5  
ATOM 9750  H HD21 . LEU B 2 67 ? 22.360  -5.698  -0.846  1.00 0.00 ? 77 LEU B HD21 5  
ATOM 9751  H HD22 . LEU B 2 67 ? 23.687  -4.625  -0.402  1.00 0.00 ? 77 LEU B HD22 5  
ATOM 9752  H HD23 . LEU B 2 67 ? 22.887  -4.441  -1.963  1.00 0.00 ? 77 LEU B HD23 5  
ATOM 9753  N N    . LEU B 2 68 ? 17.442  -4.110  -1.261  1.00 0.00 ? 78 LEU B N    5  
ATOM 9754  C CA   . LEU B 2 68 ? 16.127  -4.030  -0.632  1.00 0.00 ? 78 LEU B CA   5  
ATOM 9755  C C    . LEU B 2 68 ? 15.510  -5.421  -0.504  1.00 0.00 ? 78 LEU B C    5  
ATOM 9756  O O    . LEU B 2 68 ? 15.049  -5.808  0.571   1.00 0.00 ? 78 LEU B O    5  
ATOM 9757  C CB   . LEU B 2 68 ? 15.204  -3.110  -1.438  1.00 0.00 ? 78 LEU B CB   5  
ATOM 9758  C CG   . LEU B 2 68 ? 14.273  -2.225  -0.605  1.00 0.00 ? 78 LEU B CG   5  
ATOM 9759  C CD1  . LEU B 2 68 ? 13.960  -0.936  -1.349  1.00 0.00 ? 78 LEU B CD1  5  
ATOM 9760  C CD2  . LEU B 2 68 ? 12.987  -2.965  -0.264  1.00 0.00 ? 78 LEU B CD2  5  
ATOM 9761  H H    . LEU B 2 68 ? 17.610  -3.597  -2.083  1.00 0.00 ? 78 LEU B H    5  
ATOM 9762  H HA   . LEU B 2 68 ? 16.260  -3.617  0.357   1.00 0.00 ? 78 LEU B HA   5  
ATOM 9763  H HB2  . LEU B 2 68 ? 15.819  -2.471  -2.055  1.00 0.00 ? 78 LEU B HB2  5  
ATOM 9764  H HB3  . LEU B 2 68 ? 14.595  -3.725  -2.084  1.00 0.00 ? 78 LEU B HB3  5  
ATOM 9765  H HG   . LEU B 2 68 ? 14.766  -1.965  0.320   1.00 0.00 ? 78 LEU B HG   5  
ATOM 9766  H HD11 . LEU B 2 68 ? 14.866  -0.362  -1.469  1.00 0.00 ? 78 LEU B HD11 5  
ATOM 9767  H HD12 . LEU B 2 68 ? 13.240  -0.361  -0.786  1.00 0.00 ? 78 LEU B HD12 5  
ATOM 9768  H HD13 . LEU B 2 68 ? 13.552  -1.172  -2.321  1.00 0.00 ? 78 LEU B HD13 5  
ATOM 9769  H HD21 . LEU B 2 68 ? 13.216  -3.816  0.360   1.00 0.00 ? 78 LEU B HD21 5  
ATOM 9770  H HD22 . LEU B 2 68 ? 12.514  -3.304  -1.174  1.00 0.00 ? 78 LEU B HD22 5  
ATOM 9771  H HD23 . LEU B 2 68 ? 12.318  -2.302  0.263   1.00 0.00 ? 78 LEU B HD23 5  
ATOM 9772  N N    . LEU B 2 69 ? 15.508  -6.164  -1.607  1.00 0.00 ? 79 LEU B N    5  
ATOM 9773  C CA   . LEU B 2 69 ? 14.969  -7.523  -1.628  1.00 0.00 ? 79 LEU B CA   5  
ATOM 9774  C C    . LEU B 2 69 ? 15.637  -8.398  -0.569  1.00 0.00 ? 79 LEU B C    5  
ATOM 9775  O O    . LEU B 2 69 ? 14.967  -9.151  0.140   1.00 0.00 ? 79 LEU B O    5  
ATOM 9776  C CB   . LEU B 2 69 ? 15.157  -8.147  -3.015  1.00 0.00 ? 79 LEU B CB   5  
ATOM 9777  C CG   . LEU B 2 69 ? 13.915  -8.145  -3.912  1.00 0.00 ? 79 LEU B CG   5  
ATOM 9778  C CD1  . LEU B 2 69 ? 13.447  -6.724  -4.189  1.00 0.00 ? 79 LEU B CD1  5  
ATOM 9779  C CD2  . LEU B 2 69 ? 14.204  -8.872  -5.216  1.00 0.00 ? 79 LEU B CD2  5  
ATOM 9780  H H    . LEU B 2 69 ? 15.836  -5.770  -2.447  1.00 0.00 ? 79 LEU B H    5  
ATOM 9781  H HA   . LEU B 2 69 ? 13.913  -7.463  -1.413  1.00 0.00 ? 79 LEU B HA   5  
ATOM 9782  H HB2  . LEU B 2 69 ? 15.943  -7.608  -3.524  1.00 0.00 ? 79 LEU B HB2  5  
ATOM 9783  H HB3  . LEU B 2 69 ? 15.475  -9.171  -2.884  1.00 0.00 ? 79 LEU B HB3  5  
ATOM 9784  H HG   . LEU B 2 69 ? 13.114  -8.667  -3.408  1.00 0.00 ? 79 LEU B HG   5  
ATOM 9785  H HD11 . LEU B 2 69 ? 12.572  -6.750  -4.823  1.00 0.00 ? 79 LEU B HD11 5  
ATOM 9786  H HD12 . LEU B 2 69 ? 14.234  -6.175  -4.683  1.00 0.00 ? 79 LEU B HD12 5  
ATOM 9787  H HD13 . LEU B 2 69 ? 13.200  -6.238  -3.257  1.00 0.00 ? 79 LEU B HD13 5  
ATOM 9788  H HD21 . LEU B 2 69 ? 14.499  -9.889  -5.001  1.00 0.00 ? 79 LEU B HD21 5  
ATOM 9789  H HD22 . LEU B 2 69 ? 15.002  -8.369  -5.739  1.00 0.00 ? 79 LEU B HD22 5  
ATOM 9790  H HD23 . LEU B 2 69 ? 13.317  -8.877  -5.830  1.00 0.00 ? 79 LEU B HD23 5  
ATOM 9791  N N    . ASP B 2 70 ? 16.957  -8.285  -0.457  1.00 0.00 ? 80 ASP B N    5  
ATOM 9792  C CA   . ASP B 2 70 ? 17.707  -9.064  0.524   1.00 0.00 ? 80 ASP B CA   5  
ATOM 9793  C C    . ASP B 2 70 ? 17.364  -8.610  1.938   1.00 0.00 ? 80 ASP B C    5  
ATOM 9794  O O    . ASP B 2 70 ? 17.212  -9.428  2.847   1.00 0.00 ? 80 ASP B O    5  
ATOM 9795  C CB   . ASP B 2 70 ? 19.214  -8.942  0.285   1.00 0.00 ? 80 ASP B CB   5  
ATOM 9796  C CG   . ASP B 2 70 ? 20.012  -9.856  1.197   1.00 0.00 ? 80 ASP B CG   5  
ATOM 9797  O OD1  . ASP B 2 70 ? 20.129  -11.062 0.886   1.00 0.00 ? 80 ASP B OD1  5  
ATOM 9798  O OD2  . ASP B 2 70 ? 20.525  -9.378  2.228   1.00 0.00 ? 80 ASP B OD2  5  
ATOM 9799  H H    . ASP B 2 70 ? 17.429  -7.663  -1.053  1.00 0.00 ? 80 ASP B H    5  
ATOM 9800  H HA   . ASP B 2 70 ? 17.418  -10.099 0.413   1.00 0.00 ? 80 ASP B HA   5  
ATOM 9801  H HB2  . ASP B 2 70 ? 19.434  -9.203  -0.739  1.00 0.00 ? 80 ASP B HB2  5  
ATOM 9802  H HB3  . ASP B 2 70 ? 19.521  -7.922  0.468   1.00 0.00 ? 80 ASP B HB3  5  
ATOM 9803  N N    . THR B 2 71 ? 17.221  -7.300  2.110   1.00 0.00 ? 81 THR B N    5  
ATOM 9804  C CA   . THR B 2 71 ? 16.879  -6.727  3.403   1.00 0.00 ? 81 THR B CA   5  
ATOM 9805  C C    . THR B 2 71 ? 15.518  -7.237  3.867   1.00 0.00 ? 81 THR B C    5  
ATOM 9806  O O    . THR B 2 71 ? 15.320  -7.517  5.051   1.00 0.00 ? 81 THR B O    5  
ATOM 9807  C CB   . THR B 2 71 ? 16.869  -5.188  3.347   1.00 0.00 ? 81 THR B CB   5  
ATOM 9808  O OG1  . THR B 2 71 ? 18.112  -4.722  2.809   1.00 0.00 ? 81 THR B OG1  5  
ATOM 9809  C CG2  . THR B 2 71 ? 16.659  -4.585  4.730   1.00 0.00 ? 81 THR B CG2  5  
ATOM 9810  H H    . THR B 2 71 ? 17.355  -6.702  1.341   1.00 0.00 ? 81 THR B H    5  
ATOM 9811  H HA   . THR B 2 71 ? 17.631  -7.038  4.115   1.00 0.00 ? 81 THR B HA   5  
ATOM 9812  H HB   . THR B 2 71 ? 16.063  -4.869  2.702   1.00 0.00 ? 81 THR B HB   5  
ATOM 9813  H HG1  . THR B 2 71 ? 18.270  -5.139  1.953   1.00 0.00 ? 81 THR B HG1  5  
ATOM 9814  H HG21 . THR B 2 71 ? 16.627  -3.509  4.654   1.00 0.00 ? 81 THR B HG21 5  
ATOM 9815  H HG22 . THR B 2 71 ? 17.474  -4.876  5.376   1.00 0.00 ? 81 THR B HG22 5  
ATOM 9816  H HG23 . THR B 2 71 ? 15.727  -4.945  5.141   1.00 0.00 ? 81 THR B HG23 5  
ATOM 9817  N N    . LEU B 2 72 ? 14.586  -7.368  2.926   1.00 0.00 ? 82 LEU B N    5  
ATOM 9818  C CA   . LEU B 2 72 ? 13.256  -7.875  3.235   1.00 0.00 ? 82 LEU B CA   5  
ATOM 9819  C C    . LEU B 2 72 ? 13.365  -9.276  3.817   1.00 0.00 ? 82 LEU B C    5  
ATOM 9820  O O    . LEU B 2 72 ? 12.720  -9.600  4.809   1.00 0.00 ? 82 LEU B O    5  
ATOM 9821  C CB   . LEU B 2 72 ? 12.376  -7.898  1.983   1.00 0.00 ? 82 LEU B CB   5  
ATOM 9822  C CG   . LEU B 2 72 ? 11.935  -6.528  1.464   1.00 0.00 ? 82 LEU B CG   5  
ATOM 9823  C CD1  . LEU B 2 72 ? 11.249  -6.670  0.116   1.00 0.00 ? 82 LEU B CD1  5  
ATOM 9824  C CD2  . LEU B 2 72 ? 11.009  -5.849  2.463   1.00 0.00 ? 82 LEU B CD2  5  
ATOM 9825  H H    . LEU B 2 72 ? 14.799  -7.108  2.000   1.00 0.00 ? 82 LEU B H    5  
ATOM 9826  H HA   . LEU B 2 72 ? 12.811  -7.222  3.972   1.00 0.00 ? 82 LEU B HA   5  
ATOM 9827  H HB2  . LEU B 2 72 ? 12.923  -8.398  1.197   1.00 0.00 ? 82 LEU B HB2  5  
ATOM 9828  H HB3  . LEU B 2 72 ? 11.490  -8.475  2.204   1.00 0.00 ? 82 LEU B HB3  5  
ATOM 9829  H HG   . LEU B 2 72 ? 12.806  -5.902  1.332   1.00 0.00 ? 82 LEU B HG   5  
ATOM 9830  H HD11 . LEU B 2 72 ? 10.952  -5.695  -0.242  1.00 0.00 ? 82 LEU B HD11 5  
ATOM 9831  H HD12 . LEU B 2 72 ? 10.375  -7.296  0.221   1.00 0.00 ? 82 LEU B HD12 5  
ATOM 9832  H HD13 . LEU B 2 72 ? 11.931  -7.120  -0.590  1.00 0.00 ? 82 LEU B HD13 5  
ATOM 9833  H HD21 . LEU B 2 72 ? 11.546  -5.660  3.382   1.00 0.00 ? 82 LEU B HD21 5  
ATOM 9834  H HD22 . LEU B 2 72 ? 10.165  -6.491  2.667   1.00 0.00 ? 82 LEU B HD22 5  
ATOM 9835  H HD23 . LEU B 2 72 ? 10.660  -4.913  2.052   1.00 0.00 ? 82 LEU B HD23 5  
ATOM 9836  N N    . GLN B 2 73 ? 14.212  -10.093 3.199   1.00 0.00 ? 83 GLN B N    5  
ATOM 9837  C CA   . GLN B 2 73 ? 14.430  -11.456 3.661   1.00 0.00 ? 83 GLN B CA   5  
ATOM 9838  C C    . GLN B 2 73 ? 15.072  -11.445 5.044   1.00 0.00 ? 83 GLN B C    5  
ATOM 9839  O O    . GLN B 2 73 ? 14.650  -12.175 5.941   1.00 0.00 ? 83 GLN B O    5  
ATOM 9840  C CB   . GLN B 2 73 ? 15.320  -12.222 2.676   1.00 0.00 ? 83 GLN B CB   5  
ATOM 9841  C CG   . GLN B 2 73 ? 14.719  -12.350 1.286   1.00 0.00 ? 83 GLN B CG   5  
ATOM 9842  C CD   . GLN B 2 73 ? 13.387  -13.074 1.292   1.00 0.00 ? 83 GLN B CD   5  
ATOM 9843  O OE1  . GLN B 2 73 ? 13.154  -13.967 2.107   1.00 0.00 ? 83 GLN B OE1  5  
ATOM 9844  N NE2  . GLN B 2 73 ? 12.503  -12.691 0.387   1.00 0.00 ? 83 GLN B NE2  5  
ATOM 9845  H H    . GLN B 2 73 ? 14.698  -9.770  2.410   1.00 0.00 ? 83 GLN B H    5  
ATOM 9846  H HA   . GLN B 2 73 ? 13.469  -11.945 3.724   1.00 0.00 ? 83 GLN B HA   5  
ATOM 9847  H HB2  . GLN B 2 73 ? 16.266  -11.708 2.591   1.00 0.00 ? 83 GLN B HB2  5  
ATOM 9848  H HB3  . GLN B 2 73 ? 15.493  -13.215 3.064   1.00 0.00 ? 83 GLN B HB3  5  
ATOM 9849  H HG2  . GLN B 2 73 ? 14.571  -11.361 0.879   1.00 0.00 ? 83 GLN B HG2  5  
ATOM 9850  H HG3  . GLN B 2 73 ? 15.407  -12.898 0.660   1.00 0.00 ? 83 GLN B HG3  5  
ATOM 9851  H HE21 . GLN B 2 73 ? 12.752  -11.973 -0.229  1.00 0.00 ? 83 GLN B HE21 5  
ATOM 9852  H HE22 . GLN B 2 73 ? 11.629  -13.138 0.374   1.00 0.00 ? 83 GLN B HE22 5  
ATOM 9853  N N    . LEU B 2 74 ? 16.101  -10.617 5.202   1.00 0.00 ? 84 LEU B N    5  
ATOM 9854  C CA   . LEU B 2 74 ? 16.808  -10.484 6.472   1.00 0.00 ? 84 LEU B CA   5  
ATOM 9855  C C    . LEU B 2 74 ? 15.864  -10.089 7.607   1.00 0.00 ? 84 LEU B C    5  
ATOM 9856  O O    . LEU B 2 74 ? 15.986  -10.586 8.727   1.00 0.00 ? 84 LEU B O    5  
ATOM 9857  C CB   . LEU B 2 74 ? 17.920  -9.443  6.340   1.00 0.00 ? 84 LEU B CB   5  
ATOM 9858  C CG   . LEU B 2 74 ? 18.996  -9.500  7.424   1.00 0.00 ? 84 LEU B CG   5  
ATOM 9859  C CD1  . LEU B 2 74 ? 19.833  -10.759 7.273   1.00 0.00 ? 84 LEU B CD1  5  
ATOM 9860  C CD2  . LEU B 2 74 ? 19.875  -8.260  7.366   1.00 0.00 ? 84 LEU B CD2  5  
ATOM 9861  H H    . LEU B 2 74 ? 16.437  -10.111 4.427   1.00 0.00 ? 84 LEU B H    5  
ATOM 9862  H HA   . LEU B 2 74 ? 17.251  -11.439 6.706   1.00 0.00 ? 84 LEU B HA   5  
ATOM 9863  H HB2  . LEU B 2 74 ? 18.398  -9.577  5.380   1.00 0.00 ? 84 LEU B HB2  5  
ATOM 9864  H HB3  . LEU B 2 74 ? 17.469  -8.462  6.365   1.00 0.00 ? 84 LEU B HB3  5  
ATOM 9865  H HG   . LEU B 2 74 ? 18.521  -9.530  8.393   1.00 0.00 ? 84 LEU B HG   5  
ATOM 9866  H HD11 . LEU B 2 74 ? 20.663  -10.725 7.964   1.00 0.00 ? 84 LEU B HD11 5  
ATOM 9867  H HD12 . LEU B 2 74 ? 20.209  -10.824 6.263   1.00 0.00 ? 84 LEU B HD12 5  
ATOM 9868  H HD13 . LEU B 2 74 ? 19.224  -11.625 7.487   1.00 0.00 ? 84 LEU B HD13 5  
ATOM 9869  H HD21 . LEU B 2 74 ? 19.273  -7.383  7.546   1.00 0.00 ? 84 LEU B HD21 5  
ATOM 9870  H HD22 . LEU B 2 74 ? 20.333  -8.188  6.392   1.00 0.00 ? 84 LEU B HD22 5  
ATOM 9871  H HD23 . LEU B 2 74 ? 20.645  -8.330  8.122   1.00 0.00 ? 84 LEU B HD23 5  
ATOM 9872  N N    . SER B 2 75 ? 14.927  -9.198  7.311   1.00 0.00 ? 85 SER B N    5  
ATOM 9873  C CA   . SER B 2 75 ? 13.969  -8.736  8.307   1.00 0.00 ? 85 SER B CA   5  
ATOM 9874  C C    . SER B 2 75 ? 12.887  -9.784  8.550   1.00 0.00 ? 85 SER B C    5  
ATOM 9875  O O    . SER B 2 75 ? 12.525  -10.054 9.696   1.00 0.00 ? 85 SER B O    5  
ATOM 9876  C CB   . SER B 2 75 ? 13.339  -7.423  7.850   1.00 0.00 ? 85 SER B CB   5  
ATOM 9877  O OG   . SER B 2 75 ? 14.328  -6.540  7.345   1.00 0.00 ? 85 SER B OG   5  
ATOM 9878  H H    . SER B 2 75 ? 14.879  -8.842  6.397   1.00 0.00 ? 85 SER B H    5  
ATOM 9879  H HA   . SER B 2 75 ? 14.505  -8.566  9.229   1.00 0.00 ? 85 SER B HA   5  
ATOM 9880  H HB2  . SER B 2 75 ? 12.618  -7.621  7.070   1.00 0.00 ? 85 SER B HB2  5  
ATOM 9881  H HB3  . SER B 2 75 ? 12.845  -6.950  8.687   1.00 0.00 ? 85 SER B HB3  5  
ATOM 9882  H HG   . SER B 2 75 ? 14.732  -6.924  6.555   1.00 0.00 ? 85 SER B HG   5  
ATOM 9883  N N    . LYS B 2 76 ? 12.392  -10.367 7.460   1.00 0.00 ? 86 LYS B N    5  
ATOM 9884  C CA   . LYS B 2 76 ? 11.358  -11.395 7.512   1.00 0.00 ? 86 LYS B CA   5  
ATOM 9885  C C    . LYS B 2 76 ? 10.054  -10.828 8.082   1.00 0.00 ? 86 LYS B C    5  
ATOM 9886  O O    . LYS B 2 76 ? 9.562   -11.348 9.111   1.00 0.00 ? 86 LYS B O    5  
ATOM 9887  C CB   . LYS B 2 76 ? 11.841  -12.599 8.333   1.00 0.00 ? 86 LYS B CB   5  
ATOM 9888  C CG   . LYS B 2 76 ? 11.004  -13.850 8.137   1.00 0.00 ? 86 LYS B CG   5  
ATOM 9889  C CD   . LYS B 2 76 ? 10.597  -14.461 9.466   1.00 0.00 ? 86 LYS B CD   5  
ATOM 9890  C CE   . LYS B 2 76 ? 9.124   -14.834 9.477   1.00 0.00 ? 86 LYS B CE   5  
ATOM 9891  N NZ   . LYS B 2 76 ? 8.252   -13.688 9.101   1.00 0.00 ? 86 LYS B NZ   5  
ATOM 9892  O OXT  . LYS B 2 76 ? 9.525   -9.860  7.496   1.00 0.00 ? 86 LYS B OXT  5  
ATOM 9893  H H    . LYS B 2 76 ? 12.725  -10.086 6.580   1.00 0.00 ? 86 LYS B H    5  
ATOM 9894  H HA   . LYS B 2 76 ? 11.173  -11.719 6.499   1.00 0.00 ? 86 LYS B HA   5  
ATOM 9895  H HB2  . LYS B 2 76 ? 12.859  -12.825 8.051   1.00 0.00 ? 86 LYS B HB2  5  
ATOM 9896  H HB3  . LYS B 2 76 ? 11.819  -12.335 9.380   1.00 0.00 ? 86 LYS B HB3  5  
ATOM 9897  H HG2  . LYS B 2 76 ? 10.113  -13.592 7.584   1.00 0.00 ? 86 LYS B HG2  5  
ATOM 9898  H HG3  . LYS B 2 76 ? 11.580  -14.574 7.577   1.00 0.00 ? 86 LYS B HG3  5  
ATOM 9899  H HD2  . LYS B 2 76 ? 11.184  -15.350 9.638   1.00 0.00 ? 86 LYS B HD2  5  
ATOM 9900  H HD3  . LYS B 2 76 ? 10.783  -13.746 10.254  1.00 0.00 ? 86 LYS B HD3  5  
ATOM 9901  H HE2  . LYS B 2 76 ? 8.967   -15.640 8.776   1.00 0.00 ? 86 LYS B HE2  5  
ATOM 9902  H HE3  . LYS B 2 76 ? 8.859   -15.166 10.469  1.00 0.00 ? 86 LYS B HE3  5  
ATOM 9903  H HZ1  . LYS B 2 76 ? 8.750   -12.780 9.273   1.00 0.00 ? 86 LYS B HZ1  5  
ATOM 9904  H HZ2  . LYS B 2 76 ? 7.378   -13.701 9.663   1.00 0.00 ? 86 LYS B HZ2  5  
ATOM 9905  H HZ3  . LYS B 2 76 ? 8.000   -13.743 8.093   1.00 0.00 ? 86 LYS B HZ3  5  
ATOM 9906  N N    . THR A 1 18 ? -14.450 -6.981  8.811   1.00 0.00 ? 14 THR A N    6  
ATOM 9907  C CA   . THR A 1 18 ? -15.236 -5.772  8.490   1.00 0.00 ? 14 THR A CA   6  
ATOM 9908  C C    . THR A 1 18 ? -14.388 -4.773  7.703   1.00 0.00 ? 14 THR A C    6  
ATOM 9909  O O    . THR A 1 18 ? -13.293 -5.102  7.241   1.00 0.00 ? 14 THR A O    6  
ATOM 9910  C CB   . THR A 1 18 ? -15.795 -5.093  9.765   1.00 0.00 ? 14 THR A CB   6  
ATOM 9911  O OG1  . THR A 1 18 ? -14.783 -4.968  10.775  1.00 0.00 ? 14 THR A OG1  6  
ATOM 9912  C CG2  . THR A 1 18 ? -16.972 -5.878  10.329  1.00 0.00 ? 14 THR A CG2  6  
ATOM 9913  H H    . THR A 1 18 ? -14.195 -7.481  7.935   1.00 0.00 ? 14 THR A H    6  
ATOM 9914  H HA   . THR A 1 18 ? -16.073 -6.072  7.874   1.00 0.00 ? 14 THR A HA   6  
ATOM 9915  H HB   . THR A 1 18 ? -16.143 -4.106  9.499   1.00 0.00 ? 14 THR A HB   6  
ATOM 9916  H HG1  . THR A 1 18 ? -13.931 -5.299  10.438  1.00 0.00 ? 14 THR A HG1  6  
ATOM 9917  H HG21 . THR A 1 18 ? -17.773 -5.895  9.605   1.00 0.00 ? 14 THR A HG21 6  
ATOM 9918  H HG22 . THR A 1 18 ? -17.317 -5.405  11.236  1.00 0.00 ? 14 THR A HG22 6  
ATOM 9919  H HG23 . THR A 1 18 ? -16.659 -6.887  10.545  1.00 0.00 ? 14 THR A HG23 6  
ATOM 9920  N N    . VAL A 1 19 ? -14.903 -3.556  7.556   1.00 0.00 ? 15 VAL A N    6  
ATOM 9921  C CA   . VAL A 1 19 ? -14.209 -2.503  6.818   1.00 0.00 ? 15 VAL A CA   6  
ATOM 9922  C C    . VAL A 1 19 ? -12.861 -2.161  7.461   1.00 0.00 ? 15 VAL A C    6  
ATOM 9923  O O    . VAL A 1 19 ? -11.898 -1.838  6.767   1.00 0.00 ? 15 VAL A O    6  
ATOM 9924  C CB   . VAL A 1 19 ? -15.068 -1.220  6.724   1.00 0.00 ? 15 VAL A CB   6  
ATOM 9925  C CG1  . VAL A 1 19 ? -14.481 -0.251  5.708   1.00 0.00 ? 15 VAL A CG1  6  
ATOM 9926  C CG2  . VAL A 1 19 ? -16.511 -1.550  6.365   1.00 0.00 ? 15 VAL A CG2  6  
ATOM 9927  H H    . VAL A 1 19 ? -15.781 -3.377  7.949   1.00 0.00 ? 15 VAL A H    6  
ATOM 9928  H HA   . VAL A 1 19 ? -14.032 -2.864  5.815   1.00 0.00 ? 15 VAL A HA   6  
ATOM 9929  H HB   . VAL A 1 19 ? -15.061 -0.736  7.690   1.00 0.00 ? 15 VAL A HB   6  
ATOM 9930  H HG11 . VAL A 1 19 ? -13.507 0.074   6.041   1.00 0.00 ? 15 VAL A HG11 6  
ATOM 9931  H HG12 . VAL A 1 19 ? -15.132 0.606   5.610   1.00 0.00 ? 15 VAL A HG12 6  
ATOM 9932  H HG13 . VAL A 1 19 ? -14.389 -0.743  4.752   1.00 0.00 ? 15 VAL A HG13 6  
ATOM 9933  H HG21 . VAL A 1 19 ? -16.948 -2.153  7.148   1.00 0.00 ? 15 VAL A HG21 6  
ATOM 9934  H HG22 . VAL A 1 19 ? -16.536 -2.095  5.434   1.00 0.00 ? 15 VAL A HG22 6  
ATOM 9935  H HG23 . VAL A 1 19 ? -17.073 -0.634  6.261   1.00 0.00 ? 15 VAL A HG23 6  
ATOM 9936  N N    . SER A 1 20 ? -12.792 -2.260  8.784   1.00 0.00 ? 16 SER A N    6  
ATOM 9937  C CA   . SER A 1 20 ? -11.572 -1.942  9.518   1.00 0.00 ? 16 SER A CA   6  
ATOM 9938  C C    . SER A 1 20 ? -10.408 -2.856  9.127   1.00 0.00 ? 16 SER A C    6  
ATOM 9939  O O    . SER A 1 20 ? -9.324  -2.375  8.796   1.00 0.00 ? 16 SER A O    6  
ATOM 9940  C CB   . SER A 1 20 ? -11.833 -2.036  11.020  1.00 0.00 ? 16 SER A CB   6  
ATOM 9941  O OG   . SER A 1 20 ? -13.212 -2.246  11.281  1.00 0.00 ? 16 SER A OG   6  
ATOM 9942  H H    . SER A 1 20 ? -13.583 -2.549  9.286   1.00 0.00 ? 16 SER A H    6  
ATOM 9943  H HA   . SER A 1 20 ? -11.305 -0.924  9.277   1.00 0.00 ? 16 SER A HA   6  
ATOM 9944  H HB2  . SER A 1 20 ? -11.270 -2.860  11.432  1.00 0.00 ? 16 SER A HB2  6  
ATOM 9945  H HB3  . SER A 1 20 ? -11.524 -1.115  11.496  1.00 0.00 ? 16 SER A HB3  6  
ATOM 9946  H HG   . SER A 1 20 ? -13.313 -2.610  12.170  1.00 0.00 ? 16 SER A HG   6  
ATOM 9947  N N    . GLU A 1 21 ? -10.632 -4.169  9.154   1.00 0.00 ? 17 GLU A N    6  
ATOM 9948  C CA   . GLU A 1 21 ? -9.585  -5.131  8.817   1.00 0.00 ? 17 GLU A CA   6  
ATOM 9949  C C    . GLU A 1 21 ? -9.153  -4.990  7.364   1.00 0.00 ? 17 GLU A C    6  
ATOM 9950  O O    . GLU A 1 21 ? -7.987  -5.201  7.034   1.00 0.00 ? 17 GLU A O    6  
ATOM 9951  C CB   . GLU A 1 21 ? -10.045 -6.564  9.090   1.00 0.00 ? 17 GLU A CB   6  
ATOM 9952  C CG   . GLU A 1 21 ? -10.332 -6.843  10.556  1.00 0.00 ? 17 GLU A CG   6  
ATOM 9953  C CD   . GLU A 1 21 ? -11.775 -6.577  10.932  1.00 0.00 ? 17 GLU A CD   6  
ATOM 9954  O OE1  . GLU A 1 21 ? -12.479 -5.884  10.169  1.00 0.00 ? 17 GLU A OE1  6  
ATOM 9955  O OE2  . GLU A 1 21 ? -12.216 -7.072  11.987  1.00 0.00 ? 17 GLU A OE2  6  
ATOM 9956  H H    . GLU A 1 21 ? -11.521 -4.505  9.418   1.00 0.00 ? 17 GLU A H    6  
ATOM 9957  H HA   . GLU A 1 21 ? -8.735  -4.916  9.444   1.00 0.00 ? 17 GLU A HA   6  
ATOM 9958  H HB2  . GLU A 1 21 ? -10.946 -6.756  8.526   1.00 0.00 ? 17 GLU A HB2  6  
ATOM 9959  H HB3  . GLU A 1 21 ? -9.274  -7.245  8.761   1.00 0.00 ? 17 GLU A HB3  6  
ATOM 9960  H HG2  . GLU A 1 21 ? -10.109 -7.878  10.764  1.00 0.00 ? 17 GLU A HG2  6  
ATOM 9961  H HG3  . GLU A 1 21 ? -9.697  -6.212  11.161  1.00 0.00 ? 17 GLU A HG3  6  
ATOM 9962  N N    . TRP A 1 22 ? -10.090 -4.620  6.503   1.00 0.00 ? 18 TRP A N    6  
ATOM 9963  C CA   . TRP A 1 22 ? -9.789  -4.443  5.091   1.00 0.00 ? 18 TRP A CA   6  
ATOM 9964  C C    . TRP A 1 22 ? -8.805  -3.295  4.916   1.00 0.00 ? 18 TRP A C    6  
ATOM 9965  O O    . TRP A 1 22 ? -7.791  -3.422  4.226   1.00 0.00 ? 18 TRP A O    6  
ATOM 9966  C CB   . TRP A 1 22 ? -11.070 -4.175  4.298   1.00 0.00 ? 18 TRP A CB   6  
ATOM 9967  C CG   . TRP A 1 22 ? -10.821 -3.984  2.837   1.00 0.00 ? 18 TRP A CG   6  
ATOM 9968  C CD1  . TRP A 1 22 ? -10.426 -4.936  1.944   1.00 0.00 ? 18 TRP A CD1  6  
ATOM 9969  C CD2  . TRP A 1 22 ? -10.944 -2.764  2.100   1.00 0.00 ? 18 TRP A CD2  6  
ATOM 9970  N NE1  . TRP A 1 22 ? -10.291 -4.382  0.696   1.00 0.00 ? 18 TRP A NE1  6  
ATOM 9971  C CE2  . TRP A 1 22 ? -10.603 -3.051  0.766   1.00 0.00 ? 18 TRP A CE2  6  
ATOM 9972  C CE3  . TRP A 1 22 ? -11.307 -1.459  2.438   1.00 0.00 ? 18 TRP A CE3  6  
ATOM 9973  C CZ2  . TRP A 1 22 ? -10.614 -2.080  -0.229  1.00 0.00 ? 18 TRP A CZ2  6  
ATOM 9974  C CZ3  . TRP A 1 22 ? -11.319 -0.494  1.448   1.00 0.00 ? 18 TRP A CZ3  6  
ATOM 9975  C CH2  . TRP A 1 22 ? -10.974 -0.810  0.128   1.00 0.00 ? 18 TRP A CH2  6  
ATOM 9976  H H    . TRP A 1 22 ? -11.001 -4.450  6.825   1.00 0.00 ? 18 TRP A H    6  
ATOM 9977  H HA   . TRP A 1 22 ? -9.330  -5.351  4.730   1.00 0.00 ? 18 TRP A HA   6  
ATOM 9978  H HB2  . TRP A 1 22 ? -11.739 -5.014  4.415   1.00 0.00 ? 18 TRP A HB2  6  
ATOM 9979  H HB3  . TRP A 1 22 ? -11.546 -3.284  4.678   1.00 0.00 ? 18 TRP A HB3  6  
ATOM 9980  H HD1  . TRP A 1 22 ? -10.247 -5.971  2.196   1.00 0.00 ? 18 TRP A HD1  6  
ATOM 9981  H HE1  . TRP A 1 22 ? -10.016 -4.864  -0.117  1.00 0.00 ? 18 TRP A HE1  6  
ATOM 9982  H HE3  . TRP A 1 22 ? -11.577 -1.199  3.450   1.00 0.00 ? 18 TRP A HE3  6  
ATOM 9983  H HZ2  . TRP A 1 22 ? -10.350 -2.308  -1.251  1.00 0.00 ? 18 TRP A HZ2  6  
ATOM 9984  H HZ3  . TRP A 1 22 ? -11.594 0.521   1.692   1.00 0.00 ? 18 TRP A HZ3  6  
ATOM 9985  H HH2  . TRP A 1 22 ? -10.994 -0.025  -0.612  1.00 0.00 ? 18 TRP A HH2  6  
ATOM 9986  N N    . LEU A 1 23 ? -9.096  -2.187  5.584   1.00 0.00 ? 19 LEU A N    6  
ATOM 9987  C CA   . LEU A 1 23 ? -8.247  -1.003  5.524   1.00 0.00 ? 19 LEU A CA   6  
ATOM 9988  C C    . LEU A 1 23 ? -6.959  -1.216  6.322   1.00 0.00 ? 19 LEU A C    6  
ATOM 9989  O O    . LEU A 1 23 ? -6.030  -0.409  6.254   1.00 0.00 ? 19 LEU A O    6  
ATOM 9990  C CB   . LEU A 1 23 ? -8.999  0.225   6.038   1.00 0.00 ? 19 LEU A CB   6  
ATOM 9991  C CG   . LEU A 1 23 ? -10.015 0.805   5.050   1.00 0.00 ? 19 LEU A CG   6  
ATOM 9992  C CD1  . LEU A 1 23 ? -11.064 1.648   5.758   1.00 0.00 ? 19 LEU A CD1  6  
ATOM 9993  C CD2  . LEU A 1 23 ? -9.314  1.632   3.983   1.00 0.00 ? 19 LEU A CD2  6  
ATOM 9994  H H    . LEU A 1 23 ? -9.914  -2.176  6.131   1.00 0.00 ? 19 LEU A H    6  
ATOM 9995  H HA   . LEU A 1 23 ? -7.988  -0.842  4.489   1.00 0.00 ? 19 LEU A HA   6  
ATOM 9996  H HB2  . LEU A 1 23 ? -9.518  -0.049  6.947   1.00 0.00 ? 19 LEU A HB2  6  
ATOM 9997  H HB3  . LEU A 1 23 ? -8.274  0.990   6.271   1.00 0.00 ? 19 LEU A HB3  6  
ATOM 9998  H HG   . LEU A 1 23 ? -10.527 -0.007  4.556   1.00 0.00 ? 19 LEU A HG   6  
ATOM 9999  H HD11 . LEU A 1 23 ? -11.800 1.979   5.038   1.00 0.00 ? 19 LEU A HD11 6  
ATOM 10000 H HD12 . LEU A 1 23 ? -10.592 2.509   6.210   1.00 0.00 ? 19 LEU A HD12 6  
ATOM 10001 H HD13 . LEU A 1 23 ? -11.549 1.059   6.522   1.00 0.00 ? 19 LEU A HD13 6  
ATOM 10002 H HD21 . LEU A 1 23 ? -8.633  1.006   3.429   1.00 0.00 ? 19 LEU A HD21 6  
ATOM 10003 H HD22 . LEU A 1 23 ? -8.768  2.439   4.450   1.00 0.00 ? 19 LEU A HD22 6  
ATOM 10004 H HD23 . LEU A 1 23 ? -10.053 2.042   3.310   1.00 0.00 ? 19 LEU A HD23 6  
ATOM 10005 N N    . GLU A 1 24 ? -6.906  -2.323  7.052   1.00 0.00 ? 20 GLU A N    6  
ATOM 10006 C CA   . GLU A 1 24 ? -5.738  -2.657  7.854   1.00 0.00 ? 20 GLU A CA   6  
ATOM 10007 C C    . GLU A 1 24 ? -4.710  -3.380  6.991   1.00 0.00 ? 20 GLU A C    6  
ATOM 10008 O O    . GLU A 1 24 ? -3.512  -3.100  7.065   1.00 0.00 ? 20 GLU A O    6  
ATOM 10009 C CB   . GLU A 1 24 ? -6.129  -3.513  9.065   1.00 0.00 ? 20 GLU A CB   6  
ATOM 10010 C CG   . GLU A 1 24 ? -4.941  -4.060  9.853   1.00 0.00 ? 20 GLU A CG   6  
ATOM 10011 C CD   . GLU A 1 24 ? -4.005  -2.972  10.359  1.00 0.00 ? 20 GLU A CD   6  
ATOM 10012 O OE1  . GLU A 1 24 ? -4.416  -1.794  10.400  1.00 0.00 ? 20 GLU A OE1  6  
ATOM 10013 O OE2  . GLU A 1 24 ? -2.855  -3.292  10.736  1.00 0.00 ? 20 GLU A OE2  6  
ATOM 10014 H H    . GLU A 1 24 ? -7.666  -2.942  7.025   1.00 0.00 ? 20 GLU A H    6  
ATOM 10015 H HA   . GLU A 1 24 ? -5.306  -1.734  8.206   1.00 0.00 ? 20 GLU A HA   6  
ATOM 10016 H HB2  . GLU A 1 24 ? -6.727  -2.910  9.737   1.00 0.00 ? 20 GLU A HB2  6  
ATOM 10017 H HB3  . GLU A 1 24 ? -6.720  -4.348  8.725   1.00 0.00 ? 20 GLU A HB3  6  
ATOM 10018 H HG2  . GLU A 1 24 ? -5.318  -4.606  10.705  1.00 0.00 ? 20 GLU A HG2  6  
ATOM 10019 H HG3  . GLU A 1 24 ? -4.382  -4.731  9.216   1.00 0.00 ? 20 GLU A HG3  6  
ATOM 10020 N N    . SER A 1 25 ? -5.181  -4.289  6.142   1.00 0.00 ? 21 SER A N    6  
ATOM 10021 C CA   . SER A 1 25 ? -4.295  -5.036  5.261   1.00 0.00 ? 21 SER A CA   6  
ATOM 10022 C C    . SER A 1 25 ? -3.893  -4.187  4.054   1.00 0.00 ? 21 SER A C    6  
ATOM 10023 O O    . SER A 1 25 ? -4.036  -4.618  2.911   1.00 0.00 ? 21 SER A O    6  
ATOM 10024 C CB   . SER A 1 25 ? -4.988  -6.326  4.803   1.00 0.00 ? 21 SER A CB   6  
ATOM 10025 O OG   . SER A 1 25 ? -6.388  -6.136  4.681   1.00 0.00 ? 21 SER A OG   6  
ATOM 10026 H H    . SER A 1 25 ? -6.145  -4.477  6.107   1.00 0.00 ? 21 SER A H    6  
ATOM 10027 H HA   . SER A 1 25 ? -3.403  -5.292  5.824   1.00 0.00 ? 21 SER A HA   6  
ATOM 10028 H HB2  . SER A 1 25 ? -4.591  -6.632  3.845   1.00 0.00 ? 21 SER A HB2  6  
ATOM 10029 H HB3  . SER A 1 25 ? -4.805  -7.104  5.531   1.00 0.00 ? 21 SER A HB3  6  
ATOM 10030 H HG   . SER A 1 25 ? -6.559  -5.292  4.241   1.00 0.00 ? 21 SER A HG   6  
ATOM 10031 N N    . ILE A 1 26 ? -3.387  -2.982  4.339   1.00 0.00 ? 22 ILE A N    6  
ATOM 10032 C CA   . ILE A 1 26 ? -2.941  -2.009  3.335   1.00 0.00 ? 22 ILE A CA   6  
ATOM 10033 C C    . ILE A 1 26 ? -2.391  -0.781  4.058   1.00 0.00 ? 22 ILE A C    6  
ATOM 10034 O O    . ILE A 1 26 ? -1.703  0.047   3.462   1.00 0.00 ? 22 ILE A O    6  
ATOM 10035 C CB   . ILE A 1 26 ? -4.046  -1.540  2.349   1.00 0.00 ? 22 ILE A CB   6  
ATOM 10036 C CG1  . ILE A 1 26 ? -5.438  -1.650  2.971   1.00 0.00 ? 22 ILE A CG1  6  
ATOM 10037 C CG2  . ILE A 1 26 ? -3.968  -2.313  1.037   1.00 0.00 ? 22 ILE A CG2  6  
ATOM 10038 C CD1  . ILE A 1 26 ? -6.521  -1.062  2.101   1.00 0.00 ? 22 ILE A CD1  6  
ATOM 10039 H H    . ILE A 1 26 ? -3.265  -2.736  5.280   1.00 0.00 ? 22 ILE A H    6  
ATOM 10040 H HA   . ILE A 1 26 ? -2.147  -2.464  2.764   1.00 0.00 ? 22 ILE A HA   6  
ATOM 10041 H HB   . ILE A 1 26 ? -3.859  -0.503  2.118   1.00 0.00 ? 22 ILE A HB   6  
ATOM 10042 H HG12 . ILE A 1 26 ? -5.669  -2.689  3.139   1.00 0.00 ? 22 ILE A HG12 6  
ATOM 10043 H HG13 . ILE A 1 26 ? -5.444  -1.124  3.915   1.00 0.00 ? 22 ILE A HG13 6  
ATOM 10044 H HG21 . ILE A 1 26 ? -3.949  -3.372  1.245   1.00 0.00 ? 22 ILE A HG21 6  
ATOM 10045 H HG22 . ILE A 1 26 ? -3.069  -2.035  0.511   1.00 0.00 ? 22 ILE A HG22 6  
ATOM 10046 H HG23 . ILE A 1 26 ? -4.829  -2.084  0.424   1.00 0.00 ? 22 ILE A HG23 6  
ATOM 10047 H HD11 . ILE A 1 26 ? -6.410  0.012   2.071   1.00 0.00 ? 22 ILE A HD11 6  
ATOM 10048 H HD12 . ILE A 1 26 ? -7.487  -1.316  2.505   1.00 0.00 ? 22 ILE A HD12 6  
ATOM 10049 H HD13 . ILE A 1 26 ? -6.428  -1.460  1.102   1.00 0.00 ? 22 ILE A HD13 6  
ATOM 10050 N N    . LYS A 1 27 ? -2.716  -0.694  5.356   1.00 0.00 ? 23 LYS A N    6  
ATOM 10051 C CA   . LYS A 1 27 ? -2.283  0.401   6.222   1.00 0.00 ? 23 LYS A CA   6  
ATOM 10052 C C    . LYS A 1 27 ? -2.905  1.716   5.791   1.00 0.00 ? 23 LYS A C    6  
ATOM 10053 O O    . LYS A 1 27 ? -2.262  2.759   5.800   1.00 0.00 ? 23 LYS A O    6  
ATOM 10054 C CB   . LYS A 1 27 ? -0.755  0.497   6.269   1.00 0.00 ? 23 LYS A CB   6  
ATOM 10055 C CG   . LYS A 1 27 ? -0.101  -0.686  6.973   1.00 0.00 ? 23 LYS A CG   6  
ATOM 10056 C CD   . LYS A 1 27 ? -0.537  -0.794  8.431   1.00 0.00 ? 23 LYS A CD   6  
ATOM 10057 C CE   . LYS A 1 27 ? -0.079  -2.106  9.056   1.00 0.00 ? 23 LYS A CE   6  
ATOM 10058 N NZ   . LYS A 1 27 ? -0.451  -2.205  10.493  1.00 0.00 ? 23 LYS A NZ   6  
ATOM 10059 H H    . LYS A 1 27 ? -3.281  -1.390  5.742   1.00 0.00 ? 23 LYS A H    6  
ATOM 10060 H HA   . LYS A 1 27 ? -2.644  0.181   7.216   1.00 0.00 ? 23 LYS A HA   6  
ATOM 10061 H HB2  . LYS A 1 27 ? -0.381  0.540   5.255   1.00 0.00 ? 23 LYS A HB2  6  
ATOM 10062 H HB3  . LYS A 1 27 ? -0.474  1.402   6.786   1.00 0.00 ? 23 LYS A HB3  6  
ATOM 10063 H HG2  . LYS A 1 27 ? -0.382  -1.594  6.459   1.00 0.00 ? 23 LYS A HG2  6  
ATOM 10064 H HG3  . LYS A 1 27 ? 0.973   -0.567  6.931   1.00 0.00 ? 23 LYS A HG3  6  
ATOM 10065 H HD2  . LYS A 1 27 ? -0.110  0.026   8.992   1.00 0.00 ? 23 LYS A HD2  6  
ATOM 10066 H HD3  . LYS A 1 27 ? -1.612  -0.744  8.479   1.00 0.00 ? 23 LYS A HD3  6  
ATOM 10067 H HE2  . LYS A 1 27 ? -0.534  -2.927  8.522   1.00 0.00 ? 23 LYS A HE2  6  
ATOM 10068 H HE3  . LYS A 1 27 ? 0.996   -2.172  8.968   1.00 0.00 ? 23 LYS A HE3  6  
ATOM 10069 H HZ1  . LYS A 1 27 ? -1.466  -2.441  10.586  1.00 0.00 ? 23 LYS A HZ1  6  
ATOM 10070 H HZ2  . LYS A 1 27 ? -0.267  -1.302  10.975  1.00 0.00 ? 23 LYS A HZ2  6  
ATOM 10071 H HZ3  . LYS A 1 27 ? 0.112   -2.955  10.958  1.00 0.00 ? 23 LYS A HZ3  6  
ATOM 10072 N N    . MET A 1 28 ? -4.177  1.643   5.428   1.00 0.00 ? 24 MET A N    6  
ATOM 10073 C CA   . MET A 1 28 ? -4.934  2.810   5.012   1.00 0.00 ? 24 MET A CA   6  
ATOM 10074 C C    . MET A 1 28 ? -6.016  3.072   6.041   1.00 0.00 ? 24 MET A C    6  
ATOM 10075 O O    . MET A 1 28 ? -7.039  3.696   5.762   1.00 0.00 ? 24 MET A O    6  
ATOM 10076 C CB   . MET A 1 28 ? -5.558  2.569   3.639   1.00 0.00 ? 24 MET A CB   6  
ATOM 10077 C CG   . MET A 1 28 ? -4.539  2.235   2.567   1.00 0.00 ? 24 MET A CG   6  
ATOM 10078 S SD   . MET A 1 28 ? -3.534  3.654   2.108   1.00 0.00 ? 24 MET A SD   6  
ATOM 10079 C CE   . MET A 1 28 ? -2.068  2.832   1.498   1.00 0.00 ? 24 MET A CE   6  
ATOM 10080 H H    . MET A 1 28 ? -4.632  0.771   5.441   1.00 0.00 ? 24 MET A H    6  
ATOM 10081 H HA   . MET A 1 28 ? -4.263  3.656   4.968   1.00 0.00 ? 24 MET A HA   6  
ATOM 10082 H HB2  . MET A 1 28 ? -6.255  1.750   3.709   1.00 0.00 ? 24 MET A HB2  6  
ATOM 10083 H HB3  . MET A 1 28 ? -6.088  3.459   3.337   1.00 0.00 ? 24 MET A HB3  6  
ATOM 10084 H HG2  . MET A 1 28 ? -3.887  1.458   2.936   1.00 0.00 ? 24 MET A HG2  6  
ATOM 10085 H HG3  . MET A 1 28 ? -5.059  1.881   1.689   1.00 0.00 ? 24 MET A HG3  6  
ATOM 10086 H HE1  . MET A 1 28 ? -1.703  2.143   2.247   1.00 0.00 ? 24 MET A HE1  6  
ATOM 10087 H HE2  . MET A 1 28 ? -1.308  3.568   1.285   1.00 0.00 ? 24 MET A HE2  6  
ATOM 10088 H HE3  . MET A 1 28 ? -2.309  2.289   0.595   1.00 0.00 ? 24 MET A HE3  6  
ATOM 10089 N N    . GLN A 1 29 ? -5.743  2.594   7.247   1.00 0.00 ? 25 GLN A N    6  
ATOM 10090 C CA   . GLN A 1 29 ? -6.656  2.693   8.379   1.00 0.00 ? 25 GLN A CA   6  
ATOM 10091 C C    . GLN A 1 29 ? -7.106  4.121   8.682   1.00 0.00 ? 25 GLN A C    6  
ATOM 10092 O O    . GLN A 1 29 ? -8.185  4.308   9.237   1.00 0.00 ? 25 GLN A O    6  
ATOM 10093 C CB   . GLN A 1 29 ? -6.016  2.077   9.630   1.00 0.00 ? 25 GLN A CB   6  
ATOM 10094 C CG   . GLN A 1 29 ? -4.499  2.141   9.633   1.00 0.00 ? 25 GLN A CG   6  
ATOM 10095 C CD   . GLN A 1 29 ? -3.914  1.901   11.007  1.00 0.00 ? 25 GLN A CD   6  
ATOM 10096 O OE1  . GLN A 1 29 ? -3.694  2.841   11.768  1.00 0.00 ? 25 GLN A OE1  6  
ATOM 10097 N NE2  . GLN A 1 29 ? -3.670  0.644   11.340  1.00 0.00 ? 25 GLN A NE2  6  
ATOM 10098 H H    . GLN A 1 29 ? -4.884  2.152   7.382   1.00 0.00 ? 25 GLN A H    6  
ATOM 10099 H HA   . GLN A 1 29 ? -7.531  2.112   8.132   1.00 0.00 ? 25 GLN A HA   6  
ATOM 10100 H HB2  . GLN A 1 29 ? -6.376  2.605   10.501  1.00 0.00 ? 25 GLN A HB2  6  
ATOM 10101 H HB3  . GLN A 1 29 ? -6.311  1.042   9.704   1.00 0.00 ? 25 GLN A HB3  6  
ATOM 10102 H HG2  . GLN A 1 29 ? -4.116  1.391   8.958   1.00 0.00 ? 25 GLN A HG2  6  
ATOM 10103 H HG3  . GLN A 1 29 ? -4.196  3.120   9.295   1.00 0.00 ? 25 GLN A HG3  6  
ATOM 10104 H HE21 . GLN A 1 29 ? -3.883  -0.066  10.687  1.00 0.00 ? 25 GLN A HE21 6  
ATOM 10105 H HE22 . GLN A 1 29 ? -3.282  0.466   12.223  1.00 0.00 ? 25 GLN A HE22 6  
ATOM 10106 N N    . GLN A 1 30 ? -6.316  5.139   8.339   1.00 0.00 ? 26 GLN A N    6  
ATOM 10107 C CA   . GLN A 1 30 ? -6.713  6.518   8.620   1.00 0.00 ? 26 GLN A CA   6  
ATOM 10108 C C    . GLN A 1 30 ? -7.693  7.048   7.570   1.00 0.00 ? 26 GLN A C    6  
ATOM 10109 O O    . GLN A 1 30 ? -8.257  8.129   7.728   1.00 0.00 ? 26 GLN A O    6  
ATOM 10110 C CB   . GLN A 1 30 ? -5.472  7.421   8.697   1.00 0.00 ? 26 GLN A CB   6  
ATOM 10111 C CG   . GLN A 1 30 ? -4.616  7.425   7.436   1.00 0.00 ? 26 GLN A CG   6  
ATOM 10112 C CD   . GLN A 1 30 ? -3.620  6.280   7.398   1.00 0.00 ? 26 GLN A CD   6  
ATOM 10113 O OE1  . GLN A 1 30 ? -3.943  5.181   6.950   1.00 0.00 ? 26 GLN A OE1  6  
ATOM 10114 N NE2  . GLN A 1 30 ? -2.408  6.527   7.869   1.00 0.00 ? 26 GLN A NE2  6  
ATOM 10115 H H    . GLN A 1 30 ? -5.436  5.014   7.912   1.00 0.00 ? 26 GLN A H    6  
ATOM 10116 H HA   . GLN A 1 30 ? -7.206  6.523   9.581   1.00 0.00 ? 26 GLN A HA   6  
ATOM 10117 H HB2  . GLN A 1 30 ? -5.792  8.435   8.888   1.00 0.00 ? 26 GLN A HB2  6  
ATOM 10118 H HB3  . GLN A 1 30 ? -4.854  7.092   9.521   1.00 0.00 ? 26 GLN A HB3  6  
ATOM 10119 H HG2  . GLN A 1 30 ? -5.263  7.346   6.576   1.00 0.00 ? 26 GLN A HG2  6  
ATOM 10120 H HG3  . GLN A 1 30 ? -4.073  8.356   7.391   1.00 0.00 ? 26 GLN A HG3  6  
ATOM 10121 H HE21 . GLN A 1 30 ? -2.217  7.424   8.218   1.00 0.00 ? 26 GLN A HE21 6  
ATOM 10122 H HE22 . GLN A 1 30 ? -1.747  5.802   7.844   1.00 0.00 ? 26 GLN A HE22 6  
ATOM 10123 N N    . TYR A 1 31 ? -7.896  6.280   6.504   1.00 0.00 ? 27 TYR A N    6  
ATOM 10124 C CA   . TYR A 1 31 ? -8.812  6.677   5.443   1.00 0.00 ? 27 TYR A CA   6  
ATOM 10125 C C    . TYR A 1 31 ? -10.236 6.234   5.764   1.00 0.00 ? 27 TYR A C    6  
ATOM 10126 O O    . TYR A 1 31 ? -11.173 6.524   5.016   1.00 0.00 ? 27 TYR A O    6  
ATOM 10127 C CB   . TYR A 1 31 ? -8.361  6.102   4.102   1.00 0.00 ? 27 TYR A CB   6  
ATOM 10128 C CG   . TYR A 1 31 ? -7.135  6.783   3.541   1.00 0.00 ? 27 TYR A CG   6  
ATOM 10129 C CD1  . TYR A 1 31 ? -7.243  7.956   2.805   1.00 0.00 ? 27 TYR A CD1  6  
ATOM 10130 C CD2  . TYR A 1 31 ? -5.871  6.254   3.750   1.00 0.00 ? 27 TYR A CD2  6  
ATOM 10131 C CE1  . TYR A 1 31 ? -6.123  8.581   2.292   1.00 0.00 ? 27 TYR A CE1  6  
ATOM 10132 C CE2  . TYR A 1 31 ? -4.745  6.871   3.242   1.00 0.00 ? 27 TYR A CE2  6  
ATOM 10133 C CZ   . TYR A 1 31 ? -4.877  8.036   2.513   1.00 0.00 ? 27 TYR A CZ   6  
ATOM 10134 O OH   . TYR A 1 31 ? -3.759  8.657   2.000   1.00 0.00 ? 27 TYR A OH   6  
ATOM 10135 H H    . TYR A 1 31 ? -7.413  5.427   6.424   1.00 0.00 ? 27 TYR A H    6  
ATOM 10136 H HA   . TYR A 1 31 ? -8.793  7.755   5.382   1.00 0.00 ? 27 TYR A HA   6  
ATOM 10137 H HB2  . TYR A 1 31 ? -8.130  5.055   4.224   1.00 0.00 ? 27 TYR A HB2  6  
ATOM 10138 H HB3  . TYR A 1 31 ? -9.160  6.209   3.381   1.00 0.00 ? 27 TYR A HB3  6  
ATOM 10139 H HD1  . TYR A 1 31 ? -8.221  8.379   2.635   1.00 0.00 ? 27 TYR A HD1  6  
ATOM 10140 H HD2  . TYR A 1 31 ? -5.771  5.343   4.322   1.00 0.00 ? 27 TYR A HD2  6  
ATOM 10141 H HE1  . TYR A 1 31 ? -6.227  9.493   1.722   1.00 0.00 ? 27 TYR A HE1  6  
ATOM 10142 H HE2  . TYR A 1 31 ? -3.770  6.443   3.416   1.00 0.00 ? 27 TYR A HE2  6  
ATOM 10143 H HH   . TYR A 1 31 ? -3.052  8.010   1.895   1.00 0.00 ? 27 TYR A HH   6  
ATOM 10144 N N    . THR A 1 32 ? -10.392 5.521   6.877   1.00 0.00 ? 28 THR A N    6  
ATOM 10145 C CA   . THR A 1 32 ? -11.702 5.058   7.316   1.00 0.00 ? 28 THR A CA   6  
ATOM 10146 C C    . THR A 1 32 ? -12.593 6.254   7.623   1.00 0.00 ? 28 THR A C    6  
ATOM 10147 O O    . THR A 1 32 ? -13.779 6.274   7.284   1.00 0.00 ? 28 THR A O    6  
ATOM 10148 C CB   . THR A 1 32 ? -11.584 4.167   8.564   1.00 0.00 ? 28 THR A CB   6  
ATOM 10149 O OG1  . THR A 1 32 ? -10.462 3.285   8.421   1.00 0.00 ? 28 THR A OG1  6  
ATOM 10150 C CG2  . THR A 1 32 ? -12.850 3.349   8.773   1.00 0.00 ? 28 THR A CG2  6  
ATOM 10151 H H    . THR A 1 32 ? -9.604  5.288   7.410   1.00 0.00 ? 28 THR A H    6  
ATOM 10152 H HA   . THR A 1 32 ? -12.145 4.483   6.518   1.00 0.00 ? 28 THR A HA   6  
ATOM 10153 H HB   . THR A 1 32 ? -11.432 4.798   9.426   1.00 0.00 ? 28 THR A HB   6  
ATOM 10154 H HG1  . THR A 1 32 ? -9.740  3.587   8.988   1.00 0.00 ? 28 THR A HG1  6  
ATOM 10155 H HG21 . THR A 1 32 ? -13.040 2.750   7.894   1.00 0.00 ? 28 THR A HG21 6  
ATOM 10156 H HG22 . THR A 1 32 ? -13.684 4.012   8.945   1.00 0.00 ? 28 THR A HG22 6  
ATOM 10157 H HG23 . THR A 1 32 ? -12.720 2.701   9.627   1.00 0.00 ? 28 THR A HG23 6  
ATOM 10158 N N    . GLU A 1 33 ? -11.989 7.278   8.221   1.00 0.00 ? 29 GLU A N    6  
ATOM 10159 C CA   . GLU A 1 33 ? -12.692 8.504   8.575   1.00 0.00 ? 29 GLU A CA   6  
ATOM 10160 C C    . GLU A 1 33 ? -12.754 9.421   7.360   1.00 0.00 ? 29 GLU A C    6  
ATOM 10161 O O    . GLU A 1 33 ? -12.448 10.609  7.437   1.00 0.00 ? 29 GLU A O    6  
ATOM 10162 C CB   . GLU A 1 33 ? -11.979 9.205   9.733   1.00 0.00 ? 29 GLU A CB   6  
ATOM 10163 C CG   . GLU A 1 33 ? -11.426 8.242   10.772  1.00 0.00 ? 29 GLU A CG   6  
ATOM 10164 C CD   . GLU A 1 33 ? -10.938 8.939   12.028  1.00 0.00 ? 29 GLU A CD   6  
ATOM 10165 O OE1  . GLU A 1 33 ? -11.783 9.318   12.868  1.00 0.00 ? 29 GLU A OE1  6  
ATOM 10166 O OE2  . GLU A 1 33 ? -9.709  9.107   12.183  1.00 0.00 ? 29 GLU A OE2  6  
ATOM 10167 H H    . GLU A 1 33 ? -11.032 7.214   8.421   1.00 0.00 ? 29 GLU A H    6  
ATOM 10168 H HA   . GLU A 1 33 ? -13.698 8.245   8.871   1.00 0.00 ? 29 GLU A HA   6  
ATOM 10169 H HB2  . GLU A 1 33 ? -11.160 9.786   9.336   1.00 0.00 ? 29 GLU A HB2  6  
ATOM 10170 H HB3  . GLU A 1 33 ? -12.681 9.867   10.219  1.00 0.00 ? 29 GLU A HB3  6  
ATOM 10171 H HG2  . GLU A 1 33 ? -12.206 7.547   11.043  1.00 0.00 ? 29 GLU A HG2  6  
ATOM 10172 H HG3  . GLU A 1 33 ? -10.599 7.696   10.337  1.00 0.00 ? 29 GLU A HG3  6  
ATOM 10173 N N    . HIS A 1 34 ? -13.185 8.836   6.252   1.00 0.00 ? 30 HIS A N    6  
ATOM 10174 C CA   . HIS A 1 34 ? -13.297 9.517   4.972   1.00 0.00 ? 30 HIS A CA   6  
ATOM 10175 C C    . HIS A 1 34 ? -14.178 8.677   4.059   1.00 0.00 ? 30 HIS A C    6  
ATOM 10176 O O    . HIS A 1 34 ? -15.156 9.163   3.494   1.00 0.00 ? 30 HIS A O    6  
ATOM 10177 C CB   . HIS A 1 34 ? -11.914 9.702   4.340   1.00 0.00 ? 30 HIS A CB   6  
ATOM 10178 C CG   . HIS A 1 34 ? -11.528 11.133  4.115   1.00 0.00 ? 30 HIS A CG   6  
ATOM 10179 N ND1  . HIS A 1 34 ? -11.528 11.743  2.880   1.00 0.00 ? 30 HIS A ND1  6  
ATOM 10180 C CD2  . HIS A 1 34 ? -11.111 12.075  4.997   1.00 0.00 ? 30 HIS A CD2  6  
ATOM 10181 C CE1  . HIS A 1 34 ? -11.123 13.009  3.043   1.00 0.00 ? 30 HIS A CE1  6  
ATOM 10182 N NE2  . HIS A 1 34 ? -10.856 13.260  4.311   1.00 0.00 ? 30 HIS A NE2  6  
ATOM 10183 H H    . HIS A 1 34 ? -13.492 7.906   6.317   1.00 0.00 ? 30 HIS A H    6  
ATOM 10184 H HA   . HIS A 1 34 ? -13.759 10.480  5.132   1.00 0.00 ? 30 HIS A HA   6  
ATOM 10185 H HB2  . HIS A 1 34 ? -11.169 9.256   4.984   1.00 0.00 ? 30 HIS A HB2  6  
ATOM 10186 H HB3  . HIS A 1 34 ? -11.898 9.199   3.383   1.00 0.00 ? 30 HIS A HB3  6  
ATOM 10187 H HD1  . HIS A 1 34 ? -11.766 11.317  2.023   1.00 0.00 ? 30 HIS A HD1  6  
ATOM 10188 H HD2  . HIS A 1 34 ? -10.994 11.939  6.062   1.00 0.00 ? 30 HIS A HD2  6  
ATOM 10189 H HE1  . HIS A 1 34 ? -11.044 13.733  2.248   1.00 0.00 ? 30 HIS A HE1  6  
ATOM 10190 N N    . PHE A 1 35 ? -13.836 7.393   3.958   1.00 0.00 ? 31 PHE A N    6  
ATOM 10191 C CA   . PHE A 1 35 ? -14.587 6.446   3.138   1.00 0.00 ? 31 PHE A CA   6  
ATOM 10192 C C    . PHE A 1 35 ? -15.994 6.266   3.692   1.00 0.00 ? 31 PHE A C    6  
ATOM 10193 O O    . PHE A 1 35 ? -16.973 6.212   2.946   1.00 0.00 ? 31 PHE A O    6  
ATOM 10194 C CB   . PHE A 1 35 ? -13.886 5.086   3.117   1.00 0.00 ? 31 PHE A CB   6  
ATOM 10195 C CG   . PHE A 1 35 ? -12.740 4.981   2.150   1.00 0.00 ? 31 PHE A CG   6  
ATOM 10196 C CD1  . PHE A 1 35 ? -11.852 6.032   1.974   1.00 0.00 ? 31 PHE A CD1  6  
ATOM 10197 C CD2  . PHE A 1 35 ? -12.546 3.817   1.427   1.00 0.00 ? 31 PHE A CD2  6  
ATOM 10198 C CE1  . PHE A 1 35 ? -10.792 5.921   1.093   1.00 0.00 ? 31 PHE A CE1  6  
ATOM 10199 C CE2  . PHE A 1 35 ? -11.491 3.701   0.545   1.00 0.00 ? 31 PHE A CE2  6  
ATOM 10200 C CZ   . PHE A 1 35 ? -10.613 4.753   0.378   1.00 0.00 ? 31 PHE A CZ   6  
ATOM 10201 H H    . PHE A 1 35 ? -13.042 7.073   4.444   1.00 0.00 ? 31 PHE A H    6  
ATOM 10202 H HA   . PHE A 1 35 ? -14.642 6.835   2.131   1.00 0.00 ? 31 PHE A HA   6  
ATOM 10203 H HB2  . PHE A 1 35 ? -13.499 4.879   4.102   1.00 0.00 ? 31 PHE A HB2  6  
ATOM 10204 H HB3  . PHE A 1 35 ? -14.608 4.325   2.857   1.00 0.00 ? 31 PHE A HB3  6  
ATOM 10205 H HD1  . PHE A 1 35 ? -11.994 6.945   2.531   1.00 0.00 ? 31 PHE A HD1  6  
ATOM 10206 H HD2  . PHE A 1 35 ? -13.231 2.994   1.557   1.00 0.00 ? 31 PHE A HD2  6  
ATOM 10207 H HE1  . PHE A 1 35 ? -10.106 6.745   0.964   1.00 0.00 ? 31 PHE A HE1  6  
ATOM 10208 H HE2  . PHE A 1 35 ? -11.352 2.786   -0.013  1.00 0.00 ? 31 PHE A HE2  6  
ATOM 10209 H HZ   . PHE A 1 35 ? -9.788  4.662   -0.310  1.00 0.00 ? 31 PHE A HZ   6  
ATOM 10210 N N    . MET A 1 36 ? -16.088 6.215   5.018   1.00 0.00 ? 32 MET A N    6  
ATOM 10211 C CA   . MET A 1 36 ? -17.368 6.024   5.691   1.00 0.00 ? 32 MET A CA   6  
ATOM 10212 C C    . MET A 1 36 ? -18.201 7.299   5.675   1.00 0.00 ? 32 MET A C    6  
ATOM 10213 O O    . MET A 1 36 ? -19.386 7.281   6.009   1.00 0.00 ? 32 MET A O    6  
ATOM 10214 C CB   . MET A 1 36 ? -17.158 5.548   7.130   1.00 0.00 ? 32 MET A CB   6  
ATOM 10215 C CG   . MET A 1 36 ? -16.696 4.107   7.226   1.00 0.00 ? 32 MET A CG   6  
ATOM 10216 S SD   . MET A 1 36 ? -16.853 3.448   8.893   1.00 0.00 ? 32 MET A SD   6  
ATOM 10217 C CE   . MET A 1 36 ? -16.403 1.739   8.615   1.00 0.00 ? 32 MET A CE   6  
ATOM 10218 H H    . MET A 1 36 ? -15.277 6.318   5.559   1.00 0.00 ? 32 MET A H    6  
ATOM 10219 H HA   . MET A 1 36 ? -17.907 5.264   5.150   1.00 0.00 ? 32 MET A HA   6  
ATOM 10220 H HB2  . MET A 1 36 ? -16.418 6.174   7.605   1.00 0.00 ? 32 MET A HB2  6  
ATOM 10221 H HB3  . MET A 1 36 ? -18.092 5.639   7.670   1.00 0.00 ? 32 MET A HB3  6  
ATOM 10222 H HG2  . MET A 1 36 ? -17.292 3.506   6.557   1.00 0.00 ? 32 MET A HG2  6  
ATOM 10223 H HG3  . MET A 1 36 ? -15.657 4.054   6.928   1.00 0.00 ? 32 MET A HG3  6  
ATOM 10224 H HE1  . MET A 1 36 ? -15.420 1.693   8.167   1.00 0.00 ? 32 MET A HE1  6  
ATOM 10225 H HE2  . MET A 1 36 ? -17.122 1.281   7.953   1.00 0.00 ? 32 MET A HE2  6  
ATOM 10226 H HE3  . MET A 1 36 ? -16.393 1.212   9.557   1.00 0.00 ? 32 MET A HE3  6  
ATOM 10227 N N    . ALA A 1 37 ? -17.592 8.397   5.244   1.00 0.00 ? 33 ALA A N    6  
ATOM 10228 C CA   . ALA A 1 37 ? -18.286 9.673   5.181   1.00 0.00 ? 33 ALA A CA   6  
ATOM 10229 C C    . ALA A 1 37 ? -18.840 9.878   3.777   1.00 0.00 ? 33 ALA A C    6  
ATOM 10230 O O    . ALA A 1 37 ? -19.622 10.792  3.525   1.00 0.00 ? 33 ALA A O    6  
ATOM 10231 C CB   . ALA A 1 37 ? -17.350 10.815  5.560   1.00 0.00 ? 33 ALA A CB   6  
ATOM 10232 H H    . ALA A 1 37 ? -16.669 8.341   4.915   1.00 0.00 ? 33 ALA A H    6  
ATOM 10233 H HA   . ALA A 1 37 ? -19.104 9.650   5.888   1.00 0.00 ? 33 ALA A HA   6  
ATOM 10234 H HB1  . ALA A 1 37 ? -16.903 10.616  6.522   1.00 0.00 ? 33 ALA A HB1  6  
ATOM 10235 H HB2  . ALA A 1 37 ? -17.910 11.740  5.607   1.00 0.00 ? 33 ALA A HB2  6  
ATOM 10236 H HB3  . ALA A 1 37 ? -16.576 10.904  4.814   1.00 0.00 ? 33 ALA A HB3  6  
ATOM 10237 N N    . ALA A 1 38 ? -18.417 9.003   2.868   1.00 0.00 ? 34 ALA A N    6  
ATOM 10238 C CA   . ALA A 1 38 ? -18.855 9.055   1.479   1.00 0.00 ? 34 ALA A CA   6  
ATOM 10239 C C    . ALA A 1 38 ? -20.008 8.083   1.240   1.00 0.00 ? 34 ALA A C    6  
ATOM 10240 O O    . ALA A 1 38 ? -20.564 8.018   0.145   1.00 0.00 ? 34 ALA A O    6  
ATOM 10241 C CB   . ALA A 1 38 ? -17.694 8.739   0.548   1.00 0.00 ? 34 ALA A CB   6  
ATOM 10242 H H    . ALA A 1 38 ? -17.788 8.303   3.140   1.00 0.00 ? 34 ALA A H    6  
ATOM 10243 H HA   . ALA A 1 38 ? -19.194 10.060  1.269   1.00 0.00 ? 34 ALA A HA   6  
ATOM 10244 H HB1  . ALA A 1 38 ? -16.867 9.398   0.768   1.00 0.00 ? 34 ALA A HB1  6  
ATOM 10245 H HB2  . ALA A 1 38 ? -18.006 8.883   -0.476  1.00 0.00 ? 34 ALA A HB2  6  
ATOM 10246 H HB3  . ALA A 1 38 ? -17.386 7.714   0.689   1.00 0.00 ? 34 ALA A HB3  6  
ATOM 10247 N N    . GLY A 1 39 ? -20.351 7.321   2.272   1.00 0.00 ? 35 GLY A N    6  
ATOM 10248 C CA   . GLY A 1 39 ? -21.441 6.371   2.161   1.00 0.00 ? 35 GLY A CA   6  
ATOM 10249 C C    . GLY A 1 39 ? -20.974 4.931   2.184   1.00 0.00 ? 35 GLY A C    6  
ATOM 10250 O O    . GLY A 1 39 ? -21.789 4.009   2.249   1.00 0.00 ? 35 GLY A O    6  
ATOM 10251 H H    . GLY A 1 39 ? -19.866 7.410   3.116   1.00 0.00 ? 35 GLY A H    6  
ATOM 10252 H HA2  . GLY A 1 39 ? -22.123 6.527   2.983   1.00 0.00 ? 35 GLY A HA2  6  
ATOM 10253 H HA3  . GLY A 1 39 ? -21.967 6.552   1.235   1.00 0.00 ? 35 GLY A HA3  6  
ATOM 10254 N N    . TYR A 1 40 ? -19.667 4.721   2.148   1.00 0.00 ? 36 TYR A N    6  
ATOM 10255 C CA   . TYR A 1 40 ? -19.124 3.370   2.157   1.00 0.00 ? 36 TYR A CA   6  
ATOM 10256 C C    . TYR A 1 40 ? -18.922 2.893   3.590   1.00 0.00 ? 36 TYR A C    6  
ATOM 10257 O O    . TYR A 1 40 ? -17.816 2.940   4.126   1.00 0.00 ? 36 TYR A O    6  
ATOM 10258 C CB   . TYR A 1 40 ? -17.808 3.319   1.377   1.00 0.00 ? 36 TYR A CB   6  
ATOM 10259 C CG   . TYR A 1 40 ? -17.924 3.875   -0.025  1.00 0.00 ? 36 TYR A CG   6  
ATOM 10260 C CD1  . TYR A 1 40 ? -18.783 3.297   -0.951  1.00 0.00 ? 36 TYR A CD1  6  
ATOM 10261 C CD2  . TYR A 1 40 ? -17.181 4.981   -0.420  1.00 0.00 ? 36 TYR A CD2  6  
ATOM 10262 C CE1  . TYR A 1 40 ? -18.899 3.807   -2.230  1.00 0.00 ? 36 TYR A CE1  6  
ATOM 10263 C CE2  . TYR A 1 40 ? -17.291 5.494   -1.698  1.00 0.00 ? 36 TYR A CE2  6  
ATOM 10264 C CZ   . TYR A 1 40 ? -18.150 4.904   -2.597  1.00 0.00 ? 36 TYR A CZ   6  
ATOM 10265 O OH   . TYR A 1 40 ? -18.269 5.415   -3.867  1.00 0.00 ? 36 TYR A OH   6  
ATOM 10266 H H    . TYR A 1 40 ? -19.045 5.478   2.133   1.00 0.00 ? 36 TYR A H    6  
ATOM 10267 H HA   . TYR A 1 40 ? -19.843 2.726   1.676   1.00 0.00 ? 36 TYR A HA   6  
ATOM 10268 H HB2  . TYR A 1 40 ? -17.061 3.897   1.903   1.00 0.00 ? 36 TYR A HB2  6  
ATOM 10269 H HB3  . TYR A 1 40 ? -17.479 2.293   1.304   1.00 0.00 ? 36 TYR A HB3  6  
ATOM 10270 H HD1  . TYR A 1 40 ? -19.367 2.437   -0.662  1.00 0.00 ? 36 TYR A HD1  6  
ATOM 10271 H HD2  . TYR A 1 40 ? -16.508 5.440   0.287   1.00 0.00 ? 36 TYR A HD2  6  
ATOM 10272 H HE1  . TYR A 1 40 ? -19.572 3.345   -2.936  1.00 0.00 ? 36 TYR A HE1  6  
ATOM 10273 H HE2  . TYR A 1 40 ? -16.705 6.353   -1.987  1.00 0.00 ? 36 TYR A HE2  6  
ATOM 10274 H HH   . TYR A 1 40 ? -17.420 5.812   -4.142  1.00 0.00 ? 36 TYR A HH   6  
ATOM 10275 N N    . THR A 1 41 ? -20.007 2.454   4.210   1.00 0.00 ? 37 THR A N    6  
ATOM 10276 C CA   . THR A 1 41 ? -19.969 1.977   5.582   1.00 0.00 ? 37 THR A CA   6  
ATOM 10277 C C    . THR A 1 41 ? -19.969 0.453   5.662   1.00 0.00 ? 37 THR A C    6  
ATOM 10278 O O    . THR A 1 41 ? -20.011 -0.115  6.753   1.00 0.00 ? 37 THR A O    6  
ATOM 10279 C CB   . THR A 1 41 ? -21.174 2.523   6.363   1.00 0.00 ? 37 THR A CB   6  
ATOM 10280 O OG1  . THR A 1 41 ? -22.162 3.010   5.442   1.00 0.00 ? 37 THR A OG1  6  
ATOM 10281 C CG2  . THR A 1 41 ? -20.746 3.640   7.304   1.00 0.00 ? 37 THR A CG2  6  
ATOM 10282 H H    . THR A 1 41 ? -20.869 2.474   3.739   1.00 0.00 ? 37 THR A H    6  
ATOM 10283 H HA   . THR A 1 41 ? -19.069 2.355   6.043   1.00 0.00 ? 37 THR A HA   6  
ATOM 10284 H HB   . THR A 1 41 ? -21.602 1.720   6.948   1.00 0.00 ? 37 THR A HB   6  
ATOM 10285 H HG1  . THR A 1 41 ? -22.989 3.170   5.911   1.00 0.00 ? 37 THR A HG1  6  
ATOM 10286 H HG21 . THR A 1 41 ? -21.590 3.947   7.904   1.00 0.00 ? 37 THR A HG21 6  
ATOM 10287 H HG22 . THR A 1 41 ? -20.390 4.480   6.727   1.00 0.00 ? 37 THR A HG22 6  
ATOM 10288 H HG23 . THR A 1 41 ? -19.957 3.285   7.949   1.00 0.00 ? 37 THR A HG23 6  
ATOM 10289 N N    . ALA A 1 42 ? -19.900 -0.210  4.512   1.00 0.00 ? 38 ALA A N    6  
ATOM 10290 C CA   . ALA A 1 42 ? -19.910 -1.664  4.478   1.00 0.00 ? 38 ALA A CA   6  
ATOM 10291 C C    . ALA A 1 42 ? -19.196 -2.190  3.236   1.00 0.00 ? 38 ALA A C    6  
ATOM 10292 O O    . ALA A 1 42 ? -19.054 -1.476  2.244   1.00 0.00 ? 38 ALA A O    6  
ATOM 10293 C CB   . ALA A 1 42 ? -21.334 -2.190  4.554   1.00 0.00 ? 38 ALA A CB   6  
ATOM 10294 H H    . ALA A 1 42 ? -19.811 0.290   3.673   1.00 0.00 ? 38 ALA A H    6  
ATOM 10295 H HA   . ALA A 1 42 ? -19.381 -2.016  5.352   1.00 0.00 ? 38 ALA A HA   6  
ATOM 10296 H HB1  . ALA A 1 42 ? -21.848 -1.979  3.628   1.00 0.00 ? 38 ALA A HB1  6  
ATOM 10297 H HB2  . ALA A 1 42 ? -21.854 -1.710  5.371   1.00 0.00 ? 38 ALA A HB2  6  
ATOM 10298 H HB3  . ALA A 1 42 ? -21.316 -3.258  4.718   1.00 0.00 ? 38 ALA A HB3  6  
ATOM 10299 N N    . ILE A 1 43 ? -18.771 -3.449  3.303   1.00 0.00 ? 39 ILE A N    6  
ATOM 10300 C CA   . ILE A 1 43 ? -18.032 -4.101  2.220   1.00 0.00 ? 39 ILE A CA   6  
ATOM 10301 C C    . ILE A 1 43 ? -18.769 -4.092  0.875   1.00 0.00 ? 39 ILE A C    6  
ATOM 10302 O O    . ILE A 1 43 ? -18.154 -3.840  -0.164  1.00 0.00 ? 39 ILE A O    6  
ATOM 10303 C CB   . ILE A 1 43 ? -17.681 -5.558  2.598   1.00 0.00 ? 39 ILE A CB   6  
ATOM 10304 C CG1  . ILE A 1 43 ? -16.929 -5.599  3.935   1.00 0.00 ? 39 ILE A CG1  6  
ATOM 10305 C CG2  . ILE A 1 43 ? -16.851 -6.214  1.498   1.00 0.00 ? 39 ILE A CG2  6  
ATOM 10306 C CD1  . ILE A 1 43 ? -15.612 -4.848  3.924   1.00 0.00 ? 39 ILE A CD1  6  
ATOM 10307 H H    . ILE A 1 43 ? -18.957 -3.961  4.117   1.00 0.00 ? 39 ILE A H    6  
ATOM 10308 H HA   . ILE A 1 43 ? -17.104 -3.565  2.098   1.00 0.00 ? 39 ILE A HA   6  
ATOM 10309 H HB   . ILE A 1 43 ? -18.603 -6.112  2.694   1.00 0.00 ? 39 ILE A HB   6  
ATOM 10310 H HG12 . ILE A 1 43 ? -17.551 -5.158  4.700   1.00 0.00 ? 39 ILE A HG12 6  
ATOM 10311 H HG13 . ILE A 1 43 ? -16.725 -6.627  4.193   1.00 0.00 ? 39 ILE A HG13 6  
ATOM 10312 H HG21 . ILE A 1 43 ? -16.673 -7.249  1.749   1.00 0.00 ? 39 ILE A HG21 6  
ATOM 10313 H HG22 . ILE A 1 43 ? -15.908 -5.698  1.406   1.00 0.00 ? 39 ILE A HG22 6  
ATOM 10314 H HG23 . ILE A 1 43 ? -17.386 -6.157  0.562   1.00 0.00 ? 39 ILE A HG23 6  
ATOM 10315 H HD11 . ILE A 1 43 ? -15.800 -3.790  3.821   1.00 0.00 ? 39 ILE A HD11 6  
ATOM 10316 H HD12 . ILE A 1 43 ? -15.009 -5.189  3.096   1.00 0.00 ? 39 ILE A HD12 6  
ATOM 10317 H HD13 . ILE A 1 43 ? -15.086 -5.030  4.851   1.00 0.00 ? 39 ILE A HD13 6  
ATOM 10318 N N    . GLU A 1 44 ? -20.076 -4.340  0.882   1.00 0.00 ? 40 GLU A N    6  
ATOM 10319 C CA   . GLU A 1 44 ? -20.847 -4.383  -0.365  1.00 0.00 ? 40 GLU A CA   6  
ATOM 10320 C C    . GLU A 1 44 ? -20.822 -3.032  -1.077  1.00 0.00 ? 40 GLU A C    6  
ATOM 10321 O O    . GLU A 1 44 ? -20.862 -2.971  -2.306  1.00 0.00 ? 40 GLU A O    6  
ATOM 10322 C CB   . GLU A 1 44 ? -22.297 -4.816  -0.115  1.00 0.00 ? 40 GLU A CB   6  
ATOM 10323 C CG   . GLU A 1 44 ? -22.552 -5.369  1.276   1.00 0.00 ? 40 GLU A CG   6  
ATOM 10324 C CD   . GLU A 1 44 ? -22.934 -4.286  2.259   1.00 0.00 ? 40 GLU A CD   6  
ATOM 10325 O OE1  . GLU A 1 44 ? -22.609 -3.110  2.002   1.00 0.00 ? 40 GLU A OE1  6  
ATOM 10326 O OE2  . GLU A 1 44 ? -23.564 -4.604  3.288   1.00 0.00 ? 40 GLU A OE2  6  
ATOM 10327 H H    . GLU A 1 44 ? -20.544 -4.482  1.730   1.00 0.00 ? 40 GLU A H    6  
ATOM 10328 H HA   . GLU A 1 44 ? -20.376 -5.112  -1.009  1.00 0.00 ? 40 GLU A HA   6  
ATOM 10329 H HB2  . GLU A 1 44 ? -22.944 -3.962  -0.259  1.00 0.00 ? 40 GLU A HB2  6  
ATOM 10330 H HB3  . GLU A 1 44 ? -22.560 -5.577  -0.836  1.00 0.00 ? 40 GLU A HB3  6  
ATOM 10331 H HG2  . GLU A 1 44 ? -23.354 -6.090  1.226   1.00 0.00 ? 40 GLU A HG2  6  
ATOM 10332 H HG3  . GLU A 1 44 ? -21.653 -5.856  1.627   1.00 0.00 ? 40 GLU A HG3  6  
ATOM 10333 N N    . LYS A 1 45 ? -20.756 -1.956  -0.308  1.00 0.00 ? 41 LYS A N    6  
ATOM 10334 C CA   . LYS A 1 45 ? -20.708 -0.617  -0.880  1.00 0.00 ? 41 LYS A CA   6  
ATOM 10335 C C    . LYS A 1 45 ? -19.292 -0.294  -1.338  1.00 0.00 ? 41 LYS A C    6  
ATOM 10336 O O    . LYS A 1 45 ? -19.091 0.434   -2.307  1.00 0.00 ? 41 LYS A O    6  
ATOM 10337 C CB   . LYS A 1 45 ? -21.188 0.419   0.136   1.00 0.00 ? 41 LYS A CB   6  
ATOM 10338 C CG   . LYS A 1 45 ? -22.647 0.249   0.516   1.00 0.00 ? 41 LYS A CG   6  
ATOM 10339 C CD   . LYS A 1 45 ? -22.850 0.352   2.015   1.00 0.00 ? 41 LYS A CD   6  
ATOM 10340 C CE   . LYS A 1 45 ? -24.247 -0.095  2.411   1.00 0.00 ? 41 LYS A CE   6  
ATOM 10341 N NZ   . LYS A 1 45 ? -24.604 -1.407  1.809   1.00 0.00 ? 41 LYS A NZ   6  
ATOM 10342 H H    . LYS A 1 45 ? -20.746 -2.065  0.667   1.00 0.00 ? 41 LYS A H    6  
ATOM 10343 H HA   . LYS A 1 45 ? -21.364 -0.600  -1.739  1.00 0.00 ? 41 LYS A HA   6  
ATOM 10344 H HB2  . LYS A 1 45 ? -20.589 0.335   1.032   1.00 0.00 ? 41 LYS A HB2  6  
ATOM 10345 H HB3  . LYS A 1 45 ? -21.059 1.405   -0.283  1.00 0.00 ? 41 LYS A HB3  6  
ATOM 10346 H HG2  . LYS A 1 45 ? -23.227 1.020   0.031   1.00 0.00 ? 41 LYS A HG2  6  
ATOM 10347 H HG3  . LYS A 1 45 ? -22.984 -0.721  0.182   1.00 0.00 ? 41 LYS A HG3  6  
ATOM 10348 H HD2  . LYS A 1 45 ? -22.126 -0.274  2.513   1.00 0.00 ? 41 LYS A HD2  6  
ATOM 10349 H HD3  . LYS A 1 45 ? -22.712 1.380   2.319   1.00 0.00 ? 41 LYS A HD3  6  
ATOM 10350 H HE2  . LYS A 1 45 ? -24.292 -0.178  3.487   1.00 0.00 ? 41 LYS A HE2  6  
ATOM 10351 H HE3  . LYS A 1 45 ? -24.955 0.649   2.078   1.00 0.00 ? 41 LYS A HE3  6  
ATOM 10352 H HZ1  . LYS A 1 45 ? -23.852 -2.110  1.998   1.00 0.00 ? 41 LYS A HZ1  6  
ATOM 10353 H HZ2  . LYS A 1 45 ? -24.721 -1.309  0.782   1.00 0.00 ? 41 LYS A HZ2  6  
ATOM 10354 H HZ3  . LYS A 1 45 ? -25.498 -1.756  2.213   1.00 0.00 ? 41 LYS A HZ3  6  
ATOM 10355 N N    . VAL A 1 46 ? -18.315 -0.861  -0.643  1.00 0.00 ? 42 VAL A N    6  
ATOM 10356 C CA   . VAL A 1 46 ? -16.915 -0.646  -0.972  1.00 0.00 ? 42 VAL A CA   6  
ATOM 10357 C C    . VAL A 1 46 ? -16.594 -1.193  -2.362  1.00 0.00 ? 42 VAL A C    6  
ATOM 10358 O O    . VAL A 1 46 ? -15.857 -0.577  -3.128  1.00 0.00 ? 42 VAL A O    6  
ATOM 10359 C CB   . VAL A 1 46 ? -15.984 -1.298  0.079   1.00 0.00 ? 42 VAL A CB   6  
ATOM 10360 C CG1  . VAL A 1 46 ? -14.531 -1.259  -0.371  1.00 0.00 ? 42 VAL A CG1  6  
ATOM 10361 C CG2  . VAL A 1 46 ? -16.139 -0.605  1.425   1.00 0.00 ? 42 VAL A CG2  6  
ATOM 10362 H H    . VAL A 1 46 ? -18.544 -1.439  0.115   1.00 0.00 ? 42 VAL A H    6  
ATOM 10363 H HA   . VAL A 1 46 ? -16.735 0.419   -0.969  1.00 0.00 ? 42 VAL A HA   6  
ATOM 10364 H HB   . VAL A 1 46 ? -16.275 -2.331  0.196   1.00 0.00 ? 42 VAL A HB   6  
ATOM 10365 H HG11 . VAL A 1 46 ? -13.915 -1.761  0.361   1.00 0.00 ? 42 VAL A HG11 6  
ATOM 10366 H HG12 . VAL A 1 46 ? -14.212 -0.232  -0.466  1.00 0.00 ? 42 VAL A HG12 6  
ATOM 10367 H HG13 . VAL A 1 46 ? -14.436 -1.756  -1.324  1.00 0.00 ? 42 VAL A HG13 6  
ATOM 10368 H HG21 . VAL A 1 46 ? -17.169 -0.667  1.746   1.00 0.00 ? 42 VAL A HG21 6  
ATOM 10369 H HG22 . VAL A 1 46 ? -15.852 0.432   1.331   1.00 0.00 ? 42 VAL A HG22 6  
ATOM 10370 H HG23 . VAL A 1 46 ? -15.505 -1.088  2.153   1.00 0.00 ? 42 VAL A HG23 6  
ATOM 10371 N N    . VAL A 1 47 ? -17.182 -2.334  -2.704  1.00 0.00 ? 43 VAL A N    6  
ATOM 10372 C CA   . VAL A 1 47 ? -16.941 -2.946  -4.008  1.00 0.00 ? 43 VAL A CA   6  
ATOM 10373 C C    . VAL A 1 47 ? -17.776 -2.278  -5.098  1.00 0.00 ? 43 VAL A C    6  
ATOM 10374 O O    . VAL A 1 47 ? -17.610 -2.572  -6.285  1.00 0.00 ? 43 VAL A O    6  
ATOM 10375 C CB   . VAL A 1 47 ? -17.231 -4.464  -4.000  1.00 0.00 ? 43 VAL A CB   6  
ATOM 10376 C CG1  . VAL A 1 47 ? -16.308 -5.178  -3.028  1.00 0.00 ? 43 VAL A CG1  6  
ATOM 10377 C CG2  . VAL A 1 47 ? -18.687 -4.742  -3.660  1.00 0.00 ? 43 VAL A CG2  6  
ATOM 10378 H H    . VAL A 1 47 ? -17.793 -2.769  -2.070  1.00 0.00 ? 43 VAL A H    6  
ATOM 10379 H HA   . VAL A 1 47 ? -15.895 -2.808  -4.243  1.00 0.00 ? 43 VAL A HA   6  
ATOM 10380 H HB   . VAL A 1 47 ? -17.036 -4.850  -4.992  1.00 0.00 ? 43 VAL A HB   6  
ATOM 10381 H HG11 . VAL A 1 47 ? -15.289 -5.088  -3.369  1.00 0.00 ? 43 VAL A HG11 6  
ATOM 10382 H HG12 . VAL A 1 47 ? -16.580 -6.221  -2.974  1.00 0.00 ? 43 VAL A HG12 6  
ATOM 10383 H HG13 . VAL A 1 47 ? -16.401 -4.730  -2.050  1.00 0.00 ? 43 VAL A HG13 6  
ATOM 10384 H HG21 . VAL A 1 47 ? -18.915 -4.327  -2.689  1.00 0.00 ? 43 VAL A HG21 6  
ATOM 10385 H HG22 . VAL A 1 47 ? -18.857 -5.808  -3.646  1.00 0.00 ? 43 VAL A HG22 6  
ATOM 10386 H HG23 . VAL A 1 47 ? -19.323 -4.286  -4.405  1.00 0.00 ? 43 VAL A HG23 6  
ATOM 10387 N N    . GLN A 1 48 ? -18.669 -1.382  -4.689  1.00 0.00 ? 44 GLN A N    6  
ATOM 10388 C CA   . GLN A 1 48 ? -19.527 -0.669  -5.628  1.00 0.00 ? 44 GLN A CA   6  
ATOM 10389 C C    . GLN A 1 48 ? -18.778 0.496   -6.260  1.00 0.00 ? 44 GLN A C    6  
ATOM 10390 O O    . GLN A 1 48 ? -19.073 0.897   -7.385  1.00 0.00 ? 44 GLN A O    6  
ATOM 10391 C CB   . GLN A 1 48 ? -20.785 -0.153  -4.928  1.00 0.00 ? 44 GLN A CB   6  
ATOM 10392 C CG   . GLN A 1 48 ? -21.903 -1.177  -4.846  1.00 0.00 ? 44 GLN A CG   6  
ATOM 10393 C CD   . GLN A 1 48 ? -23.000 -0.763  -3.886  1.00 0.00 ? 44 GLN A CD   6  
ATOM 10394 O OE1  . GLN A 1 48 ? -23.250 0.425   -3.678  1.00 0.00 ? 44 GLN A OE1  6  
ATOM 10395 N NE2  . GLN A 1 48 ? -23.659 -1.743  -3.291  1.00 0.00 ? 44 GLN A NE2  6  
ATOM 10396 H H    . GLN A 1 48 ? -18.748 -1.190  -3.731  1.00 0.00 ? 44 GLN A H    6  
ATOM 10397 H HA   . GLN A 1 48 ? -19.815 -1.360  -6.407  1.00 0.00 ? 44 GLN A HA   6  
ATOM 10398 H HB2  . GLN A 1 48 ? -20.525 0.143   -3.922  1.00 0.00 ? 44 GLN A HB2  6  
ATOM 10399 H HB3  . GLN A 1 48 ? -21.153 0.708   -5.464  1.00 0.00 ? 44 GLN A HB3  6  
ATOM 10400 H HG2  . GLN A 1 48 ? -22.334 -1.302  -5.829  1.00 0.00 ? 44 GLN A HG2  6  
ATOM 10401 H HG3  . GLN A 1 48 ? -21.489 -2.116  -4.513  1.00 0.00 ? 44 GLN A HG3  6  
ATOM 10402 H HE21 . GLN A 1 48 ? -23.405 -2.665  -3.501  1.00 0.00 ? 44 GLN A HE21 6  
ATOM 10403 H HE22 . GLN A 1 48 ? -24.374 -1.506  -2.661  1.00 0.00 ? 44 GLN A HE22 6  
ATOM 10404 N N    . MET A 1 49 ? -17.818 1.044   -5.521  1.00 0.00 ? 45 MET A N    6  
ATOM 10405 C CA   . MET A 1 49 ? -17.016 2.162   -6.009  1.00 0.00 ? 45 MET A CA   6  
ATOM 10406 C C    . MET A 1 49 ? -16.104 1.705   -7.150  1.00 0.00 ? 45 MET A C    6  
ATOM 10407 O O    . MET A 1 49 ? -16.144 0.545   -7.565  1.00 0.00 ? 45 MET A O    6  
ATOM 10408 C CB   . MET A 1 49 ? -16.190 2.772   -4.864  1.00 0.00 ? 45 MET A CB   6  
ATOM 10409 C CG   . MET A 1 49 ? -14.886 2.037   -4.568  1.00 0.00 ? 45 MET A CG   6  
ATOM 10410 S SD   . MET A 1 49 ? -13.916 2.829   -3.269  1.00 0.00 ? 45 MET A SD   6  
ATOM 10411 C CE   . MET A 1 49 ? -14.859 2.383   -1.813  1.00 0.00 ? 45 MET A CE   6  
ATOM 10412 H H    . MET A 1 49 ? -17.665 0.708   -4.612  1.00 0.00 ? 45 MET A H    6  
ATOM 10413 H HA   . MET A 1 49 ? -17.696 2.911   -6.388  1.00 0.00 ? 45 MET A HA   6  
ATOM 10414 H HB2  . MET A 1 49 ? -15.950 3.793   -5.118  1.00 0.00 ? 45 MET A HB2  6  
ATOM 10415 H HB3  . MET A 1 49 ? -16.789 2.768   -3.965  1.00 0.00 ? 45 MET A HB3  6  
ATOM 10416 H HG2  . MET A 1 49 ? -15.119 1.030   -4.260  1.00 0.00 ? 45 MET A HG2  6  
ATOM 10417 H HG3  . MET A 1 49 ? -14.295 2.009   -5.472  1.00 0.00 ? 45 MET A HG3  6  
ATOM 10418 H HE1  . MET A 1 49 ? -14.306 2.660   -0.927  1.00 0.00 ? 45 MET A HE1  6  
ATOM 10419 H HE2  . MET A 1 49 ? -15.034 1.319   -1.810  1.00 0.00 ? 45 MET A HE2  6  
ATOM 10420 H HE3  . MET A 1 49 ? -15.804 2.905   -1.824  1.00 0.00 ? 45 MET A HE3  6  
ATOM 10421 N N    . THR A 1 50 ? -15.274 2.607   -7.646  1.00 0.00 ? 46 THR A N    6  
ATOM 10422 C CA   . THR A 1 50 ? -14.369 2.285   -8.733  1.00 0.00 ? 46 THR A CA   6  
ATOM 10423 C C    . THR A 1 50 ? -12.977 2.838   -8.439  1.00 0.00 ? 46 THR A C    6  
ATOM 10424 O O    . THR A 1 50 ? -12.751 3.428   -7.381  1.00 0.00 ? 46 THR A O    6  
ATOM 10425 C CB   . THR A 1 50 ? -14.894 2.815   -10.092 1.00 0.00 ? 46 THR A CB   6  
ATOM 10426 O OG1  . THR A 1 50 ? -14.165 2.218   -11.174 1.00 0.00 ? 46 THR A OG1  6  
ATOM 10427 C CG2  . THR A 1 50 ? -14.782 4.332   -10.181 1.00 0.00 ? 46 THR A CG2  6  
ATOM 10428 H H    . THR A 1 50 ? -15.226 3.498   -7.238  1.00 0.00 ? 46 THR A H    6  
ATOM 10429 H HA   . THR A 1 50 ? -14.304 1.207   -8.795  1.00 0.00 ? 46 THR A HA   6  
ATOM 10430 H HB   . THR A 1 50 ? -15.936 2.543   -10.183 1.00 0.00 ? 46 THR A HB   6  
ATOM 10431 H HG1  . THR A 1 50 ? -14.600 2.434   -12.011 1.00 0.00 ? 46 THR A HG1  6  
ATOM 10432 H HG21 . THR A 1 50 ? -13.779 4.633   -9.920  1.00 0.00 ? 46 THR A HG21 6  
ATOM 10433 H HG22 . THR A 1 50 ? -15.484 4.786   -9.499  1.00 0.00 ? 46 THR A HG22 6  
ATOM 10434 H HG23 . THR A 1 50 ? -15.002 4.650   -11.190 1.00 0.00 ? 46 THR A HG23 6  
ATOM 10435 N N    . ASN A 1 51 ? -12.058 2.657   -9.380  1.00 0.00 ? 47 ASN A N    6  
ATOM 10436 C CA   . ASN A 1 51 ? -10.678 3.112   -9.225  1.00 0.00 ? 47 ASN A CA   6  
ATOM 10437 C C    . ASN A 1 51 ? -10.609 4.615   -8.971  1.00 0.00 ? 47 ASN A C    6  
ATOM 10438 O O    . ASN A 1 51 ? -9.997  5.063   -8.002  1.00 0.00 ? 47 ASN A O    6  
ATOM 10439 C CB   . ASN A 1 51 ? -9.867  2.760   -10.475 1.00 0.00 ? 47 ASN A CB   6  
ATOM 10440 C CG   . ASN A 1 51 ? -8.372  2.924   -10.275 1.00 0.00 ? 47 ASN A CG   6  
ATOM 10441 O OD1  . ASN A 1 51 ? -7.706  2.037   -9.734  1.00 0.00 ? 47 ASN A OD1  6  
ATOM 10442 N ND2  . ASN A 1 51 ? -7.826  4.046   -10.723 1.00 0.00 ? 47 ASN A ND2  6  
ATOM 10443 H H    . ASN A 1 51 ? -12.322 2.207   -10.213 1.00 0.00 ? 47 ASN A H    6  
ATOM 10444 H HA   . ASN A 1 51 ? -10.254 2.597   -8.377  1.00 0.00 ? 47 ASN A HA   6  
ATOM 10445 H HB2  . ASN A 1 51 ? -10.063 1.733   -10.745 1.00 0.00 ? 47 ASN A HB2  6  
ATOM 10446 H HB3  . ASN A 1 51 ? -10.176 3.404   -11.286 1.00 0.00 ? 47 ASN A HB3  6  
ATOM 10447 H HD21 . ASN A 1 51 ? -8.408  4.709   -11.155 1.00 0.00 ? 47 ASN A HD21 6  
ATOM 10448 H HD22 . ASN A 1 51 ? -6.860  4.166   -10.613 1.00 0.00 ? 47 ASN A HD22 6  
ATOM 10449 N N    . ASP A 1 52 ? -11.246 5.391   -9.840  1.00 0.00 ? 48 ASP A N    6  
ATOM 10450 C CA   . ASP A 1 52 ? -11.242 6.845   -9.716  1.00 0.00 ? 48 ASP A CA   6  
ATOM 10451 C C    . ASP A 1 52 ? -12.024 7.327   -8.495  1.00 0.00 ? 48 ASP A C    6  
ATOM 10452 O O    . ASP A 1 52 ? -11.750 8.402   -7.962  1.00 0.00 ? 48 ASP A O    6  
ATOM 10453 C CB   . ASP A 1 52 ? -11.814 7.485   -10.979 1.00 0.00 ? 48 ASP A CB   6  
ATOM 10454 C CG   . ASP A 1 52 ? -11.300 8.893   -11.186 1.00 0.00 ? 48 ASP A CG   6  
ATOM 10455 O OD1  . ASP A 1 52 ? -10.097 9.048   -11.482 1.00 0.00 ? 48 ASP A OD1  6  
ATOM 10456 O OD2  . ASP A 1 52 ? -12.098 9.847   -11.063 1.00 0.00 ? 48 ASP A OD2  6  
ATOM 10457 H H    . ASP A 1 52 ? -11.701 4.983   -10.606 1.00 0.00 ? 48 ASP A H    6  
ATOM 10458 H HA   . ASP A 1 52 ? -10.216 7.158   -9.608  1.00 0.00 ? 48 ASP A HA   6  
ATOM 10459 H HB2  . ASP A 1 52 ? -11.534 6.890   -11.834 1.00 0.00 ? 48 ASP A HB2  6  
ATOM 10460 H HB3  . ASP A 1 52 ? -12.890 7.520   -10.905 1.00 0.00 ? 48 ASP A HB3  6  
ATOM 10461 N N    . ASP A 1 53 ? -13.000 6.536   -8.059  1.00 0.00 ? 49 ASP A N    6  
ATOM 10462 C CA   . ASP A 1 53 ? -13.817 6.886   -6.894  1.00 0.00 ? 49 ASP A CA   6  
ATOM 10463 C C    . ASP A 1 53 ? -12.944 7.060   -5.658  1.00 0.00 ? 49 ASP A C    6  
ATOM 10464 O O    . ASP A 1 53 ? -13.142 7.982   -4.863  1.00 0.00 ? 49 ASP A O    6  
ATOM 10465 C CB   . ASP A 1 53 ? -14.866 5.801   -6.639  1.00 0.00 ? 49 ASP A CB   6  
ATOM 10466 C CG   . ASP A 1 53 ? -16.173 6.354   -6.103  1.00 0.00 ? 49 ASP A CG   6  
ATOM 10467 O OD1  . ASP A 1 53 ? -16.237 6.690   -4.904  1.00 0.00 ? 49 ASP A OD1  6  
ATOM 10468 O OD2  . ASP A 1 53 ? -17.150 6.435   -6.880  1.00 0.00 ? 49 ASP A OD2  6  
ATOM 10469 H H    . ASP A 1 53 ? -13.195 5.709   -8.539  1.00 0.00 ? 49 ASP A H    6  
ATOM 10470 H HA   . ASP A 1 53 ? -14.318 7.819   -7.104  1.00 0.00 ? 49 ASP A HA   6  
ATOM 10471 H HB2  . ASP A 1 53 ? -15.071 5.285   -7.564  1.00 0.00 ? 49 ASP A HB2  6  
ATOM 10472 H HB3  . ASP A 1 53 ? -14.475 5.096   -5.919  1.00 0.00 ? 49 ASP A HB3  6  
ATOM 10473 N N    . ILE A 1 54 ? -11.955 6.196   -5.521  1.00 0.00 ? 50 ILE A N    6  
ATOM 10474 C CA   . ILE A 1 54 ? -11.006 6.235   -4.412  1.00 0.00 ? 50 ILE A CA   6  
ATOM 10475 C C    . ILE A 1 54 ? -10.273 7.553   -4.373  1.00 0.00 ? 50 ILE A C    6  
ATOM 10476 O O    . ILE A 1 54 ? -9.893  8.046   -3.306  1.00 0.00 ? 50 ILE A O    6  
ATOM 10477 C CB   . ILE A 1 54 ? -10.007 5.007   -4.464  1.00 0.00 ? 50 ILE A CB   6  
ATOM 10478 C CG1  . ILE A 1 54 ? -10.666 3.619   -4.185  1.00 0.00 ? 50 ILE A CG1  6  
ATOM 10479 C CG2  . ILE A 1 54 ? -8.795  5.172   -3.496  1.00 0.00 ? 50 ILE A CG2  6  
ATOM 10480 C CD1  . ILE A 1 54 ? -9.789  2.385   -4.483  1.00 0.00 ? 50 ILE A CD1  6  
ATOM 10481 H H    . ILE A 1 54 ? -11.851 5.484   -6.205  1.00 0.00 ? 50 ILE A H    6  
ATOM 10482 H HA   . ILE A 1 54 ? -11.586 6.170   -3.473  1.00 0.00 ? 50 ILE A HA   6  
ATOM 10483 H HB   . ILE A 1 54 ? -9.606  4.968   -5.499  1.00 0.00 ? 50 ILE A HB   6  
ATOM 10484 H HG12 . ILE A 1 54 ? -11.045 3.575   -3.145  1.00 0.00 ? 50 ILE A HG12 6  
ATOM 10485 H HG13 . ILE A 1 54 ? -11.570 3.505   -4.813  1.00 0.00 ? 50 ILE A HG13 6  
ATOM 10486 H HG21 . ILE A 1 54 ? -8.195  6.076   -3.700  1.00 0.00 ? 50 ILE A HG21 6  
ATOM 10487 H HG22 . ILE A 1 54 ? -9.112  5.220   -2.437  1.00 0.00 ? 50 ILE A HG22 6  
ATOM 10488 H HG23 . ILE A 1 54 ? -8.074  4.339   -3.579  1.00 0.00 ? 50 ILE A HG23 6  
ATOM 10489 H HD11 . ILE A 1 54 ? -9.430  2.380   -5.530  1.00 0.00 ? 50 ILE A HD11 6  
ATOM 10490 H HD12 . ILE A 1 54 ? -8.900  2.329   -3.828  1.00 0.00 ? 50 ILE A HD12 6  
ATOM 10491 H HD13 . ILE A 1 54 ? -10.353 1.447   -4.330  1.00 0.00 ? 50 ILE A HD13 6  
ATOM 10492 N N    . LYS A 1 55 ? -10.022 8.111   -5.546  1.00 0.00 ? 51 LYS A N    6  
ATOM 10493 C CA   . LYS A 1 55 ? -9.283  9.361   -5.665  1.00 0.00 ? 51 LYS A CA   6  
ATOM 10494 C C    . LYS A 1 55 ? -10.165 10.564  -5.355  1.00 0.00 ? 51 LYS A C    6  
ATOM 10495 O O    . LYS A 1 55 ? -9.665  11.669  -5.155  1.00 0.00 ? 51 LYS A O    6  
ATOM 10496 C CB   . LYS A 1 55 ? -8.725  9.504   -7.079  1.00 0.00 ? 51 LYS A CB   6  
ATOM 10497 C CG   . LYS A 1 55 ? -8.050  8.248   -7.605  1.00 0.00 ? 51 LYS A CG   6  
ATOM 10498 C CD   . LYS A 1 55 ? -7.805  8.335   -9.101  1.00 0.00 ? 51 LYS A CD   6  
ATOM 10499 C CE   . LYS A 1 55 ? -6.807  9.428   -9.446  1.00 0.00 ? 51 LYS A CE   6  
ATOM 10500 N NZ   . LYS A 1 55 ? -5.414  8.912   -9.487  1.00 0.00 ? 51 LYS A NZ   6  
ATOM 10501 H H    . LYS A 1 55 ? -10.368 7.691   -6.361  1.00 0.00 ? 51 LYS A H    6  
ATOM 10502 H HA   . LYS A 1 55 ? -8.462  9.335   -4.964  1.00 0.00 ? 51 LYS A HA   6  
ATOM 10503 H HB2  . LYS A 1 55 ? -9.536  9.754   -7.747  1.00 0.00 ? 51 LYS A HB2  6  
ATOM 10504 H HB3  . LYS A 1 55 ? -8.004  10.305  -7.089  1.00 0.00 ? 51 LYS A HB3  6  
ATOM 10505 H HG2  . LYS A 1 55 ? -7.102  8.122   -7.101  1.00 0.00 ? 51 LYS A HG2  6  
ATOM 10506 H HG3  . LYS A 1 55 ? -8.685  7.398   -7.400  1.00 0.00 ? 51 LYS A HG3  6  
ATOM 10507 H HD2  . LYS A 1 55 ? -7.418  7.389   -9.446  1.00 0.00 ? 51 LYS A HD2  6  
ATOM 10508 H HD3  . LYS A 1 55 ? -8.740  8.546   -9.598  1.00 0.00 ? 51 LYS A HD3  6  
ATOM 10509 H HE2  . LYS A 1 55 ? -7.060  9.835   -10.412 1.00 0.00 ? 51 LYS A HE2  6  
ATOM 10510 H HE3  . LYS A 1 55 ? -6.872  10.206  -8.700  1.00 0.00 ? 51 LYS A HE3  6  
ATOM 10511 H HZ1  . LYS A 1 55 ? -5.266  8.364   -10.357 1.00 0.00 ? 51 LYS A HZ1  6  
ATOM 10512 H HZ2  . LYS A 1 55 ? -5.230  8.296   -8.667  1.00 0.00 ? 51 LYS A HZ2  6  
ATOM 10513 H HZ3  . LYS A 1 55 ? -4.740  9.703   -9.469  1.00 0.00 ? 51 LYS A HZ3  6  
ATOM 10514 N N    . ARG A 1 56 ? -11.469 10.345  -5.309  1.00 0.00 ? 52 ARG A N    6  
ATOM 10515 C CA   . ARG A 1 56 ? -12.413 11.419  -5.039  1.00 0.00 ? 52 ARG A CA   6  
ATOM 10516 C C    . ARG A 1 56 ? -12.677 11.523  -3.545  1.00 0.00 ? 52 ARG A C    6  
ATOM 10517 O O    . ARG A 1 56 ? -12.767 12.621  -2.992  1.00 0.00 ? 52 ARG A O    6  
ATOM 10518 C CB   . ARG A 1 56 ? -13.724 11.176  -5.801  1.00 0.00 ? 52 ARG A CB   6  
ATOM 10519 C CG   . ARG A 1 56 ? -14.935 11.869  -5.190  1.00 0.00 ? 52 ARG A CG   6  
ATOM 10520 C CD   . ARG A 1 56 ? -16.130 11.853  -6.130  1.00 0.00 ? 52 ARG A CD   6  
ATOM 10521 N NE   . ARG A 1 56 ? -17.331 12.421  -5.510  1.00 0.00 ? 52 ARG A NE   6  
ATOM 10522 C CZ   . ARG A 1 56 ? -17.615 13.726  -5.478  1.00 0.00 ? 52 ARG A CZ   6  
ATOM 10523 N NH1  . ARG A 1 56 ? -16.774 14.610  -6.003  1.00 0.00 ? 52 ARG A NH1  6  
ATOM 10524 N NH2  . ARG A 1 56 ? -18.739 14.144  -4.910  1.00 0.00 ? 52 ARG A NH2  6  
ATOM 10525 H H    . ARG A 1 56 ? -11.811 9.430   -5.425  1.00 0.00 ? 52 ARG A H    6  
ATOM 10526 H HA   . ARG A 1 56 ? -11.970 12.343  -5.382  1.00 0.00 ? 52 ARG A HA   6  
ATOM 10527 H HB2  . ARG A 1 56 ? -13.606 11.534  -6.813  1.00 0.00 ? 52 ARG A HB2  6  
ATOM 10528 H HB3  . ARG A 1 56 ? -13.917 10.114  -5.826  1.00 0.00 ? 52 ARG A HB3  6  
ATOM 10529 H HG2  . ARG A 1 56 ? -15.203 11.360  -4.276  1.00 0.00 ? 52 ARG A HG2  6  
ATOM 10530 H HG3  . ARG A 1 56 ? -14.677 12.895  -4.968  1.00 0.00 ? 52 ARG A HG3  6  
ATOM 10531 H HD2  . ARG A 1 56 ? -15.884 12.429  -7.010  1.00 0.00 ? 52 ARG A HD2  6  
ATOM 10532 H HD3  . ARG A 1 56 ? -16.332 10.832  -6.419  1.00 0.00 ? 52 ARG A HD3  6  
ATOM 10533 H HE   . ARG A 1 56 ? -17.969 11.787  -5.105  1.00 0.00 ? 52 ARG A HE   6  
ATOM 10534 H HH11 . ARG A 1 56 ? -15.918 14.302  -6.429  1.00 0.00 ? 52 ARG A HH11 6  
ATOM 10535 H HH12 . ARG A 1 56 ? -16.988 15.591  -5.977  1.00 0.00 ? 52 ARG A HH12 6  
ATOM 10536 H HH21 . ARG A 1 56 ? -19.378 13.481  -4.510  1.00 0.00 ? 52 ARG A HH21 6  
ATOM 10537 H HH22 . ARG A 1 56 ? -18.957 15.123  -4.879  1.00 0.00 ? 52 ARG A HH22 6  
ATOM 10538 N N    . ILE A 1 57 ? -12.766 10.372  -2.897  1.00 0.00 ? 53 ILE A N    6  
ATOM 10539 C CA   . ILE A 1 57 ? -13.035 10.313  -1.468  1.00 0.00 ? 53 ILE A CA   6  
ATOM 10540 C C    . ILE A 1 57 ? -11.799 10.610  -0.618  1.00 0.00 ? 53 ILE A C    6  
ATOM 10541 O O    . ILE A 1 57 ? -11.780 10.325  0.579   1.00 0.00 ? 53 ILE A O    6  
ATOM 10542 C CB   . ILE A 1 57 ? -13.621 8.941   -1.072  1.00 0.00 ? 53 ILE A CB   6  
ATOM 10543 C CG1  . ILE A 1 57 ? -12.704 7.803   -1.535  1.00 0.00 ? 53 ILE A CG1  6  
ATOM 10544 C CG2  . ILE A 1 57 ? -15.014 8.786   -1.663  1.00 0.00 ? 53 ILE A CG2  6  
ATOM 10545 C CD1  . ILE A 1 57 ? -13.329 6.428   -1.416  1.00 0.00 ? 53 ILE A CD1  6  
ATOM 10546 H H    . ILE A 1 57 ? -12.678 9.535   -3.403  1.00 0.00 ? 53 ILE A H    6  
ATOM 10547 H HA   . ILE A 1 57 ? -13.784 11.062  -1.250  1.00 0.00 ? 53 ILE A HA   6  
ATOM 10548 H HB   . ILE A 1 57 ? -13.708 8.910   0.004   1.00 0.00 ? 53 ILE A HB   6  
ATOM 10549 H HG12 . ILE A 1 57 ? -12.444 7.958   -2.571  1.00 0.00 ? 53 ILE A HG12 6  
ATOM 10550 H HG13 . ILE A 1 57 ? -11.803 7.812   -0.937  1.00 0.00 ? 53 ILE A HG13 6  
ATOM 10551 H HG21 . ILE A 1 57 ? -15.643 9.592   -1.319  1.00 0.00 ? 53 ILE A HG21 6  
ATOM 10552 H HG22 . ILE A 1 57 ? -15.434 7.842   -1.350  1.00 0.00 ? 53 ILE A HG22 6  
ATOM 10553 H HG23 . ILE A 1 57 ? -14.953 8.811   -2.741  1.00 0.00 ? 53 ILE A HG23 6  
ATOM 10554 H HD11 . ILE A 1 57 ? -12.562 5.674   -1.519  1.00 0.00 ? 53 ILE A HD11 6  
ATOM 10555 H HD12 . ILE A 1 57 ? -14.066 6.300   -2.194  1.00 0.00 ? 53 ILE A HD12 6  
ATOM 10556 H HD13 . ILE A 1 57 ? -13.803 6.330   -0.451  1.00 0.00 ? 53 ILE A HD13 6  
ATOM 10557 N N    . GLY A 1 58 ? -10.768 11.190  -1.226  1.00 0.00 ? 54 GLY A N    6  
ATOM 10558 C CA   . GLY A 1 58 ? -9.570  11.525  -0.479  1.00 0.00 ? 54 GLY A CA   6  
ATOM 10559 C C    . GLY A 1 58 ? -8.288  11.171  -1.203  1.00 0.00 ? 54 GLY A C    6  
ATOM 10560 O O    . GLY A 1 58 ? -7.837  11.933  -2.053  1.00 0.00 ? 54 GLY A O    6  
ATOM 10561 H H    . GLY A 1 58 ? -10.820 11.388  -2.184  1.00 0.00 ? 54 GLY A H    6  
ATOM 10562 H HA2  . GLY A 1 58 ? -9.571  12.587  -0.281  1.00 0.00 ? 54 GLY A HA2  6  
ATOM 10563 H HA3  . GLY A 1 58 ? -9.592  10.999  0.464   1.00 0.00 ? 54 GLY A HA3  6  
ATOM 10564 N N    . VAL A 1 59 ? -7.731  10.013  -0.831  1.00 0.00 ? 55 VAL A N    6  
ATOM 10565 C CA   . VAL A 1 59 ? -6.473  9.455   -1.367  1.00 0.00 ? 55 VAL A CA   6  
ATOM 10566 C C    . VAL A 1 59 ? -5.933  10.170  -2.608  1.00 0.00 ? 55 VAL A C    6  
ATOM 10567 O O    . VAL A 1 59 ? -6.284  9.827   -3.739  1.00 0.00 ? 55 VAL A O    6  
ATOM 10568 C CB   . VAL A 1 59 ? -6.646  7.965   -1.714  1.00 0.00 ? 55 VAL A CB   6  
ATOM 10569 C CG1  . VAL A 1 59 ? -5.297  7.275   -1.780  1.00 0.00 ? 55 VAL A CG1  6  
ATOM 10570 C CG2  . VAL A 1 59 ? -7.559  7.275   -0.712  1.00 0.00 ? 55 VAL A CG2  6  
ATOM 10571 H H    . VAL A 1 59 ? -8.198  9.489   -0.147  1.00 0.00 ? 55 VAL A H    6  
ATOM 10572 H HA   . VAL A 1 59 ? -5.735  9.522   -0.586  1.00 0.00 ? 55 VAL A HA   6  
ATOM 10573 H HB   . VAL A 1 59 ? -7.106  7.897   -2.691  1.00 0.00 ? 55 VAL A HB   6  
ATOM 10574 H HG11 . VAL A 1 59 ? -4.859  7.249   -0.794  1.00 0.00 ? 55 VAL A HG11 6  
ATOM 10575 H HG12 . VAL A 1 59 ? -4.646  7.821   -2.448  1.00 0.00 ? 55 VAL A HG12 6  
ATOM 10576 H HG13 . VAL A 1 59 ? -5.425  6.268   -2.144  1.00 0.00 ? 55 VAL A HG13 6  
ATOM 10577 H HG21 . VAL A 1 59 ? -7.662  6.233   -0.978  1.00 0.00 ? 55 VAL A HG21 6  
ATOM 10578 H HG22 . VAL A 1 59 ? -8.530  7.747   -0.725  1.00 0.00 ? 55 VAL A HG22 6  
ATOM 10579 H HG23 . VAL A 1 59 ? -7.133  7.354   0.277   1.00 0.00 ? 55 VAL A HG23 6  
ATOM 10580 N N    . ARG A 1 60 ? -5.071  11.161  -2.395  1.00 0.00 ? 56 ARG A N    6  
ATOM 10581 C CA   . ARG A 1 60 ? -4.483  11.902  -3.506  1.00 0.00 ? 56 ARG A CA   6  
ATOM 10582 C C    . ARG A 1 60 ? -3.155  11.279  -3.938  1.00 0.00 ? 56 ARG A C    6  
ATOM 10583 O O    . ARG A 1 60 ? -2.653  11.557  -5.028  1.00 0.00 ? 56 ARG A O    6  
ATOM 10584 C CB   . ARG A 1 60 ? -4.278  13.374  -3.125  1.00 0.00 ? 56 ARG A CB   6  
ATOM 10585 C CG   . ARG A 1 60 ? -3.161  13.607  -2.117  1.00 0.00 ? 56 ARG A CG   6  
ATOM 10586 C CD   . ARG A 1 60 ? -1.875  14.059  -2.799  1.00 0.00 ? 56 ARG A CD   6  
ATOM 10587 N NE   . ARG A 1 60 ? -1.965  15.437  -3.282  1.00 0.00 ? 56 ARG A NE   6  
ATOM 10588 C CZ   . ARG A 1 60 ? -1.554  16.493  -2.586  1.00 0.00 ? 56 ARG A CZ   6  
ATOM 10589 N NH1  . ARG A 1 60 ? -1.039  16.333  -1.371  1.00 0.00 ? 56 ARG A NH1  6  
ATOM 10590 N NH2  . ARG A 1 60 ? -1.662  17.713  -3.104  1.00 0.00 ? 56 ARG A NH2  6  
ATOM 10591 H H    . ARG A 1 60 ? -4.863  11.436  -1.481  1.00 0.00 ? 56 ARG A H    6  
ATOM 10592 H HA   . ARG A 1 60 ? -5.172  11.849  -4.332  1.00 0.00 ? 56 ARG A HA   6  
ATOM 10593 H HB2  . ARG A 1 60 ? -4.042  13.934  -4.019  1.00 0.00 ? 56 ARG A HB2  6  
ATOM 10594 H HB3  . ARG A 1 60 ? -5.197  13.757  -2.706  1.00 0.00 ? 56 ARG A HB3  6  
ATOM 10595 H HG2  . ARG A 1 60 ? -3.471  14.370  -1.417  1.00 0.00 ? 56 ARG A HG2  6  
ATOM 10596 H HG3  . ARG A 1 60 ? -2.971  12.685  -1.585  1.00 0.00 ? 56 ARG A HG3  6  
ATOM 10597 H HD2  . ARG A 1 60 ? -1.062  13.987  -2.094  1.00 0.00 ? 56 ARG A HD2  6  
ATOM 10598 H HD3  . ARG A 1 60 ? -1.682  13.407  -3.637  1.00 0.00 ? 56 ARG A HD3  6  
ATOM 10599 H HE   . ARG A 1 60 ? -2.350  15.575  -4.179  1.00 0.00 ? 56 ARG A HE   6  
ATOM 10600 H HH11 . ARG A 1 60 ? -0.959  15.415  -0.972  1.00 0.00 ? 56 ARG A HH11 6  
ATOM 10601 H HH12 . ARG A 1 60 ? -0.726  17.128  -0.847  1.00 0.00 ? 56 ARG A HH12 6  
ATOM 10602 H HH21 . ARG A 1 60 ? -2.057  17.841  -4.020  1.00 0.00 ? 56 ARG A HH21 6  
ATOM 10603 H HH22 . ARG A 1 60 ? -1.350  18.512  -2.584  1.00 0.00 ? 56 ARG A HH22 6  
ATOM 10604 N N    . LEU A 1 61 ? -2.580  10.448  -3.076  1.00 0.00 ? 57 LEU A N    6  
ATOM 10605 C CA   . LEU A 1 61 ? -1.315  9.795   -3.380  1.00 0.00 ? 57 LEU A CA   6  
ATOM 10606 C C    . LEU A 1 61 ? -1.555  8.560   -4.247  1.00 0.00 ? 57 LEU A C    6  
ATOM 10607 O O    . LEU A 1 61 ? -2.333  7.682   -3.876  1.00 0.00 ? 57 LEU A O    6  
ATOM 10608 C CB   . LEU A 1 61 ? -0.579  9.420   -2.087  1.00 0.00 ? 57 LEU A CB   6  
ATOM 10609 C CG   . LEU A 1 61 ? 0.075   10.595  -1.351  1.00 0.00 ? 57 LEU A CG   6  
ATOM 10610 C CD1  . LEU A 1 61 ? 0.650   10.141  -0.016  1.00 0.00 ? 57 LEU A CD1  6  
ATOM 10611 C CD2  . LEU A 1 61 ? 1.160   11.224  -2.211  1.00 0.00 ? 57 LEU A CD2  6  
ATOM 10612 H H    . LEU A 1 61 ? -3.024  10.264  -2.224  1.00 0.00 ? 57 LEU A H    6  
ATOM 10613 H HA   . LEU A 1 61 ? -0.712  10.496  -3.936  1.00 0.00 ? 57 LEU A HA   6  
ATOM 10614 H HB2  . LEU A 1 61 ? -1.287  8.953   -1.417  1.00 0.00 ? 57 LEU A HB2  6  
ATOM 10615 H HB3  . LEU A 1 61 ? 0.190   8.703   -2.329  1.00 0.00 ? 57 LEU A HB3  6  
ATOM 10616 H HG   . LEU A 1 61 ? -0.674  11.347  -1.152  1.00 0.00 ? 57 LEU A HG   6  
ATOM 10617 H HD11 . LEU A 1 61 ? -0.150  9.801   0.623   1.00 0.00 ? 57 LEU A HD11 6  
ATOM 10618 H HD12 . LEU A 1 61 ? 1.160   10.968  0.456   1.00 0.00 ? 57 LEU A HD12 6  
ATOM 10619 H HD13 . LEU A 1 61 ? 1.350   9.334   -0.177  1.00 0.00 ? 57 LEU A HD13 6  
ATOM 10620 H HD21 . LEU A 1 61 ? 1.755   10.445  -2.666  1.00 0.00 ? 57 LEU A HD21 6  
ATOM 10621 H HD22 . LEU A 1 61 ? 1.792   11.845  -1.594  1.00 0.00 ? 57 LEU A HD22 6  
ATOM 10622 H HD23 . LEU A 1 61 ? 0.705   11.827  -2.981  1.00 0.00 ? 57 LEU A HD23 6  
ATOM 10623 N N    . PRO A 1 62 ? -0.881  8.480   -5.409  1.00 0.00 ? 58 PRO A N    6  
ATOM 10624 C CA   . PRO A 1 62 ? -1.039  7.361   -6.350  1.00 0.00 ? 58 PRO A CA   6  
ATOM 10625 C C    . PRO A 1 62 ? -0.662  6.020   -5.738  1.00 0.00 ? 58 PRO A C    6  
ATOM 10626 O O    . PRO A 1 62 ? -1.304  5.002   -6.001  1.00 0.00 ? 58 PRO A O    6  
ATOM 10627 C CB   . PRO A 1 62 ? -0.092  7.712   -7.503  1.00 0.00 ? 58 PRO A CB   6  
ATOM 10628 C CG   . PRO A 1 62 ? 0.865   8.701   -6.932  1.00 0.00 ? 58 PRO A CG   6  
ATOM 10629 C CD   . PRO A 1 62 ? 0.092   9.469   -5.900  1.00 0.00 ? 58 PRO A CD   6  
ATOM 10630 H HA   . PRO A 1 62 ? -2.052  7.305   -6.720  1.00 0.00 ? 58 PRO A HA   6  
ATOM 10631 H HB2  . PRO A 1 62 ? 0.417   6.819   -7.837  1.00 0.00 ? 58 PRO A HB2  6  
ATOM 10632 H HB3  . PRO A 1 62 ? -0.654  8.138   -8.320  1.00 0.00 ? 58 PRO A HB3  6  
ATOM 10633 H HG2  . PRO A 1 62 ? 1.695   8.185   -6.473  1.00 0.00 ? 58 PRO A HG2  6  
ATOM 10634 H HG3  . PRO A 1 62 ? 1.217   9.365   -7.708  1.00 0.00 ? 58 PRO A HG3  6  
ATOM 10635 H HD2  . PRO A 1 62 ? 0.746   9.799   -5.105  1.00 0.00 ? 58 PRO A HD2  6  
ATOM 10636 H HD3  . PRO A 1 62 ? -0.410  10.311  -6.353  1.00 0.00 ? 58 PRO A HD3  6  
ATOM 10637 N N    . GLY A 1 63 ? 0.374   6.024   -4.913  1.00 0.00 ? 59 GLY A N    6  
ATOM 10638 C CA   . GLY A 1 63 ? 0.809   4.804   -4.273  1.00 0.00 ? 59 GLY A CA   6  
ATOM 10639 C C    . GLY A 1 63 ? -0.195  4.315   -3.248  1.00 0.00 ? 59 GLY A C    6  
ATOM 10640 O O    . GLY A 1 63 ? -0.426  3.111   -3.118  1.00 0.00 ? 59 GLY A O    6  
ATOM 10641 H H    . GLY A 1 63 ? 0.846   6.863   -4.739  1.00 0.00 ? 59 GLY A H    6  
ATOM 10642 H HA2  . GLY A 1 63 ? 0.941   4.039   -5.029  1.00 0.00 ? 59 GLY A HA2  6  
ATOM 10643 H HA3  . GLY A 1 63 ? 1.753   4.983   -3.787  1.00 0.00 ? 59 GLY A HA3  6  
ATOM 10644 N N    . HIS A 1 64 ? -0.802  5.249   -2.523  1.00 0.00 ? 60 HIS A N    6  
ATOM 10645 C CA   . HIS A 1 64 ? -1.803  4.902   -1.526  1.00 0.00 ? 60 HIS A CA   6  
ATOM 10646 C C    . HIS A 1 64 ? -3.022  4.333   -2.235  1.00 0.00 ? 60 HIS A C    6  
ATOM 10647 O O    . HIS A 1 64 ? -3.739  3.487   -1.700  1.00 0.00 ? 60 HIS A O    6  
ATOM 10648 C CB   . HIS A 1 64 ? -2.208  6.131   -0.708  1.00 0.00 ? 60 HIS A CB   6  
ATOM 10649 C CG   . HIS A 1 64 ? -1.362  6.385   0.500   1.00 0.00 ? 60 HIS A CG   6  
ATOM 10650 N ND1  . HIS A 1 64 ? -1.747  6.073   1.784   1.00 0.00 ? 60 HIS A ND1  6  
ATOM 10651 C CD2  . HIS A 1 64 ? -0.141  6.962   0.610   1.00 0.00 ? 60 HIS A CD2  6  
ATOM 10652 C CE1  . HIS A 1 64 ? -0.776  6.464   2.615   1.00 0.00 ? 60 HIS A CE1  6  
ATOM 10653 N NE2  . HIS A 1 64 ? 0.224   7.010   1.953   1.00 0.00 ? 60 HIS A NE2  6  
ATOM 10654 H H    . HIS A 1 64 ? -0.568  6.190   -2.661  1.00 0.00 ? 60 HIS A H    6  
ATOM 10655 H HA   . HIS A 1 64 ? -1.383  4.151   -0.870  1.00 0.00 ? 60 HIS A HA   6  
ATOM 10656 H HB2  . HIS A 1 64 ? -2.151  7.003   -1.339  1.00 0.00 ? 60 HIS A HB2  6  
ATOM 10657 H HB3  . HIS A 1 64 ? -3.229  6.003   -0.377  1.00 0.00 ? 60 HIS A HB3  6  
ATOM 10658 H HD1  . HIS A 1 64 ? -2.579  5.611   2.043   1.00 0.00 ? 60 HIS A HD1  6  
ATOM 10659 H HD2  . HIS A 1 64 ? 0.460   7.331   -0.206  1.00 0.00 ? 60 HIS A HD2  6  
ATOM 10660 H HE1  . HIS A 1 64 ? -0.806  6.345   3.688   1.00 0.00 ? 60 HIS A HE1  6  
ATOM 10661 N N    . GLN A 1 65 ? -3.230  4.804   -3.462  1.00 0.00 ? 61 GLN A N    6  
ATOM 10662 C CA   . GLN A 1 65 ? -4.350  4.355   -4.280  1.00 0.00 ? 61 GLN A CA   6  
ATOM 10663 C C    . GLN A 1 65 ? -4.156  2.890   -4.655  1.00 0.00 ? 61 GLN A C    6  
ATOM 10664 O O    . GLN A 1 65 ? -4.971  2.041   -4.301  1.00 0.00 ? 61 GLN A O    6  
ATOM 10665 C CB   . GLN A 1 65 ? -4.475  5.212   -5.542  1.00 0.00 ? 61 GLN A CB   6  
ATOM 10666 C CG   . GLN A 1 65 ? -5.174  6.541   -5.312  1.00 0.00 ? 61 GLN A CG   6  
ATOM 10667 C CD   . GLN A 1 65 ? -4.796  7.588   -6.346  1.00 0.00 ? 61 GLN A CD   6  
ATOM 10668 O OE1  . GLN A 1 65 ? -4.472  7.266   -7.489  1.00 0.00 ? 61 GLN A OE1  6  
ATOM 10669 N NE2  . GLN A 1 65 ? -4.849  8.852   -5.957  1.00 0.00 ? 61 GLN A NE2  6  
ATOM 10670 H H    . GLN A 1 65 ? -2.584  5.451   -3.829  1.00 0.00 ? 61 GLN A H    6  
ATOM 10671 H HA   . GLN A 1 65 ? -5.250  4.452   -3.693  1.00 0.00 ? 61 GLN A HA   6  
ATOM 10672 H HB2  . GLN A 1 65 ? -3.485  5.413   -5.929  1.00 0.00 ? 61 GLN A HB2  6  
ATOM 10673 H HB3  . GLN A 1 65 ? -5.034  4.659   -6.282  1.00 0.00 ? 61 GLN A HB3  6  
ATOM 10674 H HG2  . GLN A 1 65 ? -6.242  6.382   -5.352  1.00 0.00 ? 61 GLN A HG2  6  
ATOM 10675 H HG3  . GLN A 1 65 ? -4.904  6.909   -4.332  1.00 0.00 ? 61 GLN A HG3  6  
ATOM 10676 H HE21 . GLN A 1 65 ? -5.131  9.041   -5.033  1.00 0.00 ? 61 GLN A HE21 6  
ATOM 10677 H HE22 . GLN A 1 65 ? -4.596  9.549   -6.600  1.00 0.00 ? 61 GLN A HE22 6  
ATOM 10678 N N    . LYS A 1 66 ? -3.093  2.635   -5.424  1.00 0.00 ? 62 LYS A N    6  
ATOM 10679 C CA   . LYS A 1 66 ? -2.716  1.282   -5.849  1.00 0.00 ? 62 LYS A CA   6  
ATOM 10680 C C    . LYS A 1 66 ? -2.892  0.245   -4.738  1.00 0.00 ? 62 LYS A C    6  
ATOM 10681 O O    . LYS A 1 66 ? -3.418  -0.838  -4.984  1.00 0.00 ? 62 LYS A O    6  
ATOM 10682 C CB   . LYS A 1 66 ? -1.269  1.263   -6.344  1.00 0.00 ? 62 LYS A CB   6  
ATOM 10683 C CG   . LYS A 1 66 ? -1.121  1.659   -7.805  1.00 0.00 ? 62 LYS A CG   6  
ATOM 10684 C CD   . LYS A 1 66 ? 0.283   1.387   -8.323  1.00 0.00 ? 62 LYS A CD   6  
ATOM 10685 C CE   . LYS A 1 66 ? 0.547   -0.102  -8.506  1.00 0.00 ? 62 LYS A CE   6  
ATOM 10686 N NZ   . LYS A 1 66 ? 1.987   -0.382  -8.744  1.00 0.00 ? 62 LYS A NZ   6  
ATOM 10687 H H    . LYS A 1 66 ? -2.626  3.405   -5.812  1.00 0.00 ? 62 LYS A H    6  
ATOM 10688 H HA   . LYS A 1 66 ? -3.362  1.012   -6.670  1.00 0.00 ? 62 LYS A HA   6  
ATOM 10689 H HB2  . LYS A 1 66 ? -0.686  1.950   -5.747  1.00 0.00 ? 62 LYS A HB2  6  
ATOM 10690 H HB3  . LYS A 1 66 ? -0.874  0.267   -6.219  1.00 0.00 ? 62 LYS A HB3  6  
ATOM 10691 H HG2  . LYS A 1 66 ? -1.825  1.092   -8.394  1.00 0.00 ? 62 LYS A HG2  6  
ATOM 10692 H HG3  . LYS A 1 66 ? -1.334  2.714   -7.901  1.00 0.00 ? 62 LYS A HG3  6  
ATOM 10693 H HD2  . LYS A 1 66 ? 0.404   1.880   -9.276  1.00 0.00 ? 62 LYS A HD2  6  
ATOM 10694 H HD3  . LYS A 1 66 ? 0.998   1.785   -7.618  1.00 0.00 ? 62 LYS A HD3  6  
ATOM 10695 H HE2  . LYS A 1 66 ? 0.235   -0.623  -7.613  1.00 0.00 ? 62 LYS A HE2  6  
ATOM 10696 H HE3  . LYS A 1 66 ? -0.027  -0.458  -9.348  1.00 0.00 ? 62 LYS A HE3  6  
ATOM 10697 H HZ1  . LYS A 1 66 ? 2.130   -1.394  -8.942  1.00 0.00 ? 62 LYS A HZ1  6  
ATOM 10698 H HZ2  . LYS A 1 66 ? 2.544   -0.125  -7.897  1.00 0.00 ? 62 LYS A HZ2  6  
ATOM 10699 H HZ3  . LYS A 1 66 ? 2.333   0.170   -9.554  1.00 0.00 ? 62 LYS A HZ3  6  
ATOM 10700 N N    . ARG A 1 67 ? -2.448  0.574   -3.529  1.00 0.00 ? 63 ARG A N    6  
ATOM 10701 C CA   . ARG A 1 67 ? -2.577  -0.341  -2.394  1.00 0.00 ? 63 ARG A CA   6  
ATOM 10702 C C    . ARG A 1 67 ? -4.048  -0.665  -2.135  1.00 0.00 ? 63 ARG A C    6  
ATOM 10703 O O    . ARG A 1 67 ? -4.437  -1.832  -2.091  1.00 0.00 ? 63 ARG A O    6  
ATOM 10704 C CB   . ARG A 1 67 ? -1.942  0.262   -1.138  1.00 0.00 ? 63 ARG A CB   6  
ATOM 10705 C CG   . ARG A 1 67 ? -0.803  -0.568  -0.561  1.00 0.00 ? 63 ARG A CG   6  
ATOM 10706 C CD   . ARG A 1 67 ? 0.560   -0.034  -0.980  1.00 0.00 ? 63 ARG A CD   6  
ATOM 10707 N NE   . ARG A 1 67 ? 1.122   -0.760  -2.128  1.00 0.00 ? 63 ARG A NE   6  
ATOM 10708 C CZ   . ARG A 1 67 ? 1.573   -0.167  -3.238  1.00 0.00 ? 63 ARG A CZ   6  
ATOM 10709 N NH1  . ARG A 1 67 ? 1.457   1.143   -3.389  1.00 0.00 ? 63 ARG A NH1  6  
ATOM 10710 N NH2  . ARG A 1 67 ? 2.133   -0.881  -4.204  1.00 0.00 ? 63 ARG A NH2  6  
ATOM 10711 H H    . ARG A 1 67 ? -2.020  1.447   -3.397  1.00 0.00 ? 63 ARG A H    6  
ATOM 10712 H HA   . ARG A 1 67 ? -2.060  -1.255  -2.647  1.00 0.00 ? 63 ARG A HA   6  
ATOM 10713 H HB2  . ARG A 1 67 ? -1.557  1.241   -1.381  1.00 0.00 ? 63 ARG A HB2  6  
ATOM 10714 H HB3  . ARG A 1 67 ? -2.704  0.364   -0.378  1.00 0.00 ? 63 ARG A HB3  6  
ATOM 10715 H HG2  . ARG A 1 67 ? -0.867  -0.548  0.518   1.00 0.00 ? 63 ARG A HG2  6  
ATOM 10716 H HG3  . ARG A 1 67 ? -0.902  -1.588  -0.906  1.00 0.00 ? 63 ARG A HG3  6  
ATOM 10717 H HD2  . ARG A 1 67 ? 0.457   1.007   -1.240  1.00 0.00 ? 63 ARG A HD2  6  
ATOM 10718 H HD3  . ARG A 1 67 ? 1.240   -0.126  -0.144  1.00 0.00 ? 63 ARG A HD3  6  
ATOM 10719 H HE   . ARG A 1 67 ? 1.191   -1.738  -2.053  1.00 0.00 ? 63 ARG A HE   6  
ATOM 10720 H HH11 . ARG A 1 67 ? 1.031   1.700   -2.677  1.00 0.00 ? 63 ARG A HH11 6  
ATOM 10721 H HH12 . ARG A 1 67 ? 1.808   1.589   -4.232  1.00 0.00 ? 63 ARG A HH12 6  
ATOM 10722 H HH21 . ARG A 1 67 ? 2.235   -1.889  -4.111  1.00 0.00 ? 63 ARG A HH21 6  
ATOM 10723 H HH22 . ARG A 1 67 ? 2.466   -0.422  -5.042  1.00 0.00 ? 63 ARG A HH22 6  
ATOM 10724 N N    . ILE A 1 68 ? -4.858  0.378   -1.978  1.00 0.00 ? 64 ILE A N    6  
ATOM 10725 C CA   . ILE A 1 68 ? -6.292  0.216   -1.736  1.00 0.00 ? 64 ILE A CA   6  
ATOM 10726 C C    . ILE A 1 68 ? -6.957  -0.554  -2.876  1.00 0.00 ? 64 ILE A C    6  
ATOM 10727 O O    . ILE A 1 68 ? -7.724  -1.488  -2.644  1.00 0.00 ? 64 ILE A O    6  
ATOM 10728 C CB   . ILE A 1 68 ? -6.997  1.583   -1.569  1.00 0.00 ? 64 ILE A CB   6  
ATOM 10729 C CG1  . ILE A 1 68 ? -6.459  2.295   -0.330  1.00 0.00 ? 64 ILE A CG1  6  
ATOM 10730 C CG2  . ILE A 1 68 ? -8.510  1.409   -1.472  1.00 0.00 ? 64 ILE A CG2  6  
ATOM 10731 C CD1  . ILE A 1 68 ? -7.002  3.693   -0.144  1.00 0.00 ? 64 ILE A CD1  6  
ATOM 10732 H H    . ILE A 1 68 ? -4.469  1.280   -2.011  1.00 0.00 ? 64 ILE A H    6  
ATOM 10733 H HA   . ILE A 1 68 ? -6.411  -0.343  -0.820  1.00 0.00 ? 64 ILE A HA   6  
ATOM 10734 H HB   . ILE A 1 68 ? -6.783  2.185   -2.441  1.00 0.00 ? 64 ILE A HB   6  
ATOM 10735 H HG12 . ILE A 1 68 ? -6.721  1.720   0.546   1.00 0.00 ? 64 ILE A HG12 6  
ATOM 10736 H HG13 . ILE A 1 68 ? -5.385  2.362   -0.404  1.00 0.00 ? 64 ILE A HG13 6  
ATOM 10737 H HG21 . ILE A 1 68 ? -8.980  2.381   -1.404  1.00 0.00 ? 64 ILE A HG21 6  
ATOM 10738 H HG22 . ILE A 1 68 ? -8.753  0.832   -0.592  1.00 0.00 ? 64 ILE A HG22 6  
ATOM 10739 H HG23 . ILE A 1 68 ? -8.871  0.896   -2.350  1.00 0.00 ? 64 ILE A HG23 6  
ATOM 10740 H HD11 . ILE A 1 68 ? -6.744  4.294   -1.002  1.00 0.00 ? 64 ILE A HD11 6  
ATOM 10741 H HD12 . ILE A 1 68 ? -6.577  4.129   0.746   1.00 0.00 ? 64 ILE A HD12 6  
ATOM 10742 H HD13 . ILE A 1 68 ? -8.077  3.649   -0.046  1.00 0.00 ? 64 ILE A HD13 6  
ATOM 10743 N N    . ALA A 1 69 ? -6.637  -0.162  -4.107  1.00 0.00 ? 65 ALA A N    6  
ATOM 10744 C CA   . ALA A 1 69 ? -7.195  -0.794  -5.298  1.00 0.00 ? 65 ALA A CA   6  
ATOM 10745 C C    . ALA A 1 69 ? -6.840  -2.274  -5.359  1.00 0.00 ? 65 ALA A C    6  
ATOM 10746 O O    . ALA A 1 69 ? -7.661  -3.105  -5.758  1.00 0.00 ? 65 ALA A O    6  
ATOM 10747 C CB   . ALA A 1 69 ? -6.697  -0.080  -6.546  1.00 0.00 ? 65 ALA A CB   6  
ATOM 10748 H H    . ALA A 1 69 ? -6.017  0.593   -4.221  1.00 0.00 ? 65 ALA A H    6  
ATOM 10749 H HA   . ALA A 1 69 ? -8.269  -0.692  -5.256  1.00 0.00 ? 65 ALA A HA   6  
ATOM 10750 H HB1  . ALA A 1 69 ? -6.843  0.984   -6.436  1.00 0.00 ? 65 ALA A HB1  6  
ATOM 10751 H HB2  . ALA A 1 69 ? -7.246  -0.432  -7.407  1.00 0.00 ? 65 ALA A HB2  6  
ATOM 10752 H HB3  . ALA A 1 69 ? -5.644  -0.284  -6.684  1.00 0.00 ? 65 ALA A HB3  6  
ATOM 10753 N N    . TYR A 1 70 ? -5.615  -2.592  -4.959  1.00 0.00 ? 66 TYR A N    6  
ATOM 10754 C CA   . TYR A 1 70 ? -5.137  -3.966  -4.952  1.00 0.00 ? 66 TYR A CA   6  
ATOM 10755 C C    . TYR A 1 70 ? -6.039  -4.844  -4.090  1.00 0.00 ? 66 TYR A C    6  
ATOM 10756 O O    . TYR A 1 70 ? -6.475  -5.916  -4.510  1.00 0.00 ? 66 TYR A O    6  
ATOM 10757 C CB   . TYR A 1 70 ? -3.699  -4.009  -4.426  1.00 0.00 ? 66 TYR A CB   6  
ATOM 10758 C CG   . TYR A 1 70 ? -3.112  -5.400  -4.298  1.00 0.00 ? 66 TYR A CG   6  
ATOM 10759 C CD1  . TYR A 1 70 ? -3.257  -6.342  -5.314  1.00 0.00 ? 66 TYR A CD1  6  
ATOM 10760 C CD2  . TYR A 1 70 ? -2.394  -5.767  -3.162  1.00 0.00 ? 66 TYR A CD2  6  
ATOM 10761 C CE1  . TYR A 1 70 ? -2.705  -7.605  -5.201  1.00 0.00 ? 66 TYR A CE1  6  
ATOM 10762 C CE2  . TYR A 1 70 ? -1.842  -7.029  -3.043  1.00 0.00 ? 66 TYR A CE2  6  
ATOM 10763 C CZ   . TYR A 1 70 ? -2.001  -7.945  -4.067  1.00 0.00 ? 66 TYR A CZ   6  
ATOM 10764 O OH   . TYR A 1 70 ? -1.451  -9.202  -3.962  1.00 0.00 ? 66 TYR A OH   6  
ATOM 10765 H H    . TYR A 1 70 ? -5.011  -1.876  -4.666  1.00 0.00 ? 66 TYR A H    6  
ATOM 10766 H HA   . TYR A 1 70 ? -5.155  -4.328  -5.968  1.00 0.00 ? 66 TYR A HA   6  
ATOM 10767 H HB2  . TYR A 1 70 ? -3.066  -3.449  -5.097  1.00 0.00 ? 66 TYR A HB2  6  
ATOM 10768 H HB3  . TYR A 1 70 ? -3.669  -3.546  -3.448  1.00 0.00 ? 66 TYR A HB3  6  
ATOM 10769 H HD1  . TYR A 1 70 ? -3.812  -6.078  -6.202  1.00 0.00 ? 66 TYR A HD1  6  
ATOM 10770 H HD2  . TYR A 1 70 ? -2.275  -5.049  -2.362  1.00 0.00 ? 66 TYR A HD2  6  
ATOM 10771 H HE1  . TYR A 1 70 ? -2.829  -8.321  -5.997  1.00 0.00 ? 66 TYR A HE1  6  
ATOM 10772 H HE2  . TYR A 1 70 ? -1.291  -7.295  -2.152  1.00 0.00 ? 66 TYR A HE2  6  
ATOM 10773 H HH   . TYR A 1 70 ? -1.366  -9.439  -3.030  1.00 0.00 ? 66 TYR A HH   6  
ATOM 10774 N N    . SER A 1 71 ? -6.323  -4.362  -2.894  1.00 0.00 ? 67 SER A N    6  
ATOM 10775 C CA   . SER A 1 71 ? -7.161  -5.077  -1.954  1.00 0.00 ? 67 SER A CA   6  
ATOM 10776 C C    . SER A 1 71 ? -8.650  -4.956  -2.311  1.00 0.00 ? 67 SER A C    6  
ATOM 10777 O O    . SER A 1 71 ? -9.496  -5.637  -1.722  1.00 0.00 ? 67 SER A O    6  
ATOM 10778 C CB   . SER A 1 71 ? -6.889  -4.581  -0.528  1.00 0.00 ? 67 SER A CB   6  
ATOM 10779 O OG   . SER A 1 71 ? -5.526  -4.782  -0.168  1.00 0.00 ? 67 SER A OG   6  
ATOM 10780 H H    . SER A 1 71 ? -5.919  -3.511  -2.628  1.00 0.00 ? 67 SER A H    6  
ATOM 10781 H HA   . SER A 1 71 ? -6.884  -6.116  -2.011  1.00 0.00 ? 67 SER A HA   6  
ATOM 10782 H HB2  . SER A 1 71 ? -7.112  -3.526  -0.463  1.00 0.00 ? 67 SER A HB2  6  
ATOM 10783 H HB3  . SER A 1 71 ? -7.514  -5.126  0.164   1.00 0.00 ? 67 SER A HB3  6  
ATOM 10784 H HG   . SER A 1 71 ? -5.422  -4.675  0.786   1.00 0.00 ? 67 SER A HG   6  
ATOM 10785 N N    . LEU A 1 72 ? -8.968  -4.121  -3.302  1.00 0.00 ? 68 LEU A N    6  
ATOM 10786 C CA   . LEU A 1 72 ? -10.354 -3.935  -3.731  1.00 0.00 ? 68 LEU A CA   6  
ATOM 10787 C C    . LEU A 1 72 ? -10.705 -4.947  -4.819  1.00 0.00 ? 68 LEU A C    6  
ATOM 10788 O O    . LEU A 1 72 ? -11.803 -5.506  -4.832  1.00 0.00 ? 68 LEU A O    6  
ATOM 10789 C CB   . LEU A 1 72 ? -10.574 -2.517  -4.263  1.00 0.00 ? 68 LEU A CB   6  
ATOM 10790 C CG   . LEU A 1 72 ? -11.838 -1.814  -3.766  1.00 0.00 ? 68 LEU A CG   6  
ATOM 10791 C CD1  . LEU A 1 72 ? -11.794 -0.343  -4.131  1.00 0.00 ? 68 LEU A CD1  6  
ATOM 10792 C CD2  . LEU A 1 72 ? -13.075 -2.462  -4.349  1.00 0.00 ? 68 LEU A CD2  6  
ATOM 10793 H H    . LEU A 1 72 ? -8.259  -3.625  -3.771  1.00 0.00 ? 68 LEU A H    6  
ATOM 10794 H HA   . LEU A 1 72 ? -11.002 -4.095  -2.874  1.00 0.00 ? 68 LEU A HA   6  
ATOM 10795 H HB2  . LEU A 1 72 ? -9.719  -1.915  -3.995  1.00 0.00 ? 68 LEU A HB2  6  
ATOM 10796 H HB3  . LEU A 1 72 ? -10.626 -2.568  -5.340  1.00 0.00 ? 68 LEU A HB3  6  
ATOM 10797 H HG   . LEU A 1 72 ? -11.894 -1.896  -2.694  1.00 0.00 ? 68 LEU A HG   6  
ATOM 10798 H HD11 . LEU A 1 72 ? -12.664 0.157   -3.733  1.00 0.00 ? 68 LEU A HD11 6  
ATOM 10799 H HD12 . LEU A 1 72 ? -11.780 -0.242  -5.206  1.00 0.00 ? 68 LEU A HD12 6  
ATOM 10800 H HD13 . LEU A 1 72 ? -10.904 0.100   -3.716  1.00 0.00 ? 68 LEU A HD13 6  
ATOM 10801 H HD21 . LEU A 1 72 ? -13.184 -3.459  -3.941  1.00 0.00 ? 68 LEU A HD21 6  
ATOM 10802 H HD22 . LEU A 1 72 ? -12.976 -2.520  -5.423  1.00 0.00 ? 68 LEU A HD22 6  
ATOM 10803 H HD23 . LEU A 1 72 ? -13.941 -1.871  -4.094  1.00 0.00 ? 68 LEU A HD23 6  
ATOM 10804 N N    . LEU A 1 73 ? -9.770  -5.177  -5.742  1.00 0.00 ? 69 LEU A N    6  
ATOM 10805 C CA   . LEU A 1 73 ? -9.992  -6.131  -6.821  1.00 0.00 ? 69 LEU A CA   6  
ATOM 10806 C C    . LEU A 1 73 ? -10.232 -7.516  -6.227  1.00 0.00 ? 69 LEU A C    6  
ATOM 10807 O O    . LEU A 1 73 ? -11.046 -8.291  -6.726  1.00 0.00 ? 69 LEU A O    6  
ATOM 10808 C CB   . LEU A 1 73 ? -8.788  -6.164  -7.772  1.00 0.00 ? 69 LEU A CB   6  
ATOM 10809 C CG   . LEU A 1 73 ? -8.398  -4.816  -8.396  1.00 0.00 ? 69 LEU A CG   6  
ATOM 10810 C CD1  . LEU A 1 73 ? -6.945  -4.816  -8.856  1.00 0.00 ? 69 LEU A CD1  6  
ATOM 10811 C CD2  . LEU A 1 73 ? -9.314  -4.485  -9.558  1.00 0.00 ? 69 LEU A CD2  6  
ATOM 10812 H H    . LEU A 1 73 ? -8.914  -4.693  -5.696  1.00 0.00 ? 69 LEU A H    6  
ATOM 10813 H HA   . LEU A 1 73 ? -10.873 -5.821  -7.367  1.00 0.00 ? 69 LEU A HA   6  
ATOM 10814 H HB2  . LEU A 1 73 ? -7.945  -6.541  -7.220  1.00 0.00 ? 69 LEU A HB2  6  
ATOM 10815 H HB3  . LEU A 1 73 ? -9.011  -6.853  -8.574  1.00 0.00 ? 69 LEU A HB3  6  
ATOM 10816 H HG   . LEU A 1 73 ? -8.507  -4.039  -7.655  1.00 0.00 ? 69 LEU A HG   6  
ATOM 10817 H HD11 . LEU A 1 73 ? -6.775  -5.643  -9.528  1.00 0.00 ? 69 LEU A HD11 6  
ATOM 10818 H HD12 . LEU A 1 73 ? -6.291  -4.907  -8.000  1.00 0.00 ? 69 LEU A HD12 6  
ATOM 10819 H HD13 . LEU A 1 73 ? -6.735  -3.889  -9.370  1.00 0.00 ? 69 LEU A HD13 6  
ATOM 10820 H HD21 . LEU A 1 73 ? -10.320 -4.342  -9.194  1.00 0.00 ? 69 LEU A HD21 6  
ATOM 10821 H HD22 . LEU A 1 73 ? -9.299  -5.295  -10.270 1.00 0.00 ? 69 LEU A HD22 6  
ATOM 10822 H HD23 . LEU A 1 73 ? -8.971  -3.579  -10.035 1.00 0.00 ? 69 LEU A HD23 6  
ATOM 10823 N N    . GLY A 1 74 ? -9.524  -7.802  -5.137  1.00 0.00 ? 70 GLY A N    6  
ATOM 10824 C CA   . GLY A 1 74 ? -9.675  -9.073  -4.469  1.00 0.00 ? 70 GLY A CA   6  
ATOM 10825 C C    . GLY A 1 74 ? -11.092 -9.283  -3.978  1.00 0.00 ? 70 GLY A C    6  
ATOM 10826 O O    . GLY A 1 74 ? -11.666 -10.343 -4.194  1.00 0.00 ? 70 GLY A O    6  
ATOM 10827 H H    . GLY A 1 74 ? -8.890  -7.143  -4.791  1.00 0.00 ? 70 GLY A H    6  
ATOM 10828 H HA2  . GLY A 1 74 ? -9.422  -9.862  -5.164  1.00 0.00 ? 70 GLY A HA2  6  
ATOM 10829 H HA3  . GLY A 1 74 ? -9.001  -9.116  -3.626  1.00 0.00 ? 70 GLY A HA3  6  
ATOM 10830 N N    . LEU A 1 75 ? -11.658 -8.266  -3.325  1.00 0.00 ? 71 LEU A N    6  
ATOM 10831 C CA   . LEU A 1 75 ? -13.025 -8.346  -2.813  1.00 0.00 ? 71 LEU A CA   6  
ATOM 10832 C C    . LEU A 1 75 ? -14.001 -8.677  -3.935  1.00 0.00 ? 71 LEU A C    6  
ATOM 10833 O O    . LEU A 1 75 ? -14.895 -9.509  -3.765  1.00 0.00 ? 71 LEU A O    6  
ATOM 10834 C CB   . LEU A 1 75 ? -13.448 -7.033  -2.151  1.00 0.00 ? 71 LEU A CB   6  
ATOM 10835 C CG   . LEU A 1 75 ? -12.695 -6.645  -0.874  1.00 0.00 ? 71 LEU A CG   6  
ATOM 10836 C CD1  . LEU A 1 75 ? -13.342 -5.428  -0.223  1.00 0.00 ? 71 LEU A CD1  6  
ATOM 10837 C CD2  . LEU A 1 75 ? -12.655 -7.806  0.107   1.00 0.00 ? 71 LEU A CD2  6  
ATOM 10838 H H    . LEU A 1 75 ? -11.134 -7.454  -3.169  1.00 0.00 ? 71 LEU A H    6  
ATOM 10839 H HA   . LEU A 1 75 ? -13.057 -9.139  -2.080  1.00 0.00 ? 71 LEU A HA   6  
ATOM 10840 H HB2  . LEU A 1 75 ? -13.319 -6.241  -2.871  1.00 0.00 ? 71 LEU A HB2  6  
ATOM 10841 H HB3  . LEU A 1 75 ? -14.499 -7.106  -1.912  1.00 0.00 ? 71 LEU A HB3  6  
ATOM 10842 H HG   . LEU A 1 75 ? -11.677 -6.385  -1.127  1.00 0.00 ? 71 LEU A HG   6  
ATOM 10843 H HD11 . LEU A 1 75 ? -13.311 -4.592  -0.909  1.00 0.00 ? 71 LEU A HD11 6  
ATOM 10844 H HD12 . LEU A 1 75 ? -12.802 -5.170  0.677   1.00 0.00 ? 71 LEU A HD12 6  
ATOM 10845 H HD13 . LEU A 1 75 ? -14.367 -5.651  0.025   1.00 0.00 ? 71 LEU A HD13 6  
ATOM 10846 H HD21 . LEU A 1 75 ? -11.999 -8.574  -0.272  1.00 0.00 ? 71 LEU A HD21 6  
ATOM 10847 H HD22 . LEU A 1 75 ? -13.650 -8.208  0.230   1.00 0.00 ? 71 LEU A HD22 6  
ATOM 10848 H HD23 . LEU A 1 75 ? -12.288 -7.457  1.061   1.00 0.00 ? 71 LEU A HD23 6  
ATOM 10849 N N    . LYS A 1 76 ? -13.832 -8.015  -5.076  1.00 0.00 ? 72 LYS A N    6  
ATOM 10850 C CA   . LYS A 1 76 ? -14.686 -8.258  -6.232  1.00 0.00 ? 72 LYS A CA   6  
ATOM 10851 C C    . LYS A 1 76 ? -14.546 -9.706  -6.702  1.00 0.00 ? 72 LYS A C    6  
ATOM 10852 O O    . LYS A 1 76 ? -15.535 -10.375 -6.994  1.00 0.00 ? 72 LYS A O    6  
ATOM 10853 C CB   . LYS A 1 76 ? -14.331 -7.298  -7.366  1.00 0.00 ? 72 LYS A CB   6  
ATOM 10854 C CG   . LYS A 1 76 ? -14.741 -5.858  -7.098  1.00 0.00 ? 72 LYS A CG   6  
ATOM 10855 C CD   . LYS A 1 76 ? -14.158 -4.926  -8.148  1.00 0.00 ? 72 LYS A CD   6  
ATOM 10856 C CE   . LYS A 1 76 ? -14.631 -3.492  -7.970  1.00 0.00 ? 72 LYS A CE   6  
ATOM 10857 N NZ   . LYS A 1 76 ? -16.027 -3.304  -8.448  1.00 0.00 ? 72 LYS A NZ   6  
ATOM 10858 H H    . LYS A 1 76 ? -13.118 -7.342  -5.140  1.00 0.00 ? 72 LYS A H    6  
ATOM 10859 H HA   . LYS A 1 76 ? -15.709 -8.086  -5.933  1.00 0.00 ? 72 LYS A HA   6  
ATOM 10860 H HB2  . LYS A 1 76 ? -13.263 -7.322  -7.524  1.00 0.00 ? 72 LYS A HB2  6  
ATOM 10861 H HB3  . LYS A 1 76 ? -14.826 -7.628  -8.267  1.00 0.00 ? 72 LYS A HB3  6  
ATOM 10862 H HG2  . LYS A 1 76 ? -15.818 -5.788  -7.121  1.00 0.00 ? 72 LYS A HG2  6  
ATOM 10863 H HG3  . LYS A 1 76 ? -14.378 -5.564  -6.125  1.00 0.00 ? 72 LYS A HG3  6  
ATOM 10864 H HD2  . LYS A 1 76 ? -13.081 -4.948  -8.069  1.00 0.00 ? 72 LYS A HD2  6  
ATOM 10865 H HD3  . LYS A 1 76 ? -14.454 -5.275  -9.125  1.00 0.00 ? 72 LYS A HD3  6  
ATOM 10866 H HE2  . LYS A 1 76 ? -14.584 -3.237  -6.920  1.00 0.00 ? 72 LYS A HE2  6  
ATOM 10867 H HE3  . LYS A 1 76 ? -13.977 -2.838  -8.527  1.00 0.00 ? 72 LYS A HE3  6  
ATOM 10868 H HZ1  . LYS A 1 76 ? -16.311 -4.104  -9.047  1.00 0.00 ? 72 LYS A HZ1  6  
ATOM 10869 H HZ2  . LYS A 1 76 ? -16.101 -2.429  -9.005  1.00 0.00 ? 72 LYS A HZ2  6  
ATOM 10870 H HZ3  . LYS A 1 76 ? -16.684 -3.239  -7.641  1.00 0.00 ? 72 LYS A HZ3  6  
ATOM 10871 N N    . ASP A 1 77 ? -13.308 -10.183 -6.762  1.00 0.00 ? 73 ASP A N    6  
ATOM 10872 C CA   . ASP A 1 77 ? -13.023 -11.552 -7.189  1.00 0.00 ? 73 ASP A CA   6  
ATOM 10873 C C    . ASP A 1 77 ? -13.552 -12.583 -6.177  1.00 0.00 ? 73 ASP A C    6  
ATOM 10874 O O    . ASP A 1 77 ? -14.131 -13.600 -6.563  1.00 0.00 ? 73 ASP A O    6  
ATOM 10875 C CB   . ASP A 1 77 ? -11.513 -11.726 -7.395  1.00 0.00 ? 73 ASP A CB   6  
ATOM 10876 C CG   . ASP A 1 77 ? -11.106 -13.173 -7.594  1.00 0.00 ? 73 ASP A CG   6  
ATOM 10877 O OD1  . ASP A 1 77 ? -11.489 -13.769 -8.622  1.00 0.00 ? 73 ASP A OD1  6  
ATOM 10878 O OD2  . ASP A 1 77 ? -10.383 -13.715 -6.730  1.00 0.00 ? 73 ASP A OD2  6  
ATOM 10879 H H    . ASP A 1 77 ? -12.556 -9.589  -6.534  1.00 0.00 ? 73 ASP A H    6  
ATOM 10880 H HA   . ASP A 1 77 ? -13.522 -11.712 -8.133  1.00 0.00 ? 73 ASP A HA   6  
ATOM 10881 H HB2  . ASP A 1 77 ? -11.213 -11.166 -8.267  1.00 0.00 ? 73 ASP A HB2  6  
ATOM 10882 H HB3  . ASP A 1 77 ? -10.991 -11.340 -6.531  1.00 0.00 ? 73 ASP A HB3  6  
ATOM 10883 N N    . GLN A 1 78 ? -13.369 -12.302 -4.887  1.00 0.00 ? 74 GLN A N    6  
ATOM 10884 C CA   . GLN A 1 78 ? -13.817 -13.196 -3.822  1.00 0.00 ? 74 GLN A CA   6  
ATOM 10885 C C    . GLN A 1 78 ? -15.333 -13.363 -3.837  1.00 0.00 ? 74 GLN A C    6  
ATOM 10886 O O    . GLN A 1 78 ? -15.848 -14.460 -3.617  1.00 0.00 ? 74 GLN A O    6  
ATOM 10887 C CB   . GLN A 1 78 ? -13.372 -12.658 -2.455  1.00 0.00 ? 74 GLN A CB   6  
ATOM 10888 C CG   . GLN A 1 78 ? -11.864 -12.647 -2.260  1.00 0.00 ? 74 GLN A CG   6  
ATOM 10889 C CD   . GLN A 1 78 ? -11.290 -14.000 -1.898  1.00 0.00 ? 74 GLN A CD   6  
ATOM 10890 O OE1  . GLN A 1 78 ? -11.839 -15.047 -2.243  1.00 0.00 ? 74 GLN A OE1  6  
ATOM 10891 N NE2  . GLN A 1 78 ? -10.183 -13.979 -1.176  1.00 0.00 ? 74 GLN A NE2  6  
ATOM 10892 H H    . GLN A 1 78 ? -12.906 -11.471 -4.642  1.00 0.00 ? 74 GLN A H    6  
ATOM 10893 H HA   . GLN A 1 78 ? -13.358 -14.161 -3.986  1.00 0.00 ? 74 GLN A HA   6  
ATOM 10894 H HB2  . GLN A 1 78 ? -13.730 -11.644 -2.350  1.00 0.00 ? 74 GLN A HB2  6  
ATOM 10895 H HB3  . GLN A 1 78 ? -13.812 -13.267 -1.676  1.00 0.00 ? 74 GLN A HB3  6  
ATOM 10896 H HG2  . GLN A 1 78 ? -11.400 -12.317 -3.176  1.00 0.00 ? 74 GLN A HG2  6  
ATOM 10897 H HG3  . GLN A 1 78 ? -11.624 -11.950 -1.470  1.00 0.00 ? 74 GLN A HG3  6  
ATOM 10898 H HE21 . GLN A 1 78 ? -9.817  -13.103 -0.915  1.00 0.00 ? 74 GLN A HE21 6  
ATOM 10899 H HE22 . GLN A 1 78 ? -9.759  -14.831 -0.950  1.00 0.00 ? 74 GLN A HE22 6  
ATOM 10900 N N    . VAL A 1 79 ? -16.049 -12.277 -4.093  1.00 0.00 ? 75 VAL A N    6  
ATOM 10901 C CA   . VAL A 1 79 ? -17.497 -12.332 -4.133  1.00 0.00 ? 75 VAL A CA   6  
ATOM 10902 C C    . VAL A 1 79 ? -17.973 -12.918 -5.465  1.00 0.00 ? 75 VAL A C    6  
ATOM 10903 O O    . VAL A 1 79 ? -19.127 -13.314 -5.612  1.00 0.00 ? 75 VAL A O    6  
ATOM 10904 C CB   . VAL A 1 79 ? -18.117 -10.938 -3.892  1.00 0.00 ? 75 VAL A CB   6  
ATOM 10905 C CG1  . VAL A 1 79 ? -18.062 -10.080 -5.146  1.00 0.00 ? 75 VAL A CG1  6  
ATOM 10906 C CG2  . VAL A 1 79 ? -19.545 -11.068 -3.372  1.00 0.00 ? 75 VAL A CG2  6  
ATOM 10907 H H    . VAL A 1 79 ? -15.594 -11.420 -4.249  1.00 0.00 ? 75 VAL A H    6  
ATOM 10908 H HA   . VAL A 1 79 ? -17.818 -12.983 -3.336  1.00 0.00 ? 75 VAL A HA   6  
ATOM 10909 H HB   . VAL A 1 79 ? -17.533 -10.440 -3.133  1.00 0.00 ? 75 VAL A HB   6  
ATOM 10910 H HG11 . VAL A 1 79 ? -18.580 -10.583 -5.945  1.00 0.00 ? 75 VAL A HG11 6  
ATOM 10911 H HG12 . VAL A 1 79 ? -17.028 -9.920  -5.427  1.00 0.00 ? 75 VAL A HG12 6  
ATOM 10912 H HG13 . VAL A 1 79 ? -18.534 -9.129  -4.953  1.00 0.00 ? 75 VAL A HG13 6  
ATOM 10913 H HG21 . VAL A 1 79 ? -19.534 -11.543 -2.401  1.00 0.00 ? 75 VAL A HG21 6  
ATOM 10914 H HG22 . VAL A 1 79 ? -20.122 -11.666 -4.057  1.00 0.00 ? 75 VAL A HG22 6  
ATOM 10915 H HG23 . VAL A 1 79 ? -19.993 -10.088 -3.287  1.00 0.00 ? 75 VAL A HG23 6  
ATOM 10916 N N    . ASN A 1 80 ? -17.058 -12.996 -6.426  1.00 0.00 ? 76 ASN A N    6  
ATOM 10917 C CA   . ASN A 1 80 ? -17.367 -13.542 -7.738  1.00 0.00 ? 76 ASN A CA   6  
ATOM 10918 C C    . ASN A 1 80 ? -17.105 -15.044 -7.755  1.00 0.00 ? 76 ASN A C    6  
ATOM 10919 O O    . ASN A 1 80 ? -17.467 -15.741 -8.702  1.00 0.00 ? 76 ASN A O    6  
ATOM 10920 C CB   . ASN A 1 80 ? -16.528 -12.855 -8.818  1.00 0.00 ? 76 ASN A CB   6  
ATOM 10921 C CG   . ASN A 1 80 ? -17.319 -11.843 -9.636  1.00 0.00 ? 76 ASN A CG   6  
ATOM 10922 O OD1  . ASN A 1 80 ? -17.955 -12.188 -10.631 1.00 0.00 ? 76 ASN A OD1  6  
ATOM 10923 N ND2  . ASN A 1 80 ? -17.284 -10.585 -9.228  1.00 0.00 ? 76 ASN A ND2  6  
ATOM 10924 H H    . ASN A 1 80 ? -16.148 -12.676 -6.249  1.00 0.00 ? 76 ASN A H    6  
ATOM 10925 H HA   . ASN A 1 80 ? -18.412 -13.363 -7.934  1.00 0.00 ? 76 ASN A HA   6  
ATOM 10926 H HB2  . ASN A 1 80 ? -15.706 -12.337 -8.346  1.00 0.00 ? 76 ASN A HB2  6  
ATOM 10927 H HB3  . ASN A 1 80 ? -16.136 -13.608 -9.489  1.00 0.00 ? 76 ASN A HB3  6  
ATOM 10928 H HD21 . ASN A 1 80 ? -16.760 -10.374 -8.424  1.00 0.00 ? 76 ASN A HD21 6  
ATOM 10929 H HD22 . ASN A 1 80 ? -17.768 -9.912  -9.755  1.00 0.00 ? 76 ASN A HD22 6  
ATOM 10930 N N    . THR A 1 81 ? -16.459 -15.533 -6.701  1.00 0.00 ? 77 THR A N    6  
ATOM 10931 C CA   . THR A 1 81 ? -16.156 -16.947 -6.578  1.00 0.00 ? 77 THR A CA   6  
ATOM 10932 C C    . THR A 1 81 ? -17.334 -17.682 -5.943  1.00 0.00 ? 77 THR A C    6  
ATOM 10933 O O    . THR A 1 81 ? -17.875 -17.243 -4.926  1.00 0.00 ? 77 THR A O    6  
ATOM 10934 C CB   . THR A 1 81 ? -14.888 -17.174 -5.735  1.00 0.00 ? 77 THR A CB   6  
ATOM 10935 O OG1  . THR A 1 81 ? -13.862 -16.254 -6.136  1.00 0.00 ? 77 THR A OG1  6  
ATOM 10936 C CG2  . THR A 1 81 ? -14.381 -18.600 -5.894  1.00 0.00 ? 77 THR A CG2  6  
ATOM 10937 H H    . THR A 1 81 ? -16.187 -14.924 -5.983  1.00 0.00 ? 77 THR A H    6  
ATOM 10938 H HA   . THR A 1 81 ? -15.986 -17.345 -7.567  1.00 0.00 ? 77 THR A HA   6  
ATOM 10939 H HB   . THR A 1 81 ? -15.129 -17.006 -4.695  1.00 0.00 ? 77 THR A HB   6  
ATOM 10940 H HG1  . THR A 1 81 ? -14.268 -15.472 -6.536  1.00 0.00 ? 77 THR A HG1  6  
ATOM 10941 H HG21 . THR A 1 81 ? -15.173 -19.292 -5.649  1.00 0.00 ? 77 THR A HG21 6  
ATOM 10942 H HG22 . THR A 1 81 ? -13.545 -18.760 -5.233  1.00 0.00 ? 77 THR A HG22 6  
ATOM 10943 H HG23 . THR A 1 81 ? -14.069 -18.758 -6.917  1.00 0.00 ? 77 THR A HG23 6  
ATOM 10944 N N    . VAL A 1 82 ? -17.734 -18.783 -6.559  1.00 0.00 ? 78 VAL A N    6  
ATOM 10945 C CA   . VAL A 1 82 ? -18.852 -19.581 -6.065  1.00 0.00 ? 78 VAL A CA   6  
ATOM 10946 C C    . VAL A 1 82 ? -18.557 -20.163 -4.685  1.00 0.00 ? 78 VAL A C    6  
ATOM 10947 O O    . VAL A 1 82 ? -19.304 -19.845 -3.737  1.00 0.00 ? 78 VAL A O    6  
ATOM 10948 C CB   . VAL A 1 82 ? -19.217 -20.721 -7.039  1.00 0.00 ? 78 VAL A CB   6  
ATOM 10949 C CG1  . VAL A 1 82 ? -20.117 -20.207 -8.147  1.00 0.00 ? 78 VAL A CG1  6  
ATOM 10950 C CG2  . VAL A 1 82 ? -17.967 -21.354 -7.630  1.00 0.00 ? 78 VAL A CG2  6  
ATOM 10951 O OXT  . VAL A 1 82 ? -17.568 -20.915 -4.544  1.00 0.00 ? 78 VAL A OXT  6  
ATOM 10952 H H    . VAL A 1 82 ? -17.262 -19.067 -7.368  1.00 0.00 ? 78 VAL A H    6  
ATOM 10953 H HA   . VAL A 1 82 ? -19.706 -18.926 -5.983  1.00 0.00 ? 78 VAL A HA   6  
ATOM 10954 H HB   . VAL A 1 82 ? -19.754 -21.479 -6.489  1.00 0.00 ? 78 VAL A HB   6  
ATOM 10955 H HG11 . VAL A 1 82 ? -21.086 -19.959 -7.740  1.00 0.00 ? 78 VAL A HG11 6  
ATOM 10956 H HG12 . VAL A 1 82 ? -20.228 -20.970 -8.903  1.00 0.00 ? 78 VAL A HG12 6  
ATOM 10957 H HG13 . VAL A 1 82 ? -19.676 -19.324 -8.589  1.00 0.00 ? 78 VAL A HG13 6  
ATOM 10958 H HG21 . VAL A 1 82 ? -17.434 -20.618 -8.212  1.00 0.00 ? 78 VAL A HG21 6  
ATOM 10959 H HG22 . VAL A 1 82 ? -18.249 -22.180 -8.266  1.00 0.00 ? 78 VAL A HG22 6  
ATOM 10960 H HG23 . VAL A 1 82 ? -17.334 -21.711 -6.833  1.00 0.00 ? 78 VAL A HG23 6  
ATOM 10961 N N    . GLY B 2 18 ? 10.134  7.224   9.123   1.00 0.00 ? 28 GLY B N    6  
ATOM 10962 C CA   . GLY B 2 18 ? 9.410   6.042   9.647   1.00 0.00 ? 28 GLY B CA   6  
ATOM 10963 C C    . GLY B 2 18 ? 10.285  4.804   9.694   1.00 0.00 ? 28 GLY B C    6  
ATOM 10964 O O    . GLY B 2 18 ? 10.337  4.110   10.711  1.00 0.00 ? 28 GLY B O    6  
ATOM 10965 H H    . GLY B 2 18 ? 9.501   8.048   9.092   1.00 0.00 ? 28 GLY B H    6  
ATOM 10966 H HA2  . GLY B 2 18 ? 9.061   6.260   10.644  1.00 0.00 ? 28 GLY B HA2  6  
ATOM 10967 H HA3  . GLY B 2 18 ? 8.557   5.844   9.013   1.00 0.00 ? 28 GLY B HA3  6  
ATOM 10968 N N    . MET B 2 19 ? 10.990  4.537   8.602   1.00 0.00 ? 29 MET B N    6  
ATOM 10969 C CA   . MET B 2 19 ? 11.861  3.374   8.523   1.00 0.00 ? 29 MET B CA   6  
ATOM 10970 C C    . MET B 2 19 ? 13.268  3.770   8.078   1.00 0.00 ? 29 MET B C    6  
ATOM 10971 O O    . MET B 2 19 ? 13.980  2.974   7.469   1.00 0.00 ? 29 MET B O    6  
ATOM 10972 C CB   . MET B 2 19 ? 11.280  2.329   7.563   1.00 0.00 ? 29 MET B CB   6  
ATOM 10973 C CG   . MET B 2 19 ? 11.010  2.856   6.162   1.00 0.00 ? 29 MET B CG   6  
ATOM 10974 S SD   . MET B 2 19 ? 10.852  1.533   4.949   1.00 0.00 ? 29 MET B SD   6  
ATOM 10975 C CE   . MET B 2 19 ? 10.120  2.419   3.577   1.00 0.00 ? 29 MET B CE   6  
ATOM 10976 H H    . MET B 2 19 ? 10.921  5.141   7.821   1.00 0.00 ? 29 MET B H    6  
ATOM 10977 H HA   . MET B 2 19 ? 11.920  2.941   9.511   1.00 0.00 ? 29 MET B HA   6  
ATOM 10978 H HB2  . MET B 2 19 ? 11.975  1.508   7.483   1.00 0.00 ? 29 MET B HB2  6  
ATOM 10979 H HB3  . MET B 2 19 ? 10.351  1.963   7.971   1.00 0.00 ? 29 MET B HB3  6  
ATOM 10980 H HG2  . MET B 2 19 ? 10.092  3.426   6.176   1.00 0.00 ? 29 MET B HG2  6  
ATOM 10981 H HG3  . MET B 2 19 ? 11.827  3.499   5.871   1.00 0.00 ? 29 MET B HG3  6  
ATOM 10982 H HE1  . MET B 2 19 ? 9.128   2.750   3.849   1.00 0.00 ? 29 MET B HE1  6  
ATOM 10983 H HE2  . MET B 2 19 ? 10.060  1.766   2.718   1.00 0.00 ? 29 MET B HE2  6  
ATOM 10984 H HE3  . MET B 2 19 ? 10.731  3.278   3.335   1.00 0.00 ? 29 MET B HE3  6  
ATOM 10985 N N    . SER B 2 20 ? 13.670  4.994   8.401   1.00 0.00 ? 30 SER B N    6  
ATOM 10986 C CA   . SER B 2 20 ? 14.994  5.486   8.036   1.00 0.00 ? 30 SER B CA   6  
ATOM 10987 C C    . SER B 2 20 ? 16.080  4.607   8.658   1.00 0.00 ? 30 SER B C    6  
ATOM 10988 O O    . SER B 2 20 ? 16.968  4.116   7.960   1.00 0.00 ? 30 SER B O    6  
ATOM 10989 C CB   . SER B 2 20 ? 15.153  6.937   8.492   1.00 0.00 ? 30 SER B CB   6  
ATOM 10990 O OG   . SER B 2 20 ? 13.895  7.596   8.517   1.00 0.00 ? 30 SER B OG   6  
ATOM 10991 H H    . SER B 2 20 ? 13.063  5.582   8.898   1.00 0.00 ? 30 SER B H    6  
ATOM 10992 H HA   . SER B 2 20 ? 15.081  5.441   6.962   1.00 0.00 ? 30 SER B HA   6  
ATOM 10993 H HB2  . SER B 2 20 ? 15.577  6.957   9.484   1.00 0.00 ? 30 SER B HB2  6  
ATOM 10994 H HB3  . SER B 2 20 ? 15.805  7.459   7.808   1.00 0.00 ? 30 SER B HB3  6  
ATOM 10995 H HG   . SER B 2 20 ? 13.479  7.528   7.631   1.00 0.00 ? 30 SER B HG   6  
ATOM 10996 N N    . ALA B 2 21 ? 15.998  4.413   9.974   1.00 0.00 ? 31 ALA B N    6  
ATOM 10997 C CA   . ALA B 2 21 ? 16.953  3.574   10.699  1.00 0.00 ? 31 ALA B CA   6  
ATOM 10998 C C    . ALA B 2 21 ? 16.974  2.157   10.131  1.00 0.00 ? 31 ALA B C    6  
ATOM 10999 O O    . ALA B 2 21 ? 18.009  1.493   10.121  1.00 0.00 ? 31 ALA B O    6  
ATOM 11000 C CB   . ALA B 2 21 ? 16.607  3.537   12.179  1.00 0.00 ? 31 ALA B CB   6  
ATOM 11001 H H    . ALA B 2 21 ? 15.300  4.888   10.475  1.00 0.00 ? 31 ALA B H    6  
ATOM 11002 H HA   . ALA B 2 21 ? 17.934  4.012   10.590  1.00 0.00 ? 31 ALA B HA   6  
ATOM 11003 H HB1  . ALA B 2 21 ? 15.550  3.352   12.296  1.00 0.00 ? 31 ALA B HB1  6  
ATOM 11004 H HB2  . ALA B 2 21 ? 16.861  4.482   12.632  1.00 0.00 ? 31 ALA B HB2  6  
ATOM 11005 H HB3  . ALA B 2 21 ? 17.165  2.746   12.657  1.00 0.00 ? 31 ALA B HB3  6  
ATOM 11006 N N    . TRP B 2 22 ? 15.823  1.713   9.652   1.00 0.00 ? 32 TRP B N    6  
ATOM 11007 C CA   . TRP B 2 22 ? 15.682  0.388   9.065   1.00 0.00 ? 32 TRP B CA   6  
ATOM 11008 C C    . TRP B 2 22 ? 16.453  0.329   7.747   1.00 0.00 ? 32 TRP B C    6  
ATOM 11009 O O    . TRP B 2 22 ? 17.341  -0.503  7.565   1.00 0.00 ? 32 TRP B O    6  
ATOM 11010 C CB   . TRP B 2 22 ? 14.193  0.104   8.842   1.00 0.00 ? 32 TRP B CB   6  
ATOM 11011 C CG   . TRP B 2 22 ? 13.868  -1.302  8.440   1.00 0.00 ? 32 TRP B CG   6  
ATOM 11012 C CD1  . TRP B 2 22 ? 13.548  -2.336  9.270   1.00 0.00 ? 32 TRP B CD1  6  
ATOM 11013 C CD2  . TRP B 2 22 ? 13.804  -1.823  7.107   1.00 0.00 ? 32 TRP B CD2  6  
ATOM 11014 N NE1  . TRP B 2 22 ? 13.284  -3.464  8.535   1.00 0.00 ? 32 TRP B NE1  6  
ATOM 11015 C CE2  . TRP B 2 22 ? 13.440  -3.176  7.206   1.00 0.00 ? 32 TRP B CE2  6  
ATOM 11016 C CE3  . TRP B 2 22 ? 14.021  -1.274  5.839   1.00 0.00 ? 32 TRP B CE3  6  
ATOM 11017 C CZ2  . TRP B 2 22 ? 13.285  -3.988  6.087   1.00 0.00 ? 32 TRP B CZ2  6  
ATOM 11018 C CZ3  . TRP B 2 22 ? 13.869  -2.082  4.728   1.00 0.00 ? 32 TRP B CZ3  6  
ATOM 11019 C CH2  . TRP B 2 22 ? 13.504  -3.427  4.859   1.00 0.00 ? 32 TRP B CH2  6  
ATOM 11020 H H    . TRP B 2 22 ? 15.043  2.299   9.685   1.00 0.00 ? 32 TRP B H    6  
ATOM 11021 H HA   . TRP B 2 22 ? 16.090  -0.338  9.754   1.00 0.00 ? 32 TRP B HA   6  
ATOM 11022 H HB2  . TRP B 2 22 ? 13.658  0.312   9.756   1.00 0.00 ? 32 TRP B HB2  6  
ATOM 11023 H HB3  . TRP B 2 22 ? 13.827  0.763   8.067   1.00 0.00 ? 32 TRP B HB3  6  
ATOM 11024 H HD1  . TRP B 2 22 ? 13.508  -2.262  10.346  1.00 0.00 ? 32 TRP B HD1  6  
ATOM 11025 H HE1  . TRP B 2 22 ? 13.019  -4.347  8.905   1.00 0.00 ? 32 TRP B HE1  6  
ATOM 11026 H HE3  . TRP B 2 22 ? 14.304  -0.241  5.721   1.00 0.00 ? 32 TRP B HE3  6  
ATOM 11027 H HZ2  . TRP B 2 22 ? 13.005  -5.027  6.172   1.00 0.00 ? 32 TRP B HZ2  6  
ATOM 11028 H HZ3  . TRP B 2 22 ? 14.034  -1.676  3.742   1.00 0.00 ? 32 TRP B HZ3  6  
ATOM 11029 H HH2  . TRP B 2 22 ? 13.398  -4.023  3.964   1.00 0.00 ? 32 TRP B HH2  6  
ATOM 11030 N N    . LEU B 2 23 ? 16.118  1.248   6.849   1.00 0.00 ? 33 LEU B N    6  
ATOM 11031 C CA   . LEU B 2 23 ? 16.762  1.335   5.541   1.00 0.00 ? 33 LEU B CA   6  
ATOM 11032 C C    . LEU B 2 23 ? 18.262  1.611   5.670   1.00 0.00 ? 33 LEU B C    6  
ATOM 11033 O O    . LEU B 2 23 ? 19.042  1.248   4.788   1.00 0.00 ? 33 LEU B O    6  
ATOM 11034 C CB   . LEU B 2 23 ? 16.096  2.416   4.693   1.00 0.00 ? 33 LEU B CB   6  
ATOM 11035 C CG   . LEU B 2 23 ? 14.799  1.992   4.000   1.00 0.00 ? 33 LEU B CG   6  
ATOM 11036 C CD1  . LEU B 2 23 ? 14.025  3.207   3.523   1.00 0.00 ? 33 LEU B CD1  6  
ATOM 11037 C CD2  . LEU B 2 23 ? 15.093  1.062   2.832   1.00 0.00 ? 33 LEU B CD2  6  
ATOM 11038 H H    . LEU B 2 23 ? 15.388  1.869   7.076   1.00 0.00 ? 33 LEU B H    6  
ATOM 11039 H HA   . LEU B 2 23 ? 16.632  0.382   5.051   1.00 0.00 ? 33 LEU B HA   6  
ATOM 11040 H HB2  . LEU B 2 23 ? 15.881  3.261   5.330   1.00 0.00 ? 33 LEU B HB2  6  
ATOM 11041 H HB3  . LEU B 2 23 ? 16.796  2.730   3.932   1.00 0.00 ? 33 LEU B HB3  6  
ATOM 11042 H HG   . LEU B 2 23 ? 14.179  1.460   4.706   1.00 0.00 ? 33 LEU B HG   6  
ATOM 11043 H HD11 . LEU B 2 23 ? 13.750  3.815   4.371   1.00 0.00 ? 33 LEU B HD11 6  
ATOM 11044 H HD12 . LEU B 2 23 ? 13.132  2.884   3.008   1.00 0.00 ? 33 LEU B HD12 6  
ATOM 11045 H HD13 . LEU B 2 23 ? 14.640  3.785   2.848   1.00 0.00 ? 33 LEU B HD13 6  
ATOM 11046 H HD21 . LEU B 2 23 ? 15.647  1.598   2.077   1.00 0.00 ? 33 LEU B HD21 6  
ATOM 11047 H HD22 . LEU B 2 23 ? 14.163  0.707   2.413   1.00 0.00 ? 33 LEU B HD22 6  
ATOM 11048 H HD23 . LEU B 2 23 ? 15.676  0.221   3.178   1.00 0.00 ? 33 LEU B HD23 6  
ATOM 11049 N N    . ARG B 2 24 ? 18.654  2.283   6.757   1.00 0.00 ? 34 ARG B N    6  
ATOM 11050 C CA   . ARG B 2 24 ? 20.064  2.586   7.035   1.00 0.00 ? 34 ARG B CA   6  
ATOM 11051 C C    . ARG B 2 24 ? 20.921  1.315   7.037   1.00 0.00 ? 34 ARG B C    6  
ATOM 11052 O O    . ARG B 2 24 ? 22.132  1.375   6.828   1.00 0.00 ? 34 ARG B O    6  
ATOM 11053 C CB   . ARG B 2 24 ? 20.192  3.299   8.389   1.00 0.00 ? 34 ARG B CB   6  
ATOM 11054 C CG   . ARG B 2 24 ? 21.624  3.643   8.779   1.00 0.00 ? 34 ARG B CG   6  
ATOM 11055 C CD   . ARG B 2 24 ? 21.984  5.065   8.385   1.00 0.00 ? 34 ARG B CD   6  
ATOM 11056 N NE   . ARG B 2 24 ? 21.387  6.042   9.293   1.00 0.00 ? 34 ARG B NE   6  
ATOM 11057 C CZ   . ARG B 2 24 ? 20.747  7.142   8.901   1.00 0.00 ? 34 ARG B CZ   6  
ATOM 11058 N NH1  . ARG B 2 24 ? 20.609  7.423   7.611   1.00 0.00 ? 34 ARG B NH1  6  
ATOM 11059 N NH2  . ARG B 2 24 ? 20.235  7.959   9.809   1.00 0.00 ? 34 ARG B NH2  6  
ATOM 11060 H H    . ARG B 2 24 ? 17.970  2.653   7.361   1.00 0.00 ? 34 ARG B H    6  
ATOM 11061 H HA   . ARG B 2 24 ? 20.420  3.245   6.257   1.00 0.00 ? 34 ARG B HA   6  
ATOM 11062 H HB2  . ARG B 2 24 ? 19.627  4.218   8.352   1.00 0.00 ? 34 ARG B HB2  6  
ATOM 11063 H HB3  . ARG B 2 24 ? 19.777  2.663   9.157   1.00 0.00 ? 34 ARG B HB3  6  
ATOM 11064 H HG2  . ARG B 2 24 ? 21.731  3.539   9.848   1.00 0.00 ? 34 ARG B HG2  6  
ATOM 11065 H HG3  . ARG B 2 24 ? 22.297  2.960   8.281   1.00 0.00 ? 34 ARG B HG3  6  
ATOM 11066 H HD2  . ARG B 2 24 ? 23.058  5.173   8.408   1.00 0.00 ? 34 ARG B HD2  6  
ATOM 11067 H HD3  . ARG B 2 24 ? 21.625  5.250   7.384   1.00 0.00 ? 34 ARG B HD3  6  
ATOM 11068 H HE   . ARG B 2 24 ? 21.468  5.862   10.258  1.00 0.00 ? 34 ARG B HE   6  
ATOM 11069 H HH11 . ARG B 2 24 ? 20.986  6.804   6.906   1.00 0.00 ? 34 ARG B HH11 6  
ATOM 11070 H HH12 . ARG B 2 24 ? 20.122  8.255   7.328   1.00 0.00 ? 34 ARG B HH12 6  
ATOM 11071 H HH21 . ARG B 2 24 ? 20.331  7.752   10.785  1.00 0.00 ? 34 ARG B HH21 6  
ATOM 11072 H HH22 . ARG B 2 24 ? 19.741  8.788   9.523   1.00 0.00 ? 34 ARG B HH22 6  
ATOM 11073 N N    . ALA B 2 25 ? 20.271  0.173   7.250   1.00 0.00 ? 35 ALA B N    6  
ATOM 11074 C CA   . ALA B 2 25 ? 20.959  -1.117  7.274   1.00 0.00 ? 35 ALA B CA   6  
ATOM 11075 C C    . ALA B 2 25 ? 21.715  -1.340  5.968   1.00 0.00 ? 35 ALA B C    6  
ATOM 11076 O O    . ALA B 2 25 ? 22.805  -1.912  5.951   1.00 0.00 ? 35 ALA B O    6  
ATOM 11077 C CB   . ALA B 2 25 ? 19.968  -2.247  7.518   1.00 0.00 ? 35 ALA B CB   6  
ATOM 11078 H H    . ALA B 2 25 ? 19.296  0.217   7.366   1.00 0.00 ? 35 ALA B H    6  
ATOM 11079 H HA   . ALA B 2 25 ? 21.667  -1.104  8.091   1.00 0.00 ? 35 ALA B HA   6  
ATOM 11080 H HB1  . ALA B 2 25 ? 19.555  -2.156  8.511   1.00 0.00 ? 35 ALA B HB1  6  
ATOM 11081 H HB2  . ALA B 2 25 ? 20.473  -3.197  7.424   1.00 0.00 ? 35 ALA B HB2  6  
ATOM 11082 H HB3  . ALA B 2 25 ? 19.170  -2.191  6.791   1.00 0.00 ? 35 ALA B HB3  6  
ATOM 11083 N N    . ILE B 2 26 ? 21.131  -0.867  4.876   1.00 0.00 ? 36 ILE B N    6  
ATOM 11084 C CA   . ILE B 2 26 ? 21.740  -0.989  3.560   1.00 0.00 ? 36 ILE B CA   6  
ATOM 11085 C C    . ILE B 2 26 ? 21.975  0.391   2.951   1.00 0.00 ? 36 ILE B C    6  
ATOM 11086 O O    . ILE B 2 26 ? 22.150  0.529   1.741   1.00 0.00 ? 36 ILE B O    6  
ATOM 11087 C CB   . ILE B 2 26 ? 20.860  -1.823  2.606   1.00 0.00 ? 36 ILE B CB   6  
ATOM 11088 C CG1  . ILE B 2 26 ? 19.410  -1.329  2.640   1.00 0.00 ? 36 ILE B CG1  6  
ATOM 11089 C CG2  . ILE B 2 26 ? 20.932  -3.296  2.980   1.00 0.00 ? 36 ILE B CG2  6  
ATOM 11090 C CD1  . ILE B 2 26 ? 18.577  -1.801  1.467   1.00 0.00 ? 36 ILE B CD1  6  
ATOM 11091 H H    . ILE B 2 26 ? 20.261  -0.418  4.959   1.00 0.00 ? 36 ILE B H    6  
ATOM 11092 H HA   . ILE B 2 26 ? 22.690  -1.489  3.675   1.00 0.00 ? 36 ILE B HA   6  
ATOM 11093 H HB   . ILE B 2 26 ? 21.249  -1.711  1.604   1.00 0.00 ? 36 ILE B HB   6  
ATOM 11094 H HG12 . ILE B 2 26 ? 18.939  -1.682  3.543   1.00 0.00 ? 36 ILE B HG12 6  
ATOM 11095 H HG13 . ILE B 2 26 ? 19.406  -0.249  2.637   1.00 0.00 ? 36 ILE B HG13 6  
ATOM 11096 H HG21 . ILE B 2 26 ? 20.507  -3.437  3.962   1.00 0.00 ? 36 ILE B HG21 6  
ATOM 11097 H HG22 . ILE B 2 26 ? 21.963  -3.617  2.985   1.00 0.00 ? 36 ILE B HG22 6  
ATOM 11098 H HG23 . ILE B 2 26 ? 20.377  -3.878  2.260   1.00 0.00 ? 36 ILE B HG23 6  
ATOM 11099 H HD11 . ILE B 2 26 ? 19.008  -1.432  0.548   1.00 0.00 ? 36 ILE B HD11 6  
ATOM 11100 H HD12 . ILE B 2 26 ? 17.569  -1.427  1.569   1.00 0.00 ? 36 ILE B HD12 6  
ATOM 11101 H HD13 . ILE B 2 26 ? 18.561  -2.881  1.449   1.00 0.00 ? 36 ILE B HD13 6  
ATOM 11102 N N    . GLY B 2 27 ? 22.018  1.396   3.822   1.00 0.00 ? 37 GLY B N    6  
ATOM 11103 C CA   . GLY B 2 27 ? 22.215  2.778   3.399   1.00 0.00 ? 37 GLY B CA   6  
ATOM 11104 C C    . GLY B 2 27 ? 21.295  3.216   2.269   1.00 0.00 ? 37 GLY B C    6  
ATOM 11105 O O    . GLY B 2 27 ? 21.715  3.946   1.374   1.00 0.00 ? 37 GLY B O    6  
ATOM 11106 H H    . GLY B 2 27 ? 21.994  1.181   4.778   1.00 0.00 ? 37 GLY B H    6  
ATOM 11107 H HA2  . GLY B 2 27 ? 22.045  3.423   4.246   1.00 0.00 ? 37 GLY B HA2  6  
ATOM 11108 H HA3  . GLY B 2 27 ? 23.239  2.895   3.076   1.00 0.00 ? 37 GLY B HA3  6  
ATOM 11109 N N    . LEU B 2 28 ? 20.043  2.779   2.301   1.00 0.00 ? 38 LEU B N    6  
ATOM 11110 C CA   . LEU B 2 28 ? 19.084  3.142   1.260   1.00 0.00 ? 38 LEU B CA   6  
ATOM 11111 C C    . LEU B 2 28 ? 17.952  3.984   1.843   1.00 0.00 ? 38 LEU B C    6  
ATOM 11112 O O    . LEU B 2 28 ? 16.900  4.148   1.227   1.00 0.00 ? 38 LEU B O    6  
ATOM 11113 C CB   . LEU B 2 28 ? 18.525  1.885   0.586   1.00 0.00 ? 38 LEU B CB   6  
ATOM 11114 C CG   . LEU B 2 28 ? 18.745  1.799   -0.928  1.00 0.00 ? 38 LEU B CG   6  
ATOM 11115 C CD1  . LEU B 2 28 ? 20.223  1.637   -1.257  1.00 0.00 ? 38 LEU B CD1  6  
ATOM 11116 C CD2  . LEU B 2 28 ? 17.939  0.652   -1.518  1.00 0.00 ? 38 LEU B CD2  6  
ATOM 11117 H H    . LEU B 2 28 ? 19.756  2.192   3.035   1.00 0.00 ? 38 LEU B H    6  
ATOM 11118 H HA   . LEU B 2 28 ? 19.610  3.731   0.522   1.00 0.00 ? 38 LEU B HA   6  
ATOM 11119 H HB2  . LEU B 2 28 ? 18.987  1.022   1.044   1.00 0.00 ? 38 LEU B HB2  6  
ATOM 11120 H HB3  . LEU B 2 28 ? 17.463  1.844   0.774   1.00 0.00 ? 38 LEU B HB3  6  
ATOM 11121 H HG   . LEU B 2 28 ? 18.403  2.714   -1.388  1.00 0.00 ? 38 LEU B HG   6  
ATOM 11122 H HD11 . LEU B 2 28 ? 20.755  2.534   -0.977  1.00 0.00 ? 38 LEU B HD11 6  
ATOM 11123 H HD12 . LEU B 2 28 ? 20.341  1.465   -2.317  1.00 0.00 ? 38 LEU B HD12 6  
ATOM 11124 H HD13 . LEU B 2 28 ? 20.624  0.796   -0.710  1.00 0.00 ? 38 LEU B HD13 6  
ATOM 11125 H HD21 . LEU B 2 28 ? 18.158  0.563   -2.572  1.00 0.00 ? 38 LEU B HD21 6  
ATOM 11126 H HD22 . LEU B 2 28 ? 16.885  0.846   -1.385  1.00 0.00 ? 38 LEU B HD22 6  
ATOM 11127 H HD23 . LEU B 2 28 ? 18.202  -0.268  -1.018  1.00 0.00 ? 38 LEU B HD23 6  
ATOM 11128 N N    . GLU B 2 29 ? 18.189  4.519   3.037   1.00 0.00 ? 39 GLU B N    6  
ATOM 11129 C CA   . GLU B 2 29 ? 17.213  5.352   3.745   1.00 0.00 ? 39 GLU B CA   6  
ATOM 11130 C C    . GLU B 2 29 ? 16.735  6.537   2.907   1.00 0.00 ? 39 GLU B C    6  
ATOM 11131 O O    . GLU B 2 29 ? 15.614  7.011   3.074   1.00 0.00 ? 39 GLU B O    6  
ATOM 11132 C CB   . GLU B 2 29 ? 17.806  5.855   5.067   1.00 0.00 ? 39 GLU B CB   6  
ATOM 11133 C CG   . GLU B 2 29 ? 18.848  6.956   4.909   1.00 0.00 ? 39 GLU B CG   6  
ATOM 11134 C CD   . GLU B 2 29 ? 20.182  6.445   4.411   1.00 0.00 ? 39 GLU B CD   6  
ATOM 11135 O OE1  . GLU B 2 29 ? 20.384  6.399   3.179   1.00 0.00 ? 39 GLU B OE1  6  
ATOM 11136 O OE2  . GLU B 2 29 ? 21.032  6.089   5.253   1.00 0.00 ? 39 GLU B OE2  6  
ATOM 11137 H H    . GLU B 2 29 ? 19.035  4.308   3.484   1.00 0.00 ? 39 GLU B H    6  
ATOM 11138 H HA   . GLU B 2 29 ? 16.360  4.731   3.970   1.00 0.00 ? 39 GLU B HA   6  
ATOM 11139 H HB2  . GLU B 2 29 ? 17.005  6.239   5.682   1.00 0.00 ? 39 GLU B HB2  6  
ATOM 11140 H HB3  . GLU B 2 29 ? 18.270  5.025   5.577   1.00 0.00 ? 39 GLU B HB3  6  
ATOM 11141 H HG2  . GLU B 2 29 ? 18.478  7.687   4.203   1.00 0.00 ? 39 GLU B HG2  6  
ATOM 11142 H HG3  . GLU B 2 29 ? 18.998  7.433   5.867   1.00 0.00 ? 39 GLU B HG3  6  
ATOM 11143 N N    . ARG B 2 30 ? 17.574  7.002   1.992   1.00 0.00 ? 40 ARG B N    6  
ATOM 11144 C CA   . ARG B 2 30 ? 17.227  8.141   1.149   1.00 0.00 ? 40 ARG B CA   6  
ATOM 11145 C C    . ARG B 2 30 ? 16.138  7.786   0.131   1.00 0.00 ? 40 ARG B C    6  
ATOM 11146 O O    . ARG B 2 30 ? 15.673  8.643   -0.621  1.00 0.00 ? 40 ARG B O    6  
ATOM 11147 C CB   . ARG B 2 30 ? 18.481  8.676   0.459   1.00 0.00 ? 40 ARG B CB   6  
ATOM 11148 C CG   . ARG B 2 30 ? 19.480  9.264   1.443   1.00 0.00 ? 40 ARG B CG   6  
ATOM 11149 C CD   . ARG B 2 30 ? 20.909  9.089   0.965   1.00 0.00 ? 40 ARG B CD   6  
ATOM 11150 N NE   . ARG B 2 30 ? 21.257  7.681   0.785   1.00 0.00 ? 40 ARG B NE   6  
ATOM 11151 C CZ   . ARG B 2 30 ? 21.815  7.192   -0.322  1.00 0.00 ? 40 ARG B CZ   6  
ATOM 11152 N NH1  . ARG B 2 30 ? 22.107  7.999   -1.336  1.00 0.00 ? 40 ARG B NH1  6  
ATOM 11153 N NH2  . ARG B 2 30 ? 22.086  5.901   -0.414  1.00 0.00 ? 40 ARG B NH2  6  
ATOM 11154 H H    . ARG B 2 30 ? 18.452  6.575   1.887   1.00 0.00 ? 40 ARG B H    6  
ATOM 11155 H HA   . ARG B 2 30 ? 16.840  8.912   1.799   1.00 0.00 ? 40 ARG B HA   6  
ATOM 11156 H HB2  . ARG B 2 30 ? 18.959  7.870   -0.078  1.00 0.00 ? 40 ARG B HB2  6  
ATOM 11157 H HB3  . ARG B 2 30 ? 18.196  9.448   -0.240  1.00 0.00 ? 40 ARG B HB3  6  
ATOM 11158 H HG2  . ARG B 2 30 ? 19.277  10.317  1.561   1.00 0.00 ? 40 ARG B HG2  6  
ATOM 11159 H HG3  . ARG B 2 30 ? 19.366  8.766   2.395   1.00 0.00 ? 40 ARG B HG3  6  
ATOM 11160 H HD2  . ARG B 2 30 ? 21.022  9.602   0.023   1.00 0.00 ? 40 ARG B HD2  6  
ATOM 11161 H HD3  . ARG B 2 30 ? 21.577  9.524   1.693   1.00 0.00 ? 40 ARG B HD3  6  
ATOM 11162 H HE   . ARG B 2 30 ? 21.057  7.064   1.539   1.00 0.00 ? 40 ARG B HE   6  
ATOM 11163 H HH11 . ARG B 2 30 ? 21.909  8.982   -1.278  1.00 0.00 ? 40 ARG B HH11 6  
ATOM 11164 H HH12 . ARG B 2 30 ? 22.535  7.632   -2.168  1.00 0.00 ? 40 ARG B HH12 6  
ATOM 11165 H HH21 . ARG B 2 30 ? 21.875  5.280   0.352   1.00 0.00 ? 40 ARG B HH21 6  
ATOM 11166 H HH22 . ARG B 2 30 ? 22.507  5.530   -1.248  1.00 0.00 ? 40 ARG B HH22 6  
ATOM 11167 N N    . TYR B 2 31 ? 15.729  6.522   0.118   1.00 0.00 ? 41 TYR B N    6  
ATOM 11168 C CA   . TYR B 2 31 ? 14.680  6.065   -0.784  1.00 0.00 ? 41 TYR B CA   6  
ATOM 11169 C C    . TYR B 2 31 ? 13.315  6.169   -0.107  1.00 0.00 ? 41 TYR B C    6  
ATOM 11170 O O    . TYR B 2 31 ? 12.281  6.182   -0.777  1.00 0.00 ? 41 TYR B O    6  
ATOM 11171 C CB   . TYR B 2 31 ? 14.933  4.622   -1.212  1.00 0.00 ? 41 TYR B CB   6  
ATOM 11172 C CG   . TYR B 2 31 ? 15.607  4.490   -2.558  1.00 0.00 ? 41 TYR B CG   6  
ATOM 11173 C CD1  . TYR B 2 31 ? 14.858  4.393   -3.724  1.00 0.00 ? 41 TYR B CD1  6  
ATOM 11174 C CD2  . TYR B 2 31 ? 16.992  4.445   -2.663  1.00 0.00 ? 41 TYR B CD2  6  
ATOM 11175 C CE1  . TYR B 2 31 ? 15.469  4.252   -4.956  1.00 0.00 ? 41 TYR B CE1  6  
ATOM 11176 C CE2  . TYR B 2 31 ? 17.609  4.309   -3.891  1.00 0.00 ? 41 TYR B CE2  6  
ATOM 11177 C CZ   . TYR B 2 31 ? 16.844  4.211   -5.033  1.00 0.00 ? 41 TYR B CZ   6  
ATOM 11178 O OH   . TYR B 2 31 ? 17.458  4.060   -6.255  1.00 0.00 ? 41 TYR B OH   6  
ATOM 11179 H H    . TYR B 2 31 ? 16.150  5.876   0.728   1.00 0.00 ? 41 TYR B H    6  
ATOM 11180 H HA   . TYR B 2 31 ? 14.691  6.704   -1.655  1.00 0.00 ? 41 TYR B HA   6  
ATOM 11181 H HB2  . TYR B 2 31 ? 15.562  4.142   -0.480  1.00 0.00 ? 41 TYR B HB2  6  
ATOM 11182 H HB3  . TYR B 2 31 ? 13.987  4.102   -1.263  1.00 0.00 ? 41 TYR B HB3  6  
ATOM 11183 H HD1  . TYR B 2 31 ? 13.780  4.429   -3.659  1.00 0.00 ? 41 TYR B HD1  6  
ATOM 11184 H HD2  . TYR B 2 31 ? 17.587  4.523   -1.766  1.00 0.00 ? 41 TYR B HD2  6  
ATOM 11185 H HE1  . TYR B 2 31 ? 14.869  4.179   -5.851  1.00 0.00 ? 41 TYR B HE1  6  
ATOM 11186 H HE2  . TYR B 2 31 ? 18.687  4.277   -3.952  1.00 0.00 ? 41 TYR B HE2  6  
ATOM 11187 H HH   . TYR B 2 31 ? 17.251  4.819   -6.816  1.00 0.00 ? 41 TYR B HH   6  
ATOM 11188 N N    . GLU B 2 32 ? 13.327  6.240   1.227   1.00 0.00 ? 42 GLU B N    6  
ATOM 11189 C CA   . GLU B 2 32 ? 12.102  6.347   2.031   1.00 0.00 ? 42 GLU B CA   6  
ATOM 11190 C C    . GLU B 2 32 ? 11.230  7.519   1.580   1.00 0.00 ? 42 GLU B C    6  
ATOM 11191 O O    . GLU B 2 32 ? 10.011  7.495   1.729   1.00 0.00 ? 42 GLU B O    6  
ATOM 11192 C CB   . GLU B 2 32 ? 12.471  6.518   3.504   1.00 0.00 ? 42 GLU B CB   6  
ATOM 11193 C CG   . GLU B 2 32 ? 11.272  6.540   4.435   1.00 0.00 ? 42 GLU B CG   6  
ATOM 11194 C CD   . GLU B 2 32 ? 11.657  6.735   5.885   1.00 0.00 ? 42 GLU B CD   6  
ATOM 11195 O OE1  . GLU B 2 32 ? 12.770  7.228   6.158   1.00 0.00 ? 42 GLU B OE1  6  
ATOM 11196 O OE2  . GLU B 2 32 ? 10.841  6.394   6.765   1.00 0.00 ? 42 GLU B OE2  6  
ATOM 11197 H H    . GLU B 2 32 ? 14.186  6.188   1.696   1.00 0.00 ? 42 GLU B H    6  
ATOM 11198 H HA   . GLU B 2 32 ? 11.547  5.432   1.912   1.00 0.00 ? 42 GLU B HA   6  
ATOM 11199 H HB2  . GLU B 2 32 ? 13.115  5.702   3.797   1.00 0.00 ? 42 GLU B HB2  6  
ATOM 11200 H HB3  . GLU B 2 32 ? 13.007  7.447   3.622   1.00 0.00 ? 42 GLU B HB3  6  
ATOM 11201 H HG2  . GLU B 2 32 ? 10.619  7.347   4.141   1.00 0.00 ? 42 GLU B HG2  6  
ATOM 11202 H HG3  . GLU B 2 32 ? 10.746  5.601   4.342   1.00 0.00 ? 42 GLU B HG3  6  
ATOM 11203 N N    . GLU B 2 33 ? 11.876  8.528   1.019   1.00 0.00 ? 43 GLU B N    6  
ATOM 11204 C CA   . GLU B 2 33 ? 11.176  9.711   0.534   1.00 0.00 ? 43 GLU B CA   6  
ATOM 11205 C C    . GLU B 2 33 ? 10.142  9.313   -0.519  1.00 0.00 ? 43 GLU B C    6  
ATOM 11206 O O    . GLU B 2 33 ? 8.988   9.742   -0.471  1.00 0.00 ? 43 GLU B O    6  
ATOM 11207 C CB   . GLU B 2 33 ? 12.160  10.724  -0.046  1.00 0.00 ? 43 GLU B CB   6  
ATOM 11208 C CG   . GLU B 2 33 ? 11.907  12.144  0.426   1.00 0.00 ? 43 GLU B CG   6  
ATOM 11209 C CD   . GLU B 2 33 ? 11.969  12.269  1.934   1.00 0.00 ? 43 GLU B CD   6  
ATOM 11210 O OE1  . GLU B 2 33 ? 13.080  12.168  2.496   1.00 0.00 ? 43 GLU B OE1  6  
ATOM 11211 O OE2  . GLU B 2 33 ? 10.910  12.476  2.565   1.00 0.00 ? 43 GLU B OE2  6  
ATOM 11212 H H    . GLU B 2 33 ? 12.847  8.436   0.927   1.00 0.00 ? 43 GLU B H    6  
ATOM 11213 H HA   . GLU B 2 33 ? 10.663  10.159  1.374   1.00 0.00 ? 43 GLU B HA   6  
ATOM 11214 H HB2  . GLU B 2 33 ? 13.162  10.443  0.240   1.00 0.00 ? 43 GLU B HB2  6  
ATOM 11215 H HB3  . GLU B 2 33 ? 12.084  10.706  -1.123  1.00 0.00 ? 43 GLU B HB3  6  
ATOM 11216 H HG2  . GLU B 2 33 ? 12.655  12.792  -0.006  1.00 0.00 ? 43 GLU B HG2  6  
ATOM 11217 H HG3  . GLU B 2 33 ? 10.928  12.454  0.092   1.00 0.00 ? 43 GLU B HG3  6  
ATOM 11218 N N    . GLY B 2 34 ? 10.565  8.481   -1.463  1.00 0.00 ? 44 GLY B N    6  
ATOM 11219 C CA   . GLY B 2 34 ? 9.667   8.024   -2.506  1.00 0.00 ? 44 GLY B CA   6  
ATOM 11220 C C    . GLY B 2 34 ? 8.677   6.999   -2.002  1.00 0.00 ? 44 GLY B C    6  
ATOM 11221 O O    . GLY B 2 34 ? 7.535   6.945   -2.465  1.00 0.00 ? 44 GLY B O    6  
ATOM 11222 H H    . GLY B 2 34 ? 11.505  8.203   -1.474  1.00 0.00 ? 44 GLY B H    6  
ATOM 11223 H HA2  . GLY B 2 34 ? 9.124   8.875   -2.895  1.00 0.00 ? 44 GLY B HA2  6  
ATOM 11224 H HA3  . GLY B 2 34 ? 10.251  7.590   -3.305  1.00 0.00 ? 44 GLY B HA3  6  
ATOM 11225 N N    . LEU B 2 35 ? 9.102   6.214   -1.018  1.00 0.00 ? 45 LEU B N    6  
ATOM 11226 C CA   . LEU B 2 35 ? 8.264   5.159   -0.438  1.00 0.00 ? 45 LEU B CA   6  
ATOM 11227 C C    . LEU B 2 35 ? 7.218   5.723   0.529   1.00 0.00 ? 45 LEU B C    6  
ATOM 11228 O O    . LEU B 2 35 ? 6.653   4.993   1.340   1.00 0.00 ? 45 LEU B O    6  
ATOM 11229 C CB   . LEU B 2 35 ? 9.142   4.135   0.292   1.00 0.00 ? 45 LEU B CB   6  
ATOM 11230 C CG   . LEU B 2 35 ? 10.006  3.248   -0.609  1.00 0.00 ? 45 LEU B CG   6  
ATOM 11231 C CD1  . LEU B 2 35 ? 11.322  2.911   0.074   1.00 0.00 ? 45 LEU B CD1  6  
ATOM 11232 C CD2  . LEU B 2 35 ? 9.260   1.973   -0.973  1.00 0.00 ? 45 LEU B CD2  6  
ATOM 11233 H H    . LEU B 2 35 ? 10.007  6.346   -0.664  1.00 0.00 ? 45 LEU B H    6  
ATOM 11234 H HA   . LEU B 2 35 ? 7.754   4.662   -1.248  1.00 0.00 ? 45 LEU B HA   6  
ATOM 11235 H HB2  . LEU B 2 35 ? 9.796   4.669   0.967   1.00 0.00 ? 45 LEU B HB2  6  
ATOM 11236 H HB3  . LEU B 2 35 ? 8.500   3.496   0.877   1.00 0.00 ? 45 LEU B HB3  6  
ATOM 11237 H HG   . LEU B 2 35 ? 10.228  3.779   -1.524  1.00 0.00 ? 45 LEU B HG   6  
ATOM 11238 H HD11 . LEU B 2 35 ? 11.884  3.818   0.240   1.00 0.00 ? 45 LEU B HD11 6  
ATOM 11239 H HD12 . LEU B 2 35 ? 11.893  2.243   -0.555  1.00 0.00 ? 45 LEU B HD12 6  
ATOM 11240 H HD13 . LEU B 2 35 ? 11.124  2.431   1.021   1.00 0.00 ? 45 LEU B HD13 6  
ATOM 11241 H HD21 . LEU B 2 35 ? 8.480   2.201   -1.684  1.00 0.00 ? 45 LEU B HD21 6  
ATOM 11242 H HD22 . LEU B 2 35 ? 8.822   1.544   -0.083  1.00 0.00 ? 45 LEU B HD22 6  
ATOM 11243 H HD23 . LEU B 2 35 ? 9.950   1.265   -1.411  1.00 0.00 ? 45 LEU B HD23 6  
ATOM 11244 N N    . VAL B 2 36 ? 6.936   7.014   0.420   1.00 0.00 ? 46 VAL B N    6  
ATOM 11245 C CA   . VAL B 2 36 ? 5.963   7.661   1.292   1.00 0.00 ? 46 VAL B CA   6  
ATOM 11246 C C    . VAL B 2 36 ? 4.637   7.853   0.555   1.00 0.00 ? 46 VAL B C    6  
ATOM 11247 O O    . VAL B 2 36 ? 3.563   7.903   1.162   1.00 0.00 ? 46 VAL B O    6  
ATOM 11248 C CB   . VAL B 2 36 ? 6.509   9.020   1.806   1.00 0.00 ? 46 VAL B CB   6  
ATOM 11249 C CG1  . VAL B 2 36 ? 5.390   9.984   2.186   1.00 0.00 ? 46 VAL B CG1  6  
ATOM 11250 C CG2  . VAL B 2 36 ? 7.433   8.794   2.992   1.00 0.00 ? 46 VAL B CG2  6  
ATOM 11251 H H    . VAL B 2 36 ? 7.366   7.540   -0.283  1.00 0.00 ? 46 VAL B H    6  
ATOM 11252 H HA   . VAL B 2 36 ? 5.799   7.015   2.144   1.00 0.00 ? 46 VAL B HA   6  
ATOM 11253 H HB   . VAL B 2 36 ? 7.086   9.472   1.014   1.00 0.00 ? 46 VAL B HB   6  
ATOM 11254 H HG11 . VAL B 2 36 ? 4.699   10.078  1.359   1.00 0.00 ? 46 VAL B HG11 6  
ATOM 11255 H HG12 . VAL B 2 36 ? 5.810   10.953  2.414   1.00 0.00 ? 46 VAL B HG12 6  
ATOM 11256 H HG13 . VAL B 2 36 ? 4.866   9.606   3.051   1.00 0.00 ? 46 VAL B HG13 6  
ATOM 11257 H HG21 . VAL B 2 36 ? 7.839   9.740   3.317   1.00 0.00 ? 46 VAL B HG21 6  
ATOM 11258 H HG22 . VAL B 2 36 ? 8.239   8.137   2.698   1.00 0.00 ? 46 VAL B HG22 6  
ATOM 11259 H HG23 . VAL B 2 36 ? 6.878   8.343   3.800   1.00 0.00 ? 46 VAL B HG23 6  
ATOM 11260 N N    . HIS B 2 37 ? 4.714   7.904   -0.768  1.00 0.00 ? 47 HIS B N    6  
ATOM 11261 C CA   . HIS B 2 37 ? 3.529   8.102   -1.599  1.00 0.00 ? 47 HIS B CA   6  
ATOM 11262 C C    . HIS B 2 37 ? 2.697   6.831   -1.690  1.00 0.00 ? 47 HIS B C    6  
ATOM 11263 O O    . HIS B 2 37 ? 1.537   6.872   -2.094  1.00 0.00 ? 47 HIS B O    6  
ATOM 11264 C CB   . HIS B 2 37 ? 3.926   8.529   -3.013  1.00 0.00 ? 47 HIS B CB   6  
ATOM 11265 C CG   . HIS B 2 37 ? 4.952   9.622   -3.055  1.00 0.00 ? 47 HIS B CG   6  
ATOM 11266 N ND1  . HIS B 2 37 ? 6.312   9.399   -3.103  1.00 0.00 ? 47 HIS B ND1  6  
ATOM 11267 C CD2  . HIS B 2 37 ? 4.795   10.970  -3.050  1.00 0.00 ? 47 HIS B CD2  6  
ATOM 11268 C CE1  . HIS B 2 37 ? 6.924   10.589  -3.123  1.00 0.00 ? 47 HIS B CE1  6  
ATOM 11269 N NE2  . HIS B 2 37 ? 6.047   11.575  -3.093  1.00 0.00 ? 47 HIS B NE2  6  
ATOM 11270 H H    . HIS B 2 37 ? 5.590   7.802   -1.200  1.00 0.00 ? 47 HIS B H    6  
ATOM 11271 H HA   . HIS B 2 37 ? 2.936   8.882   -1.151  1.00 0.00 ? 47 HIS B HA   6  
ATOM 11272 H HB2  . HIS B 2 37 ? 4.332   7.675   -3.535  1.00 0.00 ? 47 HIS B HB2  6  
ATOM 11273 H HB3  . HIS B 2 37 ? 3.044   8.874   -3.534  1.00 0.00 ? 47 HIS B HB3  6  
ATOM 11274 H HD1  . HIS B 2 37 ? 6.756   8.520   -3.122  1.00 0.00 ? 47 HIS B HD1  6  
ATOM 11275 H HD2  . HIS B 2 37 ? 3.854   11.499  -3.018  1.00 0.00 ? 47 HIS B HD2  6  
ATOM 11276 H HE1  . HIS B 2 37 ? 7.994   10.725  -3.161  1.00 0.00 ? 47 HIS B HE1  6  
ATOM 11277 N N    . ASN B 2 38 ? 3.298   5.706   -1.329  1.00 0.00 ? 48 ASN B N    6  
ATOM 11278 C CA   . ASN B 2 38 ? 2.617   4.418   -1.401  1.00 0.00 ? 48 ASN B CA   6  
ATOM 11279 C C    . ASN B 2 38 ? 2.115   3.959   -0.043  1.00 0.00 ? 48 ASN B C    6  
ATOM 11280 O O    . ASN B 2 38 ? 1.387   2.972   0.049   1.00 0.00 ? 48 ASN B O    6  
ATOM 11281 C CB   . ASN B 2 38 ? 3.544   3.350   -1.990  1.00 0.00 ? 48 ASN B CB   6  
ATOM 11282 C CG   . ASN B 2 38 ? 4.691   3.938   -2.791  1.00 0.00 ? 48 ASN B CG   6  
ATOM 11283 O OD1  . ASN B 2 38 ? 5.664   4.437   -2.226  1.00 0.00 ? 48 ASN B OD1  6  
ATOM 11284 N ND2  . ASN B 2 38 ? 4.596   3.869   -4.108  1.00 0.00 ? 48 ASN B ND2  6  
ATOM 11285 H H    . ASN B 2 38 ? 4.228   5.738   -1.018  1.00 0.00 ? 48 ASN B H    6  
ATOM 11286 H HA   . ASN B 2 38 ? 1.767   4.534   -2.051  1.00 0.00 ? 48 ASN B HA   6  
ATOM 11287 H HB2  . ASN B 2 38 ? 3.959   2.763   -1.185  1.00 0.00 ? 48 ASN B HB2  6  
ATOM 11288 H HB3  . ASN B 2 38 ? 2.970   2.706   -2.640  1.00 0.00 ? 48 ASN B HB3  6  
ATOM 11289 H HD21 . ASN B 2 38 ? 3.791   3.441   -4.499  1.00 0.00 ? 48 ASN B HD21 6  
ATOM 11290 H HD22 . ASN B 2 38 ? 5.325   4.237   -4.644  1.00 0.00 ? 48 ASN B HD22 6  
ATOM 11291 N N    . GLY B 2 39 ? 2.493   4.671   1.005   1.00 0.00 ? 49 GLY B N    6  
ATOM 11292 C CA   . GLY B 2 39 ? 2.057   4.297   2.335   1.00 0.00 ? 49 GLY B CA   6  
ATOM 11293 C C    . GLY B 2 39 ? 2.962   3.267   2.980   1.00 0.00 ? 49 GLY B C    6  
ATOM 11294 O O    . GLY B 2 39 ? 2.545   2.547   3.883   1.00 0.00 ? 49 GLY B O    6  
ATOM 11295 H H    . GLY B 2 39 ? 3.052   5.464   0.877   1.00 0.00 ? 49 GLY B H    6  
ATOM 11296 H HA2  . GLY B 2 39 ? 2.036   5.180   2.955   1.00 0.00 ? 49 GLY B HA2  6  
ATOM 11297 H HA3  . GLY B 2 39 ? 1.058   3.890   2.270   1.00 0.00 ? 49 GLY B HA3  6  
ATOM 11298 N N    . TRP B 2 40 ? 4.208   3.200   2.524   1.00 0.00 ? 50 TRP B N    6  
ATOM 11299 C CA   . TRP B 2 40 ? 5.171   2.256   3.082   1.00 0.00 ? 50 TRP B CA   6  
ATOM 11300 C C    . TRP B 2 40 ? 5.836   2.855   4.318   1.00 0.00 ? 50 TRP B C    6  
ATOM 11301 O O    . TRP B 2 40 ? 7.043   2.735   4.513   1.00 0.00 ? 50 TRP B O    6  
ATOM 11302 C CB   . TRP B 2 40 ? 6.232   1.880   2.043   1.00 0.00 ? 50 TRP B CB   6  
ATOM 11303 C CG   . TRP B 2 40 ? 5.699   1.078   0.894   1.00 0.00 ? 50 TRP B CG   6  
ATOM 11304 C CD1  . TRP B 2 40 ? 5.709   1.433   -0.420  1.00 0.00 ? 50 TRP B CD1  6  
ATOM 11305 C CD2  . TRP B 2 40 ? 5.084   -0.215  0.956   1.00 0.00 ? 50 TRP B CD2  6  
ATOM 11306 N NE1  . TRP B 2 40 ? 5.133   0.445   -1.181  1.00 0.00 ? 50 TRP B NE1  6  
ATOM 11307 C CE2  . TRP B 2 40 ? 4.743   -0.577  -0.361  1.00 0.00 ? 50 TRP B CE2  6  
ATOM 11308 C CE3  . TRP B 2 40 ? 4.789   -1.103  1.993   1.00 0.00 ? 50 TRP B CE3  6  
ATOM 11309 C CZ2  . TRP B 2 40 ? 4.123   -1.785  -0.665  1.00 0.00 ? 50 TRP B CZ2  6  
ATOM 11310 C CZ3  . TRP B 2 40 ? 4.174   -2.301  1.689   1.00 0.00 ? 50 TRP B CZ3  6  
ATOM 11311 C CH2  . TRP B 2 40 ? 3.847   -2.633  0.369   1.00 0.00 ? 50 TRP B CH2  6  
ATOM 11312 H H    . TRP B 2 40 ? 4.489   3.797   1.803   1.00 0.00 ? 50 TRP B H    6  
ATOM 11313 H HA   . TRP B 2 40 ? 4.632   1.367   3.374   1.00 0.00 ? 50 TRP B HA   6  
ATOM 11314 H HB2  . TRP B 2 40 ? 6.665   2.784   1.642   1.00 0.00 ? 50 TRP B HB2  6  
ATOM 11315 H HB3  . TRP B 2 40 ? 7.005   1.300   2.524   1.00 0.00 ? 50 TRP B HB3  6  
ATOM 11316 H HD1  . TRP B 2 40 ? 6.111   2.362   -0.796  1.00 0.00 ? 50 TRP B HD1  6  
ATOM 11317 H HE1  . TRP B 2 40 ? 5.023   0.468   -2.156  1.00 0.00 ? 50 TRP B HE1  6  
ATOM 11318 H HE3  . TRP B 2 40 ? 5.033   -0.865  3.019   1.00 0.00 ? 50 TRP B HE3  6  
ATOM 11319 H HZ2  . TRP B 2 40 ? 3.863   -2.055  -1.677  1.00 0.00 ? 50 TRP B HZ2  6  
ATOM 11320 H HZ3  . TRP B 2 40 ? 3.938   -2.999  2.479   1.00 0.00 ? 50 TRP B HZ3  6  
ATOM 11321 H HH2  . TRP B 2 40 ? 3.366   -3.581  0.179   1.00 0.00 ? 50 TRP B HH2  6  
ATOM 11322 N N    . ASP B 2 41 ? 5.030   3.496   5.151   1.00 0.00 ? 51 ASP B N    6  
ATOM 11323 C CA   . ASP B 2 41 ? 5.520   4.122   6.372   1.00 0.00 ? 51 ASP B CA   6  
ATOM 11324 C C    . ASP B 2 41 ? 5.498   3.109   7.514   1.00 0.00 ? 51 ASP B C    6  
ATOM 11325 O O    . ASP B 2 41 ? 6.036   3.345   8.599   1.00 0.00 ? 51 ASP B O    6  
ATOM 11326 C CB   . ASP B 2 41 ? 4.678   5.373   6.690   1.00 0.00 ? 51 ASP B CB   6  
ATOM 11327 C CG   . ASP B 2 41 ? 3.857   5.267   7.965   1.00 0.00 ? 51 ASP B CG   6  
ATOM 11328 O OD1  . ASP B 2 41 ? 2.832   4.561   7.964   1.00 0.00 ? 51 ASP B OD1  6  
ATOM 11329 O OD2  . ASP B 2 41 ? 4.223   5.924   8.966   1.00 0.00 ? 51 ASP B OD2  6  
ATOM 11330 H H    . ASP B 2 41 ? 4.069   3.539   4.947   1.00 0.00 ? 51 ASP B H    6  
ATOM 11331 H HA   . ASP B 2 41 ? 6.543   4.423   6.198   1.00 0.00 ? 51 ASP B HA   6  
ATOM 11332 H HB2  . ASP B 2 41 ? 5.338   6.222   6.789   1.00 0.00 ? 51 ASP B HB2  6  
ATOM 11333 H HB3  . ASP B 2 41 ? 4.001   5.551   5.868   1.00 0.00 ? 51 ASP B HB3  6  
ATOM 11334 N N    . ASP B 2 42 ? 4.904   1.960   7.231   1.00 0.00 ? 52 ASP B N    6  
ATOM 11335 C CA   . ASP B 2 42 ? 4.789   0.880   8.197   1.00 0.00 ? 52 ASP B CA   6  
ATOM 11336 C C    . ASP B 2 42 ? 5.668   -0.300  7.781   1.00 0.00 ? 52 ASP B C    6  
ATOM 11337 O O    . ASP B 2 42 ? 5.858   -0.552  6.592   1.00 0.00 ? 52 ASP B O    6  
ATOM 11338 C CB   . ASP B 2 42 ? 3.326   0.448   8.311   1.00 0.00 ? 52 ASP B CB   6  
ATOM 11339 C CG   . ASP B 2 42 ? 3.175   -0.979  8.784   1.00 0.00 ? 52 ASP B CG   6  
ATOM 11340 O OD1  . ASP B 2 42 ? 3.435   -1.245  9.976   1.00 0.00 ? 52 ASP B OD1  6  
ATOM 11341 O OD2  . ASP B 2 42 ? 2.804   -1.841  7.963   1.00 0.00 ? 52 ASP B OD2  6  
ATOM 11342 H H    . ASP B 2 42 ? 4.540   1.828   6.333   1.00 0.00 ? 52 ASP B H    6  
ATOM 11343 H HA   . ASP B 2 42 ? 5.125   1.250   9.155   1.00 0.00 ? 52 ASP B HA   6  
ATOM 11344 H HB2  . ASP B 2 42 ? 2.821   1.092   9.014   1.00 0.00 ? 52 ASP B HB2  6  
ATOM 11345 H HB3  . ASP B 2 42 ? 2.856   0.539   7.343   1.00 0.00 ? 52 ASP B HB3  6  
ATOM 11346 N N    . LEU B 2 43 ? 6.198   -1.022  8.763   1.00 0.00 ? 53 LEU B N    6  
ATOM 11347 C CA   . LEU B 2 43 ? 7.070   -2.160  8.494   1.00 0.00 ? 53 LEU B CA   6  
ATOM 11348 C C    . LEU B 2 43 ? 6.280   -3.465  8.366   1.00 0.00 ? 53 LEU B C    6  
ATOM 11349 O O    . LEU B 2 43 ? 6.756   -4.424  7.754   1.00 0.00 ? 53 LEU B O    6  
ATOM 11350 C CB   . LEU B 2 43 ? 8.120   -2.293  9.601   1.00 0.00 ? 53 LEU B CB   6  
ATOM 11351 C CG   . LEU B 2 43 ? 9.118   -1.137  9.698   1.00 0.00 ? 53 LEU B CG   6  
ATOM 11352 C CD1  . LEU B 2 43 ? 9.959   -1.266  10.956  1.00 0.00 ? 53 LEU B CD1  6  
ATOM 11353 C CD2  . LEU B 2 43 ? 10.011  -1.099  8.466   1.00 0.00 ? 53 LEU B CD2  6  
ATOM 11354 H H    . LEU B 2 43 ? 5.991   -0.787  9.691   1.00 0.00 ? 53 LEU B H    6  
ATOM 11355 H HA   . LEU B 2 43 ? 7.575   -1.972  7.559   1.00 0.00 ? 53 LEU B HA   6  
ATOM 11356 H HB2  . LEU B 2 43 ? 7.604   -2.375  10.546  1.00 0.00 ? 53 LEU B HB2  6  
ATOM 11357 H HB3  . LEU B 2 43 ? 8.674   -3.205  9.435   1.00 0.00 ? 53 LEU B HB3  6  
ATOM 11358 H HG   . LEU B 2 43 ? 8.577   -0.203  9.749   1.00 0.00 ? 53 LEU B HG   6  
ATOM 11359 H HD11 . LEU B 2 43 ? 9.327   -1.542  11.786  1.00 0.00 ? 53 LEU B HD11 6  
ATOM 11360 H HD12 . LEU B 2 43 ? 10.438  -0.321  11.168  1.00 0.00 ? 53 LEU B HD12 6  
ATOM 11361 H HD13 . LEU B 2 43 ? 10.712  -2.023  10.808  1.00 0.00 ? 53 LEU B HD13 6  
ATOM 11362 H HD21 . LEU B 2 43 ? 10.820  -0.402  8.628   1.00 0.00 ? 53 LEU B HD21 6  
ATOM 11363 H HD22 . LEU B 2 43 ? 9.432   -0.785  7.611   1.00 0.00 ? 53 LEU B HD22 6  
ATOM 11364 H HD23 . LEU B 2 43 ? 10.415  -2.084  8.285   1.00 0.00 ? 53 LEU B HD23 6  
ATOM 11365 N N    . GLU B 2 44 ? 5.071   -3.494  8.920   1.00 0.00 ? 54 GLU B N    6  
ATOM 11366 C CA   . GLU B 2 44 ? 4.239   -4.694  8.873   1.00 0.00 ? 54 GLU B CA   6  
ATOM 11367 C C    . GLU B 2 44 ? 3.864   -5.059  7.442   1.00 0.00 ? 54 GLU B C    6  
ATOM 11368 O O    . GLU B 2 44 ? 4.161   -6.159  6.979   1.00 0.00 ? 54 GLU B O    6  
ATOM 11369 C CB   . GLU B 2 44 ? 2.972   -4.515  9.709   1.00 0.00 ? 54 GLU B CB   6  
ATOM 11370 C CG   . GLU B 2 44 ? 3.238   -4.349  11.194  1.00 0.00 ? 54 GLU B CG   6  
ATOM 11371 C CD   . GLU B 2 44 ? 1.995   -4.561  12.029  1.00 0.00 ? 54 GLU B CD   6  
ATOM 11372 O OE1  . GLU B 2 44 ? 0.897   -4.156  11.593  1.00 0.00 ? 54 GLU B OE1  6  
ATOM 11373 O OE2  . GLU B 2 44 ? 2.109   -5.140  13.129  1.00 0.00 ? 54 GLU B OE2  6  
ATOM 11374 H H    . GLU B 2 44 ? 4.721   -2.685  9.361   1.00 0.00 ? 54 GLU B H    6  
ATOM 11375 H HA   . GLU B 2 44 ? 4.816   -5.505  9.291   1.00 0.00 ? 54 GLU B HA   6  
ATOM 11376 H HB2  . GLU B 2 44 ? 2.447   -3.639  9.360   1.00 0.00 ? 54 GLU B HB2  6  
ATOM 11377 H HB3  . GLU B 2 44 ? 2.341   -5.380  9.573   1.00 0.00 ? 54 GLU B HB3  6  
ATOM 11378 H HG2  . GLU B 2 44 ? 3.984   -5.068  11.497  1.00 0.00 ? 54 GLU B HG2  6  
ATOM 11379 H HG3  . GLU B 2 44 ? 3.608   -3.350  11.371  1.00 0.00 ? 54 GLU B HG3  6  
ATOM 11380 N N    . PHE B 2 45 ? 3.227   -4.136  6.731   1.00 0.00 ? 55 PHE B N    6  
ATOM 11381 C CA   . PHE B 2 45 ? 2.826   -4.399  5.354   1.00 0.00 ? 55 PHE B CA   6  
ATOM 11382 C C    . PHE B 2 45 ? 4.051   -4.425  4.449   1.00 0.00 ? 55 PHE B C    6  
ATOM 11383 O O    . PHE B 2 45 ? 4.047   -5.065  3.398   1.00 0.00 ? 55 PHE B O    6  
ATOM 11384 C CB   . PHE B 2 45 ? 1.809   -3.365  4.858   1.00 0.00 ? 55 PHE B CB   6  
ATOM 11385 C CG   . PHE B 2 45 ? 0.945   -3.871  3.729   1.00 0.00 ? 55 PHE B CG   6  
ATOM 11386 C CD1  . PHE B 2 45 ? 0.025   -4.888  3.941   1.00 0.00 ? 55 PHE B CD1  6  
ATOM 11387 C CD2  . PHE B 2 45 ? 1.059   -3.336  2.456   1.00 0.00 ? 55 PHE B CD2  6  
ATOM 11388 C CE1  . PHE B 2 45 ? -0.762  -5.359  2.905   1.00 0.00 ? 55 PHE B CE1  6  
ATOM 11389 C CE2  . PHE B 2 45 ? 0.276   -3.804  1.416   1.00 0.00 ? 55 PHE B CE2  6  
ATOM 11390 C CZ   . PHE B 2 45 ? -0.636  -4.816  1.640   1.00 0.00 ? 55 PHE B CZ   6  
ATOM 11391 H H    . PHE B 2 45 ? 3.027   -3.255  7.142   1.00 0.00 ? 55 PHE B H    6  
ATOM 11392 H HA   . PHE B 2 45 ? 2.366   -5.377  5.332   1.00 0.00 ? 55 PHE B HA   6  
ATOM 11393 H HB2  . PHE B 2 45 ? 1.161   -3.086  5.675   1.00 0.00 ? 55 PHE B HB2  6  
ATOM 11394 H HB3  . PHE B 2 45 ? 2.337   -2.490  4.509   1.00 0.00 ? 55 PHE B HB3  6  
ATOM 11395 H HD1  . PHE B 2 45 ? -0.074  -5.315  4.929   1.00 0.00 ? 55 PHE B HD1  6  
ATOM 11396 H HD2  . PHE B 2 45 ? 1.770   -2.543  2.278   1.00 0.00 ? 55 PHE B HD2  6  
ATOM 11397 H HE1  . PHE B 2 45 ? -1.474  -6.152  3.084   1.00 0.00 ? 55 PHE B HE1  6  
ATOM 11398 H HE2  . PHE B 2 45 ? 0.377   -3.377  0.429   1.00 0.00 ? 55 PHE B HE2  6  
ATOM 11399 H HZ   . PHE B 2 45 ? -1.248  -5.184  0.826   1.00 0.00 ? 55 PHE B HZ   6  
ATOM 11400 N N    . LEU B 2 46 ? 5.112   -3.744  4.878   1.00 0.00 ? 56 LEU B N    6  
ATOM 11401 C CA   . LEU B 2 46 ? 6.357   -3.703  4.120   1.00 0.00 ? 56 LEU B CA   6  
ATOM 11402 C C    . LEU B 2 46 ? 6.993   -5.088  4.083   1.00 0.00 ? 56 LEU B C    6  
ATOM 11403 O O    . LEU B 2 46 ? 7.809   -5.391  3.216   1.00 0.00 ? 56 LEU B O    6  
ATOM 11404 C CB   . LEU B 2 46 ? 7.332   -2.695  4.736   1.00 0.00 ? 56 LEU B CB   6  
ATOM 11405 C CG   . LEU B 2 46 ? 8.627   -2.469  3.948   1.00 0.00 ? 56 LEU B CG   6  
ATOM 11406 C CD1  . LEU B 2 46 ? 8.366   -1.618  2.716   1.00 0.00 ? 56 LEU B CD1  6  
ATOM 11407 C CD2  . LEU B 2 46 ? 9.680   -1.819  4.830   1.00 0.00 ? 56 LEU B CD2  6  
ATOM 11408 H H    . LEU B 2 46 ? 5.051   -3.251  5.726   1.00 0.00 ? 56 LEU B H    6  
ATOM 11409 H HA   . LEU B 2 46 ? 6.123   -3.399  3.110   1.00 0.00 ? 56 LEU B HA   6  
ATOM 11410 H HB2  . LEU B 2 46 ? 6.823   -1.746  4.829   1.00 0.00 ? 56 LEU B HB2  6  
ATOM 11411 H HB3  . LEU B 2 46 ? 7.595   -3.041  5.724   1.00 0.00 ? 56 LEU B HB3  6  
ATOM 11412 H HG   . LEU B 2 46 ? 9.009   -3.425  3.618   1.00 0.00 ? 56 LEU B HG   6  
ATOM 11413 H HD11 . LEU B 2 46 ? 7.708   -2.150  2.045   1.00 0.00 ? 56 LEU B HD11 6  
ATOM 11414 H HD12 . LEU B 2 46 ? 9.300   -1.412  2.216   1.00 0.00 ? 56 LEU B HD12 6  
ATOM 11415 H HD13 . LEU B 2 46 ? 7.903   -0.688  3.012   1.00 0.00 ? 56 LEU B HD13 6  
ATOM 11416 H HD21 . LEU B 2 46 ? 10.623  -1.790  4.303   1.00 0.00 ? 56 LEU B HD21 6  
ATOM 11417 H HD22 . LEU B 2 46 ? 9.793   -2.390  5.739   1.00 0.00 ? 56 LEU B HD22 6  
ATOM 11418 H HD23 . LEU B 2 46 ? 9.374   -0.812  5.073   1.00 0.00 ? 56 LEU B HD23 6  
ATOM 11419 N N    . SER B 2 47 ? 6.586   -5.942  5.016   1.00 0.00 ? 57 SER B N    6  
ATOM 11420 C CA   . SER B 2 47 ? 7.106   -7.298  5.095   1.00 0.00 ? 57 SER B CA   6  
ATOM 11421 C C    . SER B 2 47 ? 6.553   -8.168  3.960   1.00 0.00 ? 57 SER B C    6  
ATOM 11422 O O    . SER B 2 47 ? 6.922   -9.336  3.823   1.00 0.00 ? 57 SER B O    6  
ATOM 11423 C CB   . SER B 2 47 ? 6.757   -7.914  6.452   1.00 0.00 ? 57 SER B CB   6  
ATOM 11424 O OG   . SER B 2 47 ? 7.223   -7.101  7.520   1.00 0.00 ? 57 SER B OG   6  
ATOM 11425 H H    . SER B 2 47 ? 5.913   -5.649  5.668   1.00 0.00 ? 57 SER B H    6  
ATOM 11426 H HA   . SER B 2 47 ? 8.180   -7.246  5.000   1.00 0.00 ? 57 SER B HA   6  
ATOM 11427 H HB2  . SER B 2 47 ? 5.685   -8.013  6.535   1.00 0.00 ? 57 SER B HB2  6  
ATOM 11428 H HB3  . SER B 2 47 ? 7.216   -8.889  6.531   1.00 0.00 ? 57 SER B HB3  6  
ATOM 11429 H HG   . SER B 2 47 ? 7.070   -6.168  7.312   1.00 0.00 ? 57 SER B HG   6  
ATOM 11430 N N    . ASP B 2 48 ? 5.665   -7.598  3.151   1.00 0.00 ? 58 ASP B N    6  
ATOM 11431 C CA   . ASP B 2 48 ? 5.076   -8.323  2.030   1.00 0.00 ? 58 ASP B CA   6  
ATOM 11432 C C    . ASP B 2 48 ? 5.217   -7.515  0.743   1.00 0.00 ? 58 ASP B C    6  
ATOM 11433 O O    . ASP B 2 48 ? 4.479   -7.723  -0.220  1.00 0.00 ? 58 ASP B O    6  
ATOM 11434 C CB   . ASP B 2 48 ? 3.599   -8.632  2.304   1.00 0.00 ? 58 ASP B CB   6  
ATOM 11435 C CG   . ASP B 2 48 ? 3.069   -9.759  1.435   1.00 0.00 ? 58 ASP B CG   6  
ATOM 11436 O OD1  . ASP B 2 48 ? 3.723   -10.825 1.370   1.00 0.00 ? 58 ASP B OD1  6  
ATOM 11437 O OD2  . ASP B 2 48 ? 1.991   -9.593  0.825   1.00 0.00 ? 58 ASP B OD2  6  
ATOM 11438 H H    . ASP B 2 48 ? 5.394   -6.667  3.313   1.00 0.00 ? 58 ASP B H    6  
ATOM 11439 H HA   . ASP B 2 48 ? 5.615   -9.251  1.917   1.00 0.00 ? 58 ASP B HA   6  
ATOM 11440 H HB2  . ASP B 2 48 ? 3.483   -8.918  3.338   1.00 0.00 ? 58 ASP B HB2  6  
ATOM 11441 H HB3  . ASP B 2 48 ? 3.011   -7.747  2.111   1.00 0.00 ? 58 ASP B HB3  6  
ATOM 11442 N N    . ILE B 2 49 ? 6.176   -6.594  0.733   1.00 0.00 ? 59 ILE B N    6  
ATOM 11443 C CA   . ILE B 2 49 ? 6.411   -5.760  -0.438  1.00 0.00 ? 59 ILE B CA   6  
ATOM 11444 C C    . ILE B 2 49 ? 7.032   -6.588  -1.564  1.00 0.00 ? 59 ILE B C    6  
ATOM 11445 O O    . ILE B 2 49 ? 7.982   -7.346  -1.348  1.00 0.00 ? 59 ILE B O    6  
ATOM 11446 C CB   . ILE B 2 49 ? 7.309   -4.536  -0.101  1.00 0.00 ? 59 ILE B CB   6  
ATOM 11447 C CG1  . ILE B 2 49 ? 7.327   -3.549  -1.269  1.00 0.00 ? 59 ILE B CG1  6  
ATOM 11448 C CG2  . ILE B 2 49 ? 8.729   -4.966  0.254   1.00 0.00 ? 59 ILE B CG2  6  
ATOM 11449 C CD1  . ILE B 2 49 ? 7.958   -2.214  -0.932  1.00 0.00 ? 59 ILE B CD1  6  
ATOM 11450 H H    . ILE B 2 49 ? 6.742   -6.480  1.524   1.00 0.00 ? 59 ILE B H    6  
ATOM 11451 H HA   . ILE B 2 49 ? 5.452   -5.390  -0.772  1.00 0.00 ? 59 ILE B HA   6  
ATOM 11452 H HB   . ILE B 2 49 ? 6.889   -4.045  0.764   1.00 0.00 ? 59 ILE B HB   6  
ATOM 11453 H HG12 . ILE B 2 49 ? 7.884   -3.979  -2.087  1.00 0.00 ? 59 ILE B HG12 6  
ATOM 11454 H HG13 . ILE B 2 49 ? 6.312   -3.365  -1.588  1.00 0.00 ? 59 ILE B HG13 6  
ATOM 11455 H HG21 . ILE B 2 49 ? 8.717   -5.522  1.181   1.00 0.00 ? 59 ILE B HG21 6  
ATOM 11456 H HG22 . ILE B 2 49 ? 9.353   -4.092  0.366   1.00 0.00 ? 59 ILE B HG22 6  
ATOM 11457 H HG23 . ILE B 2 49 ? 9.124   -5.590  -0.535  1.00 0.00 ? 59 ILE B HG23 6  
ATOM 11458 H HD11 . ILE B 2 49 ? 7.949   -1.581  -1.807  1.00 0.00 ? 59 ILE B HD11 6  
ATOM 11459 H HD12 . ILE B 2 49 ? 8.978   -2.367  -0.611  1.00 0.00 ? 59 ILE B HD12 6  
ATOM 11460 H HD13 . ILE B 2 49 ? 7.399   -1.739  -0.139  1.00 0.00 ? 59 ILE B HD13 6  
ATOM 11461 N N    . THR B 2 50 ? 6.466   -6.479  -2.754  1.00 0.00 ? 60 THR B N    6  
ATOM 11462 C CA   . THR B 2 50 ? 6.970   -7.217  -3.897  1.00 0.00 ? 60 THR B CA   6  
ATOM 11463 C C    . THR B 2 50 ? 7.903   -6.344  -4.723  1.00 0.00 ? 60 THR B C    6  
ATOM 11464 O O    . THR B 2 50 ? 8.046   -5.145  -4.458  1.00 0.00 ? 60 THR B O    6  
ATOM 11465 C CB   . THR B 2 50 ? 5.820   -7.715  -4.798  1.00 0.00 ? 60 THR B CB   6  
ATOM 11466 O OG1  . THR B 2 50 ? 5.140   -6.599  -5.389  1.00 0.00 ? 60 THR B OG1  6  
ATOM 11467 C CG2  . THR B 2 50 ? 4.830   -8.555  -4.006  1.00 0.00 ? 60 THR B CG2  6  
ATOM 11468 H H    . THR B 2 50 ? 5.682   -5.891  -2.867  1.00 0.00 ? 60 THR B H    6  
ATOM 11469 H HA   . THR B 2 50 ? 7.516   -8.074  -3.532  1.00 0.00 ? 60 THR B HA   6  
ATOM 11470 H HB   . THR B 2 50 ? 6.237   -8.326  -5.585  1.00 0.00 ? 60 THR B HB   6  
ATOM 11471 H HG1  . THR B 2 50 ? 4.607   -6.147  -4.707  1.00 0.00 ? 60 THR B HG1  6  
ATOM 11472 H HG21 . THR B 2 50 ? 4.528   -8.015  -3.119  1.00 0.00 ? 60 THR B HG21 6  
ATOM 11473 H HG22 . THR B 2 50 ? 5.295   -9.486  -3.719  1.00 0.00 ? 60 THR B HG22 6  
ATOM 11474 H HG23 . THR B 2 50 ? 3.962   -8.758  -4.615  1.00 0.00 ? 60 THR B HG23 6  
ATOM 11475 N N    . GLU B 2 51 ? 8.541   -6.944  -5.718  1.00 0.00 ? 61 GLU B N    6  
ATOM 11476 C CA   . GLU B 2 51 ? 9.437   -6.208  -6.596  1.00 0.00 ? 61 GLU B CA   6  
ATOM 11477 C C    . GLU B 2 51 ? 8.642   -5.188  -7.398  1.00 0.00 ? 61 GLU B C    6  
ATOM 11478 O O    . GLU B 2 51 ? 9.161   -4.140  -7.789  1.00 0.00 ? 61 GLU B O    6  
ATOM 11479 C CB   . GLU B 2 51 ? 10.168  -7.156  -7.536  1.00 0.00 ? 61 GLU B CB   6  
ATOM 11480 C CG   . GLU B 2 51 ? 11.315  -7.897  -6.878  1.00 0.00 ? 61 GLU B CG   6  
ATOM 11481 C CD   . GLU B 2 51 ? 12.418  -8.215  -7.856  1.00 0.00 ? 61 GLU B CD   6  
ATOM 11482 O OE1  . GLU B 2 51 ? 13.232  -7.319  -8.153  1.00 0.00 ? 61 GLU B OE1  6  
ATOM 11483 O OE2  . GLU B 2 51 ? 12.471  -9.359  -8.345  1.00 0.00 ? 61 GLU B OE2  6  
ATOM 11484 H H    . GLU B 2 51 ? 8.414   -7.910  -5.860  1.00 0.00 ? 61 GLU B H    6  
ATOM 11485 H HA   . GLU B 2 51 ? 10.157  -5.689  -5.981  1.00 0.00 ? 61 GLU B HA   6  
ATOM 11486 H HB2  . GLU B 2 51 ? 9.464   -7.885  -7.912  1.00 0.00 ? 61 GLU B HB2  6  
ATOM 11487 H HB3  . GLU B 2 51 ? 10.562  -6.590  -8.367  1.00 0.00 ? 61 GLU B HB3  6  
ATOM 11488 H HG2  . GLU B 2 51 ? 11.721  -7.282  -6.087  1.00 0.00 ? 61 GLU B HG2  6  
ATOM 11489 H HG3  . GLU B 2 51 ? 10.943  -8.820  -6.462  1.00 0.00 ? 61 GLU B HG3  6  
ATOM 11490 N N    . GLU B 2 52 ? 7.377   -5.509  -7.631  1.00 0.00 ? 62 GLU B N    6  
ATOM 11491 C CA   . GLU B 2 52 ? 6.484   -4.630  -8.361  1.00 0.00 ? 62 GLU B CA   6  
ATOM 11492 C C    . GLU B 2 52 ? 6.201   -3.391  -7.529  1.00 0.00 ? 62 GLU B C    6  
ATOM 11493 O O    . GLU B 2 52 ? 6.298   -2.266  -8.019  1.00 0.00 ? 62 GLU B O    6  
ATOM 11494 C CB   . GLU B 2 52 ? 5.183   -5.360  -8.703  1.00 0.00 ? 62 GLU B CB   6  
ATOM 11495 C CG   . GLU B 2 52 ? 5.365   -6.460  -9.737  1.00 0.00 ? 62 GLU B CG   6  
ATOM 11496 C CD   . GLU B 2 52 ? 5.872   -5.927  -11.058 1.00 0.00 ? 62 GLU B CD   6  
ATOM 11497 O OE1  . GLU B 2 52 ? 5.041   -5.479  -11.874 1.00 0.00 ? 62 GLU B OE1  6  
ATOM 11498 O OE2  . GLU B 2 52 ? 7.097   -5.953  -11.287 1.00 0.00 ? 62 GLU B OE2  6  
ATOM 11499 H H    . GLU B 2 52 ? 7.033   -6.363  -7.294  1.00 0.00 ? 62 GLU B H    6  
ATOM 11500 H HA   . GLU B 2 52 ? 6.978   -4.334  -9.275  1.00 0.00 ? 62 GLU B HA   6  
ATOM 11501 H HB2  . GLU B 2 52 ? 4.784   -5.803  -7.803  1.00 0.00 ? 62 GLU B HB2  6  
ATOM 11502 H HB3  . GLU B 2 52 ? 4.470   -4.645  -9.090  1.00 0.00 ? 62 GLU B HB3  6  
ATOM 11503 H HG2  . GLU B 2 52 ? 6.078   -7.179  -9.359  1.00 0.00 ? 62 GLU B HG2  6  
ATOM 11504 H HG3  . GLU B 2 52 ? 4.415   -6.947  -9.901  1.00 0.00 ? 62 GLU B HG3  6  
ATOM 11505 N N    . ASP B 2 53 ? 5.839   -3.607  -6.269  1.00 0.00 ? 63 ASP B N    6  
ATOM 11506 C CA   . ASP B 2 53 ? 5.571   -2.506  -5.353  1.00 0.00 ? 63 ASP B CA   6  
ATOM 11507 C C    . ASP B 2 53 ? 6.766   -1.563  -5.290  1.00 0.00 ? 63 ASP B C    6  
ATOM 11508 O O    . ASP B 2 53 ? 6.602   -0.345  -5.330  1.00 0.00 ? 63 ASP B O    6  
ATOM 11509 C CB   . ASP B 2 53 ? 5.265   -3.023  -3.946  1.00 0.00 ? 63 ASP B CB   6  
ATOM 11510 C CG   . ASP B 2 53 ? 4.012   -3.871  -3.869  1.00 0.00 ? 63 ASP B CG   6  
ATOM 11511 O OD1  . ASP B 2 53 ? 2.905   -3.334  -4.081  1.00 0.00 ? 63 ASP B OD1  6  
ATOM 11512 O OD2  . ASP B 2 53 ? 4.138   -5.079  -3.583  1.00 0.00 ? 63 ASP B OD2  6  
ATOM 11513 H H    . ASP B 2 53 ? 5.680   -4.526  -5.960  1.00 0.00 ? 63 ASP B H    6  
ATOM 11514 H HA   . ASP B 2 53 ? 4.716   -1.963  -5.726  1.00 0.00 ? 63 ASP B HA   6  
ATOM 11515 H HB2  . ASP B 2 53 ? 6.096   -3.622  -3.608  1.00 0.00 ? 63 ASP B HB2  6  
ATOM 11516 H HB3  . ASP B 2 53 ? 5.147   -2.180  -3.283  1.00 0.00 ? 63 ASP B HB3  6  
ATOM 11517 N N    . LEU B 2 54 ? 7.968   -2.134  -5.177  1.00 0.00 ? 64 LEU B N    6  
ATOM 11518 C CA   . LEU B 2 54 ? 9.200   -1.351  -5.119  1.00 0.00 ? 64 LEU B CA   6  
ATOM 11519 C C    . LEU B 2 54 ? 9.355   -0.435  -6.329  1.00 0.00 ? 64 LEU B C    6  
ATOM 11520 O O    . LEU B 2 54 ? 9.453   0.780   -6.172  1.00 0.00 ? 64 LEU B O    6  
ATOM 11521 C CB   . LEU B 2 54 ? 10.413  -2.281  -5.025  1.00 0.00 ? 64 LEU B CB   6  
ATOM 11522 C CG   . LEU B 2 54 ? 10.673  -2.881  -3.643  1.00 0.00 ? 64 LEU B CG   6  
ATOM 11523 C CD1  . LEU B 2 54 ? 11.786  -3.913  -3.711  1.00 0.00 ? 64 LEU B CD1  6  
ATOM 11524 C CD2  . LEU B 2 54 ? 11.026  -1.789  -2.647  1.00 0.00 ? 64 LEU B CD2  6  
ATOM 11525 H H    . LEU B 2 54 ? 8.052   -3.108  -5.085  1.00 0.00 ? 64 LEU B H    6  
ATOM 11526 H HA   . LEU B 2 54 ? 9.159   -0.743  -4.229  1.00 0.00 ? 64 LEU B HA   6  
ATOM 11527 H HB2  . LEU B 2 54 ? 10.274  -3.092  -5.725  1.00 0.00 ? 64 LEU B HB2  6  
ATOM 11528 H HB3  . LEU B 2 54 ? 11.289  -1.725  -5.319  1.00 0.00 ? 64 LEU B HB3  6  
ATOM 11529 H HG   . LEU B 2 54 ? 9.778   -3.376  -3.298  1.00 0.00 ? 64 LEU B HG   6  
ATOM 11530 H HD11 . LEU B 2 54 ? 11.568  -4.629  -4.490  1.00 0.00 ? 64 LEU B HD11 6  
ATOM 11531 H HD12 . LEU B 2 54 ? 11.860  -4.424  -2.763  1.00 0.00 ? 64 LEU B HD12 6  
ATOM 11532 H HD13 . LEU B 2 54 ? 12.722  -3.419  -3.928  1.00 0.00 ? 64 LEU B HD13 6  
ATOM 11533 H HD21 . LEU B 2 54 ? 11.881  -1.234  -3.006  1.00 0.00 ? 64 LEU B HD21 6  
ATOM 11534 H HD22 . LEU B 2 54 ? 11.263  -2.236  -1.693  1.00 0.00 ? 64 LEU B HD22 6  
ATOM 11535 H HD23 . LEU B 2 54 ? 10.186  -1.120  -2.531  1.00 0.00 ? 64 LEU B HD23 6  
ATOM 11536 N N    . GLU B 2 55 ? 9.444   -1.027  -7.523  1.00 0.00 ? 65 GLU B N    6  
ATOM 11537 C CA   . GLU B 2 55 ? 9.586   -0.254  -8.761  1.00 0.00 ? 65 GLU B CA   6  
ATOM 11538 C C    . GLU B 2 55 ? 8.606   0.924   -8.828  1.00 0.00 ? 65 GLU B C    6  
ATOM 11539 O O    . GLU B 2 55 ? 8.960   1.995   -9.325  1.00 0.00 ? 65 GLU B O    6  
ATOM 11540 C CB   . GLU B 2 55 ? 9.460   -1.165  -9.997  1.00 0.00 ? 65 GLU B CB   6  
ATOM 11541 C CG   . GLU B 2 55 ? 8.037   -1.518  -10.407 1.00 0.00 ? 65 GLU B CG   6  
ATOM 11542 C CD   . GLU B 2 55 ? 7.480   -0.588  -11.471 1.00 0.00 ? 65 GLU B CD   6  
ATOM 11543 O OE1  . GLU B 2 55 ? 8.279   0.017   -12.220 1.00 0.00 ? 65 GLU B OE1  6  
ATOM 11544 O OE2  . GLU B 2 55 ? 6.241   -0.455  -11.560 1.00 0.00 ? 65 GLU B OE2  6  
ATOM 11545 H H    . GLU B 2 55 ? 9.535   -2.003  -7.558  1.00 0.00 ? 65 GLU B H    6  
ATOM 11546 H HA   . GLU B 2 55 ? 10.586  0.157   -8.754  1.00 0.00 ? 65 GLU B HA   6  
ATOM 11547 H HB2  . GLU B 2 55 ? 9.932   -0.676  -10.833 1.00 0.00 ? 65 GLU B HB2  6  
ATOM 11548 H HB3  . GLU B 2 55 ? 9.988   -2.084  -9.793  1.00 0.00 ? 65 GLU B HB3  6  
ATOM 11549 H HG2  . GLU B 2 55 ? 8.028   -2.526  -10.794 1.00 0.00 ? 65 GLU B HG2  6  
ATOM 11550 H HG3  . GLU B 2 55 ? 7.401   -1.464  -9.535  1.00 0.00 ? 65 GLU B HG3  6  
ATOM 11551 N N    . GLU B 2 56 ? 7.389   0.735   -8.325  1.00 0.00 ? 66 GLU B N    6  
ATOM 11552 C CA   . GLU B 2 56 ? 6.381   1.794   -8.312  1.00 0.00 ? 66 GLU B CA   6  
ATOM 11553 C C    . GLU B 2 56 ? 6.864   3.020   -7.529  1.00 0.00 ? 66 GLU B C    6  
ATOM 11554 O O    . GLU B 2 56 ? 6.556   4.160   -7.882  1.00 0.00 ? 66 GLU B O    6  
ATOM 11555 C CB   . GLU B 2 56 ? 5.088   1.244   -7.697  1.00 0.00 ? 66 GLU B CB   6  
ATOM 11556 C CG   . GLU B 2 56 ? 4.117   2.305   -7.207  1.00 0.00 ? 66 GLU B CG   6  
ATOM 11557 C CD   . GLU B 2 56 ? 3.100   1.748   -6.232  1.00 0.00 ? 66 GLU B CD   6  
ATOM 11558 O OE1  . GLU B 2 56 ? 2.736   0.561   -6.363  1.00 0.00 ? 66 GLU B OE1  6  
ATOM 11559 O OE2  . GLU B 2 56 ? 2.659   2.492   -5.334  1.00 0.00 ? 66 GLU B OE2  6  
ATOM 11560 H H    . GLU B 2 56 ? 7.127   -0.150  -7.987  1.00 0.00 ? 66 GLU B H    6  
ATOM 11561 H HA   . GLU B 2 56 ? 6.188   2.083   -9.333  1.00 0.00 ? 66 GLU B HA   6  
ATOM 11562 H HB2  . GLU B 2 56 ? 4.580   0.648   -8.439  1.00 0.00 ? 66 GLU B HB2  6  
ATOM 11563 H HB3  . GLU B 2 56 ? 5.345   0.611   -6.860  1.00 0.00 ? 66 GLU B HB3  6  
ATOM 11564 H HG2  . GLU B 2 56 ? 4.676   3.086   -6.713  1.00 0.00 ? 66 GLU B HG2  6  
ATOM 11565 H HG3  . GLU B 2 56 ? 3.593   2.717   -8.057  1.00 0.00 ? 66 GLU B HG3  6  
ATOM 11566 N N    . ALA B 2 57 ? 7.642   2.777   -6.485  1.00 0.00 ? 67 ALA B N    6  
ATOM 11567 C CA   . ALA B 2 57 ? 8.161   3.848   -5.645  1.00 0.00 ? 67 ALA B CA   6  
ATOM 11568 C C    . ALA B 2 57 ? 9.454   4.430   -6.216  1.00 0.00 ? 67 ALA B C    6  
ATOM 11569 O O    . ALA B 2 57 ? 10.088  5.281   -5.595  1.00 0.00 ? 67 ALA B O    6  
ATOM 11570 C CB   . ALA B 2 57 ? 8.389   3.339   -4.231  1.00 0.00 ? 67 ALA B CB   6  
ATOM 11571 H H    . ALA B 2 57 ? 7.883   1.847   -6.275  1.00 0.00 ? 67 ALA B H    6  
ATOM 11572 H HA   . ALA B 2 57 ? 7.415   4.629   -5.604  1.00 0.00 ? 67 ALA B HA   6  
ATOM 11573 H HB1  . ALA B 2 57 ? 7.454   2.990   -3.817  1.00 0.00 ? 67 ALA B HB1  6  
ATOM 11574 H HB2  . ALA B 2 57 ? 8.777   4.139   -3.618  1.00 0.00 ? 67 ALA B HB2  6  
ATOM 11575 H HB3  . ALA B 2 57 ? 9.099   2.525   -4.251  1.00 0.00 ? 67 ALA B HB3  6  
ATOM 11576 N N    . GLY B 2 58 ? 9.844   3.964   -7.398  1.00 0.00 ? 68 GLY B N    6  
ATOM 11577 C CA   . GLY B 2 58 ? 11.055  4.459   -8.025  1.00 0.00 ? 68 GLY B CA   6  
ATOM 11578 C C    . GLY B 2 58 ? 12.204  3.478   -7.921  1.00 0.00 ? 68 GLY B C    6  
ATOM 11579 O O    . GLY B 2 58 ? 13.211  3.609   -8.618  1.00 0.00 ? 68 GLY B O    6  
ATOM 11580 H H    . GLY B 2 58 ? 9.304   3.279   -7.849  1.00 0.00 ? 68 GLY B H    6  
ATOM 11581 H HA2  . GLY B 2 58 ? 10.854  4.650   -9.070  1.00 0.00 ? 68 GLY B HA2  6  
ATOM 11582 H HA3  . GLY B 2 58 ? 11.343  5.384   -7.549  1.00 0.00 ? 68 GLY B HA3  6  
ATOM 11583 N N    . VAL B 2 59 ? 12.054  2.486   -7.055  1.00 0.00 ? 69 VAL B N    6  
ATOM 11584 C CA   . VAL B 2 59 ? 13.087  1.477   -6.868  1.00 0.00 ? 69 VAL B CA   6  
ATOM 11585 C C    . VAL B 2 59 ? 13.012  0.446   -7.987  1.00 0.00 ? 69 VAL B C    6  
ATOM 11586 O O    . VAL B 2 59 ? 12.508  -0.656  -7.799  1.00 0.00 ? 69 VAL B O    6  
ATOM 11587 C CB   . VAL B 2 59 ? 12.955  0.761   -5.505  1.00 0.00 ? 69 VAL B CB   6  
ATOM 11588 C CG1  . VAL B 2 59 ? 14.269  0.096   -5.118  1.00 0.00 ? 69 VAL B CG1  6  
ATOM 11589 C CG2  . VAL B 2 59 ? 12.501  1.730   -4.423  1.00 0.00 ? 69 VAL B CG2  6  
ATOM 11590 H H    . VAL B 2 59 ? 11.226  2.428   -6.535  1.00 0.00 ? 69 VAL B H    6  
ATOM 11591 H HA   . VAL B 2 59 ? 14.048  1.969   -6.906  1.00 0.00 ? 69 VAL B HA   6  
ATOM 11592 H HB   . VAL B 2 59 ? 12.206  -0.011  -5.602  1.00 0.00 ? 69 VAL B HB   6  
ATOM 11593 H HG11 . VAL B 2 59 ? 14.147  -0.425  -4.180  1.00 0.00 ? 69 VAL B HG11 6  
ATOM 11594 H HG12 . VAL B 2 59 ? 15.037  0.850   -5.014  1.00 0.00 ? 69 VAL B HG12 6  
ATOM 11595 H HG13 . VAL B 2 59 ? 14.557  -0.606  -5.886  1.00 0.00 ? 69 VAL B HG13 6  
ATOM 11596 H HG21 . VAL B 2 59 ? 13.188  2.562   -4.374  1.00 0.00 ? 69 VAL B HG21 6  
ATOM 11597 H HG22 . VAL B 2 59 ? 12.483  1.223   -3.469  1.00 0.00 ? 69 VAL B HG22 6  
ATOM 11598 H HG23 . VAL B 2 59 ? 11.512  2.093   -4.656  1.00 0.00 ? 69 VAL B HG23 6  
ATOM 11599 N N    . GLN B 2 60 ? 13.491  0.824   -9.163  1.00 0.00 ? 70 GLN B N    6  
ATOM 11600 C CA   . GLN B 2 60 ? 13.464  -0.064  -10.318 1.00 0.00 ? 70 GLN B CA   6  
ATOM 11601 C C    . GLN B 2 60 ? 14.830  -0.696  -10.559 1.00 0.00 ? 70 GLN B C    6  
ATOM 11602 O O    . GLN B 2 60 ? 14.986  -1.546  -11.437 1.00 0.00 ? 70 GLN B O    6  
ATOM 11603 C CB   . GLN B 2 60 ? 13.006  0.702   -11.561 1.00 0.00 ? 70 GLN B CB   6  
ATOM 11604 C CG   . GLN B 2 60 ? 11.810  1.610   -11.305 1.00 0.00 ? 70 GLN B CG   6  
ATOM 11605 C CD   . GLN B 2 60 ? 11.327  2.311   -12.557 1.00 0.00 ? 70 GLN B CD   6  
ATOM 11606 O OE1  . GLN B 2 60 ? 11.833  3.370   -12.921 1.00 0.00 ? 70 GLN B OE1  6  
ATOM 11607 N NE2  . GLN B 2 60 ? 10.331  1.738   -13.210 1.00 0.00 ? 70 GLN B NE2  6  
ATOM 11608 H H    . GLN B 2 60 ? 13.857  1.731   -9.261  1.00 0.00 ? 70 GLN B H    6  
ATOM 11609 H HA   . GLN B 2 60 ? 12.752  -0.850  -10.111 1.00 0.00 ? 70 GLN B HA   6  
ATOM 11610 H HB2  . GLN B 2 60 ? 13.825  1.311   -11.917 1.00 0.00 ? 70 GLN B HB2  6  
ATOM 11611 H HB3  . GLN B 2 60 ? 12.734  -0.006  -12.329 1.00 0.00 ? 70 GLN B HB3  6  
ATOM 11612 H HG2  . GLN B 2 60 ? 11.001  1.014   -10.912 1.00 0.00 ? 70 GLN B HG2  6  
ATOM 11613 H HG3  . GLN B 2 60 ? 12.091  2.356   -10.577 1.00 0.00 ? 70 GLN B HG3  6  
ATOM 11614 H HE21 . GLN B 2 60 ? 9.956   0.900   -12.852 1.00 0.00 ? 70 GLN B HE21 6  
ATOM 11615 H HE22 . GLN B 2 60 ? 10.003  2.172   -14.025 1.00 0.00 ? 70 GLN B HE22 6  
ATOM 11616 N N    . ASP B 2 61 ? 15.816  -0.284  -9.770  1.00 0.00 ? 71 ASP B N    6  
ATOM 11617 C CA   . ASP B 2 61 ? 17.171  -0.812  -9.899  1.00 0.00 ? 71 ASP B CA   6  
ATOM 11618 C C    . ASP B 2 61 ? 17.238  -2.240  -9.359  1.00 0.00 ? 71 ASP B C    6  
ATOM 11619 O O    . ASP B 2 61 ? 16.758  -2.517  -8.259  1.00 0.00 ? 71 ASP B O    6  
ATOM 11620 C CB   . ASP B 2 61 ? 18.172  0.084   -9.163  1.00 0.00 ? 71 ASP B CB   6  
ATOM 11621 C CG   . ASP B 2 61 ? 19.588  -0.460  -9.213  1.00 0.00 ? 71 ASP B CG   6  
ATOM 11622 O OD1  . ASP B 2 61 ? 19.944  -1.287  -8.349  1.00 0.00 ? 71 ASP B OD1  6  
ATOM 11623 O OD2  . ASP B 2 61 ? 20.353  -0.056  -10.115 1.00 0.00 ? 71 ASP B OD2  6  
ATOM 11624 H H    . ASP B 2 61 ? 15.628  0.384   -9.083  1.00 0.00 ? 71 ASP B H    6  
ATOM 11625 H HA   . ASP B 2 61 ? 17.418  -0.826  -10.950 1.00 0.00 ? 71 ASP B HA   6  
ATOM 11626 H HB2  . ASP B 2 61 ? 18.169  1.064   -9.616  1.00 0.00 ? 71 ASP B HB2  6  
ATOM 11627 H HB3  . ASP B 2 61 ? 17.875  0.172   -8.130  1.00 0.00 ? 71 ASP B HB3  6  
ATOM 11628 N N    . PRO B 2 62 ? 17.829  -3.162  -10.138 1.00 0.00 ? 72 PRO B N    6  
ATOM 11629 C CA   . PRO B 2 62 ? 17.948  -4.580  -9.768  1.00 0.00 ? 72 PRO B CA   6  
ATOM 11630 C C    . PRO B 2 62 ? 18.619  -4.811  -8.411  1.00 0.00 ? 72 PRO B C    6  
ATOM 11631 O O    . PRO B 2 62 ? 18.061  -5.491  -7.548  1.00 0.00 ? 72 PRO B O    6  
ATOM 11632 C CB   . PRO B 2 62 ? 18.805  -5.183  -10.893 1.00 0.00 ? 72 PRO B CB   6  
ATOM 11633 C CG   . PRO B 2 62 ? 19.401  -4.020  -11.612 1.00 0.00 ? 72 PRO B CG   6  
ATOM 11634 C CD   . PRO B 2 62 ? 18.427  -2.893  -11.454 1.00 0.00 ? 72 PRO B CD   6  
ATOM 11635 H HA   . PRO B 2 62 ? 16.981  -5.060  -9.764  1.00 0.00 ? 72 PRO B HA   6  
ATOM 11636 H HB2  . PRO B 2 62 ? 19.570  -5.815  -10.465 1.00 0.00 ? 72 PRO B HB2  6  
ATOM 11637 H HB3  . PRO B 2 62 ? 18.177  -5.769  -11.549 1.00 0.00 ? 72 PRO B HB3  6  
ATOM 11638 H HG2  . PRO B 2 62 ? 20.350  -3.759  -11.165 1.00 0.00 ? 72 PRO B HG2  6  
ATOM 11639 H HG3  . PRO B 2 62 ? 19.530  -4.260  -12.656 1.00 0.00 ? 72 PRO B HG3  6  
ATOM 11640 H HD2  . PRO B 2 62 ? 18.944  -1.945  -11.460 1.00 0.00 ? 72 PRO B HD2  6  
ATOM 11641 H HD3  . PRO B 2 62 ? 17.680  -2.926  -12.231 1.00 0.00 ? 72 PRO B HD3  6  
ATOM 11642 N N    . ALA B 2 63 ? 19.802  -4.240  -8.226  1.00 0.00 ? 73 ALA B N    6  
ATOM 11643 C CA   . ALA B 2 63 ? 20.549  -4.410  -6.985  1.00 0.00 ? 73 ALA B CA   6  
ATOM 11644 C C    . ALA B 2 63 ? 19.824  -3.779  -5.804  1.00 0.00 ? 73 ALA B C    6  
ATOM 11645 O O    . ALA B 2 63 ? 19.726  -4.382  -4.734  1.00 0.00 ? 73 ALA B O    6  
ATOM 11646 C CB   . ALA B 2 63 ? 21.945  -3.824  -7.125  1.00 0.00 ? 73 ALA B CB   6  
ATOM 11647 H H    . ALA B 2 63 ? 20.184  -3.677  -8.932  1.00 0.00 ? 73 ALA B H    6  
ATOM 11648 H HA   . ALA B 2 63 ? 20.648  -5.470  -6.803  1.00 0.00 ? 73 ALA B HA   6  
ATOM 11649 H HB1  . ALA B 2 63 ? 22.496  -3.988  -6.211  1.00 0.00 ? 73 ALA B HB1  6  
ATOM 11650 H HB2  . ALA B 2 63 ? 21.872  -2.763  -7.317  1.00 0.00 ? 73 ALA B HB2  6  
ATOM 11651 H HB3  . ALA B 2 63 ? 22.456  -4.306  -7.946  1.00 0.00 ? 73 ALA B HB3  6  
ATOM 11652 N N    . HIS B 2 64 ? 19.310  -2.570  -6.001  1.00 0.00 ? 74 HIS B N    6  
ATOM 11653 C CA   . HIS B 2 64 ? 18.599  -1.857  -4.943  1.00 0.00 ? 74 HIS B CA   6  
ATOM 11654 C C    . HIS B 2 64 ? 17.377  -2.647  -4.482  1.00 0.00 ? 74 HIS B C    6  
ATOM 11655 O O    . HIS B 2 64 ? 17.107  -2.742  -3.283  1.00 0.00 ? 74 HIS B O    6  
ATOM 11656 C CB   . HIS B 2 64 ? 18.190  -0.457  -5.413  1.00 0.00 ? 74 HIS B CB   6  
ATOM 11657 C CG   . HIS B 2 64 ? 19.352  0.485   -5.572  1.00 0.00 ? 74 HIS B CG   6  
ATOM 11658 N ND1  . HIS B 2 64 ? 19.225  1.841   -5.792  1.00 0.00 ? 74 HIS B ND1  6  
ATOM 11659 C CD2  . HIS B 2 64 ? 20.687  0.239   -5.530  1.00 0.00 ? 74 HIS B CD2  6  
ATOM 11660 C CE1  . HIS B 2 64 ? 20.457  2.361   -5.873  1.00 0.00 ? 74 HIS B CE1  6  
ATOM 11661 N NE2  . HIS B 2 64 ? 21.379  1.431   -5.721  1.00 0.00 ? 74 HIS B NE2  6  
ATOM 11662 H H    . HIS B 2 64 ? 19.421  -2.140  -6.887  1.00 0.00 ? 74 HIS B H    6  
ATOM 11663 H HA   . HIS B 2 64 ? 19.277  -1.758  -4.108  1.00 0.00 ? 74 HIS B HA   6  
ATOM 11664 H HB2  . HIS B 2 64 ? 17.694  -0.538  -6.368  1.00 0.00 ? 74 HIS B HB2  6  
ATOM 11665 H HB3  . HIS B 2 64 ? 17.508  -0.029  -4.695  1.00 0.00 ? 74 HIS B HB3  6  
ATOM 11666 H HD1  . HIS B 2 64 ? 18.383  2.341   -5.886  1.00 0.00 ? 74 HIS B HD1  6  
ATOM 11667 H HD2  . HIS B 2 64 ? 21.149  -0.726  -5.380  1.00 0.00 ? 74 HIS B HD2  6  
ATOM 11668 H HE1  . HIS B 2 64 ? 20.668  3.408   -6.035  1.00 0.00 ? 74 HIS B HE1  6  
ATOM 11669 N N    . LYS B 2 65 ? 16.650  -3.224  -5.434  1.00 0.00 ? 75 LYS B N    6  
ATOM 11670 C CA   . LYS B 2 65 ? 15.471  -4.021  -5.116  1.00 0.00 ? 75 LYS B CA   6  
ATOM 11671 C C    . LYS B 2 65 ? 15.874  -5.279  -4.363  1.00 0.00 ? 75 LYS B C    6  
ATOM 11672 O O    . LYS B 2 65 ? 15.326  -5.589  -3.304  1.00 0.00 ? 75 LYS B O    6  
ATOM 11673 C CB   . LYS B 2 65 ? 14.722  -4.415  -6.388  1.00 0.00 ? 75 LYS B CB   6  
ATOM 11674 C CG   . LYS B 2 65 ? 13.885  -3.296  -6.985  1.00 0.00 ? 75 LYS B CG   6  
ATOM 11675 C CD   . LYS B 2 65 ? 12.971  -3.813  -8.086  1.00 0.00 ? 75 LYS B CD   6  
ATOM 11676 C CE   . LYS B 2 65 ? 13.757  -4.250  -9.312  1.00 0.00 ? 75 LYS B CE   6  
ATOM 11677 N NZ   . LYS B 2 65 ? 13.141  -5.431  -9.969  1.00 0.00 ? 75 LYS B NZ   6  
ATOM 11678 H H    . LYS B 2 65 ? 16.913  -3.107  -6.374  1.00 0.00 ? 75 LYS B H    6  
ATOM 11679 H HA   . LYS B 2 65 ? 14.822  -3.427  -4.489  1.00 0.00 ? 75 LYS B HA   6  
ATOM 11680 H HB2  . LYS B 2 65 ? 15.441  -4.729  -7.127  1.00 0.00 ? 75 LYS B HB2  6  
ATOM 11681 H HB3  . LYS B 2 65 ? 14.067  -5.243  -6.163  1.00 0.00 ? 75 LYS B HB3  6  
ATOM 11682 H HG2  . LYS B 2 65 ? 13.283  -2.855  -6.207  1.00 0.00 ? 75 LYS B HG2  6  
ATOM 11683 H HG3  . LYS B 2 65 ? 14.545  -2.549  -7.400  1.00 0.00 ? 75 LYS B HG3  6  
ATOM 11684 H HD2  . LYS B 2 65 ? 12.414  -4.657  -7.709  1.00 0.00 ? 75 LYS B HD2  6  
ATOM 11685 H HD3  . LYS B 2 65 ? 12.286  -3.027  -8.369  1.00 0.00 ? 75 LYS B HD3  6  
ATOM 11686 H HE2  . LYS B 2 65 ? 13.786  -3.432  -10.017 1.00 0.00 ? 75 LYS B HE2  6  
ATOM 11687 H HE3  . LYS B 2 65 ? 14.762  -4.501  -9.010  1.00 0.00 ? 75 LYS B HE3  6  
ATOM 11688 H HZ1  . LYS B 2 65 ? 12.188  -5.195  -10.307 1.00 0.00 ? 75 LYS B HZ1  6  
ATOM 11689 H HZ2  . LYS B 2 65 ? 13.070  -6.223  -9.289  1.00 0.00 ? 75 LYS B HZ2  6  
ATOM 11690 H HZ3  . LYS B 2 65 ? 13.720  -5.735  -10.775 1.00 0.00 ? 75 LYS B HZ3  6  
ATOM 11691 N N    . ARG B 2 66 ? 16.839  -5.999  -4.927  1.00 0.00 ? 76 ARG B N    6  
ATOM 11692 C CA   . ARG B 2 66 ? 17.336  -7.232  -4.331  1.00 0.00 ? 76 ARG B CA   6  
ATOM 11693 C C    . ARG B 2 66 ? 17.818  -7.000  -2.902  1.00 0.00 ? 76 ARG B C    6  
ATOM 11694 O O    . ARG B 2 66 ? 17.486  -7.770  -1.998  1.00 0.00 ? 76 ARG B O    6  
ATOM 11695 C CB   . ARG B 2 66 ? 18.469  -7.808  -5.183  1.00 0.00 ? 76 ARG B CB   6  
ATOM 11696 C CG   . ARG B 2 66 ? 18.754  -9.275  -4.908  1.00 0.00 ? 76 ARG B CG   6  
ATOM 11697 C CD   . ARG B 2 66 ? 17.486  -10.111 -5.000  1.00 0.00 ? 76 ARG B CD   6  
ATOM 11698 N NE   . ARG B 2 66 ? 17.771  -11.540 -4.965  1.00 0.00 ? 76 ARG B NE   6  
ATOM 11699 C CZ   . ARG B 2 66 ? 17.597  -12.309 -3.894  1.00 0.00 ? 76 ARG B CZ   6  
ATOM 11700 N NH1  . ARG B 2 66 ? 17.169  -11.782 -2.751  1.00 0.00 ? 76 ARG B NH1  6  
ATOM 11701 N NH2  . ARG B 2 66 ? 17.862  -13.604 -3.964  1.00 0.00 ? 76 ARG B NH2  6  
ATOM 11702 H H    . ARG B 2 66 ? 17.209  -5.699  -5.788  1.00 0.00 ? 76 ARG B H    6  
ATOM 11703 H HA   . ARG B 2 66 ? 16.518  -7.937  -4.311  1.00 0.00 ? 76 ARG B HA   6  
ATOM 11704 H HB2  . ARG B 2 66 ? 18.210  -7.703  -6.226  1.00 0.00 ? 76 ARG B HB2  6  
ATOM 11705 H HB3  . ARG B 2 66 ? 19.371  -7.245  -4.988  1.00 0.00 ? 76 ARG B HB3  6  
ATOM 11706 H HG2  . ARG B 2 66 ? 19.464  -9.638  -5.637  1.00 0.00 ? 76 ARG B HG2  6  
ATOM 11707 H HG3  . ARG B 2 66 ? 19.168  -9.373  -3.916  1.00 0.00 ? 76 ARG B HG3  6  
ATOM 11708 H HD2  . ARG B 2 66 ? 16.847  -9.865  -4.166  1.00 0.00 ? 76 ARG B HD2  6  
ATOM 11709 H HD3  . ARG B 2 66 ? 16.981  -9.875  -5.923  1.00 0.00 ? 76 ARG B HD3  6  
ATOM 11710 H HE   . ARG B 2 66 ? 18.105  -11.952 -5.795  1.00 0.00 ? 76 ARG B HE   6  
ATOM 11711 H HH11 . ARG B 2 66 ? 16.975  -10.803 -2.689  1.00 0.00 ? 76 ARG B HH11 6  
ATOM 11712 H HH12 . ARG B 2 66 ? 17.041  -12.365 -1.942  1.00 0.00 ? 76 ARG B HH12 6  
ATOM 11713 H HH21 . ARG B 2 66 ? 18.192  -14.004 -4.822  1.00 0.00 ? 76 ARG B HH21 6  
ATOM 11714 H HH22 . ARG B 2 66 ? 17.736  -14.190 -3.158  1.00 0.00 ? 76 ARG B HH22 6  
ATOM 11715 N N    . LEU B 2 67 ? 18.595  -5.941  -2.704  1.00 0.00 ? 77 LEU B N    6  
ATOM 11716 C CA   . LEU B 2 67 ? 19.117  -5.602  -1.385  1.00 0.00 ? 77 LEU B CA   6  
ATOM 11717 C C    . LEU B 2 67 ? 17.984  -5.336  -0.400  1.00 0.00 ? 77 LEU B C    6  
ATOM 11718 O O    . LEU B 2 67 ? 18.021  -5.808  0.738   1.00 0.00 ? 77 LEU B O    6  
ATOM 11719 C CB   . LEU B 2 67 ? 20.039  -4.381  -1.469  1.00 0.00 ? 77 LEU B CB   6  
ATOM 11720 C CG   . LEU B 2 67 ? 21.540  -4.690  -1.458  1.00 0.00 ? 77 LEU B CG   6  
ATOM 11721 C CD1  . LEU B 2 67 ? 21.970  -5.212  -0.098  1.00 0.00 ? 77 LEU B CD1  6  
ATOM 11722 C CD2  . LEU B 2 67 ? 21.897  -5.691  -2.546  1.00 0.00 ? 77 LEU B CD2  6  
ATOM 11723 H H    . LEU B 2 67 ? 18.848  -5.380  -3.474  1.00 0.00 ? 77 LEU B H    6  
ATOM 11724 H HA   . LEU B 2 67 ? 19.689  -6.447  -1.031  1.00 0.00 ? 77 LEU B HA   6  
ATOM 11725 H HB2  . LEU B 2 67 ? 19.809  -3.846  -2.380  1.00 0.00 ? 77 LEU B HB2  6  
ATOM 11726 H HB3  . LEU B 2 67 ? 19.822  -3.736  -0.631  1.00 0.00 ? 77 LEU B HB3  6  
ATOM 11727 H HG   . LEU B 2 67 ? 22.088  -3.778  -1.651  1.00 0.00 ? 77 LEU B HG   6  
ATOM 11728 H HD11 . LEU B 2 67 ? 23.039  -5.363  -0.091  1.00 0.00 ? 77 LEU B HD11 6  
ATOM 11729 H HD12 . LEU B 2 67 ? 21.472  -6.149  0.102   1.00 0.00 ? 77 LEU B HD12 6  
ATOM 11730 H HD13 . LEU B 2 67 ? 21.705  -4.494  0.664   1.00 0.00 ? 77 LEU B HD13 6  
ATOM 11731 H HD21 . LEU B 2 67 ? 21.273  -6.566  -2.446  1.00 0.00 ? 77 LEU B HD21 6  
ATOM 11732 H HD22 . LEU B 2 67 ? 22.933  -5.976  -2.447  1.00 0.00 ? 77 LEU B HD22 6  
ATOM 11733 H HD23 . LEU B 2 67 ? 21.738  -5.243  -3.515  1.00 0.00 ? 77 LEU B HD23 6  
ATOM 11734 N N    . LEU B 2 68 ? 16.971  -4.594  -0.837  1.00 0.00 ? 78 LEU B N    6  
ATOM 11735 C CA   . LEU B 2 68 ? 15.831  -4.291  0.020   1.00 0.00 ? 78 LEU B CA   6  
ATOM 11736 C C    . LEU B 2 68 ? 15.119  -5.582  0.408   1.00 0.00 ? 78 LEU B C    6  
ATOM 11737 O O    . LEU B 2 68 ? 14.758  -5.780  1.570   1.00 0.00 ? 78 LEU B O    6  
ATOM 11738 C CB   . LEU B 2 68 ? 14.866  -3.331  -0.681  1.00 0.00 ? 78 LEU B CB   6  
ATOM 11739 C CG   . LEU B 2 68 ? 14.198  -2.301  0.234   1.00 0.00 ? 78 LEU B CG   6  
ATOM 11740 C CD1  . LEU B 2 68 ? 13.975  -0.994  -0.508  1.00 0.00 ? 78 LEU B CD1  6  
ATOM 11741 C CD2  . LEU B 2 68 ? 12.880  -2.838  0.775   1.00 0.00 ? 78 LEU B CD2  6  
ATOM 11742 H H    . LEU B 2 68 ? 16.992  -4.241  -1.756  1.00 0.00 ? 78 LEU B H    6  
ATOM 11743 H HA   . LEU B 2 68 ? 16.209  -3.820  0.916   1.00 0.00 ? 78 LEU B HA   6  
ATOM 11744 H HB2  . LEU B 2 68 ? 15.412  -2.801  -1.447  1.00 0.00 ? 78 LEU B HB2  6  
ATOM 11745 H HB3  . LEU B 2 68 ? 14.090  -3.914  -1.155  1.00 0.00 ? 78 LEU B HB3  6  
ATOM 11746 H HG   . LEU B 2 68 ? 14.848  -2.101  1.074   1.00 0.00 ? 78 LEU B HG   6  
ATOM 11747 H HD11 . LEU B 2 68 ? 14.903  -0.671  -0.956  1.00 0.00 ? 78 LEU B HD11 6  
ATOM 11748 H HD12 . LEU B 2 68 ? 13.629  -0.242  0.184   1.00 0.00 ? 78 LEU B HD12 6  
ATOM 11749 H HD13 . LEU B 2 68 ? 13.236  -1.140  -1.280  1.00 0.00 ? 78 LEU B HD13 6  
ATOM 11750 H HD21 . LEU B 2 68 ? 13.056  -3.768  1.295   1.00 0.00 ? 78 LEU B HD21 6  
ATOM 11751 H HD22 . LEU B 2 68 ? 12.198  -3.008  -0.044  1.00 0.00 ? 78 LEU B HD22 6  
ATOM 11752 H HD23 . LEU B 2 68 ? 12.452  -2.119  1.456   1.00 0.00 ? 78 LEU B HD23 6  
ATOM 11753 N N    . LEU B 2 69 ? 14.926  -6.458  -0.575  1.00 0.00 ? 79 LEU B N    6  
ATOM 11754 C CA   . LEU B 2 69 ? 14.288  -7.754  -0.352  1.00 0.00 ? 79 LEU B CA   6  
ATOM 11755 C C    . LEU B 2 69 ? 15.034  -8.554  0.713   1.00 0.00 ? 79 LEU B C    6  
ATOM 11756 O O    . LEU B 2 69 ? 14.424  -9.245  1.528   1.00 0.00 ? 79 LEU B O    6  
ATOM 11757 C CB   . LEU B 2 69 ? 14.247  -8.557  -1.657  1.00 0.00 ? 79 LEU B CB   6  
ATOM 11758 C CG   . LEU B 2 69 ? 12.862  -8.728  -2.284  1.00 0.00 ? 79 LEU B CG   6  
ATOM 11759 C CD1  . LEU B 2 69 ? 12.298  -7.385  -2.719  1.00 0.00 ? 79 LEU B CD1  6  
ATOM 11760 C CD2  . LEU B 2 69 ? 12.933  -9.684  -3.465  1.00 0.00 ? 79 LEU B CD2  6  
ATOM 11761 H H    . LEU B 2 69 ? 15.176  -6.205  -1.493  1.00 0.00 ? 79 LEU B H    6  
ATOM 11762 H HA   . LEU B 2 69 ? 13.280  -7.576  -0.014  1.00 0.00 ? 79 LEU B HA   6  
ATOM 11763 H HB2  . LEU B 2 69 ? 14.884  -8.064  -2.376  1.00 0.00 ? 79 LEU B HB2  6  
ATOM 11764 H HB3  . LEU B 2 69 ? 14.651  -9.539  -1.461  1.00 0.00 ? 79 LEU B HB3  6  
ATOM 11765 H HG   . LEU B 2 69 ? 12.191  -9.151  -1.550  1.00 0.00 ? 79 LEU B HG   6  
ATOM 11766 H HD11 . LEU B 2 69 ? 11.317  -7.530  -3.147  1.00 0.00 ? 79 LEU B HD11 6  
ATOM 11767 H HD12 . LEU B 2 69 ? 12.952  -6.942  -3.456  1.00 0.00 ? 79 LEU B HD12 6  
ATOM 11768 H HD13 . LEU B 2 69 ? 12.224  -6.730  -1.863  1.00 0.00 ? 79 LEU B HD13 6  
ATOM 11769 H HD21 . LEU B 2 69 ? 13.316  -10.638 -3.133  1.00 0.00 ? 79 LEU B HD21 6  
ATOM 11770 H HD22 . LEU B 2 69 ? 13.590  -9.276  -4.219  1.00 0.00 ? 79 LEU B HD22 6  
ATOM 11771 H HD23 . LEU B 2 69 ? 11.946  -9.819  -3.882  1.00 0.00 ? 79 LEU B HD23 6  
ATOM 11772 N N    . ASP B 2 70 ? 16.355  -8.443  0.703   1.00 0.00 ? 80 ASP B N    6  
ATOM 11773 C CA   . ASP B 2 70 ? 17.189  -9.153  1.664   1.00 0.00 ? 80 ASP B CA   6  
ATOM 11774 C C    . ASP B 2 70 ? 17.087  -8.511  3.043   1.00 0.00 ? 80 ASP B C    6  
ATOM 11775 O O    . ASP B 2 70 ? 17.100  -9.199  4.067   1.00 0.00 ? 80 ASP B O    6  
ATOM 11776 C CB   . ASP B 2 70 ? 18.644  -9.162  1.200   1.00 0.00 ? 80 ASP B CB   6  
ATOM 11777 C CG   . ASP B 2 70 ? 19.504  -10.092 2.029   1.00 0.00 ? 80 ASP B CG   6  
ATOM 11778 O OD1  . ASP B 2 70 ? 19.073  -11.239 2.278   1.00 0.00 ? 80 ASP B OD1  6  
ATOM 11779 O OD2  . ASP B 2 70 ? 20.619  -9.686  2.420   1.00 0.00 ? 80 ASP B OD2  6  
ATOM 11780 H H    . ASP B 2 70 ? 16.781  -7.869  0.031   1.00 0.00 ? 80 ASP B H    6  
ATOM 11781 H HA   . ASP B 2 70 ? 16.833  -10.170 1.726   1.00 0.00 ? 80 ASP B HA   6  
ATOM 11782 H HB2  . ASP B 2 70 ? 18.687  -9.485  0.171   1.00 0.00 ? 80 ASP B HB2  6  
ATOM 11783 H HB3  . ASP B 2 70 ? 19.047  -8.163  1.278   1.00 0.00 ? 80 ASP B HB3  6  
ATOM 11784 N N    . THR B 2 71 ? 16.961  -7.190  3.058   1.00 0.00 ? 81 THR B N    6  
ATOM 11785 C CA   . THR B 2 71 ? 16.845  -6.444  4.303   1.00 0.00 ? 81 THR B CA   6  
ATOM 11786 C C    . THR B 2 71 ? 15.586  -6.861  5.064   1.00 0.00 ? 81 THR B C    6  
ATOM 11787 O O    . THR B 2 71 ? 15.569  -6.866  6.295   1.00 0.00 ? 81 THR B O    6  
ATOM 11788 C CB   . THR B 2 71 ? 16.821  -4.924  4.042   1.00 0.00 ? 81 THR B CB   6  
ATOM 11789 O OG1  . THR B 2 71 ? 17.855  -4.572  3.116   1.00 0.00 ? 81 THR B OG1  6  
ATOM 11790 C CG2  . THR B 2 71 ? 17.024  -4.146  5.333   1.00 0.00 ? 81 THR B CG2  6  
ATOM 11791 H H    . THR B 2 71 ? 16.945  -6.703  2.207   1.00 0.00 ? 81 THR B H    6  
ATOM 11792 H HA   . THR B 2 71 ? 17.711  -6.672  4.908   1.00 0.00 ? 81 THR B HA   6  
ATOM 11793 H HB   . THR B 2 71 ? 15.862  -4.658  3.623   1.00 0.00 ? 81 THR B HB   6  
ATOM 11794 H HG1  . THR B 2 71 ? 17.813  -5.148  2.342   1.00 0.00 ? 81 THR B HG1  6  
ATOM 11795 H HG21 . THR B 2 71 ? 16.979  -3.087  5.125   1.00 0.00 ? 81 THR B HG21 6  
ATOM 11796 H HG22 . THR B 2 71 ? 17.989  -4.389  5.752   1.00 0.00 ? 81 THR B HG22 6  
ATOM 11797 H HG23 . THR B 2 71 ? 16.249  -4.408  6.038   1.00 0.00 ? 81 THR B HG23 6  
ATOM 11798 N N    . LEU B 2 72 ? 14.538  -7.218  4.317   1.00 0.00 ? 82 LEU B N    6  
ATOM 11799 C CA   . LEU B 2 72 ? 13.274  -7.658  4.907   1.00 0.00 ? 82 LEU B CA   6  
ATOM 11800 C C    . LEU B 2 72 ? 13.498  -8.799  5.894   1.00 0.00 ? 82 LEU B C    6  
ATOM 11801 O O    . LEU B 2 72 ? 12.851  -8.873  6.934   1.00 0.00 ? 82 LEU B O    6  
ATOM 11802 C CB   . LEU B 2 72 ? 12.301  -8.112  3.812   1.00 0.00 ? 82 LEU B CB   6  
ATOM 11803 C CG   . LEU B 2 72 ? 11.844  -7.018  2.842   1.00 0.00 ? 82 LEU B CG   6  
ATOM 11804 C CD1  . LEU B 2 72 ? 11.001  -7.621  1.730   1.00 0.00 ? 82 LEU B CD1  6  
ATOM 11805 C CD2  . LEU B 2 72 ? 11.062  -5.939  3.575   1.00 0.00 ? 82 LEU B CD2  6  
ATOM 11806 H H    . LEU B 2 72 ? 14.605  -7.155  3.340   1.00 0.00 ? 82 LEU B H    6  
ATOM 11807 H HA   . LEU B 2 72 ? 12.844  -6.824  5.434   1.00 0.00 ? 82 LEU B HA   6  
ATOM 11808 H HB2  . LEU B 2 72 ? 12.782  -8.891  3.239   1.00 0.00 ? 82 LEU B HB2  6  
ATOM 11809 H HB3  . LEU B 2 72 ? 11.427  -8.526  4.288   1.00 0.00 ? 82 LEU B HB3  6  
ATOM 11810 H HG   . LEU B 2 72 ? 12.711  -6.558  2.391   1.00 0.00 ? 82 LEU B HG   6  
ATOM 11811 H HD11 . LEU B 2 72 ? 10.693  -6.842  1.049   1.00 0.00 ? 82 LEU B HD11 6  
ATOM 11812 H HD12 . LEU B 2 72 ? 10.126  -8.092  2.157   1.00 0.00 ? 82 LEU B HD12 6  
ATOM 11813 H HD13 . LEU B 2 72 ? 11.582  -8.358  1.196   1.00 0.00 ? 82 LEU B HD13 6  
ATOM 11814 H HD21 . LEU B 2 72 ? 11.695  -5.474  4.316   1.00 0.00 ? 82 LEU B HD21 6  
ATOM 11815 H HD22 . LEU B 2 72 ? 10.205  -6.382  4.061   1.00 0.00 ? 82 LEU B HD22 6  
ATOM 11816 H HD23 . LEU B 2 72 ? 10.729  -5.194  2.868   1.00 0.00 ? 82 LEU B HD23 6  
ATOM 11817 N N    . GLN B 2 73 ? 14.418  -9.691  5.559   1.00 0.00 ? 83 GLN B N    6  
ATOM 11818 C CA   . GLN B 2 73 ? 14.731  -10.817 6.422   1.00 0.00 ? 83 GLN B CA   6  
ATOM 11819 C C    . GLN B 2 73 ? 15.736  -10.408 7.491   1.00 0.00 ? 83 GLN B C    6  
ATOM 11820 O O    . GLN B 2 73 ? 15.500  -10.588 8.684   1.00 0.00 ? 83 GLN B O    6  
ATOM 11821 C CB   . GLN B 2 73 ? 15.311  -11.974 5.608   1.00 0.00 ? 83 GLN B CB   6  
ATOM 11822 C CG   . GLN B 2