data_2KWN
# 
_entry.id   2KWN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2KWN         
RCSB  RCSB101665   
WWPDB D_1000101665 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 2kwj unspecified 'DPF3b PHD with H3 peptide at ALY14'                  
PDB 2kwk unspecified 'DPF3b PHD with H3 peptide in wild type'              
PDB 2kwo unspecified 'DPF3 PHD with H4 peptide at N-terminal actyl-serine' 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2KWN 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2010-04-13 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zeng, L.'        1 
'Zhang, Q.'       2 
'Li, S.'          3 
'Plotnikov, A.N.' 4 
'Walsh, M.J.'     5 
'Zhou, M.'        6 
# 
_citation.id                        primary 
_citation.title                     'Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            466 
_citation.page_first                258 
_citation.page_last                 262 
_citation.year                      2010 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   20613843 
_citation.pdbx_database_id_DOI      10.1038/nature09139 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Zeng, L.'        1 
primary 'Zhang, Q.'       2 
primary 'Li, S.'          3 
primary 'Plotnikov, A.N.' 4 
primary 'Walsh, M.J.'     5 
primary 'Zhou, M.M.'      6 
# 
_cell.entry_id           2KWN 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2KWN 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'Histone peptide'          1681.043  1 ? ? ?                                    ? 
2 polymer     man 'Zinc finger protein DPF3' 12746.472 1 ? ? 'PHD-types 1 and 2 residues 261-372' ? 
3 non-polymer syn 'ZINC ION'                 65.409    4 ? ? ?                                    ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Zinc finger protein cer-d4, BRG1-associated factor 45C, BAF45C' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 'GLGKGGA(ALY)RHRKVLR' GLGKGGAKRHRKVLR B ? 
2 'polypeptide(L)' no no  
;GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCD
RGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
;
;GSYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCD
RGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   LEU n 
1 3   GLY n 
1 4   LYS n 
1 5   GLY n 
1 6   GLY n 
1 7   ALA n 
1 8   ALY n 
1 9   ARG n 
1 10  HIS n 
1 11  ARG n 
1 12  LYS n 
1 13  VAL n 
1 14  LEU n 
1 15  ARG n 
2 1   GLY n 
2 2   SER n 
2 3   TYR n 
2 4   CYS n 
2 5   ASP n 
2 6   PHE n 
2 7   CYS n 
2 8   LEU n 
2 9   GLY n 
2 10  GLY n 
2 11  SER n 
2 12  ASN n 
2 13  MET n 
2 14  ASN n 
2 15  LYS n 
2 16  LYS n 
2 17  SER n 
2 18  GLY n 
2 19  ARG n 
2 20  PRO n 
2 21  GLU n 
2 22  GLU n 
2 23  LEU n 
2 24  VAL n 
2 25  SER n 
2 26  CYS n 
2 27  ALA n 
2 28  ASP n 
2 29  CYS n 
2 30  GLY n 
2 31  ARG n 
2 32  SER n 
2 33  GLY n 
2 34  HIS n 
2 35  PRO n 
2 36  THR n 
2 37  CYS n 
2 38  LEU n 
2 39  GLN n 
2 40  PHE n 
2 41  THR n 
2 42  LEU n 
2 43  ASN n 
2 44  MET n 
2 45  THR n 
2 46  GLU n 
2 47  ALA n 
2 48  VAL n 
2 49  LYS n 
2 50  THR n 
2 51  TYR n 
2 52  LYS n 
2 53  TRP n 
2 54  GLN n 
2 55  CYS n 
2 56  ILE n 
2 57  GLU n 
2 58  CYS n 
2 59  LYS n 
2 60  SER n 
2 61  CYS n 
2 62  ILE n 
2 63  LEU n 
2 64  CYS n 
2 65  GLY n 
2 66  THR n 
2 67  SER n 
2 68  GLU n 
2 69  ASN n 
2 70  ASP n 
2 71  ASP n 
2 72  GLN n 
2 73  LEU n 
2 74  LEU n 
2 75  PHE n 
2 76  CYS n 
2 77  ASP n 
2 78  ASP n 
2 79  CYS n 
2 80  ASP n 
2 81  ARG n 
2 82  GLY n 
2 83  TYR n 
2 84  HIS n 
2 85  MET n 
2 86  TYR n 
2 87  CYS n 
2 88  LEU n 
2 89  ASN n 
2 90  PRO n 
2 91  PRO n 
2 92  VAL n 
2 93  ALA n 
2 94  GLU n 
2 95  PRO n 
2 96  PRO n 
2 97  GLU n 
2 98  GLY n 
2 99  SER n 
2 100 TRP n 
2 101 SER n 
2 102 CYS n 
2 103 HIS n 
2 104 LEU n 
2 105 CYS n 
2 106 TRP n 
2 107 GLU n 
2 108 LEU n 
2 109 LEU n 
2 110 LYS n 
2 111 GLU n 
2 112 LYS n 
2 113 ALA n 
2 114 SER n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DPF3, BAF45C, CERD4' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pGEX4T-1 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'The peptide was chemically synthesized' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 PDB 2KWN       2KWN   1 'GLGKGGA(ALY)RHRKVLR' 1   ? 
2 UNP DPF3_HUMAN Q92784 2 
;YCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRG
YHMYCLNPPVAEPPEGSWSCHLCWELLKEKAS
;
261 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2KWN B 1 ? 15  ? 2KWN   1   ? 15  ? 9   23  
2 2 2KWN A 3 ? 114 ? Q92784 261 ? 372 ? 261 372 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 2KWN GLY A 1 ? UNP Q92784 ? ? 'EXPRESSION TAG' 259 1 
2 2KWN SER A 2 ? UNP Q92784 ? ? 'EXPRESSION TAG' 260 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE             ? 'C3 H7 N O2'     89.093  
ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3'   188.224 
ARG 'L-peptide linking' y ARGININE            ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE          ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'     ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE            ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE           ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'     ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE             ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE           ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE          ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE             ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE              ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE          ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE       ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE             ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE              ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE           ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN          ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE            ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE              ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'          ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 2 '3D HNCACB'                            
1 2 2 '3D HN(COCA)CB'                        
1 3 1 '3D 1H-15N NOESY'                      
1 4 1 '3D 1H-13C NOESY'                      
1 5 1 '3D_13C-Edited_13C/15N-filtered NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'100 mM sodium phosphate, 2 mM DTT, 100% D2O'        1 '100% D2O'        
'100 mM sodium phosphate, 2 mM DTT, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
900 Bruker Avance 1 'Bruker Avance' 
800 Bruker Avance 2 'Bruker Avance' 
600 Bruker Avance 3 'Bruker Avance' 
500 Bruker DRX    4 'Bruker DRX'    
# 
_pdbx_nmr_refine.entry_id           2KWN 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2KWN 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2KWN 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
;Linge, O'Donoghue and Nilges
;
refinement                   ARIA    2.2  1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                   NMRPipe 2.3  2 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'chemical shift calculation' NMRPipe 2.3  3 
'Johnson, One Moon Scientific'                      'data analysis'              NMRView 5.04 4 
'Johnson, One Moon Scientific'                      'peak picking'               NMRView 5.04 5 
'Johnson, One Moon Scientific'                      'chemical shift assignment'  NMRView 5.04 6 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'         CNS     1.2  7 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2KWN 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2KWN 
_struct.title                     
;Solution structure of the double PHD (plant homeodomain) fingers of human transcriptional protein DPF3b bound to a histone H4 peptide containing acetylation at Lysine 16
;
_struct.pdbx_descriptor           'Histone peptide, Zinc finger protein DPF3' 
_struct.pdbx_model_details        'lowest energy, model 20' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2KWN 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'acetyl-lysine, Transcription regulation, Nucleus, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS B 34  ? GLN B 39  ? HIS A 292 GLN A 297 1 ? 6  
HELX_P HELX_P2 2 THR B 41  ? TYR B 51  ? THR A 299 TYR A 309 1 ? 11 
HELX_P HELX_P3 3 CYS B 55  ? LYS B 59  ? CYS A 313 LYS A 317 5 ? 5  
HELX_P HELX_P4 4 SER B 101 ? ALA B 113 ? SER A 359 ALA A 371 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A ALA 7   C   ? ? ? 1_555 A ALY 8 N  ? ? B ALA 15  B ALY 16  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2  covale ? ? A ALY 8   C   ? ? ? 1_555 A ARG 9 N  ? ? B ALY 16  B ARG 17  1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc1  metalc ? ? B HIS 84  ND1 ? ? ? 1_555 F ZN  . ZN ? ? A HIS 342 A ZN  801 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc2  metalc ? ? B HIS 34  ND1 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 292 A ZN  501 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc3  metalc ? ? B CYS 4   SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 262 A ZN  501 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc4  metalc ? ? B CYS 61  SG  ? ? ? 1_555 F ZN  . ZN ? ? A CYS 319 A ZN  801 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc5  metalc ? ? B CYS 76  SG  ? ? ? 1_555 E ZN  . ZN ? ? A CYS 334 A ZN  701 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc6  metalc ? ? B CYS 26  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 284 A ZN  601 1_555 ? ? ? ? ? ? ? 2.315 ? 
metalc7  metalc ? ? B CYS 87  SG  ? ? ? 1_555 F ZN  . ZN ? ? A CYS 345 A ZN  801 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc8  metalc ? ? B CYS 58  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 316 A ZN  601 1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc9  metalc ? ? B CYS 64  SG  ? ? ? 1_555 F ZN  . ZN ? ? A CYS 322 A ZN  801 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc10 metalc ? ? B CYS 102 SG  ? ? ? 1_555 E ZN  . ZN ? ? A CYS 360 A ZN  701 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc11 metalc ? ? B CYS 55  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 313 A ZN  601 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc12 metalc ? ? B CYS 79  SG  ? ? ? 1_555 E ZN  . ZN ? ? A CYS 337 A ZN  701 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc13 metalc ? ? B CYS 37  SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 295 A ZN  501 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc14 metalc ? ? B CYS 7   SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 265 A ZN  501 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc15 metalc ? ? B CYS 29  SG  ? ? ? 1_555 D ZN  . ZN ? ? A CYS 287 A ZN  601 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc16 metalc ? ? B CYS 105 SG  ? ? ? 1_555 E ZN  . ZN ? ? A CYS 363 A ZN  701 1_555 ? ? ? ? ? ? ? 2.326 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU B 73 ? PHE B 75 ? LEU A 331 PHE A 333 
A 2 GLY B 82 ? HIS B 84 ? GLY A 340 HIS A 342 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    74 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     332 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   B 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    83 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     341 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 501' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 601' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 701' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 801' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS B 4   ? CYS A 262 . ? 1_555 ? 
2  AC1 5 PHE B 6   ? PHE A 264 . ? 1_555 ? 
3  AC1 5 CYS B 7   ? CYS A 265 . ? 1_555 ? 
4  AC1 5 HIS B 34  ? HIS A 292 . ? 1_555 ? 
5  AC1 5 CYS B 37  ? CYS A 295 . ? 1_555 ? 
6  AC2 4 CYS B 26  ? CYS A 284 . ? 1_555 ? 
7  AC2 4 CYS B 29  ? CYS A 287 . ? 1_555 ? 
8  AC2 4 CYS B 55  ? CYS A 313 . ? 1_555 ? 
9  AC2 4 CYS B 58  ? CYS A 316 . ? 1_555 ? 
10 AC3 5 CYS B 76  ? CYS A 334 . ? 1_555 ? 
11 AC3 5 CYS B 79  ? CYS A 337 . ? 1_555 ? 
12 AC3 5 SER B 101 ? SER A 359 . ? 1_555 ? 
13 AC3 5 CYS B 102 ? CYS A 360 . ? 1_555 ? 
14 AC3 5 CYS B 105 ? CYS A 363 . ? 1_555 ? 
15 AC4 4 CYS B 61  ? CYS A 319 . ? 1_555 ? 
16 AC4 4 CYS B 64  ? CYS A 322 . ? 1_555 ? 
17 AC4 4 HIS B 84  ? HIS A 342 . ? 1_555 ? 
18 AC4 4 CYS B 87  ? CYS A 345 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2KWN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1   ? 4.253   -4.123  17.979  1.00 0.00 ? 9   GLY B N    1  
ATOM   2     C  CA   . GLY A 1 1   ? 4.961   -5.392  18.305  1.00 0.00 ? 9   GLY B CA   1  
ATOM   3     C  C    . GLY A 1 1   ? 4.015   -6.569  18.437  1.00 0.00 ? 9   GLY B C    1  
ATOM   4     O  O    . GLY A 1 1   ? 4.448   -7.721  18.475  1.00 0.00 ? 9   GLY B O    1  
ATOM   5     H  H1   . GLY A 1 1   ? 3.572   -3.890  18.730  1.00 0.00 ? 9   GLY B H1   1  
ATOM   6     H  H2   . GLY A 1 1   ? 3.740   -4.220  17.080  1.00 0.00 ? 9   GLY B H2   1  
ATOM   7     H  H3   . GLY A 1 1   ? 4.937   -3.344  17.892  1.00 0.00 ? 9   GLY B H3   1  
ATOM   8     H  HA2  . GLY A 1 1   ? 5.675   -5.604  17.523  1.00 0.00 ? 9   GLY B HA2  1  
ATOM   9     H  HA3  . GLY A 1 1   ? 5.493   -5.265  19.237  1.00 0.00 ? 9   GLY B HA3  1  
ATOM   10    N  N    . LEU A 1 2   ? 2.718   -6.281  18.508  1.00 0.00 ? 10  LEU B N    1  
ATOM   11    C  CA   . LEU A 1 2   ? 1.707   -7.325  18.637  1.00 0.00 ? 10  LEU B CA   1  
ATOM   12    C  C    . LEU A 1 2   ? 1.153   -7.720  17.272  1.00 0.00 ? 10  LEU B C    1  
ATOM   13    O  O    . LEU A 1 2   ? 1.244   -6.957  16.309  1.00 0.00 ? 10  LEU B O    1  
ATOM   14    C  CB   . LEU A 1 2   ? 0.568   -6.853  19.544  1.00 0.00 ? 10  LEU B CB   1  
ATOM   15    C  CG   . LEU A 1 2   ? 0.972   -6.530  20.984  1.00 0.00 ? 10  LEU B CG   1  
ATOM   16    C  CD1  . LEU A 1 2   ? -0.211  -5.964  21.754  1.00 0.00 ? 10  LEU B CD1  1  
ATOM   17    C  CD2  . LEU A 1 2   ? 1.515   -7.771  21.679  1.00 0.00 ? 10  LEU B CD2  1  
ATOM   18    H  H    . LEU A 1 2   ? 2.435   -5.343  18.473  1.00 0.00 ? 10  LEU B H    1  
ATOM   19    H  HA   . LEU A 1 2   ? 2.177   -8.187  19.084  1.00 0.00 ? 10  LEU B HA   1  
ATOM   20    H  HB2  . LEU A 1 2   ? 0.133   -5.966  19.107  1.00 0.00 ? 10  LEU B HB2  1  
ATOM   21    H  HB3  . LEU A 1 2   ? -0.186  -7.626  19.571  1.00 0.00 ? 10  LEU B HB3  1  
ATOM   22    H  HG   . LEU A 1 2   ? 1.752   -5.783  20.974  1.00 0.00 ? 10  LEU B HG   1  
ATOM   23    H  HD11 . LEU A 1 2   ? 0.074   -5.803  22.784  1.00 0.00 ? 10  LEU B HD11 1  
ATOM   24    H  HD12 . LEU A 1 2   ? -1.034  -6.661  21.713  1.00 0.00 ? 10  LEU B HD12 1  
ATOM   25    H  HD13 . LEU A 1 2   ? -0.512  -5.025  21.313  1.00 0.00 ? 10  LEU B HD13 1  
ATOM   26    H  HD21 . LEU A 1 2   ? 2.400   -8.114  21.163  1.00 0.00 ? 10  LEU B HD21 1  
ATOM   27    H  HD22 . LEU A 1 2   ? 0.766   -8.548  21.665  1.00 0.00 ? 10  LEU B HD22 1  
ATOM   28    H  HD23 . LEU A 1 2   ? 1.765   -7.530  22.702  1.00 0.00 ? 10  LEU B HD23 1  
ATOM   29    N  N    . GLY A 1 3   ? 0.578   -8.917  17.197  1.00 0.00 ? 11  GLY B N    1  
ATOM   30    C  CA   . GLY A 1 3   ? 0.017   -9.396  15.946  1.00 0.00 ? 11  GLY B CA   1  
ATOM   31    C  C    . GLY A 1 3   ? -1.489  -9.237  15.885  1.00 0.00 ? 11  GLY B C    1  
ATOM   32    O  O    . GLY A 1 3   ? -2.180  -10.043 15.261  1.00 0.00 ? 11  GLY B O    1  
ATOM   33    H  H    . GLY A 1 3   ? 0.536   -9.480  17.997  1.00 0.00 ? 11  GLY B H    1  
ATOM   34    H  HA2  . GLY A 1 3   ? 0.459   -8.843  15.131  1.00 0.00 ? 11  GLY B HA2  1  
ATOM   35    H  HA3  . GLY A 1 3   ? 0.262   -10.442 15.832  1.00 0.00 ? 11  GLY B HA3  1  
ATOM   36    N  N    . LYS A 1 4   ? -2.000  -8.196  16.535  1.00 0.00 ? 12  LYS B N    1  
ATOM   37    C  CA   . LYS A 1 4   ? -3.435  -7.934  16.551  1.00 0.00 ? 12  LYS B CA   1  
ATOM   38    C  C    . LYS A 1 4   ? -3.917  -7.455  15.184  1.00 0.00 ? 12  LYS B C    1  
ATOM   39    O  O    . LYS A 1 4   ? -4.916  -7.950  14.663  1.00 0.00 ? 12  LYS B O    1  
ATOM   40    C  CB   . LYS A 1 4   ? -3.775  -6.899  17.627  1.00 0.00 ? 12  LYS B CB   1  
ATOM   41    C  CG   . LYS A 1 4   ? -2.956  -5.622  17.533  1.00 0.00 ? 12  LYS B CG   1  
ATOM   42    C  CD   . LYS A 1 4   ? -3.293  -4.660  18.662  1.00 0.00 ? 12  LYS B CD   1  
ATOM   43    C  CE   . LYS A 1 4   ? -2.481  -3.379  18.567  1.00 0.00 ? 12  LYS B CE   1  
ATOM   44    N  NZ   . LYS A 1 4   ? -1.019  -3.636  18.682  1.00 0.00 ? 12  LYS B NZ   1  
ATOM   45    H  H    . LYS A 1 4   ? -1.398  -7.591  17.016  1.00 0.00 ? 12  LYS B H    1  
ATOM   46    H  HA   . LYS A 1 4   ? -3.935  -8.861  16.788  1.00 0.00 ? 12  LYS B HA   1  
ATOM   47    H  HB2  . LYS A 1 4   ? -4.820  -6.638  17.540  1.00 0.00 ? 12  LYS B HB2  1  
ATOM   48    H  HB3  . LYS A 1 4   ? -3.605  -7.339  18.599  1.00 0.00 ? 12  LYS B HB3  1  
ATOM   49    H  HG2  . LYS A 1 4   ? -1.908  -5.873  17.588  1.00 0.00 ? 12  LYS B HG2  1  
ATOM   50    H  HG3  . LYS A 1 4   ? -3.164  -5.141  16.588  1.00 0.00 ? 12  LYS B HG3  1  
ATOM   51    H  HD2  . LYS A 1 4   ? -4.343  -4.413  18.610  1.00 0.00 ? 12  LYS B HD2  1  
ATOM   52    H  HD3  . LYS A 1 4   ? -3.081  -5.141  19.606  1.00 0.00 ? 12  LYS B HD3  1  
ATOM   53    H  HE2  . LYS A 1 4   ? -2.680  -2.911  17.614  1.00 0.00 ? 12  LYS B HE2  1  
ATOM   54    H  HE3  . LYS A 1 4   ? -2.785  -2.715  19.364  1.00 0.00 ? 12  LYS B HE3  1  
ATOM   55    H  HZ1  . LYS A 1 4   ? -0.492  -2.744  18.598  1.00 0.00 ? 12  LYS B HZ1  1  
ATOM   56    H  HZ2  . LYS A 1 4   ? -0.709  -4.282  17.928  1.00 0.00 ? 12  LYS B HZ2  1  
ATOM   57    H  HZ3  . LYS A 1 4   ? -0.804  -4.068  19.603  1.00 0.00 ? 12  LYS B HZ3  1  
ATOM   58    N  N    . GLY A 1 5   ? -3.199  -6.494  14.607  1.00 0.00 ? 13  GLY B N    1  
ATOM   59    C  CA   . GLY A 1 5   ? -3.569  -5.970  13.303  1.00 0.00 ? 13  GLY B CA   1  
ATOM   60    C  C    . GLY A 1 5   ? -4.925  -5.289  13.307  1.00 0.00 ? 13  GLY B C    1  
ATOM   61    O  O    . GLY A 1 5   ? -5.962  -5.954  13.342  1.00 0.00 ? 13  GLY B O    1  
ATOM   62    H  H    . GLY A 1 5   ? -2.413  -6.138  15.071  1.00 0.00 ? 13  GLY B H    1  
ATOM   63    H  HA2  . GLY A 1 5   ? -2.822  -5.255  12.991  1.00 0.00 ? 13  GLY B HA2  1  
ATOM   64    H  HA3  . GLY A 1 5   ? -3.590  -6.784  12.594  1.00 0.00 ? 13  GLY B HA3  1  
ATOM   65    N  N    . GLY A 1 6   ? -4.917  -3.960  13.264  1.00 0.00 ? 14  GLY B N    1  
ATOM   66    C  CA   . GLY A 1 6   ? -6.159  -3.209  13.263  1.00 0.00 ? 14  GLY B CA   1  
ATOM   67    C  C    . GLY A 1 6   ? -6.999  -3.477  12.028  1.00 0.00 ? 14  GLY B C    1  
ATOM   68    O  O    . GLY A 1 6   ? -8.214  -3.284  12.043  1.00 0.00 ? 14  GLY B O    1  
ATOM   69    H  H    . GLY A 1 6   ? -4.060  -3.485  13.234  1.00 0.00 ? 14  GLY B H    1  
ATOM   70    H  HA2  . GLY A 1 6   ? -6.731  -3.478  14.138  1.00 0.00 ? 14  GLY B HA2  1  
ATOM   71    H  HA3  . GLY A 1 6   ? -5.930  -2.155  13.306  1.00 0.00 ? 14  GLY B HA3  1  
ATOM   72    N  N    . ALA A 1 7   ? -6.347  -3.922  10.958  1.00 0.00 ? 15  ALA B N    1  
ATOM   73    C  CA   . ALA A 1 7   ? -7.039  -4.218  9.709   1.00 0.00 ? 15  ALA B CA   1  
ATOM   74    C  C    . ALA A 1 7   ? -6.407  -5.416  9.004   1.00 0.00 ? 15  ALA B C    1  
ATOM   75    O  O    . ALA A 1 7   ? -6.817  -6.557  9.218   1.00 0.00 ? 15  ALA B O    1  
ATOM   76    C  CB   . ALA A 1 7   ? -7.037  -2.998  8.800   1.00 0.00 ? 15  ALA B CB   1  
ATOM   77    H  H    . ALA A 1 7   ? -5.377  -4.053  11.009  1.00 0.00 ? 15  ALA B H    1  
ATOM   78    H  HA   . ALA A 1 7   ? -8.066  -4.457  9.948   1.00 0.00 ? 15  ALA B HA   1  
ATOM   79    H  HB1  . ALA A 1 7   ? -6.020  -2.746  8.539   1.00 0.00 ? 15  ALA B HB1  1  
ATOM   80    H  HB2  . ALA A 1 7   ? -7.494  -2.165  9.314   1.00 0.00 ? 15  ALA B HB2  1  
ATOM   81    H  HB3  . ALA A 1 7   ? -7.596  -3.217  7.903   1.00 0.00 ? 15  ALA B HB3  1  
HETATM 82    O  OH   . ALY A 1 8   ? -4.695  -4.511  1.142   1.00 0.00 ? 16  ALY B OH   1  
HETATM 83    C  CH   . ALY A 1 8   ? -5.519  -5.326  0.726   1.00 0.00 ? 16  ALY B CH   1  
HETATM 84    C  CH3  . ALY A 1 8   ? -6.015  -5.171  -0.714  1.00 0.00 ? 16  ALY B CH3  1  
HETATM 85    N  NZ   . ALY A 1 8   ? -6.255  -6.046  1.565   1.00 0.00 ? 16  ALY B NZ   1  
HETATM 86    C  CE   . ALY A 1 8   ? -6.546  -5.590  2.918   1.00 0.00 ? 16  ALY B CE   1  
HETATM 87    C  CD   . ALY A 1 8   ? -5.832  -6.412  3.981   1.00 0.00 ? 16  ALY B CD   1  
HETATM 88    C  CG   . ALY A 1 8   ? -6.236  -5.974  5.383   1.00 0.00 ? 16  ALY B CG   1  
HETATM 89    C  CB   . ALY A 1 8   ? -5.667  -6.901  6.448   1.00 0.00 ? 16  ALY B CB   1  
HETATM 90    C  CA   . ALY A 1 8   ? -4.717  -6.212  7.437   1.00 0.00 ? 16  ALY B CA   1  
HETATM 91    N  N    . ALY A 1 8   ? -5.407  -5.150  8.165   1.00 0.00 ? 16  ALY B N    1  
HETATM 92    C  C    . ALY A 1 8   ? -3.499  -5.672  6.695   1.00 0.00 ? 16  ALY B C    1  
HETATM 93    O  O    . ALY A 1 8   ? -2.423  -6.270  6.743   1.00 0.00 ? 16  ALY B O    1  
HETATM 94    H  HH31 . ALY A 1 8   ? -6.489  -6.087  -1.033  1.00 0.00 ? 16  ALY B HH31 1  
HETATM 95    H  HH32 . ALY A 1 8   ? -6.729  -4.360  -0.759  1.00 0.00 ? 16  ALY B HH32 1  
HETATM 96    H  HH33 . ALY A 1 8   ? -5.179  -4.952  -1.362  1.00 0.00 ? 16  ALY B HH33 1  
HETATM 97    H  HZ   . ALY A 1 8   ? -6.889  -6.685  1.178   1.00 0.00 ? 16  ALY B HZ   1  
HETATM 98    H  HE3  . ALY A 1 8   ? -6.238  -4.555  3.009   1.00 0.00 ? 16  ALY B HE3  1  
HETATM 99    H  HE2  . ALY A 1 8   ? -7.609  -5.660  3.085   1.00 0.00 ? 16  ALY B HE2  1  
HETATM 100   H  HD3  . ALY A 1 8   ? -6.087  -7.453  3.851   1.00 0.00 ? 16  ALY B HD3  1  
HETATM 101   H  HD2  . ALY A 1 8   ? -4.766  -6.282  3.867   1.00 0.00 ? 16  ALY B HD2  1  
HETATM 102   H  HG3  . ALY A 1 8   ? -5.870  -4.974  5.558   1.00 0.00 ? 16  ALY B HG3  1  
HETATM 103   H  HG2  . ALY A 1 8   ? -7.313  -5.982  5.453   1.00 0.00 ? 16  ALY B HG2  1  
HETATM 104   H  HB3  . ALY A 1 8   ? -6.492  -7.327  7.000   1.00 0.00 ? 16  ALY B HB3  1  
HETATM 105   H  HB2  . ALY A 1 8   ? -5.132  -7.696  5.951   1.00 0.00 ? 16  ALY B HB2  1  
HETATM 106   H  HCA  . ALY A 1 8   ? -4.383  -6.940  8.161   1.00 0.00 ? 16  ALY B HCA  1  
HETATM 107   H  H    . ALY A 1 8   ? -5.125  -4.221  8.034   1.00 0.00 ? 16  ALY B H    1  
ATOM   108   N  N    . ARG A 1 9   ? -3.671  -4.540  6.013   1.00 0.00 ? 17  ARG B N    1  
ATOM   109   C  CA   . ARG A 1 9   ? -2.585  -3.932  5.247   1.00 0.00 ? 17  ARG B CA   1  
ATOM   110   C  C    . ARG A 1 9   ? -2.054  -4.913  4.208   1.00 0.00 ? 17  ARG B C    1  
ATOM   111   O  O    . ARG A 1 9   ? -2.451  -6.079  4.170   1.00 0.00 ? 17  ARG B O    1  
ATOM   112   C  CB   . ARG A 1 9   ? -1.446  -3.484  6.180   1.00 0.00 ? 17  ARG B CB   1  
ATOM   113   C  CG   . ARG A 1 9   ? -0.220  -2.898  5.469   1.00 0.00 ? 17  ARG B CG   1  
ATOM   114   C  CD   . ARG A 1 9   ? -0.488  -1.503  4.912   1.00 0.00 ? 17  ARG B CD   1  
ATOM   115   N  NE   . ARG A 1 9   ? -1.208  -0.662  5.863   1.00 0.00 ? 17  ARG B NE   1  
ATOM   116   C  CZ   . ARG A 1 9   ? -0.608  0.115   6.761   1.00 0.00 ? 17  ARG B CZ   1  
ATOM   117   N  NH1  . ARG A 1 9   ? 0.715   0.141   6.841   1.00 0.00 ? 17  ARG B NH1  1  
ATOM   118   N  NH2  . ARG A 1 9   ? -1.333  0.864   7.580   1.00 0.00 ? 17  ARG B NH2  1  
ATOM   119   H  H    . ARG A 1 9   ? -4.548  -4.104  6.026   1.00 0.00 ? 17  ARG B H    1  
ATOM   120   H  HA   . ARG A 1 9   ? -2.983  -3.067  4.737   1.00 0.00 ? 17  ARG B HA   1  
ATOM   121   H  HB2  . ARG A 1 9   ? -1.829  -2.733  6.854   1.00 0.00 ? 17  ARG B HB2  1  
ATOM   122   H  HB3  . ARG A 1 9   ? -1.121  -4.336  6.760   1.00 0.00 ? 17  ARG B HB3  1  
ATOM   123   H  HG2  . ARG A 1 9   ? 0.593   -2.836  6.176   1.00 0.00 ? 17  ARG B HG2  1  
ATOM   124   H  HG3  . ARG A 1 9   ? 0.067   -3.555  4.649   1.00 0.00 ? 17  ARG B HG3  1  
ATOM   125   H  HD2  . ARG A 1 9   ? 0.459   -1.036  4.686   1.00 0.00 ? 17  ARG B HD2  1  
ATOM   126   H  HD3  . ARG A 1 9   ? -1.069  -1.587  4.003   1.00 0.00 ? 17  ARG B HD3  1  
ATOM   127   H  HE   . ARG A 1 9   ? -2.187  -0.671  5.828   1.00 0.00 ? 17  ARG B HE   1  
ATOM   128   H  HH11 . ARG A 1 9   ? 1.265   -0.424  6.226   1.00 0.00 ? 17  ARG B HH11 1  
ATOM   129   H  HH12 . ARG A 1 9   ? 1.163   0.727   7.516   1.00 0.00 ? 17  ARG B HH12 1  
ATOM   130   H  HH21 . ARG A 1 9   ? -2.330  0.845   7.523   1.00 0.00 ? 17  ARG B HH21 1  
ATOM   131   H  HH22 . ARG A 1 9   ? -0.881  1.449   8.254   1.00 0.00 ? 17  ARG B HH22 1  
ATOM   132   N  N    . HIS A 1 10  ? -1.178  -4.421  3.354   1.00 0.00 ? 18  HIS B N    1  
ATOM   133   C  CA   . HIS A 1 10  ? -0.559  -5.226  2.322   1.00 0.00 ? 18  HIS B CA   1  
ATOM   134   C  C    . HIS A 1 10  ? 0.267   -6.367  2.935   1.00 0.00 ? 18  HIS B C    1  
ATOM   135   O  O    . HIS A 1 10  ? -0.162  -7.009  3.895   1.00 0.00 ? 18  HIS B O    1  
ATOM   136   C  CB   . HIS A 1 10  ? 0.332   -4.322  1.472   1.00 0.00 ? 18  HIS B CB   1  
ATOM   137   C  CG   . HIS A 1 10  ? -0.313  -3.031  1.099   1.00 0.00 ? 18  HIS B CG   1  
ATOM   138   N  ND1  . HIS A 1 10  ? -0.005  -1.832  1.699   1.00 0.00 ? 18  HIS B ND1  1  
ATOM   139   C  CD2  . HIS A 1 10  ? -1.259  -2.759  0.177   1.00 0.00 ? 18  HIS B CD2  1  
ATOM   140   C  CE1  . HIS A 1 10  ? -0.738  -0.876  1.164   1.00 0.00 ? 18  HIS B CE1  1  
ATOM   141   N  NE2  . HIS A 1 10  ? -1.509  -1.411  0.237   1.00 0.00 ? 18  HIS B NE2  1  
ATOM   142   H  H    . HIS A 1 10  ? -0.945  -3.472  3.412   1.00 0.00 ? 18  HIS B H    1  
ATOM   143   H  HA   . HIS A 1 10  ? -1.339  -5.642  1.703   1.00 0.00 ? 18  HIS B HA   1  
ATOM   144   H  HB2  . HIS A 1 10  ? 1.236   -4.099  2.015   1.00 0.00 ? 18  HIS B HB2  1  
ATOM   145   H  HB3  . HIS A 1 10  ? 0.582   -4.830  0.566   1.00 0.00 ? 18  HIS B HB3  1  
ATOM   146   H  HD1  . HIS A 1 10  ? 0.654   -1.701  2.413   1.00 0.00 ? 18  HIS B HD1  1  
ATOM   147   H  HD2  . HIS A 1 10  ? -1.713  -3.468  -0.497  1.00 0.00 ? 18  HIS B HD2  1  
ATOM   148   H  HE1  . HIS A 1 10  ? -0.714  0.166   1.441   1.00 0.00 ? 18  HIS B HE1  1  
ATOM   149   H  HE2  . HIS A 1 10  ? -2.220  -0.941  -0.247  1.00 0.00 ? 18  HIS B HE2  1  
ATOM   150   N  N    . ARG A 1 11  ? 1.441   -6.620  2.346   1.00 0.00 ? 19  ARG B N    1  
ATOM   151   C  CA   . ARG A 1 11  ? 2.372   -7.653  2.810   1.00 0.00 ? 19  ARG B CA   1  
ATOM   152   C  C    . ARG A 1 11  ? 2.053   -9.058  2.297   1.00 0.00 ? 19  ARG B C    1  
ATOM   153   O  O    . ARG A 1 11  ? 2.948   -9.896  2.218   1.00 0.00 ? 19  ARG B O    1  
ATOM   154   C  CB   . ARG A 1 11  ? 2.456   -7.634  4.327   1.00 0.00 ? 19  ARG B CB   1  
ATOM   155   C  CG   . ARG A 1 11  ? 3.873   -7.726  4.866   1.00 0.00 ? 19  ARG B CG   1  
ATOM   156   C  CD   . ARG A 1 11  ? 4.071   -8.976  5.705   1.00 0.00 ? 19  ARG B CD   1  
ATOM   157   N  NE   . ARG A 1 11  ? 4.565   -10.098 4.912   1.00 0.00 ? 19  ARG B NE   1  
ATOM   158   C  CZ   . ARG A 1 11  ? 5.723   -10.710 5.143   1.00 0.00 ? 19  ARG B CZ   1  
ATOM   159   N  NH1  . ARG A 1 11  ? 6.515   -10.293 6.124   1.00 0.00 ? 19  ARG B NH1  1  
ATOM   160   N  NH2  . ARG A 1 11  ? 6.094   -11.736 4.390   1.00 0.00 ? 19  ARG B NH2  1  
ATOM   161   H  H    . ARG A 1 11  ? 1.698   -6.083  1.570   1.00 0.00 ? 19  ARG B H    1  
ATOM   162   H  HA   . ARG A 1 11  ? 3.329   -7.389  2.419   1.00 0.00 ? 19  ARG B HA   1  
ATOM   163   H  HB2  . ARG A 1 11  ? 2.021   -6.707  4.667   1.00 0.00 ? 19  ARG B HB2  1  
ATOM   164   H  HB3  . ARG A 1 11  ? 1.884   -8.460  4.723   1.00 0.00 ? 19  ARG B HB3  1  
ATOM   165   H  HG2  . ARG A 1 11  ? 4.562   -7.751  4.036   1.00 0.00 ? 19  ARG B HG2  1  
ATOM   166   H  HG3  . ARG A 1 11  ? 4.074   -6.858  5.477   1.00 0.00 ? 19  ARG B HG3  1  
ATOM   167   H  HD2  . ARG A 1 11  ? 4.780   -8.761  6.489   1.00 0.00 ? 19  ARG B HD2  1  
ATOM   168   H  HD3  . ARG A 1 11  ? 3.123   -9.248  6.142   1.00 0.00 ? 19  ARG B HD3  1  
ATOM   169   H  HE   . ARG A 1 11  ? 4.002   -10.416 4.175   1.00 0.00 ? 19  ARG B HE   1  
ATOM   170   H  HH11 . ARG A 1 11  ? 6.241   -9.518  6.693   1.00 0.00 ? 19  ARG B HH11 1  
ATOM   171   H  HH12 . ARG A 1 11  ? 7.385   -10.756 6.294   1.00 0.00 ? 19  ARG B HH12 1  
ATOM   172   H  HH21 . ARG A 1 11  ? 5.503   -12.051 3.647   1.00 0.00 ? 19  ARG B HH21 1  
ATOM   173   H  HH22 . ARG A 1 11  ? 6.965   -12.195 4.564   1.00 0.00 ? 19  ARG B HH22 1  
ATOM   174   N  N    . LYS A 1 12  ? 0.795   -9.308  1.959   1.00 0.00 ? 20  LYS B N    1  
ATOM   175   C  CA   . LYS A 1 12  ? 0.362   -10.607 1.427   1.00 0.00 ? 20  LYS B CA   1  
ATOM   176   C  C    . LYS A 1 12  ? 0.938   -11.793 2.209   1.00 0.00 ? 20  LYS B C    1  
ATOM   177   O  O    . LYS A 1 12  ? 2.105   -12.159 2.060   1.00 0.00 ? 20  LYS B O    1  
ATOM   178   C  CB   . LYS A 1 12  ? 0.700   -10.721 -0.074  1.00 0.00 ? 20  LYS B CB   1  
ATOM   179   C  CG   . LYS A 1 12  ? 2.169   -10.901 -0.412  1.00 0.00 ? 20  LYS B CG   1  
ATOM   180   C  CD   . LYS A 1 12  ? 2.388   -10.760 -1.909  1.00 0.00 ? 20  LYS B CD   1  
ATOM   181   C  CE   . LYS A 1 12  ? 3.843   -10.942 -2.286  1.00 0.00 ? 20  LYS B CE   1  
ATOM   182   N  NZ   . LYS A 1 12  ? 4.019   -11.103 -3.756  1.00 0.00 ? 20  LYS B NZ   1  
ATOM   183   H  H    . LYS A 1 12  ? 0.127   -8.601  2.075   1.00 0.00 ? 20  LYS B H    1  
ATOM   184   H  HA   . LYS A 1 12  ? -0.712  -10.640 1.530   1.00 0.00 ? 20  LYS B HA   1  
ATOM   185   H  HB2  . LYS A 1 12  ? 0.162   -11.559 -0.486  1.00 0.00 ? 20  LYS B HB2  1  
ATOM   186   H  HB3  . LYS A 1 12  ? 0.368   -9.822  -0.567  1.00 0.00 ? 20  LYS B HB3  1  
ATOM   187   H  HG2  . LYS A 1 12  ? 2.746   -10.147 0.102   1.00 0.00 ? 20  LYS B HG2  1  
ATOM   188   H  HG3  . LYS A 1 12  ? 2.487   -11.883 -0.099  1.00 0.00 ? 20  LYS B HG3  1  
ATOM   189   H  HD2  . LYS A 1 12  ? 1.799   -11.506 -2.422  1.00 0.00 ? 20  LYS B HD2  1  
ATOM   190   H  HD3  . LYS A 1 12  ? 2.070   -9.774  -2.216  1.00 0.00 ? 20  LYS B HD3  1  
ATOM   191   H  HE2  . LYS A 1 12  ? 4.396   -10.072 -1.959  1.00 0.00 ? 20  LYS B HE2  1  
ATOM   192   H  HE3  . LYS A 1 12  ? 4.225   -11.820 -1.787  1.00 0.00 ? 20  LYS B HE3  1  
ATOM   193   H  HZ1  . LYS A 1 12  ? 3.665   -10.261 -4.252  1.00 0.00 ? 20  LYS B HZ1  1  
ATOM   194   H  HZ2  . LYS A 1 12  ? 3.492   -11.935 -4.089  1.00 0.00 ? 20  LYS B HZ2  1  
ATOM   195   H  HZ3  . LYS A 1 12  ? 5.026   -11.230 -3.984  1.00 0.00 ? 20  LYS B HZ3  1  
ATOM   196   N  N    . VAL A 1 13  ? 0.099   -12.397 3.043   1.00 0.00 ? 21  VAL B N    1  
ATOM   197   C  CA   . VAL A 1 13  ? 0.507   -13.549 3.837   1.00 0.00 ? 21  VAL B CA   1  
ATOM   198   C  C    . VAL A 1 13  ? -0.158  -14.823 3.311   1.00 0.00 ? 21  VAL B C    1  
ATOM   199   O  O    . VAL A 1 13  ? -1.163  -15.289 3.850   1.00 0.00 ? 21  VAL B O    1  
ATOM   200   C  CB   . VAL A 1 13  ? 0.179   -13.347 5.334   1.00 0.00 ? 21  VAL B CB   1  
ATOM   201   C  CG1  . VAL A 1 13  ? -1.283  -12.970 5.528   1.00 0.00 ? 21  VAL B CG1  1  
ATOM   202   C  CG2  . VAL A 1 13  ? 0.532   -14.591 6.139   1.00 0.00 ? 21  VAL B CG2  1  
ATOM   203   H  H    . VAL A 1 13  ? -0.817  -12.059 3.127   1.00 0.00 ? 21  VAL B H    1  
ATOM   204   H  HA   . VAL A 1 13  ? 1.579   -13.653 3.737   1.00 0.00 ? 21  VAL B HA   1  
ATOM   205   H  HB   . VAL A 1 13  ? 0.783   -12.531 5.701   1.00 0.00 ? 21  VAL B HB   1  
ATOM   206   H  HG11 . VAL A 1 13  ? -1.464  -12.754 6.570   1.00 0.00 ? 21  VAL B HG11 1  
ATOM   207   H  HG12 . VAL A 1 13  ? -1.912  -13.791 5.218   1.00 0.00 ? 21  VAL B HG12 1  
ATOM   208   H  HG13 . VAL A 1 13  ? -1.512  -12.097 4.935   1.00 0.00 ? 21  VAL B HG13 1  
ATOM   209   H  HG21 . VAL A 1 13  ? 1.567   -14.848 5.970   1.00 0.00 ? 21  VAL B HG21 1  
ATOM   210   H  HG22 . VAL A 1 13  ? -0.098  -15.412 5.829   1.00 0.00 ? 21  VAL B HG22 1  
ATOM   211   H  HG23 . VAL A 1 13  ? 0.377   -14.396 7.190   1.00 0.00 ? 21  VAL B HG23 1  
ATOM   212   N  N    . LEU A 1 14  ? 0.413   -15.376 2.243   1.00 0.00 ? 22  LEU B N    1  
ATOM   213   C  CA   . LEU A 1 14  ? -0.118  -16.588 1.624   1.00 0.00 ? 22  LEU B CA   1  
ATOM   214   C  C    . LEU A 1 14  ? -1.563  -16.378 1.179   1.00 0.00 ? 22  LEU B C    1  
ATOM   215   O  O    . LEU A 1 14  ? -2.499  -16.635 1.936   1.00 0.00 ? 22  LEU B O    1  
ATOM   216   C  CB   . LEU A 1 14  ? -0.027  -17.772 2.591   1.00 0.00 ? 22  LEU B CB   1  
ATOM   217   C  CG   . LEU A 1 14  ? -0.543  -19.105 2.040   1.00 0.00 ? 22  LEU B CG   1  
ATOM   218   C  CD1  . LEU A 1 14  ? 0.208   -19.490 0.774   1.00 0.00 ? 22  LEU B CD1  1  
ATOM   219   C  CD2  . LEU A 1 14  ? -0.415  -20.199 3.088   1.00 0.00 ? 22  LEU B CD2  1  
ATOM   220   H  H    . LEU A 1 14  ? 1.212   -14.958 1.861   1.00 0.00 ? 22  LEU B H    1  
ATOM   221   H  HA   . LEU A 1 14  ? 0.484   -16.801 0.752   1.00 0.00 ? 22  LEU B HA   1  
ATOM   222   H  HB2  . LEU A 1 14  ? 1.008   -17.899 2.873   1.00 0.00 ? 22  LEU B HB2  1  
ATOM   223   H  HB3  . LEU A 1 14  ? -0.596  -17.531 3.477   1.00 0.00 ? 22  LEU B HB3  1  
ATOM   224   H  HG   . LEU A 1 14  ? -1.589  -19.002 1.789   1.00 0.00 ? 22  LEU B HG   1  
ATOM   225   H  HD11 . LEU A 1 14  ? 0.000   -18.767 -0.002  1.00 0.00 ? 22  LEU B HD11 1  
ATOM   226   H  HD12 . LEU A 1 14  ? -0.111  -20.469 0.449   1.00 0.00 ? 22  LEU B HD12 1  
ATOM   227   H  HD13 . LEU A 1 14  ? 1.269   -19.505 0.976   1.00 0.00 ? 22  LEU B HD13 1  
ATOM   228   H  HD21 . LEU A 1 14  ? -0.979  -19.924 3.967   1.00 0.00 ? 22  LEU B HD21 1  
ATOM   229   H  HD22 . LEU A 1 14  ? 0.624   -20.325 3.353   1.00 0.00 ? 22  LEU B HD22 1  
ATOM   230   H  HD23 . LEU A 1 14  ? -0.800  -21.126 2.690   1.00 0.00 ? 22  LEU B HD23 1  
ATOM   231   N  N    . ARG A 1 15  ? -1.731  -15.910 -0.057  1.00 0.00 ? 23  ARG B N    1  
ATOM   232   C  CA   . ARG A 1 15  ? -3.057  -15.654 -0.614  1.00 0.00 ? 23  ARG B CA   1  
ATOM   233   C  C    . ARG A 1 15  ? -3.820  -14.643 0.237   1.00 0.00 ? 23  ARG B C    1  
ATOM   234   O  O    . ARG A 1 15  ? -4.543  -15.071 1.161   1.00 0.00 ? 23  ARG B O    1  
ATOM   235   C  CB   . ARG A 1 15  ? -3.858  -16.954 -0.726  1.00 0.00 ? 23  ARG B CB   1  
ATOM   236   C  CG   . ARG A 1 15  ? -3.303  -17.927 -1.753  1.00 0.00 ? 23  ARG B CG   1  
ATOM   237   C  CD   . ARG A 1 15  ? -4.186  -19.157 -1.886  1.00 0.00 ? 23  ARG B CD   1  
ATOM   238   N  NE   . ARG A 1 15  ? -4.319  -19.873 -0.621  1.00 0.00 ? 23  ARG B NE   1  
ATOM   239   C  CZ   . ARG A 1 15  ? -5.214  -20.833 -0.406  1.00 0.00 ? 23  ARG B CZ   1  
ATOM   240   N  NH1  . ARG A 1 15  ? -6.051  -21.194 -1.371  1.00 0.00 ? 23  ARG B NH1  1  
ATOM   241   N  NH2  . ARG A 1 15  ? -5.273  -21.433 0.775   1.00 0.00 ? 23  ARG B NH2  1  
ATOM   242   O  OXT  . ARG A 1 15  ? -3.685  -13.429 -0.027  1.00 0.00 ? 23  ARG B OXT  1  
ATOM   243   H  H    . ARG A 1 15  ? -0.942  -15.731 -0.609  1.00 0.00 ? 23  ARG B H    1  
ATOM   244   H  HA   . ARG A 1 15  ? -2.923  -15.241 -1.602  1.00 0.00 ? 23  ARG B HA   1  
ATOM   245   H  HB2  . ARG A 1 15  ? -3.861  -17.445 0.236   1.00 0.00 ? 23  ARG B HB2  1  
ATOM   246   H  HB3  . ARG A 1 15  ? -4.874  -16.715 -1.001  1.00 0.00 ? 23  ARG B HB3  1  
ATOM   247   H  HG2  . ARG A 1 15  ? -3.246  -17.431 -2.711  1.00 0.00 ? 23  ARG B HG2  1  
ATOM   248   H  HG3  . ARG A 1 15  ? -2.314  -18.236 -1.447  1.00 0.00 ? 23  ARG B HG3  1  
ATOM   249   H  HD2  . ARG A 1 15  ? -5.166  -18.846 -2.217  1.00 0.00 ? 23  ARG B HD2  1  
ATOM   250   H  HD3  . ARG A 1 15  ? -3.752  -19.819 -2.621  1.00 0.00 ? 23  ARG B HD3  1  
ATOM   251   H  HE   . ARG A 1 15  ? -3.712  -19.625 0.107   1.00 0.00 ? 23  ARG B HE   1  
ATOM   252   H  HH11 . ARG A 1 15  ? -6.010  -20.744 -2.263  1.00 0.00 ? 23  ARG B HH11 1  
ATOM   253   H  HH12 . ARG A 1 15  ? -6.722  -21.916 -1.205  1.00 0.00 ? 23  ARG B HH12 1  
ATOM   254   H  HH21 . ARG A 1 15  ? -4.645  -21.164 1.505   1.00 0.00 ? 23  ARG B HH21 1  
ATOM   255   H  HH22 . ARG A 1 15  ? -5.947  -22.154 0.936   1.00 0.00 ? 23  ARG B HH22 1  
ATOM   256   N  N    . GLY B 2 1   ? -16.784 0.395   -10.705 1.00 0.00 ? 259 GLY A N    1  
ATOM   257   C  CA   . GLY B 2 1   ? -17.582 -0.176  -9.586  1.00 0.00 ? 259 GLY A CA   1  
ATOM   258   C  C    . GLY B 2 1   ? -16.718 -0.607  -8.418  1.00 0.00 ? 259 GLY A C    1  
ATOM   259   O  O    . GLY B 2 1   ? -16.314 0.219   -7.599  1.00 0.00 ? 259 GLY A O    1  
ATOM   260   H  H1   . GLY B 2 1   ? -17.413 0.693   -11.478 1.00 0.00 ? 259 GLY A H1   1  
ATOM   261   H  H2   . GLY B 2 1   ? -16.118 -0.316  -11.069 1.00 0.00 ? 259 GLY A H2   1  
ATOM   262   H  H3   . GLY B 2 1   ? -16.244 1.221   -10.373 1.00 0.00 ? 259 GLY A H3   1  
ATOM   263   H  HA2  . GLY B 2 1   ? -18.286 0.567   -9.244  1.00 0.00 ? 259 GLY A HA2  1  
ATOM   264   H  HA3  . GLY B 2 1   ? -18.129 -1.034  -9.950  1.00 0.00 ? 259 GLY A HA3  1  
ATOM   265   N  N    . SER B 2 2   ? -16.436 -1.906  -8.341  1.00 0.00 ? 260 SER A N    1  
ATOM   266   C  CA   . SER B 2 2   ? -15.613 -2.455  -7.267  1.00 0.00 ? 260 SER A CA   1  
ATOM   267   C  C    . SER B 2 2   ? -16.173 -2.129  -5.897  1.00 0.00 ? 260 SER A C    1  
ATOM   268   O  O    . SER B 2 2   ? -17.279 -1.605  -5.762  1.00 0.00 ? 260 SER A O    1  
ATOM   269   C  CB   . SER B 2 2   ? -14.193 -1.927  -7.343  1.00 0.00 ? 260 SER A CB   1  
ATOM   270   O  OG   . SER B 2 2   ? -13.477 -2.518  -8.413  1.00 0.00 ? 260 SER A OG   1  
ATOM   271   H  H    . SER B 2 2   ? -16.792 -2.511  -9.025  1.00 0.00 ? 260 SER A H    1  
ATOM   272   H  HA   . SER B 2 2   ? -15.582 -3.524  -7.378  1.00 0.00 ? 260 SER A HA   1  
ATOM   273   H  HB2  . SER B 2 2   ? -14.214 -0.856  -7.483  1.00 0.00 ? 260 SER A HB2  1  
ATOM   274   H  HB3  . SER B 2 2   ? -13.696 -2.163  -6.411  1.00 0.00 ? 260 SER A HB3  1  
ATOM   275   H  HG   . SER B 2 2   ? -13.443 -3.470  -8.290  1.00 0.00 ? 260 SER A HG   1  
ATOM   276   N  N    . TYR B 2 3   ? -15.384 -2.450  -4.880  1.00 0.00 ? 261 TYR A N    1  
ATOM   277   C  CA   . TYR B 2 3   ? -15.763 -2.201  -3.506  1.00 0.00 ? 261 TYR A CA   1  
ATOM   278   C  C    . TYR B 2 3   ? -14.588 -2.440  -2.570  1.00 0.00 ? 261 TYR A C    1  
ATOM   279   O  O    . TYR B 2 3   ? -13.620 -3.108  -2.932  1.00 0.00 ? 261 TYR A O    1  
ATOM   280   C  CB   . TYR B 2 3   ? -16.910 -3.126  -3.107  1.00 0.00 ? 261 TYR A CB   1  
ATOM   281   C  CG   . TYR B 2 3   ? -16.687 -4.580  -3.461  1.00 0.00 ? 261 TYR A CG   1  
ATOM   282   C  CD1  . TYR B 2 3   ? -15.566 -5.251  -3.010  1.00 0.00 ? 261 TYR A CD1  1  
ATOM   283   C  CD2  . TYR B 2 3   ? -17.604 -5.281  -4.233  1.00 0.00 ? 261 TYR A CD2  1  
ATOM   284   C  CE1  . TYR B 2 3   ? -15.353 -6.573  -3.311  1.00 0.00 ? 261 TYR A CE1  1  
ATOM   285   C  CE2  . TYR B 2 3   ? -17.400 -6.613  -4.545  1.00 0.00 ? 261 TYR A CE2  1  
ATOM   286   C  CZ   . TYR B 2 3   ? -16.271 -7.255  -4.080  1.00 0.00 ? 261 TYR A CZ   1  
ATOM   287   O  OH   . TYR B 2 3   ? -16.061 -8.581  -4.383  1.00 0.00 ? 261 TYR A OH   1  
ATOM   288   H  H    . TYR B 2 3   ? -14.524 -2.884  -5.063  1.00 0.00 ? 261 TYR A H    1  
ATOM   289   H  HA   . TYR B 2 3   ? -16.085 -1.175  -3.420  1.00 0.00 ? 261 TYR A HA   1  
ATOM   290   H  HB2  . TYR B 2 3   ? -17.042 -3.065  -2.045  1.00 0.00 ? 261 TYR A HB2  1  
ATOM   291   H  HB3  . TYR B 2 3   ? -17.810 -2.809  -3.586  1.00 0.00 ? 261 TYR A HB3  1  
ATOM   292   H  HD1  . TYR B 2 3   ? -14.845 -4.716  -2.415  1.00 0.00 ? 261 TYR A HD1  1  
ATOM   293   H  HD2  . TYR B 2 3   ? -18.486 -4.773  -4.594  1.00 0.00 ? 261 TYR A HD2  1  
ATOM   294   H  HE1  . TYR B 2 3   ? -14.473 -7.066  -2.937  1.00 0.00 ? 261 TYR A HE1  1  
ATOM   295   H  HE2  . TYR B 2 3   ? -18.122 -7.144  -5.148  1.00 0.00 ? 261 TYR A HE2  1  
ATOM   296   H  HH   . TYR B 2 3   ? -15.798 -9.053  -3.590  1.00 0.00 ? 261 TYR A HH   1  
ATOM   297   N  N    . CYS B 2 4   ? -14.666 -1.875  -1.376  1.00 0.00 ? 262 CYS A N    1  
ATOM   298   C  CA   . CYS B 2 4   ? -13.638 -2.081  -0.378  1.00 0.00 ? 262 CYS A CA   1  
ATOM   299   C  C    . CYS B 2 4   ? -13.602 -3.544  0.036   1.00 0.00 ? 262 CYS A C    1  
ATOM   300   O  O    . CYS B 2 4   ? -14.637 -4.160  0.244   1.00 0.00 ? 262 CYS A O    1  
ATOM   301   C  CB   . CYS B 2 4   ? -13.936 -1.202  0.820   1.00 0.00 ? 262 CYS A CB   1  
ATOM   302   S  SG   . CYS B 2 4   ? -13.428 -1.853  2.441   1.00 0.00 ? 262 CYS A SG   1  
ATOM   303   H  H    . CYS B 2 4   ? -15.409 -1.263  -1.172  1.00 0.00 ? 262 CYS A H    1  
ATOM   304   H  HA   . CYS B 2 4   ? -12.688 -1.796  -0.809  1.00 0.00 ? 262 CYS A HA   1  
ATOM   305   H  HB2  . CYS B 2 4   ? -13.443 -0.259  0.691   1.00 0.00 ? 262 CYS A HB2  1  
ATOM   306   H  HB3  . CYS B 2 4   ? -15.002 -1.032  0.862   1.00 0.00 ? 262 CYS A HB3  1  
ATOM   307   N  N    . ASP B 2 5   ? -12.412 -4.092  0.150   1.00 0.00 ? 263 ASP A N    1  
ATOM   308   C  CA   . ASP B 2 5   ? -12.249 -5.494  0.536   1.00 0.00 ? 263 ASP A CA   1  
ATOM   309   C  C    . ASP B 2 5   ? -12.567 -5.692  2.024   1.00 0.00 ? 263 ASP A C    1  
ATOM   310   O  O    . ASP B 2 5   ? -12.461 -6.796  2.559   1.00 0.00 ? 263 ASP A O    1  
ATOM   311   C  CB   . ASP B 2 5   ? -10.818 -5.940  0.222   1.00 0.00 ? 263 ASP A CB   1  
ATOM   312   C  CG   . ASP B 2 5   ? -10.471 -7.301  0.796   1.00 0.00 ? 263 ASP A CG   1  
ATOM   313   O  OD1  . ASP B 2 5   ? -11.245 -8.256  0.572   1.00 0.00 ? 263 ASP A OD1  1  
ATOM   314   O  OD2  . ASP B 2 5   ? -9.423  -7.410  1.470   1.00 0.00 ? 263 ASP A OD2  1  
ATOM   315   H  H    . ASP B 2 5   ? -11.619 -3.543  -0.031  1.00 0.00 ? 263 ASP A H    1  
ATOM   316   H  HA   . ASP B 2 5   ? -12.947 -6.081  -0.054  1.00 0.00 ? 263 ASP A HA   1  
ATOM   317   H  HB2  . ASP B 2 5   ? -10.692 -5.984  -0.849  1.00 0.00 ? 263 ASP A HB2  1  
ATOM   318   H  HB3  . ASP B 2 5   ? -10.132 -5.213  0.629   1.00 0.00 ? 263 ASP A HB3  1  
ATOM   319   N  N    . PHE B 2 6   ? -12.971 -4.607  2.674   1.00 0.00 ? 264 PHE A N    1  
ATOM   320   C  CA   . PHE B 2 6   ? -13.307 -4.620  4.102   1.00 0.00 ? 264 PHE A CA   1  
ATOM   321   C  C    . PHE B 2 6   ? -14.821 -4.501  4.326   1.00 0.00 ? 264 PHE A C    1  
ATOM   322   O  O    . PHE B 2 6   ? -15.343 -5.039  5.302   1.00 0.00 ? 264 PHE A O    1  
ATOM   323   C  CB   . PHE B 2 6   ? -12.579 -3.483  4.847   1.00 0.00 ? 264 PHE A CB   1  
ATOM   324   C  CG   . PHE B 2 6   ? -11.091 -3.470  4.658   1.00 0.00 ? 264 PHE A CG   1  
ATOM   325   C  CD1  . PHE B 2 6   ? -10.538 -3.206  3.417   1.00 0.00 ? 264 PHE A CD1  1  
ATOM   326   C  CD2  . PHE B 2 6   ? -10.245 -3.702  5.730   1.00 0.00 ? 264 PHE A CD2  1  
ATOM   327   C  CE1  . PHE B 2 6   ? -9.172  -3.174  3.247   1.00 0.00 ? 264 PHE A CE1  1  
ATOM   328   C  CE2  . PHE B 2 6   ? -8.875  -3.673  5.564   1.00 0.00 ? 264 PHE A CE2  1  
ATOM   329   C  CZ   . PHE B 2 6   ? -8.339  -3.407  4.321   1.00 0.00 ? 264 PHE A CZ   1  
ATOM   330   H  H    . PHE B 2 6   ? -13.043 -3.775  2.178   1.00 0.00 ? 264 PHE A H    1  
ATOM   331   H  HA   . PHE B 2 6   ? -12.978 -5.563  4.503   1.00 0.00 ? 264 PHE A HA   1  
ATOM   332   H  HB2  . PHE B 2 6   ? -12.957 -2.538  4.500   1.00 0.00 ? 264 PHE A HB2  1  
ATOM   333   H  HB3  . PHE B 2 6   ? -12.773 -3.558  5.900   1.00 0.00 ? 264 PHE A HB3  1  
ATOM   334   H  HD1  . PHE B 2 6   ? -11.188 -3.024  2.575   1.00 0.00 ? 264 PHE A HD1  1  
ATOM   335   H  HD2  . PHE B 2 6   ? -10.665 -3.910  6.703   1.00 0.00 ? 264 PHE A HD2  1  
ATOM   336   H  HE1  . PHE B 2 6   ? -8.754  -2.968  2.273   1.00 0.00 ? 264 PHE A HE1  1  
ATOM   337   H  HE2  . PHE B 2 6   ? -8.224  -3.857  6.406   1.00 0.00 ? 264 PHE A HE2  1  
ATOM   338   H  HZ   . PHE B 2 6   ? -7.267  -3.383  4.186   1.00 0.00 ? 264 PHE A HZ   1  
ATOM   339   N  N    . CYS B 2 7   ? -15.532 -3.798  3.430   1.00 0.00 ? 265 CYS A N    1  
ATOM   340   C  CA   . CYS B 2 7   ? -16.985 -3.649  3.579   1.00 0.00 ? 265 CYS A CA   1  
ATOM   341   C  C    . CYS B 2 7   ? -17.717 -4.081  2.325   1.00 0.00 ? 265 CYS A C    1  
ATOM   342   O  O    . CYS B 2 7   ? -18.899 -4.425  2.369   1.00 0.00 ? 265 CYS A O    1  
ATOM   343   C  CB   . CYS B 2 7   ? -17.407 -2.214  3.908   1.00 0.00 ? 265 CYS A CB   1  
ATOM   344   S  SG   . CYS B 2 7   ? -16.302 -1.290  5.012   1.00 0.00 ? 265 CYS A SG   1  
ATOM   345   H  H    . CYS B 2 7   ? -15.080 -3.398  2.654   1.00 0.00 ? 265 CYS A H    1  
ATOM   346   H  HA   . CYS B 2 7   ? -17.291 -4.296  4.382   1.00 0.00 ? 265 CYS A HA   1  
ATOM   347   H  HB2  . CYS B 2 7   ? -17.514 -1.656  3.004   1.00 0.00 ? 265 CYS A HB2  1  
ATOM   348   H  HB3  . CYS B 2 7   ? -18.373 -2.256  4.393   1.00 0.00 ? 265 CYS A HB3  1  
ATOM   349   N  N    . LEU B 2 8   ? -17.007 -4.043  1.212   1.00 0.00 ? 266 LEU A N    1  
ATOM   350   C  CA   . LEU B 2 8   ? -17.548 -4.428  -0.063  1.00 0.00 ? 266 LEU A CA   1  
ATOM   351   C  C    . LEU B 2 8   ? -18.646 -3.481  -0.527  1.00 0.00 ? 266 LEU A C    1  
ATOM   352   O  O    . LEU B 2 8   ? -19.721 -3.907  -0.948  1.00 0.00 ? 266 LEU A O    1  
ATOM   353   C  CB   . LEU B 2 8   ? -18.042 -5.841  0.034   1.00 0.00 ? 266 LEU A CB   1  
ATOM   354   C  CG   . LEU B 2 8   ? -17.069 -6.794  0.707   1.00 0.00 ? 266 LEU A CG   1  
ATOM   355   C  CD1  . LEU B 2 8   ? -17.680 -8.170  0.832   1.00 0.00 ? 266 LEU A CD1  1  
ATOM   356   C  CD2  . LEU B 2 8   ? -15.756 -6.846  -0.056  1.00 0.00 ? 266 LEU A CD2  1  
ATOM   357   H  H    . LEU B 2 8   ? -16.085 -3.774  1.254   1.00 0.00 ? 266 LEU A H    1  
ATOM   358   H  HA   . LEU B 2 8   ? -16.746 -4.401  -0.773  1.00 0.00 ? 266 LEU A HA   1  
ATOM   359   H  HB2  . LEU B 2 8   ? -18.946 -5.825  0.598   1.00 0.00 ? 266 LEU A HB2  1  
ATOM   360   H  HB3  . LEU B 2 8   ? -18.241 -6.199  -0.950  1.00 0.00 ? 266 LEU A HB3  1  
ATOM   361   H  HG   . LEU B 2 8   ? -16.868 -6.429  1.700   1.00 0.00 ? 266 LEU A HG   1  
ATOM   362   H  HD11 . LEU B 2 8   ? -18.618 -8.085  1.348   1.00 0.00 ? 266 LEU A HD11 1  
ATOM   363   H  HD12 . LEU B 2 8   ? -17.016 -8.813  1.390   1.00 0.00 ? 266 LEU A HD12 1  
ATOM   364   H  HD13 . LEU B 2 8   ? -17.845 -8.584  -0.152  1.00 0.00 ? 266 LEU A HD13 1  
ATOM   365   H  HD21 . LEU B 2 8   ? -15.553 -5.870  -0.487  1.00 0.00 ? 266 LEU A HD21 1  
ATOM   366   H  HD22 . LEU B 2 8   ? -15.827 -7.581  -0.845  1.00 0.00 ? 266 LEU A HD22 1  
ATOM   367   H  HD23 . LEU B 2 8   ? -14.957 -7.115  0.618   1.00 0.00 ? 266 LEU A HD23 1  
ATOM   368   N  N    . GLY B 2 9   ? -18.351 -2.188  -0.448  1.00 0.00 ? 267 GLY A N    1  
ATOM   369   C  CA   . GLY B 2 9   ? -19.296 -1.173  -0.885  1.00 0.00 ? 267 GLY A CA   1  
ATOM   370   C  C    . GLY B 2 9   ? -18.882 -0.520  -2.191  1.00 0.00 ? 267 GLY A C    1  
ATOM   371   O  O    . GLY B 2 9   ? -19.291 -0.970  -3.262  1.00 0.00 ? 267 GLY A O    1  
ATOM   372   H  H    . GLY B 2 9   ? -17.485 -1.924  -0.072  1.00 0.00 ? 267 GLY A H    1  
ATOM   373   H  HA2  . GLY B 2 9   ? -20.262 -1.638  -1.021  1.00 0.00 ? 267 GLY A HA2  1  
ATOM   374   H  HA3  . GLY B 2 9   ? -19.381 -0.417  -0.122  1.00 0.00 ? 267 GLY A HA3  1  
ATOM   375   N  N    . GLY B 2 10  ? -18.073 0.540   -2.118  1.00 0.00 ? 268 GLY A N    1  
ATOM   376   C  CA   . GLY B 2 10  ? -17.638 1.201   -3.335  1.00 0.00 ? 268 GLY A CA   1  
ATOM   377   C  C    . GLY B 2 10  ? -16.962 2.536   -3.085  1.00 0.00 ? 268 GLY A C    1  
ATOM   378   O  O    . GLY B 2 10  ? -16.937 3.032   -1.959  1.00 0.00 ? 268 GLY A O    1  
ATOM   379   H  H    . GLY B 2 10  ? -17.768 0.870   -1.241  1.00 0.00 ? 268 GLY A H    1  
ATOM   380   H  HA2  . GLY B 2 10  ? -16.932 0.551   -3.845  1.00 0.00 ? 268 GLY A HA2  1  
ATOM   381   H  HA3  . GLY B 2 10  ? -18.492 1.355   -3.975  1.00 0.00 ? 268 GLY A HA3  1  
ATOM   382   N  N    . SER B 2 11  ? -16.411 3.114   -4.152  1.00 0.00 ? 269 SER A N    1  
ATOM   383   C  CA   . SER B 2 11  ? -15.700 4.384   -4.069  1.00 0.00 ? 269 SER A CA   1  
ATOM   384   C  C    . SER B 2 11  ? -16.661 5.567   -4.061  1.00 0.00 ? 269 SER A C    1  
ATOM   385   O  O    . SER B 2 11  ? -16.286 6.704   -4.346  1.00 0.00 ? 269 SER A O    1  
ATOM   386   C  CB   . SER B 2 11  ? -14.692 4.482   -5.207  1.00 0.00 ? 269 SER A CB   1  
ATOM   387   O  OG   . SER B 2 11  ? -14.251 5.813   -5.406  1.00 0.00 ? 269 SER A OG   1  
ATOM   388   H  H    . SER B 2 11  ? -16.485 2.670   -5.022  1.00 0.00 ? 269 SER A H    1  
ATOM   389   H  HA   . SER B 2 11  ? -15.162 4.386   -3.145  1.00 0.00 ? 269 SER A HA   1  
ATOM   390   H  HB2  . SER B 2 11  ? -13.837 3.861   -4.975  1.00 0.00 ? 269 SER A HB2  1  
ATOM   391   H  HB3  . SER B 2 11  ? -15.147 4.126   -6.101  1.00 0.00 ? 269 SER A HB3  1  
ATOM   392   H  HG   . SER B 2 11  ? -14.569 6.136   -6.252  1.00 0.00 ? 269 SER A HG   1  
ATOM   393   N  N    . ASN B 2 12  ? -17.907 5.275   -3.734  1.00 0.00 ? 270 ASN A N    1  
ATOM   394   C  CA   . ASN B 2 12  ? -18.949 6.283   -3.637  1.00 0.00 ? 270 ASN A CA   1  
ATOM   395   C  C    . ASN B 2 12  ? -20.082 5.749   -2.782  1.00 0.00 ? 270 ASN A C    1  
ATOM   396   O  O    . ASN B 2 12  ? -21.220 6.213   -2.869  1.00 0.00 ? 270 ASN A O    1  
ATOM   397   C  CB   . ASN B 2 12  ? -19.463 6.676   -5.014  1.00 0.00 ? 270 ASN A CB   1  
ATOM   398   C  CG   . ASN B 2 12  ? -19.758 5.478   -5.894  1.00 0.00 ? 270 ASN A CG   1  
ATOM   399   O  OD1  . ASN B 2 12  ? -20.872 4.953   -5.895  1.00 0.00 ? 270 ASN A OD1  1  
ATOM   400   N  ND2  . ASN B 2 12  ? -18.759 5.038   -6.650  1.00 0.00 ? 270 ASN A ND2  1  
ATOM   401   H  H    . ASN B 2 12  ? -18.140 4.340   -3.567  1.00 0.00 ? 270 ASN A H    1  
ATOM   402   H  HA   . ASN B 2 12  ? -18.531 7.156   -3.161  1.00 0.00 ? 270 ASN A HA   1  
ATOM   403   H  HB2  . ASN B 2 12  ? -20.369 7.247   -4.896  1.00 0.00 ? 270 ASN A HB2  1  
ATOM   404   H  HB3  . ASN B 2 12  ? -18.721 7.288   -5.497  1.00 0.00 ? 270 ASN A HB3  1  
ATOM   405   H  HD21 . ASN B 2 12  ? -17.899 5.505   -6.597  1.00 0.00 ? 270 ASN A HD21 1  
ATOM   406   H  HD22 . ASN B 2 12  ? -18.922 4.265   -7.230  1.00 0.00 ? 270 ASN A HD22 1  
ATOM   407   N  N    . MET B 2 13  ? -19.752 4.764   -1.948  1.00 0.00 ? 271 MET A N    1  
ATOM   408   C  CA   . MET B 2 13  ? -20.738 4.143   -1.074  1.00 0.00 ? 271 MET A CA   1  
ATOM   409   C  C    . MET B 2 13  ? -20.077 3.197   -0.082  1.00 0.00 ? 271 MET A C    1  
ATOM   410   O  O    . MET B 2 13  ? -19.699 2.079   -0.433  1.00 0.00 ? 271 MET A O    1  
ATOM   411   C  CB   . MET B 2 13  ? -21.769 3.373   -1.897  1.00 0.00 ? 271 MET A CB   1  
ATOM   412   C  CG   . MET B 2 13  ? -22.909 2.810   -1.065  1.00 0.00 ? 271 MET A CG   1  
ATOM   413   S  SD   . MET B 2 13  ? -24.145 4.053   -0.636  1.00 0.00 ? 271 MET A SD   1  
ATOM   414   C  CE   . MET B 2 13  ? -23.461 4.714   0.882   1.00 0.00 ? 271 MET A CE   1  
ATOM   415   H  H    . MET B 2 13  ? -18.815 4.455   -1.915  1.00 0.00 ? 271 MET A H    1  
ATOM   416   H  HA   . MET B 2 13  ? -21.241 4.924   -0.528  1.00 0.00 ? 271 MET A HA   1  
ATOM   417   H  HB2  . MET B 2 13  ? -22.186 4.033   -2.643  1.00 0.00 ? 271 MET A HB2  1  
ATOM   418   H  HB3  . MET B 2 13  ? -21.272 2.550   -2.392  1.00 0.00 ? 271 MET A HB3  1  
ATOM   419   H  HG2  . MET B 2 13  ? -23.391 2.021   -1.622  1.00 0.00 ? 271 MET A HG2  1  
ATOM   420   H  HG3  . MET B 2 13  ? -22.497 2.406   -0.152  1.00 0.00 ? 271 MET A HG3  1  
ATOM   421   H  HE1  . MET B 2 13  ? -22.451 5.052   0.705   1.00 0.00 ? 271 MET A HE1  1  
ATOM   422   H  HE2  . MET B 2 13  ? -23.454 3.944   1.639   1.00 0.00 ? 271 MET A HE2  1  
ATOM   423   H  HE3  . MET B 2 13  ? -24.065 5.543   1.218   1.00 0.00 ? 271 MET A HE3  1  
ATOM   424   N  N    . ASN B 2 14  ? -19.942 3.649   1.157   1.00 0.00 ? 272 ASN A N    1  
ATOM   425   C  CA   . ASN B 2 14  ? -19.344 2.831   2.202   1.00 0.00 ? 272 ASN A CA   1  
ATOM   426   C  C    . ASN B 2 14  ? -20.403 1.921   2.802   1.00 0.00 ? 272 ASN A C    1  
ATOM   427   O  O    . ASN B 2 14  ? -21.499 2.363   3.148   1.00 0.00 ? 272 ASN A O    1  
ATOM   428   C  CB   . ASN B 2 14  ? -18.719 3.705   3.286   1.00 0.00 ? 272 ASN A CB   1  
ATOM   429   C  CG   . ASN B 2 14  ? -17.785 2.931   4.196   1.00 0.00 ? 272 ASN A CG   1  
ATOM   430   O  OD1  . ASN B 2 14  ? -17.966 1.735   4.421   1.00 0.00 ? 272 ASN A OD1  1  
ATOM   431   N  ND2  . ASN B 2 14  ? -16.776 3.615   4.724   1.00 0.00 ? 272 ASN A ND2  1  
ATOM   432   H  H    . ASN B 2 14  ? -20.254 4.550   1.373   1.00 0.00 ? 272 ASN A H    1  
ATOM   433   H  HA   . ASN B 2 14  ? -18.576 2.222   1.749   1.00 0.00 ? 272 ASN A HA   1  
ATOM   434   H  HB2  . ASN B 2 14  ? -18.157 4.500   2.818   1.00 0.00 ? 272 ASN A HB2  1  
ATOM   435   H  HB3  . ASN B 2 14  ? -19.508 4.134   3.886   1.00 0.00 ? 272 ASN A HB3  1  
ATOM   436   H  HD21 . ASN B 2 14  ? -16.693 4.565   4.500   1.00 0.00 ? 272 ASN A HD21 1  
ATOM   437   H  HD22 . ASN B 2 14  ? -16.155 3.140   5.317   1.00 0.00 ? 272 ASN A HD22 1  
ATOM   438   N  N    . LYS B 2 15  ? -20.064 0.651   2.922   1.00 0.00 ? 273 LYS A N    1  
ATOM   439   C  CA   . LYS B 2 15  ? -20.982 -0.348  3.445   1.00 0.00 ? 273 LYS A CA   1  
ATOM   440   C  C    . LYS B 2 15  ? -21.054 -0.335  4.963   1.00 0.00 ? 273 LYS A C    1  
ATOM   441   O  O    . LYS B 2 15  ? -22.074 -0.702  5.546   1.00 0.00 ? 273 LYS A O    1  
ATOM   442   C  CB   . LYS B 2 15  ? -20.536 -1.720  2.960   1.00 0.00 ? 273 LYS A CB   1  
ATOM   443   C  CG   . LYS B 2 15  ? -21.014 -2.047  1.577   1.00 0.00 ? 273 LYS A CG   1  
ATOM   444   C  CD   . LYS B 2 15  ? -22.237 -2.934  1.585   1.00 0.00 ? 273 LYS A CD   1  
ATOM   445   C  CE   . LYS B 2 15  ? -22.848 -3.002  0.200   1.00 0.00 ? 273 LYS A CE   1  
ATOM   446   N  NZ   . LYS B 2 15  ? -23.278 -4.383  -0.157  1.00 0.00 ? 273 LYS A NZ   1  
ATOM   447   H  H    . LYS B 2 15  ? -19.165 0.373   2.650   1.00 0.00 ? 273 LYS A H    1  
ATOM   448   H  HA   . LYS B 2 15  ? -21.959 -0.137  3.050   1.00 0.00 ? 273 LYS A HA   1  
ATOM   449   H  HB2  . LYS B 2 15  ? -19.464 -1.742  2.943   1.00 0.00 ? 273 LYS A HB2  1  
ATOM   450   H  HB3  . LYS B 2 15  ? -20.892 -2.473  3.631   1.00 0.00 ? 273 LYS A HB3  1  
ATOM   451   H  HG2  . LYS B 2 15  ? -21.254 -1.128  1.078   1.00 0.00 ? 273 LYS A HG2  1  
ATOM   452   H  HG3  . LYS B 2 15  ? -20.220 -2.546  1.047   1.00 0.00 ? 273 LYS A HG3  1  
ATOM   453   H  HD2  . LYS B 2 15  ? -21.951 -3.929  1.896   1.00 0.00 ? 273 LYS A HD2  1  
ATOM   454   H  HD3  . LYS B 2 15  ? -22.960 -2.529  2.276   1.00 0.00 ? 273 LYS A HD3  1  
ATOM   455   H  HE2  . LYS B 2 15  ? -23.706 -2.347  0.166   1.00 0.00 ? 273 LYS A HE2  1  
ATOM   456   H  HE3  . LYS B 2 15  ? -22.107 -2.664  -0.514  1.00 0.00 ? 273 LYS A HE3  1  
ATOM   457   H  HZ1  . LYS B 2 15  ? -23.958 -4.738  0.545   1.00 0.00 ? 273 LYS A HZ1  1  
ATOM   458   H  HZ2  . LYS B 2 15  ? -22.456 -5.019  -0.181  1.00 0.00 ? 273 LYS A HZ2  1  
ATOM   459   H  HZ3  . LYS B 2 15  ? -23.731 -4.385  -1.094  1.00 0.00 ? 273 LYS A HZ3  1  
ATOM   460   N  N    . LYS B 2 16  ? -19.976 0.085   5.598   1.00 0.00 ? 274 LYS A N    1  
ATOM   461   C  CA   . LYS B 2 16  ? -19.924 0.120   7.050   1.00 0.00 ? 274 LYS A CA   1  
ATOM   462   C  C    . LYS B 2 16  ? -19.974 1.546   7.590   1.00 0.00 ? 274 LYS A C    1  
ATOM   463   O  O    . LYS B 2 16  ? -19.843 1.768   8.794   1.00 0.00 ? 274 LYS A O    1  
ATOM   464   C  CB   . LYS B 2 16  ? -18.668 -0.595  7.525   1.00 0.00 ? 274 LYS A CB   1  
ATOM   465   C  CG   . LYS B 2 16  ? -18.592 -2.033  7.042   1.00 0.00 ? 274 LYS A CG   1  
ATOM   466   C  CD   . LYS B 2 16  ? -19.077 -3.015  8.095   1.00 0.00 ? 274 LYS A CD   1  
ATOM   467   C  CE   . LYS B 2 16  ? -18.968 -4.449  7.606   1.00 0.00 ? 274 LYS A CE   1  
ATOM   468   N  NZ   . LYS B 2 16  ? -19.447 -5.422  8.626   1.00 0.00 ? 274 LYS A NZ   1  
ATOM   469   H  H    . LYS B 2 16  ? -19.194 0.369   5.081   1.00 0.00 ? 274 LYS A H    1  
ATOM   470   H  HA   . LYS B 2 16  ? -20.785 -0.416  7.420   1.00 0.00 ? 274 LYS A HA   1  
ATOM   471   H  HB2  . LYS B 2 16  ? -17.800 -0.065  7.160   1.00 0.00 ? 274 LYS A HB2  1  
ATOM   472   H  HB3  . LYS B 2 16  ? -18.656 -0.596  8.596   1.00 0.00 ? 274 LYS A HB3  1  
ATOM   473   H  HG2  . LYS B 2 16  ? -19.213 -2.131  6.168   1.00 0.00 ? 274 LYS A HG2  1  
ATOM   474   H  HG3  . LYS B 2 16  ? -17.570 -2.265  6.782   1.00 0.00 ? 274 LYS A HG3  1  
ATOM   475   H  HD2  . LYS B 2 16  ? -18.479 -2.902  8.986   1.00 0.00 ? 274 LYS A HD2  1  
ATOM   476   H  HD3  . LYS B 2 16  ? -20.110 -2.803  8.320   1.00 0.00 ? 274 LYS A HD3  1  
ATOM   477   H  HE2  . LYS B 2 16  ? -19.567 -4.553  6.714   1.00 0.00 ? 274 LYS A HE2  1  
ATOM   478   H  HE3  . LYS B 2 16  ? -17.935 -4.661  7.373   1.00 0.00 ? 274 LYS A HE3  1  
ATOM   479   H  HZ1  . LYS B 2 16  ? -19.420 -6.387  8.239   1.00 0.00 ? 274 LYS A HZ1  1  
ATOM   480   H  HZ2  . LYS B 2 16  ? -20.424 -5.199  8.902   1.00 0.00 ? 274 LYS A HZ2  1  
ATOM   481   H  HZ3  . LYS B 2 16  ? -18.842 -5.381  9.471   1.00 0.00 ? 274 LYS A HZ3  1  
ATOM   482   N  N    . SER B 2 17  ? -20.164 2.509   6.695   1.00 0.00 ? 275 SER A N    1  
ATOM   483   C  CA   . SER B 2 17  ? -20.252 3.912   7.090   1.00 0.00 ? 275 SER A CA   1  
ATOM   484   C  C    . SER B 2 17  ? -21.477 4.575   6.473   1.00 0.00 ? 275 SER A C    1  
ATOM   485   O  O    . SER B 2 17  ? -21.808 5.718   6.788   1.00 0.00 ? 275 SER A O    1  
ATOM   486   C  CB   . SER B 2 17  ? -18.985 4.668   6.698   1.00 0.00 ? 275 SER A CB   1  
ATOM   487   O  OG   . SER B 2 17  ? -17.851 4.153   7.374   1.00 0.00 ? 275 SER A OG   1  
ATOM   488   H  H    . SER B 2 17  ? -20.241 2.272   5.749   1.00 0.00 ? 275 SER A H    1  
ATOM   489   H  HA   . SER B 2 17  ? -20.357 3.941   8.159   1.00 0.00 ? 275 SER A HA   1  
ATOM   490   H  HB2  . SER B 2 17  ? -18.825 4.581   5.638   1.00 0.00 ? 275 SER A HB2  1  
ATOM   491   H  HB3  . SER B 2 17  ? -19.101 5.704   6.956   1.00 0.00 ? 275 SER A HB3  1  
ATOM   492   H  HG   . SER B 2 17  ? -17.820 3.199   7.267   1.00 0.00 ? 275 SER A HG   1  
ATOM   493   N  N    . GLY B 2 18  ? -22.140 3.840   5.592   1.00 0.00 ? 276 GLY A N    1  
ATOM   494   C  CA   . GLY B 2 18  ? -23.339 4.335   4.940   1.00 0.00 ? 276 GLY A CA   1  
ATOM   495   C  C    . GLY B 2 18  ? -23.146 5.634   4.191   1.00 0.00 ? 276 GLY A C    1  
ATOM   496   O  O    . GLY B 2 18  ? -24.116 6.319   3.866   1.00 0.00 ? 276 GLY A O    1  
ATOM   497   H  H    . GLY B 2 18  ? -21.811 2.941   5.385   1.00 0.00 ? 276 GLY A H    1  
ATOM   498   H  HA2  . GLY B 2 18  ? -23.676 3.591   4.240   1.00 0.00 ? 276 GLY A HA2  1  
ATOM   499   H  HA3  . GLY B 2 18  ? -24.098 4.479   5.687   1.00 0.00 ? 276 GLY A HA3  1  
ATOM   500   N  N    . ARG B 2 19  ? -21.902 5.976   3.917   1.00 0.00 ? 277 ARG A N    1  
ATOM   501   C  CA   . ARG B 2 19  ? -21.595 7.201   3.188   1.00 0.00 ? 277 ARG A CA   1  
ATOM   502   C  C    . ARG B 2 19  ? -20.485 6.989   2.162   1.00 0.00 ? 277 ARG A C    1  
ATOM   503   O  O    . ARG B 2 19  ? -19.699 6.055   2.252   1.00 0.00 ? 277 ARG A O    1  
ATOM   504   C  CB   . ARG B 2 19  ? -21.307 8.365   4.156   1.00 0.00 ? 277 ARG A CB   1  
ATOM   505   C  CG   . ARG B 2 19  ? -20.169 8.141   5.124   1.00 0.00 ? 277 ARG A CG   1  
ATOM   506   C  CD   . ARG B 2 19  ? -18.879 7.927   4.385   1.00 0.00 ? 277 ARG A CD   1  
ATOM   507   N  NE   . ARG B 2 19  ? -17.946 9.035   4.569   1.00 0.00 ? 277 ARG A NE   1  
ATOM   508   C  CZ   . ARG B 2 19  ? -16.840 8.953   5.301   1.00 0.00 ? 277 ARG A CZ   1  
ATOM   509   N  NH1  . ARG B 2 19  ? -16.523 7.817   5.908   1.00 0.00 ? 277 ARG A NH1  1  
ATOM   510   N  NH2  . ARG B 2 19  ? -16.047 10.009  5.427   1.00 0.00 ? 277 ARG A NH2  1  
ATOM   511   H  H    . ARG B 2 19  ? -21.176 5.393   4.217   1.00 0.00 ? 277 ARG A H    1  
ATOM   512   H  HA   . ARG B 2 19  ? -22.459 7.470   2.623   1.00 0.00 ? 277 ARG A HA   1  
ATOM   513   H  HB2  . ARG B 2 19  ? -21.074 9.244   3.577   1.00 0.00 ? 277 ARG A HB2  1  
ATOM   514   H  HB3  . ARG B 2 19  ? -22.201 8.559   4.731   1.00 0.00 ? 277 ARG A HB3  1  
ATOM   515   H  HG2  . ARG B 2 19  ? -20.074 9.021   5.735   1.00 0.00 ? 277 ARG A HG2  1  
ATOM   516   H  HG3  . ARG B 2 19  ? -20.381 7.279   5.739   1.00 0.00 ? 277 ARG A HG3  1  
ATOM   517   H  HD2  . ARG B 2 19  ? -18.421 7.011   4.727   1.00 0.00 ? 277 ARG A HD2  1  
ATOM   518   H  HD3  . ARG B 2 19  ? -19.130 7.844   3.336   1.00 0.00 ? 277 ARG A HD3  1  
ATOM   519   H  HE   . ARG B 2 19  ? -18.157 9.884   4.127   1.00 0.00 ? 277 ARG A HE   1  
ATOM   520   H  HH11 . ARG B 2 19  ? -17.117 7.018   5.816   1.00 0.00 ? 277 ARG A HH11 1  
ATOM   521   H  HH12 . ARG B 2 19  ? -15.690 7.760   6.459   1.00 0.00 ? 277 ARG A HH12 1  
ATOM   522   H  HH21 . ARG B 2 19  ? -16.281 10.867  4.971   1.00 0.00 ? 277 ARG A HH21 1  
ATOM   523   H  HH22 . ARG B 2 19  ? -15.216 9.947   5.980   1.00 0.00 ? 277 ARG A HH22 1  
ATOM   524   N  N    . PRO B 2 20  ? -20.420 7.886   1.180   1.00 0.00 ? 278 PRO A N    1  
ATOM   525   C  CA   . PRO B 2 20  ? -19.441 7.838   0.088   1.00 0.00 ? 278 PRO A CA   1  
ATOM   526   C  C    . PRO B 2 20  ? -17.991 7.906   0.561   1.00 0.00 ? 278 PRO A C    1  
ATOM   527   O  O    . PRO B 2 20  ? -17.696 8.398   1.650   1.00 0.00 ? 278 PRO A O    1  
ATOM   528   C  CB   . PRO B 2 20  ? -19.769 9.075   -0.754  1.00 0.00 ? 278 PRO A CB   1  
ATOM   529   C  CG   . PRO B 2 20  ? -21.142 9.485   -0.342  1.00 0.00 ? 278 PRO A CG   1  
ATOM   530   C  CD   . PRO B 2 20  ? -21.312 9.034   1.077   1.00 0.00 ? 278 PRO A CD   1  
ATOM   531   H  HA   . PRO B 2 20  ? -19.575 6.955   -0.516  1.00 0.00 ? 278 PRO A HA   1  
ATOM   532   H  HB2  . PRO B 2 20  ? -19.048 9.850   -0.551  1.00 0.00 ? 278 PRO A HB2  1  
ATOM   533   H  HB3  . PRO B 2 20  ? -19.736 8.816   -1.802  1.00 0.00 ? 278 PRO A HB3  1  
ATOM   534   H  HG2  . PRO B 2 20  ? -21.245 10.557  -0.411  1.00 0.00 ? 278 PRO A HG2  1  
ATOM   535   H  HG3  . PRO B 2 20  ? -21.869 8.995   -0.972  1.00 0.00 ? 278 PRO A HG3  1  
ATOM   536   H  HD2  . PRO B 2 20  ? -21.022 9.796   1.785   1.00 0.00 ? 278 PRO A HD2  1  
ATOM   537   H  HD3  . PRO B 2 20  ? -22.327 8.732   1.259   1.00 0.00 ? 278 PRO A HD3  1  
ATOM   538   N  N    . GLU B 2 21  ? -17.096 7.405   -0.284  1.00 0.00 ? 279 GLU A N    1  
ATOM   539   C  CA   . GLU B 2 21  ? -15.667 7.398   -0.007  1.00 0.00 ? 279 GLU A CA   1  
ATOM   540   C  C    . GLU B 2 21  ? -14.908 7.256   -1.326  1.00 0.00 ? 279 GLU A C    1  
ATOM   541   O  O    . GLU B 2 21  ? -15.260 7.899   -2.314  1.00 0.00 ? 279 GLU A O    1  
ATOM   542   C  CB   . GLU B 2 21  ? -15.319 6.256   0.942   1.00 0.00 ? 279 GLU A CB   1  
ATOM   543   C  CG   . GLU B 2 21  ? -14.063 6.521   1.751   1.00 0.00 ? 279 GLU A CG   1  
ATOM   544   C  CD   . GLU B 2 21  ? -14.188 7.738   2.646   1.00 0.00 ? 279 GLU A CD   1  
ATOM   545   O  OE1  . GLU B 2 21  ? -14.657 7.585   3.793   1.00 0.00 ? 279 GLU A OE1  1  
ATOM   546   O  OE2  . GLU B 2 21  ? -13.816 8.844   2.199   1.00 0.00 ? 279 GLU A OE2  1  
ATOM   547   H  H    . GLU B 2 21  ? -17.410 7.018   -1.126  1.00 0.00 ? 279 GLU A H    1  
ATOM   548   H  HA   . GLU B 2 21  ? -15.401 8.335   0.456   1.00 0.00 ? 279 GLU A HA   1  
ATOM   549   H  HB2  . GLU B 2 21  ? -16.141 6.107   1.627   1.00 0.00 ? 279 GLU A HB2  1  
ATOM   550   H  HB3  . GLU B 2 21  ? -15.170 5.355   0.367   1.00 0.00 ? 279 GLU A HB3  1  
ATOM   551   H  HG2  . GLU B 2 21  ? -13.865 5.664   2.366   1.00 0.00 ? 279 GLU A HG2  1  
ATOM   552   H  HG3  . GLU B 2 21  ? -13.239 6.675   1.071   1.00 0.00 ? 279 GLU A HG3  1  
ATOM   553   N  N    . GLU B 2 22  ? -13.871 6.424   -1.345  1.00 0.00 ? 280 GLU A N    1  
ATOM   554   C  CA   . GLU B 2 22  ? -13.104 6.196   -2.566  1.00 0.00 ? 280 GLU A CA   1  
ATOM   555   C  C    . GLU B 2 22  ? -12.086 5.079   -2.382  1.00 0.00 ? 280 GLU A C    1  
ATOM   556   O  O    . GLU B 2 22  ? -10.943 5.310   -1.985  1.00 0.00 ? 280 GLU A O    1  
ATOM   557   C  CB   . GLU B 2 22  ? -12.416 7.469   -3.049  1.00 0.00 ? 280 GLU A CB   1  
ATOM   558   C  CG   . GLU B 2 22  ? -11.915 7.358   -4.481  1.00 0.00 ? 280 GLU A CG   1  
ATOM   559   C  CD   . GLU B 2 22  ? -12.365 8.515   -5.350  1.00 0.00 ? 280 GLU A CD   1  
ATOM   560   O  OE1  . GLU B 2 22  ? -11.689 9.565   -5.340  1.00 0.00 ? 280 GLU A OE1  1  
ATOM   561   O  OE2  . GLU B 2 22  ? -13.396 8.369   -6.042  1.00 0.00 ? 280 GLU A OE2  1  
ATOM   562   H  H    . GLU B 2 22  ? -13.621 5.950   -0.527  1.00 0.00 ? 280 GLU A H    1  
ATOM   563   H  HA   . GLU B 2 22  ? -13.806 5.883   -3.321  1.00 0.00 ? 280 GLU A HA   1  
ATOM   564   H  HB2  . GLU B 2 22  ? -13.120 8.286   -2.999  1.00 0.00 ? 280 GLU A HB2  1  
ATOM   565   H  HB3  . GLU B 2 22  ? -11.575 7.684   -2.408  1.00 0.00 ? 280 GLU A HB3  1  
ATOM   566   H  HG2  . GLU B 2 22  ? -10.839 7.328   -4.474  1.00 0.00 ? 280 GLU A HG2  1  
ATOM   567   H  HG3  . GLU B 2 22  ? -12.291 6.441   -4.907  1.00 0.00 ? 280 GLU A HG3  1  
ATOM   568   N  N    . LEU B 2 23  ? -12.532 3.869   -2.684  1.00 0.00 ? 281 LEU A N    1  
ATOM   569   C  CA   . LEU B 2 23  ? -11.710 2.663   -2.576  1.00 0.00 ? 281 LEU A CA   1  
ATOM   570   C  C    . LEU B 2 23  ? -10.395 2.765   -3.325  1.00 0.00 ? 281 LEU A C    1  
ATOM   571   O  O    . LEU B 2 23  ? -10.093 3.765   -3.976  1.00 0.00 ? 281 LEU A O    1  
ATOM   572   C  CB   . LEU B 2 23  ? -12.458 1.478   -3.150  1.00 0.00 ? 281 LEU A CB   1  
ATOM   573   C  CG   . LEU B 2 23  ? -13.958 1.580   -3.128  1.00 0.00 ? 281 LEU A CG   1  
ATOM   574   C  CD1  . LEU B 2 23  ? -14.492 0.939   -4.383  1.00 0.00 ? 281 LEU A CD1  1  
ATOM   575   C  CD2  . LEU B 2 23  ? -14.516 0.915   -1.876  1.00 0.00 ? 281 LEU A CD2  1  
ATOM   576   H  H    . LEU B 2 23  ? -13.463 3.780   -2.982  1.00 0.00 ? 281 LEU A H    1  
ATOM   577   H  HA   . LEU B 2 23  ? -11.512 2.465   -1.545  1.00 0.00 ? 281 LEU A HA   1  
ATOM   578   H  HB2  . LEU B 2 23  ? -12.147 1.351   -4.175  1.00 0.00 ? 281 LEU A HB2  1  
ATOM   579   H  HB3  . LEU B 2 23  ? -12.183 0.596   -2.603  1.00 0.00 ? 281 LEU A HB3  1  
ATOM   580   H  HG   . LEU B 2 23  ? -14.248 2.613   -3.124  1.00 0.00 ? 281 LEU A HG   1  
ATOM   581   H  HD11 . LEU B 2 23  ? -14.282 -0.103  -4.342  1.00 0.00 ? 281 LEU A HD11 1  
ATOM   582   H  HD12 . LEU B 2 23  ? -14.005 1.372   -5.244  1.00 0.00 ? 281 LEU A HD12 1  
ATOM   583   H  HD13 . LEU B 2 23  ? -15.551 1.095   -4.454  1.00 0.00 ? 281 LEU A HD13 1  
ATOM   584   H  HD21 . LEU B 2 23  ? -13.783 0.222   -1.468  1.00 0.00 ? 281 LEU A HD21 1  
ATOM   585   H  HD22 . LEU B 2 23  ? -15.418 0.377   -2.128  1.00 0.00 ? 281 LEU A HD22 1  
ATOM   586   H  HD23 . LEU B 2 23  ? -14.743 1.671   -1.141  1.00 0.00 ? 281 LEU A HD23 1  
ATOM   587   N  N    . VAL B 2 24  ? -9.625  1.690   -3.214  1.00 0.00 ? 282 VAL A N    1  
ATOM   588   C  CA   . VAL B 2 24  ? -8.359  1.564   -3.903  1.00 0.00 ? 282 VAL A CA   1  
ATOM   589   C  C    . VAL B 2 24  ? -8.474  0.404   -4.850  1.00 0.00 ? 282 VAL A C    1  
ATOM   590   O  O    . VAL B 2 24  ? -8.463  -0.736  -4.410  1.00 0.00 ? 282 VAL A O    1  
ATOM   591   C  CB   . VAL B 2 24  ? -7.189  1.279   -2.961  1.00 0.00 ? 282 VAL A CB   1  
ATOM   592   C  CG1  . VAL B 2 24  ? -6.071  2.215   -3.263  1.00 0.00 ? 282 VAL A CG1  1  
ATOM   593   C  CG2  . VAL B 2 24  ? -7.571  1.426   -1.519  1.00 0.00 ? 282 VAL A CG2  1  
ATOM   594   H  H    . VAL B 2 24  ? -9.933  0.945   -2.648  1.00 0.00 ? 282 VAL A H    1  
ATOM   595   H  HA   . VAL B 2 24  ? -8.152  2.466   -4.444  1.00 0.00 ? 282 VAL A HA   1  
ATOM   596   H  HB   . VAL B 2 24  ? -6.857  0.276   -3.125  1.00 0.00 ? 282 VAL A HB   1  
ATOM   597   H  HG11 . VAL B 2 24  ? -6.314  3.164   -2.815  1.00 0.00 ? 282 VAL A HG11 1  
ATOM   598   H  HG12 . VAL B 2 24  ? -5.966  2.329   -4.333  1.00 0.00 ? 282 VAL A HG12 1  
ATOM   599   H  HG13 . VAL B 2 24  ? -5.151  1.838   -2.841  1.00 0.00 ? 282 VAL A HG13 1  
ATOM   600   H  HG21 . VAL B 2 24  ? -7.650  2.476   -1.279  1.00 0.00 ? 282 VAL A HG21 1  
ATOM   601   H  HG22 . VAL B 2 24  ? -6.812  0.971   -0.901  1.00 0.00 ? 282 VAL A HG22 1  
ATOM   602   H  HG23 . VAL B 2 24  ? -8.511  0.940   -1.347  1.00 0.00 ? 282 VAL A HG23 1  
ATOM   603   N  N    . SER B 2 25  ? -8.540  0.682   -6.139  1.00 0.00 ? 283 SER A N    1  
ATOM   604   C  CA   . SER B 2 25  ? -8.690  -0.384  -7.114  1.00 0.00 ? 283 SER A CA   1  
ATOM   605   C  C    . SER B 2 25  ? -7.348  -0.852  -7.633  1.00 0.00 ? 283 SER A C    1  
ATOM   606   O  O    . SER B 2 25  ? -6.514  -0.055  -8.062  1.00 0.00 ? 283 SER A O    1  
ATOM   607   C  CB   . SER B 2 25  ? -9.575  0.054   -8.278  1.00 0.00 ? 283 SER A CB   1  
ATOM   608   O  OG   . SER B 2 25  ? -9.203  1.335   -8.754  1.00 0.00 ? 283 SER A OG   1  
ATOM   609   H  H    . SER B 2 25  ? -8.481  1.613   -6.438  1.00 0.00 ? 283 SER A H    1  
ATOM   610   H  HA   . SER B 2 25  ? -9.171  -1.213  -6.610  1.00 0.00 ? 283 SER A HA   1  
ATOM   611   H  HB2  . SER B 2 25  ? -9.474  -0.658  -9.081  1.00 0.00 ? 283 SER A HB2  1  
ATOM   612   H  HB3  . SER B 2 25  ? -10.605 0.082   -7.956  1.00 0.00 ? 283 SER A HB3  1  
ATOM   613   H  HG   . SER B 2 25  ? -9.887  1.971   -8.531  1.00 0.00 ? 283 SER A HG   1  
ATOM   614   N  N    . CYS B 2 26  ? -7.154  -2.157  -7.585  1.00 0.00 ? 284 CYS A N    1  
ATOM   615   C  CA   . CYS B 2 26  ? -5.927  -2.766  -8.049  1.00 0.00 ? 284 CYS A CA   1  
ATOM   616   C  C    . CYS B 2 26  ? -5.829  -2.654  -9.565  1.00 0.00 ? 284 CYS A C    1  
ATOM   617   O  O    . CYS B 2 26  ? -6.829  -2.783  -10.271 1.00 0.00 ? 284 CYS A O    1  
ATOM   618   C  CB   . CYS B 2 26  ? -5.906  -4.223  -7.597  1.00 0.00 ? 284 CYS A CB   1  
ATOM   619   S  SG   . CYS B 2 26  ? -4.525  -5.214  -8.234  1.00 0.00 ? 284 CYS A SG   1  
ATOM   620   H  H    . CYS B 2 26  ? -7.864  -2.730  -7.228  1.00 0.00 ? 284 CYS A H    1  
ATOM   621   H  HA   . CYS B 2 26  ? -5.098  -2.242  -7.599  1.00 0.00 ? 284 CYS A HA   1  
ATOM   622   H  HB2  . CYS B 2 26  ? -5.849  -4.249  -6.521  1.00 0.00 ? 284 CYS A HB2  1  
ATOM   623   H  HB3  . CYS B 2 26  ? -6.823  -4.699  -7.907  1.00 0.00 ? 284 CYS A HB3  1  
ATOM   624   N  N    . ALA B 2 27  ? -4.622  -2.417  -10.062 1.00 0.00 ? 285 ALA A N    1  
ATOM   625   C  CA   . ALA B 2 27  ? -4.406  -2.275  -11.495 1.00 0.00 ? 285 ALA A CA   1  
ATOM   626   C  C    . ALA B 2 27  ? -4.012  -3.599  -12.126 1.00 0.00 ? 285 ALA A C    1  
ATOM   627   O  O    . ALA B 2 27  ? -3.581  -3.646  -13.278 1.00 0.00 ? 285 ALA A O    1  
ATOM   628   C  CB   . ALA B 2 27  ? -3.342  -1.226  -11.765 1.00 0.00 ? 285 ALA A CB   1  
ATOM   629   H  H    . ALA B 2 27  ? -3.860  -2.334  -9.451  1.00 0.00 ? 285 ALA A H    1  
ATOM   630   H  HA   . ALA B 2 27  ? -5.330  -1.937  -11.939 1.00 0.00 ? 285 ALA A HA   1  
ATOM   631   H  HB1  . ALA B 2 27  ? -2.369  -1.638  -11.544 1.00 0.00 ? 285 ALA A HB1  1  
ATOM   632   H  HB2  . ALA B 2 27  ? -3.519  -0.364  -11.139 1.00 0.00 ? 285 ALA A HB2  1  
ATOM   633   H  HB3  . ALA B 2 27  ? -3.381  -0.932  -12.803 1.00 0.00 ? 285 ALA A HB3  1  
ATOM   634   N  N    . ASP B 2 28  ? -4.162  -4.674  -11.365 1.00 0.00 ? 286 ASP A N    1  
ATOM   635   C  CA   . ASP B 2 28  ? -3.822  -5.998  -11.855 1.00 0.00 ? 286 ASP A CA   1  
ATOM   636   C  C    . ASP B 2 28  ? -5.064  -6.881  -11.937 1.00 0.00 ? 286 ASP A C    1  
ATOM   637   O  O    . ASP B 2 28  ? -5.430  -7.347  -13.016 1.00 0.00 ? 286 ASP A O    1  
ATOM   638   C  CB   . ASP B 2 28  ? -2.769  -6.646  -10.958 1.00 0.00 ? 286 ASP A CB   1  
ATOM   639   C  CG   . ASP B 2 28  ? -2.280  -7.972  -11.506 1.00 0.00 ? 286 ASP A CG   1  
ATOM   640   O  OD1  . ASP B 2 28  ? -2.984  -8.987  -11.324 1.00 0.00 ? 286 ASP A OD1  1  
ATOM   641   O  OD2  . ASP B 2 28  ? -1.191  -7.995  -12.118 1.00 0.00 ? 286 ASP A OD2  1  
ATOM   642   H  H    . ASP B 2 28  ? -4.509  -4.574  -10.455 1.00 0.00 ? 286 ASP A H    1  
ATOM   643   H  HA   . ASP B 2 28  ? -3.410  -5.880  -12.846 1.00 0.00 ? 286 ASP A HA   1  
ATOM   644   H  HB2  . ASP B 2 28  ? -1.923  -5.981  -10.868 1.00 0.00 ? 286 ASP A HB2  1  
ATOM   645   H  HB3  . ASP B 2 28  ? -3.194  -6.815  -9.980  1.00 0.00 ? 286 ASP A HB3  1  
ATOM   646   N  N    . CYS B 2 29  ? -5.712  -7.111  -10.794 1.00 0.00 ? 287 CYS A N    1  
ATOM   647   C  CA   . CYS B 2 29  ? -6.914  -7.936  -10.764 1.00 0.00 ? 287 CYS A CA   1  
ATOM   648   C  C    . CYS B 2 29  ? -8.173  -7.064  -10.740 1.00 0.00 ? 287 CYS A C    1  
ATOM   649   O  O    . CYS B 2 29  ? -9.128  -7.329  -11.471 1.00 0.00 ? 287 CYS A O    1  
ATOM   650   C  CB   . CYS B 2 29  ? -6.874  -8.908  -9.581  1.00 0.00 ? 287 CYS A CB   1  
ATOM   651   S  SG   . CYS B 2 29  ? -6.898  -8.127  -7.939  1.00 0.00 ? 287 CYS A SG   1  
ATOM   652   H  H    . CYS B 2 29  ? -5.375  -6.720  -9.959  1.00 0.00 ? 287 CYS A H    1  
ATOM   653   H  HA   . CYS B 2 29  ? -6.926  -8.512  -11.679 1.00 0.00 ? 287 CYS A HA   1  
ATOM   654   H  HB2  . CYS B 2 29  ? -7.726  -9.567  -9.639  1.00 0.00 ? 287 CYS A HB2  1  
ATOM   655   H  HB3  . CYS B 2 29  ? -5.970  -9.493  -9.649  1.00 0.00 ? 287 CYS A HB3  1  
ATOM   656   N  N    . GLY B 2 30  ? -8.174  -6.025  -9.902  1.00 0.00 ? 288 GLY A N    1  
ATOM   657   C  CA   . GLY B 2 30  ? -9.313  -5.116  -9.855  1.00 0.00 ? 288 GLY A CA   1  
ATOM   658   C  C    . GLY B 2 30  ? -10.059 -5.078  -8.530  1.00 0.00 ? 288 GLY A C    1  
ATOM   659   O  O    . GLY B 2 30  ? -11.198 -4.613  -8.485  1.00 0.00 ? 288 GLY A O    1  
ATOM   660   H  H    . GLY B 2 30  ? -7.402  -5.875  -9.319  1.00 0.00 ? 288 GLY A H    1  
ATOM   661   H  HA2  . GLY B 2 30  ? -8.956  -4.120  -10.065 1.00 0.00 ? 288 GLY A HA2  1  
ATOM   662   H  HA3  . GLY B 2 30  ? -10.008 -5.394  -10.631 1.00 0.00 ? 288 GLY A HA3  1  
ATOM   663   N  N    . ARG B 2 31  ? -9.447  -5.553  -7.451  1.00 0.00 ? 289 ARG A N    1  
ATOM   664   C  CA   . ARG B 2 31  ? -10.111 -5.515  -6.149  1.00 0.00 ? 289 ARG A CA   1  
ATOM   665   C  C    . ARG B 2 31  ? -9.884  -4.152  -5.505  1.00 0.00 ? 289 ARG A C    1  
ATOM   666   O  O    . ARG B 2 31  ? -8.824  -3.551  -5.687  1.00 0.00 ? 289 ARG A O    1  
ATOM   667   C  CB   . ARG B 2 31  ? -9.616  -6.640  -5.239  1.00 0.00 ? 289 ARG A CB   1  
ATOM   668   C  CG   . ARG B 2 31  ? -8.306  -6.338  -4.541  1.00 0.00 ? 289 ARG A CG   1  
ATOM   669   C  CD   . ARG B 2 31  ? -8.094  -7.261  -3.353  1.00 0.00 ? 289 ARG A CD   1  
ATOM   670   N  NE   . ARG B 2 31  ? -8.233  -8.667  -3.725  1.00 0.00 ? 289 ARG A NE   1  
ATOM   671   C  CZ   . ARG B 2 31  ? -9.210  -9.455  -3.284  1.00 0.00 ? 289 ARG A CZ   1  
ATOM   672   N  NH1  . ARG B 2 31  ? -10.128 -8.980  -2.453  1.00 0.00 ? 289 ARG A NH1  1  
ATOM   673   N  NH2  . ARG B 2 31  ? -9.270  -10.720 -3.677  1.00 0.00 ? 289 ARG A NH2  1  
ATOM   674   H  H    . ARG B 2 31  ? -8.543  -5.925  -7.527  1.00 0.00 ? 289 ARG A H    1  
ATOM   675   H  HA   . ARG B 2 31  ? -11.166 -5.641  -6.317  1.00 0.00 ? 289 ARG A HA   1  
ATOM   676   H  HB2  . ARG B 2 31  ? -10.364 -6.830  -4.483  1.00 0.00 ? 289 ARG A HB2  1  
ATOM   677   H  HB3  . ARG B 2 31  ? -9.484  -7.533  -5.832  1.00 0.00 ? 289 ARG A HB3  1  
ATOM   678   H  HG2  . ARG B 2 31  ? -7.496  -6.471  -5.242  1.00 0.00 ? 289 ARG A HG2  1  
ATOM   679   H  HG3  . ARG B 2 31  ? -8.326  -5.317  -4.196  1.00 0.00 ? 289 ARG A HG3  1  
ATOM   680   H  HD2  . ARG B 2 31  ? -7.102  -7.098  -2.957  1.00 0.00 ? 289 ARG A HD2  1  
ATOM   681   H  HD3  . ARG B 2 31  ? -8.826  -7.025  -2.595  1.00 0.00 ? 289 ARG A HD3  1  
ATOM   682   H  HE   . ARG B 2 31  ? -7.565  -9.042  -4.336  1.00 0.00 ? 289 ARG A HE   1  
ATOM   683   H  HH11 . ARG B 2 31  ? -10.088 -8.026  -2.154  1.00 0.00 ? 289 ARG A HH11 1  
ATOM   684   H  HH12 . ARG B 2 31  ? -10.862 -9.575  -2.125  1.00 0.00 ? 289 ARG A HH12 1  
ATOM   685   H  HH21 . ARG B 2 31  ? -8.581  -11.082 -4.304  1.00 0.00 ? 289 ARG A HH21 1  
ATOM   686   H  HH22 . ARG B 2 31  ? -10.005 -11.312 -3.346  1.00 0.00 ? 289 ARG A HH22 1  
ATOM   687   N  N    . SER B 2 32  ? -10.865 -3.655  -4.752  1.00 0.00 ? 290 SER A N    1  
ATOM   688   C  CA   . SER B 2 32  ? -10.721 -2.340  -4.138  1.00 0.00 ? 290 SER A CA   1  
ATOM   689   C  C    . SER B 2 32  ? -10.776 -2.376  -2.610  1.00 0.00 ? 290 SER A C    1  
ATOM   690   O  O    . SER B 2 32  ? -11.168 -3.377  -2.013  1.00 0.00 ? 290 SER A O    1  
ATOM   691   C  CB   . SER B 2 32  ? -11.778 -1.380  -4.672  1.00 0.00 ? 290 SER A CB   1  
ATOM   692   O  OG   . SER B 2 32  ? -11.723 -1.305  -6.084  1.00 0.00 ? 290 SER A OG   1  
ATOM   693   H  H    . SER B 2 32  ? -11.682 -4.176  -4.605  1.00 0.00 ? 290 SER A H    1  
ATOM   694   H  HA   . SER B 2 32  ? -9.759  -1.971  -4.436  1.00 0.00 ? 290 SER A HA   1  
ATOM   695   H  HB2  . SER B 2 32  ? -12.759 -1.712  -4.371  1.00 0.00 ? 290 SER A HB2  1  
ATOM   696   H  HB3  . SER B 2 32  ? -11.594 -0.399  -4.269  1.00 0.00 ? 290 SER A HB3  1  
ATOM   697   H  HG   . SER B 2 32  ? -12.228 -0.545  -6.384  1.00 0.00 ? 290 SER A HG   1  
ATOM   698   N  N    . GLY B 2 33  ? -10.362 -1.264  -1.990  1.00 0.00 ? 291 GLY A N    1  
ATOM   699   C  CA   . GLY B 2 33  ? -10.367 -1.153  -0.531  1.00 0.00 ? 291 GLY A CA   1  
ATOM   700   C  C    . GLY B 2 33  ? -10.620 0.269   -0.045  1.00 0.00 ? 291 GLY A C    1  
ATOM   701   O  O    . GLY B 2 33  ? -10.214 1.214   -0.690  1.00 0.00 ? 291 GLY A O    1  
ATOM   702   H  H    . GLY B 2 33  ? -10.024 -0.516  -2.535  1.00 0.00 ? 291 GLY A H    1  
ATOM   703   H  HA2  . GLY B 2 33  ? -11.122 -1.807  -0.125  1.00 0.00 ? 291 GLY A HA2  1  
ATOM   704   H  HA3  . GLY B 2 33  ? -9.397  -1.466  -0.168  1.00 0.00 ? 291 GLY A HA3  1  
ATOM   705   N  N    . HIS B 2 34  ? -11.286 0.457   1.090   1.00 0.00 ? 292 HIS A N    1  
ATOM   706   C  CA   . HIS B 2 34  ? -11.489 1.824   1.569   1.00 0.00 ? 292 HIS A CA   1  
ATOM   707   C  C    . HIS B 2 34  ? -10.189 2.270   2.207   1.00 0.00 ? 292 HIS A C    1  
ATOM   708   O  O    . HIS B 2 34  ? -9.737  1.624   3.147   1.00 0.00 ? 292 HIS A O    1  
ATOM   709   C  CB   . HIS B 2 34  ? -12.588 1.923   2.630   1.00 0.00 ? 292 HIS A CB   1  
ATOM   710   C  CG   . HIS B 2 34  ? -14.007 1.959   2.116   1.00 0.00 ? 292 HIS A CG   1  
ATOM   711   N  ND1  . HIS B 2 34  ? -14.939 1.081   2.581   1.00 0.00 ? 292 HIS A ND1  1  
ATOM   712   C  CD2  . HIS B 2 34  ? -14.632 2.703   1.168   1.00 0.00 ? 292 HIS A CD2  1  
ATOM   713   C  CE1  . HIS B 2 34  ? -16.083 1.255   1.952   1.00 0.00 ? 292 HIS A CE1  1  
ATOM   714   N  NE2  . HIS B 2 34  ? -15.926 2.244   1.091   1.00 0.00 ? 292 HIS A NE2  1  
ATOM   715   H  H    . HIS B 2 34  ? -11.596 -0.308  1.619   1.00 0.00 ? 292 HIS A H    1  
ATOM   716   H  HA   . HIS B 2 34  ? -11.727 2.452   0.723   1.00 0.00 ? 292 HIS A HA   1  
ATOM   717   H  HB2  . HIS B 2 34  ? -12.497 1.062   3.271   1.00 0.00 ? 292 HIS A HB2  1  
ATOM   718   H  HB3  . HIS B 2 34  ? -12.422 2.804   3.226   1.00 0.00 ? 292 HIS A HB3  1  
ATOM   719   H  HD2  . HIS B 2 34  ? -14.195 3.478   0.563   1.00 0.00 ? 292 HIS A HD2  1  
ATOM   720   H  HE1  . HIS B 2 34  ? -16.949 0.627   2.035   1.00 0.00 ? 292 HIS A HE1  1  
ATOM   721   H  HE2  . HIS B 2 34  ? -16.596 2.536   0.437   1.00 0.00 ? 292 HIS A HE2  1  
ATOM   722   N  N    . PRO B 2 35  ? -9.560  3.359   1.742   1.00 0.00 ? 293 PRO A N    1  
ATOM   723   C  CA   . PRO B 2 35  ? -8.299  3.803   2.325   1.00 0.00 ? 293 PRO A CA   1  
ATOM   724   C  C    . PRO B 2 35  ? -8.360  3.832   3.850   1.00 0.00 ? 293 PRO A C    1  
ATOM   725   O  O    . PRO B 2 35  ? -7.451  3.346   4.530   1.00 0.00 ? 293 PRO A O    1  
ATOM   726   C  CB   . PRO B 2 35  ? -8.123  5.208   1.763   1.00 0.00 ? 293 PRO A CB   1  
ATOM   727   C  CG   . PRO B 2 35  ? -8.870  5.211   0.472   1.00 0.00 ? 293 PRO A CG   1  
ATOM   728   C  CD   . PRO B 2 35  ? -9.979  4.198   0.604   1.00 0.00 ? 293 PRO A CD   1  
ATOM   729   H  HA   . PRO B 2 35  ? -7.480  3.170   2.005   1.00 0.00 ? 293 PRO A HA   1  
ATOM   730   H  HB2  . PRO B 2 35  ? -8.528  5.931   2.455   1.00 0.00 ? 293 PRO A HB2  1  
ATOM   731   H  HB3  . PRO B 2 35  ? -7.075  5.399   1.608   1.00 0.00 ? 293 PRO A HB3  1  
ATOM   732   H  HG2  . PRO B 2 35  ? -9.283  6.192   0.292   1.00 0.00 ? 293 PRO A HG2  1  
ATOM   733   H  HG3  . PRO B 2 35  ? -8.206  4.932   -0.334  1.00 0.00 ? 293 PRO A HG3  1  
ATOM   734   H  HD2  . PRO B 2 35  ? -10.917 4.690   0.813   1.00 0.00 ? 293 PRO A HD2  1  
ATOM   735   H  HD3  . PRO B 2 35  ? -10.051 3.609   -0.301  1.00 0.00 ? 293 PRO A HD3  1  
ATOM   736   N  N    . THR B 2 36  ? -9.444  4.385   4.383   1.00 0.00 ? 294 THR A N    1  
ATOM   737   C  CA   . THR B 2 36  ? -9.629  4.452   5.825   1.00 0.00 ? 294 THR A CA   1  
ATOM   738   C  C    . THR B 2 36  ? -9.671  3.048   6.419   1.00 0.00 ? 294 THR A C    1  
ATOM   739   O  O    . THR B 2 36  ? -9.265  2.830   7.560   1.00 0.00 ? 294 THR A O    1  
ATOM   740   C  CB   . THR B 2 36  ? -10.924 5.197   6.191   1.00 0.00 ? 294 THR A CB   1  
ATOM   741   O  OG1  . THR B 2 36  ? -12.052 4.567   5.572   1.00 0.00 ? 294 THR A OG1  1  
ATOM   742   C  CG2  . THR B 2 36  ? -10.841 6.646   5.757   1.00 0.00 ? 294 THR A CG2  1  
ATOM   743   H  H    . THR B 2 36  ? -10.133 4.756   3.793   1.00 0.00 ? 294 THR A H    1  
ATOM   744   H  HA   . THR B 2 36  ? -8.794  4.994   6.247   1.00 0.00 ? 294 THR A HA   1  
ATOM   745   H  HB   . THR B 2 36  ? -11.045 5.170   7.262   1.00 0.00 ? 294 THR A HB   1  
ATOM   746   H  HG1  . THR B 2 36  ? -12.434 5.160   4.922   1.00 0.00 ? 294 THR A HG1  1  
ATOM   747   H  HG21 . THR B 2 36  ? -10.004 7.112   6.252   1.00 0.00 ? 294 THR A HG21 1  
ATOM   748   H  HG22 . THR B 2 36  ? -11.753 7.158   6.027   1.00 0.00 ? 294 THR A HG22 1  
ATOM   749   H  HG23 . THR B 2 36  ? -10.701 6.696   4.687   1.00 0.00 ? 294 THR A HG23 1  
ATOM   750   N  N    . CYS B 2 37  ? -10.168 2.100   5.627   1.00 0.00 ? 295 CYS A N    1  
ATOM   751   C  CA   . CYS B 2 37  ? -10.263 0.708   6.054   1.00 0.00 ? 295 CYS A CA   1  
ATOM   752   C  C    . CYS B 2 37  ? -8.906  0.020   5.998   1.00 0.00 ? 295 CYS A C    1  
ATOM   753   O  O    . CYS B 2 37  ? -8.615  -0.853  6.816   1.00 0.00 ? 295 CYS A O    1  
ATOM   754   C  CB   . CYS B 2 37  ? -11.287 -0.051  5.197   1.00 0.00 ? 295 CYS A CB   1  
ATOM   755   S  SG   . CYS B 2 37  ? -12.991 0.482   5.496   1.00 0.00 ? 295 CYS A SG   1  
ATOM   756   H  H    . CYS B 2 37  ? -10.485 2.346   4.734   1.00 0.00 ? 295 CYS A H    1  
ATOM   757   H  HA   . CYS B 2 37  ? -10.602 0.706   7.079   1.00 0.00 ? 295 CYS A HA   1  
ATOM   758   H  HB2  . CYS B 2 37  ? -11.073 0.093   4.156   1.00 0.00 ? 295 CYS A HB2  1  
ATOM   759   H  HB3  . CYS B 2 37  ? -11.231 -1.094  5.415   1.00 0.00 ? 295 CYS A HB3  1  
ATOM   760   N  N    . LEU B 2 38  ? -8.075  0.411   5.036   1.00 0.00 ? 296 LEU A N    1  
ATOM   761   C  CA   . LEU B 2 38  ? -6.747  -0.188  4.912   1.00 0.00 ? 296 LEU A CA   1  
ATOM   762   C  C    . LEU B 2 38  ? -5.741  0.483   5.843   1.00 0.00 ? 296 LEU A C    1  
ATOM   763   O  O    . LEU B 2 38  ? -4.566  0.116   5.854   1.00 0.00 ? 296 LEU A O    1  
ATOM   764   C  CB   . LEU B 2 38  ? -6.226  -0.087  3.488   1.00 0.00 ? 296 LEU A CB   1  
ATOM   765   C  CG   . LEU B 2 38  ? -7.182  -0.542  2.399   1.00 0.00 ? 296 LEU A CG   1  
ATOM   766   C  CD1  . LEU B 2 38  ? -7.528  0.633   1.516   1.00 0.00 ? 296 LEU A CD1  1  
ATOM   767   C  CD2  . LEU B 2 38  ? -6.561  -1.660  1.581   1.00 0.00 ? 296 LEU A CD2  1  
ATOM   768   H  H    . LEU B 2 38  ? -8.364  1.105   4.393   1.00 0.00 ? 296 LEU A H    1  
ATOM   769   H  HA   . LEU B 2 38  ? -6.830  -1.228  5.174   1.00 0.00 ? 296 LEU A HA   1  
ATOM   770   H  HB2  . LEU B 2 38  ? -5.970  0.944   3.300   1.00 0.00 ? 296 LEU A HB2  1  
ATOM   771   H  HB3  . LEU B 2 38  ? -5.327  -0.680  3.415   1.00 0.00 ? 296 LEU A HB3  1  
ATOM   772   H  HG   . LEU B 2 38  ? -8.092  -0.910  2.849   1.00 0.00 ? 296 LEU A HG   1  
ATOM   773   H  HD11 . LEU B 2 38  ? -8.057  0.296   0.643   1.00 0.00 ? 296 LEU A HD11 1  
ATOM   774   H  HD12 . LEU B 2 38  ? -6.625  1.127   1.215   1.00 0.00 ? 296 LEU A HD12 1  
ATOM   775   H  HD13 . LEU B 2 38  ? -8.140  1.321   2.064   1.00 0.00 ? 296 LEU A HD13 1  
ATOM   776   H  HD21 . LEU B 2 38  ? -6.656  -1.428  0.534   1.00 0.00 ? 296 LEU A HD21 1  
ATOM   777   H  HD22 . LEU B 2 38  ? -7.070  -2.588  1.792   1.00 0.00 ? 296 LEU A HD22 1  
ATOM   778   H  HD23 . LEU B 2 38  ? -5.516  -1.756  1.835   1.00 0.00 ? 296 LEU A HD23 1  
ATOM   779   N  N    . GLN B 2 39  ? -6.204  1.477   6.602   1.00 0.00 ? 297 GLN A N    1  
ATOM   780   C  CA   . GLN B 2 39  ? -5.341  2.216   7.528   1.00 0.00 ? 297 GLN A CA   1  
ATOM   781   C  C    . GLN B 2 39  ? -4.394  3.119   6.752   1.00 0.00 ? 297 GLN A C    1  
ATOM   782   O  O    . GLN B 2 39  ? -3.400  3.609   7.287   1.00 0.00 ? 297 GLN A O    1  
ATOM   783   C  CB   . GLN B 2 39  ? -4.535  1.274   8.427   1.00 0.00 ? 297 GLN A CB   1  
ATOM   784   C  CG   . GLN B 2 39  ? -5.373  0.514   9.433   1.00 0.00 ? 297 GLN A CG   1  
ATOM   785   C  CD   . GLN B 2 39  ? -4.575  -0.534  10.191  1.00 0.00 ? 297 GLN A CD   1  
ATOM   786   O  OE1  . GLN B 2 39  ? -5.131  -1.521  10.671  1.00 0.00 ? 297 GLN A OE1  1  
ATOM   787   N  NE2  . GLN B 2 39  ? -3.262  -0.336  10.295  1.00 0.00 ? 297 GLN A NE2  1  
ATOM   788   H  H    . GLN B 2 39  ? -7.147  1.735   6.523   1.00 0.00 ? 297 GLN A H    1  
ATOM   789   H  HA   . GLN B 2 39  ? -5.975  2.831   8.146   1.00 0.00 ? 297 GLN A HA   1  
ATOM   790   H  HB2  . GLN B 2 39  ? -4.018  0.561   7.810   1.00 0.00 ? 297 GLN A HB2  1  
ATOM   791   H  HB3  . GLN B 2 39  ? -3.811  1.855   8.974   1.00 0.00 ? 297 GLN A HB3  1  
ATOM   792   H  HG2  . GLN B 2 39  ? -5.774  1.219   10.141  1.00 0.00 ? 297 GLN A HG2  1  
ATOM   793   H  HG3  . GLN B 2 39  ? -6.183  0.024   8.912   1.00 0.00 ? 297 GLN A HG3  1  
ATOM   794   H  HE21 . GLN B 2 39  ? -2.876  0.464   9.880   1.00 0.00 ? 297 GLN A HE21 1  
ATOM   795   H  HE22 . GLN B 2 39  ? -2.733  -1.000  10.784  1.00 0.00 ? 297 GLN A HE22 1  
ATOM   796   N  N    . PHE B 2 40  ? -4.719  3.329   5.482   1.00 0.00 ? 298 PHE A N    1  
ATOM   797   C  CA   . PHE B 2 40  ? -3.914  4.167   4.605   1.00 0.00 ? 298 PHE A CA   1  
ATOM   798   C  C    . PHE B 2 40  ? -3.791  5.589   5.139   1.00 0.00 ? 298 PHE A C    1  
ATOM   799   O  O    . PHE B 2 40  ? -4.359  5.936   6.174   1.00 0.00 ? 298 PHE A O    1  
ATOM   800   C  CB   . PHE B 2 40  ? -4.540  4.221   3.210   1.00 0.00 ? 298 PHE A CB   1  
ATOM   801   C  CG   . PHE B 2 40  ? -4.340  2.990   2.360   1.00 0.00 ? 298 PHE A CG   1  
ATOM   802   C  CD1  . PHE B 2 40  ? -3.643  1.882   2.822   1.00 0.00 ? 298 PHE A CD1  1  
ATOM   803   C  CD2  . PHE B 2 40  ? -4.847  2.963   1.072   1.00 0.00 ? 298 PHE A CD2  1  
ATOM   804   C  CE1  . PHE B 2 40  ? -3.464  0.776   2.011   1.00 0.00 ? 298 PHE A CE1  1  
ATOM   805   C  CE2  . PHE B 2 40  ? -4.667  1.864   0.259   1.00 0.00 ? 298 PHE A CE2  1  
ATOM   806   C  CZ   . PHE B 2 40  ? -3.978  0.770   0.726   1.00 0.00 ? 298 PHE A CZ   1  
ATOM   807   H  H    . PHE B 2 40  ? -5.526  2.906   5.123   1.00 0.00 ? 298 PHE A H    1  
ATOM   808   H  HA   . PHE B 2 40  ? -2.930  3.731   4.532   1.00 0.00 ? 298 PHE A HA   1  
ATOM   809   H  HB2  . PHE B 2 40  ? -5.599  4.380   3.310   1.00 0.00 ? 298 PHE A HB2  1  
ATOM   810   H  HB3  . PHE B 2 40  ? -4.115  5.060   2.676   1.00 0.00 ? 298 PHE A HB3  1  
ATOM   811   H  HD1  . PHE B 2 40  ? -3.242  1.885   3.824   1.00 0.00 ? 298 PHE A HD1  1  
ATOM   812   H  HD2  . PHE B 2 40  ? -5.382  3.820   0.702   1.00 0.00 ? 298 PHE A HD2  1  
ATOM   813   H  HE1  . PHE B 2 40  ? -2.922  -0.082  2.380   1.00 0.00 ? 298 PHE A HE1  1  
ATOM   814   H  HE2  . PHE B 2 40  ? -5.078  1.858   -0.739  1.00 0.00 ? 298 PHE A HE2  1  
ATOM   815   H  HZ   . PHE B 2 40  ? -3.838  -0.088  0.087   1.00 0.00 ? 298 PHE A HZ   1  
ATOM   816   N  N    . THR B 2 41  ? -3.040  6.402   4.407   1.00 0.00 ? 299 THR A N    1  
ATOM   817   C  CA   . THR B 2 41  ? -2.836  7.800   4.754   1.00 0.00 ? 299 THR A CA   1  
ATOM   818   C  C    . THR B 2 41  ? -3.256  8.680   3.581   1.00 0.00 ? 299 THR A C    1  
ATOM   819   O  O    . THR B 2 41  ? -3.720  8.168   2.565   1.00 0.00 ? 299 THR A O    1  
ATOM   820   C  CB   . THR B 2 41  ? -1.370  8.078   5.122   1.00 0.00 ? 299 THR A CB   1  
ATOM   821   O  OG1  . THR B 2 41  ? -1.174  9.476   5.370   1.00 0.00 ? 299 THR A OG1  1  
ATOM   822   C  CG2  . THR B 2 41  ? -0.437  7.617   4.015   1.00 0.00 ? 299 THR A CG2  1  
ATOM   823   H  H    . THR B 2 41  ? -2.605  6.047   3.603   1.00 0.00 ? 299 THR A H    1  
ATOM   824   H  HA   . THR B 2 41  ? -3.451  8.027   5.610   1.00 0.00 ? 299 THR A HA   1  
ATOM   825   H  HB   . THR B 2 41  ? -1.141  7.529   6.019   1.00 0.00 ? 299 THR A HB   1  
ATOM   826   H  HG1  . THR B 2 41  ? -0.295  9.732   5.083   1.00 0.00 ? 299 THR A HG1  1  
ATOM   827   H  HG21 . THR B 2 41  ? -0.749  6.643   3.665   1.00 0.00 ? 299 THR A HG21 1  
ATOM   828   H  HG22 . THR B 2 41  ? 0.572   7.556   4.396   1.00 0.00 ? 299 THR A HG22 1  
ATOM   829   H  HG23 . THR B 2 41  ? -0.471  8.321   3.197   1.00 0.00 ? 299 THR A HG23 1  
ATOM   830   N  N    . LEU B 2 42  ? -3.100  9.990   3.707   1.00 0.00 ? 300 LEU A N    1  
ATOM   831   C  CA   . LEU B 2 42  ? -3.489  10.892  2.628   1.00 0.00 ? 300 LEU A CA   1  
ATOM   832   C  C    . LEU B 2 42  ? -2.570  10.743  1.420   1.00 0.00 ? 300 LEU A C    1  
ATOM   833   O  O    . LEU B 2 42  ? -3.043  10.664  0.293   1.00 0.00 ? 300 LEU A O    1  
ATOM   834   C  CB   . LEU B 2 42  ? -3.508  12.343  3.116   1.00 0.00 ? 300 LEU A CB   1  
ATOM   835   C  CG   . LEU B 2 42  ? -4.444  13.281  2.341   1.00 0.00 ? 300 LEU A CG   1  
ATOM   836   C  CD1  . LEU B 2 42  ? -3.863  13.616  0.982   1.00 0.00 ? 300 LEU A CD1  1  
ATOM   837   C  CD2  . LEU B 2 42  ? -5.820  12.660  2.181   1.00 0.00 ? 300 LEU A CD2  1  
ATOM   838   H  H    . LEU B 2 42  ? -2.726  10.358  4.534   1.00 0.00 ? 300 LEU A H    1  
ATOM   839   H  HA   . LEU B 2 42  ? -4.486  10.618  2.319   1.00 0.00 ? 300 LEU A HA   1  
ATOM   840   H  HB2  . LEU B 2 42  ? -3.807  12.346  4.154   1.00 0.00 ? 300 LEU A HB2  1  
ATOM   841   H  HB3  . LEU B 2 42  ? -2.505  12.736  3.047   1.00 0.00 ? 300 LEU A HB3  1  
ATOM   842   H  HG   . LEU B 2 42  ? -4.559  14.195  2.892   1.00 0.00 ? 300 LEU A HG   1  
ATOM   843   H  HD11 . LEU B 2 42  ? -3.750  12.707  0.416   1.00 0.00 ? 300 LEU A HD11 1  
ATOM   844   H  HD12 . LEU B 2 42  ? -2.899  14.087  1.107   1.00 0.00 ? 300 LEU A HD12 1  
ATOM   845   H  HD13 . LEU B 2 42  ? -4.529  14.287  0.460   1.00 0.00 ? 300 LEU A HD13 1  
ATOM   846   H  HD21 . LEU B 2 42  ? -6.090  12.164  3.095   1.00 0.00 ? 300 LEU A HD21 1  
ATOM   847   H  HD22 . LEU B 2 42  ? -5.802  11.944  1.373   1.00 0.00 ? 300 LEU A HD22 1  
ATOM   848   H  HD23 . LEU B 2 42  ? -6.542  13.433  1.963   1.00 0.00 ? 300 LEU A HD23 1  
ATOM   849   N  N    . ASN B 2 43  ? -1.262  10.697  1.650   1.00 0.00 ? 301 ASN A N    1  
ATOM   850   C  CA   . ASN B 2 43  ? -0.311  10.552  0.550   1.00 0.00 ? 301 ASN A CA   1  
ATOM   851   C  C    . ASN B 2 43  ? -0.531  9.233   -0.174  1.00 0.00 ? 301 ASN A C    1  
ATOM   852   O  O    . ASN B 2 43  ? -0.467  9.177   -1.394  1.00 0.00 ? 301 ASN A O    1  
ATOM   853   C  CB   . ASN B 2 43  ? 1.121   10.623  1.061   1.00 0.00 ? 301 ASN A CB   1  
ATOM   854   C  CG   . ASN B 2 43  ? 2.051   11.318  0.089   1.00 0.00 ? 301 ASN A CG   1  
ATOM   855   O  OD1  . ASN B 2 43  ? 1.814   11.327  -1.119  1.00 0.00 ? 301 ASN A OD1  1  
ATOM   856   N  ND2  . ASN B 2 43  ? 3.121   11.897  0.613   1.00 0.00 ? 301 ASN A ND2  1  
ATOM   857   H  H    . ASN B 2 43  ? -0.931  10.757  2.570   1.00 0.00 ? 301 ASN A H    1  
ATOM   858   H  HA   . ASN B 2 43  ? -0.479  11.357  -0.152  1.00 0.00 ? 301 ASN A HA   1  
ATOM   859   H  HB2  . ASN B 2 43  ? 1.143   11.155  1.997   1.00 0.00 ? 301 ASN A HB2  1  
ATOM   860   H  HB3  . ASN B 2 43  ? 1.481   9.624   1.213   1.00 0.00 ? 301 ASN A HB3  1  
ATOM   861   H  HD21 . ASN B 2 43  ? 3.248   11.845  1.584   1.00 0.00 ? 301 ASN A HD21 1  
ATOM   862   H  HD22 . ASN B 2 43  ? 3.742   12.349  0.010   1.00 0.00 ? 301 ASN A HD22 1  
ATOM   863   N  N    . MET B 2 44  ? -0.769  8.172   0.588   1.00 0.00 ? 302 MET A N    1  
ATOM   864   C  CA   . MET B 2 44  ? -1.027  6.859   0.007   1.00 0.00 ? 302 MET A CA   1  
ATOM   865   C  C    . MET B 2 44  ? -2.317  6.886   -0.772  1.00 0.00 ? 302 MET A C    1  
ATOM   866   O  O    . MET B 2 44  ? -2.337  6.578   -1.946  1.00 0.00 ? 302 MET A O    1  
ATOM   867   C  CB   . MET B 2 44  ? -1.124  5.807   1.100   1.00 0.00 ? 302 MET A CB   1  
ATOM   868   C  CG   . MET B 2 44  ? -2.196  4.765   0.867   1.00 0.00 ? 302 MET A CG   1  
ATOM   869   S  SD   . MET B 2 44  ? -1.620  3.382   -0.112  1.00 0.00 ? 302 MET A SD   1  
ATOM   870   C  CE   . MET B 2 44  ? -0.574  2.593   1.090   1.00 0.00 ? 302 MET A CE   1  
ATOM   871   H  H    . MET B 2 44  ? -0.772  8.273   1.562   1.00 0.00 ? 302 MET A H    1  
ATOM   872   H  HA   . MET B 2 44  ? -0.216  6.601   -0.659  1.00 0.00 ? 302 MET A HA   1  
ATOM   873   H  HB2  . MET B 2 44  ? -0.182  5.296   1.178   1.00 0.00 ? 302 MET A HB2  1  
ATOM   874   H  HB3  . MET B 2 44  ? -1.332  6.298   2.025   1.00 0.00 ? 302 MET A HB3  1  
ATOM   875   H  HG2  . MET B 2 44  ? -2.513  4.393   1.818   1.00 0.00 ? 302 MET A HG2  1  
ATOM   876   H  HG3  . MET B 2 44  ? -3.036  5.218   0.367   1.00 0.00 ? 302 MET A HG3  1  
ATOM   877   H  HE1  . MET B 2 44  ? 0.120   1.952   0.587   1.00 0.00 ? 302 MET A HE1  1  
ATOM   878   H  HE2  . MET B 2 44  ? -1.178  2.010   1.768   1.00 0.00 ? 302 MET A HE2  1  
ATOM   879   H  HE3  . MET B 2 44  ? -0.035  3.345   1.643   1.00 0.00 ? 302 MET A HE3  1  
ATOM   880   N  N    . THR B 2 45  ? -3.387  7.288   -0.105  1.00 0.00 ? 303 THR A N    1  
ATOM   881   C  CA   . THR B 2 45  ? -4.693  7.327   -0.729  1.00 0.00 ? 303 THR A CA   1  
ATOM   882   C  C    . THR B 2 45  ? -4.596  8.123   -2.016  1.00 0.00 ? 303 THR A C    1  
ATOM   883   O  O    . THR B 2 45  ? -4.865  7.612   -3.092  1.00 0.00 ? 303 THR A O    1  
ATOM   884   C  CB   . THR B 2 45  ? -5.731  7.963   0.217   1.00 0.00 ? 303 THR A CB   1  
ATOM   885   O  OG1  . THR B 2 45  ? -5.861  7.170   1.401   1.00 0.00 ? 303 THR A OG1  1  
ATOM   886   C  CG2  . THR B 2 45  ? -7.088  8.103   -0.454  1.00 0.00 ? 303 THR A CG2  1  
ATOM   887   H  H    . THR B 2 45  ? -3.289  7.584   0.818   1.00 0.00 ? 303 THR A H    1  
ATOM   888   H  HA   . THR B 2 45  ? -4.997  6.312   -0.952  1.00 0.00 ? 303 THR A HA   1  
ATOM   889   H  HB   . THR B 2 45  ? -5.381  8.946   0.494   1.00 0.00 ? 303 THR A HB   1  
ATOM   890   H  HG1  . THR B 2 45  ? -6.333  7.671   2.071   1.00 0.00 ? 303 THR A HG1  1  
ATOM   891   H  HG21 . THR B 2 45  ? -7.440  7.132   -0.784  1.00 0.00 ? 303 THR A HG21 1  
ATOM   892   H  HG22 . THR B 2 45  ? -6.999  8.761   -1.305  1.00 0.00 ? 303 THR A HG22 1  
ATOM   893   H  HG23 . THR B 2 45  ? -7.794  8.519   0.250   1.00 0.00 ? 303 THR A HG23 1  
ATOM   894   N  N    . GLU B 2 46  ? -4.143  9.355   -1.890  1.00 0.00 ? 304 GLU A N    1  
ATOM   895   C  CA   . GLU B 2 46  ? -3.958  10.234  -3.031  1.00 0.00 ? 304 GLU A CA   1  
ATOM   896   C  C    . GLU B 2 46  ? -3.106  9.556   -4.107  1.00 0.00 ? 304 GLU A C    1  
ATOM   897   O  O    . GLU B 2 46  ? -3.488  9.504   -5.278  1.00 0.00 ? 304 GLU A O    1  
ATOM   898   C  CB   . GLU B 2 46  ? -3.312  11.529  -2.547  1.00 0.00 ? 304 GLU A CB   1  
ATOM   899   C  CG   . GLU B 2 46  ? -2.355  12.128  -3.516  1.00 0.00 ? 304 GLU A CG   1  
ATOM   900   C  CD   . GLU B 2 46  ? -0.975  12.352  -2.927  1.00 0.00 ? 304 GLU A CD   1  
ATOM   901   O  OE1  . GLU B 2 46  ? -0.769  13.402  -2.281  1.00 0.00 ? 304 GLU A OE1  1  
ATOM   902   O  OE2  . GLU B 2 46  ? -0.101  11.479  -3.111  1.00 0.00 ? 304 GLU A OE2  1  
ATOM   903   H  H    . GLU B 2 46  ? -3.928  9.690   -0.997  1.00 0.00 ? 304 GLU A H    1  
ATOM   904   H  HA   . GLU B 2 46  ? -4.915  10.466  -3.454  1.00 0.00 ? 304 GLU A HA   1  
ATOM   905   H  HB2  . GLU B 2 46  ? -4.087  12.253  -2.354  1.00 0.00 ? 304 GLU A HB2  1  
ATOM   906   H  HB3  . GLU B 2 46  ? -2.782  11.347  -1.643  1.00 0.00 ? 304 GLU A HB3  1  
ATOM   907   H  HG2  . GLU B 2 46  ? -2.273  11.477  -4.359  1.00 0.00 ? 304 GLU A HG2  1  
ATOM   908   H  HG3  . GLU B 2 46  ? -2.756  13.053  -3.814  1.00 0.00 ? 304 GLU A HG3  1  
ATOM   909   N  N    . ALA B 2 47  ? -1.955  9.042   -3.698  1.00 0.00 ? 305 ALA A N    1  
ATOM   910   C  CA   . ALA B 2 47  ? -1.037  8.369   -4.621  1.00 0.00 ? 305 ALA A CA   1  
ATOM   911   C  C    . ALA B 2 47  ? -1.735  7.261   -5.390  1.00 0.00 ? 305 ALA A C    1  
ATOM   912   O  O    . ALA B 2 47  ? -1.863  7.306   -6.611  1.00 0.00 ? 305 ALA A O    1  
ATOM   913   C  CB   . ALA B 2 47  ? 0.136   7.769   -3.850  1.00 0.00 ? 305 ALA A CB   1  
ATOM   914   H  H    . ALA B 2 47  ? -1.712  9.129   -2.753  1.00 0.00 ? 305 ALA A H    1  
ATOM   915   H  HA   . ALA B 2 47  ? -0.650  9.100   -5.314  1.00 0.00 ? 305 ALA A HA   1  
ATOM   916   H  HB1  . ALA B 2 47  ? -0.195  6.884   -3.294  1.00 0.00 ? 305 ALA A HB1  1  
ATOM   917   H  HB2  . ALA B 2 47  ? 0.526   8.502   -3.160  1.00 0.00 ? 305 ALA A HB2  1  
ATOM   918   H  HB3  . ALA B 2 47  ? 0.912   7.484   -4.545  1.00 0.00 ? 305 ALA A HB3  1  
ATOM   919   N  N    . VAL B 2 48  ? -2.205  6.290   -4.636  1.00 0.00 ? 306 VAL A N    1  
ATOM   920   C  CA   . VAL B 2 48  ? -2.888  5.126   -5.159  1.00 0.00 ? 306 VAL A CA   1  
ATOM   921   C  C    . VAL B 2 48  ? -4.141  5.486   -5.941  1.00 0.00 ? 306 VAL A C    1  
ATOM   922   O  O    . VAL B 2 48  ? -4.616  4.702   -6.764  1.00 0.00 ? 306 VAL A O    1  
ATOM   923   C  CB   . VAL B 2 48  ? -3.243  4.196   -4.008  1.00 0.00 ? 306 VAL A CB   1  
ATOM   924   C  CG1  . VAL B 2 48  ? -2.005  3.899   -3.182  1.00 0.00 ? 306 VAL A CG1  1  
ATOM   925   C  CG2  . VAL B 2 48  ? -4.334  4.789   -3.153  1.00 0.00 ? 306 VAL A CG2  1  
ATOM   926   H  H    . VAL B 2 48  ? -2.078  6.355   -3.673  1.00 0.00 ? 306 VAL A H    1  
ATOM   927   H  HA   . VAL B 2 48  ? -2.217  4.599   -5.800  1.00 0.00 ? 306 VAL A HA   1  
ATOM   928   H  HB   . VAL B 2 48  ? -3.600  3.275   -4.415  1.00 0.00 ? 306 VAL A HB   1  
ATOM   929   H  HG11 . VAL B 2 48  ? -2.244  3.163   -2.422  1.00 0.00 ? 306 VAL A HG11 1  
ATOM   930   H  HG12 . VAL B 2 48  ? -1.659  4.805   -2.710  1.00 0.00 ? 306 VAL A HG12 1  
ATOM   931   H  HG13 . VAL B 2 48  ? -1.230  3.511   -3.826  1.00 0.00 ? 306 VAL A HG13 1  
ATOM   932   H  HG21 . VAL B 2 48  ? -4.730  4.015   -2.531  1.00 0.00 ? 306 VAL A HG21 1  
ATOM   933   H  HG22 . VAL B 2 48  ? -5.117  5.185   -3.783  1.00 0.00 ? 306 VAL A HG22 1  
ATOM   934   H  HG23 . VAL B 2 48  ? -3.931  5.576   -2.539  1.00 0.00 ? 306 VAL A HG23 1  
ATOM   935   N  N    . LYS B 2 49  ? -4.672  6.669   -5.683  1.00 0.00 ? 307 LYS A N    1  
ATOM   936   C  CA   . LYS B 2 49  ? -5.868  7.124   -6.366  1.00 0.00 ? 307 LYS A CA   1  
ATOM   937   C  C    . LYS B 2 49  ? -5.588  7.414   -7.825  1.00 0.00 ? 307 LYS A C    1  
ATOM   938   O  O    . LYS B 2 49  ? -6.350  7.036   -8.715  1.00 0.00 ? 307 LYS A O    1  
ATOM   939   C  CB   . LYS B 2 49  ? -6.405  8.356   -5.703  1.00 0.00 ? 307 LYS A CB   1  
ATOM   940   C  CG   . LYS B 2 49  ? -7.164  7.991   -4.481  1.00 0.00 ? 307 LYS A CG   1  
ATOM   941   C  CD   . LYS B 2 49  ? -8.541  8.583   -4.482  1.00 0.00 ? 307 LYS A CD   1  
ATOM   942   C  CE   . LYS B 2 49  ? -9.063  8.493   -3.089  1.00 0.00 ? 307 LYS A CE   1  
ATOM   943   N  NZ   . LYS B 2 49  ? -10.059 9.553   -2.770  1.00 0.00 ? 307 LYS A NZ   1  
ATOM   944   H  H    . LYS B 2 49  ? -4.248  7.251   -5.019  1.00 0.00 ? 307 LYS A H    1  
ATOM   945   H  HA   . LYS B 2 49  ? -6.612  6.358   -6.263  1.00 0.00 ? 307 LYS A HA   1  
ATOM   946   H  HB2  . LYS B 2 49  ? -5.587  8.995   -5.433  1.00 0.00 ? 307 LYS A HB2  1  
ATOM   947   H  HB3  . LYS B 2 49  ? -7.072  8.877   -6.369  1.00 0.00 ? 307 LYS A HB3  1  
ATOM   948   H  HG2  . LYS B 2 49  ? -7.249  6.915   -4.433  1.00 0.00 ? 307 LYS A HG2  1  
ATOM   949   H  HG3  . LYS B 2 49  ? -6.625  8.345   -3.621  1.00 0.00 ? 307 LYS A HG3  1  
ATOM   950   H  HD2  . LYS B 2 49  ? -8.490  9.616   -4.794  1.00 0.00 ? 307 LYS A HD2  1  
ATOM   951   H  HD3  . LYS B 2 49  ? -9.180  8.019   -5.144  1.00 0.00 ? 307 LYS A HD3  1  
ATOM   952   H  HE2  . LYS B 2 49  ? -9.503  7.521   -2.944  1.00 0.00 ? 307 LYS A HE2  1  
ATOM   953   H  HE3  . LYS B 2 49  ? -8.214  8.588   -2.451  1.00 0.00 ? 307 LYS A HE3  1  
ATOM   954   H  HZ1  . LYS B 2 49  ? -10.410 9.431   -1.798  1.00 0.00 ? 307 LYS A HZ1  1  
ATOM   955   H  HZ2  . LYS B 2 49  ? -10.863 9.498   -3.426  1.00 0.00 ? 307 LYS A HZ2  1  
ATOM   956   H  HZ3  . LYS B 2 49  ? -9.621  10.492  -2.854  1.00 0.00 ? 307 LYS A HZ3  1  
ATOM   957   N  N    . THR B 2 50  ? -4.473  8.093   -8.049  1.00 0.00 ? 308 THR A N    1  
ATOM   958   C  CA   . THR B 2 50  ? -4.062  8.483   -9.390  1.00 0.00 ? 308 THR A CA   1  
ATOM   959   C  C    . THR B 2 50  ? -3.253  7.408   -10.122 1.00 0.00 ? 308 THR A C    1  
ATOM   960   O  O    . THR B 2 50  ? -3.383  7.278   -11.339 1.00 0.00 ? 308 THR A O    1  
ATOM   961   C  CB   . THR B 2 50  ? -3.249  9.792   -9.365  1.00 0.00 ? 308 THR A CB   1  
ATOM   962   O  OG1  . THR B 2 50  ? -2.622  10.006  -10.635 1.00 0.00 ? 308 THR A OG1  1  
ATOM   963   C  CG2  . THR B 2 50  ? -2.195  9.760   -8.270  1.00 0.00 ? 308 THR A CG2  1  
ATOM   964   H  H    . THR B 2 50  ? -3.918  8.352   -7.281  1.00 0.00 ? 308 THR A H    1  
ATOM   965   H  HA   . THR B 2 50  ? -4.961  8.671   -9.957  1.00 0.00 ? 308 THR A HA   1  
ATOM   966   H  HB   . THR B 2 50  ? -3.926  10.610  -9.166  1.00 0.00 ? 308 THR A HB   1  
ATOM   967   H  HG1  . THR B 2 50  ? -2.245  10.888  -10.660 1.00 0.00 ? 308 THR A HG1  1  
ATOM   968   H  HG21 . THR B 2 50  ? -2.680  9.713   -7.305  1.00 0.00 ? 308 THR A HG21 1  
ATOM   969   H  HG22 . THR B 2 50  ? -1.590  10.654  -8.326  1.00 0.00 ? 308 THR A HG22 1  
ATOM   970   H  HG23 . THR B 2 50  ? -1.566  8.891   -8.399  1.00 0.00 ? 308 THR A HG23 1  
ATOM   971   N  N    . TYR B 2 51  ? -2.421  6.632   -9.414  1.00 0.00 ? 309 TYR A N    1  
ATOM   972   C  CA   . TYR B 2 51  ? -1.622  5.619   -10.107 1.00 0.00 ? 309 TYR A CA   1  
ATOM   973   C  C    . TYR B 2 51  ? -2.110  4.181   -9.860  1.00 0.00 ? 309 TYR A C    1  
ATOM   974   O  O    . TYR B 2 51  ? -3.244  3.961   -9.435  1.00 0.00 ? 309 TYR A O    1  
ATOM   975   C  CB   . TYR B 2 51  ? -0.118  5.805   -9.827  1.00 0.00 ? 309 TYR A CB   1  
ATOM   976   C  CG   . TYR B 2 51  ? 0.463   4.959   -8.724  1.00 0.00 ? 309 TYR A CG   1  
ATOM   977   C  CD1  . TYR B 2 51  ? -0.029  5.042   -7.442  1.00 0.00 ? 309 TYR A CD1  1  
ATOM   978   C  CD2  . TYR B 2 51  ? 1.525   4.097   -8.971  1.00 0.00 ? 309 TYR A CD2  1  
ATOM   979   C  CE1  . TYR B 2 51  ? 0.514   4.289   -6.420  1.00 0.00 ? 309 TYR A CE1  1  
ATOM   980   C  CE2  . TYR B 2 51  ? 2.073   3.334   -7.961  1.00 0.00 ? 309 TYR A CE2  1  
ATOM   981   C  CZ   . TYR B 2 51  ? 1.565   3.434   -6.686  1.00 0.00 ? 309 TYR A CZ   1  
ATOM   982   O  OH   . TYR B 2 51  ? 2.111   2.679   -5.673  1.00 0.00 ? 309 TYR A OH   1  
ATOM   983   H  H    . TYR B 2 51  ? -2.345  6.743   -8.441  1.00 0.00 ? 309 TYR A H    1  
ATOM   984   H  HA   . TYR B 2 51  ? -1.769  5.810   -11.152 1.00 0.00 ? 309 TYR A HA   1  
ATOM   985   H  HB2  . TYR B 2 51  ? 0.430   5.574   -10.727 1.00 0.00 ? 309 TYR A HB2  1  
ATOM   986   H  HB3  . TYR B 2 51  ? 0.058   6.841   -9.572  1.00 0.00 ? 309 TYR A HB3  1  
ATOM   987   H  HD1  . TYR B 2 51  ? -0.856  5.704   -7.251  1.00 0.00 ? 309 TYR A HD1  1  
ATOM   988   H  HD2  . TYR B 2 51  ? 1.920   4.024   -9.973  1.00 0.00 ? 309 TYR A HD2  1  
ATOM   989   H  HE1  . TYR B 2 51  ? 0.120   4.373   -5.423  1.00 0.00 ? 309 TYR A HE1  1  
ATOM   990   H  HE2  . TYR B 2 51  ? 2.895   2.666   -8.172  1.00 0.00 ? 309 TYR A HE2  1  
ATOM   991   H  HH   . TYR B 2 51  ? 1.410   2.243   -5.184  1.00 0.00 ? 309 TYR A HH   1  
ATOM   992   N  N    . LYS B 2 52  ? -1.234  3.216   -10.133 1.00 0.00 ? 310 LYS A N    1  
ATOM   993   C  CA   . LYS B 2 52  ? -1.557  1.788   -10.047 1.00 0.00 ? 310 LYS A CA   1  
ATOM   994   C  C    . LYS B 2 52  ? -1.994  1.312   -8.663  1.00 0.00 ? 310 LYS A C    1  
ATOM   995   O  O    . LYS B 2 52  ? -3.147  0.921   -8.477  1.00 0.00 ? 310 LYS A O    1  
ATOM   996   C  CB   . LYS B 2 52  ? -0.359  0.973   -10.505 1.00 0.00 ? 310 LYS A CB   1  
ATOM   997   C  CG   . LYS B 2 52  ? 0.082   1.299   -11.910 1.00 0.00 ? 310 LYS A CG   1  
ATOM   998   C  CD   . LYS B 2 52  ? -0.585  0.409   -12.939 1.00 0.00 ? 310 LYS A CD   1  
ATOM   999   C  CE   . LYS B 2 52  ? -0.121  -1.032  -12.827 1.00 0.00 ? 310 LYS A CE   1  
ATOM   1000  N  NZ   . LYS B 2 52  ? 1.363   -1.147  -12.881 1.00 0.00 ? 310 LYS A NZ   1  
ATOM   1001  H  H    . LYS B 2 52  ? -0.319  3.472   -10.366 1.00 0.00 ? 310 LYS A H    1  
ATOM   1002  H  HA   . LYS B 2 52  ? -2.352  1.601   -10.737 1.00 0.00 ? 310 LYS A HA   1  
ATOM   1003  H  HB2  . LYS B 2 52  ? 0.457   1.166   -9.841  1.00 0.00 ? 310 LYS A HB2  1  
ATOM   1004  H  HB3  . LYS B 2 52  ? -0.605  -0.069  -10.470 1.00 0.00 ? 310 LYS A HB3  1  
ATOM   1005  H  HG2  . LYS B 2 52  ? -0.188  2.314   -12.119 1.00 0.00 ? 310 LYS A HG2  1  
ATOM   1006  H  HG3  . LYS B 2 52  ? 1.148   1.177   -11.975 1.00 0.00 ? 310 LYS A HG3  1  
ATOM   1007  H  HD2  . LYS B 2 52  ? -1.647  0.445   -12.779 1.00 0.00 ? 310 LYS A HD2  1  
ATOM   1008  H  HD3  . LYS B 2 52  ? -0.353  0.779   -13.927 1.00 0.00 ? 310 LYS A HD3  1  
ATOM   1009  H  HE2  . LYS B 2 52  ? -0.471  -1.433  -11.889 1.00 0.00 ? 310 LYS A HE2  1  
ATOM   1010  H  HE3  . LYS B 2 52  ? -0.548  -1.598  -13.641 1.00 0.00 ? 310 LYS A HE3  1  
ATOM   1011  H  HZ1  . LYS B 2 52  ? 1.720   -0.747  -13.772 1.00 0.00 ? 310 LYS A HZ1  1  
ATOM   1012  H  HZ2  . LYS B 2 52  ? 1.646   -2.146  -12.825 1.00 0.00 ? 310 LYS A HZ2  1  
ATOM   1013  H  HZ3  . LYS B 2 52  ? 1.791   -0.632  -12.085 1.00 0.00 ? 310 LYS A HZ3  1  
ATOM   1014  N  N    . TRP B 2 53  ? -1.058  1.331   -7.713  1.00 0.00 ? 311 TRP A N    1  
ATOM   1015  C  CA   . TRP B 2 53  ? -1.296  0.851   -6.346  1.00 0.00 ? 311 TRP A CA   1  
ATOM   1016  C  C    . TRP B 2 53  ? -1.198  -0.671  -6.311  1.00 0.00 ? 311 TRP A C    1  
ATOM   1017  O  O    . TRP B 2 53  ? -0.377  -1.222  -5.583  1.00 0.00 ? 311 TRP A O    1  
ATOM   1018  C  CB   . TRP B 2 53  ? -2.646  1.323   -5.769  1.00 0.00 ? 311 TRP A CB   1  
ATOM   1019  C  CG   . TRP B 2 53  ? -3.034  0.632   -4.495  1.00 0.00 ? 311 TRP A CG   1  
ATOM   1020  C  CD1  . TRP B 2 53  ? -2.498  0.825   -3.259  1.00 0.00 ? 311 TRP A CD1  1  
ATOM   1021  C  CD2  . TRP B 2 53  ? -4.049  -0.359  -4.337  1.00 0.00 ? 311 TRP A CD2  1  
ATOM   1022  N  NE1  . TRP B 2 53  ? -3.122  0.025   -2.340  1.00 0.00 ? 311 TRP A NE1  1  
ATOM   1023  C  CE2  . TRP B 2 53  ? -4.076  -0.713  -2.976  1.00 0.00 ? 311 TRP A CE2  1  
ATOM   1024  C  CE3  . TRP B 2 53  ? -4.937  -0.977  -5.212  1.00 0.00 ? 311 TRP A CE3  1  
ATOM   1025  C  CZ2  . TRP B 2 53  ? -4.958  -1.655  -2.470  1.00 0.00 ? 311 TRP A CZ2  1  
ATOM   1026  C  CZ3  . TRP B 2 53  ? -5.816  -1.919  -4.709  1.00 0.00 ? 311 TRP A CZ3  1  
ATOM   1027  C  CH2  . TRP B 2 53  ? -5.823  -2.249  -3.347  1.00 0.00 ? 311 TRP A CH2  1  
ATOM   1028  H  H    . TRP B 2 53  ? -0.171  1.679   -7.938  1.00 0.00 ? 311 TRP A H    1  
ATOM   1029  H  HA   . TRP B 2 53  ? -0.500  1.250   -5.731  1.00 0.00 ? 311 TRP A HA   1  
ATOM   1030  H  HB2  . TRP B 2 53  ? -2.587  2.371   -5.562  1.00 0.00 ? 311 TRP A HB2  1  
ATOM   1031  H  HB3  . TRP B 2 53  ? -3.432  1.161   -6.480  1.00 0.00 ? 311 TRP A HB3  1  
ATOM   1032  H  HD1  . TRP B 2 53  ? -1.703  1.518   -3.046  1.00 0.00 ? 311 TRP A HD1  1  
ATOM   1033  H  HE1  . TRP B 2 53  ? -2.915  -0.012  -1.383  1.00 0.00 ? 311 TRP A HE1  1  
ATOM   1034  H  HE3  . TRP B 2 53  ? -4.941  -0.733  -6.265  1.00 0.00 ? 311 TRP A HE3  1  
ATOM   1035  H  HZ2  . TRP B 2 53  ? -4.972  -1.910  -1.423  1.00 0.00 ? 311 TRP A HZ2  1  
ATOM   1036  H  HZ3  . TRP B 2 53  ? -6.516  -2.408  -5.369  1.00 0.00 ? 311 TRP A HZ3  1  
ATOM   1037  H  HH2  . TRP B 2 53  ? -6.526  -2.991  -2.997  1.00 0.00 ? 311 TRP A HH2  1  
ATOM   1038  N  N    . GLN B 2 54  ? -2.018  -1.340  -7.123  1.00 0.00 ? 312 GLN A N    1  
ATOM   1039  C  CA   . GLN B 2 54  ? -2.023  -2.804  -7.194  1.00 0.00 ? 312 GLN A CA   1  
ATOM   1040  C  C    . GLN B 2 54  ? -2.242  -3.418  -5.821  1.00 0.00 ? 312 GLN A C    1  
ATOM   1041  O  O    . GLN B 2 54  ? -1.418  -3.253  -4.929  1.00 0.00 ? 312 GLN A O    1  
ATOM   1042  C  CB   . GLN B 2 54  ? -0.701  -3.332  -7.768  1.00 0.00 ? 312 GLN A CB   1  
ATOM   1043  C  CG   . GLN B 2 54  ? -0.193  -2.538  -8.962  1.00 0.00 ? 312 GLN A CG   1  
ATOM   1044  C  CD   . GLN B 2 54  ? 1.182   -2.984  -9.422  1.00 0.00 ? 312 GLN A CD   1  
ATOM   1045  O  OE1  . GLN B 2 54  ? 1.503   -2.918  -10.608 1.00 0.00 ? 312 GLN A OE1  1  
ATOM   1046  N  NE2  . GLN B 2 54  ? 2.006   -3.436  -8.483  1.00 0.00 ? 312 GLN A NE2  1  
ATOM   1047  H  H    . GLN B 2 54  ? -2.638  -0.837  -7.691  1.00 0.00 ? 312 GLN A H    1  
ATOM   1048  H  HA   . GLN B 2 54  ? -2.832  -3.104  -7.843  1.00 0.00 ? 312 GLN A HA   1  
ATOM   1049  H  HB2  . GLN B 2 54  ? 0.057   -3.313  -6.993  1.00 0.00 ? 312 GLN A HB2  1  
ATOM   1050  H  HB3  . GLN B 2 54  ? -0.845  -4.355  -8.082  1.00 0.00 ? 312 GLN A HB3  1  
ATOM   1051  H  HG2  . GLN B 2 54  ? -0.885  -2.663  -9.781  1.00 0.00 ? 312 GLN A HG2  1  
ATOM   1052  H  HG3  . GLN B 2 54  ? -0.145  -1.494  -8.690  1.00 0.00 ? 312 GLN A HG3  1  
ATOM   1053  H  HE21 . GLN B 2 54  ? 1.687   -3.456  -7.556  1.00 0.00 ? 312 GLN A HE21 1  
ATOM   1054  H  HE22 . GLN B 2 54  ? 2.901   -3.730  -8.754  1.00 0.00 ? 312 GLN A HE22 1  
ATOM   1055  N  N    . CYS B 2 55  ? -3.350  -4.130  -5.649  1.00 0.00 ? 313 CYS A N    1  
ATOM   1056  C  CA   . CYS B 2 55  ? -3.627  -4.775  -4.376  1.00 0.00 ? 313 CYS A CA   1  
ATOM   1057  C  C    . CYS B 2 55  ? -2.408  -5.572  -3.945  1.00 0.00 ? 313 CYS A C    1  
ATOM   1058  O  O    . CYS B 2 55  ? -1.535  -5.879  -4.757  1.00 0.00 ? 313 CYS A O    1  
ATOM   1059  C  CB   . CYS B 2 55  ? -4.858  -5.677  -4.465  1.00 0.00 ? 313 CYS A CB   1  
ATOM   1060  S  SG   . CYS B 2 55  ? -4.521  -7.348  -5.099  1.00 0.00 ? 313 CYS A SG   1  
ATOM   1061  H  H    . CYS B 2 55  ? -3.987  -4.216  -6.382  1.00 0.00 ? 313 CYS A H    1  
ATOM   1062  H  HA   . CYS B 2 55  ? -3.805  -4.001  -3.645  1.00 0.00 ? 313 CYS A HA   1  
ATOM   1063  H  HB2  . CYS B 2 55  ? -5.288  -5.783  -3.480  1.00 0.00 ? 313 CYS A HB2  1  
ATOM   1064  H  HB3  . CYS B 2 55  ? -5.582  -5.217  -5.118  1.00 0.00 ? 313 CYS A HB3  1  
ATOM   1065  N  N    . ILE B 2 56  ? -2.359  -5.919  -2.678  1.00 0.00 ? 314 ILE A N    1  
ATOM   1066  C  CA   . ILE B 2 56  ? -1.218  -6.632  -2.141  1.00 0.00 ? 314 ILE A CA   1  
ATOM   1067  C  C    . ILE B 2 56  ? -1.059  -8.024  -2.740  1.00 0.00 ? 314 ILE A C    1  
ATOM   1068  O  O    . ILE B 2 56  ? 0.040   -8.579  -2.754  1.00 0.00 ? 314 ILE A O    1  
ATOM   1069  C  CB   . ILE B 2 56  ? -1.308  -6.723  -0.618  1.00 0.00 ? 314 ILE A CB   1  
ATOM   1070  C  CG1  . ILE B 2 56  ? -0.147  -7.506  -0.044  1.00 0.00 ? 314 ILE A CG1  1  
ATOM   1071  C  CG2  . ILE B 2 56  ? -2.600  -7.387  -0.223  1.00 0.00 ? 314 ILE A CG2  1  
ATOM   1072  C  CD1  . ILE B 2 56  ? 1.218   -7.001  -0.405  1.00 0.00 ? 314 ILE A CD1  1  
ATOM   1073  H  H    . ILE B 2 56  ? -3.116  -5.712  -2.091  1.00 0.00 ? 314 ILE A H    1  
ATOM   1074  H  HA   . ILE B 2 56  ? -0.345  -6.062  -2.381  1.00 0.00 ? 314 ILE A HA   1  
ATOM   1075  H  HB   . ILE B 2 56  ? -1.296  -5.731  -0.213  1.00 0.00 ? 314 ILE A HB   1  
ATOM   1076  H  HG12 . ILE B 2 56  ? -0.231  -7.508  1.016   1.00 0.00 ? 314 ILE A HG12 1  
ATOM   1077  H  HG13 . ILE B 2 56  ? -0.208  -8.491  -0.386  1.00 0.00 ? 314 ILE A HG13 1  
ATOM   1078  H  HG21 . ILE B 2 56  ? -2.534  -8.424  -0.487  1.00 0.00 ? 314 ILE A HG21 1  
ATOM   1079  H  HG22 . ILE B 2 56  ? -3.424  -6.926  -0.749  1.00 0.00 ? 314 ILE A HG22 1  
ATOM   1080  H  HG23 . ILE B 2 56  ? -2.749  -7.292  0.842   1.00 0.00 ? 314 ILE A HG23 1  
ATOM   1081  H  HD11 . ILE B 2 56  ? 1.237   -5.936  -0.284  1.00 0.00 ? 314 ILE A HD11 1  
ATOM   1082  H  HD12 . ILE B 2 56  ? 1.439   -7.250  -1.435  1.00 0.00 ? 314 ILE A HD12 1  
ATOM   1083  H  HD13 . ILE B 2 56  ? 1.956   -7.451  0.241   1.00 0.00 ? 314 ILE A HD13 1  
ATOM   1084  N  N    . GLU B 2 57  ? -2.146  -8.589  -3.239  1.00 0.00 ? 315 GLU A N    1  
ATOM   1085  C  CA   . GLU B 2 57  ? -2.090  -9.910  -3.828  1.00 0.00 ? 315 GLU A CA   1  
ATOM   1086  C  C    . GLU B 2 57  ? -1.363  -9.883  -5.174  1.00 0.00 ? 315 GLU A C    1  
ATOM   1087  O  O    . GLU B 2 57  ? -0.888  -10.913 -5.652  1.00 0.00 ? 315 GLU A O    1  
ATOM   1088  C  CB   . GLU B 2 57  ? -3.495  -10.485 -3.986  1.00 0.00 ? 315 GLU A CB   1  
ATOM   1089  C  CG   . GLU B 2 57  ? -4.326  -10.409 -2.716  1.00 0.00 ? 315 GLU A CG   1  
ATOM   1090  C  CD   . GLU B 2 57  ? -5.587  -11.247 -2.794  1.00 0.00 ? 315 GLU A CD   1  
ATOM   1091  O  OE1  . GLU B 2 57  ? -6.571  -10.782 -3.403  1.00 0.00 ? 315 GLU A OE1  1  
ATOM   1092  O  OE2  . GLU B 2 57  ? -5.588  -12.369 -2.246  1.00 0.00 ? 315 GLU A OE2  1  
ATOM   1093  H  H    . GLU B 2 57  ? -2.997  -8.118  -3.200  1.00 0.00 ? 315 GLU A H    1  
ATOM   1094  H  HA   . GLU B 2 57  ? -1.534  -10.531 -3.148  1.00 0.00 ? 315 GLU A HA   1  
ATOM   1095  H  HB2  . GLU B 2 57  ? -4.011  -9.943  -4.763  1.00 0.00 ? 315 GLU A HB2  1  
ATOM   1096  H  HB3  . GLU B 2 57  ? -3.414  -11.520 -4.272  1.00 0.00 ? 315 GLU A HB3  1  
ATOM   1097  H  HG2  . GLU B 2 57  ? -3.729  -10.761 -1.888  1.00 0.00 ? 315 GLU A HG2  1  
ATOM   1098  H  HG3  . GLU B 2 57  ? -4.605  -9.379  -2.545  1.00 0.00 ? 315 GLU A HG3  1  
ATOM   1099  N  N    . CYS B 2 58  ? -1.280  -8.698  -5.779  1.00 0.00 ? 316 CYS A N    1  
ATOM   1100  C  CA   . CYS B 2 58  ? -0.603  -8.534  -7.063  1.00 0.00 ? 316 CYS A CA   1  
ATOM   1101  C  C    . CYS B 2 58  ? 0.655   -7.685  -6.904  1.00 0.00 ? 316 CYS A C    1  
ATOM   1102  O  O    . CYS B 2 58  ? 1.294   -7.307  -7.887  1.00 0.00 ? 316 CYS A O    1  
ATOM   1103  C  CB   . CYS B 2 58  ? -1.531  -7.870  -8.070  1.00 0.00 ? 316 CYS A CB   1  
ATOM   1104  S  SG   . CYS B 2 58  ? -3.129  -8.717  -8.312  1.00 0.00 ? 316 CYS A SG   1  
ATOM   1105  H  H    . CYS B 2 58  ? -1.689  -7.916  -5.357  1.00 0.00 ? 316 CYS A H    1  
ATOM   1106  H  HA   . CYS B 2 58  ? -0.326  -9.512  -7.426  1.00 0.00 ? 316 CYS A HA   1  
ATOM   1107  H  HB2  . CYS B 2 58  ? -1.744  -6.864  -7.738  1.00 0.00 ? 316 CYS A HB2  1  
ATOM   1108  H  HB3  . CYS B 2 58  ? -1.031  -7.825  -9.017  1.00 0.00 ? 316 CYS A HB3  1  
ATOM   1109  N  N    . LYS B 2 59  ? 0.973   -7.374  -5.653  1.00 0.00 ? 317 LYS A N    1  
ATOM   1110  C  CA   . LYS B 2 59  ? 2.131   -6.582  -5.281  1.00 0.00 ? 317 LYS A CA   1  
ATOM   1111  C  C    . LYS B 2 59  ? 3.370   -6.867  -6.125  1.00 0.00 ? 317 LYS A C    1  
ATOM   1112  O  O    . LYS B 2 59  ? 3.451   -7.868  -6.836  1.00 0.00 ? 317 LYS A O    1  
ATOM   1113  C  CB   . LYS B 2 59  ? 2.466   -6.885  -3.840  1.00 0.00 ? 317 LYS A CB   1  
ATOM   1114  C  CG   . LYS B 2 59  ? 2.938   -5.679  -3.107  1.00 0.00 ? 317 LYS A CG   1  
ATOM   1115  C  CD   . LYS B 2 59  ? 1.778   -4.976  -2.476  1.00 0.00 ? 317 LYS A CD   1  
ATOM   1116  C  CE   . LYS B 2 59  ? 1.140   -3.976  -3.383  1.00 0.00 ? 317 LYS A CE   1  
ATOM   1117  N  NZ   . LYS B 2 59  ? -0.124  -3.447  -2.810  1.00 0.00 ? 317 LYS A NZ   1  
ATOM   1118  H  H    . LYS B 2 59  ? 0.390   -7.676  -4.937  1.00 0.00 ? 317 LYS A H    1  
ATOM   1119  H  HA   . LYS B 2 59  ? 1.869   -5.530  -5.351  1.00 0.00 ? 317 LYS A HA   1  
ATOM   1120  H  HB2  . LYS B 2 59  ? 1.581   -7.248  -3.346  1.00 0.00 ? 317 LYS A HB2  1  
ATOM   1121  H  HB3  . LYS B 2 59  ? 3.238   -7.638  -3.800  1.00 0.00 ? 317 LYS A HB3  1  
ATOM   1122  H  HG2  . LYS B 2 59  ? 3.644   -5.968  -2.348  1.00 0.00 ? 317 LYS A HG2  1  
ATOM   1123  H  HG3  . LYS B 2 59  ? 3.395   -5.025  -3.803  1.00 0.00 ? 317 LYS A HG3  1  
ATOM   1124  H  HD2  . LYS B 2 59  ? 1.045   -5.703  -2.214  1.00 0.00 ? 317 LYS A HD2  1  
ATOM   1125  H  HD3  . LYS B 2 59  ? 2.118   -4.482  -1.607  1.00 0.00 ? 317 LYS A HD3  1  
ATOM   1126  H  HE2  . LYS B 2 59  ? 1.829   -3.176  -3.508  1.00 0.00 ? 317 LYS A HE2  1  
ATOM   1127  H  HE3  . LYS B 2 59  ? 0.936   -4.440  -4.333  1.00 0.00 ? 317 LYS A HE3  1  
ATOM   1128  H  HZ1  . LYS B 2 59  ? -0.443  -2.618  -3.351  1.00 0.00 ? 317 LYS A HZ1  1  
ATOM   1129  H  HZ2  . LYS B 2 59  ? 0.023   -3.165  -1.820  1.00 0.00 ? 317 LYS A HZ2  1  
ATOM   1130  H  HZ3  . LYS B 2 59  ? -0.865  -4.176  -2.844  1.00 0.00 ? 317 LYS A HZ3  1  
ATOM   1131  N  N    . SER B 2 60  ? 4.346   -5.971  -6.003  1.00 0.00 ? 318 SER A N    1  
ATOM   1132  C  CA   . SER B 2 60  ? 5.619   -6.097  -6.704  1.00 0.00 ? 318 SER A CA   1  
ATOM   1133  C  C    . SER B 2 60  ? 6.571   -4.988  -6.304  1.00 0.00 ? 318 SER A C    1  
ATOM   1134  O  O    . SER B 2 60  ? 6.163   -3.939  -5.804  1.00 0.00 ? 318 SER A O    1  
ATOM   1135  C  CB   . SER B 2 60  ? 5.455   -6.099  -8.217  1.00 0.00 ? 318 SER A CB   1  
ATOM   1136  O  OG   . SER B 2 60  ? 4.147   -5.716  -8.604  1.00 0.00 ? 318 SER A OG   1  
ATOM   1137  H  H    . SER B 2 60  ? 4.205   -5.197  -5.416  1.00 0.00 ? 318 SER A H    1  
ATOM   1138  H  HA   . SER B 2 60  ? 6.058   -7.034  -6.412  1.00 0.00 ? 318 SER A HA   1  
ATOM   1139  H  HB2  . SER B 2 60  ? 6.161   -5.408  -8.639  1.00 0.00 ? 318 SER A HB2  1  
ATOM   1140  H  HB3  . SER B 2 60  ? 5.664   -7.089  -8.594  1.00 0.00 ? 318 SER A HB3  1  
ATOM   1141  H  HG   . SER B 2 60  ? 3.904   -6.176  -9.412  1.00 0.00 ? 318 SER A HG   1  
ATOM   1142  N  N    . CYS B 2 61  ? 7.843   -5.243  -6.535  1.00 0.00 ? 319 CYS A N    1  
ATOM   1143  C  CA   . CYS B 2 61  ? 8.900   -4.306  -6.213  1.00 0.00 ? 319 CYS A CA   1  
ATOM   1144  C  C    . CYS B 2 61  ? 9.047   -3.235  -7.288  1.00 0.00 ? 319 CYS A C    1  
ATOM   1145  O  O    . CYS B 2 61  ? 9.610   -3.498  -8.340  1.00 0.00 ? 319 CYS A O    1  
ATOM   1146  C  CB   . CYS B 2 61  ? 10.206  -5.073  -6.108  1.00 0.00 ? 319 CYS A CB   1  
ATOM   1147  S  SG   . CYS B 2 61  ? 11.615  -4.138  -5.416  1.00 0.00 ? 319 CYS A SG   1  
ATOM   1148  H  H    . CYS B 2 61  ? 8.085   -6.104  -6.933  1.00 0.00 ? 319 CYS A H    1  
ATOM   1149  H  HA   . CYS B 2 61  ? 8.683   -3.852  -5.261  1.00 0.00 ? 319 CYS A HA   1  
ATOM   1150  H  HB2  . CYS B 2 61  ? 10.050  -5.945  -5.496  1.00 0.00 ? 319 CYS A HB2  1  
ATOM   1151  H  HB3  . CYS B 2 61  ? 10.489  -5.400  -7.091  1.00 0.00 ? 319 CYS A HB3  1  
ATOM   1152  N  N    . ILE B 2 62  ? 8.544   -2.031  -7.041  1.00 0.00 ? 320 ILE A N    1  
ATOM   1153  C  CA   . ILE B 2 62  ? 8.705   -0.947  -8.012  1.00 0.00 ? 320 ILE A CA   1  
ATOM   1154  C  C    . ILE B 2 62  ? 10.140  -0.986  -8.520  1.00 0.00 ? 320 ILE A C    1  
ATOM   1155  O  O    . ILE B 2 62  ? 10.438  -0.614  -9.656  1.00 0.00 ? 320 ILE A O    1  
ATOM   1156  C  CB   . ILE B 2 62  ? 8.416   0.435   -7.374  1.00 0.00 ? 320 ILE A CB   1  
ATOM   1157  C  CG1  . ILE B 2 62  ? 9.481   1.468   -7.774  1.00 0.00 ? 320 ILE A CG1  1  
ATOM   1158  C  CG2  . ILE B 2 62  ? 8.347   0.288   -5.878  1.00 0.00 ? 320 ILE A CG2  1  
ATOM   1159  C  CD1  . ILE B 2 62  ? 9.414   2.757   -7.004  1.00 0.00 ? 320 ILE A CD1  1  
ATOM   1160  H  H    . ILE B 2 62  ? 8.065   -1.869  -6.205  1.00 0.00 ? 320 ILE A H    1  
ATOM   1161  H  HA   . ILE B 2 62  ? 8.022   -1.112  -8.835  1.00 0.00 ? 320 ILE A HA   1  
ATOM   1162  H  HB   . ILE B 2 62  ? 7.454   0.777   -7.708  1.00 0.00 ? 320 ILE A HB   1  
ATOM   1163  H  HG12 . ILE B 2 62  ? 10.454  1.050   -7.610  1.00 0.00 ? 320 ILE A HG12 1  
ATOM   1164  H  HG13 . ILE B 2 62  ? 9.365   1.705   -8.815  1.00 0.00 ? 320 ILE A HG13 1  
ATOM   1165  H  HG21 . ILE B 2 62  ? 9.321   -0.002  -5.506  1.00 0.00 ? 320 ILE A HG21 1  
ATOM   1166  H  HG22 . ILE B 2 62  ? 7.620   -0.469  -5.622  1.00 0.00 ? 320 ILE A HG22 1  
ATOM   1167  H  HG23 . ILE B 2 62  ? 8.059   1.228   -5.438  1.00 0.00 ? 320 ILE A HG23 1  
ATOM   1168  H  HD11 . ILE B 2 62  ? 8.617   2.688   -6.290  1.00 0.00 ? 320 ILE A HD11 1  
ATOM   1169  H  HD12 . ILE B 2 62  ? 9.223   3.575   -7.683  1.00 0.00 ? 320 ILE A HD12 1  
ATOM   1170  H  HD13 . ILE B 2 62  ? 10.348  2.922   -6.489  1.00 0.00 ? 320 ILE A HD13 1  
ATOM   1171  N  N    . LEU B 2 63  ? 11.016  -1.453  -7.636  1.00 0.00 ? 321 LEU A N    1  
ATOM   1172  C  CA   . LEU B 2 63  ? 12.430  -1.593  -7.924  1.00 0.00 ? 321 LEU A CA   1  
ATOM   1173  C  C    . LEU B 2 63  ? 12.657  -2.782  -8.863  1.00 0.00 ? 321 LEU A C    1  
ATOM   1174  O  O    . LEU B 2 63  ? 13.242  -2.632  -9.935  1.00 0.00 ? 321 LEU A O    1  
ATOM   1175  C  CB   . LEU B 2 63  ? 13.189  -1.746  -6.599  1.00 0.00 ? 321 LEU A CB   1  
ATOM   1176  C  CG   . LEU B 2 63  ? 12.777  -0.769  -5.474  1.00 0.00 ? 321 LEU A CG   1  
ATOM   1177  C  CD1  . LEU B 2 63  ? 13.934  -0.474  -4.550  1.00 0.00 ? 321 LEU A CD1  1  
ATOM   1178  C  CD2  . LEU B 2 63  ? 12.227  0.539   -5.995  1.00 0.00 ? 321 LEU A CD2  1  
ATOM   1179  H  H    . LEU B 2 63  ? 10.693  -1.707  -6.741  1.00 0.00 ? 321 LEU A H    1  
ATOM   1180  H  HA   . LEU B 2 63  ? 12.759  -0.692  -8.416  1.00 0.00 ? 321 LEU A HA   1  
ATOM   1181  H  HB2  . LEU B 2 63  ? 13.025  -2.746  -6.234  1.00 0.00 ? 321 LEU A HB2  1  
ATOM   1182  H  HB3  . LEU B 2 63  ? 14.234  -1.633  -6.787  1.00 0.00 ? 321 LEU A HB3  1  
ATOM   1183  H  HG   . LEU B 2 63  ? 11.993  -1.231  -4.882  1.00 0.00 ? 321 LEU A HG   1  
ATOM   1184  H  HD11 . LEU B 2 63  ? 13.780  -0.981  -3.604  1.00 0.00 ? 321 LEU A HD11 1  
ATOM   1185  H  HD12 . LEU B 2 63  ? 13.999  0.591   -4.381  1.00 0.00 ? 321 LEU A HD12 1  
ATOM   1186  H  HD13 . LEU B 2 63  ? 14.851  -0.823  -4.999  1.00 0.00 ? 321 LEU A HD13 1  
ATOM   1187  H  HD21 . LEU B 2 63  ? 11.288  0.715   -5.509  1.00 0.00 ? 321 LEU A HD21 1  
ATOM   1188  H  HD22 . LEU B 2 63  ? 12.083  0.489   -7.062  1.00 0.00 ? 321 LEU A HD22 1  
ATOM   1189  H  HD23 . LEU B 2 63  ? 12.910  1.341   -5.759  1.00 0.00 ? 321 LEU A HD23 1  
ATOM   1190  N  N    . CYS B 2 64  ? 12.192  -3.963  -8.452  1.00 0.00 ? 322 CYS A N    1  
ATOM   1191  C  CA   . CYS B 2 64  ? 12.298  -5.165  -9.284  1.00 0.00 ? 322 CYS A CA   1  
ATOM   1192  C  C    . CYS B 2 64  ? 11.065  -5.304  -10.162 1.00 0.00 ? 322 CYS A C    1  
ATOM   1193  O  O    . CYS B 2 64  ? 11.148  -5.304  -11.391 1.00 0.00 ? 322 CYS A O    1  
ATOM   1194  C  CB   . CYS B 2 64  ? 12.404  -6.439  -8.443  1.00 0.00 ? 322 CYS A CB   1  
ATOM   1195  S  SG   . CYS B 2 64  ? 13.864  -6.550  -7.376  1.00 0.00 ? 322 CYS A SG   1  
ATOM   1196  H  H    . CYS B 2 64  ? 11.782  -4.029  -7.569  1.00 0.00 ? 322 CYS A H    1  
ATOM   1197  H  HA   . CYS B 2 64  ? 13.171  -5.076  -9.907  1.00 0.00 ? 322 CYS A HA   1  
ATOM   1198  H  HB2  . CYS B 2 64  ? 11.535  -6.515  -7.810  1.00 0.00 ? 322 CYS A HB2  1  
ATOM   1199  H  HB3  . CYS B 2 64  ? 12.425  -7.287  -9.111  1.00 0.00 ? 322 CYS A HB3  1  
ATOM   1200  N  N    . GLY B 2 65  ? 9.918   -5.421  -9.501  1.00 0.00 ? 323 GLY A N    1  
ATOM   1201  C  CA   . GLY B 2 65  ? 8.664   -5.592  -10.190 1.00 0.00 ? 323 GLY A CA   1  
ATOM   1202  C  C    . GLY B 2 65  ? 8.384   -7.056  -10.376 1.00 0.00 ? 323 GLY A C    1  
ATOM   1203  O  O    . GLY B 2 65  ? 7.797   -7.468  -11.378 1.00 0.00 ? 323 GLY A O    1  
ATOM   1204  H  H    . GLY B 2 65  ? 9.925   -5.387  -8.522  1.00 0.00 ? 323 GLY A H    1  
ATOM   1205  H  HA2  . GLY B 2 65  ? 7.874   -5.143  -9.605  1.00 0.00 ? 323 GLY A HA2  1  
ATOM   1206  H  HA3  . GLY B 2 65  ? 8.714   -5.113  -11.156 1.00 0.00 ? 323 GLY A HA3  1  
ATOM   1207  N  N    . THR B 2 66  ? 8.811   -7.850  -9.396  1.00 0.00 ? 324 THR A N    1  
ATOM   1208  C  CA   . THR B 2 66  ? 8.648   -9.286  -9.473  1.00 0.00 ? 324 THR A CA   1  
ATOM   1209  C  C    . THR B 2 66  ? 8.004   -9.862  -8.222  1.00 0.00 ? 324 THR A C    1  
ATOM   1210  O  O    . THR B 2 66  ? 7.583   -11.019 -8.206  1.00 0.00 ? 324 THR A O    1  
ATOM   1211  C  CB   . THR B 2 66  ? 10.012  -9.930  -9.670  1.00 0.00 ? 324 THR A CB   1  
ATOM   1212  O  OG1  . THR B 2 66  ? 9.883   -11.340 -9.864  1.00 0.00 ? 324 THR A OG1  1  
ATOM   1213  C  CG2  . THR B 2 66  ? 10.916  -9.619  -8.493  1.00 0.00 ? 324 THR A CG2  1  
ATOM   1214  H  H    . THR B 2 66  ? 9.257   -7.456  -8.598  1.00 0.00 ? 324 THR A H    1  
ATOM   1215  H  HA   . THR B 2 66  ? 8.043   -9.516  -10.333 1.00 0.00 ? 324 THR A HA   1  
ATOM   1216  H  HB   . THR B 2 66  ? 10.449  -9.497  -10.536 1.00 0.00 ? 324 THR A HB   1  
ATOM   1217  H  HG1  . THR B 2 66  ? 10.685  -11.683 -10.264 1.00 0.00 ? 324 THR A HG1  1  
ATOM   1218  H  HG21 . THR B 2 66  ? 10.995  -8.544  -8.392  1.00 0.00 ? 324 THR A HG21 1  
ATOM   1219  H  HG22 . THR B 2 66  ? 11.895  -10.040 -8.668  1.00 0.00 ? 324 THR A HG22 1  
ATOM   1220  H  HG23 . THR B 2 66  ? 10.497  -10.037 -7.592  1.00 0.00 ? 324 THR A HG23 1  
ATOM   1221  N  N    . SER B 2 67  ? 7.942   -9.045  -7.178  1.00 0.00 ? 325 SER A N    1  
ATOM   1222  C  CA   . SER B 2 67  ? 7.371   -9.453  -5.901  1.00 0.00 ? 325 SER A CA   1  
ATOM   1223  C  C    . SER B 2 67  ? 7.984   -10.765 -5.411  1.00 0.00 ? 325 SER A C    1  
ATOM   1224  O  O    . SER B 2 67  ? 7.440   -11.414 -4.521  1.00 0.00 ? 325 SER A O    1  
ATOM   1225  C  CB   . SER B 2 67  ? 5.845   -9.586  -5.984  1.00 0.00 ? 325 SER A CB   1  
ATOM   1226  O  OG   . SER B 2 67  ? 5.445   -10.329 -7.122  1.00 0.00 ? 325 SER A OG   1  
ATOM   1227  H  H    . SER B 2 67  ? 8.291   -8.134  -7.270  1.00 0.00 ? 325 SER A H    1  
ATOM   1228  H  HA   . SER B 2 67  ? 7.609   -8.678  -5.191  1.00 0.00 ? 325 SER A HA   1  
ATOM   1229  H  HB2  . SER B 2 67  ? 5.487   -10.092 -5.101  1.00 0.00 ? 325 SER A HB2  1  
ATOM   1230  H  HB3  . SER B 2 67  ? 5.401   -8.603  -6.035  1.00 0.00 ? 325 SER A HB3  1  
ATOM   1231  H  HG   . SER B 2 67  ? 5.420   -11.263 -6.902  1.00 0.00 ? 325 SER A HG   1  
ATOM   1232  N  N    . GLU B 2 68  ? 9.117   -11.150 -6.001  1.00 0.00 ? 326 GLU A N    1  
ATOM   1233  C  CA   . GLU B 2 68  ? 9.802   -12.389 -5.623  1.00 0.00 ? 326 GLU A CA   1  
ATOM   1234  C  C    . GLU B 2 68  ? 10.020  -12.495 -4.118  1.00 0.00 ? 326 GLU A C    1  
ATOM   1235  O  O    . GLU B 2 68  ? 9.259   -13.159 -3.413  1.00 0.00 ? 326 GLU A O    1  
ATOM   1236  C  CB   . GLU B 2 68  ? 11.150  -12.486 -6.327  1.00 0.00 ? 326 GLU A CB   1  
ATOM   1237  C  CG   . GLU B 2 68  ? 11.043  -12.835 -7.785  1.00 0.00 ? 326 GLU A CG   1  
ATOM   1238  C  CD   . GLU B 2 68  ? 10.841  -14.318 -8.024  1.00 0.00 ? 326 GLU A CD   1  
ATOM   1239  O  OE1  . GLU B 2 68  ? 9.678   -14.772 -7.988  1.00 0.00 ? 326 GLU A OE1  1  
ATOM   1240  O  OE2  . GLU B 2 68  ? 11.846  -15.025 -8.248  1.00 0.00 ? 326 GLU A OE2  1  
ATOM   1241  H  H    . GLU B 2 68  ? 9.494   -10.596 -6.724  1.00 0.00 ? 326 GLU A H    1  
ATOM   1242  H  HA   . GLU B 2 68  ? 9.189   -13.213 -5.942  1.00 0.00 ? 326 GLU A HA   1  
ATOM   1243  H  HB2  . GLU B 2 68  ? 11.650  -11.540 -6.245  1.00 0.00 ? 326 GLU A HB2  1  
ATOM   1244  H  HB3  . GLU B 2 68  ? 11.743  -13.241 -5.849  1.00 0.00 ? 326 GLU A HB3  1  
ATOM   1245  H  HG2  . GLU B 2 68  ? 10.204  -12.305 -8.186  1.00 0.00 ? 326 GLU A HG2  1  
ATOM   1246  H  HG3  . GLU B 2 68  ? 11.943  -12.516 -8.286  1.00 0.00 ? 326 GLU A HG3  1  
ATOM   1247  N  N    . ASN B 2 69  ? 11.068  -11.837 -3.636  1.00 0.00 ? 327 ASN A N    1  
ATOM   1248  C  CA   . ASN B 2 69  ? 11.420  -11.876 -2.223  1.00 0.00 ? 327 ASN A CA   1  
ATOM   1249  C  C    . ASN B 2 69  ? 10.547  -10.961 -1.374  1.00 0.00 ? 327 ASN A C    1  
ATOM   1250  O  O    . ASN B 2 69  ? 11.058  -10.296 -0.491  1.00 0.00 ? 327 ASN A O    1  
ATOM   1251  C  CB   . ASN B 2 69  ? 12.887  -11.503 -2.039  1.00 0.00 ? 327 ASN A CB   1  
ATOM   1252  C  CG   . ASN B 2 69  ? 13.796  -12.195 -3.024  1.00 0.00 ? 327 ASN A CG   1  
ATOM   1253  O  OD1  . ASN B 2 69  ? 14.218  -13.333 -2.814  1.00 0.00 ? 327 ASN A OD1  1  
ATOM   1254  N  ND2  . ASN B 2 69  ? 14.113  -11.498 -4.106  1.00 0.00 ? 327 ASN A ND2  1  
ATOM   1255  H  H    . ASN B 2 69  ? 11.621  -11.308 -4.248  1.00 0.00 ? 327 ASN A H    1  
ATOM   1256  H  HA   . ASN B 2 69  ? 11.289  -12.876 -1.880  1.00 0.00 ? 327 ASN A HA   1  
ATOM   1257  H  HB2  . ASN B 2 69  ? 12.992  -10.450 -2.179  1.00 0.00 ? 327 ASN A HB2  1  
ATOM   1258  H  HB3  . ASN B 2 69  ? 13.200  -11.765 -1.039  1.00 0.00 ? 327 ASN A HB3  1  
ATOM   1259  H  HD21 . ASN B 2 69  ? 13.744  -10.595 -4.199  1.00 0.00 ? 327 ASN A HD21 1  
ATOM   1260  H  HD22 . ASN B 2 69  ? 14.706  -11.908 -4.760  1.00 0.00 ? 327 ASN A HD22 1  
ATOM   1261  N  N    . ASP B 2 70  ? 9.240   -10.919 -1.648  1.00 0.00 ? 328 ASP A N    1  
ATOM   1262  C  CA   . ASP B 2 70  ? 8.313   -10.096 -0.879  1.00 0.00 ? 328 ASP A CA   1  
ATOM   1263  C  C    . ASP B 2 70  ? 8.580   -10.146 0.617   1.00 0.00 ? 328 ASP A C    1  
ATOM   1264  O  O    . ASP B 2 70  ? 8.145   -9.267  1.362   1.00 0.00 ? 328 ASP A O    1  
ATOM   1265  C  CB   . ASP B 2 70  ? 6.877   -10.490 -1.171  1.00 0.00 ? 328 ASP A CB   1  
ATOM   1266  C  CG   . ASP B 2 70  ? 6.701   -11.990 -1.300  1.00 0.00 ? 328 ASP A CG   1  
ATOM   1267  O  OD1  . ASP B 2 70  ? 6.767   -12.686 -0.264  1.00 0.00 ? 328 ASP A OD1  1  
ATOM   1268  O  OD2  . ASP B 2 70  ? 6.499   -12.471 -2.433  1.00 0.00 ? 328 ASP A OD2  1  
ATOM   1269  H  H    . ASP B 2 70  ? 8.898   -11.405 -2.411  1.00 0.00 ? 328 ASP A H    1  
ATOM   1270  H  HA   . ASP B 2 70  ? 8.449   -9.097  -1.206  1.00 0.00 ? 328 ASP A HA   1  
ATOM   1271  H  HB2  . ASP B 2 70  ? 6.246   -10.139 -0.367  1.00 0.00 ? 328 ASP A HB2  1  
ATOM   1272  H  HB3  . ASP B 2 70  ? 6.575   -10.015 -2.095  1.00 0.00 ? 328 ASP A HB3  1  
ATOM   1273  N  N    . ASP B 2 71  ? 9.294   -11.170 1.055   1.00 0.00 ? 329 ASP A N    1  
ATOM   1274  C  CA   . ASP B 2 71  ? 9.641   -11.301 2.462   1.00 0.00 ? 329 ASP A CA   1  
ATOM   1275  C  C    . ASP B 2 71  ? 10.521  -10.125 2.865   1.00 0.00 ? 329 ASP A C    1  
ATOM   1276  O  O    . ASP B 2 71  ? 10.794  -9.902  4.044   1.00 0.00 ? 329 ASP A O    1  
ATOM   1277  C  CB   . ASP B 2 71  ? 10.365  -12.622 2.720   1.00 0.00 ? 329 ASP A CB   1  
ATOM   1278  C  CG   . ASP B 2 71  ? 9.486   -13.825 2.437   1.00 0.00 ? 329 ASP A CG   1  
ATOM   1279  O  OD1  . ASP B 2 71  ? 8.667   -14.180 3.311   1.00 0.00 ? 329 ASP A OD1  1  
ATOM   1280  O  OD2  . ASP B 2 71  ? 9.615   -14.411 1.342   1.00 0.00 ? 329 ASP A OD2  1  
ATOM   1281  H  H    . ASP B 2 71  ? 9.603   -11.841 0.415   1.00 0.00 ? 329 ASP A H    1  
ATOM   1282  H  HA   . ASP B 2 71  ? 8.727   -11.272 3.038   1.00 0.00 ? 329 ASP A HA   1  
ATOM   1283  H  HB2  . ASP B 2 71  ? 11.236  -12.679 2.085   1.00 0.00 ? 329 ASP A HB2  1  
ATOM   1284  H  HB3  . ASP B 2 71  ? 10.674  -12.660 3.754   1.00 0.00 ? 329 ASP A HB3  1  
ATOM   1285  N  N    . GLN B 2 72  ? 10.958  -9.379  1.853   1.00 0.00 ? 330 GLN A N    1  
ATOM   1286  C  CA   . GLN B 2 72  ? 11.793  -8.216  2.039   1.00 0.00 ? 330 GLN A CA   1  
ATOM   1287  C  C    . GLN B 2 72  ? 11.100  -6.997  1.462   1.00 0.00 ? 330 GLN A C    1  
ATOM   1288  O  O    . GLN B 2 72  ? 11.414  -5.866  1.807   1.00 0.00 ? 330 GLN A O    1  
ATOM   1289  C  CB   . GLN B 2 72  ? 13.133  -8.419  1.351   1.00 0.00 ? 330 GLN A CB   1  
ATOM   1290  C  CG   . GLN B 2 72  ? 13.487  -9.880  1.176   1.00 0.00 ? 330 GLN A CG   1  
ATOM   1291  C  CD   . GLN B 2 72  ? 14.967  -10.117 1.040   1.00 0.00 ? 330 GLN A CD   1  
ATOM   1292  O  OE1  . GLN B 2 72  ? 15.405  -11.023 0.331   1.00 0.00 ? 330 GLN A OE1  1  
ATOM   1293  N  NE2  . GLN B 2 72  ? 15.747  -9.309  1.735   1.00 0.00 ? 330 GLN A NE2  1  
ATOM   1294  H  H    . GLN B 2 72  ? 10.710  -9.624  0.944   1.00 0.00 ? 330 GLN A H    1  
ATOM   1295  H  HA   . GLN B 2 72  ? 11.952  -8.077  3.090   1.00 0.00 ? 330 GLN A HA   1  
ATOM   1296  H  HB2  . GLN B 2 72  ? 13.097  -7.955  0.382   1.00 0.00 ? 330 GLN A HB2  1  
ATOM   1297  H  HB3  . GLN B 2 72  ? 13.905  -7.950  1.940   1.00 0.00 ? 330 GLN A HB3  1  
ATOM   1298  H  HG2  . GLN B 2 72  ? 13.145  -10.406 2.042   1.00 0.00 ? 330 GLN A HG2  1  
ATOM   1299  H  HG3  . GLN B 2 72  ? 12.986  -10.262 0.295   1.00 0.00 ? 330 GLN A HG3  1  
ATOM   1300  H  HE21 . GLN B 2 72  ? 15.327  -8.618  2.288   1.00 0.00 ? 330 GLN A HE21 1  
ATOM   1301  H  HE22 . GLN B 2 72  ? 16.705  -9.435  1.668   1.00 0.00 ? 330 GLN A HE22 1  
ATOM   1302  N  N    . LEU B 2 73  ? 10.147  -7.230  0.577   1.00 0.00 ? 331 LEU A N    1  
ATOM   1303  C  CA   . LEU B 2 73  ? 9.428   -6.146  -0.033  1.00 0.00 ? 331 LEU A CA   1  
ATOM   1304  C  C    . LEU B 2 73  ? 8.896   -5.215  1.021   1.00 0.00 ? 331 LEU A C    1  
ATOM   1305  O  O    . LEU B 2 73  ? 8.443   -5.633  2.086   1.00 0.00 ? 331 LEU A O    1  
ATOM   1306  C  CB   . LEU B 2 73  ? 8.315   -6.674  -0.911  1.00 0.00 ? 331 LEU A CB   1  
ATOM   1307  C  CG   . LEU B 2 73  ? 8.797   -7.187  -2.261  1.00 0.00 ? 331 LEU A CG   1  
ATOM   1308  C  CD1  . LEU B 2 73  ? 7.637   -7.656  -3.084  1.00 0.00 ? 331 LEU A CD1  1  
ATOM   1309  C  CD2  . LEU B 2 73  ? 9.563   -6.121  -2.999  1.00 0.00 ? 331 LEU A CD2  1  
ATOM   1310  H  H    . LEU B 2 73  ? 9.918   -8.145  0.337   1.00 0.00 ? 331 LEU A H    1  
ATOM   1311  H  HA   . LEU B 2 73  ? 10.123  -5.599  -0.650  1.00 0.00 ? 331 LEU A HA   1  
ATOM   1312  H  HB2  . LEU B 2 73  ? 7.830   -7.488  -0.388  1.00 0.00 ? 331 LEU A HB2  1  
ATOM   1313  H  HB3  . LEU B 2 73  ? 7.598   -5.886  -1.079  1.00 0.00 ? 331 LEU A HB3  1  
ATOM   1314  H  HG   . LEU B 2 73  ? 9.446   -8.025  -2.099  1.00 0.00 ? 331 LEU A HG   1  
ATOM   1315  H  HD11 . LEU B 2 73  ? 6.747   -7.365  -2.589  1.00 0.00 ? 331 LEU A HD11 1  
ATOM   1316  H  HD12 . LEU B 2 73  ? 7.667   -8.731  -3.179  1.00 0.00 ? 331 LEU A HD12 1  
ATOM   1317  H  HD13 . LEU B 2 73  ? 7.675   -7.201  -4.063  1.00 0.00 ? 331 LEU A HD13 1  
ATOM   1318  H  HD21 . LEU B 2 73  ? 8.913   -5.300  -3.179  1.00 0.00 ? 331 LEU A HD21 1  
ATOM   1319  H  HD22 . LEU B 2 73  ? 9.916   -6.515  -3.938  1.00 0.00 ? 331 LEU A HD22 1  
ATOM   1320  H  HD23 . LEU B 2 73  ? 10.403  -5.797  -2.404  1.00 0.00 ? 331 LEU A HD23 1  
ATOM   1321  N  N    . LEU B 2 74  ? 8.973   -3.950  0.708   1.00 0.00 ? 332 LEU A N    1  
ATOM   1322  C  CA   . LEU B 2 74  ? 8.544   -2.914  1.609   1.00 0.00 ? 332 LEU A CA   1  
ATOM   1323  C  C    . LEU B 2 74  ? 7.381   -2.181  1.025   1.00 0.00 ? 332 LEU A C    1  
ATOM   1324  O  O    . LEU B 2 74  ? 7.487   -1.526  -0.003  1.00 0.00 ? 332 LEU A O    1  
ATOM   1325  C  CB   . LEU B 2 74  ? 9.674   -1.939  1.885   1.00 0.00 ? 332 LEU A CB   1  
ATOM   1326  C  CG   . LEU B 2 74  ? 10.822  -2.452  2.713   1.00 0.00 ? 332 LEU A CG   1  
ATOM   1327  C  CD1  . LEU B 2 74  ? 11.856  -1.381  2.881   1.00 0.00 ? 332 LEU A CD1  1  
ATOM   1328  C  CD2  . LEU B 2 74  ? 10.364  -2.855  4.071   1.00 0.00 ? 332 LEU A CD2  1  
ATOM   1329  H  H    . LEU B 2 74  ? 9.316   -3.705  -0.180  1.00 0.00 ? 332 LEU A H    1  
ATOM   1330  H  HA   . LEU B 2 74  ? 8.229   -3.378  2.529   1.00 0.00 ? 332 LEU A HA   1  
ATOM   1331  H  HB2  . LEU B 2 74  ? 10.067  -1.599  0.941   1.00 0.00 ? 332 LEU A HB2  1  
ATOM   1332  H  HB3  . LEU B 2 74  ? 9.263   -1.099  2.402   1.00 0.00 ? 332 LEU A HB3  1  
ATOM   1333  H  HG   . LEU B 2 74  ? 11.288  -3.290  2.245   1.00 0.00 ? 332 LEU A HG   1  
ATOM   1334  H  HD11 . LEU B 2 74  ? 11.789  -0.975  3.886   1.00 0.00 ? 332 LEU A HD11 1  
ATOM   1335  H  HD12 . LEU B 2 74  ? 11.687  -0.606  2.160   1.00 0.00 ? 332 LEU A HD12 1  
ATOM   1336  H  HD13 . LEU B 2 74  ? 12.834  -1.801  2.733   1.00 0.00 ? 332 LEU A HD13 1  
ATOM   1337  H  HD21 . LEU B 2 74  ? 11.059  -2.416  4.761   1.00 0.00 ? 332 LEU A HD21 1  
ATOM   1338  H  HD22 . LEU B 2 74  ? 10.375  -3.932  4.163   1.00 0.00 ? 332 LEU A HD22 1  
ATOM   1339  H  HD23 . LEU B 2 74  ? 9.371   -2.474  4.258   1.00 0.00 ? 332 LEU A HD23 1  
ATOM   1340  N  N    . PHE B 2 75  ? 6.287   -2.261  1.722   1.00 0.00 ? 333 PHE A N    1  
ATOM   1341  C  CA   . PHE B 2 75  ? 5.067   -1.659  1.280   1.00 0.00 ? 333 PHE A CA   1  
ATOM   1342  C  C    . PHE B 2 75  ? 4.939   -0.266  1.834   1.00 0.00 ? 333 PHE A C    1  
ATOM   1343  O  O    . PHE B 2 75  ? 4.459   -0.069  2.950   1.00 0.00 ? 333 PHE A O    1  
ATOM   1344  C  CB   . PHE B 2 75  ? 3.926   -2.559  1.737   1.00 0.00 ? 333 PHE A CB   1  
ATOM   1345  C  CG   . PHE B 2 75  ? 4.320   -4.012  1.584   1.00 0.00 ? 333 PHE A CG   1  
ATOM   1346  C  CD1  . PHE B 2 75  ? 5.089   -4.646  2.552   1.00 0.00 ? 333 PHE A CD1  1  
ATOM   1347  C  CD2  . PHE B 2 75  ? 3.978   -4.718  0.451   1.00 0.00 ? 333 PHE A CD2  1  
ATOM   1348  C  CE1  . PHE B 2 75  ? 5.503   -5.955  2.385   1.00 0.00 ? 333 PHE A CE1  1  
ATOM   1349  C  CE2  . PHE B 2 75  ? 4.396   -6.031  0.270   1.00 0.00 ? 333 PHE A CE2  1  
ATOM   1350  C  CZ   . PHE B 2 75  ? 5.164   -6.646  1.239   1.00 0.00 ? 333 PHE A CZ   1  
ATOM   1351  H  H    . PHE B 2 75  ? 6.305   -2.728  2.578   1.00 0.00 ? 333 PHE A H    1  
ATOM   1352  H  HA   . PHE B 2 75  ? 5.077   -1.617  0.203   1.00 0.00 ? 333 PHE A HA   1  
ATOM   1353  H  HB2  . PHE B 2 75  ? 3.706   -2.361  2.779   1.00 0.00 ? 333 PHE A HB2  1  
ATOM   1354  H  HB3  . PHE B 2 75  ? 3.047   -2.367  1.138   1.00 0.00 ? 333 PHE A HB3  1  
ATOM   1355  H  HD1  . PHE B 2 75  ? 5.357   -4.109  3.450   1.00 0.00 ? 333 PHE A HD1  1  
ATOM   1356  H  HD2  . PHE B 2 75  ? 3.397   -4.228  -0.304  1.00 0.00 ? 333 PHE A HD2  1  
ATOM   1357  H  HE1  . PHE B 2 75  ? 6.104   -6.432  3.146   1.00 0.00 ? 333 PHE A HE1  1  
ATOM   1358  H  HE2  . PHE B 2 75  ? 4.102   -6.583  -0.617  1.00 0.00 ? 333 PHE A HE2  1  
ATOM   1359  H  HZ   . PHE B 2 75  ? 5.507   -7.664  1.096   1.00 0.00 ? 333 PHE A HZ   1  
ATOM   1360  N  N    . CYS B 2 76  ? 5.382   0.706   1.047   1.00 0.00 ? 334 CYS A N    1  
ATOM   1361  C  CA   . CYS B 2 76  ? 5.275   2.078   1.466   1.00 0.00 ? 334 CYS A CA   1  
ATOM   1362  C  C    . CYS B 2 76  ? 3.819   2.368   1.664   1.00 0.00 ? 334 CYS A C    1  
ATOM   1363  O  O    . CYS B 2 76  ? 3.072   2.491   0.700   1.00 0.00 ? 334 CYS A O    1  
ATOM   1364  C  CB   . CYS B 2 76  ? 5.848   3.045   0.437   1.00 0.00 ? 334 CYS A CB   1  
ATOM   1365  S  SG   . CYS B 2 76  ? 5.368   4.771   0.758   1.00 0.00 ? 334 CYS A SG   1  
ATOM   1366  H  H    . CYS B 2 76  ? 5.783   0.489   0.180   1.00 0.00 ? 334 CYS A H    1  
ATOM   1367  H  HA   . CYS B 2 76  ? 5.795   2.192   2.405   1.00 0.00 ? 334 CYS A HA   1  
ATOM   1368  H  HB2  . CYS B 2 76  ? 6.927   2.989   0.454   1.00 0.00 ? 334 CYS A HB2  1  
ATOM   1369  H  HB3  . CYS B 2 76  ? 5.489   2.777   -0.546  1.00 0.00 ? 334 CYS A HB3  1  
ATOM   1370  N  N    . ASP B 2 77  ? 3.399   2.459   2.900   1.00 0.00 ? 335 ASP A N    1  
ATOM   1371  C  CA   . ASP B 2 77  ? 2.000   2.708   3.156   1.00 0.00 ? 335 ASP A CA   1  
ATOM   1372  C  C    . ASP B 2 77  ? 1.693   4.198   2.957   1.00 0.00 ? 335 ASP A C    1  
ATOM   1373  O  O    . ASP B 2 77  ? 0.885   4.792   3.671   1.00 0.00 ? 335 ASP A O    1  
ATOM   1374  C  CB   . ASP B 2 77  ? 1.608   2.221   4.548   1.00 0.00 ? 335 ASP A CB   1  
ATOM   1375  C  CG   . ASP B 2 77  ? 0.190   2.600   4.936   1.00 0.00 ? 335 ASP A CG   1  
ATOM   1376  O  OD1  . ASP B 2 77  ? -0.757  2.027   4.356   1.00 0.00 ? 335 ASP A OD1  1  
ATOM   1377  O  OD2  . ASP B 2 77  ? 0.027   3.469   5.818   1.00 0.00 ? 335 ASP A OD2  1  
ATOM   1378  H  H    . ASP B 2 77  ? 4.040   2.383   3.642   1.00 0.00 ? 335 ASP A H    1  
ATOM   1379  H  HA   . ASP B 2 77  ? 1.454   2.121   2.421   1.00 0.00 ? 335 ASP A HA   1  
ATOM   1380  H  HB2  . ASP B 2 77  ? 1.676   1.146   4.557   1.00 0.00 ? 335 ASP A HB2  1  
ATOM   1381  H  HB3  . ASP B 2 77  ? 2.289   2.633   5.275   1.00 0.00 ? 335 ASP A HB3  1  
ATOM   1382  N  N    . ASP B 2 78  ? 2.360   4.793   1.967   1.00 0.00 ? 336 ASP A N    1  
ATOM   1383  C  CA   . ASP B 2 78  ? 2.195   6.204   1.645   1.00 0.00 ? 336 ASP A CA   1  
ATOM   1384  C  C    . ASP B 2 78  ? 1.995   6.387   0.138   1.00 0.00 ? 336 ASP A C    1  
ATOM   1385  O  O    . ASP B 2 78  ? 2.027   7.505   -0.375  1.00 0.00 ? 336 ASP A O    1  
ATOM   1386  C  CB   . ASP B 2 78  ? 3.420   6.984   2.118   1.00 0.00 ? 336 ASP A CB   1  
ATOM   1387  C  CG   . ASP B 2 78  ? 3.122   8.441   2.405   1.00 0.00 ? 336 ASP A CG   1  
ATOM   1388  O  OD1  . ASP B 2 78  ? 2.316   8.714   3.318   1.00 0.00 ? 336 ASP A OD1  1  
ATOM   1389  O  OD2  . ASP B 2 78  ? 3.703   9.311   1.723   1.00 0.00 ? 336 ASP A OD2  1  
ATOM   1390  H  H    . ASP B 2 78  ? 2.984   4.265   1.437   1.00 0.00 ? 336 ASP A H    1  
ATOM   1391  H  HA   . ASP B 2 78  ? 1.318   6.564   2.162   1.00 0.00 ? 336 ASP A HA   1  
ATOM   1392  H  HB2  . ASP B 2 78  ? 3.800   6.530   3.021   1.00 0.00 ? 336 ASP A HB2  1  
ATOM   1393  H  HB3  . ASP B 2 78  ? 4.177   6.935   1.352   1.00 0.00 ? 336 ASP A HB3  1  
ATOM   1394  N  N    . CYS B 2 79  ? 1.778   5.265   -0.551  1.00 0.00 ? 337 CYS A N    1  
ATOM   1395  C  CA   . CYS B 2 79  ? 1.539   5.232   -1.987  1.00 0.00 ? 337 CYS A CA   1  
ATOM   1396  C  C    . CYS B 2 79  ? 1.454   3.781   -2.449  1.00 0.00 ? 337 CYS A C    1  
ATOM   1397  O  O    . CYS B 2 79  ? 0.952   3.498   -3.534  1.00 0.00 ? 337 CYS A O    1  
ATOM   1398  C  CB   . CYS B 2 79  ? 2.622   5.966   -2.783  1.00 0.00 ? 337 CYS A CB   1  
ATOM   1399  S  SG   . CYS B 2 79  ? 4.243   5.132   -2.813  1.00 0.00 ? 337 CYS A SG   1  
ATOM   1400  H  H    . CYS B 2 79  ? 1.759   4.422   -0.071  1.00 0.00 ? 337 CYS A H    1  
ATOM   1401  H  HA   . CYS B 2 79  ? 0.581   5.709   -2.154  1.00 0.00 ? 337 CYS A HA   1  
ATOM   1402  H  HB2  . CYS B 2 79  ? 2.292   6.067   -3.805  1.00 0.00 ? 337 CYS A HB2  1  
ATOM   1403  H  HB3  . CYS B 2 79  ? 2.759   6.946   -2.366  1.00 0.00 ? 337 CYS A HB3  1  
ATOM   1404  N  N    . ASP B 2 80  ? 1.988   2.886   -1.604  1.00 0.00 ? 338 ASP A N    1  
ATOM   1405  C  CA   . ASP B 2 80  ? 1.972   1.429   -1.825  1.00 0.00 ? 338 ASP A CA   1  
ATOM   1406  C  C    . ASP B 2 80  ? 3.230   0.877   -2.509  1.00 0.00 ? 338 ASP A C    1  
ATOM   1407  O  O    . ASP B 2 80  ? 3.495   -0.323  -2.421  1.00 0.00 ? 338 ASP A O    1  
ATOM   1408  C  CB   . ASP B 2 80  ? 0.738   1.009   -2.611  1.00 0.00 ? 338 ASP A CB   1  
ATOM   1409  C  CG   . ASP B 2 80  ? 0.633   -0.491  -2.737  1.00 0.00 ? 338 ASP A CG   1  
ATOM   1410  O  OD1  . ASP B 2 80  ? 1.230   -1.050  -3.679  1.00 0.00 ? 338 ASP A OD1  1  
ATOM   1411  O  OD2  . ASP B 2 80  ? -0.036  -1.107  -1.885  1.00 0.00 ? 338 ASP A OD2  1  
ATOM   1412  H  H    . ASP B 2 80  ? 2.415   3.223   -0.793  1.00 0.00 ? 338 ASP A H    1  
ATOM   1413  H  HA   . ASP B 2 80  ? 1.909   0.973   -0.849  1.00 0.00 ? 338 ASP A HA   1  
ATOM   1414  H  HB2  . ASP B 2 80  ? -0.146  1.375   -2.109  1.00 0.00 ? 338 ASP A HB2  1  
ATOM   1415  H  HB3  . ASP B 2 80  ? 0.788   1.435   -3.600  1.00 0.00 ? 338 ASP A HB3  1  
ATOM   1416  N  N    . ARG B 2 81  ? 3.997   1.728   -3.184  1.00 0.00 ? 339 ARG A N    1  
ATOM   1417  C  CA   . ARG B 2 81  ? 5.216   1.283   -3.872  1.00 0.00 ? 339 ARG A CA   1  
ATOM   1418  C  C    . ARG B 2 81  ? 6.020   0.289   -3.021  1.00 0.00 ? 339 ARG A C    1  
ATOM   1419  O  O    . ARG B 2 81  ? 6.459   0.617   -1.919  1.00 0.00 ? 339 ARG A O    1  
ATOM   1420  C  CB   . ARG B 2 81  ? 6.067   2.494   -4.234  1.00 0.00 ? 339 ARG A CB   1  
ATOM   1421  C  CG   . ARG B 2 81  ? 5.441   3.343   -5.325  1.00 0.00 ? 339 ARG A CG   1  
ATOM   1422  C  CD   . ARG B 2 81  ? 6.243   3.285   -6.614  1.00 0.00 ? 339 ARG A CD   1  
ATOM   1423  N  NE   . ARG B 2 81  ? 5.533   3.918   -7.723  1.00 0.00 ? 339 ARG A NE   1  
ATOM   1424  C  CZ   . ARG B 2 81  ? 5.955   3.890   -8.985  1.00 0.00 ? 339 ARG A CZ   1  
ATOM   1425  N  NH1  . ARG B 2 81  ? 7.077   3.256   -9.300  1.00 0.00 ? 339 ARG A NH1  1  
ATOM   1426  N  NH2  . ARG B 2 81  ? 5.252   4.494   -9.933  1.00 0.00 ? 339 ARG A NH2  1  
ATOM   1427  H  H    . ARG B 2 81  ? 3.743   2.673   -3.226  1.00 0.00 ? 339 ARG A H    1  
ATOM   1428  H  HA   . ARG B 2 81  ? 4.919   0.791   -4.786  1.00 0.00 ? 339 ARG A HA   1  
ATOM   1429  H  HB2  . ARG B 2 81  ? 6.197   3.108   -3.355  1.00 0.00 ? 339 ARG A HB2  1  
ATOM   1430  H  HB3  . ARG B 2 81  ? 7.031   2.158   -4.576  1.00 0.00 ? 339 ARG A HB3  1  
ATOM   1431  H  HG2  . ARG B 2 81  ? 4.442   2.979   -5.520  1.00 0.00 ? 339 ARG A HG2  1  
ATOM   1432  H  HG3  . ARG B 2 81  ? 5.393   4.367   -4.985  1.00 0.00 ? 339 ARG A HG3  1  
ATOM   1433  H  HD2  . ARG B 2 81  ? 7.190   3.803   -6.461  1.00 0.00 ? 339 ARG A HD2  1  
ATOM   1434  H  HD3  . ARG B 2 81  ? 6.432   2.250   -6.859  1.00 0.00 ? 339 ARG A HD3  1  
ATOM   1435  H  HE   . ARG B 2 81  ? 4.699   4.390   -7.517  1.00 0.00 ? 339 ARG A HE   1  
ATOM   1436  H  HH11 . ARG B 2 81  ? 7.608   2.798   -8.589  1.00 0.00 ? 339 ARG A HH11 1  
ATOM   1437  H  HH12 . ARG B 2 81  ? 7.392   3.238   -10.249 1.00 0.00 ? 339 ARG A HH12 1  
ATOM   1438  H  HH21 . ARG B 2 81  ? 4.405   4.971   -9.701  1.00 0.00 ? 339 ARG A HH21 1  
ATOM   1439  H  HH22 . ARG B 2 81  ? 5.570   4.473   -10.882 1.00 0.00 ? 339 ARG A HH22 1  
ATOM   1440  N  N    . GLY B 2 82  ? 6.209   -0.929  -3.547  1.00 0.00 ? 340 GLY A N    1  
ATOM   1441  C  CA   . GLY B 2 82  ? 6.943   -1.959  -2.816  1.00 0.00 ? 340 GLY A CA   1  
ATOM   1442  C  C    . GLY B 2 82  ? 8.404   -2.068  -3.223  1.00 0.00 ? 340 GLY A C    1  
ATOM   1443  O  O    . GLY B 2 82  ? 8.721   -2.099  -4.404  1.00 0.00 ? 340 GLY A O    1  
ATOM   1444  H  H    . GLY B 2 82  ? 5.847   -1.129  -4.435  1.00 0.00 ? 340 GLY A H    1  
ATOM   1445  H  HA2  . GLY B 2 82  ? 6.890   -1.735  -1.768  1.00 0.00 ? 340 GLY A HA2  1  
ATOM   1446  H  HA3  . GLY B 2 82  ? 6.470   -2.921  -2.982  1.00 0.00 ? 340 GLY A HA3  1  
ATOM   1447  N  N    . TYR B 2 83  ? 9.300   -2.097  -2.238  1.00 0.00 ? 341 TYR A N    1  
ATOM   1448  C  CA   . TYR B 2 83  ? 10.736  -2.238  -2.498  1.00 0.00 ? 341 TYR A CA   1  
ATOM   1449  C  C    . TYR B 2 83  ? 11.315  -3.273  -1.558  1.00 0.00 ? 341 TYR A C    1  
ATOM   1450  O  O    . TYR B 2 83  ? 11.152  -3.153  -0.353  1.00 0.00 ? 341 TYR A O    1  
ATOM   1451  C  CB   . TYR B 2 83  ? 11.574  -0.996  -2.172  1.00 0.00 ? 341 TYR A CB   1  
ATOM   1452  C  CG   . TYR B 2 83  ? 11.195  0.369   -2.705  1.00 0.00 ? 341 TYR A CG   1  
ATOM   1453  C  CD1  . TYR B 2 83  ? 9.957   0.656   -3.222  1.00 0.00 ? 341 TYR A CD1  1  
ATOM   1454  C  CD2  . TYR B 2 83  ? 12.106  1.416   -2.579  1.00 0.00 ? 341 TYR A CD2  1  
ATOM   1455  C  CE1  . TYR B 2 83  ? 9.630   1.936   -3.605  1.00 0.00 ? 341 TYR A CE1  1  
ATOM   1456  C  CE2  . TYR B 2 83  ? 11.789  2.693   -2.978  1.00 0.00 ? 341 TYR A CE2  1  
ATOM   1457  C  CZ   . TYR B 2 83  ? 10.543  2.944   -3.489  1.00 0.00 ? 341 TYR A CZ   1  
ATOM   1458  O  OH   . TYR B 2 83  ? 10.191  4.212   -3.864  1.00 0.00 ? 341 TYR A OH   1  
ATOM   1459  H  H    . TYR B 2 83  ? 8.989   -2.044  -1.315  1.00 0.00 ? 341 TYR A H    1  
ATOM   1460  H  HA   . TYR B 2 83  ? 10.883  -2.539  -3.522  1.00 0.00 ? 341 TYR A HA   1  
ATOM   1461  H  HB2  . TYR B 2 83  ? 11.590  -0.906  -1.100  1.00 0.00 ? 341 TYR A HB2  1  
ATOM   1462  H  HB3  . TYR B 2 83  ? 12.581  -1.188  -2.482  1.00 0.00 ? 341 TYR A HB3  1  
ATOM   1463  H  HD1  . TYR B 2 83  ? 9.250   -0.134  -3.349  1.00 0.00 ? 341 TYR A HD1  1  
ATOM   1464  H  HD2  . TYR B 2 83  ? 13.087  1.209   -2.176  1.00 0.00 ? 341 TYR A HD2  1  
ATOM   1465  H  HE1  . TYR B 2 83  ? 8.656   2.142   -3.998  1.00 0.00 ? 341 TYR A HE1  1  
ATOM   1466  H  HE2  . TYR B 2 83  ? 12.515  3.487   -2.885  1.00 0.00 ? 341 TYR A HE2  1  
ATOM   1467  H  HH   . TYR B 2 83  ? 9.302   4.403   -3.555  1.00 0.00 ? 341 TYR A HH   1  
ATOM   1468  N  N    . HIS B 2 84  ? 12.064  -4.227  -2.062  1.00 0.00 ? 342 HIS A N    1  
ATOM   1469  C  CA   . HIS B 2 84  ? 12.666  -5.190  -1.158  1.00 0.00 ? 342 HIS A CA   1  
ATOM   1470  C  C    . HIS B 2 84  ? 13.624  -4.376  -0.295  1.00 0.00 ? 342 HIS A C    1  
ATOM   1471  O  O    . HIS B 2 84  ? 14.462  -3.708  -0.857  1.00 0.00 ? 342 HIS A O    1  
ATOM   1472  C  CB   . HIS B 2 84  ? 13.441  -6.284  -1.912  1.00 0.00 ? 342 HIS A CB   1  
ATOM   1473  C  CG   . HIS B 2 84  ? 12.617  -7.232  -2.747  1.00 0.00 ? 342 HIS A CG   1  
ATOM   1474  N  ND1  . HIS B 2 84  ? 12.516  -7.153  -4.122  1.00 0.00 ? 342 HIS A ND1  1  
ATOM   1475  C  CD2  . HIS B 2 84  ? 11.855  -8.287  -2.392  1.00 0.00 ? 342 HIS A CD2  1  
ATOM   1476  C  CE1  . HIS B 2 84  ? 11.731  -8.107  -4.577  1.00 0.00 ? 342 HIS A CE1  1  
ATOM   1477  N  NE2  . HIS B 2 84  ? 11.319  -8.818  -3.545  1.00 0.00 ? 342 HIS A NE2  1  
ATOM   1478  H  H    . HIS B 2 84  ? 12.283  -4.228  -3.011  1.00 0.00 ? 342 HIS A H    1  
ATOM   1479  H  HA   . HIS B 2 84  ? 11.894  -5.626  -0.539  1.00 0.00 ? 342 HIS A HA   1  
ATOM   1480  H  HB2  . HIS B 2 84  ? 14.152  -5.816  -2.563  1.00 0.00 ? 342 HIS A HB2  1  
ATOM   1481  H  HB3  . HIS B 2 84  ? 13.972  -6.868  -1.188  1.00 0.00 ? 342 HIS A HB3  1  
ATOM   1482  H  HD2  . HIS B 2 84  ? 11.665  -8.625  -1.387  1.00 0.00 ? 342 HIS A HD2  1  
ATOM   1483  H  HE1  . HIS B 2 84  ? 11.410  -8.227  -5.612  1.00 0.00 ? 342 HIS A HE1  1  
ATOM   1484  H  HE2  . HIS B 2 84  ? 10.664  -9.546  -3.586  1.00 0.00 ? 342 HIS A HE2  1  
ATOM   1485  N  N    . MET B 2 85  ? 13.466  -4.353  1.035   1.00 0.00 ? 343 MET A N    1  
ATOM   1486  C  CA   . MET B 2 85  ? 14.357  -3.537  1.897   1.00 0.00 ? 343 MET A CA   1  
ATOM   1487  C  C    . MET B 2 85  ? 15.767  -3.441  1.355   1.00 0.00 ? 343 MET A C    1  
ATOM   1488  O  O    . MET B 2 85  ? 16.463  -2.455  1.594   1.00 0.00 ? 343 MET A O    1  
ATOM   1489  C  CB   . MET B 2 85  ? 14.479  -4.053  3.338   1.00 0.00 ? 343 MET A CB   1  
ATOM   1490  C  CG   . MET B 2 85  ? 13.193  -4.274  4.080   1.00 0.00 ? 343 MET A CG   1  
ATOM   1491  S  SD   . MET B 2 85  ? 12.621  -5.983  4.112   1.00 0.00 ? 343 MET A SD   1  
ATOM   1492  C  CE   . MET B 2 85  ? 14.139  -6.882  4.398   1.00 0.00 ? 343 MET A CE   1  
ATOM   1493  H  H    . MET B 2 85  ? 12.732  -4.848  1.436   1.00 0.00 ? 343 MET A H    1  
ATOM   1494  H  HA   . MET B 2 85  ? 13.950  -2.534  1.916   1.00 0.00 ? 343 MET A HA   1  
ATOM   1495  H  HB2  . MET B 2 85  ? 15.037  -4.972  3.339   1.00 0.00 ? 343 MET A HB2  1  
ATOM   1496  H  HB3  . MET B 2 85  ? 15.023  -3.310  3.892   1.00 0.00 ? 343 MET A HB3  1  
ATOM   1497  H  HG2  . MET B 2 85  ? 13.332  -3.949  5.098   1.00 0.00 ? 343 MET A HG2  1  
ATOM   1498  H  HG3  . MET B 2 85  ? 12.457  -3.664  3.614   1.00 0.00 ? 343 MET A HG3  1  
ATOM   1499  H  HE1  . MET B 2 85  ? 14.806  -6.730  3.564   1.00 0.00 ? 343 MET A HE1  1  
ATOM   1500  H  HE2  . MET B 2 85  ? 13.923  -7.935  4.499   1.00 0.00 ? 343 MET A HE2  1  
ATOM   1501  H  HE3  . MET B 2 85  ? 14.604  -6.521  5.298   1.00 0.00 ? 343 MET A HE3  1  
ATOM   1502  N  N    . TYR B 2 86  ? 16.198  -4.457  0.645   1.00 0.00 ? 344 TYR A N    1  
ATOM   1503  C  CA   . TYR B 2 86  ? 17.543  -4.443  0.102   1.00 0.00 ? 344 TYR A CA   1  
ATOM   1504  C  C    . TYR B 2 86  ? 17.525  -4.005  -1.353  1.00 0.00 ? 344 TYR A C    1  
ATOM   1505  O  O    . TYR B 2 86  ? 18.390  -4.392  -2.140  1.00 0.00 ? 344 TYR A O    1  
ATOM   1506  C  CB   . TYR B 2 86  ? 18.226  -5.805  0.264   1.00 0.00 ? 344 TYR A CB   1  
ATOM   1507  C  CG   . TYR B 2 86  ? 17.664  -6.897  -0.611  1.00 0.00 ? 344 TYR A CG   1  
ATOM   1508  C  CD1  . TYR B 2 86  ? 16.348  -7.312  -0.479  1.00 0.00 ? 344 TYR A CD1  1  
ATOM   1509  C  CD2  . TYR B 2 86  ? 18.457  -7.522  -1.566  1.00 0.00 ? 344 TYR A CD2  1  
ATOM   1510  C  CE1  . TYR B 2 86  ? 15.839  -8.316  -1.271  1.00 0.00 ? 344 TYR A CE1  1  
ATOM   1511  C  CE2  . TYR B 2 86  ? 17.951  -8.529  -2.366  1.00 0.00 ? 344 TYR A CE2  1  
ATOM   1512  C  CZ   . TYR B 2 86  ? 16.641  -8.923  -2.213  1.00 0.00 ? 344 TYR A CZ   1  
ATOM   1513  O  OH   . TYR B 2 86  ? 16.130  -9.927  -3.005  1.00 0.00 ? 344 TYR A OH   1  
ATOM   1514  H  H    . TYR B 2 86  ? 15.589  -5.209  0.456   1.00 0.00 ? 344 TYR A H    1  
ATOM   1515  H  HA   . TYR B 2 86  ? 18.102  -3.708  0.665   1.00 0.00 ? 344 TYR A HA   1  
ATOM   1516  H  HB2  . TYR B 2 86  ? 19.273  -5.701  0.025   1.00 0.00 ? 344 TYR A HB2  1  
ATOM   1517  H  HB3  . TYR B 2 86  ? 18.131  -6.122  1.293   1.00 0.00 ? 344 TYR A HB3  1  
ATOM   1518  H  HD1  . TYR B 2 86  ? 15.711  -6.837  0.258   1.00 0.00 ? 344 TYR A HD1  1  
ATOM   1519  H  HD2  . TYR B 2 86  ? 19.485  -7.210  -1.680  1.00 0.00 ? 344 TYR A HD2  1  
ATOM   1520  H  HE1  . TYR B 2 86  ? 14.810  -8.616  -1.147  1.00 0.00 ? 344 TYR A HE1  1  
ATOM   1521  H  HE2  . TYR B 2 86  ? 18.583  -9.002  -3.103  1.00 0.00 ? 344 TYR A HE2  1  
ATOM   1522  H  HH   . TYR B 2 86  ? 16.756  -10.653 -3.045  1.00 0.00 ? 344 TYR A HH   1  
ATOM   1523  N  N    . CYS B 2 87  ? 16.534  -3.186  -1.708  1.00 0.00 ? 345 CYS A N    1  
ATOM   1524  C  CA   . CYS B 2 87  ? 16.422  -2.685  -3.061  1.00 0.00 ? 345 CYS A CA   1  
ATOM   1525  C  C    . CYS B 2 87  ? 16.435  -1.182  -3.037  1.00 0.00 ? 345 CYS A C    1  
ATOM   1526  O  O    . CYS B 2 87  ? 16.826  -0.521  -4.000  1.00 0.00 ? 345 CYS A O    1  
ATOM   1527  C  CB   . CYS B 2 87  ? 15.143  -3.190  -3.736  1.00 0.00 ? 345 CYS A CB   1  
ATOM   1528  S  SG   . CYS B 2 87  ? 15.286  -4.907  -4.274  1.00 0.00 ? 345 CYS A SG   1  
ATOM   1529  H  H    . CYS B 2 87  ? 15.857  -2.904  -1.035  1.00 0.00 ? 345 CYS A H    1  
ATOM   1530  H  HA   . CYS B 2 87  ? 17.273  -3.043  -3.602  1.00 0.00 ? 345 CYS A HA   1  
ATOM   1531  H  HB2  . CYS B 2 87  ? 14.320  -3.122  -3.044  1.00 0.00 ? 345 CYS A HB2  1  
ATOM   1532  H  HB3  . CYS B 2 87  ? 14.922  -2.580  -4.607  1.00 0.00 ? 345 CYS A HB3  1  
ATOM   1533  N  N    . LEU B 2 88  ? 16.011  -0.662  -1.904  1.00 0.00 ? 346 LEU A N    1  
ATOM   1534  C  CA   . LEU B 2 88  ? 15.919  0.770   -1.696  1.00 0.00 ? 346 LEU A CA   1  
ATOM   1535  C  C    . LEU B 2 88  ? 17.241  1.479   -1.966  1.00 0.00 ? 346 LEU A C    1  
ATOM   1536  O  O    . LEU B 2 88  ? 18.248  0.856   -2.303  1.00 0.00 ? 346 LEU A O    1  
ATOM   1537  C  CB   . LEU B 2 88  ? 15.469  1.070   -0.263  1.00 0.00 ? 346 LEU A CB   1  
ATOM   1538  C  CG   . LEU B 2 88  ? 14.969  -0.140  0.516   1.00 0.00 ? 346 LEU A CG   1  
ATOM   1539  C  CD1  . LEU B 2 88  ? 14.580  0.222   1.917   1.00 0.00 ? 346 LEU A CD1  1  
ATOM   1540  C  CD2  . LEU B 2 88  ? 13.788  -0.764  -0.167  1.00 0.00 ? 346 LEU A CD2  1  
ATOM   1541  H  H    . LEU B 2 88  ? 15.737  -1.271  -1.179  1.00 0.00 ? 346 LEU A H    1  
ATOM   1542  H  HA   . LEU B 2 88  ? 15.175  1.134   -2.372  1.00 0.00 ? 346 LEU A HA   1  
ATOM   1543  H  HB2  . LEU B 2 88  ? 16.303  1.496   0.270   1.00 0.00 ? 346 LEU A HB2  1  
ATOM   1544  H  HB3  . LEU B 2 88  ? 14.676  1.800   -0.299  1.00 0.00 ? 346 LEU A HB3  1  
ATOM   1545  H  HG   . LEU B 2 88  ? 15.748  -0.877  0.566   1.00 0.00 ? 346 LEU A HG   1  
ATOM   1546  H  HD11 . LEU B 2 88  ? 13.882  -0.525  2.261   1.00 0.00 ? 346 LEU A HD11 1  
ATOM   1547  H  HD12 . LEU B 2 88  ? 14.114  1.196   1.927   1.00 0.00 ? 346 LEU A HD12 1  
ATOM   1548  H  HD13 . LEU B 2 88  ? 15.453  0.224   2.552   1.00 0.00 ? 346 LEU A HD13 1  
ATOM   1549  H  HD21 . LEU B 2 88  ? 13.789  -0.472  -1.202  1.00 0.00 ? 346 LEU A HD21 1  
ATOM   1550  H  HD22 . LEU B 2 88  ? 12.877  -0.426  0.303   1.00 0.00 ? 346 LEU A HD22 1  
ATOM   1551  H  HD23 . LEU B 2 88  ? 13.854  -1.838  -0.095  1.00 0.00 ? 346 LEU A HD23 1  
ATOM   1552  N  N    . ASN B 2 89  ? 17.215  2.794   -1.808  1.00 0.00 ? 347 ASN A N    1  
ATOM   1553  C  CA   . ASN B 2 89  ? 18.393  3.623   -1.982  1.00 0.00 ? 347 ASN A CA   1  
ATOM   1554  C  C    . ASN B 2 89  ? 19.158  3.619   -0.685  1.00 0.00 ? 347 ASN A C    1  
ATOM   1555  O  O    . ASN B 2 89  ? 20.385  3.508   -0.674  1.00 0.00 ? 347 ASN A O    1  
ATOM   1556  C  CB   . ASN B 2 89  ? 17.992  5.034   -2.365  1.00 0.00 ? 347 ASN A CB   1  
ATOM   1557  C  CG   . ASN B 2 89  ? 19.061  5.767   -3.107  1.00 0.00 ? 347 ASN A CG   1  
ATOM   1558  O  OD1  . ASN B 2 89  ? 19.984  5.172   -3.663  1.00 0.00 ? 347 ASN A OD1  1  
ATOM   1559  N  ND2  . ASN B 2 89  ? 18.928  7.073   -3.131  1.00 0.00 ? 347 ASN A ND2  1  
ATOM   1560  H  H    . ASN B 2 89  ? 16.379  3.219   -1.543  1.00 0.00 ? 347 ASN A H    1  
ATOM   1561  H  HA   . ASN B 2 89  ? 19.008  3.198   -2.746  1.00 0.00 ? 347 ASN A HA   1  
ATOM   1562  H  HB2  . ASN B 2 89  ? 17.127  4.991   -2.989  1.00 0.00 ? 347 ASN A HB2  1  
ATOM   1563  H  HB3  . ASN B 2 89  ? 17.760  5.591   -1.470  1.00 0.00 ? 347 ASN A HB3  1  
ATOM   1564  H  HD21 . ASN B 2 89  ? 18.160  7.472   -2.671  1.00 0.00 ? 347 ASN A HD21 1  
ATOM   1565  H  HD22 . ASN B 2 89  ? 19.585  7.580   -3.609  1.00 0.00 ? 347 ASN A HD22 1  
ATOM   1566  N  N    . PRO B 2 90  ? 18.433  3.775   0.438   1.00 0.00 ? 348 PRO A N    1  
ATOM   1567  C  CA   . PRO B 2 90  ? 18.974  3.703   1.759   1.00 0.00 ? 348 PRO A CA   1  
ATOM   1568  C  C    . PRO B 2 90  ? 18.394  2.491   2.488   1.00 0.00 ? 348 PRO A C    1  
ATOM   1569  O  O    . PRO B 2 90  ? 17.784  2.620   3.549   1.00 0.00 ? 348 PRO A O    1  
ATOM   1570  C  CB   . PRO B 2 90  ? 18.443  4.997   2.301   1.00 0.00 ? 348 PRO A CB   1  
ATOM   1571  C  CG   . PRO B 2 90  ? 17.065  5.095   1.743   1.00 0.00 ? 348 PRO A CG   1  
ATOM   1572  C  CD   . PRO B 2 90  ? 17.024  4.172   0.551   1.00 0.00 ? 348 PRO A CD   1  
ATOM   1573  H  HA   . PRO B 2 90  ? 20.046  3.696   1.769   1.00 0.00 ? 348 PRO A HA   1  
ATOM   1574  H  HB2  . PRO B 2 90  ? 18.437  4.979   3.368   1.00 0.00 ? 348 PRO A HB2  1  
ATOM   1575  H  HB3  . PRO B 2 90  ? 19.067  5.788   1.933   1.00 0.00 ? 348 PRO A HB3  1  
ATOM   1576  H  HG2  . PRO B 2 90  ? 16.341  4.788   2.484   1.00 0.00 ? 348 PRO A HG2  1  
ATOM   1577  H  HG3  . PRO B 2 90  ? 16.885  6.103   1.436   1.00 0.00 ? 348 PRO A HG3  1  
ATOM   1578  H  HD2  . PRO B 2 90  ? 16.389  3.320   0.746   1.00 0.00 ? 348 PRO A HD2  1  
ATOM   1579  H  HD3  . PRO B 2 90  ? 16.698  4.703   -0.321  1.00 0.00 ? 348 PRO A HD3  1  
ATOM   1580  N  N    . PRO B 2 91  ? 18.577  1.299   1.881   1.00 0.00 ? 349 PRO A N    1  
ATOM   1581  C  CA   . PRO B 2 91  ? 18.078  0.018   2.354   1.00 0.00 ? 349 PRO A CA   1  
ATOM   1582  C  C    . PRO B 2 91  ? 17.883  -0.091  3.861   1.00 0.00 ? 349 PRO A C    1  
ATOM   1583  O  O    . PRO B 2 91  ? 18.584  0.538   4.654   1.00 0.00 ? 349 PRO A O    1  
ATOM   1584  C  CB   . PRO B 2 91  ? 19.154  -0.963  1.883   1.00 0.00 ? 349 PRO A CB   1  
ATOM   1585  C  CG   . PRO B 2 91  ? 20.064  -0.188  0.987   1.00 0.00 ? 349 PRO A CG   1  
ATOM   1586  C  CD   . PRO B 2 91  ? 19.342  1.082   0.665   1.00 0.00 ? 349 PRO A CD   1  
ATOM   1587  H  HA   . PRO B 2 91  ? 17.154  -0.233  1.857   1.00 0.00 ? 349 PRO A HA   1  
ATOM   1588  H  HB2  . PRO B 2 91  ? 19.680  -1.338  2.728   1.00 0.00 ? 349 PRO A HB2  1  
ATOM   1589  H  HB3  . PRO B 2 91  ? 18.685  -1.778  1.357   1.00 0.00 ? 349 PRO A HB3  1  
ATOM   1590  H  HG2  . PRO B 2 91  ? 20.990  0.029   1.497   1.00 0.00 ? 349 PRO A HG2  1  
ATOM   1591  H  HG3  . PRO B 2 91  ? 20.252  -0.752  0.095   1.00 0.00 ? 349 PRO A HG3  1  
ATOM   1592  H  HD2  . PRO B 2 91  ? 20.030  1.898   0.495   1.00 0.00 ? 349 PRO A HD2  1  
ATOM   1593  H  HD3  . PRO B 2 91  ? 18.689  0.946   -0.181  1.00 0.00 ? 349 PRO A HD3  1  
ATOM   1594  N  N    . VAL B 2 92  ? 16.925  -0.931  4.228   1.00 0.00 ? 350 VAL A N    1  
ATOM   1595  C  CA   . VAL B 2 92  ? 16.580  -1.191  5.612   1.00 0.00 ? 350 VAL A CA   1  
ATOM   1596  C  C    . VAL B 2 92  ? 16.659  -2.693  5.853   1.00 0.00 ? 350 VAL A C    1  
ATOM   1597  O  O    . VAL B 2 92  ? 16.894  -3.463  4.923   1.00 0.00 ? 350 VAL A O    1  
ATOM   1598  C  CB   . VAL B 2 92  ? 15.179  -0.613  5.927   1.00 0.00 ? 350 VAL A CB   1  
ATOM   1599  C  CG1  . VAL B 2 92  ? 14.190  -1.008  4.860   1.00 0.00 ? 350 VAL A CG1  1  
ATOM   1600  C  CG2  . VAL B 2 92  ? 14.661  -1.003  7.296   1.00 0.00 ? 350 VAL A CG2  1  
ATOM   1601  H  H    . VAL B 2 92  ? 16.433  -1.409  3.532   1.00 0.00 ? 350 VAL A H    1  
ATOM   1602  H  HA   . VAL B 2 92  ? 17.306  -0.701  6.245   1.00 0.00 ? 350 VAL A HA   1  
ATOM   1603  H  HB   . VAL B 2 92  ? 15.263  0.454   5.906   1.00 0.00 ? 350 VAL A HB   1  
ATOM   1604  H  HG11 . VAL B 2 92  ? 13.335  -1.483  5.313   1.00 0.00 ? 350 VAL A HG11 1  
ATOM   1605  H  HG12 . VAL B 2 92  ? 14.660  -1.691  4.171   1.00 0.00 ? 350 VAL A HG12 1  
ATOM   1606  H  HG13 . VAL B 2 92  ? 13.868  -0.126  4.328   1.00 0.00 ? 350 VAL A HG13 1  
ATOM   1607  H  HG21 . VAL B 2 92  ? 13.895  -1.756  7.184   1.00 0.00 ? 350 VAL A HG21 1  
ATOM   1608  H  HG22 . VAL B 2 92  ? 14.239  -0.133  7.779   1.00 0.00 ? 350 VAL A HG22 1  
ATOM   1609  H  HG23 . VAL B 2 92  ? 15.467  -1.389  7.897   1.00 0.00 ? 350 VAL A HG23 1  
ATOM   1610  N  N    . ALA B 2 93  ? 16.489  -3.107  7.089   1.00 0.00 ? 351 ALA A N    1  
ATOM   1611  C  CA   . ALA B 2 93  ? 16.601  -4.526  7.430   1.00 0.00 ? 351 ALA A CA   1  
ATOM   1612  C  C    . ALA B 2 93  ? 15.263  -5.255  7.556   1.00 0.00 ? 351 ALA A C    1  
ATOM   1613  O  O    . ALA B 2 93  ? 15.154  -6.411  7.154   1.00 0.00 ? 351 ALA A O    1  
ATOM   1614  C  CB   . ALA B 2 93  ? 17.394  -4.694  8.715   1.00 0.00 ? 351 ALA A CB   1  
ATOM   1615  H  H    . ALA B 2 93  ? 16.289  -2.445  7.781   1.00 0.00 ? 351 ALA A H    1  
ATOM   1616  H  HA   . ALA B 2 93  ? 17.165  -4.998  6.642   1.00 0.00 ? 351 ALA A HA   1  
ATOM   1617  H  HB1  . ALA B 2 93  ? 16.715  -4.716  9.555   1.00 0.00 ? 351 ALA A HB1  1  
ATOM   1618  H  HB2  . ALA B 2 93  ? 18.079  -3.867  8.827   1.00 0.00 ? 351 ALA A HB2  1  
ATOM   1619  H  HB3  . ALA B 2 93  ? 17.949  -5.620  8.677   1.00 0.00 ? 351 ALA A HB3  1  
ATOM   1620  N  N    . GLU B 2 94  ? 14.258  -4.603  8.133   1.00 0.00 ? 352 GLU A N    1  
ATOM   1621  C  CA   . GLU B 2 94  ? 12.944  -5.242  8.338   1.00 0.00 ? 352 GLU A CA   1  
ATOM   1622  C  C    . GLU B 2 94  ? 11.875  -4.217  8.713   1.00 0.00 ? 352 GLU A C    1  
ATOM   1623  O  O    . GLU B 2 94  ? 10.783  -4.197  8.143   1.00 0.00 ? 352 GLU A O    1  
ATOM   1624  C  CB   . GLU B 2 94  ? 12.996  -6.306  9.453   1.00 0.00 ? 352 GLU A CB   1  
ATOM   1625  C  CG   . GLU B 2 94  ? 14.384  -6.621  10.000  1.00 0.00 ? 352 GLU A CG   1  
ATOM   1626  C  CD   . GLU B 2 94  ? 14.363  -7.731  11.032  1.00 0.00 ? 352 GLU A CD   1  
ATOM   1627  O  OE1  . GLU B 2 94  ? 14.492  -8.910  10.638  1.00 0.00 ? 352 GLU A OE1  1  
ATOM   1628  O  OE2  . GLU B 2 94  ? 14.217  -7.423  12.234  1.00 0.00 ? 352 GLU A OE2  1  
ATOM   1629  H  H    . GLU B 2 94  ? 14.387  -3.668  8.405   1.00 0.00 ? 352 GLU A H    1  
ATOM   1630  H  HA   . GLU B 2 94  ? 12.664  -5.705  7.414   1.00 0.00 ? 352 GLU A HA   1  
ATOM   1631  H  HB2  . GLU B 2 94  ? 12.398  -5.951  10.281  1.00 0.00 ? 352 GLU A HB2  1  
ATOM   1632  H  HB3  . GLU B 2 94  ? 12.567  -7.214  9.079   1.00 0.00 ? 352 GLU A HB3  1  
ATOM   1633  H  HG2  . GLU B 2 94  ? 15.023  -6.923  9.186   1.00 0.00 ? 352 GLU A HG2  1  
ATOM   1634  H  HG3  . GLU B 2 94  ? 14.786  -5.731  10.461  1.00 0.00 ? 352 GLU A HG3  1  
ATOM   1635  N  N    . PRO B 2 95  ? 12.194  -3.396  9.725   1.00 0.00 ? 353 PRO A N    1  
ATOM   1636  C  CA   . PRO B 2 95  ? 11.410  -2.308  10.270  1.00 0.00 ? 353 PRO A CA   1  
ATOM   1637  C  C    . PRO B 2 95  ? 10.157  -1.858  9.507   1.00 0.00 ? 353 PRO A C    1  
ATOM   1638  O  O    . PRO B 2 95  ? 9.098   -1.750  10.124  1.00 0.00 ? 353 PRO A O    1  
ATOM   1639  C  CB   . PRO B 2 95  ? 12.494  -1.223  10.269  1.00 0.00 ? 353 PRO A CB   1  
ATOM   1640  C  CG   . PRO B 2 95  ? 13.792  -1.981  10.435  1.00 0.00 ? 353 PRO A CG   1  
ATOM   1641  C  CD   . PRO B 2 95  ? 13.424  -3.423  10.492  1.00 0.00 ? 353 PRO A CD   1  
ATOM   1642  H  HA   . PRO B 2 95  ? 11.137  -2.508  11.293  1.00 0.00 ? 353 PRO A HA   1  
ATOM   1643  H  HB2  . PRO B 2 95  ? 12.466  -0.699  9.321   1.00 0.00 ? 353 PRO A HB2  1  
ATOM   1644  H  HB3  . PRO B 2 95  ? 12.330  -0.533  11.080  1.00 0.00 ? 353 PRO A HB3  1  
ATOM   1645  H  HG2  . PRO B 2 95  ? 14.425  -1.816  9.579   1.00 0.00 ? 353 PRO A HG2  1  
ATOM   1646  H  HG3  . PRO B 2 95  ? 14.291  -1.687  11.340  1.00 0.00 ? 353 PRO A HG3  1  
ATOM   1647  H  HD2  . PRO B 2 95  ? 14.175  -4.025  10.024  1.00 0.00 ? 353 PRO A HD2  1  
ATOM   1648  H  HD3  . PRO B 2 95  ? 13.241  -3.749  11.504  1.00 0.00 ? 353 PRO A HD3  1  
ATOM   1649  N  N    . PRO B 2 96  ? 10.213  -1.558  8.189   1.00 0.00 ? 354 PRO A N    1  
ATOM   1650  C  CA   . PRO B 2 96  ? 9.051   -1.078  7.474   1.00 0.00 ? 354 PRO A CA   1  
ATOM   1651  C  C    . PRO B 2 96  ? 8.030   -2.154  7.135   1.00 0.00 ? 354 PRO A C    1  
ATOM   1652  O  O    . PRO B 2 96  ? 7.557   -2.238  6.001   1.00 0.00 ? 354 PRO A O    1  
ATOM   1653  C  CB   . PRO B 2 96  ? 9.635   -0.470  6.208   1.00 0.00 ? 354 PRO A CB   1  
ATOM   1654  C  CG   . PRO B 2 96  ? 11.087  -0.459  6.409   1.00 0.00 ? 354 PRO A CG   1  
ATOM   1655  C  CD   . PRO B 2 96  ? 11.356  -1.606  7.287   1.00 0.00 ? 354 PRO A CD   1  
ATOM   1656  H  HA   . PRO B 2 96  ? 8.580   -0.300  8.034   1.00 0.00 ? 354 PRO A HA   1  
ATOM   1657  H  HB2  . PRO B 2 96  ? 9.352   -1.047  5.348   1.00 0.00 ? 354 PRO A HB2  1  
ATOM   1658  H  HB3  . PRO B 2 96  ? 9.276   0.519   6.115   1.00 0.00 ? 354 PRO A HB3  1  
ATOM   1659  H  HG2  . PRO B 2 96  ? 11.601  -0.565  5.472   1.00 0.00 ? 354 PRO A HG2  1  
ATOM   1660  H  HG3  . PRO B 2 96  ? 11.369  0.457   6.900   1.00 0.00 ? 354 PRO A HG3  1  
ATOM   1661  H  HD2  . PRO B 2 96  ? 11.389  -2.530  6.728   1.00 0.00 ? 354 PRO A HD2  1  
ATOM   1662  H  HD3  . PRO B 2 96  ? 12.242  -1.438  7.794   1.00 0.00 ? 354 PRO A HD3  1  
ATOM   1663  N  N    . GLU B 2 97  ? 7.691   -2.973  8.117   1.00 0.00 ? 355 GLU A N    1  
ATOM   1664  C  CA   . GLU B 2 97  ? 6.704   -4.022  7.915   1.00 0.00 ? 355 GLU A CA   1  
ATOM   1665  C  C    . GLU B 2 97  ? 5.303   -3.422  7.892   1.00 0.00 ? 355 GLU A C    1  
ATOM   1666  O  O    . GLU B 2 97  ? 4.313   -4.132  7.715   1.00 0.00 ? 355 GLU A O    1  
ATOM   1667  C  CB   . GLU B 2 97  ? 6.803   -5.077  9.014   1.00 0.00 ? 355 GLU A CB   1  
ATOM   1668  C  CG   . GLU B 2 97  ? 8.087   -5.890  8.963   1.00 0.00 ? 355 GLU A CG   1  
ATOM   1669  C  CD   . GLU B 2 97  ? 7.964   -7.221  9.680   1.00 0.00 ? 355 GLU A CD   1  
ATOM   1670  O  OE1  . GLU B 2 97  ? 7.569   -8.211  9.028   1.00 0.00 ? 355 GLU A OE1  1  
ATOM   1671  O  OE2  . GLU B 2 97  ? 8.263   -7.273  10.892  1.00 0.00 ? 355 GLU A OE2  1  
ATOM   1672  H  H    . GLU B 2 97  ? 8.118   -2.875  8.992   1.00 0.00 ? 355 GLU A H    1  
ATOM   1673  H  HA   . GLU B 2 97  ? 6.902   -4.484  6.960   1.00 0.00 ? 355 GLU A HA   1  
ATOM   1674  H  HB2  . GLU B 2 97  ? 6.753   -4.582  9.972   1.00 0.00 ? 355 GLU A HB2  1  
ATOM   1675  H  HB3  . GLU B 2 97  ? 5.968   -5.756  8.924   1.00 0.00 ? 355 GLU A HB3  1  
ATOM   1676  H  HG2  . GLU B 2 97  ? 8.340   -6.077  7.930   1.00 0.00 ? 355 GLU A HG2  1  
ATOM   1677  H  HG3  . GLU B 2 97  ? 8.877   -5.319  9.428   1.00 0.00 ? 355 GLU A HG3  1  
ATOM   1678  N  N    . GLY B 2 98  ? 5.233   -2.105  8.077   1.00 0.00 ? 356 GLY A N    1  
ATOM   1679  C  CA   . GLY B 2 98  ? 3.955   -1.421  8.072   1.00 0.00 ? 356 GLY A CA   1  
ATOM   1680  C  C    . GLY B 2 98  ? 4.034   -0.012  7.531   1.00 0.00 ? 356 GLY A C    1  
ATOM   1681  O  O    . GLY B 2 98  ? 3.520   0.275   6.450   1.00 0.00 ? 356 GLY A O    1  
ATOM   1682  H  H    . GLY B 2 98  ? 6.056   -1.598  8.218   1.00 0.00 ? 356 GLY A H    1  
ATOM   1683  H  HA2  . GLY B 2 98  ? 3.271   -1.984  7.468   1.00 0.00 ? 356 GLY A HA2  1  
ATOM   1684  H  HA3  . GLY B 2 98  ? 3.574   -1.372  9.081   1.00 0.00 ? 356 GLY A HA3  1  
ATOM   1685  N  N    . SER B 2 99  ? 4.676   0.868   8.289   1.00 0.00 ? 357 SER A N    1  
ATOM   1686  C  CA   . SER B 2 99  ? 4.797   2.265   7.897   1.00 0.00 ? 357 SER A CA   1  
ATOM   1687  C  C    . SER B 2 99  ? 5.636   2.426   6.625   1.00 0.00 ? 357 SER A C    1  
ATOM   1688  O  O    . SER B 2 99  ? 5.239   1.967   5.554   1.00 0.00 ? 357 SER A O    1  
ATOM   1689  C  CB   . SER B 2 99  ? 5.393   3.090   9.041   1.00 0.00 ? 357 SER A CB   1  
ATOM   1690  O  OG   . SER B 2 99  ? 5.328   4.477   8.758   1.00 0.00 ? 357 SER A OG   1  
ATOM   1691  H  H    . SER B 2 99  ? 5.075   0.571   9.133   1.00 0.00 ? 357 SER A H    1  
ATOM   1692  H  HA   . SER B 2 99  ? 3.799   2.618   7.699   1.00 0.00 ? 357 SER A HA   1  
ATOM   1693  H  HB2  . SER B 2 99  ? 4.843   2.894   9.950   1.00 0.00 ? 357 SER A HB2  1  
ATOM   1694  H  HB3  . SER B 2 99  ? 6.428   2.812   9.179   1.00 0.00 ? 357 SER A HB3  1  
ATOM   1695  H  HG   . SER B 2 99  ? 6.019   4.710   8.134   1.00 0.00 ? 357 SER A HG   1  
ATOM   1696  N  N    . TRP B 2 100 ? 6.789   3.095   6.748   1.00 0.00 ? 358 TRP A N    1  
ATOM   1697  C  CA   . TRP B 2 100 ? 7.684   3.321   5.618   1.00 0.00 ? 358 TRP A CA   1  
ATOM   1698  C  C    . TRP B 2 100 ? 7.064   4.295   4.637   1.00 0.00 ? 358 TRP A C    1  
ATOM   1699  O  O    . TRP B 2 100 ? 5.842   4.427   4.565   1.00 0.00 ? 358 TRP A O    1  
ATOM   1700  C  CB   . TRP B 2 100 ? 8.006   2.005   4.925   1.00 0.00 ? 358 TRP A CB   1  
ATOM   1701  C  CG   . TRP B 2 100 ? 9.308   2.006   4.186   1.00 0.00 ? 358 TRP A CG   1  
ATOM   1702  C  CD1  . TRP B 2 100 ? 10.547  2.347   4.657   1.00 0.00 ? 358 TRP A CD1  1  
ATOM   1703  C  CD2  . TRP B 2 100 ? 9.495   1.599   2.844   1.00 0.00 ? 358 TRP A CD2  1  
ATOM   1704  N  NE1  . TRP B 2 100 ? 11.480  2.207   3.659   1.00 0.00 ? 358 TRP A NE1  1  
ATOM   1705  C  CE2  . TRP B 2 100 ? 10.855  1.749   2.544   1.00 0.00 ? 358 TRP A CE2  1  
ATOM   1706  C  CE3  . TRP B 2 100 ? 8.638   1.131   1.860   1.00 0.00 ? 358 TRP A CE3  1  
ATOM   1707  C  CZ2  . TRP B 2 100 ? 11.372  1.446   1.306   1.00 0.00 ? 358 TRP A CZ2  1  
ATOM   1708  C  CZ3  . TRP B 2 100 ? 9.161   0.824   0.627   1.00 0.00 ? 358 TRP A CZ3  1  
ATOM   1709  C  CH2  . TRP B 2 100 ? 10.515  0.985   0.369   1.00 0.00 ? 358 TRP A CH2  1  
ATOM   1710  H  H    . TRP B 2 100 ? 7.040   3.454   7.618   1.00 0.00 ? 358 TRP A H    1  
ATOM   1711  H  HA   . TRP B 2 100 ? 8.598   3.750   5.998   1.00 0.00 ? 358 TRP A HA   1  
ATOM   1712  H  HB2  . TRP B 2 100 ? 8.042   1.228   5.663   1.00 0.00 ? 358 TRP A HB2  1  
ATOM   1713  H  HB3  . TRP B 2 100 ? 7.229   1.774   4.215   1.00 0.00 ? 358 TRP A HB3  1  
ATOM   1714  H  HD1  . TRP B 2 100 ? 10.746  2.676   5.660   1.00 0.00 ? 358 TRP A HD1  1  
ATOM   1715  H  HE1  . TRP B 2 100 ? 12.438  2.397   3.730   1.00 0.00 ? 358 TRP A HE1  1  
ATOM   1716  H  HE3  . TRP B 2 100 ? 7.593   0.989   2.059   1.00 0.00 ? 358 TRP A HE3  1  
ATOM   1717  H  HZ2  . TRP B 2 100 ? 12.416  1.539   1.086   1.00 0.00 ? 358 TRP A HZ2  1  
ATOM   1718  H  HZ3  . TRP B 2 100 ? 8.528   0.430   -0.148  1.00 0.00 ? 358 TRP A HZ3  1  
ATOM   1719  H  HH2  . TRP B 2 100 ? 10.877  0.736   -0.597  1.00 0.00 ? 358 TRP A HH2  1  
ATOM   1720  N  N    . SER B 2 101 ? 7.909   4.978   3.881   1.00 0.00 ? 359 SER A N    1  
ATOM   1721  C  CA   . SER B 2 101 ? 7.408   5.956   2.919   1.00 0.00 ? 359 SER A CA   1  
ATOM   1722  C  C    . SER B 2 101 ? 8.135   5.929   1.571   1.00 0.00 ? 359 SER A C    1  
ATOM   1723  O  O    . SER B 2 101 ? 8.036   6.880   0.807   1.00 0.00 ? 359 SER A O    1  
ATOM   1724  C  CB   . SER B 2 101 ? 7.483   7.359   3.515   1.00 0.00 ? 359 SER A CB   1  
ATOM   1725  O  OG   . SER B 2 101 ? 6.477   7.554   4.493   1.00 0.00 ? 359 SER A OG   1  
ATOM   1726  H  H    . SER B 2 101 ? 8.876   4.826   3.983   1.00 0.00 ? 359 SER A H    1  
ATOM   1727  H  HA   . SER B 2 101 ? 6.371   5.721   2.748   1.00 0.00 ? 359 SER A HA   1  
ATOM   1728  H  HB2  . SER B 2 101 ? 8.444   7.491   3.977   1.00 0.00 ? 359 SER A HB2  1  
ATOM   1729  H  HB3  . SER B 2 101 ? 7.358   8.091   2.730   1.00 0.00 ? 359 SER A HB3  1  
ATOM   1730  H  HG   . SER B 2 101 ? 6.862   7.474   5.369   1.00 0.00 ? 359 SER A HG   1  
ATOM   1731  N  N    . CYS B 2 102 ? 8.845   4.846   1.273   1.00 0.00 ? 360 CYS A N    1  
ATOM   1732  C  CA   . CYS B 2 102 ? 9.569   4.724   -0.005  1.00 0.00 ? 360 CYS A CA   1  
ATOM   1733  C  C    . CYS B 2 102 ? 10.365  5.990   -0.337  1.00 0.00 ? 360 CYS A C    1  
ATOM   1734  O  O    . CYS B 2 102 ? 10.409  6.933   0.449   1.00 0.00 ? 360 CYS A O    1  
ATOM   1735  C  CB   . CYS B 2 102 ? 8.596   4.437   -1.149  1.00 0.00 ? 360 CYS A CB   1  
ATOM   1736  S  SG   . CYS B 2 102 ? 7.822   5.923   -1.866  1.00 0.00 ? 360 CYS A SG   1  
ATOM   1737  H  H    . CYS B 2 102 ? 8.884   4.110   1.918   1.00 0.00 ? 360 CYS A H    1  
ATOM   1738  H  HA   . CYS B 2 102 ? 10.255  3.894   0.083   1.00 0.00 ? 360 CYS A HA   1  
ATOM   1739  H  HB2  . CYS B 2 102 ? 9.124   3.935   -1.937  1.00 0.00 ? 360 CYS A HB2  1  
ATOM   1740  H  HB3  . CYS B 2 102 ? 7.809   3.795   -0.792  1.00 0.00 ? 360 CYS A HB3  1  
ATOM   1741  N  N    . HIS B 2 103 ? 11.032  5.988   -1.491  1.00 0.00 ? 361 HIS A N    1  
ATOM   1742  C  CA   . HIS B 2 103 ? 11.805  7.135   -1.920  1.00 0.00 ? 361 HIS A CA   1  
ATOM   1743  C  C    . HIS B 2 103 ? 10.920  8.217   -2.536  1.00 0.00 ? 361 HIS A C    1  
ATOM   1744  O  O    . HIS B 2 103 ? 11.186  9.403   -2.371  1.00 0.00 ? 361 HIS A O    1  
ATOM   1745  C  CB   . HIS B 2 103 ? 12.933  6.730   -2.878  1.00 0.00 ? 361 HIS A CB   1  
ATOM   1746  C  CG   . HIS B 2 103 ? 12.520  5.992   -4.117  1.00 0.00 ? 361 HIS A CG   1  
ATOM   1747  N  ND1  . HIS B 2 103 ? 13.194  4.881   -4.582  1.00 0.00 ? 361 HIS A ND1  1  
ATOM   1748  C  CD2  . HIS B 2 103 ? 11.532  6.223   -5.010  1.00 0.00 ? 361 HIS A CD2  1  
ATOM   1749  C  CE1  . HIS B 2 103 ? 12.638  4.468   -5.706  1.00 0.00 ? 361 HIS A CE1  1  
ATOM   1750  N  NE2  . HIS B 2 103 ? 11.629  5.266   -5.987  1.00 0.00 ? 361 HIS A NE2  1  
ATOM   1751  H  H    . HIS B 2 103 ? 10.971  5.220   -2.080  1.00 0.00 ? 361 HIS A H    1  
ATOM   1752  H  HA   . HIS B 2 103 ? 12.256  7.552   -1.031  1.00 0.00 ? 361 HIS A HA   1  
ATOM   1753  H  HB2  . HIS B 2 103 ? 13.437  7.616   -3.194  1.00 0.00 ? 361 HIS A HB2  1  
ATOM   1754  H  HB3  . HIS B 2 103 ? 13.632  6.105   -2.344  1.00 0.00 ? 361 HIS A HB3  1  
ATOM   1755  H  HD1  . HIS B 2 103 ? 13.966  4.459   -4.151  1.00 0.00 ? 361 HIS A HD1  1  
ATOM   1756  H  HD2  . HIS B 2 103 ? 10.778  6.991   -4.946  1.00 0.00 ? 361 HIS A HD2  1  
ATOM   1757  H  HE1  . HIS B 2 103 ? 12.947  3.614   -6.288  1.00 0.00 ? 361 HIS A HE1  1  
ATOM   1758  H  HE2  . HIS B 2 103 ? 11.082  5.222   -6.799  1.00 0.00 ? 361 HIS A HE2  1  
ATOM   1759  N  N    . LEU B 2 104 ? 9.862   7.801   -3.240  1.00 0.00 ? 362 LEU A N    1  
ATOM   1760  C  CA   . LEU B 2 104 ? 8.964   8.747   -3.905  1.00 0.00 ? 362 LEU A CA   1  
ATOM   1761  C  C    . LEU B 2 104 ? 8.386   9.752   -2.927  1.00 0.00 ? 362 LEU A C    1  
ATOM   1762  O  O    . LEU B 2 104 ? 8.481   10.971  -3.108  1.00 0.00 ? 362 LEU A O    1  
ATOM   1763  C  CB   . LEU B 2 104 ? 7.786   8.021   -4.555  1.00 0.00 ? 362 LEU A CB   1  
ATOM   1764  C  CG   . LEU B 2 104 ? 8.127   6.928   -5.548  1.00 0.00 ? 362 LEU A CG   1  
ATOM   1765  C  CD1  . LEU B 2 104 ? 6.856   6.302   -6.062  1.00 0.00 ? 362 LEU A CD1  1  
ATOM   1766  C  CD2  . LEU B 2 104 ? 8.959   7.467   -6.689  1.00 0.00 ? 362 LEU A CD2  1  
ATOM   1767  H  H    . LEU B 2 104 ? 9.683   6.840   -3.314  1.00 0.00 ? 362 LEU A H    1  
ATOM   1768  H  HA   . LEU B 2 104 ? 9.521   9.256   -4.665  1.00 0.00 ? 362 LEU A HA   1  
ATOM   1769  H  HB2  . LEU B 2 104 ? 7.186   7.579   -3.774  1.00 0.00 ? 362 LEU A HB2  1  
ATOM   1770  H  HB3  . LEU B 2 104 ? 7.185   8.754   -5.066  1.00 0.00 ? 362 LEU A HB3  1  
ATOM   1771  H  HG   . LEU B 2 104 ? 8.695   6.165   -5.046  1.00 0.00 ? 362 LEU A HG   1  
ATOM   1772  H  HD11 . LEU B 2 104 ? 6.442   5.670   -5.291  1.00 0.00 ? 362 LEU A HD11 1  
ATOM   1773  H  HD12 . LEU B 2 104 ? 7.073   5.712   -6.940  1.00 0.00 ? 362 LEU A HD12 1  
ATOM   1774  H  HD13 . LEU B 2 104 ? 6.146   7.077   -6.313  1.00 0.00 ? 362 LEU A HD13 1  
ATOM   1775  H  HD21 . LEU B 2 104 ? 9.996   7.351   -6.439  1.00 0.00 ? 362 LEU A HD21 1  
ATOM   1776  H  HD22 . LEU B 2 104 ? 8.736   8.514   -6.839  1.00 0.00 ? 362 LEU A HD22 1  
ATOM   1777  H  HD23 . LEU B 2 104 ? 8.740   6.916   -7.591  1.00 0.00 ? 362 LEU A HD23 1  
ATOM   1778  N  N    . CYS B 2 105 ? 7.827   9.212   -1.867  1.00 0.00 ? 363 CYS A N    1  
ATOM   1779  C  CA   . CYS B 2 105 ? 7.173   10.019  -0.844  1.00 0.00 ? 363 CYS A CA   1  
ATOM   1780  C  C    . CYS B 2 105 ? 8.167   10.778  -0.030  1.00 0.00 ? 363 CYS A C    1  
ATOM   1781  O  O    . CYS B 2 105 ? 7.893   11.876  0.439   1.00 0.00 ? 363 CYS A O    1  
ATOM   1782  C  CB   . CYS B 2 105 ? 6.330   9.158   0.090   1.00 0.00 ? 363 CYS A CB   1  
ATOM   1783  S  SG   . CYS B 2 105 ? 4.996   8.228   -0.753  1.00 0.00 ? 363 CYS A SG   1  
ATOM   1784  H  H    . CYS B 2 105 ? 7.887   8.237   -1.758  1.00 0.00 ? 363 CYS A H    1  
ATOM   1785  H  HA   . CYS B 2 105 ? 6.541   10.725  -1.336  1.00 0.00 ? 363 CYS A HA   1  
ATOM   1786  H  HB2  . CYS B 2 105 ? 6.979   8.464   0.606   1.00 0.00 ? 363 CYS A HB2  1  
ATOM   1787  H  HB3  . CYS B 2 105 ? 5.863   9.801   0.823   1.00 0.00 ? 363 CYS A HB3  1  
ATOM   1788  N  N    . TRP B 2 106 ? 9.307   10.174  0.155   1.00 0.00 ? 364 TRP A N    1  
ATOM   1789  C  CA   . TRP B 2 106 ? 10.340  10.760  0.952   1.00 0.00 ? 364 TRP A CA   1  
ATOM   1790  C  C    . TRP B 2 106 ? 10.949  11.954  0.328   1.00 0.00 ? 364 TRP A C    1  
ATOM   1791  O  O    . TRP B 2 106 ? 11.058  12.986  0.947   1.00 0.00 ? 364 TRP A O    1  
ATOM   1792  C  CB   . TRP B 2 106 ? 11.398  9.752   1.245   1.00 0.00 ? 364 TRP A CB   1  
ATOM   1793  C  CG   . TRP B 2 106 ? 11.419  9.514   2.676   1.00 0.00 ? 364 TRP A CG   1  
ATOM   1794  C  CD1  . TRP B 2 106 ? 10.334  9.304   3.429   1.00 0.00 ? 364 TRP A CD1  1  
ATOM   1795  C  CD2  . TRP B 2 106 ? 12.535  9.532   3.529   1.00 0.00 ? 364 TRP A CD2  1  
ATOM   1796  N  NE1  . TRP B 2 106 ? 10.686  9.157   4.727   1.00 0.00 ? 364 TRP A NE1  1  
ATOM   1797  C  CE2  . TRP B 2 106 ? 12.060  9.290   4.826   1.00 0.00 ? 364 TRP A CE2  1  
ATOM   1798  C  CE3  . TRP B 2 106 ? 13.890  9.718   3.309   1.00 0.00 ? 364 TRP A CE3  1  
ATOM   1799  C  CZ2  . TRP B 2 106 ? 12.919  9.233   5.921   1.00 0.00 ? 364 TRP A CZ2  1  
ATOM   1800  C  CZ3  . TRP B 2 106 ? 14.745  9.668   4.387   1.00 0.00 ? 364 TRP A CZ3  1  
ATOM   1801  C  CH2  . TRP B 2 106 ? 14.259  9.425   5.680   1.00 0.00 ? 364 TRP A CH2  1  
ATOM   1802  H  H    . TRP B 2 106 ? 9.465   9.315   -0.276  1.00 0.00 ? 364 TRP A H    1  
ATOM   1803  H  HA   . TRP B 2 106 ? 9.891   11.065  1.885   1.00 0.00 ? 364 TRP A HA   1  
ATOM   1804  H  HB2  . TRP B 2 106 ? 11.162  8.836   0.740   1.00 0.00 ? 364 TRP A HB2  1  
ATOM   1805  H  HB3  . TRP B 2 106 ? 12.364  10.119  0.936   1.00 0.00 ? 364 TRP A HB3  1  
ATOM   1806  H  HD1  . TRP B 2 106 ? 9.336   9.271   3.027   1.00 0.00 ? 364 TRP A HD1  1  
ATOM   1807  H  HE1  . TRP B 2 106 ? 10.062  8.987   5.446   1.00 0.00 ? 364 TRP A HE1  1  
ATOM   1808  H  HE3  . TRP B 2 106 ? 14.267  9.915   2.305   1.00 0.00 ? 364 TRP A HE3  1  
ATOM   1809  H  HZ2  . TRP B 2 106 ? 12.561  9.048   6.923   1.00 0.00 ? 364 TRP A HZ2  1  
ATOM   1810  H  HZ3  . TRP B 2 106 ? 15.805  9.813   4.242   1.00 0.00 ? 364 TRP A HZ3  1  
ATOM   1811  H  HH2  . TRP B 2 106 ? 14.965  9.403   6.491   1.00 0.00 ? 364 TRP A HH2  1  
ATOM   1812  N  N    . GLU B 2 107 ? 11.382  11.814  -0.878  1.00 0.00 ? 365 GLU A N    1  
ATOM   1813  C  CA   . GLU B 2 107 ? 11.974  12.934  -1.537  1.00 0.00 ? 365 GLU A CA   1  
ATOM   1814  C  C    . GLU B 2 107 ? 10.931  14.028  -1.607  1.00 0.00 ? 365 GLU A C    1  
ATOM   1815  O  O    . GLU B 2 107 ? 11.245  15.218  -1.645  1.00 0.00 ? 365 GLU A O    1  
ATOM   1816  C  CB   . GLU B 2 107 ? 12.450  12.521  -2.901  1.00 0.00 ? 365 GLU A CB   1  
ATOM   1817  C  CG   . GLU B 2 107 ? 11.322  12.066  -3.796  1.00 0.00 ? 365 GLU A CG   1  
ATOM   1818  C  CD   . GLU B 2 107 ? 11.740  11.917  -5.246  1.00 0.00 ? 365 GLU A CD   1  
ATOM   1819  O  OE1  . GLU B 2 107 ? 12.251  10.838  -5.609  1.00 0.00 ? 365 GLU A OE1  1  
ATOM   1820  O  OE2  . GLU B 2 107 ? 11.556  12.882  -6.019  1.00 0.00 ? 365 GLU A OE2  1  
ATOM   1821  H  H    . GLU B 2 107 ? 11.286  10.956  -1.336  1.00 0.00 ? 365 GLU A H    1  
ATOM   1822  H  HA   . GLU B 2 107 ? 12.810  13.259  -0.931  1.00 0.00 ? 365 GLU A HA   1  
ATOM   1823  H  HB2  . GLU B 2 107 ? 12.968  13.344  -3.371  1.00 0.00 ? 365 GLU A HB2  1  
ATOM   1824  H  HB3  . GLU B 2 107 ? 13.125  11.697  -2.762  1.00 0.00 ? 365 GLU A HB3  1  
ATOM   1825  H  HG2  . GLU B 2 107 ? 10.974  11.115  -3.435  1.00 0.00 ? 365 GLU A HG2  1  
ATOM   1826  H  HG3  . GLU B 2 107 ? 10.518  12.783  -3.732  1.00 0.00 ? 365 GLU A HG3  1  
ATOM   1827  N  N    . LEU B 2 108 ? 9.671   13.593  -1.615  1.00 0.00 ? 366 LEU A N    1  
ATOM   1828  C  CA   . LEU B 2 108 ? 8.552   14.504  -1.624  1.00 0.00 ? 366 LEU A CA   1  
ATOM   1829  C  C    . LEU B 2 108 ? 8.407   15.090  -0.234  1.00 0.00 ? 366 LEU A C    1  
ATOM   1830  O  O    . LEU B 2 108 ? 7.881   16.179  -0.043  1.00 0.00 ? 366 LEU A O    1  
ATOM   1831  C  CB   . LEU B 2 108 ? 7.290   13.784  -2.062  1.00 0.00 ? 366 LEU A CB   1  
ATOM   1832  C  CG   . LEU B 2 108 ? 6.166   14.668  -2.607  1.00 0.00 ? 366 LEU A CG   1  
ATOM   1833  C  CD1  . LEU B 2 108 ? 5.304   15.189  -1.477  1.00 0.00 ? 366 LEU A CD1  1  
ATOM   1834  C  CD2  . LEU B 2 108 ? 6.739   15.812  -3.417  1.00 0.00 ? 366 LEU A CD2  1  
ATOM   1835  H  H    . LEU B 2 108 ? 9.492   12.617  -1.608  1.00 0.00 ? 366 LEU A H    1  
ATOM   1836  H  HA   . LEU B 2 108 ? 8.766   15.283  -2.318  1.00 0.00 ? 366 LEU A HA   1  
ATOM   1837  H  HB2  . LEU B 2 108 ? 7.568   13.091  -2.828  1.00 0.00 ? 366 LEU A HB2  1  
ATOM   1838  H  HB3  . LEU B 2 108 ? 6.913   13.238  -1.221  1.00 0.00 ? 366 LEU A HB3  1  
ATOM   1839  H  HG   . LEU B 2 108 ? 5.545   14.081  -3.261  1.00 0.00 ? 366 LEU A HG   1  
ATOM   1840  H  HD11 . LEU B 2 108 ? 5.249   14.441  -0.702  1.00 0.00 ? 366 LEU A HD11 1  
ATOM   1841  H  HD12 . LEU B 2 108 ? 4.311   15.400  -1.847  1.00 0.00 ? 366 LEU A HD12 1  
ATOM   1842  H  HD13 . LEU B 2 108 ? 5.740   16.092  -1.077  1.00 0.00 ? 366 LEU A HD13 1  
ATOM   1843  H  HD21 . LEU B 2 108 ? 7.770   15.590  -3.635  1.00 0.00 ? 366 LEU A HD21 1  
ATOM   1844  H  HD22 . LEU B 2 108 ? 6.675   16.728  -2.847  1.00 0.00 ? 366 LEU A HD22 1  
ATOM   1845  H  HD23 . LEU B 2 108 ? 6.188   15.917  -4.339  1.00 0.00 ? 366 LEU A HD23 1  
ATOM   1846  N  N    . LEU B 2 109 ? 8.882   14.311  0.726   1.00 0.00 ? 367 LEU A N    1  
ATOM   1847  C  CA   . LEU B 2 109 ? 8.876   14.662  2.135   1.00 0.00 ? 367 LEU A CA   1  
ATOM   1848  C  C    . LEU B 2 109 ? 9.873   15.765  2.390   1.00 0.00 ? 367 LEU A C    1  
ATOM   1849  O  O    . LEU B 2 109 ? 9.540   16.841  2.883   1.00 0.00 ? 367 LEU A O    1  
ATOM   1850  C  CB   . LEU B 2 109 ? 9.306   13.452  2.924   1.00 0.00 ? 367 LEU A CB   1  
ATOM   1851  C  CG   . LEU B 2 109 ? 8.410   13.014  4.056   1.00 0.00 ? 367 LEU A CG   1  
ATOM   1852  C  CD1  . LEU B 2 109 ? 7.480   11.930  3.553   1.00 0.00 ? 367 LEU A CD1  1  
ATOM   1853  C  CD2  . LEU B 2 109 ? 9.262   12.523  5.215   1.00 0.00 ? 367 LEU A CD2  1  
ATOM   1854  H  H    . LEU B 2 109 ? 9.278   13.454  0.469   1.00 0.00 ? 367 LEU A H    1  
ATOM   1855  H  HA   . LEU B 2 109 ? 7.898   14.954  2.434   1.00 0.00 ? 367 LEU A HA   1  
ATOM   1856  H  HB2  . LEU B 2 109 ? 9.376   12.637  2.235   1.00 0.00 ? 367 LEU A HB2  1  
ATOM   1857  H  HB3  . LEU B 2 109 ? 10.283  13.648  3.320   1.00 0.00 ? 367 LEU A HB3  1  
ATOM   1858  H  HG   . LEU B 2 109 ? 7.816   13.848  4.391   1.00 0.00 ? 367 LEU A HG   1  
ATOM   1859  H  HD11 . LEU B 2 109 ? 7.840   11.585  2.588   1.00 0.00 ? 367 LEU A HD11 1  
ATOM   1860  H  HD12 . LEU B 2 109 ? 6.482   12.330  3.447   1.00 0.00 ? 367 LEU A HD12 1  
ATOM   1861  H  HD13 . LEU B 2 109 ? 7.470   11.107  4.251   1.00 0.00 ? 367 LEU A HD13 1  
ATOM   1862  H  HD21 . LEU B 2 109 ? 10.171  12.072  4.825   1.00 0.00 ? 367 LEU A HD21 1  
ATOM   1863  H  HD22 . LEU B 2 109 ? 8.709   11.791  5.785   1.00 0.00 ? 367 LEU A HD22 1  
ATOM   1864  H  HD23 . LEU B 2 109 ? 9.519   13.359  5.850   1.00 0.00 ? 367 LEU A HD23 1  
ATOM   1865  N  N    . LYS B 2 110 ? 11.114  15.456  2.045   1.00 0.00 ? 368 LYS A N    1  
ATOM   1866  C  CA   . LYS B 2 110 ? 12.220  16.375  2.204   1.00 0.00 ? 368 LYS A CA   1  
ATOM   1867  C  C    . LYS B 2 110 ? 11.872  17.693  1.537   1.00 0.00 ? 368 LYS A C    1  
ATOM   1868  O  O    . LYS B 2 110 ? 12.262  18.767  1.995   1.00 0.00 ? 368 LYS A O    1  
ATOM   1869  C  CB   . LYS B 2 110 ? 13.478  15.767  1.584   1.00 0.00 ? 368 LYS A CB   1  
ATOM   1870  C  CG   . LYS B 2 110 ? 13.451  14.248  1.581   1.00 0.00 ? 368 LYS A CG   1  
ATOM   1871  C  CD   . LYS B 2 110 ? 14.835  13.645  1.474   1.00 0.00 ? 368 LYS A CD   1  
ATOM   1872  C  CE   . LYS B 2 110 ? 14.756  12.140  1.336   1.00 0.00 ? 368 LYS A CE   1  
ATOM   1873  N  NZ   . LYS B 2 110 ? 14.447  11.718  -0.057  1.00 0.00 ? 368 LYS A NZ   1  
ATOM   1874  H  H    . LYS B 2 110 ? 11.285  14.568  1.654   1.00 0.00 ? 368 LYS A H    1  
ATOM   1875  H  HA   . LYS B 2 110 ? 12.377  16.531  3.261   1.00 0.00 ? 368 LYS A HA   1  
ATOM   1876  H  HB2  . LYS B 2 110 ? 13.566  16.108  0.563   1.00 0.00 ? 368 LYS A HB2  1  
ATOM   1877  H  HB3  . LYS B 2 110 ? 14.342  16.093  2.144   1.00 0.00 ? 368 LYS A HB3  1  
ATOM   1878  H  HG2  . LYS B 2 110 ? 12.999  13.910  2.502   1.00 0.00 ? 368 LYS A HG2  1  
ATOM   1879  H  HG3  . LYS B 2 110 ? 12.852  13.910  0.742   1.00 0.00 ? 368 LYS A HG3  1  
ATOM   1880  H  HD2  . LYS B 2 110 ? 15.337  14.056  0.612   1.00 0.00 ? 368 LYS A HD2  1  
ATOM   1881  H  HD3  . LYS B 2 110 ? 15.386  13.881  2.368   1.00 0.00 ? 368 LYS A HD3  1  
ATOM   1882  H  HE2  . LYS B 2 110 ? 15.702  11.712  1.634   1.00 0.00 ? 368 LYS A HE2  1  
ATOM   1883  H  HE3  . LYS B 2 110 ? 13.973  11.780  1.995   1.00 0.00 ? 368 LYS A HE3  1  
ATOM   1884  H  HZ1  . LYS B 2 110 ? 14.815  10.760  -0.230  1.00 0.00 ? 368 LYS A HZ1  1  
ATOM   1885  H  HZ2  . LYS B 2 110 ? 14.883  12.374  -0.735  1.00 0.00 ? 368 LYS A HZ2  1  
ATOM   1886  H  HZ3  . LYS B 2 110 ? 13.419  11.714  -0.207  1.00 0.00 ? 368 LYS A HZ3  1  
ATOM   1887  N  N    . GLU B 2 111 ? 11.127  17.588  0.441   1.00 0.00 ? 369 GLU A N    1  
ATOM   1888  C  CA   . GLU B 2 111 ? 10.682  18.750  -0.301  1.00 0.00 ? 369 GLU A CA   1  
ATOM   1889  C  C    . GLU B 2 111 ? 9.516   19.426  0.412   1.00 0.00 ? 369 GLU A C    1  
ATOM   1890  O  O    . GLU B 2 111 ? 9.449   20.654  0.478   1.00 0.00 ? 369 GLU A O    1  
ATOM   1891  C  CB   . GLU B 2 111 ? 10.271  18.347  -1.708  1.00 0.00 ? 369 GLU A CB   1  
ATOM   1892  C  CG   . GLU B 2 111 ? 10.943  19.175  -2.784  1.00 0.00 ? 369 GLU A CG   1  
ATOM   1893  C  CD   . GLU B 2 111 ? 10.461  20.612  -2.803  1.00 0.00 ? 369 GLU A CD   1  
ATOM   1894  O  OE1  . GLU B 2 111 ? 11.054  21.447  -2.088  1.00 0.00 ? 369 GLU A OE1  1  
ATOM   1895  O  OE2  . GLU B 2 111 ? 9.490   20.903  -3.533  1.00 0.00 ? 369 GLU A OE2  1  
ATOM   1896  H  H    . GLU B 2 111 ? 10.885  16.697  0.113   1.00 0.00 ? 369 GLU A H    1  
ATOM   1897  H  HA   . GLU B 2 111 ? 11.505  19.439  -0.368  1.00 0.00 ? 369 GLU A HA   1  
ATOM   1898  H  HB2  . GLU B 2 111 ? 10.538  17.316  -1.859  1.00 0.00 ? 369 GLU A HB2  1  
ATOM   1899  H  HB3  . GLU B 2 111 ? 9.202   18.456  -1.810  1.00 0.00 ? 369 GLU A HB3  1  
ATOM   1900  H  HG2  . GLU B 2 111 ? 12.006  19.170  -2.604  1.00 0.00 ? 369 GLU A HG2  1  
ATOM   1901  H  HG3  . GLU B 2 111 ? 10.739  18.728  -3.743  1.00 0.00 ? 369 GLU A HG3  1  
ATOM   1902  N  N    . LYS B 2 112 ? 8.594   18.619  0.946   1.00 0.00 ? 370 LYS A N    1  
ATOM   1903  C  CA   . LYS B 2 112 ? 7.447   19.140  1.645   1.00 0.00 ? 370 LYS A CA   1  
ATOM   1904  C  C    . LYS B 2 112 ? 7.846   19.998  2.840   1.00 0.00 ? 370 LYS A C    1  
ATOM   1905  O  O    . LYS B 2 112 ? 7.367   21.120  3.003   1.00 0.00 ? 370 LYS A O    1  
ATOM   1906  C  CB   . LYS B 2 112 ? 6.585   17.997  2.100   1.00 0.00 ? 370 LYS A CB   1  
ATOM   1907  C  CG   . LYS B 2 112 ? 5.563   17.625  1.065   1.00 0.00 ? 370 LYS A CG   1  
ATOM   1908  C  CD   . LYS B 2 112 ? 4.589   16.603  1.576   1.00 0.00 ? 370 LYS A CD   1  
ATOM   1909  C  CE   . LYS B 2 112 ? 5.281   15.327  2.034   1.00 0.00 ? 370 LYS A CE   1  
ATOM   1910  N  NZ   . LYS B 2 112 ? 4.304   14.297  2.481   1.00 0.00 ? 370 LYS A NZ   1  
ATOM   1911  H  H    . LYS B 2 112 ? 8.674   17.644  0.854   1.00 0.00 ? 370 LYS A H    1  
ATOM   1912  H  HA   . LYS B 2 112 ? 6.880   19.716  0.945   1.00 0.00 ? 370 LYS A HA   1  
ATOM   1913  H  HB2  . LYS B 2 112 ? 7.213   17.148  2.284   1.00 0.00 ? 370 LYS A HB2  1  
ATOM   1914  H  HB3  . LYS B 2 112 ? 6.077   18.269  3.003   1.00 0.00 ? 370 LYS A HB3  1  
ATOM   1915  H  HG2  . LYS B 2 112 ? 5.019   18.510  0.776   1.00 0.00 ? 370 LYS A HG2  1  
ATOM   1916  H  HG3  . LYS B 2 112 ? 6.072   17.220  0.207   1.00 0.00 ? 370 LYS A HG3  1  
ATOM   1917  H  HD2  . LYS B 2 112 ? 4.031   17.022  2.400   1.00 0.00 ? 370 LYS A HD2  1  
ATOM   1918  H  HD3  . LYS B 2 112 ? 3.931   16.374  0.771   1.00 0.00 ? 370 LYS A HD3  1  
ATOM   1919  H  HE2  . LYS B 2 112 ? 5.858   14.931  1.213   1.00 0.00 ? 370 LYS A HE2  1  
ATOM   1920  H  HE3  . LYS B 2 112 ? 5.941   15.566  2.855   1.00 0.00 ? 370 LYS A HE3  1  
ATOM   1921  H  HZ1  . LYS B 2 112 ? 3.786   14.634  3.318   1.00 0.00 ? 370 LYS A HZ1  1  
ATOM   1922  H  HZ2  . LYS B 2 112 ? 4.799   13.416  2.725   1.00 0.00 ? 370 LYS A HZ2  1  
ATOM   1923  H  HZ3  . LYS B 2 112 ? 3.622   14.099  1.721   1.00 0.00 ? 370 LYS A HZ3  1  
ATOM   1924  N  N    . ALA B 2 113 ? 8.729   19.451  3.673   1.00 0.00 ? 371 ALA A N    1  
ATOM   1925  C  CA   . ALA B 2 113 ? 9.200   20.141  4.865   1.00 0.00 ? 371 ALA A CA   1  
ATOM   1926  C  C    . ALA B 2 113 ? 9.816   21.489  4.524   1.00 0.00 ? 371 ALA A C    1  
ATOM   1927  O  O    . ALA B 2 113 ? 9.983   21.830  3.352   1.00 0.00 ? 371 ALA A O    1  
ATOM   1928  C  CB   . ALA B 2 113 ? 10.220  19.286  5.593   1.00 0.00 ? 371 ALA A CB   1  
ATOM   1929  H  H    . ALA B 2 113 ? 9.076   18.558  3.478   1.00 0.00 ? 371 ALA A H    1  
ATOM   1930  H  HA   . ALA B 2 113 ? 8.356   20.287  5.522   1.00 0.00 ? 371 ALA A HA   1  
ATOM   1931  H  HB1  . ALA B 2 113 ? 11.168  19.358  5.082   1.00 0.00 ? 371 ALA A HB1  1  
ATOM   1932  H  HB2  . ALA B 2 113 ? 9.890   18.257  5.599   1.00 0.00 ? 371 ALA A HB2  1  
ATOM   1933  H  HB3  . ALA B 2 113 ? 10.328  19.637  6.608   1.00 0.00 ? 371 ALA A HB3  1  
ATOM   1934  N  N    . SER B 2 114 ? 10.164  22.247  5.558   1.00 0.00 ? 372 SER A N    1  
ATOM   1935  C  CA   . SER B 2 114 ? 10.776  23.555  5.375   1.00 0.00 ? 372 SER A CA   1  
ATOM   1936  C  C    . SER B 2 114 ? 11.186  24.155  6.717   1.00 0.00 ? 372 SER A C    1  
ATOM   1937  O  O    . SER B 2 114 ? 10.339  24.817  7.352   1.00 0.00 ? 372 SER A O    1  
ATOM   1938  C  CB   . SER B 2 114 ? 9.818   24.502  4.649   1.00 0.00 ? 372 SER A CB   1  
ATOM   1939  O  OG   . SER B 2 114 ? 10.394  25.788  4.492   1.00 0.00 ? 372 SER A OG   1  
ATOM   1940  O  OXT  . SER B 2 114 ? 12.351  23.957  7.121   1.00 0.00 ? 372 SER A OXT  1  
ATOM   1941  H  H    . SER B 2 114 ? 10.006  21.916  6.467   1.00 0.00 ? 372 SER A H    1  
ATOM   1942  H  HA   . SER B 2 114 ? 11.660  23.416  4.771   1.00 0.00 ? 372 SER A HA   1  
ATOM   1943  H  HB2  . SER B 2 114 ? 9.591   24.102  3.672   1.00 0.00 ? 372 SER A HB2  1  
ATOM   1944  H  HB3  . SER B 2 114 ? 8.906   24.596  5.220   1.00 0.00 ? 372 SER A HB3  1  
ATOM   1945  H  HG   . SER B 2 114 ? 9.713   26.416  4.242   1.00 0.00 ? 372 SER A HG   1  
HETATM 1946  ZN ZN   . ZN  C 3 .   ? -14.439 -0.428  3.928   1.00 0.00 ? 501 ZN  A ZN   1  
HETATM 1947  ZN ZN   . ZN  D 3 .   ? -4.772  -7.361  -7.404  1.00 0.00 ? 601 ZN  A ZN   1  
HETATM 1948  ZN ZN   . ZN  E 3 .   ? 5.614   6.025   -1.169  1.00 0.00 ? 701 ZN  A ZN   1  
HETATM 1949  ZN ZN   . ZN  F 3 .   ? 13.350  -5.655  -5.301  1.00 0.00 ? 801 ZN  A ZN   1  
ATOM   1950  N  N    . GLY A 1 1   ? -17.836 -20.965 11.397  1.00 0.00 ? 9   GLY B N    2  
ATOM   1951  C  CA   . GLY A 1 1   ? -16.749 -19.953 11.297  1.00 0.00 ? 9   GLY B CA   2  
ATOM   1952  C  C    . GLY A 1 1   ? -15.657 -20.368 10.329  1.00 0.00 ? 9   GLY B C    2  
ATOM   1953  O  O    . GLY A 1 1   ? -14.990 -21.382 10.534  1.00 0.00 ? 9   GLY B O    2  
ATOM   1954  H  H1   . GLY A 1 1   ? -18.564 -20.644 12.066  1.00 0.00 ? 9   GLY B H1   2  
ATOM   1955  H  H2   . GLY A 1 1   ? -17.451 -21.872 11.729  1.00 0.00 ? 9   GLY B H2   2  
ATOM   1956  H  H3   . GLY A 1 1   ? -18.277 -21.109 10.465  1.00 0.00 ? 9   GLY B H3   2  
ATOM   1957  H  HA2  . GLY A 1 1   ? -17.172 -19.017 10.965  1.00 0.00 ? 9   GLY B HA2  2  
ATOM   1958  H  HA3  . GLY A 1 1   ? -16.313 -19.812 12.275  1.00 0.00 ? 9   GLY B HA3  2  
ATOM   1959  N  N    . LEU A 1 2   ? -15.475 -19.581 9.273   1.00 0.00 ? 10  LEU B N    2  
ATOM   1960  C  CA   . LEU A 1 2   ? -14.457 -19.874 8.269   1.00 0.00 ? 10  LEU B CA   2  
ATOM   1961  C  C    . LEU A 1 2   ? -13.318 -18.862 8.338   1.00 0.00 ? 10  LEU B C    2  
ATOM   1962  O  O    . LEU A 1 2   ? -12.628 -18.622 7.346   1.00 0.00 ? 10  LEU B O    2  
ATOM   1963  C  CB   . LEU A 1 2   ? -15.076 -19.872 6.869   1.00 0.00 ? 10  LEU B CB   2  
ATOM   1964  C  CG   . LEU A 1 2   ? -16.209 -20.880 6.656   1.00 0.00 ? 10  LEU B CG   2  
ATOM   1965  C  CD1  . LEU A 1 2   ? -16.794 -20.735 5.259   1.00 0.00 ? 10  LEU B CD1  2  
ATOM   1966  C  CD2  . LEU A 1 2   ? -15.710 -22.300 6.880   1.00 0.00 ? 10  LEU B CD2  2  
ATOM   1967  H  H    . LEU A 1 2   ? -16.039 -18.787 9.165   1.00 0.00 ? 10  LEU B H    2  
ATOM   1968  H  HA   . LEU A 1 2   ? -14.062 -20.857 8.477   1.00 0.00 ? 10  LEU B HA   2  
ATOM   1969  H  HB2  . LEU A 1 2   ? -15.460 -18.882 6.670   1.00 0.00 ? 10  LEU B HB2  2  
ATOM   1970  H  HB3  . LEU A 1 2   ? -14.296 -20.087 6.155   1.00 0.00 ? 10  LEU B HB3  2  
ATOM   1971  H  HG   . LEU A 1 2   ? -16.996 -20.684 7.369   1.00 0.00 ? 10  LEU B HG   2  
ATOM   1972  H  HD11 . LEU A 1 2   ? -17.155 -19.726 5.123   1.00 0.00 ? 10  LEU B HD11 2  
ATOM   1973  H  HD12 . LEU A 1 2   ? -17.613 -21.429 5.138   1.00 0.00 ? 10  LEU B HD12 2  
ATOM   1974  H  HD13 . LEU A 1 2   ? -16.031 -20.946 4.526   1.00 0.00 ? 10  LEU B HD13 2  
ATOM   1975  H  HD21 . LEU A 1 2   ? -16.525 -22.994 6.736   1.00 0.00 ? 10  LEU B HD21 2  
ATOM   1976  H  HD22 . LEU A 1 2   ? -15.329 -22.394 7.886   1.00 0.00 ? 10  LEU B HD22 2  
ATOM   1977  H  HD23 . LEU A 1 2   ? -14.923 -22.520 6.174   1.00 0.00 ? 10  LEU B HD23 2  
ATOM   1978  N  N    . GLY A 1 3   ? -13.126 -18.271 9.513   1.00 0.00 ? 11  GLY B N    2  
ATOM   1979  C  CA   . GLY A 1 3   ? -12.069 -17.293 9.691   1.00 0.00 ? 11  GLY B CA   2  
ATOM   1980  C  C    . GLY A 1 3   ? -12.558 -16.025 10.363  1.00 0.00 ? 11  GLY B C    2  
ATOM   1981  O  O    . GLY A 1 3   ? -13.674 -15.982 10.885  1.00 0.00 ? 11  GLY B O    2  
ATOM   1982  H  H    . GLY A 1 3   ? -13.708 -18.504 10.268  1.00 0.00 ? 11  GLY B H    2  
ATOM   1983  H  HA2  . GLY A 1 3   ? -11.287 -17.729 10.295  1.00 0.00 ? 11  GLY B HA2  2  
ATOM   1984  H  HA3  . GLY A 1 3   ? -11.661 -17.040 8.722   1.00 0.00 ? 11  GLY B HA3  2  
ATOM   1985  N  N    . LYS A 1 4   ? -11.723 -14.989 10.354  1.00 0.00 ? 12  LYS B N    2  
ATOM   1986  C  CA   . LYS A 1 4   ? -12.078 -13.716 10.968  1.00 0.00 ? 12  LYS B CA   2  
ATOM   1987  C  C    . LYS A 1 4   ? -11.311 -12.567 10.320  1.00 0.00 ? 12  LYS B C    2  
ATOM   1988  O  O    . LYS A 1 4   ? -10.229 -12.194 10.774  1.00 0.00 ? 12  LYS B O    2  
ATOM   1989  C  CB   . LYS A 1 4   ? -11.791 -13.754 12.471  1.00 0.00 ? 12  LYS B CB   2  
ATOM   1990  C  CG   . LYS A 1 4   ? -12.342 -12.556 13.226  1.00 0.00 ? 12  LYS B CG   2  
ATOM   1991  C  CD   . LYS A 1 4   ? -11.996 -12.623 14.705  1.00 0.00 ? 12  LYS B CD   2  
ATOM   1992  C  CE   . LYS A 1 4   ? -12.642 -11.487 15.480  1.00 0.00 ? 12  LYS B CE   2  
ATOM   1993  N  NZ   . LYS A 1 4   ? -14.128 -11.544 15.413  1.00 0.00 ? 12  LYS B NZ   2  
ATOM   1994  H  H    . LYS A 1 4   ? -10.849 -15.085 9.922   1.00 0.00 ? 12  LYS B H    2  
ATOM   1995  H  HA   . LYS A 1 4   ? -13.135 -13.557 10.817  1.00 0.00 ? 12  LYS B HA   2  
ATOM   1996  H  HB2  . LYS A 1 4   ? -12.230 -14.648 12.886  1.00 0.00 ? 12  LYS B HB2  2  
ATOM   1997  H  HB3  . LYS A 1 4   ? -10.721 -13.785 12.620  1.00 0.00 ? 12  LYS B HB3  2  
ATOM   1998  H  HG2  . LYS A 1 4   ? -11.921 -11.654 12.808  1.00 0.00 ? 12  LYS B HG2  2  
ATOM   1999  H  HG3  . LYS A 1 4   ? -13.416 -12.538 13.118  1.00 0.00 ? 12  LYS B HG3  2  
ATOM   2000  H  HD2  . LYS A 1 4   ? -12.345 -13.563 15.104  1.00 0.00 ? 12  LYS B HD2  2  
ATOM   2001  H  HD3  . LYS A 1 4   ? -10.923 -12.559 14.816  1.00 0.00 ? 12  LYS B HD3  2  
ATOM   2002  H  HE2  . LYS A 1 4   ? -12.335 -11.553 16.514  1.00 0.00 ? 12  LYS B HE2  2  
ATOM   2003  H  HE3  . LYS A 1 4   ? -12.307 -10.548 15.065  1.00 0.00 ? 12  LYS B HE3  2  
ATOM   2004  H  HZ1  . LYS A 1 4   ? -14.468 -12.456 15.782  1.00 0.00 ? 12  LYS B HZ1  2  
ATOM   2005  H  HZ2  . LYS A 1 4   ? -14.446 -11.441 14.429  1.00 0.00 ? 12  LYS B HZ2  2  
ATOM   2006  H  HZ3  . LYS A 1 4   ? -14.542 -10.778 15.982  1.00 0.00 ? 12  LYS B HZ3  2  
ATOM   2007  N  N    . GLY A 1 5   ? -11.879 -12.012 9.253   1.00 0.00 ? 13  GLY B N    2  
ATOM   2008  C  CA   . GLY A 1 5   ? -11.237 -10.912 8.556   1.00 0.00 ? 13  GLY B CA   2  
ATOM   2009  C  C    . GLY A 1 5   ? -11.317 -9.608  9.324   1.00 0.00 ? 13  GLY B C    2  
ATOM   2010  O  O    . GLY A 1 5   ? -12.316 -9.330  9.987   1.00 0.00 ? 13  GLY B O    2  
ATOM   2011  H  H    . GLY A 1 5   ? -12.743 -12.351 8.937   1.00 0.00 ? 13  GLY B H    2  
ATOM   2012  H  HA2  . GLY A 1 5   ? -10.198 -11.161 8.396   1.00 0.00 ? 13  GLY B HA2  2  
ATOM   2013  H  HA3  . GLY A 1 5   ? -11.716 -10.782 7.596   1.00 0.00 ? 13  GLY B HA3  2  
ATOM   2014  N  N    . GLY A 1 6   ? -10.259 -8.807  9.233   1.00 0.00 ? 14  GLY B N    2  
ATOM   2015  C  CA   . GLY A 1 6   ? -10.228 -7.533  9.926   1.00 0.00 ? 14  GLY B CA   2  
ATOM   2016  C  C    . GLY A 1 6   ? -9.264  -6.553  9.287   1.00 0.00 ? 14  GLY B C    2  
ATOM   2017  O  O    . GLY A 1 6   ? -9.573  -5.370  9.143   1.00 0.00 ? 14  GLY B O    2  
ATOM   2018  H  H    . GLY A 1 6   ? -9.493  -9.086  8.689   1.00 0.00 ? 14  GLY B H    2  
ATOM   2019  H  HA2  . GLY A 1 6   ? -11.219 -7.105  9.917   1.00 0.00 ? 14  GLY B HA2  2  
ATOM   2020  H  HA3  . GLY A 1 6   ? -9.927  -7.699  10.950  1.00 0.00 ? 14  GLY B HA3  2  
ATOM   2021  N  N    . ALA A 1 7   ? -8.091  -7.049  8.903   1.00 0.00 ? 15  ALA B N    2  
ATOM   2022  C  CA   . ALA A 1 7   ? -7.075  -6.216  8.273   1.00 0.00 ? 15  ALA B CA   2  
ATOM   2023  C  C    . ALA A 1 7   ? -6.350  -6.980  7.171   1.00 0.00 ? 15  ALA B C    2  
ATOM   2024  O  O    . ALA A 1 7   ? -6.382  -8.210  7.131   1.00 0.00 ? 15  ALA B O    2  
ATOM   2025  C  CB   . ALA A 1 7   ? -6.081  -5.719  9.312   1.00 0.00 ? 15  ALA B CB   2  
ATOM   2026  H  H    . ALA A 1 7   ? -7.907  -8.000  9.047   1.00 0.00 ? 15  ALA B H    2  
ATOM   2027  H  HA   . ALA A 1 7   ? -7.568  -5.358  7.840   1.00 0.00 ? 15  ALA B HA   2  
ATOM   2028  H  HB1  . ALA A 1 7   ? -5.577  -6.562  9.760   1.00 0.00 ? 15  ALA B HB1  2  
ATOM   2029  H  HB2  . ALA A 1 7   ? -6.606  -5.166  10.077  1.00 0.00 ? 15  ALA B HB2  2  
ATOM   2030  H  HB3  . ALA A 1 7   ? -5.355  -5.075  8.838   1.00 0.00 ? 15  ALA B HB3  2  
HETATM 2031  O  OH   . ALY A 1 8   ? -5.557  -5.708  -1.259  1.00 0.00 ? 16  ALY B OH   2  
HETATM 2032  C  CH   . ALY A 1 8   ? -6.782  -5.825  -1.214  1.00 0.00 ? 16  ALY B CH   2  
HETATM 2033  C  CH3  . ALY A 1 8   ? -7.621  -5.081  -2.255  1.00 0.00 ? 16  ALY B CH3  2  
HETATM 2034  N  NZ   . ALY A 1 8   ? -7.393  -6.289  -0.131  1.00 0.00 ? 16  ALY B NZ   2  
HETATM 2035  C  CE   . ALY A 1 8   ? -6.765  -6.274  1.185   1.00 0.00 ? 16  ALY B CE   2  
HETATM 2036  C  CD   . ALY A 1 8   ? -6.081  -7.594  1.507   1.00 0.00 ? 16  ALY B CD   2  
HETATM 2037  C  CG   . ALY A 1 8   ? -5.146  -7.471  2.702   1.00 0.00 ? 16  ALY B CG   2  
HETATM 2038  C  CB   . ALY A 1 8   ? -5.888  -7.068  3.970   1.00 0.00 ? 16  ALY B CB   2  
HETATM 2039  C  CA   . ALY A 1 8   ? -4.966  -6.853  5.173   1.00 0.00 ? 16  ALY B CA   2  
HETATM 2040  N  N    . ALY A 1 8   ? -5.700  -6.244  6.276   1.00 0.00 ? 16  ALY B N    2  
HETATM 2041  C  C    . ALY A 1 8   ? -3.780  -5.989  4.761   1.00 0.00 ? 16  ALY B C    2  
HETATM 2042  O  O    . ALY A 1 8   ? -2.635  -6.442  4.784   1.00 0.00 ? 16  ALY B O    2  
HETATM 2043  H  HH31 . ALY A 1 8   ? -8.643  -5.424  -2.206  1.00 0.00 ? 16  ALY B HH31 2  
HETATM 2044  H  HH32 . ALY A 1 8   ? -7.585  -4.022  -2.047  1.00 0.00 ? 16  ALY B HH32 2  
HETATM 2045  H  HH33 . ALY A 1 8   ? -7.223  -5.268  -3.241  1.00 0.00 ? 16  ALY B HH33 2  
HETATM 2046  H  HZ   . ALY A 1 8   ? -8.369  -6.368  -0.152  1.00 0.00 ? 16  ALY B HZ   2  
HETATM 2047  H  HE3  . ALY A 1 8   ? -6.034  -5.475  1.215   1.00 0.00 ? 16  ALY B HE3  2  
HETATM 2048  H  HE2  . ALY A 1 8   ? -7.526  -6.092  1.929   1.00 0.00 ? 16  ALY B HE2  2  
HETATM 2049  H  HD3  . ALY A 1 8   ? -6.835  -8.336  1.729   1.00 0.00 ? 16  ALY B HD3  2  
HETATM 2050  H  HD2  . ALY A 1 8   ? -5.509  -7.909  0.648   1.00 0.00 ? 16  ALY B HD2  2  
HETATM 2051  H  HG3  . ALY A 1 8   ? -4.664  -8.424  2.870   1.00 0.00 ? 16  ALY B HG3  2  
HETATM 2052  H  HG2  . ALY A 1 8   ? -4.399  -6.724  2.483   1.00 0.00 ? 16  ALY B HG2  2  
HETATM 2053  H  HB3  . ALY A 1 8   ? -6.423  -6.150  3.772   1.00 0.00 ? 16  ALY B HB3  2  
HETATM 2054  H  HB2  . ALY A 1 8   ? -6.600  -7.845  4.210   1.00 0.00 ? 16  ALY B HB2  2  
HETATM 2055  H  HCA  . ALY A 1 8   ? -4.600  -7.811  5.509   1.00 0.00 ? 16  ALY B HCA  2  
HETATM 2056  H  H    . ALY A 1 8   ? -5.712  -5.267  6.360   1.00 0.00 ? 16  ALY B H    2  
ATOM   2057  N  N    . ARG A 1 9   ? -4.065  -4.746  4.385   1.00 0.00 ? 17  ARG B N    2  
ATOM   2058  C  CA   . ARG A 1 9   ? -3.027  -3.819  3.950   1.00 0.00 ? 17  ARG B CA   2  
ATOM   2059  C  C    . ARG A 1 9   ? -2.278  -4.386  2.747   1.00 0.00 ? 17  ARG B C    2  
ATOM   2060  O  O    . ARG A 1 9   ? -2.753  -4.304  1.615   1.00 0.00 ? 17  ARG B O    2  
ATOM   2061  C  CB   . ARG A 1 9   ? -2.046  -3.520  5.093   1.00 0.00 ? 17  ARG B CB   2  
ATOM   2062  C  CG   . ARG A 1 9   ? -0.843  -2.685  4.670   1.00 0.00 ? 17  ARG B CG   2  
ATOM   2063  C  CD   . ARG A 1 9   ? -1.174  -1.202  4.639   1.00 0.00 ? 17  ARG B CD   2  
ATOM   2064  N  NE   . ARG A 1 9   ? -1.402  -0.667  5.979   1.00 0.00 ? 17  ARG B NE   2  
ATOM   2065  C  CZ   . ARG A 1 9   ? -0.447  -0.549  6.899   1.00 0.00 ? 17  ARG B CZ   2  
ATOM   2066  N  NH1  . ARG A 1 9   ? 0.794   -0.926  6.625   1.00 0.00 ? 17  ARG B NH1  2  
ATOM   2067  N  NH2  . ARG A 1 9   ? -0.734  -0.055  8.095   1.00 0.00 ? 17  ARG B NH2  2  
ATOM   2068  H  H    . ARG A 1 9   ? -4.998  -4.445  4.400   1.00 0.00 ? 17  ARG B H    2  
ATOM   2069  H  HA   . ARG A 1 9   ? -3.511  -2.900  3.653   1.00 0.00 ? 17  ARG B HA   2  
ATOM   2070  H  HB2  . ARG A 1 9   ? -2.573  -2.986  5.870   1.00 0.00 ? 17  ARG B HB2  2  
ATOM   2071  H  HB3  . ARG A 1 9   ? -1.685  -4.456  5.494   1.00 0.00 ? 17  ARG B HB3  2  
ATOM   2072  H  HG2  . ARG A 1 9   ? -0.041  -2.848  5.377   1.00 0.00 ? 17  ARG B HG2  2  
ATOM   2073  H  HG3  . ARG A 1 9   ? -0.523  -2.999  3.681   1.00 0.00 ? 17  ARG B HG3  2  
ATOM   2074  H  HD2  . ARG A 1 9   ? -0.351  -0.671  4.185   1.00 0.00 ? 17  ARG B HD2  2  
ATOM   2075  H  HD3  . ARG A 1 9   ? -2.065  -1.057  4.047   1.00 0.00 ? 17  ARG B HD3  2  
ATOM   2076  H  HE   . ARG A 1 9   ? -2.310  -0.381  6.205   1.00 0.00 ? 17  ARG B HE   2  
ATOM   2077  H  HH11 . ARG A 1 9   ? 1.017   -1.301  5.725   1.00 0.00 ? 17  ARG B HH11 2  
ATOM   2078  H  HH12 . ARG A 1 9   ? 1.509   -0.837  7.319   1.00 0.00 ? 17  ARG B HH12 2  
ATOM   2079  H  HH21 . ARG A 1 9   ? -1.669  0.231   8.307   1.00 0.00 ? 17  ARG B HH21 2  
ATOM   2080  H  HH22 . ARG A 1 9   ? -0.016  0.031   8.787   1.00 0.00 ? 17  ARG B HH22 2  
ATOM   2081  N  N    . HIS A 1 10  ? -1.117  -4.981  3.008   1.00 0.00 ? 18  HIS B N    2  
ATOM   2082  C  CA   . HIS A 1 10  ? -0.290  -5.558  1.961   1.00 0.00 ? 18  HIS B CA   2  
ATOM   2083  C  C    . HIS A 1 10  ? 0.400   -6.822  2.477   1.00 0.00 ? 18  HIS B C    2  
ATOM   2084  O  O    . HIS A 1 10  ? -0.173  -7.579  3.262   1.00 0.00 ? 18  HIS B O    2  
ATOM   2085  C  CB   . HIS A 1 10  ? 0.767   -4.541  1.495   1.00 0.00 ? 18  HIS B CB   2  
ATOM   2086  C  CG   . HIS A 1 10  ? 0.227   -3.188  1.128   1.00 0.00 ? 18  HIS B CG   2  
ATOM   2087  N  ND1  . HIS A 1 10  ? 0.681   -2.018  1.700   1.00 0.00 ? 18  HIS B ND1  2  
ATOM   2088  C  CD2  . HIS A 1 10  ? -0.720  -2.818  0.232   1.00 0.00 ? 18  HIS B CD2  2  
ATOM   2089  C  CE1  . HIS A 1 10  ? 0.038   -0.991  1.175   1.00 0.00 ? 18  HIS B CE1  2  
ATOM   2090  N  NE2  . HIS A 1 10  ? -0.816  -1.449  0.282   1.00 0.00 ? 18  HIS B NE2  2  
ATOM   2091  H  H    . HIS A 1 10  ? -0.810  -5.038  3.936   1.00 0.00 ? 18  HIS B H    2  
ATOM   2092  H  HA   . HIS A 1 10  ? -0.929  -5.815  1.131   1.00 0.00 ? 18  HIS B HA   2  
ATOM   2093  H  HB2  . HIS A 1 10  ? 1.487   -4.402  2.282   1.00 0.00 ? 18  HIS B HB2  2  
ATOM   2094  H  HB3  . HIS A 1 10  ? 1.275   -4.934  0.630   1.00 0.00 ? 18  HIS B HB3  2  
ATOM   2095  H  HD1  . HIS A 1 10  ? 1.373   -1.952  2.390   1.00 0.00 ? 18  HIS B HD1  2  
ATOM   2096  H  HD2  . HIS A 1 10  ? -1.288  -3.473  -0.408  1.00 0.00 ? 18  HIS B HD2  2  
ATOM   2097  H  HE1  . HIS A 1 10  ? 0.186   0.046   1.434   1.00 0.00 ? 18  HIS B HE1  2  
ATOM   2098  H  HE2  . HIS A 1 10  ? -1.441  -0.901  -0.238  1.00 0.00 ? 18  HIS B HE2  2  
ATOM   2099  N  N    . ARG A 1 11  ? 1.629   -7.041  2.015   1.00 0.00 ? 19  ARG B N    2  
ATOM   2100  C  CA   . ARG A 1 11  ? 2.442   -8.187  2.416   1.00 0.00 ? 19  ARG B CA   2  
ATOM   2101  C  C    . ARG A 1 11  ? 1.941   -9.513  1.850   1.00 0.00 ? 19  ARG B C    2  
ATOM   2102  O  O    . ARG A 1 11  ? 2.641   -10.522 1.929   1.00 0.00 ? 19  ARG B O    2  
ATOM   2103  C  CB   . ARG A 1 11  ? 2.560   -8.255  3.931   1.00 0.00 ? 19  ARG B CB   2  
ATOM   2104  C  CG   . ARG A 1 11  ? 3.668   -9.184  4.402   1.00 0.00 ? 19  ARG B CG   2  
ATOM   2105  C  CD   . ARG A 1 11  ? 4.006   -8.969  5.867   1.00 0.00 ? 19  ARG B CD   2  
ATOM   2106  N  NE   . ARG A 1 11  ? 5.100   -9.836  6.300   1.00 0.00 ? 19  ARG B NE   2  
ATOM   2107  C  CZ   . ARG A 1 11  ? 6.266   -9.386  6.753   1.00 0.00 ? 19  ARG B CZ   2  
ATOM   2108  N  NH1  . ARG A 1 11  ? 6.488   -8.082  6.848   1.00 0.00 ? 19  ARG B NH1  2  
ATOM   2109  N  NH2  . ARG A 1 11  ? 7.213   -10.242 7.112   1.00 0.00 ? 19  ARG B NH2  2  
ATOM   2110  H  H    . ARG A 1 11  ? 2.007   -6.406  1.374   1.00 0.00 ? 19  ARG B H    2  
ATOM   2111  H  HA   . ARG A 1 11  ? 3.421   -8.018  2.012   1.00 0.00 ? 19  ARG B HA   2  
ATOM   2112  H  HB2  . ARG A 1 11  ? 2.761   -7.261  4.294   1.00 0.00 ? 19  ARG B HB2  2  
ATOM   2113  H  HB3  . ARG A 1 11  ? 1.624   -8.602  4.341   1.00 0.00 ? 19  ARG B HB3  2  
ATOM   2114  H  HG2  . ARG A 1 11  ? 3.348   -10.206 4.266   1.00 0.00 ? 19  ARG B HG2  2  
ATOM   2115  H  HG3  . ARG A 1 11  ? 4.553   -9.001  3.808   1.00 0.00 ? 19  ARG B HG3  2  
ATOM   2116  H  HD2  . ARG A 1 11  ? 4.296   -7.939  6.010   1.00 0.00 ? 19  ARG B HD2  2  
ATOM   2117  H  HD3  . ARG A 1 11  ? 3.130   -9.184  6.462   1.00 0.00 ? 19  ARG B HD3  2  
ATOM   2118  H  HE   . ARG A 1 11  ? 4.959   -10.804 6.243   1.00 0.00 ? 19  ARG B HE   2  
ATOM   2119  H  HH11 . ARG A 1 11  ? 5.777   -7.432  6.576   1.00 0.00 ? 19  ARG B HH11 2  
ATOM   2120  H  HH12 . ARG A 1 11  ? 7.366   -7.748  7.189   1.00 0.00 ? 19  ARG B HH12 2  
ATOM   2121  H  HH21 . ARG A 1 11  ? 7.051   -11.227 7.042   1.00 0.00 ? 19  ARG B HH21 2  
ATOM   2122  H  HH22 . ARG A 1 11  ? 8.091   -9.903  7.453   1.00 0.00 ? 19  ARG B HH22 2  
ATOM   2123  N  N    . LYS A 1 12  ? 0.737   -9.503  1.289   1.00 0.00 ? 20  LYS B N    2  
ATOM   2124  C  CA   . LYS A 1 12  ? 0.147   -10.695 0.676   1.00 0.00 ? 20  LYS B CA   2  
ATOM   2125  C  C    . LYS A 1 12  ? 0.422   -11.962 1.490   1.00 0.00 ? 20  LYS B C    2  
ATOM   2126  O  O    . LYS A 1 12  ? 0.613   -11.900 2.705   1.00 0.00 ? 20  LYS B O    2  
ATOM   2127  C  CB   . LYS A 1 12  ? 0.668   -10.847 -0.760  1.00 0.00 ? 20  LYS B CB   2  
ATOM   2128  C  CG   . LYS A 1 12  ? 2.134   -11.213 -0.872  1.00 0.00 ? 20  LYS B CG   2  
ATOM   2129  C  CD   . LYS A 1 12  ? 2.647   -10.940 -2.275  1.00 0.00 ? 20  LYS B CD   2  
ATOM   2130  C  CE   . LYS A 1 12  ? 4.146   -11.125 -2.367  1.00 0.00 ? 20  LYS B CE   2  
ATOM   2131  N  NZ   . LYS A 1 12  ? 4.545   -11.773 -3.647  1.00 0.00 ? 20  LYS B NZ   2  
ATOM   2132  H  H    . LYS A 1 12  ? 0.224   -8.670  1.285   1.00 0.00 ? 20  LYS B H    2  
ATOM   2133  H  HA   . LYS A 1 12  ? -0.920  -10.542 0.638   1.00 0.00 ? 20  LYS B HA   2  
ATOM   2134  H  HB2  . LYS A 1 12  ? 0.093   -11.607 -1.264  1.00 0.00 ? 20  LYS B HB2  2  
ATOM   2135  H  HB3  . LYS A 1 12  ? 0.534   -9.909  -1.274  1.00 0.00 ? 20  LYS B HB3  2  
ATOM   2136  H  HG2  . LYS A 1 12  ? 2.702   -10.623 -0.170  1.00 0.00 ? 20  LYS B HG2  2  
ATOM   2137  H  HG3  . LYS A 1 12  ? 2.255   -12.262 -0.650  1.00 0.00 ? 20  LYS B HG3  2  
ATOM   2138  H  HD2  . LYS A 1 12  ? 2.166   -11.618 -2.963  1.00 0.00 ? 20  LYS B HD2  2  
ATOM   2139  H  HD3  . LYS A 1 12  ? 2.404   -9.919  -2.540  1.00 0.00 ? 20  LYS B HD3  2  
ATOM   2140  H  HE2  . LYS A 1 12  ? 4.618   -10.152 -2.299  1.00 0.00 ? 20  LYS B HE2  2  
ATOM   2141  H  HE3  . LYS A 1 12  ? 4.471   -11.742 -1.542  1.00 0.00 ? 20  LYS B HE3  2  
ATOM   2142  H  HZ1  . LYS A 1 12  ? 4.244   -11.187 -4.452  1.00 0.00 ? 20  LYS B HZ1  2  
ATOM   2143  H  HZ2  . LYS A 1 12  ? 4.100   -12.709 -3.727  1.00 0.00 ? 20  LYS B HZ2  2  
ATOM   2144  H  HZ3  . LYS A 1 12  ? 5.577   -11.889 -3.682  1.00 0.00 ? 20  LYS B HZ3  2  
ATOM   2145  N  N    . VAL A 1 13  ? 0.423   -13.108 0.816   1.00 0.00 ? 21  VAL B N    2  
ATOM   2146  C  CA   . VAL A 1 13  ? 0.671   -14.386 1.476   1.00 0.00 ? 21  VAL B CA   2  
ATOM   2147  C  C    . VAL A 1 13  ? 2.159   -14.723 1.482   1.00 0.00 ? 21  VAL B C    2  
ATOM   2148  O  O    . VAL A 1 13  ? 2.964   -14.037 0.849   1.00 0.00 ? 21  VAL B O    2  
ATOM   2149  C  CB   . VAL A 1 13  ? -0.103  -15.532 0.796   1.00 0.00 ? 21  VAL B CB   2  
ATOM   2150  C  CG1  . VAL A 1 13  ? -1.595  -15.236 0.786   1.00 0.00 ? 21  VAL B CG1  2  
ATOM   2151  C  CG2  . VAL A 1 13  ? 0.408   -15.761 -0.619  1.00 0.00 ? 21  VAL B CG2  2  
ATOM   2152  H  H    . VAL A 1 13  ? 0.250   -13.097 -0.149  1.00 0.00 ? 21  VAL B H    2  
ATOM   2153  H  HA   . VAL A 1 13  ? 0.327   -14.304 2.498   1.00 0.00 ? 21  VAL B HA   2  
ATOM   2154  H  HB   . VAL A 1 13  ? 0.057   -16.436 1.364   1.00 0.00 ? 21  VAL B HB   2  
ATOM   2155  H  HG11 . VAL A 1 13  ? -2.118  -16.041 0.290   1.00 0.00 ? 21  VAL B HG11 2  
ATOM   2156  H  HG12 . VAL A 1 13  ? -1.775  -14.311 0.259   1.00 0.00 ? 21  VAL B HG12 2  
ATOM   2157  H  HG13 . VAL A 1 13  ? -1.951  -15.148 1.803   1.00 0.00 ? 21  VAL B HG13 2  
ATOM   2158  H  HG21 . VAL A 1 13  ? 0.315   -14.849 -1.190  1.00 0.00 ? 21  VAL B HG21 2  
ATOM   2159  H  HG22 . VAL A 1 13  ? -0.173  -16.540 -1.090  1.00 0.00 ? 21  VAL B HG22 2  
ATOM   2160  H  HG23 . VAL A 1 13  ? 1.446   -16.059 -0.584  1.00 0.00 ? 21  VAL B HG23 2  
ATOM   2161  N  N    . LEU A 1 14  ? 2.520   -15.783 2.200   1.00 0.00 ? 22  LEU B N    2  
ATOM   2162  C  CA   . LEU A 1 14  ? 3.912   -16.213 2.285   1.00 0.00 ? 22  LEU B CA   2  
ATOM   2163  C  C    . LEU A 1 14  ? 4.022   -17.617 2.875   1.00 0.00 ? 22  LEU B C    2  
ATOM   2164  O  O    . LEU A 1 14  ? 5.087   -18.234 2.839   1.00 0.00 ? 22  LEU B O    2  
ATOM   2165  C  CB   . LEU A 1 14  ? 4.728   -15.221 3.125   1.00 0.00 ? 22  LEU B CB   2  
ATOM   2166  C  CG   . LEU A 1 14  ? 4.095   -14.805 4.458   1.00 0.00 ? 22  LEU B CG   2  
ATOM   2167  C  CD1  . LEU A 1 14  ? 4.222   -15.915 5.491   1.00 0.00 ? 22  LEU B CD1  2  
ATOM   2168  C  CD2  . LEU A 1 14  ? 4.737   -13.525 4.971   1.00 0.00 ? 22  LEU B CD2  2  
ATOM   2169  H  H    . LEU A 1 14  ? 1.834   -16.287 2.685   1.00 0.00 ? 22  LEU B H    2  
ATOM   2170  H  HA   . LEU A 1 14  ? 4.311   -16.229 1.282   1.00 0.00 ? 22  LEU B HA   2  
ATOM   2171  H  HB2  . LEU A 1 14  ? 5.690   -15.666 3.331   1.00 0.00 ? 22  LEU B HB2  2  
ATOM   2172  H  HB3  . LEU A 1 14  ? 4.883   -14.330 2.535   1.00 0.00 ? 22  LEU B HB3  2  
ATOM   2173  H  HG   . LEU A 1 14  ? 3.043   -14.612 4.304   1.00 0.00 ? 22  LEU B HG   2  
ATOM   2174  H  HD11 . LEU A 1 14  ? 3.643   -16.769 5.177   1.00 0.00 ? 22  LEU B HD11 2  
ATOM   2175  H  HD12 . LEU A 1 14  ? 3.856   -15.563 6.444   1.00 0.00 ? 22  LEU B HD12 2  
ATOM   2176  H  HD13 . LEU A 1 14  ? 5.261   -16.199 5.588   1.00 0.00 ? 22  LEU B HD13 2  
ATOM   2177  H  HD21 . LEU A 1 14  ? 5.786   -13.699 5.158   1.00 0.00 ? 22  LEU B HD21 2  
ATOM   2178  H  HD22 . LEU A 1 14  ? 4.254   -13.222 5.888   1.00 0.00 ? 22  LEU B HD22 2  
ATOM   2179  H  HD23 . LEU A 1 14  ? 4.627   -12.745 4.232   1.00 0.00 ? 22  LEU B HD23 2  
ATOM   2180  N  N    . ARG A 1 15  ? 2.914   -18.118 3.415   1.00 0.00 ? 23  ARG B N    2  
ATOM   2181  C  CA   . ARG A 1 15  ? 2.890   -19.450 4.012   1.00 0.00 ? 23  ARG B CA   2  
ATOM   2182  C  C    . ARG A 1 15  ? 2.346   -20.484 3.029   1.00 0.00 ? 23  ARG B C    2  
ATOM   2183  O  O    . ARG A 1 15  ? 3.145   -21.008 2.224   1.00 0.00 ? 23  ARG B O    2  
ATOM   2184  C  CB   . ARG A 1 15  ? 2.054   -19.440 5.296   1.00 0.00 ? 23  ARG B CB   2  
ATOM   2185  C  CG   . ARG A 1 15  ? 0.707   -18.749 5.149   1.00 0.00 ? 23  ARG B CG   2  
ATOM   2186  C  CD   . ARG A 1 15  ? -0.020  -18.656 6.481   1.00 0.00 ? 23  ARG B CD   2  
ATOM   2187  N  NE   . ARG A 1 15  ? 0.705   -17.833 7.445   1.00 0.00 ? 23  ARG B NE   2  
ATOM   2188  C  CZ   . ARG A 1 15  ? 0.252   -17.551 8.664   1.00 0.00 ? 23  ARG B CZ   2  
ATOM   2189  N  NH1  . ARG A 1 15  ? -0.922  -18.022 9.064   1.00 0.00 ? 23  ARG B NH1  2  
ATOM   2190  N  NH2  . ARG A 1 15  ? 0.973   -16.797 9.482   1.00 0.00 ? 23  ARG B NH2  2  
ATOM   2191  O  OXT  . ARG A 1 15  ? 1.129   -20.764 3.070   1.00 0.00 ? 23  ARG B OXT  2  
ATOM   2192  H  H    . ARG A 1 15  ? 2.096   -17.580 3.412   1.00 0.00 ? 23  ARG B H    2  
ATOM   2193  H  HA   . ARG A 1 15  ? 3.906   -19.713 4.261   1.00 0.00 ? 23  ARG B HA   2  
ATOM   2194  H  HB2  . ARG A 1 15  ? 1.878   -20.459 5.605   1.00 0.00 ? 23  ARG B HB2  2  
ATOM   2195  H  HB3  . ARG A 1 15  ? 2.612   -18.931 6.069   1.00 0.00 ? 23  ARG B HB3  2  
ATOM   2196  H  HG2  . ARG A 1 15  ? 0.864   -17.752 4.768   1.00 0.00 ? 23  ARG B HG2  2  
ATOM   2197  H  HG3  . ARG A 1 15  ? 0.099   -19.310 4.456   1.00 0.00 ? 23  ARG B HG3  2  
ATOM   2198  H  HD2  . ARG A 1 15  ? -0.996  -18.224 6.316   1.00 0.00 ? 23  ARG B HD2  2  
ATOM   2199  H  HD3  . ARG A 1 15  ? -0.133  -19.652 6.885   1.00 0.00 ? 23  ARG B HD3  2  
ATOM   2200  H  HE   . ARG A 1 15  ? 1.574   -17.472 7.170   1.00 0.00 ? 23  ARG B HE   2  
ATOM   2201  H  HH11 . ARG A 1 15  ? -1.469  -18.590 8.450   1.00 0.00 ? 23  ARG B HH11 2  
ATOM   2202  H  HH12 . ARG A 1 15  ? -1.259  -17.808 9.982   1.00 0.00 ? 23  ARG B HH12 2  
ATOM   2203  H  HH21 . ARG A 1 15  ? 1.858   -16.439 9.183   1.00 0.00 ? 23  ARG B HH21 2  
ATOM   2204  H  HH22 . ARG A 1 15  ? 0.631   -16.586 10.398  1.00 0.00 ? 23  ARG B HH22 2  
ATOM   2205  N  N    . GLY B 2 1   ? -19.613 -1.383  -10.735 1.00 0.00 ? 259 GLY A N    2  
ATOM   2206  C  CA   . GLY B 2 1   ? -18.914 -0.615  -9.669  1.00 0.00 ? 259 GLY A CA   2  
ATOM   2207  C  C    . GLY B 2 1   ? -18.108 -1.506  -8.743  1.00 0.00 ? 259 GLY A C    2  
ATOM   2208  O  O    . GLY B 2 1   ? -18.378 -2.702  -8.633  1.00 0.00 ? 259 GLY A O    2  
ATOM   2209  H  H1   . GLY B 2 1   ? -20.272 -2.066  -10.311 1.00 0.00 ? 259 GLY A H1   2  
ATOM   2210  H  H2   . GLY B 2 1   ? -18.920 -1.900  -11.316 1.00 0.00 ? 259 GLY A H2   2  
ATOM   2211  H  H3   . GLY B 2 1   ? -20.148 -0.736  -11.349 1.00 0.00 ? 259 GLY A H3   2  
ATOM   2212  H  HA2  . GLY B 2 1   ? -18.250 0.101   -10.131 1.00 0.00 ? 259 GLY A HA2  2  
ATOM   2213  H  HA3  . GLY B 2 1   ? -19.650 -0.081  -9.085  1.00 0.00 ? 259 GLY A HA3  2  
ATOM   2214  N  N    . SER B 2 2   ? -17.118 -0.920  -8.079  1.00 0.00 ? 260 SER A N    2  
ATOM   2215  C  CA   . SER B 2 2   ? -16.267 -1.664  -7.156  1.00 0.00 ? 260 SER A CA   2  
ATOM   2216  C  C    . SER B 2 2   ? -16.688 -1.462  -5.716  1.00 0.00 ? 260 SER A C    2  
ATOM   2217  O  O    . SER B 2 2   ? -17.726 -0.864  -5.430  1.00 0.00 ? 260 SER A O    2  
ATOM   2218  C  CB   . SER B 2 2   ? -14.816 -1.246  -7.295  1.00 0.00 ? 260 SER A CB   2  
ATOM   2219  O  OG   . SER B 2 2   ? -14.237 -1.767  -8.479  1.00 0.00 ? 260 SER A OG   2  
ATOM   2220  H  H    . SER B 2 2   ? -16.954 0.038   -8.210  1.00 0.00 ? 260 SER A H    2  
ATOM   2221  H  HA   . SER B 2 2   ? -16.342 -2.711  -7.391  1.00 0.00 ? 260 SER A HA   2  
ATOM   2222  H  HB2  . SER B 2 2   ? -14.753 -0.167  -7.320  1.00 0.00 ? 260 SER A HB2  2  
ATOM   2223  H  HB3  . SER B 2 2   ? -14.273 -1.623  -6.439  1.00 0.00 ? 260 SER A HB3  2  
ATOM   2224  H  HG   . SER B 2 2   ? -13.338 -2.049  -8.298  1.00 0.00 ? 260 SER A HG   2  
ATOM   2225  N  N    . TYR B 2 3   ? -15.860 -1.970  -4.815  1.00 0.00 ? 261 TYR A N    2  
ATOM   2226  C  CA   . TYR B 2 3   ? -16.108 -1.860  -3.395  1.00 0.00 ? 261 TYR A CA   2  
ATOM   2227  C  C    . TYR B 2 3   ? -14.872 -2.256  -2.601  1.00 0.00 ? 261 TYR A C    2  
ATOM   2228  O  O    . TYR B 2 3   ? -13.982 -2.936  -3.114  1.00 0.00 ? 261 TYR A O    2  
ATOM   2229  C  CB   . TYR B 2 3   ? -17.274 -2.763  -2.998  1.00 0.00 ? 261 TYR A CB   2  
ATOM   2230  C  CG   . TYR B 2 3   ? -17.172 -4.176  -3.528  1.00 0.00 ? 261 TYR A CG   2  
ATOM   2231  C  CD1  . TYR B 2 3   ? -16.068 -4.956  -3.245  1.00 0.00 ? 261 TYR A CD1  2  
ATOM   2232  C  CD2  . TYR B 2 3   ? -18.189 -4.733  -4.295  1.00 0.00 ? 261 TYR A CD2  2  
ATOM   2233  C  CE1  . TYR B 2 3   ? -15.964 -6.245  -3.704  1.00 0.00 ? 261 TYR A CE1  2  
ATOM   2234  C  CE2  . TYR B 2 3   ? -18.095 -6.031  -4.765  1.00 0.00 ? 261 TYR A CE2  2  
ATOM   2235  C  CZ   . TYR B 2 3   ? -16.979 -6.783  -4.467  1.00 0.00 ? 261 TYR A CZ   2  
ATOM   2236  O  OH   . TYR B 2 3   ? -16.880 -8.077  -4.928  1.00 0.00 ? 261 TYR A OH   2  
ATOM   2237  H  H    . TYR B 2 3   ? -15.060 -2.449  -5.120  1.00 0.00 ? 261 TYR A H    2  
ATOM   2238  H  HA   . TYR B 2 3   ? -16.360 -0.834  -3.171  1.00 0.00 ? 261 TYR A HA   2  
ATOM   2239  H  HB2  . TYR B 2 3   ? -17.316 -2.817  -1.928  1.00 0.00 ? 261 TYR A HB2  2  
ATOM   2240  H  HB3  . TYR B 2 3   ? -18.188 -2.347  -3.360  1.00 0.00 ? 261 TYR A HB3  2  
ATOM   2241  H  HD1  . TYR B 2 3   ? -15.271 -4.531  -2.657  1.00 0.00 ? 261 TYR A HD1  2  
ATOM   2242  H  HD2  . TYR B 2 3   ? -19.060 -4.137  -4.525  1.00 0.00 ? 261 TYR A HD2  2  
ATOM   2243  H  HE1  . TYR B 2 3   ? -15.092 -6.826  -3.458  1.00 0.00 ? 261 TYR A HE1  2  
ATOM   2244  H  HE2  . TYR B 2 3   ? -18.893 -6.447  -5.363  1.00 0.00 ? 261 TYR A HE2  2  
ATOM   2245  H  HH   . TYR B 2 3   ? -16.563 -8.645  -4.223  1.00 0.00 ? 261 TYR A HH   2  
ATOM   2246  N  N    . CYS B 2 4   ? -14.809 -1.808  -1.360  1.00 0.00 ? 262 CYS A N    2  
ATOM   2247  C  CA   . CYS B 2 4   ? -13.711 -2.156  -0.483  1.00 0.00 ? 262 CYS A CA   2  
ATOM   2248  C  C    . CYS B 2 4   ? -13.723 -3.652  -0.203  1.00 0.00 ? 262 CYS A C    2  
ATOM   2249  O  O    . CYS B 2 4   ? -14.756 -4.217  0.128   1.00 0.00 ? 262 CYS A O    2  
ATOM   2250  C  CB   . CYS B 2 4   ? -13.860 -1.379  0.811   1.00 0.00 ? 262 CYS A CB   2  
ATOM   2251  S  SG   . CYS B 2 4   ? -13.229 -2.185  2.312   1.00 0.00 ? 262 CYS A SG   2  
ATOM   2252  H  H    . CYS B 2 4   ? -15.500 -1.190  -1.031  1.00 0.00 ? 262 CYS A H    2  
ATOM   2253  H  HA   . CYS B 2 4   ? -12.785 -1.878  -0.970  1.00 0.00 ? 262 CYS A HA   2  
ATOM   2254  H  HB2  . CYS B 2 4   ? -13.348 -0.443  0.717   1.00 0.00 ? 262 CYS A HB2  2  
ATOM   2255  H  HB3  . CYS B 2 4   ? -14.910 -1.181  0.971   1.00 0.00 ? 262 CYS A HB3  2  
ATOM   2256  N  N    . ASP B 2 5   ? -12.579 -4.293  -0.342  1.00 0.00 ? 263 ASP A N    2  
ATOM   2257  C  CA   . ASP B 2 5   ? -12.483 -5.731  -0.093  1.00 0.00 ? 263 ASP A CA   2  
ATOM   2258  C  C    . ASP B 2 5   ? -12.645 -6.038  1.400   1.00 0.00 ? 263 ASP A C    2  
ATOM   2259  O  O    . ASP B 2 5   ? -12.554 -7.190  1.826   1.00 0.00 ? 263 ASP A O    2  
ATOM   2260  C  CB   . ASP B 2 5   ? -11.136 -6.251  -0.594  1.00 0.00 ? 263 ASP A CB   2  
ATOM   2261  C  CG   . ASP B 2 5   ? -10.971 -7.746  -0.396  1.00 0.00 ? 263 ASP A CG   2  
ATOM   2262  O  OD1  . ASP B 2 5   ? -11.618 -8.517  -1.133  1.00 0.00 ? 263 ASP A OD1  2  
ATOM   2263  O  OD2  . ASP B 2 5   ? -10.193 -8.143  0.498   1.00 0.00 ? 263 ASP A OD2  2  
ATOM   2264  H  H    . ASP B 2 5   ? -11.784 -3.793  -0.627  1.00 0.00 ? 263 ASP A H    2  
ATOM   2265  H  HA   . ASP B 2 5   ? -13.282 -6.217  -0.644  1.00 0.00 ? 263 ASP A HA   2  
ATOM   2266  H  HB2  . ASP B 2 5   ? -11.042 -6.034  -1.647  1.00 0.00 ? 263 ASP A HB2  2  
ATOM   2267  H  HB3  . ASP B 2 5   ? -10.347 -5.746  -0.056  1.00 0.00 ? 263 ASP A HB3  2  
ATOM   2268  N  N    . PHE B 2 6   ? -12.894 -4.993  2.182   1.00 0.00 ? 264 PHE A N    2  
ATOM   2269  C  CA   . PHE B 2 6   ? -13.064 -5.120  3.632   1.00 0.00 ? 264 PHE A CA   2  
ATOM   2270  C  C    . PHE B 2 6   ? -14.539 -4.966  4.036   1.00 0.00 ? 264 PHE A C    2  
ATOM   2271  O  O    . PHE B 2 6   ? -14.965 -5.542  5.038   1.00 0.00 ? 264 PHE A O    2  
ATOM   2272  C  CB   . PHE B 2 6   ? -12.193 -4.089  4.385   1.00 0.00 ? 264 PHE A CB   2  
ATOM   2273  C  CG   . PHE B 2 6   ? -10.741 -4.089  3.987   1.00 0.00 ? 264 PHE A CG   2  
ATOM   2274  C  CD1  . PHE B 2 6   ? -10.351 -3.719  2.708   1.00 0.00 ? 264 PHE A CD1  2  
ATOM   2275  C  CD2  . PHE B 2 6   ? -9.763  -4.443  4.902   1.00 0.00 ? 264 PHE A CD2  2  
ATOM   2276  C  CE1  . PHE B 2 6   ? -9.020  -3.705  2.351   1.00 0.00 ? 264 PHE A CE1  2  
ATOM   2277  C  CE2  . PHE B 2 6   ? -8.427  -4.431  4.549   1.00 0.00 ? 264 PHE A CE2  2  
ATOM   2278  C  CZ   . PHE B 2 6   ? -8.056  -4.060  3.271   1.00 0.00 ? 264 PHE A CZ   2  
ATOM   2279  H  H    . PHE B 2 6   ? -12.967 -4.114  1.771   1.00 0.00 ? 264 PHE A H    2  
ATOM   2280  H  HA   . PHE B 2 6   ? -12.741 -6.111  3.907   1.00 0.00 ? 264 PHE A HA   2  
ATOM   2281  H  HB2  . PHE B 2 6   ? -12.579 -3.104  4.203   1.00 0.00 ? 264 PHE A HB2  2  
ATOM   2282  H  HB3  . PHE B 2 6   ? -12.240 -4.279  5.441   1.00 0.00 ? 264 PHE A HB3  2  
ATOM   2283  H  HD1  . PHE B 2 6   ? -11.103 -3.442  1.985   1.00 0.00 ? 264 PHE A HD1  2  
ATOM   2284  H  HD2  . PHE B 2 6   ? -10.053 -4.733  5.901   1.00 0.00 ? 264 PHE A HD2  2  
ATOM   2285  H  HE1  . PHE B 2 6   ? -8.731  -3.415  1.352   1.00 0.00 ? 264 PHE A HE1  2  
ATOM   2286  H  HE2  . PHE B 2 6   ? -7.674  -4.711  5.271   1.00 0.00 ? 264 PHE A HE2  2  
ATOM   2287  H  HZ   . PHE B 2 6   ? -7.013  -4.049  2.991   1.00 0.00 ? 264 PHE A HZ   2  
ATOM   2288  N  N    . CYS B 2 7   ? -15.322 -4.192  3.267   1.00 0.00 ? 265 CYS A N    2  
ATOM   2289  C  CA   . CYS B 2 7   ? -16.749 -4.015  3.583   1.00 0.00 ? 265 CYS A CA   2  
ATOM   2290  C  C    . CYS B 2 7   ? -17.625 -4.298  2.381   1.00 0.00 ? 265 CYS A C    2  
ATOM   2291  O  O    . CYS B 2 7   ? -18.797 -4.650  2.520   1.00 0.00 ? 265 CYS A O    2  
ATOM   2292  C  CB   . CYS B 2 7   ? -17.078 -2.609  4.083   1.00 0.00 ? 265 CYS A CB   2  
ATOM   2293  S  SG   . CYS B 2 7   ? -15.851 -1.851  5.172   1.00 0.00 ? 265 CYS A SG   2  
ATOM   2294  H  H    . CYS B 2 7   ? -14.941 -3.747  2.475   1.00 0.00 ? 265 CYS A H    2  
ATOM   2295  H  HA   . CYS B 2 7   ? -16.996 -4.726  4.351   1.00 0.00 ? 265 CYS A HA   2  
ATOM   2296  H  HB2  . CYS B 2 7   ? -17.225 -1.957  3.250   1.00 0.00 ? 265 CYS A HB2  2  
ATOM   2297  H  HB3  . CYS B 2 7   ? -18.004 -2.659  4.638   1.00 0.00 ? 265 CYS A HB3  2  
ATOM   2298  N  N    . LEU B 2 8   ? -17.047 -4.121  1.205   1.00 0.00 ? 266 LEU A N    2  
ATOM   2299  C  CA   . LEU B 2 8   ? -17.729 -4.348  -0.039  1.00 0.00 ? 266 LEU A CA   2  
ATOM   2300  C  C    . LEU B 2 8   ? -18.814 -3.312  -0.295  1.00 0.00 ? 266 LEU A C    2  
ATOM   2301  O  O    . LEU B 2 8   ? -19.935 -3.643  -0.683  1.00 0.00 ? 266 LEU A O    2  
ATOM   2302  C  CB   . LEU B 2 8   ? -18.289 -5.739  -0.035  1.00 0.00 ? 266 LEU A CB   2  
ATOM   2303  C  CG   . LEU B 2 8   ? -17.314 -6.799  0.445   1.00 0.00 ? 266 LEU A CG   2  
ATOM   2304  C  CD1  . LEU B 2 8   ? -17.991 -8.148  0.487   1.00 0.00 ? 266 LEU A CD1  2  
ATOM   2305  C  CD2  . LEU B 2 8   ? -16.078 -6.828  -0.440  1.00 0.00 ? 266 LEU A CD2  2  
ATOM   2306  H  H    . LEU B 2 8   ? -16.127 -3.851  1.176   1.00 0.00 ? 266 LEU A H    2  
ATOM   2307  H  HA   . LEU B 2 8   ? -16.998 -4.283  -0.820  1.00 0.00 ? 266 LEU A HA   2  
ATOM   2308  H  HB2  . LEU B 2 8   ? -19.135 -5.739  0.613   1.00 0.00 ? 266 LEU A HB2  2  
ATOM   2309  H  HB3  . LEU B 2 8   ? -18.597 -5.984  -1.025  1.00 0.00 ? 266 LEU A HB3  2  
ATOM   2310  H  HG   . LEU B 2 8   ? -17.007 -6.551  1.446   1.00 0.00 ? 266 LEU A HG   2  
ATOM   2311  H  HD11 . LEU B 2 8   ? -18.874 -8.069  1.095   1.00 0.00 ? 266 LEU A HD11 2  
ATOM   2312  H  HD12 . LEU B 2 8   ? -17.320 -8.877  0.916   1.00 0.00 ? 266 LEU A HD12 2  
ATOM   2313  H  HD13 . LEU B 2 8   ? -18.266 -8.447  -0.512  1.00 0.00 ? 266 LEU A HD13 2  
ATOM   2314  H  HD21 . LEU B 2 8   ? -15.875 -5.826  -0.807  1.00 0.00 ? 266 LEU A HD21 2  
ATOM   2315  H  HD22 . LEU B 2 8   ? -16.248 -7.492  -1.275  1.00 0.00 ? 266 LEU A HD22 2  
ATOM   2316  H  HD23 . LEU B 2 8   ? -15.233 -7.179  0.134   1.00 0.00 ? 266 LEU A HD23 2  
ATOM   2317  N  N    . GLY B 2 9   ? -18.460 -2.054  -0.073  1.00 0.00 ? 267 GLY A N    2  
ATOM   2318  C  CA   . GLY B 2 9   ? -19.386 -0.960  -0.308  1.00 0.00 ? 267 GLY A CA   2  
ATOM   2319  C  C    . GLY B 2 9   ? -19.068 -0.217  -1.590  1.00 0.00 ? 267 GLY A C    2  
ATOM   2320  O  O    . GLY B 2 9   ? -19.588 -0.562  -2.652  1.00 0.00 ? 267 GLY A O    2  
ATOM   2321  H  H    . GLY B 2 9   ? -17.558 -1.868  0.264   1.00 0.00 ? 267 GLY A H    2  
ATOM   2322  H  HA2  . GLY B 2 9   ? -20.389 -1.360  -0.372  1.00 0.00 ? 267 GLY A HA2  2  
ATOM   2323  H  HA3  . GLY B 2 9   ? -19.341 -0.273  0.521   1.00 0.00 ? 267 GLY A HA3  2  
ATOM   2324  N  N    . GLY B 2 10  ? -18.215 0.805   -1.504  1.00 0.00 ? 268 GLY A N    2  
ATOM   2325  C  CA   . GLY B 2 10  ? -17.851 1.547   -2.697  1.00 0.00 ? 268 GLY A CA   2  
ATOM   2326  C  C    . GLY B 2 10  ? -17.065 2.811   -2.403  1.00 0.00 ? 268 GLY A C    2  
ATOM   2327  O  O    . GLY B 2 10  ? -16.862 3.176   -1.245  1.00 0.00 ? 268 GLY A O    2  
ATOM   2328  H  H    . GLY B 2 10  ? -17.839 1.059   -0.631  1.00 0.00 ? 268 GLY A H    2  
ATOM   2329  H  HA2  . GLY B 2 10  ? -17.236 0.904   -3.323  1.00 0.00 ? 268 GLY A HA2  2  
ATOM   2330  H  HA3  . GLY B 2 10  ? -18.745 1.805   -3.238  1.00 0.00 ? 268 GLY A HA3  2  
ATOM   2331  N  N    . SER B 2 11  ? -16.625 3.475   -3.470  1.00 0.00 ? 269 SER A N    2  
ATOM   2332  C  CA   . SER B 2 11  ? -15.827 4.688   -3.358  1.00 0.00 ? 269 SER A CA   2  
ATOM   2333  C  C    . SER B 2 11  ? -16.690 5.920   -3.104  1.00 0.00 ? 269 SER A C    2  
ATOM   2334  O  O    . SER B 2 11  ? -16.226 7.056   -3.194  1.00 0.00 ? 269 SER A O    2  
ATOM   2335  C  CB   . SER B 2 11  ? -14.976 4.850   -4.609  1.00 0.00 ? 269 SER A CB   2  
ATOM   2336  O  OG   . SER B 2 11  ? -14.531 6.185   -4.774  1.00 0.00 ? 269 SER A OG   2  
ATOM   2337  H  H    . SER B 2 11  ? -16.847 3.136   -4.362  1.00 0.00 ? 269 SER A H    2  
ATOM   2338  H  HA   . SER B 2 11  ? -15.170 4.560   -2.523  1.00 0.00 ? 269 SER A HA   2  
ATOM   2339  H  HB2  . SER B 2 11  ? -14.114 4.200   -4.537  1.00 0.00 ? 269 SER A HB2  2  
ATOM   2340  H  HB3  . SER B 2 11  ? -15.556 4.568   -5.457  1.00 0.00 ? 269 SER A HB3  2  
ATOM   2341  H  HG   . SER B 2 11  ? -15.184 6.684   -5.271  1.00 0.00 ? 269 SER A HG   2  
ATOM   2342  N  N    . ASN B 2 12  ? -17.950 5.679   -2.789  1.00 0.00 ? 270 ASN A N    2  
ATOM   2343  C  CA   . ASN B 2 12  ? -18.890 6.745   -2.480  1.00 0.00 ? 270 ASN A CA   2  
ATOM   2344  C  C    . ASN B 2 12  ? -19.884 6.251   -1.451  1.00 0.00 ? 270 ASN A C    2  
ATOM   2345  O  O    . ASN B 2 12  ? -20.955 6.831   -1.266  1.00 0.00 ? 270 ASN A O    2  
ATOM   2346  C  CB   . ASN B 2 12  ? -19.617 7.225   -3.727  1.00 0.00 ? 270 ASN A CB   2  
ATOM   2347  C  CG   . ASN B 2 12  ? -20.082 6.087   -4.613  1.00 0.00 ? 270 ASN A CG   2  
ATOM   2348  O  OD1  . ASN B 2 12  ? -21.193 5.581   -4.459  1.00 0.00 ? 270 ASN A OD1  2  
ATOM   2349  N  ND2  . ASN B 2 12  ? -19.232 5.679   -5.547  1.00 0.00 ? 270 ASN A ND2  2  
ATOM   2350  H  H    . ASN B 2 12  ? -18.264 4.751   -2.767  1.00 0.00 ? 270 ASN A H    2  
ATOM   2351  H  HA   . ASN B 2 12  ? -18.337 7.570   -2.061  1.00 0.00 ? 270 ASN A HA   2  
ATOM   2352  H  HB2  . ASN B 2 12  ? -20.478 7.799   -3.424  1.00 0.00 ? 270 ASN A HB2  2  
ATOM   2353  H  HB3  . ASN B 2 12  ? -18.954 7.859   -4.290  1.00 0.00 ? 270 ASN A HB3  2  
ATOM   2354  H  HD21 . ASN B 2 12  ? -18.363 6.130   -5.612  1.00 0.00 ? 270 ASN A HD21 2  
ATOM   2355  H  HD22 . ASN B 2 12  ? -19.507 4.944   -6.135  1.00 0.00 ? 270 ASN A HD22 2  
ATOM   2356  N  N    . MET B 2 13  ? -19.511 5.166   -0.782  1.00 0.00 ? 271 MET A N    2  
ATOM   2357  C  CA   . MET B 2 13  ? -20.364 4.574   0.233   1.00 0.00 ? 271 MET A CA   2  
ATOM   2358  C  C    . MET B 2 13  ? -19.613 3.521   1.031   1.00 0.00 ? 271 MET A C    2  
ATOM   2359  O  O    . MET B 2 13  ? -19.199 2.494   0.495   1.00 0.00 ? 271 MET A O    2  
ATOM   2360  C  CB   . MET B 2 13  ? -21.605 3.946   -0.403  1.00 0.00 ? 271 MET A CB   2  
ATOM   2361  C  CG   . MET B 2 13  ? -22.560 3.316   0.603   1.00 0.00 ? 271 MET A CG   2  
ATOM   2362  S  SD   . MET B 2 13  ? -23.860 4.445   1.159   1.00 0.00 ? 271 MET A SD   2  
ATOM   2363  C  CE   . MET B 2 13  ? -22.916 5.807   1.847   1.00 0.00 ? 271 MET A CE   2  
ATOM   2364  H  H    . MET B 2 13  ? -18.631 4.760   -0.973  1.00 0.00 ? 271 MET A H    2  
ATOM   2365  H  HA   . MET B 2 13  ? -20.673 5.360   0.903   1.00 0.00 ? 271 MET A HA   2  
ATOM   2366  H  HB2  . MET B 2 13  ? -22.141 4.707   -0.949  1.00 0.00 ? 271 MET A HB2  2  
ATOM   2367  H  HB3  . MET B 2 13  ? -21.286 3.176   -1.094  1.00 0.00 ? 271 MET A HB3  2  
ATOM   2368  H  HG2  . MET B 2 13  ? -23.029 2.460   0.140   1.00 0.00 ? 271 MET A HG2  2  
ATOM   2369  H  HG3  . MET B 2 13  ? -21.992 2.987   1.463   1.00 0.00 ? 271 MET A HG3  2  
ATOM   2370  H  HE1  . MET B 2 13  ? -22.217 5.432   2.582   1.00 0.00 ? 271 MET A HE1  2  
ATOM   2371  H  HE2  . MET B 2 13  ? -23.588 6.508   2.318   1.00 0.00 ? 271 MET A HE2  2  
ATOM   2372  H  HE3  . MET B 2 13  ? -22.374 6.304   1.057   1.00 0.00 ? 271 MET A HE3  2  
ATOM   2373  N  N    . ASN B 2 14  ? -19.443 3.787   2.315   1.00 0.00 ? 272 ASN A N    2  
ATOM   2374  C  CA   . ASN B 2 14  ? -18.756 2.863   3.198   1.00 0.00 ? 272 ASN A CA   2  
ATOM   2375  C  C    . ASN B 2 14  ? -19.766 1.978   3.909   1.00 0.00 ? 272 ASN A C    2  
ATOM   2376  O  O    . ASN B 2 14  ? -20.657 2.458   4.607   1.00 0.00 ? 272 ASN A O    2  
ATOM   2377  C  CB   . ASN B 2 14  ? -17.899 3.627   4.199   1.00 0.00 ? 272 ASN A CB   2  
ATOM   2378  C  CG   . ASN B 2 14  ? -16.781 4.385   3.521   1.00 0.00 ? 272 ASN A CG   2  
ATOM   2379  O  OD1  . ASN B 2 14  ? -16.898 4.768   2.358   1.00 0.00 ? 272 ASN A OD1  2  
ATOM   2380  N  ND2  . ASN B 2 14  ? -15.691 4.602   4.248   1.00 0.00 ? 272 ASN A ND2  2  
ATOM   2381  H  H    . ASN B 2 14  ? -19.792 4.626   2.679   1.00 0.00 ? 272 ASN A H    2  
ATOM   2382  H  HA   . ASN B 2 14  ? -18.117 2.241   2.590   1.00 0.00 ? 272 ASN A HA   2  
ATOM   2383  H  HB2  . ASN B 2 14  ? -18.521 4.335   4.732   1.00 0.00 ? 272 ASN A HB2  2  
ATOM   2384  H  HB3  . ASN B 2 14  ? -17.460 2.940   4.895   1.00 0.00 ? 272 ASN A HB3  2  
ATOM   2385  H  HD21 . ASN B 2 14  ? -15.673 4.264   5.168   1.00 0.00 ? 272 ASN A HD21 2  
ATOM   2386  H  HD22 . ASN B 2 14  ? -14.949 5.090   3.837   1.00 0.00 ? 272 ASN A HD22 2  
ATOM   2387  N  N    . LYS B 2 15  ? -19.615 0.684   3.710   1.00 0.00 ? 273 LYS A N    2  
ATOM   2388  C  CA   . LYS B 2 15  ? -20.511 -0.306  4.284   1.00 0.00 ? 273 LYS A CA   2  
ATOM   2389  C  C    . LYS B 2 15  ? -20.372 -0.418  5.795   1.00 0.00 ? 273 LYS A C    2  
ATOM   2390  O  O    . LYS B 2 15  ? -21.334 -0.741  6.493   1.00 0.00 ? 273 LYS A O    2  
ATOM   2391  C  CB   . LYS B 2 15  ? -20.220 -1.652  3.638   1.00 0.00 ? 273 LYS A CB   2  
ATOM   2392  C  CG   . LYS B 2 15  ? -20.886 -1.824  2.307   1.00 0.00 ? 273 LYS A CG   2  
ATOM   2393  C  CD   . LYS B 2 15  ? -22.157 -2.632  2.411   1.00 0.00 ? 273 LYS A CD   2  
ATOM   2394  C  CE   . LYS B 2 15  ? -22.925 -2.564  1.110   1.00 0.00 ? 273 LYS A CE   2  
ATOM   2395  N  NZ   . LYS B 2 15  ? -23.611 -3.848  0.794   1.00 0.00 ? 273 LYS A NZ   2  
ATOM   2396  H  H    . LYS B 2 15  ? -18.870 0.377   3.151   1.00 0.00 ? 273 LYS A H    2  
ATOM   2397  H  HA   . LYS B 2 15  ? -21.518 -0.017  4.047   1.00 0.00 ? 273 LYS A HA   2  
ATOM   2398  H  HB2  . LYS B 2 15  ? -19.161 -1.735  3.485   1.00 0.00 ? 273 LYS A HB2  2  
ATOM   2399  H  HB3  . LYS B 2 15  ? -20.544 -2.439  4.287   1.00 0.00 ? 273 LYS A HB3  2  
ATOM   2400  H  HG2  . LYS B 2 15  ? -21.121 -0.852  1.921   1.00 0.00 ? 273 LYS A HG2  2  
ATOM   2401  H  HG3  . LYS B 2 15  ? -20.205 -2.323  1.637   1.00 0.00 ? 273 LYS A HG3  2  
ATOM   2402  H  HD2  . LYS B 2 15  ? -21.908 -3.661  2.624   1.00 0.00 ? 273 LYS A HD2  2  
ATOM   2403  H  HD3  . LYS B 2 15  ? -22.763 -2.229  3.205   1.00 0.00 ? 273 LYS A HD3  2  
ATOM   2404  H  HE2  . LYS B 2 15  ? -23.664 -1.780  1.184   1.00 0.00 ? 273 LYS A HE2  2  
ATOM   2405  H  HE3  . LYS B 2 15  ? -22.226 -2.328  0.320   1.00 0.00 ? 273 LYS A HE3  2  
ATOM   2406  H  HZ1  . LYS B 2 15  ? -24.146 -3.759  -0.093  1.00 0.00 ? 273 LYS A HZ1  2  
ATOM   2407  H  HZ2  . LYS B 2 15  ? -24.270 -4.099  1.559   1.00 0.00 ? 273 LYS A HZ2  2  
ATOM   2408  H  HZ3  . LYS B 2 15  ? -22.911 -4.611  0.691   1.00 0.00 ? 273 LYS A HZ3  2  
ATOM   2409  N  N    . LYS B 2 16  ? -19.180 -0.151  6.295   1.00 0.00 ? 274 LYS A N    2  
ATOM   2410  C  CA   . LYS B 2 16  ? -18.917 -0.257  7.720   1.00 0.00 ? 274 LYS A CA   2  
ATOM   2411  C  C    . LYS B 2 16  ? -18.723 1.106   8.374   1.00 0.00 ? 274 LYS A C    2  
ATOM   2412  O  O    . LYS B 2 16  ? -18.355 1.197   9.545   1.00 0.00 ? 274 LYS A O    2  
ATOM   2413  C  CB   . LYS B 2 16  ? -17.706 -1.137  7.909   1.00 0.00 ? 274 LYS A CB   2  
ATOM   2414  C  CG   . LYS B 2 16  ? -17.932 -2.514  7.325   1.00 0.00 ? 274 LYS A CG   2  
ATOM   2415  C  CD   . LYS B 2 16  ? -18.602 -3.435  8.311   1.00 0.00 ? 274 LYS A CD   2  
ATOM   2416  C  CE   . LYS B 2 16  ? -18.721 -4.838  7.761   1.00 0.00 ? 274 LYS A CE   2  
ATOM   2417  N  NZ   . LYS B 2 16  ? -19.003 -5.836  8.830   1.00 0.00 ? 274 LYS A NZ   2  
ATOM   2418  H  H    . LYS B 2 16  ? -18.453 0.110   5.692   1.00 0.00 ? 274 LYS A H    2  
ATOM   2419  H  HA   . LYS B 2 16  ? -19.763 -0.748  8.178   1.00 0.00 ? 274 LYS A HA   2  
ATOM   2420  H  HB2  . LYS B 2 16  ? -16.853 -0.685  7.424   1.00 0.00 ? 274 LYS A HB2  2  
ATOM   2421  H  HB3  . LYS B 2 16  ? -17.510 -1.239  8.957   1.00 0.00 ? 274 LYS A HB3  2  
ATOM   2422  H  HG2  . LYS B 2 16  ? -18.572 -2.420  6.475   1.00 0.00 ? 274 LYS A HG2  2  
ATOM   2423  H  HG3  . LYS B 2 16  ? -16.987 -2.935  7.016   1.00 0.00 ? 274 LYS A HG3  2  
ATOM   2424  H  HD2  . LYS B 2 16  ? -18.017 -3.457  9.201   1.00 0.00 ? 274 LYS A HD2  2  
ATOM   2425  H  HD3  . LYS B 2 16  ? -19.590 -3.058  8.532   1.00 0.00 ? 274 LYS A HD3  2  
ATOM   2426  H  HE2  . LYS B 2 16  ? -19.521 -4.861  7.037   1.00 0.00 ? 274 LYS A HE2  2  
ATOM   2427  H  HE3  . LYS B 2 16  ? -17.792 -5.088  7.280   1.00 0.00 ? 274 LYS A HE3  2  
ATOM   2428  H  HZ1  . LYS B 2 16  ? -19.904 -5.610  9.300   1.00 0.00 ? 274 LYS A HZ1  2  
ATOM   2429  H  HZ2  . LYS B 2 16  ? -18.243 -5.825  9.539   1.00 0.00 ? 274 LYS A HZ2  2  
ATOM   2430  H  HZ3  . LYS B 2 16  ? -19.067 -6.790  8.421   1.00 0.00 ? 274 LYS A HZ3  2  
ATOM   2431  N  N    . SER B 2 17  ? -18.971 2.161   7.609   1.00 0.00 ? 275 SER A N    2  
ATOM   2432  C  CA   . SER B 2 17  ? -18.852 3.522   8.121   1.00 0.00 ? 275 SER A CA   2  
ATOM   2433  C  C    . SER B 2 17  ? -20.109 4.319   7.804   1.00 0.00 ? 275 SER A C    2  
ATOM   2434  O  O    . SER B 2 17  ? -20.326 5.408   8.336   1.00 0.00 ? 275 SER A O    2  
ATOM   2435  C  CB   . SER B 2 17  ? -17.618 4.216   7.551   1.00 0.00 ? 275 SER A CB   2  
ATOM   2436  O  OG   . SER B 2 17  ? -16.430 3.544   7.928   1.00 0.00 ? 275 SER A OG   2  
ATOM   2437  H  H    . SER B 2 17  ? -19.236 2.022   6.676   1.00 0.00 ? 275 SER A H    2  
ATOM   2438  H  HA   . SER B 2 17  ? -18.756 3.461   9.189   1.00 0.00 ? 275 SER A HA   2  
ATOM   2439  H  HB2  . SER B 2 17  ? -17.680 4.235   6.479   1.00 0.00 ? 275 SER A HB2  2  
ATOM   2440  H  HB3  . SER B 2 17  ? -17.579 5.223   7.922   1.00 0.00 ? 275 SER A HB3  2  
ATOM   2441  H  HG   . SER B 2 17  ? -16.627 2.911   8.624   1.00 0.00 ? 275 SER A HG   2  
ATOM   2442  N  N    . GLY B 2 18  ? -20.932 3.758   6.930   1.00 0.00 ? 276 GLY A N    2  
ATOM   2443  C  CA   . GLY B 2 18  ? -22.180 4.396   6.558   1.00 0.00 ? 276 GLY A CA   2  
ATOM   2444  C  C    . GLY B 2 18  ? -22.009 5.683   5.788   1.00 0.00 ? 276 GLY A C    2  
ATOM   2445  O  O    . GLY B 2 18  ? -22.992 6.334   5.431   1.00 0.00 ? 276 GLY A O    2  
ATOM   2446  H  H    . GLY B 2 18  ? -20.688 2.896   6.538   1.00 0.00 ? 276 GLY A H    2  
ATOM   2447  H  HA2  . GLY B 2 18  ? -22.765 3.711   5.967   1.00 0.00 ? 276 GLY A HA2  2  
ATOM   2448  H  HA3  . GLY B 2 18  ? -22.713 4.618   7.460   1.00 0.00 ? 276 GLY A HA3  2  
ATOM   2449  N  N    . ARG B 2 19  ? -20.772 6.055   5.529   1.00 0.00 ? 277 ARG A N    2  
ATOM   2450  C  CA   . ARG B 2 19  ? -20.495 7.292   4.812   1.00 0.00 ? 277 ARG A CA   2  
ATOM   2451  C  C    . ARG B 2 19  ? -19.569 7.076   3.620   1.00 0.00 ? 277 ARG A C    2  
ATOM   2452  O  O    . ARG B 2 19  ? -18.884 6.074   3.518   1.00 0.00 ? 277 ARG A O    2  
ATOM   2453  C  CB   . ARG B 2 19  ? -19.969 8.363   5.782   1.00 0.00 ? 277 ARG A CB   2  
ATOM   2454  C  CG   . ARG B 2 19  ? -18.739 7.968   6.565   1.00 0.00 ? 277 ARG A CG   2  
ATOM   2455  C  CD   . ARG B 2 19  ? -17.599 7.664   5.633   1.00 0.00 ? 277 ARG A CD   2  
ATOM   2456  N  NE   . ARG B 2 19  ? -16.471 8.572   5.816   1.00 0.00 ? 277 ARG A NE   2  
ATOM   2457  C  CZ   . ARG B 2 19  ? -15.305 8.203   6.340   1.00 0.00 ? 277 ARG A CZ   2  
ATOM   2458  N  NH1  . ARG B 2 19  ? -15.116 6.949   6.731   1.00 0.00 ? 277 ARG A NH1  2  
ATOM   2459  N  NH2  . ARG B 2 19  ? -14.326 9.086   6.474   1.00 0.00 ? 277 ARG A NH2  2  
ATOM   2460  H  H    . ARG B 2 19  ? -20.032 5.483   5.825   1.00 0.00 ? 277 ARG A H    2  
ATOM   2461  H  HA   . ARG B 2 19  ? -21.411 7.655   4.408   1.00 0.00 ? 277 ARG A HA   2  
ATOM   2462  H  HB2  . ARG B 2 19  ? -19.730 9.251   5.220   1.00 0.00 ? 277 ARG A HB2  2  
ATOM   2463  H  HB3  . ARG B 2 19  ? -20.752 8.602   6.486   1.00 0.00 ? 277 ARG A HB3  2  
ATOM   2464  H  HG2  . ARG B 2 19  ? -18.463 8.792   7.193   1.00 0.00 ? 277 ARG A HG2  2  
ATOM   2465  H  HG3  . ARG B 2 19  ? -18.957 7.098   7.166   1.00 0.00 ? 277 ARG A HG3  2  
ATOM   2466  H  HD2  . ARG B 2 19  ? -17.271 6.647   5.798   1.00 0.00 ? 277 ARG A HD2  2  
ATOM   2467  H  HD3  . ARG B 2 19  ? -17.983 7.768   4.627   1.00 0.00 ? 277 ARG A HD3  2  
ATOM   2468  H  HE   . ARG B 2 19  ? -16.587 9.503   5.536   1.00 0.00 ? 277 ARG A HE   2  
ATOM   2469  H  HH11 . ARG B 2 19  ? -15.851 6.279   6.633   1.00 0.00 ? 277 ARG A HH11 2  
ATOM   2470  H  HH12 . ARG B 2 19  ? -14.239 6.675   7.124   1.00 0.00 ? 277 ARG A HH12 2  
ATOM   2471  H  HH21 . ARG B 2 19  ? -14.464 10.032  6.181   1.00 0.00 ? 277 ARG A HH21 2  
ATOM   2472  H  HH22 . ARG B 2 19  ? -13.451 8.806   6.867   1.00 0.00 ? 277 ARG A HH22 2  
ATOM   2473  N  N    . PRO B 2 20  ? -19.566 8.039   2.704   1.00 0.00 ? 278 PRO A N    2  
ATOM   2474  C  CA   . PRO B 2 20  ? -18.743 8.012   1.492   1.00 0.00 ? 278 PRO A CA   2  
ATOM   2475  C  C    . PRO B 2 20  ? -17.242 8.042   1.772   1.00 0.00 ? 278 PRO A C    2  
ATOM   2476  O  O    . PRO B 2 20  ? -16.789 8.597   2.773   1.00 0.00 ? 278 PRO A O    2  
ATOM   2477  C  CB   . PRO B 2 20  ? -19.144 9.284   0.741   1.00 0.00 ? 278 PRO A CB   2  
ATOM   2478  C  CG   . PRO B 2 20  ? -20.408 9.746   1.378   1.00 0.00 ? 278 PRO A CG   2  
ATOM   2479  C  CD   . PRO B 2 20  ? -20.393 9.233   2.788   1.00 0.00 ? 278 PRO A CD   2  
ATOM   2480  H  HA   . PRO B 2 20  ? -18.976 7.153   0.882   1.00 0.00 ? 278 PRO A HA   2  
ATOM   2481  H  HB2  . PRO B 2 20  ? -18.361 10.021  0.838   1.00 0.00 ? 278 PRO A HB2  2  
ATOM   2482  H  HB3  . PRO B 2 20  ? -19.293 9.054   -0.303  1.00 0.00 ? 278 PRO A HB3  2  
ATOM   2483  H  HG2  . PRO B 2 20  ? -20.456 10.824  1.370   1.00 0.00 ? 278 PRO A HG2  2  
ATOM   2484  H  HG3  . PRO B 2 20  ? -21.247 9.326   0.844   1.00 0.00 ? 278 PRO A HG3  2  
ATOM   2485  H  HD2  . PRO B 2 20  ? -19.960 9.938   3.479   1.00 0.00 ? 278 PRO A HD2  2  
ATOM   2486  H  HD3  . PRO B 2 20  ? -21.386 8.972   3.105   1.00 0.00 ? 278 PRO A HD3  2  
ATOM   2487  N  N    . GLU B 2 21  ? -16.486 7.439   0.865   1.00 0.00 ? 279 GLU A N    2  
ATOM   2488  C  CA   . GLU B 2 21  ? -15.030 7.396   0.948   1.00 0.00 ? 279 GLU A CA   2  
ATOM   2489  C  C    . GLU B 2 21  ? -14.461 7.332   -0.465  1.00 0.00 ? 279 GLU A C    2  
ATOM   2490  O  O    . GLU B 2 21  ? -14.864 8.110   -1.329  1.00 0.00 ? 279 GLU A O    2  
ATOM   2491  C  CB   . GLU B 2 21  ? -14.566 6.202   1.780   1.00 0.00 ? 279 GLU A CB   2  
ATOM   2492  C  CG   . GLU B 2 21  ? -13.142 6.349   2.274   1.00 0.00 ? 279 GLU A CG   2  
ATOM   2493  C  CD   . GLU B 2 21  ? -12.975 7.505   3.241   1.00 0.00 ? 279 GLU A CD   2  
ATOM   2494  O  OE1  . GLU B 2 21  ? -13.137 7.287   4.460   1.00 0.00 ? 279 GLU A OE1  2  
ATOM   2495  O  OE2  . GLU B 2 21  ? -12.684 8.629   2.779   1.00 0.00 ? 279 GLU A OE2  2  
ATOM   2496  H  H    . GLU B 2 21  ? -16.925 6.998   0.107   1.00 0.00 ? 279 GLU A H    2  
ATOM   2497  H  HA   . GLU B 2 21  ? -14.688 8.303   1.422   1.00 0.00 ? 279 GLU A HA   2  
ATOM   2498  H  HB2  . GLU B 2 21  ? -15.210 6.104   2.635   1.00 0.00 ? 279 GLU A HB2  2  
ATOM   2499  H  HB3  . GLU B 2 21  ? -14.637 5.301   1.191   1.00 0.00 ? 279 GLU A HB3  2  
ATOM   2500  H  HG2  . GLU B 2 21  ? -12.856 5.443   2.771   1.00 0.00 ? 279 GLU A HG2  2  
ATOM   2501  H  HG3  . GLU B 2 21  ? -12.497 6.515   1.424   1.00 0.00 ? 279 GLU A HG3  2  
ATOM   2502  N  N    . GLU B 2 22  ? -13.531 6.414   -0.704  1.00 0.00 ? 280 GLU A N    2  
ATOM   2503  C  CA   . GLU B 2 22  ? -12.946 6.247   -2.031  1.00 0.00 ? 280 GLU A CA   2  
ATOM   2504  C  C    . GLU B 2 22  ? -11.954 5.094   -2.049  1.00 0.00 ? 280 GLU A C    2  
ATOM   2505  O  O    . GLU B 2 22  ? -10.761 5.262   -1.800  1.00 0.00 ? 280 GLU A O    2  
ATOM   2506  C  CB   . GLU B 2 22  ? -12.286 7.531   -2.529  1.00 0.00 ? 280 GLU A CB   2  
ATOM   2507  C  CG   . GLU B 2 22  ? -12.022 7.518   -4.027  1.00 0.00 ? 280 GLU A CG   2  
ATOM   2508  C  CD   . GLU B 2 22  ? -12.562 8.751   -4.726  1.00 0.00 ? 280 GLU A CD   2  
ATOM   2509  O  OE1  . GLU B 2 22  ? -13.768 8.766   -5.052  1.00 0.00 ? 280 GLU A OE1  2  
ATOM   2510  O  OE2  . GLU B 2 22  ? -11.781 9.699   -4.949  1.00 0.00 ? 280 GLU A OE2  2  
ATOM   2511  H  H    . GLU B 2 22  ? -13.239 5.830   0.027   1.00 0.00 ? 280 GLU A H    2  
ATOM   2512  H  HA   . GLU B 2 22  ? -13.753 5.999   -2.701  1.00 0.00 ? 280 GLU A HA   2  
ATOM   2513  H  HB2  . GLU B 2 22  ? -12.938 8.363   -2.308  1.00 0.00 ? 280 GLU A HB2  2  
ATOM   2514  H  HB3  . GLU B 2 22  ? -11.347 7.668   -2.016  1.00 0.00 ? 280 GLU A HB3  2  
ATOM   2515  H  HG2  . GLU B 2 22  ? -10.960 7.463   -4.194  1.00 0.00 ? 280 GLU A HG2  2  
ATOM   2516  H  HG3  . GLU B 2 22  ? -12.494 6.646   -4.454  1.00 0.00 ? 280 GLU A HG3  2  
ATOM   2517  N  N    . LEU B 2 23  ? -12.492 3.927   -2.354  1.00 0.00 ? 281 LEU A N    2  
ATOM   2518  C  CA   . LEU B 2 23  ? -11.734 2.678   -2.423  1.00 0.00 ? 281 LEU A CA   2  
ATOM   2519  C  C    . LEU B 2 23  ? -10.458 2.778   -3.249  1.00 0.00 ? 281 LEU A C    2  
ATOM   2520  O  O    . LEU B 2 23  ? -10.184 3.787   -3.900  1.00 0.00 ? 281 LEU A O    2  
ATOM   2521  C  CB   . LEU B 2 23  ? -12.602 1.603   -3.039  1.00 0.00 ? 281 LEU A CB   2  
ATOM   2522  C  CG   . LEU B 2 23  ? -14.085 1.768   -2.827  1.00 0.00 ? 281 LEU A CG   2  
ATOM   2523  C  CD1  . LEU B 2 23  ? -14.803 1.256   -4.048  1.00 0.00 ? 281 LEU A CD1  2  
ATOM   2524  C  CD2  . LEU B 2 23  ? -14.531 1.034   -1.569  1.00 0.00 ? 281 LEU A CD2  2  
ATOM   2525  H  H    . LEU B 2 23  ? -13.458 3.898   -2.530  1.00 0.00 ? 281 LEU A H    2  
ATOM   2526  H  HA   . LEU B 2 23  ? -11.481 2.375   -1.431  1.00 0.00 ? 281 LEU A HA   2  
ATOM   2527  H  HB2  . LEU B 2 23  ? -12.415 1.588   -4.102  1.00 0.00 ? 281 LEU A HB2  2  
ATOM   2528  H  HB3  . LEU B 2 23  ? -12.317 0.652   -2.631  1.00 0.00 ? 281 LEU A HB3  2  
ATOM   2529  H  HG   . LEU B 2 23  ? -14.316 2.809   -2.712  1.00 0.00 ? 281 LEU A HG   2  
ATOM   2530  H  HD11 . LEU B 2 23  ? -14.639 0.208   -4.117  1.00 0.00 ? 281 LEU A HD11 2  
ATOM   2531  H  HD12 . LEU B 2 23  ? -14.410 1.743   -4.930  1.00 0.00 ? 281 LEU A HD12 2  
ATOM   2532  H  HD13 . LEU B 2 23  ? -15.854 1.456   -3.968  1.00 0.00 ? 281 LEU A HD13 2  
ATOM   2533  H  HD21 . LEU B 2 23  ? -13.813 0.257   -1.320  1.00 0.00 ? 281 LEU A HD21 2  
ATOM   2534  H  HD22 . LEU B 2 23  ? -15.500 0.586   -1.740  1.00 0.00 ? 281 LEU A HD22 2  
ATOM   2535  H  HD23 . LEU B 2 23  ? -14.602 1.734   -0.752  1.00 0.00 ? 281 LEU A HD23 2  
ATOM   2536  N  N    . VAL B 2 24  ? -9.689  1.692   -3.206  1.00 0.00 ? 282 VAL A N    2  
ATOM   2537  C  CA   . VAL B 2 24  ? -8.455  1.574   -3.962  1.00 0.00 ? 282 VAL A CA   2  
ATOM   2538  C  C    . VAL B 2 24  ? -8.600  0.431   -4.933  1.00 0.00 ? 282 VAL A C    2  
ATOM   2539  O  O    . VAL B 2 24  ? -8.575  -0.720  -4.521  1.00 0.00 ? 282 VAL A O    2  
ATOM   2540  C  CB   . VAL B 2 24  ? -7.237  1.273   -3.090  1.00 0.00 ? 282 VAL A CB   2  
ATOM   2541  C  CG1  . VAL B 2 24  ? -6.147  2.241   -3.407  1.00 0.00 ? 282 VAL A CG1  2  
ATOM   2542  C  CG2  . VAL B 2 24  ? -7.551  1.356   -1.627  1.00 0.00 ? 282 VAL A CG2  2  
ATOM   2543  H  H    . VAL B 2 24  ? -9.976  0.933   -2.646  1.00 0.00 ? 282 VAL A H    2  
ATOM   2544  H  HA   . VAL B 2 24  ? -8.272  2.488   -4.492  1.00 0.00 ? 282 VAL A HA   2  
ATOM   2545  H  HB   . VAL B 2 24  ? -6.897  0.283   -3.311  1.00 0.00 ? 282 VAL A HB   2  
ATOM   2546  H  HG11 . VAL B 2 24  ? -6.348  3.144   -2.858  1.00 0.00 ? 282 VAL A HG11 2  
ATOM   2547  H  HG12 . VAL B 2 24  ? -6.138  2.448   -4.467  1.00 0.00 ? 282 VAL A HG12 2  
ATOM   2548  H  HG13 . VAL B 2 24  ? -5.194  1.835   -3.102  1.00 0.00 ? 282 VAL A HG13 2  
ATOM   2549  H  HG21 . VAL B 2 24  ? -7.577  2.395   -1.329  1.00 0.00 ? 282 VAL A HG21 2  
ATOM   2550  H  HG22 . VAL B 2 24  ? -6.785  0.841   -1.069  1.00 0.00 ? 282 VAL A HG22 2  
ATOM   2551  H  HG23 . VAL B 2 24  ? -8.501  0.898   -1.439  1.00 0.00 ? 282 VAL A HG23 2  
ATOM   2552  N  N    . SER B 2 25  ? -8.702  0.742   -6.213  1.00 0.00 ? 283 SER A N    2  
ATOM   2553  C  CA   . SER B 2 25  ? -8.873  -0.290  -7.227  1.00 0.00 ? 283 SER A CA   2  
ATOM   2554  C  C    . SER B 2 25  ? -7.532  -0.696  -7.819  1.00 0.00 ? 283 SER A C    2  
ATOM   2555  O  O    . SER B 2 25  ? -6.764  0.154   -8.270  1.00 0.00 ? 283 SER A O    2  
ATOM   2556  C  CB   . SER B 2 25  ? -9.800  0.202   -8.336  1.00 0.00 ? 283 SER A CB   2  
ATOM   2557  O  OG   . SER B 2 25  ? -9.435  1.500   -8.771  1.00 0.00 ? 283 SER A OG   2  
ATOM   2558  H  H    . SER B 2 25  ? -8.651  1.684   -6.482  1.00 0.00 ? 283 SER A H    2  
ATOM   2559  H  HA   . SER B 2 25  ? -9.329  -1.146  -6.747  1.00 0.00 ? 283 SER A HA   2  
ATOM   2560  H  HB2  . SER B 2 25  ? -9.740  -0.475  -9.177  1.00 0.00 ? 283 SER A HB2  2  
ATOM   2561  H  HB3  . SER B 2 25  ? -10.812 0.226   -7.968  1.00 0.00 ? 283 SER A HB3  2  
ATOM   2562  H  HG   . SER B 2 25  ? -8.502  1.645   -8.600  1.00 0.00 ? 283 SER A HG   2  
ATOM   2563  N  N    . CYS B 2 26  ? -7.251  -1.997  -7.821  1.00 0.00 ? 284 CYS A N    2  
ATOM   2564  C  CA   . CYS B 2 26  ? -5.991  -2.485  -8.369  1.00 0.00 ? 284 CYS A CA   2  
ATOM   2565  C  C    . CYS B 2 26  ? -5.944  -2.200  -9.863  1.00 0.00 ? 284 CYS A C    2  
ATOM   2566  O  O    . CYS B 2 26  ? -6.951  -2.331  -10.558 1.00 0.00 ? 284 CYS A O    2  
ATOM   2567  C  CB   . CYS B 2 26  ? -5.815  -3.987  -8.084  1.00 0.00 ? 284 CYS A CB   2  
ATOM   2568  S  SG   . CYS B 2 26  ? -4.394  -4.762  -8.936  1.00 0.00 ? 284 CYS A SG   2  
ATOM   2569  H  H    . CYS B 2 26  ? -7.902  -2.631  -7.460  1.00 0.00 ? 284 CYS A H    2  
ATOM   2570  H  HA   . CYS B 2 26  ? -5.193  -1.941  -7.888  1.00 0.00 ? 284 CYS A HA   2  
ATOM   2571  H  HB2  . CYS B 2 26  ? -5.670  -4.122  -7.027  1.00 0.00 ? 284 CYS A HB2  2  
ATOM   2572  H  HB3  . CYS B 2 26  ? -6.705  -4.512  -8.382  1.00 0.00 ? 284 CYS A HB3  2  
ATOM   2573  N  N    . ALA B 2 27  ? -4.773  -1.815  -10.355 1.00 0.00 ? 285 ALA A N    2  
ATOM   2574  C  CA   . ALA B 2 27  ? -4.613  -1.506  -11.767 1.00 0.00 ? 285 ALA A CA   2  
ATOM   2575  C  C    . ALA B 2 27  ? -4.327  -2.770  -12.555 1.00 0.00 ? 285 ALA A C    2  
ATOM   2576  O  O    . ALA B 2 27  ? -3.799  -2.724  -13.667 1.00 0.00 ? 285 ALA A O    2  
ATOM   2577  C  CB   . ALA B 2 27  ? -3.511  -0.480  -11.971 1.00 0.00 ? 285 ALA A CB   2  
ATOM   2578  H  H    . ALA B 2 27  ? -4.001  -1.738  -9.756  1.00 0.00 ? 285 ALA A H    2  
ATOM   2579  H  HA   . ALA B 2 27  ? -5.541  -1.079  -12.121 1.00 0.00 ? 285 ALA A HA   2  
ATOM   2580  H  HB1  . ALA B 2 27  ? -2.566  -0.984  -12.103 1.00 0.00 ? 285 ALA A HB1  2  
ATOM   2581  H  HB2  . ALA B 2 27  ? -3.456  0.164   -11.105 1.00 0.00 ? 285 ALA A HB2  2  
ATOM   2582  H  HB3  . ALA B 2 27  ? -3.728  0.112   -12.846 1.00 0.00 ? 285 ALA A HB3  2  
ATOM   2583  N  N    . ASP B 2 28  ? -4.682  -3.900  -11.962 1.00 0.00 ? 286 ASP A N    2  
ATOM   2584  C  CA   . ASP B 2 28  ? -4.473  -5.191  -12.585 1.00 0.00 ? 286 ASP A CA   2  
ATOM   2585  C  C    . ASP B 2 28  ? -5.702  -6.077  -12.401 1.00 0.00 ? 286 ASP A C    2  
ATOM   2586  O  O    . ASP B 2 28  ? -6.277  -6.582  -13.366 1.00 0.00 ? 286 ASP A O    2  
ATOM   2587  C  CB   . ASP B 2 28  ? -3.257  -5.875  -11.966 1.00 0.00 ? 286 ASP A CB   2  
ATOM   2588  C  CG   . ASP B 2 28  ? -2.902  -7.175  -12.661 1.00 0.00 ? 286 ASP A CG   2  
ATOM   2589  O  OD1  . ASP B 2 28  ? -2.147  -7.130  -13.655 1.00 0.00 ? 286 ASP A OD1  2  
ATOM   2590  O  OD2  . ASP B 2 28  ? -3.380  -8.238  -12.212 1.00 0.00 ? 286 ASP A OD2  2  
ATOM   2591  H  H    . ASP B 2 28  ? -5.097  -3.862  -11.076 1.00 0.00 ? 286 ASP A H    2  
ATOM   2592  H  HA   . ASP B 2 28  ? -4.294  -5.024  -13.635 1.00 0.00 ? 286 ASP A HA   2  
ATOM   2593  H  HB2  . ASP B 2 28  ? -2.407  -5.211  -12.027 1.00 0.00 ? 286 ASP A HB2  2  
ATOM   2594  H  HB3  . ASP B 2 28  ? -3.471  -6.088  -10.928 1.00 0.00 ? 286 ASP A HB3  2  
ATOM   2595  N  N    . CYS B 2 29  ? -6.094  -6.252  -11.140 1.00 0.00 ? 287 CYS A N    2  
ATOM   2596  C  CA   . CYS B 2 29  ? -7.244  -7.076  -10.779 1.00 0.00 ? 287 CYS A CA   2  
ATOM   2597  C  C    . CYS B 2 29  ? -8.552  -6.321  -10.956 1.00 0.00 ? 287 CYS A C    2  
ATOM   2598  O  O    . CYS B 2 29  ? -9.457  -6.764  -11.662 1.00 0.00 ? 287 CYS A O    2  
ATOM   2599  C  CB   . CYS B 2 29  ? -7.144  -7.506  -9.314  1.00 0.00 ? 287 CYS A CB   2  
ATOM   2600  S  SG   . CYS B 2 29  ? -5.621  -8.397  -8.882  1.00 0.00 ? 287 CYS A SG   2  
ATOM   2601  H  H    . CYS B 2 29  ? -5.591  -5.813  -10.428 1.00 0.00 ? 287 CYS A H    2  
ATOM   2602  H  HA   . CYS B 2 29  ? -7.247  -7.953  -11.407 1.00 0.00 ? 287 CYS A HA   2  
ATOM   2603  H  HB2  . CYS B 2 29  ? -7.192  -6.628  -8.687  1.00 0.00 ? 287 CYS A HB2  2  
ATOM   2604  H  HB3  . CYS B 2 29  ? -7.979  -8.150  -9.081  1.00 0.00 ? 287 CYS A HB3  2  
ATOM   2605  N  N    . GLY B 2 30  ? -8.628  -5.175  -10.297 1.00 0.00 ? 288 GLY A N    2  
ATOM   2606  C  CA   . GLY B 2 30  ? -9.828  -4.366  -10.327 1.00 0.00 ? 288 GLY A CA   2  
ATOM   2607  C  C    . GLY B 2 30  ? -10.517 -4.367  -8.976  1.00 0.00 ? 288 GLY A C    2  
ATOM   2608  O  O    . GLY B 2 30  ? -11.620 -3.842  -8.827  1.00 0.00 ? 288 GLY A O    2  
ATOM   2609  H  H    . GLY B 2 30  ? -7.850  -4.868  -9.792  1.00 0.00 ? 288 GLY A H    2  
ATOM   2610  H  HA2  . GLY B 2 30  ? -9.565  -3.352  -10.593 1.00 0.00 ? 288 GLY A HA2  2  
ATOM   2611  H  HA3  . GLY B 2 30  ? -10.506 -4.764  -11.068 1.00 0.00 ? 288 GLY A HA3  2  
ATOM   2612  N  N    . ARG B 2 31  ? -9.847  -4.961  -7.987  1.00 0.00 ? 289 ARG A N    2  
ATOM   2613  C  CA   . ARG B 2 31  ? -10.377 -5.046  -6.629  1.00 0.00 ? 289 ARG A CA   2  
ATOM   2614  C  C    . ARG B 2 31  ? -10.169 -3.726  -5.907  1.00 0.00 ? 289 ARG A C    2  
ATOM   2615  O  O    . ARG B 2 31  ? -9.119  -3.103  -6.049  1.00 0.00 ? 289 ARG A O    2  
ATOM   2616  C  CB   . ARG B 2 31  ? -9.675  -6.160  -5.855  1.00 0.00 ? 289 ARG A CB   2  
ATOM   2617  C  CG   . ARG B 2 31  ? -10.512 -6.732  -4.729  1.00 0.00 ? 289 ARG A CG   2  
ATOM   2618  C  CD   . ARG B 2 31  ? -9.722  -7.740  -3.914  1.00 0.00 ? 289 ARG A CD   2  
ATOM   2619  N  NE   . ARG B 2 31  ? -9.444  -8.960  -4.667  1.00 0.00 ? 289 ARG A NE   2  
ATOM   2620  C  CZ   . ARG B 2 31  ? -8.692  -9.956  -4.208  1.00 0.00 ? 289 ARG A CZ   2  
ATOM   2621  N  NH1  . ARG B 2 31  ? -8.149  -9.881  -3.001  1.00 0.00 ? 289 ARG A NH1  2  
ATOM   2622  N  NH2  . ARG B 2 31  ? -8.485  -11.032 -4.956  1.00 0.00 ? 289 ARG A NH2  2  
ATOM   2623  H  H    . ARG B 2 31  ? -8.962  -5.342  -8.176  1.00 0.00 ? 289 ARG A H    2  
ATOM   2624  H  HA   . ARG B 2 31  ? -11.432 -5.260  -6.685  1.00 0.00 ? 289 ARG A HA   2  
ATOM   2625  H  HB2  . ARG B 2 31  ? -9.427  -6.960  -6.537  1.00 0.00 ? 289 ARG A HB2  2  
ATOM   2626  H  HB3  . ARG B 2 31  ? -8.766  -5.764  -5.427  1.00 0.00 ? 289 ARG A HB3  2  
ATOM   2627  H  HG2  . ARG B 2 31  ? -10.828 -5.928  -4.082  1.00 0.00 ? 289 ARG A HG2  2  
ATOM   2628  H  HG3  . ARG B 2 31  ? -11.377 -7.220  -5.151  1.00 0.00 ? 289 ARG A HG3  2  
ATOM   2629  H  HD2  . ARG B 2 31  ? -8.783  -7.290  -3.621  1.00 0.00 ? 289 ARG A HD2  2  
ATOM   2630  H  HD3  . ARG B 2 31  ? -10.292 -7.992  -3.033  1.00 0.00 ? 289 ARG A HD3  2  
ATOM   2631  H  HE   . ARG B 2 31  ? -9.838  -9.040  -5.561  1.00 0.00 ? 289 ARG A HE   2  
ATOM   2632  H  HH11 . ARG B 2 31  ? -8.304  -9.073  -2.432  1.00 0.00 ? 289 ARG A HH11 2  
ATOM   2633  H  HH12 . ARG B 2 31  ? -7.583  -10.631 -2.659  1.00 0.00 ? 289 ARG A HH12 2  
ATOM   2634  H  HH21 . ARG B 2 31  ? -8.894  -11.095 -5.866  1.00 0.00 ? 289 ARG A HH21 2  
ATOM   2635  H  HH22 . ARG B 2 31  ? -7.918  -11.780 -4.610  1.00 0.00 ? 289 ARG A HH22 2  
ATOM   2636  N  N    . SER B 2 32  ? -11.150 -3.305  -5.119  1.00 0.00 ? 290 SER A N    2  
ATOM   2637  C  CA   . SER B 2 32  ? -11.028 -2.040  -4.413  1.00 0.00 ? 290 SER A CA   2  
ATOM   2638  C  C    . SER B 2 32  ? -11.014 -2.212  -2.896  1.00 0.00 ? 290 SER A C    2  
ATOM   2639  O  O    . SER B 2 32  ? -11.440 -3.237  -2.374  1.00 0.00 ? 290 SER A O    2  
ATOM   2640  C  CB   . SER B 2 32  ? -12.132 -1.084  -4.834  1.00 0.00 ? 290 SER A CB   2  
ATOM   2641  O  OG   . SER B 2 32  ? -12.179 -0.958  -6.243  1.00 0.00 ? 290 SER A OG   2  
ATOM   2642  H  H    . SER B 2 32  ? -11.959 -3.848  -5.012  1.00 0.00 ? 290 SER A H    2  
ATOM   2643  H  HA   . SER B 2 32  ? -10.092 -1.616  -4.708  1.00 0.00 ? 290 SER A HA   2  
ATOM   2644  H  HB2  . SER B 2 32  ? -13.079 -1.448  -4.479  1.00 0.00 ? 290 SER A HB2  2  
ATOM   2645  H  HB3  . SER B 2 32  ? -11.939 -0.117  -4.408  1.00 0.00 ? 290 SER A HB3  2  
ATOM   2646  H  HG   . SER B 2 32  ? -12.338 -1.818  -6.638  1.00 0.00 ? 290 SER A HG   2  
ATOM   2647  N  N    . GLY B 2 33  ? -10.500 -1.190  -2.203  1.00 0.00 ? 291 GLY A N    2  
ATOM   2648  C  CA   . GLY B 2 33  ? -10.422 -1.222  -0.743  1.00 0.00 ? 291 GLY A CA   2  
ATOM   2649  C  C    . GLY B 2 33  ? -10.586 0.152   -0.113  1.00 0.00 ? 291 GLY A C    2  
ATOM   2650  O  O    . GLY B 2 33  ? -10.165 1.138   -0.679  1.00 0.00 ? 291 GLY A O    2  
ATOM   2651  H  H    . GLY B 2 33  ? -10.157 -0.409  -2.692  1.00 0.00 ? 291 GLY A H    2  
ATOM   2652  H  HA2  . GLY B 2 33  ? -11.183 -1.882  -0.357  1.00 0.00 ? 291 GLY A HA2  2  
ATOM   2653  H  HA3  . GLY B 2 33  ? -9.449  -1.606  -0.466  1.00 0.00 ? 291 GLY A HA3  2  
ATOM   2654  N  N    . HIS B 2 34  ? -11.181 0.251   1.069   1.00 0.00 ? 292 HIS A N    2  
ATOM   2655  C  CA   . HIS B 2 34  ? -11.313 1.571   1.682   1.00 0.00 ? 292 HIS A CA   2  
ATOM   2656  C  C    . HIS B 2 34  ? -9.960  1.941   2.249   1.00 0.00 ? 292 HIS A C    2  
ATOM   2657  O  O    . HIS B 2 34  ? -9.454  1.219   3.102   1.00 0.00 ? 292 HIS A O    2  
ATOM   2658  C  CB   . HIS B 2 34  ? -12.321 1.580   2.831   1.00 0.00 ? 292 HIS A CB   2  
ATOM   2659  C  CG   . HIS B 2 34  ? -13.774 1.672   2.438   1.00 0.00 ? 292 HIS A CG   2  
ATOM   2660  N  ND1  . HIS B 2 34  ? -14.674 0.747   2.877   1.00 0.00 ? 292 HIS A ND1  2  
ATOM   2661  C  CD2  . HIS B 2 34  ? -14.464 2.514   1.629   1.00 0.00 ? 292 HIS A CD2  2  
ATOM   2662  C  CE1  . HIS B 2 34  ? -15.861 0.988   2.362   1.00 0.00 ? 292 HIS A CE1  2  
ATOM   2663  N  NE2  . HIS B 2 34  ? -15.764 2.066   1.604   1.00 0.00 ? 292 HIS A NE2  2  
ATOM   2664  H  H    . HIS B 2 34  ? -11.481 -0.552  1.542   1.00 0.00 ? 292 HIS A H    2  
ATOM   2665  H  HA   . HIS B 2 34  ? -11.605 2.274   0.919   1.00 0.00 ? 292 HIS A HA   2  
ATOM   2666  H  HB2  . HIS B 2 34  ? -12.194 0.662   3.381   1.00 0.00 ? 292 HIS A HB2  2  
ATOM   2667  H  HB3  . HIS B 2 34  ? -12.095 2.399   3.492   1.00 0.00 ? 292 HIS A HB3  2  
ATOM   2668  H  HD2  . HIS B 2 34  ? -14.068 3.351   1.075   1.00 0.00 ? 292 HIS A HD2  2  
ATOM   2669  H  HE1  . HIS B 2 34  ? -16.722 0.355   2.444   1.00 0.00 ? 292 HIS A HE1  2  
ATOM   2670  H  HE2  . HIS B 2 34  ? -16.512 2.512   1.156   1.00 0.00 ? 292 HIS A HE2  2  
ATOM   2671  N  N    . PRO B 2 35  ? -9.344  3.051   1.817   1.00 0.00 ? 293 PRO A N    2  
ATOM   2672  C  CA   . PRO B 2 35  ? -8.038  3.435   2.337   1.00 0.00 ? 293 PRO A CA   2  
ATOM   2673  C  C    . PRO B 2 35  ? -7.986  3.365   3.858   1.00 0.00 ? 293 PRO A C    2  
ATOM   2674  O  O    . PRO B 2 35  ? -6.996  2.911   4.434   1.00 0.00 ? 293 PRO A O    2  
ATOM   2675  C  CB   . PRO B 2 35  ? -7.873  4.868   1.853   1.00 0.00 ? 293 PRO A CB   2  
ATOM   2676  C  CG   . PRO B 2 35  ? -8.684  4.949   0.605   1.00 0.00 ? 293 PRO A CG   2  
ATOM   2677  C  CD   . PRO B 2 35  ? -9.816  3.968   0.757   1.00 0.00 ? 293 PRO A CD   2  
ATOM   2678  H  HA   . PRO B 2 35  ? -7.255  2.814   1.920   1.00 0.00 ? 293 PRO A HA   2  
ATOM   2679  H  HB2  . PRO B 2 35  ? -8.233  5.552   2.606   1.00 0.00 ? 293 PRO A HB2  2  
ATOM   2680  H  HB3  . PRO B 2 35  ? -6.832  5.055   1.656   1.00 0.00 ? 293 PRO A HB3  2  
ATOM   2681  H  HG2  . PRO B 2 35  ? -9.072  5.950   0.486   1.00 0.00 ? 293 PRO A HG2  2  
ATOM   2682  H  HG3  . PRO B 2 35  ? -8.072  4.683   -0.246  1.00 0.00 ? 293 PRO A HG3  2  
ATOM   2683  H  HD2  . PRO B 2 35  ? -10.718 4.479   1.056   1.00 0.00 ? 293 PRO A HD2  2  
ATOM   2684  H  HD3  . PRO B 2 35  ? -9.969  3.435   -0.171  1.00 0.00 ? 293 PRO A HD3  2  
ATOM   2685  N  N    . THR B 2 36  ? -9.058  3.800   4.508   1.00 0.00 ? 294 THR A N    2  
ATOM   2686  C  CA   . THR B 2 36  ? -9.127  3.755   5.961   1.00 0.00 ? 294 THR A CA   2  
ATOM   2687  C  C    . THR B 2 36  ? -9.135  2.308   6.442   1.00 0.00 ? 294 THR A C    2  
ATOM   2688  O  O    . THR B 2 36  ? -8.649  1.997   7.529   1.00 0.00 ? 294 THR A O    2  
ATOM   2689  C  CB   . THR B 2 36  ? -10.379 4.474   6.493   1.00 0.00 ? 294 THR A CB   2  
ATOM   2690  O  OG1  . THR B 2 36  ? -11.555 3.970   5.847   1.00 0.00 ? 294 THR A OG1  2  
ATOM   2691  C  CG2  . THR B 2 36  ? -10.267 5.970   6.269   1.00 0.00 ? 294 THR A CG2  2  
ATOM   2692  H  H    . THR B 2 36  ? -9.817  4.157   4.001   1.00 0.00 ? 294 THR A H    2  
ATOM   2693  H  HA   . THR B 2 36  ? -8.254  4.255   6.355   1.00 0.00 ? 294 THR A HA   2  
ATOM   2694  H  HB   . THR B 2 36  ? -10.453 4.294   7.554   1.00 0.00 ? 294 THR A HB   2  
ATOM   2695  H  HG1  . THR B 2 36  ? -11.301 3.373   5.139   1.00 0.00 ? 294 THR A HG1  2  
ATOM   2696  H  HG21 . THR B 2 36  ? -9.408  6.339   6.803   1.00 0.00 ? 294 THR A HG21 2  
ATOM   2697  H  HG22 . THR B 2 36  ? -11.159 6.457   6.635   1.00 0.00 ? 294 THR A HG22 2  
ATOM   2698  H  HG23 . THR B 2 36  ? -10.152 6.171   5.214   1.00 0.00 ? 294 THR A HG23 2  
ATOM   2699  N  N    . CYS B 2 37  ? -9.694  1.430   5.611   1.00 0.00 ? 295 CYS A N    2  
ATOM   2700  C  CA   . CYS B 2 37  ? -9.767  0.008   5.922   1.00 0.00 ? 295 CYS A CA   2  
ATOM   2701  C  C    . CYS B 2 37  ? -8.416  -0.662  5.737   1.00 0.00 ? 295 CYS A C    2  
ATOM   2702  O  O    . CYS B 2 37  ? -8.064  -1.575  6.486   1.00 0.00 ? 295 CYS A O    2  
ATOM   2703  C  CB   . CYS B 2 37  ? -10.841 -0.672  5.066   1.00 0.00 ? 295 CYS A CB   2  
ATOM   2704  S  SG   . CYS B 2 37  ? -12.508 -0.165  5.539   1.00 0.00 ? 295 CYS A SG   2  
ATOM   2705  H  H    . CYS B 2 37  ? -10.075 1.752   4.770   1.00 0.00 ? 295 CYS A H    2  
ATOM   2706  H  HA   . CYS B 2 37  ? -10.046 -0.081  6.962   1.00 0.00 ? 295 CYS A HA   2  
ATOM   2707  H  HB2  . CYS B 2 37  ? -10.697 -0.427  4.030   1.00 0.00 ? 295 CYS A HB2  2  
ATOM   2708  H  HB3  . CYS B 2 37  ? -10.777 -1.730  5.181   1.00 0.00 ? 295 CYS A HB3  2  
ATOM   2709  N  N    . LEU B 2 38  ? -7.657  -0.215  4.743   1.00 0.00 ? 296 LEU A N    2  
ATOM   2710  C  CA   . LEU B 2 38  ? -6.333  -0.784  4.516   1.00 0.00 ? 296 LEU A CA   2  
ATOM   2711  C  C    . LEU B 2 38  ? -5.330  -0.168  5.480   1.00 0.00 ? 296 LEU A C    2  
ATOM   2712  O  O    . LEU B 2 38  ? -4.160  -0.548  5.502   1.00 0.00 ? 296 LEU A O    2  
ATOM   2713  C  CB   . LEU B 2 38  ? -5.863  -0.558  3.086   1.00 0.00 ? 296 LEU A CB   2  
ATOM   2714  C  CG   . LEU B 2 38  ? -6.866  -0.927  2.005   1.00 0.00 ? 296 LEU A CG   2  
ATOM   2715  C  CD1  . LEU B 2 38  ? -7.344  0.326   1.311   1.00 0.00 ? 296 LEU A CD1  2  
ATOM   2716  C  CD2  . LEU B 2 38  ? -6.248  -1.886  1.005   1.00 0.00 ? 296 LEU A CD2  2  
ATOM   2717  H  H    . LEU B 2 38  ? -7.994  0.506   4.154   1.00 0.00 ? 296 LEU A H    2  
ATOM   2718  H  HA   . LEU B 2 38  ? -6.394  -1.844  4.700   1.00 0.00 ? 296 LEU A HA   2  
ATOM   2719  H  HB2  . LEU B 2 38  ? -5.616  0.487   2.976   1.00 0.00 ? 296 LEU A HB2  2  
ATOM   2720  H  HB3  . LEU B 2 38  ? -4.967  -1.140  2.928   1.00 0.00 ? 296 LEU A HB3  2  
ATOM   2721  H  HG   . LEU B 2 38  ? -7.719  -1.410  2.457   1.00 0.00 ? 296 LEU A HG   2  
ATOM   2722  H  HD11 . LEU B 2 38  ? -7.959  0.069   0.464   1.00 0.00 ? 296 LEU A HD11 2  
ATOM   2723  H  HD12 . LEU B 2 38  ? -6.495  0.891   0.974   1.00 0.00 ? 296 LEU A HD12 2  
ATOM   2724  H  HD13 . LEU B 2 38  ? -7.910  0.920   2.000   1.00 0.00 ? 296 LEU A HD13 2  
ATOM   2725  H  HD21 . LEU B 2 38  ? -6.632  -1.667  0.023   1.00 0.00 ? 296 LEU A HD21 2  
ATOM   2726  H  HD22 . LEU B 2 38  ? -6.502  -2.901  1.274   1.00 0.00 ? 296 LEU A HD22 2  
ATOM   2727  H  HD23 . LEU B 2 38  ? -5.174  -1.769  1.008   1.00 0.00 ? 296 LEU A HD23 2  
ATOM   2728  N  N    . GLN B 2 39  ? -5.806  0.800   6.265   1.00 0.00 ? 297 GLN A N    2  
ATOM   2729  C  CA   . GLN B 2 39  ? -4.973  1.497   7.242   1.00 0.00 ? 297 GLN A CA   2  
ATOM   2730  C  C    . GLN B 2 39  ? -3.997  2.427   6.533   1.00 0.00 ? 297 GLN A C    2  
ATOM   2731  O  O    . GLN B 2 39  ? -2.960  2.801   7.082   1.00 0.00 ? 297 GLN A O    2  
ATOM   2732  C  CB   . GLN B 2 39  ? -4.216  0.505   8.128   1.00 0.00 ? 297 GLN A CB   2  
ATOM   2733  C  CG   . GLN B 2 39  ? -4.236  0.872   9.599   1.00 0.00 ? 297 GLN A CG   2  
ATOM   2734  C  CD   . GLN B 2 39  ? -3.191  0.126   10.407  1.00 0.00 ? 297 GLN A CD   2  
ATOM   2735  O  OE1  . GLN B 2 39  ? -2.683  0.635   11.405  1.00 0.00 ? 297 GLN A OE1  2  
ATOM   2736  N  NE2  . GLN B 2 39  ? -2.863  -1.089  9.977   1.00 0.00 ? 297 GLN A NE2  2  
ATOM   2737  H  H    . GLN B 2 39  ? -6.747  1.062   6.175   1.00 0.00 ? 297 GLN A H    2  
ATOM   2738  H  HA   . GLN B 2 39  ? -5.626  2.093   7.862   1.00 0.00 ? 297 GLN A HA   2  
ATOM   2739  H  HB2  . GLN B 2 39  ? -4.666  -0.470  8.022   1.00 0.00 ? 297 GLN A HB2  2  
ATOM   2740  H  HB3  . GLN B 2 39  ? -3.188  0.457   7.803   1.00 0.00 ? 297 GLN A HB3  2  
ATOM   2741  H  HG2  . GLN B 2 39  ? -4.055  1.933   9.695   1.00 0.00 ? 297 GLN A HG2  2  
ATOM   2742  H  HG3  . GLN B 2 39  ? -5.212  0.635   9.994   1.00 0.00 ? 297 GLN A HG3  2  
ATOM   2743  H  HE21 . GLN B 2 39  ? -3.307  -1.433  9.174   1.00 0.00 ? 297 GLN A HE21 2  
ATOM   2744  H  HE22 . GLN B 2 39  ? -2.190  -1.592  10.482  1.00 0.00 ? 297 GLN A HE22 2  
ATOM   2745  N  N    . PHE B 2 40  ? -4.348  2.791   5.305   1.00 0.00 ? 298 PHE A N    2  
ATOM   2746  C  CA   . PHE B 2 40  ? -3.529  3.682   4.493   1.00 0.00 ? 298 PHE A CA   2  
ATOM   2747  C  C    . PHE B 2 40  ? -3.425  5.069   5.123   1.00 0.00 ? 298 PHE A C    2  
ATOM   2748  O  O    . PHE B 2 40  ? -3.771  5.276   6.286   1.00 0.00 ? 298 PHE A O    2  
ATOM   2749  C  CB   . PHE B 2 40  ? -4.144  3.844   3.102   1.00 0.00 ? 298 PHE A CB   2  
ATOM   2750  C  CG   . PHE B 2 40  ? -4.003  2.668   2.164   1.00 0.00 ? 298 PHE A CG   2  
ATOM   2751  C  CD1  . PHE B 2 40  ? -3.232  1.558   2.483   1.00 0.00 ? 298 PHE A CD1  2  
ATOM   2752  C  CD2  . PHE B 2 40  ? -4.642  2.702   0.935   1.00 0.00 ? 298 PHE A CD2  2  
ATOM   2753  C  CE1  . PHE B 2 40  ? -3.107  0.509   1.586   1.00 0.00 ? 298 PHE A CE1  2  
ATOM   2754  C  CE2  . PHE B 2 40  ? -4.515  1.662   0.039   1.00 0.00 ? 298 PHE A CE2  2  
ATOM   2755  C  CZ   . PHE B 2 40  ? -3.751  0.567   0.361   1.00 0.00 ? 298 PHE A CZ   2  
ATOM   2756  H  H    . PHE B 2 40  ? -5.184  2.446   4.931   1.00 0.00 ? 298 PHE A H    2  
ATOM   2757  H  HA   . PHE B 2 40  ? -2.543  3.254   4.401   1.00 0.00 ? 298 PHE A HA   2  
ATOM   2758  H  HB2  . PHE B 2 40  ? -5.191  4.049   3.209   1.00 0.00 ? 298 PHE A HB2  2  
ATOM   2759  H  HB3  . PHE B 2 40  ? -3.681  4.695   2.626   1.00 0.00 ? 298 PHE A HB3  2  
ATOM   2760  H  HD1  . PHE B 2 40  ? -2.731  1.514   3.437   1.00 0.00 ? 298 PHE A HD1  2  
ATOM   2761  H  HD2  . PHE B 2 40  ? -5.230  3.565   0.671   1.00 0.00 ? 298 PHE A HD2  2  
ATOM   2762  H  HE1  . PHE B 2 40  ? -2.505  -0.351  1.840   1.00 0.00 ? 298 PHE A HE1  2  
ATOM   2763  H  HE2  . PHE B 2 40  ? -5.028  1.704   -0.911  1.00 0.00 ? 298 PHE A HE2  2  
ATOM   2764  H  HZ   . PHE B 2 40  ? -3.651  -0.241  -0.347  1.00 0.00 ? 298 PHE A HZ   2  
ATOM   2765  N  N    . THR B 2 41  ? -2.940  6.013   4.322   1.00 0.00 ? 299 THR A N    2  
ATOM   2766  C  CA   . THR B 2 41  ? -2.805  7.401   4.738   1.00 0.00 ? 299 THR A CA   2  
ATOM   2767  C  C    . THR B 2 41  ? -3.318  8.308   3.627   1.00 0.00 ? 299 THR A C    2  
ATOM   2768  O  O    . THR B 2 41  ? -3.594  7.837   2.526   1.00 0.00 ? 299 THR A O    2  
ATOM   2769  C  CB   . THR B 2 41  ? -1.351  7.765   5.072   1.00 0.00 ? 299 THR A CB   2  
ATOM   2770  O  OG1  . THR B 2 41  ? -1.254  9.154   5.407   1.00 0.00 ? 299 THR A OG1  2  
ATOM   2771  C  CG2  . THR B 2 41  ? -0.428  7.455   3.906   1.00 0.00 ? 299 THR A CG2  2  
ATOM   2772  H  H    . THR B 2 41  ? -2.662  5.765   3.416   1.00 0.00 ? 299 THR A H    2  
ATOM   2773  H  HA   . THR B 2 41  ? -3.404  7.546   5.623   1.00 0.00 ? 299 THR A HA   2  
ATOM   2774  H  HB   . THR B 2 41  ? -1.045  7.178   5.923   1.00 0.00 ? 299 THR A HB   2  
ATOM   2775  H  HG1  . THR B 2 41  ? -1.079  9.246   6.346   1.00 0.00 ? 299 THR A HG1  2  
ATOM   2776  H  HG21 . THR B 2 41  ? -0.620  6.452   3.553   1.00 0.00 ? 299 THR A HG21 2  
ATOM   2777  H  HG22 . THR B 2 41  ? 0.600   7.532   4.229   1.00 0.00 ? 299 THR A HG22 2  
ATOM   2778  H  HG23 . THR B 2 41  ? -0.608  8.159   3.107   1.00 0.00 ? 299 THR A HG23 2  
ATOM   2779  N  N    . LEU B 2 42  ? -3.448  9.596   3.900   1.00 0.00 ? 300 LEU A N    2  
ATOM   2780  C  CA   . LEU B 2 42  ? -3.949  10.524  2.894   1.00 0.00 ? 300 LEU A CA   2  
ATOM   2781  C  C    . LEU B 2 42  ? -3.053  10.545  1.658   1.00 0.00 ? 300 LEU A C    2  
ATOM   2782  O  O    . LEU B 2 42  ? -3.548  10.550  0.534   1.00 0.00 ? 300 LEU A O    2  
ATOM   2783  C  CB   . LEU B 2 42  ? -4.093  11.931  3.480   1.00 0.00 ? 300 LEU A CB   2  
ATOM   2784  C  CG   . LEU B 2 42  ? -5.119  12.829  2.778   1.00 0.00 ? 300 LEU A CG   2  
ATOM   2785  C  CD1  . LEU B 2 42  ? -4.578  13.323  1.453   1.00 0.00 ? 300 LEU A CD1  2  
ATOM   2786  C  CD2  . LEU B 2 42  ? -6.426  12.088  2.565   1.00 0.00 ? 300 LEU A CD2  2  
ATOM   2787  H  H    . LEU B 2 42  ? -3.206  9.931   4.789   1.00 0.00 ? 300 LEU A H    2  
ATOM   2788  H  HA   . LEU B 2 42  ? -4.924  10.178  2.588   1.00 0.00 ? 300 LEU A HA   2  
ATOM   2789  H  HB2  . LEU B 2 42  ? -4.378  11.836  4.518   1.00 0.00 ? 300 LEU A HB2  2  
ATOM   2790  H  HB3  . LEU B 2 42  ? -3.130  12.418  3.432   1.00 0.00 ? 300 LEU A HB3  2  
ATOM   2791  H  HG   . LEU B 2 42  ? -5.323  13.680  3.398   1.00 0.00 ? 300 LEU A HG   2  
ATOM   2792  H  HD11 . LEU B 2 42  ? -4.364  12.474  0.826   1.00 0.00 ? 300 LEU A HD11 2  
ATOM   2793  H  HD12 . LEU B 2 42  ? -3.673  13.888  1.620   1.00 0.00 ? 300 LEU A HD12 2  
ATOM   2794  H  HD13 . LEU B 2 42  ? -5.314  13.950  0.973   1.00 0.00 ? 300 LEU A HD13 2  
ATOM   2795  H  HD21 . LEU B 2 42  ? -6.615  11.461  3.416   1.00 0.00 ? 300 LEU A HD21 2  
ATOM   2796  H  HD22 . LEU B 2 42  ? -6.356  11.479  1.676   1.00 0.00 ? 300 LEU A HD22 2  
ATOM   2797  H  HD23 . LEU B 2 42  ? -7.231  12.798  2.454   1.00 0.00 ? 300 LEU A HD23 2  
ATOM   2798  N  N    . ASN B 2 43  ? -1.740  10.542  1.863   1.00 0.00 ? 301 ASN A N    2  
ATOM   2799  C  CA   . ASN B 2 43  ? -0.802  10.568  0.743   1.00 0.00 ? 301 ASN A CA   2  
ATOM   2800  C  C    . ASN B 2 43  ? -0.906  9.298   -0.095  1.00 0.00 ? 301 ASN A C    2  
ATOM   2801  O  O    . ASN B 2 43  ? -0.981  9.372   -1.314  1.00 0.00 ? 301 ASN A O    2  
ATOM   2802  C  CB   . ASN B 2 43  ? 0.627   10.744  1.242   1.00 0.00 ? 301 ASN A CB   2  
ATOM   2803  C  CG   . ASN B 2 43  ? 1.358   11.866  0.538   1.00 0.00 ? 301 ASN A CG   2  
ATOM   2804  O  OD1  . ASN B 2 43  ? 1.016   12.240  -0.584  1.00 0.00 ? 301 ASN A OD1  2  
ATOM   2805  N  ND2  . ASN B 2 43  ? 2.381   12.402  1.190   1.00 0.00 ? 301 ASN A ND2  2  
ATOM   2806  H  H    . ASN B 2 43  ? -1.395  10.519  2.780   1.00 0.00 ? 301 ASN A H    2  
ATOM   2807  H  HA   . ASN B 2 43  ? -1.065  11.414  0.117   1.00 0.00 ? 301 ASN A HA   2  
ATOM   2808  H  HB2  . ASN B 2 43  ? 0.607   10.961  2.296   1.00 0.00 ? 301 ASN A HB2  2  
ATOM   2809  H  HB3  . ASN B 2 43  ? 1.170   9.829   1.077   1.00 0.00 ? 301 ASN A HB3  2  
ATOM   2810  H  HD21 . ASN B 2 43  ? 2.603   12.048  2.076   1.00 0.00 ? 301 ASN A HD21 2  
ATOM   2811  H  HD22 . ASN B 2 43  ? 2.872   13.130  0.761   1.00 0.00 ? 301 ASN A HD22 2  
ATOM   2812  N  N    . MET B 2 44  ? -0.883  8.134   0.556   1.00 0.00 ? 302 MET A N    2  
ATOM   2813  C  CA   . MET B 2 44  ? -1.003  6.863   -0.162  1.00 0.00 ? 302 MET A CA   2  
ATOM   2814  C  C    . MET B 2 44  ? -2.293  6.836   -0.918  1.00 0.00 ? 302 MET A C    2  
ATOM   2815  O  O    . MET B 2 44  ? -2.311  6.599   -2.114  1.00 0.00 ? 302 MET A O    2  
ATOM   2816  C  CB   . MET B 2 44  ? -0.958  5.675   0.804   1.00 0.00 ? 302 MET A CB   2  
ATOM   2817  C  CG   . MET B 2 44  ? -2.150  4.748   0.725   1.00 0.00 ? 302 MET A CG   2  
ATOM   2818  S  SD   . MET B 2 44  ? -2.133  3.687   -0.709  1.00 0.00 ? 302 MET A SD   2  
ATOM   2819  C  CE   . MET B 2 44  ? -0.531  2.920   -0.552  1.00 0.00 ? 302 MET A CE   2  
ATOM   2820  H  H    . MET B 2 44  ? -0.782  8.129   1.530   1.00 0.00 ? 302 MET A H    2  
ATOM   2821  H  HA   . MET B 2 44  ? -0.192  6.784   -0.870  1.00 0.00 ? 302 MET A HA   2  
ATOM   2822  H  HB2  . MET B 2 44  ? -0.080  5.095   0.602   1.00 0.00 ? 302 MET A HB2  2  
ATOM   2823  H  HB3  . MET B 2 44  ? -0.905  6.046   1.798   1.00 0.00 ? 302 MET A HB3  2  
ATOM   2824  H  HG2  . MET B 2 44  ? -2.167  4.126   1.597   1.00 0.00 ? 302 MET A HG2  2  
ATOM   2825  H  HG3  . MET B 2 44  ? -3.047  5.343   0.701   1.00 0.00 ? 302 MET A HG3  2  
ATOM   2826  H  HE1  . MET B 2 44  ? -0.520  2.289   0.312   1.00 0.00 ? 302 MET A HE1  2  
ATOM   2827  H  HE2  . MET B 2 44  ? 0.224   3.683   -0.448  1.00 0.00 ? 302 MET A HE2  2  
ATOM   2828  H  HE3  . MET B 2 44  ? -0.329  2.332   -1.431  1.00 0.00 ? 302 MET A HE3  2  
ATOM   2829  N  N    . THR B 2 45  ? -3.361  7.132   -0.206  1.00 0.00 ? 303 THR A N    2  
ATOM   2830  C  CA   . THR B 2 45  ? -4.673  7.129   -0.787  1.00 0.00 ? 303 THR A CA   2  
ATOM   2831  C  C    . THR B 2 45  ? -4.619  7.986   -2.031  1.00 0.00 ? 303 THR A C    2  
ATOM   2832  O  O    . THR B 2 45  ? -4.959  7.547   -3.117  1.00 0.00 ? 303 THR A O    2  
ATOM   2833  C  CB   . THR B 2 45  ? -5.701  7.691   0.217   1.00 0.00 ? 303 THR A CB   2  
ATOM   2834  O  OG1  . THR B 2 45  ? -5.738  6.870   1.389   1.00 0.00 ? 303 THR A OG1  2  
ATOM   2835  C  CG2  . THR B 2 45  ? -7.087  7.774   -0.389  1.00 0.00 ? 303 THR A CG2  2  
ATOM   2836  H  H    . THR B 2 45  ? -3.251  7.372   0.731   1.00 0.00 ? 303 THR A H    2  
ATOM   2837  H  HA   . THR B 2 45  ? -4.942  6.109   -1.041  1.00 0.00 ? 303 THR A HA   2  
ATOM   2838  H  HB   . THR B 2 45  ? -5.392  8.686   0.501   1.00 0.00 ? 303 THR A HB   2  
ATOM   2839  H  HG1  . THR B 2 45  ? -6.549  7.040   1.874   1.00 0.00 ? 303 THR A HG1  2  
ATOM   2840  H  HG21 . THR B 2 45  ? -7.414  6.789   -0.696  1.00 0.00 ? 303 THR A HG21 2  
ATOM   2841  H  HG22 . THR B 2 45  ? -7.059  8.427   -1.245  1.00 0.00 ? 303 THR A HG22 2  
ATOM   2842  H  HG23 . THR B 2 45  ? -7.776  8.170   0.343   1.00 0.00 ? 303 THR A HG23 2  
ATOM   2843  N  N    . GLU B 2 46  ? -4.076  9.176   -1.857  1.00 0.00 ? 304 GLU A N    2  
ATOM   2844  C  CA   . GLU B 2 46  ? -3.917  10.137  -2.936  1.00 0.00 ? 304 GLU A CA   2  
ATOM   2845  C  C    . GLU B 2 46  ? -3.160  9.528   -4.121  1.00 0.00 ? 304 GLU A C    2  
ATOM   2846  O  O    . GLU B 2 46  ? -3.620  9.565   -5.268  1.00 0.00 ? 304 GLU A O    2  
ATOM   2847  C  CB   . GLU B 2 46  ? -3.115  11.323  -2.395  1.00 0.00 ? 304 GLU A CB   2  
ATOM   2848  C  CG   . GLU B 2 46  ? -3.382  12.626  -3.091  1.00 0.00 ? 304 GLU A CG   2  
ATOM   2849  C  CD   . GLU B 2 46  ? -2.316  13.667  -2.811  1.00 0.00 ? 304 GLU A CD   2  
ATOM   2850  O  OE1  . GLU B 2 46  ? -2.377  14.306  -1.740  1.00 0.00 ? 304 GLU A OE1  2  
ATOM   2851  O  OE2  . GLU B 2 46  ? -1.420  13.844  -3.664  1.00 0.00 ? 304 GLU A OE2  2  
ATOM   2852  H  H    . GLU B 2 46  ? -3.764  9.420   -0.963  1.00 0.00 ? 304 GLU A H    2  
ATOM   2853  H  HA   . GLU B 2 46  ? -4.897  10.464  -3.254  1.00 0.00 ? 304 GLU A HA   2  
ATOM   2854  H  HB2  . GLU B 2 46  ? -3.338  11.451  -1.349  1.00 0.00 ? 304 GLU A HB2  2  
ATOM   2855  H  HB3  . GLU B 2 46  ? -2.067  11.104  -2.506  1.00 0.00 ? 304 GLU A HB3  2  
ATOM   2856  H  HG2  . GLU B 2 46  ? -3.415  12.439  -4.146  1.00 0.00 ? 304 GLU A HG2  2  
ATOM   2857  H  HG3  . GLU B 2 46  ? -4.328  13.003  -2.747  1.00 0.00 ? 304 GLU A HG3  2  
ATOM   2858  N  N    . ALA B 2 47  ? -2.002  8.955   -3.815  1.00 0.00 ? 305 ALA A N    2  
ATOM   2859  C  CA   . ALA B 2 47  ? -1.133  8.349   -4.820  1.00 0.00 ? 305 ALA A CA   2  
ATOM   2860  C  C    . ALA B 2 47  ? -1.861  7.267   -5.589  1.00 0.00 ? 305 ALA A C    2  
ATOM   2861  O  O    . ALA B 2 47  ? -2.046  7.342   -6.802  1.00 0.00 ? 305 ALA A O    2  
ATOM   2862  C  CB   . ALA B 2 47  ? 0.103   7.752   -4.144  1.00 0.00 ? 305 ALA A CB   2  
ATOM   2863  H  H    . ALA B 2 47  ? -1.729  8.927   -2.874  1.00 0.00 ? 305 ALA A H    2  
ATOM   2864  H  HA   . ALA B 2 47  ? -0.810  9.119   -5.504  1.00 0.00 ? 305 ALA A HA   2  
ATOM   2865  H  HB1  . ALA B 2 47  ? -0.171  6.849   -3.586  1.00 0.00 ? 305 ALA A HB1  2  
ATOM   2866  H  HB2  . ALA B 2 47  ? 0.525   8.478   -3.465  1.00 0.00 ? 305 ALA A HB2  2  
ATOM   2867  H  HB3  . ALA B 2 47  ? 0.834   7.498   -4.896  1.00 0.00 ? 305 ALA A HB3  2  
ATOM   2868  N  N    . VAL B 2 48  ? -2.282  6.279   -4.838  1.00 0.00 ? 306 VAL A N    2  
ATOM   2869  C  CA   . VAL B 2 48  ? -2.986  5.127   -5.346  1.00 0.00 ? 306 VAL A CA   2  
ATOM   2870  C  C    . VAL B 2 48  ? -4.292  5.490   -6.034  1.00 0.00 ? 306 VAL A C    2  
ATOM   2871  O  O    . VAL B 2 48  ? -4.830  4.707   -6.815  1.00 0.00 ? 306 VAL A O    2  
ATOM   2872  C  CB   . VAL B 2 48  ? -3.209  4.166   -4.199  1.00 0.00 ? 306 VAL A CB   2  
ATOM   2873  C  CG1  . VAL B 2 48  ? -1.870  3.875   -3.563  1.00 0.00 ? 306 VAL A CG1  2  
ATOM   2874  C  CG2  . VAL B 2 48  ? -4.191  4.721   -3.196  1.00 0.00 ? 306 VAL A CG2  2  
ATOM   2875  H  H    . VAL B 2 48  ? -2.102  6.322   -3.881  1.00 0.00 ? 306 VAL A H    2  
ATOM   2876  H  HA   . VAL B 2 48  ? -2.357  4.634   -6.052  1.00 0.00 ? 306 VAL A HA   2  
ATOM   2877  H  HB   . VAL B 2 48  ? -3.599  3.250   -4.578  1.00 0.00 ? 306 VAL A HB   2  
ATOM   2878  H  HG11 . VAL B 2 48  ? -1.957  3.005   -2.929  1.00 0.00 ? 306 VAL A HG11 2  
ATOM   2879  H  HG12 . VAL B 2 48  ? -1.558  4.724   -2.973  1.00 0.00 ? 306 VAL A HG12 2  
ATOM   2880  H  HG13 . VAL B 2 48  ? -1.138  3.686   -4.335  1.00 0.00 ? 306 VAL A HG13 2  
ATOM   2881  H  HG21 . VAL B 2 48  ? -4.640  3.901   -2.676  1.00 0.00 ? 306 VAL A HG21 2  
ATOM   2882  H  HG22 . VAL B 2 48  ? -4.955  5.287   -3.709  1.00 0.00 ? 306 VAL A HG22 2  
ATOM   2883  H  HG23 . VAL B 2 48  ? -3.681  5.353   -2.495  1.00 0.00 ? 306 VAL A HG23 2  
ATOM   2884  N  N    . LYS B 2 49  ? -4.797  6.677   -5.741  1.00 0.00 ? 307 LYS A N    2  
ATOM   2885  C  CA   . LYS B 2 49  ? -6.032  7.135   -6.348  1.00 0.00 ? 307 LYS A CA   2  
ATOM   2886  C  C    . LYS B 2 49  ? -5.829  7.471   -7.813  1.00 0.00 ? 307 LYS A C    2  
ATOM   2887  O  O    . LYS B 2 49  ? -6.626  7.100   -8.676  1.00 0.00 ? 307 LYS A O    2  
ATOM   2888  C  CB   . LYS B 2 49  ? -6.544  8.348   -5.635  1.00 0.00 ? 307 LYS A CB   2  
ATOM   2889  C  CG   . LYS B 2 49  ? -7.252  7.957   -4.391  1.00 0.00 ? 307 LYS A CG   2  
ATOM   2890  C  CD   . LYS B 2 49  ? -8.626  8.551   -4.316  1.00 0.00 ? 307 LYS A CD   2  
ATOM   2891  C  CE   . LYS B 2 49  ? -9.056  8.496   -2.892  1.00 0.00 ? 307 LYS A CE   2  
ATOM   2892  N  NZ   . LYS B 2 49  ? -10.009 9.581   -2.531  1.00 0.00 ? 307 LYS A NZ   2  
ATOM   2893  H  H    . LYS B 2 49  ? -4.330  7.257   -5.105  1.00 0.00 ? 307 LYS A H    2  
ATOM   2894  H  HA   . LYS B 2 49  ? -6.762  6.360   -6.226  1.00 0.00 ? 307 LYS A HA   2  
ATOM   2895  H  HB2  . LYS B 2 49  ? -5.716  8.984   -5.384  1.00 0.00 ? 307 LYS A HB2  2  
ATOM   2896  H  HB3  . LYS B 2 49  ? -7.236  8.881   -6.264  1.00 0.00 ? 307 LYS A HB3  2  
ATOM   2897  H  HG2  . LYS B 2 49  ? -7.336  6.881   -4.362  1.00 0.00 ? 307 LYS A HG2  2  
ATOM   2898  H  HG3  . LYS B 2 49  ? -6.671  8.293   -3.547  1.00 0.00 ? 307 LYS A HG3  2  
ATOM   2899  H  HD2  . LYS B 2 49  ? -8.595  9.578   -4.653  1.00 0.00 ? 307 LYS A HD2  2  
ATOM   2900  H  HD3  . LYS B 2 49  ? -9.307  7.974   -4.922  1.00 0.00 ? 307 LYS A HD3  2  
ATOM   2901  H  HE2  . LYS B 2 49  ? -9.503  7.532   -2.696  1.00 0.00 ? 307 LYS A HE2  2  
ATOM   2902  H  HE3  . LYS B 2 49  ? -8.165  8.590   -2.316  1.00 0.00 ? 307 LYS A HE3  2  
ATOM   2903  H  HZ1  . LYS B 2 49  ? -10.310 9.477   -1.540  1.00 0.00 ? 307 LYS A HZ1  2  
ATOM   2904  H  HZ2  . LYS B 2 49  ? -10.849 9.538   -3.142  1.00 0.00 ? 307 LYS A HZ2  2  
ATOM   2905  H  HZ3  . LYS B 2 49  ? -9.557  10.509  -2.650  1.00 0.00 ? 307 LYS A HZ3  2  
ATOM   2906  N  N    . THR B 2 50  ? -4.740  8.184   -8.074  1.00 0.00 ? 308 THR A N    2  
ATOM   2907  C  CA   . THR B 2 50  ? -4.411  8.631   -9.426  1.00 0.00 ? 308 THR A CA   2  
ATOM   2908  C  C    . THR B 2 50  ? -3.565  7.640   -10.239 1.00 0.00 ? 308 THR A C    2  
ATOM   2909  O  O    . THR B 2 50  ? -3.913  7.337   -11.381 1.00 0.00 ? 308 THR A O    2  
ATOM   2910  C  CB   . THR B 2 50  ? -3.680  9.986   -9.391  1.00 0.00 ? 308 THR A CB   2  
ATOM   2911  O  OG1  . THR B 2 50  ? -3.158  10.297  -10.688 1.00 0.00 ? 308 THR A OG1  2  
ATOM   2912  C  CG2  . THR B 2 50  ? -2.549  9.968   -8.374  1.00 0.00 ? 308 THR A CG2  2  
ATOM   2913  H  H    . THR B 2 50  ? -4.152  8.434   -7.325  1.00 0.00 ? 308 THR A H    2  
ATOM   2914  H  HA   . THR B 2 50  ? -5.344  8.782   -9.946  1.00 0.00 ? 308 THR A HA   2  
ATOM   2915  H  HB   . THR B 2 50  ? -4.387  10.751  -9.104  1.00 0.00 ? 308 THR A HB   2  
ATOM   2916  H  HG1  . THR B 2 50  ? -2.215  10.121  -10.705 1.00 0.00 ? 308 THR A HG1  2  
ATOM   2917  H  HG21 . THR B 2 50  ? -2.959  9.837   -7.383  1.00 0.00 ? 308 THR A HG21 2  
ATOM   2918  H  HG22 . THR B 2 50  ? -2.008  10.901  -8.420  1.00 0.00 ? 308 THR A HG22 2  
ATOM   2919  H  HG23 . THR B 2 50  ? -1.878  9.151   -8.596  1.00 0.00 ? 308 THR A HG23 2  
ATOM   2920  N  N    . TYR B 2 51  ? -2.464  7.131   -9.678  1.00 0.00 ? 309 TYR A N    2  
ATOM   2921  C  CA   . TYR B 2 51  ? -1.595  6.232   -10.440 1.00 0.00 ? 309 TYR A CA   2  
ATOM   2922  C  C    . TYR B 2 51  ? -1.963  4.750   -10.276 1.00 0.00 ? 309 TYR A C    2  
ATOM   2923  O  O    . TYR B 2 51  ? -3.027  4.411   -9.759  1.00 0.00 ? 309 TYR A O    2  
ATOM   2924  C  CB   . TYR B 2 51  ? -0.117  6.503   -10.100 1.00 0.00 ? 309 TYR A CB   2  
ATOM   2925  C  CG   . TYR B 2 51  ? 0.513   5.541   -9.117  1.00 0.00 ? 309 TYR A CG   2  
ATOM   2926  C  CD1  . TYR B 2 51  ? -0.078  5.286   -7.895  1.00 0.00 ? 309 TYR A CD1  2  
ATOM   2927  C  CD2  . TYR B 2 51  ? 1.706   4.895   -9.419  1.00 0.00 ? 309 TYR A CD2  2  
ATOM   2928  C  CE1  . TYR B 2 51  ? 0.496   4.413   -6.993  1.00 0.00 ? 309 TYR A CE1  2  
ATOM   2929  C  CE2  . TYR B 2 51  ? 2.288   4.019   -8.526  1.00 0.00 ? 309 TYR A CE2  2  
ATOM   2930  C  CZ   . TYR B 2 51  ? 1.679   3.781   -7.313  1.00 0.00 ? 309 TYR A CZ   2  
ATOM   2931  O  OH   . TYR B 2 51  ? 2.254   2.908   -6.418  1.00 0.00 ? 309 TYR A OH   2  
ATOM   2932  H  H    . TYR B 2 51  ? -2.237  7.354   -8.749  1.00 0.00 ? 309 TYR A H    2  
ATOM   2933  H  HA   . TYR B 2 51  ? -1.741  6.481   -11.475 1.00 0.00 ? 309 TYR A HA   2  
ATOM   2934  H  HB2  . TYR B 2 51  ? 0.462   6.459   -11.009 1.00 0.00 ? 309 TYR A HB2  2  
ATOM   2935  H  HB3  . TYR B 2 51  ? -0.035  7.497   -9.684  1.00 0.00 ? 309 TYR A HB3  2  
ATOM   2936  H  HD1  . TYR B 2 51  ? -1.007  5.780   -7.655  1.00 0.00 ? 309 TYR A HD1  2  
ATOM   2937  H  HD2  . TYR B 2 51  ? 2.180   5.086   -10.371 1.00 0.00 ? 309 TYR A HD2  2  
ATOM   2938  H  HE1  . TYR B 2 51  ? 0.019   4.230   -6.046  1.00 0.00 ? 309 TYR A HE1  2  
ATOM   2939  H  HE2  . TYR B 2 51  ? 3.214   3.525   -8.778  1.00 0.00 ? 309 TYR A HE2  2  
ATOM   2940  H  HH   . TYR B 2 51  ? 1.588   2.298   -6.092  1.00 0.00 ? 309 TYR A HH   2  
ATOM   2941  N  N    . LYS B 2 52  ? -1.058  3.883   -10.730 1.00 0.00 ? 310 LYS A N    2  
ATOM   2942  C  CA   . LYS B 2 52  ? -1.254  2.433   -10.690 1.00 0.00 ? 310 LYS A CA   2  
ATOM   2943  C  C    . LYS B 2 52  ? -0.951  1.881   -9.307  1.00 0.00 ? 310 LYS A C    2  
ATOM   2944  O  O    . LYS B 2 52  ? 0.182   1.496   -9.014  1.00 0.00 ? 310 LYS A O    2  
ATOM   2945  C  CB   . LYS B 2 52  ? -0.359  1.757   -11.718 1.00 0.00 ? 310 LYS A CB   2  
ATOM   2946  C  CG   . LYS B 2 52  ? -0.550  2.280   -13.117 1.00 0.00 ? 310 LYS A CG   2  
ATOM   2947  C  CD   . LYS B 2 52  ? -1.413  1.360   -13.956 1.00 0.00 ? 310 LYS A CD   2  
ATOM   2948  C  CE   . LYS B 2 52  ? -0.723  0.034   -14.226 1.00 0.00 ? 310 LYS A CE   2  
ATOM   2949  N  NZ   . LYS B 2 52  ? 0.638   0.220   -14.799 1.00 0.00 ? 310 LYS A NZ   2  
ATOM   2950  H  H    . LYS B 2 52  ? -0.211  4.232   -11.067 1.00 0.00 ? 310 LYS A H    2  
ATOM   2951  H  HA   . LYS B 2 52  ? -2.274  2.221   -10.941 1.00 0.00 ? 310 LYS A HA   2  
ATOM   2952  H  HB2  . LYS B 2 52  ? 0.658   1.918   -11.437 1.00 0.00 ? 310 LYS A HB2  2  
ATOM   2953  H  HB3  . LYS B 2 52  ? -0.562  0.704   -11.730 1.00 0.00 ? 310 LYS A HB3  2  
ATOM   2954  H  HG2  . LYS B 2 52  ? -1.031  3.235   -13.056 1.00 0.00 ? 310 LYS A HG2  2  
ATOM   2955  H  HG3  . LYS B 2 52  ? 0.414   2.378   -13.578 1.00 0.00 ? 310 LYS A HG3  2  
ATOM   2956  H  HD2  . LYS B 2 52  ? -2.327  1.175   -13.424 1.00 0.00 ? 310 LYS A HD2  2  
ATOM   2957  H  HD3  . LYS B 2 52  ? -1.630  1.843   -14.897 1.00 0.00 ? 310 LYS A HD3  2  
ATOM   2958  H  HE2  . LYS B 2 52  ? -0.643  -0.507  -13.296 1.00 0.00 ? 310 LYS A HE2  2  
ATOM   2959  H  HE3  . LYS B 2 52  ? -1.323  -0.535  -14.922 1.00 0.00 ? 310 LYS A HE3  2  
ATOM   2960  H  HZ1  . LYS B 2 52  ? 1.086   -0.704  -14.966 1.00 0.00 ? 310 LYS A HZ1  2  
ATOM   2961  H  HZ2  . LYS B 2 52  ? 1.232   0.766   -14.142 1.00 0.00 ? 310 LYS A HZ2  2  
ATOM   2962  H  HZ3  . LYS B 2 52  ? 0.579   0.733   -15.702 1.00 0.00 ? 310 LYS A HZ3  2  
ATOM   2963  N  N    . TRP B 2 53  ? -1.967  1.845   -8.461  1.00 0.00 ? 311 TRP A N    2  
ATOM   2964  C  CA   . TRP B 2 53  ? -1.811  1.338   -7.109  1.00 0.00 ? 311 TRP A CA   2  
ATOM   2965  C  C    . TRP B 2 53  ? -1.431  -0.131  -7.123  1.00 0.00 ? 311 TRP A C    2  
ATOM   2966  O  O    . TRP B 2 53  ? -0.520  -0.543  -6.407  1.00 0.00 ? 311 TRP A O    2  
ATOM   2967  C  CB   . TRP B 2 53  ? -3.099  1.564   -6.320  1.00 0.00 ? 311 TRP A CB   2  
ATOM   2968  C  CG   . TRP B 2 53  ? -3.225  0.758   -5.058  1.00 0.00 ? 311 TRP A CG   2  
ATOM   2969  C  CD1  . TRP B 2 53  ? -2.459  0.848   -3.936  1.00 0.00 ? 311 TRP A CD1  2  
ATOM   2970  C  CD2  . TRP B 2 53  ? -4.196  -0.255  -4.790  1.00 0.00 ? 311 TRP A CD2  2  
ATOM   2971  N  NE1  . TRP B 2 53  ? -2.905  -0.028  -2.982  1.00 0.00 ? 311 TRP A NE1  2  
ATOM   2972  C  CE2  . TRP B 2 53  ? -3.968  -0.721  -3.484  1.00 0.00 ? 311 TRP A CE2  2  
ATOM   2973  C  CE3  . TRP B 2 53  ? -5.238  -0.807  -5.528  1.00 0.00 ? 311 TRP A CE3  2  
ATOM   2974  C  CZ2  . TRP B 2 53  ? -4.748  -1.711  -2.901  1.00 0.00 ? 311 TRP A CZ2  2  
ATOM   2975  C  CZ3  . TRP B 2 53  ? -6.011  -1.795  -4.951  1.00 0.00 ? 311 TRP A CZ3  2  
ATOM   2976  C  CH2  . TRP B 2 53  ? -5.765  -2.236  -3.646  1.00 0.00 ? 311 TRP A CH2  2  
ATOM   2977  H  H    . TRP B 2 53  ? -2.845  2.168   -8.753  1.00 0.00 ? 311 TRP A H    2  
ATOM   2978  H  HA   . TRP B 2 53  ? -1.014  1.896   -6.641  1.00 0.00 ? 311 TRP A HA   2  
ATOM   2979  H  HB2  . TRP B 2 53  ? -3.147  2.598   -6.057  1.00 0.00 ? 311 TRP A HB2  2  
ATOM   2980  H  HB3  . TRP B 2 53  ? -3.943  1.340   -6.938  1.00 0.00 ? 311 TRP A HB3  2  
ATOM   2981  H  HD1  . TRP B 2 53  ? -1.633  1.528   -3.823  1.00 0.00 ? 311 TRP A HD1  2  
ATOM   2982  H  HE1  . TRP B 2 53  ? -2.519  -0.142  -2.088  1.00 0.00 ? 311 TRP A HE1  2  
ATOM   2983  H  HE3  . TRP B 2 53  ? -5.442  -0.475  -6.535  1.00 0.00 ? 311 TRP A HE3  2  
ATOM   2984  H  HZ2  . TRP B 2 53  ? -4.573  -2.050  -1.893  1.00 0.00 ? 311 TRP A HZ2  2  
ATOM   2985  H  HZ3  . TRP B 2 53  ? -6.824  -2.236  -5.508  1.00 0.00 ? 311 TRP A HZ3  2  
ATOM   2986  H  HH2  . TRP B 2 53  ? -6.393  -3.013  -3.236  1.00 0.00 ? 311 TRP A HH2  2  
ATOM   2987  N  N    . GLN B 2 54  ? -2.114  -0.909  -7.957  1.00 0.00 ? 312 GLN A N    2  
ATOM   2988  C  CA   . GLN B 2 54  ? -1.845  -2.337  -8.054  1.00 0.00 ? 312 GLN A CA   2  
ATOM   2989  C  C    . GLN B 2 54  ? -1.899  -2.971  -6.671  1.00 0.00 ? 312 GLN A C    2  
ATOM   2990  O  O    . GLN B 2 54  ? -0.954  -2.856  -5.890  1.00 0.00 ? 312 GLN A O    2  
ATOM   2991  C  CB   . GLN B 2 54  ? -0.477  -2.580  -8.695  1.00 0.00 ? 312 GLN A CB   2  
ATOM   2992  C  CG   . GLN B 2 54  ? -0.339  -1.971  -10.081 1.00 0.00 ? 312 GLN A CG   2  
ATOM   2993  C  CD   . GLN B 2 54  ? 1.052   -2.141  -10.664 1.00 0.00 ? 312 GLN A CD   2  
ATOM   2994  O  OE1  . GLN B 2 54  ? 1.524   -1.299  -11.428 1.00 0.00 ? 312 GLN A OE1  2  
ATOM   2995  N  NE2  . GLN B 2 54  ? 1.716   -3.236  -10.310 1.00 0.00 ? 312 GLN A NE2  2  
ATOM   2996  H  H    . GLN B 2 54  ? -2.814  -0.514  -8.517  1.00 0.00 ? 312 GLN A H    2  
ATOM   2997  H  HA   . GLN B 2 54  ? -2.611  -2.780  -8.674  1.00 0.00 ? 312 GLN A HA   2  
ATOM   2998  H  HB2  . GLN B 2 54  ? 0.285   -2.151  -8.059  1.00 0.00 ? 312 GLN A HB2  2  
ATOM   2999  H  HB3  . GLN B 2 54  ? -0.312  -3.643  -8.774  1.00 0.00 ? 312 GLN A HB3  2  
ATOM   3000  H  HG2  . GLN B 2 54  ? -1.048  -2.448  -10.741 1.00 0.00 ? 312 GLN A HG2  2  
ATOM   3001  H  HG3  . GLN B 2 54  ? -0.560  -0.915  -10.020 1.00 0.00 ? 312 GLN A HG3  2  
ATOM   3002  H  HE21 . GLN B 2 54  ? 1.279   -3.867  -9.702  1.00 0.00 ? 312 GLN A HE21 2  
ATOM   3003  H  HE22 . GLN B 2 54  ? 2.618   -3.368  -10.672 1.00 0.00 ? 312 GLN A HE22 2  
ATOM   3004  N  N    . CYS B 2 55  ? -3.014  -3.632  -6.374  1.00 0.00 ? 313 CYS A N    2  
ATOM   3005  C  CA   . CYS B 2 55  ? -3.209  -4.272  -5.078  1.00 0.00 ? 313 CYS A CA   2  
ATOM   3006  C  C    . CYS B 2 55  ? -1.958  -5.010  -4.622  1.00 0.00 ? 313 CYS A C    2  
ATOM   3007  O  O    . CYS B 2 55  ? -1.055  -5.261  -5.410  1.00 0.00 ? 313 CYS A O    2  
ATOM   3008  C  CB   . CYS B 2 55  ? -4.393  -5.250  -5.125  1.00 0.00 ? 313 CYS A CB   2  
ATOM   3009  S  SG   . CYS B 2 55  ? -3.990  -6.905  -5.788  1.00 0.00 ? 313 CYS A SG   2  
ATOM   3010  H  H    . CYS B 2 55  ? -3.725  -3.688  -7.044  1.00 0.00 ? 313 CYS A H    2  
ATOM   3011  H  HA   . CYS B 2 55  ? -3.429  -3.498  -4.361  1.00 0.00 ? 313 CYS A HA   2  
ATOM   3012  H  HB2  . CYS B 2 55  ? -4.767  -5.388  -4.124  1.00 0.00 ? 313 CYS A HB2  2  
ATOM   3013  H  HB3  . CYS B 2 55  ? -5.176  -4.832  -5.734  1.00 0.00 ? 313 CYS A HB3  2  
ATOM   3014  N  N    . ILE B 2 56  ? -1.915  -5.323  -3.338  1.00 0.00 ? 314 ILE A N    2  
ATOM   3015  C  CA   . ILE B 2 56  ? -0.803  -6.053  -2.743  1.00 0.00 ? 314 ILE A CA   2  
ATOM   3016  C  C    . ILE B 2 56  ? -0.474  -7.286  -3.564  1.00 0.00 ? 314 ILE A C    2  
ATOM   3017  O  O    . ILE B 2 56  ? 0.688   -7.589  -3.817  1.00 0.00 ? 314 ILE A O    2  
ATOM   3018  C  CB   . ILE B 2 56  ? -1.192  -6.468  -1.320  1.00 0.00 ? 314 ILE A CB   2  
ATOM   3019  C  CG1  . ILE B 2 56  ? -0.351  -7.614  -0.814  1.00 0.00 ? 314 ILE A CG1  2  
ATOM   3020  C  CG2  . ILE B 2 56  ? -2.642  -6.893  -1.302  1.00 0.00 ? 314 ILE A CG2  2  
ATOM   3021  C  CD1  . ILE B 2 56  ? 1.111   -7.300  -0.696  1.00 0.00 ? 314 ILE A CD1  2  
ATOM   3022  H  H    . ILE B 2 56  ? -2.663  -5.061  -2.764  1.00 0.00 ? 314 ILE A H    2  
ATOM   3023  H  HA   . ILE B 2 56  ? 0.071   -5.413  -2.697  1.00 0.00 ? 314 ILE A HA   2  
ATOM   3024  H  HB   . ILE B 2 56  ? -1.063  -5.618  -0.676  1.00 0.00 ? 314 ILE A HB   2  
ATOM   3025  H  HG12 . ILE B 2 56  ? -0.707  -7.897  0.156   1.00 0.00 ? 314 ILE A HG12 2  
ATOM   3026  H  HG13 . ILE B 2 56  ? -0.465  -8.440  -1.490  1.00 0.00 ? 314 ILE A HG13 2  
ATOM   3027  H  HG21 . ILE B 2 56  ? -2.746  -7.758  -1.944  1.00 0.00 ? 314 ILE A HG21 2  
ATOM   3028  H  HG22 . ILE B 2 56  ? -3.262  -6.088  -1.669  1.00 0.00 ? 314 ILE A HG22 2  
ATOM   3029  H  HG23 . ILE B 2 56  ? -2.933  -7.150  -0.296  1.00 0.00 ? 314 ILE A HG23 2  
ATOM   3030  H  HD11 . ILE B 2 56  ? 1.242   -6.260  -0.409  1.00 0.00 ? 314 ILE A HD11 2  
ATOM   3031  H  HD12 . ILE B 2 56  ? 1.582   -7.476  -1.644  1.00 0.00 ? 314 ILE A HD12 2  
ATOM   3032  H  HD13 . ILE B 2 56  ? 1.557   -7.938  0.046   1.00 0.00 ? 314 ILE A HD13 2  
ATOM   3033  N  N    . GLU B 2 57  ? -1.500  -8.001  -3.986  1.00 0.00 ? 315 GLU A N    2  
ATOM   3034  C  CA   . GLU B 2 57  ? -1.289  -9.183  -4.790  1.00 0.00 ? 315 GLU A CA   2  
ATOM   3035  C  C    . GLU B 2 57  ? -0.541  -8.819  -6.078  1.00 0.00 ? 315 GLU A C    2  
ATOM   3036  O  O    . GLU B 2 57  ? -0.194  -9.690  -6.875  1.00 0.00 ? 315 GLU A O    2  
ATOM   3037  C  CB   . GLU B 2 57  ? -2.622  -9.848  -5.142  1.00 0.00 ? 315 GLU A CB   2  
ATOM   3038  C  CG   . GLU B 2 57  ? -3.575  -9.982  -3.964  1.00 0.00 ? 315 GLU A CG   2  
ATOM   3039  C  CD   . GLU B 2 57  ? -4.882  -10.651 -4.345  1.00 0.00 ? 315 GLU A CD   2  
ATOM   3040  O  OE1  . GLU B 2 57  ? -5.705  -10.000 -5.023  1.00 0.00 ? 315 GLU A OE1  2  
ATOM   3041  O  OE2  . GLU B 2 57  ? -5.082  -11.824 -3.966  1.00 0.00 ? 315 GLU A OE2  2  
ATOM   3042  H  H    . GLU B 2 57  ? -2.405  -7.739  -3.739  1.00 0.00 ? 315 GLU A H    2  
ATOM   3043  H  HA   . GLU B 2 57  ? -0.698  -9.862  -4.206  1.00 0.00 ? 315 GLU A HA   2  
ATOM   3044  H  HB2  . GLU B 2 57  ? -3.109  -9.264  -5.907  1.00 0.00 ? 315 GLU A HB2  2  
ATOM   3045  H  HB3  . GLU B 2 57  ? -2.425  -10.838 -5.529  1.00 0.00 ? 315 GLU A HB3  2  
ATOM   3046  H  HG2  . GLU B 2 57  ? -3.098  -10.572 -3.195  1.00 0.00 ? 315 GLU A HG2  2  
ATOM   3047  H  HG3  . GLU B 2 57  ? -3.791  -8.998  -3.578  1.00 0.00 ? 315 GLU A HG3  2  
ATOM   3048  N  N    . CYS B 2 58  ? -0.295  -7.517  -6.264  1.00 0.00 ? 316 CYS A N    2  
ATOM   3049  C  CA   . CYS B 2 58  ? 0.376   -7.010  -7.451  1.00 0.00 ? 316 CYS A CA   2  
ATOM   3050  C  C    . CYS B 2 58  ? 1.333   -5.846  -7.169  1.00 0.00 ? 316 CYS A C    2  
ATOM   3051  O  O    . CYS B 2 58  ? 1.921   -5.309  -8.109  1.00 0.00 ? 316 CYS A O    2  
ATOM   3052  C  CB   . CYS B 2 58  ? -0.667  -6.488  -8.423  1.00 0.00 ? 316 CYS A CB   2  
ATOM   3053  S  SG   . CYS B 2 58  ? -1.955  -7.679  -8.883  1.00 0.00 ? 316 CYS A SG   2  
ATOM   3054  H  H    . CYS B 2 58  ? -0.586  -6.883  -5.592  1.00 0.00 ? 316 CYS A H    2  
ATOM   3055  H  HA   . CYS B 2 58  ? 0.914   -7.820  -7.914  1.00 0.00 ? 316 CYS A HA   2  
ATOM   3056  H  HB2  . CYS B 2 58  ? -1.160  -5.635  -7.980  1.00 0.00 ? 316 CYS A HB2  2  
ATOM   3057  H  HB3  . CYS B 2 58  ? -0.168  -6.176  -9.315  1.00 0.00 ? 316 CYS A HB3  2  
ATOM   3058  N  N    . LYS B 2 59  ? 1.498   -5.436  -5.910  1.00 0.00 ? 317 LYS A N    2  
ATOM   3059  C  CA   . LYS B 2 59  ? 2.360   -4.300  -5.622  1.00 0.00 ? 317 LYS A CA   2  
ATOM   3060  C  C    . LYS B 2 59  ? 3.767   -4.520  -6.166  1.00 0.00 ? 317 LYS A C    2  
ATOM   3061  O  O    . LYS B 2 59  ? 4.355   -3.634  -6.787  1.00 0.00 ? 317 LYS A O    2  
ATOM   3062  C  CB   . LYS B 2 59  ? 2.384   -3.978  -4.127  1.00 0.00 ? 317 LYS A CB   2  
ATOM   3063  C  CG   . LYS B 2 59  ? 3.396   -4.740  -3.361  1.00 0.00 ? 317 LYS A CG   2  
ATOM   3064  C  CD   . LYS B 2 59  ? 2.715   -5.892  -2.778  1.00 0.00 ? 317 LYS A CD   2  
ATOM   3065  C  CE   . LYS B 2 59  ? 3.384   -7.177  -3.132  1.00 0.00 ? 317 LYS A CE   2  
ATOM   3066  N  NZ   . LYS B 2 59  ? 4.866   -7.071  -3.140  1.00 0.00 ? 317 LYS A NZ   2  
ATOM   3067  H  H    . LYS B 2 59  ? 1.054   -5.903  -5.176  1.00 0.00 ? 317 LYS A H    2  
ATOM   3068  H  HA   . LYS B 2 59  ? 1.945   -3.474  -6.128  1.00 0.00 ? 317 LYS A HA   2  
ATOM   3069  H  HB2  . LYS B 2 59  ? 2.567   -2.930  -3.986  1.00 0.00 ? 317 LYS A HB2  2  
ATOM   3070  H  HB3  . LYS B 2 59  ? 1.423   -4.240  -3.692  1.00 0.00 ? 317 LYS A HB3  2  
ATOM   3071  H  HG2  . LYS B 2 59  ? 4.177   -5.073  -4.003  1.00 0.00 ? 317 LYS A HG2  2  
ATOM   3072  H  HG3  . LYS B 2 59  ? 3.776   -4.144  -2.576  1.00 0.00 ? 317 LYS A HG3  2  
ATOM   3073  H  HD2  . LYS B 2 59  ? 2.696   -5.780  -1.710  1.00 0.00 ? 317 LYS A HD2  2  
ATOM   3074  H  HD3  . LYS B 2 59  ? 1.706   -5.906  -3.162  1.00 0.00 ? 317 LYS A HD3  2  
ATOM   3075  H  HE2  . LYS B 2 59  ? 3.083   -7.899  -2.406  1.00 0.00 ? 317 LYS A HE2  2  
ATOM   3076  H  HE3  . LYS B 2 59  ? 3.036   -7.473  -4.100  1.00 0.00 ? 317 LYS A HE3  2  
ATOM   3077  H  HZ1  . LYS B 2 59  ? 5.198   -6.639  -2.254  1.00 0.00 ? 317 LYS A HZ1  2  
ATOM   3078  H  HZ2  . LYS B 2 59  ? 5.179   -6.482  -3.938  1.00 0.00 ? 317 LYS A HZ2  2  
ATOM   3079  H  HZ3  . LYS B 2 59  ? 5.291   -8.015  -3.233  1.00 0.00 ? 317 LYS A HZ3  2  
ATOM   3080  N  N    . SER B 2 60  ? 4.265   -5.721  -5.947  1.00 0.00 ? 318 SER A N    2  
ATOM   3081  C  CA   . SER B 2 60  ? 5.607   -6.124  -6.381  1.00 0.00 ? 318 SER A CA   2  
ATOM   3082  C  C    . SER B 2 60  ? 6.665   -5.095  -6.004  1.00 0.00 ? 318 SER A C    2  
ATOM   3083  O  O    . SER B 2 60  ? 6.364   -4.027  -5.470  1.00 0.00 ? 318 SER A O    2  
ATOM   3084  C  CB   . SER B 2 60  ? 5.659   -6.363  -7.886  1.00 0.00 ? 318 SER A CB   2  
ATOM   3085  O  OG   . SER B 2 60  ? 4.420   -6.060  -8.504  1.00 0.00 ? 318 SER A OG   2  
ATOM   3086  H  H    . SER B 2 60  ? 3.703   -6.359  -5.473  1.00 0.00 ? 318 SER A H    2  
ATOM   3087  H  HA   . SER B 2 60  ? 5.847   -7.047  -5.887  1.00 0.00 ? 318 SER A HA   2  
ATOM   3088  H  HB2  . SER B 2 60  ? 6.422   -5.735  -8.305  1.00 0.00 ? 318 SER A HB2  2  
ATOM   3089  H  HB3  . SER B 2 60  ? 5.907   -7.396  -8.077  1.00 0.00 ? 318 SER A HB3  2  
ATOM   3090  H  HG   . SER B 2 60  ? 3.932   -6.873  -8.658  1.00 0.00 ? 318 SER A HG   2  
ATOM   3091  N  N    . CYS B 2 61  ? 7.917   -5.439  -6.270  1.00 0.00 ? 319 CYS A N    2  
ATOM   3092  C  CA   . CYS B 2 61  ? 9.027   -4.550  -5.988  1.00 0.00 ? 319 CYS A CA   2  
ATOM   3093  C  C    . CYS B 2 61  ? 9.225   -3.543  -7.113  1.00 0.00 ? 319 CYS A C    2  
ATOM   3094  O  O    . CYS B 2 61  ? 9.832   -3.863  -8.122  1.00 0.00 ? 319 CYS A O    2  
ATOM   3095  C  CB   . CYS B 2 61  ? 10.310  -5.350  -5.827  1.00 0.00 ? 319 CYS A CB   2  
ATOM   3096  S  SG   . CYS B 2 61  ? 11.725  -4.398  -5.165  1.00 0.00 ? 319 CYS A SG   2  
ATOM   3097  H  H    . CYS B 2 61  ? 8.103   -6.326  -6.644  1.00 0.00 ? 319 CYS A H    2  
ATOM   3098  H  HA   . CYS B 2 61  ? 8.822   -4.035  -5.067  1.00 0.00 ? 319 CYS A HA   2  
ATOM   3099  H  HB2  . CYS B 2 61  ? 10.125  -6.183  -5.171  1.00 0.00 ? 319 CYS A HB2  2  
ATOM   3100  H  HB3  . CYS B 2 61  ? 10.598  -5.731  -6.788  1.00 0.00 ? 319 CYS A HB3  2  
ATOM   3101  N  N    . ILE B 2 62  ? 8.713   -2.330  -6.952  1.00 0.00 ? 320 ILE A N    2  
ATOM   3102  C  CA   . ILE B 2 62  ? 8.909   -1.297  -7.970  1.00 0.00 ? 320 ILE A CA   2  
ATOM   3103  C  C    . ILE B 2 62  ? 10.356  -1.365  -8.442  1.00 0.00 ? 320 ILE A C    2  
ATOM   3104  O  O    . ILE B 2 62  ? 10.683  -1.044  -9.584  1.00 0.00 ? 320 ILE A O    2  
ATOM   3105  C  CB   . ILE B 2 62  ? 8.606   0.112   -7.406  1.00 0.00 ? 320 ILE A CB   2  
ATOM   3106  C  CG1  . ILE B 2 62  ? 9.679   1.126   -7.829  1.00 0.00 ? 320 ILE A CG1  2  
ATOM   3107  C  CG2  . ILE B 2 62  ? 8.502   0.036   -5.907  1.00 0.00 ? 320 ILE A CG2  2  
ATOM   3108  C  CD1  . ILE B 2 62  ? 9.579   2.456   -7.134  1.00 0.00 ? 320 ILE A CD1  2  
ATOM   3109  H  H    . ILE B 2 62  ? 8.204   -2.124  -6.142  1.00 0.00 ? 320 ILE A H    2  
ATOM   3110  H  HA   . ILE B 2 62  ? 8.247   -1.499  -8.800  1.00 0.00 ? 320 ILE A HA   2  
ATOM   3111  H  HB   . ILE B 2 62  ? 7.652   0.435   -7.778  1.00 0.00 ? 320 ILE A HB   2  
ATOM   3112  H  HG12 . ILE B 2 62  ? 10.647  0.723   -7.611  1.00 0.00 ? 320 ILE A HG12 2  
ATOM   3113  H  HG13 . ILE B 2 62  ? 9.596   1.305   -8.883  1.00 0.00 ? 320 ILE A HG13 2  
ATOM   3114  H  HG21 . ILE B 2 62  ? 9.460   -0.258  -5.499  1.00 0.00 ? 320 ILE A HG21 2  
ATOM   3115  H  HG22 . ILE B 2 62  ? 7.752   -0.692  -5.632  1.00 0.00 ? 320 ILE A HG22 2  
ATOM   3116  H  HG23 . ILE B 2 62  ? 8.224   1.002   -5.516  1.00 0.00 ? 320 ILE A HG23 2  
ATOM   3117  H  HD11 . ILE B 2 62  ? 8.774   2.412   -6.427  1.00 0.00 ? 320 ILE A HD11 2  
ATOM   3118  H  HD12 . ILE B 2 62  ? 9.384   3.230   -7.860  1.00 0.00 ? 320 ILE A HD12 2  
ATOM   3119  H  HD13 . ILE B 2 62  ? 10.504  2.666   -6.618  1.00 0.00 ? 320 ILE A HD13 2  
ATOM   3120  N  N    . LEU B 2 63  ? 11.210  -1.798  -7.517  1.00 0.00 ? 321 LEU A N    2  
ATOM   3121  C  CA   . LEU B 2 63  ? 12.627  -1.959  -7.769  1.00 0.00 ? 321 LEU A CA   2  
ATOM   3122  C  C    . LEU B 2 63  ? 12.865  -3.192  -8.649  1.00 0.00 ? 321 LEU A C    2  
ATOM   3123  O  O    . LEU B 2 63  ? 13.462  -3.091  -9.720  1.00 0.00 ? 321 LEU A O    2  
ATOM   3124  C  CB   . LEU B 2 63  ? 13.356  -2.058  -6.421  1.00 0.00 ? 321 LEU A CB   2  
ATOM   3125  C  CG   . LEU B 2 63  ? 12.926  -1.024  -5.353  1.00 0.00 ? 321 LEU A CG   2  
ATOM   3126  C  CD1  . LEU B 2 63  ? 14.066  -0.690  -4.422  1.00 0.00 ? 321 LEU A CD1  2  
ATOM   3127  C  CD2  . LEU B 2 63  ? 12.395  0.259   -5.949  1.00 0.00 ? 321 LEU A CD2  2  
ATOM   3128  H  H    . LEU B 2 63  ? 10.867  -2.008  -6.619  1.00 0.00 ? 321 LEU A H    2  
ATOM   3129  H  HA   . LEU B 2 63  ? 12.974  -1.084  -8.293  1.00 0.00 ? 321 LEU A HA   2  
ATOM   3130  H  HB2  . LEU B 2 63  ? 13.175  -3.038  -6.014  1.00 0.00 ? 321 LEU A HB2  2  
ATOM   3131  H  HB3  . LEU B 2 63  ? 14.406  -1.960  -6.589  1.00 0.00 ? 321 LEU A HB3  2  
ATOM   3132  H  HG   . LEU B 2 63  ? 12.126  -1.453  -4.757  1.00 0.00 ? 321 LEU A HG   2  
ATOM   3133  H  HD11 . LEU B 2 63  ? 13.893  -1.155  -3.459  1.00 0.00 ? 321 LEU A HD11 2  
ATOM   3134  H  HD12 . LEU B 2 63  ? 14.128  0.381   -4.298  1.00 0.00 ? 321 LEU A HD12 2  
ATOM   3135  H  HD13 . LEU B 2 63  ? 14.991  -1.058  -4.839  1.00 0.00 ? 321 LEU A HD13 2  
ATOM   3136  H  HD21 . LEU B 2 63  ? 11.446  0.465   -5.489  1.00 0.00 ? 321 LEU A HD21 2  
ATOM   3137  H  HD22 . LEU B 2 63  ? 12.271  0.158   -7.014  1.00 0.00 ? 321 LEU A HD22 2  
ATOM   3138  H  HD23 . LEU B 2 63  ? 13.078  1.067   -5.738  1.00 0.00 ? 321 LEU A HD23 2  
ATOM   3139  N  N    . CYS B 2 64  ? 12.394  -4.351  -8.190  1.00 0.00 ? 322 CYS A N    2  
ATOM   3140  C  CA   . CYS B 2 64  ? 12.507  -5.591  -8.962  1.00 0.00 ? 322 CYS A CA   2  
ATOM   3141  C  C    . CYS B 2 64  ? 11.286  -5.763  -9.851  1.00 0.00 ? 322 CYS A C    2  
ATOM   3142  O  O    . CYS B 2 64  ? 11.384  -5.817  -11.077 1.00 0.00 ? 322 CYS A O    2  
ATOM   3143  C  CB   . CYS B 2 64  ? 12.586  -6.824  -8.060  1.00 0.00 ? 322 CYS A CB   2  
ATOM   3144  S  SG   . CYS B 2 64  ? 14.017  -6.895  -6.951  1.00 0.00 ? 322 CYS A SG   2  
ATOM   3145  H  H    . CYS B 2 64  ? 11.974  -4.376  -7.308  1.00 0.00 ? 322 CYS A H    2  
ATOM   3146  H  HA   . CYS B 2 64  ? 13.392  -5.537  -9.575  1.00 0.00 ? 322 CYS A HA   2  
ATOM   3147  H  HB2  . CYS B 2 64  ? 11.702  -6.866  -7.446  1.00 0.00 ? 322 CYS A HB2  2  
ATOM   3148  H  HB3  . CYS B 2 64  ? 12.617  -7.703  -8.687  1.00 0.00 ? 322 CYS A HB3  2  
ATOM   3149  N  N    . GLY B 2 65  ? 10.133  -5.846  -9.198  1.00 0.00 ? 323 GLY A N    2  
ATOM   3150  C  CA   . GLY B 2 65  ? 8.882   -6.047  -9.887  1.00 0.00 ? 323 GLY A CA   2  
ATOM   3151  C  C    . GLY B 2 65  ? 8.604   -7.517  -10.014 1.00 0.00 ? 323 GLY A C    2  
ATOM   3152  O  O    . GLY B 2 65  ? 8.034   -7.973  -11.006 1.00 0.00 ? 323 GLY A O    2  
ATOM   3153  H  H    . GLY B 2 65  ? 10.134  -5.762  -8.221  1.00 0.00 ? 323 GLY A H    2  
ATOM   3154  H  HA2  . GLY B 2 65  ? 8.088   -5.576  -9.324  1.00 0.00 ? 323 GLY A HA2  2  
ATOM   3155  H  HA3  . GLY B 2 65  ? 8.936   -5.608  -10.870 1.00 0.00 ? 323 GLY A HA3  2  
ATOM   3156  N  N    . THR B 2 66  ? 9.014   -8.266  -8.993  1.00 0.00 ? 324 THR A N    2  
ATOM   3157  C  CA   . THR B 2 66  ? 8.853   -9.704  -9.003  1.00 0.00 ? 324 THR A CA   2  
ATOM   3158  C  C    . THR B 2 66  ? 8.199   -10.216 -7.731  1.00 0.00 ? 324 THR A C    2  
ATOM   3159  O  O    . THR B 2 66  ? 7.754   -11.362 -7.666  1.00 0.00 ? 324 THR A O    2  
ATOM   3160  C  CB   . THR B 2 66  ? 10.220  -10.358 -9.155  1.00 0.00 ? 324 THR A CB   2  
ATOM   3161  O  OG1  . THR B 2 66  ? 10.090  -11.774 -9.291  1.00 0.00 ? 324 THR A OG1  2  
ATOM   3162  C  CG2  . THR B 2 66  ? 11.111  -10.000 -7.982  1.00 0.00 ? 324 THR A CG2  2  
ATOM   3163  H  H    . THR B 2 66  ? 9.444   -7.834  -8.210  1.00 0.00 ? 324 THR A H    2  
ATOM   3164  H  HA   . THR B 2 66  ? 8.256   -9.976  -9.854  1.00 0.00 ? 324 THR A HA   2  
ATOM   3165  H  HB   . THR B 2 66  ? 10.667  -9.963  -10.033 1.00 0.00 ? 324 THR A HB   2  
ATOM   3166  H  HG1  . THR B 2 66  ? 10.887  -12.132 -9.688  1.00 0.00 ? 324 THR A HG1  2  
ATOM   3167  H  HG21 . THR B 2 66  ? 11.209  -8.924  -7.935  1.00 0.00 ? 324 THR A HG21 2  
ATOM   3168  H  HG22 . THR B 2 66  ? 12.085  -10.448 -8.118  1.00 0.00 ? 324 THR A HG22 2  
ATOM   3169  H  HG23 . THR B 2 66  ? 10.673  -10.363 -7.068  1.00 0.00 ? 324 THR A HG23 2  
ATOM   3170  N  N    . SER B 2 67  ? 8.156   -9.353  -6.724  1.00 0.00 ? 325 SER A N    2  
ATOM   3171  C  CA   . SER B 2 67  ? 7.578   -9.692  -5.430  1.00 0.00 ? 325 SER A CA   2  
ATOM   3172  C  C    . SER B 2 67  ? 8.164   -10.993 -4.885  1.00 0.00 ? 325 SER A C    2  
ATOM   3173  O  O    . SER B 2 67  ? 7.596   -11.604 -3.982  1.00 0.00 ? 325 SER A O    2  
ATOM   3174  C  CB   . SER B 2 67  ? 6.049   -9.788  -5.512  1.00 0.00 ? 325 SER A CB   2  
ATOM   3175  O  OG   . SER B 2 67  ? 5.636   -10.636 -6.569  1.00 0.00 ? 325 SER A OG   2  
ATOM   3176  H  H    . SER B 2 67  ? 8.528   -8.456  -6.855  1.00 0.00 ? 325 SER A H    2  
ATOM   3177  H  HA   . SER B 2 67  ? 7.835   -8.896  -4.754  1.00 0.00 ? 325 SER A HA   2  
ATOM   3178  H  HB2  . SER B 2 67  ? 5.670   -10.187 -4.585  1.00 0.00 ? 325 SER A HB2  2  
ATOM   3179  H  HB3  . SER B 2 67  ? 5.634   -8.803  -5.671  1.00 0.00 ? 325 SER A HB3  2  
ATOM   3180  H  HG   . SER B 2 67  ? 5.674   -11.551 -6.280  1.00 0.00 ? 325 SER A HG   2  
ATOM   3181  N  N    . GLU B 2 68  ? 9.303   -11.408 -5.440  1.00 0.00 ? 326 GLU A N    2  
ATOM   3182  C  CA   . GLU B 2 68  ? 9.970   -12.637 -5.006  1.00 0.00 ? 326 GLU A CA   2  
ATOM   3183  C  C    . GLU B 2 68  ? 10.170  -12.687 -3.495  1.00 0.00 ? 326 GLU A C    2  
ATOM   3184  O  O    . GLU B 2 68  ? 9.410   -13.339 -2.778  1.00 0.00 ? 326 GLU A O    2  
ATOM   3185  C  CB   . GLU B 2 68  ? 11.325  -12.774 -5.690  1.00 0.00 ? 326 GLU A CB   2  
ATOM   3186  C  CG   . GLU B 2 68  ? 11.232  -13.182 -7.135  1.00 0.00 ? 326 GLU A CG   2  
ATOM   3187  C  CD   . GLU B 2 68  ? 11.023  -14.673 -7.317  1.00 0.00 ? 326 GLU A CD   2  
ATOM   3188  O  OE1  . GLU B 2 68  ? 12.027  -15.415 -7.338  1.00 0.00 ? 326 GLU A OE1  2  
ATOM   3189  O  OE2  . GLU B 2 68  ? 9.854   -15.097 -7.436  1.00 0.00 ? 326 GLU A OE2  2  
ATOM   3190  H  H    . GLU B 2 68  ? 9.695   -10.885 -6.179  1.00 0.00 ? 326 GLU A H    2  
ATOM   3191  H  HA   . GLU B 2 68  ? 9.353   -13.468 -5.301  1.00 0.00 ? 326 GLU A HA   2  
ATOM   3192  H  HB2  . GLU B 2 68  ? 11.830  -11.830 -5.641  1.00 0.00 ? 326 GLU A HB2  2  
ATOM   3193  H  HB3  . GLU B 2 68  ? 11.907  -13.513 -5.175  1.00 0.00 ? 326 GLU A HB3  2  
ATOM   3194  H  HG2  . GLU B 2 68  ? 10.402  -12.663 -7.568  1.00 0.00 ? 326 GLU A HG2  2  
ATOM   3195  H  HG3  . GLU B 2 68  ? 12.141  -12.890 -7.638  1.00 0.00 ? 326 GLU A HG3  2  
ATOM   3196  N  N    . ASN B 2 69  ? 11.201  -11.994 -3.020  1.00 0.00 ? 327 ASN A N    2  
ATOM   3197  C  CA   . ASN B 2 69  ? 11.531  -11.980 -1.600  1.00 0.00 ? 327 ASN A CA   2  
ATOM   3198  C  C    . ASN B 2 69  ? 10.644  -11.034 -0.803  1.00 0.00 ? 327 ASN A C    2  
ATOM   3199  O  O    . ASN B 2 69  ? 11.131  -10.357 0.085   1.00 0.00 ? 327 ASN A O    2  
ATOM   3200  C  CB   . ASN B 2 69  ? 12.995  -11.602 -1.402  1.00 0.00 ? 327 ASN A CB   2  
ATOM   3201  C  CG   . ASN B 2 69  ? 13.924  -12.355 -2.322  1.00 0.00 ? 327 ASN A CG   2  
ATOM   3202  O  OD1  . ASN B 2 69  ? 14.354  -13.470 -2.023  1.00 0.00 ? 327 ASN A OD1  2  
ATOM   3203  N  ND2  . ASN B 2 69  ? 14.247  -11.737 -3.448  1.00 0.00 ? 327 ASN A ND2  2  
ATOM   3204  H  H    . ASN B 2 69  ? 11.753  -11.475 -3.642  1.00 0.00 ? 327 ASN A H    2  
ATOM   3205  H  HA   . ASN B 2 69  ? 11.391  -12.965 -1.222  1.00 0.00 ? 327 ASN A HA   2  
ATOM   3206  H  HB2  . ASN B 2 69  ? 13.109  -10.560 -1.601  1.00 0.00 ? 327 ASN A HB2  2  
ATOM   3207  H  HB3  . ASN B 2 69  ? 13.282  -11.805 -0.381  1.00 0.00 ? 327 ASN A HB3  2  
ATOM   3208  H  HD21 . ASN B 2 69  ? 13.868  -10.849 -3.614  1.00 0.00 ? 327 ASN A HD21 2  
ATOM   3209  H  HD22 . ASN B 2 69  ? 14.855  -12.187 -4.061  1.00 0.00 ? 327 ASN A HD22 2  
ATOM   3210  N  N    . ASP B 2 70  ? 9.351   -10.978 -1.131  1.00 0.00 ? 328 ASP A N    2  
ATOM   3211  C  CA   . ASP B 2 70  ? 8.399   -10.129 -0.424  1.00 0.00 ? 328 ASP A CA   2  
ATOM   3212  C  C    . ASP B 2 70  ? 8.603   -10.122 1.082   1.00 0.00 ? 328 ASP A C    2  
ATOM   3213  O  O    . ASP B 2 70  ? 8.129   -9.220  1.774   1.00 0.00 ? 328 ASP A O    2  
ATOM   3214  C  CB   . ASP B 2 70  ? 6.977   -10.526 -0.761  1.00 0.00 ? 328 ASP A CB   2  
ATOM   3215  C  CG   . ASP B 2 70  ? 6.768   -12.029 -0.731  1.00 0.00 ? 328 ASP A CG   2  
ATOM   3216  O  OD1  . ASP B 2 70  ? 6.525   -12.571 0.367   1.00 0.00 ? 328 ASP A OD1  2  
ATOM   3217  O  OD2  . ASP B 2 70  ? 6.851   -12.663 -1.803  1.00 0.00 ? 328 ASP A OD2  2  
ATOM   3218  H  H    . ASP B 2 70  ? 9.038   -11.474 -1.901  1.00 0.00 ? 328 ASP A H    2  
ATOM   3219  H  HA   . ASP B 2 70  ? 8.552   -9.142  -0.780  1.00 0.00 ? 328 ASP A HA   2  
ATOM   3220  H  HB2  . ASP B 2 70  ? 6.304   -10.073 -0.046  1.00 0.00 ? 328 ASP A HB2  2  
ATOM   3221  H  HB3  . ASP B 2 70  ? 6.750   -10.155 -1.750  1.00 0.00 ? 328 ASP A HB3  2  
ATOM   3222  N  N    . ASP B 2 71  ? 9.304   -11.120 1.591   1.00 0.00 ? 329 ASP A N    2  
ATOM   3223  C  CA   . ASP B 2 71  ? 9.586   -11.186 3.017   1.00 0.00 ? 329 ASP A CA   2  
ATOM   3224  C  C    . ASP B 2 71  ? 10.449  -9.991  3.400   1.00 0.00 ? 329 ASP A C    2  
ATOM   3225  O  O    . ASP B 2 71  ? 10.662  -9.703  4.578   1.00 0.00 ? 329 ASP A O    2  
ATOM   3226  C  CB   . ASP B 2 71  ? 10.296  -12.493 3.374   1.00 0.00 ? 329 ASP A CB   2  
ATOM   3227  C  CG   . ASP B 2 71  ? 10.550  -12.620 4.864   1.00 0.00 ? 329 ASP A CG   2  
ATOM   3228  O  OD1  . ASP B 2 71  ? 9.566   -12.715 5.629   1.00 0.00 ? 329 ASP A OD1  2  
ATOM   3229  O  OD2  . ASP B 2 71  ? 11.733  -12.620 5.267   1.00 0.00 ? 329 ASP A OD2  2  
ATOM   3230  H  H    . ASP B 2 71  ? 9.650   -11.812 0.994   1.00 0.00 ? 329 ASP A H    2  
ATOM   3231  H  HA   . ASP B 2 71  ? 8.647   -11.129 3.548   1.00 0.00 ? 329 ASP A HA   2  
ATOM   3232  H  HB2  . ASP B 2 71  ? 9.685   -13.326 3.060   1.00 0.00 ? 329 ASP A HB2  2  
ATOM   3233  H  HB3  . ASP B 2 71  ? 11.245  -12.532 2.860   1.00 0.00 ? 329 ASP A HB3  2  
ATOM   3234  N  N    . GLN B 2 72  ? 10.938  -9.301  2.371   1.00 0.00 ? 330 GLN A N    2  
ATOM   3235  C  CA   . GLN B 2 72  ? 11.764  -8.130  2.534   1.00 0.00 ? 330 GLN A CA   2  
ATOM   3236  C  C    . GLN B 2 72  ? 11.087  -6.938  1.884   1.00 0.00 ? 330 GLN A C    2  
ATOM   3237  O  O    . GLN B 2 72  ? 11.381  -5.791  2.196   1.00 0.00 ? 330 GLN A O    2  
ATOM   3238  C  CB   . GLN B 2 72  ? 13.127  -8.356  1.898   1.00 0.00 ? 330 GLN A CB   2  
ATOM   3239  C  CG   . GLN B 2 72  ? 13.499  -9.820  1.814   1.00 0.00 ? 330 GLN A CG   2  
ATOM   3240  C  CD   . GLN B 2 72  ? 14.977  -10.044 1.639   1.00 0.00 ? 330 GLN A CD   2  
ATOM   3241  O  OE1  . GLN B 2 72  ? 15.404  -10.988 0.976   1.00 0.00 ? 330 GLN A OE1  2  
ATOM   3242  N  NE2  . GLN B 2 72  ? 15.768  -9.180  2.251   1.00 0.00 ? 330 GLN A NE2  2  
ATOM   3243  H  H    . GLN B 2 72  ? 10.736  -9.595  1.463   1.00 0.00 ? 330 GLN A H    2  
ATOM   3244  H  HA   . GLN B 2 72  ? 11.889  -7.945  3.583   1.00 0.00 ? 330 GLN A HA   2  
ATOM   3245  H  HB2  . GLN B 2 72  ? 13.115  -7.946  0.906   1.00 0.00 ? 330 GLN A HB2  2  
ATOM   3246  H  HB3  . GLN B 2 72  ? 13.876  -7.847  2.485   1.00 0.00 ? 330 GLN A HB3  2  
ATOM   3247  H  HG2  . GLN B 2 72  ? 13.197  -10.290 2.724   1.00 0.00 ? 330 GLN A HG2  2  
ATOM   3248  H  HG3  . GLN B 2 72  ? 12.975  -10.271 0.979   1.00 0.00 ? 330 GLN A HG3  2  
ATOM   3249  H  HE21 . GLN B 2 72  ? 15.355  -8.461  2.772   1.00 0.00 ? 330 GLN A HE21 2  
ATOM   3250  H  HE22 . GLN B 2 72  ? 16.725  -9.294  2.153   1.00 0.00 ? 330 GLN A HE22 2  
ATOM   3251  N  N    . LEU B 2 73  ? 10.171  -7.214  0.971   1.00 0.00 ? 331 LEU A N    2  
ATOM   3252  C  CA   . LEU B 2 73  ? 9.466   -6.163  0.290   1.00 0.00 ? 331 LEU A CA   2  
ATOM   3253  C  C    . LEU B 2 73  ? 8.895   -5.183  1.274   1.00 0.00 ? 331 LEU A C    2  
ATOM   3254  O  O    . LEU B 2 73  ? 8.419   -5.548  2.349   1.00 0.00 ? 331 LEU A O    2  
ATOM   3255  C  CB   . LEU B 2 73  ? 8.380   -6.733  -0.591  1.00 0.00 ? 331 LEU A CB   2  
ATOM   3256  C  CG   . LEU B 2 73  ? 8.888   -7.284  -1.914  1.00 0.00 ? 331 LEU A CG   2  
ATOM   3257  C  CD1  . LEU B 2 73  ? 7.743   -7.778  -2.737  1.00 0.00 ? 331 LEU A CD1  2  
ATOM   3258  C  CD2  . LEU B 2 73  ? 9.662   -6.238  -2.671  1.00 0.00 ? 331 LEU A CD2  2  
ATOM   3259  H  H    . LEU B 2 73  ? 9.960   -8.139  0.756   1.00 0.00 ? 331 LEU A H    2  
ATOM   3260  H  HA   . LEU B 2 73  ? 10.177  -5.643  -0.334  1.00 0.00 ? 331 LEU A HA   2  
ATOM   3261  H  HB2  . LEU B 2 73  ? 7.895   -7.535  -0.050  1.00 0.00 ? 331 LEU A HB2  2  
ATOM   3262  H  HB3  . LEU B 2 73  ? 7.656   -5.959  -0.797  1.00 0.00 ? 331 LEU A HB3  2  
ATOM   3263  H  HG   . LEU B 2 73  ? 9.536   -8.116  -1.715  1.00 0.00 ? 331 LEU A HG   2  
ATOM   3264  H  HD11 . LEU B 2 73  ? 6.846   -7.482  -2.259  1.00 0.00 ? 331 LEU A HD11 2  
ATOM   3265  H  HD12 . LEU B 2 73  ? 7.783   -8.855  -2.808  1.00 0.00 ? 331 LEU A HD12 2  
ATOM   3266  H  HD13 . LEU B 2 73  ? 7.790   -7.345  -3.725  1.00 0.00 ? 331 LEU A HD13 2  
ATOM   3267  H  HD21 . LEU B 2 73  ? 9.013   -5.427  -2.888  1.00 0.00 ? 331 LEU A HD21 2  
ATOM   3268  H  HD22 . LEU B 2 73  ? 10.033  -6.660  -3.590  1.00 0.00 ? 331 LEU A HD22 2  
ATOM   3269  H  HD23 . LEU B 2 73  ? 10.489  -5.893  -2.073  1.00 0.00 ? 331 LEU A HD23 2  
ATOM   3270  N  N    . LEU B 2 74  ? 8.954   -3.940  0.887   1.00 0.00 ? 332 LEU A N    2  
ATOM   3271  C  CA   . LEU B 2 74  ? 8.478   -2.864  1.707   1.00 0.00 ? 332 LEU A CA   2  
ATOM   3272  C  C    . LEU B 2 74  ? 7.345   -2.167  1.025   1.00 0.00 ? 332 LEU A C    2  
ATOM   3273  O  O    . LEU B 2 74  ? 7.517   -1.512  0.007   1.00 0.00 ? 332 LEU A O    2  
ATOM   3274  C  CB   . LEU B 2 74  ? 9.592   -1.870  1.990   1.00 0.00 ? 332 LEU A CB   2  
ATOM   3275  C  CG   . LEU B 2 74  ? 10.722  -2.341  2.869   1.00 0.00 ? 332 LEU A CG   2  
ATOM   3276  C  CD1  . LEU B 2 74  ? 11.767  -1.275  2.983   1.00 0.00 ? 332 LEU A CD1  2  
ATOM   3277  C  CD2  . LEU B 2 74  ? 10.243  -2.651  4.243   1.00 0.00 ? 332 LEU A CD2  2  
ATOM   3278  H  H    . LEU B 2 74  ? 9.323   -3.739  -0.001  1.00 0.00 ? 332 LEU A H    2  
ATOM   3279  H  HA   . LEU B 2 74  ? 8.112   -3.285  2.629   1.00 0.00 ? 332 LEU A HA   2  
ATOM   3280  H  HB2  . LEU B 2 74  ? 10.012  -1.561  1.048   1.00 0.00 ? 332 LEU A HB2  2  
ATOM   3281  H  HB3  . LEU B 2 74  ? 9.158   -1.016  2.462   1.00 0.00 ? 332 LEU A HB3  2  
ATOM   3282  H  HG   . LEU B 2 74  ? 11.185  -3.213  2.464   1.00 0.00 ? 332 LEU A HG   2  
ATOM   3283  H  HD11 . LEU B 2 74  ? 11.675  -0.788  3.950   1.00 0.00 ? 332 LEU A HD11 2  
ATOM   3284  H  HD12 . LEU B 2 74  ? 11.633  -0.558  2.197   1.00 0.00 ? 332 LEU A HD12 2  
ATOM   3285  H  HD13 . LEU B 2 74  ? 12.742  -1.718  2.902   1.00 0.00 ? 332 LEU A HD13 2  
ATOM   3286  H  HD21 . LEU B 2 74  ? 10.937  -2.179  4.912   1.00 0.00 ? 332 LEU A HD21 2  
ATOM   3287  H  HD22 . LEU B 2 74  ? 10.239  -3.721  4.403   1.00 0.00 ? 332 LEU A HD22 2  
ATOM   3288  H  HD23 . LEU B 2 74  ? 9.254   -2.247  4.392   1.00 0.00 ? 332 LEU A HD23 2  
ATOM   3289  N  N    . PHE B 2 75  ? 6.203   -2.285  1.627   1.00 0.00 ? 333 PHE A N    2  
ATOM   3290  C  CA   . PHE B 2 75  ? 5.001   -1.722  1.092   1.00 0.00 ? 333 PHE A CA   2  
ATOM   3291  C  C    . PHE B 2 75  ? 4.834   -0.313  1.580   1.00 0.00 ? 333 PHE A C    2  
ATOM   3292  O  O    . PHE B 2 75  ? 4.294   -0.076  2.662   1.00 0.00 ? 333 PHE A O    2  
ATOM   3293  C  CB   . PHE B 2 75  ? 3.846   -2.616  1.521   1.00 0.00 ? 333 PHE A CB   2  
ATOM   3294  C  CG   . PHE B 2 75  ? 4.250   -4.066  1.411   1.00 0.00 ? 333 PHE A CG   2  
ATOM   3295  C  CD1  . PHE B 2 75  ? 4.962   -4.683  2.432   1.00 0.00 ? 333 PHE A CD1  2  
ATOM   3296  C  CD2  . PHE B 2 75  ? 3.984   -4.787  0.267   1.00 0.00 ? 333 PHE A CD2  2  
ATOM   3297  C  CE1  . PHE B 2 75  ? 5.395   -5.989  2.307   1.00 0.00 ? 333 PHE A CE1  2  
ATOM   3298  C  CE2  . PHE B 2 75  ? 4.419   -6.092  0.124   1.00 0.00 ? 333 PHE A CE2  2  
ATOM   3299  C  CZ   . PHE B 2 75  ? 5.130   -6.694  1.149   1.00 0.00 ? 333 PHE A CZ   2  
ATOM   3300  H  H    . PHE B 2 75  ? 6.169   -2.750  2.481   1.00 0.00 ? 333 PHE A H    2  
ATOM   3301  H  HA   . PHE B 2 75  ? 5.073   -1.723  0.015   1.00 0.00 ? 333 PHE A HA   2  
ATOM   3302  H  HB2  . PHE B 2 75  ? 3.588   -2.400  2.551   1.00 0.00 ? 333 PHE A HB2  2  
ATOM   3303  H  HB3  . PHE B 2 75  ? 2.989   -2.436  0.887   1.00 0.00 ? 333 PHE A HB3  2  
ATOM   3304  H  HD1  . PHE B 2 75  ? 5.170   -4.133  3.339   1.00 0.00 ? 333 PHE A HD1  2  
ATOM   3305  H  HD2  . PHE B 2 75  ? 3.445   -4.317  -0.526  1.00 0.00 ? 333 PHE A HD2  2  
ATOM   3306  H  HE1  . PHE B 2 75  ? 5.948   -6.454  3.109   1.00 0.00 ? 333 PHE A HE1  2  
ATOM   3307  H  HE2  . PHE B 2 75  ? 4.180   -6.646  -0.783  1.00 0.00 ? 333 PHE A HE2  2  
ATOM   3308  H  HZ   . PHE B 2 75  ? 5.494   -7.709  1.044   1.00 0.00 ? 333 PHE A HZ   2  
ATOM   3309  N  N    . CYS B 2 76  ? 5.311   0.629   0.779   1.00 0.00 ? 334 CYS A N    2  
ATOM   3310  C  CA   . CYS B 2 76  ? 5.182   2.014   1.137   1.00 0.00 ? 334 CYS A CA   2  
ATOM   3311  C  C    . CYS B 2 76  ? 3.724   2.295   1.334   1.00 0.00 ? 334 CYS A C    2  
ATOM   3312  O  O    . CYS B 2 76  ? 2.967   2.357   0.373   1.00 0.00 ? 334 CYS A O    2  
ATOM   3313  C  CB   . CYS B 2 76  ? 5.735   2.943   0.063   1.00 0.00 ? 334 CYS A CB   2  
ATOM   3314  S  SG   . CYS B 2 76  ? 5.241   4.677   0.316   1.00 0.00 ? 334 CYS A SG   2  
ATOM   3315  H  H    . CYS B 2 76  ? 5.754   0.380   -0.059  1.00 0.00 ? 334 CYS A H    2  
ATOM   3316  H  HA   . CYS B 2 76  ? 5.708   2.178   2.066   1.00 0.00 ? 334 CYS A HA   2  
ATOM   3317  H  HB2  . CYS B 2 76  ? 6.815   2.897   0.071   1.00 0.00 ? 334 CYS A HB2  2  
ATOM   3318  H  HB3  . CYS B 2 76  ? 5.369   2.630   -0.905  1.00 0.00 ? 334 CYS A HB3  2  
ATOM   3319  N  N    . ASP B 2 77  ? 3.311   2.436   2.571   1.00 0.00 ? 335 ASP A N    2  
ATOM   3320  C  CA   . ASP B 2 77  ? 1.916   2.696   2.828   1.00 0.00 ? 335 ASP A CA   2  
ATOM   3321  C  C    . ASP B 2 77  ? 1.618   4.170   2.532   1.00 0.00 ? 335 ASP A C    2  
ATOM   3322  O  O    . ASP B 2 77  ? 0.805   4.802   3.206   1.00 0.00 ? 335 ASP A O    2  
ATOM   3323  C  CB   . ASP B 2 77  ? 1.554   2.358   4.271   1.00 0.00 ? 335 ASP A CB   2  
ATOM   3324  C  CG   . ASP B 2 77  ? 2.019   0.971   4.670   1.00 0.00 ? 335 ASP A CG   2  
ATOM   3325  O  OD1  . ASP B 2 77  ? 1.703   0.007   3.941   1.00 0.00 ? 335 ASP A OD1  2  
ATOM   3326  O  OD2  . ASP B 2 77  ? 2.703   0.850   5.706   1.00 0.00 ? 335 ASP A OD2  2  
ATOM   3327  H  H    . ASP B 2 77  ? 3.955   2.381   3.314   1.00 0.00 ? 335 ASP A H    2  
ATOM   3328  H  HA   . ASP B 2 77  ? 1.347   2.054   2.156   1.00 0.00 ? 335 ASP A HA   2  
ATOM   3329  H  HB2  . ASP B 2 77  ? 2.014   3.077   4.928   1.00 0.00 ? 335 ASP A HB2  2  
ATOM   3330  H  HB3  . ASP B 2 77  ? 0.480   2.405   4.382   1.00 0.00 ? 335 ASP A HB3  2  
ATOM   3331  N  N    . ASP B 2 78  ? 2.294   4.701   1.507   1.00 0.00 ? 336 ASP A N    2  
ATOM   3332  C  CA   . ASP B 2 78  ? 2.159   6.097   1.107   1.00 0.00 ? 336 ASP A CA   2  
ATOM   3333  C  C    . ASP B 2 78  ? 1.964   6.201   -0.407  1.00 0.00 ? 336 ASP A C    2  
ATOM   3334  O  O    . ASP B 2 78  ? 1.975   7.296   -0.970  1.00 0.00 ? 336 ASP A O    2  
ATOM   3335  C  CB   . ASP B 2 78  ? 3.383   6.898   1.542   1.00 0.00 ? 336 ASP A CB   2  
ATOM   3336  C  CG   . ASP B 2 78  ? 3.059   8.353   1.819   1.00 0.00 ? 336 ASP A CG   2  
ATOM   3337  O  OD1  . ASP B 2 78  ? 2.562   8.649   2.926   1.00 0.00 ? 336 ASP A OD1  2  
ATOM   3338  O  OD2  . ASP B 2 78  ? 3.303   9.196   0.930   1.00 0.00 ? 336 ASP A OD2  2  
ATOM   3339  H  H    . ASP B 2 78  ? 2.878   4.125   0.988   1.00 0.00 ? 336 ASP A H    2  
ATOM   3340  H  HA   . ASP B 2 78  ? 1.287   6.499   1.598   1.00 0.00 ? 336 ASP A HA   2  
ATOM   3341  H  HB2  . ASP B 2 78  ? 3.791   6.460   2.440   1.00 0.00 ? 336 ASP A HB2  2  
ATOM   3342  H  HB3  . ASP B 2 78  ? 4.123   6.857   0.759   1.00 0.00 ? 336 ASP A HB3  2  
ATOM   3343  N  N    . CYS B 2 79  ? 1.775   5.044   -1.046  1.00 0.00 ? 337 CYS A N    2  
ATOM   3344  C  CA   . CYS B 2 79  ? 1.533   4.951   -2.479  1.00 0.00 ? 337 CYS A CA   2  
ATOM   3345  C  C    . CYS B 2 79  ? 1.499   3.480   -2.906  1.00 0.00 ? 337 CYS A C    2  
ATOM   3346  O  O    . CYS B 2 79  ? 1.089   3.156   -4.020  1.00 0.00 ? 337 CYS A O    2  
ATOM   3347  C  CB   . CYS B 2 79  ? 2.579   5.708   -3.303  1.00 0.00 ? 337 CYS A CB   2  
ATOM   3348  S  SG   . CYS B 2 79  ? 4.239   4.945   -3.311  1.00 0.00 ? 337 CYS A SG   2  
ATOM   3349  H  H    . CYS B 2 79  ? 1.783   4.220   -0.532  1.00 0.00 ? 337 CYS A H    2  
ATOM   3350  H  HA   . CYS B 2 79  ? 0.557   5.387   -2.647  1.00 0.00 ? 337 CYS A HA   2  
ATOM   3351  H  HB2  . CYS B 2 79  ? 2.236   5.764   -4.324  1.00 0.00 ? 337 CYS A HB2  2  
ATOM   3352  H  HB3  . CYS B 2 79  ? 2.672   6.705   -2.917  1.00 0.00 ? 337 CYS A HB3  2  
ATOM   3353  N  N    . ASP B 2 80  ? 1.969   2.614   -1.997  1.00 0.00 ? 338 ASP A N    2  
ATOM   3354  C  CA   . ASP B 2 80  ? 1.984   1.150   -2.176  1.00 0.00 ? 338 ASP A CA   2  
ATOM   3355  C  C    . ASP B 2 80  ? 3.259   0.615   -2.844  1.00 0.00 ? 338 ASP A C    2  
ATOM   3356  O  O    . ASP B 2 80  ? 3.497   -0.593  -2.829  1.00 0.00 ? 338 ASP A O    2  
ATOM   3357  C  CB   . ASP B 2 80  ? 0.749   0.673   -2.940  1.00 0.00 ? 338 ASP A CB   2  
ATOM   3358  C  CG   . ASP B 2 80  ? 0.671   -0.839  -3.014  1.00 0.00 ? 338 ASP A CG   2  
ATOM   3359  O  OD1  . ASP B 2 80  ? 0.722   -1.487  -1.946  1.00 0.00 ? 338 ASP A OD1  2  
ATOM   3360  O  OD2  . ASP B 2 80  ? 0.568   -1.375  -4.137  1.00 0.00 ? 338 ASP A OD2  2  
ATOM   3361  H  H    . ASP B 2 80  ? 2.326   2.978   -1.164  1.00 0.00 ? 338 ASP A H    2  
ATOM   3362  H  HA   . ASP B 2 80  ? 1.939   0.725   -1.185  1.00 0.00 ? 338 ASP A HA   2  
ATOM   3363  H  HB2  . ASP B 2 80  ? -0.142  1.038   -2.447  1.00 0.00 ? 338 ASP A HB2  2  
ATOM   3364  H  HB3  . ASP B 2 80  ? 0.783   1.068   -3.939  1.00 0.00 ? 338 ASP A HB3  2  
ATOM   3365  N  N    . ARG B 2 81  ? 4.072   1.491   -3.427  1.00 0.00 ? 339 ARG A N    2  
ATOM   3366  C  CA   . ARG B 2 81  ? 5.315   1.061   -4.075  1.00 0.00 ? 339 ARG A CA   2  
ATOM   3367  C  C    . ARG B 2 81  ? 6.124   0.136   -3.159  1.00 0.00 ? 339 ARG A C    2  
ATOM   3368  O  O    . ARG B 2 81  ? 6.580   0.550   -2.093  1.00 0.00 ? 339 ARG A O    2  
ATOM   3369  C  CB   . ARG B 2 81  ? 6.138   2.283   -4.467  1.00 0.00 ? 339 ARG A CB   2  
ATOM   3370  C  CG   . ARG B 2 81  ? 5.535   3.046   -5.632  1.00 0.00 ? 339 ARG A CG   2  
ATOM   3371  C  CD   . ARG B 2 81  ? 6.373   2.907   -6.889  1.00 0.00 ? 339 ARG A CD   2  
ATOM   3372  N  NE   . ARG B 2 81  ? 5.693   3.458   -8.060  1.00 0.00 ? 339 ARG A NE   2  
ATOM   3373  C  CZ   . ARG B 2 81  ? 5.719   2.895   -9.266  1.00 0.00 ? 339 ARG A CZ   2  
ATOM   3374  N  NH1  . ARG B 2 81  ? 6.383   1.764   -9.460  1.00 0.00 ? 339 ARG A NH1  2  
ATOM   3375  N  NH2  . ARG B 2 81  ? 5.078   3.463   -10.277 1.00 0.00 ? 339 ARG A NH2  2  
ATOM   3376  H  H    . ARG B 2 81  ? 3.836   2.441   -3.432  1.00 0.00 ? 339 ARG A H    2  
ATOM   3377  H  HA   . ARG B 2 81  ? 5.055   0.519   -4.972  1.00 0.00 ? 339 ARG A HA   2  
ATOM   3378  H  HB2  . ARG B 2 81  ? 6.205   2.949   -3.620  1.00 0.00 ? 339 ARG A HB2  2  
ATOM   3379  H  HB3  . ARG B 2 81  ? 7.130   1.965   -4.746  1.00 0.00 ? 339 ARG A HB3  2  
ATOM   3380  H  HG2  . ARG B 2 81  ? 4.545   2.657   -5.829  1.00 0.00 ? 339 ARG A HG2  2  
ATOM   3381  H  HG3  . ARG B 2 81  ? 5.467   4.089   -5.367  1.00 0.00 ? 339 ARG A HG3  2  
ATOM   3382  H  HD2  . ARG B 2 81  ? 7.313   3.443   -6.745  1.00 0.00 ? 339 ARG A HD2  2  
ATOM   3383  H  HD3  . ARG B 2 81  ? 6.575   1.860   -7.055  1.00 0.00 ? 339 ARG A HD3  2  
ATOM   3384  H  HE   . ARG B 2 81  ? 5.192   4.291   -7.942  1.00 0.00 ? 339 ARG A HE   2  
ATOM   3385  H  HH11 . ARG B 2 81  ? 6.866   1.332   -8.701  1.00 0.00 ? 339 ARG A HH11 2  
ATOM   3386  H  HH12 . ARG B 2 81  ? 6.400   1.344   -10.367 1.00 0.00 ? 339 ARG A HH12 2  
ATOM   3387  H  HH21 . ARG B 2 81  ? 4.573   4.314   -10.136 1.00 0.00 ? 339 ARG A HH21 2  
ATOM   3388  H  HH22 . ARG B 2 81  ? 5.098   3.039   -11.184 1.00 0.00 ? 339 ARG A HH22 2  
ATOM   3389  N  N    . GLY B 2 82  ? 6.297   -1.120  -3.585  1.00 0.00 ? 340 GLY A N    2  
ATOM   3390  C  CA   . GLY B 2 82  ? 7.032   -2.088  -2.778  1.00 0.00 ? 340 GLY A CA   2  
ATOM   3391  C  C    . GLY B 2 82  ? 8.500   -2.208  -3.151  1.00 0.00 ? 340 GLY A C    2  
ATOM   3392  O  O    . GLY B 2 82  ? 8.840   -2.266  -4.323  1.00 0.00 ? 340 GLY A O    2  
ATOM   3393  H  H    . GLY B 2 82  ? 5.926   -1.390  -4.450  1.00 0.00 ? 340 GLY A H    2  
ATOM   3394  H  HA2  . GLY B 2 82  ? 6.961   -1.793  -1.750  1.00 0.00 ? 340 GLY A HA2  2  
ATOM   3395  H  HA3  . GLY B 2 82  ? 6.570   -3.065  -2.885  1.00 0.00 ? 340 GLY A HA3  2  
ATOM   3396  N  N    . TYR B 2 83  ? 9.376   -2.206  -2.149  1.00 0.00 ? 341 TYR A N    2  
ATOM   3397  C  CA   . TYR B 2 83  ? 10.815  -2.362  -2.376  1.00 0.00 ? 341 TYR A CA   2  
ATOM   3398  C  C    . TYR B 2 83  ? 11.368  -3.356  -1.373  1.00 0.00 ? 341 TYR A C    2  
ATOM   3399  O  O    . TYR B 2 83  ? 11.164  -3.183  -0.179  1.00 0.00 ? 341 TYR A O    2  
ATOM   3400  C  CB   . TYR B 2 83  ? 11.652  -1.109  -2.093  1.00 0.00 ? 341 TYR A CB   2  
ATOM   3401  C  CG   . TYR B 2 83  ? 11.287  0.235   -2.693  1.00 0.00 ? 341 TYR A CG   2  
ATOM   3402  C  CD1  . TYR B 2 83  ? 10.060  0.505   -3.243  1.00 0.00 ? 341 TYR A CD1  2  
ATOM   3403  C  CD2  . TYR B 2 83  ? 12.202  1.282   -2.597  1.00 0.00 ? 341 TYR A CD2  2  
ATOM   3404  C  CE1  . TYR B 2 83  ? 9.745   1.769   -3.687  1.00 0.00 ? 341 TYR A CE1  2  
ATOM   3405  C  CE2  . TYR B 2 83  ? 11.897  2.542   -3.057  1.00 0.00 ? 341 TYR A CE2  2  
ATOM   3406  C  CZ   . TYR B 2 83  ? 10.661  2.777   -3.598  1.00 0.00 ? 341 TYR A CZ   2  
ATOM   3407  O  OH   . TYR B 2 83  ? 10.323  4.030   -4.035  1.00 0.00 ? 341 TYR A OH   2  
ATOM   3408  H  H    . TYR B 2 83  ? 9.048   -2.112  -1.232  1.00 0.00 ? 341 TYR A H    2  
ATOM   3409  H  HA   . TYR B 2 83  ? 10.981  -2.713  -3.381  1.00 0.00 ? 341 TYR A HA   2  
ATOM   3410  H  HB2  . TYR B 2 83  ? 11.651  -0.970  -1.028  1.00 0.00 ? 341 TYR A HB2  2  
ATOM   3411  H  HB3  . TYR B 2 83  ? 12.666  -1.318  -2.377  1.00 0.00 ? 341 TYR A HB3  2  
ATOM   3412  H  HD1  . TYR B 2 83  ? 9.349   -0.285  -3.344  1.00 0.00 ? 341 TYR A HD1  2  
ATOM   3413  H  HD2  . TYR B 2 83  ? 13.174  1.090   -2.170  1.00 0.00 ? 341 TYR A HD2  2  
ATOM   3414  H  HE1  . TYR B 2 83  ? 8.778   1.963   -4.110  1.00 0.00 ? 341 TYR A HE1  2  
ATOM   3415  H  HE2  . TYR B 2 83  ? 12.625  3.336   -2.984  1.00 0.00 ? 341 TYR A HE2  2  
ATOM   3416  H  HH   . TYR B 2 83  ? 9.442   4.251   -3.724  1.00 0.00 ? 341 TYR A HH   2  
ATOM   3417  N  N    . HIS B 2 84  ? 12.133  -4.333  -1.810  1.00 0.00 ? 342 HIS A N    2  
ATOM   3418  C  CA   . HIS B 2 84  ? 12.704  -5.256  -0.843  1.00 0.00 ? 342 HIS A CA   2  
ATOM   3419  C  C    . HIS B 2 84  ? 13.646  -4.408  0.002   1.00 0.00 ? 342 HIS A C    2  
ATOM   3420  O  O    . HIS B 2 84  ? 14.522  -3.800  -0.569  1.00 0.00 ? 342 HIS A O    2  
ATOM   3421  C  CB   . HIS B 2 84  ? 13.487  -6.398  -1.516  1.00 0.00 ? 342 HIS A CB   2  
ATOM   3422  C  CG   . HIS B 2 84  ? 12.677  -7.379  -2.325  1.00 0.00 ? 342 HIS A CG   2  
ATOM   3423  N  ND1  . HIS B 2 84  ? 12.587  -7.350  -3.703  1.00 0.00 ? 342 HIS A ND1  2  
ATOM   3424  C  CD2  . HIS B 2 84  ? 11.912  -8.419  -1.937  1.00 0.00 ? 342 HIS A CD2  2  
ATOM   3425  C  CE1  . HIS B 2 84  ? 11.800  -8.318  -4.127  1.00 0.00 ? 342 HIS A CE1  2  
ATOM   3426  N  NE2  . HIS B 2 84  ? 11.380  -8.990  -3.073  1.00 0.00 ? 342 HIS A NE2  2  
ATOM   3427  H  H    . HIS B 2 84  ? 12.381  -4.378  -2.752  1.00 0.00 ? 342 HIS A H    2  
ATOM   3428  H  HA   . HIS B 2 84  ? 11.914  -5.652  -0.221  1.00 0.00 ? 342 HIS A HA   2  
ATOM   3429  H  HB2  . HIS B 2 84  ? 14.227  -5.975  -2.167  1.00 0.00 ? 342 HIS A HB2  2  
ATOM   3430  H  HB3  . HIS B 2 84  ? 13.984  -6.951  -0.746  1.00 0.00 ? 342 HIS A HB3  2  
ATOM   3431  H  HD2  . HIS B 2 84  ? 11.719  -8.724  -0.922  1.00 0.00 ? 342 HIS A HD2  2  
ATOM   3432  H  HE1  . HIS B 2 84  ? 11.477  -8.467  -5.159  1.00 0.00 ? 342 HIS A HE1  2  
ATOM   3433  H  HE2  . HIS B 2 84  ? 10.716  -9.710  -3.092  1.00 0.00 ? 342 HIS A HE2  2  
ATOM   3434  N  N    . MET B 2 85  ? 13.436  -4.294  1.321   1.00 0.00 ? 343 MET A N    2  
ATOM   3435  C  CA   . MET B 2 85  ? 14.307  -3.439  2.167   1.00 0.00 ? 343 MET A CA   2  
ATOM   3436  C  C    . MET B 2 85  ? 15.734  -3.368  1.662   1.00 0.00 ? 343 MET A C    2  
ATOM   3437  O  O    . MET B 2 85  ? 16.423  -2.372  1.877   1.00 0.00 ? 343 MET A O    2  
ATOM   3438  C  CB   . MET B 2 85  ? 14.380  -3.884  3.634   1.00 0.00 ? 343 MET A CB   2  
ATOM   3439  C  CG   . MET B 2 85  ? 13.067  -4.099  4.327   1.00 0.00 ? 343 MET A CG   2  
ATOM   3440  S  SD   . MET B 2 85  ? 12.572  -5.821  4.514   1.00 0.00 ? 343 MET A SD   2  
ATOM   3441  C  CE   . MET B 2 85  ? 14.128  -6.620  4.878   1.00 0.00 ? 343 MET A CE   2  
ATOM   3442  H  H    . MET B 2 85  ? 12.676  -4.750  1.722   1.00 0.00 ? 343 MET A H    2  
ATOM   3443  H  HA   . MET B 2 85  ? 13.902  -2.436  2.125   1.00 0.00 ? 343 MET A HA   2  
ATOM   3444  H  HB2  . MET B 2 85  ? 14.956  -4.787  3.702   1.00 0.00 ? 343 MET A HB2  2  
ATOM   3445  H  HB3  . MET B 2 85  ? 14.883  -3.104  4.176   1.00 0.00 ? 343 MET A HB3  2  
ATOM   3446  H  HG2  . MET B 2 85  ? 13.137  -3.665  5.310   1.00 0.00 ? 343 MET A HG2  2  
ATOM   3447  H  HG3  . MET B 2 85  ? 12.331  -3.578  3.764   1.00 0.00 ? 343 MET A HG3  2  
ATOM   3448  H  HE1  . MET B 2 85  ? 14.774  -6.537  4.021   1.00 0.00 ? 343 MET A HE1  2  
ATOM   3449  H  HE2  . MET B 2 85  ? 13.958  -7.662  5.104   1.00 0.00 ? 343 MET A HE2  2  
ATOM   3450  H  HE3  . MET B 2 85  ? 14.590  -6.138  5.722   1.00 0.00 ? 343 MET A HE3  2  
ATOM   3451  N  N    . TYR B 2 86  ? 16.187  -4.416  1.014   1.00 0.00 ? 344 TYR A N    2  
ATOM   3452  C  CA   . TYR B 2 86  ? 17.547  -4.423  0.505   1.00 0.00 ? 344 TYR A CA   2  
ATOM   3453  C  C    . TYR B 2 86  ? 17.564  -4.057  -0.972  1.00 0.00 ? 344 TYR A C    2  
ATOM   3454  O  O    . TYR B 2 86  ? 18.451  -4.476  -1.716  1.00 0.00 ? 344 TYR A O    2  
ATOM   3455  C  CB   . TYR B 2 86  ? 18.229  -5.771  0.748   1.00 0.00 ? 344 TYR A CB   2  
ATOM   3456  C  CG   . TYR B 2 86  ? 17.701  -6.900  -0.101  1.00 0.00 ? 344 TYR A CG   2  
ATOM   3457  C  CD1  . TYR B 2 86  ? 16.385  -7.318  0.007   1.00 0.00 ? 344 TYR A CD1  2  
ATOM   3458  C  CD2  . TYR B 2 86  ? 18.528  -7.554  -1.006  1.00 0.00 ? 344 TYR A CD2  2  
ATOM   3459  C  CE1  . TYR B 2 86  ? 15.906  -8.353  -0.763  1.00 0.00 ? 344 TYR A CE1  2  
ATOM   3460  C  CE2  . TYR B 2 86  ? 18.052  -8.593  -1.783  1.00 0.00 ? 344 TYR A CE2  2  
ATOM   3461  C  CZ   . TYR B 2 86  ? 16.738  -8.989  -1.657  1.00 0.00 ? 344 TYR A CZ   2  
ATOM   3462  O  OH   . TYR B 2 86  ? 16.257  -10.024 -2.425  1.00 0.00 ? 344 TYR A OH   2  
ATOM   3463  H  H    . TYR B 2 86  ? 15.586  -5.179  0.848   1.00 0.00 ? 344 TYR A H    2  
ATOM   3464  H  HA   . TYR B 2 86  ? 18.090  -3.659  1.044   1.00 0.00 ? 344 TYR A HA   2  
ATOM   3465  H  HB2  . TYR B 2 86  ? 19.284  -5.672  0.541   1.00 0.00 ? 344 TYR A HB2  2  
ATOM   3466  H  HB3  . TYR B 2 86  ? 18.100  -6.048  1.784   1.00 0.00 ? 344 TYR A HB3  2  
ATOM   3467  H  HD1  . TYR B 2 86  ? 15.724  -6.819  0.707   1.00 0.00 ? 344 TYR A HD1  2  
ATOM   3468  H  HD2  . TYR B 2 86  ? 19.557  -7.241  -1.100  1.00 0.00 ? 344 TYR A HD2  2  
ATOM   3469  H  HE1  . TYR B 2 86  ? 14.876  -8.656  -0.659  1.00 0.00 ? 344 TYR A HE1  2  
ATOM   3470  H  HE2  . TYR B 2 86  ? 18.707  -9.089  -2.482  1.00 0.00 ? 344 TYR A HE2  2  
ATOM   3471  H  HH   . TYR B 2 86  ? 15.417  -9.770  -2.813  1.00 0.00 ? 344 TYR A HH   2  
ATOM   3472  N  N    . CYS B 2 87  ? 16.577  -3.264  -1.393  1.00 0.00 ? 345 CYS A N    2  
ATOM   3473  C  CA   . CYS B 2 87  ? 16.495  -2.834  -2.773  1.00 0.00 ? 345 CYS A CA   2  
ATOM   3474  C  C    . CYS B 2 87  ? 16.512  -1.331  -2.819  1.00 0.00 ? 345 CYS A C    2  
ATOM   3475  O  O    . CYS B 2 87  ? 16.931  -0.716  -3.801  1.00 0.00 ? 345 CYS A O    2  
ATOM   3476  C  CB   . CYS B 2 87  ? 15.226  -3.370  -3.449  1.00 0.00 ? 345 CYS A CB   2  
ATOM   3477  S  SG   . CYS B 2 87  ? 15.367  -5.115  -3.893  1.00 0.00 ? 345 CYS A SG   2  
ATOM   3478  H  H    . CYS B 2 87  ? 15.884  -2.951  -0.752  1.00 0.00 ? 345 CYS A H    2  
ATOM   3479  H  HA   . CYS B 2 87  ? 17.355  -3.220  -3.277  1.00 0.00 ? 345 CYS A HA   2  
ATOM   3480  H  HB2  . CYS B 2 87  ? 14.389  -3.261  -2.779  1.00 0.00 ? 345 CYS A HB2  2  
ATOM   3481  H  HB3  . CYS B 2 87  ? 15.028  -2.806  -4.355  1.00 0.00 ? 345 CYS A HB3  2  
ATOM   3482  N  N    . LEU B 2 88  ? 16.059  -0.757  -1.722  1.00 0.00 ? 346 LEU A N    2  
ATOM   3483  C  CA   . LEU B 2 88  ? 15.964  0.682   -1.580  1.00 0.00 ? 346 LEU A CA   2  
ATOM   3484  C  C    . LEU B 2 88  ? 17.295  1.376   -1.845  1.00 0.00 ? 346 LEU A C    2  
ATOM   3485  O  O    . LEU B 2 88  ? 18.311  0.735   -2.117  1.00 0.00 ? 346 LEU A O    2  
ATOM   3486  C  CB   . LEU B 2 88  ? 15.473  1.045   -0.174  1.00 0.00 ? 346 LEU A CB   2  
ATOM   3487  C  CG   . LEU B 2 88  ? 14.960  -0.133  0.647   1.00 0.00 ? 346 LEU A CG   2  
ATOM   3488  C  CD1  . LEU B 2 88  ? 14.526  0.288   2.019   1.00 0.00 ? 346 LEU A CD1  2  
ATOM   3489  C  CD2  . LEU B 2 88  ? 13.805  -0.801  -0.041  1.00 0.00 ? 346 LEU A CD2  2  
ATOM   3490  H  H    . LEU B 2 88  ? 15.764  -1.333  -0.979  1.00 0.00 ? 346 LEU A H    2  
ATOM   3491  H  HA   . LEU B 2 88  ? 15.242  1.017   -2.292  1.00 0.00 ? 346 LEU A HA   2  
ATOM   3492  H  HB2  . LEU B 2 88  ? 16.289  1.501   0.361   1.00 0.00 ? 346 LEU A HB2  2  
ATOM   3493  H  HB3  . LEU B 2 88  ? 14.676  1.766   -0.266  1.00 0.00 ? 346 LEU A HB3  2  
ATOM   3494  H  HG   . LEU B 2 88  ? 15.743  -0.858  0.752   1.00 0.00 ? 346 LEU A HG   2  
ATOM   3495  H  HD11 . LEU B 2 88  ? 13.823  -0.449  2.379   1.00 0.00 ? 346 LEU A HD11 2  
ATOM   3496  H  HD12 . LEU B 2 88  ? 14.052  1.258   1.973   1.00 0.00 ? 346 LEU A HD12 2  
ATOM   3497  H  HD13 . LEU B 2 88  ? 15.380  0.327   2.678   1.00 0.00 ? 346 LEU A HD13 2  
ATOM   3498  H  HD21 . LEU B 2 88  ? 13.818  -0.531  -1.082  1.00 0.00 ? 346 LEU A HD21 2  
ATOM   3499  H  HD22 . LEU B 2 88  ? 12.879  -0.474  0.407   1.00 0.00 ? 346 LEU A HD22 2  
ATOM   3500  H  HD23 . LEU B 2 88  ? 13.897  -1.871  0.056   1.00 0.00 ? 346 LEU A HD23 2  
ATOM   3501  N  N    . ASN B 2 89  ? 17.271  2.698   -1.755  1.00 0.00 ? 347 ASN A N    2  
ATOM   3502  C  CA   . ASN B 2 89  ? 18.461  3.513   -1.937  1.00 0.00 ? 347 ASN A CA   2  
ATOM   3503  C  C    . ASN B 2 89  ? 19.189  3.570   -0.620  1.00 0.00 ? 347 ASN A C    2  
ATOM   3504  O  O    . ASN B 2 89  ? 20.414  3.453   -0.569  1.00 0.00 ? 347 ASN A O    2  
ATOM   3505  C  CB   . ASN B 2 89  ? 18.084  4.905   -2.407  1.00 0.00 ? 347 ASN A CB   2  
ATOM   3506  C  CG   . ASN B 2 89  ? 19.130  5.535   -3.273  1.00 0.00 ? 347 ASN A CG   2  
ATOM   3507  O  OD1  . ASN B 2 89  ? 20.291  5.126   -3.281  1.00 0.00 ? 347 ASN A OD1  2  
ATOM   3508  N  ND2  . ASN B 2 89  ? 18.722  6.555   -3.996  1.00 0.00 ? 347 ASN A ND2  2  
ATOM   3509  H  H    . ASN B 2 89  ? 16.429  3.138   -1.536  1.00 0.00 ? 347 ASN A H    2  
ATOM   3510  H  HA   . ASN B 2 89  ? 19.092  3.045   -2.658  1.00 0.00 ? 347 ASN A HA   2  
ATOM   3511  H  HB2  . ASN B 2 89  ? 17.175  4.838   -2.968  1.00 0.00 ? 347 ASN A HB2  2  
ATOM   3512  H  HB3  . ASN B 2 89  ? 17.928  5.544   -1.557  1.00 0.00 ? 347 ASN A HB3  2  
ATOM   3513  H  HD21 . ASN B 2 89  ? 17.783  6.828   -3.926  1.00 0.00 ? 347 ASN A HD21 2  
ATOM   3514  H  HD22 . ASN B 2 89  ? 19.366  6.997   -4.554  1.00 0.00 ? 347 ASN A HD22 2  
ATOM   3515  N  N    . PRO B 2 90  ? 18.435  3.787   0.473   1.00 0.00 ? 348 PRO A N    2  
ATOM   3516  C  CA   . PRO B 2 90  ? 18.938  3.779   1.812   1.00 0.00 ? 348 PRO A CA   2  
ATOM   3517  C  C    . PRO B 2 90  ? 18.329  2.606   2.582   1.00 0.00 ? 348 PRO A C    2  
ATOM   3518  O  O    . PRO B 2 90  ? 17.691  2.788   3.618   1.00 0.00 ? 348 PRO A O    2  
ATOM   3519  C  CB   . PRO B 2 90  ? 18.399  5.100   2.275   1.00 0.00 ? 348 PRO A CB   2  
ATOM   3520  C  CG   . PRO B 2 90  ? 17.039  5.179   1.669   1.00 0.00 ? 348 PRO A CG   2  
ATOM   3521  C  CD   . PRO B 2 90  ? 17.028  4.201   0.522   1.00 0.00 ? 348 PRO A CD   2  
ATOM   3522  H  HA   . PRO B 2 90  ? 20.009  3.767   1.855   1.00 0.00 ? 348 PRO A HA   2  
ATOM   3523  H  HB2  . PRO B 2 90  ? 18.359  5.133   3.340   1.00 0.00 ? 348 PRO A HB2  2  
ATOM   3524  H  HB3  . PRO B 2 90  ? 19.039  5.870   1.890   1.00 0.00 ? 348 PRO A HB3  2  
ATOM   3525  H  HG2  . PRO B 2 90  ? 16.291  4.913   2.401   1.00 0.00 ? 348 PRO A HG2  2  
ATOM   3526  H  HG3  . PRO B 2 90  ? 16.877  6.173   1.308   1.00 0.00 ? 348 PRO A HG3  2  
ATOM   3527  H  HD2  . PRO B 2 90  ? 16.379  3.364   0.737   1.00 0.00 ? 348 PRO A HD2  2  
ATOM   3528  H  HD3  . PRO B 2 90  ? 16.734  4.692   -0.384  1.00 0.00 ? 348 PRO A HD3  2  
ATOM   3529  N  N    . PRO B 2 91  ? 18.526  1.385   2.041   1.00 0.00 ? 349 PRO A N    2  
ATOM   3530  C  CA   . PRO B 2 91  ? 18.006  0.131   2.561   1.00 0.00 ? 349 PRO A CA   2  
ATOM   3531  C  C    . PRO B 2 91  ? 17.768  0.099   4.064   1.00 0.00 ? 349 PRO A C    2  
ATOM   3532  O  O    . PRO B 2 91  ? 18.455  0.756   4.846   1.00 0.00 ? 349 PRO A O    2  
ATOM   3533  C  CB   . PRO B 2 91  ? 19.089  -0.877  2.171   1.00 0.00 ? 349 PRO A CB   2  
ATOM   3534  C  CG   . PRO B 2 91  ? 20.034  -0.148  1.273   1.00 0.00 ? 349 PRO A CG   2  
ATOM   3535  C  CD   . PRO B 2 91  ? 19.329  1.104   0.863   1.00 0.00 ? 349 PRO A CD   2  
ATOM   3536  H  HA   . PRO B 2 91  ? 17.096  -0.139  2.053   1.00 0.00 ? 349 PRO A HA   2  
ATOM   3537  H  HB2  . PRO B 2 91  ? 19.583  -1.219  3.049   1.00 0.00 ? 349 PRO A HB2  2  
ATOM   3538  H  HB3  . PRO B 2 91  ? 18.630  -1.711  1.665   1.00 0.00 ? 349 PRO A HB3  2  
ATOM   3539  H  HG2  . PRO B 2 91  ? 20.941  0.090   1.806   1.00 0.00 ? 349 PRO A HG2  2  
ATOM   3540  H  HG3  . PRO B 2 91  ? 20.254  -0.756  0.417   1.00 0.00 ? 349 PRO A HG3  2  
ATOM   3541  H  HD2  . PRO B 2 91  ? 20.026  1.908   0.675   1.00 0.00 ? 349 PRO A HD2  2  
ATOM   3542  H  HD3  . PRO B 2 91  ? 18.703  0.926   0.005   1.00 0.00 ? 349 PRO A HD3  2  
ATOM   3543  N  N    . VAL B 2 92  ? 16.790  -0.710  4.442   1.00 0.00 ? 350 VAL A N    2  
ATOM   3544  C  CA   . VAL B 2 92  ? 16.406  -0.896  5.825   1.00 0.00 ? 350 VAL A CA   2  
ATOM   3545  C  C    . VAL B 2 92  ? 16.482  -2.383  6.150   1.00 0.00 ? 350 VAL A C    2  
ATOM   3546  O  O    . VAL B 2 92  ? 16.716  -3.205  5.266   1.00 0.00 ? 350 VAL A O    2  
ATOM   3547  C  CB   . VAL B 2 92  ? 14.994  -0.310  6.075   1.00 0.00 ? 350 VAL A CB   2  
ATOM   3548  C  CG1  . VAL B 2 92  ? 14.027  -0.765  5.011   1.00 0.00 ? 350 VAL A CG1  2  
ATOM   3549  C  CG2  . VAL B 2 92  ? 14.452  -0.629  7.453   1.00 0.00 ? 350 VAL A CG2  2  
ATOM   3550  H  H    . VAL B 2 92  ? 16.312  -1.216  3.757   1.00 0.00 ? 350 VAL A H    2  
ATOM   3551  H  HA   . VAL B 2 92  ? 17.114  -0.370  6.449   1.00 0.00 ? 350 VAL A HA   2  
ATOM   3552  H  HB   . VAL B 2 92  ? 15.075  0.755   6.001   1.00 0.00 ? 350 VAL A HB   2  
ATOM   3553  H  HG11 . VAL B 2 92  ? 13.159  -1.212  5.470   1.00 0.00 ? 350 VAL A HG11 2  
ATOM   3554  H  HG12 . VAL B 2 92  ? 14.510  -1.487  4.373   1.00 0.00 ? 350 VAL A HG12 2  
ATOM   3555  H  HG13 . VAL B 2 92  ? 13.720  0.085   4.421   1.00 0.00 ? 350 VAL A HG13 2  
ATOM   3556  H  HG21 . VAL B 2 92  ? 13.689  -1.388  7.366   1.00 0.00 ? 350 VAL A HG21 2  
ATOM   3557  H  HG22 . VAL B 2 92  ? 14.022  0.265   7.883   1.00 0.00 ? 350 VAL A HG22 2  
ATOM   3558  H  HG23 . VAL B 2 92  ? 15.247  -0.983  8.085   1.00 0.00 ? 350 VAL A HG23 2  
ATOM   3559  N  N    . ALA B 2 93  ? 16.312  -2.719  7.406   1.00 0.00 ? 351 ALA A N    2  
ATOM   3560  C  CA   . ALA B 2 93  ? 16.418  -4.111  7.839   1.00 0.00 ? 351 ALA A CA   2  
ATOM   3561  C  C    . ALA B 2 93  ? 15.075  -4.823  7.989   1.00 0.00 ? 351 ALA A C    2  
ATOM   3562  O  O    . ALA B 2 93  ? 14.958  -5.998  7.646   1.00 0.00 ? 351 ALA A O    2  
ATOM   3563  C  CB   . ALA B 2 93  ? 17.184  -4.191  9.148   1.00 0.00 ? 351 ALA A CB   2  
ATOM   3564  H  H    . ALA B 2 93  ? 16.115  -2.015  8.054   1.00 0.00 ? 351 ALA A H    2  
ATOM   3565  H  HA   . ALA B 2 93  ? 16.995  -4.634  7.095   1.00 0.00 ? 351 ALA A HA   2  
ATOM   3566  H  HB1  . ALA B 2 93  ? 16.485  -4.204  9.972   1.00 0.00 ? 351 ALA A HB1  2  
ATOM   3567  H  HB2  . ALA B 2 93  ? 17.833  -3.332  9.240   1.00 0.00 ? 351 ALA A HB2  2  
ATOM   3568  H  HB3  . ALA B 2 93  ? 17.777  -5.094  9.165   1.00 0.00 ? 351 ALA A HB3  2  
ATOM   3569  N  N    . GLU B 2 94  ? 14.072  -4.130  8.518   1.00 0.00 ? 352 GLU A N    2  
ATOM   3570  C  CA   . GLU B 2 94  ? 12.751  -4.742  8.748   1.00 0.00 ? 352 GLU A CA   2  
ATOM   3571  C  C    . GLU B 2 94  ? 11.689  -3.688  9.048   1.00 0.00 ? 352 GLU A C    2  
ATOM   3572  O  O    . GLU B 2 94  ? 10.601  -3.699  8.476   1.00 0.00 ? 352 GLU A O    2  
ATOM   3573  C  CB   . GLU B 2 94  ? 12.785  -5.732  9.930   1.00 0.00 ? 352 GLU A CB   2  
ATOM   3574  C  CG   . GLU B 2 94  ? 14.168  -6.030  10.499  1.00 0.00 ? 352 GLU A CG   2  
ATOM   3575  C  CD   . GLU B 2 94  ? 14.124  -7.030  11.637  1.00 0.00 ? 352 GLU A CD   2  
ATOM   3576  O  OE1  . GLU B 2 94  ? 13.971  -6.602  12.800  1.00 0.00 ? 352 GLU A OE1  2  
ATOM   3577  O  OE2  . GLU B 2 94  ? 14.244  -8.244  11.366  1.00 0.00 ? 352 GLU A OE2  2  
ATOM   3578  H  H    . GLU B 2 94  ? 14.209  -3.183  8.737   1.00 0.00 ? 352 GLU A H    2  
ATOM   3579  H  HA   . GLU B 2 94  ? 12.475  -5.260  7.853   1.00 0.00 ? 352 GLU A HA   2  
ATOM   3580  H  HB2  . GLU B 2 94  ? 12.191  -5.313  10.732  1.00 0.00 ? 352 GLU A HB2  2  
ATOM   3581  H  HB3  . GLU B 2 94  ? 12.343  -6.655  9.616   1.00 0.00 ? 352 GLU A HB3  2  
ATOM   3582  H  HG2  . GLU B 2 94  ? 14.792  -6.428  9.715   1.00 0.00 ? 352 GLU A HG2  2  
ATOM   3583  H  HG3  . GLU B 2 94  ? 14.598  -5.109  10.866  1.00 0.00 ? 352 GLU A HG3  2  
ATOM   3584  N  N    . PRO B 2 95  ? 12.010  -2.801  10.004  1.00 0.00 ? 353 PRO A N    2  
ATOM   3585  C  CA   . PRO B 2 95  ? 11.234  -1.674  10.470  1.00 0.00 ? 353 PRO A CA   2  
ATOM   3586  C  C    . PRO B 2 95  ? 9.973   -1.286  9.687   1.00 0.00 ? 353 PRO A C    2  
ATOM   3587  O  O    . PRO B 2 95  ? 8.926   -1.118  10.312  1.00 0.00 ? 353 PRO A O    2  
ATOM   3588  C  CB   . PRO B 2 95  ? 12.318  -0.598  10.379  1.00 0.00 ? 353 PRO A CB   2  
ATOM   3589  C  CG   . PRO B 2 95  ? 13.610  -1.348  10.626  1.00 0.00 ? 353 PRO A CG   2  
ATOM   3590  C  CD   . PRO B 2 95  ? 13.234  -2.784  10.779  1.00 0.00 ? 353 PRO A CD   2  
ATOM   3591  H  HA   . PRO B 2 95  ? 10.969  -1.795  11.507  1.00 0.00 ? 353 PRO A HA   2  
ATOM   3592  H  HB2  . PRO B 2 95  ? 12.300  -0.163  9.386   1.00 0.00 ? 353 PRO A HB2  2  
ATOM   3593  H  HB3  . PRO B 2 95  ? 12.149  0.163   11.124  1.00 0.00 ? 353 PRO A HB3  2  
ATOM   3594  H  HG2  . PRO B 2 95  ? 14.261  -1.247  9.774   1.00 0.00 ? 353 PRO A HG2  2  
ATOM   3595  H  HG3  . PRO B 2 95  ? 14.092  -0.993  11.518  1.00 0.00 ? 353 PRO A HG3  2  
ATOM   3596  H  HD2  . PRO B 2 95  ? 13.984  -3.420  10.357  1.00 0.00 ? 353 PRO A HD2  2  
ATOM   3597  H  HD3  . PRO B 2 95  ? 13.044  -3.040  11.809  1.00 0.00 ? 353 PRO A HD3  2  
ATOM   3598  N  N    . PRO B 2 96  ? 10.006  -1.097  8.346   1.00 0.00 ? 354 PRO A N    2  
ATOM   3599  C  CA   . PRO B 2 96  ? 8.821   -0.693  7.619   1.00 0.00 ? 354 PRO A CA   2  
ATOM   3600  C  C    . PRO B 2 96  ? 7.800   -1.810  7.437   1.00 0.00 ? 354 PRO A C    2  
ATOM   3601  O  O    . PRO B 2 96  ? 7.267   -2.007  6.343   1.00 0.00 ? 354 PRO A O    2  
ATOM   3602  C  CB   . PRO B 2 96  ? 9.364   -0.219  6.277   1.00 0.00 ? 354 PRO A CB   2  
ATOM   3603  C  CG   . PRO B 2 96  ? 10.821  -0.163  6.436   1.00 0.00 ? 354 PRO A CG   2  
ATOM   3604  C  CD   . PRO B 2 96  ? 11.139  -1.199  7.430   1.00 0.00 ? 354 PRO A CD   2  
ATOM   3605  H  HA   . PRO B 2 96  ? 8.361   0.136   8.111   1.00 0.00 ? 354 PRO A HA   2  
ATOM   3606  H  HB2  . PRO B 2 96  ? 9.072   -0.889  5.492   1.00 0.00 ? 354 PRO A HB2  2  
ATOM   3607  H  HB3  . PRO B 2 96  ? 8.987   0.748   6.085   1.00 0.00 ? 354 PRO A HB3  2  
ATOM   3608  H  HG2  . PRO B 2 96  ? 11.311  -0.364  5.502   1.00 0.00 ? 354 PRO A HG2  2  
ATOM   3609  H  HG3  . PRO B 2 96  ? 11.097  0.808   6.813   1.00 0.00 ? 354 PRO A HG3  2  
ATOM   3610  H  HD2  . PRO B 2 96  ? 11.197  -2.176  6.972   1.00 0.00 ? 354 PRO A HD2  2  
ATOM   3611  H  HD3  . PRO B 2 96  ? 12.029  -0.946  7.897   1.00 0.00 ? 354 PRO A HD3  2  
ATOM   3612  N  N    . GLU B 2 97  ? 7.534   -2.537  8.514   1.00 0.00 ? 355 GLU A N    2  
ATOM   3613  C  CA   . GLU B 2 97  ? 6.562   -3.620  8.483   1.00 0.00 ? 355 GLU A CA   2  
ATOM   3614  C  C    . GLU B 2 97  ? 5.153   -3.057  8.615   1.00 0.00 ? 355 GLU A C    2  
ATOM   3615  O  O    . GLU B 2 97  ? 4.168   -3.793  8.565   1.00 0.00 ? 355 GLU A O    2  
ATOM   3616  C  CB   . GLU B 2 97  ? 6.833   -4.616  9.610   1.00 0.00 ? 355 GLU A CB   2  
ATOM   3617  C  CG   . GLU B 2 97  ? 8.183   -5.301  9.506   1.00 0.00 ? 355 GLU A CG   2  
ATOM   3618  C  CD   . GLU B 2 97  ? 8.333   -6.447  10.486  1.00 0.00 ? 355 GLU A CD   2  
ATOM   3619  O  OE1  . GLU B 2 97  ? 8.755   -6.195  11.635  1.00 0.00 ? 355 GLU A OE1  2  
ATOM   3620  O  OE2  . GLU B 2 97  ? 8.029   -7.597  10.107  1.00 0.00 ? 355 GLU A OE2  2  
ATOM   3621  H  H    . GLU B 2 97  ? 8.003   -2.343  9.347   1.00 0.00 ? 355 GLU A H    2  
ATOM   3622  H  HA   . GLU B 2 97  ? 6.651   -4.124  7.533   1.00 0.00 ? 355 GLU A HA   2  
ATOM   3623  H  HB2  . GLU B 2 97  ? 6.796   -4.092  10.551  1.00 0.00 ? 355 GLU A HB2  2  
ATOM   3624  H  HB3  . GLU B 2 97  ? 6.065   -5.376  9.599   1.00 0.00 ? 355 GLU A HB3  2  
ATOM   3625  H  HG2  . GLU B 2 97  ? 8.304   -5.684  8.504   1.00 0.00 ? 355 GLU A HG2  2  
ATOM   3626  H  HG3  . GLU B 2 97  ? 8.952   -4.571  9.709   1.00 0.00 ? 355 GLU A HG3  2  
ATOM   3627  N  N    . GLY B 2 98  ? 5.071   -1.739  8.782   1.00 0.00 ? 356 GLY A N    2  
ATOM   3628  C  CA   . GLY B 2 98  ? 3.788   -1.085  8.916   1.00 0.00 ? 356 GLY A CA   2  
ATOM   3629  C  C    . GLY B 2 98  ? 3.890   0.418   8.901   1.00 0.00 ? 356 GLY A C    2  
ATOM   3630  O  O    . GLY B 2 98  ? 3.455   1.094   9.833   1.00 0.00 ? 356 GLY A O    2  
ATOM   3631  H  H    . GLY B 2 98  ? 5.891   -1.208  8.803   1.00 0.00 ? 356 GLY A H    2  
ATOM   3632  H  HA2  . GLY B 2 98  ? 3.178   -1.376  8.086   1.00 0.00 ? 356 GLY A HA2  2  
ATOM   3633  H  HA3  . GLY B 2 98  ? 3.320   -1.400  9.835   1.00 0.00 ? 356 GLY A HA3  2  
ATOM   3634  N  N    . SER B 2 99  ? 4.457   0.924   7.818   1.00 0.00 ? 357 SER A N    2  
ATOM   3635  C  CA   . SER B 2 99  ? 4.629   2.355   7.613   1.00 0.00 ? 357 SER A CA   2  
ATOM   3636  C  C    . SER B 2 99  ? 5.437   2.592   6.340   1.00 0.00 ? 357 SER A C    2  
ATOM   3637  O  O    . SER B 2 99  ? 5.010   2.207   5.252   1.00 0.00 ? 357 SER A O    2  
ATOM   3638  C  CB   . SER B 2 99  ? 5.329   3.006   8.811   1.00 0.00 ? 357 SER A CB   2  
ATOM   3639  O  OG   . SER B 2 99  ? 5.333   4.418   8.694   1.00 0.00 ? 357 SER A OG   2  
ATOM   3640  H  H    . SER B 2 99  ? 4.767   0.308   7.122   1.00 0.00 ? 357 SER A H    2  
ATOM   3641  H  HA   . SER B 2 99  ? 3.647   2.781   7.495   1.00 0.00 ? 357 SER A HA   2  
ATOM   3642  H  HB2  . SER B 2 99  ? 4.816   2.734   9.721   1.00 0.00 ? 357 SER A HB2  2  
ATOM   3643  H  HB3  . SER B 2 99  ? 6.353   2.660   8.856   1.00 0.00 ? 357 SER A HB3  2  
ATOM   3644  H  HG   . SER B 2 99  ? 5.301   4.662   7.765   1.00 0.00 ? 357 SER A HG   2  
ATOM   3645  N  N    . TRP B 2 100 ? 6.601   3.231   6.479   1.00 0.00 ? 358 TRP A N    2  
ATOM   3646  C  CA   . TRP B 2 100 ? 7.479   3.482   5.351   1.00 0.00 ? 358 TRP A CA   2  
ATOM   3647  C  C    . TRP B 2 100 ? 6.843   4.422   4.350   1.00 0.00 ? 358 TRP A C    2  
ATOM   3648  O  O    . TRP B 2 100 ? 5.621   4.570   4.300   1.00 0.00 ? 358 TRP A O    2  
ATOM   3649  C  CB   . TRP B 2 100 ? 7.826   2.160   4.687   1.00 0.00 ? 358 TRP A CB   2  
ATOM   3650  C  CG   . TRP B 2 100 ? 9.157   2.139   4.018   1.00 0.00 ? 358 TRP A CG   2  
ATOM   3651  C  CD1  . TRP B 2 100 ? 10.367  2.507   4.532   1.00 0.00 ? 358 TRP A CD1  2  
ATOM   3652  C  CD2  . TRP B 2 100 ? 9.405   1.680   2.709   1.00 0.00 ? 358 TRP A CD2  2  
ATOM   3653  N  NE1  . TRP B 2 100 ? 11.347  2.330   3.585   1.00 0.00 ? 358 TRP A NE1  2  
ATOM   3654  C  CE2  . TRP B 2 100 ? 10.774  1.825   2.464   1.00 0.00 ? 358 TRP A CE2  2  
ATOM   3655  C  CE3  . TRP B 2 100 ? 8.590   1.169   1.713   1.00 0.00 ? 358 TRP A CE3  2  
ATOM   3656  C  CZ2  . TRP B 2 100 ? 11.343  1.474   1.263   1.00 0.00 ? 358 TRP A CZ2  2  
ATOM   3657  C  CZ3  . TRP B 2 100 ? 9.162   0.814   0.519   1.00 0.00 ? 358 TRP A CZ3  2  
ATOM   3658  C  CH2  . TRP B 2 100 ? 10.526  0.971   0.311   1.00 0.00 ? 358 TRP A CH2  2  
ATOM   3659  H  H    . TRP B 2 100 ? 6.868   3.553   7.357   1.00 0.00 ? 358 TRP A H    2  
ATOM   3660  H  HA   . TRP B 2 100 ? 8.385   3.934   5.725   1.00 0.00 ? 358 TRP A HA   2  
ATOM   3661  H  HB2  . TRP B 2 100 ? 7.818   1.388   5.430   1.00 0.00 ? 358 TRP A HB2  2  
ATOM   3662  H  HB3  . TRP B 2 100 ? 7.085   1.930   3.940   1.00 0.00 ? 358 TRP A HB3  2  
ATOM   3663  H  HD1  . TRP B 2 100 ? 10.513  2.879   5.527   1.00 0.00 ? 358 TRP A HD1  2  
ATOM   3664  H  HE1  . TRP B 2 100 ? 12.300  2.527   3.692   1.00 0.00 ? 358 TRP A HE1  2  
ATOM   3665  H  HE3  . TRP B 2 100 ? 7.538   1.030   1.876   1.00 0.00 ? 358 TRP A HE3  2  
ATOM   3666  H  HZ2  . TRP B 2 100 ? 12.395  1.565   1.083   1.00 0.00 ? 358 TRP A HZ2  2  
ATOM   3667  H  HZ3  . TRP B 2 100 ? 8.561   0.384   -0.261  1.00 0.00 ? 358 TRP A HZ3  2  
ATOM   3668  H  HH2  . TRP B 2 100 ? 10.926  0.688   -0.628  1.00 0.00 ? 358 TRP A HH2  2  
ATOM   3669  N  N    . SER B 2 101 ? 7.682   5.060   3.554   1.00 0.00 ? 359 SER A N    2  
ATOM   3670  C  CA   . SER B 2 101 ? 7.185   5.998   2.551   1.00 0.00 ? 359 SER A CA   2  
ATOM   3671  C  C    . SER B 2 101 ? 7.946   5.936   1.225   1.00 0.00 ? 359 SER A C    2  
ATOM   3672  O  O    . SER B 2 101 ? 7.818   6.836   0.404   1.00 0.00 ? 359 SER A O    2  
ATOM   3673  C  CB   . SER B 2 101 ? 7.223   7.422   3.100   1.00 0.00 ? 359 SER A CB   2  
ATOM   3674  O  OG   . SER B 2 101 ? 6.253   7.605   4.117   1.00 0.00 ? 359 SER A OG   2  
ATOM   3675  H  H    . SER B 2 101 ? 8.648   4.903   3.657   1.00 0.00 ? 359 SER A H    2  
ATOM   3676  H  HA   . SER B 2 101 ? 6.159   5.740   2.361   1.00 0.00 ? 359 SER A HA   2  
ATOM   3677  H  HB2  . SER B 2 101 ? 8.196   7.613   3.512   1.00 0.00 ? 359 SER A HB2  2  
ATOM   3678  H  HB3  . SER B 2 101 ? 7.027   8.121   2.300   1.00 0.00 ? 359 SER A HB3  2  
ATOM   3679  H  HG   . SER B 2 101 ? 6.588   7.256   4.946   1.00 0.00 ? 359 SER A HG   2  
ATOM   3680  N  N    . CYS B 2 102 ? 8.721   4.878   1.006   1.00 0.00 ? 360 CYS A N    2  
ATOM   3681  C  CA   . CYS B 2 102 ? 9.486   4.724   -0.243  1.00 0.00 ? 360 CYS A CA   2  
ATOM   3682  C  C    . CYS B 2 102 ? 10.253  6.001   -0.601  1.00 0.00 ? 360 CYS A C    2  
ATOM   3683  O  O    . CYS B 2 102 ? 10.209  6.989   0.129   1.00 0.00 ? 360 CYS A O    2  
ATOM   3684  C  CB   . CYS B 2 102 ? 8.558   4.356   -1.403  1.00 0.00 ? 360 CYS A CB   2  
ATOM   3685  S  SG   . CYS B 2 102 ? 7.781   5.783   -2.235  1.00 0.00 ? 360 CYS A SG   2  
ATOM   3686  H  H    . CYS B 2 102 ? 8.778   4.182   1.693   1.00 0.00 ? 360 CYS A H    2  
ATOM   3687  H  HA   . CYS B 2 102 ? 10.195  3.921   -0.098  1.00 0.00 ? 360 CYS A HA   2  
ATOM   3688  H  HB2  . CYS B 2 102 ? 9.123   3.819   -2.143  1.00 0.00 ? 360 CYS A HB2  2  
ATOM   3689  H  HB3  . CYS B 2 102 ? 7.771   3.720   -1.036  1.00 0.00 ? 360 CYS A HB3  2  
ATOM   3690  N  N    . HIS B 2 103 ? 10.994  5.966   -1.708  1.00 0.00 ? 361 HIS A N    2  
ATOM   3691  C  CA   . HIS B 2 103 ? 11.739  7.126   -2.149  1.00 0.00 ? 361 HIS A CA   2  
ATOM   3692  C  C    . HIS B 2 103 ? 10.840  8.130   -2.854  1.00 0.00 ? 361 HIS A C    2  
ATOM   3693  O  O    . HIS B 2 103 ? 11.037  9.333   -2.729  1.00 0.00 ? 361 HIS A O    2  
ATOM   3694  C  CB   . HIS B 2 103 ? 12.923  6.743   -3.043  1.00 0.00 ? 361 HIS A CB   2  
ATOM   3695  C  CG   . HIS B 2 103 ? 12.595  5.910   -4.247  1.00 0.00 ? 361 HIS A CG   2  
ATOM   3696  N  ND1  . HIS B 2 103 ? 13.325  4.794   -4.607  1.00 0.00 ? 361 HIS A ND1  2  
ATOM   3697  C  CD2  . HIS B 2 103 ? 11.643  6.049   -5.198  1.00 0.00 ? 361 HIS A CD2  2  
ATOM   3698  C  CE1  . HIS B 2 103 ? 12.834  4.290   -5.726  1.00 0.00 ? 361 HIS A CE1  2  
ATOM   3699  N  NE2  . HIS B 2 103 ? 11.816  5.034   -6.103  1.00 0.00 ? 361 HIS A NE2  2  
ATOM   3700  H  H    . HIS B 2 103 ? 11.009  5.165   -2.254  1.00 0.00 ? 361 HIS A H    2  
ATOM   3701  H  HA   . HIS B 2 103 ? 12.130  7.601   -1.260  1.00 0.00 ? 361 HIS A HA   2  
ATOM   3702  H  HB2  . HIS B 2 103 ? 13.374  7.646   -3.397  1.00 0.00 ? 361 HIS A HB2  2  
ATOM   3703  H  HB3  . HIS B 2 103 ? 13.644  6.200   -2.453  1.00 0.00 ? 361 HIS A HB3  2  
ATOM   3704  H  HD1  . HIS B 2 103 ? 14.089  4.428   -4.115  1.00 0.00 ? 361 HIS A HD1  2  
ATOM   3705  H  HD2  . HIS B 2 103 ? 10.863  6.792   -5.218  1.00 0.00 ? 361 HIS A HD2  2  
ATOM   3706  H  HE1  . HIS B 2 103 ? 13.190  3.408   -6.232  1.00 0.00 ? 361 HIS A HE1  2  
ATOM   3707  H  HE2  . HIS B 2 103 ? 11.236  4.852   -6.872  1.00 0.00 ? 361 HIS A HE2  2  
ATOM   3708  N  N    . LEU B 2 104 ? 9.840   7.633   -3.584  1.00 0.00 ? 362 LEU A N    2  
ATOM   3709  C  CA   . LEU B 2 104 ? 8.940   8.505   -4.331  1.00 0.00 ? 362 LEU A CA   2  
ATOM   3710  C  C    . LEU B 2 104 ? 8.305   9.541   -3.432  1.00 0.00 ? 362 LEU A C    2  
ATOM   3711  O  O    . LEU B 2 104 ? 8.363   10.744  -3.689  1.00 0.00 ? 362 LEU A O    2  
ATOM   3712  C  CB   . LEU B 2 104 ? 7.806   7.709   -4.982  1.00 0.00 ? 362 LEU A CB   2  
ATOM   3713  C  CG   . LEU B 2 104 ? 8.213   6.602   -5.934  1.00 0.00 ? 362 LEU A CG   2  
ATOM   3714  C  CD1  . LEU B 2 104 ? 6.979   5.946   -6.496  1.00 0.00 ? 362 LEU A CD1  2  
ATOM   3715  C  CD2  . LEU B 2 104 ? 9.091   7.131   -7.044  1.00 0.00 ? 362 LEU A CD2  2  
ATOM   3716  H  H    . LEU B 2 104 ? 9.706   6.662   -3.616  1.00 0.00 ? 362 LEU A H    2  
ATOM   3717  H  HA   . LEU B 2 104 ? 9.509   8.990   -5.098  1.00 0.00 ? 362 LEU A HA   2  
ATOM   3718  H  HB2  . LEU B 2 104 ? 7.210   7.265   -4.199  1.00 0.00 ? 362 LEU A HB2  2  
ATOM   3719  H  HB3  . LEU B 2 104 ? 7.186   8.399   -5.526  1.00 0.00 ? 362 LEU A HB3  2  
ATOM   3720  H  HG   . LEU B 2 104 ? 8.767   5.858   -5.389  1.00 0.00 ? 362 LEU A HG   2  
ATOM   3721  H  HD11 . LEU B 2 104 ? 6.527   5.341   -5.727  1.00 0.00 ? 362 LEU A HD11 2  
ATOM   3722  H  HD12 . LEU B 2 104 ? 7.251   5.323   -7.337  1.00 0.00 ? 362 LEU A HD12 2  
ATOM   3723  H  HD13 . LEU B 2 104 ? 6.281   6.704   -6.818  1.00 0.00 ? 362 LEU A HD13 2  
ATOM   3724  H  HD21 . LEU B 2 104 ? 10.116  7.020   -6.750  1.00 0.00 ? 362 LEU A HD21 2  
ATOM   3725  H  HD22 . LEU B 2 104 ? 8.872   8.175   -7.215  1.00 0.00 ? 362 LEU A HD22 2  
ATOM   3726  H  HD23 . LEU B 2 104 ? 8.910   6.569   -7.949  1.00 0.00 ? 362 LEU A HD23 2  
ATOM   3727  N  N    . CYS B 2 105 ? 7.743   9.051   -2.350  1.00 0.00 ? 363 CYS A N    2  
ATOM   3728  C  CA   . CYS B 2 105 ? 7.037   9.902   -1.402  1.00 0.00 ? 363 CYS A CA   2  
ATOM   3729  C  C    . CYS B 2 105 ? 7.971   10.723  -0.576  1.00 0.00 ? 363 CYS A C    2  
ATOM   3730  O  O    . CYS B 2 105 ? 7.650   11.840  -0.198  1.00 0.00 ? 363 CYS A O    2  
ATOM   3731  C  CB   . CYS B 2 105 ? 6.160   9.082   -0.462  1.00 0.00 ? 363 CYS A CB   2  
ATOM   3732  S  SG   . CYS B 2 105 ? 4.878   8.088   -1.309  1.00 0.00 ? 363 CYS A SG   2  
ATOM   3733  H  H    . CYS B 2 105 ? 7.836   8.089   -2.173  1.00 0.00 ? 363 CYS A H    2  
ATOM   3734  H  HA   . CYS B 2 105 ? 6.422   10.573  -1.961  1.00 0.00 ? 363 CYS A HA   2  
ATOM   3735  H  HB2  . CYS B 2 105 ? 6.791   8.429   0.126   1.00 0.00 ? 363 CYS A HB2  2  
ATOM   3736  H  HB3  . CYS B 2 105 ? 5.652   9.760   0.210   1.00 0.00 ? 363 CYS A HB3  2  
ATOM   3737  N  N    . TRP B 2 106 ? 9.101   10.153  -0.263  1.00 0.00 ? 364 TRP A N    2  
ATOM   3738  C  CA   . TRP B 2 106 ? 10.060  10.829  0.555   1.00 0.00 ? 364 TRP A CA   2  
ATOM   3739  C  C    . TRP B 2 106 ? 10.720  11.961  -0.133  1.00 0.00 ? 364 TRP A C    2  
ATOM   3740  O  O    . TRP B 2 106 ? 10.767  13.054  0.389   1.00 0.00 ? 364 TRP A O    2  
ATOM   3741  C  CB   . TRP B 2 106 ? 11.085  9.873   1.072   1.00 0.00 ? 364 TRP A CB   2  
ATOM   3742  C  CG   . TRP B 2 106 ? 10.964  9.819   2.523   1.00 0.00 ? 364 TRP A CG   2  
ATOM   3743  C  CD1  . TRP B 2 106 ? 9.812   9.660   3.187   1.00 0.00 ? 364 TRP A CD1  2  
ATOM   3744  C  CD2  . TRP B 2 106 ? 11.982  10.002  3.479   1.00 0.00 ? 364 TRP A CD2  2  
ATOM   3745  N  NE1  . TRP B 2 106 ? 10.028  9.694   4.520   1.00 0.00 ? 364 TRP A NE1  2  
ATOM   3746  C  CE2  . TRP B 2 106 ? 11.376  9.903   4.742   1.00 0.00 ? 364 TRP A CE2  2  
ATOM   3747  C  CE3  . TRP B 2 106 ? 13.347  10.222  3.384   1.00 0.00 ? 364 TRP A CE3  2  
ATOM   3748  C  CZ2  . TRP B 2 106 ? 12.109  10.027  5.919   1.00 0.00 ? 364 TRP A CZ2  2  
ATOM   3749  C  CZ3  . TRP B 2 106 ? 14.078  10.350  4.545   1.00 0.00 ? 364 TRP A CZ3  2  
ATOM   3750  C  CH2  . TRP B 2 106 ? 13.460  10.250  5.799   1.00 0.00 ? 364 TRP A CH2  2  
ATOM   3751  H  H    . TRP B 2 106 ? 9.299   9.264   -0.604  1.00 0.00 ? 364 TRP A H    2  
ATOM   3752  H  HA   . TRP B 2 106 ? 9.521   11.230  1.399   1.00 0.00 ? 364 TRP A HA   2  
ATOM   3753  H  HB2  . TRP B 2 106 ? 10.897  8.898   0.665   1.00 0.00 ? 364 TRP A HB2  2  
ATOM   3754  H  HB3  . TRP B 2 106 ? 12.077  10.209  0.815   1.00 0.00 ? 364 TRP A HB3  2  
ATOM   3755  H  HD1  . TRP B 2 106 ? 8.861   9.530   2.702   1.00 0.00 ? 364 TRP A HD1  2  
ATOM   3756  H  HE1  . TRP B 2 106 ? 9.336   9.586   5.186   1.00 0.00 ? 364 TRP A HE1  2  
ATOM   3757  H  HE3  . TRP B 2 106 ? 13.828  10.309  2.412   1.00 0.00 ? 364 TRP A HE3  2  
ATOM   3758  H  HZ2  . TRP B 2 106 ? 11.648  9.952   6.894   1.00 0.00 ? 364 TRP A HZ2  2  
ATOM   3759  H  HZ3  . TRP B 2 106 ? 15.143  10.525  4.496   1.00 0.00 ? 364 TRP A HZ3  2  
ATOM   3760  H  HH2  . TRP B 2 106 ? 14.072  10.364  6.679   1.00 0.00 ? 364 TRP A HH2  2  
ATOM   3761  N  N    . GLU B 2 107 ? 11.252  11.714  -1.287  1.00 0.00 ? 365 GLU A N    2  
ATOM   3762  C  CA   . GLU B 2 107 ? 11.899  12.778  -1.987  1.00 0.00 ? 365 GLU A CA   2  
ATOM   3763  C  C    . GLU B 2 107 ? 10.854  13.830  -2.294  1.00 0.00 ? 365 GLU A C    2  
ATOM   3764  O  O    . GLU B 2 107 ? 11.152  15.020  -2.416  1.00 0.00 ? 365 GLU A O    2  
ATOM   3765  C  CB   . GLU B 2 107 ? 12.596  12.253  -3.224  1.00 0.00 ? 365 GLU A CB   2  
ATOM   3766  C  CG   . GLU B 2 107 ? 11.661  11.748  -4.309  1.00 0.00 ? 365 GLU A CG   2  
ATOM   3767  C  CD   . GLU B 2 107 ? 12.264  11.853  -5.696  1.00 0.00 ? 365 GLU A CD   2  
ATOM   3768  O  OE1  . GLU B 2 107 ? 12.990  10.920  -6.101  1.00 0.00 ? 365 GLU A OE1  2  
ATOM   3769  O  OE2  . GLU B 2 107 ? 12.008  12.868  -6.378  1.00 0.00 ? 365 GLU A OE2  2  
ATOM   3770  H  H    . GLU B 2 107 ? 11.188  10.819  -1.679  1.00 0.00 ? 365 GLU A H    2  
ATOM   3771  H  HA   . GLU B 2 107 ? 12.632  13.196  -1.305  1.00 0.00 ? 365 GLU A HA   2  
ATOM   3772  H  HB2  . GLU B 2 107 ? 13.221  13.030  -3.640  1.00 0.00 ? 365 GLU A HB2  2  
ATOM   3773  H  HB3  . GLU B 2 107 ? 13.212  11.432  -2.902  1.00 0.00 ? 365 GLU A HB3  2  
ATOM   3774  H  HG2  . GLU B 2 107 ? 11.437  10.714  -4.112  1.00 0.00 ? 365 GLU A HG2  2  
ATOM   3775  H  HG3  . GLU B 2 107 ? 10.751  12.320  -4.281  1.00 0.00 ? 365 GLU A HG3  2  
ATOM   3776  N  N    . LEU B 2 108 ? 9.610   13.365  -2.389  1.00 0.00 ? 366 LEU A N    2  
ATOM   3777  C  CA   . LEU B 2 108 ? 8.488   14.245  -2.618  1.00 0.00 ? 366 LEU A CA   2  
ATOM   3778  C  C    . LEU B 2 108 ? 8.177   14.955  -1.315  1.00 0.00 ? 366 LEU A C    2  
ATOM   3779  O  O    . LEU B 2 108 ? 7.616   16.040  -1.297  1.00 0.00 ? 366 LEU A O    2  
ATOM   3780  C  CB   . LEU B 2 108 ? 7.292   13.463  -3.130  1.00 0.00 ? 366 LEU A CB   2  
ATOM   3781  C  CG   . LEU B 2 108 ? 6.254   14.254  -3.931  1.00 0.00 ? 366 LEU A CG   2  
ATOM   3782  C  CD1  . LEU B 2 108 ? 5.250   14.905  -3.005  1.00 0.00 ? 366 LEU A CD1  2  
ATOM   3783  C  CD2  . LEU B 2 108 ? 6.930   15.290  -4.798  1.00 0.00 ? 366 LEU A CD2  2  
ATOM   3784  H  H    . LEU B 2 108 ? 9.443   12.394  -2.289  1.00 0.00 ? 366 LEU A H    2  
ATOM   3785  H  HA   . LEU B 2 108 ? 8.777   14.959  -3.351  1.00 0.00 ? 366 LEU A HA   2  
ATOM   3786  H  HB2  . LEU B 2 108 ? 7.669   12.688  -3.762  1.00 0.00 ? 366 LEU A HB2  2  
ATOM   3787  H  HB3  . LEU B 2 108 ? 6.803   13.016  -2.288  1.00 0.00 ? 366 LEU A HB3  2  
ATOM   3788  H  HG   . LEU B 2 108 ? 5.725   13.580  -4.579  1.00 0.00 ? 366 LEU A HG   2  
ATOM   3789  H  HD11 . LEU B 2 108 ? 5.061   14.246  -2.173  1.00 0.00 ? 366 LEU A HD11 2  
ATOM   3790  H  HD12 . LEU B 2 108 ? 4.330   15.085  -3.541  1.00 0.00 ? 366 LEU A HD12 2  
ATOM   3791  H  HD13 . LEU B 2 108 ? 5.646   15.841  -2.642  1.00 0.00 ? 366 LEU A HD13 2  
ATOM   3792  H  HD21 . LEU B 2 108 ? 7.988   15.097  -4.790  1.00 0.00 ? 366 LEU A HD21 2  
ATOM   3793  H  HD22 . LEU B 2 108 ? 6.737   16.278  -4.405  1.00 0.00 ? 366 LEU A HD22 2  
ATOM   3794  H  HD23 . LEU B 2 108 ? 6.556   15.220  -5.809  1.00 0.00 ? 366 LEU A HD23 2  
ATOM   3795  N  N    . LEU B 2 109 ? 8.554   14.286  -0.230  1.00 0.00 ? 367 LEU A N    2  
ATOM   3796  C  CA   . LEU B 2 109 ? 8.379   14.771  1.131   1.00 0.00 ? 367 LEU A CA   2  
ATOM   3797  C  C    . LEU B 2 109 ? 9.300   15.936  1.377   1.00 0.00 ? 367 LEU A C    2  
ATOM   3798  O  O    . LEU B 2 109 ? 8.877   17.040  1.718   1.00 0.00 ? 367 LEU A O    2  
ATOM   3799  C  CB   . LEU B 2 109 ? 8.757   13.668  2.086   1.00 0.00 ? 367 LEU A CB   2  
ATOM   3800  C  CG   . LEU B 2 109 ? 7.798   13.383  3.219   1.00 0.00 ? 367 LEU A CG   2  
ATOM   3801  C  CD1  . LEU B 2 109 ? 6.998   12.140  2.887   1.00 0.00 ? 367 LEU A CD1  2  
ATOM   3802  C  CD2  . LEU B 2 109 ? 8.575   13.214  4.514   1.00 0.00 ? 367 LEU A CD2  2  
ATOM   3803  H  H    . LEU B 2 109 ? 8.999   13.421  -0.355  1.00 0.00 ? 367 LEU A H    2  
ATOM   3804  H  HA   . LEU B 2 109 ? 7.365   15.047  1.293   1.00 0.00 ? 367 LEU A HA   2  
ATOM   3805  H  HB2  . LEU B 2 109 ? 8.861   12.770  1.512   1.00 0.00 ? 367 LEU A HB2  2  
ATOM   3806  H  HB3  . LEU B 2 109 ? 9.710   13.915  2.508   1.00 0.00 ? 367 LEU A HB3  2  
ATOM   3807  H  HG   . LEU B 2 109 ? 7.116   14.209  3.330   1.00 0.00 ? 367 LEU A HG   2  
ATOM   3808  H  HD11 . LEU B 2 109 ? 7.378   11.719  1.962   1.00 0.00 ? 367 LEU A HD11 2  
ATOM   3809  H  HD12 . LEU B 2 109 ? 5.956   12.402  2.765   1.00 0.00 ? 367 LEU A HD12 2  
ATOM   3810  H  HD13 . LEU B 2 109 ? 7.100   11.419  3.682   1.00 0.00 ? 367 LEU A HD13 2  
ATOM   3811  H  HD21 . LEU B 2 109 ? 9.534   12.747  4.300   1.00 0.00 ? 367 LEU A HD21 2  
ATOM   3812  H  HD22 . LEU B 2 109 ? 8.014   12.593  5.196   1.00 0.00 ? 367 LEU A HD22 2  
ATOM   3813  H  HD23 . LEU B 2 109 ? 8.741   14.185  4.963   1.00 0.00 ? 367 LEU A HD23 2  
ATOM   3814  N  N    . LYS B 2 110 ? 10.582  15.647  1.206   1.00 0.00 ? 368 LYS A N    2  
ATOM   3815  C  CA   . LYS B 2 110 ? 11.626  16.632  1.384   1.00 0.00 ? 368 LYS A CA   2  
ATOM   3816  C  C    . LYS B 2 110 ? 11.290  17.852  0.547   1.00 0.00 ? 368 LYS A C    2  
ATOM   3817  O  O    . LYS B 2 110 ? 11.597  18.988  0.913   1.00 0.00 ? 368 LYS A O    2  
ATOM   3818  C  CB   . LYS B 2 110 ? 12.968  16.031  0.967   1.00 0.00 ? 368 LYS A CB   2  
ATOM   3819  C  CG   . LYS B 2 110 ? 13.010  14.523  1.147   1.00 0.00 ? 368 LYS A CG   2  
ATOM   3820  C  CD   . LYS B 2 110 ? 14.424  13.988  1.239   1.00 0.00 ? 368 LYS A CD   2  
ATOM   3821  C  CE   . LYS B 2 110 ? 14.429  12.476  1.311   1.00 0.00 ? 368 LYS A CE   2  
ATOM   3822  N  NZ   . LYS B 2 110 ? 14.384  11.847  -0.036  1.00 0.00 ? 368 LYS A NZ   2  
ATOM   3823  H  H    . LYS B 2 110 ? 10.827  14.731  0.936   1.00 0.00 ? 368 LYS A H    2  
ATOM   3824  H  HA   . LYS B 2 110 ? 11.658  16.903  2.429   1.00 0.00 ? 368 LYS A HA   2  
ATOM   3825  H  HB2  . LYS B 2 110 ? 13.141  16.254  -0.077  1.00 0.00 ? 368 LYS A HB2  2  
ATOM   3826  H  HB3  . LYS B 2 110 ? 13.755  16.470  1.562   1.00 0.00 ? 368 LYS A HB3  2  
ATOM   3827  H  HG2  . LYS B 2 110 ? 12.488  14.271  2.058   1.00 0.00 ? 368 LYS A HG2  2  
ATOM   3828  H  HG3  . LYS B 2 110 ? 12.508  14.058  0.306   1.00 0.00 ? 368 LYS A HG3  2  
ATOM   3829  H  HD2  . LYS B 2 110 ? 14.984  14.304  0.372   1.00 0.00 ? 368 LYS A HD2  2  
ATOM   3830  H  HD3  . LYS B 2 110 ? 14.881  14.373  2.131   1.00 0.00 ? 368 LYS A HD3  2  
ATOM   3831  H  HE2  . LYS B 2 110 ? 15.325  12.155  1.820   1.00 0.00 ? 368 LYS A HE2  2  
ATOM   3832  H  HE3  . LYS B 2 110 ? 13.560  12.162  1.877   1.00 0.00 ? 368 LYS A HE3  2  
ATOM   3833  H  HZ1  . LYS B 2 110 ? 15.280  12.012  -0.538  1.00 0.00 ? 368 LYS A HZ1  2  
ATOM   3834  H  HZ2  . LYS B 2 110 ? 13.609  12.252  -0.594  1.00 0.00 ? 368 LYS A HZ2  2  
ATOM   3835  H  HZ3  . LYS B 2 110 ? 14.233  10.821  0.053   1.00 0.00 ? 368 LYS A HZ3  2  
ATOM   3836  N  N    . GLU B 2 111 ? 10.650  17.591  -0.589  1.00 0.00 ? 369 GLU A N    2  
ATOM   3837  C  CA   . GLU B 2 111 ? 10.221  18.639  -1.491  1.00 0.00 ? 369 GLU A CA   2  
ATOM   3838  C  C    . GLU B 2 111 ? 8.957   19.319  -0.967  1.00 0.00 ? 369 GLU A C    2  
ATOM   3839  O  O    . GLU B 2 111 ? 8.813   20.537  -1.077  1.00 0.00 ? 369 GLU A O    2  
ATOM   3840  C  CB   . GLU B 2 111 ? 9.971   18.063  -2.879  1.00 0.00 ? 369 GLU A CB   2  
ATOM   3841  C  CG   . GLU B 2 111 ? 10.707  18.800  -3.980  1.00 0.00 ? 369 GLU A CG   2  
ATOM   3842  C  CD   . GLU B 2 111 ? 10.561  18.130  -5.332  1.00 0.00 ? 369 GLU A CD   2  
ATOM   3843  O  OE1  . GLU B 2 111 ? 9.523   18.345  -5.992  1.00 0.00 ? 369 GLU A OE1  2  
ATOM   3844  O  OE2  . GLU B 2 111 ? 11.484  17.388  -5.729  1.00 0.00 ? 369 GLU A OE2  2  
ATOM   3845  H  H    . GLU B 2 111 ? 10.485  16.656  -0.838  1.00 0.00 ? 369 GLU A H    2  
ATOM   3846  H  HA   . GLU B 2 111 ? 11.012  19.366  -1.554  1.00 0.00 ? 369 GLU A HA   2  
ATOM   3847  H  HB2  . GLU B 2 111 ? 10.297  17.039  -2.885  1.00 0.00 ? 369 GLU A HB2  2  
ATOM   3848  H  HB3  . GLU B 2 111 ? 8.913   18.101  -3.091  1.00 0.00 ? 369 GLU A HB3  2  
ATOM   3849  H  HG2  . GLU B 2 111 ? 10.316  19.804  -4.049  1.00 0.00 ? 369 GLU A HG2  2  
ATOM   3850  H  HG3  . GLU B 2 111 ? 11.755  18.839  -3.724  1.00 0.00 ? 369 GLU A HG3  2  
ATOM   3851  N  N    . LYS B 2 112 ? 8.037   18.530  -0.396  1.00 0.00 ? 370 LYS A N    2  
ATOM   3852  C  CA   . LYS B 2 112 ? 6.806   19.064  0.134   1.00 0.00 ? 370 LYS A CA   2  
ATOM   3853  C  C    . LYS B 2 112 ? 7.061   20.129  1.192   1.00 0.00 ? 370 LYS A C    2  
ATOM   3854  O  O    . LYS B 2 112 ? 6.230   21.008  1.417   1.00 0.00 ? 370 LYS A O    2  
ATOM   3855  C  CB   . LYS B 2 112 ? 5.997   17.941  0.738   1.00 0.00 ? 370 LYS A CB   2  
ATOM   3856  C  CG   . LYS B 2 112 ? 5.158   17.190  -0.270  1.00 0.00 ? 370 LYS A CG   2  
ATOM   3857  C  CD   . LYS B 2 112 ? 5.021   15.733  0.102   1.00 0.00 ? 370 LYS A CD   2  
ATOM   3858  C  CE   . LYS B 2 112 ? 4.539   15.553  1.528   1.00 0.00 ? 370 LYS A CE   2  
ATOM   3859  N  NZ   . LYS B 2 112 ? 3.144   16.040  1.710   1.00 0.00 ? 370 LYS A NZ   2  
ATOM   3860  H  H    . LYS B 2 112 ? 8.177   17.557  -0.340  1.00 0.00 ? 370 LYS A H    2  
ATOM   3861  H  HA   . LYS B 2 112 ? 6.258   19.477  -0.684  1.00 0.00 ? 370 LYS A HA   2  
ATOM   3862  H  HB2  . LYS B 2 112 ? 6.675   17.247  1.188   1.00 0.00 ? 370 LYS A HB2  2  
ATOM   3863  H  HB3  . LYS B 2 112 ? 5.350   18.341  1.491   1.00 0.00 ? 370 LYS A HB3  2  
ATOM   3864  H  HG2  . LYS B 2 112 ? 4.180   17.638  -0.333  1.00 0.00 ? 370 LYS A HG2  2  
ATOM   3865  H  HG3  . LYS B 2 112 ? 5.652   17.249  -1.219  1.00 0.00 ? 370 LYS A HG3  2  
ATOM   3866  H  HD2  . LYS B 2 112 ? 4.318   15.262  -0.570  1.00 0.00 ? 370 LYS A HD2  2  
ATOM   3867  H  HD3  . LYS B 2 112 ? 5.991   15.277  -0.009  1.00 0.00 ? 370 LYS A HD3  2  
ATOM   3868  H  HE2  . LYS B 2 112 ? 4.583   14.504  1.781   1.00 0.00 ? 370 LYS A HE2  2  
ATOM   3869  H  HE3  . LYS B 2 112 ? 5.194   16.108  2.178   1.00 0.00 ? 370 LYS A HE3  2  
ATOM   3870  H  HZ1  . LYS B 2 112 ? 3.104   17.070  1.568   1.00 0.00 ? 370 LYS A HZ1  2  
ATOM   3871  H  HZ2  . LYS B 2 112 ? 2.811   15.820  2.671   1.00 0.00 ? 370 LYS A HZ2  2  
ATOM   3872  H  HZ3  . LYS B 2 112 ? 2.511   15.581  1.023   1.00 0.00 ? 370 LYS A HZ3  2  
ATOM   3873  N  N    . ALA B 2 113 ? 8.220   20.036  1.843   1.00 0.00 ? 371 ALA A N    2  
ATOM   3874  C  CA   . ALA B 2 113 ? 8.592   20.968  2.892   1.00 0.00 ? 371 ALA A CA   2  
ATOM   3875  C  C    . ALA B 2 113 ? 8.688   22.392  2.377   1.00 0.00 ? 371 ALA A C    2  
ATOM   3876  O  O    . ALA B 2 113 ? 8.197   22.721  1.296   1.00 0.00 ? 371 ALA A O    2  
ATOM   3877  C  CB   . ALA B 2 113 ? 9.921   20.557  3.493   1.00 0.00 ? 371 ALA A CB   2  
ATOM   3878  H  H    . ALA B 2 113 ? 8.848   19.325  1.602   1.00 0.00 ? 371 ALA A H    2  
ATOM   3879  H  HA   . ALA B 2 113 ? 7.849   20.922  3.670   1.00 0.00 ? 371 ALA A HA   2  
ATOM   3880  H  HB1  . ALA B 2 113 ? 10.716  20.996  2.911   1.00 0.00 ? 371 ALA A HB1  2  
ATOM   3881  H  HB2  . ALA B 2 113 ? 10.010  19.481  3.475   1.00 0.00 ? 371 ALA A HB2  2  
ATOM   3882  H  HB3  . ALA B 2 113 ? 9.982   20.909  4.512   1.00 0.00 ? 371 ALA A HB3  2  
ATOM   3883  N  N    . SER B 2 114 ? 9.327   23.228  3.178   1.00 0.00 ? 372 SER A N    2  
ATOM   3884  C  CA   . SER B 2 114 ? 9.529   24.628  2.848   1.00 0.00 ? 372 SER A CA   2  
ATOM   3885  C  C    . SER B 2 114 ? 8.203   25.381  2.805   1.00 0.00 ? 372 SER A C    2  
ATOM   3886  O  O    . SER B 2 114 ? 7.566   25.397  1.731   1.00 0.00 ? 372 SER A O    2  
ATOM   3887  C  CB   . SER B 2 114 ? 10.258  24.763  1.510   1.00 0.00 ? 372 SER A CB   2  
ATOM   3888  O  OG   . SER B 2 114 ? 10.574  26.117  1.235   1.00 0.00 ? 372 SER A OG   2  
ATOM   3889  O  OXT  . SER B 2 114 ? 7.812   25.947  3.847   1.00 0.00 ? 372 SER A OXT  2  
ATOM   3890  H  H    . SER B 2 114 ? 9.668   22.887  4.030   1.00 0.00 ? 372 SER A H    2  
ATOM   3891  H  HA   . SER B 2 114 ? 10.147  25.050  3.623   1.00 0.00 ? 372 SER A HA   2  
ATOM   3892  H  HB2  . SER B 2 114 ? 11.173  24.192  1.543   1.00 0.00 ? 372 SER A HB2  2  
ATOM   3893  H  HB3  . SER B 2 114 ? 9.626   24.386  0.719   1.00 0.00 ? 372 SER A HB3  2  
ATOM   3894  H  HG   . SER B 2 114 ? 11.434  26.328  1.607   1.00 0.00 ? 372 SER A HG   2  
HETATM 3895  ZN ZN   . ZN  C 3 .   ? -14.084 -0.899  4.011   1.00 0.00 ? 501 ZN  A ZN   2  
HETATM 3896  ZN ZN   . ZN  D 3 .   ? -4.008  -6.911  -8.116  1.00 0.00 ? 601 ZN  A ZN   2  
HETATM 3897  ZN ZN   . ZN  E 3 .   ? 5.544   5.883   -1.635  1.00 0.00 ? 701 ZN  A ZN   2  
HETATM 3898  ZN ZN   . ZN  F 3 .   ? 13.453  -5.909  -4.932  1.00 0.00 ? 801 ZN  A ZN   2  
ATOM   3899  N  N    . GLY A 1 1   ? -17.564 -9.219  13.624  1.00 0.00 ? 9   GLY B N    3  
ATOM   3900  C  CA   . GLY A 1 1   ? -16.421 -8.270  13.733  1.00 0.00 ? 9   GLY B CA   3  
ATOM   3901  C  C    . GLY A 1 1   ? -15.216 -8.890  14.414  1.00 0.00 ? 9   GLY B C    3  
ATOM   3902  O  O    . GLY A 1 1   ? -14.761 -8.402  15.448  1.00 0.00 ? 9   GLY B O    3  
ATOM   3903  H  H1   . GLY A 1 1   ? -18.364 -8.759  13.145  1.00 0.00 ? 9   GLY B H1   3  
ATOM   3904  H  H2   . GLY A 1 1   ? -17.868 -9.523  14.570  1.00 0.00 ? 9   GLY B H2   3  
ATOM   3905  H  H3   . GLY A 1 1   ? -17.282 -10.058 13.076  1.00 0.00 ? 9   GLY B H3   3  
ATOM   3906  H  HA2  . GLY A 1 1   ? -16.135 -7.951  12.741  1.00 0.00 ? 9   GLY B HA2  3  
ATOM   3907  H  HA3  . GLY A 1 1   ? -16.736 -7.408  14.300  1.00 0.00 ? 9   GLY B HA3  3  
ATOM   3908  N  N    . LEU A 1 2   ? -14.701 -9.968  13.831  1.00 0.00 ? 10  LEU B N    3  
ATOM   3909  C  CA   . LEU A 1 2   ? -13.541 -10.659 14.387  1.00 0.00 ? 10  LEU B CA   3  
ATOM   3910  C  C    . LEU A 1 2   ? -12.255 -9.904  14.064  1.00 0.00 ? 10  LEU B C    3  
ATOM   3911  O  O    . LEU A 1 2   ? -11.583 -9.394  14.960  1.00 0.00 ? 10  LEU B O    3  
ATOM   3912  C  CB   . LEU A 1 2   ? -13.456 -12.088 13.842  1.00 0.00 ? 10  LEU B CB   3  
ATOM   3913  C  CG   . LEU A 1 2   ? -14.508 -13.062 14.383  1.00 0.00 ? 10  LEU B CG   3  
ATOM   3914  C  CD1  . LEU A 1 2   ? -15.893 -12.705 13.867  1.00 0.00 ? 10  LEU B CD1  3  
ATOM   3915  C  CD2  . LEU A 1 2   ? -14.151 -14.492 14.005  1.00 0.00 ? 10  LEU B CD2  3  
ATOM   3916  H  H    . LEU A 1 2   ? -15.109 -10.307 13.008  1.00 0.00 ? 10  LEU B H    3  
ATOM   3917  H  HA   . LEU A 1 2   ? -13.661 -10.698 15.459  1.00 0.00 ? 10  LEU B HA   3  
ATOM   3918  H  HB2  . LEU A 1 2   ? -13.555 -12.046 12.767  1.00 0.00 ? 10  LEU B HB2  3  
ATOM   3919  H  HB3  . LEU A 1 2   ? -12.479 -12.482 14.079  1.00 0.00 ? 10  LEU B HB3  3  
ATOM   3920  H  HG   . LEU A 1 2   ? -14.528 -12.997 15.461  1.00 0.00 ? 10  LEU B HG   3  
ATOM   3921  H  HD11 . LEU A 1 2   ? -16.608 -13.432 14.220  1.00 0.00 ? 10  LEU B HD11 3  
ATOM   3922  H  HD12 . LEU A 1 2   ? -15.886 -12.701 12.787  1.00 0.00 ? 10  LEU B HD12 3  
ATOM   3923  H  HD13 . LEU A 1 2   ? -16.168 -11.724 14.227  1.00 0.00 ? 10  LEU B HD13 3  
ATOM   3924  H  HD21 . LEU A 1 2   ? -13.180 -14.740 14.409  1.00 0.00 ? 10  LEU B HD21 3  
ATOM   3925  H  HD22 . LEU A 1 2   ? -14.127 -14.585 12.929  1.00 0.00 ? 10  LEU B HD22 3  
ATOM   3926  H  HD23 . LEU A 1 2   ? -14.891 -15.166 14.408  1.00 0.00 ? 10  LEU B HD23 3  
ATOM   3927  N  N    . GLY A 1 3   ? -11.920 -9.838  12.780  1.00 0.00 ? 11  GLY B N    3  
ATOM   3928  C  CA   . GLY A 1 3   ? -10.716 -9.145  12.362  1.00 0.00 ? 11  GLY B CA   3  
ATOM   3929  C  C    . GLY A 1 3   ? -9.456  -9.923  12.692  1.00 0.00 ? 11  GLY B C    3  
ATOM   3930  O  O    . GLY A 1 3   ? -9.250  -10.325 13.837  1.00 0.00 ? 11  GLY B O    3  
ATOM   3931  H  H    . GLY A 1 3   ? -12.496 -10.263 12.110  1.00 0.00 ? 11  GLY B H    3  
ATOM   3932  H  HA2  . GLY A 1 3   ? -10.758 -8.984  11.296  1.00 0.00 ? 11  GLY B HA2  3  
ATOM   3933  H  HA3  . GLY A 1 3   ? -10.674 -8.186  12.859  1.00 0.00 ? 11  GLY B HA3  3  
ATOM   3934  N  N    . LYS A 1 4   ? -8.614  -10.132 11.686  1.00 0.00 ? 12  LYS B N    3  
ATOM   3935  C  CA   . LYS A 1 4   ? -7.368  -10.868 11.871  1.00 0.00 ? 12  LYS B CA   3  
ATOM   3936  C  C    . LYS A 1 4   ? -6.358  -10.037 12.657  1.00 0.00 ? 12  LYS B C    3  
ATOM   3937  O  O    . LYS A 1 4   ? -5.973  -10.398 13.769  1.00 0.00 ? 12  LYS B O    3  
ATOM   3938  C  CB   . LYS A 1 4   ? -6.777  -11.260 10.515  1.00 0.00 ? 12  LYS B CB   3  
ATOM   3939  C  CG   . LYS A 1 4   ? -7.712  -12.098 9.656   1.00 0.00 ? 12  LYS B CG   3  
ATOM   3940  C  CD   . LYS A 1 4   ? -8.025  -13.444 10.296  1.00 0.00 ? 12  LYS B CD   3  
ATOM   3941  C  CE   . LYS A 1 4   ? -6.865  -14.421 10.160  1.00 0.00 ? 12  LYS B CE   3  
ATOM   3942  N  NZ   . LYS A 1 4   ? -5.733  -14.082 11.066  1.00 0.00 ? 12  LYS B NZ   3  
ATOM   3943  H  H    . LYS A 1 4   ? -8.835  -9.785  10.797  1.00 0.00 ? 12  LYS B H    3  
ATOM   3944  H  HA   . LYS A 1 4   ? -7.592  -11.764 12.429  1.00 0.00 ? 12  LYS B HA   3  
ATOM   3945  H  HB2  . LYS A 1 4   ? -6.533  -10.360 9.970   1.00 0.00 ? 12  LYS B HB2  3  
ATOM   3946  H  HB3  . LYS A 1 4   ? -5.872  -11.824 10.680  1.00 0.00 ? 12  LYS B HB3  3  
ATOM   3947  H  HG2  . LYS A 1 4   ? -8.636  -11.557 9.517   1.00 0.00 ? 12  LYS B HG2  3  
ATOM   3948  H  HG3  . LYS A 1 4   ? -7.246  -12.267 8.696   1.00 0.00 ? 12  LYS B HG3  3  
ATOM   3949  H  HD2  . LYS A 1 4   ? -8.230  -13.293 11.345  1.00 0.00 ? 12  LYS B HD2  3  
ATOM   3950  H  HD3  . LYS A 1 4   ? -8.895  -13.865 9.816   1.00 0.00 ? 12  LYS B HD3  3  
ATOM   3951  H  HE2  . LYS A 1 4   ? -7.218  -15.413 10.397  1.00 0.00 ? 12  LYS B HE2  3  
ATOM   3952  H  HE3  . LYS A 1 4   ? -6.515  -14.400 9.138   1.00 0.00 ? 12  LYS B HE3  3  
ATOM   3953  H  HZ1  . LYS A 1 4   ? -5.032  -14.850 11.064  1.00 0.00 ? 12  LYS B HZ1  3  
ATOM   3954  H  HZ2  . LYS A 1 4   ? -6.080  -13.946 12.037  1.00 0.00 ? 12  LYS B HZ2  3  
ATOM   3955  H  HZ3  . LYS A 1 4   ? -5.271  -13.206 10.750  1.00 0.00 ? 12  LYS B HZ3  3  
ATOM   3956  N  N    . GLY A 1 5   ? -5.934  -8.922  12.069  1.00 0.00 ? 13  GLY B N    3  
ATOM   3957  C  CA   . GLY A 1 5   ? -4.972  -8.056  12.725  1.00 0.00 ? 13  GLY B CA   3  
ATOM   3958  C  C    . GLY A 1 5   ? -4.055  -7.359  11.739  1.00 0.00 ? 13  GLY B C    3  
ATOM   3959  O  O    . GLY A 1 5   ? -3.958  -6.131  11.733  1.00 0.00 ? 13  GLY B O    3  
ATOM   3960  H  H    . GLY A 1 5   ? -6.277  -8.686  11.181  1.00 0.00 ? 13  GLY B H    3  
ATOM   3961  H  HA2  . GLY A 1 5   ? -5.506  -7.309  13.294  1.00 0.00 ? 13  GLY B HA2  3  
ATOM   3962  H  HA3  . GLY A 1 5   ? -4.373  -8.647  13.401  1.00 0.00 ? 13  GLY B HA3  3  
ATOM   3963  N  N    . GLY A 1 6   ? -3.384  -8.144  10.903  1.00 0.00 ? 14  GLY B N    3  
ATOM   3964  C  CA   . GLY A 1 6   ? -2.479  -7.581  9.918   1.00 0.00 ? 14  GLY B CA   3  
ATOM   3965  C  C    . GLY A 1 6   ? -2.142  -8.562  8.813   1.00 0.00 ? 14  GLY B C    3  
ATOM   3966  O  O    . GLY A 1 6   ? -0.996  -8.995  8.687   1.00 0.00 ? 14  GLY B O    3  
ATOM   3967  H  H    . GLY A 1 6   ? -3.504  -9.115  10.956  1.00 0.00 ? 14  GLY B H    3  
ATOM   3968  H  HA2  . GLY A 1 6   ? -2.939  -6.708  9.481   1.00 0.00 ? 14  GLY B HA2  3  
ATOM   3969  H  HA3  . GLY A 1 6   ? -1.565  -7.284  10.412  1.00 0.00 ? 14  GLY B HA3  3  
ATOM   3970  N  N    . ALA A 1 7   ? -3.142  -8.912  8.009   1.00 0.00 ? 15  ALA B N    3  
ATOM   3971  C  CA   . ALA A 1 7   ? -2.948  -9.848  6.908   1.00 0.00 ? 15  ALA B CA   3  
ATOM   3972  C  C    . ALA A 1 7   ? -3.665  -9.371  5.649   1.00 0.00 ? 15  ALA B C    3  
ATOM   3973  O  O    . ALA A 1 7   ? -3.402  -9.862  4.551   1.00 0.00 ? 15  ALA B O    3  
ATOM   3974  C  CB   . ALA A 1 7   ? -3.438  -11.234 7.302   1.00 0.00 ? 15  ALA B CB   3  
ATOM   3975  H  H    . ALA A 1 7   ? -4.031  -8.529  8.160   1.00 0.00 ? 15  ALA B H    3  
ATOM   3976  H  HA   . ALA A 1 7   ? -1.889  -9.911  6.706   1.00 0.00 ? 15  ALA B HA   3  
ATOM   3977  H  HB1  . ALA A 1 7   ? -2.928  -11.554 8.198   1.00 0.00 ? 15  ALA B HB1  3  
ATOM   3978  H  HB2  . ALA A 1 7   ? -3.230  -11.929 6.502   1.00 0.00 ? 15  ALA B HB2  3  
ATOM   3979  H  HB3  . ALA A 1 7   ? -4.501  -11.201 7.484   1.00 0.00 ? 15  ALA B HB3  3  
HETATM 3980  O  OH   . ALY A 1 8   ? -6.047  -6.330  0.316   1.00 0.00 ? 16  ALY B OH   3  
HETATM 3981  C  CH   . ALY A 1 8   ? -7.142  -6.381  -0.245  1.00 0.00 ? 16  ALY B CH   3  
HETATM 3982  C  CH3  . ALY A 1 8   ? -7.294  -5.613  -1.560  1.00 0.00 ? 16  ALY B CH3  3  
HETATM 3983  N  NZ   . ALY A 1 8   ? -8.247  -6.635  0.447   1.00 0.00 ? 16  ALY B NZ   3  
HETATM 3984  C  CE   . ALY A 1 8   ? -8.363  -6.245  1.848   1.00 0.00 ? 16  ALY B CE   3  
HETATM 3985  C  CD   . ALY A 1 8   ? -7.636  -7.200  2.786   1.00 0.00 ? 16  ALY B CD   3  
HETATM 3986  C  CG   . ALY A 1 8   ? -7.489  -6.591  4.175   1.00 0.00 ? 16  ALY B CG   3  
HETATM 3987  C  CB   . ALY A 1 8   ? -6.747  -7.510  5.136   1.00 0.00 ? 16  ALY B CB   3  
HETATM 3988  C  CA   . ALY A 1 8   ? -5.325  -7.871  4.692   1.00 0.00 ? 16  ALY B CA   3  
HETATM 3989  N  N    . ALY A 1 8   ? -4.570  -8.413  5.817   1.00 0.00 ? 16  ALY B N    3  
HETATM 3990  C  C    . ALY A 1 8   ? -4.619  -6.655  4.095   1.00 0.00 ? 16  ALY B C    3  
HETATM 3991  O  O    . ALY A 1 8   ? -4.708  -6.410  2.893   1.00 0.00 ? 16  ALY B O    3  
HETATM 3992  H  HH31 . ALY A 1 8   ? -8.262  -5.820  -1.989  1.00 0.00 ? 16  ALY B HH31 3  
HETATM 3993  H  HH32 . ALY A 1 8   ? -7.204  -4.553  -1.363  1.00 0.00 ? 16  ALY B HH32 3  
HETATM 3994  H  HH33 . ALY A 1 8   ? -6.519  -5.918  -2.248  1.00 0.00 ? 16  ALY B HH33 3  
HETATM 3995  H  HZ   . ALY A 1 8   ? -9.087  -6.678  -0.053  1.00 0.00 ? 16  ALY B HZ   3  
HETATM 3996  H  HE3  . ALY A 1 8   ? -7.945  -5.252  1.968   1.00 0.00 ? 16  ALY B HE3  3  
HETATM 3997  H  HE2  . ALY A 1 8   ? -9.409  -6.226  2.117   1.00 0.00 ? 16  ALY B HE2  3  
HETATM 3998  H  HD3  . ALY A 1 8   ? -8.200  -8.117  2.862   1.00 0.00 ? 16  ALY B HD3  3  
HETATM 3999  H  HD2  . ALY A 1 8   ? -6.656  -7.407  2.386   1.00 0.00 ? 16  ALY B HD2  3  
HETATM 4000  H  HG3  . ALY A 1 8   ? -6.944  -5.662  4.093   1.00 0.00 ? 16  ALY B HG3  3  
HETATM 4001  H  HG2  . ALY A 1 8   ? -8.473  -6.396  4.572   1.00 0.00 ? 16  ALY B HG2  3  
HETATM 4002  H  HB3  . ALY A 1 8   ? -6.695  -7.020  6.098   1.00 0.00 ? 16  ALY B HB3  3  
HETATM 4003  H  HB2  . ALY A 1 8   ? -7.319  -8.419  5.238   1.00 0.00 ? 16  ALY B HB2  3  
HETATM 4004  H  HCA  . ALY A 1 8   ? -5.382  -8.639  3.936   1.00 0.00 ? 16  ALY B HCA  3  
HETATM 4005  H  H    . ALY A 1 8   ? -4.736  -8.063  6.716   1.00 0.00 ? 16  ALY B H    3  
ATOM   4006  N  N    . ARG A 1 9   ? -3.921  -5.896  4.940   1.00 0.00 ? 17  ARG B N    3  
ATOM   4007  C  CA   . ARG A 1 9   ? -3.191  -4.718  4.478   1.00 0.00 ? 17  ARG B CA   3  
ATOM   4008  C  C    . ARG A 1 9   ? -2.263  -5.097  3.325   1.00 0.00 ? 17  ARG B C    3  
ATOM   4009  O  O    . ARG A 1 9   ? -2.656  -5.056  2.159   1.00 0.00 ? 17  ARG B O    3  
ATOM   4010  C  CB   . ARG A 1 9   ? -2.385  -4.102  5.631   1.00 0.00 ? 17  ARG B CB   3  
ATOM   4011  C  CG   . ARG A 1 9   ? -1.410  -3.014  5.196   1.00 0.00 ? 17  ARG B CG   3  
ATOM   4012  C  CD   . ARG A 1 9   ? -2.096  -1.666  5.045   1.00 0.00 ? 17  ARG B CD   3  
ATOM   4013  N  NE   . ARG A 1 9   ? -2.229  -0.977  6.327   1.00 0.00 ? 17  ARG B NE   3  
ATOM   4014  C  CZ   . ARG A 1 9   ? -1.238  -0.303  6.908   1.00 0.00 ? 17  ARG B CZ   3  
ATOM   4015  N  NH1  . ARG A 1 9   ? -0.046  -0.236  6.328   1.00 0.00 ? 17  ARG B NH1  3  
ATOM   4016  N  NH2  . ARG A 1 9   ? -1.435  0.302   8.071   1.00 0.00 ? 17  ARG B NH2  3  
ATOM   4017  H  H    . ARG A 1 9   ? -3.899  -6.131  5.891   1.00 0.00 ? 17  ARG B H    3  
ATOM   4018  H  HA   . ARG A 1 9   ? -3.912  -3.996  4.125   1.00 0.00 ? 17  ARG B HA   3  
ATOM   4019  H  HB2  . ARG A 1 9   ? -3.072  -3.673  6.346   1.00 0.00 ? 17  ARG B HB2  3  
ATOM   4020  H  HB3  . ARG A 1 9   ? -1.821  -4.886  6.117   1.00 0.00 ? 17  ARG B HB3  3  
ATOM   4021  H  HG2  . ARG A 1 9   ? -0.633  -2.926  5.940   1.00 0.00 ? 17  ARG B HG2  3  
ATOM   4022  H  HG3  . ARG A 1 9   ? -0.971  -3.295  4.249   1.00 0.00 ? 17  ARG B HG3  3  
ATOM   4023  H  HD2  . ARG A 1 9   ? -1.512  -1.051  4.374   1.00 0.00 ? 17  ARG B HD2  3  
ATOM   4024  H  HD3  . ARG A 1 9   ? -3.079  -1.822  4.626   1.00 0.00 ? 17  ARG B HD3  3  
ATOM   4025  H  HE   . ARG A 1 9   ? -3.099  -1.017  6.775   1.00 0.00 ? 17  ARG B HE   3  
ATOM   4026  H  HH11 . ARG A 1 9   ? 0.109   -0.691  5.452   1.00 0.00 ? 17  ARG B HH11 3  
ATOM   4027  H  HH12 . ARG A 1 9   ? 0.695   0.271   6.767   1.00 0.00 ? 17  ARG B HH12 3  
ATOM   4028  H  HH21 . ARG A 1 9   ? -2.329  0.253   8.513   1.00 0.00 ? 17  ARG B HH21 3  
ATOM   4029  H  HH22 . ARG A 1 9   ? -0.688  0.807   8.504   1.00 0.00 ? 17  ARG B HH22 3  
ATOM   4030  N  N    . HIS A 1 10  ? -1.034  -5.474  3.662   1.00 0.00 ? 18  HIS B N    3  
ATOM   4031  C  CA   . HIS A 1 10  ? -0.052  -5.880  2.668   1.00 0.00 ? 18  HIS B CA   3  
ATOM   4032  C  C    . HIS A 1 10  ? 0.735   -7.080  3.184   1.00 0.00 ? 18  HIS B C    3  
ATOM   4033  O  O    . HIS A 1 10  ? 0.231   -7.859  3.995   1.00 0.00 ? 18  HIS B O    3  
ATOM   4034  C  CB   . HIS A 1 10  ? 0.921   -4.735  2.343   1.00 0.00 ? 18  HIS B CB   3  
ATOM   4035  C  CG   . HIS A 1 10  ? 0.271   -3.420  2.034   1.00 0.00 ? 18  HIS B CG   3  
ATOM   4036  N  ND1  . HIS A 1 10  ? 0.677   -2.233  2.607   1.00 0.00 ? 18  HIS B ND1  3  
ATOM   4037  C  CD2  . HIS A 1 10  ? -0.743  -3.097  1.194   1.00 0.00 ? 18  HIS B CD2  3  
ATOM   4038  C  CE1  . HIS A 1 10  ? -0.057  -1.242  2.137   1.00 0.00 ? 18  HIS B CE1  3  
ATOM   4039  N  NE2  . HIS A 1 10  ? -0.925  -1.740  1.277   1.00 0.00 ? 18  HIS B NE2  3  
ATOM   4040  H  H    . HIS A 1 10  ? -0.782  -5.483  4.609   1.00 0.00 ? 18  HIS B H    3  
ATOM   4041  H  HA   . HIS A 1 10  ? -0.580  -6.163  1.772   1.00 0.00 ? 18  HIS B HA   3  
ATOM   4042  H  HB2  . HIS A 1 10  ? 1.576   -4.588  3.182   1.00 0.00 ? 18  HIS B HB2  3  
ATOM   4043  H  HB3  . HIS A 1 10  ? 1.515   -5.017  1.487   1.00 0.00 ? 18  HIS B HB3  3  
ATOM   4044  H  HD1  . HIS A 1 10  ? 1.399   -2.133  3.262   1.00 0.00 ? 18  HIS B HD1  3  
ATOM   4045  H  HD2  . HIS A 1 10  ? -1.299  -3.780  0.571   1.00 0.00 ? 18  HIS B HD2  3  
ATOM   4046  H  HE1  . HIS A 1 10  ? 0.038   -0.202  2.407   1.00 0.00 ? 18  HIS B HE1  3  
ATOM   4047  H  HE2  . HIS A 1 10  ? -1.533  -1.212  0.719   1.00 0.00 ? 18  HIS B HE2  3  
ATOM   4048  N  N    . ARG A 1 11  ? 1.963   -7.227  2.696   1.00 0.00 ? 19  ARG B N    3  
ATOM   4049  C  CA   . ARG A 1 11  ? 2.847   -8.312  3.110   1.00 0.00 ? 19  ARG B CA   3  
ATOM   4050  C  C    . ARG A 1 11  ? 2.371   -9.672  2.608   1.00 0.00 ? 19  ARG B C    3  
ATOM   4051  O  O    . ARG A 1 11  ? 3.100   -10.659 2.696   1.00 0.00 ? 19  ARG B O    3  
ATOM   4052  C  CB   . ARG A 1 11  ? 2.994   -8.321  4.629   1.00 0.00 ? 19  ARG B CB   3  
ATOM   4053  C  CG   . ARG A 1 11  ? 4.075   -9.259  5.147   1.00 0.00 ? 19  ARG B CG   3  
ATOM   4054  C  CD   . ARG A 1 11  ? 5.465   -8.806  4.730   1.00 0.00 ? 19  ARG B CD   3  
ATOM   4055  N  NE   . ARG A 1 11  ? 6.504   -9.709  5.222   1.00 0.00 ? 19  ARG B NE   3  
ATOM   4056  C  CZ   . ARG A 1 11  ? 7.583   -9.303  5.886   1.00 0.00 ? 19  ARG B CZ   3  
ATOM   4057  N  NH1  . ARG A 1 11  ? 7.760   -8.016  6.154   1.00 0.00 ? 19  ARG B NH1  3  
ATOM   4058  N  NH2  . ARG A 1 11  ? 8.484   -10.189 6.289   1.00 0.00 ? 19  ARG B NH2  3  
ATOM   4059  H  H    . ARG A 1 11  ? 2.287   -6.584  2.032   1.00 0.00 ? 19  ARG B H    3  
ATOM   4060  H  HA   . ARG A 1 11  ? 3.808   -8.116  2.673   1.00 0.00 ? 19  ARG B HA   3  
ATOM   4061  H  HB2  . ARG A 1 11  ? 3.228   -7.319  4.952   1.00 0.00 ? 19  ARG B HB2  3  
ATOM   4062  H  HB3  . ARG A 1 11  ? 2.052   -8.617  5.065   1.00 0.00 ? 19  ARG B HB3  3  
ATOM   4063  H  HG2  . ARG A 1 11  ? 4.026   -9.287  6.224   1.00 0.00 ? 19  ARG B HG2  3  
ATOM   4064  H  HG3  . ARG A 1 11  ? 3.895   -10.249 4.753   1.00 0.00 ? 19  ARG B HG3  3  
ATOM   4065  H  HD2  . ARG A 1 11  ? 5.511   -8.776  3.651   1.00 0.00 ? 19  ARG B HD2  3  
ATOM   4066  H  HD3  . ARG A 1 11  ? 5.642   -7.817  5.125   1.00 0.00 ? 19  ARG B HD3  3  
ATOM   4067  H  HE   . ARG A 1 11  ? 6.392   -10.666 5.044   1.00 0.00 ? 19  ARG B HE   3  
ATOM   4068  H  HH11 . ARG A 1 11  ? 7.081   -7.345  5.857   1.00 0.00 ? 19  ARG B HH11 3  
ATOM   4069  H  HH12 . ARG A 1 11  ? 8.574   -7.718  6.654   1.00 0.00 ? 19  ARG B HH12 3  
ATOM   4070  H  HH21 . ARG A 1 11  ? 8.353   -11.161 6.094   1.00 0.00 ? 19  ARG B HH21 3  
ATOM   4071  H  HH22 . ARG A 1 11  ? 9.296   -9.885  6.788   1.00 0.00 ? 19  ARG B HH22 3  
ATOM   4072  N  N    . LYS A 1 12  ? 1.150   -9.710  2.082   1.00 0.00 ? 20  LYS B N    3  
ATOM   4073  C  CA   . LYS A 1 12  ? 0.563   -10.935 1.538   1.00 0.00 ? 20  LYS B CA   3  
ATOM   4074  C  C    . LYS A 1 12  ? 0.863   -12.161 2.402   1.00 0.00 ? 20  LYS B C    3  
ATOM   4075  O  O    . LYS A 1 12  ? 1.141   -12.041 3.596   1.00 0.00 ? 20  LYS B O    3  
ATOM   4076  C  CB   . LYS A 1 12  ? 1.050   -11.153 0.102   1.00 0.00 ? 20  LYS B CB   3  
ATOM   4077  C  CG   . LYS A 1 12  ? 2.543   -11.364 -0.044  1.00 0.00 ? 20  LYS B CG   3  
ATOM   4078  C  CD   . LYS A 1 12  ? 2.932   -11.329 -1.504  1.00 0.00 ? 20  LYS B CD   3  
ATOM   4079  C  CE   . LYS A 1 12  ? 4.421   -11.487 -1.682  1.00 0.00 ? 20  LYS B CE   3  
ATOM   4080  N  NZ   . LYS A 1 12  ? 4.763   -12.045 -3.018  1.00 0.00 ? 20  LYS B NZ   3  
ATOM   4081  H  H    . LYS A 1 12  ? 0.622   -8.886  2.055   1.00 0.00 ? 20  LYS B H    3  
ATOM   4082  H  HA   . LYS A 1 12  ? -0.507  -10.793 1.516   1.00 0.00 ? 20  LYS B HA   3  
ATOM   4083  H  HB2  . LYS A 1 12  ? 0.547   -12.011 -0.312  1.00 0.00 ? 20  LYS B HB2  3  
ATOM   4084  H  HB3  . LYS A 1 12  ? 0.794   -10.284 -0.480  1.00 0.00 ? 20  LYS B HB3  3  
ATOM   4085  H  HG2  . LYS A 1 12  ? 3.064   -10.577 0.478   1.00 0.00 ? 20  LYS B HG2  3  
ATOM   4086  H  HG3  . LYS A 1 12  ? 2.815   -12.320 0.372   1.00 0.00 ? 20  LYS B HG3  3  
ATOM   4087  H  HD2  . LYS A 1 12  ? 2.428   -12.128 -2.025  1.00 0.00 ? 20  LYS B HD2  3  
ATOM   4088  H  HD3  . LYS A 1 12  ? 2.632   -10.376 -1.918  1.00 0.00 ? 20  LYS B HD3  3  
ATOM   4089  H  HE2  . LYS A 1 12  ? 4.886   -10.514 -1.576  1.00 0.00 ? 20  LYS B HE2  3  
ATOM   4090  H  HE3  . LYS A 1 12  ? 4.795   -12.150 -0.915  1.00 0.00 ? 20  LYS B HE3  3  
ATOM   4091  H  HZ1  . LYS A 1 12  ? 4.302   -11.489 -3.765  1.00 0.00 ? 20  LYS B HZ1  3  
ATOM   4092  H  HZ2  . LYS A 1 12  ? 4.441   -13.031 -3.086  1.00 0.00 ? 20  LYS B HZ2  3  
ATOM   4093  H  HZ3  . LYS A 1 12  ? 5.792   -12.017 -3.165  1.00 0.00 ? 20  LYS B HZ3  3  
ATOM   4094  N  N    . VAL A 1 13  ? 0.783   -13.340 1.792   1.00 0.00 ? 21  VAL B N    3  
ATOM   4095  C  CA   . VAL A 1 13  ? 1.037   -14.591 2.500   1.00 0.00 ? 21  VAL B CA   3  
ATOM   4096  C  C    . VAL A 1 13  ? 2.495   -14.690 2.942   1.00 0.00 ? 21  VAL B C    3  
ATOM   4097  O  O    . VAL A 1 13  ? 3.391   -14.154 2.291   1.00 0.00 ? 21  VAL B O    3  
ATOM   4098  C  CB   . VAL A 1 13  ? 0.687   -15.810 1.622   1.00 0.00 ? 21  VAL B CB   3  
ATOM   4099  C  CG1  . VAL A 1 13  ? 1.595   -15.877 0.403   1.00 0.00 ? 21  VAL B CG1  3  
ATOM   4100  C  CG2  . VAL A 1 13  ? 0.769   -17.097 2.430   1.00 0.00 ? 21  VAL B CG2  3  
ATOM   4101  H  H    . VAL A 1 13  ? 0.545   -13.371 0.842   1.00 0.00 ? 21  VAL B H    3  
ATOM   4102  H  HA   . VAL A 1 13  ? 0.405   -14.611 3.375   1.00 0.00 ? 21  VAL B HA   3  
ATOM   4103  H  HB   . VAL A 1 13  ? -0.330  -15.695 1.276   1.00 0.00 ? 21  VAL B HB   3  
ATOM   4104  H  HG11 . VAL A 1 13  ? 1.491   -14.970 -0.174  1.00 0.00 ? 21  VAL B HG11 3  
ATOM   4105  H  HG12 . VAL A 1 13  ? 1.317   -16.724 -0.207  1.00 0.00 ? 21  VAL B HG12 3  
ATOM   4106  H  HG13 . VAL A 1 13  ? 2.620   -15.986 0.723   1.00 0.00 ? 21  VAL B HG13 3  
ATOM   4107  H  HG21 . VAL A 1 13  ? 1.770   -17.215 2.818   1.00 0.00 ? 21  VAL B HG21 3  
ATOM   4108  H  HG22 . VAL A 1 13  ? 0.526   -17.936 1.797   1.00 0.00 ? 21  VAL B HG22 3  
ATOM   4109  H  HG23 . VAL A 1 13  ? 0.069   -17.052 3.251   1.00 0.00 ? 21  VAL B HG23 3  
ATOM   4110  N  N    . LEU A 1 14  ? 2.721   -15.382 4.055   1.00 0.00 ? 22  LEU B N    3  
ATOM   4111  C  CA   . LEU A 1 14  ? 4.067   -15.560 4.589   1.00 0.00 ? 22  LEU B CA   3  
ATOM   4112  C  C    . LEU A 1 14  ? 4.488   -17.024 4.516   1.00 0.00 ? 22  LEU B C    3  
ATOM   4113  O  O    . LEU A 1 14  ? 3.688   -17.922 4.776   1.00 0.00 ? 22  LEU B O    3  
ATOM   4114  C  CB   . LEU A 1 14  ? 4.132   -15.070 6.036   1.00 0.00 ? 22  LEU B CB   3  
ATOM   4115  C  CG   . LEU A 1 14  ? 3.881   -13.573 6.227   1.00 0.00 ? 22  LEU B CG   3  
ATOM   4116  C  CD1  . LEU A 1 14  ? 3.736   -13.240 7.703   1.00 0.00 ? 22  LEU B CD1  3  
ATOM   4117  C  CD2  . LEU A 1 14  ? 5.009   -12.761 5.606   1.00 0.00 ? 22  LEU B CD2  3  
ATOM   4118  H  H    . LEU A 1 14  ? 1.964   -15.783 4.529   1.00 0.00 ? 22  LEU B H    3  
ATOM   4119  H  HA   . LEU A 1 14  ? 4.743   -14.972 3.986   1.00 0.00 ? 22  LEU B HA   3  
ATOM   4120  H  HB2  . LEU A 1 14  ? 3.395   -15.613 6.611   1.00 0.00 ? 22  LEU B HB2  3  
ATOM   4121  H  HB3  . LEU A 1 14  ? 5.111   -15.300 6.428   1.00 0.00 ? 22  LEU B HB3  3  
ATOM   4122  H  HG   . LEU A 1 14  ? 2.960   -13.301 5.731   1.00 0.00 ? 22  LEU B HG   3  
ATOM   4123  H  HD11 . LEU A 1 14  ? 2.936   -13.828 8.128   1.00 0.00 ? 22  LEU B HD11 3  
ATOM   4124  H  HD12 . LEU A 1 14  ? 3.510   -12.190 7.815   1.00 0.00 ? 22  LEU B HD12 3  
ATOM   4125  H  HD13 . LEU A 1 14  ? 4.659   -13.466 8.216   1.00 0.00 ? 22  LEU B HD13 3  
ATOM   4126  H  HD21 . LEU A 1 14  ? 5.941   -13.012 6.089   1.00 0.00 ? 22  LEU B HD21 3  
ATOM   4127  H  HD22 . LEU A 1 14  ? 4.808   -11.708 5.737   1.00 0.00 ? 22  LEU B HD22 3  
ATOM   4128  H  HD23 . LEU A 1 14  ? 5.077   -12.987 4.553   1.00 0.00 ? 22  LEU B HD23 3  
ATOM   4129  N  N    . ARG A 1 15  ? 5.748   -17.256 4.162   1.00 0.00 ? 23  ARG B N    3  
ATOM   4130  C  CA   . ARG A 1 15  ? 6.275   -18.612 4.055   1.00 0.00 ? 23  ARG B CA   3  
ATOM   4131  C  C    . ARG A 1 15  ? 7.589   -18.749 4.818   1.00 0.00 ? 23  ARG B C    3  
ATOM   4132  O  O    . ARG A 1 15  ? 8.651   -18.480 4.219   1.00 0.00 ? 23  ARG B O    3  
ATOM   4133  C  CB   . ARG A 1 15  ? 6.479   -18.988 2.585   1.00 0.00 ? 23  ARG B CB   3  
ATOM   4134  C  CG   . ARG A 1 15  ? 5.201   -18.946 1.763   1.00 0.00 ? 23  ARG B CG   3  
ATOM   4135  C  CD   . ARG A 1 15  ? 5.452   -19.359 0.321   1.00 0.00 ? 23  ARG B CD   3  
ATOM   4136  N  NE   . ARG A 1 15  ? 4.230   -19.323 -0.480  1.00 0.00 ? 23  ARG B NE   3  
ATOM   4137  C  CZ   . ARG A 1 15  ? 4.186   -19.624 -1.775  1.00 0.00 ? 23  ARG B CZ   3  
ATOM   4138  N  NH1  . ARG A 1 15  ? 5.291   -19.978 -2.417  1.00 0.00 ? 23  ARG B NH1  3  
ATOM   4139  N  NH2  . ARG A 1 15  ? 3.033   -19.571 -2.429  1.00 0.00 ? 23  ARG B NH2  3  
ATOM   4140  O  OXT  . ARG A 1 15  ? 7.544   -19.123 6.008   1.00 0.00 ? 23  ARG B OXT  3  
ATOM   4141  H  H    . ARG A 1 15  ? 6.338   -16.497 3.969   1.00 0.00 ? 23  ARG B H    3  
ATOM   4142  H  HA   . ARG A 1 15  ? 5.549   -19.283 4.490   1.00 0.00 ? 23  ARG B HA   3  
ATOM   4143  H  HB2  . ARG A 1 15  ? 7.188   -18.302 2.146   1.00 0.00 ? 23  ARG B HB2  3  
ATOM   4144  H  HB3  . ARG A 1 15  ? 6.881   -19.990 2.536   1.00 0.00 ? 23  ARG B HB3  3  
ATOM   4145  H  HG2  . ARG A 1 15  ? 4.482   -19.622 2.199   1.00 0.00 ? 23  ARG B HG2  3  
ATOM   4146  H  HG3  . ARG A 1 15  ? 4.809   -17.940 1.777   1.00 0.00 ? 23  ARG B HG3  3  
ATOM   4147  H  HD2  . ARG A 1 15  ? 6.174   -18.684 -0.114  1.00 0.00 ? 23  ARG B HD2  3  
ATOM   4148  H  HD3  . ARG A 1 15  ? 5.849   -20.364 0.310   1.00 0.00 ? 23  ARG B HD3  3  
ATOM   4149  H  HE   . ARG A 1 15  ? 3.400   -19.065 -0.028  1.00 0.00 ? 23  ARG B HE   3  
ATOM   4150  H  HH11 . ARG A 1 15  ? 6.162   -20.020 -1.928  1.00 0.00 ? 23  ARG B HH11 3  
ATOM   4151  H  HH12 . ARG A 1 15  ? 5.252   -20.202 -3.390  1.00 0.00 ? 23  ARG B HH12 3  
ATOM   4152  H  HH21 . ARG A 1 15  ? 2.198   -19.305 -1.950  1.00 0.00 ? 23  ARG B HH21 3  
ATOM   4153  H  HH22 . ARG A 1 15  ? 3.001   -19.795 -3.404  1.00 0.00 ? 23  ARG B HH22 3  
ATOM   4154  N  N    . GLY B 2 1   ? -19.183 0.339   -9.494  1.00 0.00 ? 259 GLY A N    3  
ATOM   4155  C  CA   . GLY B 2 1   ? -17.712 0.327   -9.720  1.00 0.00 ? 259 GLY A CA   3  
ATOM   4156  C  C    . GLY B 2 1   ? -16.950 -0.245  -8.540  1.00 0.00 ? 259 GLY A C    3  
ATOM   4157  O  O    . GLY B 2 1   ? -16.494 0.499   -7.671  1.00 0.00 ? 259 GLY A O    3  
ATOM   4158  H  H1   . GLY B 2 1   ? -19.528 -0.630  -9.335  1.00 0.00 ? 259 GLY A H1   3  
ATOM   4159  H  H2   . GLY B 2 1   ? -19.670 0.736   -10.323 1.00 0.00 ? 259 GLY A H2   3  
ATOM   4160  H  H3   . GLY B 2 1   ? -19.412 0.917   -8.661  1.00 0.00 ? 259 GLY A H3   3  
ATOM   4161  H  HA2  . GLY B 2 1   ? -17.498 -0.269  -10.595 1.00 0.00 ? 259 GLY A HA2  3  
ATOM   4162  H  HA3  . GLY B 2 1   ? -17.377 1.338   -9.895  1.00 0.00 ? 259 GLY A HA3  3  
ATOM   4163  N  N    . SER B 2 2   ? -16.816 -1.569  -8.510  1.00 0.00 ? 260 SER A N    3  
ATOM   4164  C  CA   . SER B 2 2   ? -16.106 -2.248  -7.429  1.00 0.00 ? 260 SER A CA   3  
ATOM   4165  C  C    . SER B 2 2   ? -16.703 -1.933  -6.075  1.00 0.00 ? 260 SER A C    3  
ATOM   4166  O  O    . SER B 2 2   ? -17.753 -1.300  -5.964  1.00 0.00 ? 260 SER A O    3  
ATOM   4167  C  CB   . SER B 2 2   ? -14.638 -1.855  -7.406  1.00 0.00 ? 260 SER A CB   3  
ATOM   4168  O  OG   . SER B 2 2   ? -13.923 -2.462  -8.468  1.00 0.00 ? 260 SER A OG   3  
ATOM   4169  H  H    . SER B 2 2   ? -17.206 -2.104  -9.233  1.00 0.00 ? 260 SER A H    3  
ATOM   4170  H  HA   . SER B 2 2   ? -16.169 -3.309  -7.591  1.00 0.00 ? 260 SER A HA   3  
ATOM   4171  H  HB2  . SER B 2 2   ? -14.551 -0.782  -7.493  1.00 0.00 ? 260 SER A HB2  3  
ATOM   4172  H  HB3  . SER B 2 2   ? -14.217 -2.179  -6.465  1.00 0.00 ? 260 SER A HB3  3  
ATOM   4173  H  HG   . SER B 2 2   ? -13.195 -2.978  -8.113  1.00 0.00 ? 260 SER A HG   3  
ATOM   4174  N  N    . TYR B 2 3   ? -16.010 -2.393  -5.047  1.00 0.00 ? 261 TYR A N    3  
ATOM   4175  C  CA   . TYR B 2 3   ? -16.420 -2.177  -3.680  1.00 0.00 ? 261 TYR A CA   3  
ATOM   4176  C  C    . TYR B 2 3   ? -15.275 -2.515  -2.740  1.00 0.00 ? 261 TYR A C    3  
ATOM   4177  O  O    . TYR B 2 3   ? -14.425 -3.348  -3.055  1.00 0.00 ? 261 TYR A O    3  
ATOM   4178  C  CB   . TYR B 2 3   ? -17.643 -3.034  -3.351  1.00 0.00 ? 261 TYR A CB   3  
ATOM   4179  C  CG   . TYR B 2 3   ? -17.500 -4.493  -3.718  1.00 0.00 ? 261 TYR A CG   3  
ATOM   4180  C  CD1  . TYR B 2 3   ? -16.447 -5.234  -3.227  1.00 0.00 ? 261 TYR A CD1  3  
ATOM   4181  C  CD2  . TYR B 2 3   ? -18.423 -5.128  -4.539  1.00 0.00 ? 261 TYR A CD2  3  
ATOM   4182  C  CE1  . TYR B 2 3   ? -16.298 -6.562  -3.533  1.00 0.00 ? 261 TYR A CE1  3  
ATOM   4183  C  CE2  . TYR B 2 3   ? -18.286 -6.467  -4.857  1.00 0.00 ? 261 TYR A CE2  3  
ATOM   4184  C  CZ   . TYR B 2 3   ? -17.219 -7.181  -4.351  1.00 0.00 ? 261 TYR A CZ   3  
ATOM   4185  O  OH   . TYR B 2 3   ? -17.076 -8.515  -4.662  1.00 0.00 ? 261 TYR A OH   3  
ATOM   4186  H  H    . TYR B 2 3   ? -15.195 -2.911  -5.215  1.00 0.00 ? 261 TYR A H    3  
ATOM   4187  H  HA   . TYR B 2 3   ? -16.672 -1.133  -3.564  1.00 0.00 ? 261 TYR A HA   3  
ATOM   4188  H  HB2  . TYR B 2 3   ? -17.825 -2.978  -2.298  1.00 0.00 ? 261 TYR A HB2  3  
ATOM   4189  H  HB3  . TYR B 2 3   ? -18.495 -2.653  -3.868  1.00 0.00 ? 261 TYR A HB3  3  
ATOM   4190  H  HD1  . TYR B 2 3   ? -15.725 -4.746  -2.596  1.00 0.00 ? 261 TYR A HD1  3  
ATOM   4191  H  HD2  . TYR B 2 3   ? -19.254 -4.562  -4.931  1.00 0.00 ? 261 TYR A HD2  3  
ATOM   4192  H  HE1  . TYR B 2 3   ? -15.463 -7.107  -3.127  1.00 0.00 ? 261 TYR A HE1  3  
ATOM   4193  H  HE2  . TYR B 2 3   ? -19.010 -6.946  -5.499  1.00 0.00 ? 261 TYR A HE2  3  
ATOM   4194  H  HH   . TYR B 2 3   ? -16.865 -9.008  -3.866  1.00 0.00 ? 261 TYR A HH   3  
ATOM   4195  N  N    . CYS B 2 4   ? -15.226 -1.840  -1.608  1.00 0.00 ? 262 CYS A N    3  
ATOM   4196  C  CA   . CYS B 2 4   ? -14.191 -2.096  -0.624  1.00 0.00 ? 262 CYS A CA   3  
ATOM   4197  C  C    . CYS B 2 4   ? -14.251 -3.545  -0.161  1.00 0.00 ? 262 CYS A C    3  
ATOM   4198  O  O    . CYS B 2 4   ? -15.310 -4.053  0.181   1.00 0.00 ? 262 CYS A O    3  
ATOM   4199  C  CB   . CYS B 2 4   ? -14.379 -1.158  0.553   1.00 0.00 ? 262 CYS A CB   3  
ATOM   4200  S  SG   . CYS B 2 4   ? -13.966 -1.837  2.191   1.00 0.00 ? 262 CYS A SG   3  
ATOM   4201  H  H    . CYS B 2 4   ? -15.885 -1.137  -1.439  1.00 0.00 ? 262 CYS A H    3  
ATOM   4202  H  HA   . CYS B 2 4   ? -13.229 -1.900  -1.086  1.00 0.00 ? 262 CYS A HA   3  
ATOM   4203  H  HB2  . CYS B 2 4   ? -13.767 -0.290  0.408   1.00 0.00 ? 262 CYS A HB2  3  
ATOM   4204  H  HB3  . CYS B 2 4   ? -15.412 -0.848  0.578   1.00 0.00 ? 262 CYS A HB3  3  
ATOM   4205  N  N    . ASP B 2 5   ? -13.112 -4.201  -0.160  1.00 0.00 ? 263 ASP A N    3  
ATOM   4206  C  CA   . ASP B 2 5   ? -13.028 -5.601  0.257   1.00 0.00 ? 263 ASP A CA   3  
ATOM   4207  C  C    . ASP B 2 5   ? -13.379 -5.756  1.746   1.00 0.00 ? 263 ASP A C    3  
ATOM   4208  O  O    . ASP B 2 5   ? -13.434 -6.867  2.274   1.00 0.00 ? 263 ASP A O    3  
ATOM   4209  C  CB   . ASP B 2 5   ? -11.605 -6.110  -0.028  1.00 0.00 ? 263 ASP A CB   3  
ATOM   4210  C  CG   . ASP B 2 5   ? -11.295 -7.465  0.583   1.00 0.00 ? 263 ASP A CG   3  
ATOM   4211  O  OD1  . ASP B 2 5   ? -11.153 -7.544  1.821   1.00 0.00 ? 263 ASP A OD1  3  
ATOM   4212  O  OD2  . ASP B 2 5   ? -11.168 -8.441  -0.181  1.00 0.00 ? 263 ASP A OD2  3  
ATOM   4213  H  H    . ASP B 2 5   ? -12.299 -3.736  -0.451  1.00 0.00 ? 263 ASP A H    3  
ATOM   4214  H  HA   . ASP B 2 5   ? -13.740 -6.167  -0.336  1.00 0.00 ? 263 ASP A HA   3  
ATOM   4215  H  HB2  . ASP B 2 5   ? -11.473 -6.189  -1.097  1.00 0.00 ? 263 ASP A HB2  3  
ATOM   4216  H  HB3  . ASP B 2 5   ? -10.897 -5.392  0.357   1.00 0.00 ? 263 ASP A HB3  3  
ATOM   4217  N  N    . PHE B 2 6   ? -13.653 -4.632  2.401   1.00 0.00 ? 264 PHE A N    3  
ATOM   4218  C  CA   . PHE B 2 6   ? -13.975 -4.615  3.833   1.00 0.00 ? 264 PHE A CA   3  
ATOM   4219  C  C    . PHE B 2 6   ? -15.474 -4.391  4.082   1.00 0.00 ? 264 PHE A C    3  
ATOM   4220  O  O    . PHE B 2 6   ? -16.018 -4.908  5.058   1.00 0.00 ? 264 PHE A O    3  
ATOM   4221  C  CB   . PHE B 2 6   ? -13.152 -3.532  4.560   1.00 0.00 ? 264 PHE A CB   3  
ATOM   4222  C  CG   . PHE B 2 6   ? -11.674 -3.595  4.293   1.00 0.00 ? 264 PHE A CG   3  
ATOM   4223  C  CD1  . PHE B 2 6   ? -11.174 -3.353  3.024   1.00 0.00 ? 264 PHE A CD1  3  
ATOM   4224  C  CD2  . PHE B 2 6   ? -10.784 -3.875  5.316   1.00 0.00 ? 264 PHE A CD2  3  
ATOM   4225  C  CE1  . PHE B 2 6   ? -9.821  -3.393  2.778   1.00 0.00 ? 264 PHE A CE1  3  
ATOM   4226  C  CE2  . PHE B 2 6   ? -9.424  -3.918  5.075   1.00 0.00 ? 264 PHE A CE2  3  
ATOM   4227  C  CZ   . PHE B 2 6   ? -8.943  -3.676  3.803   1.00 0.00 ? 264 PHE A CZ   3  
ATOM   4228  H  H    . PHE B 2 6   ? -13.650 -3.794  1.907   1.00 0.00 ? 264 PHE A H    3  
ATOM   4229  H  HA   . PHE B 2 6   ? -13.707 -5.577  4.234   1.00 0.00 ? 264 PHE A HA   3  
ATOM   4230  H  HB2  . PHE B 2 6   ? -13.496 -2.561  4.250   1.00 0.00 ? 264 PHE A HB2  3  
ATOM   4231  H  HB3  . PHE B 2 6   ? -13.294 -3.620  5.622   1.00 0.00 ? 264 PHE A HB3  3  
ATOM   4232  H  HD1  . PHE B 2 6   ? -11.858 -3.133  2.219   1.00 0.00 ? 264 PHE A HD1  3  
ATOM   4233  H  HD2  . PHE B 2 6   ? -11.161 -4.066  6.310   1.00 0.00 ? 264 PHE A HD2  3  
ATOM   4234  H  HE1  . PHE B 2 6   ? -9.446  -3.203  1.783   1.00 0.00 ? 264 PHE A HE1  3  
ATOM   4235  H  HE2  . PHE B 2 6   ? -8.738  -4.140  5.880   1.00 0.00 ? 264 PHE A HE2  3  
ATOM   4236  H  HZ   . PHE B 2 6   ? -7.881  -3.708  3.608   1.00 0.00 ? 264 PHE A HZ   3  
ATOM   4237  N  N    . CYS B 2 7   ? -16.146 -3.627  3.210   1.00 0.00 ? 265 CYS A N    3  
ATOM   4238  C  CA   . CYS B 2 7   ? -17.584 -3.380  3.386   1.00 0.00 ? 265 CYS A CA   3  
ATOM   4239  C  C    . CYS B 2 7   ? -18.363 -3.802  2.163   1.00 0.00 ? 265 CYS A C    3  
ATOM   4240  O  O    . CYS B 2 7   ? -19.550 -4.119  2.246   1.00 0.00 ? 265 CYS A O    3  
ATOM   4241  C  CB   . CYS B 2 7   ? -17.912 -1.911  3.664   1.00 0.00 ? 265 CYS A CB   3  
ATOM   4242  S  SG   . CYS B 2 7   ? -16.768 -1.030  4.760   1.00 0.00 ? 265 CYS A SG   3  
ATOM   4243  H  H    . CYS B 2 7   ? -15.678 -3.246  2.434   1.00 0.00 ? 265 CYS A H    3  
ATOM   4244  H  HA   . CYS B 2 7   ? -17.914 -3.978  4.216   1.00 0.00 ? 265 CYS A HA   3  
ATOM   4245  H  HB2  . CYS B 2 7   ? -17.959 -1.374  2.743   1.00 0.00 ? 265 CYS A HB2  3  
ATOM   4246  H  HB3  . CYS B 2 7   ? -18.887 -1.870  4.125   1.00 0.00 ? 265 CYS A HB3  3  
ATOM   4247  N  N    . LEU B 2 8   ? -17.684 -3.786  1.033   1.00 0.00 ? 266 LEU A N    3  
ATOM   4248  C  CA   . LEU B 2 8   ? -18.270 -4.158  -0.223  1.00 0.00 ? 266 LEU A CA   3  
ATOM   4249  C  C    . LEU B 2 8   ? -19.331 -3.156  -0.660  1.00 0.00 ? 266 LEU A C    3  
ATOM   4250  O  O    . LEU B 2 8   ? -20.443 -3.524  -1.040  1.00 0.00 ? 266 LEU A O    3  
ATOM   4251  C  CB   . LEU B 2 8   ? -18.832 -5.541  -0.096  1.00 0.00 ? 266 LEU A CB   3  
ATOM   4252  C  CG   . LEU B 2 8   ? -17.900 -6.529  0.583   1.00 0.00 ? 266 LEU A CG   3  
ATOM   4253  C  CD1  . LEU B 2 8   ? -18.590 -7.861  0.762   1.00 0.00 ? 266 LEU A CD1  3  
ATOM   4254  C  CD2  . LEU B 2 8   ? -16.610 -6.679  -0.208  1.00 0.00 ? 266 LEU A CD2  3  
ATOM   4255  H  H    . LEU B 2 8   ? -16.756 -3.539  1.049   1.00 0.00 ? 266 LEU A H    3  
ATOM   4256  H  HA   . LEU B 2 8   ? -17.485 -4.177  -0.951  1.00 0.00 ? 266 LEU A HA   3  
ATOM   4257  H  HB2  . LEU B 2 8   ? -19.727 -5.470  0.479   1.00 0.00 ? 266 LEU A HB2  3  
ATOM   4258  H  HB3  . LEU B 2 8   ? -19.063 -5.906  -1.070  1.00 0.00 ? 266 LEU A HB3  3  
ATOM   4259  H  HG   . LEU B 2 8   ? -17.655 -6.149  1.560   1.00 0.00 ? 266 LEU A HG   3  
ATOM   4260  H  HD11 . LEU B 2 8   ? -19.507 -7.702  1.301   1.00 0.00 ? 266 LEU A HD11 3  
ATOM   4261  H  HD12 . LEU B 2 8   ? -17.950 -8.527  1.322   1.00 0.00 ? 266 LEU A HD12 3  
ATOM   4262  H  HD13 . LEU B 2 8   ? -18.808 -8.289  -0.204  1.00 0.00 ? 266 LEU A HD13 3  
ATOM   4263  H  HD21 . LEU B 2 8   ? -16.356 -5.728  -0.668  1.00 0.00 ? 266 LEU A HD21 3  
ATOM   4264  H  HD22 . LEU B 2 8   ? -16.742 -7.428  -0.975  1.00 0.00 ? 266 LEU A HD22 3  
ATOM   4265  H  HD23 . LEU B 2 8   ? -15.814 -6.981  0.457   1.00 0.00 ? 266 LEU A HD23 3  
ATOM   4266  N  N    . GLY B 2 9   ? -18.959 -1.883  -0.605  1.00 0.00 ? 267 GLY A N    3  
ATOM   4267  C  CA   . GLY B 2 9   ? -19.857 -0.815  -1.009  1.00 0.00 ? 267 GLY A CA   3  
ATOM   4268  C  C    . GLY B 2 9   ? -19.414 -0.147  -2.292  1.00 0.00 ? 267 GLY A C    3  
ATOM   4269  O  O    . GLY B 2 9   ? -19.847 -0.533  -3.379  1.00 0.00 ? 267 GLY A O    3  
ATOM   4270  H  H    . GLY B 2 9   ? -18.062 -1.667  -0.276  1.00 0.00 ? 267 GLY A H    3  
ATOM   4271  H  HA2  . GLY B 2 9   ? -20.848 -1.227  -1.147  1.00 0.00 ? 267 GLY A HA2  3  
ATOM   4272  H  HA3  . GLY B 2 9   ? -19.899 -0.077  -0.223  1.00 0.00 ? 267 GLY A HA3  3  
ATOM   4273  N  N    . GLY B 2 10  ? -18.549 0.862   -2.176  1.00 0.00 ? 268 GLY A N    3  
ATOM   4274  C  CA   . GLY B 2 10  ? -18.066 1.550   -3.353  1.00 0.00 ? 268 GLY A CA   3  
ATOM   4275  C  C    . GLY B 2 10  ? -17.248 2.774   -3.011  1.00 0.00 ? 268 GLY A C    3  
ATOM   4276  O  O    . GLY B 2 10  ? -17.093 3.123   -1.841  1.00 0.00 ? 268 GLY A O    3  
ATOM   4277  H  H    . GLY B 2 10  ? -18.240 1.146   -1.285  1.00 0.00 ? 268 GLY A H    3  
ATOM   4278  H  HA2  . GLY B 2 10  ? -17.443 0.867   -3.924  1.00 0.00 ? 268 GLY A HA2  3  
ATOM   4279  H  HA3  . GLY B 2 10  ? -18.909 1.848   -3.959  1.00 0.00 ? 268 GLY A HA3  3  
ATOM   4280  N  N    . SER B 2 11  ? -16.715 3.422   -4.037  1.00 0.00 ? 269 SER A N    3  
ATOM   4281  C  CA   . SER B 2 11  ? -15.887 4.599   -3.847  1.00 0.00 ? 269 SER A CA   3  
ATOM   4282  C  C    . SER B 2 11  ? -16.734 5.815   -3.512  1.00 0.00 ? 269 SER A C    3  
ATOM   4283  O  O    . SER B 2 11  ? -16.423 6.554   -2.586  1.00 0.00 ? 269 SER A O    3  
ATOM   4284  C  CB   . SER B 2 11  ? -15.019 4.820   -5.077  1.00 0.00 ? 269 SER A CB   3  
ATOM   4285  O  OG   . SER B 2 11  ? -14.590 6.168   -5.178  1.00 0.00 ? 269 SER A OG   3  
ATOM   4286  H  H    . SER B 2 11  ? -16.885 3.100   -4.946  1.00 0.00 ? 269 SER A H    3  
ATOM   4287  H  HA   . SER B 2 11  ? -15.241 4.400   -3.014  1.00 0.00 ? 269 SER A HA   3  
ATOM   4288  H  HB2  . SER B 2 11  ? -14.153 4.172   -5.015  1.00 0.00 ? 269 SER A HB2  3  
ATOM   4289  H  HB3  . SER B 2 11  ? -15.579 4.564   -5.944  1.00 0.00 ? 269 SER A HB3  3  
ATOM   4290  H  HG   . SER B 2 11  ? -13.964 6.255   -5.902  1.00 0.00 ? 269 SER A HG   3  
ATOM   4291  N  N    . ASN B 2 12  ? -17.807 6.019   -4.254  1.00 0.00 ? 270 ASN A N    3  
ATOM   4292  C  CA   . ASN B 2 12  ? -18.701 7.132   -3.981  1.00 0.00 ? 270 ASN A CA   3  
ATOM   4293  C  C    . ASN B 2 12  ? -19.814 6.672   -3.052  1.00 0.00 ? 270 ASN A C    3  
ATOM   4294  O  O    . ASN B 2 12  ? -20.895 7.261   -3.016  1.00 0.00 ? 270 ASN A O    3  
ATOM   4295  C  CB   . ASN B 2 12  ? -19.283 7.689   -5.271  1.00 0.00 ? 270 ASN A CB   3  
ATOM   4296  C  CG   . ASN B 2 12  ? -19.815 6.605   -6.187  1.00 0.00 ? 270 ASN A CG   3  
ATOM   4297  O  OD1  . ASN B 2 12  ? -20.999 6.274   -6.155  1.00 0.00 ? 270 ASN A OD1  3  
ATOM   4298  N  ND2  . ASN B 2 12  ? -18.935 6.040   -7.007  1.00 0.00 ? 270 ASN A ND2  3  
ATOM   4299  H  H    . ASN B 2 12  ? -18.002 5.413   -4.998  1.00 0.00 ? 270 ASN A H    3  
ATOM   4300  H  HA   . ASN B 2 12  ? -18.135 7.909   -3.492  1.00 0.00 ? 270 ASN A HA   3  
ATOM   4301  H  HB2  . ASN B 2 12  ? -20.091 8.359   -5.027  1.00 0.00 ? 270 ASN A HB2  3  
ATOM   4302  H  HB3  . ASN B 2 12  ? -18.514 8.235   -5.788  1.00 0.00 ? 270 ASN A HB3  3  
ATOM   4303  H  HD21 . ASN B 2 12  ? -18.006 6.350   -6.975  1.00 0.00 ? 270 ASN A HD21 3  
ATOM   4304  H  HD22 . ASN B 2 12  ? -19.251 5.335   -7.610  1.00 0.00 ? 270 ASN A HD22 3  
ATOM   4305  N  N    . MET B 2 13  ? -19.534 5.608   -2.297  1.00 0.00 ? 271 MET A N    3  
ATOM   4306  C  CA   . MET B 2 13  ? -20.516 5.055   -1.369  1.00 0.00 ? 271 MET A CA   3  
ATOM   4307  C  C    . MET B 2 13  ? -19.901 4.016   -0.442  1.00 0.00 ? 271 MET A C    3  
ATOM   4308  O  O    . MET B 2 13  ? -19.466 2.956   -0.889  1.00 0.00 ? 271 MET A O    3  
ATOM   4309  C  CB   . MET B 2 13  ? -21.661 4.404   -2.139  1.00 0.00 ? 271 MET A CB   3  
ATOM   4310  C  CG   . MET B 2 13  ? -22.799 3.933   -1.246  1.00 0.00 ? 271 MET A CG   3  
ATOM   4311  S  SD   . MET B 2 13  ? -23.879 5.278   -0.716  1.00 0.00 ? 271 MET A SD   3  
ATOM   4312  C  CE   . MET B 2 13  ? -23.040 5.837   0.764   1.00 0.00 ? 271 MET A CE   3  
ATOM   4313  H  H    . MET B 2 13  ? -18.643 5.188   -2.366  1.00 0.00 ? 271 MET A H    3  
ATOM   4314  H  HA   . MET B 2 13  ? -20.911 5.864   -0.777  1.00 0.00 ? 271 MET A HA   3  
ATOM   4315  H  HB2  . MET B 2 13  ? -22.056 5.113   -2.851  1.00 0.00 ? 271 MET A HB2  3  
ATOM   4316  H  HB3  . MET B 2 13  ? -21.273 3.546   -2.672  1.00 0.00 ? 271 MET A HB3  3  
ATOM   4317  H  HG2  . MET B 2 13  ? -23.389 3.208   -1.786  1.00 0.00 ? 271 MET A HG2  3  
ATOM   4318  H  HG3  . MET B 2 13  ? -22.372 3.468   -0.368  1.00 0.00 ? 271 MET A HG3  3  
ATOM   4319  H  HE1  . MET B 2 13  ? -22.020 6.096   0.525   1.00 0.00 ? 271 MET A HE1  3  
ATOM   4320  H  HE2  . MET B 2 13  ? -23.047 5.048   1.502   1.00 0.00 ? 271 MET A HE2  3  
ATOM   4321  H  HE3  . MET B 2 13  ? -23.547 6.704   1.161   1.00 0.00 ? 271 MET A HE3  3  
ATOM   4322  N  N    . ASN B 2 14  ? -19.877 4.316   0.850   1.00 0.00 ? 272 ASN A N    3  
ATOM   4323  C  CA   . ASN B 2 14  ? -19.343 3.382   1.829   1.00 0.00 ? 272 ASN A CA   3  
ATOM   4324  C  C    . ASN B 2 14  ? -20.483 2.612   2.480   1.00 0.00 ? 272 ASN A C    3  
ATOM   4325  O  O    . ASN B 2 14  ? -21.553 3.163   2.742   1.00 0.00 ? 272 ASN A O    3  
ATOM   4326  C  CB   . ASN B 2 14  ? -18.511 4.105   2.883   1.00 0.00 ? 272 ASN A CB   3  
ATOM   4327  C  CG   . ASN B 2 14  ? -17.261 4.720   2.303   1.00 0.00 ? 272 ASN A CG   3  
ATOM   4328  O  OD1  . ASN B 2 14  ? -17.238 5.128   1.143   1.00 0.00 ? 272 ASN A OD1  3  
ATOM   4329  N  ND2  . ASN B 2 14  ? -16.209 4.780   3.112   1.00 0.00 ? 272 ASN A ND2  3  
ATOM   4330  H  H    . ASN B 2 14  ? -20.223 5.182   1.150   1.00 0.00 ? 272 ASN A H    3  
ATOM   4331  H  HA   . ASN B 2 14  ? -18.711 2.681   1.302   1.00 0.00 ? 272 ASN A HA   3  
ATOM   4332  H  HB2  . ASN B 2 14  ? -19.105 4.888   3.330   1.00 0.00 ? 272 ASN A HB2  3  
ATOM   4333  H  HB3  . ASN B 2 14  ? -18.216 3.404   3.643   1.00 0.00 ? 272 ASN A HB3  3  
ATOM   4334  H  HD21 . ASN B 2 14  ? -16.306 4.428   4.022   1.00 0.00 ? 272 ASN A HD21 3  
ATOM   4335  H  HD22 . ASN B 2 14  ? -15.381 5.171   2.768   1.00 0.00 ? 272 ASN A HD22 3  
ATOM   4336  N  N    . LYS B 2 15  ? -20.242 1.337   2.737   1.00 0.00 ? 273 LYS A N    3  
ATOM   4337  C  CA   . LYS B 2 15  ? -21.250 0.462   3.321   1.00 0.00 ? 273 LYS A CA   3  
ATOM   4338  C  C    . LYS B 2 15  ? -21.246 0.496   4.841   1.00 0.00 ? 273 LYS A C    3  
ATOM   4339  O  O    . LYS B 2 15  ? -22.286 0.323   5.476   1.00 0.00 ? 273 LYS A O    3  
ATOM   4340  C  CB   . LYS B 2 15  ? -20.996 -0.961  2.840   1.00 0.00 ? 273 LYS A CB   3  
ATOM   4341  C  CG   . LYS B 2 15  ? -21.632 -1.267  1.517   1.00 0.00 ? 273 LYS A CG   3  
ATOM   4342  C  CD   . LYS B 2 15  ? -22.878 -2.105  1.669   1.00 0.00 ? 273 LYS A CD   3  
ATOM   4343  C  CE   . LYS B 2 15  ? -23.550 -2.300  0.328   1.00 0.00 ? 273 LYS A CE   3  
ATOM   4344  N  NZ   . LYS B 2 15  ? -23.867 -3.730  0.064   1.00 0.00 ? 273 LYS A NZ   3  
ATOM   4345  H  H    . LYS B 2 15  ? -19.359 0.969   2.528   1.00 0.00 ? 273 LYS A H    3  
ATOM   4346  H  HA   . LYS B 2 15  ? -22.213 0.783   2.966   1.00 0.00 ? 273 LYS A HA   3  
ATOM   4347  H  HB2  . LYS B 2 15  ? -19.938 -1.099  2.728   1.00 0.00 ? 273 LYS A HB2  3  
ATOM   4348  H  HB3  . LYS B 2 15  ? -21.368 -1.656  3.564   1.00 0.00 ? 273 LYS A HB3  3  
ATOM   4349  H  HG2  . LYS B 2 15  ? -21.890 -0.339  1.044   1.00 0.00 ? 273 LYS A HG2  3  
ATOM   4350  H  HG3  . LYS B 2 15  ? -20.924 -1.798  0.905   1.00 0.00 ? 273 LYS A HG3  3  
ATOM   4351  H  HD2  . LYS B 2 15  ? -22.608 -3.069  2.075   1.00 0.00 ? 273 LYS A HD2  3  
ATOM   4352  H  HD3  . LYS B 2 15  ? -23.553 -1.603  2.337   1.00 0.00 ? 273 LYS A HD3  3  
ATOM   4353  H  HE2  . LYS B 2 15  ? -24.464 -1.726  0.309   1.00 0.00 ? 273 LYS A HE2  3  
ATOM   4354  H  HE3  . LYS B 2 15  ? -22.879 -1.938  -0.440  1.00 0.00 ? 273 LYS A HE3  3  
ATOM   4355  H  HZ1  . LYS B 2 15  ? -23.000 -4.303  0.114   1.00 0.00 ? 273 LYS A HZ1  3  
ATOM   4356  H  HZ2  . LYS B 2 15  ? -24.283 -3.836  -0.882  1.00 0.00 ? 273 LYS A HZ2  3  
ATOM   4357  H  HZ3  . LYS B 2 15  ? -24.543 -4.082  0.771   1.00 0.00 ? 273 LYS A HZ3  3  
ATOM   4358  N  N    . LYS B 2 16  ? -20.079 0.715   5.416   1.00 0.00 ? 274 LYS A N    3  
ATOM   4359  C  CA   . LYS B 2 16  ? -19.937 0.739   6.860   1.00 0.00 ? 274 LYS A CA   3  
ATOM   4360  C  C    . LYS B 2 16  ? -19.685 2.149   7.378   1.00 0.00 ? 274 LYS A C    3  
ATOM   4361  O  O    . LYS B 2 16  ? -19.418 2.350   8.563   1.00 0.00 ? 274 LYS A O    3  
ATOM   4362  C  CB   . LYS B 2 16  ? -18.813 -0.194  7.240   1.00 0.00 ? 274 LYS A CB   3  
ATOM   4363  C  CG   . LYS B 2 16  ? -19.077 -1.601  6.753   1.00 0.00 ? 274 LYS A CG   3  
ATOM   4364  C  CD   . LYS B 2 16  ? -19.894 -2.389  7.743   1.00 0.00 ? 274 LYS A CD   3  
ATOM   4365  C  CE   . LYS B 2 16  ? -20.072 -3.820  7.289   1.00 0.00 ? 274 LYS A CE   3  
ATOM   4366  N  NZ   . LYS B 2 16  ? -20.593 -4.692  8.378   1.00 0.00 ? 274 LYS A NZ   3  
ATOM   4367  H  H    . LYS B 2 16  ? -19.289 0.858   4.855   1.00 0.00 ? 274 LYS A H    3  
ATOM   4368  H  HA   . LYS B 2 16  ? -20.852 0.360   7.295   1.00 0.00 ? 274 LYS A HA   3  
ATOM   4369  H  HB2  . LYS B 2 16  ? -17.890 0.161   6.804   1.00 0.00 ? 274 LYS A HB2  3  
ATOM   4370  H  HB3  . LYS B 2 16  ? -18.721 -0.212  8.307   1.00 0.00 ? 274 LYS A HB3  3  
ATOM   4371  H  HG2  . LYS B 2 16  ? -19.631 -1.544  5.843   1.00 0.00 ? 274 LYS A HG2  3  
ATOM   4372  H  HG3  . LYS B 2 16  ? -18.139 -2.103  6.570   1.00 0.00 ? 274 LYS A HG3  3  
ATOM   4373  H  HD2  . LYS B 2 16  ? -19.390 -2.377  8.681   1.00 0.00 ? 274 LYS A HD2  3  
ATOM   4374  H  HD3  . LYS B 2 16  ? -20.865 -1.927  7.847   1.00 0.00 ? 274 LYS A HD3  3  
ATOM   4375  H  HE2  . LYS B 2 16  ? -20.766 -3.837  6.462   1.00 0.00 ? 274 LYS A HE2  3  
ATOM   4376  H  HE3  . LYS B 2 16  ? -19.116 -4.189  6.964   1.00 0.00 ? 274 LYS A HE3  3  
ATOM   4377  H  HZ1  . LYS B 2 16  ? -21.521 -4.349  8.697   1.00 0.00 ? 274 LYS A HZ1  3  
ATOM   4378  H  HZ2  . LYS B 2 16  ? -19.938 -4.685  9.186   1.00 0.00 ? 274 LYS A HZ2  3  
ATOM   4379  H  HZ3  . LYS B 2 16  ? -20.693 -5.669  8.037   1.00 0.00 ? 274 LYS A HZ3  3  
ATOM   4380  N  N    . SER B 2 17  ? -19.773 3.121   6.478   1.00 0.00 ? 275 SER A N    3  
ATOM   4381  C  CA   . SER B 2 17  ? -19.572 4.520   6.838   1.00 0.00 ? 275 SER A CA   3  
ATOM   4382  C  C    . SER B 2 17  ? -20.757 5.362   6.389   1.00 0.00 ? 275 SER A C    3  
ATOM   4383  O  O    . SER B 2 17  ? -20.886 6.529   6.761   1.00 0.00 ? 275 SER A O    3  
ATOM   4384  C  CB   . SER B 2 17  ? -18.281 5.054   6.223   1.00 0.00 ? 275 SER A CB   3  
ATOM   4385  O  OG   . SER B 2 17  ? -17.152 4.353   6.712   1.00 0.00 ? 275 SER A OG   3  
ATOM   4386  H  H    . SER B 2 17  ? -19.974 2.889   5.548   1.00 0.00 ? 275 SER A H    3  
ATOM   4387  H  HA   . SER B 2 17  ? -19.501 4.574   7.909   1.00 0.00 ? 275 SER A HA   3  
ATOM   4388  H  HB2  . SER B 2 17  ? -18.322 4.946   5.153   1.00 0.00 ? 275 SER A HB2  3  
ATOM   4389  H  HB3  . SER B 2 17  ? -18.178 6.095   6.472   1.00 0.00 ? 275 SER A HB3  3  
ATOM   4390  H  HG   . SER B 2 17  ? -17.066 4.500   7.656   1.00 0.00 ? 275 SER A HG   3  
ATOM   4391  N  N    . GLY B 2 18  ? -21.614 4.751   5.587   1.00 0.00 ? 276 GLY A N    3  
ATOM   4392  C  CA   . GLY B 2 18  ? -22.799 5.423   5.087   1.00 0.00 ? 276 GLY A CA   3  
ATOM   4393  C  C    . GLY B 2 18  ? -22.504 6.710   4.353   1.00 0.00 ? 276 GLY A C    3  
ATOM   4394  O  O    . GLY B 2 18  ? -23.392 7.542   4.165   1.00 0.00 ? 276 GLY A O    3  
ATOM   4395  H  H    . GLY B 2 18  ? -21.441 3.821   5.334   1.00 0.00 ? 276 GLY A H    3  
ATOM   4396  H  HA2  . GLY B 2 18  ? -23.310 4.759   4.413   1.00 0.00 ? 276 GLY A HA2  3  
ATOM   4397  H  HA3  . GLY B 2 18  ? -23.444 5.642   5.918   1.00 0.00 ? 276 GLY A HA3  3  
ATOM   4398  N  N    . ARG B 2 19  ? -21.264 6.873   3.934   1.00 0.00 ? 277 ARG A N    3  
ATOM   4399  C  CA   . ARG B 2 19  ? -20.861 8.068   3.206   1.00 0.00 ? 277 ARG A CA   3  
ATOM   4400  C  C    . ARG B 2 19  ? -19.823 7.753   2.136   1.00 0.00 ? 277 ARG A C    3  
ATOM   4401  O  O    . ARG B 2 19  ? -19.175 6.715   2.160   1.00 0.00 ? 277 ARG A O    3  
ATOM   4402  C  CB   . ARG B 2 19  ? -20.404 9.175   4.178   1.00 0.00 ? 277 ARG A CB   3  
ATOM   4403  C  CG   . ARG B 2 19  ? -19.217 8.833   5.049   1.00 0.00 ? 277 ARG A CG   3  
ATOM   4404  C  CD   . ARG B 2 19  ? -17.993 8.567   4.215   1.00 0.00 ? 277 ARG A CD   3  
ATOM   4405  N  NE   . ARG B 2 19  ? -17.043 9.676   4.255   1.00 0.00 ? 277 ARG A NE   3  
ATOM   4406  C  CZ   . ARG B 2 19  ? -15.926 9.665   4.977   1.00 0.00 ? 277 ARG A CZ   3  
ATOM   4407  N  NH1  . ARG B 2 19  ? -15.624 8.611   5.724   1.00 0.00 ? 277 ARG A NH1  3  
ATOM   4408  N  NH2  . ARG B 2 19  ? -15.110 10.710  4.955   1.00 0.00 ? 277 ARG A NH2  3  
ATOM   4409  H  H    . ARG B 2 19  ? -20.604 6.175   4.122   1.00 0.00 ? 277 ARG A H    3  
ATOM   4410  H  HA   . ARG B 2 19  ? -21.714 8.439   2.684   1.00 0.00 ? 277 ARG A HA   3  
ATOM   4411  H  HB2  . ARG B 2 19  ? -20.145 10.050  3.604   1.00 0.00 ? 277 ARG A HB2  3  
ATOM   4412  H  HB3  . ARG B 2 19  ? -21.233 9.422   4.826   1.00 0.00 ? 277 ARG A HB3  3  
ATOM   4413  H  HG2  . ARG B 2 19  ? -19.020 9.676   5.686   1.00 0.00 ? 277 ARG A HG2  3  
ATOM   4414  H  HG3  . ARG B 2 19  ? -19.444 7.962   5.645   1.00 0.00 ? 277 ARG A HG3  3  
ATOM   4415  H  HD2  . ARG B 2 19  ? -17.511 7.669   4.567   1.00 0.00 ? 277 ARG A HD2  3  
ATOM   4416  H  HD3  . ARG B 2 19  ? -18.331 8.429   3.199   1.00 0.00 ? 277 ARG A HD3  3  
ATOM   4417  H  HE   . ARG B 2 19  ? -17.246 10.468  3.714   1.00 0.00 ? 277 ARG A HE   3  
ATOM   4418  H  HH11 . ARG B 2 19  ? -16.236 7.821   5.745   1.00 0.00 ? 277 ARG A HH11 3  
ATOM   4419  H  HH12 . ARG B 2 19  ? -14.783 8.607   6.266   1.00 0.00 ? 277 ARG A HH12 3  
ATOM   4420  H  HH21 . ARG B 2 19  ? -15.334 11.507  4.393   1.00 0.00 ? 277 ARG A HH21 3  
ATOM   4421  H  HH22 . ARG B 2 19  ? -14.271 10.701  5.498   1.00 0.00 ? 277 ARG A HH22 3  
ATOM   4422  N  N    . PRO B 2 20  ? -19.680 8.666   1.179   1.00 0.00 ? 278 PRO A N    3  
ATOM   4423  C  CA   . PRO B 2 20  ? -18.735 8.541   0.067   1.00 0.00 ? 278 PRO A CA   3  
ATOM   4424  C  C    . PRO B 2 20  ? -17.270 8.558   0.503   1.00 0.00 ? 278 PRO A C    3  
ATOM   4425  O  O    . PRO B 2 20  ? -16.880 9.294   1.409   1.00 0.00 ? 278 PRO A O    3  
ATOM   4426  C  CB   . PRO B 2 20  ? -19.020 9.767   -0.806  1.00 0.00 ? 278 PRO A CB   3  
ATOM   4427  C  CG   . PRO B 2 20  ? -20.322 10.310  -0.327  1.00 0.00 ? 278 PRO A CG   3  
ATOM   4428  C  CD   . PRO B 2 20  ? -20.463 9.891   1.106   1.00 0.00 ? 278 PRO A CD   3  
ATOM   4429  H  HA   . PRO B 2 20  ? -18.926 7.648   -0.506  1.00 0.00 ? 278 PRO A HA   3  
ATOM   4430  H  HB2  . PRO B 2 20  ? -18.225 10.485  -0.689  1.00 0.00 ? 278 PRO A HB2  3  
ATOM   4431  H  HB3  . PRO B 2 20  ? -19.081 9.463   -1.841  1.00 0.00 ? 278 PRO A HB3  3  
ATOM   4432  H  HG2  . PRO B 2 20  ? -20.326 11.387  -0.405  1.00 0.00 ? 278 PRO A HG2  3  
ATOM   4433  H  HG3  . PRO B 2 20  ? -21.122 9.886   -0.914  1.00 0.00 ? 278 PRO A HG3  3  
ATOM   4434  H  HD2  . PRO B 2 20  ? -20.072 10.625  1.792   1.00 0.00 ? 278 PRO A HD2  3  
ATOM   4435  H  HD3  . PRO B 2 20  ? -21.494 9.685   1.336   1.00 0.00 ? 278 PRO A HD3  3  
ATOM   4436  N  N    . GLU B 2 21  ? -16.474 7.733   -0.165  1.00 0.00 ? 279 GLU A N    3  
ATOM   4437  C  CA   . GLU B 2 21  ? -15.039 7.635   0.082   1.00 0.00 ? 279 GLU A CA   3  
ATOM   4438  C  C    . GLU B 2 21  ? -14.332 7.485   -1.260  1.00 0.00 ? 279 GLU A C    3  
ATOM   4439  O  O    . GLU B 2 21  ? -14.541 8.297   -2.162  1.00 0.00 ? 279 GLU A O    3  
ATOM   4440  C  CB   . GLU B 2 21  ? -14.727 6.449   0.990   1.00 0.00 ? 279 GLU A CB   3  
ATOM   4441  C  CG   . GLU B 2 21  ? -13.378 6.566   1.668   1.00 0.00 ? 279 GLU A CG   3  
ATOM   4442  C  CD   . GLU B 2 21  ? -13.306 7.742   2.622   1.00 0.00 ? 279 GLU A CD   3  
ATOM   4443  O  OE1  . GLU B 2 21  ? -13.778 7.605   3.770   1.00 0.00 ? 279 GLU A OE1  3  
ATOM   4444  O  OE2  . GLU B 2 21  ? -12.777 8.800   2.221   1.00 0.00 ? 279 GLU A OE2  3  
ATOM   4445  H  H    . GLU B 2 21  ? -16.869 7.161   -0.852  1.00 0.00 ? 279 GLU A H    3  
ATOM   4446  H  HA   . GLU B 2 21  ? -14.705 8.543   0.559   1.00 0.00 ? 279 GLU A HA   3  
ATOM   4447  H  HB2  . GLU B 2 21  ? -15.483 6.383   1.749   1.00 0.00 ? 279 GLU A HB2  3  
ATOM   4448  H  HB3  . GLU B 2 21  ? -14.742 5.538   0.410   1.00 0.00 ? 279 GLU A HB3  3  
ATOM   4449  H  HG2  . GLU B 2 21  ? -13.193 5.666   2.220   1.00 0.00 ? 279 GLU A HG2  3  
ATOM   4450  H  HG3  . GLU B 2 21  ? -12.619 6.689   0.911   1.00 0.00 ? 279 GLU A HG3  3  
ATOM   4451  N  N    . GLU B 2 22  ? -13.508 6.449   -1.400  1.00 0.00 ? 280 GLU A N    3  
ATOM   4452  C  CA   . GLU B 2 22  ? -12.829 6.180   -2.664  1.00 0.00 ? 280 GLU A CA   3  
ATOM   4453  C  C    . GLU B 2 22  ? -11.941 4.952   -2.576  1.00 0.00 ? 280 GLU A C    3  
ATOM   4454  O  O    . GLU B 2 22  ? -10.771 5.021   -2.197  1.00 0.00 ? 280 GLU A O    3  
ATOM   4455  C  CB   . GLU B 2 22  ? -12.033 7.376   -3.170  1.00 0.00 ? 280 GLU A CB   3  
ATOM   4456  C  CG   . GLU B 2 22  ? -11.720 7.274   -4.655  1.00 0.00 ? 280 GLU A CG   3  
ATOM   4457  C  CD   . GLU B 2 22  ? -12.063 8.540   -5.416  1.00 0.00 ? 280 GLU A CD   3  
ATOM   4458  O  OE1  . GLU B 2 22  ? -13.229 8.675   -5.842  1.00 0.00 ? 280 GLU A OE1  3  
ATOM   4459  O  OE2  . GLU B 2 22  ? -11.167 9.392   -5.590  1.00 0.00 ? 280 GLU A OE2  3  
ATOM   4460  H  H    . GLU B 2 22  ? -13.355 5.852   -0.637  1.00 0.00 ? 280 GLU A H    3  
ATOM   4461  H  HA   . GLU B 2 22  ? -13.602 5.968   -3.384  1.00 0.00 ? 280 GLU A HA   3  
ATOM   4462  H  HB2  . GLU B 2 22  ? -12.607 8.274   -3.005  1.00 0.00 ? 280 GLU A HB2  3  
ATOM   4463  H  HB3  . GLU B 2 22  ? -11.103 7.440   -2.627  1.00 0.00 ? 280 GLU A HB3  3  
ATOM   4464  H  HG2  . GLU B 2 22  ? -10.671 7.069   -4.778  1.00 0.00 ? 280 GLU A HG2  3  
ATOM   4465  H  HG3  . GLU B 2 22  ? -12.292 6.459   -5.071  1.00 0.00 ? 280 GLU A HG3  3  
ATOM   4466  N  N    . LEU B 2 23  ? -12.535 3.835   -2.951  1.00 0.00 ? 281 LEU A N    3  
ATOM   4467  C  CA   . LEU B 2 23  ? -11.887 2.527   -2.954  1.00 0.00 ? 281 LEU A CA   3  
ATOM   4468  C  C    . LEU B 2 23  ? -10.536 2.501   -3.641  1.00 0.00 ? 281 LEU A C    3  
ATOM   4469  O  O    . LEU B 2 23  ? -10.111 3.462   -4.282  1.00 0.00 ? 281 LEU A O    3  
ATOM   4470  C  CB   . LEU B 2 23  ? -12.768 1.560   -3.690  1.00 0.00 ? 281 LEU A CB   3  
ATOM   4471  C  CG   . LEU B 2 23  ? -14.248 1.724   -3.454  1.00 0.00 ? 281 LEU A CG   3  
ATOM   4472  C  CD1  . LEU B 2 23  ? -14.996 1.165   -4.640  1.00 0.00 ? 281 LEU A CD1  3  
ATOM   4473  C  CD2  . LEU B 2 23  ? -14.686 1.061   -2.144  1.00 0.00 ? 281 LEU A CD2  3  
ATOM   4474  H  H    . LEU B 2 23  ? -13.474 3.889   -3.239  1.00 0.00 ? 281 LEU A H    3  
ATOM   4475  H  HA   . LEU B 2 23  ? -11.779 2.173   -1.952  1.00 0.00 ? 281 LEU A HA   3  
ATOM   4476  H  HB2  . LEU B 2 23  ? -12.579 1.667   -4.748  1.00 0.00 ? 281 LEU A HB2  3  
ATOM   4477  H  HB3  . LEU B 2 23  ? -12.494 0.577   -3.395  1.00 0.00 ? 281 LEU A HB3  3  
ATOM   4478  H  HG   . LEU B 2 23  ? -14.469 2.771   -3.388  1.00 0.00 ? 281 LEU A HG   3  
ATOM   4479  H  HD11 . LEU B 2 23  ? -14.876 0.108   -4.653  1.00 0.00 ? 281 LEU A HD11 3  
ATOM   4480  H  HD12 . LEU B 2 23  ? -14.594 1.583   -5.551  1.00 0.00 ? 281 LEU A HD12 3  
ATOM   4481  H  HD13 . LEU B 2 23  ? -16.039 1.411   -4.565  1.00 0.00 ? 281 LEU A HD13 3  
ATOM   4482  H  HD21 . LEU B 2 23  ? -14.056 0.202   -1.921  1.00 0.00 ? 281 LEU A HD21 3  
ATOM   4483  H  HD22 . LEU B 2 23  ? -15.712 0.738   -2.233  1.00 0.00 ? 281 LEU A HD22 3  
ATOM   4484  H  HD23 . LEU B 2 23  ? -14.608 1.778   -1.343  1.00 0.00 ? 281 LEU A HD23 3  
ATOM   4485  N  N    . VAL B 2 24  ? -9.877  1.357   -3.487  1.00 0.00 ? 282 VAL A N    3  
ATOM   4486  C  CA   . VAL B 2 24  ? -8.609  1.099   -4.129  1.00 0.00 ? 282 VAL A CA   3  
ATOM   4487  C  C    . VAL B 2 24  ? -8.752  -0.165  -4.929  1.00 0.00 ? 282 VAL A C    3  
ATOM   4488  O  O    . VAL B 2 24  ? -8.826  -1.246  -4.353  1.00 0.00 ? 282 VAL A O    3  
ATOM   4489  C  CB   . VAL B 2 24  ? -7.454  0.894   -3.153  1.00 0.00 ? 282 VAL A CB   3  
ATOM   4490  C  CG1  . VAL B 2 24  ? -6.346  1.831   -3.496  1.00 0.00 ? 282 VAL A CG1  3  
ATOM   4491  C  CG2  . VAL B 2 24  ? -7.868  1.117   -1.729  1.00 0.00 ? 282 VAL A CG2  3  
ATOM   4492  H  H    . VAL B 2 24  ? -10.269 0.658   -2.914  1.00 0.00 ? 282 VAL A H    3  
ATOM   4493  H  HA   . VAL B 2 24  ? -8.368  1.918   -4.779  1.00 0.00 ? 282 VAL A HA   3  
ATOM   4494  H  HB   . VAL B 2 24  ? -7.104  -0.111  -3.254  1.00 0.00 ? 282 VAL A HB   3  
ATOM   4495  H  HG11 . VAL B 2 24  ? -6.632  2.808   -3.152  1.00 0.00 ? 282 VAL A HG11 3  
ATOM   4496  H  HG12 . VAL B 2 24  ? -6.196  1.846   -4.566  1.00 0.00 ? 282 VAL A HG12 3  
ATOM   4497  H  HG13 . VAL B 2 24  ? -5.437  1.522   -3.001  1.00 0.00 ? 282 VAL A HG13 3  
ATOM   4498  H  HG21 . VAL B 2 24  ? -8.049  2.170   -1.569  1.00 0.00 ? 282 VAL A HG21 3  
ATOM   4499  H  HG22 . VAL B 2 24  ? -7.080  0.783   -1.072  1.00 0.00 ? 282 VAL A HG22 3  
ATOM   4500  H  HG23 . VAL B 2 24  ? -8.763  0.558   -1.528  1.00 0.00 ? 282 VAL A HG23 3  
ATOM   4501  N  N    . SER B 2 25  ? -8.767  -0.031  -6.244  1.00 0.00 ? 283 SER A N    3  
ATOM   4502  C  CA   . SER B 2 25  ? -8.924  -1.180  -7.116  1.00 0.00 ? 283 SER A CA   3  
ATOM   4503  C  C    . SER B 2 25  ? -7.595  -1.586  -7.714  1.00 0.00 ? 283 SER A C    3  
ATOM   4504  O  O    . SER B 2 25  ? -6.930  -0.783  -8.369  1.00 0.00 ? 283 SER A O    3  
ATOM   4505  C  CB   . SER B 2 25  ? -9.920  -0.874  -8.227  1.00 0.00 ? 283 SER A CB   3  
ATOM   4506  O  OG   . SER B 2 25  ? -9.794  -1.795  -9.296  1.00 0.00 ? 283 SER A OG   3  
ATOM   4507  H  H    . SER B 2 25  ? -8.667  0.861   -6.637  1.00 0.00 ? 283 SER A H    3  
ATOM   4508  H  HA   . SER B 2 25  ? -9.310  -1.990  -6.525  1.00 0.00 ? 283 SER A HA   3  
ATOM   4509  H  HB2  . SER B 2 25  ? -10.920 -0.940  -7.831  1.00 0.00 ? 283 SER A HB2  3  
ATOM   4510  H  HB3  . SER B 2 25  ? -9.743  0.119   -8.597  1.00 0.00 ? 283 SER A HB3  3  
ATOM   4511  H  HG   . SER B 2 25  ? -9.352  -2.588  -8.984  1.00 0.00 ? 283 SER A HG   3  
ATOM   4512  N  N    . CYS B 2 26  ? -7.204  -2.832  -7.486  1.00 0.00 ? 284 CYS A N    3  
ATOM   4513  C  CA   . CYS B 2 26  ? -5.951  -3.319  -8.027  1.00 0.00 ? 284 CYS A CA   3  
ATOM   4514  C  C    . CYS B 2 26  ? -6.005  -3.189  -9.545  1.00 0.00 ? 284 CYS A C    3  
ATOM   4515  O  O    . CYS B 2 26  ? -7.037  -3.464  -10.156 1.00 0.00 ? 284 CYS A O    3  
ATOM   4516  C  CB   . CYS B 2 26  ? -5.715  -4.776  -7.584  1.00 0.00 ? 284 CYS A CB   3  
ATOM   4517  S  SG   . CYS B 2 26  ? -4.233  -5.565  -8.297  1.00 0.00 ? 284 CYS A SG   3  
ATOM   4518  H  H    . CYS B 2 26  ? -7.771  -3.427  -6.952  1.00 0.00 ? 284 CYS A H    3  
ATOM   4519  H  HA   . CYS B 2 26  ? -5.156  -2.694  -7.648  1.00 0.00 ? 284 CYS A HA   3  
ATOM   4520  H  HB2  . CYS B 2 26  ? -5.605  -4.794  -6.512  1.00 0.00 ? 284 CYS A HB2  3  
ATOM   4521  H  HB3  . CYS B 2 26  ? -6.569  -5.372  -7.856  1.00 0.00 ? 284 CYS A HB3  3  
ATOM   4522  N  N    . ALA B 2 27  ? -4.902  -2.773  -10.154 1.00 0.00 ? 285 ALA A N    3  
ATOM   4523  C  CA   . ALA B 2 27  ? -4.870  -2.599  -11.600 1.00 0.00 ? 285 ALA A CA   3  
ATOM   4524  C  C    . ALA B 2 27  ? -4.651  -3.931  -12.286 1.00 0.00 ? 285 ALA A C    3  
ATOM   4525  O  O    . ALA B 2 27  ? -4.559  -4.013  -13.511 1.00 0.00 ? 285 ALA A O    3  
ATOM   4526  C  CB   . ALA B 2 27  ? -3.799  -1.597  -12.002 1.00 0.00 ? 285 ALA A CB   3  
ATOM   4527  H  H    . ALA B 2 27  ? -4.100  -2.578  -9.626  1.00 0.00 ? 285 ALA A H    3  
ATOM   4528  H  HA   . ALA B 2 27  ? -5.829  -2.206  -11.906 1.00 0.00 ? 285 ALA A HA   3  
ATOM   4529  H  HB1  . ALA B 2 27  ? -2.823  -1.990  -11.762 1.00 0.00 ? 285 ALA A HB1  3  
ATOM   4530  H  HB2  . ALA B 2 27  ? -3.954  -0.672  -11.467 1.00 0.00 ? 285 ALA A HB2  3  
ATOM   4531  H  HB3  . ALA B 2 27  ? -3.861  -1.411  -13.065 1.00 0.00 ? 285 ALA A HB3  3  
ATOM   4532  N  N    . ASP B 2 28  ? -4.571  -4.974  -11.475 1.00 0.00 ? 286 ASP A N    3  
ATOM   4533  C  CA   . ASP B 2 28  ? -4.372  -6.309  -11.962 1.00 0.00 ? 286 ASP A CA   3  
ATOM   4534  C  C    . ASP B 2 28  ? -5.611  -7.157  -11.701 1.00 0.00 ? 286 ASP A C    3  
ATOM   4535  O  O    . ASP B 2 28  ? -6.127  -7.833  -12.591 1.00 0.00 ? 286 ASP A O    3  
ATOM   4536  C  CB   . ASP B 2 28  ? -3.188  -6.911  -11.233 1.00 0.00 ? 286 ASP A CB   3  
ATOM   4537  C  CG   . ASP B 2 28  ? -1.872  -6.667  -11.945 1.00 0.00 ? 286 ASP A CG   3  
ATOM   4538  O  OD1  . ASP B 2 28  ? -1.238  -5.624  -11.680 1.00 0.00 ? 286 ASP A OD1  3  
ATOM   4539  O  OD2  . ASP B 2 28  ? -1.473  -7.520  -12.767 1.00 0.00 ? 286 ASP A OD2  3  
ATOM   4540  H  H    . ASP B 2 28  ? -4.629  -4.841  -10.511 1.00 0.00 ? 286 ASP A H    3  
ATOM   4541  H  HA   . ASP B 2 28  ? -4.164  -6.259  -13.018 1.00 0.00 ? 286 ASP A HA   3  
ATOM   4542  H  HB2  . ASP B 2 28  ? -3.135  -6.470  -10.249 1.00 0.00 ? 286 ASP A HB2  3  
ATOM   4543  H  HB3  . ASP B 2 28  ? -3.343  -7.963  -11.135 1.00 0.00 ? 286 ASP A HB3  3  
ATOM   4544  N  N    . CYS B 2 29  ? -6.075  -7.103  -10.455 1.00 0.00 ? 287 CYS A N    3  
ATOM   4545  C  CA   . CYS B 2 29  ? -7.244  -7.856  -10.018 1.00 0.00 ? 287 CYS A CA   3  
ATOM   4546  C  C    . CYS B 2 29  ? -8.526  -7.064  -10.227 1.00 0.00 ? 287 CYS A C    3  
ATOM   4547  O  O    . CYS B 2 29  ? -9.490  -7.555  -10.815 1.00 0.00 ? 287 CYS A O    3  
ATOM   4548  C  CB   . CYS B 2 29  ? -7.115  -8.197  -8.533  1.00 0.00 ? 287 CYS A CB   3  
ATOM   4549  S  SG   . CYS B 2 29  ? -5.617  -9.136  -8.104  1.00 0.00 ? 287 CYS A SG   3  
ATOM   4550  H  H    . CYS B 2 29  ? -5.614  -6.534  -9.806  1.00 0.00 ? 287 CYS A H    3  
ATOM   4551  H  HA   . CYS B 2 29  ? -7.291  -8.771  -10.589 1.00 0.00 ? 287 CYS A HA   3  
ATOM   4552  H  HB2  . CYS B 2 29  ? -7.099  -7.281  -7.962  1.00 0.00 ? 287 CYS A HB2  3  
ATOM   4553  H  HB3  . CYS B 2 29  ? -7.969  -8.786  -8.233  1.00 0.00 ? 287 CYS A HB3  3  
ATOM   4554  N  N    . GLY B 2 30  ? -8.521  -5.835  -9.734  1.00 0.00 ? 288 GLY A N    3  
ATOM   4555  C  CA   . GLY B 2 30  ? -9.688  -4.980  -9.839  1.00 0.00 ? 288 GLY A CA   3  
ATOM   4556  C  C    . GLY B 2 30  ? -10.469 -4.928  -8.537  1.00 0.00 ? 288 GLY A C    3  
ATOM   4557  O  O    . GLY B 2 30  ? -11.558 -4.357  -8.478  1.00 0.00 ? 288 GLY A O    3  
ATOM   4558  H  H    . GLY B 2 30  ? -7.707  -5.501  -9.301  1.00 0.00 ? 288 GLY A H    3  
ATOM   4559  H  HA2  . GLY B 2 30  ? -9.370  -3.981  -10.099 1.00 0.00 ? 288 GLY A HA2  3  
ATOM   4560  H  HA3  . GLY B 2 30  ? -10.332 -5.359  -10.619 1.00 0.00 ? 288 GLY A HA3  3  
ATOM   4561  N  N    . ARG B 2 31  ? -9.900  -5.525  -7.491  1.00 0.00 ? 289 ARG A N    3  
ATOM   4562  C  CA   . ARG B 2 31  ? -10.535 -5.560  -6.176  1.00 0.00 ? 289 ARG A CA   3  
ATOM   4563  C  C    . ARG B 2 31  ? -10.369 -4.222  -5.468  1.00 0.00 ? 289 ARG A C    3  
ATOM   4564  O  O    . ARG B 2 31  ? -9.267  -3.677  -5.427  1.00 0.00 ? 289 ARG A O    3  
ATOM   4565  C  CB   . ARG B 2 31  ? -9.910  -6.664  -5.327  1.00 0.00 ? 289 ARG A CB   3  
ATOM   4566  C  CG   . ARG B 2 31  ? -10.871 -7.286  -4.336  1.00 0.00 ? 289 ARG A CG   3  
ATOM   4567  C  CD   . ARG B 2 31  ? -10.132 -8.095  -3.283  1.00 0.00 ? 289 ARG A CD   3  
ATOM   4568  N  NE   . ARG B 2 31  ? -10.301 -9.533  -3.476  1.00 0.00 ? 289 ARG A NE   3  
ATOM   4569  C  CZ   . ARG B 2 31  ? -9.754  -10.453 -2.685  1.00 0.00 ? 289 ARG A CZ   3  
ATOM   4570  N  NH1  . ARG B 2 31  ? -8.992  -10.084 -1.663  1.00 0.00 ? 289 ARG A NH1  3  
ATOM   4571  N  NH2  . ARG B 2 31  ? -9.967  -11.740 -2.916  1.00 0.00 ? 289 ARG A NH2  3  
ATOM   4572  H  H    . ARG B 2 31  ? -9.024  -5.951  -7.607  1.00 0.00 ? 289 ARG A H    3  
ATOM   4573  H  HA   . ARG B 2 31  ? -11.587 -5.764  -6.311  1.00 0.00 ? 289 ARG A HA   3  
ATOM   4574  H  HB2  . ARG B 2 31  ? -9.547  -7.442  -5.980  1.00 0.00 ? 289 ARG A HB2  3  
ATOM   4575  H  HB3  . ARG B 2 31  ? -9.078  -6.250  -4.776  1.00 0.00 ? 289 ARG A HB3  3  
ATOM   4576  H  HG2  . ARG B 2 31  ? -11.432 -6.502  -3.849  1.00 0.00 ? 289 ARG A HG2  3  
ATOM   4577  H  HG3  . ARG B 2 31  ? -11.545 -7.936  -4.873  1.00 0.00 ? 289 ARG A HG3  3  
ATOM   4578  H  HD2  . ARG B 2 31  ? -9.079  -7.856  -3.339  1.00 0.00 ? 289 ARG A HD2  3  
ATOM   4579  H  HD3  . ARG B 2 31  ? -10.511 -7.824  -2.308  1.00 0.00 ? 289 ARG A HD3  3  
ATOM   4580  H  HE   . ARG B 2 31  ? -10.855 -9.829  -4.230  1.00 0.00 ? 289 ARG A HE   3  
ATOM   4581  H  HH11 . ARG B 2 31  ? -8.828  -9.114  -1.487  1.00 0.00 ? 289 ARG A HH11 3  
ATOM   4582  H  HH12 . ARG B 2 31  ? -8.583  -10.778 -1.070  1.00 0.00 ? 289 ARG A HH12 3  
ATOM   4583  H  HH21 . ARG B 2 31  ? -10.540 -12.022 -3.685  1.00 0.00 ? 289 ARG A HH21 3  
ATOM   4584  H  HH22 . ARG B 2 31  ? -9.555  -12.429 -2.320  1.00 0.00 ? 289 ARG A HH22 3  
ATOM   4585  N  N    . SER B 2 32  ? -11.449 -3.702  -4.882  1.00 0.00 ? 290 SER A N    3  
ATOM   4586  C  CA   . SER B 2 32  ? -11.373 -2.412  -4.203  1.00 0.00 ? 290 SER A CA   3  
ATOM   4587  C  C    . SER B 2 32  ? -11.210 -2.538  -2.702  1.00 0.00 ? 290 SER A C    3  
ATOM   4588  O  O    . SER B 2 32  ? -11.374 -3.606  -2.116  1.00 0.00 ? 290 SER A O    3  
ATOM   4589  C  CB   . SER B 2 32  ? -12.603 -1.546  -4.449  1.00 0.00 ? 290 SER A CB   3  
ATOM   4590  O  OG   . SER B 2 32  ? -13.177 -1.156  -3.222  1.00 0.00 ? 290 SER A OG   3  
ATOM   4591  H  H    . SER B 2 32  ? -12.296 -4.194  -4.899  1.00 0.00 ? 290 SER A H    3  
ATOM   4592  H  HA   . SER B 2 32  ? -10.520 -1.899  -4.598  1.00 0.00 ? 290 SER A HA   3  
ATOM   4593  H  HB2  . SER B 2 32  ? -12.321 -0.660  -4.994  1.00 0.00 ? 290 SER A HB2  3  
ATOM   4594  H  HB3  . SER B 2 32  ? -13.331 -2.080  -4.995  1.00 0.00 ? 290 SER A HB3  3  
ATOM   4595  H  HG   . SER B 2 32  ? -12.529 -0.685  -2.698  1.00 0.00 ? 290 SER A HG   3  
ATOM   4596  N  N    . GLY B 2 33  ? -10.866 -1.404  -2.109  1.00 0.00 ? 291 GLY A N    3  
ATOM   4597  C  CA   . GLY B 2 33  ? -10.726 -1.295  -0.671  1.00 0.00 ? 291 GLY A CA   3  
ATOM   4598  C  C    . GLY B 2 33  ? -10.913 0.141   -0.209  1.00 0.00 ? 291 GLY A C    3  
ATOM   4599  O  O    . GLY B 2 33  ? -10.436 1.059   -0.854  1.00 0.00 ? 291 GLY A O    3  
ATOM   4600  H  H    . GLY B 2 33  ? -10.661 -0.627  -2.677  1.00 0.00 ? 291 GLY A H    3  
ATOM   4601  H  HA2  . GLY B 2 33  ? -11.461 -1.923  -0.190  1.00 0.00 ? 291 GLY A HA2  3  
ATOM   4602  H  HA3  . GLY B 2 33  ? -9.736  -1.623  -0.390  1.00 0.00 ? 291 GLY A HA3  3  
ATOM   4603  N  N    . HIS B 2 34  ? -11.622 0.376   0.883   1.00 0.00 ? 292 HIS A N    3  
ATOM   4604  C  CA   . HIS B 2 34  ? -11.758 1.753   1.343   1.00 0.00 ? 292 HIS A CA   3  
ATOM   4605  C  C    . HIS B 2 34  ? -10.441 2.107   2.002   1.00 0.00 ? 292 HIS A C    3  
ATOM   4606  O  O    . HIS B 2 34  ? -10.048 1.419   2.939   1.00 0.00 ? 292 HIS A O    3  
ATOM   4607  C  CB   . HIS B 2 34  ? -12.867 1.922   2.381   1.00 0.00 ? 292 HIS A CB   3  
ATOM   4608  C  CG   . HIS B 2 34  ? -14.272 2.029   1.840   1.00 0.00 ? 292 HIS A CG   3  
ATOM   4609  N  ND1  . HIS B 2 34  ? -15.252 1.201   2.293   1.00 0.00 ? 292 HIS A ND1  3  
ATOM   4610  C  CD2  . HIS B 2 34  ? -14.842 2.789   0.871   1.00 0.00 ? 292 HIS A CD2  3  
ATOM   4611  C  CE1  . HIS B 2 34  ? -16.371 1.420   1.636   1.00 0.00 ? 292 HIS A CE1  3  
ATOM   4612  N  NE2  . HIS B 2 34  ? -16.152 2.390   0.770   1.00 0.00 ? 292 HIS A NE2  3  
ATOM   4613  H  H    . HIS B 2 34  ? -12.010 -0.363  1.394   1.00 0.00 ? 292 HIS A H    3  
ATOM   4614  H  HA   . HIS B 2 34  ? -11.944 2.382   0.482   1.00 0.00 ? 292 HIS A HA   3  
ATOM   4615  H  HB2  . HIS B 2 34  ? -12.834 1.061   3.027   1.00 0.00 ? 292 HIS A HB2  3  
ATOM   4616  H  HB3  . HIS B 2 34  ? -12.663 2.795   2.975   1.00 0.00 ? 292 HIS A HB3  3  
ATOM   4617  H  HD2  . HIS B 2 34  ? -14.358 3.529   0.260   1.00 0.00 ? 292 HIS A HD2  3  
ATOM   4618  H  HE1  . HIS B 2 34  ? -17.258 0.826   1.695   1.00 0.00 ? 292 HIS A HE1  3  
ATOM   4619  H  HE2  . HIS B 2 34  ? -16.843 2.835   0.235   1.00 0.00 ? 292 HIS A HE2  3  
ATOM   4620  N  N    . PRO B 2 35  ? -9.728  3.153   1.566   1.00 0.00 ? 293 PRO A N    3  
ATOM   4621  C  CA   . PRO B 2 35  ? -8.442  3.484   2.172   1.00 0.00 ? 293 PRO A CA   3  
ATOM   4622  C  C    . PRO B 2 35  ? -8.495  3.460   3.698   1.00 0.00 ? 293 PRO A C    3  
ATOM   4623  O  O    . PRO B 2 35  ? -7.658  2.825   4.350   1.00 0.00 ? 293 PRO A O    3  
ATOM   4624  C  CB   . PRO B 2 35  ? -8.170  4.890   1.657   1.00 0.00 ? 293 PRO A CB   3  
ATOM   4625  C  CG   . PRO B 2 35  ? -8.867  4.956   0.340   1.00 0.00 ? 293 PRO A CG   3  
ATOM   4626  C  CD   . PRO B 2 35  ? -10.065 4.048   0.442   1.00 0.00 ? 293 PRO A CD   3  
ATOM   4627  H  HA   . PRO B 2 35  ? -7.668  2.811   1.827   1.00 0.00 ? 293 PRO A HA   3  
ATOM   4628  H  HB2  . PRO B 2 35  ? -8.563  5.615   2.352   1.00 0.00 ? 293 PRO A HB2  3  
ATOM   4629  H  HB3  . PRO B 2 35  ? -7.108  5.026   1.544   1.00 0.00 ? 293 PRO A HB3  3  
ATOM   4630  H  HG2  . PRO B 2 35  ? -9.183  5.970   0.145   1.00 0.00 ? 293 PRO A HG2  3  
ATOM   4631  H  HG3  . PRO B 2 35  ? -8.206  4.613   -0.442  1.00 0.00 ? 293 PRO A HG3  3  
ATOM   4632  H  HD2  . PRO B 2 35  ? -10.955 4.624   0.653   1.00 0.00 ? 293 PRO A HD2  3  
ATOM   4633  H  HD3  . PRO B 2 35  ? -10.185 3.487   -0.475  1.00 0.00 ? 293 PRO A HD3  3  
ATOM   4634  N  N    . THR B 2 36  ? -9.492  4.128   4.268   1.00 0.00 ? 294 THR A N    3  
ATOM   4635  C  CA   . THR B 2 36  ? -9.652  4.155   5.714   1.00 0.00 ? 294 THR A CA   3  
ATOM   4636  C  C    . THR B 2 36  ? -9.821  2.739   6.258   1.00 0.00 ? 294 THR A C    3  
ATOM   4637  O  O    . THR B 2 36  ? -9.452  2.450   7.398   1.00 0.00 ? 294 THR A O    3  
ATOM   4638  C  CB   . THR B 2 36  ? -10.863 5.007   6.134   1.00 0.00 ? 294 THR A CB   3  
ATOM   4639  O  OG1  . THR B 2 36  ? -12.030 4.597   5.412   1.00 0.00 ? 294 THR A OG1  3  
ATOM   4640  C  CG2  . THR B 2 36  ? -10.590 6.477   5.883   1.00 0.00 ? 294 THR A CG2  3  
ATOM   4641  H  H    . THR B 2 36  ? -10.131 4.611   3.704   1.00 0.00 ? 294 THR A H    3  
ATOM   4642  H  HA   . THR B 2 36  ? -8.763  4.595   6.143   1.00 0.00 ? 294 THR A HA   3  
ATOM   4643  H  HB   . THR B 2 36  ? -11.031 4.867   7.190   1.00 0.00 ? 294 THR A HB   3  
ATOM   4644  H  HG1  . THR B 2 36  ? -12.787 4.594   6.004   1.00 0.00 ? 294 THR A HG1  3  
ATOM   4645  H  HG21 . THR B 2 36  ? -9.747  6.785   6.482   1.00 0.00 ? 294 THR A HG21 3  
ATOM   4646  H  HG22 . THR B 2 36  ? -11.460 7.057   6.157   1.00 0.00 ? 294 THR A HG22 3  
ATOM   4647  H  HG23 . THR B 2 36  ? -10.366 6.632   4.839   1.00 0.00 ? 294 THR A HG23 3  
ATOM   4648  N  N    . CYS B 2 37  ? -10.386 1.861   5.431   1.00 0.00 ? 295 CYS A N    3  
ATOM   4649  C  CA   . CYS B 2 37  ? -10.603 0.468   5.814   1.00 0.00 ? 295 CYS A CA   3  
ATOM   4650  C  C    . CYS B 2 37  ? -9.311  -0.335  5.740   1.00 0.00 ? 295 CYS A C    3  
ATOM   4651  O  O    . CYS B 2 37  ? -9.080  -1.216  6.569   1.00 0.00 ? 295 CYS A O    3  
ATOM   4652  C  CB   . CYS B 2 37  ? -11.682 -0.178  4.934   1.00 0.00 ? 295 CYS A CB   3  
ATOM   4653  S  SG   . CYS B 2 37  ? -13.335 0.509   5.211   1.00 0.00 ? 295 CYS A SG   3  
ATOM   4654  H  H    . CYS B 2 37  ? -10.669 2.160   4.543   1.00 0.00 ? 295 CYS A H    3  
ATOM   4655  H  HA   . CYS B 2 37  ? -10.946 0.465   6.837   1.00 0.00 ? 295 CYS A HA   3  
ATOM   4656  H  HB2  . CYS B 2 37  ? -11.439 -0.048  3.898   1.00 0.00 ? 295 CYS A HB2  3  
ATOM   4657  H  HB3  . CYS B 2 37  ? -11.731 -1.222  5.143   1.00 0.00 ? 295 CYS A HB3  3  
ATOM   4658  N  N    . LEU B 2 38  ? -8.464  -0.037  4.755   1.00 0.00 ? 296 LEU A N    3  
ATOM   4659  C  CA   . LEU B 2 38  ? -7.203  -0.767  4.616   1.00 0.00 ? 296 LEU A CA   3  
ATOM   4660  C  C    . LEU B 2 38  ? -6.140  -0.245  5.578   1.00 0.00 ? 296 LEU A C    3  
ATOM   4661  O  O    . LEU B 2 38  ? -5.007  -0.725  5.569   1.00 0.00 ? 296 LEU A O    3  
ATOM   4662  C  CB   . LEU B 2 38  ? -6.658  -0.669  3.204   1.00 0.00 ? 296 LEU A CB   3  
ATOM   4663  C  CG   . LEU B 2 38  ? -7.643  -0.965  2.091   1.00 0.00 ? 296 LEU A CG   3  
ATOM   4664  C  CD1  . LEU B 2 38  ? -7.889  0.293   1.297   1.00 0.00 ? 296 LEU A CD1  3  
ATOM   4665  C  CD2  . LEU B 2 38  ? -7.115  -2.065  1.190   1.00 0.00 ? 296 LEU A CD2  3  
ATOM   4666  H  H    . LEU B 2 38  ? -8.694  0.678   4.108   1.00 0.00 ? 296 LEU A H    3  
ATOM   4667  H  HA   . LEU B 2 38  ? -7.397  -1.803  4.838   1.00 0.00 ? 296 LEU A HA   3  
ATOM   4668  H  HB2  . LEU B 2 38  ? -6.286  0.333   3.063   1.00 0.00 ? 296 LEU A HB2  3  
ATOM   4669  H  HB3  . LEU B 2 38  ? -5.830  -1.356  3.114   1.00 0.00 ? 296 LEU A HB3  3  
ATOM   4670  H  HG   . LEU B 2 38  ? -8.581  -1.287  2.515   1.00 0.00 ? 296 LEU A HG   3  
ATOM   4671  H  HD11 . LEU B 2 38  ? -8.421  0.056   0.394   1.00 0.00 ? 296 LEU A HD11 3  
ATOM   4672  H  HD12 . LEU B 2 38  ? -6.947  0.746   1.048   1.00 0.00 ? 296 LEU A HD12 3  
ATOM   4673  H  HD13 . LEU B 2 38  ? -8.467  0.978   1.885   1.00 0.00 ? 296 LEU A HD13 3  
ATOM   4674  H  HD21 . LEU B 2 38  ? -7.165  -1.736  0.165   1.00 0.00 ? 296 LEU A HD21 3  
ATOM   4675  H  HD22 . LEU B 2 38  ? -7.716  -2.954  1.312   1.00 0.00 ? 296 LEU A HD22 3  
ATOM   4676  H  HD23 . LEU B 2 38  ? -6.090  -2.284  1.449   1.00 0.00 ? 296 LEU A HD23 3  
ATOM   4677  N  N    . GLN B 2 39  ? -6.507  0.753   6.379   1.00 0.00 ? 297 GLN A N    3  
ATOM   4678  C  CA   . GLN B 2 39  ? -5.586  1.360   7.345   1.00 0.00 ? 297 GLN A CA   3  
ATOM   4679  C  C    . GLN B 2 39  ? -4.618  2.295   6.637   1.00 0.00 ? 297 GLN A C    3  
ATOM   4680  O  O    . GLN B 2 39  ? -3.629  2.740   7.219   1.00 0.00 ? 297 GLN A O    3  
ATOM   4681  C  CB   . GLN B 2 39  ? -4.798  0.306   8.127   1.00 0.00 ? 297 GLN A CB   3  
ATOM   4682  C  CG   . GLN B 2 39  ? -5.167  0.259   9.595   1.00 0.00 ? 297 GLN A CG   3  
ATOM   4683  C  CD   . GLN B 2 39  ? -4.067  -0.312  10.475  1.00 0.00 ? 297 GLN A CD   3  
ATOM   4684  O  OE1  . GLN B 2 39  ? -4.039  -0.067  11.681  1.00 0.00 ? 297 GLN A OE1  3  
ATOM   4685  N  NE2  . GLN B 2 39  ? -3.134  -1.049  9.877   1.00 0.00 ? 297 GLN A NE2  3  
ATOM   4686  H  H    . GLN B 2 39  ? -7.419  1.112   6.303   1.00 0.00 ? 297 GLN A H    3  
ATOM   4687  H  HA   . GLN B 2 39  ? -6.179  1.932   8.044   1.00 0.00 ? 297 GLN A HA   3  
ATOM   4688  H  HB2  . GLN B 2 39  ? -4.991  -0.665  7.700   1.00 0.00 ? 297 GLN A HB2  3  
ATOM   4689  H  HB3  . GLN B 2 39  ? -3.745  0.526   8.048   1.00 0.00 ? 297 GLN A HB3  3  
ATOM   4690  H  HG2  . GLN B 2 39  ? -5.385  1.263   9.928   1.00 0.00 ? 297 GLN A HG2  3  
ATOM   4691  H  HG3  . GLN B 2 39  ? -6.047  -0.350  9.700   1.00 0.00 ? 297 GLN A HG3  3  
ATOM   4692  H  HE21 . GLN B 2 39  ? -3.196  -1.184  8.909   1.00 0.00 ? 297 GLN A HE21 3  
ATOM   4693  H  HE22 . GLN B 2 39  ? -2.420  -1.429  10.431  1.00 0.00 ? 297 GLN A HE22 3  
ATOM   4694  N  N    . PHE B 2 40  ? -4.908  2.580   5.370   1.00 0.00 ? 298 PHE A N    3  
ATOM   4695  C  CA   . PHE B 2 40  ? -4.070  3.465   4.570   1.00 0.00 ? 298 PHE A CA   3  
ATOM   4696  C  C    . PHE B 2 40  ? -3.969  4.849   5.207   1.00 0.00 ? 298 PHE A C    3  
ATOM   4697  O  O    . PHE B 2 40  ? -4.396  5.064   6.341   1.00 0.00 ? 298 PHE A O    3  
ATOM   4698  C  CB   . PHE B 2 40  ? -4.649  3.626   3.161   1.00 0.00 ? 298 PHE A CB   3  
ATOM   4699  C  CG   . PHE B 2 40  ? -4.557  2.416   2.260   1.00 0.00 ? 298 PHE A CG   3  
ATOM   4700  C  CD1  . PHE B 2 40  ? -4.012  1.209   2.685   1.00 0.00 ? 298 PHE A CD1  3  
ATOM   4701  C  CD2  . PHE B 2 40  ? -5.012  2.512   0.960   1.00 0.00 ? 298 PHE A CD2  3  
ATOM   4702  C  CE1  . PHE B 2 40  ? -3.930  0.131   1.815   1.00 0.00 ? 298 PHE A CE1  3  
ATOM   4703  C  CE2  . PHE B 2 40  ? -4.932  1.446   0.093   1.00 0.00 ? 298 PHE A CE2  3  
ATOM   4704  C  CZ   . PHE B 2 40  ? -4.393  0.256   0.515   1.00 0.00 ? 298 PHE A CZ   3  
ATOM   4705  H  H    . PHE B 2 40  ? -5.706  2.182   4.963   1.00 0.00 ? 298 PHE A H    3  
ATOM   4706  H  HA   . PHE B 2 40  ? -3.085  3.031   4.502   1.00 0.00 ? 298 PHE A HA   3  
ATOM   4707  H  HB2  . PHE B 2 40  ? -5.688  3.889   3.242   1.00 0.00 ? 298 PHE A HB2  3  
ATOM   4708  H  HB3  . PHE B 2 40  ? -4.129  4.435   2.671   1.00 0.00 ? 298 PHE A HB3  3  
ATOM   4709  H  HD1  . PHE B 2 40  ? -3.651  1.112   3.697   1.00 0.00 ? 298 PHE A HD1  3  
ATOM   4710  H  HD2  . PHE B 2 40  ? -5.426  3.439   0.623   1.00 0.00 ? 298 PHE A HD2  3  
ATOM   4711  H  HE1  . PHE B 2 40  ? -3.505  -0.804  2.151   1.00 0.00 ? 298 PHE A HE1  3  
ATOM   4712  H  HE2  . PHE B 2 40  ? -5.308  1.540   -0.914  1.00 0.00 ? 298 PHE A HE2  3  
ATOM   4713  H  HZ   . PHE B 2 40  ? -4.333  -0.574  -0.170  1.00 0.00 ? 298 PHE A HZ   3  
ATOM   4714  N  N    . THR B 2 41  ? -3.405  5.783   4.452   1.00 0.00 ? 299 THR A N    3  
ATOM   4715  C  CA   . THR B 2 41  ? -3.254  7.158   4.902   1.00 0.00 ? 299 THR A CA   3  
ATOM   4716  C  C    . THR B 2 41  ? -3.567  8.111   3.754   1.00 0.00 ? 299 THR A C    3  
ATOM   4717  O  O    . THR B 2 41  ? -3.953  7.668   2.676   1.00 0.00 ? 299 THR A O    3  
ATOM   4718  C  CB   . THR B 2 41  ? -1.839  7.417   5.438   1.00 0.00 ? 299 THR A CB   3  
ATOM   4719  O  OG1  . THR B 2 41  ? -1.679  8.797   5.788   1.00 0.00 ? 299 THR A OG1  3  
ATOM   4720  C  CG2  . THR B 2 41  ? -0.795  7.022   4.412   1.00 0.00 ? 299 THR A CG2  3  
ATOM   4721  H  H    . THR B 2 41  ? -3.079  5.539   3.561   1.00 0.00 ? 299 THR A H    3  
ATOM   4722  H  HA   . THR B 2 41  ? -3.955  7.325   5.704   1.00 0.00 ? 299 THR A HA   3  
ATOM   4723  H  HB   . THR B 2 41  ? -1.700  6.814   6.321   1.00 0.00 ? 299 THR A HB   3  
ATOM   4724  H  HG1  . THR B 2 41  ? -1.250  8.862   6.643   1.00 0.00 ? 299 THR A HG1  3  
ATOM   4725  H  HG21 . THR B 2 41  ? -1.069  6.081   3.962   1.00 0.00 ? 299 THR A HG21 3  
ATOM   4726  H  HG22 . THR B 2 41  ? 0.165   6.921   4.897   1.00 0.00 ? 299 THR A HG22 3  
ATOM   4727  H  HG23 . THR B 2 41  ? -0.734  7.783   3.647   1.00 0.00 ? 299 THR A HG23 3  
ATOM   4728  N  N    . LEU B 2 42  ? -3.407  9.408   3.971   1.00 0.00 ? 300 LEU A N    3  
ATOM   4729  C  CA   . LEU B 2 42  ? -3.707  10.384  2.928   1.00 0.00 ? 300 LEU A CA   3  
ATOM   4730  C  C    . LEU B 2 42  ? -2.717  10.318  1.767   1.00 0.00 ? 300 LEU A C    3  
ATOM   4731  O  O    . LEU B 2 42  ? -3.132  10.311  0.614   1.00 0.00 ? 300 LEU A O    3  
ATOM   4732  C  CB   . LEU B 2 42  ? -3.760  11.796  3.516   1.00 0.00 ? 300 LEU A CB   3  
ATOM   4733  C  CG   . LEU B 2 42  ? -4.617  12.799  2.733   1.00 0.00 ? 300 LEU A CG   3  
ATOM   4734  C  CD1  . LEU B 2 42  ? -3.908  13.229  1.466   1.00 0.00 ? 300 LEU A CD1  3  
ATOM   4735  C  CD2  . LEU B 2 42  ? -5.973  12.204  2.398   1.00 0.00 ? 300 LEU A CD2  3  
ATOM   4736  H  H    . LEU B 2 42  ? -3.085  9.718   4.842   1.00 0.00 ? 300 LEU A H    3  
ATOM   4737  H  HA   . LEU B 2 42  ? -4.685  10.143  2.536   1.00 0.00 ? 300 LEU A HA   3  
ATOM   4738  H  HB2  . LEU B 2 42  ? -4.149  11.730  4.522   1.00 0.00 ? 300 LEU A HB2  3  
ATOM   4739  H  HB3  . LEU B 2 42  ? -2.752  12.180  3.563   1.00 0.00 ? 300 LEU A HB3  3  
ATOM   4740  H  HG   . LEU B 2 42  ? -4.782  13.669  3.339   1.00 0.00 ? 300 LEU A HG   3  
ATOM   4741  H  HD11 . LEU B 2 42  ? -3.774  12.367  0.833   1.00 0.00 ? 300 LEU A HD11 3  
ATOM   4742  H  HD12 . LEU B 2 42  ? -2.946  13.649  1.715   1.00 0.00 ? 300 LEU A HD12 3  
ATOM   4743  H  HD13 . LEU B 2 42  ? -4.504  13.967  0.950   1.00 0.00 ? 300 LEU A HD13 3  
ATOM   4744  H  HD21 . LEU B 2 42  ? -6.332  11.647  3.244   1.00 0.00 ? 300 LEU A HD21 3  
ATOM   4745  H  HD22 . LEU B 2 42  ? -5.879  11.546  1.546   1.00 0.00 ? 300 LEU A HD22 3  
ATOM   4746  H  HD23 . LEU B 2 42  ? -6.668  12.997  2.166   1.00 0.00 ? 300 LEU A HD23 3  
ATOM   4747  N  N    . ASN B 2 43  ? -1.419  10.265  2.056   1.00 0.00 ? 301 ASN A N    3  
ATOM   4748  C  CA   . ASN B 2 43  ? -0.420  10.212  0.986   1.00 0.00 ? 301 ASN A CA   3  
ATOM   4749  C  C    . ASN B 2 43  ? -0.558  8.924   0.180   1.00 0.00 ? 301 ASN A C    3  
ATOM   4750  O  O    . ASN B 2 43  ? -0.377  8.927   -1.034  1.00 0.00 ? 301 ASN A O    3  
ATOM   4751  C  CB   . ASN B 2 43  ? 0.998   10.313  1.549   1.00 0.00 ? 301 ASN A CB   3  
ATOM   4752  C  CG   . ASN B 2 43  ? 1.878   11.261  0.757   1.00 0.00 ? 301 ASN A CG   3  
ATOM   4753  O  OD1  . ASN B 2 43  ? 1.564   11.608  -0.383  1.00 0.00 ? 301 ASN A OD1  3  
ATOM   4754  N  ND2  . ASN B 2 43  ? 3.002   11.671  1.344   1.00 0.00 ? 301 ASN A ND2  3  
ATOM   4755  H  H    . ASN B 2 43  ? -1.130  10.252  2.993   1.00 0.00 ? 301 ASN A H    3  
ATOM   4756  H  HA   . ASN B 2 43  ? -0.599  11.052  0.325   1.00 0.00 ? 301 ASN A HA   3  
ATOM   4757  H  HB2  . ASN B 2 43  ? 0.952   10.662  2.566   1.00 0.00 ? 301 ASN A HB2  3  
ATOM   4758  H  HB3  . ASN B 2 43  ? 1.447   9.336   1.528   1.00 0.00 ? 301 ASN A HB3  3  
ATOM   4759  H  HD21 . ASN B 2 43  ? 3.208   11.344  2.247   1.00 0.00 ? 301 ASN A HD21 3  
ATOM   4760  H  HD22 . ASN B 2 43  ? 3.576   12.287  0.851   1.00 0.00 ? 301 ASN A HD22 3  
ATOM   4761  N  N    . MET B 2 44  ? -0.856  7.823   0.866   1.00 0.00 ? 302 MET A N    3  
ATOM   4762  C  CA   . MET B 2 44  ? -1.041  6.530   0.206   1.00 0.00 ? 302 MET A CA   3  
ATOM   4763  C  C    . MET B 2 44  ? -2.304  6.549   -0.596  1.00 0.00 ? 302 MET A C    3  
ATOM   4764  O  O    . MET B 2 44  ? -2.282  6.312   -1.787  1.00 0.00 ? 302 MET A O    3  
ATOM   4765  C  CB   . MET B 2 44  ? -1.080  5.411   1.238   1.00 0.00 ? 302 MET A CB   3  
ATOM   4766  C  CG   . MET B 2 44  ? -2.032  4.285   0.966   1.00 0.00 ? 302 MET A CG   3  
ATOM   4767  S  SD   . MET B 2 44  ? -1.583  2.835   1.927   1.00 0.00 ? 302 MET A SD   3  
ATOM   4768  C  CE   . MET B 2 44  ? -0.891  1.787   0.664   1.00 0.00 ? 302 MET A CE   3  
ATOM   4769  H  H    . MET B 2 44  ? -0.954  7.879   1.839   1.00 0.00 ? 302 MET A H    3  
ATOM   4770  H  HA   . MET B 2 44  ? -0.210  6.364   -0.468  1.00 0.00 ? 302 MET A HA   3  
ATOM   4771  H  HB2  . MET B 2 44  ? -0.114  4.975   1.303   1.00 0.00 ? 302 MET A HB2  3  
ATOM   4772  H  HB3  . MET B 2 44  ? -1.333  5.835   2.183   1.00 0.00 ? 302 MET A HB3  3  
ATOM   4773  H  HG2  . MET B 2 44  ? -3.022  4.601   1.241   1.00 0.00 ? 302 MET A HG2  3  
ATOM   4774  H  HG3  . MET B 2 44  ? -2.002  4.037   -0.083  1.00 0.00 ? 302 MET A HG3  3  
ATOM   4775  H  HE1  . MET B 2 44  ? 0.181   1.840   0.713   1.00 0.00 ? 302 MET A HE1  3  
ATOM   4776  H  HE2  . MET B 2 44  ? -1.224  2.124   -0.307  1.00 0.00 ? 302 MET A HE2  3  
ATOM   4777  H  HE3  . MET B 2 44  ? -1.211  0.768   0.823   1.00 0.00 ? 302 MET A HE3  3  
ATOM   4778  N  N    . THR B 2 45  ? -3.396  6.900   0.047   1.00 0.00 ? 303 THR A N    3  
ATOM   4779  C  CA   . THR B 2 45  ? -4.656  6.952   -0.646  1.00 0.00 ? 303 THR A CA   3  
ATOM   4780  C  C    . THR B 2 45  ? -4.437  7.785   -1.891  1.00 0.00 ? 303 THR A C    3  
ATOM   4781  O  O    . THR B 2 45  ? -4.768  7.376   -2.989  1.00 0.00 ? 303 THR A O    3  
ATOM   4782  C  CB   . THR B 2 45  ? -5.751  7.584   0.236   1.00 0.00 ? 303 THR A CB   3  
ATOM   4783  O  OG1  . THR B 2 45  ? -5.960  6.784   1.402   1.00 0.00 ? 303 THR A OG1  3  
ATOM   4784  C  CG2  . THR B 2 45  ? -7.060  7.731   -0.523  1.00 0.00 ? 303 THR A CG2  3  
ATOM   4785  H  H    . THR B 2 45  ? -3.344  7.138   0.990   1.00 0.00 ? 303 THR A H    3  
ATOM   4786  H  HA   . THR B 2 45  ? -4.947  5.948   -0.919  1.00 0.00 ? 303 THR A HA   3  
ATOM   4787  H  HB   . THR B 2 45  ? -5.420  8.565   0.543   1.00 0.00 ? 303 THR A HB   3  
ATOM   4788  H  HG1  . THR B 2 45  ? -5.170  6.271   1.585   1.00 0.00 ? 303 THR A HG1  3  
ATOM   4789  H  HG21 . THR B 2 45  ? -7.396  6.762   -0.869  1.00 0.00 ? 303 THR A HG21 3  
ATOM   4790  H  HG22 . THR B 2 45  ? -6.909  8.384   -1.369  1.00 0.00 ? 303 THR A HG22 3  
ATOM   4791  H  HG23 . THR B 2 45  ? -7.807  8.158   0.130   1.00 0.00 ? 303 THR A HG23 3  
ATOM   4792  N  N    . GLU B 2 46  ? -3.759  8.902   -1.699  1.00 0.00 ? 304 GLU A N    3  
ATOM   4793  C  CA   . GLU B 2 46  ? -3.430  9.818   -2.779  1.00 0.00 ? 304 GLU A CA   3  
ATOM   4794  C  C    . GLU B 2 46  ? -2.633  9.113   -3.878  1.00 0.00 ? 304 GLU A C    3  
ATOM   4795  O  O    . GLU B 2 46  ? -2.980  9.183   -5.058  1.00 0.00 ? 304 GLU A O    3  
ATOM   4796  C  CB   . GLU B 2 46  ? -2.586  10.962  -2.212  1.00 0.00 ? 304 GLU A CB   3  
ATOM   4797  C  CG   . GLU B 2 46  ? -2.560  12.202  -3.060  1.00 0.00 ? 304 GLU A CG   3  
ATOM   4798  C  CD   . GLU B 2 46  ? -1.381  13.101  -2.745  1.00 0.00 ? 304 GLU A CD   3  
ATOM   4799  O  OE1  . GLU B 2 46  ? -1.498  13.930  -1.818  1.00 0.00 ? 304 GLU A OE1  3  
ATOM   4800  O  OE2  . GLU B 2 46  ? -0.342  12.977  -3.426  1.00 0.00 ? 304 GLU A OE2  3  
ATOM   4801  H  H    . GLU B 2 46  ? -3.463  9.120   -0.793  1.00 0.00 ? 304 GLU A H    3  
ATOM   4802  H  HA   . GLU B 2 46  ? -4.352  10.206  -3.191  1.00 0.00 ? 304 GLU A HA   3  
ATOM   4803  H  HB2  . GLU B 2 46  ? -2.964  11.230  -1.240  1.00 0.00 ? 304 GLU A HB2  3  
ATOM   4804  H  HB3  . GLU B 2 46  ? -1.572  10.617  -2.111  1.00 0.00 ? 304 GLU A HB3  3  
ATOM   4805  H  HG2  . GLU B 2 46  ? -2.505  11.905  -4.090  1.00 0.00 ? 304 GLU A HG2  3  
ATOM   4806  H  HG3  . GLU B 2 46  ? -3.466  12.750  -2.882  1.00 0.00 ? 304 GLU A HG3  3  
ATOM   4807  N  N    . ALA B 2 47  ? -1.565  8.428   -3.470  1.00 0.00 ? 305 ALA A N    3  
ATOM   4808  C  CA   . ALA B 2 47  ? -0.693  7.722   -4.408  1.00 0.00 ? 305 ALA A CA   3  
ATOM   4809  C  C    . ALA B 2 47  ? -1.464  6.657   -5.161  1.00 0.00 ? 305 ALA A C    3  
ATOM   4810  O  O    . ALA B 2 47  ? -1.577  6.681   -6.384  1.00 0.00 ? 305 ALA A O    3  
ATOM   4811  C  CB   . ALA B 2 47  ? 0.476   7.081   -3.662  1.00 0.00 ? 305 ALA A CB   3  
ATOM   4812  H  H    . ALA B 2 47  ? -1.374  8.377   -2.508  1.00 0.00 ? 305 ALA A H    3  
ATOM   4813  H  HA   . ALA B 2 47  ? -0.297  8.440   -5.110  1.00 0.00 ? 305 ALA A HA   3  
ATOM   4814  H  HB1  . ALA B 2 47  ? 0.143   6.170   -3.154  1.00 0.00 ? 305 ALA A HB1  3  
ATOM   4815  H  HB2  . ALA B 2 47  ? 0.861   7.777   -2.932  1.00 0.00 ? 305 ALA A HB2  3  
ATOM   4816  H  HB3  . ALA B 2 47  ? 1.256   6.833   -4.367  1.00 0.00 ? 305 ALA A HB3  3  
ATOM   4817  N  N    . VAL B 2 48  ? -1.994  5.739   -4.392  1.00 0.00 ? 306 VAL A N    3  
ATOM   4818  C  CA   . VAL B 2 48  ? -2.768  4.631   -4.895  1.00 0.00 ? 306 VAL A CA   3  
ATOM   4819  C  C    . VAL B 2 48  ? -3.914  5.085   -5.800  1.00 0.00 ? 306 VAL A C    3  
ATOM   4820  O  O    . VAL B 2 48  ? -4.422  4.305   -6.606  1.00 0.00 ? 306 VAL A O    3  
ATOM   4821  C  CB   . VAL B 2 48  ? -3.317  3.819   -3.718  1.00 0.00 ? 306 VAL A CB   3  
ATOM   4822  C  CG1  . VAL B 2 48  ? -2.293  3.720   -2.600  1.00 0.00 ? 306 VAL A CG1  3  
ATOM   4823  C  CG2  . VAL B 2 48  ? -4.594  4.412   -3.189  1.00 0.00 ? 306 VAL A CG2  3  
ATOM   4824  H  H    . VAL B 2 48  ? -1.851  5.805   -3.430  1.00 0.00 ? 306 VAL A H    3  
ATOM   4825  H  HA   . VAL B 2 48  ? -2.116  3.990   -5.455  1.00 0.00 ? 306 VAL A HA   3  
ATOM   4826  H  HB   . VAL B 2 48  ? -3.524  2.827   -4.061  1.00 0.00 ? 306 VAL A HB   3  
ATOM   4827  H  HG11 . VAL B 2 48  ? -2.211  2.698   -2.270  1.00 0.00 ? 306 VAL A HG11 3  
ATOM   4828  H  HG12 . VAL B 2 48  ? -2.608  4.334   -1.772  1.00 0.00 ? 306 VAL A HG12 3  
ATOM   4829  H  HG13 . VAL B 2 48  ? -1.334  4.063   -2.958  1.00 0.00 ? 306 VAL A HG13 3  
ATOM   4830  H  HG21 . VAL B 2 48  ? -5.073  3.673   -2.588  1.00 0.00 ? 306 VAL A HG21 3  
ATOM   4831  H  HG22 . VAL B 2 48  ? -5.239  4.691   -4.008  1.00 0.00 ? 306 VAL A HG22 3  
ATOM   4832  H  HG23 . VAL B 2 48  ? -4.371  5.279   -2.587  1.00 0.00 ? 306 VAL A HG23 3  
ATOM   4833  N  N    . LYS B 2 49  ? -4.316  6.346   -5.663  1.00 0.00 ? 307 LYS A N    3  
ATOM   4834  C  CA   . LYS B 2 49  ? -5.407  6.889   -6.463  1.00 0.00 ? 307 LYS A CA   3  
ATOM   4835  C  C    . LYS B 2 49  ? -4.964  7.226   -7.874  1.00 0.00 ? 307 LYS A C    3  
ATOM   4836  O  O    . LYS B 2 49  ? -5.628  6.893   -8.855  1.00 0.00 ? 307 LYS A O    3  
ATOM   4837  C  CB   . LYS B 2 49  ? -5.949  8.131   -5.825  1.00 0.00 ? 307 LYS A CB   3  
ATOM   4838  C  CG   . LYS B 2 49  ? -6.758  7.788   -4.628  1.00 0.00 ? 307 LYS A CG   3  
ATOM   4839  C  CD   . LYS B 2 49  ? -8.166  8.304   -4.720  1.00 0.00 ? 307 LYS A CD   3  
ATOM   4840  C  CE   . LYS B 2 49  ? -8.741  8.273   -3.345  1.00 0.00 ? 307 LYS A CE   3  
ATOM   4841  N  NZ   . LYS B 2 49  ? -9.721  9.368   -3.105  1.00 0.00 ? 307 LYS A NZ   3  
ATOM   4842  H  H    . LYS B 2 49  ? -3.869  6.923   -5.009  1.00 0.00 ? 307 LYS A H    3  
ATOM   4843  H  HA   . LYS B 2 49  ? -6.199  6.171   -6.468  1.00 0.00 ? 307 LYS A HA   3  
ATOM   4844  H  HB2  . LYS B 2 49  ? -5.127  8.758   -5.528  1.00 0.00 ? 307 LYS A HB2  3  
ATOM   4845  H  HB3  . LYS B 2 49  ? -6.580  8.659   -6.519  1.00 0.00 ? 307 LYS A HB3  3  
ATOM   4846  H  HG2  . LYS B 2 49  ? -6.789  6.714   -4.527  1.00 0.00 ? 307 LYS A HG2  3  
ATOM   4847  H  HG3  . LYS B 2 49  ? -6.280  8.213   -3.766  1.00 0.00 ? 307 LYS A HG3  3  
ATOM   4848  H  HD2  . LYS B 2 49  ? -8.156  9.317   -5.093  1.00 0.00 ? 307 LYS A HD2  3  
ATOM   4849  H  HD3  . LYS B 2 49  ? -8.746  7.666   -5.369  1.00 0.00 ? 307 LYS A HD3  3  
ATOM   4850  H  HE2  . LYS B 2 49  ? -9.212  7.316   -3.176  1.00 0.00 ? 307 LYS A HE2  3  
ATOM   4851  H  HE3  . LYS B 2 49  ? -7.913  8.377   -2.680  1.00 0.00 ? 307 LYS A HE3  3  
ATOM   4852  H  HZ1  . LYS B 2 49  ? -10.551 9.247   -3.718  1.00 0.00 ? 307 LYS A HZ1  3  
ATOM   4853  H  HZ2  . LYS B 2 49  ? -9.285  10.290  -3.309  1.00 0.00 ? 307 LYS A HZ2  3  
ATOM   4854  H  HZ3  . LYS B 2 49  ? -10.032 9.358   -2.112  1.00 0.00 ? 307 LYS A HZ3  3  
ATOM   4855  N  N    . THR B 2 50  ? -3.821  7.893   -7.951  1.00 0.00 ? 308 THR A N    3  
ATOM   4856  C  CA   . THR B 2 50  ? -3.264  8.331   -9.224  1.00 0.00 ? 308 THR A CA   3  
ATOM   4857  C  C    . THR B 2 50  ? -2.616  7.203   -10.027 1.00 0.00 ? 308 THR A C    3  
ATOM   4858  O  O    . THR B 2 50  ? -2.776  7.156   -11.247 1.00 0.00 ? 308 THR A O    3  
ATOM   4859  C  CB   . THR B 2 50  ? -2.240  9.468   -9.033  1.00 0.00 ? 308 THR A CB   3  
ATOM   4860  O  OG1  . THR B 2 50  ? -1.463  9.636   -10.225 1.00 0.00 ? 308 THR A OG1  3  
ATOM   4861  C  CG2  . THR B 2 50  ? -1.319  9.190   -7.855  1.00 0.00 ? 308 THR A CG2  3  
ATOM   4862  H  H    . THR B 2 50  ? -3.348  8.109   -7.119  1.00 0.00 ? 308 THR A H    3  
ATOM   4863  H  HA   . THR B 2 50  ? -4.081  8.729   -9.808  1.00 0.00 ? 308 THR A HA   3  
ATOM   4864  H  HB   . THR B 2 50  ? -2.779  10.384  -8.837  1.00 0.00 ? 308 THR A HB   3  
ATOM   4865  H  HG1  . THR B 2 50  ? -1.962  10.153  -10.862 1.00 0.00 ? 308 THR A HG1  3  
ATOM   4866  H  HG21 . THR B 2 50  ? -1.896  9.183   -6.941  1.00 0.00 ? 308 THR A HG21 3  
ATOM   4867  H  HG22 . THR B 2 50  ? -0.564  9.960   -7.798  1.00 0.00 ? 308 THR A HG22 3  
ATOM   4868  H  HG23 . THR B 2 50  ? -0.844  8.229   -7.988  1.00 0.00 ? 308 THR A HG23 3  
ATOM   4869  N  N    . TYR B 2 51  ? -1.889  6.291   -9.374  1.00 0.00 ? 309 TYR A N    3  
ATOM   4870  C  CA   . TYR B 2 51  ? -1.242  5.216   -10.126 1.00 0.00 ? 309 TYR A CA   3  
ATOM   4871  C  C    . TYR B 2 51  ? -1.925  3.853   -9.931  1.00 0.00 ? 309 TYR A C    3  
ATOM   4872  O  O    . TYR B 2 51  ? -3.085  3.778   -9.525  1.00 0.00 ? 309 TYR A O    3  
ATOM   4873  C  CB   . TYR B 2 51  ? 0.270   5.172   -9.836  1.00 0.00 ? 309 TYR A CB   3  
ATOM   4874  C  CG   . TYR B 2 51  ? 0.701   4.246   -8.726  1.00 0.00 ? 309 TYR A CG   3  
ATOM   4875  C  CD1  . TYR B 2 51  ? 0.167   4.363   -7.460  1.00 0.00 ? 309 TYR A CD1  3  
ATOM   4876  C  CD2  . TYR B 2 51  ? 1.658   3.263   -8.951  1.00 0.00 ? 309 TYR A CD2  3  
ATOM   4877  C  CE1  . TYR B 2 51  ? 0.569   3.527   -6.439  1.00 0.00 ? 309 TYR A CE1  3  
ATOM   4878  C  CE2  . TYR B 2 51  ? 2.065   2.420   -7.937  1.00 0.00 ? 309 TYR A CE2  3  
ATOM   4879  C  CZ   . TYR B 2 51  ? 1.518   2.556   -6.681  1.00 0.00 ? 309 TYR A CZ   3  
ATOM   4880  O  OH   . TYR B 2 51  ? 1.918   1.721   -5.664  1.00 0.00 ? 309 TYR A OH   3  
ATOM   4881  H  H    . TYR B 2 51  ? -1.787  6.343   -8.397  1.00 0.00 ? 309 TYR A H    3  
ATOM   4882  H  HA   . TYR B 2 51  ? -1.360  5.475   -11.162 1.00 0.00 ? 309 TYR A HA   3  
ATOM   4883  H  HB2  . TYR B 2 51  ? 0.784   4.857   -10.732 1.00 0.00 ? 309 TYR A HB2  3  
ATOM   4884  H  HB3  . TYR B 2 51  ? 0.601   6.168   -9.580  1.00 0.00 ? 309 TYR A HB3  3  
ATOM   4885  H  HD1  . TYR B 2 51  ? -0.579  5.121   -7.279  1.00 0.00 ? 309 TYR A HD1  3  
ATOM   4886  H  HD2  . TYR B 2 51  ? 2.085   3.162   -9.937  1.00 0.00 ? 309 TYR A HD2  3  
ATOM   4887  H  HE1  . TYR B 2 51  ? 0.142   3.634   -5.461  1.00 0.00 ? 309 TYR A HE1  3  
ATOM   4888  H  HE2  . TYR B 2 51  ? 2.808   1.661   -8.129  1.00 0.00 ? 309 TYR A HE2  3  
ATOM   4889  H  HH   . TYR B 2 51  ? 2.873   1.624   -5.686  1.00 0.00 ? 309 TYR A HH   3  
ATOM   4890  N  N    . LYS B 2 52  ? -1.186  2.787   -10.226 1.00 0.00 ? 310 LYS A N    3  
ATOM   4891  C  CA   . LYS B 2 52  ? -1.699  1.416   -10.167 1.00 0.00 ? 310 LYS A CA   3  
ATOM   4892  C  C    . LYS B 2 52  ? -2.107  0.977   -8.766  1.00 0.00 ? 310 LYS A C    3  
ATOM   4893  O  O    . LYS B 2 52  ? -3.204  0.452   -8.574  1.00 0.00 ? 310 LYS A O    3  
ATOM   4894  C  CB   . LYS B 2 52  ? -0.638  0.462   -10.692 1.00 0.00 ? 310 LYS A CB   3  
ATOM   4895  C  CG   . LYS B 2 52  ? -0.253  0.705   -12.124 1.00 0.00 ? 310 LYS A CG   3  
ATOM   4896  C  CD   . LYS B 2 52  ? -1.010  -0.210  -13.059 1.00 0.00 ? 310 LYS A CD   3  
ATOM   4897  C  CE   . LYS B 2 52  ? -0.495  -0.101  -14.477 1.00 0.00 ? 310 LYS A CE   3  
ATOM   4898  N  NZ   . LYS B 2 52  ? -0.558  1.294   -14.991 1.00 0.00 ? 310 LYS A NZ   3  
ATOM   4899  H  H    . LYS B 2 52  ? -0.245  2.922   -10.454 1.00 0.00 ? 310 LYS A H    3  
ATOM   4900  H  HA   . LYS B 2 52  ? -2.548  1.343   -10.814 1.00 0.00 ? 310 LYS A HA   3  
ATOM   4901  H  HB2  . LYS B 2 52  ? 0.237   0.565   -10.095 1.00 0.00 ? 310 LYS A HB2  3  
ATOM   4902  H  HB3  . LYS B 2 52  ? -0.999  -0.544  -10.616 1.00 0.00 ? 310 LYS A HB3  3  
ATOM   4903  H  HG2  . LYS B 2 52  ? -0.481  1.724   -12.373 1.00 0.00 ? 310 LYS A HG2  3  
ATOM   4904  H  HG3  . LYS B 2 52  ? 0.801   0.524   -12.232 1.00 0.00 ? 310 LYS A HG3  3  
ATOM   4905  H  HD2  . LYS B 2 52  ? -0.896  -1.229  -12.722 1.00 0.00 ? 310 LYS A HD2  3  
ATOM   4906  H  HD3  . LYS B 2 52  ? -2.052  0.062   -13.045 1.00 0.00 ? 310 LYS A HD3  3  
ATOM   4907  H  HE2  . LYS B 2 52  ? 0.529   -0.443  -14.504 1.00 0.00 ? 310 LYS A HE2  3  
ATOM   4908  H  HE3  . LYS B 2 52  ? -1.101  -0.733  -15.099 1.00 0.00 ? 310 LYS A HE3  3  
ATOM   4909  H  HZ1  . LYS B 2 52  ? -0.188  1.335   -15.962 1.00 0.00 ? 310 LYS A HZ1  3  
ATOM   4910  H  HZ2  . LYS B 2 52  ? 0.010   1.923   -14.389 1.00 0.00 ? 310 LYS A HZ2  3  
ATOM   4911  H  HZ3  . LYS B 2 52  ? -1.542  1.631   -14.992 1.00 0.00 ? 310 LYS A HZ3  3  
ATOM   4912  N  N    . TRP B 2 53  ? -1.222  1.209   -7.798  1.00 0.00 ? 311 TRP A N    3  
ATOM   4913  C  CA   . TRP B 2 53  ? -1.428  0.775   -6.416  1.00 0.00 ? 311 TRP A CA   3  
ATOM   4914  C  C    . TRP B 2 53  ? -1.206  -0.726  -6.342  1.00 0.00 ? 311 TRP A C    3  
ATOM   4915  O  O    . TRP B 2 53  ? -0.355  -1.195  -5.590  1.00 0.00 ? 311 TRP A O    3  
ATOM   4916  C  CB   . TRP B 2 53  ? -2.814  1.152   -5.853  1.00 0.00 ? 311 TRP A CB   3  
ATOM   4917  C  CG   . TRP B 2 53  ? -3.152  0.430   -4.581  1.00 0.00 ? 311 TRP A CG   3  
ATOM   4918  C  CD1  . TRP B 2 53  ? -2.593  0.621   -3.355  1.00 0.00 ? 311 TRP A CD1  3  
ATOM   4919  C  CD2  . TRP B 2 53  ? -4.126  -0.598  -4.414  1.00 0.00 ? 311 TRP A CD2  3  
ATOM   4920  N  NE1  . TRP B 2 53  ? -3.165  -0.217  -2.435  1.00 0.00 ? 311 TRP A NE1  3  
ATOM   4921  C  CE2  . TRP B 2 53  ? -4.108  -0.979  -3.061  1.00 0.00 ? 311 TRP A CE2  3  
ATOM   4922  C  CE3  . TRP B 2 53  ? -5.012  -1.229  -5.279  1.00 0.00 ? 311 TRP A CE3  3  
ATOM   4923  C  CZ2  . TRP B 2 53  ? -4.944  -1.964  -2.555  1.00 0.00 ? 311 TRP A CZ2  3  
ATOM   4924  C  CZ3  . TRP B 2 53  ? -5.845  -2.214  -4.777  1.00 0.00 ? 311 TRP A CZ3  3  
ATOM   4925  C  CH2  . TRP B 2 53  ? -5.805  -2.572  -3.423  1.00 0.00 ? 311 TRP A CH2  3  
ATOM   4926  H  H    . TRP B 2 53  ? -0.397  1.688   -8.022  1.00 0.00 ? 311 TRP A H    3  
ATOM   4927  H  HA   . TRP B 2 53  ? -0.666  1.256   -5.816  1.00 0.00 ? 311 TRP A HA   3  
ATOM   4928  H  HB2  . TRP B 2 53  ? -2.831  2.203   -5.646  1.00 0.00 ? 311 TRP A HB2  3  
ATOM   4929  H  HB3  . TRP B 2 53  ? -3.583  0.933   -6.568  1.00 0.00 ? 311 TRP A HB3  3  
ATOM   4930  H  HD1  . TRP B 2 53  ? -1.820  1.343   -3.151  1.00 0.00 ? 311 TRP A HD1  3  
ATOM   4931  H  HE1  . TRP B 2 53  ? -2.932  -0.263  -1.484  1.00 0.00 ? 311 TRP A HE1  3  
ATOM   4932  H  HE3  . TRP B 2 53  ? -5.052  -0.957  -6.321  1.00 0.00 ? 311 TRP A HE3  3  
ATOM   4933  H  HZ2  . TRP B 2 53  ? -4.927  -2.243  -1.514  1.00 0.00 ? 311 TRP A HZ2  3  
ATOM   4934  H  HZ3  . TRP B 2 53  ? -6.538  -2.718  -5.432  1.00 0.00 ? 311 TRP A HZ3  3  
ATOM   4935  H  HH2  . TRP B 2 53  ? -6.467  -3.350  -3.073  1.00 0.00 ? 311 TRP A HH2  3  
ATOM   4936  N  N    . GLN B 2 54  ? -1.955  -1.467  -7.160  1.00 0.00 ? 312 GLN A N    3  
ATOM   4937  C  CA   . GLN B 2 54  ? -1.842  -2.919  -7.217  1.00 0.00 ? 312 GLN A CA   3  
ATOM   4938  C  C    . GLN B 2 54  ? -1.990  -3.535  -5.838  1.00 0.00 ? 312 GLN A C    3  
ATOM   4939  O  O    . GLN B 2 54  ? -1.147  -3.334  -4.964  1.00 0.00 ? 312 GLN A O    3  
ATOM   4940  C  CB   . GLN B 2 54  ? -0.498  -3.326  -7.823  1.00 0.00 ? 312 GLN A CB   3  
ATOM   4941  C  CG   . GLN B 2 54  ? -0.292  -2.829  -9.245  1.00 0.00 ? 312 GLN A CG   3  
ATOM   4942  C  CD   . GLN B 2 54  ? 0.996   -3.339  -9.865  1.00 0.00 ? 312 GLN A CD   3  
ATOM   4943  O  OE1  . GLN B 2 54  ? 1.079   -3.533  -11.077 1.00 0.00 ? 312 GLN A OE1  3  
ATOM   4944  N  NE2  . GLN B 2 54  ? 2.010   -3.558  -9.036  1.00 0.00 ? 312 GLN A NE2  3  
ATOM   4945  H  H    . GLN B 2 54  ? -2.604  -1.023  -7.738  1.00 0.00 ? 312 GLN A H    3  
ATOM   4946  H  HA   . GLN B 2 54  ? -2.636  -3.286  -7.849  1.00 0.00 ? 312 GLN A HA   3  
ATOM   4947  H  HB2  . GLN B 2 54  ? 0.297   -2.928  -7.209  1.00 0.00 ? 312 GLN A HB2  3  
ATOM   4948  H  HB3  . GLN B 2 54  ? -0.431  -4.404  -7.828  1.00 0.00 ? 312 GLN A HB3  3  
ATOM   4949  H  HG2  . GLN B 2 54  ? -1.121  -3.162  -9.851  1.00 0.00 ? 312 GLN A HG2  3  
ATOM   4950  H  HG3  . GLN B 2 54  ? -0.266  -1.750  -9.234  1.00 0.00 ? 312 GLN A HG3  3  
ATOM   4951  H  HE21 . GLN B 2 54  ? 1.877   -3.381  -8.082  1.00 0.00 ? 312 GLN A HE21 3  
ATOM   4952  H  HE22 . GLN B 2 54  ? 2.852   -3.890  -9.413  1.00 0.00 ? 312 GLN A HE22 3  
ATOM   4953  N  N    . CYS B 2 55  ? -3.063  -4.292  -5.644  1.00 0.00 ? 313 CYS A N    3  
ATOM   4954  C  CA   . CYS B 2 55  ? -3.301  -4.941  -4.367  1.00 0.00 ? 313 CYS A CA   3  
ATOM   4955  C  C    . CYS B 2 55  ? -2.037  -5.623  -3.891  1.00 0.00 ? 313 CYS A C    3  
ATOM   4956  O  O    . CYS B 2 55  ? -1.131  -5.882  -4.677  1.00 0.00 ? 313 CYS A O    3  
ATOM   4957  C  CB   . CYS B 2 55  ? -4.436  -5.965  -4.468  1.00 0.00 ? 313 CYS A CB   3  
ATOM   4958  S  SG   . CYS B 2 55  ? -3.918  -7.608  -5.073  1.00 0.00 ? 313 CYS A SG   3  
ATOM   4959  H  H    . CYS B 2 55  ? -3.705  -4.413  -6.373  1.00 0.00 ? 313 CYS A H    3  
ATOM   4960  H  HA   . CYS B 2 55  ? -3.569  -4.183  -3.648  1.00 0.00 ? 313 CYS A HA   3  
ATOM   4961  H  HB2  . CYS B 2 55  ? -4.868  -6.102  -3.489  1.00 0.00 ? 313 CYS A HB2  3  
ATOM   4962  H  HB3  . CYS B 2 55  ? -5.193  -5.591  -5.133  1.00 0.00 ? 313 CYS A HB3  3  
ATOM   4963  N  N    . ILE B 2 56  ? -1.978  -5.893  -2.607  1.00 0.00 ? 314 ILE A N    3  
ATOM   4964  C  CA   . ILE B 2 56  ? -0.830  -6.550  -2.017  1.00 0.00 ? 314 ILE A CA   3  
ATOM   4965  C  C    . ILE B 2 56  ? -0.426  -7.790  -2.811  1.00 0.00 ? 314 ILE A C    3  
ATOM   4966  O  O    . ILE B 2 56  ? 0.748   -8.033  -3.040  1.00 0.00 ? 314 ILE A O    3  
ATOM   4967  C  CB   . ILE B 2 56  ? -1.150  -6.950  -0.583  1.00 0.00 ? 314 ILE A CB   3  
ATOM   4968  C  CG1  . ILE B 2 56  ? -0.102  -7.903  -0.086  1.00 0.00 ? 314 ILE A CG1  3  
ATOM   4969  C  CG2  . ILE B 2 56  ? -2.519  -7.590  -0.511  1.00 0.00 ? 314 ILE A CG2  3  
ATOM   4970  C  CD1  . ILE B 2 56  ? 1.292   -7.323  -0.117  1.00 0.00 ? 314 ILE A CD1  3  
ATOM   4971  H  H    . ILE B 2 56  ? -2.737  -5.658  -2.035  1.00 0.00 ? 314 ILE A H    3  
ATOM   4972  H  HA   . ILE B 2 56  ? 0.012   -5.862  -1.991  1.00 0.00 ? 314 ILE A HA   3  
ATOM   4973  H  HB   . ILE B 2 56  ? -1.149  -6.065  0.031   1.00 0.00 ? 314 ILE A HB   3  
ATOM   4974  H  HG12 . ILE B 2 56  ? -0.341  -8.178  0.918   1.00 0.00 ? 314 ILE A HG12 3  
ATOM   4975  H  HG13 . ILE B 2 56  ? -0.115  -8.776  -0.708  1.00 0.00 ? 314 ILE A HG13 3  
ATOM   4976  H  HG21 . ILE B 2 56  ? -2.510  -8.483  -1.111  1.00 0.00 ? 314 ILE A HG21 3  
ATOM   4977  H  HG22 . ILE B 2 56  ? -3.261  -6.903  -0.893  1.00 0.00 ? 314 ILE A HG22 3  
ATOM   4978  H  HG23 . ILE B 2 56  ? -2.750  -7.842  0.512   1.00 0.00 ? 314 ILE A HG23 3  
ATOM   4979  H  HD11 . ILE B 2 56  ? 1.316   -6.416  0.464   1.00 0.00 ? 314 ILE A HD11 3  
ATOM   4980  H  HD12 . ILE B 2 56  ? 1.560   -7.099  -1.141  1.00 0.00 ? 314 ILE A HD12 3  
ATOM   4981  H  HD13 . ILE B 2 56  ? 1.991   -8.035  0.291   1.00 0.00 ? 314 ILE A HD13 3  
ATOM   4982  N  N    . GLU B 2 57  ? -1.398  -8.586  -3.210  1.00 0.00 ? 315 GLU A N    3  
ATOM   4983  C  CA   . GLU B 2 57  ? -1.117  -9.791  -3.979  1.00 0.00 ? 315 GLU A CA   3  
ATOM   4984  C  C    . GLU B 2 57  ? -0.347  -9.473  -5.269  1.00 0.00 ? 315 GLU A C    3  
ATOM   4985  O  O    . GLU B 2 57  ? 0.148   -10.378 -5.942  1.00 0.00 ? 315 GLU A O    3  
ATOM   4986  C  CB   . GLU B 2 57  ? -2.418  -10.520 -4.319  1.00 0.00 ? 315 GLU A CB   3  
ATOM   4987  C  CG   . GLU B 2 57  ? -3.326  -10.738 -3.120  1.00 0.00 ? 315 GLU A CG   3  
ATOM   4988  C  CD   . GLU B 2 57  ? -4.583  -11.509 -3.472  1.00 0.00 ? 315 GLU A CD   3  
ATOM   4989  O  OE1  . GLU B 2 57  ? -4.556  -12.755 -3.394  1.00 0.00 ? 315 GLU A OE1  3  
ATOM   4990  O  OE2  . GLU B 2 57  ? -5.594  -10.866 -3.824  1.00 0.00 ? 315 GLU A OE2  3  
ATOM   4991  H  H    . GLU B 2 57  ? -2.315  -8.380  -2.957  1.00 0.00 ? 315 GLU A H    3  
ATOM   4992  H  HA   . GLU B 2 57  ? -0.514  -10.429 -3.359  1.00 0.00 ? 315 GLU A HA   3  
ATOM   4993  H  HB2  . GLU B 2 57  ? -2.958  -9.944  -5.055  1.00 0.00 ? 315 GLU A HB2  3  
ATOM   4994  H  HB3  . GLU B 2 57  ? -2.174  -11.486 -4.739  1.00 0.00 ? 315 GLU A HB3  3  
ATOM   4995  H  HG2  . GLU B 2 57  ? -2.782  -11.291 -2.369  1.00 0.00 ? 315 GLU A HG2  3  
ATOM   4996  H  HG3  . GLU B 2 57  ? -3.610  -9.775  -2.721  1.00 0.00 ? 315 GLU A HG3  3  
ATOM   4997  N  N    . CYS B 2 58  ? -0.251  -8.186  -5.607  1.00 0.00 ? 316 CYS A N    3  
ATOM   4998  C  CA   . CYS B 2 58  ? 0.438   -7.747  -6.821  1.00 0.00 ? 316 CYS A CA   3  
ATOM   4999  C  C    . CYS B 2 58  ? 1.354   -6.544  -6.573  1.00 0.00 ? 316 CYS A C    3  
ATOM   5000  O  O    . CYS B 2 58  ? 2.014   -6.059  -7.491  1.00 0.00 ? 316 CYS A O    3  
ATOM   5001  C  CB   . CYS B 2 58  ? -0.596  -7.341  -7.859  1.00 0.00 ? 316 CYS A CB   3  
ATOM   5002  S  SG   . CYS B 2 58  ? -1.912  -8.564  -8.135  1.00 0.00 ? 316 CYS A SG   3  
ATOM   5003  H  H    . CYS B 2 58  ? -0.666  -7.518  -5.038  1.00 0.00 ? 316 CYS A H    3  
ATOM   5004  H  HA   . CYS B 2 58  ? 1.019   -8.571  -7.202  1.00 0.00 ? 316 CYS A HA   3  
ATOM   5005  H  HB2  . CYS B 2 58  ? -1.067  -6.423  -7.543  1.00 0.00 ? 316 CYS A HB2  3  
ATOM   5006  H  HB3  . CYS B 2 58  ? -0.097  -7.175  -8.790  1.00 0.00 ? 316 CYS A HB3  3  
ATOM   5007  N  N    . LYS B 2 59  ? 1.375   -6.071  -5.337  1.00 0.00 ? 317 LYS A N    3  
ATOM   5008  C  CA   . LYS B 2 59  ? 2.162   -4.898  -4.949  1.00 0.00 ? 317 LYS A CA   3  
ATOM   5009  C  C    . LYS B 2 59  ? 3.563   -4.845  -5.567  1.00 0.00 ? 317 LYS A C    3  
ATOM   5010  O  O    . LYS B 2 59  ? 4.057   -3.769  -5.902  1.00 0.00 ? 317 LYS A O    3  
ATOM   5011  C  CB   . LYS B 2 59  ? 2.208   -4.782  -3.418  1.00 0.00 ? 317 LYS A CB   3  
ATOM   5012  C  CG   . LYS B 2 59  ? 3.239   -5.631  -2.748  1.00 0.00 ? 317 LYS A CG   3  
ATOM   5013  C  CD   . LYS B 2 59  ? 3.278   -7.007  -3.341  1.00 0.00 ? 317 LYS A CD   3  
ATOM   5014  C  CE   . LYS B 2 59  ? 3.591   -8.041  -2.304  1.00 0.00 ? 317 LYS A CE   3  
ATOM   5015  N  NZ   . LYS B 2 59  ? 4.978   -8.556  -2.423  1.00 0.00 ? 317 LYS A NZ   3  
ATOM   5016  H  H    . LYS B 2 59  ? 0.837   -6.522  -4.657  1.00 0.00 ? 317 LYS A H    3  
ATOM   5017  H  HA   . LYS B 2 59  ? 1.651   -4.066  -5.311  1.00 0.00 ? 317 LYS A HA   3  
ATOM   5018  H  HB2  . LYS B 2 59  ? 2.423   -3.776  -3.165  1.00 0.00 ? 317 LYS A HB2  3  
ATOM   5019  H  HB3  . LYS B 2 59  ? 1.246   -5.049  -3.013  1.00 0.00 ? 317 LYS A HB3  3  
ATOM   5020  H  HG2  . LYS B 2 59  ? 4.186   -5.165  -2.882  1.00 0.00 ? 317 LYS A HG2  3  
ATOM   5021  H  HG3  . LYS B 2 59  ? 3.008   -5.702  -1.697  1.00 0.00 ? 317 LYS A HG3  3  
ATOM   5022  H  HD2  . LYS B 2 59  ? 2.319   -7.225  -3.776  1.00 0.00 ? 317 LYS A HD2  3  
ATOM   5023  H  HD3  . LYS B 2 59  ? 4.026   -7.024  -4.105  1.00 0.00 ? 317 LYS A HD3  3  
ATOM   5024  H  HE2  . LYS B 2 59  ? 3.456   -7.600  -1.330  1.00 0.00 ? 317 LYS A HE2  3  
ATOM   5025  H  HE3  . LYS B 2 59  ? 2.896   -8.843  -2.423  1.00 0.00 ? 317 LYS A HE3  3  
ATOM   5026  H  HZ1  . LYS B 2 59  ? 5.034   -9.260  -3.185  1.00 0.00 ? 317 LYS A HZ1  3  
ATOM   5027  H  HZ2  . LYS B 2 59  ? 5.274   -9.000  -1.531  1.00 0.00 ? 317 LYS A HZ2  3  
ATOM   5028  H  HZ3  . LYS B 2 59  ? 5.627   -7.774  -2.640  1.00 0.00 ? 317 LYS A HZ3  3  
ATOM   5029  N  N    . SER B 2 60  ? 4.149   -6.006  -5.752  1.00 0.00 ? 318 SER A N    3  
ATOM   5030  C  CA   . SER B 2 60  ? 5.504   -6.162  -6.310  1.00 0.00 ? 318 SER A CA   3  
ATOM   5031  C  C    . SER B 2 60  ? 6.477   -5.078  -5.847  1.00 0.00 ? 318 SER A C    3  
ATOM   5032  O  O    . SER B 2 60  ? 6.170   -4.238  -5.002  1.00 0.00 ? 318 SER A O    3  
ATOM   5033  C  CB   . SER B 2 60  ? 5.488   -6.160  -7.836  1.00 0.00 ? 318 SER A CB   3  
ATOM   5034  O  OG   . SER B 2 60  ? 4.532   -5.247  -8.345  1.00 0.00 ? 318 SER A OG   3  
ATOM   5035  H  H    . SER B 2 60  ? 3.644   -6.799  -5.510  1.00 0.00 ? 318 SER A H    3  
ATOM   5036  H  HA   . SER B 2 60  ? 5.882   -7.113  -5.978  1.00 0.00 ? 318 SER A HA   3  
ATOM   5037  H  HB2  . SER B 2 60  ? 6.459   -5.868  -8.173  1.00 0.00 ? 318 SER A HB2  3  
ATOM   5038  H  HB3  . SER B 2 60  ? 5.277   -7.144  -8.213  1.00 0.00 ? 318 SER A HB3  3  
ATOM   5039  H  HG   . SER B 2 60  ? 4.944   -4.684  -9.005  1.00 0.00 ? 318 SER A HG   3  
ATOM   5040  N  N    . CYS B 2 61  ? 7.684   -5.151  -6.395  1.00 0.00 ? 319 CYS A N    3  
ATOM   5041  C  CA   . CYS B 2 61  ? 8.730   -4.186  -6.116  1.00 0.00 ? 319 CYS A CA   3  
ATOM   5042  C  C    . CYS B 2 61  ? 8.765   -3.085  -7.176  1.00 0.00 ? 319 CYS A C    3  
ATOM   5043  O  O    . CYS B 2 61  ? 9.295   -3.297  -8.255  1.00 0.00 ? 319 CYS A O    3  
ATOM   5044  C  CB   . CYS B 2 61  ? 10.077  -4.889  -6.123  1.00 0.00 ? 319 CYS A CB   3  
ATOM   5045  S  SG   . CYS B 2 61  ? 11.479  -3.892  -5.501  1.00 0.00 ? 319 CYS A SG   3  
ATOM   5046  H  H    . CYS B 2 61  ? 7.896   -5.915  -6.966  1.00 0.00 ? 319 CYS A H    3  
ATOM   5047  H  HA   . CYS B 2 61  ? 8.559   -3.763  -5.146  1.00 0.00 ? 319 CYS A HA   3  
ATOM   5048  H  HB2  . CYS B 2 61  ? 10.011  -5.785  -5.531  1.00 0.00 ? 319 CYS A HB2  3  
ATOM   5049  H  HB3  . CYS B 2 61  ? 10.308  -5.171  -7.135  1.00 0.00 ? 319 CYS A HB3  3  
ATOM   5050  N  N    . ILE B 2 62  ? 8.211   -1.913  -6.887  1.00 0.00 ? 320 ILE A N    3  
ATOM   5051  C  CA   . ILE B 2 62  ? 8.263   -0.809  -7.852  1.00 0.00 ? 320 ILE A CA   3  
ATOM   5052  C  C    . ILE B 2 62  ? 9.663   -0.766  -8.450  1.00 0.00 ? 320 ILE A C    3  
ATOM   5053  O  O    . ILE B 2 62  ? 9.867   -0.374  -9.599  1.00 0.00 ? 320 ILE A O    3  
ATOM   5054  C  CB   . ILE B 2 62  ? 7.948   0.549   -7.179  1.00 0.00 ? 320 ILE A CB   3  
ATOM   5055  C  CG1  . ILE B 2 62  ? 8.940   1.637   -7.625  1.00 0.00 ? 320 ILE A CG1  3  
ATOM   5056  C  CG2  . ILE B 2 62  ? 7.976   0.378   -5.686  1.00 0.00 ? 320 ILE A CG2  3  
ATOM   5057  C  CD1  . ILE B 2 62  ? 8.850   2.920   -6.843  1.00 0.00 ? 320 ILE A CD1  3  
ATOM   5058  H  H    . ILE B 2 62  ? 7.773   -1.785  -6.023  1.00 0.00 ? 320 ILE A H    3  
ATOM   5059  H  HA   . ILE B 2 62  ? 7.539   -0.996  -8.633  1.00 0.00 ? 320 ILE A HA   3  
ATOM   5060  H  HB   . ILE B 2 62  ? 6.953   0.850   -7.449  1.00 0.00 ? 320 ILE A HB   3  
ATOM   5061  H  HG12 . ILE B 2 62  ? 9.939   1.266   -7.515  1.00 0.00 ? 320 ILE A HG12 3  
ATOM   5062  H  HG13 . ILE B 2 62  ? 8.758   1.872   -8.656  1.00 0.00 ? 320 ILE A HG13 3  
ATOM   5063  H  HG21 . ILE B 2 62  ? 8.978   0.106   -5.381  1.00 0.00 ? 320 ILE A HG21 3  
ATOM   5064  H  HG22 . ILE B 2 62  ? 7.284   -0.399  -5.397  1.00 0.00 ? 320 ILE A HG22 3  
ATOM   5065  H  HG23 . ILE B 2 62  ? 7.696   1.303   -5.217  1.00 0.00 ? 320 ILE A HG23 3  
ATOM   5066  H  HD11 . ILE B 2 62  ? 8.119   2.802   -6.070  1.00 0.00 ? 320 ILE A HD11 3  
ATOM   5067  H  HD12 . ILE B 2 62  ? 8.555   3.725   -7.500  1.00 0.00 ? 320 ILE A HD12 3  
ATOM   5068  H  HD13 . ILE B 2 62  ? 9.810   3.143   -6.402  1.00 0.00 ? 320 ILE A HD13 3  
ATOM   5069  N  N    . LEU B 2 63  ? 10.619  -1.187  -7.627  1.00 0.00 ? 321 LEU A N    3  
ATOM   5070  C  CA   . LEU B 2 63  ? 12.017  -1.243  -8.008  1.00 0.00 ? 321 LEU A CA   3  
ATOM   5071  C  C    . LEU B 2 63  ? 12.237  -2.394  -8.996  1.00 0.00 ? 321 LEU A C    3  
ATOM   5072  O  O    . LEU B 2 63  ? 12.739  -2.185  -10.101 1.00 0.00 ? 321 LEU A O    3  
ATOM   5073  C  CB   . LEU B 2 63  ? 12.865  -1.394  -6.738  1.00 0.00 ? 321 LEU A CB   3  
ATOM   5074  C  CG   . LEU B 2 63  ? 12.476  -0.466  -5.560  1.00 0.00 ? 321 LEU A CG   3  
ATOM   5075  C  CD1  . LEU B 2 63  ? 13.675  -0.133  -4.702  1.00 0.00 ? 321 LEU A CD1  3  
ATOM   5076  C  CD2  . LEU B 2 63  ? 11.831  0.825   -6.011  1.00 0.00 ? 321 LEU A CD2  3  
ATOM   5077  H  H    . LEU B 2 63  ? 10.370  -1.464  -6.717  1.00 0.00 ? 321 LEU A H    3  
ATOM   5078  H  HA   . LEU B 2 63  ? 12.268  -0.314  -8.492  1.00 0.00 ? 321 LEU A HA   3  
ATOM   5079  H  HB2  . LEU B 2 63  ? 12.775  -2.410  -6.393  1.00 0.00 ? 321 LEU A HB2  3  
ATOM   5080  H  HB3  . LEU B 2 63  ? 13.890  -1.221  -6.986  1.00 0.00 ? 321 LEU A HB3  3  
ATOM   5081  H  HG   . LEU B 2 63  ? 11.754  -0.982  -4.934  1.00 0.00 ? 321 LEU A HG   3  
ATOM   5082  H  HD11 . LEU B 2 63  ? 13.608  -0.670  -3.761  1.00 0.00 ? 321 LEU A HD11 3  
ATOM   5083  H  HD12 . LEU B 2 63  ? 13.696  0.930   -4.510  1.00 0.00 ? 321 LEU A HD12 3  
ATOM   5084  H  HD13 . LEU B 2 63  ? 14.578  -0.423  -5.218  1.00 0.00 ? 321 LEU A HD13 3  
ATOM   5085  H  HD21 . LEU B 2 63  ? 10.921  0.947   -5.455  1.00 0.00 ? 321 LEU A HD21 3  
ATOM   5086  H  HD22 . LEU B 2 63  ? 11.614  0.790   -7.066  1.00 0.00 ? 321 LEU A HD22 3  
ATOM   5087  H  HD23 . LEU B 2 63  ? 12.492  1.653   -5.804  1.00 0.00 ? 321 LEU A HD23 3  
ATOM   5088  N  N    . CYS B 2 64  ? 11.858  -3.604  -8.588  1.00 0.00 ? 322 CYS A N    3  
ATOM   5089  C  CA   . CYS B 2 64  ? 11.958  -4.781  -9.456  1.00 0.00 ? 322 CYS A CA   3  
ATOM   5090  C  C    . CYS B 2 64  ? 10.658  -4.971  -10.229 1.00 0.00 ? 322 CYS A C    3  
ATOM   5091  O  O    . CYS B 2 64  ? 10.625  -4.937  -11.459 1.00 0.00 ? 322 CYS A O    3  
ATOM   5092  C  CB   . CYS B 2 64  ? 12.202  -6.060  -8.652  1.00 0.00 ? 322 CYS A CB   3  
ATOM   5093  S  SG   . CYS B 2 64  ? 13.733  -6.097  -7.681  1.00 0.00 ? 322 CYS A SG   3  
ATOM   5094  H  H    . CYS B 2 64  ? 11.525  -3.711  -7.677  1.00 0.00 ? 322 CYS A H    3  
ATOM   5095  H  HA   . CYS B 2 64  ? 12.768  -4.631  -10.149 1.00 0.00 ? 322 CYS A HA   3  
ATOM   5096  H  HB2  . CYS B 2 64  ? 11.383  -6.203  -7.966  1.00 0.00 ? 322 CYS A HB2  3  
ATOM   5097  H  HB3  . CYS B 2 64  ? 12.232  -6.893  -9.338  1.00 0.00 ? 322 CYS A HB3  3  
ATOM   5098  N  N    . GLY B 2 65  ? 9.588   -5.172  -9.466  1.00 0.00 ? 323 GLY A N    3  
ATOM   5099  C  CA   . GLY B 2 65  ? 8.272   -5.404  -10.023 1.00 0.00 ? 323 GLY A CA   3  
ATOM   5100  C  C    . GLY B 2 65  ? 8.056   -6.872  -10.246 1.00 0.00 ? 323 GLY A C    3  
ATOM   5101  O  O    . GLY B 2 65  ? 7.350   -7.280  -11.169 1.00 0.00 ? 323 GLY A O    3  
ATOM   5102  H  H    . GLY B 2 65  ? 9.699   -5.154  -8.493  1.00 0.00 ? 323 GLY A H    3  
ATOM   5103  H  HA2  . GLY B 2 65  ? 7.532   -5.030  -9.339  1.00 0.00 ? 323 GLY A HA2  3  
ATOM   5104  H  HA3  . GLY B 2 65  ? 8.170   -4.891  -10.957 1.00 0.00 ? 323 GLY A HA3  3  
ATOM   5105  N  N    . THR B 2 66  ? 8.674   -7.671  -9.386  1.00 0.00 ? 324 THR A N    3  
ATOM   5106  C  CA   . THR B 2 66  ? 8.593   -9.111  -9.502  1.00 0.00 ? 324 THR A CA   3  
ATOM   5107  C  C    . THR B 2 66  ? 8.020   -9.738  -8.248  1.00 0.00 ? 324 THR A C    3  
ATOM   5108  O  O    . THR B 2 66  ? 7.563   -10.882 -8.259  1.00 0.00 ? 324 THR A O    3  
ATOM   5109  C  CB   . THR B 2 66  ? 9.984   -9.677  -9.761  1.00 0.00 ? 324 THR A CB   3  
ATOM   5110  O  OG1  . THR B 2 66  ? 9.926   -11.095 -9.932  1.00 0.00 ? 324 THR A OG1  3  
ATOM   5111  C  CG2  . THR B 2 66  ? 10.925  -9.301  -8.634  1.00 0.00 ? 324 THR A CG2  3  
ATOM   5112  H  H    . THR B 2 66  ? 9.200   -7.276  -8.642  1.00 0.00 ? 324 THR A H    3  
ATOM   5113  H  HA   . THR B 2 66  ? 7.970   -9.351  -10.346 1.00 0.00 ? 324 THR A HA   3  
ATOM   5114  H  HB   . THR B 2 66  ? 10.353  -9.234  -10.655 1.00 0.00 ? 324 THR A HB   3  
ATOM   5115  H  HG1  . THR B 2 66  ? 9.013   -11.366 -10.053 1.00 0.00 ? 324 THR A HG1  3  
ATOM   5116  H  HG21 . THR B 2 66  ? 10.955  -8.222  -8.554  1.00 0.00 ? 324 THR A HG21 3  
ATOM   5117  H  HG22 . THR B 2 66  ? 11.915  -9.676  -8.849  1.00 0.00 ? 324 THR A HG22 3  
ATOM   5118  H  HG23 . THR B 2 66  ? 10.570  -9.722  -7.708  1.00 0.00 ? 324 THR A HG23 3  
ATOM   5119  N  N    . SER B 2 67  ? 8.052   -8.973  -7.167  1.00 0.00 ? 325 SER A N    3  
ATOM   5120  C  CA   . SER B 2 67  ? 7.550   -9.431  -5.885  1.00 0.00 ? 325 SER A CA   3  
ATOM   5121  C  C    . SER B 2 67  ? 8.297   -10.686 -5.421  1.00 0.00 ? 325 SER A C    3  
ATOM   5122  O  O    . SER B 2 67  ? 7.871   -11.361 -4.487  1.00 0.00 ? 325 SER A O    3  
ATOM   5123  C  CB   . SER B 2 67  ? 6.044   -9.701  -5.966  1.00 0.00 ? 325 SER A CB   3  
ATOM   5124  O  OG   . SER B 2 67  ? 5.570   -10.319 -4.786  1.00 0.00 ? 325 SER A OG   3  
ATOM   5125  H  H    . SER B 2 67  ? 8.424   -8.070  -7.234  1.00 0.00 ? 325 SER A H    3  
ATOM   5126  H  HA   . SER B 2 67  ? 7.721   -8.638  -5.176  1.00 0.00 ? 325 SER A HA   3  
ATOM   5127  H  HB2  . SER B 2 67  ? 5.520   -8.764  -6.096  1.00 0.00 ? 325 SER A HB2  3  
ATOM   5128  H  HB3  . SER B 2 67  ? 5.840   -10.348 -6.807  1.00 0.00 ? 325 SER A HB3  3  
ATOM   5129  H  HG   . SER B 2 67  ? 6.025   -9.950  -4.026  1.00 0.00 ? 325 SER A HG   3  
ATOM   5130  N  N    . GLU B 2 68  ? 9.414   -10.987 -6.087  1.00 0.00 ? 326 GLU A N    3  
ATOM   5131  C  CA   . GLU B 2 68  ? 10.229  -12.163 -5.758  1.00 0.00 ? 326 GLU A CA   3  
ATOM   5132  C  C    . GLU B 2 68  ? 10.515  -12.294 -4.264  1.00 0.00 ? 326 GLU A C    3  
ATOM   5133  O  O    . GLU B 2 68  ? 9.824   -13.020 -3.550  1.00 0.00 ? 326 GLU A O    3  
ATOM   5134  C  CB   . GLU B 2 68  ? 11.557  -12.117 -6.507  1.00 0.00 ? 326 GLU A CB   3  
ATOM   5135  C  CG   . GLU B 2 68  ? 11.444  -12.472 -7.965  1.00 0.00 ? 326 GLU A CG   3  
ATOM   5136  C  CD   . GLU B 2 68  ? 11.396  -13.968 -8.206  1.00 0.00 ? 326 GLU A CD   3  
ATOM   5137  O  OE1  . GLU B 2 68  ? 10.323  -14.570 -7.995  1.00 0.00 ? 326 GLU A OE1  3  
ATOM   5138  O  OE2  . GLU B 2 68  ? 12.433  -14.538 -8.605  1.00 0.00 ? 326 GLU A OE2  3  
ATOM   5139  H  H    . GLU B 2 68  ? 9.692   -10.410 -6.836  1.00 0.00 ? 326 GLU A H    3  
ATOM   5140  H  HA   . GLU B 2 68  ? 9.687   -13.035 -6.081  1.00 0.00 ? 326 GLU A HA   3  
ATOM   5141  H  HB2  . GLU B 2 68  ? 11.958  -11.126 -6.431  1.00 0.00 ? 326 GLU A HB2  3  
ATOM   5142  H  HB3  . GLU B 2 68  ? 12.240  -12.807 -6.052  1.00 0.00 ? 326 GLU A HB3  3  
ATOM   5143  H  HG2  . GLU B 2 68  ? 10.542  -12.034 -8.339  1.00 0.00 ? 326 GLU A HG2  3  
ATOM   5144  H  HG3  . GLU B 2 68  ? 12.290  -12.059 -8.489  1.00 0.00 ? 326 GLU A HG3  3  
ATOM   5145  N  N    . ASN B 2 69  ? 11.549  -11.595 -3.802  1.00 0.00 ? 327 ASN A N    3  
ATOM   5146  C  CA   . ASN B 2 69  ? 11.961  -11.661 -2.406  1.00 0.00 ? 327 ASN A CA   3  
ATOM   5147  C  C    . ASN B 2 69  ? 11.086  -10.814 -1.489  1.00 0.00 ? 327 ASN A C    3  
ATOM   5148  O  O    . ASN B 2 69  ? 11.604  -10.129 -0.624  1.00 0.00 ? 327 ASN A O    3  
ATOM   5149  C  CB   . ASN B 2 69  ? 13.418  -11.237 -2.267  1.00 0.00 ? 327 ASN A CB   3  
ATOM   5150  C  CG   . ASN B 2 69  ? 14.327  -11.939 -3.247  1.00 0.00 ? 327 ASN A CG   3  
ATOM   5151  O  OD1  . ASN B 2 69  ? 14.794  -13.051 -3.000  1.00 0.00 ? 327 ASN A OD1  3  
ATOM   5152  N  ND2  . ASN B 2 69  ? 14.589  -11.282 -4.367  1.00 0.00 ? 327 ASN A ND2  3  
ATOM   5153  H  H    . ASN B 2 69  ? 12.048  -11.019 -4.419  1.00 0.00 ? 327 ASN A H    3  
ATOM   5154  H  HA   . ASN B 2 69  ? 11.884  -12.674 -2.092  1.00 0.00 ? 327 ASN A HA   3  
ATOM   5155  H  HB2  . ASN B 2 69  ? 13.489  -10.187 -2.448  1.00 0.00 ? 327 ASN A HB2  3  
ATOM   5156  H  HB3  . ASN B 2 69  ? 13.761  -11.452 -1.266  1.00 0.00 ? 327 ASN A HB3  3  
ATOM   5157  H  HD21 . ASN B 2 69  ? 14.184  -10.398 -4.491  1.00 0.00 ? 327 ASN A HD21 3  
ATOM   5158  H  HD22 . ASN B 2 69  ? 15.178  -11.701 -5.019  1.00 0.00 ? 327 ASN A HD22 3  
ATOM   5159  N  N    . ASP B 2 70  ? 9.769   -10.857 -1.686  1.00 0.00 ? 328 ASP A N    3  
ATOM   5160  C  CA   . ASP B 2 70  ? 8.832   -10.110 -0.854  1.00 0.00 ? 328 ASP A CA   3  
ATOM   5161  C  C    . ASP B 2 70  ? 9.184   -10.155 0.623   1.00 0.00 ? 328 ASP A C    3  
ATOM   5162  O  O    . ASP B 2 70  ? 8.748   -9.304  1.398   1.00 0.00 ? 328 ASP A O    3  
ATOM   5163  C  CB   . ASP B 2 70  ? 7.420   -10.613 -1.061  1.00 0.00 ? 328 ASP A CB   3  
ATOM   5164  C  CG   . ASP B 2 70  ? 7.358   -12.121 -1.203  1.00 0.00 ? 328 ASP A CG   3  
ATOM   5165  O  OD1  . ASP B 2 70  ? 7.595   -12.626 -2.318  1.00 0.00 ? 328 ASP A OD1  3  
ATOM   5166  O  OD2  . ASP B 2 70  ? 7.069   -12.800 -0.194  1.00 0.00 ? 328 ASP A OD2  3  
ATOM   5167  H  H    . ASP B 2 70  ? 9.419   -11.360 -2.435  1.00 0.00 ? 328 ASP A H    3  
ATOM   5168  H  HA   . ASP B 2 70  ? 8.870   -9.101  -1.176  1.00 0.00 ? 328 ASP A HA   3  
ATOM   5169  H  HB2  . ASP B 2 70  ? 6.816   -10.324 -0.213  1.00 0.00 ? 328 ASP A HB2  3  
ATOM   5170  H  HB3  . ASP B 2 70  ? 7.021   -10.154 -1.954  1.00 0.00 ? 328 ASP A HB3  3  
ATOM   5171  N  N    . ASP B 2 71  ? 9.969   -11.145 1.010   1.00 0.00 ? 329 ASP A N    3  
ATOM   5172  C  CA   . ASP B 2 71  ? 10.391  -11.267 2.396   1.00 0.00 ? 329 ASP A CA   3  
ATOM   5173  C  C    . ASP B 2 71  ? 11.201  -10.035 2.774   1.00 0.00 ? 329 ASP A C    3  
ATOM   5174  O  O    . ASP B 2 71  ? 11.505  -9.800  3.943   1.00 0.00 ? 329 ASP A O    3  
ATOM   5175  C  CB   . ASP B 2 71  ? 11.223  -12.535 2.600   1.00 0.00 ? 329 ASP A CB   3  
ATOM   5176  C  CG   . ASP B 2 71  ? 11.599  -12.749 4.053   1.00 0.00 ? 329 ASP A CG   3  
ATOM   5177  O  OD1  . ASP B 2 71  ? 10.682  -12.839 4.896   1.00 0.00 ? 329 ASP A OD1  3  
ATOM   5178  O  OD2  . ASP B 2 71  ? 12.811  -12.823 4.348   1.00 0.00 ? 329 ASP A OD2  3  
ATOM   5179  H  H    . ASP B 2 71  ? 10.281  -11.792 0.347   1.00 0.00 ? 329 ASP A H    3  
ATOM   5180  H  HA   . ASP B 2 71  ? 9.507   -11.313 3.015   1.00 0.00 ? 329 ASP A HA   3  
ATOM   5181  H  HB2  . ASP B 2 71  ? 10.655  -13.390 2.265   1.00 0.00 ? 329 ASP A HB2  3  
ATOM   5182  H  HB3  . ASP B 2 71  ? 12.130  -12.460 2.019   1.00 0.00 ? 329 ASP A HB3  3  
ATOM   5183  N  N    . GLN B 2 72  ? 11.539  -9.250  1.752   1.00 0.00 ? 330 GLN A N    3  
ATOM   5184  C  CA   . GLN B 2 72  ? 12.299  -8.034  1.920   1.00 0.00 ? 330 GLN A CA   3  
ATOM   5185  C  C    . GLN B 2 72  ? 11.510  -6.849  1.388   1.00 0.00 ? 330 GLN A C    3  
ATOM   5186  O  O    . GLN B 2 72  ? 11.782  -5.705  1.725   1.00 0.00 ? 330 GLN A O    3  
ATOM   5187  C  CB   . GLN B 2 72  ? 13.622  -8.145  1.178   1.00 0.00 ? 330 GLN A CB   3  
ATOM   5188  C  CG   . GLN B 2 72  ? 14.062  -9.579  0.972   1.00 0.00 ? 330 GLN A CG   3  
ATOM   5189  C  CD   . GLN B 2 72  ? 15.525  -9.706  0.649   1.00 0.00 ? 330 GLN A CD   3  
ATOM   5190  O  OE1  . GLN B 2 72  ? 15.936  -10.578 -0.116  1.00 0.00 ? 330 GLN A OE1  3  
ATOM   5191  N  NE2  . GLN B 2 72  ? 16.327  -8.842  1.247   1.00 0.00 ? 330 GLN A NE2  3  
ATOM   5192  H  H    . GLN B 2 72  ? 11.268  -9.503  0.849   1.00 0.00 ? 330 GLN A H    3  
ATOM   5193  H  HA   . GLN B 2 72  ? 12.493  -7.898  2.965   1.00 0.00 ? 330 GLN A HA   3  
ATOM   5194  H  HB2  . GLN B 2 72  ? 13.518  -7.675  0.217   1.00 0.00 ? 330 GLN A HB2  3  
ATOM   5195  H  HB3  . GLN B 2 72  ? 14.386  -7.632  1.742   1.00 0.00 ? 330 GLN A HB3  3  
ATOM   5196  H  HG2  . GLN B 2 72  ? 13.874  -10.114 1.877   1.00 0.00 ? 330 GLN A HG2  3  
ATOM   5197  H  HG3  . GLN B 2 72  ? 13.486  -10.014 0.165   1.00 0.00 ? 330 GLN A HG3  3  
ATOM   5198  H  HE21 . GLN B 2 72  ? 15.931  -8.184  1.855   1.00 0.00 ? 330 GLN A HE21 3  
ATOM   5199  H  HE22 . GLN B 2 72  ? 17.274  -8.896  1.056   1.00 0.00 ? 330 GLN A HE22 3  
ATOM   5200  N  N    . LEU B 2 73  ? 10.517  -7.129  0.559   1.00 0.00 ? 331 LEU A N    3  
ATOM   5201  C  CA   . LEU B 2 73  ? 9.710   -6.085  -0.017  1.00 0.00 ? 331 LEU A CA   3  
ATOM   5202  C  C    . LEU B 2 73  ? 9.150   -5.187  1.055   1.00 0.00 ? 331 LEU A C    3  
ATOM   5203  O  O    . LEU B 2 73  ? 8.708   -5.636  2.112   1.00 0.00 ? 331 LEU A O    3  
ATOM   5204  C  CB   . LEU B 2 73  ? 8.611   -6.685  -0.869  1.00 0.00 ? 331 LEU A CB   3  
ATOM   5205  C  CG   . LEU B 2 73  ? 9.096   -7.159  -2.233  1.00 0.00 ? 331 LEU A CG   3  
ATOM   5206  C  CD1  . LEU B 2 73  ? 7.966   -7.737  -3.030  1.00 0.00 ? 331 LEU A CD1  3  
ATOM   5207  C  CD2  . LEU B 2 73  ? 9.737   -6.029  -2.992  1.00 0.00 ? 331 LEU A CD2  3  
ATOM   5208  H  H    . LEU B 2 73  ? 10.311  -8.054  0.340   1.00 0.00 ? 331 LEU A H    3  
ATOM   5209  H  HA   . LEU B 2 73  ? 10.350  -5.493  -0.655  1.00 0.00 ? 331 LEU A HA   3  
ATOM   5210  H  HB2  . LEU B 2 73  ? 8.198   -7.533  -0.338  1.00 0.00 ? 331 LEU A HB2  3  
ATOM   5211  H  HB3  . LEU B 2 73  ? 7.837   -5.948  -1.014  1.00 0.00 ? 331 LEU A HB3  3  
ATOM   5212  H  HG   . LEU B 2 73  ? 9.825   -7.931  -2.088  1.00 0.00 ? 331 LEU A HG   3  
ATOM   5213  H  HD11 . LEU B 2 73  ? 7.059   -7.506  -2.538  1.00 0.00 ? 331 LEU A HD11 3  
ATOM   5214  H  HD12 . LEU B 2 73  ? 8.081   -8.809  -3.100  1.00 0.00 ? 331 LEU A HD12 3  
ATOM   5215  H  HD13 . LEU B 2 73  ? 7.962   -7.306  -4.021  1.00 0.00 ? 331 LEU A HD13 3  
ATOM   5216  H  HD21 . LEU B 2 73  ? 9.006   -5.275  -3.154  1.00 0.00 ? 331 LEU A HD21 3  
ATOM   5217  H  HD22 . LEU B 2 73  ? 10.099  -6.390  -3.940  1.00 0.00 ? 331 LEU A HD22 3  
ATOM   5218  H  HD23 . LEU B 2 73  ? 10.556  -5.624  -2.420  1.00 0.00 ? 331 LEU A HD23 3  
ATOM   5219  N  N    . LEU B 2 74  ? 9.189   -3.911  0.761   1.00 0.00 ? 332 LEU A N    3  
ATOM   5220  C  CA   . LEU B 2 74  ? 8.721   -2.897  1.672   1.00 0.00 ? 332 LEU A CA   3  
ATOM   5221  C  C    . LEU B 2 74  ? 7.513   -2.219  1.096   1.00 0.00 ? 332 LEU A C    3  
ATOM   5222  O  O    . LEU B 2 74  ? 7.586   -1.528  0.088   1.00 0.00 ? 332 LEU A O    3  
ATOM   5223  C  CB   . LEU B 2 74  ? 9.805   -1.868  1.939   1.00 0.00 ? 332 LEU A CB   3  
ATOM   5224  C  CG   . LEU B 2 74  ? 11.032  -2.340  2.675   1.00 0.00 ? 332 LEU A CG   3  
ATOM   5225  C  CD1  . LEU B 2 74  ? 12.065  -1.262  2.682   1.00 0.00 ? 332 LEU A CD1  3  
ATOM   5226  C  CD2  . LEU B 2 74  ? 10.716  -2.685  4.094   1.00 0.00 ? 332 LEU A CD2  3  
ATOM   5227  H  H    . LEU B 2 74  ? 9.532   -3.645  -0.120  1.00 0.00 ? 332 LEU A H    3  
ATOM   5228  H  HA   . LEU B 2 74  ? 8.436   -3.379  2.594   1.00 0.00 ? 332 LEU A HA   3  
ATOM   5229  H  HB2  . LEU B 2 74  ? 10.121  -1.459  0.995   1.00 0.00 ? 332 LEU A HB2  3  
ATOM   5230  H  HB3  . LEU B 2 74  ? 9.374   -1.079  2.521   1.00 0.00 ? 332 LEU A HB3  3  
ATOM   5231  H  HG   . LEU B 2 74  ? 11.456  -3.193  2.203   1.00 0.00 ? 332 LEU A HG   3  
ATOM   5232  H  HD11 . LEU B 2 74  ? 11.974  -0.692  3.594   1.00 0.00 ? 332 LEU A HD11 3  
ATOM   5233  H  HD12 . LEU B 2 74  ? 11.921  -0.619  1.831   1.00 0.00 ? 332 LEU A HD12 3  
ATOM   5234  H  HD13 . LEU B 2 74  ? 13.043  -1.704  2.637   1.00 0.00 ? 332 LEU A HD13 3  
ATOM   5235  H  HD21 . LEU B 2 74  ? 11.469  -2.216  4.703   1.00 0.00 ? 332 LEU A HD21 3  
ATOM   5236  H  HD22 . LEU B 2 74  ? 10.745  -3.758  4.227   1.00 0.00 ? 332 LEU A HD22 3  
ATOM   5237  H  HD23 . LEU B 2 74  ? 9.742   -2.305  4.359   1.00 0.00 ? 332 LEU A HD23 3  
ATOM   5238  N  N    . PHE B 2 75  ? 6.426   -2.390  1.783   1.00 0.00 ? 333 PHE A N    3  
ATOM   5239  C  CA   . PHE B 2 75  ? 5.157   -1.868  1.358   1.00 0.00 ? 333 PHE A CA   3  
ATOM   5240  C  C    . PHE B 2 75  ? 4.944   -0.468  1.889   1.00 0.00 ? 333 PHE A C    3  
ATOM   5241  O  O    . PHE B 2 75  ? 4.502   -0.295  3.025   1.00 0.00 ? 333 PHE A O    3  
ATOM   5242  C  CB   . PHE B 2 75  ? 4.083   -2.827  1.870   1.00 0.00 ? 333 PHE A CB   3  
ATOM   5243  C  CG   . PHE B 2 75  ? 4.546   -4.263  1.770   1.00 0.00 ? 333 PHE A CG   3  
ATOM   5244  C  CD1  . PHE B 2 75  ? 5.363   -4.814  2.749   1.00 0.00 ? 333 PHE A CD1  3  
ATOM   5245  C  CD2  . PHE B 2 75  ? 4.211   -5.042  0.680   1.00 0.00 ? 333 PHE A CD2  3  
ATOM   5246  C  CE1  . PHE B 2 75  ? 5.833   -6.108  2.639   1.00 0.00 ? 333 PHE A CE1  3  
ATOM   5247  C  CE2  . PHE B 2 75  ? 4.684   -6.340  0.556   1.00 0.00 ? 333 PHE A CE2  3  
ATOM   5248  C  CZ   . PHE B 2 75  ? 5.501   -6.873  1.539   1.00 0.00 ? 333 PHE A CZ   3  
ATOM   5249  H  H    . PHE B 2 75  ? 6.479   -2.869  2.630   1.00 0.00 ? 333 PHE A H    3  
ATOM   5250  H  HA   . PHE B 2 75  ? 5.135   -1.852  0.280   1.00 0.00 ? 333 PHE A HA   3  
ATOM   5251  H  HB2  . PHE B 2 75  ? 3.875   -2.608  2.910   1.00 0.00 ? 333 PHE A HB2  3  
ATOM   5252  H  HB3  . PHE B 2 75  ? 3.179   -2.707  1.289   1.00 0.00 ? 333 PHE A HB3  3  
ATOM   5253  H  HD1  . PHE B 2 75  ? 5.626   -4.219  3.612   1.00 0.00 ? 333 PHE A HD1  3  
ATOM   5254  H  HD2  . PHE B 2 75  ? 3.589   -4.622  -0.083  1.00 0.00 ? 333 PHE A HD2  3  
ATOM   5255  H  HE1  . PHE B 2 75  ? 6.469   -6.519  3.409   1.00 0.00 ? 333 PHE A HE1  3  
ATOM   5256  H  HE2  . PHE B 2 75  ? 4.397   -6.944  -0.300  1.00 0.00 ? 333 PHE A HE2  3  
ATOM   5257  H  HZ   . PHE B 2 75  ? 5.892   -7.880  1.442   1.00 0.00 ? 333 PHE A HZ   3  
ATOM   5258  N  N    . CYS B 2 76  ? 5.266   0.540   1.074   1.00 0.00 ? 334 CYS A N    3  
ATOM   5259  C  CA   . CYS B 2 76  ? 5.054   1.903   1.510   1.00 0.00 ? 334 CYS A CA   3  
ATOM   5260  C  C    . CYS B 2 76  ? 3.593   2.056   1.827   1.00 0.00 ? 334 CYS A C    3  
ATOM   5261  O  O    . CYS B 2 76  ? 2.771   2.128   0.931   1.00 0.00 ? 334 CYS A O    3  
ATOM   5262  C  CB   . CYS B 2 76  ? 5.439   2.962   0.463   1.00 0.00 ? 334 CYS A CB   3  
ATOM   5263  S  SG   . CYS B 2 76  ? 4.830   4.620   0.944   1.00 0.00 ? 334 CYS A SG   3  
ATOM   5264  H  H    . CYS B 2 76  ? 5.642   0.357   0.187   1.00 0.00 ? 334 CYS A H    3  
ATOM   5265  H  HA   . CYS B 2 76  ? 5.629   2.059   2.412   1.00 0.00 ? 334 CYS A HA   3  
ATOM   5266  H  HB2  . CYS B 2 76  ? 6.513   3.004   0.378   1.00 0.00 ? 334 CYS A HB2  3  
ATOM   5267  H  HB3  . CYS B 2 76  ? 5.005   2.707   -0.491  1.00 0.00 ? 334 CYS A HB3  3  
ATOM   5268  N  N    . ASP B 2 77  ? 3.247   2.095   3.089   1.00 0.00 ? 335 ASP A N    3  
ATOM   5269  C  CA   . ASP B 2 77  ? 1.846   2.241   3.422   1.00 0.00 ? 335 ASP A CA   3  
ATOM   5270  C  C    . ASP B 2 77  ? 1.426   3.693   3.184   1.00 0.00 ? 335 ASP A C    3  
ATOM   5271  O  O    . ASP B 2 77  ? 0.447   4.181   3.748   1.00 0.00 ? 335 ASP A O    3  
ATOM   5272  C  CB   . ASP B 2 77  ? 1.567   1.826   4.861   1.00 0.00 ? 335 ASP A CB   3  
ATOM   5273  C  CG   . ASP B 2 77  ? 2.066   2.837   5.873   1.00 0.00 ? 335 ASP A CG   3  
ATOM   5274  O  OD1  . ASP B 2 77  ? 3.244   3.241   5.779   1.00 0.00 ? 335 ASP A OD1  3  
ATOM   5275  O  OD2  . ASP B 2 77  ? 1.279   3.220   6.765   1.00 0.00 ? 335 ASP A OD2  3  
ATOM   5276  H  H    . ASP B 2 77  ? 3.930   2.044   3.791   1.00 0.00 ? 335 ASP A H    3  
ATOM   5277  H  HA   . ASP B 2 77  ? 1.295   1.586   2.750   1.00 0.00 ? 335 ASP A HA   3  
ATOM   5278  H  HB2  . ASP B 2 77  ? 0.501   1.714   4.983   1.00 0.00 ? 335 ASP A HB2  3  
ATOM   5279  H  HB3  . ASP B 2 77  ? 2.049   0.878   5.056   1.00 0.00 ? 335 ASP A HB3  3  
ATOM   5280  N  N    . ASP B 2 78  ? 2.201   4.366   2.332   1.00 0.00 ? 336 ASP A N    3  
ATOM   5281  C  CA   . ASP B 2 78  ? 1.981   5.760   1.975   1.00 0.00 ? 336 ASP A CA   3  
ATOM   5282  C  C    . ASP B 2 78  ? 1.869   5.881   0.449   1.00 0.00 ? 336 ASP A C    3  
ATOM   5283  O  O    . ASP B 2 78  ? 1.882   6.980   -0.105  1.00 0.00 ? 336 ASP A O    3  
ATOM   5284  C  CB   . ASP B 2 78  ? 3.128   6.617   2.514   1.00 0.00 ? 336 ASP A CB   3  
ATOM   5285  C  CG   . ASP B 2 78  ? 2.693   7.996   2.969   1.00 0.00 ? 336 ASP A CG   3  
ATOM   5286  O  OD1  . ASP B 2 78  ? 1.629   8.103   3.604   1.00 0.00 ? 336 ASP A OD1  3  
ATOM   5287  O  OD2  . ASP B 2 78  ? 3.424   8.970   2.696   1.00 0.00 ? 336 ASP A OD2  3  
ATOM   5288  H  H    . ASP B 2 78  ? 2.945   3.899   1.913   1.00 0.00 ? 336 ASP A H    3  
ATOM   5289  H  HA   . ASP B 2 78  ? 1.047   6.078   2.421   1.00 0.00 ? 336 ASP A HA   3  
ATOM   5290  H  HB2  . ASP B 2 78  ? 3.579   6.112   3.354   1.00 0.00 ? 336 ASP A HB2  3  
ATOM   5291  H  HB3  . ASP B 2 78  ? 3.862   6.730   1.736   1.00 0.00 ? 336 ASP A HB3  3  
ATOM   5292  N  N    . CYS B 2 79  ? 1.743   4.716   -0.206  1.00 0.00 ? 337 CYS A N    3  
ATOM   5293  C  CA   . CYS B 2 79  ? 1.564   4.597   -1.652  1.00 0.00 ? 337 CYS A CA   3  
ATOM   5294  C  C    . CYS B 2 79  ? 1.219   3.159   -1.987  1.00 0.00 ? 337 CYS A C    3  
ATOM   5295  O  O    . CYS B 2 79  ? 0.382   2.881   -2.841  1.00 0.00 ? 337 CYS A O    3  
ATOM   5296  C  CB   . CYS B 2 79  ? 2.806   4.914   -2.475  1.00 0.00 ? 337 CYS A CB   3  
ATOM   5297  S  SG   . CYS B 2 79  ? 3.621   6.505   -2.187  1.00 0.00 ? 337 CYS A SG   3  
ATOM   5298  H  H    . CYS B 2 79  ? 1.761   3.893   0.310   1.00 0.00 ? 337 CYS A H    3  
ATOM   5299  H  HA   . CYS B 2 79  ? 0.759   5.238   -1.938  1.00 0.00 ? 337 CYS A HA   3  
ATOM   5300  H  HB2  . CYS B 2 79  ? 3.521   4.152   -2.294  1.00 0.00 ? 337 CYS A HB2  3  
ATOM   5301  H  HB3  . CYS B 2 79  ? 2.523   4.883   -3.521  1.00 0.00 ? 337 CYS A HB3  3  
ATOM   5302  N  N    . ASP B 2 80  ? 1.959   2.274   -1.323  1.00 0.00 ? 338 ASP A N    3  
ATOM   5303  C  CA   . ASP B 2 80  ? 1.860   0.822   -1.460  1.00 0.00 ? 338 ASP A CA   3  
ATOM   5304  C  C    . ASP B 2 80  ? 3.036   0.319   -2.287  1.00 0.00 ? 338 ASP A C    3  
ATOM   5305  O  O    . ASP B 2 80  ? 3.232   -0.885  -2.460  1.00 0.00 ? 338 ASP A O    3  
ATOM   5306  C  CB   . ASP B 2 80  ? 0.536   0.380   -2.078  1.00 0.00 ? 338 ASP A CB   3  
ATOM   5307  C  CG   . ASP B 2 80  ? 0.372   -1.126  -2.068  1.00 0.00 ? 338 ASP A CG   3  
ATOM   5308  O  OD1  . ASP B 2 80  ? 0.650   -1.744  -1.017  1.00 0.00 ? 338 ASP A OD1  3  
ATOM   5309  O  OD2  . ASP B 2 80  ? -0.027  -1.689  -3.107  1.00 0.00 ? 338 ASP A OD2  3  
ATOM   5310  H  H    . ASP B 2 80  ? 2.633   2.625   -0.709  1.00 0.00 ? 338 ASP A H    3  
ATOM   5311  H  HA   . ASP B 2 80  ? 1.941   0.406   -0.464  1.00 0.00 ? 338 ASP A HA   3  
ATOM   5312  H  HB2  . ASP B 2 80  ? -0.280  0.817   -1.523  1.00 0.00 ? 338 ASP A HB2  3  
ATOM   5313  H  HB3  . ASP B 2 80  ? 0.496   0.728   -3.095  1.00 0.00 ? 338 ASP A HB3  3  
ATOM   5314  N  N    . ARG B 2 81  ? 3.815   1.273   -2.789  1.00 0.00 ? 339 ARG A N    3  
ATOM   5315  C  CA   . ARG B 2 81  ? 5.002   0.988   -3.583  1.00 0.00 ? 339 ARG A CA   3  
ATOM   5316  C  C    . ARG B 2 81  ? 5.942   0.051   -2.829  1.00 0.00 ? 339 ARG A C    3  
ATOM   5317  O  O    . ARG B 2 81  ? 6.552   0.442   -1.834  1.00 0.00 ? 339 ARG A O    3  
ATOM   5318  C  CB   . ARG B 2 81  ? 5.707   2.304   -3.905  1.00 0.00 ? 339 ARG A CB   3  
ATOM   5319  C  CG   . ARG B 2 81  ? 4.946   3.167   -4.895  1.00 0.00 ? 339 ARG A CG   3  
ATOM   5320  C  CD   . ARG B 2 81  ? 5.670   3.245   -6.227  1.00 0.00 ? 339 ARG A CD   3  
ATOM   5321  N  NE   . ARG B 2 81  ? 4.869   3.916   -7.248  1.00 0.00 ? 339 ARG A NE   3  
ATOM   5322  C  CZ   . ARG B 2 81  ? 5.228   4.009   -8.527  1.00 0.00 ? 339 ARG A CZ   3  
ATOM   5323  N  NH1  . ARG B 2 81  ? 6.360   3.460   -8.943  1.00 0.00 ? 339 ARG A NH1  3  
ATOM   5324  N  NH2  . ARG B 2 81  ? 4.451   4.649   -9.391  1.00 0.00 ? 339 ARG A NH2  3  
ATOM   5325  H  H    . ARG B 2 81  ? 3.580   2.208   -2.624  1.00 0.00 ? 339 ARG A H    3  
ATOM   5326  H  HA   . ARG B 2 81  ? 4.694   0.518   -4.505  1.00 0.00 ? 339 ARG A HA   3  
ATOM   5327  H  HB2  . ARG B 2 81  ? 5.830   2.865   -2.991  1.00 0.00 ? 339 ARG A HB2  3  
ATOM   5328  H  HB3  . ARG B 2 81  ? 6.676   2.090   -4.318  1.00 0.00 ? 339 ARG A HB3  3  
ATOM   5329  H  HG2  . ARG B 2 81  ? 3.965   2.740   -5.053  1.00 0.00 ? 339 ARG A HG2  3  
ATOM   5330  H  HG3  . ARG B 2 81  ? 4.847   4.165   -4.489  1.00 0.00 ? 339 ARG A HG3  3  
ATOM   5331  H  HD2  . ARG B 2 81  ? 6.596   3.801   -6.088  1.00 0.00 ? 339 ARG A HD2  3  
ATOM   5332  H  HD3  . ARG B 2 81  ? 5.897   2.243   -6.555  1.00 0.00 ? 339 ARG A HD3  3  
ATOM   5333  H  HE   . ARG B 2 81  ? 4.022   4.322   -6.967  1.00 0.00 ? 339 ARG A HE   3  
ATOM   5334  H  HH11 . ARG B 2 81  ? 6.947   2.973   -8.298  1.00 0.00 ? 339 ARG A HH11 3  
ATOM   5335  H  HH12 . ARG B 2 81  ? 6.626   3.532   -9.905  1.00 0.00 ? 339 ARG A HH12 3  
ATOM   5336  H  HH21 . ARG B 2 81  ? 3.595   5.063   -9.082  1.00 0.00 ? 339 ARG A HH21 3  
ATOM   5337  H  HH22 . ARG B 2 81  ? 4.723   4.718   -10.351 1.00 0.00 ? 339 ARG A HH22 3  
ATOM   5338  N  N    . GLY B 2 82  ? 6.055   -1.186  -3.308  1.00 0.00 ? 340 GLY A N    3  
ATOM   5339  C  CA   . GLY B 2 82  ? 6.912   -2.157  -2.649  1.00 0.00 ? 340 GLY A CA   3  
ATOM   5340  C  C    . GLY B 2 82  ? 8.351   -2.113  -3.125  1.00 0.00 ? 340 GLY A C    3  
ATOM   5341  O  O    . GLY B 2 82  ? 8.612   -2.040  -4.316  1.00 0.00 ? 340 GLY A O    3  
ATOM   5342  H  H    . GLY B 2 82  ? 5.555   -1.441  -4.112  1.00 0.00 ? 340 GLY A H    3  
ATOM   5343  H  HA2  . GLY B 2 82  ? 6.891   -1.968  -1.594  1.00 0.00 ? 340 GLY A HA2  3  
ATOM   5344  H  HA3  . GLY B 2 82  ? 6.523   -3.150  -2.826  1.00 0.00 ? 340 GLY A HA3  3  
ATOM   5345  N  N    . TYR B 2 83  ? 9.290   -2.103  -2.187  1.00 0.00 ? 341 TYR A N    3  
ATOM   5346  C  CA   . TYR B 2 83  ? 10.714  -2.124  -2.521  1.00 0.00 ? 341 TYR A CA   3  
ATOM   5347  C  C    . TYR B 2 83  ? 11.404  -3.144  -1.644  1.00 0.00 ? 341 TYR A C    3  
ATOM   5348  O  O    . TYR B 2 83  ? 11.310  -3.058  -0.425  1.00 0.00 ? 341 TYR A O    3  
ATOM   5349  C  CB   . TYR B 2 83  ? 11.479  -0.837  -2.199  1.00 0.00 ? 341 TYR A CB   3  
ATOM   5350  C  CG   . TYR B 2 83  ? 11.000  0.510   -2.694  1.00 0.00 ? 341 TYR A CG   3  
ATOM   5351  C  CD1  . TYR B 2 83  ? 9.719   0.743   -3.128  1.00 0.00 ? 341 TYR A CD1  3  
ATOM   5352  C  CD2  . TYR B 2 83  ? 11.865  1.598   -2.606  1.00 0.00 ? 341 TYR A CD2  3  
ATOM   5353  C  CE1  . TYR B 2 83  ? 9.308   2.013   -3.468  1.00 0.00 ? 341 TYR A CE1  3  
ATOM   5354  C  CE2  . TYR B 2 83  ? 11.463  2.862   -2.961  1.00 0.00 ? 341 TYR A CE2  3  
ATOM   5355  C  CZ   . TYR B 2 83  ? 10.178  3.062   -3.390  1.00 0.00 ? 341 TYR A CZ   3  
ATOM   5356  O  OH   . TYR B 2 83  ? 9.747   4.320   -3.725  1.00 0.00 ? 341 TYR A OH   3  
ATOM   5357  H  H    . TYR B 2 83  ? 9.022   -2.090  -1.247  1.00 0.00 ? 341 TYR A H    3  
ATOM   5358  H  HA   . TYR B 2 83  ? 10.828  -2.387  -3.560  1.00 0.00 ? 341 TYR A HA   3  
ATOM   5359  H  HB2  . TYR B 2 83  ? 11.522  -0.763  -1.128  1.00 0.00 ? 341 TYR A HB2  3  
ATOM   5360  H  HB3  . TYR B 2 83  ? 12.488  -0.959  -2.543  1.00 0.00 ? 341 TYR A HB3  3  
ATOM   5361  H  HD1  . TYR B 2 83  ? 9.042   -0.081  -3.224  1.00 0.00 ? 341 TYR A HD1  3  
ATOM   5362  H  HD2  . TYR B 2 83  ? 12.877  1.434   -2.268  1.00 0.00 ? 341 TYR A HD2  3  
ATOM   5363  H  HE1  . TYR B 2 83  ? 8.304   2.179   -3.799  1.00 0.00 ? 341 TYR A HE1  3  
ATOM   5364  H  HE2  . TYR B 2 83  ? 12.155  3.687   -2.898  1.00 0.00 ? 341 TYR A HE2  3  
ATOM   5365  H  HH   . TYR B 2 83  ? 8.859   4.455   -3.387  1.00 0.00 ? 341 TYR A HH   3  
ATOM   5366  N  N    . HIS B 2 84  ? 12.165  -4.047  -2.215  1.00 0.00 ? 342 HIS A N    3  
ATOM   5367  C  CA   . HIS B 2 84  ? 12.866  -4.998  -1.371  1.00 0.00 ? 342 HIS A CA   3  
ATOM   5368  C  C    . HIS B 2 84  ? 13.837  -4.157  -0.553  1.00 0.00 ? 342 HIS A C    3  
ATOM   5369  O  O    . HIS B 2 84  ? 14.660  -3.508  -1.152  1.00 0.00 ? 342 HIS A O    3  
ATOM   5370  C  CB   . HIS B 2 84  ? 13.649  -6.040  -2.190  1.00 0.00 ? 342 HIS A CB   3  
ATOM   5371  C  CG   . HIS B 2 84  ? 12.833  -7.007  -3.007  1.00 0.00 ? 342 HIS A CG   3  
ATOM   5372  N  ND1  . HIS B 2 84  ? 12.627  -6.886  -4.368  1.00 0.00 ? 342 HIS A ND1  3  
ATOM   5373  C  CD2  . HIS B 2 84  ? 12.165  -8.119  -2.642  1.00 0.00 ? 342 HIS A CD2  3  
ATOM   5374  C  CE1  . HIS B 2 84  ? 11.865  -7.870  -4.803  1.00 0.00 ? 342 HIS A CE1  3  
ATOM   5375  N  NE2  . HIS B 2 84  ? 11.576  -8.640  -3.772  1.00 0.00 ? 342 HIS A NE2  3  
ATOM   5376  H  H    . HIS B 2 84  ? 12.324  -4.015  -3.177  1.00 0.00 ? 342 HIS A H    3  
ATOM   5377  H  HA   . HIS B 2 84  ? 12.154  -5.482  -0.714  1.00 0.00 ? 342 HIS A HA   3  
ATOM   5378  H  HB2  . HIS B 2 84  ? 14.309  -5.526  -2.863  1.00 0.00 ? 342 HIS A HB2  3  
ATOM   5379  H  HB3  . HIS B 2 84  ? 14.238  -6.615  -1.507  1.00 0.00 ? 342 HIS A HB3  3  
ATOM   5380  H  HD2  . HIS B 2 84  ? 12.079  -8.507  -1.641  1.00 0.00 ? 342 HIS A HD2  3  
ATOM   5381  H  HE1  . HIS B 2 84  ? 11.469  -7.967  -5.813  1.00 0.00 ? 342 HIS A HE1  3  
ATOM   5382  H  HE2  . HIS B 2 84  ? 10.981  -9.420  -3.799  1.00 0.00 ? 342 HIS A HE2  3  
ATOM   5383  N  N    . MET B 2 85  ? 13.703  -4.095  0.781   1.00 0.00 ? 343 MET A N    3  
ATOM   5384  C  CA   . MET B 2 85  ? 14.599  -3.249  1.611   1.00 0.00 ? 343 MET A CA   3  
ATOM   5385  C  C    . MET B 2 85  ? 15.980  -3.072  1.011   1.00 0.00 ? 343 MET A C    3  
ATOM   5386  O  O    . MET B 2 85  ? 16.633  -2.057  1.242   1.00 0.00 ? 343 MET A O    3  
ATOM   5387  C  CB   . MET B 2 85  ? 14.803  -3.774  3.036   1.00 0.00 ? 343 MET A CB   3  
ATOM   5388  C  CG   . MET B 2 85  ? 13.556  -4.093  3.808   1.00 0.00 ? 343 MET A CG   3  
ATOM   5389  S  SD   . MET B 2 85  ? 13.184  -5.850  3.969   1.00 0.00 ? 343 MET A SD   3  
ATOM   5390  C  CE   . MET B 2 85  ? 14.814  -6.569  4.100   1.00 0.00 ? 343 MET A CE   3  
ATOM   5391  H  H    . MET B 2 85  ? 12.978  -4.584  1.209   1.00 0.00 ? 343 MET A H    3  
ATOM   5392  H  HA   . MET B 2 85  ? 14.147  -2.268  1.662   1.00 0.00 ? 343 MET A HA   3  
ATOM   5393  H  HB2  . MET B 2 85  ? 15.424  -4.647  3.006   1.00 0.00 ? 343 MET A HB2  3  
ATOM   5394  H  HB3  . MET B 2 85  ? 15.306  -3.002  3.587   1.00 0.00 ? 343 MET A HB3  3  
ATOM   5395  H  HG2  . MET B 2 85  ? 13.667  -3.686  4.799   1.00 0.00 ? 343 MET A HG2  3  
ATOM   5396  H  HG3  . MET B 2 85  ? 12.751  -3.603  3.316   1.00 0.00 ? 343 MET A HG3  3  
ATOM   5397  H  HE1  . MET B 2 85  ? 15.355  -6.377  3.190   1.00 0.00 ? 343 MET A HE1  3  
ATOM   5398  H  HE2  . MET B 2 85  ? 14.731  -7.634  4.254   1.00 0.00 ? 343 MET A HE2  3  
ATOM   5399  H  HE3  . MET B 2 85  ? 15.339  -6.124  4.929   1.00 0.00 ? 343 MET A HE3  3  
ATOM   5400  N  N    . TYR B 2 86  ? 16.438  -4.052  0.268   1.00 0.00 ? 344 TYR A N    3  
ATOM   5401  C  CA   . TYR B 2 86  ? 17.755  -3.947  -0.337  1.00 0.00 ? 344 TYR A CA   3  
ATOM   5402  C  C    . TYR B 2 86  ? 17.639  -3.489  -1.783  1.00 0.00 ? 344 TYR A C    3  
ATOM   5403  O  O    . TYR B 2 86  ? 18.492  -3.800  -2.616  1.00 0.00 ? 344 TYR A O    3  
ATOM   5404  C  CB   . TYR B 2 86  ? 18.527  -5.266  -0.237  1.00 0.00 ? 344 TYR A CB   3  
ATOM   5405  C  CG   . TYR B 2 86  ? 17.996  -6.364  -1.124  1.00 0.00 ? 344 TYR A CG   3  
ATOM   5406  C  CD1  . TYR B 2 86  ? 16.720  -6.870  -0.940  1.00 0.00 ? 344 TYR A CD1  3  
ATOM   5407  C  CD2  . TYR B 2 86  ? 18.778  -6.901  -2.140  1.00 0.00 ? 344 TYR A CD2  3  
ATOM   5408  C  CE1  . TYR B 2 86  ? 16.237  -7.879  -1.741  1.00 0.00 ? 344 TYR A CE1  3  
ATOM   5409  C  CE2  . TYR B 2 86  ? 18.298  -7.912  -2.949  1.00 0.00 ? 344 TYR A CE2  3  
ATOM   5410  C  CZ   . TYR B 2 86  ? 17.026  -8.398  -2.745  1.00 0.00 ? 344 TYR A CZ   3  
ATOM   5411  O  OH   . TYR B 2 86  ? 16.541  -9.406  -3.546  1.00 0.00 ? 344 TYR A OH   3  
ATOM   5412  H  H    . TYR B 2 86  ? 15.868  -4.838  0.100   1.00 0.00 ? 344 TYR A H    3  
ATOM   5413  H  HA   . TYR B 2 86  ? 18.295  -3.190  0.211   1.00 0.00 ? 344 TYR A HA   3  
ATOM   5414  H  HB2  . TYR B 2 86  ? 19.555  -5.091  -0.512  1.00 0.00 ? 344 TYR A HB2  3  
ATOM   5415  H  HB3  . TYR B 2 86  ? 18.490  -5.617  0.784   1.00 0.00 ? 344 TYR A HB3  3  
ATOM   5416  H  HD1  . TYR B 2 86  ? 16.094  -6.463  -0.154  1.00 0.00 ? 344 TYR A HD1  3  
ATOM   5417  H  HD2  . TYR B 2 86  ? 19.776  -6.516  -2.295  1.00 0.00 ? 344 TYR A HD2  3  
ATOM   5418  H  HE1  . TYR B 2 86  ? 15.239  -8.252  -1.575  1.00 0.00 ? 344 TYR A HE1  3  
ATOM   5419  H  HE2  . TYR B 2 86  ? 18.919  -8.316  -3.735  1.00 0.00 ? 344 TYR A HE2  3  
ATOM   5420  H  HH   . TYR B 2 86  ? 15.656  -9.183  -3.843  1.00 0.00 ? 344 TYR A HH   3  
ATOM   5421  N  N    . CYS B 2 87  ? 16.575  -2.737  -2.079  1.00 0.00 ? 345 CYS A N    3  
ATOM   5422  C  CA   . CYS B 2 87  ? 16.362  -2.227  -3.416  1.00 0.00 ? 345 CYS A CA   3  
ATOM   5423  C  C    . CYS B 2 87  ? 16.306  -0.725  -3.361  1.00 0.00 ? 345 CYS A C    3  
ATOM   5424  O  O    . CYS B 2 87  ? 16.593  -0.027  -4.334  1.00 0.00 ? 345 CYS A O    3  
ATOM   5425  C  CB   . CYS B 2 87  ? 15.069  -2.782  -4.026  1.00 0.00 ? 345 CYS A CB   3  
ATOM   5426  S  SG   . CYS B 2 87  ? 15.255  -4.482  -4.609  1.00 0.00 ? 345 CYS A SG   3  
ATOM   5427  H  H    . CYS B 2 87  ? 15.913  -2.513  -1.369  1.00 0.00 ? 345 CYS A H    3  
ATOM   5428  H  HA   . CYS B 2 87  ? 17.197  -2.534  -4.010  1.00 0.00 ? 345 CYS A HA   3  
ATOM   5429  H  HB2  . CYS B 2 87  ? 14.287  -2.766  -3.286  1.00 0.00 ? 345 CYS A HB2  3  
ATOM   5430  H  HB3  . CYS B 2 87  ? 14.769  -2.168  -4.869  1.00 0.00 ? 345 CYS A HB3  3  
ATOM   5431  N  N    . LEU B 2 88  ? 15.944  -0.248  -2.188  1.00 0.00 ? 346 LEU A N    3  
ATOM   5432  C  CA   . LEU B 2 88  ? 15.799  1.171   -1.941  1.00 0.00 ? 346 LEU A CA   3  
ATOM   5433  C  C    . LEU B 2 88  ? 17.080  1.942   -2.242  1.00 0.00 ? 346 LEU A C    3  
ATOM   5434  O  O    . LEU B 2 88  ? 18.096  1.368   -2.638  1.00 0.00 ? 346 LEU A O    3  
ATOM   5435  C  CB   . LEU B 2 88  ? 15.391  1.418   -0.484  1.00 0.00 ? 346 LEU A CB   3  
ATOM   5436  C  CG   . LEU B 2 88  ? 14.992  0.166   0.289   1.00 0.00 ? 346 LEU A CG   3  
ATOM   5437  C  CD1  . LEU B 2 88  ? 14.635  0.478   1.713   1.00 0.00 ? 346 LEU A CD1  3  
ATOM   5438  C  CD2  . LEU B 2 88  ? 13.826  -0.517  -0.366  1.00 0.00 ? 346 LEU A CD2  3  
ATOM   5439  H  H    . LEU B 2 88  ? 15.757  -0.884  -1.458  1.00 0.00 ? 346 LEU A H    3  
ATOM   5440  H  HA   . LEU B 2 88  ? 15.014  1.517   -2.579  1.00 0.00 ? 346 LEU A HA   3  
ATOM   5441  H  HB2  . LEU B 2 88  ? 16.222  1.880   0.026   1.00 0.00 ? 346 LEU A HB2  3  
ATOM   5442  H  HB3  . LEU B 2 88  ? 14.559  2.102   -0.472  1.00 0.00 ? 346 LEU A HB3  3  
ATOM   5443  H  HG   . LEU B 2 88  ? 15.815  -0.522  0.297   1.00 0.00 ? 346 LEU A HG   3  
ATOM   5444  H  HD11 . LEU B 2 88  ? 13.990  -0.311  2.065   1.00 0.00 ? 346 LEU A HD11 3  
ATOM   5445  H  HD12 . LEU B 2 88  ? 14.117  1.425   1.761   1.00 0.00 ? 346 LEU A HD12 3  
ATOM   5446  H  HD13 . LEU B 2 88  ? 15.527  0.516   2.317   1.00 0.00 ? 346 LEU A HD13 3  
ATOM   5447  H  HD21 . LEU B 2 88  ? 13.729  -0.152  -1.373  1.00 0.00 ? 346 LEU A HD21 3  
ATOM   5448  H  HD22 . LEU B 2 88  ? 12.923  -0.301  0.186   1.00 0.00 ? 346 LEU A HD22 3  
ATOM   5449  H  HD23 . LEU B 2 88  ? 13.994  -1.584  -0.383  1.00 0.00 ? 346 LEU A HD23 3  
ATOM   5450  N  N    . ASN B 2 89  ? 17.011  3.251   -2.048  1.00 0.00 ? 347 ASN A N    3  
ATOM   5451  C  CA   . ASN B 2 89  ? 18.151  4.129   -2.243  1.00 0.00 ? 347 ASN A CA   3  
ATOM   5452  C  C    . ASN B 2 89  ? 18.953  4.135   -0.970  1.00 0.00 ? 347 ASN A C    3  
ATOM   5453  O  O    . ASN B 2 89  ? 20.183  4.074   -0.996  1.00 0.00 ? 347 ASN A O    3  
ATOM   5454  C  CB   . ASN B 2 89  ? 17.685  5.529   -2.591  1.00 0.00 ? 347 ASN A CB   3  
ATOM   5455  C  CG   . ASN B 2 89  ? 18.717  6.327   -3.320  1.00 0.00 ? 347 ASN A CG   3  
ATOM   5456  O  OD1  . ASN B 2 89  ? 19.670  5.788   -3.883  1.00 0.00 ? 347 ASN A OD1  3  
ATOM   5457  N  ND2  . ASN B 2 89  ? 18.518  7.624   -3.323  1.00 0.00 ? 347 ASN A ND2  3  
ATOM   5458  H  H    . ASN B 2 89  ? 16.170  3.638   -1.744  1.00 0.00 ? 347 ASN A H    3  
ATOM   5459  H  HA   . ASN B 2 89  ? 18.759  3.739   -3.030  1.00 0.00 ? 347 ASN A HA   3  
ATOM   5460  H  HB2  . ASN B 2 89  ? 16.819  5.464   -3.212  1.00 0.00 ? 347 ASN A HB2  3  
ATOM   5461  H  HB3  . ASN B 2 89  ? 17.434  6.055   -1.682  1.00 0.00 ? 347 ASN A HB3  3  
ATOM   5462  H  HD21 . ASN B 2 89  ? 17.730  7.977   -2.859  1.00 0.00 ? 347 ASN A HD21 3  
ATOM   5463  H  HD22 . ASN B 2 89  ? 19.150  8.172   -3.791  1.00 0.00 ? 347 ASN A HD22 3  
ATOM   5464  N  N    . PRO B 2 90  ? 18.257  4.245   0.177   1.00 0.00 ? 348 PRO A N    3  
ATOM   5465  C  CA   . PRO B 2 90  ? 18.841  4.177   1.479   1.00 0.00 ? 348 PRO A CA   3  
ATOM   5466  C  C    . PRO B 2 90  ? 18.336  2.930   2.205   1.00 0.00 ? 348 PRO A C    3  
ATOM   5467  O  O    . PRO B 2 90  ? 17.752  3.017   3.285   1.00 0.00 ? 348 PRO A O    3  
ATOM   5468  C  CB   . PRO B 2 90  ? 18.276  5.440   2.058   1.00 0.00 ? 348 PRO A CB   3  
ATOM   5469  C  CG   . PRO B 2 90  ? 16.879  5.493   1.542   1.00 0.00 ? 348 PRO A CG   3  
ATOM   5470  C  CD   . PRO B 2 90  ? 16.838  4.583   0.339   1.00 0.00 ? 348 PRO A CD   3  
ATOM   5471  H  HA   . PRO B 2 90  ? 19.913  4.213   1.455   1.00 0.00 ? 348 PRO A HA   3  
ATOM   5472  H  HB2  . PRO B 2 90  ? 18.303  5.406   3.124   1.00 0.00 ? 348 PRO A HB2  3  
ATOM   5473  H  HB3  . PRO B 2 90  ? 18.858  6.261   1.685   1.00 0.00 ? 348 PRO A HB3  3  
ATOM   5474  H  HG2  . PRO B 2 90  ? 16.191  5.152   2.300   1.00 0.00 ? 348 PRO A HG2  3  
ATOM   5475  H  HG3  . PRO B 2 90  ? 16.654  6.498   1.253   1.00 0.00 ? 348 PRO A HG3  3  
ATOM   5476  H  HD2  . PRO B 2 90  ? 16.244  3.704   0.543   1.00 0.00 ? 348 PRO A HD2  3  
ATOM   5477  H  HD3  . PRO B 2 90  ? 16.463  5.111   -0.514  1.00 0.00 ? 348 PRO A HD3  3  
ATOM   5478  N  N    . PRO B 2 91  ? 18.551  1.755   1.576   1.00 0.00 ? 349 PRO A N    3  
ATOM   5479  C  CA   . PRO B 2 91  ? 18.122  0.446   2.044   1.00 0.00 ? 349 PRO A CA   3  
ATOM   5480  C  C    . PRO B 2 91  ? 17.983  0.307   3.556   1.00 0.00 ? 349 PRO A C    3  
ATOM   5481  O  O    . PRO B 2 91  ? 18.668  0.970   4.335   1.00 0.00 ? 349 PRO A O    3  
ATOM   5482  C  CB   . PRO B 2 91  ? 19.225  -0.480  1.523   1.00 0.00 ? 349 PRO A CB   3  
ATOM   5483  C  CG   . PRO B 2 91  ? 20.079  0.352   0.623   1.00 0.00 ? 349 PRO A CG   3  
ATOM   5484  C  CD   . PRO B 2 91  ? 19.287  1.586   0.334   1.00 0.00 ? 349 PRO A CD   3  
ATOM   5485  H  HA   . PRO B 2 91  ? 17.193  0.164   1.574   1.00 0.00 ? 349 PRO A HA   3  
ATOM   5486  H  HB2  . PRO B 2 91  ? 19.788  -0.853  2.345   1.00 0.00 ? 349 PRO A HB2  3  
ATOM   5487  H  HB3  . PRO B 2 91  ? 18.776  -1.301  0.989   1.00 0.00 ? 349 PRO A HB3  3  
ATOM   5488  H  HG2  . PRO B 2 91  ? 21.001  0.609   1.121   1.00 0.00 ? 349 PRO A HG2  3  
ATOM   5489  H  HG3  . PRO B 2 91  ? 20.279  -0.189  -0.281  1.00 0.00 ? 349 PRO A HG3  3  
ATOM   5490  H  HD2  . PRO B 2 91  ? 19.928  2.436   0.150   1.00 0.00 ? 349 PRO A HD2  3  
ATOM   5491  H  HD3  . PRO B 2 91  ? 18.614  1.425   -0.492  1.00 0.00 ? 349 PRO A HD3  3  
ATOM   5492  N  N    . VAL B 2 92  ? 17.092  -0.596  3.945   1.00 0.00 ? 350 VAL A N    3  
ATOM   5493  C  CA   . VAL B 2 92  ? 16.813  -0.885  5.337   1.00 0.00 ? 350 VAL A CA   3  
ATOM   5494  C  C    . VAL B 2 92  ? 16.953  -2.386  5.559   1.00 0.00 ? 350 VAL A C    3  
ATOM   5495  O  O    . VAL B 2 92  ? 17.197  -3.139  4.616   1.00 0.00 ? 350 VAL A O    3  
ATOM   5496  C  CB   . VAL B 2 92  ? 15.408  -0.362  5.720   1.00 0.00 ? 350 VAL A CB   3  
ATOM   5497  C  CG1  . VAL B 2 92  ? 14.371  -0.839  4.730   1.00 0.00 ? 350 VAL A CG1  3  
ATOM   5498  C  CG2  . VAL B 2 92  ? 15.007  -0.726  7.137   1.00 0.00 ? 350 VAL A CG2  3  
ATOM   5499  H  H    . VAL B 2 92  ? 16.609  -1.102  3.263   1.00 0.00 ? 350 VAL A H    3  
ATOM   5500  H  HA   . VAL B 2 92  ? 17.546  -0.379  5.946   1.00 0.00 ? 350 VAL A HA   3  
ATOM   5501  H  HB   . VAL B 2 92  ? 15.438  0.706   5.660   1.00 0.00 ? 350 VAL A HB   3  
ATOM   5502  H  HG11 . VAL B 2 92  ? 13.613  -1.411  5.239   1.00 0.00 ? 350 VAL A HG11 3  
ATOM   5503  H  HG12 . VAL B 2 92  ? 14.846  -1.453  3.983   1.00 0.00 ? 350 VAL A HG12 3  
ATOM   5504  H  HG13 . VAL B 2 92  ? 13.915  0.016   4.252   1.00 0.00 ? 350 VAL A HG13 3  
ATOM   5505  H  HG21 . VAL B 2 92  ? 14.288  -1.532  7.109   1.00 0.00 ? 350 VAL A HG21 3  
ATOM   5506  H  HG22 . VAL B 2 92  ? 14.563  0.135   7.616   1.00 0.00 ? 350 VAL A HG22 3  
ATOM   5507  H  HG23 . VAL B 2 92  ? 15.877  -1.035  7.693   1.00 0.00 ? 350 VAL A HG23 3  
ATOM   5508  N  N    . ALA B 2 93  ? 16.822  -2.816  6.793   1.00 0.00 ? 351 ALA A N    3  
ATOM   5509  C  CA   . ALA B 2 93  ? 16.991  -4.231  7.126   1.00 0.00 ? 351 ALA A CA   3  
ATOM   5510  C  C    . ALA B 2 93  ? 15.679  -4.991  7.321   1.00 0.00 ? 351 ALA A C    3  
ATOM   5511  O  O    . ALA B 2 93  ? 15.558  -6.137  6.892   1.00 0.00 ? 351 ALA A O    3  
ATOM   5512  C  CB   . ALA B 2 93  ? 17.848  -4.369  8.373   1.00 0.00 ? 351 ALA A CB   3  
ATOM   5513  H  H    . ALA B 2 93  ? 16.611  -2.167  7.493   1.00 0.00 ? 351 ALA A H    3  
ATOM   5514  H  HA   . ALA B 2 93  ? 17.532  -4.691  6.312   1.00 0.00 ? 351 ALA A HA   3  
ATOM   5515  H  HB1  . ALA B 2 93  ? 17.208  -4.448  9.240   1.00 0.00 ? 351 ALA A HB1  3  
ATOM   5516  H  HB2  . ALA B 2 93  ? 18.484  -3.502  8.472   1.00 0.00 ? 351 ALA A HB2  3  
ATOM   5517  H  HB3  . ALA B 2 93  ? 18.458  -5.258  8.294   1.00 0.00 ? 351 ALA A HB3  3  
ATOM   5518  N  N    . GLU B 2 94  ? 14.709  -4.372  7.984   1.00 0.00 ? 352 GLU A N    3  
ATOM   5519  C  CA   . GLU B 2 94  ? 13.423  -5.036  8.273   1.00 0.00 ? 352 GLU A CA   3  
ATOM   5520  C  C    . GLU B 2 94  ? 12.378  -4.035  8.760   1.00 0.00 ? 352 GLU A C    3  
ATOM   5521  O  O    . GLU B 2 94  ? 11.254  -4.003  8.258   1.00 0.00 ? 352 GLU A O    3  
ATOM   5522  C  CB   . GLU B 2 94  ? 13.583  -6.119  9.359   1.00 0.00 ? 352 GLU A CB   3  
ATOM   5523  C  CG   . GLU B 2 94  ? 15.016  -6.419  9.786   1.00 0.00 ? 352 GLU A CG   3  
ATOM   5524  C  CD   . GLU B 2 94  ? 15.094  -7.530  10.815  1.00 0.00 ? 352 GLU A CD   3  
ATOM   5525  O  OE1  . GLU B 2 94  ? 15.073  -8.712  10.414  1.00 0.00 ? 352 GLU A OE1  3  
ATOM   5526  O  OE2  . GLU B 2 94  ? 15.179  -7.216  12.021  1.00 0.00 ? 352 GLU A OE2  3  
ATOM   5527  H  H    . GLU B 2 94  ? 14.843  -3.440  8.264   1.00 0.00 ? 352 GLU A H    3  
ATOM   5528  H  HA   . GLU B 2 94  ? 13.076  -5.483  7.364   1.00 0.00 ? 352 GLU A HA   3  
ATOM   5529  H  HB2  . GLU B 2 94  ? 13.047  -5.791  10.239  1.00 0.00 ? 352 GLU A HB2  3  
ATOM   5530  H  HB3  . GLU B 2 94  ? 13.141  -7.028  9.002   1.00 0.00 ? 352 GLU A HB3  3  
ATOM   5531  H  HG2  . GLU B 2 94  ? 15.587  -6.712  8.921   1.00 0.00 ? 352 GLU A HG2  3  
ATOM   5532  H  HG3  . GLU B 2 94  ? 15.445  -5.524  10.212  1.00 0.00 ? 352 GLU A HG3  3  
ATOM   5533  N  N    . PRO B 2 95  ? 12.748  -3.245  9.774   1.00 0.00 ? 353 PRO A N    3  
ATOM   5534  C  CA   . PRO B 2 95  ? 11.971  -2.197  10.399  1.00 0.00 ? 353 PRO A CA   3  
ATOM   5535  C  C    . PRO B 2 95  ? 10.658  -1.790  9.716   1.00 0.00 ? 353 PRO A C    3  
ATOM   5536  O  O    . PRO B 2 95  ? 9.603   -1.856  10.347  1.00 0.00 ? 353 PRO A O    3  
ATOM   5537  C  CB   . PRO B 2 95  ? 13.015  -1.077  10.333  1.00 0.00 ? 353 PRO A CB   3  
ATOM   5538  C  CG   . PRO B 2 95  ? 14.347  -1.792  10.362  1.00 0.00 ? 353 PRO A CG   3  
ATOM   5539  C  CD   . PRO B 2 95  ? 14.033  -3.247  10.434  1.00 0.00 ? 353 PRO A CD   3  
ATOM   5540  H  HA   . PRO B 2 95  ? 11.775  -2.420  11.435  1.00 0.00 ? 353 PRO A HA   3  
ATOM   5541  H  HB2  . PRO B 2 95  ? 12.888  -0.534  9.403   1.00 0.00 ? 353 PRO A HB2  3  
ATOM   5542  H  HB3  . PRO B 2 95  ? 12.899  -0.415  11.162  1.00 0.00 ? 353 PRO A HB3  3  
ATOM   5543  H  HG2  . PRO B 2 95  ? 14.887  -1.595  9.449   1.00 0.00 ? 353 PRO A HG2  3  
ATOM   5544  H  HG3  . PRO B 2 95  ? 14.917  -1.490  11.213  1.00 0.00 ? 353 PRO A HG3  3  
ATOM   5545  H  HD2  . PRO B 2 95  ? 14.759  -3.819  9.892   1.00 0.00 ? 353 PRO A HD2  3  
ATOM   5546  H  HD3  . PRO B 2 95  ? 13.946  -3.589  11.452  1.00 0.00 ? 353 PRO A HD3  3  
ATOM   5547  N  N    . PRO B 2 96  ? 10.676  -1.369  8.435   1.00 0.00 ? 354 PRO A N    3  
ATOM   5548  C  CA   . PRO B 2 96  ? 9.476   -0.917  7.743   1.00 0.00 ? 354 PRO A CA   3  
ATOM   5549  C  C    . PRO B 2 96  ? 8.438   -2.007  7.511   1.00 0.00 ? 354 PRO A C    3  
ATOM   5550  O  O    . PRO B 2 96  ? 8.300   -2.534  6.406   1.00 0.00 ? 354 PRO A O    3  
ATOM   5551  C  CB   . PRO B 2 96  ? 10.012  -0.394  6.416   1.00 0.00 ? 354 PRO A CB   3  
ATOM   5552  C  CG   . PRO B 2 96  ? 11.458  -0.210  6.639   1.00 0.00 ? 354 PRO A CG   3  
ATOM   5553  C  CD   . PRO B 2 96  ? 11.814  -1.323  7.525   1.00 0.00 ? 354 PRO A CD   3  
ATOM   5554  H  HA   . PRO B 2 96  ? 9.021   -0.107  8.274   1.00 0.00 ? 354 PRO A HA   3  
ATOM   5555  H  HB2  . PRO B 2 96  ? 9.814   -1.104  5.633   1.00 0.00 ? 354 PRO A HB2  3  
ATOM   5556  H  HB3  . PRO B 2 96  ? 9.544   0.533   6.194   1.00 0.00 ? 354 PRO A HB3  3  
ATOM   5557  H  HG2  . PRO B 2 96  ? 12.000  -0.281  5.714   1.00 0.00 ? 354 PRO A HG2  3  
ATOM   5558  H  HG3  . PRO B 2 96  ? 11.641  0.734   7.123   1.00 0.00 ? 354 PRO A HG3  3  
ATOM   5559  H  HD2  . PRO B 2 96  ? 11.869  -2.214  6.966   1.00 0.00 ? 354 PRO A HD2  3  
ATOM   5560  H  HD3  . PRO B 2 96  ? 12.730  -1.124  8.030   1.00 0.00 ? 354 PRO A HD3  3  
ATOM   5561  N  N    . GLU B 2 97  ? 7.713   -2.332  8.565   1.00 0.00 ? 355 GLU A N    3  
ATOM   5562  C  CA   . GLU B 2 97  ? 6.653   -3.330  8.502   1.00 0.00 ? 355 GLU A CA   3  
ATOM   5563  C  C    . GLU B 2 97  ? 5.289   -2.663  8.682   1.00 0.00 ? 355 GLU A C    3  
ATOM   5564  O  O    . GLU B 2 97  ? 4.249   -3.320  8.640   1.00 0.00 ? 355 GLU A O    3  
ATOM   5565  C  CB   . GLU B 2 97  ? 6.861   -4.394  9.579   1.00 0.00 ? 355 GLU A CB   3  
ATOM   5566  C  CG   . GLU B 2 97  ? 8.225   -5.056  9.518   1.00 0.00 ? 355 GLU A CG   3  
ATOM   5567  C  CD   . GLU B 2 97  ? 8.304   -6.309  10.368  1.00 0.00 ? 355 GLU A CD   3  
ATOM   5568  O  OE1  . GLU B 2 97  ? 8.506   -6.184  11.594  1.00 0.00 ? 355 GLU A OE1  3  
ATOM   5569  O  OE2  . GLU B 2 97  ? 8.163   -7.416  9.806   1.00 0.00 ? 355 GLU A OE2  3  
ATOM   5570  H  H    . GLU B 2 97  ? 7.911   -1.899  9.419   1.00 0.00 ? 355 GLU A H    3  
ATOM   5571  H  HA   . GLU B 2 97  ? 6.690   -3.796  7.530   1.00 0.00 ? 355 GLU A HA   3  
ATOM   5572  H  HB2  . GLU B 2 97  ? 6.754   -3.930  10.547  1.00 0.00 ? 355 GLU A HB2  3  
ATOM   5573  H  HB3  . GLU B 2 97  ? 6.105   -5.158  9.468   1.00 0.00 ? 355 GLU A HB3  3  
ATOM   5574  H  HG2  . GLU B 2 97  ? 8.439   -5.321  8.494   1.00 0.00 ? 355 GLU A HG2  3  
ATOM   5575  H  HG3  . GLU B 2 97  ? 8.963   -4.353  9.872   1.00 0.00 ? 355 GLU A HG3  3  
ATOM   5576  N  N    . GLY B 2 98  ? 5.316   -1.347  8.881   1.00 0.00 ? 356 GLY A N    3  
ATOM   5577  C  CA   . GLY B 2 98  ? 4.099   -0.582  9.070   1.00 0.00 ? 356 GLY A CA   3  
ATOM   5578  C  C    . GLY B 2 98  ? 4.380   0.838   9.483   1.00 0.00 ? 356 GLY A C    3  
ATOM   5579  O  O    . GLY B 2 98  ? 3.871   1.317   10.497  1.00 0.00 ? 356 GLY A O    3  
ATOM   5580  H  H    . GLY B 2 98  ? 6.175   -0.889  8.899   1.00 0.00 ? 356 GLY A H    3  
ATOM   5581  H  HA2  . GLY B 2 98  ? 3.554   -0.553  8.143   1.00 0.00 ? 356 GLY A HA2  3  
ATOM   5582  H  HA3  . GLY B 2 98  ? 3.497   -1.056  9.826   1.00 0.00 ? 356 GLY A HA3  3  
ATOM   5583  N  N    . SER B 2 99  ? 5.182   1.510   8.670   1.00 0.00 ? 357 SER A N    3  
ATOM   5584  C  CA   . SER B 2 99  ? 5.559   2.896   8.925   1.00 0.00 ? 357 SER A CA   3  
ATOM   5585  C  C    . SER B 2 99  ? 6.246   3.511   7.707   1.00 0.00 ? 357 SER A C    3  
ATOM   5586  O  O    . SER B 2 99  ? 6.084   4.698   7.423   1.00 0.00 ? 357 SER A O    3  
ATOM   5587  C  CB   . SER B 2 99  ? 6.507   2.997   10.122  1.00 0.00 ? 357 SER A CB   3  
ATOM   5588  O  OG   . SER B 2 99  ? 6.063   2.209   11.214  1.00 0.00 ? 357 SER A OG   3  
ATOM   5589  H  H    . SER B 2 99  ? 5.512   1.062   7.866   1.00 0.00 ? 357 SER A H    3  
ATOM   5590  H  HA   . SER B 2 99  ? 4.654   3.439   9.137   1.00 0.00 ? 357 SER A HA   3  
ATOM   5591  H  HB2  . SER B 2 99  ? 7.490   2.659   9.824   1.00 0.00 ? 357 SER A HB2  3  
ATOM   5592  H  HB3  . SER B 2 99  ? 6.566   4.028   10.441  1.00 0.00 ? 357 SER A HB3  3  
ATOM   5593  H  HG   . SER B 2 99  ? 6.136   2.716   12.025  1.00 0.00 ? 357 SER A HG   3  
ATOM   5594  N  N    . TRP B 2 100 ? 7.034   2.684   7.019   1.00 0.00 ? 358 TRP A N    3  
ATOM   5595  C  CA   . TRP B 2 100 ? 7.780   3.071   5.839   1.00 0.00 ? 358 TRP A CA   3  
ATOM   5596  C  C    . TRP B 2 100 ? 7.033   4.050   4.964   1.00 0.00 ? 358 TRP A C    3  
ATOM   5597  O  O    . TRP B 2 100 ? 5.812   4.184   5.035   1.00 0.00 ? 358 TRP A O    3  
ATOM   5598  C  CB   . TRP B 2 100 ? 8.103   1.828   5.035   1.00 0.00 ? 358 TRP A CB   3  
ATOM   5599  C  CG   . TRP B 2 100 ? 9.371   1.918   4.256   1.00 0.00 ? 358 TRP A CG   3  
ATOM   5600  C  CD1  . TRP B 2 100 ? 10.610  2.289   4.697   1.00 0.00 ? 358 TRP A CD1  3  
ATOM   5601  C  CD2  . TRP B 2 100 ? 9.520   1.576   2.898   1.00 0.00 ? 358 TRP A CD2  3  
ATOM   5602  N  NE1  . TRP B 2 100 ? 11.508  2.235   3.660   1.00 0.00 ? 358 TRP A NE1  3  
ATOM   5603  C  CE2  . TRP B 2 100 ? 10.858  1.798   2.552   1.00 0.00 ? 358 TRP A CE2  3  
ATOM   5604  C  CE3  . TRP B 2 100 ? 8.640   1.113   1.934   1.00 0.00 ? 358 TRP A CE3  3  
ATOM   5605  C  CZ2  . TRP B 2 100 ? 11.332  1.571   1.283   1.00 0.00 ? 358 TRP A CZ2  3  
ATOM   5606  C  CZ3  . TRP B 2 100 ? 9.120   0.879   0.674   1.00 0.00 ? 358 TRP A CZ3  3  
ATOM   5607  C  CH2  . TRP B 2 100 ? 10.453  1.110   0.367   1.00 0.00 ? 358 TRP A CH2  3  
ATOM   5608  H  H    . TRP B 2 100 ? 7.131   1.773   7.325   1.00 0.00 ? 358 TRP A H    3  
ATOM   5609  H  HA   . TRP B 2 100 ? 8.705   3.524   6.159   1.00 0.00 ? 358 TRP A HA   3  
ATOM   5610  H  HB2  . TRP B 2 100 ? 8.182   0.993   5.704   1.00 0.00 ? 358 TRP A HB2  3  
ATOM   5611  H  HB3  . TRP B 2 100 ? 7.302   1.641   4.336   1.00 0.00 ? 358 TRP A HB3  3  
ATOM   5612  H  HD1  . TRP B 2 100 ? 10.833  2.578   5.708   1.00 0.00 ? 358 TRP A HD1  3  
ATOM   5613  H  HE1  . TRP B 2 100 ? 12.460  2.465   3.703   1.00 0.00 ? 358 TRP A HE1  3  
ATOM   5614  H  HE3  . TRP B 2 100 ? 7.610   0.917   2.170   1.00 0.00 ? 358 TRP A HE3  3  
ATOM   5615  H  HZ2  . TRP B 2 100 ? 12.363  1.724   1.021   1.00 0.00 ? 358 TRP A HZ2  3  
ATOM   5616  H  HZ3  . TRP B 2 100 ? 8.473   0.485   -0.089  1.00 0.00 ? 358 TRP A HZ3  3  
ATOM   5617  H  HH2  . TRP B 2 100 ? 10.779  0.920   -0.620  1.00 0.00 ? 358 TRP A HH2  3  
ATOM   5618  N  N    . SER B 2 101 ? 7.790   4.706   4.111   1.00 0.00 ? 359 SER A N    3  
ATOM   5619  C  CA   . SER B 2 101 ? 7.210   5.704   3.213   1.00 0.00 ? 359 SER A CA   3  
ATOM   5620  C  C    . SER B 2 101 ? 7.789   5.703   1.795   1.00 0.00 ? 359 SER A C    3  
ATOM   5621  O  O    . SER B 2 101 ? 7.453   6.569   1.012   1.00 0.00 ? 359 SER A O    3  
ATOM   5622  C  CB   . SER B 2 101 ? 7.367   7.099   3.816   1.00 0.00 ? 359 SER A CB   3  
ATOM   5623  O  OG   . SER B 2 101 ? 6.190   7.868   3.641   1.00 0.00 ? 359 SER A OG   3  
ATOM   5624  H  H    . SER B 2 101 ? 8.753   4.515   4.104   1.00 0.00 ? 359 SER A H    3  
ATOM   5625  H  HA   . SER B 2 101 ? 6.163   5.484   3.140   1.00 0.00 ? 359 SER A HA   3  
ATOM   5626  H  HB2  . SER B 2 101 ? 7.578   7.017   4.872   1.00 0.00 ? 359 SER A HB2  3  
ATOM   5627  H  HB3  . SER B 2 101 ? 8.185   7.602   3.324   1.00 0.00 ? 359 SER A HB3  3  
ATOM   5628  H  HG   . SER B 2 101 ? 5.595   7.411   3.040   1.00 0.00 ? 359 SER A HG   3  
ATOM   5629  N  N    . CYS B 2 102 ? 8.628   4.741   1.454   1.00 0.00 ? 360 CYS A N    3  
ATOM   5630  C  CA   . CYS B 2 102 ? 9.228   4.687   0.103   1.00 0.00 ? 360 CYS A CA   3  
ATOM   5631  C  C    . CYS B 2 102 ? 10.011  5.964   -0.225  1.00 0.00 ? 360 CYS A C    3  
ATOM   5632  O  O    . CYS B 2 102 ? 10.001  6.924   0.545   1.00 0.00 ? 360 CYS A O    3  
ATOM   5633  C  CB   . CYS B 2 102 ? 8.158   4.482   -0.978  1.00 0.00 ? 360 CYS A CB   3  
ATOM   5634  S  SG   . CYS B 2 102 ? 7.367   6.026   -1.569  1.00 0.00 ? 360 CYS A SG   3  
ATOM   5635  H  H    . CYS B 2 102 ? 8.842   4.047   2.107   1.00 0.00 ? 360 CYS A H    3  
ATOM   5636  H  HA   . CYS B 2 102 ? 9.910   3.850   0.080   1.00 0.00 ? 360 CYS A HA   3  
ATOM   5637  H  HB2  . CYS B 2 102 ? 8.616   4.011   -1.830  1.00 0.00 ? 360 CYS A HB2  3  
ATOM   5638  H  HB3  . CYS B 2 102 ? 7.392   3.836   -0.598  1.00 0.00 ? 360 CYS A HB3  3  
ATOM   5639  N  N    . HIS B 2 103 ? 10.701  5.962   -1.372  1.00 0.00 ? 361 HIS A N    3  
ATOM   5640  C  CA   . HIS B 2 103 ? 11.474  7.115   -1.799  1.00 0.00 ? 361 HIS A CA   3  
ATOM   5641  C  C    . HIS B 2 103 ? 10.580  8.208   -2.370  1.00 0.00 ? 361 HIS A C    3  
ATOM   5642  O  O    . HIS B 2 103 ? 10.894  9.391   -2.255  1.00 0.00 ? 361 HIS A O    3  
ATOM   5643  C  CB   . HIS B 2 103 ? 12.566  6.727   -2.808  1.00 0.00 ? 361 HIS A CB   3  
ATOM   5644  C  CG   . HIS B 2 103 ? 12.105  6.055   -4.068  1.00 0.00 ? 361 HIS A CG   3  
ATOM   5645  N  ND1  . HIS B 2 103 ? 12.743  4.955   -4.603  1.00 0.00 ? 361 HIS A ND1  3  
ATOM   5646  C  CD2  . HIS B 2 103 ? 11.100  6.350   -4.924  1.00 0.00 ? 361 HIS A CD2  3  
ATOM   5647  C  CE1  . HIS B 2 103 ? 12.148  4.608   -5.731  1.00 0.00 ? 361 HIS A CE1  3  
ATOM   5648  N  NE2  . HIS B 2 103 ? 11.151  5.438   -5.946  1.00 0.00 ? 361 HIS A NE2  3  
ATOM   5649  H  H    . HIS B 2 103 ? 10.669  5.184   -1.951  1.00 0.00 ? 361 HIS A H    3  
ATOM   5650  H  HA   . HIS B 2 103 ? 11.957  7.511   -0.917  1.00 0.00 ? 361 HIS A HA   3  
ATOM   5651  H  HB2  . HIS B 2 103 ? 13.074  7.618   -3.103  1.00 0.00 ? 361 HIS A HB2  3  
ATOM   5652  H  HB3  . HIS B 2 103 ? 13.269  6.069   -2.323  1.00 0.00 ? 361 HIS A HB3  3  
ATOM   5653  H  HD1  . HIS B 2 103 ? 13.517  4.497   -4.214  1.00 0.00 ? 361 HIS A HD1  3  
ATOM   5654  H  HD2  . HIS B 2 103 ? 10.374  7.136   -4.812  1.00 0.00 ? 361 HIS A HD2  3  
ATOM   5655  H  HE1  . HIS B 2 103 ? 12.423  3.778   -6.362  1.00 0.00 ? 361 HIS A HE1  3  
ATOM   5656  H  HE2  . HIS B 2 103 ? 10.585  5.447   -6.746  1.00 0.00 ? 361 HIS A HE2  3  
ATOM   5657  N  N    . LEU B 2 104 ? 9.466   7.812   -2.984  1.00 0.00 ? 362 LEU A N    3  
ATOM   5658  C  CA   . LEU B 2 104 ? 8.545   8.778   -3.575  1.00 0.00 ? 362 LEU A CA   3  
ATOM   5659  C  C    . LEU B 2 104 ? 8.114   9.792   -2.537  1.00 0.00 ? 362 LEU A C    3  
ATOM   5660  O  O    . LEU B 2 104 ? 8.156   11.004  -2.752  1.00 0.00 ? 362 LEU A O    3  
ATOM   5661  C  CB   . LEU B 2 104 ? 7.292   8.092   -4.122  1.00 0.00 ? 362 LEU A CB   3  
ATOM   5662  C  CG   . LEU B 2 104 ? 7.524   6.914   -5.048  1.00 0.00 ? 362 LEU A CG   3  
ATOM   5663  C  CD1  . LEU B 2 104 ? 6.200   6.277   -5.400  1.00 0.00 ? 362 LEU A CD1  3  
ATOM   5664  C  CD2  . LEU B 2 104 ? 8.261   7.345   -6.298  1.00 0.00 ? 362 LEU A CD2  3  
ATOM   5665  H  H    . LEU B 2 104 ? 9.261   6.855   -3.039  1.00 0.00 ? 362 LEU A H    3  
ATOM   5666  H  HA   . LEU B 2 104 ? 9.053   9.275   -4.376  1.00 0.00 ? 362 LEU A HA   3  
ATOM   5667  H  HB2  . LEU B 2 104 ? 6.701   7.743   -3.289  1.00 0.00 ? 362 LEU A HB2  3  
ATOM   5668  H  HB3  . LEU B 2 104 ? 6.716   8.825   -4.660  1.00 0.00 ? 362 LEU A HB3  3  
ATOM   5669  H  HG   . LEU B 2 104 ? 8.123   6.180   -4.539  1.00 0.00 ? 362 LEU A HG   3  
ATOM   5670  H  HD11 . LEU B 2 104 ? 5.866   5.675   -4.567  1.00 0.00 ? 362 LEU A HD11 3  
ATOM   5671  H  HD12 . LEU B 2 104 ? 6.319   5.655   -6.273  1.00 0.00 ? 362 LEU A HD12 3  
ATOM   5672  H  HD13 . LEU B 2 104 ? 5.470   7.048   -5.601  1.00 0.00 ? 362 LEU A HD13 3  
ATOM   5673  H  HD21 . LEU B 2 104 ? 9.316   7.351   -6.093  1.00 0.00 ? 362 LEU A HD21 3  
ATOM   5674  H  HD22 . LEU B 2 104 ? 7.941   8.336   -6.583  1.00 0.00 ? 362 LEU A HD22 3  
ATOM   5675  H  HD23 . LEU B 2 104 ? 8.052   6.652   -7.100  1.00 0.00 ? 362 LEU A HD23 3  
ATOM   5676  N  N    . CYS B 2 105 ? 7.727   9.259   -1.399  1.00 0.00 ? 363 CYS A N    3  
ATOM   5677  C  CA   . CYS B 2 105 ? 7.239   10.066  -0.287  1.00 0.00 ? 363 CYS A CA   3  
ATOM   5678  C  C    . CYS B 2 105 ? 8.307   10.912  0.311   1.00 0.00 ? 363 CYS A C    3  
ATOM   5679  O  O    . CYS B 2 105 ? 8.053   12.022  0.744   1.00 0.00 ? 363 CYS A O    3  
ATOM   5680  C  CB   . CYS B 2 105 ? 6.736   9.192   0.846   1.00 0.00 ? 363 CYS A CB   3  
ATOM   5681  S  SG   . CYS B 2 105 ? 5.141   8.371   0.557   1.00 0.00 ? 363 CYS A SG   3  
ATOM   5682  H  H    . CYS B 2 105 ? 7.796   8.285   -1.296  1.00 0.00 ? 363 CYS A H    3  
ATOM   5683  H  HA   . CYS B 2 105 ? 6.455   10.698  -0.634  1.00 0.00 ? 363 CYS A HA   3  
ATOM   5684  H  HB2  . CYS B 2 105 ? 7.480   8.448   1.060   1.00 0.00 ? 363 CYS A HB2  3  
ATOM   5685  H  HB3  . CYS B 2 105 ? 6.620   9.815   1.723   1.00 0.00 ? 363 CYS A HB3  3  
ATOM   5686  N  N    . TRP B 2 106 ? 9.481   10.359  0.365   1.00 0.00 ? 364 TRP A N    3  
ATOM   5687  C  CA   . TRP B 2 106 ? 10.582  11.020  0.993   1.00 0.00 ? 364 TRP A CA   3  
ATOM   5688  C  C    . TRP B 2 106 ? 11.069  12.203  0.264   1.00 0.00 ? 364 TRP A C    3  
ATOM   5689  O  O    . TRP B 2 106 ? 11.270  13.246  0.848   1.00 0.00 ? 364 TRP A O    3  
ATOM   5690  C  CB   . TRP B 2 106 ? 11.692  10.059  1.211   1.00 0.00 ? 364 TRP A CB   3  
ATOM   5691  C  CG   . TRP B 2 106 ? 11.861  9.881   2.642   1.00 0.00 ? 364 TRP A CG   3  
ATOM   5692  C  CD1  . TRP B 2 106 ? 10.865  9.651   3.504   1.00 0.00 ? 364 TRP A CD1  3  
ATOM   5693  C  CD2  . TRP B 2 106 ? 13.047  10.001  3.380   1.00 0.00 ? 364 TRP A CD2  3  
ATOM   5694  N  NE1  . TRP B 2 106 ? 11.349  9.558   4.767   1.00 0.00 ? 364 TRP A NE1  3  
ATOM   5695  C  CE2  . TRP B 2 106 ? 12.715  9.773   4.724   1.00 0.00 ? 364 TRP A CE2  3  
ATOM   5696  C  CE3  . TRP B 2 106 ? 14.357  10.258  3.021   1.00 0.00 ? 364 TRP A CE3  3  
ATOM   5697  C  CZ2  . TRP B 2 106 ? 13.675  9.802   5.729   1.00 0.00 ? 364 TRP A CZ2  3  
ATOM   5698  C  CZ3  . TRP B 2 106 ? 15.315  10.293  4.012   1.00 0.00 ? 364 TRP A CZ3  3  
ATOM   5699  C  CH2  . TRP B 2 106 ? 14.971  10.062  5.352   1.00 0.00 ? 364 TRP A CH2  3  
ATOM   5700  H  H    . TRP B 2 106 ? 9.616   9.488   -0.050  1.00 0.00 ? 364 TRP A H    3  
ATOM   5701  H  HA   . TRP B 2 106 ? 10.238  11.350  1.957   1.00 0.00 ? 364 TRP A HA   3  
ATOM   5702  H  HB2  . TRP B 2 106 ? 11.429  9.117   0.770   1.00 0.00 ? 364 TRP A HB2  3  
ATOM   5703  H  HB3  . TRP B 2 106 ? 12.611  10.437  0.790   1.00 0.00 ? 364 TRP A HB3  3  
ATOM   5704  H  HD1  . TRP B 2 106 ? 9.838   9.557   3.201   1.00 0.00 ? 364 TRP A HD1  3  
ATOM   5705  H  HE1  . TRP B 2 106 ? 10.810  9.373   5.553   1.00 0.00 ? 364 TRP A HE1  3  
ATOM   5706  H  HE3  . TRP B 2 106 ? 14.618  10.450  1.980   1.00 0.00 ? 364 TRP A HE3  3  
ATOM   5707  H  HZ2  . TRP B 2 106 ? 13.427  9.626   6.765   1.00 0.00 ? 364 TRP A HZ2  3  
ATOM   5708  H  HZ3  . TRP B 2 106 ? 16.345  10.494  3.759   1.00 0.00 ? 364 TRP A HZ3  3  
ATOM   5709  H  HH2  . TRP B 2 106 ? 15.749  10.107  6.093   1.00 0.00 ? 364 TRP A HH2  3  
ATOM   5710  N  N    . GLU B 2 107 ? 11.302  12.046  -0.991  1.00 0.00 ? 365 GLU A N    3  
ATOM   5711  C  CA   . GLU B 2 107 ? 11.761  13.156  -1.749  1.00 0.00 ? 365 GLU A CA   3  
ATOM   5712  C  C    . GLU B 2 107 ? 10.655  14.192  -1.737  1.00 0.00 ? 365 GLU A C    3  
ATOM   5713  O  O    . GLU B 2 107 ? 10.891  15.400  -1.821  1.00 0.00 ? 365 GLU A O    3  
ATOM   5714  C  CB   . GLU B 2 107 ? 12.104  12.688  -3.133  1.00 0.00 ? 365 GLU A CB   3  
ATOM   5715  C  CG   . GLU B 2 107 ? 10.918  12.072  -3.840  1.00 0.00 ? 365 GLU A CG   3  
ATOM   5716  C  CD   . GLU B 2 107 ? 11.200  11.745  -5.294  1.00 0.00 ? 365 GLU A CD   3  
ATOM   5717  O  OE1  . GLU B 2 107 ? 11.029  12.640  -6.148  1.00 0.00 ? 365 GLU A OE1  3  
ATOM   5718  O  OE2  . GLU B 2 107 ? 11.589  10.592  -5.578  1.00 0.00 ? 365 GLU A OE2  3  
ATOM   5719  H  H    . GLU B 2 107 ? 11.144  11.179  -1.416  1.00 0.00 ? 365 GLU A H    3  
ATOM   5720  H  HA   . GLU B 2 107 ? 12.641  13.544  -1.253  1.00 0.00 ? 365 GLU A HA   3  
ATOM   5721  H  HB2  . GLU B 2 107 ? 12.482  13.514  -3.718  1.00 0.00 ? 365 GLU A HB2  3  
ATOM   5722  H  HB3  . GLU B 2 107 ? 12.862  11.932  -3.028  1.00 0.00 ? 365 GLU A HB3  3  
ATOM   5723  H  HG2  . GLU B 2 107 ? 10.658  11.167  -3.323  1.00 0.00 ? 365 GLU A HG2  3  
ATOM   5724  H  HG3  . GLU B 2 107 ? 10.088  12.759  -3.787  1.00 0.00 ? 365 GLU A HG3  3  
ATOM   5725  N  N    . LEU B 2 108 ? 9.432   13.681  -1.597  1.00 0.00 ? 366 LEU A N    3  
ATOM   5726  C  CA   . LEU B 2 108 ? 8.259   14.517  -1.504  1.00 0.00 ? 366 LEU A CA   3  
ATOM   5727  C  C    . LEU B 2 108 ? 8.229   15.135  -0.121  1.00 0.00 ? 366 LEU A C    3  
ATOM   5728  O  O    . LEU B 2 108 ? 7.622   16.171  0.105   1.00 0.00 ? 366 LEU A O    3  
ATOM   5729  C  CB   . LEU B 2 108 ? 7.003   13.712  -1.786  1.00 0.00 ? 366 LEU A CB   3  
ATOM   5730  C  CG   . LEU B 2 108 ? 5.783   14.508  -2.259  1.00 0.00 ? 366 LEU A CG   3  
ATOM   5731  C  CD1  . LEU B 2 108 ? 5.037   15.090  -1.080  1.00 0.00 ? 366 LEU A CD1  3  
ATOM   5732  C  CD2  . LEU B 2 108 ? 6.202   15.599  -3.214  1.00 0.00 ? 366 LEU A CD2  3  
ATOM   5733  H  H    . LEU B 2 108 ? 9.320   12.699  -1.547  1.00 0.00 ? 366 LEU A H    3  
ATOM   5734  H  HA   . LEU B 2 108 ? 8.348   15.288  -2.234  1.00 0.00 ? 366 LEU A HA   3  
ATOM   5735  H  HB2  . LEU B 2 108 ? 7.245   12.998  -2.544  1.00 0.00 ? 366 LEU A HB2  3  
ATOM   5736  H  HB3  . LEU B 2 108 ? 6.739   13.188  -0.889  1.00 0.00 ? 366 LEU A HB3  3  
ATOM   5737  H  HG   . LEU B 2 108 ? 5.119   13.848  -2.787  1.00 0.00 ? 366 LEU A HG   3  
ATOM   5738  H  HD11 . LEU B 2 108 ? 5.034   14.367  -0.282  1.00 0.00 ? 366 LEU A HD11 3  
ATOM   5739  H  HD12 . LEU B 2 108 ? 4.021   15.314  -1.370  1.00 0.00 ? 366 LEU A HD12 3  
ATOM   5740  H  HD13 . LEU B 2 108 ? 5.528   15.992  -0.750  1.00 0.00 ? 366 LEU A HD13 3  
ATOM   5741  H  HD21 . LEU B 2 108 ? 7.250   15.484  -3.410  1.00 0.00 ? 366 LEU A HD21 3  
ATOM   5742  H  HD22 . LEU B 2 108 ? 6.016   16.565  -2.768  1.00 0.00 ? 366 LEU A HD22 3  
ATOM   5743  H  HD23 . LEU B 2 108 ? 5.648   15.510  -4.137  1.00 0.00 ? 366 LEU A HD23 3  
ATOM   5744  N  N    . LEU B 2 109 ? 8.877   14.427  0.795   1.00 0.00 ? 367 LEU A N    3  
ATOM   5745  C  CA   . LEU B 2 109 ? 9.012   14.824  2.184   1.00 0.00 ? 367 LEU A CA   3  
ATOM   5746  C  C    . LEU B 2 109 ? 9.938   16.010  2.259   1.00 0.00 ? 367 LEU A C    3  
ATOM   5747  O  O    . LEU B 2 109 ? 9.605   17.054  2.820   1.00 0.00 ? 367 LEU A O    3  
ATOM   5748  C  CB   . LEU B 2 109 ? 9.590   13.667  2.961   1.00 0.00 ? 367 LEU A CB   3  
ATOM   5749  C  CG   . LEU B 2 109 ? 8.822   13.220  4.190   1.00 0.00 ? 367 LEU A CG   3  
ATOM   5750  C  CD1  . LEU B 2 109 ? 8.015   11.961  3.883   1.00 0.00 ? 367 LEU A CD1  3  
ATOM   5751  C  CD2  . LEU B 2 109 ? 9.799   12.980  5.326   1.00 0.00 ? 367 LEU A CD2  3  
ATOM   5752  H  H    . LEU B 2 109 ? 9.306   13.593  0.514   1.00 0.00 ? 367 LEU A H    3  
ATOM   5753  H  HA   . LEU B 2 109 ? 8.064   15.075  2.583   1.00 0.00 ? 367 LEU A HA   3  
ATOM   5754  H  HB2  . LEU B 2 109 ? 9.645   12.836  2.291   1.00 0.00 ? 367 LEU A HB2  3  
ATOM   5755  H  HB3  . LEU B 2 109 ? 10.584  13.933  3.259   1.00 0.00 ? 367 LEU A HB3  3  
ATOM   5756  H  HG   . LEU B 2 109 ? 8.134   13.997  4.488   1.00 0.00 ? 367 LEU A HG   3  
ATOM   5757  H  HD11 . LEU B 2 109 ? 8.040   11.759  2.816   1.00 0.00 ? 367 LEU A HD11 3  
ATOM   5758  H  HD12 . LEU B 2 109 ? 6.992   12.105  4.197   1.00 0.00 ? 367 LEU A HD12 3  
ATOM   5759  H  HD13 . LEU B 2 109 ? 8.440   11.124  4.417   1.00 0.00 ? 367 LEU A HD13 3  
ATOM   5760  H  HD21 . LEU B 2 109 ? 10.762  12.693  4.910   1.00 0.00 ? 367 LEU A HD21 3  
ATOM   5761  H  HD22 . LEU B 2 109 ? 9.429   12.191  5.963   1.00 0.00 ? 367 LEU A HD22 3  
ATOM   5762  H  HD23 . LEU B 2 109 ? 9.912   13.889  5.901   1.00 0.00 ? 367 LEU A HD23 3  
ATOM   5763  N  N    . LYS B 2 110 ? 11.120  15.816  1.694   1.00 0.00 ? 368 LYS A N    3  
ATOM   5764  C  CA   . LYS B 2 110 ? 12.114  16.865  1.623   1.00 0.00 ? 368 LYS A CA   3  
ATOM   5765  C  C    . LYS B 2 110 ? 11.442  18.131  1.114   1.00 0.00 ? 368 LYS A C    3  
ATOM   5766  O  O    . LYS B 2 110 ? 11.745  19.242  1.552   1.00 0.00 ? 368 LYS A O    3  
ATOM   5767  C  CB   . LYS B 2 110 ? 13.241  16.469  0.663   1.00 0.00 ? 368 LYS A CB   3  
ATOM   5768  C  CG   . LYS B 2 110 ? 13.630  15.002  0.719   1.00 0.00 ? 368 LYS A CG   3  
ATOM   5769  C  CD   . LYS B 2 110 ? 14.057  14.585  2.118   1.00 0.00 ? 368 LYS A CD   3  
ATOM   5770  C  CE   . LYS B 2 110 ? 14.836  13.287  2.085   1.00 0.00 ? 368 LYS A CE   3  
ATOM   5771  N  NZ   . LYS B 2 110 ? 16.004  13.359  1.164   1.00 0.00 ? 368 LYS A NZ   3  
ATOM   5772  H  H    . LYS B 2 110 ? 11.331  14.925  1.333   1.00 0.00 ? 368 LYS A H    3  
ATOM   5773  H  HA   . LYS B 2 110 ? 12.513  17.028  2.613   1.00 0.00 ? 368 LYS A HA   3  
ATOM   5774  H  HB2  . LYS B 2 110 ? 12.925  16.682  -0.344  1.00 0.00 ? 368 LYS A HB2  3  
ATOM   5775  H  HB3  . LYS B 2 110 ? 14.117  17.060  0.889   1.00 0.00 ? 368 LYS A HB3  3  
ATOM   5776  H  HG2  . LYS B 2 110 ? 12.782  14.403  0.407   1.00 0.00 ? 368 LYS A HG2  3  
ATOM   5777  H  HG3  . LYS B 2 110 ? 14.454  14.838  0.038   1.00 0.00 ? 368 LYS A HG3  3  
ATOM   5778  H  HD2  . LYS B 2 110 ? 14.680  15.358  2.542   1.00 0.00 ? 368 LYS A HD2  3  
ATOM   5779  H  HD3  . LYS B 2 110 ? 13.178  14.448  2.731   1.00 0.00 ? 368 LYS A HD3  3  
ATOM   5780  H  HE2  . LYS B 2 110 ? 15.188  13.067  3.082   1.00 0.00 ? 368 LYS A HE2  3  
ATOM   5781  H  HE3  . LYS B 2 110 ? 14.174  12.498  1.755   1.00 0.00 ? 368 LYS A HE3  3  
ATOM   5782  H  HZ1  . LYS B 2 110 ? 16.517  12.454  1.165   1.00 0.00 ? 368 LYS A HZ1  3  
ATOM   5783  H  HZ2  . LYS B 2 110 ? 16.652  14.113  1.468   1.00 0.00 ? 368 LYS A HZ2  3  
ATOM   5784  H  HZ3  . LYS B 2 110 ? 15.683  13.563  0.195   1.00 0.00 ? 368 LYS A HZ3  3  
ATOM   5785  N  N    . GLU B 2 111 ? 10.517  17.935  0.174   1.00 0.00 ? 369 GLU A N    3  
ATOM   5786  C  CA   . GLU B 2 111 ? 9.766   19.030  -0.418  1.00 0.00 ? 369 GLU A CA   3  
ATOM   5787  C  C    . GLU B 2 111 ? 8.642   19.508  0.502   1.00 0.00 ? 369 GLU A C    3  
ATOM   5788  O  O    . GLU B 2 111 ? 8.373   20.707  0.584   1.00 0.00 ? 369 GLU A O    3  
ATOM   5789  C  CB   . GLU B 2 111 ? 9.190   18.596  -1.757  1.00 0.00 ? 369 GLU A CB   3  
ATOM   5790  C  CG   . GLU B 2 111 ? 9.532   19.544  -2.887  1.00 0.00 ? 369 GLU A CG   3  
ATOM   5791  C  CD   . GLU B 2 111 ? 8.871   20.900  -2.735  1.00 0.00 ? 369 GLU A CD   3  
ATOM   5792  O  OE1  . GLU B 2 111 ? 9.471   21.784  -2.088  1.00 0.00 ? 369 GLU A OE1  3  
ATOM   5793  O  OE2  . GLU B 2 111 ? 7.752   21.078  -3.263  1.00 0.00 ? 369 GLU A OE2  3  
ATOM   5794  H  H    . GLU B 2 111 ? 10.351  17.020  -0.146  1.00 0.00 ? 369 GLU A H    3  
ATOM   5795  H  HA   . GLU B 2 111 ? 10.450  19.840  -0.591  1.00 0.00 ? 369 GLU A HA   3  
ATOM   5796  H  HB2  . GLU B 2 111 ? 9.586   17.624  -2.000  1.00 0.00 ? 369 GLU A HB2  3  
ATOM   5797  H  HB3  . GLU B 2 111 ? 8.115   18.532  -1.677  1.00 0.00 ? 369 GLU A HB3  3  
ATOM   5798  H  HG2  . GLU B 2 111 ? 10.602  19.681  -2.904  1.00 0.00 ? 369 GLU A HG2  3  
ATOM   5799  H  HG3  . GLU B 2 111 ? 9.212   19.105  -3.817  1.00 0.00 ? 369 GLU A HG3  3  
ATOM   5800  N  N    . LYS B 2 112 ? 7.988   18.571  1.193   1.00 0.00 ? 370 LYS A N    3  
ATOM   5801  C  CA   . LYS B 2 112 ? 6.905   18.895  2.089   1.00 0.00 ? 370 LYS A CA   3  
ATOM   5802  C  C    . LYS B 2 112 ? 7.310   19.953  3.109   1.00 0.00 ? 370 LYS A C    3  
ATOM   5803  O  O    . LYS B 2 112 ? 6.522   20.835  3.455   1.00 0.00 ? 370 LYS A O    3  
ATOM   5804  C  CB   . LYS B 2 112 ? 6.492   17.643  2.824   1.00 0.00 ? 370 LYS A CB   3  
ATOM   5805  C  CG   . LYS B 2 112 ? 5.464   16.808  2.104   1.00 0.00 ? 370 LYS A CG   3  
ATOM   5806  C  CD   . LYS B 2 112 ? 5.682   15.349  2.402   1.00 0.00 ? 370 LYS A CD   3  
ATOM   5807  C  CE   . LYS B 2 112 ? 4.421   14.541  2.200   1.00 0.00 ? 370 LYS A CE   3  
ATOM   5808  N  NZ   . LYS B 2 112 ? 3.289   15.061  3.015   1.00 0.00 ? 370 LYS A NZ   3  
ATOM   5809  H  H    . LYS B 2 112 ? 8.218   17.625  1.081   1.00 0.00 ? 370 LYS A H    3  
ATOM   5810  H  HA   . LYS B 2 112 ? 6.082   19.235  1.497   1.00 0.00 ? 370 LYS A HA   3  
ATOM   5811  H  HB2  . LYS B 2 112 ? 7.364   17.040  2.962   1.00 0.00 ? 370 LYS A HB2  3  
ATOM   5812  H  HB3  . LYS B 2 112 ? 6.101   17.915  3.782   1.00 0.00 ? 370 LYS A HB3  3  
ATOM   5813  H  HG2  . LYS B 2 112 ? 4.475   17.096  2.424   1.00 0.00 ? 370 LYS A HG2  3  
ATOM   5814  H  HG3  . LYS B 2 112 ? 5.570   16.959  1.043   1.00 0.00 ? 370 LYS A HG3  3  
ATOM   5815  H  HD2  . LYS B 2 112 ? 6.441   14.991  1.727   1.00 0.00 ? 370 LYS A HD2  3  
ATOM   5816  H  HD3  . LYS B 2 112 ? 6.019   15.241  3.424   1.00 0.00 ? 370 LYS A HD3  3  
ATOM   5817  H  HE2  . LYS B 2 112 ? 4.159   14.589  1.160   1.00 0.00 ? 370 LYS A HE2  3  
ATOM   5818  H  HE3  . LYS B 2 112 ? 4.616   13.515  2.477   1.00 0.00 ? 370 LYS A HE3  3  
ATOM   5819  H  HZ1  . LYS B 2 112 ? 3.541   15.049  4.025   1.00 0.00 ? 370 LYS A HZ1  3  
ATOM   5820  H  HZ2  . LYS B 2 112 ? 2.445   14.469  2.874   1.00 0.00 ? 370 LYS A HZ2  3  
ATOM   5821  H  HZ3  . LYS B 2 112 ? 3.066   16.037  2.735   1.00 0.00 ? 370 LYS A HZ3  3  
ATOM   5822  N  N    . ALA B 2 113 ? 8.547   19.849  3.591   1.00 0.00 ? 371 ALA A N    3  
ATOM   5823  C  CA   . ALA B 2 113 ? 9.072   20.772  4.587   1.00 0.00 ? 371 ALA A CA   3  
ATOM   5824  C  C    . ALA B 2 113 ? 8.964   22.219  4.128   1.00 0.00 ? 371 ALA A C    3  
ATOM   5825  O  O    . ALA B 2 113 ? 8.506   22.503  3.021   1.00 0.00 ? 371 ALA A O    3  
ATOM   5826  C  CB   . ALA B 2 113 ? 10.521  20.443  4.886   1.00 0.00 ? 371 ALA A CB   3  
ATOM   5827  H  H    . ALA B 2 113 ? 9.128   19.133  3.261   1.00 0.00 ? 371 ALA A H    3  
ATOM   5828  H  HA   . ALA B 2 113 ? 8.504   20.641  5.495   1.00 0.00 ? 371 ALA A HA   3  
ATOM   5829  H  HB1  . ALA B 2 113 ? 11.141  20.834  4.094   1.00 0.00 ? 371 ALA A HB1  3  
ATOM   5830  H  HB2  . ALA B 2 113 ? 10.643  19.371  4.948   1.00 0.00 ? 371 ALA A HB2  3  
ATOM   5831  H  HB3  . ALA B 2 113 ? 10.808  20.894  5.825   1.00 0.00 ? 371 ALA A HB3  3  
ATOM   5832  N  N    . SER B 2 114 ? 9.399   23.132  4.989   1.00 0.00 ? 372 SER A N    3  
ATOM   5833  C  CA   . SER B 2 114 ? 9.363   24.550  4.673   1.00 0.00 ? 372 SER A CA   3  
ATOM   5834  C  C    . SER B 2 114 ? 10.274  25.340  5.606   1.00 0.00 ? 372 SER A C    3  
ATOM   5835  O  O    . SER B 2 114 ? 9.796   25.765  6.680   1.00 0.00 ? 372 SER A O    3  
ATOM   5836  C  CB   . SER B 2 114 ? 7.929   25.079  4.763   1.00 0.00 ? 372 SER A CB   3  
ATOM   5837  O  OG   . SER B 2 114 ? 7.865   26.446  4.397   1.00 0.00 ? 372 SER A OG   3  
ATOM   5838  O  OXT  . SER B 2 114 ? 11.459  25.527  5.257   1.00 0.00 ? 372 SER A OXT  3  
ATOM   5839  H  H    . SER B 2 114 ? 9.751   22.843  5.856   1.00 0.00 ? 372 SER A H    3  
ATOM   5840  H  HA   . SER B 2 114 ? 9.718   24.664  3.660   1.00 0.00 ? 372 SER A HA   3  
ATOM   5841  H  HB2  . SER B 2 114 ? 7.295   24.510  4.099   1.00 0.00 ? 372 SER A HB2  3  
ATOM   5842  H  HB3  . SER B 2 114 ? 7.573   24.972  5.778   1.00 0.00 ? 372 SER A HB3  3  
ATOM   5843  H  HG   . SER B 2 114 ? 8.130   26.545  3.481   1.00 0.00 ? 372 SER A HG   3  
HETATM 5844  ZN ZN   . ZN  C 3 .   ? -14.853 -0.317  3.661   1.00 0.00 ? 501 ZN  A ZN   3  
HETATM 5845  ZN ZN   . ZN  D 3 .   ? -3.935  -7.695  -7.398  1.00 0.00 ? 601 ZN  A ZN   3  
HETATM 5846  ZN ZN   . ZN  E 3 .   ? 5.284   6.336   -0.571  1.00 0.00 ? 701 ZN  A ZN   3  
HETATM 5847  ZN ZN   . ZN  F 3 .   ? 13.301  -5.305  -5.545  1.00 0.00 ? 801 ZN  A ZN   3  
ATOM   5848  N  N    . GLY A 1 1   ? -8.809  -12.719 13.005  1.00 0.00 ? 9   GLY B N    4  
ATOM   5849  C  CA   . GLY A 1 1   ? -9.924  -12.313 13.904  1.00 0.00 ? 9   GLY B CA   4  
ATOM   5850  C  C    . GLY A 1 1   ? -9.581  -12.494 15.370  1.00 0.00 ? 9   GLY B C    4  
ATOM   5851  O  O    . GLY A 1 1   ? -9.912  -11.648 16.200  1.00 0.00 ? 9   GLY B O    4  
ATOM   5852  H  H1   . GLY A 1 1   ? -7.965  -12.142 13.199  1.00 0.00 ? 9   GLY B H1   4  
ATOM   5853  H  H2   . GLY A 1 1   ? -9.085  -12.585 12.011  1.00 0.00 ? 9   GLY B H2   4  
ATOM   5854  H  H3   . GLY A 1 1   ? -8.573  -13.720 13.156  1.00 0.00 ? 9   GLY B H3   4  
ATOM   5855  H  HA2  . GLY A 1 1   ? -10.156 -11.274 13.726  1.00 0.00 ? 9   GLY B HA2  4  
ATOM   5856  H  HA3  . GLY A 1 1   ? -10.793 -12.910 13.673  1.00 0.00 ? 9   GLY B HA3  4  
ATOM   5857  N  N    . LEU A 1 2   ? -8.914  -13.599 15.687  1.00 0.00 ? 10  LEU B N    4  
ATOM   5858  C  CA   . LEU A 1 2   ? -8.524  -13.891 17.062  1.00 0.00 ? 10  LEU B CA   4  
ATOM   5859  C  C    . LEU A 1 2   ? -7.088  -13.452 17.325  1.00 0.00 ? 10  LEU B C    4  
ATOM   5860  O  O    . LEU A 1 2   ? -6.140  -14.113 16.902  1.00 0.00 ? 10  LEU B O    4  
ATOM   5861  C  CB   . LEU A 1 2   ? -8.674  -15.387 17.349  1.00 0.00 ? 10  LEU B CB   4  
ATOM   5862  C  CG   . LEU A 1 2   ? -8.281  -15.821 18.764  1.00 0.00 ? 10  LEU B CG   4  
ATOM   5863  C  CD1  . LEU A 1 2   ? -9.247  -15.247 19.789  1.00 0.00 ? 10  LEU B CD1  4  
ATOM   5864  C  CD2  . LEU A 1 2   ? -8.235  -17.338 18.861  1.00 0.00 ? 10  LEU B CD2  4  
ATOM   5865  H  H    . LEU A 1 2   ? -8.679  -14.235 14.979  1.00 0.00 ? 10  LEU B H    4  
ATOM   5866  H  HA   . LEU A 1 2   ? -9.183  -13.341 17.717  1.00 0.00 ? 10  LEU B HA   4  
ATOM   5867  H  HB2  . LEU A 1 2   ? -9.705  -15.663 17.185  1.00 0.00 ? 10  LEU B HB2  4  
ATOM   5868  H  HB3  . LEU A 1 2   ? -8.059  -15.931 16.648  1.00 0.00 ? 10  LEU B HB3  4  
ATOM   5869  H  HG   . LEU A 1 2   ? -7.295  -15.442 18.988  1.00 0.00 ? 10  LEU B HG   4  
ATOM   5870  H  HD11 . LEU A 1 2   ? -9.230  -14.169 19.735  1.00 0.00 ? 10  LEU B HD11 4  
ATOM   5871  H  HD12 . LEU A 1 2   ? -8.953  -15.564 20.778  1.00 0.00 ? 10  LEU B HD12 4  
ATOM   5872  H  HD13 . LEU A 1 2   ? -10.246 -15.602 19.579  1.00 0.00 ? 10  LEU B HD13 4  
ATOM   5873  H  HD21 . LEU A 1 2   ? -7.968  -17.627 19.867  1.00 0.00 ? 10  LEU B HD21 4  
ATOM   5874  H  HD22 . LEU A 1 2   ? -7.500  -17.722 18.169  1.00 0.00 ? 10  LEU B HD22 4  
ATOM   5875  H  HD23 . LEU A 1 2   ? -9.206  -17.744 18.616  1.00 0.00 ? 10  LEU B HD23 4  
ATOM   5876  N  N    . GLY A 1 3   ? -6.934  -12.332 18.024  1.00 0.00 ? 11  GLY B N    4  
ATOM   5877  C  CA   . GLY A 1 3   ? -5.610  -11.825 18.332  1.00 0.00 ? 11  GLY B CA   4  
ATOM   5878  C  C    . GLY A 1 3   ? -5.543  -10.311 18.302  1.00 0.00 ? 11  GLY B C    4  
ATOM   5879  O  O    . GLY A 1 3   ? -5.231  -9.677  19.311  1.00 0.00 ? 11  GLY B O    4  
ATOM   5880  H  H    . GLY A 1 3   ? -7.727  -11.845 18.334  1.00 0.00 ? 11  GLY B H    4  
ATOM   5881  H  HA2  . GLY A 1 3   ? -5.326  -12.167 19.316  1.00 0.00 ? 11  GLY B HA2  4  
ATOM   5882  H  HA3  . GLY A 1 3   ? -4.910  -12.219 17.610  1.00 0.00 ? 11  GLY B HA3  4  
ATOM   5883  N  N    . LYS A 1 4   ? -5.837  -9.730  17.143  1.00 0.00 ? 12  LYS B N    4  
ATOM   5884  C  CA   . LYS A 1 4   ? -5.805  -8.281  16.983  1.00 0.00 ? 12  LYS B CA   4  
ATOM   5885  C  C    . LYS A 1 4   ? -6.968  -7.799  16.122  1.00 0.00 ? 12  LYS B C    4  
ATOM   5886  O  O    . LYS A 1 4   ? -7.407  -6.655  16.238  1.00 0.00 ? 12  LYS B O    4  
ATOM   5887  C  CB   . LYS A 1 4   ? -4.473  -7.836  16.366  1.00 0.00 ? 12  LYS B CB   4  
ATOM   5888  C  CG   . LYS A 1 4   ? -4.249  -8.331  14.942  1.00 0.00 ? 12  LYS B CG   4  
ATOM   5889  C  CD   . LYS A 1 4   ? -3.932  -9.818  14.904  1.00 0.00 ? 12  LYS B CD   4  
ATOM   5890  C  CE   . LYS A 1 4   ? -3.655  -10.293 13.488  1.00 0.00 ? 12  LYS B CE   4  
ATOM   5891  N  NZ   . LYS A 1 4   ? -3.443  -11.766 13.428  1.00 0.00 ? 12  LYS B NZ   4  
ATOM   5892  H  H    . LYS A 1 4   ? -6.080  -10.289 16.376  1.00 0.00 ? 12  LYS B H    4  
ATOM   5893  H  HA   . LYS A 1 4   ? -5.898  -7.841  17.966  1.00 0.00 ? 12  LYS B HA   4  
ATOM   5894  H  HB2  . LYS A 1 4   ? -4.440  -6.757  16.355  1.00 0.00 ? 12  LYS B HB2  4  
ATOM   5895  H  HB3  . LYS A 1 4   ? -3.665  -8.203  16.982  1.00 0.00 ? 12  LYS B HB3  4  
ATOM   5896  H  HG2  . LYS A 1 4   ? -5.143  -8.150  14.365  1.00 0.00 ? 12  LYS B HG2  4  
ATOM   5897  H  HG3  . LYS A 1 4   ? -3.423  -7.785  14.509  1.00 0.00 ? 12  LYS B HG3  4  
ATOM   5898  H  HD2  . LYS A 1 4   ? -3.060  -10.006 15.513  1.00 0.00 ? 12  LYS B HD2  4  
ATOM   5899  H  HD3  . LYS A 1 4   ? -4.774  -10.365 15.300  1.00 0.00 ? 12  LYS B HD3  4  
ATOM   5900  H  HE2  . LYS A 1 4   ? -4.497  -10.034 12.864  1.00 0.00 ? 12  LYS B HE2  4  
ATOM   5901  H  HE3  . LYS A 1 4   ? -2.770  -9.795  13.122  1.00 0.00 ? 12  LYS B HE3  4  
ATOM   5902  H  HZ1  . LYS A 1 4   ? -2.638  -12.035 14.030  1.00 0.00 ? 12  LYS B HZ1  4  
ATOM   5903  H  HZ2  . LYS A 1 4   ? -3.245  -12.059 12.452  1.00 0.00 ? 12  LYS B HZ2  4  
ATOM   5904  H  HZ3  . LYS A 1 4   ? -4.293  -12.263 13.762  1.00 0.00 ? 12  LYS B HZ3  4  
ATOM   5905  N  N    . GLY A 1 5   ? -7.464  -8.680  15.257  1.00 0.00 ? 13  GLY B N    4  
ATOM   5906  C  CA   . GLY A 1 5   ? -8.573  -8.325  14.391  1.00 0.00 ? 13  GLY B CA   4  
ATOM   5907  C  C    . GLY A 1 5   ? -8.292  -8.627  12.931  1.00 0.00 ? 13  GLY B C    4  
ATOM   5908  O  O    . GLY A 1 5   ? -7.840  -9.721  12.593  1.00 0.00 ? 13  GLY B O    4  
ATOM   5909  H  H    . GLY A 1 5   ? -7.072  -9.577  15.206  1.00 0.00 ? 13  GLY B H    4  
ATOM   5910  H  HA2  . GLY A 1 5   ? -9.447  -8.879  14.698  1.00 0.00 ? 13  GLY B HA2  4  
ATOM   5911  H  HA3  . GLY A 1 5   ? -8.774  -7.270  14.495  1.00 0.00 ? 13  GLY B HA3  4  
ATOM   5912  N  N    . GLY A 1 6   ? -8.560  -7.653  12.067  1.00 0.00 ? 14  GLY B N    4  
ATOM   5913  C  CA   . GLY A 1 6   ? -8.329  -7.837  10.646  1.00 0.00 ? 14  GLY B CA   4  
ATOM   5914  C  C    . GLY A 1 6   ? -6.909  -7.496  10.240  1.00 0.00 ? 14  GLY B C    4  
ATOM   5915  O  O    . GLY A 1 6   ? -6.055  -8.380  10.151  1.00 0.00 ? 14  GLY B O    4  
ATOM   5916  H  H    . GLY A 1 6   ? -8.920  -6.804  12.397  1.00 0.00 ? 14  GLY B H    4  
ATOM   5917  H  HA2  . GLY A 1 6   ? -8.527  -8.868  10.392  1.00 0.00 ? 14  GLY B HA2  4  
ATOM   5918  H  HA3  . GLY A 1 6   ? -9.011  -7.204  10.097  1.00 0.00 ? 14  GLY B HA3  4  
ATOM   5919  N  N    . ALA A 1 7   ? -6.657  -6.212  9.995   1.00 0.00 ? 15  ALA B N    4  
ATOM   5920  C  CA   . ALA A 1 7   ? -5.332  -5.749  9.594   1.00 0.00 ? 15  ALA B CA   4  
ATOM   5921  C  C    . ALA A 1 7   ? -4.875  -6.435  8.310   1.00 0.00 ? 15  ALA B C    4  
ATOM   5922  O  O    . ALA A 1 7   ? -4.305  -7.526  8.346   1.00 0.00 ? 15  ALA B O    4  
ATOM   5923  C  CB   . ALA A 1 7   ? -4.326  -5.986  10.711  1.00 0.00 ? 15  ALA B CB   4  
ATOM   5924  H  H    . ALA A 1 7   ? -7.383  -5.559  10.086  1.00 0.00 ? 15  ALA B H    4  
ATOM   5925  H  HA   . ALA A 1 7   ? -5.393  -4.684  9.417   1.00 0.00 ? 15  ALA B HA   4  
ATOM   5926  H  HB1  . ALA A 1 7   ? -4.260  -7.045  10.918  1.00 0.00 ? 15  ALA B HB1  4  
ATOM   5927  H  HB2  . ALA A 1 7   ? -4.646  -5.465  11.601  1.00 0.00 ? 15  ALA B HB2  4  
ATOM   5928  H  HB3  . ALA A 1 7   ? -3.357  -5.618  10.408  1.00 0.00 ? 15  ALA B HB3  4  
HETATM 5929  O  OH   . ALY A 1 8   ? -5.517  -6.417  -0.545  1.00 0.00 ? 16  ALY B OH   4  
HETATM 5930  C  CH   . ALY A 1 8   ? -6.576  -5.963  -0.109  1.00 0.00 ? 16  ALY B CH   4  
HETATM 5931  C  CH3  . ALY A 1 8   ? -7.589  -5.408  -1.112  1.00 0.00 ? 16  ALY B CH3  4  
HETATM 5932  N  NZ   . ALY A 1 8   ? -6.702  -5.615  1.166   1.00 0.00 ? 16  ALY B NZ   4  
HETATM 5933  C  CE   . ALY A 1 8   ? -5.549  -5.267  1.993   1.00 0.00 ? 16  ALY B CE   4  
HETATM 5934  C  CD   . ALY A 1 8   ? -4.889  -6.495  2.603   1.00 0.00 ? 16  ALY B CD   4  
HETATM 5935  C  CG   . ALY A 1 8   ? -5.766  -7.134  3.671   1.00 0.00 ? 16  ALY B CG   4  
HETATM 5936  C  CB   . ALY A 1 8   ? -5.913  -6.244  4.901   1.00 0.00 ? 16  ALY B CB   4  
HETATM 5937  C  CA   . ALY A 1 8   ? -4.739  -6.334  5.883   1.00 0.00 ? 16  ALY B CA   4  
HETATM 5938  N  N    . ALY A 1 8   ? -5.124  -5.786  7.178   1.00 0.00 ? 16  ALY B N    4  
HETATM 5939  C  C    . ALY A 1 8   ? -3.526  -5.599  5.322   1.00 0.00 ? 16  ALY B C    4  
HETATM 5940  O  O    . ALY A 1 8   ? -2.457  -6.188  5.161   1.00 0.00 ? 16  ALY B O    4  
HETATM 5941  H  HH31 . ALY A 1 8   ? -8.491  -5.118  -0.593  1.00 0.00 ? 16  ALY B HH31 4  
HETATM 5942  H  HH32 . ALY A 1 8   ? -7.165  -4.546  -1.607  1.00 0.00 ? 16  ALY B HH32 4  
HETATM 5943  H  HH33 . ALY A 1 8   ? -7.824  -6.165  -1.846  1.00 0.00 ? 16  ALY B HH33 4  
HETATM 5944  H  HZ   . ALY A 1 8   ? -7.570  -5.267  1.460   1.00 0.00 ? 16  ALY B HZ   4  
HETATM 5945  H  HE3  . ALY A 1 8   ? -4.825  -4.746  1.382   1.00 0.00 ? 16  ALY B HE3  4  
HETATM 5946  H  HE2  . ALY A 1 8   ? -5.874  -4.619  2.792   1.00 0.00 ? 16  ALY B HE2  4  
HETATM 5947  H  HD3  . ALY A 1 8   ? -4.707  -7.220  1.822   1.00 0.00 ? 16  ALY B HD3  4  
HETATM 5948  H  HD2  . ALY A 1 8   ? -3.951  -6.203  3.048   1.00 0.00 ? 16  ALY B HD2  4  
HETATM 5949  H  HG3  . ALY A 1 8   ? -6.746  -7.319  3.255   1.00 0.00 ? 16  ALY B HG3  4  
HETATM 5950  H  HG2  . ALY A 1 8   ? -5.321  -8.071  3.971   1.00 0.00 ? 16  ALY B HG2  4  
HETATM 5951  H  HB3  . ALY A 1 8   ? -6.010  -5.222  4.568   1.00 0.00 ? 16  ALY B HB3  4  
HETATM 5952  H  HB2  . ALY A 1 8   ? -6.818  -6.531  5.416   1.00 0.00 ? 16  ALY B HB2  4  
HETATM 5953  H  HCA  . ALY A 1 8   ? -4.481  -7.373  6.027   1.00 0.00 ? 16  ALY B HCA  4  
HETATM 5954  H  H    . ALY A 1 8   ? -5.577  -4.918  7.214   1.00 0.00 ? 16  ALY B H    4  
ATOM   5955  N  N    . ARG A 1 9   ? -3.699  -4.311  5.029   1.00 0.00 ? 17  ARG B N    4  
ATOM   5956  C  CA   . ARG A 1 9   ? -2.620  -3.498  4.477   1.00 0.00 ? 17  ARG B CA   4  
ATOM   5957  C  C    . ARG A 1 9   ? -2.063  -4.133  3.207   1.00 0.00 ? 17  ARG B C    4  
ATOM   5958  O  O    . ARG A 1 9   ? -2.623  -3.975  2.123   1.00 0.00 ? 17  ARG B O    4  
ATOM   5959  C  CB   . ARG A 1 9   ? -1.498  -3.313  5.510   1.00 0.00 ? 17  ARG B CB   4  
ATOM   5960  C  CG   . ARG A 1 9   ? -0.242  -2.638  4.960   1.00 0.00 ? 17  ARG B CG   4  
ATOM   5961  C  CD   . ARG A 1 9   ? -0.441  -1.141  4.777   1.00 0.00 ? 17  ARG B CD   4  
ATOM   5962  N  NE   . ARG A 1 9   ? -0.969  -0.510  5.984   1.00 0.00 ? 17  ARG B NE   4  
ATOM   5963  C  CZ   . ARG A 1 9   ? -0.244  0.249   6.802   1.00 0.00 ? 17  ARG B CZ   4  
ATOM   5964  N  NH1  . ARG A 1 9   ? 1.040   0.465   6.551   1.00 0.00 ? 17  ARG B NH1  4  
ATOM   5965  N  NH2  . ARG A 1 9   ? -0.804  0.792   7.875   1.00 0.00 ? 17  ARG B NH2  4  
ATOM   5966  H  H    . ARG A 1 9   ? -4.573  -3.899  5.189   1.00 0.00 ? 17  ARG B H    4  
ATOM   5967  H  HA   . ARG A 1 9   ? -3.029  -2.530  4.228   1.00 0.00 ? 17  ARG B HA   4  
ATOM   5968  H  HB2  . ARG A 1 9   ? -1.872  -2.710  6.323   1.00 0.00 ? 17  ARG B HB2  4  
ATOM   5969  H  HB3  . ARG A 1 9   ? -1.218  -4.283  5.894   1.00 0.00 ? 17  ARG B HB3  4  
ATOM   5970  H  HG2  . ARG A 1 9   ? 0.572   -2.798  5.653   1.00 0.00 ? 17  ARG B HG2  4  
ATOM   5971  H  HG3  . ARG A 1 9   ? 0.010   -3.083  3.997   1.00 0.00 ? 17  ARG B HG3  4  
ATOM   5972  H  HD2  . ARG A 1 9   ? 0.511   -0.692  4.536   1.00 0.00 ? 17  ARG B HD2  4  
ATOM   5973  H  HD3  . ARG A 1 9   ? -1.132  -0.977  3.963   1.00 0.00 ? 17  ARG B HD3  4  
ATOM   5974  H  HE   . ARG A 1 9   ? -1.915  -0.656  6.196   1.00 0.00 ? 17  ARG B HE   4  
ATOM   5975  H  HH11 . ARG A 1 9   ? 1.468   0.057   5.745   1.00 0.00 ? 17  ARG B HH11 4  
ATOM   5976  H  HH12 . ARG A 1 9   ? 1.582   1.036   7.169   1.00 0.00 ? 17  ARG B HH12 4  
ATOM   5977  H  HH21 . ARG A 1 9   ? -1.771  0.631   8.069   1.00 0.00 ? 17  ARG B HH21 4  
ATOM   5978  H  HH22 . ARG A 1 9   ? -0.259  1.362   8.489   1.00 0.00 ? 17  ARG B HH22 4  
ATOM   5979  N  N    . HIS A 1 10  ? -0.967  -4.869  3.361   1.00 0.00 ? 18  HIS B N    4  
ATOM   5980  C  CA   . HIS A 1 10  ? -0.307  -5.526  2.246   1.00 0.00 ? 18  HIS B CA   4  
ATOM   5981  C  C    . HIS A 1 10  ? 0.424   -6.775  2.745   1.00 0.00 ? 18  HIS B C    4  
ATOM   5982  O  O    . HIS A 1 10  ? -0.112  -7.540  3.547   1.00 0.00 ? 18  HIS B O    4  
ATOM   5983  C  CB   . HIS A 1 10  ? 0.694   -4.567  1.585   1.00 0.00 ? 18  HIS B CB   4  
ATOM   5984  C  CG   . HIS A 1 10  ? 0.136   -3.223  1.219   1.00 0.00 ? 18  HIS B CG   4  
ATOM   5985  N  ND1  . HIS A 1 10  ? 0.417   -2.073  1.925   1.00 0.00 ? 18  HIS B ND1  4  
ATOM   5986  C  CD2  . HIS A 1 10  ? -0.678  -2.848  0.206   1.00 0.00 ? 18  HIS B CD2  4  
ATOM   5987  C  CE1  . HIS A 1 10  ? -0.202  -1.050  1.364   1.00 0.00 ? 18  HIS B CE1  4  
ATOM   5988  N  NE2  . HIS A 1 10  ? -0.874  -1.494  0.319   1.00 0.00 ? 18  HIS B NE2  4  
ATOM   5989  H  H    . HIS A 1 10  ? -0.591  -4.978  4.259   1.00 0.00 ? 18  HIS B H    4  
ATOM   5990  H  HA   . HIS A 1 10  ? -1.059  -5.815  1.527   1.00 0.00 ? 18  HIS B HA   4  
ATOM   5991  H  HB2  . HIS A 1 10  ? 1.520   -4.407  2.257   1.00 0.00 ? 18  HIS B HB2  4  
ATOM   5992  H  HB3  . HIS A 1 10  ? 1.063   -5.019  0.685   1.00 0.00 ? 18  HIS B HB3  4  
ATOM   5993  H  HD1  . HIS A 1 10  ? 0.987   -2.014  2.721   1.00 0.00 ? 18  HIS B HD1  4  
ATOM   5994  H  HD2  . HIS A 1 10  ? -1.081  -3.488  -0.561  1.00 0.00 ? 18  HIS B HD2  4  
ATOM   5995  H  HE1  . HIS A 1 10  ? -0.164  -0.025  1.702   1.00 0.00 ? 18  HIS B HE1  4  
ATOM   5996  H  HE2  . HIS A 1 10  ? -1.399  -0.940  -0.294  1.00 0.00 ? 18  HIS B HE2  4  
ATOM   5997  N  N    . ARG A 1 11  ? 1.649   -6.974  2.258   1.00 0.00 ? 19  ARG B N    4  
ATOM   5998  C  CA   . ARG A 1 11  ? 2.483   -8.107  2.654   1.00 0.00 ? 19  ARG B CA   4  
ATOM   5999  C  C    . ARG A 1 11  ? 1.916   -9.439  2.193   1.00 0.00 ? 19  ARG B C    4  
ATOM   6000  O  O    . ARG A 1 11  ? 2.567   -10.475 2.332   1.00 0.00 ? 19  ARG B O    4  
ATOM   6001  C  CB   . ARG A 1 11  ? 2.708   -8.093  4.155   1.00 0.00 ? 19  ARG B CB   4  
ATOM   6002  C  CG   . ARG A 1 11  ? 3.863   -8.979  4.598   1.00 0.00 ? 19  ARG B CG   4  
ATOM   6003  C  CD   . ARG A 1 11  ? 4.159   -8.834  6.081   1.00 0.00 ? 19  ARG B CD   4  
ATOM   6004  N  NE   . ARG A 1 11  ? 5.217   -9.748  6.509   1.00 0.00 ? 19  ARG B NE   4  
ATOM   6005  C  CZ   . ARG A 1 11  ? 6.036   -9.510  7.528   1.00 0.00 ? 19  ARG B CZ   4  
ATOM   6006  N  NH1  . ARG A 1 11  ? 5.914   -8.396  8.239   1.00 0.00 ? 19  ARG B NH1  4  
ATOM   6007  N  NH2  . ARG A 1 11  ? 6.980   -10.390 7.840   1.00 0.00 ? 19  ARG B NH2  4  
ATOM   6008  H  H    . ARG A 1 11  ? 2.007   -6.335  1.609   1.00 0.00 ? 19  ARG B H    4  
ATOM   6009  H  HA   . ARG A 1 11  ? 3.435   -7.979  2.172   1.00 0.00 ? 19  ARG B HA   4  
ATOM   6010  H  HB2  . ARG A 1 11  ? 2.918   -7.076  4.445   1.00 0.00 ? 19  ARG B HB2  4  
ATOM   6011  H  HB3  . ARG A 1 11  ? 1.809   -8.428  4.651   1.00 0.00 ? 19  ARG B HB3  4  
ATOM   6012  H  HG2  . ARG A 1 11  ? 3.612   -10.008 4.392   1.00 0.00 ? 19  ARG B HG2  4  
ATOM   6013  H  HG3  . ARG A 1 11  ? 4.746   -8.706  4.036   1.00 0.00 ? 19  ARG B HG3  4  
ATOM   6014  H  HD2  . ARG A 1 11  ? 4.470   -7.819  6.278   1.00 0.00 ? 19  ARG B HD2  4  
ATOM   6015  H  HD3  . ARG A 1 11  ? 3.260   -9.052  6.639   1.00 0.00 ? 19  ARG B HD3  4  
ATOM   6016  H  HE   . ARG A 1 11  ? 5.326   -10.581 6.004   1.00 0.00 ? 19  ARG B HE   4  
ATOM   6017  H  HH11 . ARG A 1 11  ? 5.204   -7.731  8.008   1.00 0.00 ? 19  ARG B HH11 4  
ATOM   6018  H  HH12 . ARG A 1 11  ? 6.532   -8.221  9.006   1.00 0.00 ? 19  ARG B HH12 4  
ATOM   6019  H  HH21 . ARG A 1 11  ? 7.073   -11.232 7.308   1.00 0.00 ? 19  ARG B HH21 4  
ATOM   6020  H  HH22 . ARG A 1 11  ? 7.596   -10.213 8.608   1.00 0.00 ? 19  ARG B HH22 4  
ATOM   6021  N  N    . LYS A 1 12  ? 0.707   -9.399  1.643   1.00 0.00 ? 20  LYS B N    4  
ATOM   6022  C  CA   . LYS A 1 12  ? 0.045   -10.587 1.113   1.00 0.00 ? 20  LYS B CA   4  
ATOM   6023  C  C    . LYS A 1 12  ? 0.335   -11.839 1.941   1.00 0.00 ? 20  LYS B C    4  
ATOM   6024  O  O    . LYS A 1 12  ? 0.551   -11.758 3.151   1.00 0.00 ? 20  LYS B O    4  
ATOM   6025  C  CB   . LYS A 1 12  ? 0.473   -10.774 -0.344  1.00 0.00 ? 20  LYS B CB   4  
ATOM   6026  C  CG   . LYS A 1 12  ? 1.931   -11.139 -0.541  1.00 0.00 ? 20  LYS B CG   4  
ATOM   6027  C  CD   . LYS A 1 12  ? 2.438   -10.591 -1.863  1.00 0.00 ? 20  LYS B CD   4  
ATOM   6028  C  CE   . LYS A 1 12  ? 3.942   -10.707 -1.972  1.00 0.00 ? 20  LYS B CE   4  
ATOM   6029  N  NZ   . LYS A 1 12  ? 4.352   -11.929 -2.718  1.00 0.00 ? 20  LYS B NZ   4  
ATOM   6030  H  H    . LYS A 1 12  ? 0.243   -8.539  1.586   1.00 0.00 ? 20  LYS B H    4  
ATOM   6031  H  HA   . LYS A 1 12  ? -1.018  -10.403 1.136   1.00 0.00 ? 20  LYS B HA   4  
ATOM   6032  H  HB2  . LYS A 1 12  ? -0.136  -11.538 -0.802  1.00 0.00 ? 20  LYS B HB2  4  
ATOM   6033  H  HB3  . LYS A 1 12  ? 0.310   -9.842  -0.856  1.00 0.00 ? 20  LYS B HB3  4  
ATOM   6034  H  HG2  . LYS A 1 12  ? 2.513   -10.718 0.261   1.00 0.00 ? 20  LYS B HG2  4  
ATOM   6035  H  HG3  . LYS A 1 12  ? 2.031   -12.209 -0.541  1.00 0.00 ? 20  LYS B HG3  4  
ATOM   6036  H  HD2  . LYS A 1 12  ? 1.985   -11.146 -2.670  1.00 0.00 ? 20  LYS B HD2  4  
ATOM   6037  H  HD3  . LYS A 1 12  ? 2.162   -9.550  -1.938  1.00 0.00 ? 20  LYS B HD3  4  
ATOM   6038  H  HE2  . LYS A 1 12  ? 4.321   -9.831  -2.483  1.00 0.00 ? 20  LYS B HE2  4  
ATOM   6039  H  HE3  . LYS A 1 12  ? 4.357   -10.748 -0.977  1.00 0.00 ? 20  LYS B HE3  4  
ATOM   6040  H  HZ1  . LYS A 1 12  ? 3.876   -11.960 -3.642  1.00 0.00 ? 20  LYS B HZ1  4  
ATOM   6041  H  HZ2  . LYS A 1 12  ? 4.094   -12.780 -2.178  1.00 0.00 ? 20  LYS B HZ2  4  
ATOM   6042  H  HZ3  . LYS A 1 12  ? 5.381   -11.926 -2.869  1.00 0.00 ? 20  LYS B HZ3  4  
ATOM   6043  N  N    . VAL A 1 13  ? 0.314   -12.997 1.288   1.00 0.00 ? 21  VAL B N    4  
ATOM   6044  C  CA   . VAL A 1 13  ? 0.575   -14.261 1.964   1.00 0.00 ? 21  VAL B CA   4  
ATOM   6045  C  C    . VAL A 1 13  ? 2.032   -14.350 2.407   1.00 0.00 ? 21  VAL B C    4  
ATOM   6046  O  O    . VAL A 1 13  ? 2.937   -13.922 1.691   1.00 0.00 ? 21  VAL B O    4  
ATOM   6047  C  CB   . VAL A 1 13  ? 0.252   -15.463 1.054   1.00 0.00 ? 21  VAL B CB   4  
ATOM   6048  C  CG1  . VAL A 1 13  ? 0.281   -16.760 1.849   1.00 0.00 ? 21  VAL B CG1  4  
ATOM   6049  C  CG2  . VAL A 1 13  ? -1.099  -15.275 0.379   1.00 0.00 ? 21  VAL B CG2  4  
ATOM   6050  H  H    . VAL A 1 13  ? 0.115   -13.002 0.329   1.00 0.00 ? 21  VAL B H    4  
ATOM   6051  H  HA   . VAL A 1 13  ? -0.061  -14.313 2.837   1.00 0.00 ? 21  VAL B HA   4  
ATOM   6052  H  HB   . VAL A 1 13  ? 1.008   -15.522 0.287   1.00 0.00 ? 21  VAL B HB   4  
ATOM   6053  H  HG11 . VAL A 1 13  ? -0.452  -16.715 2.640   1.00 0.00 ? 21  VAL B HG11 4  
ATOM   6054  H  HG12 . VAL A 1 13  ? 1.264   -16.897 2.276   1.00 0.00 ? 21  VAL B HG12 4  
ATOM   6055  H  HG13 . VAL A 1 13  ? 0.055   -17.589 1.194   1.00 0.00 ? 21  VAL B HG13 4  
ATOM   6056  H  HG21 . VAL A 1 13  ? -1.327  -16.146 -0.217  1.00 0.00 ? 21  VAL B HG21 4  
ATOM   6057  H  HG22 . VAL A 1 13  ? -1.064  -14.403 -0.258  1.00 0.00 ? 21  VAL B HG22 4  
ATOM   6058  H  HG23 . VAL A 1 13  ? -1.863  -15.141 1.130   1.00 0.00 ? 21  VAL B HG23 4  
ATOM   6059  N  N    . LEU A 1 14  ? 2.251   -14.907 3.595   1.00 0.00 ? 22  LEU B N    4  
ATOM   6060  C  CA   . LEU A 1 14  ? 3.598   -15.054 4.134   1.00 0.00 ? 22  LEU B CA   4  
ATOM   6061  C  C    . LEU A 1 14  ? 4.449   -15.953 3.244   1.00 0.00 ? 22  LEU B C    4  
ATOM   6062  O  O    . LEU A 1 14  ? 3.928   -16.648 2.372   1.00 0.00 ? 22  LEU B O    4  
ATOM   6063  C  CB   . LEU A 1 14  ? 3.543   -15.613 5.560   1.00 0.00 ? 22  LEU B CB   4  
ATOM   6064  C  CG   . LEU A 1 14  ? 2.544   -16.753 5.784   1.00 0.00 ? 22  LEU B CG   4  
ATOM   6065  C  CD1  . LEU A 1 14  ? 3.049   -18.048 5.165   1.00 0.00 ? 22  LEU B CD1  4  
ATOM   6066  C  CD2  . LEU A 1 14  ? 2.278   -16.941 7.270   1.00 0.00 ? 22  LEU B CD2  4  
ATOM   6067  H  H    . LEU A 1 14  ? 1.488   -15.225 4.121   1.00 0.00 ? 22  LEU B H    4  
ATOM   6068  H  HA   . LEU A 1 14  ? 4.048   -14.072 4.163   1.00 0.00 ? 22  LEU B HA   4  
ATOM   6069  H  HB2  . LEU A 1 14  ? 4.529   -15.972 5.819   1.00 0.00 ? 22  LEU B HB2  4  
ATOM   6070  H  HB3  . LEU A 1 14  ? 3.287   -14.805 6.230   1.00 0.00 ? 22  LEU B HB3  4  
ATOM   6071  H  HG   . LEU A 1 14  ? 1.608   -16.499 5.307   1.00 0.00 ? 22  LEU B HG   4  
ATOM   6072  H  HD11 . LEU A 1 14  ? 4.002   -18.308 5.602   1.00 0.00 ? 22  LEU B HD11 4  
ATOM   6073  H  HD12 . LEU A 1 14  ? 3.164   -17.918 4.100   1.00 0.00 ? 22  LEU B HD12 4  
ATOM   6074  H  HD13 . LEU A 1 14  ? 2.338   -18.838 5.357   1.00 0.00 ? 22  LEU B HD13 4  
ATOM   6075  H  HD21 . LEU A 1 14  ? 1.881   -16.024 7.682   1.00 0.00 ? 22  LEU B HD21 4  
ATOM   6076  H  HD22 . LEU A 1 14  ? 3.201   -17.191 7.772   1.00 0.00 ? 22  LEU B HD22 4  
ATOM   6077  H  HD23 . LEU A 1 14  ? 1.565   -17.739 7.410   1.00 0.00 ? 22  LEU B HD23 4  
ATOM   6078  N  N    . ARG A 1 15  ? 5.761   -15.931 3.471   1.00 0.00 ? 23  ARG B N    4  
ATOM   6079  C  CA   . ARG A 1 15  ? 6.692   -16.742 2.691   1.00 0.00 ? 23  ARG B CA   4  
ATOM   6080  C  C    . ARG A 1 15  ? 6.607   -16.394 1.207   1.00 0.00 ? 23  ARG B C    4  
ATOM   6081  O  O    . ARG A 1 15  ? 5.788   -17.016 0.499   1.00 0.00 ? 23  ARG B O    4  
ATOM   6082  C  CB   . ARG A 1 15  ? 6.405   -18.232 2.901   1.00 0.00 ? 23  ARG B CB   4  
ATOM   6083  C  CG   . ARG A 1 15  ? 7.370   -19.155 2.172   1.00 0.00 ? 23  ARG B CG   4  
ATOM   6084  C  CD   . ARG A 1 15  ? 8.789   -19.008 2.697   1.00 0.00 ? 23  ARG B CD   4  
ATOM   6085  N  NE   . ARG A 1 15  ? 8.868   -19.256 4.134   1.00 0.00 ? 23  ARG B NE   4  
ATOM   6086  C  CZ   . ARG A 1 15  ? 10.002  -19.227 4.829   1.00 0.00 ? 23  ARG B CZ   4  
ATOM   6087  N  NH1  . ARG A 1 15  ? 11.152  -18.963 4.221   1.00 0.00 ? 23  ARG B NH1  4  
ATOM   6088  N  NH2  . ARG A 1 15  ? 9.987   -19.461 6.134   1.00 0.00 ? 23  ARG B NH2  4  
ATOM   6089  O  OXT  . ARG A 1 15  ? 7.361   -15.501 0.767   1.00 0.00 ? 23  ARG B OXT  4  
ATOM   6090  H  H    . ARG A 1 15  ? 6.112   -15.355 4.182   1.00 0.00 ? 23  ARG B H    4  
ATOM   6091  H  HA   . ARG A 1 15  ? 7.690   -16.526 3.041   1.00 0.00 ? 23  ARG B HA   4  
ATOM   6092  H  HB2  . ARG A 1 15  ? 6.461   -18.452 3.956   1.00 0.00 ? 23  ARG B HB2  4  
ATOM   6093  H  HB3  . ARG A 1 15  ? 5.405   -18.446 2.552   1.00 0.00 ? 23  ARG B HB3  4  
ATOM   6094  H  HG2  . ARG A 1 15  ? 7.051   -20.176 2.311   1.00 0.00 ? 23  ARG B HG2  4  
ATOM   6095  H  HG3  . ARG A 1 15  ? 7.358   -18.912 1.119   1.00 0.00 ? 23  ARG B HG3  4  
ATOM   6096  H  HD2  . ARG A 1 15  ? 9.425   -19.715 2.184   1.00 0.00 ? 23  ARG B HD2  4  
ATOM   6097  H  HD3  . ARG A 1 15  ? 9.132   -18.003 2.495   1.00 0.00 ? 23  ARG B HD3  4  
ATOM   6098  H  HE   . ARG A 1 15  ? 8.033   -19.454 4.605   1.00 0.00 ? 23  ARG B HE   4  
ATOM   6099  H  HH11 . ARG A 1 15  ? 11.169  -18.785 3.237   1.00 0.00 ? 23  ARG B HH11 4  
ATOM   6100  H  HH12 . ARG A 1 15  ? 12.002  -18.941 4.748   1.00 0.00 ? 23  ARG B HH12 4  
ATOM   6101  H  HH21 . ARG A 1 15  ? 9.123   -19.661 6.595   1.00 0.00 ? 23  ARG B HH21 4  
ATOM   6102  H  HH22 . ARG A 1 15  ? 10.839  -19.439 6.655   1.00 0.00 ? 23  ARG B HH22 4  
ATOM   6103  N  N    . GLY B 2 1   ? -19.666 -1.267  -10.364 1.00 0.00 ? 259 GLY A N    4  
ATOM   6104  C  CA   . GLY B 2 1   ? -18.239 -0.870  -10.218 1.00 0.00 ? 259 GLY A CA   4  
ATOM   6105  C  C    . GLY B 2 1   ? -17.498 -1.736  -9.218  1.00 0.00 ? 259 GLY A C    4  
ATOM   6106  O  O    . GLY B 2 1   ? -17.684 -2.953  -9.183  1.00 0.00 ? 259 GLY A O    4  
ATOM   6107  H  H1   . GLY B 2 1   ? -19.732 -2.247  -10.702 1.00 0.00 ? 259 GLY A H1   4  
ATOM   6108  H  H2   . GLY B 2 1   ? -20.143 -0.643  -11.046 1.00 0.00 ? 259 GLY A H2   4  
ATOM   6109  H  H3   . GLY B 2 1   ? -20.153 -1.194  -9.447  1.00 0.00 ? 259 GLY A H3   4  
ATOM   6110  H  HA2  . GLY B 2 1   ? -17.753 -0.953  -11.178 1.00 0.00 ? 259 GLY A HA2  4  
ATOM   6111  H  HA3  . GLY B 2 1   ? -18.193 0.158   -9.890  1.00 0.00 ? 259 GLY A HA3  4  
ATOM   6112  N  N    . SER B 2 2   ? -16.657 -1.107  -8.405  1.00 0.00 ? 260 SER A N    4  
ATOM   6113  C  CA   . SER B 2 2   ? -15.883 -1.826  -7.397  1.00 0.00 ? 260 SER A CA   4  
ATOM   6114  C  C    . SER B 2 2   ? -16.397 -1.556  -5.999  1.00 0.00 ? 260 SER A C    4  
ATOM   6115  O  O    . SER B 2 2   ? -17.430 -0.915  -5.807  1.00 0.00 ? 260 SER A O    4  
ATOM   6116  C  CB   . SER B 2 2   ? -14.418 -1.434  -7.459  1.00 0.00 ? 260 SER A CB   4  
ATOM   6117  O  OG   . SER B 2 2   ? -13.784 -1.974  -8.605  1.00 0.00 ? 260 SER A OG   4  
ATOM   6118  H  H    . SER B 2 2   ? -16.553 -0.136  -8.483  1.00 0.00 ? 260 SER A H    4  
ATOM   6119  H  HA   . SER B 2 2   ? -15.962 -2.880  -7.594  1.00 0.00 ? 260 SER A HA   4  
ATOM   6120  H  HB2  . SER B 2 2   ? -14.333 -0.358  -7.486  1.00 0.00 ? 260 SER A HB2  4  
ATOM   6121  H  HB3  . SER B 2 2   ? -13.928 -1.814  -6.572  1.00 0.00 ? 260 SER A HB3  4  
ATOM   6122  H  HG   . SER B 2 2   ? -14.448 -2.329  -9.201  1.00 0.00 ? 260 SER A HG   4  
ATOM   6123  N  N    . TYR B 2 3   ? -15.653 -2.059  -5.026  1.00 0.00 ? 261 TYR A N    4  
ATOM   6124  C  CA   . TYR B 2 3   ? -15.994 -1.887  -3.631  1.00 0.00 ? 261 TYR A CA   4  
ATOM   6125  C  C    . TYR B 2 3   ? -14.811 -2.234  -2.748  1.00 0.00 ? 261 TYR A C    4  
ATOM   6126  O  O    . TYR B 2 3   ? -13.887 -2.928  -3.174  1.00 0.00 ? 261 TYR A O    4  
ATOM   6127  C  CB   . TYR B 2 3   ? -17.179 -2.780  -3.261  1.00 0.00 ? 261 TYR A CB   4  
ATOM   6128  C  CG   . TYR B 2 3   ? -17.036 -4.219  -3.704  1.00 0.00 ? 261 TYR A CG   4  
ATOM   6129  C  CD1  . TYR B 2 3   ? -15.945 -4.970  -3.316  1.00 0.00 ? 261 TYR A CD1  4  
ATOM   6130  C  CD2  . TYR B 2 3   ? -18.005 -4.828  -4.492  1.00 0.00 ? 261 TYR A CD2  4  
ATOM   6131  C  CE1  . TYR B 2 3   ? -15.806 -6.282  -3.693  1.00 0.00 ? 261 TYR A CE1  4  
ATOM   6132  C  CE2  . TYR B 2 3   ? -17.876 -6.150  -4.881  1.00 0.00 ? 261 TYR A CE2  4  
ATOM   6133  C  CZ   . TYR B 2 3   ? -16.773 -6.872  -4.478  1.00 0.00 ? 261 TYR A CZ   4  
ATOM   6134  O  OH   . TYR B 2 3   ? -16.638 -8.188  -4.860  1.00 0.00 ? 261 TYR A OH   4  
ATOM   6135  H  H    . TYR B 2 3   ? -14.849 -2.571  -5.257  1.00 0.00 ? 261 TYR A H    4  
ATOM   6136  H  HA   . TYR B 2 3   ? -16.260 -0.856  -3.471  1.00 0.00 ? 261 TYR A HA   4  
ATOM   6137  H  HB2  . TYR B 2 3   ? -17.289 -2.778  -2.192  1.00 0.00 ? 261 TYR A HB2  4  
ATOM   6138  H  HB3  . TYR B 2 3   ? -18.072 -2.393  -3.701  1.00 0.00 ? 261 TYR A HB3  4  
ATOM   6139  H  HD1  . TYR B 2 3   ? -15.185 -4.506  -2.710  1.00 0.00 ? 261 TYR A HD1  4  
ATOM   6140  H  HD2  . TYR B 2 3   ? -18.866 -4.256  -4.804  1.00 0.00 ? 261 TYR A HD2  4  
ATOM   6141  H  HE1  . TYR B 2 3   ? -14.945 -6.838  -3.366  1.00 0.00 ? 261 TYR A HE1  4  
ATOM   6142  H  HE2  . TYR B 2 3   ? -18.636 -6.608  -5.497  1.00 0.00 ? 261 TYR A HE2  4  
ATOM   6143  H  HH   . TYR B 2 3   ? -16.821 -8.270  -5.798  1.00 0.00 ? 261 TYR A HH   4  
ATOM   6144  N  N    . CYS B 2 4   ? -14.824 -1.721  -1.533  1.00 0.00 ? 262 CYS A N    4  
ATOM   6145  C  CA   . CYS B 2 4   ? -13.781 -2.024  -0.579  1.00 0.00 ? 262 CYS A CA   4  
ATOM   6146  C  C    . CYS B 2 4   ? -13.819 -3.499  -0.223  1.00 0.00 ? 262 CYS A C    4  
ATOM   6147  O  O    . CYS B 2 4   ? -14.877 -4.057  0.028   1.00 0.00 ? 262 CYS A O    4  
ATOM   6148  C  CB   . CYS B 2 4   ? -13.977 -1.173  0.662   1.00 0.00 ? 262 CYS A CB   4  
ATOM   6149  S  SG   . CYS B 2 4   ? -13.484 -1.926  2.246   1.00 0.00 ? 262 CYS A SG   4  
ATOM   6150  H  H    . CYS B 2 4   ? -15.528 -1.084  -1.282  1.00 0.00 ? 262 CYS A H    4  
ATOM   6151  H  HA   . CYS B 2 4   ? -12.832 -1.781  -1.036  1.00 0.00 ? 262 CYS A HA   4  
ATOM   6152  H  HB2  . CYS B 2 4   ? -13.411 -0.268  0.556   1.00 0.00 ? 262 CYS A HB2  4  
ATOM   6153  H  HB3  . CYS B 2 4   ? -15.024 -0.918  0.740   1.00 0.00 ? 262 CYS A HB3  4  
ATOM   6154  N  N    . ASP B 2 5   ? -12.664 -4.126  -0.213  1.00 0.00 ? 263 ASP A N    4  
ATOM   6155  C  CA   . ASP B 2 5   ? -12.566 -5.547  0.115   1.00 0.00 ? 263 ASP A CA   4  
ATOM   6156  C  C    . ASP B 2 5   ? -12.878 -5.786  1.599   1.00 0.00 ? 263 ASP A C    4  
ATOM   6157  O  O    . ASP B 2 5   ? -12.839 -6.914  2.089   1.00 0.00 ? 263 ASP A O    4  
ATOM   6158  C  CB   . ASP B 2 5   ? -11.155 -6.035  -0.237  1.00 0.00 ? 263 ASP A CB   4  
ATOM   6159  C  CG   . ASP B 2 5   ? -10.761 -7.322  0.461   1.00 0.00 ? 263 ASP A CG   4  
ATOM   6160  O  OD1  . ASP B 2 5   ? -11.484 -8.330  0.306   1.00 0.00 ? 263 ASP A OD1  4  
ATOM   6161  O  OD2  . ASP B 2 5   ? -9.725  -7.320  1.163   1.00 0.00 ? 263 ASP A OD2  4  
ATOM   6162  H  H    . ASP B 2 5   ? -11.852 -3.623  -0.434  1.00 0.00 ? 263 ASP A H    4  
ATOM   6163  H  HA   . ASP B 2 5   ? -13.293 -6.079  -0.491  1.00 0.00 ? 263 ASP A HA   4  
ATOM   6164  H  HB2  . ASP B 2 5   ? -11.096 -6.199  -1.302  1.00 0.00 ? 263 ASP A HB2  4  
ATOM   6165  H  HB3  . ASP B 2 5   ? -10.448 -5.268  0.041   1.00 0.00 ? 263 ASP A HB3  4  
ATOM   6166  N  N    . PHE B 2 6   ? -13.213 -4.704  2.294   1.00 0.00 ? 264 PHE A N    4  
ATOM   6167  C  CA   . PHE B 2 6   ? -13.522 -4.754  3.726   1.00 0.00 ? 264 PHE A CA   4  
ATOM   6168  C  C    . PHE B 2 6   ? -15.016 -4.490  4.017   1.00 0.00 ? 264 PHE A C    4  
ATOM   6169  O  O    . PHE B 2 6   ? -15.539 -4.980  5.020   1.00 0.00 ? 264 PHE A O    4  
ATOM   6170  C  CB   . PHE B 2 6   ? -12.629 -3.758  4.494   1.00 0.00 ? 264 PHE A CB   4  
ATOM   6171  C  CG   . PHE B 2 6   ? -11.162 -3.914  4.198   1.00 0.00 ? 264 PHE A CG   4  
ATOM   6172  C  CD1  . PHE B 2 6   ? -10.642 -3.525  2.972   1.00 0.00 ? 264 PHE A CD1  4  
ATOM   6173  C  CD2  . PHE B 2 6   ? -10.303 -4.445  5.146   1.00 0.00 ? 264 PHE A CD2  4  
ATOM   6174  C  CE1  . PHE B 2 6   ? -9.295  -3.661  2.697   1.00 0.00 ? 264 PHE A CE1  4  
ATOM   6175  C  CE2  . PHE B 2 6   ? -8.954  -4.584  4.876   1.00 0.00 ? 264 PHE A CE2  4  
ATOM   6176  C  CZ   . PHE B 2 6   ? -8.451  -4.193  3.650   1.00 0.00 ? 264 PHE A CZ   4  
ATOM   6177  H  H    . PHE B 2 6   ? -13.245 -3.852  1.832   1.00 0.00 ? 264 PHE A H    4  
ATOM   6178  H  HA   . PHE B 2 6   ? -13.286 -5.747  4.063   1.00 0.00 ? 264 PHE A HA   4  
ATOM   6179  H  HB2  . PHE B 2 6   ? -12.911 -2.755  4.232   1.00 0.00 ? 264 PHE A HB2  4  
ATOM   6180  H  HB3  . PHE B 2 6   ? -12.765 -3.886  5.552   1.00 0.00 ? 264 PHE A HB3  4  
ATOM   6181  H  HD1  . PHE B 2 6   ? -11.304 -3.114  2.227   1.00 0.00 ? 264 PHE A HD1  4  
ATOM   6182  H  HD2  . PHE B 2 6   ? -10.694 -4.752  6.105   1.00 0.00 ? 264 PHE A HD2  4  
ATOM   6183  H  HE1  . PHE B 2 6   ? -8.900  -3.349  1.736   1.00 0.00 ? 264 PHE A HE1  4  
ATOM   6184  H  HE2  . PHE B 2 6   ? -8.294  -5.000  5.623   1.00 0.00 ? 264 PHE A HE2  4  
ATOM   6185  H  HZ   . PHE B 2 6   ? -7.400  -4.300  3.438   1.00 0.00 ? 264 PHE A HZ   4  
ATOM   6186  N  N    . CYS B 2 7   ? -15.710 -3.722  3.155   1.00 0.00 ? 265 CYS A N    4  
ATOM   6187  C  CA   . CYS B 2 7   ? -17.148 -3.453  3.364   1.00 0.00 ? 265 CYS A CA   4  
ATOM   6188  C  C    . CYS B 2 7   ? -17.948 -3.770  2.114   1.00 0.00 ? 265 CYS A C    4  
ATOM   6189  O  O    . CYS B 2 7   ? -19.174 -3.872  2.150   1.00 0.00 ? 265 CYS A O    4  
ATOM   6190  C  CB   . CYS B 2 7   ? -17.443 -1.999  3.779   1.00 0.00 ? 265 CYS A CB   4  
ATOM   6191  S  SG   . CYS B 2 7   ? -16.246 -1.251  4.913   1.00 0.00 ? 265 CYS A SG   4  
ATOM   6192  H  H    . CYS B 2 7   ? -15.257 -3.351  2.366   1.00 0.00 ? 265 CYS A H    4  
ATOM   6193  H  HA   . CYS B 2 7   ? -17.484 -4.112  4.143   1.00 0.00 ? 265 CYS A HA   4  
ATOM   6194  H  HB2  . CYS B 2 7   ? -17.497 -1.387  2.917   1.00 0.00 ? 265 CYS A HB2  4  
ATOM   6195  H  HB3  . CYS B 2 7   ? -18.410 -1.963  4.264   1.00 0.00 ? 265 CYS A HB3  4  
ATOM   6196  N  N    . LEU B 2 8   ? -17.235 -3.926  1.014   1.00 0.00 ? 266 LEU A N    4  
ATOM   6197  C  CA   . LEU B 2 8   ? -17.835 -4.235  -0.258  1.00 0.00 ? 266 LEU A CA   4  
ATOM   6198  C  C    . LEU B 2 8   ? -18.907 -3.225  -0.637  1.00 0.00 ? 266 LEU A C    4  
ATOM   6199  O  O    . LEU B 2 8   ? -19.983 -3.583  -1.113  1.00 0.00 ? 266 LEU A O    4  
ATOM   6200  C  CB   . LEU B 2 8   ? -18.386 -5.634  -0.201  1.00 0.00 ? 266 LEU A CB   4  
ATOM   6201  C  CG   . LEU B 2 8   ? -17.419 -6.661  0.367   1.00 0.00 ? 266 LEU A CG   4  
ATOM   6202  C  CD1  . LEU B 2 8   ? -18.060 -8.032  0.398   1.00 0.00 ? 266 LEU A CD1  4  
ATOM   6203  C  CD2  . LEU B 2 8   ? -16.127 -6.688  -0.436  1.00 0.00 ? 266 LEU A CD2  4  
ATOM   6204  H  H    . LEU B 2 8   ? -16.275 -3.858  1.065   1.00 0.00 ? 266 LEU A H    4  
ATOM   6205  H  HA   . LEU B 2 8   ? -17.060 -4.209  -0.997  1.00 0.00 ? 266 LEU A HA   4  
ATOM   6206  H  HB2  . LEU B 2 8   ? -19.260 -5.612  0.413   1.00 0.00 ? 266 LEU A HB2  4  
ATOM   6207  H  HB3  . LEU B 2 8   ? -18.655 -5.933  -1.190  1.00 0.00 ? 266 LEU A HB3  4  
ATOM   6208  H  HG   . LEU B 2 8   ? -17.181 -6.383  1.379   1.00 0.00 ? 266 LEU A HG   4  
ATOM   6209  H  HD11 . LEU B 2 8   ? -18.966 -7.978  0.973   1.00 0.00 ? 266 LEU A HD11 4  
ATOM   6210  H  HD12 . LEU B 2 8   ? -17.381 -8.739  0.854   1.00 0.00 ? 266 LEU A HD12 4  
ATOM   6211  H  HD13 . LEU B 2 8   ? -18.289 -8.347  -0.609  1.00 0.00 ? 266 LEU A HD13 4  
ATOM   6212  H  HD21 . LEU B 2 8   ? -15.906 -5.689  -0.800  1.00 0.00 ? 266 LEU A HD21 4  
ATOM   6213  H  HD22 . LEU B 2 8   ? -16.238 -7.361  -1.274  1.00 0.00 ? 266 LEU A HD22 4  
ATOM   6214  H  HD23 . LEU B 2 8   ? -15.318 -7.027  0.194   1.00 0.00 ? 266 LEU A HD23 4  
ATOM   6215  N  N    . GLY B 2 9   ? -18.586 -1.955  -0.426  1.00 0.00 ? 267 GLY A N    4  
ATOM   6216  C  CA   . GLY B 2 9   ? -19.507 -0.884  -0.762  1.00 0.00 ? 267 GLY A CA   4  
ATOM   6217  C  C    . GLY B 2 9   ? -19.131 -0.177  -2.048  1.00 0.00 ? 267 GLY A C    4  
ATOM   6218  O  O    . GLY B 2 9   ? -19.749 -0.415  -3.087  1.00 0.00 ? 267 GLY A O    4  
ATOM   6219  H  H    . GLY B 2 9   ? -17.718 -1.747  -0.021  1.00 0.00 ? 267 GLY A H    4  
ATOM   6220  H  HA2  . GLY B 2 9   ? -20.499 -1.302  -0.870  1.00 0.00 ? 267 GLY A HA2  4  
ATOM   6221  H  HA3  . GLY B 2 9   ? -19.524 -0.167  0.042   1.00 0.00 ? 267 GLY A HA3  4  
ATOM   6222  N  N    . GLY B 2 10  ? -18.122 0.693   -1.994  1.00 0.00 ? 268 GLY A N    4  
ATOM   6223  C  CA   . GLY B 2 10  ? -17.715 1.397   -3.193  1.00 0.00 ? 268 GLY A CA   4  
ATOM   6224  C  C    . GLY B 2 10  ? -17.022 2.708   -2.899  1.00 0.00 ? 268 GLY A C    4  
ATOM   6225  O  O    . GLY B 2 10  ? -16.911 3.120   -1.745  1.00 0.00 ? 268 GLY A O    4  
ATOM   6226  H  H    . GLY B 2 10  ? -17.651 0.859   -1.140  1.00 0.00 ? 268 GLY A H    4  
ATOM   6227  H  HA2  . GLY B 2 10  ? -17.032 0.767   -3.751  1.00 0.00 ? 268 GLY A HA2  4  
ATOM   6228  H  HA3  . GLY B 2 10  ? -18.587 1.589   -3.799  1.00 0.00 ? 268 GLY A HA3  4  
ATOM   6229  N  N    . SER B 2 11  ? -16.554 3.361   -3.956  1.00 0.00 ? 269 SER A N    4  
ATOM   6230  C  CA   . SER B 2 11  ? -15.848 4.626   -3.831  1.00 0.00 ? 269 SER A CA   4  
ATOM   6231  C  C    . SER B 2 11  ? -16.826 5.776   -3.598  1.00 0.00 ? 269 SER A C    4  
ATOM   6232  O  O    . SER B 2 11  ? -16.585 6.927   -3.962  1.00 0.00 ? 269 SER A O    4  
ATOM   6233  C  CB   . SER B 2 11  ? -14.976 4.840   -5.057  1.00 0.00 ? 269 SER A CB   4  
ATOM   6234  O  OG   . SER B 2 11  ? -14.611 6.200   -5.217  1.00 0.00 ? 269 SER A OG   4  
ATOM   6235  H  H    . SER B 2 11  ? -16.689 2.980   -4.850  1.00 0.00 ? 269 SER A H    4  
ATOM   6236  H  HA   . SER B 2 11  ? -15.208 4.549   -2.974  1.00 0.00 ? 269 SER A HA   4  
ATOM   6237  H  HB2  . SER B 2 11  ? -14.077 4.244   -4.957  1.00 0.00 ? 269 SER A HB2  4  
ATOM   6238  H  HB3  . SER B 2 11  ? -15.512 4.514   -5.918  1.00 0.00 ? 269 SER A HB3  4  
ATOM   6239  H  HG   . SER B 2 11  ? -14.431 6.380   -6.142  1.00 0.00 ? 269 SER A HG   4  
ATOM   6240  N  N    . ASN B 2 12  ? -17.942 5.414   -2.988  1.00 0.00 ? 270 ASN A N    4  
ATOM   6241  C  CA   . ASN B 2 12  ? -19.005 6.334   -2.621  1.00 0.00 ? 270 ASN A CA   4  
ATOM   6242  C  C    . ASN B 2 12  ? -19.935 5.616   -1.663  1.00 0.00 ? 270 ASN A C    4  
ATOM   6243  O  O    . ASN B 2 12  ? -21.123 5.924   -1.568  1.00 0.00 ? 270 ASN A O    4  
ATOM   6244  C  CB   . ASN B 2 12  ? -19.769 6.819   -3.843  1.00 0.00 ? 270 ASN A CB   4  
ATOM   6245  C  CG   . ASN B 2 12  ? -19.997 5.726   -4.867  1.00 0.00 ? 270 ASN A CG   4  
ATOM   6246  O  OD1  . ASN B 2 12  ? -21.002 5.016   -4.823  1.00 0.00 ? 270 ASN A OD1  4  
ATOM   6247  N  ND2  . ASN B 2 12  ? -19.059 5.583   -5.797  1.00 0.00 ? 270 ASN A ND2  4  
ATOM   6248  H  H    . ASN B 2 12  ? -18.066 4.468   -2.789  1.00 0.00 ? 270 ASN A H    4  
ATOM   6249  H  HA   . ASN B 2 12  ? -18.572 7.182   -2.117  1.00 0.00 ? 270 ASN A HA   4  
ATOM   6250  H  HB2  . ASN B 2 12  ? -20.727 7.194   -3.522  1.00 0.00 ? 270 ASN A HB2  4  
ATOM   6251  H  HB3  . ASN B 2 12  ? -19.215 7.619   -4.304  1.00 0.00 ? 270 ASN A HB3  4  
ATOM   6252  H  HD21 . ASN B 2 12  ? -18.286 6.184   -5.770  1.00 0.00 ? 270 ASN A HD21 4  
ATOM   6253  H  HD22 . ASN B 2 12  ? -19.180 4.884   -6.473  1.00 0.00 ? 270 ASN A HD22 4  
ATOM   6254  N  N    . MET B 2 13  ? -19.365 4.646   -0.948  1.00 0.00 ? 271 MET A N    4  
ATOM   6255  C  CA   . MET B 2 13  ? -20.120 3.848   0.002   1.00 0.00 ? 271 MET A CA   4  
ATOM   6256  C  C    . MET B 2 13  ? -19.187 3.164   1.000   1.00 0.00 ? 271 MET A C    4  
ATOM   6257  O  O    . MET B 2 13  ? -18.316 2.393   0.605   1.00 0.00 ? 271 MET A O    4  
ATOM   6258  C  CB   . MET B 2 13  ? -20.917 2.779   -0.733  1.00 0.00 ? 271 MET A CB   4  
ATOM   6259  C  CG   . MET B 2 13  ? -22.199 2.372   -0.027  1.00 0.00 ? 271 MET A CG   4  
ATOM   6260  S  SD   . MET B 2 13  ? -22.332 2.982   1.661   1.00 0.00 ? 271 MET A SD   4  
ATOM   6261  C  CE   . MET B 2 13  ? -23.185 4.524   1.348   1.00 0.00 ? 271 MET A CE   4  
ATOM   6262  H  H    . MET B 2 13  ? -18.402 4.471   -1.059  1.00 0.00 ? 271 MET A H    4  
ATOM   6263  H  HA   . MET B 2 13  ? -20.804 4.503   0.521   1.00 0.00 ? 271 MET A HA   4  
ATOM   6264  H  HB2  . MET B 2 13  ? -21.175 3.149   -1.713  1.00 0.00 ? 271 MET A HB2  4  
ATOM   6265  H  HB3  . MET B 2 13  ? -20.300 1.899   -0.843  1.00 0.00 ? 271 MET A HB3  4  
ATOM   6266  H  HG2  . MET B 2 13  ? -23.016 2.781   -0.580  1.00 0.00 ? 271 MET A HG2  4  
ATOM   6267  H  HG3  . MET B 2 13  ? -22.269 1.294   -0.017  1.00 0.00 ? 271 MET A HG3  4  
ATOM   6268  H  HE1  . MET B 2 13  ? -22.512 5.214   0.861   1.00 0.00 ? 271 MET A HE1  4  
ATOM   6269  H  HE2  . MET B 2 13  ? -23.523 4.945   2.279   1.00 0.00 ? 271 MET A HE2  4  
ATOM   6270  H  HE3  . MET B 2 13  ? -24.035 4.341   0.707   1.00 0.00 ? 271 MET A HE3  4  
ATOM   6271  N  N    . ASN B 2 14  ? -19.379 3.436   2.284   1.00 0.00 ? 272 ASN A N    4  
ATOM   6272  C  CA   . ASN B 2 14  ? -18.553 2.836   3.328   1.00 0.00 ? 272 ASN A CA   4  
ATOM   6273  C  C    . ASN B 2 14  ? -19.327 1.742   4.038   1.00 0.00 ? 272 ASN A C    4  
ATOM   6274  O  O    . ASN B 2 14  ? -19.070 1.452   5.198   1.00 0.00 ? 272 ASN A O    4  
ATOM   6275  C  CB   . ASN B 2 14  ? -18.080 3.892   4.334   1.00 0.00 ? 272 ASN A CB   4  
ATOM   6276  C  CG   . ASN B 2 14  ? -17.049 3.359   5.316   1.00 0.00 ? 272 ASN A CG   4  
ATOM   6277  O  OD1  . ASN B 2 14  ? -16.884 3.899   6.409   1.00 0.00 ? 272 ASN A OD1  4  
ATOM   6278  N  ND2  . ASN B 2 14  ? -16.352 2.296   4.933   1.00 0.00 ? 272 ASN A ND2  4  
ATOM   6279  H  H    . ASN B 2 14  ? -20.094 4.054   2.537   1.00 0.00 ? 272 ASN A H    4  
ATOM   6280  H  HA   . ASN B 2 14  ? -17.695 2.397   2.853   1.00 0.00 ? 272 ASN A HA   4  
ATOM   6281  H  HB2  . ASN B 2 14  ? -17.638 4.717   3.797   1.00 0.00 ? 272 ASN A HB2  4  
ATOM   6282  H  HB3  . ASN B 2 14  ? -18.931 4.249   4.894   1.00 0.00 ? 272 ASN A HB3  4  
ATOM   6283  H  HD21 . ASN B 2 14  ? -16.535 1.915   4.051   1.00 0.00 ? 272 ASN A HD21 4  
ATOM   6284  H  HD22 . ASN B 2 14  ? -15.682 1.936   5.552   1.00 0.00 ? 272 ASN A HD22 4  
ATOM   6285  N  N    . LYS B 2 15  ? -20.238 1.125   3.282   1.00 0.00 ? 273 LYS A N    4  
ATOM   6286  C  CA   . LYS B 2 15  ? -21.116 0.059   3.746   1.00 0.00 ? 273 LYS A CA   4  
ATOM   6287  C  C    . LYS B 2 15  ? -21.208 -0.044  5.266   1.00 0.00 ? 273 LYS A C    4  
ATOM   6288  O  O    . LYS B 2 15  ? -22.235 0.285   5.860   1.00 0.00 ? 273 LYS A O    4  
ATOM   6289  C  CB   . LYS B 2 15  ? -20.633 -1.238  3.126   1.00 0.00 ? 273 LYS A CB   4  
ATOM   6290  C  CG   . LYS B 2 15  ? -21.212 -1.476  1.757   1.00 0.00 ? 273 LYS A CG   4  
ATOM   6291  C  CD   . LYS B 2 15  ? -22.485 -2.289  1.806   1.00 0.00 ? 273 LYS A CD   4  
ATOM   6292  C  CE   . LYS B 2 15  ? -23.247 -2.163  0.500   1.00 0.00 ? 273 LYS A CE   4  
ATOM   6293  N  NZ   . LYS B 2 15  ? -24.060 -3.374  0.206   1.00 0.00 ? 273 LYS A NZ   4  
ATOM   6294  H  H    . LYS B 2 15  ? -20.281 1.355   2.343   1.00 0.00 ? 273 LYS A H    4  
ATOM   6295  H  HA   . LYS B 2 15  ? -22.103 0.269   3.362   1.00 0.00 ? 273 LYS A HA   4  
ATOM   6296  H  HB2  . LYS B 2 15  ? -19.562 -1.193  3.027   1.00 0.00 ? 273 LYS A HB2  4  
ATOM   6297  H  HB3  . LYS B 2 15  ? -20.891 -2.054  3.754   1.00 0.00 ? 273 LYS A HB3  4  
ATOM   6298  H  HG2  . LYS B 2 15  ? -21.431 -0.523  1.316   1.00 0.00 ? 273 LYS A HG2  4  
ATOM   6299  H  HG3  . LYS B 2 15  ? -20.487 -1.992  1.152   1.00 0.00 ? 273 LYS A HG3  4  
ATOM   6300  H  HD2  . LYS B 2 15  ? -22.234 -3.328  1.970   1.00 0.00 ? 273 LYS A HD2  4  
ATOM   6301  H  HD3  . LYS B 2 15  ? -23.097 -1.929  2.614   1.00 0.00 ? 273 LYS A HD3  4  
ATOM   6302  H  HE2  . LYS B 2 15  ? -23.904 -1.307  0.565   1.00 0.00 ? 273 LYS A HE2  4  
ATOM   6303  H  HE3  . LYS B 2 15  ? -22.534 -2.008  -0.300  1.00 0.00 ? 273 LYS A HE3  4  
ATOM   6304  H  HZ1  . LYS B 2 15  ? -23.444 -4.209  0.128   1.00 0.00 ? 273 LYS A HZ1  4  
ATOM   6305  H  HZ2  . LYS B 2 15  ? -24.573 -3.252  -0.689  1.00 0.00 ? 273 LYS A HZ2  4  
ATOM   6306  H  HZ3  . LYS B 2 15  ? -24.751 -3.536  0.969   1.00 0.00 ? 273 LYS A HZ3  4  
ATOM   6307  N  N    . LYS B 2 16  ? -20.135 -0.511  5.878   1.00 0.00 ? 274 LYS A N    4  
ATOM   6308  C  CA   . LYS B 2 16  ? -20.066 -0.669  7.324   1.00 0.00 ? 274 LYS A CA   4  
ATOM   6309  C  C    . LYS B 2 16  ? -20.467 0.617   8.071   1.00 0.00 ? 274 LYS A C    4  
ATOM   6310  O  O    . LYS B 2 16  ? -20.730 0.585   9.274   1.00 0.00 ? 274 LYS A O    4  
ATOM   6311  C  CB   . LYS B 2 16  ? -18.653 -1.109  7.686   1.00 0.00 ? 274 LYS A CB   4  
ATOM   6312  C  CG   . LYS B 2 16  ? -18.260 -2.407  7.009   1.00 0.00 ? 274 LYS A CG   4  
ATOM   6313  C  CD   . LYS B 2 16  ? -18.420 -3.599  7.940   1.00 0.00 ? 274 LYS A CD   4  
ATOM   6314  C  CE   . LYS B 2 16  ? -17.982 -4.889  7.270   1.00 0.00 ? 274 LYS A CE   4  
ATOM   6315  N  NZ   . LYS B 2 16  ? -17.983 -6.036  8.220   1.00 0.00 ? 274 LYS A NZ   4  
ATOM   6316  H  H    . LYS B 2 16  ? -19.356 -0.759  5.341   1.00 0.00 ? 274 LYS A H    4  
ATOM   6317  H  HA   . LYS B 2 16  ? -20.753 -1.454  7.600   1.00 0.00 ? 274 LYS A HA   4  
ATOM   6318  H  HB2  . LYS B 2 16  ? -17.957 -0.342  7.376   1.00 0.00 ? 274 LYS A HB2  4  
ATOM   6319  H  HB3  . LYS B 2 16  ? -18.585 -1.247  8.751   1.00 0.00 ? 274 LYS A HB3  4  
ATOM   6320  H  HG2  . LYS B 2 16  ? -18.893 -2.549  6.147   1.00 0.00 ? 274 LYS A HG2  4  
ATOM   6321  H  HG3  . LYS B 2 16  ? -17.234 -2.341  6.687   1.00 0.00 ? 274 LYS A HG3  4  
ATOM   6322  H  HD2  . LYS B 2 16  ? -17.817 -3.440  8.821   1.00 0.00 ? 274 LYS A HD2  4  
ATOM   6323  H  HD3  . LYS B 2 16  ? -19.458 -3.685  8.221   1.00 0.00 ? 274 LYS A HD3  4  
ATOM   6324  H  HE2  . LYS B 2 16  ? -18.664 -5.104  6.462   1.00 0.00 ? 274 LYS A HE2  4  
ATOM   6325  H  HE3  . LYS B 2 16  ? -16.986 -4.757  6.876   1.00 0.00 ? 274 LYS A HE3  4  
ATOM   6326  H  HZ1  . LYS B 2 16  ? -17.671 -6.902  7.735   1.00 0.00 ? 274 LYS A HZ1  4  
ATOM   6327  H  HZ2  . LYS B 2 16  ? -18.940 -6.189  8.596   1.00 0.00 ? 274 LYS A HZ2  4  
ATOM   6328  H  HZ3  . LYS B 2 16  ? -17.337 -5.844  9.012   1.00 0.00 ? 274 LYS A HZ3  4  
ATOM   6329  N  N    . SER B 2 17  ? -20.510 1.741   7.352   1.00 0.00 ? 275 SER A N    4  
ATOM   6330  C  CA   . SER B 2 17  ? -20.904 3.027   7.923   1.00 0.00 ? 275 SER A CA   4  
ATOM   6331  C  C    . SER B 2 17  ? -22.047 3.601   7.135   1.00 0.00 ? 275 SER A C    4  
ATOM   6332  O  O    . SER B 2 17  ? -22.840 4.400   7.631   1.00 0.00 ? 275 SER A O    4  
ATOM   6333  C  CB   . SER B 2 17  ? -19.766 4.038   7.871   1.00 0.00 ? 275 SER A CB   4  
ATOM   6334  O  OG   . SER B 2 17  ? -18.549 3.475   8.329   1.00 0.00 ? 275 SER A OG   4  
ATOM   6335  H  H    . SER B 2 17  ? -20.273 1.709   6.411   1.00 0.00 ? 275 SER A H    4  
ATOM   6336  H  HA   . SER B 2 17  ? -21.211 2.878   8.933   1.00 0.00 ? 275 SER A HA   4  
ATOM   6337  H  HB2  . SER B 2 17  ? -19.644 4.383   6.851   1.00 0.00 ? 275 SER A HB2  4  
ATOM   6338  H  HB3  . SER B 2 17  ? -20.022 4.879   8.491   1.00 0.00 ? 275 SER A HB3  4  
ATOM   6339  H  HG   . SER B 2 17  ? -18.496 2.558   8.052   1.00 0.00 ? 275 SER A HG   4  
ATOM   6340  N  N    . GLY B 2 18  ? -22.114 3.173   5.896   1.00 0.00 ? 276 GLY A N    4  
ATOM   6341  C  CA   . GLY B 2 18  ? -23.118 3.670   5.004   1.00 0.00 ? 276 GLY A CA   4  
ATOM   6342  C  C    . GLY B 2 18  ? -22.749 5.047   4.527   1.00 0.00 ? 276 GLY A C    4  
ATOM   6343  O  O    . GLY B 2 18  ? -23.604 5.819   4.092   1.00 0.00 ? 276 GLY A O    4  
ATOM   6344  H  H    . GLY B 2 18  ? -21.472 2.502   5.591   1.00 0.00 ? 276 GLY A H    4  
ATOM   6345  H  HA2  . GLY B 2 18  ? -23.199 3.010   4.156   1.00 0.00 ? 276 GLY A HA2  4  
ATOM   6346  H  HA3  . GLY B 2 18  ? -24.058 3.718   5.519   1.00 0.00 ? 276 GLY A HA3  4  
ATOM   6347  N  N    . ARG B 2 19  ? -21.462 5.368   4.640   1.00 0.00 ? 277 ARG A N    4  
ATOM   6348  C  CA   . ARG B 2 19  ? -20.980 6.674   4.203   1.00 0.00 ? 277 ARG A CA   4  
ATOM   6349  C  C    . ARG B 2 19  ? -20.114 6.617   2.959   1.00 0.00 ? 277 ARG A C    4  
ATOM   6350  O  O    . ARG B 2 19  ? -19.352 5.696   2.736   1.00 0.00 ? 277 ARG A O    4  
ATOM   6351  C  CB   . ARG B 2 19  ? -20.175 7.416   5.264   1.00 0.00 ? 277 ARG A CB   4  
ATOM   6352  C  CG   . ARG B 2 19  ? -20.758 7.416   6.654   1.00 0.00 ? 277 ARG A CG   4  
ATOM   6353  C  CD   . ARG B 2 19  ? -22.245 7.638   6.609   1.00 0.00 ? 277 ARG A CD   4  
ATOM   6354  N  NE   . ARG B 2 19  ? -22.931 7.092   7.777   1.00 0.00 ? 277 ARG A NE   4  
ATOM   6355  C  CZ   . ARG B 2 19  ? -24.255 7.027   7.892   1.00 0.00 ? 277 ARG A CZ   4  
ATOM   6356  N  NH1  . ARG B 2 19  ? -25.032 7.471   6.912   1.00 0.00 ? 277 ARG A NH1  4  
ATOM   6357  N  NH2  . ARG B 2 19  ? -24.802 6.519   8.988   1.00 0.00 ? 277 ARG A NH2  4  
ATOM   6358  H  H    . ARG B 2 19  ? -20.844 4.720   5.037   1.00 0.00 ? 277 ARG A H    4  
ATOM   6359  H  HA   . ARG B 2 19  ? -21.855 7.262   3.979   1.00 0.00 ? 277 ARG A HA   4  
ATOM   6360  H  HB2  . ARG B 2 19  ? -19.194 6.994   5.305   1.00 0.00 ? 277 ARG A HB2  4  
ATOM   6361  H  HB3  . ARG B 2 19  ? -20.095 8.443   4.945   1.00 0.00 ? 277 ARG A HB3  4  
ATOM   6362  H  HG2  . ARG B 2 19  ? -20.548 6.475   7.138   1.00 0.00 ? 277 ARG A HG2  4  
ATOM   6363  H  HG3  . ARG B 2 19  ? -20.306 8.223   7.199   1.00 0.00 ? 277 ARG A HG3  4  
ATOM   6364  H  HD2  . ARG B 2 19  ? -22.438 8.700   6.548   1.00 0.00 ? 277 ARG A HD2  4  
ATOM   6365  H  HD3  . ARG B 2 19  ? -22.607 7.156   5.724   1.00 0.00 ? 277 ARG A HD3  4  
ATOM   6366  H  HE   . ARG B 2 19  ? -22.377 6.759   8.513   1.00 0.00 ? 277 ARG A HE   4  
ATOM   6367  H  HH11 . ARG B 2 19  ? -24.624 7.856   6.085   1.00 0.00 ? 277 ARG A HH11 4  
ATOM   6368  H  HH12 . ARG B 2 19  ? -26.027 7.419   7.002   1.00 0.00 ? 277 ARG A HH12 4  
ATOM   6369  H  HH21 . ARG B 2 19  ? -24.219 6.184   9.728   1.00 0.00 ? 277 ARG A HH21 4  
ATOM   6370  H  HH22 . ARG B 2 19  ? -25.797 6.469   9.072   1.00 0.00 ? 277 ARG A HH22 4  
ATOM   6371  N  N    . PRO B 2 20  ? -20.207 7.667   2.166   1.00 0.00 ? 278 PRO A N    4  
ATOM   6372  C  CA   . PRO B 2 20  ? -19.443 7.819   0.931   1.00 0.00 ? 278 PRO A CA   4  
ATOM   6373  C  C    . PRO B 2 20  ? -17.944 7.978   1.174   1.00 0.00 ? 278 PRO A C    4  
ATOM   6374  O  O    . PRO B 2 20  ? -17.524 8.752   2.036   1.00 0.00 ? 278 PRO A O    4  
ATOM   6375  C  CB   . PRO B 2 20  ? -19.996 9.095   0.304   1.00 0.00 ? 278 PRO A CB   4  
ATOM   6376  C  CG   . PRO B 2 20  ? -21.233 9.426   1.065   1.00 0.00 ? 278 PRO A CG   4  
ATOM   6377  C  CD   . PRO B 2 20  ? -21.105 8.782   2.420   1.00 0.00 ? 278 PRO A CD   4  
ATOM   6378  H  HA   . PRO B 2 20  ? -19.615 6.992   0.263   1.00 0.00 ? 278 PRO A HA   4  
ATOM   6379  H  HB2  . PRO B 2 20  ? -19.262 9.883   0.376   1.00 0.00 ? 278 PRO A HB2  4  
ATOM   6380  H  HB3  . PRO B 2 20  ? -20.221 8.897   -0.734  1.00 0.00 ? 278 PRO A HB3  4  
ATOM   6381  H  HG2  . PRO B 2 20  ? -21.332 10.496  1.164   1.00 0.00 ? 278 PRO A HG2  4  
ATOM   6382  H  HG3  . PRO B 2 20  ? -22.077 9.014   0.538   1.00 0.00 ? 278 PRO A HG3  4  
ATOM   6383  H  HD2  . PRO B 2 20  ? -20.692 9.443   3.170   1.00 0.00 ? 278 PRO A HD2  4  
ATOM   6384  H  HD3  . PRO B 2 20  ? -22.057 8.413   2.757   1.00 0.00 ? 278 PRO A HD3  4  
ATOM   6385  N  N    . GLU B 2 21  ? -17.143 7.245   0.406   1.00 0.00 ? 279 GLU A N    4  
ATOM   6386  C  CA   . GLU B 2 21  ? -15.690 7.314   0.521   1.00 0.00 ? 279 GLU A CA   4  
ATOM   6387  C  C    . GLU B 2 21  ? -15.045 7.215   -0.862  1.00 0.00 ? 279 GLU A C    4  
ATOM   6388  O  O    . GLU B 2 21  ? -15.533 7.804   -1.826  1.00 0.00 ? 279 GLU A O    4  
ATOM   6389  C  CB   . GLU B 2 21  ? -15.184 6.187   1.426   1.00 0.00 ? 279 GLU A CB   4  
ATOM   6390  C  CG   . GLU B 2 21  ? -13.920 6.536   2.197   1.00 0.00 ? 279 GLU A CG   4  
ATOM   6391  C  CD   . GLU B 2 21  ? -12.653 6.084   1.511   1.00 0.00 ? 279 GLU A CD   4  
ATOM   6392  O  OE1  . GLU B 2 21  ? -12.466 4.860   1.378   1.00 0.00 ? 279 GLU A OE1  4  
ATOM   6393  O  OE2  . GLU B 2 21  ? -11.851 6.951   1.103   1.00 0.00 ? 279 GLU A OE2  4  
ATOM   6394  H  H    . GLU B 2 21  ? -17.539 6.628   -0.244  1.00 0.00 ? 279 GLU A H    4  
ATOM   6395  H  HA   . GLU B 2 21  ? -15.433 8.266   0.962   1.00 0.00 ? 279 GLU A HA   4  
ATOM   6396  H  HB2  . GLU B 2 21  ? -15.957 5.939   2.138   1.00 0.00 ? 279 GLU A HB2  4  
ATOM   6397  H  HB3  . GLU B 2 21  ? -14.980 5.318   0.817   1.00 0.00 ? 279 GLU A HB3  4  
ATOM   6398  H  HG2  . GLU B 2 21  ? -13.875 7.603   2.327   1.00 0.00 ? 279 GLU A HG2  4  
ATOM   6399  H  HG3  . GLU B 2 21  ? -13.967 6.059   3.155   1.00 0.00 ? 279 GLU A HG3  4  
ATOM   6400  N  N    . GLU B 2 22  ? -13.944 6.477   -0.946  1.00 0.00 ? 280 GLU A N    4  
ATOM   6401  C  CA   . GLU B 2 22  ? -13.235 6.280   -2.211  1.00 0.00 ? 280 GLU A CA   4  
ATOM   6402  C  C    . GLU B 2 22  ? -12.199 5.166   -2.087  1.00 0.00 ? 280 GLU A C    4  
ATOM   6403  O  O    . GLU B 2 22  ? -11.113 5.353   -1.541  1.00 0.00 ? 280 GLU A O    4  
ATOM   6404  C  CB   . GLU B 2 22  ? -12.579 7.571   -2.694  1.00 0.00 ? 280 GLU A CB   4  
ATOM   6405  C  CG   . GLU B 2 22  ? -12.129 7.498   -4.145  1.00 0.00 ? 280 GLU A CG   4  
ATOM   6406  C  CD   . GLU B 2 22  ? -12.531 8.721   -4.946  1.00 0.00 ? 280 GLU A CD   4  
ATOM   6407  O  OE1  . GLU B 2 22  ? -11.755 9.700   -4.967  1.00 0.00 ? 280 GLU A OE1  4  
ATOM   6408  O  OE2  . GLU B 2 22  ? -13.622 8.698   -5.554  1.00 0.00 ? 280 GLU A OE2  4  
ATOM   6409  H  H    . GLU B 2 22  ? -13.606 6.046   -0.135  1.00 0.00 ? 280 GLU A H    4  
ATOM   6410  H  HA   . GLU B 2 22  ? -13.968 5.976   -2.941  1.00 0.00 ? 280 GLU A HA   4  
ATOM   6411  H  HB2  . GLU B 2 22  ? -13.287 8.379   -2.597  1.00 0.00 ? 280 GLU A HB2  4  
ATOM   6412  H  HB3  . GLU B 2 22  ? -11.715 7.779   -2.079  1.00 0.00 ? 280 GLU A HB3  4  
ATOM   6413  H  HG2  . GLU B 2 22  ? -11.058 7.401   -4.175  1.00 0.00 ? 280 GLU A HG2  4  
ATOM   6414  H  HG3  . GLU B 2 22  ? -12.577 6.627   -4.600  1.00 0.00 ? 280 GLU A HG3  4  
ATOM   6415  N  N    . LEU B 2 23  ? -12.569 4.015   -2.624  1.00 0.00 ? 281 LEU A N    4  
ATOM   6416  C  CA   . LEU B 2 23  ? -11.749 2.797   -2.593  1.00 0.00 ? 281 LEU A CA   4  
ATOM   6417  C  C    . LEU B 2 23  ? -10.415 2.903   -3.322  1.00 0.00 ? 281 LEU A C    4  
ATOM   6418  O  O    . LEU B 2 23  ? -10.046 3.947   -3.861  1.00 0.00 ? 281 LEU A O    4  
ATOM   6419  C  CB   . LEU B 2 23  ? -12.525 1.672   -3.235  1.00 0.00 ? 281 LEU A CB   4  
ATOM   6420  C  CG   . LEU B 2 23  ? -14.022 1.789   -3.150  1.00 0.00 ? 281 LEU A CG   4  
ATOM   6421  C  CD1  . LEU B 2 23  ? -14.618 1.242   -4.419  1.00 0.00 ? 281 LEU A CD1  4  
ATOM   6422  C  CD2  . LEU B 2 23  ? -14.541 1.050   -1.926  1.00 0.00 ? 281 LEU A CD2  4  
ATOM   6423  H  H    . LEU B 2 23  ? -13.448 3.973   -3.058  1.00 0.00 ? 281 LEU A H    4  
ATOM   6424  H  HA   . LEU B 2 23  ? -11.569 2.532   -1.573  1.00 0.00 ? 281 LEU A HA   4  
ATOM   6425  H  HB2  . LEU B 2 23  ? -12.250 1.625   -4.278  1.00 0.00 ? 281 LEU A HB2  4  
ATOM   6426  H  HB3  . LEU B 2 23  ? -12.243 0.745   -2.769  1.00 0.00 ? 281 LEU A HB3  4  
ATOM   6427  H  HG   . LEU B 2 23  ? -14.296 2.823   -3.064  1.00 0.00 ? 281 LEU A HG   4  
ATOM   6428  H  HD11 . LEU B 2 23  ? -14.418 0.199   -4.458  1.00 0.00 ? 281 LEU A HD11 4  
ATOM   6429  H  HD12 . LEU B 2 23  ? -14.164 1.729   -5.271  1.00 0.00 ? 281 LEU A HD12 4  
ATOM   6430  H  HD13 . LEU B 2 23  ? -15.678 1.410   -4.432  1.00 0.00 ? 281 LEU A HD13 4  
ATOM   6431  H  HD21 . LEU B 2 23  ? -13.784 0.357   -1.566  1.00 0.00 ? 281 LEU A HD21 4  
ATOM   6432  H  HD22 . LEU B 2 23  ? -15.432 0.502   -2.189  1.00 0.00 ? 281 LEU A HD22 4  
ATOM   6433  H  HD23 . LEU B 2 23  ? -14.773 1.761   -1.149  1.00 0.00 ? 281 LEU A HD23 4  
ATOM   6434  N  N    . VAL B 2 24  ? -9.708  1.767   -3.313  1.00 0.00 ? 282 VAL A N    4  
ATOM   6435  C  CA   . VAL B 2 24  ? -8.431  1.614   -3.988  1.00 0.00 ? 282 VAL A CA   4  
ATOM   6436  C  C    . VAL B 2 24  ? -8.544  0.461   -4.951  1.00 0.00 ? 282 VAL A C    4  
ATOM   6437  O  O    . VAL B 2 24  ? -8.559  -0.685  -4.524  1.00 0.00 ? 282 VAL A O    4  
ATOM   6438  C  CB   . VAL B 2 24  ? -7.276  1.280   -3.041  1.00 0.00 ? 282 VAL A CB   4  
ATOM   6439  C  CG1  . VAL B 2 24  ? -6.154  2.226   -3.281  1.00 0.00 ? 282 VAL A CG1  4  
ATOM   6440  C  CG2  . VAL B 2 24  ? -7.674  1.350   -1.590  1.00 0.00 ? 282 VAL A CG2  4  
ATOM   6441  H  H    . VAL B 2 24  ? -10.075 0.993   -2.828  1.00 0.00 ? 282 VAL A H    4  
ATOM   6442  H  HA   . VAL B 2 24  ? -8.191  2.517   -4.515  1.00 0.00 ? 282 VAL A HA   4  
ATOM   6443  H  HB   . VAL B 2 24  ? -6.940  0.288   -3.259  1.00 0.00 ? 282 VAL A HB   4  
ATOM   6444  H  HG11 . VAL B 2 24  ? -6.398  3.145   -2.781  1.00 0.00 ? 282 VAL A HG11 4  
ATOM   6445  H  HG12 . VAL B 2 24  ? -6.043  2.402   -4.341  1.00 0.00 ? 282 VAL A HG12 4  
ATOM   6446  H  HG13 . VAL B 2 24  ? -5.239  1.823   -2.875  1.00 0.00 ? 282 VAL A HG13 4  
ATOM   6447  H  HG21 . VAL B 2 24  ? -7.748  2.386   -1.292  1.00 0.00 ? 282 VAL A HG21 4  
ATOM   6448  H  HG22 . VAL B 2 24  ? -6.927  0.855   -0.989  1.00 0.00 ? 282 VAL A HG22 4  
ATOM   6449  H  HG23 . VAL B 2 24  ? -8.620  0.863   -1.456  1.00 0.00 ? 282 VAL A HG23 4  
ATOM   6450  N  N    . SER B 2 25  ? -8.566  0.749   -6.239  1.00 0.00 ? 283 SER A N    4  
ATOM   6451  C  CA   . SER B 2 25  ? -8.706  -0.304  -7.236  1.00 0.00 ? 283 SER A CA   4  
ATOM   6452  C  C    . SER B 2 25  ? -7.356  -0.736  -7.776  1.00 0.00 ? 283 SER A C    4  
ATOM   6453  O  O    . SER B 2 25  ? -6.575  0.094   -8.241  1.00 0.00 ? 283 SER A O    4  
ATOM   6454  C  CB   . SER B 2 25  ? -9.598  0.163   -8.383  1.00 0.00 ? 283 SER A CB   4  
ATOM   6455  O  OG   . SER B 2 25  ? -9.232  1.459   -8.822  1.00 0.00 ? 283 SER A OG   4  
ATOM   6456  H  H    . SER B 2 25  ? -8.476  1.682   -6.525  1.00 0.00 ? 283 SER A H    4  
ATOM   6457  H  HA   . SER B 2 25  ? -9.177  -1.146  -6.752  1.00 0.00 ? 283 SER A HA   4  
ATOM   6458  H  HB2  . SER B 2 25  ? -9.503  -0.524  -9.211  1.00 0.00 ? 283 SER A HB2  4  
ATOM   6459  H  HB3  . SER B 2 25  ? -10.622 0.182   -8.050  1.00 0.00 ? 283 SER A HB3  4  
ATOM   6460  H  HG   . SER B 2 25  ? -9.775  1.708   -9.575  1.00 0.00 ? 283 SER A HG   4  
ATOM   6461  N  N    . CYS B 2 26  ? -7.076  -2.038  -7.715  1.00 0.00 ? 284 CYS A N    4  
ATOM   6462  C  CA   . CYS B 2 26  ? -5.808  -2.536  -8.223  1.00 0.00 ? 284 CYS A CA   4  
ATOM   6463  C  C    . CYS B 2 26  ? -5.723  -2.213  -9.706  1.00 0.00 ? 284 CYS A C    4  
ATOM   6464  O  O    . CYS B 2 26  ? -6.712  -2.329  -10.430 1.00 0.00 ? 284 CYS A O    4  
ATOM   6465  C  CB   . CYS B 2 26  ? -5.652  -4.049  -7.969  1.00 0.00 ? 284 CYS A CB   4  
ATOM   6466  S  SG   . CYS B 2 26  ? -4.224  -4.813  -8.824  1.00 0.00 ? 284 CYS A SG   4  
ATOM   6467  H  H    . CYS B 2 26  ? -7.730  -2.659  -7.337  1.00 0.00 ? 284 CYS A H    4  
ATOM   6468  H  HA   . CYS B 2 26  ? -5.024  -2.012  -7.709  1.00 0.00 ? 284 CYS A HA   4  
ATOM   6469  H  HB2  . CYS B 2 26  ? -5.520  -4.209  -6.912  1.00 0.00 ? 284 CYS A HB2  4  
ATOM   6470  H  HB3  . CYS B 2 26  ? -6.542  -4.560  -8.290  1.00 0.00 ? 284 CYS A HB3  4  
ATOM   6471  N  N    . ALA B 2 27  ? -4.545  -1.810  -10.159 1.00 0.00 ? 285 ALA A N    4  
ATOM   6472  C  CA   . ALA B 2 27  ? -4.361  -1.457  -11.557 1.00 0.00 ? 285 ALA A CA   4  
ATOM   6473  C  C    . ALA B 2 27  ? -4.125  -2.701  -12.396 1.00 0.00 ? 285 ALA A C    4  
ATOM   6474  O  O    . ALA B 2 27  ? -3.717  -2.625  -13.554 1.00 0.00 ? 285 ALA A O    4  
ATOM   6475  C  CB   . ALA B 2 27  ? -3.228  -0.455  -11.704 1.00 0.00 ? 285 ALA A CB   4  
ATOM   6476  H  H    . ALA B 2 27  ? -3.787  -1.747  -9.543  1.00 0.00 ? 285 ALA A H    4  
ATOM   6477  H  HA   . ALA B 2 27  ? -5.272  -0.983  -11.897 1.00 0.00 ? 285 ALA A HA   4  
ATOM   6478  H  HB1  . ALA B 2 27  ? -2.356  -0.942  -12.106 1.00 0.00 ? 285 ALA A HB1  4  
ATOM   6479  H  HB2  . ALA B 2 27  ? -2.991  -0.036  -10.738 1.00 0.00 ? 285 ALA A HB2  4  
ATOM   6480  H  HB3  . ALA B 2 27  ? -3.536  0.338   -12.371 1.00 0.00 ? 285 ALA A HB3  4  
ATOM   6481  N  N    . ASP B 2 28  ? -4.391  -3.848  -11.784 1.00 0.00 ? 286 ASP A N    4  
ATOM   6482  C  CA   . ASP B 2 28  ? -4.241  -5.133  -12.445 1.00 0.00 ? 286 ASP A CA   4  
ATOM   6483  C  C    . ASP B 2 28  ? -5.516  -5.959  -12.281 1.00 0.00 ? 286 ASP A C    4  
ATOM   6484  O  O    . ASP B 2 28  ? -6.189  -6.293  -13.256 1.00 0.00 ? 286 ASP A O    4  
ATOM   6485  C  CB   . ASP B 2 28  ? -3.059  -5.896  -11.851 1.00 0.00 ? 286 ASP A CB   4  
ATOM   6486  C  CG   . ASP B 2 28  ? -2.735  -7.157  -12.627 1.00 0.00 ? 286 ASP A CG   4  
ATOM   6487  O  OD1  . ASP B 2 28  ? -3.447  -8.167  -12.444 1.00 0.00 ? 286 ASP A OD1  4  
ATOM   6488  O  OD2  . ASP B 2 28  ? -1.769  -7.135  -13.418 1.00 0.00 ? 286 ASP A OD2  4  
ATOM   6489  H  H    . ASP B 2 28  ? -4.688  -3.827  -10.851 1.00 0.00 ? 286 ASP A H    4  
ATOM   6490  H  HA   . ASP B 2 28  ? -4.060  -4.950  -13.493 1.00 0.00 ? 286 ASP A HA   4  
ATOM   6491  H  HB2  . ASP B 2 28  ? -2.188  -5.258  -11.851 1.00 0.00 ? 286 ASP A HB2  4  
ATOM   6492  H  HB3  . ASP B 2 28  ? -3.302  -6.171  -10.833 1.00 0.00 ? 286 ASP A HB3  4  
ATOM   6493  N  N    . CYS B 2 29  ? -5.830  -6.279  -11.027 1.00 0.00 ? 287 CYS A N    4  
ATOM   6494  C  CA   . CYS B 2 29  ? -7.016  -7.059  -10.690 1.00 0.00 ? 287 CYS A CA   4  
ATOM   6495  C  C    . CYS B 2 29  ? -8.289  -6.292  -10.995 1.00 0.00 ? 287 CYS A C    4  
ATOM   6496  O  O    . CYS B 2 29  ? -9.135  -6.733  -11.772 1.00 0.00 ? 287 CYS A O    4  
ATOM   6497  C  CB   . CYS B 2 29  ? -7.027  -7.395  -9.196  1.00 0.00 ? 287 CYS A CB   4  
ATOM   6498  S  SG   . CYS B 2 29  ? -5.616  -8.380  -8.623  1.00 0.00 ? 287 CYS A SG   4  
ATOM   6499  H  H    . CYS B 2 29  ? -5.242  -5.984  -10.306 1.00 0.00 ? 287 CYS A H    4  
ATOM   6500  H  HA   . CYS B 2 29  ? -7.001  -7.973  -11.260 1.00 0.00 ? 287 CYS A HA   4  
ATOM   6501  H  HB2  . CYS B 2 29  ? -7.029  -6.476  -8.632  1.00 0.00 ? 287 CYS A HB2  4  
ATOM   6502  H  HB3  . CYS B 2 29  ? -7.927  -7.949  -8.970  1.00 0.00 ? 287 CYS A HB3  4  
ATOM   6503  N  N    . GLY B 2 30  ? -8.404  -5.133  -10.365 1.00 0.00 ? 288 GLY A N    4  
ATOM   6504  C  CA   . GLY B 2 30  ? -9.583  -4.309  -10.517 1.00 0.00 ? 288 GLY A CA   4  
ATOM   6505  C  C    . GLY B 2 30  ? -10.426 -4.310  -9.254  1.00 0.00 ? 288 GLY A C    4  
ATOM   6506  O  O    . GLY B 2 30  ? -11.533 -3.772  -9.237  1.00 0.00 ? 288 GLY A O    4  
ATOM   6507  H  H    . GLY B 2 30  ? -7.663  -4.822  -9.803  1.00 0.00 ? 288 GLY A H    4  
ATOM   6508  H  HA2  . GLY B 2 30  ? -9.281  -3.296  -10.740 1.00 0.00 ? 288 GLY A HA2  4  
ATOM   6509  H  HA3  . GLY B 2 30  ? -10.176 -4.689  -11.335 1.00 0.00 ? 288 GLY A HA3  4  
ATOM   6510  N  N    . ARG B 2 31  ? -9.893  -4.917  -8.188  1.00 0.00 ? 289 ARG A N    4  
ATOM   6511  C  CA   . ARG B 2 31  ? -10.602 -4.985  -6.910  1.00 0.00 ? 289 ARG A CA   4  
ATOM   6512  C  C    . ARG B 2 31  ? -10.303 -3.730  -6.110  1.00 0.00 ? 289 ARG A C    4  
ATOM   6513  O  O    . ARG B 2 31  ? -9.264  -3.111  -6.318  1.00 0.00 ? 289 ARG A O    4  
ATOM   6514  C  CB   . ARG B 2 31  ? -10.201 -6.233  -6.120  1.00 0.00 ? 289 ARG A CB   4  
ATOM   6515  C  CG   . ARG B 2 31  ? -8.838  -6.125  -5.466  1.00 0.00 ? 289 ARG A CG   4  
ATOM   6516  C  CD   . ARG B 2 31  ? -8.682  -7.133  -4.339  1.00 0.00 ? 289 ARG A CD   4  
ATOM   6517  N  NE   . ARG B 2 31  ? -8.765  -8.510  -4.818  1.00 0.00 ? 289 ARG A NE   4  
ATOM   6518  C  CZ   . ARG B 2 31  ? -8.706  -9.575  -4.023  1.00 0.00 ? 289 ARG A CZ   4  
ATOM   6519  N  NH1  . ARG B 2 31  ? -8.552  -9.422  -2.715  1.00 0.00 ? 289 ARG A NH1  4  
ATOM   6520  N  NH2  . ARG B 2 31  ? -8.799  -10.794 -4.537  1.00 0.00 ? 289 ARG A NH2  4  
ATOM   6521  H  H    . ARG B 2 31  ? -8.988  -5.294  -8.256  1.00 0.00 ? 289 ARG A H    4  
ATOM   6522  H  HA   . ARG B 2 31  ? -11.657 -5.021  -7.116  1.00 0.00 ? 289 ARG A HA   4  
ATOM   6523  H  HB2  . ARG B 2 31  ? -10.934 -6.407  -5.346  1.00 0.00 ? 289 ARG A HB2  4  
ATOM   6524  H  HB3  . ARG B 2 31  ? -10.189 -7.080  -6.789  1.00 0.00 ? 289 ARG A HB3  4  
ATOM   6525  H  HG2  . ARG B 2 31  ? -8.078  -6.308  -6.210  1.00 0.00 ? 289 ARG A HG2  4  
ATOM   6526  H  HG3  . ARG B 2 31  ? -8.726  -5.130  -5.069  1.00 0.00 ? 289 ARG A HG3  4  
ATOM   6527  H  HD2  . ARG B 2 31  ? -7.721  -6.982  -3.867  1.00 0.00 ? 289 ARG A HD2  4  
ATOM   6528  H  HD3  . ARG B 2 31  ? -9.466  -6.966  -3.614  1.00 0.00 ? 289 ARG A HD3  4  
ATOM   6529  H  HE   . ARG B 2 31  ? -8.874  -8.648  -5.783  1.00 0.00 ? 289 ARG A HE   4  
ATOM   6530  H  HH11 . ARG B 2 31  ? -8.481  -8.505  -2.324  1.00 0.00 ? 289 ARG A HH11 4  
ATOM   6531  H  HH12 . ARG B 2 31  ? -8.509  -10.224 -2.120  1.00 0.00 ? 289 ARG A HH12 4  
ATOM   6532  H  HH21 . ARG B 2 31  ? -8.913  -10.914 -5.523  1.00 0.00 ? 289 ARG A HH21 4  
ATOM   6533  H  HH22 . ARG B 2 31  ? -8.755  -11.593 -3.938  1.00 0.00 ? 289 ARG A HH22 4  
ATOM   6534  N  N    . SER B 2 32  ? -11.178 -3.357  -5.182  1.00 0.00 ? 290 SER A N    4  
ATOM   6535  C  CA   . SER B 2 32  ? -10.941 -2.135  -4.431  1.00 0.00 ? 290 SER A CA   4  
ATOM   6536  C  C    . SER B 2 32  ? -11.010 -2.298  -2.911  1.00 0.00 ? 290 SER A C    4  
ATOM   6537  O  O    . SER B 2 32  ? -11.463 -3.315  -2.392  1.00 0.00 ? 290 SER A O    4  
ATOM   6538  C  CB   . SER B 2 32  ? -11.902 -1.049  -4.890  1.00 0.00 ? 290 SER A CB   4  
ATOM   6539  O  OG   . SER B 2 32  ? -11.828 -0.870  -6.294  1.00 0.00 ? 290 SER A OG   4  
ATOM   6540  H  H    . SER B 2 32  ? -11.976 -3.899  -5.006  1.00 0.00 ? 290 SER A H    4  
ATOM   6541  H  HA   . SER B 2 32  ? -9.949  -1.821  -4.678  1.00 0.00 ? 290 SER A HA   4  
ATOM   6542  H  HB2  . SER B 2 32  ? -12.909 -1.319  -4.622  1.00 0.00 ? 290 SER A HB2  4  
ATOM   6543  H  HB3  . SER B 2 32  ? -11.638 -0.123  -4.412  1.00 0.00 ? 290 SER A HB3  4  
ATOM   6544  H  HG   . SER B 2 32  ? -12.353 -0.107  -6.548  1.00 0.00 ? 290 SER A HG   4  
ATOM   6545  N  N    . GLY B 2 33  ? -10.524 -1.258  -2.220  1.00 0.00 ? 291 GLY A N    4  
ATOM   6546  C  CA   . GLY B 2 33  ? -10.506 -1.231  -0.758  1.00 0.00 ? 291 GLY A CA   4  
ATOM   6547  C  C    . GLY B 2 33  ? -10.678 0.179   -0.209  1.00 0.00 ? 291 GLY A C    4  
ATOM   6548  O  O    . GLY B 2 33  ? -10.337 1.132   -0.871  1.00 0.00 ? 291 GLY A O    4  
ATOM   6549  H  H    . GLY B 2 33  ? -10.152 -0.497  -2.717  1.00 0.00 ? 291 GLY A H    4  
ATOM   6550  H  HA2  . GLY B 2 33  ? -11.288 -1.865  -0.373  1.00 0.00 ? 291 GLY A HA2  4  
ATOM   6551  H  HA3  . GLY B 2 33  ? -9.548  -1.607  -0.427  1.00 0.00 ? 291 GLY A HA3  4  
ATOM   6552  N  N    . HIS B 2 34  ? -11.220 0.348   0.987   1.00 0.00 ? 292 HIS A N    4  
ATOM   6553  C  CA   . HIS B 2 34  ? -11.338 1.707   1.521   1.00 0.00 ? 292 HIS A CA   4  
ATOM   6554  C  C    . HIS B 2 34  ? -10.011 2.061   2.157   1.00 0.00 ? 292 HIS A C    4  
ATOM   6555  O  O    . HIS B 2 34  ? -9.602  1.385   3.091   1.00 0.00 ? 292 HIS A O    4  
ATOM   6556  C  CB   . HIS B 2 34  ? -12.418 1.819   2.591   1.00 0.00 ? 292 HIS A CB   4  
ATOM   6557  C  CG   . HIS B 2 34  ? -13.831 1.927   2.085   1.00 0.00 ? 292 HIS A CG   4  
ATOM   6558  N  ND1  . HIS B 2 34  ? -14.790 1.077   2.533   1.00 0.00 ? 292 HIS A ND1  4  
ATOM   6559  C  CD2  . HIS B 2 34  ? -14.430 2.710   1.153   1.00 0.00 ? 292 HIS A CD2  4  
ATOM   6560  C  CE1  . HIS B 2 34  ? -15.924 1.305   1.911   1.00 0.00 ? 292 HIS A CE1  4  
ATOM   6561  N  NE2  . HIS B 2 34  ? -15.736 2.301   1.066   1.00 0.00 ? 292 HIS A NE2  4  
ATOM   6562  H  H    . HIS B 2 34  ? -11.502 -0.422  1.519   1.00 0.00 ? 292 HIS A H    4  
ATOM   6563  H  HA   . HIS B 2 34  ? -11.548 2.373   0.701   1.00 0.00 ? 292 HIS A HA   4  
ATOM   6564  H  HB2  . HIS B 2 34  ? -12.362 0.932   3.199   1.00 0.00 ? 292 HIS A HB2  4  
ATOM   6565  H  HB3  . HIS B 2 34  ? -12.212 2.668   3.217   1.00 0.00 ? 292 HIS A HB3  4  
ATOM   6566  H  HD2  . HIS B 2 34  ? -13.969 3.480   0.562   1.00 0.00 ? 292 HIS A HD2  4  
ATOM   6567  H  HE1  . HIS B 2 34  ? -16.824 0.726   2.009   1.00 0.00 ? 292 HIS A HE1  4  
ATOM   6568  H  HE2  . HIS B 2 34  ? -16.370 2.578   0.374   1.00 0.00 ? 292 HIS A HE2  4  
ATOM   6569  N  N    . PRO B 2 35  ? -9.329  3.126   1.724   1.00 0.00 ? 293 PRO A N    4  
ATOM   6570  C  CA   . PRO B 2 35  ? -8.025  3.464   2.284   1.00 0.00 ? 293 PRO A CA   4  
ATOM   6571  C  C    . PRO B 2 35  ? -8.044  3.440   3.810   1.00 0.00 ? 293 PRO A C    4  
ATOM   6572  O  O    . PRO B 2 35  ? -7.129  2.910   4.445   1.00 0.00 ? 293 PRO A O    4  
ATOM   6573  C  CB   . PRO B 2 35  ? -7.767  4.868   1.745   1.00 0.00 ? 293 PRO A CB   4  
ATOM   6574  C  CG   . PRO B 2 35  ? -8.524  4.912   0.463   1.00 0.00 ? 293 PRO A CG   4  
ATOM   6575  C  CD   . PRO B 2 35  ? -9.755  4.083   0.689   1.00 0.00 ? 293 PRO A CD   4  
ATOM   6576  H  HA   . PRO B 2 35  ? -7.263  2.782   1.923   1.00 0.00 ? 293 PRO A HA   4  
ATOM   6577  H  HB2  . PRO B 2 35  ? -8.130  5.603   2.448   1.00 0.00 ? 293 PRO A HB2  4  
ATOM   6578  H  HB3  . PRO B 2 35  ? -6.711  5.006   1.579   1.00 0.00 ? 293 PRO A HB3  4  
ATOM   6579  H  HG2  . PRO B 2 35  ? -8.796  5.931   0.230   1.00 0.00 ? 293 PRO A HG2  4  
ATOM   6580  H  HG3  . PRO B 2 35  ? -7.927  4.490   -0.332  1.00 0.00 ? 293 PRO A HG3  4  
ATOM   6581  H  HD2  . PRO B 2 35  ? -10.557 4.703   1.046   1.00 0.00 ? 293 PRO A HD2  4  
ATOM   6582  H  HD3  . PRO B 2 35  ? -10.042 3.573   -0.216  1.00 0.00 ? 293 PRO A HD3  4  
ATOM   6583  N  N    . THR B 2 36  ? -9.104  3.988   4.397   1.00 0.00 ? 294 THR A N    4  
ATOM   6584  C  CA   . THR B 2 36  ? -9.245  3.991   5.845   1.00 0.00 ? 294 THR A CA   4  
ATOM   6585  C  C    . THR B 2 36  ? -9.322  2.557   6.363   1.00 0.00 ? 294 THR A C    4  
ATOM   6586  O  O    . THR B 2 36  ? -8.859  2.251   7.462   1.00 0.00 ? 294 THR A O    4  
ATOM   6587  C  CB   . THR B 2 36  ? -10.498 4.761   6.291   1.00 0.00 ? 294 THR A CB   4  
ATOM   6588  O  OG1  . THR B 2 36  ? -11.668 4.209   5.674   1.00 0.00 ? 294 THR A OG1  4  
ATOM   6589  C  CG2  . THR B 2 36  ? -10.373 6.228   5.935   1.00 0.00 ? 294 THR A CG2  4  
ATOM   6590  H  H    . THR B 2 36  ? -9.802  4.397   3.844   1.00 0.00 ? 294 THR A H    4  
ATOM   6591  H  HA   . THR B 2 36  ? -8.376  4.476   6.268   1.00 0.00 ? 294 THR A HA   4  
ATOM   6592  H  HB   . THR B 2 36  ? -10.590 4.680   7.362   1.00 0.00 ? 294 THR A HB   4  
ATOM   6593  H  HG1  . THR B 2 36  ? -11.407 3.552   5.025   1.00 0.00 ? 294 THR A HG1  4  
ATOM   6594  H  HG21 . THR B 2 36  ? -9.505  6.634   6.428   1.00 0.00 ? 294 THR A HG21 4  
ATOM   6595  H  HG22 . THR B 2 36  ? -11.257 6.757   6.261   1.00 0.00 ? 294 THR A HG22 4  
ATOM   6596  H  HG23 . THR B 2 36  ? -10.262 6.333   4.865   1.00 0.00 ? 294 THR A HG23 4  
ATOM   6597  N  N    . CYS B 2 37  ? -9.917  1.684   5.550   1.00 0.00 ? 295 CYS A N    4  
ATOM   6598  C  CA   . CYS B 2 37  ? -10.056 0.273   5.894   1.00 0.00 ? 295 CYS A CA   4  
ATOM   6599  C  C    . CYS B 2 37  ? -8.727  -0.460  5.745   1.00 0.00 ? 295 CYS A C    4  
ATOM   6600  O  O    . CYS B 2 37  ? -8.435  -1.383  6.506   1.00 0.00 ? 295 CYS A O    4  
ATOM   6601  C  CB   . CYS B 2 37  ? -11.144 -0.385  5.030   1.00 0.00 ? 295 CYS A CB   4  
ATOM   6602  S  SG   . CYS B 2 37  ? -12.800 0.264   5.375   1.00 0.00 ? 295 CYS A SG   4  
ATOM   6603  H  H    . CYS B 2 37  ? -10.282 2.003   4.700   1.00 0.00 ? 295 CYS A H    4  
ATOM   6604  H  HA   . CYS B 2 37  ? -10.360 0.221   6.929   1.00 0.00 ? 295 CYS A HA   4  
ATOM   6605  H  HB2  . CYS B 2 37  ? -10.934 -0.225  3.990   1.00 0.00 ? 295 CYS A HB2  4  
ATOM   6606  H  HB3  . CYS B 2 37  ? -11.162 -1.434  5.219   1.00 0.00 ? 295 CYS A HB3  4  
ATOM   6607  N  N    . LEU B 2 38  ? -7.921  -0.051  4.766   1.00 0.00 ? 296 LEU A N    4  
ATOM   6608  C  CA   . LEU B 2 38  ? -6.615  -0.680  4.559   1.00 0.00 ? 296 LEU A CA   4  
ATOM   6609  C  C    . LEU B 2 38  ? -5.566  -0.072  5.484   1.00 0.00 ? 296 LEU A C    4  
ATOM   6610  O  O    . LEU B 2 38  ? -4.389  -0.428  5.416   1.00 0.00 ? 296 LEU A O    4  
ATOM   6611  C  CB   . LEU B 2 38  ? -6.147  -0.542  3.112   1.00 0.00 ? 296 LEU A CB   4  
ATOM   6612  C  CG   . LEU B 2 38  ? -7.100  -1.089  2.056   1.00 0.00 ? 296 LEU A CG   4  
ATOM   6613  C  CD1  . LEU B 2 38  ? -7.949  0.022   1.497   1.00 0.00 ? 296 LEU A CD1  4  
ATOM   6614  C  CD2  . LEU B 2 38  ? -6.336  -1.798  0.955   1.00 0.00 ? 296 LEU A CD2  4  
ATOM   6615  H  H    . LEU B 2 38  ? -8.214  0.677   4.168   1.00 0.00 ? 296 LEU A H    4  
ATOM   6616  H  HA   . LEU B 2 38  ? -6.716  -1.728  4.792   1.00 0.00 ? 296 LEU A HA   4  
ATOM   6617  H  HB2  . LEU B 2 38  ? -5.987  0.506   2.912   1.00 0.00 ? 296 LEU A HB2  4  
ATOM   6618  H  HB3  . LEU B 2 38  ? -5.204  -1.057  3.012   1.00 0.00 ? 296 LEU A HB3  4  
ATOM   6619  H  HG   . LEU B 2 38  ? -7.762  -1.798  2.510   1.00 0.00 ? 296 LEU A HG   4  
ATOM   6620  H  HD11 . LEU B 2 38  ? -7.931  -0.005  0.429   1.00 0.00 ? 296 LEU A HD11 4  
ATOM   6621  H  HD12 . LEU B 2 38  ? -7.570  0.972   1.838   1.00 0.00 ? 296 LEU A HD12 4  
ATOM   6622  H  HD13 . LEU B 2 38  ? -8.965  -0.104  1.837   1.00 0.00 ? 296 LEU A HD13 4  
ATOM   6623  H  HD21 . LEU B 2 38  ? -6.796  -1.578  0.007   1.00 0.00 ? 296 LEU A HD21 4  
ATOM   6624  H  HD22 . LEU B 2 38  ? -6.359  -2.863  1.129   1.00 0.00 ? 296 LEU A HD22 4  
ATOM   6625  H  HD23 . LEU B 2 38  ? -5.313  -1.457  0.948   1.00 0.00 ? 296 LEU A HD23 4  
ATOM   6626  N  N    . GLN B 2 39  ? -6.001  0.862   6.332   1.00 0.00 ? 297 GLN A N    4  
ATOM   6627  C  CA   . GLN B 2 39  ? -5.112  1.532   7.282   1.00 0.00 ? 297 GLN A CA   4  
ATOM   6628  C  C    . GLN B 2 39  ? -4.159  2.477   6.560   1.00 0.00 ? 297 GLN A C    4  
ATOM   6629  O  O    . GLN B 2 39  ? -3.127  2.874   7.103   1.00 0.00 ? 297 GLN A O    4  
ATOM   6630  C  CB   . GLN B 2 39  ? -4.327  0.519   8.114   1.00 0.00 ? 297 GLN A CB   4  
ATOM   6631  C  CG   . GLN B 2 39  ? -5.123  -0.046  9.265   1.00 0.00 ? 297 GLN A CG   4  
ATOM   6632  C  CD   . GLN B 2 39  ? -4.344  -1.056  10.088  1.00 0.00 ? 297 GLN A CD   4  
ATOM   6633  O  OE1  . GLN B 2 39  ? -4.589  -1.217  11.284  1.00 0.00 ? 297 GLN A OE1  4  
ATOM   6634  N  NE2  . GLN B 2 39  ? -3.396  -1.741  9.455   1.00 0.00 ? 297 GLN A NE2  4  
ATOM   6635  H  H    . GLN B 2 39  ? -6.947  1.123   6.303   1.00 0.00 ? 297 GLN A H    4  
ATOM   6636  H  HA   . GLN B 2 39  ? -5.734  2.109   7.948   1.00 0.00 ? 297 GLN A HA   4  
ATOM   6637  H  HB2  . GLN B 2 39  ? -4.037  -0.301  7.482   1.00 0.00 ? 297 GLN A HB2  4  
ATOM   6638  H  HB3  . GLN B 2 39  ? -3.443  0.995   8.511   1.00 0.00 ? 297 GLN A HB3  4  
ATOM   6639  H  HG2  . GLN B 2 39  ? -5.426  0.766   9.911   1.00 0.00 ? 297 GLN A HG2  4  
ATOM   6640  H  HG3  . GLN B 2 39  ? -5.995  -0.525  8.859   1.00 0.00 ? 297 GLN A HG3  4  
ATOM   6641  H  HE21 . GLN B 2 39  ? -3.249  -1.560  8.503   1.00 0.00 ? 297 GLN A HE21 4  
ATOM   6642  H  HE22 . GLN B 2 39  ? -2.881  -2.398  9.967   1.00 0.00 ? 297 GLN A HE22 4  
ATOM   6643  N  N    . PHE B 2 40  ? -4.517  2.828   5.331   1.00 0.00 ? 298 PHE A N    4  
ATOM   6644  C  CA   . PHE B 2 40  ? -3.714  3.730   4.517   1.00 0.00 ? 298 PHE A CA   4  
ATOM   6645  C  C    . PHE B 2 40  ? -3.618  5.115   5.149   1.00 0.00 ? 298 PHE A C    4  
ATOM   6646  O  O    . PHE B 2 40  ? -4.062  5.337   6.276   1.00 0.00 ? 298 PHE A O    4  
ATOM   6647  C  CB   . PHE B 2 40  ? -4.335  3.883   3.125   1.00 0.00 ? 298 PHE A CB   4  
ATOM   6648  C  CG   . PHE B 2 40  ? -4.186  2.696   2.204   1.00 0.00 ? 298 PHE A CG   4  
ATOM   6649  C  CD1  . PHE B 2 40  ? -3.485  1.557   2.579   1.00 0.00 ? 298 PHE A CD1  4  
ATOM   6650  C  CD2  . PHE B 2 40  ? -4.752  2.739   0.941   1.00 0.00 ? 298 PHE A CD2  4  
ATOM   6651  C  CE1  . PHE B 2 40  ? -3.356  0.491   1.705   1.00 0.00 ? 298 PHE A CE1  4  
ATOM   6652  C  CE2  . PHE B 2 40  ? -4.624  1.682   0.067   1.00 0.00 ? 298 PHE A CE2  4  
ATOM   6653  C  CZ   . PHE B 2 40  ? -3.927  0.558   0.446   1.00 0.00 ? 298 PHE A CZ   4  
ATOM   6654  H  H    . PHE B 2 40  ? -5.347  2.464   4.958   1.00 0.00 ? 298 PHE A H    4  
ATOM   6655  H  HA   . PHE B 2 40  ? -2.725  3.313   4.419   1.00 0.00 ? 298 PHE A HA   4  
ATOM   6656  H  HB2  . PHE B 2 40  ? -5.385  4.079   3.235   1.00 0.00 ? 298 PHE A HB2  4  
ATOM   6657  H  HB3  . PHE B 2 40  ? -3.877  4.732   2.639   1.00 0.00 ? 298 PHE A HB3  4  
ATOM   6658  H  HD1  . PHE B 2 40  ? -3.039  1.504   3.561   1.00 0.00 ? 298 PHE A HD1  4  
ATOM   6659  H  HD2  . PHE B 2 40  ? -5.289  3.622   0.635   1.00 0.00 ? 298 PHE A HD2  4  
ATOM   6660  H  HE1  . PHE B 2 40  ? -2.808  -0.390  2.004   1.00 0.00 ? 298 PHE A HE1  4  
ATOM   6661  H  HE2  . PHE B 2 40  ? -5.077  1.731   -0.911  1.00 0.00 ? 298 PHE A HE2  4  
ATOM   6662  H  HZ   . PHE B 2 40  ? -3.826  -0.266  -0.241  1.00 0.00 ? 298 PHE A HZ   4  
ATOM   6663  N  N    . THR B 2 41  ? -3.029  6.040   4.398   1.00 0.00 ? 299 THR A N    4  
ATOM   6664  C  CA   . THR B 2 41  ? -2.883  7.422   4.832   1.00 0.00 ? 299 THR A CA   4  
ATOM   6665  C  C    . THR B 2 41  ? -3.378  8.354   3.732   1.00 0.00 ? 299 THR A C    4  
ATOM   6666  O  O    . THR B 2 41  ? -3.724  7.894   2.647   1.00 0.00 ? 299 THR A O    4  
ATOM   6667  C  CB   . THR B 2 41  ? -1.426  7.762   5.183   1.00 0.00 ? 299 THR A CB   4  
ATOM   6668  O  OG1  . THR B 2 41  ? -1.315  9.143   5.545   1.00 0.00 ? 299 THR A OG1  4  
ATOM   6669  C  CG2  . THR B 2 41  ? -0.501  7.461   4.017   1.00 0.00 ? 299 THR A CG2  4  
ATOM   6670  H  H    . THR B 2 41  ? -2.682  5.783   3.519   1.00 0.00 ? 299 THR A H    4  
ATOM   6671  H  HA   . THR B 2 41  ? -3.486  7.561   5.716   1.00 0.00 ? 299 THR A HA   4  
ATOM   6672  H  HB   . THR B 2 41  ? -1.134  7.155   6.024   1.00 0.00 ? 299 THR A HB   4  
ATOM   6673  H  HG1  . THR B 2 41  ? -1.977  9.356   6.207   1.00 0.00 ? 299 THR A HG1  4  
ATOM   6674  H  HG21 . THR B 2 41  ? -0.718  6.476   3.630   1.00 0.00 ? 299 THR A HG21 4  
ATOM   6675  H  HG22 . THR B 2 41  ? 0.525   7.499   4.351   1.00 0.00 ? 299 THR A HG22 4  
ATOM   6676  H  HG23 . THR B 2 41  ? -0.653  8.195   3.239   1.00 0.00 ? 299 THR A HG23 4  
ATOM   6677  N  N    . LEU B 2 42  ? -3.409  9.651   3.996   1.00 0.00 ? 300 LEU A N    4  
ATOM   6678  C  CA   . LEU B 2 42  ? -3.885  10.604  2.999   1.00 0.00 ? 300 LEU A CA   4  
ATOM   6679  C  C    . LEU B 2 42  ? -2.996  10.610  1.758   1.00 0.00 ? 300 LEU A C    4  
ATOM   6680  O  O    . LEU B 2 42  ? -3.500  10.614  0.637   1.00 0.00 ? 300 LEU A O    4  
ATOM   6681  C  CB   . LEU B 2 42  ? -3.988  12.008  3.601   1.00 0.00 ? 300 LEU A CB   4  
ATOM   6682  C  CG   . LEU B 2 42  ? -4.996  12.940  2.916   1.00 0.00 ? 300 LEU A CG   4  
ATOM   6683  C  CD1  . LEU B 2 42  ? -4.448  13.437  1.595   1.00 0.00 ? 300 LEU A CD1  4  
ATOM   6684  C  CD2  . LEU B 2 42  ? -6.323  12.237  2.699   1.00 0.00 ? 300 LEU A CD2  4  
ATOM   6685  H  H    . LEU B 2 42  ? -3.110  9.975   4.871   1.00 0.00 ? 300 LEU A H    4  
ATOM   6686  H  HA   . LEU B 2 42  ? -4.871  10.289  2.692   1.00 0.00 ? 300 LEU A HA   4  
ATOM   6687  H  HB2  . LEU B 2 42  ? -4.270  11.910  4.640   1.00 0.00 ? 300 LEU A HB2  4  
ATOM   6688  H  HB3  . LEU B 2 42  ? -3.014  12.470  3.550   1.00 0.00 ? 300 LEU A HB3  4  
ATOM   6689  H  HG   . LEU B 2 42  ? -5.174  13.789  3.547   1.00 0.00 ? 300 LEU A HG   4  
ATOM   6690  H  HD11 . LEU B 2 42  ? -4.273  12.592  0.950   1.00 0.00 ? 300 LEU A HD11 4  
ATOM   6691  H  HD12 . LEU B 2 42  ? -3.520  13.963  1.762   1.00 0.00 ? 300 LEU A HD12 4  
ATOM   6692  H  HD13 . LEU B 2 42  ? -5.163  14.102  1.133   1.00 0.00 ? 300 LEU A HD13 4  
ATOM   6693  H  HD21 . LEU B 2 42  ? -6.524  11.603  3.542   1.00 0.00 ? 300 LEU A HD21 4  
ATOM   6694  H  HD22 . LEU B 2 42  ? -6.273  11.641  1.801   1.00 0.00 ? 300 LEU A HD22 4  
ATOM   6695  H  HD23 . LEU B 2 42  ? -7.110  12.971  2.604   1.00 0.00 ? 300 LEU A HD23 4  
ATOM   6696  N  N    . ASN B 2 43  ? -1.681  10.601  1.949   1.00 0.00 ? 301 ASN A N    4  
ATOM   6697  C  CA   . ASN B 2 43  ? -0.757  10.606  0.817   1.00 0.00 ? 301 ASN A CA   4  
ATOM   6698  C  C    . ASN B 2 43  ? -0.906  9.332   -0.007  1.00 0.00 ? 301 ASN A C    4  
ATOM   6699  O  O    . ASN B 2 43  ? -1.032  9.398   -1.221  1.00 0.00 ? 301 ASN A O    4  
ATOM   6700  C  CB   . ASN B 2 43  ? 0.685   10.744  1.288   1.00 0.00 ? 301 ASN A CB   4  
ATOM   6701  C  CG   . ASN B 2 43  ? 1.504   11.664  0.405   1.00 0.00 ? 301 ASN A CG   4  
ATOM   6702  O  OD1  . ASN B 2 43  ? 1.144   11.925  -0.743  1.00 0.00 ? 301 ASN A OD1  4  
ATOM   6703  N  ND2  . ASN B 2 43  ? 2.624   12.148  0.932   1.00 0.00 ? 301 ASN A ND2  4  
ATOM   6704  H  H    . ASN B 2 43  ? -1.325  10.589  2.863   1.00 0.00 ? 301 ASN A H    4  
ATOM   6705  H  HA   . ASN B 2 43  ? -1.010  11.452  0.186   1.00 0.00 ? 301 ASN A HA   4  
ATOM   6706  H  HB2  . ASN B 2 43  ? 0.699   11.134  2.291   1.00 0.00 ? 301 ASN A HB2  4  
ATOM   6707  H  HB3  . ASN B 2 43  ? 1.144   9.773   1.280   1.00 0.00 ? 301 ASN A HB3  4  
ATOM   6708  H  HD21 . ASN B 2 43  ? 2.859   11.888  1.847   1.00 0.00 ? 301 ASN A HD21 4  
ATOM   6709  H  HD22 . ASN B 2 43  ? 3.166   12.748  0.384   1.00 0.00 ? 301 ASN A HD22 4  
ATOM   6710  N  N    . MET B 2 44  ? -0.861  8.172   0.652   1.00 0.00 ? 302 MET A N    4  
ATOM   6711  C  CA   . MET B 2 44  ? -1.031  6.893   -0.043  1.00 0.00 ? 302 MET A CA   4  
ATOM   6712  C  C    . MET B 2 44  ? -2.326  6.909   -0.799  1.00 0.00 ? 302 MET A C    4  
ATOM   6713  O  O    . MET B 2 44  ? -2.354  6.692   -1.997  1.00 0.00 ? 302 MET A O    4  
ATOM   6714  C  CB   . MET B 2 44  ? -1.035  5.728   0.949   1.00 0.00 ? 302 MET A CB   4  
ATOM   6715  C  CG   . MET B 2 44  ? -2.145  4.712   0.746   1.00 0.00 ? 302 MET A CG   4  
ATOM   6716  S  SD   . MET B 2 44  ? -1.645  3.302   -0.240  1.00 0.00 ? 302 MET A SD   4  
ATOM   6717  C  CE   . MET B 2 44  ? -0.555  2.475   0.900   1.00 0.00 ? 302 MET A CE   4  
ATOM   6718  H  H    . MET B 2 44  ? -0.710  8.175   1.620   1.00 0.00 ? 302 MET A H    4  
ATOM   6719  H  HA   . MET B 2 44  ? -0.219  6.761   -0.745  1.00 0.00 ? 302 MET A HA   4  
ATOM   6720  H  HB2  . MET B 2 44  ? -0.101  5.205   0.873   1.00 0.00 ? 302 MET A HB2  4  
ATOM   6721  H  HB3  . MET B 2 44  ? -1.131  6.124   1.935   1.00 0.00 ? 302 MET A HB3  4  
ATOM   6722  H  HG2  . MET B 2 44  ? -2.445  4.355   1.708   1.00 0.00 ? 302 MET A HG2  4  
ATOM   6723  H  HG3  . MET B 2 44  ? -2.985  5.187   0.270   1.00 0.00 ? 302 MET A HG3  4  
ATOM   6724  H  HE1  . MET B 2 44  ? 0.308   2.133   0.366   1.00 0.00 ? 302 MET A HE1  4  
ATOM   6725  H  HE2  . MET B 2 44  ? -1.065  1.633   1.342   1.00 0.00 ? 302 MET A HE2  4  
ATOM   6726  H  HE3  . MET B 2 44  ? -0.253  3.164   1.674   1.00 0.00 ? 302 MET A HE3  4  
ATOM   6727  N  N    . THR B 2 45  ? -3.392  7.226   -0.091  1.00 0.00 ? 303 THR A N    4  
ATOM   6728  C  CA   . THR B 2 45  ? -4.701  7.252   -0.688  1.00 0.00 ? 303 THR A CA   4  
ATOM   6729  C  C    . THR B 2 45  ? -4.625  8.107   -1.938  1.00 0.00 ? 303 THR A C    4  
ATOM   6730  O  O    . THR B 2 45  ? -4.958  7.668   -3.027  1.00 0.00 ? 303 THR A O    4  
ATOM   6731  C  CB   . THR B 2 45  ? -5.740  7.826   0.296   1.00 0.00 ? 303 THR A CB   4  
ATOM   6732  O  OG1  . THR B 2 45  ? -5.801  7.011   1.471   1.00 0.00 ? 303 THR A OG1  4  
ATOM   6733  C  CG2  . THR B 2 45  ? -7.118  7.906   -0.335  1.00 0.00 ? 303 THR A CG2  4  
ATOM   6734  H  H    . THR B 2 45  ? -3.285  7.462   0.847   1.00 0.00 ? 303 THR A H    4  
ATOM   6735  H  HA   . THR B 2 45  ? -4.984  6.237   -0.949  1.00 0.00 ? 303 THR A HA   4  
ATOM   6736  H  HB   . THR B 2 45  ? -5.432  8.823   0.581   1.00 0.00 ? 303 THR A HB   4  
ATOM   6737  H  HG1  . THR B 2 45  ? -6.200  7.510   2.187   1.00 0.00 ? 303 THR A HG1  4  
ATOM   6738  H  HG21 . THR B 2 45  ? -7.431  6.923   -0.660  1.00 0.00 ? 303 THR A HG21 4  
ATOM   6739  H  HG22 . THR B 2 45  ? -7.081  8.571   -1.184  1.00 0.00 ? 303 THR A HG22 4  
ATOM   6740  H  HG23 . THR B 2 45  ? -7.824  8.288   0.388   1.00 0.00 ? 303 THR A HG23 4  
ATOM   6741  N  N    . GLU B 2 46  ? -4.083  9.296   -1.764  1.00 0.00 ? 304 GLU A N    4  
ATOM   6742  C  CA   . GLU B 2 46  ? -3.908  10.250  -2.847  1.00 0.00 ? 304 GLU A CA   4  
ATOM   6743  C  C    . GLU B 2 46  ? -3.168  9.622   -4.033  1.00 0.00 ? 304 GLU A C    4  
ATOM   6744  O  O    . GLU B 2 46  ? -3.624  9.671   -5.181  1.00 0.00 ? 304 GLU A O    4  
ATOM   6745  C  CB   . GLU B 2 46  ? -3.077  11.421  -2.313  1.00 0.00 ? 304 GLU A CB   4  
ATOM   6746  C  CG   . GLU B 2 46  ? -3.302  12.722  -3.028  1.00 0.00 ? 304 GLU A CG   4  
ATOM   6747  C  CD   . GLU B 2 46  ? -2.205  13.733  -2.763  1.00 0.00 ? 304 GLU A CD   4  
ATOM   6748  O  OE1  . GLU B 2 46  ? -1.210  13.742  -3.518  1.00 0.00 ? 304 GLU A OE1  4  
ATOM   6749  O  OE2  . GLU B 2 46  ? -2.339  14.518  -1.800  1.00 0.00 ? 304 GLU A OE2  4  
ATOM   6750  H  H    . GLU B 2 46  ? -3.785  9.547   -0.866  1.00 0.00 ? 304 GLU A H    4  
ATOM   6751  H  HA   . GLU B 2 46  ? -4.881  10.598  -3.163  1.00 0.00 ? 304 GLU A HA   4  
ATOM   6752  H  HB2  . GLU B 2 46  ? -3.306  11.568  -1.271  1.00 0.00 ? 304 GLU A HB2  4  
ATOM   6753  H  HB3  . GLU B 2 46  ? -2.036  11.171  -2.413  1.00 0.00 ? 304 GLU A HB3  4  
ATOM   6754  H  HG2  . GLU B 2 46  ? -3.342  12.521  -4.081  1.00 0.00 ? 304 GLU A HG2  4  
ATOM   6755  H  HG3  . GLU B 2 46  ? -4.236  13.132  -2.692  1.00 0.00 ? 304 GLU A HG3  4  
ATOM   6756  N  N    . ALA B 2 47  ? -2.027  9.018   -3.725  1.00 0.00 ? 305 ALA A N    4  
ATOM   6757  C  CA   . ALA B 2 47  ? -1.172  8.390   -4.726  1.00 0.00 ? 305 ALA A CA   4  
ATOM   6758  C  C    . ALA B 2 47  ? -1.909  7.292   -5.462  1.00 0.00 ? 305 ALA A C    4  
ATOM   6759  O  O    . ALA B 2 47  ? -2.116  7.342   -6.673  1.00 0.00 ? 305 ALA A O    4  
ATOM   6760  C  CB   . ALA B 2 47  ? 0.057   7.798   -4.040  1.00 0.00 ? 305 ALA A CB   4  
ATOM   6761  H  H    . ALA B 2 47  ? -1.760  8.980   -2.785  1.00 0.00 ? 305 ALA A H    4  
ATOM   6762  H  HA   . ALA B 2 47  ? -0.846  9.142   -5.428  1.00 0.00 ? 305 ALA A HA   4  
ATOM   6763  H  HB1  . ALA B 2 47  ? -0.238  6.943   -3.420  1.00 0.00 ? 305 ALA A HB1  4  
ATOM   6764  H  HB2  . ALA B 2 47  ? 0.517   8.552   -3.418  1.00 0.00 ? 305 ALA A HB2  4  
ATOM   6765  H  HB3  . ALA B 2 47  ? 0.763   7.471   -4.789  1.00 0.00 ? 305 ALA A HB3  4  
ATOM   6766  N  N    . VAL B 2 48  ? -2.310  6.317   -4.683  1.00 0.00 ? 306 VAL A N    4  
ATOM   6767  C  CA   . VAL B 2 48  ? -3.024  5.157   -5.152  1.00 0.00 ? 306 VAL A CA   4  
ATOM   6768  C  C    . VAL B 2 48  ? -4.304  5.524   -5.890  1.00 0.00 ? 306 VAL A C    4  
ATOM   6769  O  O    . VAL B 2 48  ? -4.842  4.724   -6.658  1.00 0.00 ? 306 VAL A O    4  
ATOM   6770  C  CB   . VAL B 2 48  ? -3.316  4.254   -3.961  1.00 0.00 ? 306 VAL A CB   4  
ATOM   6771  C  CG1  . VAL B 2 48  ? -2.046  4.037   -3.167  1.00 0.00 ? 306 VAL A CG1  4  
ATOM   6772  C  CG2  . VAL B 2 48  ? -4.400  4.826   -3.087  1.00 0.00 ? 306 VAL A CG2  4  
ATOM   6773  H  H    . VAL B 2 48  ? -2.109  6.379   -3.732  1.00 0.00 ? 306 VAL A H    4  
ATOM   6774  H  HA   . VAL B 2 48  ? -2.385  4.614   -5.818  1.00 0.00 ? 306 VAL A HA   4  
ATOM   6775  H  HB   . VAL B 2 48  ? -3.642  3.304   -4.320  1.00 0.00 ? 306 VAL A HB   4  
ATOM   6776  H  HG11 . VAL B 2 48  ? -2.145  3.139   -2.573  1.00 0.00 ? 306 VAL A HG11 4  
ATOM   6777  H  HG12 . VAL B 2 48  ? -1.875  4.878   -2.518  1.00 0.00 ? 306 VAL A HG12 4  
ATOM   6778  H  HG13 . VAL B 2 48  ? -1.213  3.929   -3.844  1.00 0.00 ? 306 VAL A HG13 4  
ATOM   6779  H  HG21 . VAL B 2 48  ? -4.873  4.014   -2.572  1.00 0.00 ? 306 VAL A HG21 4  
ATOM   6780  H  HG22 . VAL B 2 48  ? -5.127  5.345   -3.695  1.00 0.00 ? 306 VAL A HG22 4  
ATOM   6781  H  HG23 . VAL B 2 48  ? -3.971  5.505   -2.372  1.00 0.00 ? 306 VAL A HG23 4  
ATOM   6782  N  N    . LYS B 2 49  ? -4.789  6.736   -5.655  1.00 0.00 ? 307 LYS A N    4  
ATOM   6783  C  CA   . LYS B 2 49  ? -6.002  7.209   -6.303  1.00 0.00 ? 307 LYS A CA   4  
ATOM   6784  C  C    . LYS B 2 49  ? -5.757  7.541   -7.763  1.00 0.00 ? 307 LYS A C    4  
ATOM   6785  O  O    . LYS B 2 49  ? -6.536  7.174   -8.644  1.00 0.00 ? 307 LYS A O    4  
ATOM   6786  C  CB   . LYS B 2 49  ? -6.520  8.429   -5.605  1.00 0.00 ? 307 LYS A CB   4  
ATOM   6787  C  CG   . LYS B 2 49  ? -7.219  8.053   -4.353  1.00 0.00 ? 307 LYS A CG   4  
ATOM   6788  C  CD   . LYS B 2 49  ? -8.629  8.567   -4.321  1.00 0.00 ? 307 LYS A CD   4  
ATOM   6789  C  CE   . LYS B 2 49  ? -9.113  8.453   -2.917  1.00 0.00 ? 307 LYS A CE   4  
ATOM   6790  N  NZ   . LYS B 2 49  ? -10.124 9.485   -2.564  1.00 0.00 ? 307 LYS A NZ   4  
ATOM   6791  H  H    . LYS B 2 49  ? -4.319  7.327   -5.030  1.00 0.00 ? 307 LYS A H    4  
ATOM   6792  H  HA   . LYS B 2 49  ? -6.747  6.446   -6.202  1.00 0.00 ? 307 LYS A HA   4  
ATOM   6793  H  HB2  . LYS B 2 49  ? -5.696  9.074   -5.366  1.00 0.00 ? 307 LYS A HB2  4  
ATOM   6794  H  HB3  . LYS B 2 49  ? -7.220  8.948   -6.237  1.00 0.00 ? 307 LYS A HB3  4  
ATOM   6795  H  HG2  . LYS B 2 49  ? -7.241  6.976   -4.278  1.00 0.00 ? 307 LYS A HG2  4  
ATOM   6796  H  HG3  . LYS B 2 49  ? -6.671  8.459   -3.521  1.00 0.00 ? 307 LYS A HG3  4  
ATOM   6797  H  HD2  . LYS B 2 49  ? -8.643  9.602   -4.634  1.00 0.00 ? 307 LYS A HD2  4  
ATOM   6798  H  HD3  . LYS B 2 49  ? -9.251  7.969   -4.969  1.00 0.00 ? 307 LYS A HD3  4  
ATOM   6799  H  HE2  . LYS B 2 49  ? -9.525  7.467   -2.767  1.00 0.00 ? 307 LYS A HE2  4  
ATOM   6800  H  HE3  . LYS B 2 49  ? -8.251  8.565   -2.301  1.00 0.00 ? 307 LYS A HE3  4  
ATOM   6801  H  HZ1  . LYS B 2 49  ? -10.409 9.380   -1.569  1.00 0.00 ? 307 LYS A HZ1  4  
ATOM   6802  H  HZ2  . LYS B 2 49  ? -10.965 9.384   -3.165  1.00 0.00 ? 307 LYS A HZ2  4  
ATOM   6803  H  HZ3  . LYS B 2 49  ? -9.727  10.437  -2.700  1.00 0.00 ? 307 LYS A HZ3  4  
ATOM   6804  N  N    . THR B 2 50  ? -4.657  8.245   -8.000  1.00 0.00 ? 308 THR A N    4  
ATOM   6805  C  CA   . THR B 2 50  ? -4.295  8.685   -9.346  1.00 0.00 ? 308 THR A CA   4  
ATOM   6806  C  C    . THR B 2 50  ? -3.453  7.679   -10.141 1.00 0.00 ? 308 THR A C    4  
ATOM   6807  O  O    . THR B 2 50  ? -3.799  7.356   -11.278 1.00 0.00 ? 308 THR A O    4  
ATOM   6808  C  CB   . THR B 2 50  ? -3.542  10.029  -9.300  1.00 0.00 ? 308 THR A CB   4  
ATOM   6809  O  OG1  . THR B 2 50  ? -2.988  10.325  -10.586 1.00 0.00 ? 308 THR A OG1  4  
ATOM   6810  C  CG2  . THR B 2 50  ? -2.434  9.996   -8.257  1.00 0.00 ? 308 THR A CG2  4  
ATOM   6811  H  H    . THR B 2 50  ? -4.083  8.493   -7.239  1.00 0.00 ? 308 THR A H    4  
ATOM   6812  H  HA   . THR B 2 50  ? -5.216  8.852   -9.885  1.00 0.00 ? 308 THR A HA   4  
ATOM   6813  H  HB   . THR B 2 50  ? -4.243  10.806  -9.032  1.00 0.00 ? 308 THR A HB   4  
ATOM   6814  H  HG1  . THR B 2 50  ? -2.893  11.276  -10.683 1.00 0.00 ? 308 THR A HG1  4  
ATOM   6815  H  HG21 . THR B 2 50  ? -2.868  9.876   -7.276  1.00 0.00 ? 308 THR A HG21 4  
ATOM   6816  H  HG22 . THR B 2 50  ? -1.877  10.920  -8.295  1.00 0.00 ? 308 THR A HG22 4  
ATOM   6817  H  HG23 . THR B 2 50  ? -1.772  9.168   -8.461  1.00 0.00 ? 308 THR A HG23 4  
ATOM   6818  N  N    . TYR B 2 51  ? -2.357  7.175   -9.566  1.00 0.00 ? 309 TYR A N    4  
ATOM   6819  C  CA   . TYR B 2 51  ? -1.488  6.260   -10.308 1.00 0.00 ? 309 TYR A CA   4  
ATOM   6820  C  C    . TYR B 2 51  ? -1.878  4.785   -10.141 1.00 0.00 ? 309 TYR A C    4  
ATOM   6821  O  O    . TYR B 2 51  ? -2.959  4.463   -9.646  1.00 0.00 ? 309 TYR A O    4  
ATOM   6822  C  CB   . TYR B 2 51  ? -0.012  6.511   -9.939  1.00 0.00 ? 309 TYR A CB   4  
ATOM   6823  C  CG   . TYR B 2 51  ? 0.578   5.543   -8.939  1.00 0.00 ? 309 TYR A CG   4  
ATOM   6824  C  CD1  . TYR B 2 51  ? -0.040  5.312   -7.725  1.00 0.00 ? 309 TYR A CD1  4  
ATOM   6825  C  CD2  . TYR B 2 51  ? 1.759   4.866   -9.216  1.00 0.00 ? 309 TYR A CD2  4  
ATOM   6826  C  CE1  . TYR B 2 51  ? 0.497   4.430   -6.809  1.00 0.00 ? 309 TYR A CE1  4  
ATOM   6827  C  CE2  . TYR B 2 51  ? 2.302   3.981   -8.306  1.00 0.00 ? 309 TYR A CE2  4  
ATOM   6828  C  CZ   . TYR B 2 51  ? 1.668   3.766   -7.103  1.00 0.00 ? 309 TYR A CZ   4  
ATOM   6829  O  OH   . TYR B 2 51  ? 2.205   2.885   -6.194  1.00 0.00 ? 309 TYR A OH   4  
ATOM   6830  H  H    . TYR B 2 51  ? -2.133  7.415   -8.642  1.00 0.00 ? 309 TYR A H    4  
ATOM   6831  H  HA   . TYR B 2 51  ? -1.609  6.506   -11.347 1.00 0.00 ? 309 TYR A HA   4  
ATOM   6832  H  HB2  . TYR B 2 51  ? 0.583   6.451   -10.837 1.00 0.00 ? 309 TYR A HB2  4  
ATOM   6833  H  HB3  . TYR B 2 51  ? 0.077   7.506   -9.528  1.00 0.00 ? 309 TYR A HB3  4  
ATOM   6834  H  HD1  . TYR B 2 51  ? -0.958  5.832   -7.503  1.00 0.00 ? 309 TYR A HD1  4  
ATOM   6835  H  HD2  . TYR B 2 51  ? 2.254   5.037   -10.160 1.00 0.00 ? 309 TYR A HD2  4  
ATOM   6836  H  HE1  . TYR B 2 51  ? -0.002  4.265   -5.870  1.00 0.00 ? 309 TYR A HE1  4  
ATOM   6837  H  HE2  . TYR B 2 51  ? 3.219   3.461   -8.541  1.00 0.00 ? 309 TYR A HE2  4  
ATOM   6838  H  HH   . TYR B 2 51  ? 1.516   2.301   -5.869  1.00 0.00 ? 309 TYR A HH   4  
ATOM   6839  N  N    . LYS B 2 52  ? -0.972  3.904   -10.565 1.00 0.00 ? 310 LYS A N    4  
ATOM   6840  C  CA   . LYS B 2 52  ? -1.182  2.458   -10.515 1.00 0.00 ? 310 LYS A CA   4  
ATOM   6841  C  C    . LYS B 2 52  ? -0.933  1.913   -9.116  1.00 0.00 ? 310 LYS A C    4  
ATOM   6842  O  O    . LYS B 2 52  ? 0.167   1.452   -8.810  1.00 0.00 ? 310 LYS A O    4  
ATOM   6843  C  CB   . LYS B 2 52  ? -0.254  1.764   -11.500 1.00 0.00 ? 310 LYS A CB   4  
ATOM   6844  C  CG   . LYS B 2 52  ? -0.444  2.197   -12.925 1.00 0.00 ? 310 LYS A CG   4  
ATOM   6845  C  CD   . LYS B 2 52  ? -1.309  1.217   -13.685 1.00 0.00 ? 310 LYS A CD   4  
ATOM   6846  C  CE   . LYS B 2 52  ? -1.301  1.498   -15.170 1.00 0.00 ? 310 LYS A CE   4  
ATOM   6847  N  NZ   . LYS B 2 52  ? 0.045   1.288   -15.772 1.00 0.00 ? 310 LYS A NZ   4  
ATOM   6848  H  H    . LYS B 2 52  ? -0.114  4.242   -10.887 1.00 0.00 ? 310 LYS A H    4  
ATOM   6849  H  HA   . LYS B 2 52  ? -2.193  2.248   -10.802 1.00 0.00 ? 310 LYS A HA   4  
ATOM   6850  H  HB2  . LYS B 2 52  ? 0.752   1.970   -11.224 1.00 0.00 ? 310 LYS A HB2  4  
ATOM   6851  H  HB3  . LYS B 2 52  ? -0.422  0.705   -11.457 1.00 0.00 ? 310 LYS A HB3  4  
ATOM   6852  H  HG2  . LYS B 2 52  ? -0.919  3.160   -12.931 1.00 0.00 ? 310 LYS A HG2  4  
ATOM   6853  H  HG3  . LYS B 2 52  ? 0.520   2.255   -13.396 1.00 0.00 ? 310 LYS A HG3  4  
ATOM   6854  H  HD2  . LYS B 2 52  ? -0.937  0.218   -13.517 1.00 0.00 ? 310 LYS A HD2  4  
ATOM   6855  H  HD3  . LYS B 2 52  ? -2.321  1.292   -13.321 1.00 0.00 ? 310 LYS A HD3  4  
ATOM   6856  H  HE2  . LYS B 2 52  ? -2.003  0.836   -15.639 1.00 0.00 ? 310 LYS A HE2  4  
ATOM   6857  H  HE3  . LYS B 2 52  ? -1.605  2.522   -15.333 1.00 0.00 ? 310 LYS A HE3  4  
ATOM   6858  H  HZ1  . LYS B 2 52  ? 0.738   1.929   -15.334 1.00 0.00 ? 310 LYS A HZ1  4  
ATOM   6859  H  HZ2  . LYS B 2 52  ? 0.014   1.474   -16.794 1.00 0.00 ? 310 LYS A HZ2  4  
ATOM   6860  H  HZ3  . LYS B 2 52  ? 0.355   0.306   -15.619 1.00 0.00 ? 310 LYS A HZ3  4  
ATOM   6861  N  N    . TRP B 2 53  ? -1.951  1.970   -8.268  1.00 0.00 ? 311 TRP A N    4  
ATOM   6862  C  CA   . TRP B 2 53  ? -1.823  1.469   -6.908  1.00 0.00 ? 311 TRP A CA   4  
ATOM   6863  C  C    . TRP B 2 53  ? -1.417  0.005   -6.926  1.00 0.00 ? 311 TRP A C    4  
ATOM   6864  O  O    . TRP B 2 53  ? -0.510  -0.398  -6.199  1.00 0.00 ? 311 TRP A O    4  
ATOM   6865  C  CB   . TRP B 2 53  ? -3.132  1.665   -6.139  1.00 0.00 ? 311 TRP A CB   4  
ATOM   6866  C  CG   . TRP B 2 53  ? -3.234  0.870   -4.868  1.00 0.00 ? 311 TRP A CG   4  
ATOM   6867  C  CD1  . TRP B 2 53  ? -2.493  1.022   -3.736  1.00 0.00 ? 311 TRP A CD1  4  
ATOM   6868  C  CD2  . TRP B 2 53  ? -4.143  -0.197  -4.602  1.00 0.00 ? 311 TRP A CD2  4  
ATOM   6869  N  NE1  . TRP B 2 53  ? -2.896  0.132   -2.778  1.00 0.00 ? 311 TRP A NE1  4  
ATOM   6870  C  CE2  . TRP B 2 53  ? -3.905  -0.633  -3.288  1.00 0.00 ? 311 TRP A CE2  4  
ATOM   6871  C  CE3  . TRP B 2 53  ? -5.135  -0.822  -5.348  1.00 0.00 ? 311 TRP A CE3  4  
ATOM   6872  C  CZ2  . TRP B 2 53  ? -4.626  -1.663  -2.704  1.00 0.00 ? 311 TRP A CZ2  4  
ATOM   6873  C  CZ3  . TRP B 2 53  ? -5.853  -1.853  -4.771  1.00 0.00 ? 311 TRP A CZ3  4  
ATOM   6874  C  CH2  . TRP B 2 53  ? -5.595  -2.263  -3.457  1.00 0.00 ? 311 TRP A CH2  4  
ATOM   6875  H  H    . TRP B 2 53  ? -2.803  2.354   -8.562  1.00 0.00 ? 311 TRP A H    4  
ATOM   6876  H  HA   . TRP B 2 53  ? -1.043  2.037   -6.422  1.00 0.00 ? 311 TRP A HA   4  
ATOM   6877  H  HB2  . TRP B 2 53  ? -3.221  2.701   -5.888  1.00 0.00 ? 311 TRP A HB2  4  
ATOM   6878  H  HB3  . TRP B 2 53  ? -3.962  1.398   -6.761  1.00 0.00 ? 311 TRP A HB3  4  
ATOM   6879  H  HD1  . TRP B 2 53  ? -1.715  1.756   -3.618  1.00 0.00 ? 311 TRP A HD1  4  
ATOM   6880  H  HE1  . TRP B 2 53  ? -2.518  0.053   -1.877  1.00 0.00 ? 311 TRP A HE1  4  
ATOM   6881  H  HE3  . TRP B 2 53  ? -5.343  -0.511  -6.359  1.00 0.00 ? 311 TRP A HE3  4  
ATOM   6882  H  HZ2  . TRP B 2 53  ? -4.443  -1.977  -1.692  1.00 0.00 ? 311 TRP A HZ2  4  
ATOM   6883  H  HZ3  . TRP B 2 53  ? -6.626  -2.352  -5.336  1.00 0.00 ? 311 TRP A HZ3  4  
ATOM   6884  H  HH2  . TRP B 2 53  ? -6.174  -3.077  -3.044  1.00 0.00 ? 311 TRP A HH2  4  
ATOM   6885  N  N    . GLN B 2 54  ? -2.078  -0.775  -7.779  1.00 0.00 ? 312 GLN A N    4  
ATOM   6886  C  CA   . GLN B 2 54  ? -1.787  -2.199  -7.906  1.00 0.00 ? 312 GLN A CA   4  
ATOM   6887  C  C    . GLN B 2 54  ? -1.759  -2.878  -6.544  1.00 0.00 ? 312 GLN A C    4  
ATOM   6888  O  O    . GLN B 2 54  ? -0.805  -2.727  -5.780  1.00 0.00 ? 312 GLN A O    4  
ATOM   6889  C  CB   . GLN B 2 54  ? -0.454  -2.408  -8.621  1.00 0.00 ? 312 GLN A CB   4  
ATOM   6890  C  CG   . GLN B 2 54  ? -0.579  -2.529  -10.131 1.00 0.00 ? 312 GLN A CG   4  
ATOM   6891  C  CD   . GLN B 2 54  ? 0.694   -3.036  -10.784 1.00 0.00 ? 312 GLN A CD   4  
ATOM   6892  O  OE1  . GLN B 2 54  ? 0.651   -3.689  -11.827 1.00 0.00 ? 312 GLN A OE1  4  
ATOM   6893  N  NE2  . GLN B 2 54  ? 1.836   -2.742  -10.172 1.00 0.00 ? 312 GLN A NE2  4  
ATOM   6894  H  H    . GLN B 2 54  ? -2.780  -0.382  -8.338  1.00 0.00 ? 312 GLN A H    4  
ATOM   6895  H  HA   . GLN B 2 54  ? -2.573  -2.644  -8.496  1.00 0.00 ? 312 GLN A HA   4  
ATOM   6896  H  HB2  . GLN B 2 54  ? 0.188   -1.572  -8.404  1.00 0.00 ? 312 GLN A HB2  4  
ATOM   6897  H  HB3  . GLN B 2 54  ? 0.002   -3.310  -8.245  1.00 0.00 ? 312 GLN A HB3  4  
ATOM   6898  H  HG2  . GLN B 2 54  ? -1.380  -3.216  -10.360 1.00 0.00 ? 312 GLN A HG2  4  
ATOM   6899  H  HG3  . GLN B 2 54  ? -0.813  -1.556  -10.539 1.00 0.00 ? 312 GLN A HG3  4  
ATOM   6900  H  HE21 . GLN B 2 54  ? 1.797   -2.219  -9.344  1.00 0.00 ? 312 GLN A HE21 4  
ATOM   6901  H  HE22 . GLN B 2 54  ? 2.672   -3.061  -10.572 1.00 0.00 ? 312 GLN A HE22 4  
ATOM   6902  N  N    . CYS B 2 55  ? -2.809  -3.632  -6.253  1.00 0.00 ? 313 CYS A N    4  
ATOM   6903  C  CA   . CYS B 2 55  ? -2.923  -4.340  -4.987  1.00 0.00 ? 313 CYS A CA   4  
ATOM   6904  C  C    . CYS B 2 55  ? -1.627  -5.063  -4.635  1.00 0.00 ? 313 CYS A C    4  
ATOM   6905  O  O    . CYS B 2 55  ? -0.764  -5.268  -5.486  1.00 0.00 ? 313 CYS A O    4  
ATOM   6906  C  CB   . CYS B 2 55  ? -4.070  -5.349  -5.052  1.00 0.00 ? 313 CYS A CB   4  
ATOM   6907  S  SG   . CYS B 2 55  ? -3.599  -6.971  -5.741  1.00 0.00 ? 313 CYS A SG   4  
ATOM   6908  H  H    . CYS B 2 55  ? -3.531  -3.714  -6.910  1.00 0.00 ? 313 CYS A H    4  
ATOM   6909  H  HA   . CYS B 2 55  ? -3.138  -3.615  -4.217  1.00 0.00 ? 313 CYS A HA   4  
ATOM   6910  H  HB2  . CYS B 2 55  ? -4.448  -5.516  -4.055  1.00 0.00 ? 313 CYS A HB2  4  
ATOM   6911  H  HB3  . CYS B 2 55  ? -4.858  -4.947  -5.667  1.00 0.00 ? 313 CYS A HB3  4  
ATOM   6912  N  N    . ILE B 2 56  ? -1.503  -5.439  -3.373  1.00 0.00 ? 314 ILE A N    4  
ATOM   6913  C  CA   . ILE B 2 56  ? -0.331  -6.158  -2.889  1.00 0.00 ? 314 ILE A CA   4  
ATOM   6914  C  C    . ILE B 2 56  ? -0.069  -7.399  -3.743  1.00 0.00 ? 314 ILE A C    4  
ATOM   6915  O  O    . ILE B 2 56  ? 1.074   -7.728  -4.038  1.00 0.00 ? 314 ILE A O    4  
ATOM   6916  C  CB   . ILE B 2 56  ? -0.542  -6.572  -1.435  1.00 0.00 ? 314 ILE A CB   4  
ATOM   6917  C  CG1  . ILE B 2 56  ? 0.452   -7.631  -1.028  1.00 0.00 ? 314 ILE A CG1  4  
ATOM   6918  C  CG2  . ILE B 2 56  ? -1.947  -7.103  -1.257  1.00 0.00 ? 314 ILE A CG2  4  
ATOM   6919  C  CD1  . ILE B 2 56  ? 1.795   -7.107  -0.646  1.00 0.00 ? 314 ILE A CD1  4  
ATOM   6920  H  H    . ILE B 2 56  ? -2.231  -5.240  -2.746  1.00 0.00 ? 314 ILE A H    4  
ATOM   6921  H  HA   . ILE B 2 56  ? 0.537   -5.509  -2.926  1.00 0.00 ? 314 ILE A HA   4  
ATOM   6922  H  HB   . ILE B 2 56  ? -0.408  -5.698  -0.813  1.00 0.00 ? 314 ILE A HB   4  
ATOM   6923  H  HG12 . ILE B 2 56  ? 0.060   -8.157  -0.182  1.00 0.00 ? 314 ILE A HG12 4  
ATOM   6924  H  HG13 . ILE B 2 56  ? 0.587   -8.316  -1.849  1.00 0.00 ? 314 ILE A HG13 4  
ATOM   6925  H  HG21 . ILE B 2 56  ? -2.090  -7.929  -1.940  1.00 0.00 ? 314 ILE A HG21 4  
ATOM   6926  H  HG22 . ILE B 2 56  ? -2.662  -6.321  -1.476  1.00 0.00 ? 314 ILE A HG22 4  
ATOM   6927  H  HG23 . ILE B 2 56  ? -2.082  -7.444  -0.242  1.00 0.00 ? 314 ILE A HG23 4  
ATOM   6928  H  HD11 . ILE B 2 56  ? 1.709   -6.061  -0.415  1.00 0.00 ? 314 ILE A HD11 4  
ATOM   6929  H  HD12 . ILE B 2 56  ? 2.486   -7.251  -1.461  1.00 0.00 ? 314 ILE A HD12 4  
ATOM   6930  H  HD13 . ILE B 2 56  ? 2.154   -7.637  0.221   1.00 0.00 ? 314 ILE A HD13 4  
ATOM   6931  N  N    . GLU B 2 57  ? -1.126  -8.103  -4.130  1.00 0.00 ? 315 GLU A N    4  
ATOM   6932  C  CA   . GLU B 2 57  ? -0.954  -9.287  -4.957  1.00 0.00 ? 315 GLU A CA   4  
ATOM   6933  C  C    . GLU B 2 57  ? -0.160  -8.924  -6.213  1.00 0.00 ? 315 GLU A C    4  
ATOM   6934  O  O    . GLU B 2 57  ? 0.512   -9.765  -6.809  1.00 0.00 ? 315 GLU A O    4  
ATOM   6935  C  CB   . GLU B 2 57  ? -2.303  -9.898  -5.342  1.00 0.00 ? 315 GLU A CB   4  
ATOM   6936  C  CG   . GLU B 2 57  ? -3.241  -10.103 -4.164  1.00 0.00 ? 315 GLU A CG   4  
ATOM   6937  C  CD   . GLU B 2 57  ? -4.555  -10.744 -4.570  1.00 0.00 ? 315 GLU A CD   4  
ATOM   6938  O  OE1  . GLU B 2 57  ? -4.576  -11.975 -4.776  1.00 0.00 ? 315 GLU A OE1  4  
ATOM   6939  O  OE2  . GLU B 2 57  ? -5.561  -10.013 -4.684  1.00 0.00 ? 315 GLU A OE2  4  
ATOM   6940  H  H    . GLU B 2 57  ? -2.021  -7.835  -3.847  1.00 0.00 ? 315 GLU A H    4  
ATOM   6941  H  HA   . GLU B 2 57  ? -0.396  -10.001 -4.374  1.00 0.00 ? 315 GLU A HA   4  
ATOM   6942  H  HB2  . GLU B 2 57  ? -2.790  -9.251  -6.055  1.00 0.00 ? 315 GLU A HB2  4  
ATOM   6943  H  HB3  . GLU B 2 57  ? -2.130  -10.858 -5.805  1.00 0.00 ? 315 GLU A HB3  4  
ATOM   6944  H  HG2  . GLU B 2 57  ? -2.756  -10.741 -3.439  1.00 0.00 ? 315 GLU A HG2  4  
ATOM   6945  H  HG3  . GLU B 2 57  ? -3.449  -9.143  -3.714  1.00 0.00 ? 315 GLU A HG3  4  
ATOM   6946  N  N    . CYS B 2 58  ? -0.252  -7.650  -6.598  1.00 0.00 ? 316 CYS A N    4  
ATOM   6947  C  CA   . CYS B 2 58  ? 0.447   -7.123  -7.764  1.00 0.00 ? 316 CYS A CA   4  
ATOM   6948  C  C    . CYS B 2 58  ? 1.265   -5.895  -7.395  1.00 0.00 ? 316 CYS A C    4  
ATOM   6949  O  O    . CYS B 2 58  ? 1.271   -4.900  -8.118  1.00 0.00 ? 316 CYS A O    4  
ATOM   6950  C  CB   . CYS B 2 58  ? -0.553  -6.707  -8.818  1.00 0.00 ? 316 CYS A CB   4  
ATOM   6951  S  SG   . CYS B 2 58  ? -1.943  -7.854  -9.044  1.00 0.00 ? 316 CYS A SG   4  
ATOM   6952  H  H    . CYS B 2 58  ? -0.825  -7.046  -6.089  1.00 0.00 ? 316 CYS A H    4  
ATOM   6953  H  HA   . CYS B 2 58  ? 1.094   -7.889  -8.160  1.00 0.00 ? 316 CYS A HA   4  
ATOM   6954  H  HB2  . CYS B 2 58  ? -0.962  -5.745  -8.549  1.00 0.00 ? 316 CYS A HB2  4  
ATOM   6955  H  HB3  . CYS B 2 58  ? -0.036  -6.621  -9.748  1.00 0.00 ? 316 CYS A HB3  4  
ATOM   6956  N  N    . LYS B 2 59  ? 1.967   -5.977  -6.290  1.00 0.00 ? 317 LYS A N    4  
ATOM   6957  C  CA   . LYS B 2 59  ? 2.748   -4.862  -5.801  1.00 0.00 ? 317 LYS A CA   4  
ATOM   6958  C  C    . LYS B 2 59  ? 4.202   -4.971  -6.216  1.00 0.00 ? 317 LYS A C    4  
ATOM   6959  O  O    . LYS B 2 59  ? 4.958   -4.007  -6.124  1.00 0.00 ? 317 LYS A O    4  
ATOM   6960  C  CB   . LYS B 2 59  ? 2.642   -4.810  -4.296  1.00 0.00 ? 317 LYS A CB   4  
ATOM   6961  C  CG   . LYS B 2 59  ? 3.115   -6.073  -3.647  1.00 0.00 ? 317 LYS A CG   4  
ATOM   6962  C  CD   . LYS B 2 59  ? 4.549   -5.975  -3.307  1.00 0.00 ? 317 LYS A CD   4  
ATOM   6963  C  CE   . LYS B 2 59  ? 4.779   -4.866  -2.313  1.00 0.00 ? 317 LYS A CE   4  
ATOM   6964  N  NZ   . LYS B 2 59  ? 6.166   -4.859  -1.794  1.00 0.00 ? 317 LYS A NZ   4  
ATOM   6965  H  H    . LYS B 2 59  ? 1.984   -6.818  -5.803  1.00 0.00 ? 317 LYS A H    4  
ATOM   6966  H  HA   . LYS B 2 59  ? 2.349   -3.972  -6.207  1.00 0.00 ? 317 LYS A HA   4  
ATOM   6967  H  HB2  . LYS B 2 59  ? 3.237   -3.997  -3.948  1.00 0.00 ? 317 LYS A HB2  4  
ATOM   6968  H  HB3  . LYS B 2 59  ? 1.627   -4.652  -3.993  1.00 0.00 ? 317 LYS A HB3  4  
ATOM   6969  H  HG2  . LYS B 2 59  ? 2.549   -6.239  -2.755  1.00 0.00 ? 317 LYS A HG2  4  
ATOM   6970  H  HG3  . LYS B 2 59  ? 2.983   -6.897  -4.326  1.00 0.00 ? 317 LYS A HG3  4  
ATOM   6971  H  HD2  . LYS B 2 59  ? 4.862   -6.910  -2.886  1.00 0.00 ? 317 LYS A HD2  4  
ATOM   6972  H  HD3  . LYS B 2 59  ? 5.085   -5.768  -4.211  1.00 0.00 ? 317 LYS A HD3  4  
ATOM   6973  H  HE2  . LYS B 2 59  ? 4.562   -3.923  -2.777  1.00 0.00 ? 317 LYS A HE2  4  
ATOM   6974  H  HE3  . LYS B 2 59  ? 4.100   -5.012  -1.501  1.00 0.00 ? 317 LYS A HE3  4  
ATOM   6975  H  HZ1  . LYS B 2 59  ? 6.273   -4.123  -1.066  1.00 0.00 ? 317 LYS A HZ1  4  
ATOM   6976  H  HZ2  . LYS B 2 59  ? 6.838   -4.671  -2.564  1.00 0.00 ? 317 LYS A HZ2  4  
ATOM   6977  H  HZ3  . LYS B 2 59  ? 6.387   -5.781  -1.373  1.00 0.00 ? 317 LYS A HZ3  4  
ATOM   6978  N  N    . SER B 2 60  ? 4.552   -6.169  -6.647  1.00 0.00 ? 318 SER A N    4  
ATOM   6979  C  CA   . SER B 2 60  ? 5.905   -6.523  -7.099  1.00 0.00 ? 318 SER A CA   4  
ATOM   6980  C  C    . SER B 2 60  ? 6.902   -5.375  -7.008  1.00 0.00 ? 318 SER A C    4  
ATOM   6981  O  O    . SER B 2 60  ? 6.754   -4.347  -7.668  1.00 0.00 ? 318 SER A O    4  
ATOM   6982  C  CB   . SER B 2 60  ? 5.876   -7.046  -8.525  1.00 0.00 ? 318 SER A CB   4  
ATOM   6983  O  OG   . SER B 2 60  ? 4.570   -6.992  -9.072  1.00 0.00 ? 318 SER A OG   4  
ATOM   6984  H  H    . SER B 2 60  ? 3.860   -6.855  -6.655  1.00 0.00 ? 318 SER A H    4  
ATOM   6985  H  HA   . SER B 2 60  ? 6.259   -7.315  -6.466  1.00 0.00 ? 318 SER A HA   4  
ATOM   6986  H  HB2  . SER B 2 60  ? 6.531   -6.444  -9.119  1.00 0.00 ? 318 SER A HB2  4  
ATOM   6987  H  HB3  . SER B 2 60  ? 6.224   -8.067  -8.539  1.00 0.00 ? 318 SER A HB3  4  
ATOM   6988  H  HG   . SER B 2 60  ? 4.383   -7.810  -9.536  1.00 0.00 ? 318 SER A HG   4  
ATOM   6989  N  N    . CYS B 2 61  ? 7.931   -5.601  -6.196  1.00 0.00 ? 319 CYS A N    4  
ATOM   6990  C  CA   . CYS B 2 61  ? 9.009   -4.643  -5.966  1.00 0.00 ? 319 CYS A CA   4  
ATOM   6991  C  C    . CYS B 2 61  ? 9.162   -3.639  -7.100  1.00 0.00 ? 319 CYS A C    4  
ATOM   6992  O  O    . CYS B 2 61  ? 9.733   -3.958  -8.133  1.00 0.00 ? 319 CYS A O    4  
ATOM   6993  C  CB   . CYS B 2 61  ? 10.321  -5.399  -5.832  1.00 0.00 ? 319 CYS A CB   4  
ATOM   6994  S  SG   . CYS B 2 61  ? 11.730  -4.414  -5.203  1.00 0.00 ? 319 CYS A SG   4  
ATOM   6995  H  H    . CYS B 2 61  ? 7.968   -6.460  -5.725  1.00 0.00 ? 319 CYS A H    4  
ATOM   6996  H  HA   . CYS B 2 61  ? 8.815   -4.125  -5.042  1.00 0.00 ? 319 CYS A HA   4  
ATOM   6997  H  HB2  . CYS B 2 61  ? 10.177  -6.237  -5.175  1.00 0.00 ? 319 CYS A HB2  4  
ATOM   6998  H  HB3  . CYS B 2 61  ? 10.599  -5.775  -6.801  1.00 0.00 ? 319 CYS A HB3  4  
ATOM   6999  N  N    . ILE B 2 62  ? 8.655   -2.426  -6.919  1.00 0.00 ? 320 ILE A N    4  
ATOM   7000  C  CA   . ILE B 2 62  ? 8.815   -1.392  -7.939  1.00 0.00 ? 320 ILE A CA   4  
ATOM   7001  C  C    . ILE B 2 62  ? 10.258  -1.429  -8.424  1.00 0.00 ? 320 ILE A C    4  
ATOM   7002  O  O    . ILE B 2 62  ? 10.564  -1.113  -9.574  1.00 0.00 ? 320 ILE A O    4  
ATOM   7003  C  CB   . ILE B 2 62  ? 8.495   0.013   -7.371  1.00 0.00 ? 320 ILE A CB   4  
ATOM   7004  C  CG1  . ILE B 2 62  ? 9.547   1.044   -7.812  1.00 0.00 ? 320 ILE A CG1  4  
ATOM   7005  C  CG2  . ILE B 2 62  ? 8.414   -0.060  -5.867  1.00 0.00 ? 320 ILE A CG2  4  
ATOM   7006  C  CD1  . ILE B 2 62  ? 9.457   2.359   -7.091  1.00 0.00 ? 320 ILE A CD1  4  
ATOM   7007  H  H    . ILE B 2 62  ? 8.171   -2.225  -6.093  1.00 0.00 ? 320 ILE A H    4  
ATOM   7008  H  HA   . ILE B 2 62  ? 8.147   -1.607  -8.761  1.00 0.00 ? 320 ILE A HA   4  
ATOM   7009  H  HB   . ILE B 2 62  ? 7.530   0.321   -7.729  1.00 0.00 ? 320 ILE A HB   4  
ATOM   7010  H  HG12 . ILE B 2 62  ? 10.526  0.647   -7.628  1.00 0.00 ? 320 ILE A HG12 4  
ATOM   7011  H  HG13 . ILE B 2 62  ? 9.430   1.238   -8.864  1.00 0.00 ? 320 ILE A HG13 4  
ATOM   7012  H  HG21 . ILE B 2 62  ? 9.387   -0.325  -5.473  1.00 0.00 ? 320 ILE A HG21 4  
ATOM   7013  H  HG22 . ILE B 2 62  ? 7.690   -0.808  -5.581  1.00 0.00 ? 320 ILE A HG22 4  
ATOM   7014  H  HG23 . ILE B 2 62  ? 8.115   0.899   -5.475  1.00 0.00 ? 320 ILE A HG23 4  
ATOM   7015  H  HD11 . ILE B 2 62  ? 8.633   2.315   -6.405  1.00 0.00 ? 320 ILE A HD11 4  
ATOM   7016  H  HD12 . ILE B 2 62  ? 9.296   3.155   -7.803  1.00 0.00 ? 320 ILE A HD12 4  
ATOM   7017  H  HD13 . ILE B 2 62  ? 10.372  2.538   -6.546  1.00 0.00 ? 320 ILE A HD13 4  
ATOM   7018  N  N    . LEU B 2 63  ? 11.134  -1.833  -7.506  1.00 0.00 ? 321 LEU A N    4  
ATOM   7019  C  CA   . LEU B 2 63  ? 12.555  -1.947  -7.773  1.00 0.00 ? 321 LEU A CA   4  
ATOM   7020  C  C    . LEU B 2 63  ? 12.833  -3.160  -8.663  1.00 0.00 ? 321 LEU A C    4  
ATOM   7021  O  O    . LEU B 2 63  ? 13.418  -3.028  -9.739  1.00 0.00 ? 321 LEU A O    4  
ATOM   7022  C  CB   . LEU B 2 63  ? 13.302  -2.033  -6.437  1.00 0.00 ? 321 LEU A CB   4  
ATOM   7023  C  CG   . LEU B 2 63  ? 12.871  -1.012  -5.363  1.00 0.00 ? 321 LEU A CG   4  
ATOM   7024  C  CD1  . LEU B 2 63  ? 14.017  -0.669  -4.443  1.00 0.00 ? 321 LEU A CD1  4  
ATOM   7025  C  CD2  . LEU B 2 63  ? 12.316  0.267   -5.950  1.00 0.00 ? 321 LEU A CD2  4  
ATOM   7026  H  H    . LEU B 2 63  ? 10.805  -2.057  -6.605  1.00 0.00 ? 321 LEU A H    4  
ATOM   7027  H  HA   . LEU B 2 63  ? 12.867  -1.056  -8.293  1.00 0.00 ? 321 LEU A HA   4  
ATOM   7028  H  HB2  . LEU B 2 63  ? 13.147  -3.017  -6.028  1.00 0.00 ? 321 LEU A HB2  4  
ATOM   7029  H  HB3  . LEU B 2 63  ? 14.349  -1.915  -6.621  1.00 0.00 ? 321 LEU A HB3  4  
ATOM   7030  H  HG   . LEU B 2 63  ? 12.084  -1.454  -4.759  1.00 0.00 ? 321 LEU A HG   4  
ATOM   7031  H  HD11 . LEU B 2 63  ? 13.851  -1.126  -3.474  1.00 0.00 ? 321 LEU A HD11 4  
ATOM   7032  H  HD12 . LEU B 2 63  ? 14.079  0.404   -4.330  1.00 0.00 ? 321 LEU A HD12 4  
ATOM   7033  H  HD13 . LEU B 2 63  ? 14.938  -1.041  -4.863  1.00 0.00 ? 321 LEU A HD13 4  
ATOM   7034  H  HD21 . LEU B 2 63  ? 11.353  0.437   -5.509  1.00 0.00 ? 321 LEU A HD21 4  
ATOM   7035  H  HD22 . LEU B 2 63  ? 12.217  0.179   -7.020  1.00 0.00 ? 321 LEU A HD22 4  
ATOM   7036  H  HD23 . LEU B 2 63  ? 12.971  1.089   -5.712  1.00 0.00 ? 321 LEU A HD23 4  
ATOM   7037  N  N    . CYS B 2 64  ? 12.412  -4.340  -8.210  1.00 0.00 ? 322 CYS A N    4  
ATOM   7038  C  CA   . CYS B 2 64  ? 12.577  -5.566  -8.991  1.00 0.00 ? 322 CYS A CA   4  
ATOM   7039  C  C    . CYS B 2 64  ? 11.394  -5.754  -9.920  1.00 0.00 ? 322 CYS A C    4  
ATOM   7040  O  O    . CYS B 2 64  ? 11.530  -5.777  -11.143 1.00 0.00 ? 322 CYS A O    4  
ATOM   7041  C  CB   . CYS B 2 64  ? 12.643  -6.807  -8.102  1.00 0.00 ? 322 CYS A CB   4  
ATOM   7042  S  SG   . CYS B 2 64  ? 14.059  -6.894  -6.978  1.00 0.00 ? 322 CYS A SG   4  
ATOM   7043  H  H    . CYS B 2 64  ? 11.991  -4.387  -7.330  1.00 0.00 ? 322 CYS A H    4  
ATOM   7044  H  HA   . CYS B 2 64  ? 13.482  -5.491  -9.570  1.00 0.00 ? 322 CYS A HA   4  
ATOM   7045  H  HB2  . CYS B 2 64  ? 11.751  -6.853  -7.499  1.00 0.00 ? 322 CYS A HB2  4  
ATOM   7046  H  HB3  . CYS B 2 64  ? 12.680  -7.678  -8.737  1.00 0.00 ? 322 CYS A HB3  4  
ATOM   7047  N  N    . GLY B 2 65  ? 10.228  -5.885  -9.301  1.00 0.00 ? 323 GLY A N    4  
ATOM   7048  C  CA   . GLY B 2 65  ? 9.011   -6.113  -10.030 1.00 0.00 ? 323 GLY A CA   4  
ATOM   7049  C  C    . GLY B 2 65  ? 8.738   -7.590  -10.102 1.00 0.00 ? 323 GLY A C    4  
ATOM   7050  O  O    . GLY B 2 65  ? 8.152   -8.081  -11.068 1.00 0.00 ? 323 GLY A O    4  
ATOM   7051  H  H    . GLY B 2 65  ? 10.198  -5.817  -8.323  1.00 0.00 ? 323 GLY A H    4  
ATOM   7052  H  HA2  . GLY B 2 65  ? 8.197   -5.617  -9.522  1.00 0.00 ? 323 GLY A HA2  4  
ATOM   7053  H  HA3  . GLY B 2 65  ? 9.107   -5.720  -11.029 1.00 0.00 ? 323 GLY A HA3  4  
ATOM   7054  N  N    . THR B 2 66  ? 9.170   -8.305  -9.061  1.00 0.00 ? 324 THR A N    4  
ATOM   7055  C  CA   . THR B 2 66  ? 9.013   -9.745  -9.024  1.00 0.00 ? 324 THR A CA   4  
ATOM   7056  C  C    . THR B 2 66  ? 8.265   -10.209 -7.784  1.00 0.00 ? 324 THR A C    4  
ATOM   7057  O  O    . THR B 2 66  ? 7.721   -11.314 -7.750  1.00 0.00 ? 324 THR A O    4  
ATOM   7058  C  CB   . THR B 2 66  ? 10.383  -10.414 -9.067  1.00 0.00 ? 324 THR A CB   4  
ATOM   7059  O  OG1  . THR B 2 66  ? 10.243  -11.832 -9.156  1.00 0.00 ? 324 THR A OG1  4  
ATOM   7060  C  CG2  . THR B 2 66  ? 11.214  -10.025 -7.856  1.00 0.00 ? 324 THR A CG2  4  
ATOM   7061  H  H    . THR B 2 66  ? 9.605   -7.846  -8.294  1.00 0.00 ? 324 THR A H    4  
ATOM   7062  H  HA   . THR B 2 66  ? 8.470   -10.047 -9.902  1.00 0.00 ? 324 THR A HA   4  
ATOM   7063  H  HB   . THR B 2 66  ? 10.888  -10.061 -9.936  1.00 0.00 ? 324 THR A HB   4  
ATOM   7064  H  HG1  . THR B 2 66  ? 10.466  -12.122 -10.043 1.00 0.00 ? 324 THR A HG1  4  
ATOM   7065  H  HG21 . THR B 2 66  ? 11.451  -8.972  -7.915  1.00 0.00 ? 324 THR A HG21 4  
ATOM   7066  H  HG22 . THR B 2 66  ? 12.127  -10.602 -7.843  1.00 0.00 ? 324 THR A HG22 4  
ATOM   7067  H  HG23 . THR B 2 66  ? 10.653  -10.217 -6.956  1.00 0.00 ? 324 THR A HG23 4  
ATOM   7068  N  N    . SER B 2 67  ? 8.249   -9.358  -6.766  1.00 0.00 ? 325 SER A N    4  
ATOM   7069  C  CA   . SER B 2 67  ? 7.579   -9.669  -5.513  1.00 0.00 ? 325 SER A CA   4  
ATOM   7070  C  C    . SER B 2 67  ? 8.172   -10.924 -4.865  1.00 0.00 ? 325 SER A C    4  
ATOM   7071  O  O    . SER B 2 67  ? 7.612   -11.465 -3.915  1.00 0.00 ? 325 SER A O    4  
ATOM   7072  C  CB   . SER B 2 67  ? 6.075   -9.847  -5.736  1.00 0.00 ? 325 SER A CB   4  
ATOM   7073  O  OG   . SER B 2 67  ? 5.439   -10.345 -4.575  1.00 0.00 ? 325 SER A OG   4  
ATOM   7074  H  H    . SER B 2 67  ? 8.698   -8.494  -6.862  1.00 0.00 ? 325 SER A H    4  
ATOM   7075  H  HA   . SER B 2 67  ? 7.734   -8.832  -4.854  1.00 0.00 ? 325 SER A HA   4  
ATOM   7076  H  HB2  . SER B 2 67  ? 5.637   -8.890  -5.982  1.00 0.00 ? 325 SER A HB2  4  
ATOM   7077  H  HB3  . SER B 2 67  ? 5.911   -10.539 -6.549  1.00 0.00 ? 325 SER A HB3  4  
ATOM   7078  H  HG   . SER B 2 67  ? 4.771   -10.988 -4.825  1.00 0.00 ? 325 SER A HG   4  
ATOM   7079  N  N    . GLU B 2 68  ? 9.313   -11.375 -5.388  1.00 0.00 ? 326 GLU A N    4  
ATOM   7080  C  CA   . GLU B 2 68  ? 9.987   -12.572 -4.875  1.00 0.00 ? 326 GLU A CA   4  
ATOM   7081  C  C    . GLU B 2 68  ? 10.141  -12.568 -3.356  1.00 0.00 ? 326 GLU A C    4  
ATOM   7082  O  O    . GLU B 2 68  ? 9.359   -13.192 -2.639  1.00 0.00 ? 326 GLU A O    4  
ATOM   7083  C  CB   . GLU B 2 68  ? 11.367  -12.710 -5.507  1.00 0.00 ? 326 GLU A CB   4  
ATOM   7084  C  CG   . GLU B 2 68  ? 11.331  -13.186 -6.933  1.00 0.00 ? 326 GLU A CG   4  
ATOM   7085  C  CD   . GLU B 2 68  ? 11.115  -14.681 -7.050  1.00 0.00 ? 326 GLU A CD   4  
ATOM   7086  O  OE1  . GLU B 2 68  ? 12.117  -15.427 -7.050  1.00 0.00 ? 326 GLU A OE1  4  
ATOM   7087  O  OE2  . GLU B 2 68  ? 9.944   -15.106 -7.141  1.00 0.00 ? 326 GLU A OE2  4  
ATOM   7088  H  H    . GLU B 2 68  ? 9.706   -10.899 -6.156  1.00 0.00 ? 326 GLU A H    4  
ATOM   7089  H  HA   . GLU B 2 68  ? 9.398   -13.426 -5.159  1.00 0.00 ? 326 GLU A HA   4  
ATOM   7090  H  HB2  . GLU B 2 68  ? 11.853  -11.752 -5.484  1.00 0.00 ? 326 GLU A HB2  4  
ATOM   7091  H  HB3  . GLU B 2 68  ? 11.947  -13.411 -4.938  1.00 0.00 ? 326 GLU A HB3  4  
ATOM   7092  H  HG2  . GLU B 2 68  ? 10.526  -12.683 -7.425  1.00 0.00 ? 326 GLU A HG2  4  
ATOM   7093  H  HG3  . GLU B 2 68  ? 12.264  -12.927 -7.412  1.00 0.00 ? 326 GLU A HG3  4  
ATOM   7094  N  N    . ASN B 2 69  ? 11.162  -11.865 -2.877  1.00 0.00 ? 327 ASN A N    4  
ATOM   7095  C  CA   . ASN B 2 69  ? 11.464  -11.806 -1.450  1.00 0.00 ? 327 ASN A CA   4  
ATOM   7096  C  C    . ASN B 2 69  ? 10.533  -10.874 -0.680  1.00 0.00 ? 327 ASN A C    4  
ATOM   7097  O  O    . ASN B 2 69  ? 10.997  -10.112 0.150   1.00 0.00 ? 327 ASN A O    4  
ATOM   7098  C  CB   . ASN B 2 69  ? 12.907  -11.368 -1.240  1.00 0.00 ? 327 ASN A CB   4  
ATOM   7099  C  CG   . ASN B 2 69  ? 13.752  -11.511 -2.483  1.00 0.00 ? 327 ASN A CG   4  
ATOM   7100  O  OD1  . ASN B 2 69  ? 13.739  -10.654 -3.365  1.00 0.00 ? 327 ASN A OD1  4  
ATOM   7101  N  ND2  . ASN B 2 69  ? 14.504  -12.600 -2.550  1.00 0.00 ? 327 ASN A ND2  4  
ATOM   7102  H  H    . ASN B 2 69  ? 11.729  -11.367 -3.502  1.00 0.00 ? 327 ASN A H    4  
ATOM   7103  H  HA   . ASN B 2 69  ? 11.357  -12.786 -1.050  1.00 0.00 ? 327 ASN A HA   4  
ATOM   7104  H  HB2  . ASN B 2 69  ? 12.910  -10.347 -0.939  1.00 0.00 ? 327 ASN A HB2  4  
ATOM   7105  H  HB3  . ASN B 2 69  ? 13.354  -11.964 -0.461  1.00 0.00 ? 327 ASN A HB3  4  
ATOM   7106  H  HD21 . ASN B 2 69  ? 14.466  -13.235 -1.805  1.00 0.00 ? 327 ASN A HD21 4  
ATOM   7107  H  HD22 . ASN B 2 69  ? 15.069  -12.718 -3.334  1.00 0.00 ? 327 ASN A HD22 4  
ATOM   7108  N  N    . ASP B 2 70  ? 9.230   -10.926 -0.959  1.00 0.00 ? 328 ASP A N    4  
ATOM   7109  C  CA   . ASP B 2 70  ? 8.257   -10.101 -0.257  1.00 0.00 ? 328 ASP A CA   4  
ATOM   7110  C  C    . ASP B 2 70  ? 8.424   -10.143 1.256   1.00 0.00 ? 328 ASP A C    4  
ATOM   7111  O  O    . ASP B 2 70  ? 7.777   -9.382  1.976   1.00 0.00 ? 328 ASP A O    4  
ATOM   7112  C  CB   . ASP B 2 70  ? 6.844   -10.492 -0.640  1.00 0.00 ? 328 ASP A CB   4  
ATOM   7113  C  CG   . ASP B 2 70  ? 6.642   -11.994 -0.685  1.00 0.00 ? 328 ASP A CG   4  
ATOM   7114  O  OD1  . ASP B 2 70  ? 6.924   -12.601 -1.738  1.00 0.00 ? 328 ASP A OD1  4  
ATOM   7115  O  OD2  . ASP B 2 70  ? 6.203   -12.563 0.336   1.00 0.00 ? 328 ASP A OD2  4  
ATOM   7116  H  H    . ASP B 2 70  ? 8.923   -11.479 -1.686  1.00 0.00 ? 328 ASP A H    4  
ATOM   7117  H  HA   . ASP B 2 70  ? 8.418   -9.101  -0.582  1.00 0.00 ? 328 ASP A HA   4  
ATOM   7118  H  HB2  . ASP B 2 70  ? 6.157   -10.077 0.085   1.00 0.00 ? 328 ASP A HB2  4  
ATOM   7119  H  HB3  . ASP B 2 70  ? 6.628   -10.074 -1.614  1.00 0.00 ? 328 ASP A HB3  4  
ATOM   7120  N  N    . ASP B 2 71  ? 9.289   -11.025 1.742   1.00 0.00 ? 329 ASP A N    4  
ATOM   7121  C  CA   . ASP B 2 71  ? 9.551   -11.104 3.170   1.00 0.00 ? 329 ASP A CA   4  
ATOM   7122  C  C    . ASP B 2 71  ? 10.514  -9.983  3.507   1.00 0.00 ? 329 ASP A C    4  
ATOM   7123  O  O    . ASP B 2 71  ? 10.931  -9.796  4.650   1.00 0.00 ? 329 ASP A O    4  
ATOM   7124  C  CB   . ASP B 2 71  ? 10.143  -12.462 3.556   1.00 0.00 ? 329 ASP A CB   4  
ATOM   7125  C  CG   . ASP B 2 71  ? 10.346  -12.593 5.053   1.00 0.00 ? 329 ASP A CG   4  
ATOM   7126  O  OD1  . ASP B 2 71  ? 9.355   -12.449 5.803   1.00 0.00 ? 329 ASP A OD1  4  
ATOM   7127  O  OD2  . ASP B 2 71  ? 11.496  -12.832 5.476   1.00 0.00 ? 329 ASP A OD2  4  
ATOM   7128  H  H    . ASP B 2 71  ? 9.784   -11.602 1.126   1.00 0.00 ? 329 ASP A H    4  
ATOM   7129  H  HA   . ASP B 2 71  ? 8.621   -10.946 3.697   1.00 0.00 ? 329 ASP A HA   4  
ATOM   7130  H  HB2  . ASP B 2 71  ? 9.473   -13.244 3.233   1.00 0.00 ? 329 ASP A HB2  4  
ATOM   7131  H  HB3  . ASP B 2 71  ? 11.098  -12.584 3.067   1.00 0.00 ? 329 ASP A HB3  4  
ATOM   7132  N  N    . GLN B 2 72  ? 10.844  -9.240  2.456   1.00 0.00 ? 330 GLN A N    4  
ATOM   7133  C  CA   . GLN B 2 72  ? 11.737  -8.108  2.526   1.00 0.00 ? 330 GLN A CA   4  
ATOM   7134  C  C    . GLN B 2 72  ? 11.068  -6.913  1.878   1.00 0.00 ? 330 GLN A C    4  
ATOM   7135  O  O    . GLN B 2 72  ? 11.373  -5.767  2.185   1.00 0.00 ? 330 GLN A O    4  
ATOM   7136  C  CB   . GLN B 2 72  ? 13.040  -8.394  1.800   1.00 0.00 ? 330 GLN A CB   4  
ATOM   7137  C  CG   . GLN B 2 72  ? 13.409  -9.858  1.772   1.00 0.00 ? 330 GLN A CG   4  
ATOM   7138  C  CD   . GLN B 2 72  ? 14.222  -10.285 2.977   1.00 0.00 ? 330 GLN A CD   4  
ATOM   7139  O  OE1  . GLN B 2 72  ? 14.082  -11.403 3.473   1.00 0.00 ? 330 GLN A OE1  4  
ATOM   7140  N  NE2  . GLN B 2 72  ? 15.096  -9.399  3.441   1.00 0.00 ? 330 GLN A NE2  4  
ATOM   7141  H  H    . GLN B 2 72  ? 10.452  -9.464  1.589   1.00 0.00 ? 330 GLN A H    4  
ATOM   7142  H  HA   . GLN B 2 72  ? 11.945  -7.899  3.553   1.00 0.00 ? 330 GLN A HA   4  
ATOM   7143  H  HB2  . GLN B 2 72  ? 12.949  -8.047  0.788   1.00 0.00 ? 330 GLN A HB2  4  
ATOM   7144  H  HB3  . GLN B 2 72  ? 13.836  -7.852  2.287   1.00 0.00 ? 330 GLN A HB3  4  
ATOM   7145  H  HG2  . GLN B 2 72  ? 12.505  -10.443 1.730   1.00 0.00 ? 330 GLN A HG2  4  
ATOM   7146  H  HG3  . GLN B 2 72  ? 13.984  -10.036 0.892   1.00 0.00 ? 330 GLN A HG3  4  
ATOM   7147  H  HE21 . GLN B 2 72  ? 15.164  -8.533  2.987   1.00 0.00 ? 330 GLN A HE21 4  
ATOM   7148  H  HE22 . GLN B 2 72  ? 15.642  -9.647  4.214   1.00 0.00 ? 330 GLN A HE22 4  
ATOM   7149  N  N    . LEU B 2 73  ? 10.149  -7.188  0.961   1.00 0.00 ? 331 LEU A N    4  
ATOM   7150  C  CA   . LEU B 2 73  ? 9.450   -6.133  0.283   1.00 0.00 ? 331 LEU A CA   4  
ATOM   7151  C  C    . LEU B 2 73  ? 8.915   -5.150  1.283   1.00 0.00 ? 331 LEU A C    4  
ATOM   7152  O  O    . LEU B 2 73  ? 8.433   -5.518  2.355   1.00 0.00 ? 331 LEU A O    4  
ATOM   7153  C  CB   . LEU B 2 73  ? 8.338   -6.682  -0.588  1.00 0.00 ? 331 LEU A CB   4  
ATOM   7154  C  CG   . LEU B 2 73  ? 8.823   -7.287  -1.900  1.00 0.00 ? 331 LEU A CG   4  
ATOM   7155  C  CD1  . LEU B 2 73  ? 7.668   -7.811  -2.708  1.00 0.00 ? 331 LEU A CD1  4  
ATOM   7156  C  CD2  . LEU B 2 73  ? 9.607   -6.276  -2.697  1.00 0.00 ? 331 LEU A CD2  4  
ATOM   7157  H  H    . LEU B 2 73  ? 9.933   -8.112  0.749   1.00 0.00 ? 331 LEU A H    4  
ATOM   7158  H  HA   . LEU B 2 73  ? 10.162  -5.622  -0.349  1.00 0.00 ? 331 LEU A HA   4  
ATOM   7159  H  HB2  . LEU B 2 73  ? 7.807   -7.441  -0.031  1.00 0.00 ? 331 LEU A HB2  4  
ATOM   7160  H  HB3  . LEU B 2 73  ? 7.660   -5.880  -0.815  1.00 0.00 ? 331 LEU A HB3  4  
ATOM   7161  H  HG   . LEU B 2 73  ? 9.467   -8.113  -1.677  1.00 0.00 ? 331 LEU A HG   4  
ATOM   7162  H  HD11 . LEU B 2 73  ? 6.765   -7.460  -2.275  1.00 0.00 ? 331 LEU A HD11 4  
ATOM   7163  H  HD12 . LEU B 2 73  ? 7.680   -8.890  -2.703  1.00 0.00 ? 331 LEU A HD12 4  
ATOM   7164  H  HD13 . LEU B 2 73  ? 7.746   -7.452  -3.725  1.00 0.00 ? 331 LEU A HD13 4  
ATOM   7165  H  HD21 . LEU B 2 73  ? 8.979   -5.442  -2.909  1.00 0.00 ? 331 LEU A HD21 4  
ATOM   7166  H  HD22 . LEU B 2 73  ? 9.937   -6.723  -3.620  1.00 0.00 ? 331 LEU A HD22 4  
ATOM   7167  H  HD23 . LEU B 2 73  ? 10.464  -5.947  -2.127  1.00 0.00 ? 331 LEU A HD23 4  
ATOM   7168  N  N    . LEU B 2 74  ? 9.016   -3.905  0.920   1.00 0.00 ? 332 LEU A N    4  
ATOM   7169  C  CA   . LEU B 2 74  ? 8.589   -2.833  1.773   1.00 0.00 ? 332 LEU A CA   4  
ATOM   7170  C  C    . LEU B 2 74  ? 7.414   -2.134  1.164   1.00 0.00 ? 332 LEU A C    4  
ATOM   7171  O  O    . LEU B 2 74  ? 7.505   -1.527  0.104   1.00 0.00 ? 332 LEU A O    4  
ATOM   7172  C  CB   . LEU B 2 74  ? 9.718   -1.848  2.006   1.00 0.00 ? 332 LEU A CB   4  
ATOM   7173  C  CG   . LEU B 2 74  ? 10.867  -2.330  2.854   1.00 0.00 ? 332 LEU A CG   4  
ATOM   7174  C  CD1  . LEU B 2 74  ? 11.896  -1.251  2.990   1.00 0.00 ? 332 LEU A CD1  4  
ATOM   7175  C  CD2  . LEU B 2 74  ? 10.407  -2.694  4.222   1.00 0.00 ? 332 LEU A CD2  4  
ATOM   7176  H  H    . LEU B 2 74  ? 9.373   -3.701  0.027   1.00 0.00 ? 332 LEU A H    4  
ATOM   7177  H  HA   . LEU B 2 74  ? 8.280   -3.258  2.714   1.00 0.00 ? 332 LEU A HA   4  
ATOM   7178  H  HB2  . LEU B 2 74  ? 10.111  -1.548  1.048   1.00 0.00 ? 332 LEU A HB2  4  
ATOM   7179  H  HB3  . LEU B 2 74  ? 9.309   -0.988  2.489   1.00 0.00 ? 332 LEU A HB3  4  
ATOM   7180  H  HG   . LEU B 2 74  ? 11.339  -3.180  2.416   1.00 0.00 ? 332 LEU A HG   4  
ATOM   7181  H  HD11 . LEU B 2 74  ? 11.811  -0.799  3.974   1.00 0.00 ? 332 LEU A HD11 4  
ATOM   7182  H  HD12 . LEU B 2 74  ? 11.740  -0.510  2.232   1.00 0.00 ? 332 LEU A HD12 4  
ATOM   7183  H  HD13 . LEU B 2 74  ? 12.877  -1.675  2.880   1.00 0.00 ? 332 LEU A HD13 4  
ATOM   7184  H  HD21 . LEU B 2 74  ? 11.085  -2.215  4.902   1.00 0.00 ? 332 LEU A HD21 4  
ATOM   7185  H  HD22 . LEU B 2 74  ? 10.442  -3.767  4.352   1.00 0.00 ? 332 LEU A HD22 4  
ATOM   7186  H  HD23 . LEU B 2 74  ? 9.404   -2.331  4.387   1.00 0.00 ? 332 LEU A HD23 4  
ATOM   7187  N  N    . PHE B 2 75  ? 6.327   -2.198  1.872   1.00 0.00 ? 333 PHE A N    4  
ATOM   7188  C  CA   . PHE B 2 75  ? 5.092   -1.635  1.418   1.00 0.00 ? 333 PHE A CA   4  
ATOM   7189  C  C    . PHE B 2 75  ? 4.977   -0.199  1.846   1.00 0.00 ? 333 PHE A C    4  
ATOM   7190  O  O    . PHE B 2 75  ? 4.535   0.101   2.956   1.00 0.00 ? 333 PHE A O    4  
ATOM   7191  C  CB   . PHE B 2 75  ? 3.966   -2.496  1.981   1.00 0.00 ? 333 PHE A CB   4  
ATOM   7192  C  CG   . PHE B 2 75  ? 4.342   -3.954  1.877   1.00 0.00 ? 333 PHE A CG   4  
ATOM   7193  C  CD1  . PHE B 2 75  ? 5.092   -4.577  2.865   1.00 0.00 ? 333 PHE A CD1  4  
ATOM   7194  C  CD2  . PHE B 2 75  ? 4.010   -4.674  0.754   1.00 0.00 ? 333 PHE A CD2  4  
ATOM   7195  C  CE1  . PHE B 2 75  ? 5.497   -5.894  2.723   1.00 0.00 ? 333 PHE A CE1  4  
ATOM   7196  C  CE2  . PHE B 2 75  ? 4.417   -5.986  0.589   1.00 0.00 ? 333 PHE A CE2  4  
ATOM   7197  C  CZ   . PHE B 2 75  ? 5.167   -6.600  1.579   1.00 0.00 ? 333 PHE A CZ   4  
ATOM   7198  H  H    . PHE B 2 75  ? 6.361   -2.624  2.747   1.00 0.00 ? 333 PHE A H    4  
ATOM   7199  H  HA   . PHE B 2 75  ? 5.071   -1.687  0.341   1.00 0.00 ? 333 PHE A HA   4  
ATOM   7200  H  HB2  . PHE B 2 75  ? 3.799   -2.243  3.019   1.00 0.00 ? 333 PHE A HB2  4  
ATOM   7201  H  HB3  . PHE B 2 75  ? 3.061   -2.328  1.414   1.00 0.00 ? 333 PHE A HB3  4  
ATOM   7202  H  HD1  . PHE B 2 75  ? 5.352   -4.029  3.759   1.00 0.00 ? 333 PHE A HD1  4  
ATOM   7203  H  HD2  . PHE B 2 75  ? 3.441   -4.197  -0.019  1.00 0.00 ? 333 PHE A HD2  4  
ATOM   7204  H  HE1  . PHE B 2 75  ? 6.081   -6.367  3.499   1.00 0.00 ? 333 PHE A HE1  4  
ATOM   7205  H  HE2  . PHE B 2 75  ? 4.122   -6.533  -0.323  1.00 0.00 ? 333 PHE A HE2  4  
ATOM   7206  H  HZ   . PHE B 2 75  ? 5.507   -7.623  1.455   1.00 0.00 ? 333 PHE A HZ   4  
ATOM   7207  N  N    . CYS B 2 76  ? 5.390   0.697   0.957   1.00 0.00 ? 334 CYS A N    4  
ATOM   7208  C  CA   . CYS B 2 76  ? 5.294   2.101   1.247   1.00 0.00 ? 334 CYS A CA   4  
ATOM   7209  C  C    . CYS B 2 76  ? 3.840   2.407   1.471   1.00 0.00 ? 334 CYS A C    4  
ATOM   7210  O  O    . CYS B 2 76  ? 3.062   2.457   0.525   1.00 0.00 ? 334 CYS A O    4  
ATOM   7211  C  CB   . CYS B 2 76  ? 5.831   2.969   0.112   1.00 0.00 ? 334 CYS A CB   4  
ATOM   7212  S  SG   . CYS B 2 76  ? 5.408   4.722   0.338   1.00 0.00 ? 334 CYS A SG   4  
ATOM   7213  H  H    . CYS B 2 76  ? 5.759   0.400   0.100   1.00 0.00 ? 334 CYS A H    4  
ATOM   7214  H  HA   . CYS B 2 76  ? 5.845   2.301   2.155   1.00 0.00 ? 334 CYS A HA   4  
ATOM   7215  H  HB2  . CYS B 2 76  ? 6.910   2.889   0.071   1.00 0.00 ? 334 CYS A HB2  4  
ATOM   7216  H  HB3  . CYS B 2 76  ? 5.410   2.642   -0.826  1.00 0.00 ? 334 CYS A HB3  4  
ATOM   7217  N  N    . ASP B 2 77  ? 3.460   2.599   2.711   1.00 0.00 ? 335 ASP A N    4  
ATOM   7218  C  CA   . ASP B 2 77  ? 2.067   2.856   3.001   1.00 0.00 ? 335 ASP A CA   4  
ATOM   7219  C  C    . ASP B 2 77  ? 1.711   4.299   2.653   1.00 0.00 ? 335 ASP A C    4  
ATOM   7220  O  O    . ASP B 2 77  ? 0.796   4.881   3.234   1.00 0.00 ? 335 ASP A O    4  
ATOM   7221  C  CB   . ASP B 2 77  ? 1.742   2.563   4.463   1.00 0.00 ? 335 ASP A CB   4  
ATOM   7222  C  CG   . ASP B 2 77  ? 2.338   3.582   5.414   1.00 0.00 ? 335 ASP A CG   4  
ATOM   7223  O  OD1  . ASP B 2 77  ? 3.560   3.825   5.336   1.00 0.00 ? 335 ASP A OD1  4  
ATOM   7224  O  OD2  . ASP B 2 77  ? 1.581   4.132   6.242   1.00 0.00 ? 335 ASP A OD2  4  
ATOM   7225  H  H    . ASP B 2 77  ? 4.127   2.597   3.432   1.00 0.00 ? 335 ASP A H    4  
ATOM   7226  H  HA   . ASP B 2 77  ? 1.489   2.184   2.375   1.00 0.00 ? 335 ASP A HA   4  
ATOM   7227  H  HB2  . ASP B 2 77  ? 0.669   2.567   4.582   1.00 0.00 ? 335 ASP A HB2  4  
ATOM   7228  H  HB3  . ASP B 2 77  ? 2.125   1.587   4.721   1.00 0.00 ? 335 ASP A HB3  4  
ATOM   7229  N  N    . ASP B 2 78  ? 2.447   4.868   1.698   1.00 0.00 ? 336 ASP A N    4  
ATOM   7230  C  CA   . ASP B 2 78  ? 2.227   6.241   1.270   1.00 0.00 ? 336 ASP A CA   4  
ATOM   7231  C  C    . ASP B 2 78  ? 1.955   6.310   -0.233  1.00 0.00 ? 336 ASP A C    4  
ATOM   7232  O  O    . ASP B 2 78  ? 1.981   7.387   -0.829  1.00 0.00 ? 336 ASP A O    4  
ATOM   7233  C  CB   . ASP B 2 78  ? 3.445   7.090   1.620   1.00 0.00 ? 336 ASP A CB   4  
ATOM   7234  C  CG   . ASP B 2 78  ? 3.125   8.566   1.724   1.00 0.00 ? 336 ASP A CG   4  
ATOM   7235  O  OD1  . ASP B 2 78  ? 2.708   9.006   2.817   1.00 0.00 ? 336 ASP A OD1  4  
ATOM   7236  O  OD2  . ASP B 2 78  ? 3.294   9.285   0.718   1.00 0.00 ? 336 ASP A OD2  4  
ATOM   7237  H  H    . ASP B 2 78  ? 3.157   4.350   1.271   1.00 0.00 ? 336 ASP A H    4  
ATOM   7238  H  HA   . ASP B 2 78  ? 1.365   6.619   1.798   1.00 0.00 ? 336 ASP A HA   4  
ATOM   7239  H  HB2  . ASP B 2 78  ? 3.848   6.760   2.565   1.00 0.00 ? 336 ASP A HB2  4  
ATOM   7240  H  HB3  . ASP B 2 78  ? 4.189   6.955   0.852   1.00 0.00 ? 336 ASP A HB3  4  
ATOM   7241  N  N    . CYS B 2 79  ? 1.678   5.147   -0.826  1.00 0.00 ? 337 CYS A N    4  
ATOM   7242  C  CA   . CYS B 2 79  ? 1.371   5.024   -2.245  1.00 0.00 ? 337 CYS A CA   4  
ATOM   7243  C  C    . CYS B 2 79  ? 1.302   3.545   -2.629  1.00 0.00 ? 337 CYS A C    4  
ATOM   7244  O  O    . CYS B 2 79  ? 0.790   3.194   -3.692  1.00 0.00 ? 337 CYS A O    4  
ATOM   7245  C  CB   . CYS B 2 79  ? 2.411   5.727   -3.115  1.00 0.00 ? 337 CYS A CB   4  
ATOM   7246  S  SG   . CYS B 2 79  ? 4.011   4.872   -3.177  1.00 0.00 ? 337 CYS A SG   4  
ATOM   7247  H  H    . CYS B 2 79  ? 1.667   4.342   -0.288  1.00 0.00 ? 337 CYS A H    4  
ATOM   7248  H  HA   . CYS B 2 79  ? 0.400   5.478   -2.398  1.00 0.00 ? 337 CYS A HA   4  
ATOM   7249  H  HB2  . CYS B 2 79  ? 2.037   5.791   -4.126  1.00 0.00 ? 337 CYS A HB2  4  
ATOM   7250  H  HB3  . CYS B 2 79  ? 2.577   6.719   -2.740  1.00 0.00 ? 337 CYS A HB3  4  
ATOM   7251  N  N    . ASP B 2 80  ? 1.874   2.705   -1.755  1.00 0.00 ? 338 ASP A N    4  
ATOM   7252  C  CA   . ASP B 2 80  ? 1.879   1.238   -1.899  1.00 0.00 ? 338 ASP A CA   4  
ATOM   7253  C  C    . ASP B 2 80  ? 3.109   0.676   -2.635  1.00 0.00 ? 338 ASP A C    4  
ATOM   7254  O  O    . ASP B 2 80  ? 3.241   -0.542  -2.767  1.00 0.00 ? 338 ASP A O    4  
ATOM   7255  C  CB   . ASP B 2 80  ? 0.595   0.751   -2.572  1.00 0.00 ? 338 ASP A CB   4  
ATOM   7256  C  CG   . ASP B 2 80  ? 0.479   -0.760  -2.575  1.00 0.00 ? 338 ASP A CG   4  
ATOM   7257  O  OD1  . ASP B 2 80  ? 0.991   -1.395  -1.626  1.00 0.00 ? 338 ASP A OD1  4  
ATOM   7258  O  OD2  . ASP B 2 80  ? -0.117  -1.310  -3.524  1.00 0.00 ? 338 ASP A OD2  4  
ATOM   7259  H  H    . ASP B 2 80  ? 2.318   3.092   -0.975  1.00 0.00 ? 338 ASP A H    4  
ATOM   7260  H  HA   . ASP B 2 80  ? 1.895   0.838   -0.896  1.00 0.00 ? 338 ASP A HA   4  
ATOM   7261  H  HB2  . ASP B 2 80  ? -0.258  1.159   -2.050  1.00 0.00 ? 338 ASP A HB2  4  
ATOM   7262  H  HB3  . ASP B 2 80  ? 0.583   1.098   -3.592  1.00 0.00 ? 338 ASP A HB3  4  
ATOM   7263  N  N    . ARG B 2 81  ? 4.008   1.534   -3.110  1.00 0.00 ? 339 ARG A N    4  
ATOM   7264  C  CA   . ARG B 2 81  ? 5.215   1.066   -3.804  1.00 0.00 ? 339 ARG A CA   4  
ATOM   7265  C  C    . ARG B 2 81  ? 6.007   0.088   -2.930  1.00 0.00 ? 339 ARG A C    4  
ATOM   7266  O  O    . ARG B 2 81  ? 6.353   0.403   -1.792  1.00 0.00 ? 339 ARG A O    4  
ATOM   7267  C  CB   . ARG B 2 81  ? 6.077   2.258   -4.197  1.00 0.00 ? 339 ARG A CB   4  
ATOM   7268  C  CG   . ARG B 2 81  ? 5.489   3.036   -5.360  1.00 0.00 ? 339 ARG A CG   4  
ATOM   7269  C  CD   . ARG B 2 81  ? 6.254   2.781   -6.646  1.00 0.00 ? 339 ARG A CD   4  
ATOM   7270  N  NE   . ARG B 2 81  ? 5.466   3.138   -7.825  1.00 0.00 ? 339 ARG A NE   4  
ATOM   7271  C  CZ   . ARG B 2 81  ? 5.991   3.583   -8.965  1.00 0.00 ? 339 ARG A CZ   4  
ATOM   7272  N  NH1  . ARG B 2 81  ? 7.300   3.753   -9.077  1.00 0.00 ? 339 ARG A NH1  4  
ATOM   7273  N  NH2  . ARG B 2 81  ? 5.204   3.866   -9.993  1.00 0.00 ? 339 ARG A NH2  4  
ATOM   7274  H  H    . ARG B 2 81  ? 3.861   2.496   -3.003  1.00 0.00 ? 339 ARG A H    4  
ATOM   7275  H  HA   . ARG B 2 81  ? 4.906   0.557   -4.703  1.00 0.00 ? 339 ARG A HA   4  
ATOM   7276  H  HB2  . ARG B 2 81  ? 6.170   2.922   -3.350  1.00 0.00 ? 339 ARG A HB2  4  
ATOM   7277  H  HB3  . ARG B 2 81  ? 7.055   1.905   -4.483  1.00 0.00 ? 339 ARG A HB3  4  
ATOM   7278  H  HG2  . ARG B 2 81  ? 4.461   2.730   -5.499  1.00 0.00 ? 339 ARG A HG2  4  
ATOM   7279  H  HG3  . ARG B 2 81  ? 5.525   4.089   -5.129  1.00 0.00 ? 339 ARG A HG3  4  
ATOM   7280  H  HD2  . ARG B 2 81  ? 7.170   3.375   -6.636  1.00 0.00 ? 339 ARG A HD2  4  
ATOM   7281  H  HD3  . ARG B 2 81  ? 6.503   1.732   -6.692  1.00 0.00 ? 339 ARG A HD3  4  
ATOM   7282  H  HE   . ARG B 2 81  ? 4.495   3.035   -7.765  1.00 0.00 ? 339 ARG A HE   4  
ATOM   7283  H  HH11 . ARG B 2 81  ? 7.898   3.548   -8.303  1.00 0.00 ? 339 ARG A HH11 4  
ATOM   7284  H  HH12 . ARG B 2 81  ? 7.691   4.084   -9.936  1.00 0.00 ? 339 ARG A HH12 4  
ATOM   7285  H  HH21 . ARG B 2 81  ? 4.214   3.747   -9.913  1.00 0.00 ? 339 ARG A HH21 4  
ATOM   7286  H  HH22 . ARG B 2 81  ? 5.598   4.199   -10.849 1.00 0.00 ? 339 ARG A HH22 4  
ATOM   7287  N  N    . GLY B 2 82  ? 6.296   -1.099  -3.474  1.00 0.00 ? 340 GLY A N    4  
ATOM   7288  C  CA   . GLY B 2 82  ? 7.024   -2.110  -2.716  1.00 0.00 ? 340 GLY A CA   4  
ATOM   7289  C  C    . GLY B 2 82  ? 8.489   -2.233  -3.101  1.00 0.00 ? 340 GLY A C    4  
ATOM   7290  O  O    . GLY B 2 82  ? 8.819   -2.328  -4.275  1.00 0.00 ? 340 GLY A O    4  
ATOM   7291  H  H    . GLY B 2 82  ? 6.014   -1.289  -4.394  1.00 0.00 ? 340 GLY A H    4  
ATOM   7292  H  HA2  . GLY B 2 82  ? 6.960   -1.866  -1.673  1.00 0.00 ? 340 GLY A HA2  4  
ATOM   7293  H  HA3  . GLY B 2 82  ? 6.552   -3.072  -2.867  1.00 0.00 ? 340 GLY A HA3  4  
ATOM   7294  N  N    . TYR B 2 83  ? 9.372   -2.213  -2.106  1.00 0.00 ? 341 TYR A N    4  
ATOM   7295  C  CA   . TYR B 2 83  ? 10.810  -2.360  -2.341  1.00 0.00 ? 341 TYR A CA   4  
ATOM   7296  C  C    . TYR B 2 83  ? 11.382  -3.352  -1.352  1.00 0.00 ? 341 TYR A C    4  
ATOM   7297  O  O    . TYR B 2 83  ? 11.213  -3.178  -0.154  1.00 0.00 ? 341 TYR A O    4  
ATOM   7298  C  CB   . TYR B 2 83  ? 11.634  -1.101  -2.057  1.00 0.00 ? 341 TYR A CB   4  
ATOM   7299  C  CG   . TYR B 2 83  ? 11.273  0.226   -2.691  1.00 0.00 ? 341 TYR A CG   4  
ATOM   7300  C  CD1  . TYR B 2 83  ? 10.041  0.488   -3.233  1.00 0.00 ? 341 TYR A CD1  4  
ATOM   7301  C  CD2  . TYR B 2 83  ? 12.198  1.265   -2.645  1.00 0.00 ? 341 TYR A CD2  4  
ATOM   7302  C  CE1  . TYR B 2 83  ? 9.733   1.737   -3.719  1.00 0.00 ? 341 TYR A CE1  4  
ATOM   7303  C  CE2  . TYR B 2 83  ? 11.901  2.509   -3.145  1.00 0.00 ? 341 TYR A CE2  4  
ATOM   7304  C  CZ   . TYR B 2 83  ? 10.661  2.735   -3.681  1.00 0.00 ? 341 TYR A CZ   4  
ATOM   7305  O  OH   . TYR B 2 83  ? 10.329  3.971   -4.162  1.00 0.00 ? 341 TYR A OH   4  
ATOM   7306  H  H    . TYR B 2 83  ? 9.049   -2.116  -1.191  1.00 0.00 ? 341 TYR A H    4  
ATOM   7307  H  HA   . TYR B 2 83  ? 10.971  -2.703  -3.350  1.00 0.00 ? 341 TYR A HA   4  
ATOM   7308  H  HB2  . TYR B 2 83  ? 11.612  -0.944  -0.995  1.00 0.00 ? 341 TYR A HB2  4  
ATOM   7309  H  HB3  . TYR B 2 83  ? 12.654  -1.310  -2.322  1.00 0.00 ? 341 TYR A HB3  4  
ATOM   7310  H  HD1  . TYR B 2 83  ? 9.322   -0.298  -3.300  1.00 0.00 ? 341 TYR A HD1  4  
ATOM   7311  H  HD2  . TYR B 2 83  ? 13.175  1.077   -2.221  1.00 0.00 ? 341 TYR A HD2  4  
ATOM   7312  H  HE1  . TYR B 2 83  ? 8.762   1.928   -4.126  1.00 0.00 ? 341 TYR A HE1  4  
ATOM   7313  H  HE2  . TYR B 2 83  ? 12.638  3.298   -3.114  1.00 0.00 ? 341 TYR A HE2  4  
ATOM   7314  H  HH   . TYR B 2 83  ? 9.410   4.159   -3.958  1.00 0.00 ? 341 TYR A HH   4  
ATOM   7315  N  N    . HIS B 2 84  ? 12.136  -4.325  -1.810  1.00 0.00 ? 342 HIS A N    4  
ATOM   7316  C  CA   . HIS B 2 84  ? 12.729  -5.250  -0.861  1.00 0.00 ? 342 HIS A CA   4  
ATOM   7317  C  C    . HIS B 2 84  ? 13.686  -4.403  -0.036  1.00 0.00 ? 342 HIS A C    4  
ATOM   7318  O  O    . HIS B 2 84  ? 14.545  -3.785  -0.624  1.00 0.00 ? 342 HIS A O    4  
ATOM   7319  C  CB   . HIS B 2 84  ? 13.505  -6.383  -1.556  1.00 0.00 ? 342 HIS A CB   4  
ATOM   7320  C  CG   . HIS B 2 84  ? 12.683  -7.353  -2.360  1.00 0.00 ? 342 HIS A CG   4  
ATOM   7321  N  ND1  . HIS B 2 84  ? 12.620  -7.348  -3.738  1.00 0.00 ? 342 HIS A ND1  4  
ATOM   7322  C  CD2  . HIS B 2 84  ? 11.896  -8.372  -1.969  1.00 0.00 ? 342 HIS A CD2  4  
ATOM   7323  C  CE1  . HIS B 2 84  ? 11.836  -8.318  -4.161  1.00 0.00 ? 342 HIS A CE1  4  
ATOM   7324  N  NE2  . HIS B 2 84  ? 11.384  -8.962  -3.103  1.00 0.00 ? 342 HIS A NE2  4  
ATOM   7325  H  H    . HIS B 2 84  ? 12.364  -4.363  -2.756  1.00 0.00 ? 342 HIS A H    4  
ATOM   7326  H  HA   . HIS B 2 84  ? 11.954  -5.652  -0.224  1.00 0.00 ? 342 HIS A HA   4  
ATOM   7327  H  HB2  . HIS B 2 84  ? 14.231  -5.950  -2.215  1.00 0.00 ? 342 HIS A HB2  4  
ATOM   7328  H  HB3  . HIS B 2 84  ? 14.017  -6.943  -0.800  1.00 0.00 ? 342 HIS A HB3  4  
ATOM   7329  H  HD2  . HIS B 2 84  ? 11.673  -8.645  -0.951  1.00 0.00 ? 342 HIS A HD2  4  
ATOM   7330  H  HE1  . HIS B 2 84  ? 11.552  -8.502  -5.194  1.00 0.00 ? 342 HIS A HE1  4  
ATOM   7331  H  HE2  . HIS B 2 84  ? 10.819  -9.763  -3.125  1.00 0.00 ? 342 HIS A HE2  4  
ATOM   7332  N  N    . MET B 2 85  ? 13.508  -4.301  1.287   1.00 0.00 ? 343 MET A N    4  
ATOM   7333  C  CA   . MET B 2 85  ? 14.391  -3.444  2.114   1.00 0.00 ? 343 MET A CA   4  
ATOM   7334  C  C    . MET B 2 85  ? 15.802  -3.355  1.575   1.00 0.00 ? 343 MET A C    4  
ATOM   7335  O  O    . MET B 2 85  ? 16.481  -2.347  1.761   1.00 0.00 ? 343 MET A O    4  
ATOM   7336  C  CB   . MET B 2 85  ? 14.521  -3.905  3.569   1.00 0.00 ? 343 MET A CB   4  
ATOM   7337  C  CG   . MET B 2 85  ? 13.246  -4.105  4.329   1.00 0.00 ? 343 MET A CG   4  
ATOM   7338  S  SD   . MET B 2 85  ? 12.680  -5.811  4.435   1.00 0.00 ? 343 MET A SD   4  
ATOM   7339  C  CE   . MET B 2 85  ? 14.220  -6.702  4.610   1.00 0.00 ? 343 MET A CE   4  
ATOM   7340  H  H    . MET B 2 85  ? 12.763  -4.770  1.704   1.00 0.00 ? 343 MET A H    4  
ATOM   7341  H  HA   . MET B 2 85  ? 13.978  -2.445  2.094   1.00 0.00 ? 343 MET A HA   4  
ATOM   7342  H  HB2  . MET B 2 85  ? 15.086  -4.817  3.601   1.00 0.00 ? 343 MET A HB2  4  
ATOM   7343  H  HB3  . MET B 2 85  ? 15.063  -3.137  4.091   1.00 0.00 ? 343 MET A HB3  4  
ATOM   7344  H  HG2  . MET B 2 85  ? 13.400  -3.748  5.330   1.00 0.00 ? 343 MET A HG2  4  
ATOM   7345  H  HG3  . MET B 2 85  ? 12.500  -3.511  3.852   1.00 0.00 ? 343 MET A HG3  4  
ATOM   7346  H  HE1  . MET B 2 85  ? 14.764  -6.651  3.681   1.00 0.00 ? 343 MET A HE1  4  
ATOM   7347  H  HE2  . MET B 2 85  ? 14.015  -7.734  4.853   1.00 0.00 ? 343 MET A HE2  4  
ATOM   7348  H  HE3  . MET B 2 85  ? 14.807  -6.256  5.395   1.00 0.00 ? 343 MET A HE3  4  
ATOM   7349  N  N    . TYR B 2 86  ? 16.254  -4.403  0.931   1.00 0.00 ? 344 TYR A N    4  
ATOM   7350  C  CA   . TYR B 2 86  ? 17.601  -4.398  0.397   1.00 0.00 ? 344 TYR A CA   4  
ATOM   7351  C  C    . TYR B 2 86  ? 17.584  -4.038  -1.079  1.00 0.00 ? 344 TYR A C    4  
ATOM   7352  O  O    . TYR B 2 86  ? 18.440  -4.477  -1.847  1.00 0.00 ? 344 TYR A O    4  
ATOM   7353  C  CB   . TYR B 2 86  ? 18.308  -5.736  0.649   1.00 0.00 ? 344 TYR A CB   4  
ATOM   7354  C  CG   . TYR B 2 86  ? 17.762  -6.903  -0.138  1.00 0.00 ? 344 TYR A CG   4  
ATOM   7355  C  CD1  . TYR B 2 86  ? 16.439  -7.299  -0.011  1.00 0.00 ? 344 TYR A CD1  4  
ATOM   7356  C  CD2  . TYR B 2 86  ? 18.584  -7.624  -0.996  1.00 0.00 ? 344 TYR A CD2  4  
ATOM   7357  C  CE1  . TYR B 2 86  ? 15.951  -8.374  -0.713  1.00 0.00 ? 344 TYR A CE1  4  
ATOM   7358  C  CE2  . TYR B 2 86  ? 18.098  -8.703  -1.708  1.00 0.00 ? 344 TYR A CE2  4  
ATOM   7359  C  CZ   . TYR B 2 86  ? 16.780  -9.075  -1.563  1.00 0.00 ? 344 TYR A CZ   4  
ATOM   7360  O  OH   . TYR B 2 86  ? 16.291  -10.150 -2.267  1.00 0.00 ? 344 TYR A OH   4  
ATOM   7361  H  H    . TYR B 2 86  ? 15.659  -5.172  0.780   1.00 0.00 ? 344 TYR A H    4  
ATOM   7362  H  HA   . TYR B 2 86  ? 18.143  -3.622  0.921   1.00 0.00 ? 344 TYR A HA   4  
ATOM   7363  H  HB2  . TYR B 2 86  ? 19.350  -5.633  0.396   1.00 0.00 ? 344 TYR A HB2  4  
ATOM   7364  H  HB3  . TYR B 2 86  ? 18.224  -5.979  1.698   1.00 0.00 ? 344 TYR A HB3  4  
ATOM   7365  H  HD1  . TYR B 2 86  ? 15.780  -6.751  0.646   1.00 0.00 ? 344 TYR A HD1  4  
ATOM   7366  H  HD2  . TYR B 2 86  ? 19.617  -7.328  -1.106  1.00 0.00 ? 344 TYR A HD2  4  
ATOM   7367  H  HE1  . TYR B 2 86  ? 14.919  -8.654  -0.596  1.00 0.00 ? 344 TYR A HE1  4  
ATOM   7368  H  HE2  . TYR B 2 86  ? 18.751  -9.250  -2.372  1.00 0.00 ? 344 TYR A HE2  4  
ATOM   7369  H  HH   . TYR B 2 86  ? 15.490  -9.893  -2.729  1.00 0.00 ? 344 TYR A HH   4  
ATOM   7370  N  N    . CYS B 2 87  ? 16.598  -3.228  -1.474  1.00 0.00 ? 345 CYS A N    4  
ATOM   7371  C  CA   . CYS B 2 87  ? 16.491  -2.794  -2.849  1.00 0.00 ? 345 CYS A CA   4  
ATOM   7372  C  C    . CYS B 2 87  ? 16.499  -1.291  -2.896  1.00 0.00 ? 345 CYS A C    4  
ATOM   7373  O  O    . CYS B 2 87  ? 16.893  -0.675  -3.887  1.00 0.00 ? 345 CYS A O    4  
ATOM   7374  C  CB   . CYS B 2 87  ? 15.219  -3.342  -3.503  1.00 0.00 ? 345 CYS A CB   4  
ATOM   7375  S  SG   . CYS B 2 87  ? 15.376  -5.089  -3.928  1.00 0.00 ? 345 CYS A SG   4  
ATOM   7376  H  H    . CYS B 2 87  ? 15.916  -2.913  -0.817  1.00 0.00 ? 345 CYS A H    4  
ATOM   7377  H  HA   . CYS B 2 87  ? 17.346  -3.174  -3.366  1.00 0.00 ? 345 CYS A HA   4  
ATOM   7378  H  HB2  . CYS B 2 87  ? 14.391  -3.235  -2.821  1.00 0.00 ? 345 CYS A HB2  4  
ATOM   7379  H  HB3  . CYS B 2 87  ? 15.003  -2.790  -4.412  1.00 0.00 ? 345 CYS A HB3  4  
ATOM   7380  N  N    . LEU B 2 88  ? 16.065  -0.717  -1.791  1.00 0.00 ? 346 LEU A N    4  
ATOM   7381  C  CA   . LEU B 2 88  ? 15.968  0.724   -1.654  1.00 0.00 ? 346 LEU A CA   4  
ATOM   7382  C  C    . LEU B 2 88  ? 17.293  1.421   -1.944  1.00 0.00 ? 346 LEU A C    4  
ATOM   7383  O  O    . LEU B 2 88  ? 18.303  0.779   -2.239  1.00 0.00 ? 346 LEU A O    4  
ATOM   7384  C  CB   . LEU B 2 88  ? 15.501  1.091   -0.241  1.00 0.00 ? 346 LEU A CB   4  
ATOM   7385  C  CG   . LEU B 2 88  ? 15.013  -0.085  0.597   1.00 0.00 ? 346 LEU A CG   4  
ATOM   7386  C  CD1  . LEU B 2 88  ? 14.604  0.343   1.973   1.00 0.00 ? 346 LEU A CD1  4  
ATOM   7387  C  CD2  . LEU B 2 88  ? 13.849  -0.768  -0.062  1.00 0.00 ? 346 LEU A CD2  4  
ATOM   7388  H  H    . LEU B 2 88  ? 15.787  -1.292  -1.038  1.00 0.00 ? 346 LEU A H    4  
ATOM   7389  H  HA   . LEU B 2 88  ? 15.232  1.053   -2.356  1.00 0.00 ? 346 LEU A HA   4  
ATOM   7390  H  HB2  . LEU B 2 88  ? 16.323  1.557   0.276   1.00 0.00 ? 346 LEU A HB2  4  
ATOM   7391  H  HB3  . LEU B 2 88  ? 14.697  1.805   -0.322  1.00 0.00 ? 346 LEU A HB3  4  
ATOM   7392  H  HG   . LEU B 2 88  ? 15.804  -0.803  0.693   1.00 0.00 ? 346 LEU A HG   4  
ATOM   7393  H  HD11 . LEU B 2 88  ? 13.898  -0.387  2.342   1.00 0.00 ? 346 LEU A HD11 4  
ATOM   7394  H  HD12 . LEU B 2 88  ? 14.139  1.317   1.931   1.00 0.00 ? 346 LEU A HD12 4  
ATOM   7395  H  HD13 . LEU B 2 88  ? 15.467  0.373   2.620   1.00 0.00 ? 346 LEU A HD13 4  
ATOM   7396  H  HD21 . LEU B 2 88  ? 13.816  -0.480  -1.096  1.00 0.00 ? 346 LEU A HD21 4  
ATOM   7397  H  HD22 . LEU B 2 88  ? 12.931  -0.472  0.425   1.00 0.00 ? 346 LEU A HD22 4  
ATOM   7398  H  HD23 . LEU B 2 88  ? 13.968  -1.838  0.012   1.00 0.00 ? 346 LEU A HD23 4  
ATOM   7399  N  N    . ASN B 2 89  ? 17.272  2.743   -1.855  1.00 0.00 ? 347 ASN A N    4  
ATOM   7400  C  CA   . ASN B 2 89  ? 18.459  3.555   -2.059  1.00 0.00 ? 347 ASN A CA   4  
ATOM   7401  C  C    . ASN B 2 89  ? 19.218  3.603   -0.761  1.00 0.00 ? 347 ASN A C    4  
ATOM   7402  O  O    . ASN B 2 89  ? 20.445  3.487   -0.740  1.00 0.00 ? 347 ASN A O    4  
ATOM   7403  C  CB   . ASN B 2 89  ? 18.074  4.951   -2.507  1.00 0.00 ? 347 ASN A CB   4  
ATOM   7404  C  CG   . ASN B 2 89  ? 19.159  5.644   -3.269  1.00 0.00 ? 347 ASN A CG   4  
ATOM   7405  O  OD1  . ASN B 2 89  ? 20.081  5.018   -3.790  1.00 0.00 ? 347 ASN A OD1  4  
ATOM   7406  N  ND2  . ASN B 2 89  ? 19.039  6.949   -3.349  1.00 0.00 ? 347 ASN A ND2  4  
ATOM   7407  H  H    . ASN B 2 89  ? 16.436  3.187   -1.622  1.00 0.00 ? 347 ASN A H    4  
ATOM   7408  H  HA   . ASN B 2 89  ? 19.073  3.091   -2.800  1.00 0.00 ? 347 ASN A HA   4  
ATOM   7409  H  HB2  . ASN B 2 89  ? 17.216  4.890   -3.138  1.00 0.00 ? 347 ASN A HB2  4  
ATOM   7410  H  HB3  . ASN B 2 89  ? 17.838  5.548   -1.640  1.00 0.00 ? 347 ASN A HB3  4  
ATOM   7411  H  HD21 . ASN B 2 89  ? 18.269  7.373   -2.914  1.00 0.00 ? 347 ASN A HD21 4  
ATOM   7412  H  HD22 . ASN B 2 89  ? 19.704  7.429   -3.841  1.00 0.00 ? 347 ASN A HD22 4  
ATOM   7413  N  N    . PRO B 2 90  ? 18.489  3.811   0.352   1.00 0.00 ? 348 PRO A N    4  
ATOM   7414  C  CA   . PRO B 2 90  ? 19.024  3.795   1.677   1.00 0.00 ? 348 PRO A CA   4  
ATOM   7415  C  C    . PRO B 2 90  ? 18.433  2.616   2.453   1.00 0.00 ? 348 PRO A C    4  
ATOM   7416  O  O    . PRO B 2 90  ? 17.822  2.790   3.507   1.00 0.00 ? 348 PRO A O    4  
ATOM   7417  C  CB   . PRO B 2 90  ? 18.497  5.112   2.160   1.00 0.00 ? 348 PRO A CB   4  
ATOM   7418  C  CG   . PRO B 2 90  ? 17.123  5.197   1.588   1.00 0.00 ? 348 PRO A CG   4  
ATOM   7419  C  CD   . PRO B 2 90  ? 17.082  4.221   0.439   1.00 0.00 ? 348 PRO A CD   4  
ATOM   7420  H  HA   . PRO B 2 90  ? 20.095  3.782   1.693   1.00 0.00 ? 348 PRO A HA   4  
ATOM   7421  H  HB2  . PRO B 2 90  ? 18.482  5.139   3.227   1.00 0.00 ? 348 PRO A HB2  4  
ATOM   7422  H  HB3  . PRO B 2 90  ? 19.129  5.884   1.766   1.00 0.00 ? 348 PRO A HB3  4  
ATOM   7423  H  HG2  . PRO B 2 90  ? 16.391  4.931   2.337   1.00 0.00 ? 348 PRO A HG2  4  
ATOM   7424  H  HG3  . PRO B 2 90  ? 16.955  6.192   1.235   1.00 0.00 ? 348 PRO A HG3  4  
ATOM   7425  H  HD2  . PRO B 2 90  ? 16.441  3.384   0.669   1.00 0.00 ? 348 PRO A HD2  4  
ATOM   7426  H  HD3  . PRO B 2 90  ? 16.764  4.716   -0.457  1.00 0.00 ? 348 PRO A HD3  4  
ATOM   7427  N  N    . PRO B 2 91  ? 18.615  1.400   1.897   1.00 0.00 ? 349 PRO A N    4  
ATOM   7428  C  CA   . PRO B 2 91  ? 18.104  0.142   2.417   1.00 0.00 ? 349 PRO A CA   4  
ATOM   7429  C  C    . PRO B 2 91  ? 17.908  0.083   3.926   1.00 0.00 ? 349 PRO A C    4  
ATOM   7430  O  O    . PRO B 2 91  ? 18.605  0.738   4.701   1.00 0.00 ? 349 PRO A O    4  
ATOM   7431  C  CB   . PRO B 2 91  ? 19.171  -0.866  1.982   1.00 0.00 ? 349 PRO A CB   4  
ATOM   7432  C  CG   . PRO B 2 91  ? 20.102  -0.126  1.078   1.00 0.00 ? 349 PRO A CG   4  
ATOM   7433  C  CD   . PRO B 2 91  ? 19.386  1.129   0.696   1.00 0.00 ? 349 PRO A CD   4  
ATOM   7434  H  HA   . PRO B 2 91  ? 17.178  -0.117  1.931   1.00 0.00 ? 349 PRO A HA   4  
ATOM   7435  H  HB2  . PRO B 2 91  ? 19.683  -1.229  2.842   1.00 0.00 ? 349 PRO A HB2  4  
ATOM   7436  H  HB3  . PRO B 2 91  ? 18.696  -1.688  1.470   1.00 0.00 ? 349 PRO A HB3  4  
ATOM   7437  H  HG2  . PRO B 2 91  ? 21.016  0.108   1.599   1.00 0.00 ? 349 PRO A HG2  4  
ATOM   7438  H  HG3  . PRO B 2 91  ? 20.307  -0.723  0.210   1.00 0.00 ? 349 PRO A HG3  4  
ATOM   7439  H  HD2  . PRO B 2 91  ? 20.078  1.935   0.496   1.00 0.00 ? 349 PRO A HD2  4  
ATOM   7440  H  HD3  . PRO B 2 91  ? 18.739  0.958   -0.147  1.00 0.00 ? 349 PRO A HD3  4  
ATOM   7441  N  N    . VAL B 2 92  ? 16.949  -0.745  4.312   1.00 0.00 ? 350 VAL A N    4  
ATOM   7442  C  CA   . VAL B 2 92  ? 16.600  -0.974  5.699   1.00 0.00 ? 350 VAL A CA   4  
ATOM   7443  C  C    . VAL B 2 92  ? 16.674  -2.472  5.960   1.00 0.00 ? 350 VAL A C    4  
ATOM   7444  O  O    . VAL B 2 92  ? 16.929  -3.252  5.043   1.00 0.00 ? 350 VAL A O    4  
ATOM   7445  C  CB   . VAL B 2 92  ? 15.199  -0.386  6.003   1.00 0.00 ? 350 VAL A CB   4  
ATOM   7446  C  CG1  . VAL B 2 92  ? 14.203  -0.812  4.956   1.00 0.00 ? 350 VAL A CG1  4  
ATOM   7447  C  CG2  . VAL B 2 92  ? 14.690  -0.735  7.386   1.00 0.00 ? 350 VAL A CG2  4  
ATOM   7448  H  H    . VAL B 2 92  ? 16.457  -1.238  3.627   1.00 0.00 ? 350 VAL A H    4  
ATOM   7449  H  HA   . VAL B 2 92  ? 17.328  -0.478  6.324   1.00 0.00 ? 350 VAL A HA   4  
ATOM   7450  H  HB   . VAL B 2 92  ? 15.283  0.679   5.951   1.00 0.00 ? 350 VAL A HB   4  
ATOM   7451  H  HG11 . VAL B 2 92  ? 13.344  -1.263  5.429   1.00 0.00 ? 350 VAL A HG11 4  
ATOM   7452  H  HG12 . VAL B 2 92  ? 14.664  -1.522  4.290   1.00 0.00 ? 350 VAL A HG12 4  
ATOM   7453  H  HG13 . VAL B 2 92  ? 13.887  0.053   4.394   1.00 0.00 ? 350 VAL A HG13 4  
ATOM   7454  H  HG21 . VAL B 2 92  ? 13.910  -1.479  7.302   1.00 0.00 ? 350 VAL A HG21 4  
ATOM   7455  H  HG22 . VAL B 2 92  ? 14.289  0.152   7.854   1.00 0.00 ? 350 VAL A HG22 4  
ATOM   7456  H  HG23 . VAL B 2 92  ? 15.496  -1.121  7.987   1.00 0.00 ? 350 VAL A HG23 4  
ATOM   7457  N  N    . ALA B 2 93  ? 16.484  -2.870  7.194   1.00 0.00 ? 351 ALA A N    4  
ATOM   7458  C  CA   . ALA B 2 93  ? 16.585  -4.285  7.550   1.00 0.00 ? 351 ALA A CA   4  
ATOM   7459  C  C    . ALA B 2 93  ? 15.241  -4.982  7.749   1.00 0.00 ? 351 ALA A C    4  
ATOM   7460  O  O    . ALA B 2 93  ? 15.090  -6.144  7.375   1.00 0.00 ? 351 ALA A O    4  
ATOM   7461  C  CB   . ALA B 2 93  ? 17.431  -4.443  8.803   1.00 0.00 ? 351 ALA A CB   4  
ATOM   7462  H  H    . ALA B 2 93  ? 16.286  -2.201  7.876   1.00 0.00 ? 351 ALA A H    4  
ATOM   7463  H  HA   . ALA B 2 93  ? 17.104  -4.782  6.745   1.00 0.00 ? 351 ALA A HA   4  
ATOM   7464  H  HB1  . ALA B 2 93  ? 16.794  -4.385  9.675   1.00 0.00 ? 351 ALA A HB1  4  
ATOM   7465  H  HB2  . ALA B 2 93  ? 18.167  -3.655  8.842   1.00 0.00 ? 351 ALA A HB2  4  
ATOM   7466  H  HB3  . ALA B 2 93  ? 17.929  -5.402  8.783   1.00 0.00 ? 351 ALA A HB3  4  
ATOM   7467  N  N    . GLU B 2 94  ? 14.275  -4.296  8.348   1.00 0.00 ? 352 GLU A N    4  
ATOM   7468  C  CA   . GLU B 2 94  ? 12.965  -4.908  8.626   1.00 0.00 ? 352 GLU A CA   4  
ATOM   7469  C  C    . GLU B 2 94  ? 11.922  -3.860  8.999   1.00 0.00 ? 352 GLU A C    4  
ATOM   7470  O  O    . GLU B 2 94  ? 10.804  -3.863  8.483   1.00 0.00 ? 352 GLU A O    4  
ATOM   7471  C  CB   . GLU B 2 94  ? 13.052  -5.924  9.781   1.00 0.00 ? 352 GLU A CB   4  
ATOM   7472  C  CG   . GLU B 2 94  ? 14.458  -6.230  10.283  1.00 0.00 ? 352 GLU A CG   4  
ATOM   7473  C  CD   . GLU B 2 94  ? 14.467  -7.274  11.382  1.00 0.00 ? 352 GLU A CD   4  
ATOM   7474  O  OE1  . GLU B 2 94  ? 14.546  -8.478  11.057  1.00 0.00 ? 352 GLU A OE1  4  
ATOM   7475  O  OE2  . GLU B 2 94  ? 14.392  -6.889  12.568  1.00 0.00 ? 352 GLU A OE2  4  
ATOM   7476  H  H    . GLU B 2 94  ? 14.429  -3.355  8.584   1.00 0.00 ? 352 GLU A H    4  
ATOM   7477  H  HA   . GLU B 2 94  ? 12.645  -5.405  7.733   1.00 0.00 ? 352 GLU A HA   4  
ATOM   7478  H  HB2  . GLU B 2 94  ? 12.491  -5.528  10.617  1.00 0.00 ? 352 GLU A HB2  4  
ATOM   7479  H  HB3  . GLU B 2 94  ? 12.600  -6.842  9.464   1.00 0.00 ? 352 GLU A HB3  4  
ATOM   7480  H  HG2  . GLU B 2 94  ? 15.055  -6.591  9.461   1.00 0.00 ? 352 GLU A HG2  4  
ATOM   7481  H  HG3  . GLU B 2 94  ? 14.894  -5.321  10.670  1.00 0.00 ? 352 GLU A HG3  4  
ATOM   7482  N  N    . PRO B 2 95  ? 12.287  -2.994  9.956   1.00 0.00 ? 353 PRO A N    4  
ATOM   7483  C  CA   . PRO B 2 95  ? 11.529  -1.880  10.474  1.00 0.00 ? 353 PRO A CA   4  
ATOM   7484  C  C    . PRO B 2 95  ? 10.246  -1.486  9.735   1.00 0.00 ? 353 PRO A C    4  
ATOM   7485  O  O    . PRO B 2 95  ? 9.215   -1.335  10.389  1.00 0.00 ? 353 PRO A O    4  
ATOM   7486  C  CB   . PRO B 2 95  ? 12.610  -0.798  10.374  1.00 0.00 ? 353 PRO A CB   4  
ATOM   7487  C  CG   . PRO B 2 95  ? 13.913  -1.554  10.541  1.00 0.00 ? 353 PRO A CG   4  
ATOM   7488  C  CD   . PRO B 2 95  ? 13.544  -2.993  10.676  1.00 0.00 ? 353 PRO A CD   4  
ATOM   7489  H  HA   . PRO B 2 95  ? 11.295  -2.026  11.516  1.00 0.00 ? 353 PRO A HA   4  
ATOM   7490  H  HB2  . PRO B 2 95  ? 12.551  -0.330  9.398   1.00 0.00 ? 353 PRO A HB2  4  
ATOM   7491  H  HB3  . PRO B 2 95  ? 12.473  -0.063  11.152  1.00 0.00 ? 353 PRO A HB3  4  
ATOM   7492  H  HG2  . PRO B 2 95  ? 14.521  -1.432  9.662   1.00 0.00 ? 353 PRO A HG2  4  
ATOM   7493  H  HG3  . PRO B 2 95  ? 14.439  -1.220  11.417  1.00 0.00 ? 353 PRO A HG3  4  
ATOM   7494  H  HD2  . PRO B 2 95  ? 14.276  -3.619  10.206  1.00 0.00 ? 353 PRO A HD2  4  
ATOM   7495  H  HD3  . PRO B 2 95  ? 13.400  -3.274  11.707  1.00 0.00 ? 353 PRO A HD3  4  
ATOM   7496  N  N    . PRO B 2 96  ? 10.244  -1.273  8.397   1.00 0.00 ? 354 PRO A N    4  
ATOM   7497  C  CA   . PRO B 2 96  ? 9.041   -0.876  7.704   1.00 0.00 ? 354 PRO A CA   4  
ATOM   7498  C  C    . PRO B 2 96  ? 8.048   -2.014  7.517   1.00 0.00 ? 354 PRO A C    4  
ATOM   7499  O  O    . PRO B 2 96  ? 7.524   -2.225  6.423   1.00 0.00 ? 354 PRO A O    4  
ATOM   7500  C  CB   . PRO B 2 96  ? 9.547   -0.367  6.360   1.00 0.00 ? 354 PRO A CB   4  
ATOM   7501  C  CG   . PRO B 2 96  ? 11.003  -0.281  6.497   1.00 0.00 ? 354 PRO A CG   4  
ATOM   7502  C  CD   . PRO B 2 96  ? 11.356  -1.342  7.454   1.00 0.00 ? 354 PRO A CD   4  
ATOM   7503  H  HA   . PRO B 2 96  ? 8.573   -0.067  8.224   1.00 0.00 ? 354 PRO A HA   4  
ATOM   7504  H  HB2  . PRO B 2 96  ? 9.256   -1.033  5.572   1.00 0.00 ? 354 PRO A HB2  4  
ATOM   7505  H  HB3  . PRO B 2 96  ? 9.144   0.595   6.188   1.00 0.00 ? 354 PRO A HB3  4  
ATOM   7506  H  HG2  . PRO B 2 96  ? 11.482  -0.445  5.550   1.00 0.00 ? 354 PRO A HG2  4  
ATOM   7507  H  HG3  . PRO B 2 96  ? 11.266  0.683   6.899   1.00 0.00 ? 354 PRO A HG3  4  
ATOM   7508  H  HD2  . PRO B 2 96  ? 11.414  -2.305  6.969   1.00 0.00 ? 354 PRO A HD2  4  
ATOM   7509  H  HD3  . PRO B 2 96  ? 12.251  -1.092  7.907   1.00 0.00 ? 354 PRO A HD3  4  
ATOM   7510  N  N    . GLU B 2 97  ? 7.793   -2.740  8.595   1.00 0.00 ? 355 GLU A N    4  
ATOM   7511  C  CA   . GLU B 2 97  ? 6.861   -3.842  8.577   1.00 0.00 ? 355 GLU A CA   4  
ATOM   7512  C  C    . GLU B 2 97  ? 5.448   -3.306  8.744   1.00 0.00 ? 355 GLU A C    4  
ATOM   7513  O  O    . GLU B 2 97  ? 4.464   -3.988  8.455   1.00 0.00 ? 355 GLU A O    4  
ATOM   7514  C  CB   . GLU B 2 97  ? 7.226   -4.801  9.693   1.00 0.00 ? 355 GLU A CB   4  
ATOM   7515  C  CG   . GLU B 2 97  ? 6.244   -4.755  10.813  1.00 0.00 ? 355 GLU A CG   4  
ATOM   7516  C  CD   . GLU B 2 97  ? 6.455   -5.848  11.842  1.00 0.00 ? 355 GLU A CD   4  
ATOM   7517  O  OE1  . GLU B 2 97  ? 5.909   -6.955  11.652  1.00 0.00 ? 355 GLU A OE1  4  
ATOM   7518  O  OE2  . GLU B 2 97  ? 7.167   -5.597  12.837  1.00 0.00 ? 355 GLU A OE2  4  
ATOM   7519  H  H    . GLU B 2 97  ? 8.236   -2.522  9.440   1.00 0.00 ? 355 GLU A H    4  
ATOM   7520  H  HA   . GLU B 2 97  ? 6.926   -4.351  7.644   1.00 0.00 ? 355 GLU A HA   4  
ATOM   7521  H  HB2  . GLU B 2 97  ? 7.271   -5.807  9.305   1.00 0.00 ? 355 GLU A HB2  4  
ATOM   7522  H  HB3  . GLU B 2 97  ? 8.192   -4.519  10.081  1.00 0.00 ? 355 GLU A HB3  4  
ATOM   7523  H  HG2  . GLU B 2 97  ? 6.334   -3.791  11.292  1.00 0.00 ? 355 GLU A HG2  4  
ATOM   7524  H  HG3  . GLU B 2 97  ? 5.266   -4.858  10.376  1.00 0.00 ? 355 GLU A HG3  4  
ATOM   7525  N  N    . GLY B 2 98  ? 5.370   -2.068  9.213   1.00 0.00 ? 356 GLY A N    4  
ATOM   7526  C  CA   . GLY B 2 98  ? 4.090   -1.426  9.417   1.00 0.00 ? 356 GLY A CA   4  
ATOM   7527  C  C    . GLY B 2 98  ? 4.214   0.065   9.422   1.00 0.00 ? 356 GLY A C    4  
ATOM   7528  O  O    . GLY B 2 98  ? 3.668   0.755   10.284  1.00 0.00 ? 356 GLY A O    4  
ATOM   7529  H  H    . GLY B 2 98  ? 6.196   -1.574  9.401   1.00 0.00 ? 356 GLY A H    4  
ATOM   7530  H  HA2  . GLY B 2 98  ? 3.454   -1.694  8.602   1.00 0.00 ? 356 GLY A HA2  4  
ATOM   7531  H  HA3  . GLY B 2 98  ? 3.658   -1.758  10.348  1.00 0.00 ? 356 GLY A HA3  4  
ATOM   7532  N  N    . SER B 2 99  ? 4.931   0.536   8.420   1.00 0.00 ? 357 SER A N    4  
ATOM   7533  C  CA   . SER B 2 99  ? 5.190   1.949   8.213   1.00 0.00 ? 357 SER A CA   4  
ATOM   7534  C  C    . SER B 2 99  ? 6.386   2.112   7.296   1.00 0.00 ? 357 SER A C    4  
ATOM   7535  O  O    . SER B 2 99  ? 7.364   1.391   7.442   1.00 0.00 ? 357 SER A O    4  
ATOM   7536  C  CB   . SER B 2 99  ? 5.490   2.665   9.517   1.00 0.00 ? 357 SER A CB   4  
ATOM   7537  O  OG   . SER B 2 99  ? 4.406   3.484   9.920   1.00 0.00 ? 357 SER A OG   4  
ATOM   7538  H  H    . SER B 2 99  ? 5.295   -0.106  7.777   1.00 0.00 ? 357 SER A H    4  
ATOM   7539  H  HA   . SER B 2 99  ? 4.316   2.377   7.752   1.00 0.00 ? 357 SER A HA   4  
ATOM   7540  H  HB2  . SER B 2 99  ? 5.689   1.940   10.292  1.00 0.00 ? 357 SER A HB2  4  
ATOM   7541  H  HB3  . SER B 2 99  ? 6.360   3.281   9.366   1.00 0.00 ? 357 SER A HB3  4  
ATOM   7542  H  HG   . SER B 2 99  ? 3.626   3.255   9.410   1.00 0.00 ? 357 SER A HG   4  
ATOM   7543  N  N    . TRP B 2 100 ? 6.329   3.093   6.402   1.00 0.00 ? 358 TRP A N    4  
ATOM   7544  C  CA   . TRP B 2 100 ? 7.416   3.323   5.441   1.00 0.00 ? 358 TRP A CA   4  
ATOM   7545  C  C    . TRP B 2 100 ? 6.977   4.248   4.314   1.00 0.00 ? 358 TRP A C    4  
ATOM   7546  O  O    . TRP B 2 100 ? 5.818   4.240   3.900   1.00 0.00 ? 358 TRP A O    4  
ATOM   7547  C  CB   . TRP B 2 100 ? 7.870   1.997   4.829   1.00 0.00 ? 358 TRP A CB   4  
ATOM   7548  C  CG   . TRP B 2 100 ? 9.199   2.038   4.134   1.00 0.00 ? 358 TRP A CG   4  
ATOM   7549  C  CD1  . TRP B 2 100 ? 10.416  2.410   4.640   1.00 0.00 ? 358 TRP A CD1  4  
ATOM   7550  C  CD2  . TRP B 2 100 ? 9.438   1.629   2.799   1.00 0.00 ? 358 TRP A CD2  4  
ATOM   7551  N  NE1  . TRP B 2 100 ? 11.382  2.288   3.667   1.00 0.00 ? 358 TRP A NE1  4  
ATOM   7552  C  CE2  . TRP B 2 100 ? 10.801  1.812   2.534   1.00 0.00 ? 358 TRP A CE2  4  
ATOM   7553  C  CE3  . TRP B 2 100 ? 8.620   1.137   1.796   1.00 0.00 ? 358 TRP A CE3  4  
ATOM   7554  C  CZ2  . TRP B 2 100 ? 11.358  1.516   1.307   1.00 0.00 ? 358 TRP A CZ2  4  
ATOM   7555  C  CZ3  . TRP B 2 100 ? 9.182   0.836   0.578   1.00 0.00 ? 358 TRP A CZ3  4  
ATOM   7556  C  CH2  . TRP B 2 100 ? 10.538  1.028   0.351   1.00 0.00 ? 358 TRP A CH2  4  
ATOM   7557  H  H    . TRP B 2 100 ? 5.562   3.696   6.416   1.00 0.00 ? 358 TRP A H    4  
ATOM   7558  H  HA   . TRP B 2 100 ? 8.244   3.773   5.966   1.00 0.00 ? 358 TRP A HA   4  
ATOM   7559  H  HB2  . TRP B 2 100 ? 7.929   1.260   5.600   1.00 0.00 ? 358 TRP A HB2  4  
ATOM   7560  H  HB3  . TRP B 2 100 ? 7.138   1.677   4.104   1.00 0.00 ? 358 TRP A HB3  4  
ATOM   7561  H  HD1  . TRP B 2 100 ? 10.581  2.747   5.649   1.00 0.00 ? 358 TRP A HD1  4  
ATOM   7562  H  HE1  . TRP B 2 100 ? 12.333  2.502   3.764   1.00 0.00 ? 358 TRP A HE1  4  
ATOM   7563  H  HE3  . TRP B 2 100 ? 7.576   0.968   1.969   1.00 0.00 ? 358 TRP A HE3  4  
ATOM   7564  H  HZ2  . TRP B 2 100 ? 12.403  1.635   1.110   1.00 0.00 ? 358 TRP A HZ2  4  
ATOM   7565  H  HZ3  . TRP B 2 100 ? 8.578   0.422   -0.207  1.00 0.00 ? 358 TRP A HZ3  4  
ATOM   7566  H  HH2  . TRP B 2 100 ? 10.933  0.782   -0.606  1.00 0.00 ? 358 TRP A HH2  4  
ATOM   7567  N  N    . SER B 2 101 ? 7.918   5.044   3.828   1.00 0.00 ? 359 SER A N    4  
ATOM   7568  C  CA   . SER B 2 101 ? 7.672   5.954   2.741   1.00 0.00 ? 359 SER A CA   4  
ATOM   7569  C  C    . SER B 2 101 ? 8.758   5.785   1.684   1.00 0.00 ? 359 SER A C    4  
ATOM   7570  O  O    . SER B 2 101 ? 9.894   6.220   1.874   1.00 0.00 ? 359 SER A O    4  
ATOM   7571  C  CB   . SER B 2 101 ? 7.667   7.379   3.274   1.00 0.00 ? 359 SER A CB   4  
ATOM   7572  O  OG   . SER B 2 101 ? 8.848   7.644   4.009   1.00 0.00 ? 359 SER A OG   4  
ATOM   7573  H  H    . SER B 2 101 ? 8.800   5.038   4.227   1.00 0.00 ? 359 SER A H    4  
ATOM   7574  H  HA   . SER B 2 101 ? 6.702   5.719   2.314   1.00 0.00 ? 359 SER A HA   4  
ATOM   7575  H  HB2  . SER B 2 101 ? 7.602   8.077   2.453   1.00 0.00 ? 359 SER A HB2  4  
ATOM   7576  H  HB3  . SER B 2 101 ? 6.825   7.501   3.928   1.00 0.00 ? 359 SER A HB3  4  
ATOM   7577  H  HG   . SER B 2 101 ? 9.228   6.817   4.317   1.00 0.00 ? 359 SER A HG   4  
ATOM   7578  N  N    . CYS B 2 102 ? 8.400   5.124   0.592   1.00 0.00 ? 360 CYS A N    4  
ATOM   7579  C  CA   . CYS B 2 102 ? 9.313   4.868   -0.518  1.00 0.00 ? 360 CYS A CA   4  
ATOM   7580  C  C    . CYS B 2 102 ? 10.081  6.126   -0.931  1.00 0.00 ? 360 CYS A C    4  
ATOM   7581  O  O    . CYS B 2 102 ? 9.890   7.199   -0.361  1.00 0.00 ? 360 CYS A O    4  
ATOM   7582  C  CB   . CYS B 2 102 ? 8.519   4.366   -1.706  1.00 0.00 ? 360 CYS A CB   4  
ATOM   7583  S  SG   . CYS B 2 102 ? 7.628   5.685   -2.577  1.00 0.00 ? 360 CYS A SG   4  
ATOM   7584  H  H    . CYS B 2 102 ? 7.488   4.783   0.530   1.00 0.00 ? 360 CYS A H    4  
ATOM   7585  H  HA   . CYS B 2 102 ? 10.011  4.098   -0.215  1.00 0.00 ? 360 CYS A HA   4  
ATOM   7586  H  HB2  . CYS B 2 102 ? 9.188   3.901   -2.402  1.00 0.00 ? 360 CYS A HB2  4  
ATOM   7587  H  HB3  . CYS B 2 102 ? 7.794   3.641   -1.370  1.00 0.00 ? 360 CYS A HB3  4  
ATOM   7588  N  N    . HIS B 2 103 ? 10.925  5.999   -1.955  1.00 0.00 ? 361 HIS A N    4  
ATOM   7589  C  CA   . HIS B 2 103 ? 11.714  7.120   -2.427  1.00 0.00 ? 361 HIS A CA   4  
ATOM   7590  C  C    . HIS B 2 103 ? 10.860  8.109   -3.207  1.00 0.00 ? 361 HIS A C    4  
ATOM   7591  O  O    . HIS B 2 103 ? 11.183  9.291   -3.268  1.00 0.00 ? 361 HIS A O    4  
ATOM   7592  C  CB   . HIS B 2 103 ? 12.905  6.642   -3.269  1.00 0.00 ? 361 HIS A CB   4  
ATOM   7593  C  CG   . HIS B 2 103 ? 12.558  5.811   -4.466  1.00 0.00 ? 361 HIS A CG   4  
ATOM   7594  N  ND1  . HIS B 2 103 ? 13.280  4.695   -4.837  1.00 0.00 ? 361 HIS A ND1  4  
ATOM   7595  C  CD2  . HIS B 2 103 ? 11.584  5.945   -5.392  1.00 0.00 ? 361 HIS A CD2  4  
ATOM   7596  C  CE1  . HIS B 2 103 ? 12.762  4.184   -5.941  1.00 0.00 ? 361 HIS A CE1  4  
ATOM   7597  N  NE2  . HIS B 2 103 ? 11.734  4.925   -6.298  1.00 0.00 ? 361 HIS A NE2  4  
ATOM   7598  H  H    . HIS B 2 103 ? 10.997  5.148   -2.417  1.00 0.00 ? 361 HIS A H    4  
ATOM   7599  H  HA   . HIS B 2 103 ? 12.098  7.626   -1.554  1.00 0.00 ? 361 HIS A HA   4  
ATOM   7600  H  HB2  . HIS B 2 103 ? 13.431  7.502   -3.623  1.00 0.00 ? 361 HIS A HB2  4  
ATOM   7601  H  HB3  . HIS B 2 103 ? 13.564  6.060   -2.642  1.00 0.00 ? 361 HIS A HB3  4  
ATOM   7602  H  HD1  . HIS B 2 103 ? 14.057  4.332   -4.362  1.00 0.00 ? 361 HIS A HD1  4  
ATOM   7603  H  HD2  . HIS B 2 103 ? 10.798  6.683   -5.391  1.00 0.00 ? 361 HIS A HD2  4  
ATOM   7604  H  HE1  . HIS B 2 103 ? 13.107  3.298   -6.449  1.00 0.00 ? 361 HIS A HE1  4  
ATOM   7605  H  HE2  . HIS B 2 103 ? 11.220  4.818   -7.125  1.00 0.00 ? 361 HIS A HE2  4  
ATOM   7606  N  N    . LEU B 2 104 ? 9.770   7.626   -3.809  1.00 0.00 ? 362 LEU A N    4  
ATOM   7607  C  CA   . LEU B 2 104 ? 8.885   8.500   -4.570  1.00 0.00 ? 362 LEU A CA   4  
ATOM   7608  C  C    . LEU B 2 104 ? 8.283   9.535   -3.647  1.00 0.00 ? 362 LEU A C    4  
ATOM   7609  O  O    . LEU B 2 104 ? 8.316   10.743  -3.896  1.00 0.00 ? 362 LEU A O    4  
ATOM   7610  C  CB   . LEU B 2 104 ? 7.735   7.721   -5.208  1.00 0.00 ? 362 LEU A CB   4  
ATOM   7611  C  CG   . LEU B 2 104 ? 8.122   6.534   -6.064  1.00 0.00 ? 362 LEU A CG   4  
ATOM   7612  C  CD1  . LEU B 2 104 ? 6.878   5.850   -6.566  1.00 0.00 ? 362 LEU A CD1  4  
ATOM   7613  C  CD2  . LEU B 2 104 ? 9.003   6.957   -7.215  1.00 0.00 ? 362 LEU A CD2  4  
ATOM   7614  H  H    . LEU B 2 104 ? 9.560   6.672   -3.736  1.00 0.00 ? 362 LEU A H    4  
ATOM   7615  H  HA   . LEU B 2 104 ? 9.462   8.978   -5.337  1.00 0.00 ? 362 LEU A HA   4  
ATOM   7616  H  HB2  . LEU B 2 104 ? 7.089   7.364   -4.421  1.00 0.00 ? 362 LEU A HB2  4  
ATOM   7617  H  HB3  . LEU B 2 104 ? 7.173   8.402   -5.823  1.00 0.00 ? 362 LEU A HB3  4  
ATOM   7618  H  HG   . LEU B 2 104 ? 8.669   5.830   -5.459  1.00 0.00 ? 362 LEU A HG   4  
ATOM   7619  H  HD11 . LEU B 2 104 ? 6.441   5.288   -5.755  1.00 0.00 ? 362 LEU A HD11 4  
ATOM   7620  H  HD12 . LEU B 2 104 ? 7.134   5.183   -7.375  1.00 0.00 ? 362 LEU A HD12 4  
ATOM   7621  H  HD13 . LEU B 2 104 ? 6.172   6.589   -6.915  1.00 0.00 ? 362 LEU A HD13 4  
ATOM   7622  H  HD21 . LEU B 2 104 ? 10.026  6.903   -6.897  1.00 0.00 ? 362 LEU A HD21 4  
ATOM   7623  H  HD22 . LEU B 2 104 ? 8.765   7.971   -7.503  1.00 0.00 ? 362 LEU A HD22 4  
ATOM   7624  H  HD23 . LEU B 2 104 ? 8.848   6.295   -8.055  1.00 0.00 ? 362 LEU A HD23 4  
ATOM   7625  N  N    . CYS B 2 105 ? 7.759   9.019   -2.556  1.00 0.00 ? 363 CYS A N    4  
ATOM   7626  C  CA   . CYS B 2 105 ? 7.104   9.831   -1.545  1.00 0.00 ? 363 CYS A CA   4  
ATOM   7627  C  C    . CYS B 2 105 ? 8.088   10.674  -0.813  1.00 0.00 ? 363 CYS A C    4  
ATOM   7628  O  O    . CYS B 2 105 ? 7.783   11.782  -0.401  1.00 0.00 ? 363 CYS A O    4  
ATOM   7629  C  CB   . CYS B 2 105 ? 6.351   8.957   -0.549  1.00 0.00 ? 363 CYS A CB   4  
ATOM   7630  S  SG   . CYS B 2 105 ? 4.954   8.061   -1.322  1.00 0.00 ? 363 CYS A SG   4  
ATOM   7631  H  H    . CYS B 2 105 ? 7.845   8.050   -2.417  1.00 0.00 ? 363 CYS A H    4  
ATOM   7632  H  HA   . CYS B 2 105 ? 6.412   10.479  -2.037  1.00 0.00 ? 363 CYS A HA   4  
ATOM   7633  H  HB2  . CYS B 2 105 ? 7.045   8.244   -0.091  1.00 0.00 ? 363 CYS A HB2  4  
ATOM   7634  H  HB3  . CYS B 2 105 ? 5.945   9.586   0.230   1.00 0.00 ? 363 CYS A HB3  4  
ATOM   7635  N  N    . TRP B 2 106 ? 9.261   10.130  -0.653  1.00 0.00 ? 364 TRP A N    4  
ATOM   7636  C  CA   . TRP B 2 106 ? 10.301  10.794  0.067   1.00 0.00 ? 364 TRP A CA   4  
ATOM   7637  C  C    . TRP B 2 106 ? 10.823  11.986  -0.632  1.00 0.00 ? 364 TRP A C    4  
ATOM   7638  O  O    . TRP B 2 106 ? 10.913  13.048  -0.060  1.00 0.00 ? 364 TRP A O    4  
ATOM   7639  C  CB   . TRP B 2 106 ? 11.415  9.844   0.338   1.00 0.00 ? 364 TRP A CB   4  
ATOM   7640  C  CG   . TRP B 2 106 ? 11.529  9.677   1.772   1.00 0.00 ? 364 TRP A CG   4  
ATOM   7641  C  CD1  . TRP B 2 106 ? 10.495  9.461   2.589   1.00 0.00 ? 364 TRP A CD1  4  
ATOM   7642  C  CD2  . TRP B 2 106 ? 12.686  9.783   2.562   1.00 0.00 ? 364 TRP A CD2  4  
ATOM   7643  N  NE1  . TRP B 2 106 ? 10.916  9.390   3.870   1.00 0.00 ? 364 TRP A NE1  4  
ATOM   7644  C  CE2  . TRP B 2 106 ? 12.287  9.585   3.892   1.00 0.00 ? 364 TRP A CE2  4  
ATOM   7645  C  CE3  . TRP B 2 106 ? 14.021  10.014  2.265   1.00 0.00 ? 364 TRP A CE3  4  
ATOM   7646  C  CZ2  . TRP B 2 106 ? 13.199  9.616   4.944   1.00 0.00 ? 364 TRP A CZ2  4  
ATOM   7647  C  CZ3  . TRP B 2 106 ? 14.929  10.050  3.302   1.00 0.00 ? 364 TRP A CZ3  4  
ATOM   7648  C  CH2  . TRP B 2 106 ? 14.517  9.850   4.626   1.00 0.00 ? 364 TRP A CH2  4  
ATOM   7649  H  H    . TRP B 2 106 ? 9.437   9.257   -1.048  1.00 0.00 ? 364 TRP A H    4  
ATOM   7650  H  HA   . TRP B 2 106 ? 9.887   11.111  1.009   1.00 0.00 ? 364 TRP A HA   4  
ATOM   7651  H  HB2  . TRP B 2 106 ? 11.181  8.898   -0.108  1.00 0.00 ? 364 TRP A HB2  4  
ATOM   7652  H  HB3  . TRP B 2 106 ? 12.345  10.229  -0.049  1.00 0.00 ? 364 TRP A HB3  4  
ATOM   7653  H  HD1  . TRP B 2 106 ? 9.479   9.366   2.243   1.00 0.00 ? 364 TRP A HD1  4  
ATOM   7654  H  HE1  . TRP B 2 106 ? 10.334  9.228   4.625   1.00 0.00 ? 364 TRP A HE1  4  
ATOM   7655  H  HE3  . TRP B 2 106 ? 14.340  10.177  1.237   1.00 0.00 ? 364 TRP A HE3  4  
ATOM   7656  H  HZ2  . TRP B 2 106 ? 12.899  9.464   5.970   1.00 0.00 ? 364 TRP A HZ2  4  
ATOM   7657  H  HZ3  . TRP B 2 106 ? 15.973  10.233  3.096   1.00 0.00 ? 364 TRP A HZ3  4  
ATOM   7658  H  HH2  . TRP B 2 106 ? 15.261  9.896   5.402   1.00 0.00 ? 364 TRP A HH2  4  
ATOM   7659  N  N    . GLU B 2 107 ? 11.206  11.812  -1.848  1.00 0.00 ? 365 GLU A N    4  
ATOM   7660  C  CA   . GLU B 2 107 ? 11.711  12.922  -2.586  1.00 0.00 ? 365 GLU A CA   4  
ATOM   7661  C  C    . GLU B 2 107 ? 10.614  13.962  -2.652  1.00 0.00 ? 365 GLU A C    4  
ATOM   7662  O  O    . GLU B 2 107 ? 10.869  15.159  -2.768  1.00 0.00 ? 365 GLU A O    4  
ATOM   7663  C  CB   . GLU B 2 107 ? 12.137  12.464  -3.951  1.00 0.00 ? 365 GLU A CB   4  
ATOM   7664  C  CG   . GLU B 2 107 ? 10.989  11.896  -4.753  1.00 0.00 ? 365 GLU A CG   4  
ATOM   7665  C  CD   . GLU B 2 107 ? 11.356  11.615  -6.197  1.00 0.00 ? 365 GLU A CD   4  
ATOM   7666  O  OE1  . GLU B 2 107 ? 11.846  10.501  -6.479  1.00 0.00 ? 365 GLU A OE1  4  
ATOM   7667  O  OE2  . GLU B 2 107 ? 11.155  12.509  -7.046  1.00 0.00 ? 365 GLU A OE2  4  
ATOM   7668  H  H    . GLU B 2 107 ? 11.132  10.930  -2.260  1.00 0.00 ? 365 GLU A H    4  
ATOM   7669  H  HA   . GLU B 2 107 ? 12.560  13.317  -2.038  1.00 0.00 ? 365 GLU A HA   4  
ATOM   7670  H  HB2  . GLU B 2 107 ? 12.576  13.288  -4.492  1.00 0.00 ? 365 GLU A HB2  4  
ATOM   7671  H  HB3  . GLU B 2 107 ? 12.866  11.688  -3.811  1.00 0.00 ? 365 GLU A HB3  4  
ATOM   7672  H  HG2  . GLU B 2 107 ? 10.680  10.977  -4.288  1.00 0.00 ? 365 GLU A HG2  4  
ATOM   7673  H  HG3  . GLU B 2 107 ? 10.169  12.596  -4.728  1.00 0.00 ? 365 GLU A HG3  4  
ATOM   7674  N  N    . LEU B 2 108 ? 9.377   13.469  -2.574  1.00 0.00 ? 366 LEU A N    4  
ATOM   7675  C  CA   . LEU B 2 108 ? 8.214   14.326  -2.563  1.00 0.00 ? 366 LEU A CA   4  
ATOM   7676  C  C    . LEU B 2 108 ? 8.096   14.948  -1.185  1.00 0.00 ? 366 LEU A C    4  
ATOM   7677  O  O    . LEU B 2 108 ? 7.500   16.002  -1.001  1.00 0.00 ? 366 LEU A O    4  
ATOM   7678  C  CB   . LEU B 2 108 ? 6.970   13.539  -2.921  1.00 0.00 ? 366 LEU A CB   4  
ATOM   7679  C  CG   . LEU B 2 108 ? 5.788   14.359  -3.444  1.00 0.00 ? 366 LEU A CG   4  
ATOM   7680  C  CD1  . LEU B 2 108 ? 4.992   14.934  -2.290  1.00 0.00 ? 366 LEU A CD1  4  
ATOM   7681  C  CD2  . LEU B 2 108 ? 6.271   15.460  -4.365  1.00 0.00 ? 366 LEU A CD2  4  
ATOM   7682  H  H    . LEU B 2 108 ? 9.246   12.487  -2.516  1.00 0.00 ? 366 LEU A H    4  
ATOM   7683  H  HA   . LEU B 2 108 ? 8.362   15.092  -3.288  1.00 0.00 ? 366 LEU A HA   4  
ATOM   7684  H  HB2  . LEU B 2 108 ? 7.244   12.831  -3.675  1.00 0.00 ? 366 LEU A HB2  4  
ATOM   7685  H  HB3  . LEU B 2 108 ? 6.653   13.008  -2.047  1.00 0.00 ? 366 LEU A HB3  4  
ATOM   7686  H  HG   . LEU B 2 108 ? 5.141   13.716  -4.013  1.00 0.00 ? 366 LEU A HG   4  
ATOM   7687  H  HD11 . LEU B 2 108 ? 4.968   14.213  -1.487  1.00 0.00 ? 366 LEU A HD11 4  
ATOM   7688  H  HD12 . LEU B 2 108 ? 3.984   15.146  -2.616  1.00 0.00 ? 366 LEU A HD12 4  
ATOM   7689  H  HD13 . LEU B 2 108 ? 5.461   15.843  -1.945  1.00 0.00 ? 366 LEU A HD13 4  
ATOM   7690  H  HD21 . LEU B 2 108 ? 7.296   15.258  -4.635  1.00 0.00 ? 366 LEU A HD21 4  
ATOM   7691  H  HD22 . LEU B 2 108 ? 6.210   16.412  -3.858  1.00 0.00 ? 366 LEU A HD22 4  
ATOM   7692  H  HD23 . LEU B 2 108 ? 5.660   15.483  -5.255  1.00 0.00 ? 366 LEU A HD23 4  
ATOM   7693  N  N    . LEU B 2 109 ? 8.654   14.229  -0.222  1.00 0.00 ? 367 LEU A N    4  
ATOM   7694  C  CA   . LEU B 2 109 ? 8.684   14.627  1.173   1.00 0.00 ? 367 LEU A CA   4  
ATOM   7695  C  C    . LEU B 2 109 ? 9.616   15.800  1.345   1.00 0.00 ? 367 LEU A C    4  
ATOM   7696  O  O    . LEU B 2 109 ? 9.242   16.859  1.845   1.00 0.00 ? 367 LEU A O    4  
ATOM   7697  C  CB   . LEU B 2 109 ? 9.211   13.471  1.989   1.00 0.00 ? 367 LEU A CB   4  
ATOM   7698  C  CG   . LEU B 2 109 ? 8.336   12.974  3.119   1.00 0.00 ? 367 LEU A CG   4  
ATOM   7699  C  CD1  . LEU B 2 109 ? 7.322   11.992  2.567   1.00 0.00 ? 367 LEU A CD1  4  
ATOM   7700  C  CD2  . LEU B 2 109 ? 9.201   12.326  4.188   1.00 0.00 ? 367 LEU A CD2  4  
ATOM   7701  H  H    . LEU B 2 109 ? 9.086   13.385  -0.469  1.00 0.00 ? 367 LEU A H    4  
ATOM   7702  H  HA   . LEU B 2 109 ? 7.705   14.871  1.498   1.00 0.00 ? 367 LEU A HA   4  
ATOM   7703  H  HB2  . LEU B 2 109 ? 9.355   12.656  1.314   1.00 0.00 ? 367 LEU A HB2  4  
ATOM   7704  H  HB3  . LEU B 2 109 ? 10.163  13.752  2.389   1.00 0.00 ? 367 LEU A HB3  4  
ATOM   7705  H  HG   . LEU B 2 109 ? 7.806   13.804  3.560   1.00 0.00 ? 367 LEU A HG   4  
ATOM   7706  H  HD11 . LEU B 2 109 ? 7.671   11.636  1.603   1.00 0.00 ? 367 LEU A HD11 4  
ATOM   7707  H  HD12 . LEU B 2 109 ? 6.368   12.485  2.449   1.00 0.00 ? 367 LEU A HD12 4  
ATOM   7708  H  HD13 . LEU B 2 109 ? 7.218   11.158  3.244   1.00 0.00 ? 367 LEU A HD13 4  
ATOM   7709  H  HD21 . LEU B 2 109 ? 10.186  12.127  3.775   1.00 0.00 ? 367 LEU A HD21 4  
ATOM   7710  H  HD22 . LEU B 2 109 ? 8.748   11.399  4.506   1.00 0.00 ? 367 LEU A HD22 4  
ATOM   7711  H  HD23 . LEU B 2 109 ? 9.292   12.993  5.031   1.00 0.00 ? 367 LEU A HD23 4  
ATOM   7712  N  N    . LYS B 2 110 ? 10.846  15.572  0.920   1.00 0.00 ? 368 LYS A N    4  
ATOM   7713  C  CA   . LYS B 2 110 ? 11.889  16.573  0.986   1.00 0.00 ? 368 LYS A CA   4  
ATOM   7714  C  C    . LYS B 2 110 ? 11.448  17.814  0.224   1.00 0.00 ? 368 LYS A C    4  
ATOM   7715  O  O    . LYS B 2 110 ? 11.790  18.941  0.581   1.00 0.00 ? 368 LYS A O    4  
ATOM   7716  C  CB   . LYS B 2 110 ? 13.173  16.006  0.376   1.00 0.00 ? 368 LYS A CB   4  
ATOM   7717  C  CG   . LYS B 2 110 ? 13.236  14.486  0.422   1.00 0.00 ? 368 LYS A CG   4  
ATOM   7718  C  CD   . LYS B 2 110 ? 14.650  13.963  0.277   1.00 0.00 ? 368 LYS A CD   4  
ATOM   7719  C  CE   . LYS B 2 110 ? 14.662  12.451  0.204   1.00 0.00 ? 368 LYS A CE   4  
ATOM   7720  N  NZ   . LYS B 2 110 ? 14.324  11.948  -1.155  1.00 0.00 ? 368 LYS A NZ   4  
ATOM   7721  H  H    . LYS B 2 110 ? 11.057  14.688  0.542   1.00 0.00 ? 368 LYS A H    4  
ATOM   7722  H  HA   . LYS B 2 110 ? 12.058  16.817  2.024   1.00 0.00 ? 368 LYS A HA   4  
ATOM   7723  H  HB2  . LYS B 2 110 ? 13.229  16.314  -0.659  1.00 0.00 ? 368 LYS A HB2  4  
ATOM   7724  H  HB3  . LYS B 2 110 ? 14.024  16.400  0.911   1.00 0.00 ? 368 LYS A HB3  4  
ATOM   7725  H  HG2  . LYS B 2 110 ? 12.840  14.153  1.369   1.00 0.00 ? 368 LYS A HG2  4  
ATOM   7726  H  HG3  . LYS B 2 110 ? 12.628  14.085  -0.383  1.00 0.00 ? 368 LYS A HG3  4  
ATOM   7727  H  HD2  . LYS B 2 110 ? 15.090  14.366  -0.622  1.00 0.00 ? 368 LYS A HD2  4  
ATOM   7728  H  HD3  . LYS B 2 110 ? 15.222  14.270  1.135   1.00 0.00 ? 368 LYS A HD3  4  
ATOM   7729  H  HE2  . LYS B 2 110 ? 15.645  12.096  0.476   1.00 0.00 ? 368 LYS A HE2  4  
ATOM   7730  H  HE3  . LYS B 2 110 ? 13.933  12.072  0.910   1.00 0.00 ? 368 LYS A HE3  4  
ATOM   7731  H  HZ1  . LYS B 2 110 ? 14.760  12.553  -1.880  1.00 0.00 ? 368 LYS A HZ1  4  
ATOM   7732  H  HZ2  . LYS B 2 110 ? 13.295  11.949  -1.290  1.00 0.00 ? 368 LYS A HZ2  4  
ATOM   7733  H  HZ3  . LYS B 2 110 ? 14.676  10.976  -1.273  1.00 0.00 ? 368 LYS A HZ3  4  
ATOM   7734  N  N    . GLU B 2 111 ? 10.679  17.578  -0.834  1.00 0.00 ? 369 GLU A N    4  
ATOM   7735  C  CA   . GLU B 2 111 ? 10.169  18.644  -1.681  1.00 0.00 ? 369 GLU A CA   4  
ATOM   7736  C  C    . GLU B 2 111 ? 8.978   19.369  -1.054  1.00 0.00 ? 369 GLU A C    4  
ATOM   7737  O  O    . GLU B 2 111 ? 8.937   20.600  -1.052  1.00 0.00 ? 369 GLU A O    4  
ATOM   7738  C  CB   . GLU B 2 111 ? 9.764   18.078  -3.036  1.00 0.00 ? 369 GLU A CB   4  
ATOM   7739  C  CG   . GLU B 2 111 ? 10.366  18.826  -4.208  1.00 0.00 ? 369 GLU A CG   4  
ATOM   7740  C  CD   . GLU B 2 111 ? 10.051  18.178  -5.542  1.00 0.00 ? 369 GLU A CD   4  
ATOM   7741  O  OE1  . GLU B 2 111 ? 8.950   18.424  -6.077  1.00 0.00 ? 369 GLU A OE1  4  
ATOM   7742  O  OE2  . GLU B 2 111 ? 10.907  17.426  -6.053  1.00 0.00 ? 369 GLU A OE2  4  
ATOM   7743  H  H    . GLU B 2 111 ? 10.468  16.652  -1.067  1.00 0.00 ? 369 GLU A H    4  
ATOM   7744  H  HA   . GLU B 2 111 ? 10.965  19.350  -1.832  1.00 0.00 ? 369 GLU A HA   4  
ATOM   7745  H  HB2  . GLU B 2 111 ? 10.088  17.055  -3.089  1.00 0.00 ? 369 GLU A HB2  4  
ATOM   7746  H  HB3  . GLU B 2 111 ? 8.688   18.113  -3.126  1.00 0.00 ? 369 GLU A HB3  4  
ATOM   7747  H  HG2  . GLU B 2 111 ? 9.977   19.833  -4.214  1.00 0.00 ? 369 GLU A HG2  4  
ATOM   7748  H  HG3  . GLU B 2 111 ? 11.437  18.853  -4.079  1.00 0.00 ? 369 GLU A HG3  4  
ATOM   7749  N  N    . LYS B 2 112 ? 8.007   18.620  -0.522  1.00 0.00 ? 370 LYS A N    4  
ATOM   7750  C  CA   . LYS B 2 112 ? 6.835   19.232  0.053   1.00 0.00 ? 370 LYS A CA   4  
ATOM   7751  C  C    . LYS B 2 112 ? 7.152   19.949  1.361   1.00 0.00 ? 370 LYS A C    4  
ATOM   7752  O  O    . LYS B 2 112 ? 6.521   20.948  1.705   1.00 0.00 ? 370 LYS A O    4  
ATOM   7753  C  CB   . LYS B 2 112 ? 5.752   18.202  0.261   1.00 0.00 ? 370 LYS A CB   4  
ATOM   7754  C  CG   . LYS B 2 112 ? 5.893   17.466  1.550   1.00 0.00 ? 370 LYS A CG   4  
ATOM   7755  C  CD   . LYS B 2 112 ? 5.474   16.037  1.383   1.00 0.00 ? 370 LYS A CD   4  
ATOM   7756  C  CE   . LYS B 2 112 ? 5.597   15.253  2.680   1.00 0.00 ? 370 LYS A CE   4  
ATOM   7757  N  NZ   . LYS B 2 112 ? 4.810   15.874  3.783   1.00 0.00 ? 370 LYS A NZ   4  
ATOM   7758  H  H    . LYS B 2 112 ? 8.075   17.643  -0.515  1.00 0.00 ? 370 LYS A H    4  
ATOM   7759  H  HA   . LYS B 2 112 ? 6.484   19.927  -0.647  1.00 0.00 ? 370 LYS A HA   4  
ATOM   7760  H  HB2  . LYS B 2 112 ? 4.808   18.693  0.250   1.00 0.00 ? 370 LYS A HB2  4  
ATOM   7761  H  HB3  . LYS B 2 112 ? 5.790   17.485  -0.543  1.00 0.00 ? 370 LYS A HB3  4  
ATOM   7762  H  HG2  . LYS B 2 112 ? 6.927   17.499  1.824   1.00 0.00 ? 370 LYS A HG2  4  
ATOM   7763  H  HG3  . LYS B 2 112 ? 5.286   17.938  2.308   1.00 0.00 ? 370 LYS A HG3  4  
ATOM   7764  H  HD2  . LYS B 2 112 ? 4.448   16.005  1.044   1.00 0.00 ? 370 LYS A HD2  4  
ATOM   7765  H  HD3  . LYS B 2 112 ? 6.118   15.606  0.639   1.00 0.00 ? 370 LYS A HD3  4  
ATOM   7766  H  HE2  . LYS B 2 112 ? 5.237   14.249  2.516   1.00 0.00 ? 370 LYS A HE2  4  
ATOM   7767  H  HE3  . LYS B 2 112 ? 6.638   15.219  2.968   1.00 0.00 ? 370 LYS A HE3  4  
ATOM   7768  H  HZ1  . LYS B 2 112 ? 3.804   15.915  3.524   1.00 0.00 ? 370 LYS A HZ1  4  
ATOM   7769  H  HZ2  . LYS B 2 112 ? 5.150   16.839  3.964   1.00 0.00 ? 370 LYS A HZ2  4  
ATOM   7770  H  HZ3  . LYS B 2 112 ? 4.911   15.314  4.654   1.00 0.00 ? 370 LYS A HZ3  4  
ATOM   7771  N  N    . ALA B 2 113 ? 8.136   19.426  2.081   1.00 0.00 ? 371 ALA A N    4  
ATOM   7772  C  CA   . ALA B 2 113 ? 8.549   19.995  3.355   1.00 0.00 ? 371 ALA A CA   4  
ATOM   7773  C  C    . ALA B 2 113 ? 9.060   21.419  3.189   1.00 0.00 ? 371 ALA A C    4  
ATOM   7774  O  O    . ALA B 2 113 ? 9.073   21.963  2.085   1.00 0.00 ? 371 ALA A O    4  
ATOM   7775  C  CB   . ALA B 2 113 ? 9.627   19.133  3.987   1.00 0.00 ? 371 ALA A CB   4  
ATOM   7776  H  H    . ALA B 2 113 ? 8.596   18.632  1.744   1.00 0.00 ? 371 ALA A H    4  
ATOM   7777  H  HA   . ALA B 2 113 ? 7.694   20.001  4.016   1.00 0.00 ? 371 ALA A HA   4  
ATOM   7778  H  HB1  . ALA B 2 113 ? 10.571  19.335  3.501   1.00 0.00 ? 371 ALA A HB1  4  
ATOM   7779  H  HB2  . ALA B 2 113 ? 9.374   18.090  3.862   1.00 0.00 ? 371 ALA A HB2  4  
ATOM   7780  H  HB3  . ALA B 2 113 ? 9.705   19.363  5.038   1.00 0.00 ? 371 ALA A HB3  4  
ATOM   7781  N  N    . SER B 2 114 ? 9.486   22.013  4.298   1.00 0.00 ? 372 SER A N    4  
ATOM   7782  C  CA   . SER B 2 114 ? 10.011  23.372  4.283   1.00 0.00 ? 372 SER A CA   4  
ATOM   7783  C  C    . SER B 2 114 ? 10.611  23.740  5.637   1.00 0.00 ? 372 SER A C    4  
ATOM   7784  O  O    . SER B 2 114 ? 9.854   24.215  6.510   1.00 0.00 ? 372 SER A O    4  
ATOM   7785  C  CB   . SER B 2 114 ? 8.909   24.368  3.913   1.00 0.00 ? 372 SER A CB   4  
ATOM   7786  O  OG   . SER B 2 114 ? 9.392   25.699  3.949   1.00 0.00 ? 372 SER A OG   4  
ATOM   7787  O  OXT  . SER B 2 114 ? 11.833  23.548  5.813   1.00 0.00 ? 372 SER A OXT  4  
ATOM   7788  H  H    . SER B 2 114 ? 9.447   21.526  5.148   1.00 0.00 ? 372 SER A H    4  
ATOM   7789  H  HA   . SER B 2 114 ? 10.788  23.412  3.536   1.00 0.00 ? 372 SER A HA   4  
ATOM   7790  H  HB2  . SER B 2 114 ? 8.555   24.154  2.915   1.00 0.00 ? 372 SER A HB2  4  
ATOM   7791  H  HB3  . SER B 2 114 ? 8.092   24.274  4.612   1.00 0.00 ? 372 SER A HB3  4  
ATOM   7792  H  HG   . SER B 2 114 ? 10.310  25.716  3.668   1.00 0.00 ? 372 SER A HG   4  
HETATM 7793  ZN ZN   . ZN  C 3 .   ? -14.346 -0.495  3.819   1.00 0.00 ? 501 ZN  A ZN   4  
HETATM 7794  ZN ZN   . ZN  D 3 .   ? -3.854  -6.981  -8.052  1.00 0.00 ? 601 ZN  A ZN   4  
HETATM 7795  ZN ZN   . ZN  E 3 .   ? 5.500   5.838   -1.687  1.00 0.00 ? 701 ZN  A ZN   4  
HETATM 7796  ZN ZN   . ZN  F 3 .   ? 13.476  -5.906  -4.967  1.00 0.00 ? 801 ZN  A ZN   4  
ATOM   7797  N  N    . GLY A 1 1   ? -14.246 -23.266 9.694   1.00 0.00 ? 9   GLY B N    5  
ATOM   7798  C  CA   . GLY A 1 1   ? -12.956 -22.525 9.653   1.00 0.00 ? 9   GLY B CA   5  
ATOM   7799  C  C    . GLY A 1 1   ? -13.070 -21.130 10.236  1.00 0.00 ? 9   GLY B C    5  
ATOM   7800  O  O    . GLY A 1 1   ? -14.019 -20.403 9.942   1.00 0.00 ? 9   GLY B O    5  
ATOM   7801  H  H1   . GLY A 1 1   ? -14.575 -23.356 10.676  1.00 0.00 ? 9   GLY B H1   5  
ATOM   7802  H  H2   . GLY A 1 1   ? -14.126 -24.218 9.293   1.00 0.00 ? 9   GLY B H2   5  
ATOM   7803  H  H3   . GLY A 1 1   ? -14.968 -22.758 9.143   1.00 0.00 ? 9   GLY B H3   5  
ATOM   7804  H  HA2  . GLY A 1 1   ? -12.218 -23.079 10.214  1.00 0.00 ? 9   GLY B HA2  5  
ATOM   7805  H  HA3  . GLY A 1 1   ? -12.630 -22.450 8.626   1.00 0.00 ? 9   GLY B HA3  5  
ATOM   7806  N  N    . LEU A 1 2   ? -12.099 -20.757 11.063  1.00 0.00 ? 10  LEU B N    5  
ATOM   7807  C  CA   . LEU A 1 2   ? -12.091 -19.441 11.691  1.00 0.00 ? 10  LEU B CA   5  
ATOM   7808  C  C    . LEU A 1 2   ? -11.481 -18.399 10.760  1.00 0.00 ? 10  LEU B C    5  
ATOM   7809  O  O    . LEU A 1 2   ? -11.063 -18.717 9.647   1.00 0.00 ? 10  LEU B O    5  
ATOM   7810  C  CB   . LEU A 1 2   ? -11.315 -19.483 13.012  1.00 0.00 ? 10  LEU B CB   5  
ATOM   7811  C  CG   . LEU A 1 2   ? -12.033 -20.180 14.171  1.00 0.00 ? 10  LEU B CG   5  
ATOM   7812  C  CD1  . LEU A 1 2   ? -12.182 -21.671 13.898  1.00 0.00 ? 10  LEU B CD1  5  
ATOM   7813  C  CD2  . LEU A 1 2   ? -11.284 -19.948 15.474  1.00 0.00 ? 10  LEU B CD2  5  
ATOM   7814  H  H    . LEU A 1 2   ? -11.369 -21.383 11.257  1.00 0.00 ? 10  LEU B H    5  
ATOM   7815  H  HA   . LEU A 1 2   ? -13.116 -19.167 11.895  1.00 0.00 ? 10  LEU B HA   5  
ATOM   7816  H  HB2  . LEU A 1 2   ? -10.380 -19.992 12.837  1.00 0.00 ? 10  LEU B HB2  5  
ATOM   7817  H  HB3  . LEU A 1 2   ? -11.102 -18.467 13.309  1.00 0.00 ? 10  LEU B HB3  5  
ATOM   7818  H  HG   . LEU A 1 2   ? -13.023 -19.760 14.276  1.00 0.00 ? 10  LEU B HG   5  
ATOM   7819  H  HD11 . LEU A 1 2   ? -11.209 -22.104 13.726  1.00 0.00 ? 10  LEU B HD11 5  
ATOM   7820  H  HD12 . LEU A 1 2   ? -12.802 -21.816 13.026  1.00 0.00 ? 10  LEU B HD12 5  
ATOM   7821  H  HD13 . LEU A 1 2   ? -12.643 -22.148 14.751  1.00 0.00 ? 10  LEU B HD13 5  
ATOM   7822  H  HD21 . LEU A 1 2   ? -11.792 -20.462 16.277  1.00 0.00 ? 10  LEU B HD21 5  
ATOM   7823  H  HD22 . LEU A 1 2   ? -11.253 -18.890 15.689  1.00 0.00 ? 10  LEU B HD22 5  
ATOM   7824  H  HD23 . LEU A 1 2   ? -10.277 -20.327 15.384  1.00 0.00 ? 10  LEU B HD23 5  
ATOM   7825  N  N    . GLY A 1 3   ? -11.434 -17.153 11.224  1.00 0.00 ? 11  GLY B N    5  
ATOM   7826  C  CA   . GLY A 1 3   ? -10.872 -16.085 10.419  1.00 0.00 ? 11  GLY B CA   5  
ATOM   7827  C  C    . GLY A 1 3   ? -11.445 -14.726 10.771  1.00 0.00 ? 11  GLY B C    5  
ATOM   7828  O  O    . GLY A 1 3   ? -12.522 -14.358 10.300  1.00 0.00 ? 11  GLY B O    5  
ATOM   7829  H  H    . GLY A 1 3   ? -11.783 -16.959 12.119  1.00 0.00 ? 11  GLY B H    5  
ATOM   7830  H  HA2  . GLY A 1 3   ? -9.803  -16.061 10.569  1.00 0.00 ? 11  GLY B HA2  5  
ATOM   7831  H  HA3  . GLY A 1 3   ? -11.075 -16.289 9.378   1.00 0.00 ? 11  GLY B HA3  5  
ATOM   7832  N  N    . LYS A 1 4   ? -10.725 -13.979 11.601  1.00 0.00 ? 12  LYS B N    5  
ATOM   7833  C  CA   . LYS A 1 4   ? -11.164 -12.650 12.014  1.00 0.00 ? 12  LYS B CA   5  
ATOM   7834  C  C    . LYS A 1 4   ? -10.423 -11.569 11.233  1.00 0.00 ? 12  LYS B C    5  
ATOM   7835  O  O    . LYS A 1 4   ? -9.194  -11.495 11.270  1.00 0.00 ? 12  LYS B O    5  
ATOM   7836  C  CB   . LYS A 1 4   ? -10.936 -12.459 13.516  1.00 0.00 ? 12  LYS B CB   5  
ATOM   7837  C  CG   . LYS A 1 4   ? -11.713 -13.440 14.379  1.00 0.00 ? 12  LYS B CG   5  
ATOM   7838  C  CD   . LYS A 1 4   ? -11.358 -13.292 15.850  1.00 0.00 ? 12  LYS B CD   5  
ATOM   7839  C  CE   . LYS A 1 4   ? -12.159 -14.251 16.715  1.00 0.00 ? 12  LYS B CE   5  
ATOM   7840  N  NZ   . LYS A 1 4   ? -13.622 -13.990 16.625  1.00 0.00 ? 12  LYS B NZ   5  
ATOM   7841  H  H    . LYS A 1 4   ? -9.877  -14.330 11.945  1.00 0.00 ? 12  LYS B H    5  
ATOM   7842  H  HA   . LYS A 1 4   ? -12.220 -12.569 11.806  1.00 0.00 ? 12  LYS B HA   5  
ATOM   7843  H  HB2  . LYS A 1 4   ? -9.884  -12.581 13.728  1.00 0.00 ? 12  LYS B HB2  5  
ATOM   7844  H  HB3  . LYS A 1 4   ? -11.234 -11.457 13.789  1.00 0.00 ? 12  LYS B HB3  5  
ATOM   7845  H  HG2  . LYS A 1 4   ? -12.770 -13.255 14.254  1.00 0.00 ? 12  LYS B HG2  5  
ATOM   7846  H  HG3  . LYS A 1 4   ? -11.482 -14.446 14.061  1.00 0.00 ? 12  LYS B HG3  5  
ATOM   7847  H  HD2  . LYS A 1 4   ? -10.307 -13.500 15.978  1.00 0.00 ? 12  LYS B HD2  5  
ATOM   7848  H  HD3  . LYS A 1 4   ? -11.567 -12.279 16.161  1.00 0.00 ? 12  LYS B HD3  5  
ATOM   7849  H  HE2  . LYS A 1 4   ? -11.963 -15.262 16.387  1.00 0.00 ? 12  LYS B HE2  5  
ATOM   7850  H  HE3  . LYS A 1 4   ? -11.844 -14.139 17.741  1.00 0.00 ? 12  LYS B HE3  5  
ATOM   7851  H  HZ1  . LYS A 1 4   ? -13.833 -13.024 16.950  1.00 0.00 ? 12  LYS B HZ1  5  
ATOM   7852  H  HZ2  . LYS A 1 4   ? -14.144 -14.665 17.219  1.00 0.00 ? 12  LYS B HZ2  5  
ATOM   7853  H  HZ3  . LYS A 1 4   ? -13.944 -14.091 15.641  1.00 0.00 ? 12  LYS B HZ3  5  
ATOM   7854  N  N    . GLY A 1 5   ? -11.178 -10.734 10.525  1.00 0.00 ? 13  GLY B N    5  
ATOM   7855  C  CA   . GLY A 1 5   ? -10.575 -9.670  9.742   1.00 0.00 ? 13  GLY B CA   5  
ATOM   7856  C  C    . GLY A 1 5   ? -10.622 -8.328  10.446  1.00 0.00 ? 13  GLY B C    5  
ATOM   7857  O  O    . GLY A 1 5   ? -11.011 -8.244  11.612  1.00 0.00 ? 13  GLY B O    5  
ATOM   7858  H  H    . GLY A 1 5   ? -12.152 -10.840 10.536  1.00 0.00 ? 13  GLY B H    5  
ATOM   7859  H  HA2  . GLY A 1 5   ? -9.544  -9.924  9.544   1.00 0.00 ? 13  GLY B HA2  5  
ATOM   7860  H  HA3  . GLY A 1 5   ? -11.101 -9.589  8.801   1.00 0.00 ? 13  GLY B HA3  5  
ATOM   7861  N  N    . GLY A 1 6   ? -10.224 -7.277  9.734   1.00 0.00 ? 14  GLY B N    5  
ATOM   7862  C  CA   . GLY A 1 6   ? -10.228 -5.944  10.310  1.00 0.00 ? 14  GLY B CA   5  
ATOM   7863  C  C    . GLY A 1 6   ? -9.359  -4.975  9.531   1.00 0.00 ? 14  GLY B C    5  
ATOM   7864  O  O    . GLY A 1 6   ? -9.792  -3.871  9.199   1.00 0.00 ? 14  GLY B O    5  
ATOM   7865  H  H    . GLY A 1 6   ? -9.926  -7.408  8.811   1.00 0.00 ? 14  GLY B H    5  
ATOM   7866  H  HA2  . GLY A 1 6   ? -11.242 -5.572  10.322  1.00 0.00 ? 14  GLY B HA2  5  
ATOM   7867  H  HA3  . GLY A 1 6   ? -9.863  -6.000  11.325  1.00 0.00 ? 14  GLY B HA3  5  
ATOM   7868  N  N    . ALA A 1 7   ? -8.130  -5.388  9.241   1.00 0.00 ? 15  ALA B N    5  
ATOM   7869  C  CA   . ALA A 1 7   ? -7.194  -4.555  8.494   1.00 0.00 ? 15  ALA B CA   5  
ATOM   7870  C  C    . ALA A 1 7   ? -6.010  -5.375  7.994   1.00 0.00 ? 15  ALA B C    5  
ATOM   7871  O  O    . ALA A 1 7   ? -5.751  -6.471  8.493   1.00 0.00 ? 15  ALA B O    5  
ATOM   7872  C  CB   . ALA A 1 7   ? -6.712  -3.400  9.359   1.00 0.00 ? 15  ALA B CB   5  
ATOM   7873  H  H    . ALA A 1 7   ? -7.844  -6.278  9.535   1.00 0.00 ? 15  ALA B H    5  
ATOM   7874  H  HA   . ALA A 1 7   ? -7.719  -4.143  7.645   1.00 0.00 ? 15  ALA B HA   5  
ATOM   7875  H  HB1  . ALA A 1 7   ? -6.046  -2.774  8.783   1.00 0.00 ? 15  ALA B HB1  5  
ATOM   7876  H  HB2  . ALA A 1 7   ? -6.188  -3.789  10.219  1.00 0.00 ? 15  ALA B HB2  5  
ATOM   7877  H  HB3  . ALA A 1 7   ? -7.560  -2.816  9.685   1.00 0.00 ? 15  ALA B HB3  5  
HETATM 7878  O  OH   . ALY A 1 8   ? -4.853  -4.611  0.125   1.00 0.00 ? 16  ALY B OH   5  
HETATM 7879  C  CH   . ALY A 1 8   ? -5.774  -5.415  0.003   1.00 0.00 ? 16  ALY B CH   5  
HETATM 7880  C  CH3  . ALY A 1 8   ? -6.675  -5.282  -1.228  1.00 0.00 ? 16  ALY B CH3  5  
HETATM 7881  N  NZ   . ALY A 1 8   ? -6.245  -6.082  1.052   1.00 0.00 ? 16  ALY B NZ   5  
HETATM 7882  C  CE   . ALY A 1 8   ? -6.140  -5.558  2.411   1.00 0.00 ? 16  ALY B CE   5  
HETATM 7883  C  CD   . ALY A 1 8   ? -5.166  -6.344  3.274   1.00 0.00 ? 16  ALY B CD   5  
HETATM 7884  C  CG   . ALY A 1 8   ? -5.704  -6.523  4.687   1.00 0.00 ? 16  ALY B CG   5  
HETATM 7885  C  CB   . ALY A 1 8   ? -4.594  -6.787  5.694   1.00 0.00 ? 16  ALY B CB   5  
HETATM 7886  C  CA   . ALY A 1 8   ? -4.137  -5.534  6.448   1.00 0.00 ? 16  ALY B CA   5  
HETATM 7887  N  N    . ALY A 1 8   ? -5.291  -4.839  7.012   1.00 0.00 ? 16  ALY B N    5  
HETATM 7888  C  C    . ALY A 1 8   ? -3.337  -4.630  5.514   1.00 0.00 ? 16  ALY B C    5  
HETATM 7889  O  O    . ALY A 1 8   ? -2.121  -4.759  5.424   1.00 0.00 ? 16  ALY B O    5  
HETATM 7890  H  HH31 . ALY A 1 8   ? -7.486  -5.993  -1.160  1.00 0.00 ? 16  ALY B HH31 5  
HETATM 7891  H  HH32 . ALY A 1 8   ? -7.076  -4.279  -1.269  1.00 0.00 ? 16  ALY B HH32 5  
HETATM 7892  H  HH33 . ALY A 1 8   ? -6.097  -5.477  -2.119  1.00 0.00 ? 16  ALY B HH33 5  
HETATM 7893  H  HZ   . ALY A 1 8   ? -6.973  -6.717  0.891   1.00 0.00 ? 16  ALY B HZ   5  
HETATM 7894  H  HE3  . ALY A 1 8   ? -5.811  -4.528  2.363   1.00 0.00 ? 16  ALY B HE3  5  
HETATM 7895  H  HE2  . ALY A 1 8   ? -7.116  -5.599  2.871   1.00 0.00 ? 16  ALY B HE2  5  
HETATM 7896  H  HD3  . ALY A 1 8   ? -5.008  -7.317  2.832   1.00 0.00 ? 16  ALY B HD3  5  
HETATM 7897  H  HD2  . ALY A 1 8   ? -4.228  -5.811  3.321   1.00 0.00 ? 16  ALY B HD2  5  
HETATM 7898  H  HG3  . ALY A 1 8   ? -6.232  -5.626  4.977   1.00 0.00 ? 16  ALY B HG3  5  
HETATM 7899  H  HG2  . ALY A 1 8   ? -6.387  -7.360  4.694   1.00 0.00 ? 16  ALY B HG2  5  
HETATM 7900  H  HB3  . ALY A 1 8   ? -4.952  -7.513  6.409   1.00 0.00 ? 16  ALY B HB3  5  
HETATM 7901  H  HB2  . ALY A 1 8   ? -3.749  -7.203  5.164   1.00 0.00 ? 16  ALY B HB2  5  
HETATM 7902  H  HCA  . ALY A 1 8   ? -3.501  -5.834  7.267   1.00 0.00 ? 16  ALY B HCA  5  
HETATM 7903  H  H    . ALY A 1 8   ? -5.539  -3.958  6.659   1.00 0.00 ? 16  ALY B H    5  
ATOM   7904  N  N    . ARG A 1 9   ? -4.040  -3.716  4.838   1.00 0.00 ? 17  ARG B N    5  
ATOM   7905  C  CA   . ARG A 1 9   ? -3.440  -2.779  3.877   1.00 0.00 ? 17  ARG B CA   5  
ATOM   7906  C  C    . ARG A 1 9   ? -2.776  -3.532  2.714   1.00 0.00 ? 17  ARG B C    5  
ATOM   7907  O  O    . ARG A 1 9   ? -3.235  -3.430  1.579   1.00 0.00 ? 17  ARG B O    5  
ATOM   7908  C  CB   . ARG A 1 9   ? -2.485  -1.776  4.566   1.00 0.00 ? 17  ARG B CB   5  
ATOM   7909  C  CG   . ARG A 1 9   ? -1.040  -2.226  4.731   1.00 0.00 ? 17  ARG B CG   5  
ATOM   7910  C  CD   . ARG A 1 9   ? -0.142  -1.057  5.102   1.00 0.00 ? 17  ARG B CD   5  
ATOM   7911  N  NE   . ARG A 1 9   ? -0.275  -0.686  6.509   1.00 0.00 ? 17  ARG B NE   5  
ATOM   7912  C  CZ   . ARG A 1 9   ? -0.620  0.530   6.924   1.00 0.00 ? 17  ARG B CZ   5  
ATOM   7913  N  NH1  . ARG A 1 9   ? -0.911  1.479   6.046   1.00 0.00 ? 17  ARG B NH1  5  
ATOM   7914  N  NH2  . ARG A 1 9   ? -0.683  0.795   8.222   1.00 0.00 ? 17  ARG B NH2  5  
ATOM   7915  H  H    . ARG A 1 9   ? -5.007  -3.667  4.991   1.00 0.00 ? 17  ARG B H    5  
ATOM   7916  H  HA   . ARG A 1 9   ? -4.263  -2.216  3.458   1.00 0.00 ? 17  ARG B HA   5  
ATOM   7917  H  HB2  . ARG A 1 9   ? -2.479  -0.865  3.989   1.00 0.00 ? 17  ARG B HB2  5  
ATOM   7918  H  HB3  . ARG A 1 9   ? -2.879  -1.556  5.549   1.00 0.00 ? 17  ARG B HB3  5  
ATOM   7919  H  HG2  . ARG A 1 9   ? -0.990  -2.966  5.513   1.00 0.00 ? 17  ARG B HG2  5  
ATOM   7920  H  HG3  . ARG A 1 9   ? -0.692  -2.654  3.801   1.00 0.00 ? 17  ARG B HG3  5  
ATOM   7921  H  HD2  . ARG A 1 9   ? 0.883   -1.332  4.909   1.00 0.00 ? 17  ARG B HD2  5  
ATOM   7922  H  HD3  . ARG A 1 9   ? -0.411  -0.209  4.490   1.00 0.00 ? 17  ARG B HD3  5  
ATOM   7923  H  HE   . ARG A 1 9   ? -0.084  -1.375  7.180   1.00 0.00 ? 17  ARG B HE   5  
ATOM   7924  H  HH11 . ARG A 1 9   ? -0.872  1.283   5.065   1.00 0.00 ? 17  ARG B HH11 5  
ATOM   7925  H  HH12 . ARG A 1 9   ? -1.169  2.391   6.362   1.00 0.00 ? 17  ARG B HH12 5  
ATOM   7926  H  HH21 . ARG A 1 9   ? -0.470  0.081   8.889   1.00 0.00 ? 17  ARG B HH21 5  
ATOM   7927  H  HH22 . ARG A 1 9   ? -0.941  1.709   8.534   1.00 0.00 ? 17  ARG B HH22 5  
ATOM   7928  N  N    . HIS A 1 10  ? -1.706  -4.277  2.999   1.00 0.00 ? 18  HIS B N    5  
ATOM   7929  C  CA   . HIS A 1 10  ? -1.009  -5.083  1.999   1.00 0.00 ? 18  HIS B CA   5  
ATOM   7930  C  C    . HIS A 1 10  ? 0.298   -5.633  2.551   1.00 0.00 ? 18  HIS B C    5  
ATOM   7931  O  O    . HIS A 1 10  ? 1.268   -4.903  2.756   1.00 0.00 ? 18  HIS B O    5  
ATOM   7932  C  CB   . HIS A 1 10  ? -0.758  -4.335  0.682   1.00 0.00 ? 18  HIS B CB   5  
ATOM   7933  C  CG   . HIS A 1 10  ? 0.007   -3.063  0.786   1.00 0.00 ? 18  HIS B CG   5  
ATOM   7934  N  ND1  . HIS A 1 10  ? -0.289  -2.058  1.678   1.00 0.00 ? 18  HIS B ND1  5  
ATOM   7935  C  CD2  . HIS A 1 10  ? 1.063   -2.632  0.068   1.00 0.00 ? 18  HIS B CD2  5  
ATOM   7936  C  CE1  . HIS A 1 10  ? 0.556   -1.058  1.503   1.00 0.00 ? 18  HIS B CE1  5  
ATOM   7937  N  NE2  . HIS A 1 10  ? 1.388   -1.382  0.530   1.00 0.00 ? 18  HIS B NE2  5  
ATOM   7938  H  H    . HIS A 1 10  ? -1.370  -4.282  3.915   1.00 0.00 ? 18  HIS B H    5  
ATOM   7939  H  HA   . HIS A 1 10  ? -1.650  -5.928  1.785   1.00 0.00 ? 18  HIS B HA   5  
ATOM   7940  H  HB2  . HIS A 1 10  ? -0.197  -4.984  0.028   1.00 0.00 ? 18  HIS B HB2  5  
ATOM   7941  H  HB3  . HIS A 1 10  ? -1.705  -4.123  0.217   1.00 0.00 ? 18  HIS B HB3  5  
ATOM   7942  H  HD1  . HIS A 1 10  ? -1.014  -2.071  2.336   1.00 0.00 ? 18  HIS B HD1  5  
ATOM   7943  H  HD2  . HIS A 1 10  ? 1.552   -3.177  -0.729  1.00 0.00 ? 18  HIS B HD2  5  
ATOM   7944  H  HE1  . HIS A 1 10  ? 0.567   -0.134  2.062   1.00 0.00 ? 18  HIS B HE1  5  
ATOM   7945  H  HE2  . HIS A 1 10  ? 2.183   -0.871  0.273   1.00 0.00 ? 18  HIS B HE2  5  
ATOM   7946  N  N    . ARG A 1 11  ? 0.300   -6.937  2.790   1.00 0.00 ? 19  ARG B N    5  
ATOM   7947  C  CA   . ARG A 1 11  ? 1.462   -7.637  3.314   1.00 0.00 ? 19  ARG B CA   5  
ATOM   7948  C  C    . ARG A 1 11  ? 1.436   -9.089  2.843   1.00 0.00 ? 19  ARG B C    5  
ATOM   7949  O  O    . ARG A 1 11  ? 2.417   -9.814  2.980   1.00 0.00 ? 19  ARG B O    5  
ATOM   7950  C  CB   . ARG A 1 11  ? 1.463   -7.566  4.841   1.00 0.00 ? 19  ARG B CB   5  
ATOM   7951  C  CG   . ARG A 1 11  ? 2.534   -8.419  5.504   1.00 0.00 ? 19  ARG B CG   5  
ATOM   7952  C  CD   . ARG A 1 11  ? 3.923   -7.832  5.311   1.00 0.00 ? 19  ARG B CD   5  
ATOM   7953  N  NE   . ARG A 1 11  ? 4.975   -8.822  5.546   1.00 0.00 ? 19  ARG B NE   5  
ATOM   7954  C  CZ   . ARG A 1 11  ? 6.225   -8.513  5.880   1.00 0.00 ? 19  ARG B CZ   5  
ATOM   7955  N  NH1  . ARG A 1 11  ? 6.577   -7.246  6.057   1.00 0.00 ? 19  ARG B NH1  5  
ATOM   7956  N  NH2  . ARG A 1 11  ? 7.126   -9.474  6.044   1.00 0.00 ? 19  ARG B NH2  5  
ATOM   7957  H  H    . ARG A 1 11  ? -0.516  -7.448  2.606   1.00 0.00 ? 19  ARG B H    5  
ATOM   7958  H  HA   . ARG A 1 11  ? 2.349   -7.155  2.932   1.00 0.00 ? 19  ARG B HA   5  
ATOM   7959  H  HB2  . ARG A 1 11  ? 1.615   -6.539  5.141   1.00 0.00 ? 19  ARG B HB2  5  
ATOM   7960  H  HB3  . ARG A 1 11  ? 0.499   -7.893  5.193   1.00 0.00 ? 19  ARG B HB3  5  
ATOM   7961  H  HG2  . ARG A 1 11  ? 2.326   -8.485  6.561   1.00 0.00 ? 19  ARG B HG2  5  
ATOM   7962  H  HG3  . ARG A 1 11  ? 2.508   -9.405  5.069   1.00 0.00 ? 19  ARG B HG3  5  
ATOM   7963  H  HD2  . ARG A 1 11  ? 4.006   -7.469  4.299   1.00 0.00 ? 19  ARG B HD2  5  
ATOM   7964  H  HD3  . ARG A 1 11  ? 4.053   -7.011  6.000   1.00 0.00 ? 19  ARG B HD3  5  
ATOM   7965  H  HE   . ARG A 1 11  ? 4.739   -9.766  5.437   1.00 0.00 ? 19  ARG B HE   5  
ATOM   7966  H  HH11 . ARG A 1 11  ? 5.901   -6.518  5.940   1.00 0.00 ? 19  ARG B HH11 5  
ATOM   7967  H  HH12 . ARG A 1 11  ? 7.518   -7.018  6.310   1.00 0.00 ? 19  ARG B HH12 5  
ATOM   7968  H  HH21 . ARG A 1 11  ? 6.864   -10.431 5.915   1.00 0.00 ? 19  ARG B HH21 5  
ATOM   7969  H  HH22 . ARG A 1 11  ? 8.065   -9.243  6.295   1.00 0.00 ? 19  ARG B HH22 5  
ATOM   7970  N  N    . LYS A 1 12  ? 0.280   -9.488  2.302   1.00 0.00 ? 20  LYS B N    5  
ATOM   7971  C  CA   . LYS A 1 12  ? 0.049   -10.835 1.764   1.00 0.00 ? 20  LYS B CA   5  
ATOM   7972  C  C    . LYS A 1 12  ? 0.407   -11.948 2.755   1.00 0.00 ? 20  LYS B C    5  
ATOM   7973  O  O    . LYS A 1 12  ? 0.353   -13.128 2.405   1.00 0.00 ? 20  LYS B O    5  
ATOM   7974  C  CB   . LYS A 1 12  ? 0.801   -11.024 0.437   1.00 0.00 ? 20  LYS B CB   5  
ATOM   7975  C  CG   . LYS A 1 12  ? 2.268   -11.357 0.593   1.00 0.00 ? 20  LYS B CG   5  
ATOM   7976  C  CD   . LYS A 1 12  ? 3.113   -10.567 -0.372  1.00 0.00 ? 20  LYS B CD   5  
ATOM   7977  C  CE   . LYS A 1 12  ? 3.843   -9.454  0.360   1.00 0.00 ? 20  LYS B CE   5  
ATOM   7978  N  NZ   . LYS A 1 12  ? 4.712   -9.986  1.446   1.00 0.00 ? 20  LYS B NZ   5  
ATOM   7979  H  H    . LYS A 1 12  ? -0.457  -8.844  2.263   1.00 0.00 ? 20  LYS B H    5  
ATOM   7980  H  HA   . LYS A 1 12  ? -1.008  -10.908 1.559   1.00 0.00 ? 20  LYS B HA   5  
ATOM   7981  H  HB2  . LYS A 1 12  ? 0.332   -11.818 -0.123  1.00 0.00 ? 20  LYS B HB2  5  
ATOM   7982  H  HB3  . LYS A 1 12  ? 0.733   -10.109 -0.132  1.00 0.00 ? 20  LYS B HB3  5  
ATOM   7983  H  HG2  . LYS A 1 12  ? 2.572   -11.103 1.591   1.00 0.00 ? 20  LYS B HG2  5  
ATOM   7984  H  HG3  . LYS A 1 12  ? 2.422   -12.409 0.416   1.00 0.00 ? 20  LYS B HG3  5  
ATOM   7985  H  HD2  . LYS A 1 12  ? 3.836   -11.225 -0.832  1.00 0.00 ? 20  LYS B HD2  5  
ATOM   7986  H  HD3  . LYS A 1 12  ? 2.468   -10.136 -1.134  1.00 0.00 ? 20  LYS B HD3  5  
ATOM   7987  H  HE2  . LYS A 1 12  ? 4.457   -8.916  -0.346  1.00 0.00 ? 20  LYS B HE2  5  
ATOM   7988  H  HE3  . LYS A 1 12  ? 3.114   -8.784  0.790   1.00 0.00 ? 20  LYS B HE3  5  
ATOM   7989  H  HZ1  . LYS A 1 12  ? 5.447   -10.605 1.046   1.00 0.00 ? 20  LYS B HZ1  5  
ATOM   7990  H  HZ2  . LYS A 1 12  ? 4.145   -10.534 2.123   1.00 0.00 ? 20  LYS B HZ2  5  
ATOM   7991  H  HZ3  . LYS A 1 12  ? 5.172   -9.202  1.953   1.00 0.00 ? 20  LYS B HZ3  5  
ATOM   7992  N  N    . VAL A 1 13  ? 0.757   -11.580 3.987   1.00 0.00 ? 21  VAL B N    5  
ATOM   7993  C  CA   . VAL A 1 13  ? 1.102   -12.566 5.011   1.00 0.00 ? 21  VAL B CA   5  
ATOM   7994  C  C    . VAL A 1 13  ? 0.758   -12.048 6.405   1.00 0.00 ? 21  VAL B C    5  
ATOM   7995  O  O    . VAL A 1 13  ? 0.673   -10.839 6.622   1.00 0.00 ? 21  VAL B O    5  
ATOM   7996  C  CB   . VAL A 1 13  ? 2.599   -12.952 4.982   1.00 0.00 ? 21  VAL B CB   5  
ATOM   7997  C  CG1  . VAL A 1 13  ? 2.983   -13.554 3.640   1.00 0.00 ? 21  VAL B CG1  5  
ATOM   7998  C  CG2  . VAL A 1 13  ? 3.473   -11.752 5.302   1.00 0.00 ? 21  VAL B CG2  5  
ATOM   7999  H  H    . VAL A 1 13  ? 0.780   -10.629 4.214   1.00 0.00 ? 21  VAL B H    5  
ATOM   8000  H  HA   . VAL A 1 13  ? 0.520   -13.457 4.822   1.00 0.00 ? 21  VAL B HA   5  
ATOM   8001  H  HB   . VAL A 1 13  ? 2.767   -13.700 5.742   1.00 0.00 ? 21  VAL B HB   5  
ATOM   8002  H  HG11 . VAL A 1 13  ? 2.365   -14.418 3.442   1.00 0.00 ? 21  VAL B HG11 5  
ATOM   8003  H  HG12 . VAL A 1 13  ? 4.021   -13.854 3.664   1.00 0.00 ? 21  VAL B HG12 5  
ATOM   8004  H  HG13 . VAL A 1 13  ? 2.838   -12.822 2.861   1.00 0.00 ? 21  VAL B HG13 5  
ATOM   8005  H  HG21 . VAL A 1 13  ? 3.211   -11.365 6.276   1.00 0.00 ? 21  VAL B HG21 5  
ATOM   8006  H  HG22 . VAL A 1 13  ? 3.320   -10.986 4.556   1.00 0.00 ? 21  VAL B HG22 5  
ATOM   8007  H  HG23 . VAL A 1 13  ? 4.511   -12.052 5.301   1.00 0.00 ? 21  VAL B HG23 5  
ATOM   8008  N  N    . LEU A 1 14  ? 0.563   -12.973 7.342   1.00 0.00 ? 22  LEU B N    5  
ATOM   8009  C  CA   . LEU A 1 14  ? 0.231   -12.624 8.721   1.00 0.00 ? 22  LEU B CA   5  
ATOM   8010  C  C    . LEU A 1 14  ? -1.062  -11.816 8.788   1.00 0.00 ? 22  LEU B C    5  
ATOM   8011  O  O    . LEU A 1 14  ? -1.069  -10.610 8.541   1.00 0.00 ? 22  LEU B O    5  
ATOM   8012  C  CB   . LEU A 1 14  ? 1.380   -11.837 9.363   1.00 0.00 ? 22  LEU B CB   5  
ATOM   8013  C  CG   . LEU A 1 14  ? 1.245   -11.601 10.871  1.00 0.00 ? 22  LEU B CG   5  
ATOM   8014  C  CD1  . LEU A 1 14  ? 2.610   -11.647 11.538  1.00 0.00 ? 22  LEU B CD1  5  
ATOM   8015  C  CD2  . LEU A 1 14  ? 0.569   -10.266 11.144  1.00 0.00 ? 22  LEU B CD2  5  
ATOM   8016  H  H    . LEU A 1 14  ? 0.644   -13.919 7.099   1.00 0.00 ? 22  LEU B H    5  
ATOM   8017  H  HA   . LEU A 1 14  ? 0.091   -13.544 9.268   1.00 0.00 ? 22  LEU B HA   5  
ATOM   8018  H  HB2  . LEU A 1 14  ? 2.299   -12.375 9.185   1.00 0.00 ? 22  LEU B HB2  5  
ATOM   8019  H  HB3  . LEU A 1 14  ? 1.445   -10.876 8.876   1.00 0.00 ? 22  LEU B HB3  5  
ATOM   8020  H  HG   . LEU A 1 14  ? 0.635   -12.382 11.300  1.00 0.00 ? 22  LEU B HG   5  
ATOM   8021  H  HD11 . LEU A 1 14  ? 3.236   -10.866 11.135  1.00 0.00 ? 22  LEU B HD11 5  
ATOM   8022  H  HD12 . LEU A 1 14  ? 3.068   -12.608 11.352  1.00 0.00 ? 22  LEU B HD12 5  
ATOM   8023  H  HD13 . LEU A 1 14  ? 2.495   -11.505 12.603  1.00 0.00 ? 22  LEU B HD13 5  
ATOM   8024  H  HD21 . LEU A 1 14  ? -0.422  -10.269 10.713  1.00 0.00 ? 22  LEU B HD21 5  
ATOM   8025  H  HD22 . LEU A 1 14  ? 1.150   -9.469  10.705  1.00 0.00 ? 22  LEU B HD22 5  
ATOM   8026  H  HD23 . LEU A 1 14  ? 0.496   -10.112 12.212  1.00 0.00 ? 22  LEU B HD23 5  
ATOM   8027  N  N    . ARG A 1 15  ? -2.156  -12.492 9.128   1.00 0.00 ? 23  ARG B N    5  
ATOM   8028  C  CA   . ARG A 1 15  ? -3.457  -11.842 9.231   1.00 0.00 ? 23  ARG B CA   5  
ATOM   8029  C  C    . ARG A 1 15  ? -4.061  -12.051 10.616  1.00 0.00 ? 23  ARG B C    5  
ATOM   8030  O  O    . ARG A 1 15  ? -4.683  -13.112 10.837  1.00 0.00 ? 23  ARG B O    5  
ATOM   8031  C  CB   . ARG A 1 15  ? -4.406  -12.381 8.158   1.00 0.00 ? 23  ARG B CB   5  
ATOM   8032  C  CG   . ARG A 1 15  ? -5.773  -11.718 8.167   1.00 0.00 ? 23  ARG B CG   5  
ATOM   8033  C  CD   . ARG A 1 15  ? -6.658  -12.252 7.053   1.00 0.00 ? 23  ARG B CD   5  
ATOM   8034  N  NE   . ARG A 1 15  ? -6.065  -12.044 5.735   1.00 0.00 ? 23  ARG B NE   5  
ATOM   8035  C  CZ   . ARG A 1 15  ? -6.475  -12.668 4.635   1.00 0.00 ? 23  ARG B CZ   5  
ATOM   8036  N  NH1  . ARG A 1 15  ? -7.474  -13.539 4.694   1.00 0.00 ? 23  ARG B NH1  5  
ATOM   8037  N  NH2  . ARG A 1 15  ? -5.886  -12.421 3.473   1.00 0.00 ? 23  ARG B NH2  5  
ATOM   8038  O  OXT  . ARG A 1 15  ? -3.908  -11.151 11.469  1.00 0.00 ? 23  ARG B OXT  5  
ATOM   8039  H  H    . ARG A 1 15  ? -2.086  -13.451 9.315   1.00 0.00 ? 23  ARG B H    5  
ATOM   8040  H  HA   . ARG A 1 15  ? -3.312  -10.783 9.071   1.00 0.00 ? 23  ARG B HA   5  
ATOM   8041  H  HB2  . ARG A 1 15  ? -3.960  -12.224 7.187   1.00 0.00 ? 23  ARG B HB2  5  
ATOM   8042  H  HB3  . ARG A 1 15  ? -4.542  -13.441 8.315   1.00 0.00 ? 23  ARG B HB3  5  
ATOM   8043  H  HG2  . ARG A 1 15  ? -6.250  -11.910 9.116   1.00 0.00 ? 23  ARG B HG2  5  
ATOM   8044  H  HG3  . ARG A 1 15  ? -5.647  -10.653 8.035   1.00 0.00 ? 23  ARG B HG3  5  
ATOM   8045  H  HD2  . ARG A 1 15  ? -6.809  -13.311 7.206   1.00 0.00 ? 23  ARG B HD2  5  
ATOM   8046  H  HD3  . ARG A 1 15  ? -7.611  -11.745 7.093   1.00 0.00 ? 23  ARG B HD3  5  
ATOM   8047  H  HE   . ARG A 1 15  ? -5.323  -11.408 5.667   1.00 0.00 ? 23  ARG B HE   5  
ATOM   8048  H  HH11 . ARG A 1 15  ? -7.920  -13.729 5.568   1.00 0.00 ? 23  ARG B HH11 5  
ATOM   8049  H  HH12 . ARG A 1 15  ? -7.781  -14.005 3.865   1.00 0.00 ? 23  ARG B HH12 5  
ATOM   8050  H  HH21 . ARG A 1 15  ? -5.131  -11.766 3.423   1.00 0.00 ? 23  ARG B HH21 5  
ATOM   8051  H  HH22 . ARG A 1 15  ? -6.196  -12.890 2.645   1.00 0.00 ? 23  ARG B HH22 5  
ATOM   8052  N  N    . GLY B 2 1   ? -19.669 -1.856  -9.947  1.00 0.00 ? 259 GLY A N    5  
ATOM   8053  C  CA   . GLY B 2 1   ? -18.218 -1.530  -9.856  1.00 0.00 ? 259 GLY A CA   5  
ATOM   8054  C  C    . GLY B 2 1   ? -17.525 -2.273  -8.730  1.00 0.00 ? 259 GLY A C    5  
ATOM   8055  O  O    . GLY B 2 1   ? -18.100 -3.184  -8.134  1.00 0.00 ? 259 GLY A O    5  
ATOM   8056  H  H1   . GLY B 2 1   ? -19.795 -2.876  -10.112 1.00 0.00 ? 259 GLY A H1   5  
ATOM   8057  H  H2   . GLY B 2 1   ? -20.105 -1.333  -10.733 1.00 0.00 ? 259 GLY A H2   5  
ATOM   8058  H  H3   . GLY B 2 1   ? -20.149 -1.596  -9.063  1.00 0.00 ? 259 GLY A H3   5  
ATOM   8059  H  HA2  . GLY B 2 1   ? -17.742 -1.791  -10.791 1.00 0.00 ? 259 GLY A HA2  5  
ATOM   8060  H  HA3  . GLY B 2 1   ? -18.108 -0.468  -9.693  1.00 0.00 ? 259 GLY A HA3  5  
ATOM   8061  N  N    . SER B 2 2   ? -16.288 -1.883  -8.440  1.00 0.00 ? 260 SER A N    5  
ATOM   8062  C  CA   . SER B 2 2   ? -15.515 -2.518  -7.377  1.00 0.00 ? 260 SER A CA   5  
ATOM   8063  C  C    . SER B 2 2   ? -16.112 -2.259  -6.011  1.00 0.00 ? 260 SER A C    5  
ATOM   8064  O  O    . SER B 2 2   ? -17.184 -1.671  -5.876  1.00 0.00 ? 260 SER A O    5  
ATOM   8065  C  CB   . SER B 2 2   ? -14.081 -2.018  -7.368  1.00 0.00 ? 260 SER A CB   5  
ATOM   8066  O  OG   . SER B 2 2   ? -13.326 -2.588  -8.423  1.00 0.00 ? 260 SER A OG   5  
ATOM   8067  H  H    . SER B 2 2   ? -15.884 -1.152  -8.952  1.00 0.00 ? 260 SER A H    5  
ATOM   8068  H  HA   . SER B 2 2   ? -15.502 -3.579  -7.549  1.00 0.00 ? 260 SER A HA   5  
ATOM   8069  H  HB2  . SER B 2 2   ? -14.074 -0.943  -7.472  1.00 0.00 ? 260 SER A HB2  5  
ATOM   8070  H  HB3  . SER B 2 2   ? -13.636 -2.295  -6.423  1.00 0.00 ? 260 SER A HB3  5  
ATOM   8071  H  HG   . SER B 2 2   ? -12.987 -3.442  -8.150  1.00 0.00 ? 260 SER A HG   5  
ATOM   8072  N  N    . TYR B 2 3   ? -15.387 -2.711  -5.001  1.00 0.00 ? 261 TYR A N    5  
ATOM   8073  C  CA   . TYR B 2 3   ? -15.791 -2.547  -3.627  1.00 0.00 ? 261 TYR A CA   5  
ATOM   8074  C  C    . TYR B 2 3   ? -14.604 -2.785  -2.707  1.00 0.00 ? 261 TYR A C    5  
ATOM   8075  O  O    . TYR B 2 3   ? -13.681 -3.527  -3.044  1.00 0.00 ? 261 TYR A O    5  
ATOM   8076  C  CB   . TYR B 2 3   ? -16.916 -3.522  -3.282  1.00 0.00 ? 261 TYR A CB   5  
ATOM   8077  C  CG   . TYR B 2 3   ? -16.645 -4.952  -3.685  1.00 0.00 ? 261 TYR A CG   5  
ATOM   8078  C  CD1  . TYR B 2 3   ? -15.522 -5.602  -3.222  1.00 0.00 ? 261 TYR A CD1  5  
ATOM   8079  C  CD2  . TYR B 2 3   ? -17.514 -5.651  -4.513  1.00 0.00 ? 261 TYR A CD2  5  
ATOM   8080  C  CE1  . TYR B 2 3   ? -15.254 -6.903  -3.561  1.00 0.00 ? 261 TYR A CE1  5  
ATOM   8081  C  CE2  . TYR B 2 3   ? -17.257 -6.963  -4.866  1.00 0.00 ? 261 TYR A CE2  5  
ATOM   8082  C  CZ   . TYR B 2 3   ? -16.123 -7.587  -4.386  1.00 0.00 ? 261 TYR A CZ   5  
ATOM   8083  O  OH   . TYR B 2 3   ? -15.860 -8.893  -4.729  1.00 0.00 ? 261 TYR A OH   5  
ATOM   8084  H  H    . TYR B 2 3   ? -14.548 -3.182  -5.191  1.00 0.00 ? 261 TYR A H    5  
ATOM   8085  H  HA   . TYR B 2 3   ? -16.141 -1.534  -3.494  1.00 0.00 ? 261 TYR A HA   5  
ATOM   8086  H  HB2  . TYR B 2 3   ? -17.068 -3.505  -2.221  1.00 0.00 ? 261 TYR A HB2  5  
ATOM   8087  H  HB3  . TYR B 2 3   ? -17.817 -3.213  -3.764  1.00 0.00 ? 261 TYR A HB3  5  
ATOM   8088  H  HD1  . TYR B 2 3   ? -14.842 -5.063  -2.585  1.00 0.00 ? 261 TYR A HD1  5  
ATOM   8089  H  HD2  . TYR B 2 3   ? -18.399 -5.156  -4.884  1.00 0.00 ? 261 TYR A HD2  5  
ATOM   8090  H  HE1  . TYR B 2 3   ? -14.368 -7.377  -3.176  1.00 0.00 ? 261 TYR A HE1  5  
ATOM   8091  H  HE2  . TYR B 2 3   ? -17.941 -7.494  -5.512  1.00 0.00 ? 261 TYR A HE2  5  
ATOM   8092  H  HH   . TYR B 2 3   ? -15.615 -9.387  -3.944  1.00 0.00 ? 261 TYR A HH   5  
ATOM   8093  N  N    . CYS B 2 4   ? -14.609 -2.122  -1.569  1.00 0.00 ? 262 CYS A N    5  
ATOM   8094  C  CA   . CYS B 2 4   ? -13.548 -2.289  -0.595  1.00 0.00 ? 262 CYS A CA   5  
ATOM   8095  C  C    . CYS B 2 4   ? -13.473 -3.744  -0.155  1.00 0.00 ? 262 CYS A C    5  
ATOM   8096  O  O    . CYS B 2 4   ? -14.480 -4.343  0.207   1.00 0.00 ? 262 CYS A O    5  
ATOM   8097  C  CB   . CYS B 2 4   ? -13.829 -1.394  0.596   1.00 0.00 ? 262 CYS A CB   5  
ATOM   8098  S  SG   . CYS B 2 4   ? -13.348 -2.050  2.223   1.00 0.00 ? 262 CYS A SG   5  
ATOM   8099  H  H    . CYS B 2 4   ? -15.332 -1.491  -1.384  1.00 0.00 ? 262 CYS A H    5  
ATOM   8100  H  HA   . CYS B 2 4   ? -12.609 -1.989  -1.058  1.00 0.00 ? 262 CYS A HA   5  
ATOM   8101  H  HB2  . CYS B 2 4   ? -13.312 -0.467  0.466   1.00 0.00 ? 262 CYS A HB2  5  
ATOM   8102  H  HB3  . CYS B 2 4   ? -14.888 -1.193  0.626   1.00 0.00 ? 262 CYS A HB3  5  
ATOM   8103  N  N    . ASP B 2 5   ? -12.283 -4.306  -0.189  1.00 0.00 ? 263 ASP A N    5  
ATOM   8104  C  CA   . ASP B 2 5   ? -12.080 -5.701  0.202   1.00 0.00 ? 263 ASP A CA   5  
ATOM   8105  C  C    . ASP B 2 5   ? -12.347 -5.905  1.700   1.00 0.00 ? 263 ASP A C    5  
ATOM   8106  O  O    . ASP B 2 5   ? -12.178 -7.003  2.232   1.00 0.00 ? 263 ASP A O    5  
ATOM   8107  C  CB   . ASP B 2 5   ? -10.648 -6.115  -0.140  1.00 0.00 ? 263 ASP A CB   5  
ATOM   8108  C  CG   . ASP B 2 5   ? -10.303 -7.518  0.322   1.00 0.00 ? 263 ASP A CG   5  
ATOM   8109  O  OD1  . ASP B 2 5   ? -11.035 -8.461  -0.042  1.00 0.00 ? 263 ASP A OD1  5  
ATOM   8110  O  OD2  . ASP B 2 5   ? -9.298  -7.670  1.050   1.00 0.00 ? 263 ASP A OD2  5  
ATOM   8111  H  H    . ASP B 2 5   ? -11.517 -3.772  -0.491  1.00 0.00 ? 263 ASP A H    5  
ATOM   8112  H  HA   . ASP B 2 5   ? -12.775 -6.310  -0.366  1.00 0.00 ? 263 ASP A HA   5  
ATOM   8113  H  HB2  . ASP B 2 5   ? -10.513 -6.067  -1.209  1.00 0.00 ? 263 ASP A HB2  5  
ATOM   8114  H  HB3  . ASP B 2 5   ? -9.968  -5.422  0.335   1.00 0.00 ? 263 ASP A HB3  5  
ATOM   8115  N  N    . PHE B 2 6   ? -12.777 -4.839  2.366   1.00 0.00 ? 264 PHE A N    5  
ATOM   8116  C  CA   . PHE B 2 6   ? -13.064 -4.877  3.804   1.00 0.00 ? 264 PHE A CA   5  
ATOM   8117  C  C    . PHE B 2 6   ? -14.572 -4.823  4.068   1.00 0.00 ? 264 PHE A C    5  
ATOM   8118  O  O    . PHE B 2 6   ? -15.051 -5.404  5.044   1.00 0.00 ? 264 PHE A O    5  
ATOM   8119  C  CB   . PHE B 2 6   ? -12.359 -3.716  4.538   1.00 0.00 ? 264 PHE A CB   5  
ATOM   8120  C  CG   . PHE B 2 6   ? -10.879 -3.635  4.296   1.00 0.00 ? 264 PHE A CG   5  
ATOM   8121  C  CD1  . PHE B 2 6   ? -10.378 -3.368  3.032   1.00 0.00 ? 264 PHE A CD1  5  
ATOM   8122  C  CD2  . PHE B 2 6   ? -9.987  -3.811  5.341   1.00 0.00 ? 264 PHE A CD2  5  
ATOM   8123  C  CE1  . PHE B 2 6   ? -9.020  -3.280  2.814   1.00 0.00 ? 264 PHE A CE1  5  
ATOM   8124  C  CE2  . PHE B 2 6   ? -8.625  -3.725  5.128   1.00 0.00 ? 264 PHE A CE2  5  
ATOM   8125  C  CZ   . PHE B 2 6   ? -8.143  -3.459  3.863   1.00 0.00 ? 264 PHE A CZ   5  
ATOM   8126  H  H    . PHE B 2 6   ? -12.912 -4.009  1.877   1.00 0.00 ? 264 PHE A H    5  
ATOM   8127  H  HA   . PHE B 2 6   ? -12.685 -5.810  4.186   1.00 0.00 ? 264 PHE A HA   5  
ATOM   8128  H  HB2  . PHE B 2 6   ? -12.791 -2.785  4.220   1.00 0.00 ? 264 PHE A HB2  5  
ATOM   8129  H  HB3  . PHE B 2 6   ? -12.511 -3.813  5.597   1.00 0.00 ? 264 PHE A HB3  5  
ATOM   8130  H  HD1  . PHE B 2 6   ? -11.065 -3.229  2.209   1.00 0.00 ? 264 PHE A HD1  5  
ATOM   8131  H  HD2  . PHE B 2 6   ? -10.365 -4.018  6.330   1.00 0.00 ? 264 PHE A HD2  5  
ATOM   8132  H  HE1  . PHE B 2 6   ? -8.643  -3.072  1.823   1.00 0.00 ? 264 PHE A HE1  5  
ATOM   8133  H  HE2  . PHE B 2 6   ? -7.940  -3.864  5.950   1.00 0.00 ? 264 PHE A HE2  5  
ATOM   8134  H  HZ   . PHE B 2 6   ? -7.078  -3.390  3.694   1.00 0.00 ? 264 PHE A HZ   5  
ATOM   8135  N  N    . CYS B 2 7   ? -15.324 -4.130  3.204   1.00 0.00 ? 265 CYS A N    5  
ATOM   8136  C  CA   . CYS B 2 7   ? -16.762 -4.025  3.369   1.00 0.00 ? 265 CYS A CA   5  
ATOM   8137  C  C    . CYS B 2 7   ? -17.495 -4.615  2.197   1.00 0.00 ? 265 CYS A C    5  
ATOM   8138  O  O    . CYS B 2 7   ? -18.560 -5.214  2.346   1.00 0.00 ? 265 CYS A O    5  
ATOM   8139  C  CB   . CYS B 2 7   ? -17.189 -2.596  3.488   1.00 0.00 ? 265 CYS A CB   5  
ATOM   8140  S  SG   . CYS B 2 7   ? -16.292 -1.600  4.701   1.00 0.00 ? 265 CYS A SG   5  
ATOM   8141  H  H    . CYS B 2 7   ? -14.908 -3.678  2.444   1.00 0.00 ? 265 CYS A H    5  
ATOM   8142  H  HA   . CYS B 2 7   ? -17.039 -4.539  4.245   1.00 0.00 ? 265 CYS A HA   5  
ATOM   8143  H  HB2  . CYS B 2 7   ? -17.079 -2.140  2.546   1.00 0.00 ? 265 CYS A HB2  5  
ATOM   8144  H  HB3  . CYS B 2 7   ? -18.210 -2.586  3.753   1.00 0.00 ? 265 CYS A HB3  5  
ATOM   8145  N  N    . LEU B 2 8   ? -16.914 -4.399  1.032   1.00 0.00 ? 266 LEU A N    5  
ATOM   8146  C  CA   . LEU B 2 8   ? -17.450 -4.866  -0.213  1.00 0.00 ? 266 LEU A CA   5  
ATOM   8147  C  C    . LEU B 2 8   ? -18.597 -3.983  -0.682  1.00 0.00 ? 266 LEU A C    5  
ATOM   8148  O  O    . LEU B 2 8   ? -19.586 -4.456  -1.241  1.00 0.00 ? 266 LEU A O    5  
ATOM   8149  C  CB   . LEU B 2 8   ? -17.864 -6.299  -0.071  1.00 0.00 ? 266 LEU A CB   5  
ATOM   8150  C  CG   . LEU B 2 8   ? -16.810 -7.200  0.557   1.00 0.00 ? 266 LEU A CG   5  
ATOM   8151  C  CD1  . LEU B 2 8   ? -17.331 -8.615  0.670   1.00 0.00 ? 266 LEU A CD1  5  
ATOM   8152  C  CD2  . LEU B 2 8   ? -15.519 -7.151  -0.245  1.00 0.00 ? 266 LEU A CD2  5  
ATOM   8153  H  H    . LEU B 2 8   ? -16.083 -3.921  1.017   1.00 0.00 ? 266 LEU A H    5  
ATOM   8154  H  HA   . LEU B 2 8   ? -16.663 -4.814  -0.940  1.00 0.00 ? 266 LEU A HA   5  
ATOM   8155  H  HB2  . LEU B 2 8   ? -18.736 -6.318  0.540   1.00 0.00 ? 266 LEU A HB2  5  
ATOM   8156  H  HB3  . LEU B 2 8   ? -18.098 -6.675  -1.035  1.00 0.00 ? 266 LEU A HB3  5  
ATOM   8157  H  HG   . LEU B 2 8   ? -16.603 -6.845  1.552   1.00 0.00 ? 266 LEU A HG   5  
ATOM   8158  H  HD11 . LEU B 2 8   ? -18.232 -8.607  1.260   1.00 0.00 ? 266 LEU A HD11 5  
ATOM   8159  H  HD12 . LEU B 2 8   ? -16.591 -9.237  1.150   1.00 0.00 ? 266 LEU A HD12 5  
ATOM   8160  H  HD13 . LEU B 2 8   ? -17.547 -9.002  -0.314  1.00 0.00 ? 266 LEU A HD13 5  
ATOM   8161  H  HD21 . LEU B 2 8   ? -15.396 -6.159  -0.672  1.00 0.00 ? 266 LEU A HD21 5  
ATOM   8162  H  HD22 . LEU B 2 8   ? -15.561 -7.883  -1.038  1.00 0.00 ? 266 LEU A HD22 5  
ATOM   8163  H  HD23 . LEU B 2 8   ? -14.684 -7.370  0.404   1.00 0.00 ? 266 LEU A HD23 5  
ATOM   8164  N  N    . GLY B 2 9   ? -18.437 -2.683  -0.444  1.00 0.00 ? 267 GLY A N    5  
ATOM   8165  C  CA   . GLY B 2 9   ? -19.430 -1.710  -0.863  1.00 0.00 ? 267 GLY A CA   5  
ATOM   8166  C  C    . GLY B 2 9   ? -19.022 -0.988  -2.131  1.00 0.00 ? 267 GLY A C    5  
ATOM   8167  O  O    . GLY B 2 9   ? -19.350 -1.427  -3.234  1.00 0.00 ? 267 GLY A O    5  
ATOM   8168  H  H    . GLY B 2 9   ? -17.638 -2.386  0.040   1.00 0.00 ? 267 GLY A H    5  
ATOM   8169  H  HA2  . GLY B 2 9   ? -20.371 -2.218  -1.029  1.00 0.00 ? 267 GLY A HA2  5  
ATOM   8170  H  HA3  . GLY B 2 9   ? -19.562 -0.985  -0.074  1.00 0.00 ? 267 GLY A HA3  5  
ATOM   8171  N  N    . GLY B 2 10  ? -18.307 0.126   -1.980  1.00 0.00 ? 268 GLY A N    5  
ATOM   8172  C  CA   . GLY B 2 10  ? -17.862 0.880   -3.128  1.00 0.00 ? 268 GLY A CA   5  
ATOM   8173  C  C    . GLY B 2 10  ? -17.148 2.144   -2.716  1.00 0.00 ? 268 GLY A C    5  
ATOM   8174  O  O    . GLY B 2 10  ? -16.926 2.380   -1.531  1.00 0.00 ? 268 GLY A O    5  
ATOM   8175  H  H    . GLY B 2 10  ? -18.086 0.450   -1.076  1.00 0.00 ? 268 GLY A H    5  
ATOM   8176  H  HA2  . GLY B 2 10  ? -17.176 0.266   -3.710  1.00 0.00 ? 268 GLY A HA2  5  
ATOM   8177  H  HA3  . GLY B 2 10  ? -18.715 1.138   -3.737  1.00 0.00 ? 268 GLY A HA3  5  
ATOM   8178  N  N    . SER B 2 11  ? -16.775 2.957   -3.687  1.00 0.00 ? 269 SER A N    5  
ATOM   8179  C  CA   . SER B 2 11  ? -16.064 4.186   -3.398  1.00 0.00 ? 269 SER A CA   5  
ATOM   8180  C  C    . SER B 2 11  ? -17.027 5.267   -2.937  1.00 0.00 ? 269 SER A C    5  
ATOM   8181  O  O    . SER B 2 11  ? -16.952 5.724   -1.800  1.00 0.00 ? 269 SER A O    5  
ATOM   8182  C  CB   . SER B 2 11  ? -15.258 4.598   -4.616  1.00 0.00 ? 269 SER A CB   5  
ATOM   8183  O  OG   . SER B 2 11  ? -15.641 5.872   -5.102  1.00 0.00 ? 269 SER A OG   5  
ATOM   8184  H  H    . SER B 2 11  ? -16.983 2.726   -4.616  1.00 0.00 ? 269 SER A H    5  
ATOM   8185  H  HA   . SER B 2 11  ? -15.380 3.975   -2.600  1.00 0.00 ? 269 SER A HA   5  
ATOM   8186  H  HB2  . SER B 2 11  ? -14.213 4.610   -4.361  1.00 0.00 ? 269 SER A HB2  5  
ATOM   8187  H  HB3  . SER B 2 11  ? -15.401 3.875   -5.370  1.00 0.00 ? 269 SER A HB3  5  
ATOM   8188  H  HG   . SER B 2 11  ? -15.301 6.554   -4.518  1.00 0.00 ? 269 SER A HG   5  
ATOM   8189  N  N    . ASN B 2 12  ? -17.947 5.661   -3.803  1.00 0.00 ? 270 ASN A N    5  
ATOM   8190  C  CA   . ASN B 2 12  ? -18.941 6.662   -3.444  1.00 0.00 ? 270 ASN A CA   5  
ATOM   8191  C  C    . ASN B 2 12  ? -20.029 6.017   -2.597  1.00 0.00 ? 270 ASN A C    5  
ATOM   8192  O  O    . ASN B 2 12  ? -21.087 6.605   -2.374  1.00 0.00 ? 270 ASN A O    5  
ATOM   8193  C  CB   . ASN B 2 12  ? -19.545 7.287   -4.693  1.00 0.00 ? 270 ASN A CB   5  
ATOM   8194  C  CG   . ASN B 2 12  ? -20.421 6.326   -5.462  1.00 0.00 ? 270 ASN A CG   5  
ATOM   8195  O  OD1  . ASN B 2 12  ? -21.624 6.232   -5.218  1.00 0.00 ? 270 ASN A OD1  5  
ATOM   8196  N  ND2  . ASN B 2 12  ? -19.823 5.603   -6.395  1.00 0.00 ? 270 ASN A ND2  5  
ATOM   8197  H  H    . ASN B 2 12  ? -17.957 5.273   -4.703  1.00 0.00 ? 270 ASN A H    5  
ATOM   8198  H  HA   . ASN B 2 12  ? -18.463 7.437   -2.860  1.00 0.00 ? 270 ASN A HA   5  
ATOM   8199  H  HB2  . ASN B 2 12  ? -20.140 8.130   -4.404  1.00 0.00 ? 270 ASN A HB2  5  
ATOM   8200  H  HB3  . ASN B 2 12  ? -18.748 7.618   -5.340  1.00 0.00 ? 270 ASN A HB3  5  
ATOM   8201  H  HD21 . ASN B 2 12  ? -18.860 5.727   -6.533  1.00 0.00 ? 270 ASN A HD21 5  
ATOM   8202  H  HD22 . ASN B 2 12  ? -20.367 4.979   -6.909  1.00 0.00 ? 270 ASN A HD22 5  
ATOM   8203  N  N    . MET B 2 13  ? -19.758 4.796   -2.127  1.00 0.00 ? 271 MET A N    5  
ATOM   8204  C  CA   . MET B 2 13  ? -20.720 4.076   -1.297  1.00 0.00 ? 271 MET A CA   5  
ATOM   8205  C  C    . MET B 2 13  ? -20.051 3.040   -0.414  1.00 0.00 ? 271 MET A C    5  
ATOM   8206  O  O    . MET B 2 13  ? -19.306 2.189   -0.883  1.00 0.00 ? 271 MET A O    5  
ATOM   8207  C  CB   . MET B 2 13  ? -21.765 3.365   -2.144  1.00 0.00 ? 271 MET A CB   5  
ATOM   8208  C  CG   . MET B 2 13  ? -22.857 2.707   -1.307  1.00 0.00 ? 271 MET A CG   5  
ATOM   8209  S  SD   . MET B 2 13  ? -24.263 3.797   -0.975  1.00 0.00 ? 271 MET A SD   5  
ATOM   8210  C  CE   . MET B 2 13  ? -23.526 5.079   0.043   1.00 0.00 ? 271 MET A CE   5  
ATOM   8211  H  H    . MET B 2 13  ? -18.890 4.378   -2.337  1.00 0.00 ? 271 MET A H    5  
ATOM   8212  H  HA   . MET B 2 13  ? -21.213 4.798   -0.668  1.00 0.00 ? 271 MET A HA   5  
ATOM   8213  H  HB2  . MET B 2 13  ? -22.222 4.076   -2.817  1.00 0.00 ? 271 MET A HB2  5  
ATOM   8214  H  HB3  . MET B 2 13  ? -21.269 2.592   -2.718  1.00 0.00 ? 271 MET A HB3  5  
ATOM   8215  H  HG2  . MET B 2 13  ? -23.217 1.837   -1.835  1.00 0.00 ? 271 MET A HG2  5  
ATOM   8216  H  HG3  . MET B 2 13  ? -22.427 2.398   -0.359  1.00 0.00 ? 271 MET A HG3  5  
ATOM   8217  H  HE1  . MET B 2 13  ? -22.717 4.663   0.627   1.00 0.00 ? 271 MET A HE1  5  
ATOM   8218  H  HE2  . MET B 2 13  ? -24.275 5.484   0.707   1.00 0.00 ? 271 MET A HE2  5  
ATOM   8219  H  HE3  . MET B 2 13  ? -23.145 5.866   -0.590  1.00 0.00 ? 271 MET A HE3  5  
ATOM   8220  N  N    . ASN B 2 14  ? -20.345 3.116   0.867   1.00 0.00 ? 272 ASN A N    5  
ATOM   8221  C  CA   . ASN B 2 14  ? -19.811 2.188   1.840   1.00 0.00 ? 272 ASN A CA   5  
ATOM   8222  C  C    . ASN B 2 14  ? -20.794 1.058   2.137   1.00 0.00 ? 272 ASN A C    5  
ATOM   8223  O  O    . ASN B 2 14  ? -21.818 0.904   1.471   1.00 0.00 ? 272 ASN A O    5  
ATOM   8224  C  CB   . ASN B 2 14  ? -19.588 2.957   3.113   1.00 0.00 ? 272 ASN A CB   5  
ATOM   8225  C  CG   . ASN B 2 14  ? -20.922 3.330   3.734   1.00 0.00 ? 272 ASN A CG   5  
ATOM   8226  O  OD1  . ASN B 2 14  ? -21.480 2.575   4.526   1.00 0.00 ? 272 ASN A OD1  5  
ATOM   8227  N  ND2  . ASN B 2 14  ? -21.464 4.475   3.342   1.00 0.00 ? 272 ASN A ND2  5  
ATOM   8228  H  H    . ASN B 2 14  ? -20.913 3.849   1.184   1.00 0.00 ? 272 ASN A H    5  
ATOM   8229  H  HA   . ASN B 2 14  ? -18.876 1.790   1.484   1.00 0.00 ? 272 ASN A HA   5  
ATOM   8230  H  HB2  . ASN B 2 14  ? -19.030 2.358   3.817   1.00 0.00 ? 272 ASN A HB2  5  
ATOM   8231  H  HB3  . ASN B 2 14  ? -19.036 3.863   2.889   1.00 0.00 ? 272 ASN A HB3  5  
ATOM   8232  H  HD21 . ASN B 2 14  ? -20.981 5.013   2.681   1.00 0.00 ? 272 ASN A HD21 5  
ATOM   8233  H  HD22 . ASN B 2 14  ? -22.326 4.736   3.729   1.00 0.00 ? 272 ASN A HD22 5  
ATOM   8234  N  N    . LYS B 2 15  ? -20.452 0.278   3.155   1.00 0.00 ? 273 LYS A N    5  
ATOM   8235  C  CA   . LYS B 2 15  ? -21.275 -0.821  3.624   1.00 0.00 ? 273 LYS A CA   5  
ATOM   8236  C  C    . LYS B 2 15  ? -21.258 -0.855  5.149   1.00 0.00 ? 273 LYS A C    5  
ATOM   8237  O  O    . LYS B 2 15  ? -22.281 -1.079  5.795   1.00 0.00 ? 273 LYS A O    5  
ATOM   8238  C  CB   . LYS B 2 15  ? -20.744 -2.122  3.052   1.00 0.00 ? 273 LYS A CB   5  
ATOM   8239  C  CG   . LYS B 2 15  ? -21.242 -2.400  1.669   1.00 0.00 ? 273 LYS A CG   5  
ATOM   8240  C  CD   . LYS B 2 15  ? -22.200 -3.573  1.632   1.00 0.00 ? 273 LYS A CD   5  
ATOM   8241  C  CE   . LYS B 2 15  ? -22.769 -3.768  0.239   1.00 0.00 ? 273 LYS A CE   5  
ATOM   8242  N  NZ   . LYS B 2 15  ? -22.467 -5.123  -0.302  1.00 0.00 ? 273 LYS A NZ   5  
ATOM   8243  H  H    . LYS B 2 15  ? -19.592 0.424   3.586   1.00 0.00 ? 273 LYS A H    5  
ATOM   8244  H  HA   . LYS B 2 15  ? -22.287 -0.663  3.278   1.00 0.00 ? 273 LYS A HA   5  
ATOM   8245  H  HB2  . LYS B 2 15  ? -19.678 -2.056  2.999   1.00 0.00 ? 273 LYS A HB2  5  
ATOM   8246  H  HB3  . LYS B 2 15  ? -21.021 -2.936  3.690   1.00 0.00 ? 273 LYS A HB3  5  
ATOM   8247  H  HG2  . LYS B 2 15  ? -21.743 -1.524  1.307   1.00 0.00 ? 273 LYS A HG2  5  
ATOM   8248  H  HG3  . LYS B 2 15  ? -20.396 -2.614  1.046   1.00 0.00 ? 273 LYS A HG3  5  
ATOM   8249  H  HD2  . LYS B 2 15  ? -21.675 -4.468  1.927   1.00 0.00 ? 273 LYS A HD2  5  
ATOM   8250  H  HD3  . LYS B 2 15  ? -23.007 -3.382  2.318   1.00 0.00 ? 273 LYS A HD3  5  
ATOM   8251  H  HE2  . LYS B 2 15  ? -23.839 -3.634  0.277   1.00 0.00 ? 273 LYS A HE2  5  
ATOM   8252  H  HE3  . LYS B 2 15  ? -22.336 -3.024  -0.414  1.00 0.00 ? 273 LYS A HE3  5  
ATOM   8253  H  HZ1  . LYS B 2 15  ? -22.880 -5.853  0.313   1.00 0.00 ? 273 LYS A HZ1  5  
ATOM   8254  H  HZ2  . LYS B 2 15  ? -21.440 -5.268  -0.351  1.00 0.00 ? 273 LYS A HZ2  5  
ATOM   8255  H  HZ3  . LYS B 2 15  ? -22.866 -5.223  -1.258  1.00 0.00 ? 273 LYS A HZ3  5  
ATOM   8256  N  N    . LYS B 2 16  ? -20.070 -0.633  5.709   1.00 0.00 ? 274 LYS A N    5  
ATOM   8257  C  CA   . LYS B 2 16  ? -19.876 -0.601  7.153   1.00 0.00 ? 274 LYS A CA   5  
ATOM   8258  C  C    . LYS B 2 16  ? -19.794 0.849   7.625   1.00 0.00 ? 274 LYS A C    5  
ATOM   8259  O  O    . LYS B 2 16  ? -19.139 1.171   8.618   1.00 0.00 ? 274 LYS A O    5  
ATOM   8260  C  CB   . LYS B 2 16  ? -18.592 -1.333  7.506   1.00 0.00 ? 274 LYS A CB   5  
ATOM   8261  C  CG   . LYS B 2 16  ? -18.541 -2.752  6.978   1.00 0.00 ? 274 LYS A CG   5  
ATOM   8262  C  CD   . LYS B 2 16  ? -19.364 -3.707  7.825   1.00 0.00 ? 274 LYS A CD   5  
ATOM   8263  C  CE   . LYS B 2 16  ? -19.120 -5.151  7.422   1.00 0.00 ? 274 LYS A CE   5  
ATOM   8264  N  NZ   . LYS B 2 16  ? -17.682 -5.523  7.526   1.00 0.00 ? 274 LYS A NZ   5  
ATOM   8265  H  H    . LYS B 2 16  ? -19.293 -0.500  5.129   1.00 0.00 ? 274 LYS A H    5  
ATOM   8266  H  HA   . LYS B 2 16  ? -20.715 -1.090  7.624   1.00 0.00 ? 274 LYS A HA   5  
ATOM   8267  H  HB2  . LYS B 2 16  ? -17.754 -0.791  7.092   1.00 0.00 ? 274 LYS A HB2  5  
ATOM   8268  H  HB3  . LYS B 2 16  ? -18.502 -1.365  8.570   1.00 0.00 ? 274 LYS A HB3  5  
ATOM   8269  H  HG2  . LYS B 2 16  ? -18.933 -2.754  5.978   1.00 0.00 ? 274 LYS A HG2  5  
ATOM   8270  H  HG3  . LYS B 2 16  ? -17.515 -3.084  6.964   1.00 0.00 ? 274 LYS A HG3  5  
ATOM   8271  H  HD2  . LYS B 2 16  ? -19.094 -3.582  8.863   1.00 0.00 ? 274 LYS A HD2  5  
ATOM   8272  H  HD3  . LYS B 2 16  ? -20.410 -3.481  7.690   1.00 0.00 ? 274 LYS A HD3  5  
ATOM   8273  H  HE2  . LYS B 2 16  ? -19.697 -5.795  8.068   1.00 0.00 ? 274 LYS A HE2  5  
ATOM   8274  H  HE3  . LYS B 2 16  ? -19.445 -5.283  6.400   1.00 0.00 ? 274 LYS A HE3  5  
ATOM   8275  H  HZ1  . LYS B 2 16  ? -17.108 -4.905  6.918   1.00 0.00 ? 274 LYS A HZ1  5  
ATOM   8276  H  HZ2  . LYS B 2 16  ? -17.545 -6.510  7.225   1.00 0.00 ? 274 LYS A HZ2  5  
ATOM   8277  H  HZ3  . LYS B 2 16  ? -17.358 -5.425  8.509   1.00 0.00 ? 274 LYS A HZ3  5  
ATOM   8278  N  N    . SER B 2 17  ? -20.464 1.700   6.866   1.00 0.00 ? 275 SER A N    5  
ATOM   8279  C  CA   . SER B 2 17  ? -20.519 3.144   7.089   1.00 0.00 ? 275 SER A CA   5  
ATOM   8280  C  C    . SER B 2 17  ? -19.184 3.762   6.792   1.00 0.00 ? 275 SER A C    5  
ATOM   8281  O  O    . SER B 2 17  ? -18.798 4.765   7.392   1.00 0.00 ? 275 SER A O    5  
ATOM   8282  C  CB   . SER B 2 17  ? -20.986 3.574   8.473   1.00 0.00 ? 275 SER A CB   5  
ATOM   8283  O  OG   . SER B 2 17  ? -21.117 2.482   9.366   1.00 0.00 ? 275 SER A OG   5  
ATOM   8284  H  H    . SER B 2 17  ? -20.916 1.342   6.085   1.00 0.00 ? 275 SER A H    5  
ATOM   8285  H  HA   . SER B 2 17  ? -21.221 3.536   6.365   1.00 0.00 ? 275 SER A HA   5  
ATOM   8286  H  HB2  . SER B 2 17  ? -20.274 4.280   8.871   1.00 0.00 ? 275 SER A HB2  5  
ATOM   8287  H  HB3  . SER B 2 17  ? -21.937 4.067   8.371   1.00 0.00 ? 275 SER A HB3  5  
ATOM   8288  H  HG   . SER B 2 17  ? -20.935 2.777   10.262  1.00 0.00 ? 275 SER A HG   5  
ATOM   8289  N  N    . GLY B 2 18  ? -18.464 3.142   5.877   1.00 0.00 ? 276 GLY A N    5  
ATOM   8290  C  CA   . GLY B 2 18  ? -17.211 3.700   5.469   1.00 0.00 ? 276 GLY A CA   5  
ATOM   8291  C  C    . GLY B 2 18  ? -17.496 5.029   4.830   1.00 0.00 ? 276 GLY A C    5  
ATOM   8292  O  O    . GLY B 2 18  ? -16.618 5.871   4.638   1.00 0.00 ? 276 GLY A O    5  
ATOM   8293  H  H    . GLY B 2 18  ? -18.798 2.315   5.467   1.00 0.00 ? 276 GLY A H    5  
ATOM   8294  H  HA2  . GLY B 2 18  ? -16.568 3.827   6.328   1.00 0.00 ? 276 GLY A HA2  5  
ATOM   8295  H  HA3  . GLY B 2 18  ? -16.752 3.045   4.752   1.00 0.00 ? 276 GLY A HA3  5  
ATOM   8296  N  N    . ARG B 2 19  ? -18.780 5.181   4.509   1.00 0.00 ? 277 ARG A N    5  
ATOM   8297  C  CA   . ARG B 2 19  ? -19.323 6.368   3.894   1.00 0.00 ? 277 ARG A CA   5  
ATOM   8298  C  C    . ARG B 2 19  ? -18.699 6.595   2.539   1.00 0.00 ? 277 ARG A C    5  
ATOM   8299  O  O    . ARG B 2 19  ? -17.625 6.083   2.237   1.00 0.00 ? 277 ARG A O    5  
ATOM   8300  C  CB   . ARG B 2 19  ? -19.172 7.582   4.802   1.00 0.00 ? 277 ARG A CB   5  
ATOM   8301  C  CG   . ARG B 2 19  ? -19.783 7.394   6.150   1.00 0.00 ? 277 ARG A CG   5  
ATOM   8302  C  CD   . ARG B 2 19  ? -21.286 7.463   6.094   1.00 0.00 ? 277 ARG A CD   5  
ATOM   8303  N  NE   . ARG B 2 19  ? -21.886 7.548   7.422   1.00 0.00 ? 277 ARG A NE   5  
ATOM   8304  C  CZ   . ARG B 2 19  ? -23.132 7.167   7.693   1.00 0.00 ? 277 ARG A CZ   5  
ATOM   8305  N  NH1  . ARG B 2 19  ? -23.905 6.681   6.730   1.00 0.00 ? 277 ARG A NH1  5  
ATOM   8306  N  NH2  . ARG B 2 19  ? -23.605 7.271   8.927   1.00 0.00 ? 277 ARG A NH2  5  
ATOM   8307  H  H    . ARG B 2 19  ? -19.384 4.426   4.669   1.00 0.00 ? 277 ARG A H    5  
ATOM   8308  H  HA   . ARG B 2 19  ? -20.382 6.198   3.730   1.00 0.00 ? 277 ARG A HA   5  
ATOM   8309  H  HB2  . ARG B 2 19  ? -18.145 7.801   4.926   1.00 0.00 ? 277 ARG A HB2  5  
ATOM   8310  H  HB3  . ARG B 2 19  ? -19.662 8.406   4.356   1.00 0.00 ? 277 ARG A HB3  5  
ATOM   8311  H  HG2  . ARG B 2 19  ? -19.514 6.435   6.467   1.00 0.00 ? 277 ARG A HG2  5  
ATOM   8312  H  HG3  . ARG B 2 19  ? -19.408 8.140   6.833   1.00 0.00 ? 277 ARG A HG3  5  
ATOM   8313  H  HD2  . ARG B 2 19  ? -21.579 8.324   5.514   1.00 0.00 ? 277 ARG A HD2  5  
ATOM   8314  H  HD3  . ARG B 2 19  ? -21.629 6.566   5.614   1.00 0.00 ? 277 ARG A HD3  5  
ATOM   8315  H  HE   . ARG B 2 19  ? -21.334 7.905   8.149   1.00 0.00 ? 277 ARG A HE   5  
ATOM   8316  H  HH11 . ARG B 2 19  ? -23.552 6.601   5.798   1.00 0.00 ? 277 ARG A HH11 5  
ATOM   8317  H  HH12 . ARG B 2 19  ? -24.840 6.394   6.937   1.00 0.00 ? 277 ARG A HH12 5  
ATOM   8318  H  HH21 . ARG B 2 19  ? -23.025 7.637   9.655   1.00 0.00 ? 277 ARG A HH21 5  
ATOM   8319  H  HH22 . ARG B 2 19  ? -24.542 6.984   9.129   1.00 0.00 ? 277 ARG A HH22 5  
ATOM   8320  N  N    . PRO B 2 20  ? -19.411 7.357   1.715   1.00 0.00 ? 278 PRO A N    5  
ATOM   8321  C  CA   . PRO B 2 20  ? -19.008 7.675   0.346   1.00 0.00 ? 278 PRO A CA   5  
ATOM   8322  C  C    . PRO B 2 20  ? -17.550 8.090   0.273   1.00 0.00 ? 278 PRO A C    5  
ATOM   8323  O  O    . PRO B 2 20  ? -17.215 9.271   0.180   1.00 0.00 ? 278 PRO A O    5  
ATOM   8324  C  CB   . PRO B 2 20  ? -19.942 8.816   -0.043  1.00 0.00 ? 278 PRO A CB   5  
ATOM   8325  C  CG   . PRO B 2 20  ? -21.139 8.656   0.844   1.00 0.00 ? 278 PRO A CG   5  
ATOM   8326  C  CD   . PRO B 2 20  ? -20.669 7.990   2.102   1.00 0.00 ? 278 PRO A CD   5  
ATOM   8327  H  HA   . PRO B 2 20  ? -19.171 6.836   -0.311  1.00 0.00 ? 278 PRO A HA   5  
ATOM   8328  H  HB2  . PRO B 2 20  ? -19.443 9.755   0.112   1.00 0.00 ? 278 PRO A HB2  5  
ATOM   8329  H  HB3  . PRO B 2 20  ? -20.212 8.718   -1.084  1.00 0.00 ? 278 PRO A HB3  5  
ATOM   8330  H  HG2  . PRO B 2 20  ? -21.566 9.621   1.069   1.00 0.00 ? 278 PRO A HG2  5  
ATOM   8331  H  HG3  . PRO B 2 20  ? -21.866 8.027   0.361   1.00 0.00 ? 278 PRO A HG3  5  
ATOM   8332  H  HD2  . PRO B 2 20  ? -20.504 8.699   2.901   1.00 0.00 ? 278 PRO A HD2  5  
ATOM   8333  H  HD3  . PRO B 2 20  ? -21.373 7.244   2.424   1.00 0.00 ? 278 PRO A HD3  5  
ATOM   8334  N  N    . GLU B 2 21  ? -16.695 7.081   0.316   1.00 0.00 ? 279 GLU A N    5  
ATOM   8335  C  CA   . GLU B 2 21  ? -15.256 7.262   0.286   1.00 0.00 ? 279 GLU A CA   5  
ATOM   8336  C  C    . GLU B 2 21  ? -14.727 7.189   -1.147  1.00 0.00 ? 279 GLU A C    5  
ATOM   8337  O  O    . GLU B 2 21  ? -15.243 7.855   -2.043  1.00 0.00 ? 279 GLU A O    5  
ATOM   8338  C  CB   . GLU B 2 21  ? -14.612 6.189   1.155   1.00 0.00 ? 279 GLU A CB   5  
ATOM   8339  C  CG   . GLU B 2 21  ? -13.215 6.554   1.614   1.00 0.00 ? 279 GLU A CG   5  
ATOM   8340  C  CD   . GLU B 2 21  ? -13.199 7.774   2.513   1.00 0.00 ? 279 GLU A CD   5  
ATOM   8341  O  OE1  . GLU B 2 21  ? -13.454 7.621   3.726   1.00 0.00 ? 279 GLU A OE1  5  
ATOM   8342  O  OE2  . GLU B 2 21  ? -12.932 8.883   2.004   1.00 0.00 ? 279 GLU A OE2  5  
ATOM   8343  H  H    . GLU B 2 21  ? -17.052 6.168   0.371   1.00 0.00 ? 279 GLU A H    5  
ATOM   8344  H  HA   . GLU B 2 21  ? -15.019 8.227   0.701   1.00 0.00 ? 279 GLU A HA   5  
ATOM   8345  H  HB2  . GLU B 2 21  ? -15.226 6.034   2.026   1.00 0.00 ? 279 GLU A HB2  5  
ATOM   8346  H  HB3  . GLU B 2 21  ? -14.566 5.264   0.600   1.00 0.00 ? 279 GLU A HB3  5  
ATOM   8347  H  HG2  . GLU B 2 21  ? -12.804 5.725   2.154   1.00 0.00 ? 279 GLU A HG2  5  
ATOM   8348  H  HG3  . GLU B 2 21  ? -12.609 6.758   0.745   1.00 0.00 ? 279 GLU A HG3  5  
ATOM   8349  N  N    . GLU B 2 22  ? -13.697 6.378   -1.349  1.00 0.00 ? 280 GLU A N    5  
ATOM   8350  C  CA   . GLU B 2 22  ? -13.095 6.200   -2.665  1.00 0.00 ? 280 GLU A CA   5  
ATOM   8351  C  C    . GLU B 2 22  ? -12.106 5.044   -2.625  1.00 0.00 ? 280 GLU A C    5  
ATOM   8352  O  O    . GLU B 2 22  ? -10.926 5.220   -2.322  1.00 0.00 ? 280 GLU A O    5  
ATOM   8353  C  CB   . GLU B 2 22  ? -12.394 7.479   -3.125  1.00 0.00 ? 280 GLU A CB   5  
ATOM   8354  C  CG   . GLU B 2 22  ? -12.084 7.497   -4.613  1.00 0.00 ? 280 GLU A CG   5  
ATOM   8355  C  CD   . GLU B 2 22  ? -13.036 8.379   -5.398  1.00 0.00 ? 280 GLU A CD   5  
ATOM   8356  O  OE1  . GLU B 2 22  ? -14.123 7.893   -5.773  1.00 0.00 ? 280 GLU A OE1  5  
ATOM   8357  O  OE2  . GLU B 2 22  ? -12.693 9.556   -5.639  1.00 0.00 ? 280 GLU A OE2  5  
ATOM   8358  H  H    . GLU B 2 22  ? -13.331 5.876   -0.592  1.00 0.00 ? 280 GLU A H    5  
ATOM   8359  H  HA   . GLU B 2 22  ? -13.888 5.956   -3.368  1.00 0.00 ? 280 GLU A HA   5  
ATOM   8360  H  HB2  . GLU B 2 22  ? -13.028 8.325   -2.900  1.00 0.00 ? 280 GLU A HB2  5  
ATOM   8361  H  HB3  . GLU B 2 22  ? -11.465 7.583   -2.583  1.00 0.00 ? 280 GLU A HB3  5  
ATOM   8362  H  HG2  . GLU B 2 22  ? -11.078 7.865   -4.756  1.00 0.00 ? 280 GLU A HG2  5  
ATOM   8363  H  HG3  . GLU B 2 22  ? -12.154 6.489   -4.995  1.00 0.00 ? 280 GLU A HG3  5  
ATOM   8364  N  N    . LEU B 2 23  ? -12.617 3.866   -2.937  1.00 0.00 ? 281 LEU A N    5  
ATOM   8365  C  CA   . LEU B 2 23  ? -11.836 2.631   -2.946  1.00 0.00 ? 281 LEU A CA   5  
ATOM   8366  C  C    . LEU B 2 23  ? -10.513 2.751   -3.655  1.00 0.00 ? 281 LEU A C    5  
ATOM   8367  O  O    . LEU B 2 23  ? -10.269 3.675   -4.432  1.00 0.00 ? 281 LEU A O    5  
ATOM   8368  C  CB   . LEU B 2 23  ? -12.617 1.562   -3.654  1.00 0.00 ? 281 LEU A CB   5  
ATOM   8369  C  CG   . LEU B 2 23  ? -14.092 1.539   -3.355  1.00 0.00 ? 281 LEU A CG   5  
ATOM   8370  C  CD1  . LEU B 2 23  ? -14.817 0.923   -4.526  1.00 0.00 ? 281 LEU A CD1  5  
ATOM   8371  C  CD2  . LEU B 2 23  ? -14.392 0.795   -2.048  1.00 0.00 ? 281 LEU A CD2  5  
ATOM   8372  H  H    . LEU B 2 23  ? -13.577 3.818   -3.163  1.00 0.00 ? 281 LEU A H    5  
ATOM   8373  H  HA   . LEU B 2 23  ? -11.660 2.302   -1.945  1.00 0.00 ? 281 LEU A HA   5  
ATOM   8374  H  HB2  . LEU B 2 23  ? -12.489 1.695   -4.718  1.00 0.00 ? 281 LEU A HB2  5  
ATOM   8375  H  HB3  . LEU B 2 23  ? -12.209 0.619   -3.380  1.00 0.00 ? 281 LEU A HB3  5  
ATOM   8376  H  HG   . LEU B 2 23  ? -14.433 2.546   -3.249  1.00 0.00 ? 281 LEU A HG   5  
ATOM   8377  H  HD11 . LEU B 2 23  ? -14.551 -0.103  -4.589  1.00 0.00 ? 281 LEU A HD11 5  
ATOM   8378  H  HD12 . LEU B 2 23  ? -14.523 1.427   -5.435  1.00 0.00 ? 281 LEU A HD12 5  
ATOM   8379  H  HD13 . LEU B 2 23  ? -15.877 1.018   -4.392  1.00 0.00 ? 281 LEU A HD13 5  
ATOM   8380  H  HD21 . LEU B 2 23  ? -13.656 0.015   -1.870  1.00 0.00 ? 281 LEU A HD21 5  
ATOM   8381  H  HD22 . LEU B 2 23  ? -15.374 0.350   -2.109  1.00 0.00 ? 281 LEU A HD22 5  
ATOM   8382  H  HD23 . LEU B 2 23  ? -14.371 1.497   -1.232  1.00 0.00 ? 281 LEU A HD23 5  
ATOM   8383  N  N    . VAL B 2 24  ? -9.662  1.779   -3.369  1.00 0.00 ? 282 VAL A N    5  
ATOM   8384  C  CA   . VAL B 2 24  ? -8.377  1.685   -4.006  1.00 0.00 ? 282 VAL A CA   5  
ATOM   8385  C  C    . VAL B 2 24  ? -8.451  0.522   -4.945  1.00 0.00 ? 282 VAL A C    5  
ATOM   8386  O  O    . VAL B 2 24  ? -8.492  -0.617  -4.495  1.00 0.00 ? 282 VAL A O    5  
ATOM   8387  C  CB   . VAL B 2 24  ? -7.220  1.444   -3.036  1.00 0.00 ? 282 VAL A CB   5  
ATOM   8388  C  CG1  . VAL B 2 24  ? -6.130  2.421   -3.315  1.00 0.00 ? 282 VAL A CG1  5  
ATOM   8389  C  CG2  . VAL B 2 24  ? -7.641  1.578   -1.602  1.00 0.00 ? 282 VAL A CG2  5  
ATOM   8390  H  H    . VAL B 2 24  ? -9.930  1.085   -2.716  1.00 0.00 ? 282 VAL A H    5  
ATOM   8391  H  HA   . VAL B 2 24  ? -8.183  2.588   -4.554  1.00 0.00 ? 282 VAL A HA   5  
ATOM   8392  H  HB   . VAL B 2 24  ? -6.845  0.455   -3.190  1.00 0.00 ? 282 VAL A HB   5  
ATOM   8393  H  HG11 . VAL B 2 24  ? -6.417  3.359   -2.875  1.00 0.00 ? 282 VAL A HG11 5  
ATOM   8394  H  HG12 . VAL B 2 24  ? -6.007  2.537   -4.383  1.00 0.00 ? 282 VAL A HG12 5  
ATOM   8395  H  HG13 . VAL B 2 24  ? -5.207  2.079   -2.874  1.00 0.00 ? 282 VAL A HG13 5  
ATOM   8396  H  HG21 . VAL B 2 24  ? -7.882  2.610   -1.398  1.00 0.00 ? 282 VAL A HG21 5  
ATOM   8397  H  HG22 . VAL B 2 24  ? -6.831  1.264   -0.961  1.00 0.00 ? 282 VAL A HG22 5  
ATOM   8398  H  HG23 . VAL B 2 24  ? -8.500  0.960   -1.423  1.00 0.00 ? 282 VAL A HG23 5  
ATOM   8399  N  N    . SER B 2 25  ? -8.474  0.800   -6.235  1.00 0.00 ? 283 SER A N    5  
ATOM   8400  C  CA   . SER B 2 25  ? -8.572  -0.258  -7.218  1.00 0.00 ? 283 SER A CA   5  
ATOM   8401  C  C    . SER B 2 25  ? -7.202  -0.654  -7.713  1.00 0.00 ? 283 SER A C    5  
ATOM   8402  O  O    . SER B 2 25  ? -6.445  0.170   -8.227  1.00 0.00 ? 283 SER A O    5  
ATOM   8403  C  CB   . SER B 2 25  ? -9.451  0.164   -8.391  1.00 0.00 ? 283 SER A CB   5  
ATOM   8404  O  OG   . SER B 2 25  ? -9.110  1.462   -8.846  1.00 0.00 ? 283 SER A OG   5  
ATOM   8405  H  H    . SER B 2 25  ? -8.420  1.733   -6.530  1.00 0.00 ? 283 SER A H    5  
ATOM   8406  H  HA   . SER B 2 25  ? -9.027  -1.112  -6.731  1.00 0.00 ? 283 SER A HA   5  
ATOM   8407  H  HB2  . SER B 2 25  ? -9.318  -0.535  -9.203  1.00 0.00 ? 283 SER A HB2  5  
ATOM   8408  H  HB3  . SER B 2 25  ? -10.484 0.160   -8.082  1.00 0.00 ? 283 SER A HB3  5  
ATOM   8409  H  HG   . SER B 2 25  ? -8.641  1.395   -9.682  1.00 0.00 ? 283 SER A HG   5  
ATOM   8410  N  N    . CYS B 2 26  ? -6.894  -1.923  -7.549  1.00 0.00 ? 284 CYS A N    5  
ATOM   8411  C  CA   . CYS B 2 26  ? -5.621  -2.454  -7.978  1.00 0.00 ? 284 CYS A CA   5  
ATOM   8412  C  C    . CYS B 2 26  ? -5.478  -2.288  -9.484  1.00 0.00 ? 284 CYS A C    5  
ATOM   8413  O  O    . CYS B 2 26  ? -6.444  -2.454  -10.229 1.00 0.00 ? 284 CYS A O    5  
ATOM   8414  C  CB   . CYS B 2 26  ? -5.542  -3.920  -7.567  1.00 0.00 ? 284 CYS A CB   5  
ATOM   8415  S  SG   . CYS B 2 26  ? -4.100  -4.834  -8.188  1.00 0.00 ? 284 CYS A SG   5  
ATOM   8416  H  H    . CYS B 2 26  ? -7.548  -2.521  -7.130  1.00 0.00 ? 284 CYS A H    5  
ATOM   8417  H  HA   . CYS B 2 26  ? -4.838  -1.900  -7.483  1.00 0.00 ? 284 CYS A HA   5  
ATOM   8418  H  HB2  . CYS B 2 26  ? -5.513  -3.971  -6.492  1.00 0.00 ? 284 CYS A HB2  5  
ATOM   8419  H  HB3  . CYS B 2 26  ? -6.428  -4.426  -7.912  1.00 0.00 ? 284 CYS A HB3  5  
ATOM   8420  N  N    . ALA B 2 27  ? -4.275  -1.960  -9.926  1.00 0.00 ? 285 ALA A N    5  
ATOM   8421  C  CA   . ALA B 2 27  ? -4.022  -1.755  -11.344 1.00 0.00 ? 285 ALA A CA   5  
ATOM   8422  C  C    . ALA B 2 27  ? -3.539  -3.032  -12.007 1.00 0.00 ? 285 ALA A C    5  
ATOM   8423  O  O    . ALA B 2 27  ? -3.034  -3.009  -13.129 1.00 0.00 ? 285 ALA A O    5  
ATOM   8424  C  CB   . ALA B 2 27  ? -3.012  -0.642  -11.541 1.00 0.00 ? 285 ALA A CB   5  
ATOM   8425  H  H    . ALA B 2 27  ? -3.540  -1.852  -9.287  1.00 0.00 ? 285 ALA A H    5  
ATOM   8426  H  HA   . ALA B 2 27  ? -4.951  -1.452  -11.807 1.00 0.00 ? 285 ALA A HA   5  
ATOM   8427  H  HB1  . ALA B 2 27  ? -2.025  -1.009  -11.308 1.00 0.00 ? 285 ALA A HB1  5  
ATOM   8428  H  HB2  . ALA B 2 27  ? -3.253  0.183   -10.887 1.00 0.00 ? 285 ALA A HB2  5  
ATOM   8429  H  HB3  . ALA B 2 27  ? -3.039  -0.307  -12.568 1.00 0.00 ? 285 ALA A HB3  5  
ATOM   8430  N  N    . ASP B 2 28  ? -3.698  -4.145  -11.305 1.00 0.00 ? 286 ASP A N    5  
ATOM   8431  C  CA   . ASP B 2 28  ? -3.277  -5.431  -11.830 1.00 0.00 ? 286 ASP A CA   5  
ATOM   8432  C  C    . ASP B 2 28  ? -4.463  -6.383  -11.949 1.00 0.00 ? 286 ASP A C    5  
ATOM   8433  O  O    . ASP B 2 28  ? -4.786  -6.848  -13.042 1.00 0.00 ? 286 ASP A O    5  
ATOM   8434  C  CB   . ASP B 2 28  ? -2.198  -6.045  -10.944 1.00 0.00 ? 286 ASP A CB   5  
ATOM   8435  C  CG   . ASP B 2 28  ? -1.633  -7.327  -11.523 1.00 0.00 ? 286 ASP A CG   5  
ATOM   8436  O  OD1  . ASP B 2 28  ? -2.190  -8.406  -11.234 1.00 0.00 ? 286 ASP A OD1  5  
ATOM   8437  O  OD2  . ASP B 2 28  ? -0.632  -7.251  -12.267 1.00 0.00 ? 286 ASP A OD2  5  
ATOM   8438  H  H    . ASP B 2 28  ? -4.107  -4.100  -10.417 1.00 0.00 ? 286 ASP A H    5  
ATOM   8439  H  HA   . ASP B 2 28  ? -2.866  -5.258  -12.814 1.00 0.00 ? 286 ASP A HA   5  
ATOM   8440  H  HB2  . ASP B 2 28  ? -1.391  -5.338  -10.827 1.00 0.00 ? 286 ASP A HB2  5  
ATOM   8441  H  HB3  . ASP B 2 28  ? -2.621  -6.265  -9.975  1.00 0.00 ? 286 ASP A HB3  5  
ATOM   8442  N  N    . CYS B 2 29  ? -5.115  -6.672  -10.820 1.00 0.00 ? 287 CYS A N    5  
ATOM   8443  C  CA   . CYS B 2 29  ? -6.264  -7.570  -10.825 1.00 0.00 ? 287 CYS A CA   5  
ATOM   8444  C  C    . CYS B 2 29  ? -7.579  -6.782  -10.781 1.00 0.00 ? 287 CYS A C    5  
ATOM   8445  O  O    . CYS B 2 29  ? -8.507  -7.083  -11.534 1.00 0.00 ? 287 CYS A O    5  
ATOM   8446  C  CB   . CYS B 2 29  ? -6.165  -8.583  -9.677  1.00 0.00 ? 287 CYS A CB   5  
ATOM   8447  S  SG   . CYS B 2 29  ? -6.297  -7.882  -8.003  1.00 0.00 ? 287 CYS A SG   5  
ATOM   8448  H  H    . CYS B 2 29  ? -4.816  -6.277  -9.974  1.00 0.00 ? 287 CYS A H    5  
ATOM   8449  H  HA   . CYS B 2 29  ? -6.236  -8.111  -11.760 1.00 0.00 ? 287 CYS A HA   5  
ATOM   8450  H  HB2  . CYS B 2 29  ? -6.953  -9.312  -9.786  1.00 0.00 ? 287 CYS A HB2  5  
ATOM   8451  H  HB3  . CYS B 2 29  ? -5.211  -9.084  -9.745  1.00 0.00 ? 287 CYS A HB3  5  
ATOM   8452  N  N    . GLY B 2 30  ? -7.662  -5.778  -9.905  1.00 0.00 ? 288 GLY A N    5  
ATOM   8453  C  CA   . GLY B 2 30  ? -8.864  -4.952  -9.844  1.00 0.00 ? 288 GLY A CA   5  
ATOM   8454  C  C    . GLY B 2 30  ? -9.615  -4.999  -8.521  1.00 0.00 ? 288 GLY A C    5  
ATOM   8455  O  O    . GLY B 2 30  ? -10.818 -4.737  -8.488  1.00 0.00 ? 288 GLY A O    5  
ATOM   8456  H  H    . GLY B 2 30  ? -6.911  -5.597  -9.304  1.00 0.00 ? 288 GLY A H    5  
ATOM   8457  H  HA2  . GLY B 2 30  ? -8.581  -3.928  -10.033 1.00 0.00 ? 288 GLY A HA2  5  
ATOM   8458  H  HA3  . GLY B 2 30  ? -9.535  -5.266  -10.630 1.00 0.00 ? 288 GLY A HA3  5  
ATOM   8459  N  N    . ARG B 2 31  ? -8.928  -5.325  -7.433  1.00 0.00 ? 289 ARG A N    5  
ATOM   8460  C  CA   . ARG B 2 31  ? -9.576  -5.376  -6.120  1.00 0.00 ? 289 ARG A CA   5  
ATOM   8461  C  C    . ARG B 2 31  ? -9.558  -3.998  -5.458  1.00 0.00 ? 289 ARG A C    5  
ATOM   8462  O  O    . ARG B 2 31  ? -8.541  -3.307  -5.495  1.00 0.00 ? 289 ARG A O    5  
ATOM   8463  C  CB   . ARG B 2 31  ? -8.880  -6.391  -5.217  1.00 0.00 ? 289 ARG A CB   5  
ATOM   8464  C  CG   . ARG B 2 31  ? -9.767  -6.886  -4.091  1.00 0.00 ? 289 ARG A CG   5  
ATOM   8465  C  CD   . ARG B 2 31  ? -9.049  -7.891  -3.210  1.00 0.00 ? 289 ARG A CD   5  
ATOM   8466  N  NE   . ARG B 2 31  ? -8.801  -9.153  -3.903  1.00 0.00 ? 289 ARG A NE   5  
ATOM   8467  C  CZ   . ARG B 2 31  ? -8.811  -10.339 -3.302  1.00 0.00 ? 289 ARG A CZ   5  
ATOM   8468  N  NH1  . ARG B 2 31  ? -9.058  -10.427 -2.002  1.00 0.00 ? 289 ARG A NH1  5  
ATOM   8469  N  NH2  . ARG B 2 31  ? -8.576  -11.441 -4.001  1.00 0.00 ? 289 ARG A NH2  5  
ATOM   8470  H  H    . ARG B 2 31  ? -7.974  -5.536  -7.508  1.00 0.00 ? 289 ARG A H    5  
ATOM   8471  H  HA   . ARG B 2 31  ? -10.602 -5.680  -6.265  1.00 0.00 ? 289 ARG A HA   5  
ATOM   8472  H  HB2  . ARG B 2 31  ? -8.576  -7.240  -5.812  1.00 0.00 ? 289 ARG A HB2  5  
ATOM   8473  H  HB3  . ARG B 2 31  ? -8.006  -5.931  -4.783  1.00 0.00 ? 289 ARG A HB3  5  
ATOM   8474  H  HG2  . ARG B 2 31  ? -10.069 -6.043  -3.487  1.00 0.00 ? 289 ARG A HG2  5  
ATOM   8475  H  HG3  . ARG B 2 31  ? -10.639 -7.353  -4.520  1.00 0.00 ? 289 ARG A HG3  5  
ATOM   8476  H  HD2  . ARG B 2 31  ? -8.104  -7.470  -2.900  1.00 0.00 ? 289 ARG A HD2  5  
ATOM   8477  H  HD3  . ARG B 2 31  ? -9.659  -8.082  -2.340  1.00 0.00 ? 289 ARG A HD3  5  
ATOM   8478  H  HE   . ARG B 2 31  ? -8.618  -9.113  -4.865  1.00 0.00 ? 289 ARG A HE   5  
ATOM   8479  H  HH11 . ARG B 2 31  ? -9.238  -9.600  -1.470  1.00 0.00 ? 289 ARG A HH11 5  
ATOM   8480  H  HH12 . ARG B 2 31  ? -9.064  -11.320 -1.553  1.00 0.00 ? 289 ARG A HH12 5  
ATOM   8481  H  HH21 . ARG B 2 31  ? -8.390  -11.381 -4.983  1.00 0.00 ? 289 ARG A HH21 5  
ATOM   8482  H  HH22 . ARG B 2 31  ? -8.583  -12.332 -3.548  1.00 0.00 ? 289 ARG A HH22 5  
ATOM   8483  N  N    . SER B 2 32  ? -10.679 -3.592  -4.850  1.00 0.00 ? 290 SER A N    5  
ATOM   8484  C  CA   . SER B 2 32  ? -10.734 -2.287  -4.193  1.00 0.00 ? 290 SER A CA   5  
ATOM   8485  C  C    . SER B 2 32  ? -10.545 -2.386  -2.690  1.00 0.00 ? 290 SER A C    5  
ATOM   8486  O  O    . SER B 2 32  ? -10.558 -3.468  -2.106  1.00 0.00 ? 290 SER A O    5  
ATOM   8487  C  CB   . SER B 2 32  ? -12.055 -1.553  -4.423  1.00 0.00 ? 290 SER A CB   5  
ATOM   8488  O  OG   . SER B 2 32  ? -12.637 -1.201  -3.188  1.00 0.00 ? 290 SER A OG   5  
ATOM   8489  H  H    . SER B 2 32  ? -11.469 -4.174  -4.847  1.00 0.00 ? 290 SER A H    5  
ATOM   8490  H  HA   . SER B 2 32  ? -9.942  -1.692  -4.606  1.00 0.00 ? 290 SER A HA   5  
ATOM   8491  H  HB2  . SER B 2 32  ? -11.879 -0.652  -4.988  1.00 0.00 ? 290 SER A HB2  5  
ATOM   8492  H  HB3  . SER B 2 32  ? -12.742 -2.168  -4.941  1.00 0.00 ? 290 SER A HB3  5  
ATOM   8493  H  HG   . SER B 2 32  ? -12.044 -0.621  -2.705  1.00 0.00 ? 290 SER A HG   5  
ATOM   8494  N  N    . GLY B 2 33  ? -10.357 -1.219  -2.087  1.00 0.00 ? 291 GLY A N    5  
ATOM   8495  C  CA   . GLY B 2 33  ? -10.234 -1.112  -0.644  1.00 0.00 ? 291 GLY A CA   5  
ATOM   8496  C  C    . GLY B 2 33  ? -10.576 0.289   -0.165  1.00 0.00 ? 291 GLY A C    5  
ATOM   8497  O  O    . GLY B 2 33  ? -10.227 1.260   -0.812  1.00 0.00 ? 291 GLY A O    5  
ATOM   8498  H  H    . GLY B 2 33  ? -10.256 -0.413  -2.647  1.00 0.00 ? 291 GLY A H    5  
ATOM   8499  H  HA2  . GLY B 2 33  ? -10.901 -1.821  -0.176  1.00 0.00 ? 291 GLY A HA2  5  
ATOM   8500  H  HA3  . GLY B 2 33  ? -9.218  -1.340  -0.361  1.00 0.00 ? 291 GLY A HA3  5  
ATOM   8501  N  N    . HIS B 2 34  ? -11.285 0.436   0.941   1.00 0.00 ? 292 HIS A N    5  
ATOM   8502  C  CA   . HIS B 2 34  ? -11.569 1.786   1.408   1.00 0.00 ? 292 HIS A CA   5  
ATOM   8503  C  C    . HIS B 2 34  ? -10.295 2.298   2.048   1.00 0.00 ? 292 HIS A C    5  
ATOM   8504  O  O    . HIS B 2 34  ? -9.825  1.679   2.996   1.00 0.00 ? 292 HIS A O    5  
ATOM   8505  C  CB   . HIS B 2 34  ? -12.677 1.816   2.458   1.00 0.00 ? 292 HIS A CB   5  
ATOM   8506  C  CG   . HIS B 2 34  ? -14.085 1.765   1.923   1.00 0.00 ? 292 HIS A CG   5  
ATOM   8507  N  ND1  . HIS B 2 34  ? -14.965 0.829   2.366   1.00 0.00 ? 292 HIS A ND1  5  
ATOM   8508  C  CD2  . HIS B 2 34  ? -14.744 2.468   0.965   1.00 0.00 ? 292 HIS A CD2  5  
ATOM   8509  C  CE1  . HIS B 2 34  ? -16.104 0.932   1.717   1.00 0.00 ? 292 HIS A CE1  5  
ATOM   8510  N  NE2  . HIS B 2 34  ? -16.001 1.931   0.865   1.00 0.00 ? 292 HIS A NE2  5  
ATOM   8511  H  H    . HIS B 2 34  ? -11.582 -0.346  1.452   1.00 0.00 ? 292 HIS A H    5  
ATOM   8512  H  HA   . HIS B 2 34  ? -11.839 2.391   0.553   1.00 0.00 ? 292 HIS A HA   5  
ATOM   8513  H  HB2  . HIS B 2 34  ? -12.541 0.960   3.098   1.00 0.00 ? 292 HIS A HB2  5  
ATOM   8514  H  HB3  . HIS B 2 34  ? -12.573 2.703   3.058   1.00 0.00 ? 292 HIS A HB3  5  
ATOM   8515  H  HD2  . HIS B 2 34  ? -14.344 3.249   0.348   1.00 0.00 ? 292 HIS A HD2  5  
ATOM   8516  H  HE1  . HIS B 2 34  ? -16.916 0.241   1.767   1.00 0.00 ? 292 HIS A HE1  5  
ATOM   8517  H  HE2  . HIS B 2 34  ? -16.754 2.342   0.393   1.00 0.00 ? 292 HIS A HE2  5  
ATOM   8518  N  N    . PRO B 2 35  ? -9.707  3.412   1.586   1.00 0.00 ? 293 PRO A N    5  
ATOM   8519  C  CA   . PRO B 2 35  ? -8.468  3.900   2.179   1.00 0.00 ? 293 PRO A CA   5  
ATOM   8520  C  C    . PRO B 2 35  ? -8.531  3.920   3.703   1.00 0.00 ? 293 PRO A C    5  
ATOM   8521  O  O    . PRO B 2 35  ? -7.577  3.524   4.381   1.00 0.00 ? 293 PRO A O    5  
ATOM   8522  C  CB   . PRO B 2 35  ? -8.341  5.312   1.625   1.00 0.00 ? 293 PRO A CB   5  
ATOM   8523  C  CG   . PRO B 2 35  ? -9.064  5.285   0.321   1.00 0.00 ? 293 PRO A CG   5  
ATOM   8524  C  CD   . PRO B 2 35  ? -10.145 4.240   0.443   1.00 0.00 ? 293 PRO A CD   5  
ATOM   8525  H  HA   . PRO B 2 35  ? -7.624  3.300   1.859   1.00 0.00 ? 293 PRO A HA   5  
ATOM   8526  H  HB2  . PRO B 2 35  ? -8.788  6.015   2.313   1.00 0.00 ? 293 PRO A HB2  5  
ATOM   8527  H  HB3  . PRO B 2 35  ? -7.298  5.545   1.492   1.00 0.00 ? 293 PRO A HB3  5  
ATOM   8528  H  HG2  . PRO B 2 35  ? -9.502  6.253   0.129   1.00 0.00 ? 293 PRO A HG2  5  
ATOM   8529  H  HG3  . PRO B 2 35  ? -8.377  5.022   -0.470  1.00 0.00 ? 293 PRO A HG3  5  
ATOM   8530  H  HD2  . PRO B 2 35  ? -11.098 4.707   0.642   1.00 0.00 ? 293 PRO A HD2  5  
ATOM   8531  H  HD3  . PRO B 2 35  ? -10.194 3.650   -0.462  1.00 0.00 ? 293 PRO A HD3  5  
ATOM   8532  N  N    . THR B 2 36  ? -9.662  4.361   4.241   1.00 0.00 ? 294 THR A N    5  
ATOM   8533  C  CA   . THR B 2 36  ? -9.846  4.400   5.684   1.00 0.00 ? 294 THR A CA   5  
ATOM   8534  C  C    . THR B 2 36  ? -9.828  2.987   6.255   1.00 0.00 ? 294 THR A C    5  
ATOM   8535  O  O    . THR B 2 36  ? -9.423  2.768   7.397   1.00 0.00 ? 294 THR A O    5  
ATOM   8536  C  CB   . THR B 2 36  ? -11.167 5.089   6.069   1.00 0.00 ? 294 THR A CB   5  
ATOM   8537  O  OG1  . THR B 2 36  ? -12.264 4.476   5.382   1.00 0.00 ? 294 THR A OG1  5  
ATOM   8538  C  CG2  . THR B 2 36  ? -11.112 6.566   5.739   1.00 0.00 ? 294 THR A CG2  5  
ATOM   8539  H  H    . THR B 2 36  ? -10.386 4.666   3.655   1.00 0.00 ? 294 THR A H    5  
ATOM   8540  H  HA   . THR B 2 36  ? -9.029  4.965   6.111   1.00 0.00 ? 294 THR A HA   5  
ATOM   8541  H  HB   . THR B 2 36  ? -11.310 4.984   7.133   1.00 0.00 ? 294 THR A HB   5  
ATOM   8542  H  HG1  . THR B 2 36  ? -12.862 4.082   6.022   1.00 0.00 ? 294 THR A HG1  5  
ATOM   8543  H  HG21 . THR B 2 36  ? -10.305 7.019   6.293   1.00 0.00 ? 294 THR A HG21 5  
ATOM   8544  H  HG22 . THR B 2 36  ? -12.046 7.033   6.012   1.00 0.00 ? 294 THR A HG22 5  
ATOM   8545  H  HG23 . THR B 2 36  ? -10.939 6.694   4.680   1.00 0.00 ? 294 THR A HG23 5  
ATOM   8546  N  N    . CYS B 2 37  ? -10.275 2.029   5.444   1.00 0.00 ? 295 CYS A N    5  
ATOM   8547  C  CA   . CYS B 2 37  ? -10.307 0.629   5.848   1.00 0.00 ? 295 CYS A CA   5  
ATOM   8548  C  C    . CYS B 2 37  ? -8.918  0.003   5.789   1.00 0.00 ? 295 CYS A C    5  
ATOM   8549  O  O    . CYS B 2 37  ? -8.593  -0.859  6.607   1.00 0.00 ? 295 CYS A O    5  
ATOM   8550  C  CB   . CYS B 2 37  ? -11.296 -0.166  4.986   1.00 0.00 ? 295 CYS A CB   5  
ATOM   8551  S  SG   . CYS B 2 37  ? -13.026 0.268   5.310   1.00 0.00 ? 295 CYS A SG   5  
ATOM   8552  H  H    . CYS B 2 37  ? -10.602 2.275   4.555   1.00 0.00 ? 295 CYS A H    5  
ATOM   8553  H  HA   . CYS B 2 37  ? -10.645 0.599   6.874   1.00 0.00 ? 295 CYS A HA   5  
ATOM   8554  H  HB2  . CYS B 2 37  ? -11.099 0.007   3.946   1.00 0.00 ? 295 CYS A HB2  5  
ATOM   8555  H  HB3  . CYS B 2 37  ? -11.183 -1.208  5.185   1.00 0.00 ? 295 CYS A HB3  5  
ATOM   8556  N  N    . LEU B 2 38  ? -8.093  0.426   4.830   1.00 0.00 ? 296 LEU A N    5  
ATOM   8557  C  CA   . LEU B 2 38  ? -6.740  -0.118  4.734   1.00 0.00 ? 296 LEU A CA   5  
ATOM   8558  C  C    . LEU B 2 38  ? -5.793  0.664   5.626   1.00 0.00 ? 296 LEU A C    5  
ATOM   8559  O  O    . LEU B 2 38  ? -4.592  0.390   5.651   1.00 0.00 ? 296 LEU A O    5  
ATOM   8560  C  CB   . LEU B 2 38  ? -6.199  -0.065  3.314   1.00 0.00 ? 296 LEU A CB   5  
ATOM   8561  C  CG   . LEU B 2 38  ? -7.151  -0.502  2.218   1.00 0.00 ? 296 LEU A CG   5  
ATOM   8562  C  CD1  . LEU B 2 38  ? -7.577  0.707   1.422   1.00 0.00 ? 296 LEU A CD1  5  
ATOM   8563  C  CD2  . LEU B 2 38  ? -6.490  -1.530  1.317   1.00 0.00 ? 296 LEU A CD2  5  
ATOM   8564  H  H    . LEU B 2 38  ? -8.397  1.112   4.182   1.00 0.00 ? 296 LEU A H    5  
ATOM   8565  H  HA   . LEU B 2 38  ? -6.771  -1.144  5.057   1.00 0.00 ? 296 LEU A HA   5  
ATOM   8566  H  HB2  . LEU B 2 38  ? -5.899  0.952   3.111   1.00 0.00 ? 296 LEU A HB2  5  
ATOM   8567  H  HB3  . LEU B 2 38  ? -5.319  -0.693  3.267   1.00 0.00 ? 296 LEU A HB3  5  
ATOM   8568  H  HG   . LEU B 2 38  ? -8.030  -0.946  2.660   1.00 0.00 ? 296 LEU A HG   5  
ATOM   8569  H  HD11 . LEU B 2 38  ? -8.082  0.396   0.527   1.00 0.00 ? 296 LEU A HD11 5  
ATOM   8570  H  HD12 . LEU B 2 38  ? -6.709  1.285   1.158   1.00 0.00 ? 296 LEU A HD12 5  
ATOM   8571  H  HD13 . LEU B 2 38  ? -8.235  1.311   2.014   1.00 0.00 ? 296 LEU A HD13 5  
ATOM   8572  H  HD21 . LEU B 2 38  ? -6.605  -1.226  0.290   1.00 0.00 ? 296 LEU A HD21 5  
ATOM   8573  H  HD22 . LEU B 2 38  ? -6.956  -2.493  1.463   1.00 0.00 ? 296 LEU A HD22 5  
ATOM   8574  H  HD23 . LEU B 2 38  ? -5.439  -1.597  1.557   1.00 0.00 ? 296 LEU A HD23 5  
ATOM   8575  N  N    . GLN B 2 39  ? -6.346  1.647   6.340   1.00 0.00 ? 297 GLN A N    5  
ATOM   8576  C  CA   . GLN B 2 39  ? -5.570  2.514   7.223   1.00 0.00 ? 297 GLN A CA   5  
ATOM   8577  C  C    . GLN B 2 39  ? -4.883  3.593   6.395   1.00 0.00 ? 297 GLN A C    5  
ATOM   8578  O  O    . GLN B 2 39  ? -5.130  4.782   6.595   1.00 0.00 ? 297 GLN A O    5  
ATOM   8579  C  CB   . GLN B 2 39  ? -4.541  1.727   8.040   1.00 0.00 ? 297 GLN A CB   5  
ATOM   8580  C  CG   . GLN B 2 39  ? -5.152  0.635   8.900   1.00 0.00 ? 297 GLN A CG   5  
ATOM   8581  C  CD   . GLN B 2 39  ? -4.117  -0.318  9.476   1.00 0.00 ? 297 GLN A CD   5  
ATOM   8582  O  OE1  . GLN B 2 39  ? -4.419  -1.477  9.755   1.00 0.00 ? 297 GLN A OE1  5  
ATOM   8583  N  NE2  . GLN B 2 39  ? -2.886  0.157   9.647   1.00 0.00 ? 297 GLN A NE2  5  
ATOM   8584  H  H    . GLN B 2 39  ? -7.311  1.801   6.258   1.00 0.00 ? 297 GLN A H    5  
ATOM   8585  H  HA   . GLN B 2 39  ? -6.261  2.992   7.900   1.00 0.00 ? 297 GLN A HA   5  
ATOM   8586  H  HB2  . GLN B 2 39  ? -3.833  1.276   7.370   1.00 0.00 ? 297 GLN A HB2  5  
ATOM   8587  H  HB3  . GLN B 2 39  ? -4.022  2.410   8.693   1.00 0.00 ? 297 GLN A HB3  5  
ATOM   8588  H  HG2  . GLN B 2 39  ? -5.680  1.103   9.715   1.00 0.00 ? 297 GLN A HG2  5  
ATOM   8589  H  HG3  . GLN B 2 39  ? -5.848  0.069   8.298   1.00 0.00 ? 297 GLN A HG3  5  
ATOM   8590  H  HE21 . GLN B 2 39  ? -2.706  1.087   9.397   1.00 0.00 ? 297 GLN A HE21 5  
ATOM   8591  H  HE22 . GLN B 2 39  ? -2.208  -0.443  10.020  1.00 0.00 ? 297 GLN A HE22 5  
ATOM   8592  N  N    . PHE B 2 40  ? -4.042  3.155   5.452   1.00 0.00 ? 298 PHE A N    5  
ATOM   8593  C  CA   . PHE B 2 40  ? -3.311  4.057   4.556   1.00 0.00 ? 298 PHE A CA   5  
ATOM   8594  C  C    . PHE B 2 40  ? -3.087  5.437   5.190   1.00 0.00 ? 298 PHE A C    5  
ATOM   8595  O  O    . PHE B 2 40  ? -2.695  5.545   6.353   1.00 0.00 ? 298 PHE A O    5  
ATOM   8596  C  CB   . PHE B 2 40  ? -4.078  4.210   3.232   1.00 0.00 ? 298 PHE A CB   5  
ATOM   8597  C  CG   . PHE B 2 40  ? -4.077  2.992   2.334   1.00 0.00 ? 298 PHE A CG   5  
ATOM   8598  C  CD1  . PHE B 2 40  ? -3.462  1.803   2.710   1.00 0.00 ? 298 PHE A CD1  5  
ATOM   8599  C  CD2  . PHE B 2 40  ? -4.681  3.056   1.087   1.00 0.00 ? 298 PHE A CD2  5  
ATOM   8600  C  CE1  . PHE B 2 40  ? -3.455  0.711   1.859   1.00 0.00 ? 298 PHE A CE1  5  
ATOM   8601  C  CE2  . PHE B 2 40  ? -4.671  1.972   0.235   1.00 0.00 ? 298 PHE A CE2  5  
ATOM   8602  C  CZ   . PHE B 2 40  ? -4.060  0.801   0.619   1.00 0.00 ? 298 PHE A CZ   5  
ATOM   8603  H  H    . PHE B 2 40  ? -3.916  2.188   5.350   1.00 0.00 ? 298 PHE A H    5  
ATOM   8604  H  HA   . PHE B 2 40  ? -2.349  3.611   4.351   1.00 0.00 ? 298 PHE A HA   5  
ATOM   8605  H  HB2  . PHE B 2 40  ? -5.098  4.456   3.449   1.00 0.00 ? 298 PHE A HB2  5  
ATOM   8606  H  HB3  . PHE B 2 40  ? -3.639  5.022   2.675   1.00 0.00 ? 298 PHE A HB3  5  
ATOM   8607  H  HD1  . PHE B 2 40  ? -2.989  1.731   3.678   1.00 0.00 ? 298 PHE A HD1  5  
ATOM   8608  H  HD2  . PHE B 2 40  ? -5.163  3.969   0.780   1.00 0.00 ? 298 PHE A HD2  5  
ATOM   8609  H  HE1  . PHE B 2 40  ? -2.974  -0.207  2.162   1.00 0.00 ? 298 PHE A HE1  5  
ATOM   8610  H  HE2  . PHE B 2 40  ? -5.150  2.039   -0.730  1.00 0.00 ? 298 PHE A HE2  5  
ATOM   8611  H  HZ   . PHE B 2 40  ? -4.055  -0.045  -0.052  1.00 0.00 ? 298 PHE A HZ   5  
ATOM   8612  N  N    . THR B 2 41  ? -3.337  6.483   4.403   1.00 0.00 ? 299 THR A N    5  
ATOM   8613  C  CA   . THR B 2 41  ? -3.188  7.864   4.846   1.00 0.00 ? 299 THR A CA   5  
ATOM   8614  C  C    . THR B 2 41  ? -3.590  8.802   3.714   1.00 0.00 ? 299 THR A C    5  
ATOM   8615  O  O    . THR B 2 41  ? -4.042  8.342   2.669   1.00 0.00 ? 299 THR A O    5  
ATOM   8616  C  CB   . THR B 2 41  ? -1.746  8.170   5.296   1.00 0.00 ? 299 THR A CB   5  
ATOM   8617  O  OG1  . THR B 2 41  ? -1.623  9.545   5.672   1.00 0.00 ? 299 THR A OG1  5  
ATOM   8618  C  CG2  . THR B 2 41  ? -0.748  7.847   4.196   1.00 0.00 ? 299 THR A CG2  5  
ATOM   8619  H  H    . THR B 2 41  ? -3.633  6.322   3.485   1.00 0.00 ? 299 THR A H    5  
ATOM   8620  H  HA   . THR B 2 41  ? -3.845  8.018   5.688   1.00 0.00 ? 299 THR A HA   5  
ATOM   8621  H  HB   . THR B 2 41  ? -1.528  7.554   6.153   1.00 0.00 ? 299 THR A HB   5  
ATOM   8622  H  HG1  . THR B 2 41  ? -0.747  9.703   6.030   1.00 0.00 ? 299 THR A HG1  5  
ATOM   8623  H  HG21 . THR B 2 41  ? -0.895  6.830   3.863   1.00 0.00 ? 299 THR A HG21 5  
ATOM   8624  H  HG22 . THR B 2 41  ? 0.256   7.959   4.579   1.00 0.00 ? 299 THR A HG22 5  
ATOM   8625  H  HG23 . THR B 2 41  ? -0.894  8.523   3.367   1.00 0.00 ? 299 THR A HG23 5  
ATOM   8626  N  N    . LEU B 2 42  ? -3.448  10.106  3.906   1.00 0.00 ? 300 LEU A N    5  
ATOM   8627  C  CA   . LEU B 2 42  ? -3.811  11.055  2.859   1.00 0.00 ? 300 LEU A CA   5  
ATOM   8628  C  C    . LEU B 2 42  ? -2.843  10.956  1.686   1.00 0.00 ? 300 LEU A C    5  
ATOM   8629  O  O    . LEU B 2 42  ? -3.265  10.920  0.533   1.00 0.00 ? 300 LEU A O    5  
ATOM   8630  C  CB   . LEU B 2 42  ? -3.855  12.482  3.412   1.00 0.00 ? 300 LEU A CB   5  
ATOM   8631  C  CG   . LEU B 2 42  ? -4.731  13.463  2.623   1.00 0.00 ? 300 LEU A CG   5  
ATOM   8632  C  CD1  . LEU B 2 42  ? -4.058  13.853  1.324   1.00 0.00 ? 300 LEU A CD1  5  
ATOM   8633  C  CD2  . LEU B 2 42  ? -6.097  12.864  2.343   1.00 0.00 ? 300 LEU A CD2  5  
ATOM   8634  H  H    . LEU B 2 42  ? -3.100  10.437  4.760   1.00 0.00 ? 300 LEU A H    5  
ATOM   8635  H  HA   . LEU B 2 42  ? -4.795  10.788  2.500   1.00 0.00 ? 300 LEU A HA   5  
ATOM   8636  H  HB2  . LEU B 2 42  ? -4.224  12.439  4.427   1.00 0.00 ? 300 LEU A HB2  5  
ATOM   8637  H  HB3  . LEU B 2 42  ? -2.848  12.869  3.430   1.00 0.00 ? 300 LEU A HB3  5  
ATOM   8638  H  HG   . LEU B 2 42  ? -4.877  14.352  3.206   1.00 0.00 ? 300 LEU A HG   5  
ATOM   8639  H  HD11 . LEU B 2 42  ? -3.944  12.972  0.714   1.00 0.00 ? 300 LEU A HD11 5  
ATOM   8640  H  HD12 . LEU B 2 42  ? -3.086  14.276  1.534   1.00 0.00 ? 300 LEU A HD12 5  
ATOM   8641  H  HD13 . LEU B 2 42  ? -4.665  14.578  0.803   1.00 0.00 ? 300 LEU A HD13 5  
ATOM   8642  H  HD21 . LEU B 2 42  ? -6.432  12.330  3.213   1.00 0.00 ? 300 LEU A HD21 5  
ATOM   8643  H  HD22 . LEU B 2 42  ? -6.028  12.183  1.506   1.00 0.00 ? 300 LEU A HD22 5  
ATOM   8644  H  HD23 . LEU B 2 42  ? -6.797  13.652  2.111   1.00 0.00 ? 300 LEU A HD23 5  
ATOM   8645  N  N    . ASN B 2 43  ? -1.549  10.908  1.979   1.00 0.00 ? 301 ASN A N    5  
ATOM   8646  C  CA   . ASN B 2 43  ? -0.546  10.792  0.926   1.00 0.00 ? 301 ASN A CA   5  
ATOM   8647  C  C    . ASN B 2 43  ? -0.733  9.483   0.172   1.00 0.00 ? 301 ASN A C    5  
ATOM   8648  O  O    . ASN B 2 43  ? -0.578  9.435   -1.045  1.00 0.00 ? 301 ASN A O    5  
ATOM   8649  C  CB   . ASN B 2 43  ? 0.860   10.850  1.508   1.00 0.00 ? 301 ASN A CB   5  
ATOM   8650  C  CG   . ASN B 2 43  ? 1.185   12.175  2.162   1.00 0.00 ? 301 ASN A CG   5  
ATOM   8651  O  OD1  . ASN B 2 43  ? 0.297   12.892  2.623   1.00 0.00 ? 301 ASN A OD1  5  
ATOM   8652  N  ND2  . ASN B 2 43  ? 2.471   12.499  2.212   1.00 0.00 ? 301 ASN A ND2  5  
ATOM   8653  H  H    . ASN B 2 43  ? -1.264  10.953  2.915   1.00 0.00 ? 301 ASN A H    5  
ATOM   8654  H  HA   . ASN B 2 43  ? -0.683  11.612  0.239   1.00 0.00 ? 301 ASN A HA   5  
ATOM   8655  H  HB2  . ASN B 2 43  ? 0.959   10.078  2.244   1.00 0.00 ? 301 ASN A HB2  5  
ATOM   8656  H  HB3  . ASN B 2 43  ? 1.576   10.678  0.716   1.00 0.00 ? 301 ASN A HB3  5  
ATOM   8657  H  HD21 . ASN B 2 43  ? 3.121   11.874  1.829   1.00 0.00 ? 301 ASN A HD21 5  
ATOM   8658  H  HD22 . ASN B 2 43  ? 2.718   13.346  2.633   1.00 0.00 ? 301 ASN A HD22 5  
ATOM   8659  N  N    . MET B 2 44  ? -1.054  8.420   0.906   1.00 0.00 ? 302 MET A N    5  
ATOM   8660  C  CA   . MET B 2 44  ? -1.282  7.112   0.300   1.00 0.00 ? 302 MET A CA   5  
ATOM   8661  C  C    . MET B 2 44  ? -2.525  7.147   -0.541  1.00 0.00 ? 302 MET A C    5  
ATOM   8662  O  O    . MET B 2 44  ? -2.479  6.895   -1.725  1.00 0.00 ? 302 MET A O    5  
ATOM   8663  C  CB   . MET B 2 44  ? -1.484  6.041   1.361   1.00 0.00 ? 302 MET A CB   5  
ATOM   8664  C  CG   . MET B 2 44  ? -1.620  4.646   0.796   1.00 0.00 ? 302 MET A CG   5  
ATOM   8665  S  SD   . MET B 2 44  ? -0.948  3.410   1.912   1.00 0.00 ? 302 MET A SD   5  
ATOM   8666  C  CE   . MET B 2 44  ? -0.553  2.112   0.760   1.00 0.00 ? 302 MET A CE   5  
ATOM   8667  H  H    . MET B 2 44  ? -1.140  8.518   1.876   1.00 0.00 ? 302 MET A H    5  
ATOM   8668  H  HA   . MET B 2 44  ? -0.434  6.857   -0.326  1.00 0.00 ? 302 MET A HA   5  
ATOM   8669  H  HB2  . MET B 2 44  ? -0.664  6.050   2.047   1.00 0.00 ? 302 MET A HB2  5  
ATOM   8670  H  HB3  . MET B 2 44  ? -2.389  6.264   1.895   1.00 0.00 ? 302 MET A HB3  5  
ATOM   8671  H  HG2  . MET B 2 44  ? -2.668  4.439   0.642   1.00 0.00 ? 302 MET A HG2  5  
ATOM   8672  H  HG3  . MET B 2 44  ? -1.104  4.589   -0.150  1.00 0.00 ? 302 MET A HG3  5  
ATOM   8673  H  HE1  . MET B 2 44  ? 0.411   2.314   0.331   1.00 0.00 ? 302 MET A HE1  5  
ATOM   8674  H  HE2  . MET B 2 44  ? -1.298  2.081   -0.020  1.00 0.00 ? 302 MET A HE2  5  
ATOM   8675  H  HE3  . MET B 2 44  ? -0.529  1.165   1.277   1.00 0.00 ? 302 MET A HE3  5  
ATOM   8676  N  N    . THR B 2 45  ? -3.629  7.516   0.077   1.00 0.00 ? 303 THR A N    5  
ATOM   8677  C  CA   . THR B 2 45  ? -4.890  7.559   -0.622  1.00 0.00 ? 303 THR A CA   5  
ATOM   8678  C  C    . THR B 2 45  ? -4.704  8.365   -1.894  1.00 0.00 ? 303 THR A C    5  
ATOM   8679  O  O    . THR B 2 45  ? -4.911  7.865   -2.990  1.00 0.00 ? 303 THR A O    5  
ATOM   8680  C  CB   . THR B 2 45  ? -5.985  8.194   0.260   1.00 0.00 ? 303 THR A CB   5  
ATOM   8681  O  OG1  . THR B 2 45  ? -6.184  7.401   1.434   1.00 0.00 ? 303 THR A OG1  5  
ATOM   8682  C  CG2  . THR B 2 45  ? -7.299  8.325   -0.493  1.00 0.00 ? 303 THR A CG2  5  
ATOM   8683  H  H    . THR B 2 45  ? -3.588  7.777   1.014   1.00 0.00 ? 303 THR A H    5  
ATOM   8684  H  HA   . THR B 2 45  ? -5.180  6.545   -0.868  1.00 0.00 ? 303 THR A HA   5  
ATOM   8685  H  HB   . THR B 2 45  ? -5.657  9.178   0.557   1.00 0.00 ? 303 THR A HB   5  
ATOM   8686  H  HG1  . THR B 2 45  ? -6.652  7.918   2.094   1.00 0.00 ? 303 THR A HG1  5  
ATOM   8687  H  HG21 . THR B 2 45  ? -7.623  7.350   -0.837  1.00 0.00 ? 303 THR A HG21 5  
ATOM   8688  H  HG22 . THR B 2 45  ? -7.162  8.977   -1.342  1.00 0.00 ? 303 THR A HG22 5  
ATOM   8689  H  HG23 . THR B 2 45  ? -8.049  8.741   0.164   1.00 0.00 ? 303 THR A HG23 5  
ATOM   8690  N  N    . GLU B 2 46  ? -4.231  9.588   -1.733  1.00 0.00 ? 304 GLU A N    5  
ATOM   8691  C  CA   . GLU B 2 46  ? -3.976  10.474  -2.859  1.00 0.00 ? 304 GLU A CA   5  
ATOM   8692  C  C    . GLU B 2 46  ? -3.068  9.807   -3.902  1.00 0.00 ? 304 GLU A C    5  
ATOM   8693  O  O    . GLU B 2 46  ? -3.370  9.813   -5.100  1.00 0.00 ? 304 GLU A O    5  
ATOM   8694  C  CB   . GLU B 2 46  ? -3.326  11.759  -2.341  1.00 0.00 ? 304 GLU A CB   5  
ATOM   8695  C  CG   . GLU B 2 46  ? -2.746  12.637  -3.425  1.00 0.00 ? 304 GLU A CG   5  
ATOM   8696  C  CD   . GLU B 2 46  ? -2.089  13.888  -2.876  1.00 0.00 ? 304 GLU A CD   5  
ATOM   8697  O  OE1  . GLU B 2 46  ? -0.905  13.814  -2.483  1.00 0.00 ? 304 GLU A OE1  5  
ATOM   8698  O  OE2  . GLU B 2 46  ? -2.758  14.942  -2.837  1.00 0.00 ? 304 GLU A OE2  5  
ATOM   8699  H  H    . GLU B 2 46  ? -4.050  9.910   -0.828  1.00 0.00 ? 304 GLU A H    5  
ATOM   8700  H  HA   . GLU B 2 46  ? -4.922  10.713  -3.320  1.00 0.00 ? 304 GLU A HA   5  
ATOM   8701  H  HB2  . GLU B 2 46  ? -4.064  12.332  -1.802  1.00 0.00 ? 304 GLU A HB2  5  
ATOM   8702  H  HB3  . GLU B 2 46  ? -2.527  11.494  -1.666  1.00 0.00 ? 304 GLU A HB3  5  
ATOM   8703  H  HG2  . GLU B 2 46  ? -2.009  12.068  -3.964  1.00 0.00 ? 304 GLU A HG2  5  
ATOM   8704  H  HG3  . GLU B 2 46  ? -3.536  12.925  -4.089  1.00 0.00 ? 304 GLU A HG3  5  
ATOM   8705  N  N    . ALA B 2 47  ? -1.965  9.219   -3.438  1.00 0.00 ? 305 ALA A N    5  
ATOM   8706  C  CA   . ALA B 2 47  ? -1.008  8.565   -4.335  1.00 0.00 ? 305 ALA A CA   5  
ATOM   8707  C  C    . ALA B 2 47  ? -1.668  7.435   -5.102  1.00 0.00 ? 305 ALA A C    5  
ATOM   8708  O  O    . ALA B 2 47  ? -1.762  7.451   -6.328  1.00 0.00 ? 305 ALA A O    5  
ATOM   8709  C  CB   . ALA B 2 47  ? 0.170   8.010   -3.535  1.00 0.00 ? 305 ALA A CB   5  
ATOM   8710  H  H    . ALA B 2 47  ? -1.800  9.210   -2.471  1.00 0.00 ? 305 ALA A H    5  
ATOM   8711  H  HA   . ALA B 2 47  ? -0.634  9.300   -5.031  1.00 0.00 ? 305 ALA A HA   5  
ATOM   8712  H  HB1  . ALA B 2 47  ? -0.125  7.086   -3.027  1.00 0.00 ? 305 ALA A HB1  5  
ATOM   8713  H  HB2  . ALA B 2 47  ? 0.479   8.740   -2.802  1.00 0.00 ? 305 ALA A HB2  5  
ATOM   8714  H  HB3  . ALA B 2 47  ? 0.991   7.805   -4.205  1.00 0.00 ? 305 ALA A HB3  5  
ATOM   8715  N  N    . VAL B 2 48  ? -2.137  6.475   -4.340  1.00 0.00 ? 306 VAL A N    5  
ATOM   8716  C  CA   . VAL B 2 48  ? -2.801  5.297   -4.845  1.00 0.00 ? 306 VAL A CA   5  
ATOM   8717  C  C    . VAL B 2 48  ? -4.002  5.637   -5.720  1.00 0.00 ? 306 VAL A C    5  
ATOM   8718  O  O    . VAL B 2 48  ? -4.447  4.816   -6.523  1.00 0.00 ? 306 VAL A O    5  
ATOM   8719  C  CB   . VAL B 2 48  ? -3.237  4.424   -3.669  1.00 0.00 ? 306 VAL A CB   5  
ATOM   8720  C  CG1  . VAL B 2 48  ? -2.079  4.200   -2.715  1.00 0.00 ? 306 VAL A CG1  5  
ATOM   8721  C  CG2  . VAL B 2 48  ? -4.416  5.021   -2.944  1.00 0.00 ? 306 VAL A CG2  5  
ATOM   8722  H  H    . VAL B 2 48  ? -2.017  6.557   -3.378  1.00 0.00 ? 306 VAL A H    5  
ATOM   8723  H  HA   . VAL B 2 48  ? -2.098  4.733   -5.423  1.00 0.00 ? 306 VAL A HA   5  
ATOM   8724  H  HB   . VAL B 2 48  ? -3.533  3.472   -4.048  1.00 0.00 ? 306 VAL A HB   5  
ATOM   8725  H  HG11 . VAL B 2 48  ? -2.357  3.449   -1.992  1.00 0.00 ? 306 VAL A HG11 5  
ATOM   8726  H  HG12 . VAL B 2 48  ? -1.842  5.120   -2.209  1.00 0.00 ? 306 VAL A HG12 5  
ATOM   8727  H  HG13 . VAL B 2 48  ? -1.218  3.862   -3.270  1.00 0.00 ? 306 VAL A HG13 5  
ATOM   8728  H  HG21 . VAL B 2 48  ? -4.907  4.237   -2.403  1.00 0.00 ? 306 VAL A HG21 5  
ATOM   8729  H  HG22 . VAL B 2 48  ? -5.101  5.458   -3.654  1.00 0.00 ? 306 VAL A HG22 5  
ATOM   8730  H  HG23 . VAL B 2 48  ? -4.076  5.775   -2.254  1.00 0.00 ? 306 VAL A HG23 5  
ATOM   8731  N  N    . LYS B 2 49  ? -4.521  6.846   -5.564  1.00 0.00 ? 307 LYS A N    5  
ATOM   8732  C  CA   . LYS B 2 49  ? -5.672  7.283   -6.338  1.00 0.00 ? 307 LYS A CA   5  
ATOM   8733  C  C    . LYS B 2 49  ? -5.303  7.588   -7.778  1.00 0.00 ? 307 LYS A C    5  
ATOM   8734  O  O    . LYS B 2 49  ? -5.987  7.179   -8.716  1.00 0.00 ? 307 LYS A O    5  
ATOM   8735  C  CB   . LYS B 2 49  ? -6.273  8.506   -5.718  1.00 0.00 ? 307 LYS A CB   5  
ATOM   8736  C  CG   . LYS B 2 49  ? -7.084  8.138   -4.530  1.00 0.00 ? 307 LYS A CG   5  
ATOM   8737  C  CD   . LYS B 2 49  ? -8.505  8.607   -4.651  1.00 0.00 ? 307 LYS A CD   5  
ATOM   8738  C  CE   . LYS B 2 49  ? -9.108  8.572   -3.290  1.00 0.00 ? 307 LYS A CE   5  
ATOM   8739  N  NZ   . LYS B 2 49  ? -10.169 9.600   -3.105  1.00 0.00 ? 307 LYS A NZ   5  
ATOM   8740  H  H    . LYS B 2 49  ? -4.122  7.458   -4.912  1.00 0.00 ? 307 LYS A H    5  
ATOM   8741  H  HA   . LYS B 2 49  ? -6.414  6.511   -6.287  1.00 0.00 ? 307 LYS A HA   5  
ATOM   8742  H  HB2  . LYS B 2 49  ? -5.484  9.169   -5.415  1.00 0.00 ? 307 LYS A HB2  5  
ATOM   8743  H  HB3  . LYS B 2 49  ? -6.914  9.001   -6.427  1.00 0.00 ? 307 LYS A HB3  5  
ATOM   8744  H  HG2  . LYS B 2 49  ? -7.082  7.063   -4.428  1.00 0.00 ? 307 LYS A HG2  5  
ATOM   8745  H  HG3  . LYS B 2 49  ? -6.637  8.580   -3.661  1.00 0.00 ? 307 LYS A HG3  5  
ATOM   8746  H  HD2  . LYS B 2 49  ? -8.521  9.617   -5.034  1.00 0.00 ? 307 LYS A HD2  5  
ATOM   8747  H  HD3  . LYS B 2 49  ? -9.053  7.946   -5.307  1.00 0.00 ? 307 LYS A HD3  5  
ATOM   8748  H  HE2  . LYS B 2 49  ? -9.515  7.588   -3.109  1.00 0.00 ? 307 LYS A HE2  5  
ATOM   8749  H  HE3  . LYS B 2 49  ? -8.308  8.752   -2.608  1.00 0.00 ? 307 LYS A HE3  5  
ATOM   8750  H  HZ1  . LYS B 2 49  ? -10.936 9.449   -3.790  1.00 0.00 ? 307 LYS A HZ1  5  
ATOM   8751  H  HZ2  . LYS B 2 49  ? -9.774  10.551  -3.248  1.00 0.00 ? 307 LYS A HZ2  5  
ATOM   8752  H  HZ3  . LYS B 2 49  ? -10.560 9.541   -2.142  1.00 0.00 ? 307 LYS A HZ3  5  
ATOM   8753  N  N    . THR B 2 50  ? -4.205  8.314   -7.931  1.00 0.00 ? 308 THR A N    5  
ATOM   8754  C  CA   . THR B 2 50  ? -3.730  8.732   -9.248  1.00 0.00 ? 308 THR A CA   5  
ATOM   8755  C  C    . THR B 2 50  ? -2.861  7.692   -9.965  1.00 0.00 ? 308 THR A C    5  
ATOM   8756  O  O    . THR B 2 50  ? -3.124  7.369   -11.123 1.00 0.00 ? 308 THR A O    5  
ATOM   8757  C  CB   . THR B 2 50  ? -2.944  10.055  -9.157  1.00 0.00 ? 308 THR A CB   5  
ATOM   8758  O  OG1  . THR B 2 50  ? -2.261  10.307  -10.391 1.00 0.00 ? 308 THR A OG1  5  
ATOM   8759  C  CG2  . THR B 2 50  ? -1.941  10.015  -8.013  1.00 0.00 ? 308 THR A CG2  5  
ATOM   8760  H  H    . THR B 2 50  ? -3.711  8.595   -7.129  1.00 0.00 ? 308 THR A H    5  
ATOM   8761  H  HA   . THR B 2 50  ? -4.602  8.918   -9.857  1.00 0.00 ? 308 THR A HA   5  
ATOM   8762  H  HB   . THR B 2 50  ? -3.644  10.857  -8.973  1.00 0.00 ? 308 THR A HB   5  
ATOM   8763  H  HG1  . THR B 2 50  ? -2.724  9.869   -11.109 1.00 0.00 ? 308 THR A HG1  5  
ATOM   8764  H  HG21 . THR B 2 50  ? -2.471  9.945   -7.074  1.00 0.00 ? 308 THR A HG21 5  
ATOM   8765  H  HG22 . THR B 2 50  ? -1.346  10.916  -8.025  1.00 0.00 ? 308 THR A HG22 5  
ATOM   8766  H  HG23 . THR B 2 50  ? -1.298  9.156   -8.129  1.00 0.00 ? 308 THR A HG23 5  
ATOM   8767  N  N    . TYR B 2 51  ? -1.832  7.164   -9.298  1.00 0.00 ? 309 TYR A N    5  
ATOM   8768  C  CA   . TYR B 2 51  ? -0.938  6.208   -9.953  1.00 0.00 ? 309 TYR A CA   5  
ATOM   8769  C  C    . TYR B 2 51  ? -1.391  4.750   -9.777  1.00 0.00 ? 309 TYR A C    5  
ATOM   8770  O  O    . TYR B 2 51  ? -2.526  4.479   -9.387  1.00 0.00 ? 309 TYR A O    5  
ATOM   8771  C  CB   . TYR B 2 51  ? 0.510   6.418   -9.475  1.00 0.00 ? 309 TYR A CB   5  
ATOM   8772  C  CG   . TYR B 2 51  ? 0.971   5.456   -8.406  1.00 0.00 ? 309 TYR A CG   5  
ATOM   8773  C  CD1  . TYR B 2 51  ? 0.260   5.314   -7.232  1.00 0.00 ? 309 TYR A CD1  5  
ATOM   8774  C  CD2  . TYR B 2 51  ? 2.111   4.687   -8.585  1.00 0.00 ? 309 TYR A CD2  5  
ATOM   8775  C  CE1  . TYR B 2 51  ? 0.668   4.430   -6.256  1.00 0.00 ? 309 TYR A CE1  5  
ATOM   8776  C  CE2  . TYR B 2 51  ? 2.529   3.800   -7.615  1.00 0.00 ? 309 TYR A CE2  5  
ATOM   8777  C  CZ   . TYR B 2 51  ? 1.804   3.672   -6.453  1.00 0.00 ? 309 TYR A CZ   5  
ATOM   8778  O  OH   . TYR B 2 51  ? 2.216   2.785   -5.487  1.00 0.00 ? 309 TYR A OH   5  
ATOM   8779  H  H    . TYR B 2 51  ? -1.673  7.413   -8.363  1.00 0.00 ? 309 TYR A H    5  
ATOM   8780  H  HA   . TYR B 2 51  ? -0.972  6.431   -11.003 1.00 0.00 ? 309 TYR A HA   5  
ATOM   8781  H  HB2  . TYR B 2 51  ? 1.175   6.309   -10.318 1.00 0.00 ? 309 TYR A HB2  5  
ATOM   8782  H  HB3  . TYR B 2 51  ? 0.605   7.420   -9.081  1.00 0.00 ? 309 TYR A HB3  5  
ATOM   8783  H  HD1  . TYR B 2 51  ? -0.630  5.905   -7.090  1.00 0.00 ? 309 TYR A HD1  5  
ATOM   8784  H  HD2  . TYR B 2 51  ? 2.678   4.790   -9.499  1.00 0.00 ? 309 TYR A HD2  5  
ATOM   8785  H  HE1  . TYR B 2 51  ? 0.099   4.334   -5.345  1.00 0.00 ? 309 TYR A HE1  5  
ATOM   8786  H  HE2  . TYR B 2 51  ? 3.417   3.207   -7.772  1.00 0.00 ? 309 TYR A HE2  5  
ATOM   8787  H  HH   . TYR B 2 51  ? 1.464   2.270   -5.183  1.00 0.00 ? 309 TYR A HH   5  
ATOM   8788  N  N    . LYS B 2 52  ? -0.476  3.827   -10.076 1.00 0.00 ? 310 LYS A N    5  
ATOM   8789  C  CA   . LYS B 2 52  ? -0.737  2.391   -9.995  1.00 0.00 ? 310 LYS A CA   5  
ATOM   8790  C  C    . LYS B 2 52  ? -0.561  1.874   -8.571  1.00 0.00 ? 310 LYS A C    5  
ATOM   8791  O  O    . LYS B 2 52  ? 0.534   1.468   -8.181  1.00 0.00 ? 310 LYS A O    5  
ATOM   8792  C  CB   . LYS B 2 52  ? 0.207   1.647   -10.925 1.00 0.00 ? 310 LYS A CB   5  
ATOM   8793  C  CG   . LYS B 2 52  ? 0.129   2.105   -12.358 1.00 0.00 ? 310 LYS A CG   5  
ATOM   8794  C  CD   . LYS B 2 52  ? -0.716  1.179   -13.207 1.00 0.00 ? 310 LYS A CD   5  
ATOM   8795  C  CE   . LYS B 2 52  ? -0.083  -0.193  -13.351 1.00 0.00 ? 310 LYS A CE   5  
ATOM   8796  N  NZ   . LYS B 2 52  ? 1.198   -0.140  -14.109 1.00 0.00 ? 310 LYS A NZ   5  
ATOM   8797  H  H    . LYS B 2 52  ? 0.418   4.126   -10.330 1.00 0.00 ? 310 LYS A H    5  
ATOM   8798  H  HA   . LYS B 2 52  ? -1.742  2.210   -10.317 1.00 0.00 ? 310 LYS A HA   5  
ATOM   8799  H  HB2  . LYS B 2 52  ? 1.206   1.797   -10.581 1.00 0.00 ? 310 LYS A HB2  5  
ATOM   8800  H  HB3  . LYS B 2 52  ? -0.021  0.600   -10.901 1.00 0.00 ? 310 LYS A HB3  5  
ATOM   8801  H  HG2  . LYS B 2 52  ? -0.313  3.080   -12.374 1.00 0.00 ? 310 LYS A HG2  5  
ATOM   8802  H  HG3  . LYS B 2 52  ? 1.124   2.141   -12.758 1.00 0.00 ? 310 LYS A HG3  5  
ATOM   8803  H  HD2  . LYS B 2 52  ? -1.678  1.070   -12.743 1.00 0.00 ? 310 LYS A HD2  5  
ATOM   8804  H  HD3  . LYS B 2 52  ? -0.835  1.616   -14.189 1.00 0.00 ? 310 LYS A HD3  5  
ATOM   8805  H  HE2  . LYS B 2 52  ? 0.110   -0.592  -12.366 1.00 0.00 ? 310 LYS A HE2  5  
ATOM   8806  H  HE3  . LYS B 2 52  ? -0.774  -0.837  -13.869 1.00 0.00 ? 310 LYS A HE3  5  
ATOM   8807  H  HZ1  . LYS B 2 52  ? 1.888   0.452   -13.604 1.00 0.00 ? 310 LYS A HZ1  5  
ATOM   8808  H  HZ2  . LYS B 2 52  ? 1.037   0.266   -15.054 1.00 0.00 ? 310 LYS A HZ2  5  
ATOM   8809  H  HZ3  . LYS B 2 52  ? 1.589   -1.097  -14.218 1.00 0.00 ? 310 LYS A HZ3  5  
ATOM   8810  N  N    . TRP B 2 53  ? -1.641  1.883   -7.803  1.00 0.00 ? 311 TRP A N    5  
ATOM   8811  C  CA   . TRP B 2 53  ? -1.601  1.413   -6.425  1.00 0.00 ? 311 TRP A CA   5  
ATOM   8812  C  C    . TRP B 2 53  ? -1.276  -0.074  -6.367  1.00 0.00 ? 311 TRP A C    5  
ATOM   8813  O  O    . TRP B 2 53  ? -0.376  -0.488  -5.637  1.00 0.00 ? 311 TRP A O    5  
ATOM   8814  C  CB   . TRP B 2 53  ? -2.933  1.715   -5.738  1.00 0.00 ? 311 TRP A CB   5  
ATOM   8815  C  CG   . TRP B 2 53  ? -3.164  0.975   -4.454  1.00 0.00 ? 311 TRP A CG   5  
ATOM   8816  C  CD1  . TRP B 2 53  ? -2.540  1.166   -3.261  1.00 0.00 ? 311 TRP A CD1  5  
ATOM   8817  C  CD2  . TRP B 2 53  ? -4.113  -0.063  -4.243  1.00 0.00 ? 311 TRP A CD2  5  
ATOM   8818  N  NE1  . TRP B 2 53  ? -3.054  0.316   -2.316  1.00 0.00 ? 311 TRP A NE1  5  
ATOM   8819  C  CE2  . TRP B 2 53  ? -4.022  -0.453  -2.898  1.00 0.00 ? 311 TRP A CE2  5  
ATOM   8820  C  CE3  . TRP B 2 53  ? -5.033  -0.694  -5.066  1.00 0.00 ? 311 TRP A CE3  5  
ATOM   8821  C  CZ2  . TRP B 2 53  ? -4.823  -1.447  -2.357  1.00 0.00 ? 311 TRP A CZ2  5  
ATOM   8822  C  CZ3  . TRP B 2 53  ? -5.830  -1.690  -4.536  1.00 0.00 ? 311 TRP A CZ3  5  
ATOM   8823  C  CH2  . TRP B 2 53  ? -5.723  -2.057  -3.189  1.00 0.00 ? 311 TRP A CH2  5  
ATOM   8824  H  H    . TRP B 2 53  ? -2.487  2.217   -8.170  1.00 0.00 ? 311 TRP A H    5  
ATOM   8825  H  HA   . TRP B 2 53  ? -0.817  1.955   -5.918  1.00 0.00 ? 311 TRP A HA   5  
ATOM   8826  H  HB2  . TRP B 2 53  ? -2.969  2.763   -5.523  1.00 0.00 ? 311 TRP A HB2  5  
ATOM   8827  H  HB3  . TRP B 2 53  ? -3.744  1.480   -6.401  1.00 0.00 ? 311 TRP A HB3  5  
ATOM   8828  H  HD1  . TRP B 2 53  ? -1.763  1.891   -3.093  1.00 0.00 ? 311 TRP A HD1  5  
ATOM   8829  H  HE1  . TRP B 2 53  ? -2.771  0.266   -1.379  1.00 0.00 ? 311 TRP A HE1  5  
ATOM   8830  H  HE3  . TRP B 2 53  ? -5.120  -0.416  -6.103  1.00 0.00 ? 311 TRP A HE3  5  
ATOM   8831  H  HZ2  . TRP B 2 53  ? -4.754  -1.729  -1.321  1.00 0.00 ? 311 TRP A HZ2  5  
ATOM   8832  H  HZ3  . TRP B 2 53  ? -6.552  -2.193  -5.163  1.00 0.00 ? 311 TRP A HZ3  5  
ATOM   8833  H  HH2  . TRP B 2 53  ? -6.365  -2.841  -2.813  1.00 0.00 ? 311 TRP A HH2  5  
ATOM   8834  N  N    . GLN B 2 54  ? -2.002  -0.868  -7.150  1.00 0.00 ? 312 GLN A N    5  
ATOM   8835  C  CA   . GLN B 2 54  ? -1.790  -2.312  -7.198  1.00 0.00 ? 312 GLN A CA   5  
ATOM   8836  C  C    . GLN B 2 54  ? -1.919  -2.935  -5.811  1.00 0.00 ? 312 GLN A C    5  
ATOM   8837  O  O    . GLN B 2 54  ? -1.071  -2.731  -4.941  1.00 0.00 ? 312 GLN A O    5  
ATOM   8838  C  CB   . GLN B 2 54  ? -0.415  -2.634  -7.785  1.00 0.00 ? 312 GLN A CB   5  
ATOM   8839  C  CG   . GLN B 2 54  ? -0.186  -2.035  -9.163  1.00 0.00 ? 312 GLN A CG   5  
ATOM   8840  C  CD   . GLN B 2 54  ? 1.181   -2.373  -9.729  1.00 0.00 ? 312 GLN A CD   5  
ATOM   8841  O  OE1  . GLN B 2 54  ? 1.351   -2.490  -10.943 1.00 0.00 ? 312 GLN A OE1  5  
ATOM   8842  N  NE2  . GLN B 2 54  ? 2.166   -2.529  -8.851  1.00 0.00 ? 312 GLN A NE2  5  
ATOM   8843  H  H    . GLN B 2 54  ? -2.699  -0.470  -7.713  1.00 0.00 ? 312 GLN A H    5  
ATOM   8844  H  HA   . GLN B 2 54  ? -2.550  -2.735  -7.838  1.00 0.00 ? 312 GLN A HA   5  
ATOM   8845  H  HB2  . GLN B 2 54  ? 0.345   -2.255  -7.120  1.00 0.00 ? 312 GLN A HB2  5  
ATOM   8846  H  HB3  . GLN B 2 54  ? -0.312  -3.706  -7.861  1.00 0.00 ? 312 GLN A HB3  5  
ATOM   8847  H  HG2  . GLN B 2 54  ? -0.940  -2.416  -9.836  1.00 0.00 ? 312 GLN A HG2  5  
ATOM   8848  H  HG3  . GLN B 2 54  ? -0.276  -0.961  -9.094  1.00 0.00 ? 312 GLN A HG3  5  
ATOM   8849  H  HE21 . GLN B 2 54  ? 1.960   -2.418  -7.899  1.00 0.00 ? 312 GLN A HE21 5  
ATOM   8850  H  HE22 . GLN B 2 54  ? 3.058   -2.750  -9.191  1.00 0.00 ? 312 GLN A HE22 5  
ATOM   8851  N  N    . CYS B 2 55  ? -2.984  -3.703  -5.618  1.00 0.00 ? 313 CYS A N    5  
ATOM   8852  C  CA   . CYS B 2 55  ? -3.236  -4.364  -4.345  1.00 0.00 ? 313 CYS A CA   5  
ATOM   8853  C  C    . CYS B 2 55  ? -2.039  -5.198  -3.911  1.00 0.00 ? 313 CYS A C    5  
ATOM   8854  O  O    . CYS B 2 55  ? -1.075  -5.358  -4.654  1.00 0.00 ? 313 CYS A O    5  
ATOM   8855  C  CB   . CYS B 2 55  ? -4.481  -5.250  -4.440  1.00 0.00 ? 313 CYS A CB   5  
ATOM   8856  S  SG   . CYS B 2 55  ? -4.150  -6.940  -5.034  1.00 0.00 ? 313 CYS A SG   5  
ATOM   8857  H  H    . CYS B 2 55  ? -3.620  -3.822  -6.347  1.00 0.00 ? 313 CYS A H    5  
ATOM   8858  H  HA   . CYS B 2 55  ? -3.407  -3.600  -3.603  1.00 0.00 ? 313 CYS A HA   5  
ATOM   8859  H  HB2  . CYS B 2 55  ? -4.932  -5.328  -3.462  1.00 0.00 ? 313 CYS A HB2  5  
ATOM   8860  H  HB3  . CYS B 2 55  ? -5.187  -4.795  -5.119  1.00 0.00 ? 313 CYS A HB3  5  
ATOM   8861  N  N    . ILE B 2 56  ? -2.124  -5.731  -2.706  1.00 0.00 ? 314 ILE A N    5  
ATOM   8862  C  CA   . ILE B 2 56  ? -1.069  -6.537  -2.128  1.00 0.00 ? 314 ILE A CA   5  
ATOM   8863  C  C    . ILE B 2 56  ? -0.649  -7.713  -3.008  1.00 0.00 ? 314 ILE A C    5  
ATOM   8864  O  O    . ILE B 2 56  ? 0.520   -7.857  -3.318  1.00 0.00 ? 314 ILE A O    5  
ATOM   8865  C  CB   . ILE B 2 56  ? -1.530  -7.064  -0.769  1.00 0.00 ? 314 ILE A CB   5  
ATOM   8866  C  CG1  . ILE B 2 56  ? -0.528  -8.044  -0.223  1.00 0.00 ? 314 ILE A CG1  5  
ATOM   8867  C  CG2  . ILE B 2 56  ? -2.879  -7.722  -0.891  1.00 0.00 ? 314 ILE A CG2  5  
ATOM   8868  C  CD1  . ILE B 2 56  ? 0.884   -7.503  -0.151  1.00 0.00 ? 314 ILE A CD1  5  
ATOM   8869  H  H    . ILE B 2 56  ? -2.935  -5.584  -2.179  1.00 0.00 ? 314 ILE A H    5  
ATOM   8870  H  HA   . ILE B 2 56  ? -0.199  -5.911  -1.962  1.00 0.00 ? 314 ILE A HA   5  
ATOM   8871  H  HB   . ILE B 2 56  ? -1.625  -6.240  -0.095  1.00 0.00 ? 314 ILE A HB   5  
ATOM   8872  H  HG12 . ILE B 2 56  ? -0.835  -8.331  0.762   1.00 0.00 ? 314 ILE A HG12 5  
ATOM   8873  H  HG13 . ILE B 2 56  ? -0.521  -8.909  -0.860  1.00 0.00 ? 314 ILE A HG13 5  
ATOM   8874  H  HG21 . ILE B 2 56  ? -2.756  -8.624  -1.450  1.00 0.00 ? 314 ILE A HG21 5  
ATOM   8875  H  HG22 . ILE B 2 56  ? -3.562  -7.063  -1.406  1.00 0.00 ? 314 ILE A HG22 5  
ATOM   8876  H  HG23 . ILE B 2 56  ? -3.263  -7.954  0.091   1.00 0.00 ? 314 ILE A HG23 5  
ATOM   8877  H  HD11 . ILE B 2 56  ? 0.887   -6.586  0.411   1.00 0.00 ? 314 ILE A HD11 5  
ATOM   8878  H  HD12 . ILE B 2 56  ? 1.245   -7.314  -1.151  1.00 0.00 ? 314 ILE A HD12 5  
ATOM   8879  H  HD13 . ILE B 2 56  ? 1.522   -8.226  0.332   1.00 0.00 ? 314 ILE A HD13 5  
ATOM   8880  N  N    . GLU B 2 57  ? -1.581  -8.563  -3.396  1.00 0.00 ? 315 GLU A N    5  
ATOM   8881  C  CA   . GLU B 2 57  ? -1.236  -9.714  -4.213  1.00 0.00 ? 315 GLU A CA   5  
ATOM   8882  C  C    . GLU B 2 57  ? -0.483  -9.299  -5.479  1.00 0.00 ? 315 GLU A C    5  
ATOM   8883  O  O    . GLU B 2 57  ? 0.225   -10.106 -6.079  1.00 0.00 ? 315 GLU A O    5  
ATOM   8884  C  CB   . GLU B 2 57  ? -2.491  -10.507 -4.582  1.00 0.00 ? 315 GLU A CB   5  
ATOM   8885  C  CG   . GLU B 2 57  ? -3.313  -10.934 -3.377  1.00 0.00 ? 315 GLU A CG   5  
ATOM   8886  C  CD   . GLU B 2 57  ? -4.448  -11.868 -3.747  1.00 0.00 ? 315 GLU A CD   5  
ATOM   8887  O  OE1  . GLU B 2 57  ? -4.211  -13.092 -3.813  1.00 0.00 ? 315 GLU A OE1  5  
ATOM   8888  O  OE2  . GLU B 2 57  ? -5.575  -11.376 -3.969  1.00 0.00 ? 315 GLU A OE2  5  
ATOM   8889  H  H    . GLU B 2 57  ? -2.508  -8.422  -3.128  1.00 0.00 ? 315 GLU A H    5  
ATOM   8890  H  HA   . GLU B 2 57  ? -0.586  -10.342 -3.613  1.00 0.00 ? 315 GLU A HA   5  
ATOM   8891  H  HB2  . GLU B 2 57  ? -3.114  -9.896  -5.219  1.00 0.00 ? 315 GLU A HB2  5  
ATOM   8892  H  HB3  . GLU B 2 57  ? -2.197  -11.394 -5.123  1.00 0.00 ? 315 GLU A HB3  5  
ATOM   8893  H  HG2  . GLU B 2 57  ? -2.666  -11.438 -2.676  1.00 0.00 ? 315 GLU A HG2  5  
ATOM   8894  H  HG3  . GLU B 2 57  ? -3.730  -10.052 -2.911  1.00 0.00 ? 315 GLU A HG3  5  
ATOM   8895  N  N    . CYS B 2 58  ? -0.638  -8.036  -5.880  1.00 0.00 ? 316 CYS A N    5  
ATOM   8896  C  CA   . CYS B 2 58  ? 0.032   -7.525  -7.070  1.00 0.00 ? 316 CYS A CA   5  
ATOM   8897  C  C    . CYS B 2 58  ? 0.820   -6.253  -6.772  1.00 0.00 ? 316 CYS A C    5  
ATOM   8898  O  O    . CYS B 2 58  ? 1.093   -5.452  -7.666  1.00 0.00 ? 316 CYS A O    5  
ATOM   8899  C  CB   . CYS B 2 58  ? -0.987  -7.209  -8.147  1.00 0.00 ? 316 CYS A CB   5  
ATOM   8900  S  SG   . CYS B 2 58  ? -2.481  -8.258  -8.151  1.00 0.00 ? 316 CYS A SG   5  
ATOM   8901  H  H    . CYS B 2 58  ? -1.224  -7.441  -5.375  1.00 0.00 ? 316 CYS A H    5  
ATOM   8902  H  HA   . CYS B 2 58  ? 0.706   -8.284  -7.434  1.00 0.00 ? 316 CYS A HA   5  
ATOM   8903  H  HB2  . CYS B 2 58  ? -1.310  -6.185  -8.031  1.00 0.00 ? 316 CYS A HB2  5  
ATOM   8904  H  HB3  . CYS B 2 58  ? -0.506  -7.314  -9.089  1.00 0.00 ? 316 CYS A HB3  5  
ATOM   8905  N  N    . LYS B 2 59  ? 1.179   -6.081  -5.517  1.00 0.00 ? 317 LYS A N    5  
ATOM   8906  C  CA   . LYS B 2 59  ? 1.911   -4.893  -5.075  1.00 0.00 ? 317 LYS A CA   5  
ATOM   8907  C  C    . LYS B 2 59  ? 3.322   -4.826  -5.660  1.00 0.00 ? 317 LYS A C    5  
ATOM   8908  O  O    . LYS B 2 59  ? 3.830   -3.748  -5.962  1.00 0.00 ? 317 LYS A O    5  
ATOM   8909  C  CB   . LYS B 2 59  ? 1.899   -4.790  -3.537  1.00 0.00 ? 317 LYS A CB   5  
ATOM   8910  C  CG   . LYS B 2 59  ? 2.953   -5.588  -2.837  1.00 0.00 ? 317 LYS A CG   5  
ATOM   8911  C  CD   . LYS B 2 59  ? 3.087   -6.955  -3.442  1.00 0.00 ? 317 LYS A CD   5  
ATOM   8912  C  CE   . LYS B 2 59  ? 3.290   -8.011  -2.399  1.00 0.00 ? 317 LYS A CE   5  
ATOM   8913  N  NZ   . LYS B 2 59  ? 4.475   -8.862  -2.686  1.00 0.00 ? 317 LYS A NZ   5  
ATOM   8914  H  H    . LYS B 2 59  ? 0.941   -6.767  -4.872  1.00 0.00 ? 317 LYS A H    5  
ATOM   8915  H  HA   . LYS B 2 59  ? 1.398   -4.070  -5.453  1.00 0.00 ? 317 LYS A HA   5  
ATOM   8916  H  HB2  . LYS B 2 59  ? 2.044   -3.769  -3.271  1.00 0.00 ? 317 LYS A HB2  5  
ATOM   8917  H  HB3  . LYS B 2 59  ? 0.936   -5.116  -3.161  1.00 0.00 ? 317 LYS A HB3  5  
ATOM   8918  H  HG2  . LYS B 2 59  ? 3.880   -5.068  -2.934  1.00 0.00 ? 317 LYS A HG2  5  
ATOM   8919  H  HG3  . LYS B 2 59  ? 2.691   -5.683  -1.796  1.00 0.00 ? 317 LYS A HG3  5  
ATOM   8920  H  HD2  . LYS B 2 59  ? 2.189   -7.179  -3.989  1.00 0.00 ? 317 LYS A HD2  5  
ATOM   8921  H  HD3  . LYS B 2 59  ? 3.917   -6.942  -4.115  1.00 0.00 ? 317 LYS A HD3  5  
ATOM   8922  H  HE2  . LYS B 2 59  ? 3.412   -7.529  -1.441  1.00 0.00 ? 317 LYS A HE2  5  
ATOM   8923  H  HE3  . LYS B 2 59  ? 2.409   -8.630  -2.371  1.00 0.00 ? 317 LYS A HE3  5  
ATOM   8924  H  HZ1  . LYS B 2 59  ? 4.550   -9.622  -1.980  1.00 0.00 ? 317 LYS A HZ1  5  
ATOM   8925  H  HZ2  . LYS B 2 59  ? 5.339   -8.291  -2.654  1.00 0.00 ? 317 LYS A HZ2  5  
ATOM   8926  H  HZ3  . LYS B 2 59  ? 4.388   -9.288  -3.631  1.00 0.00 ? 317 LYS A HZ3  5  
ATOM   8927  N  N    . SER B 2 60  ? 3.897   -5.993  -5.853  1.00 0.00 ? 318 SER A N    5  
ATOM   8928  C  CA   . SER B 2 60  ? 5.249   -6.180  -6.407  1.00 0.00 ? 318 SER A CA   5  
ATOM   8929  C  C    . SER B 2 60  ? 6.270   -5.133  -5.954  1.00 0.00 ? 318 SER A C    5  
ATOM   8930  O  O    . SER B 2 60  ? 5.968   -4.192  -5.223  1.00 0.00 ? 318 SER A O    5  
ATOM   8931  C  CB   . SER B 2 60  ? 5.208   -6.210  -7.929  1.00 0.00 ? 318 SER A CB   5  
ATOM   8932  O  OG   . SER B 2 60  ? 3.946   -5.795  -8.423  1.00 0.00 ? 318 SER A OG   5  
ATOM   8933  H  H    . SER B 2 60  ? 3.378   -6.780  -5.614  1.00 0.00 ? 318 SER A H    5  
ATOM   8934  H  HA   . SER B 2 60  ? 5.598   -7.139  -6.074  1.00 0.00 ? 318 SER A HA   5  
ATOM   8935  H  HB2  . SER B 2 60  ? 5.965   -5.549  -8.309  1.00 0.00 ? 318 SER A HB2  5  
ATOM   8936  H  HB3  . SER B 2 60  ? 5.410   -7.215  -8.272  1.00 0.00 ? 318 SER A HB3  5  
ATOM   8937  H  HG   . SER B 2 60  ? 3.797   -4.876  -8.191  1.00 0.00 ? 318 SER A HG   5  
ATOM   8938  N  N    . CYS B 2 61  ? 7.509   -5.351  -6.384  1.00 0.00 ? 319 CYS A N    5  
ATOM   8939  C  CA   . CYS B 2 61  ? 8.616   -4.456  -6.088  1.00 0.00 ? 319 CYS A CA   5  
ATOM   8940  C  C    . CYS B 2 61  ? 8.774   -3.406  -7.182  1.00 0.00 ? 319 CYS A C    5  
ATOM   8941  O  O    . CYS B 2 61  ? 9.308   -3.703  -8.241  1.00 0.00 ? 319 CYS A O    5  
ATOM   8942  C  CB   . CYS B 2 61  ? 9.907   -5.259  -6.017  1.00 0.00 ? 319 CYS A CB   5  
ATOM   8943  S  SG   . CYS B 2 61  ? 11.361  -4.341  -5.384  1.00 0.00 ? 319 CYS A SG   5  
ATOM   8944  H  H    . CYS B 2 61  ? 7.695   -6.165  -6.894  1.00 0.00 ? 319 CYS A H    5  
ATOM   8945  H  HA   . CYS B 2 61  ? 8.439   -3.983  -5.136  1.00 0.00 ? 319 CYS A HA   5  
ATOM   8946  H  HB2  . CYS B 2 61  ? 9.753   -6.119  -5.388  1.00 0.00 ? 319 CYS A HB2  5  
ATOM   8947  H  HB3  . CYS B 2 61  ? 10.150  -5.603  -7.005  1.00 0.00 ? 319 CYS A HB3  5  
ATOM   8948  N  N    . ILE B 2 62  ? 8.314   -2.186  -6.945  1.00 0.00 ? 320 ILE A N    5  
ATOM   8949  C  CA   . ILE B 2 62  ? 8.483   -1.124  -7.939  1.00 0.00 ? 320 ILE A CA   5  
ATOM   8950  C  C    . ILE B 2 62  ? 9.902   -1.208  -8.486  1.00 0.00 ? 320 ILE A C    5  
ATOM   8951  O  O    . ILE B 2 62  ? 10.176  -0.871  -9.637  1.00 0.00 ? 320 ILE A O    5  
ATOM   8952  C  CB   . ILE B 2 62  ? 8.250   0.272   -7.317  1.00 0.00 ? 320 ILE A CB   5  
ATOM   8953  C  CG1  . ILE B 2 62  ? 9.329   1.270   -7.769  1.00 0.00 ? 320 ILE A CG1  5  
ATOM   8954  C  CG2  . ILE B 2 62  ? 8.219   0.152   -5.816  1.00 0.00 ? 320 ILE A CG2  5  
ATOM   8955  C  CD1  . ILE B 2 62  ? 9.334   2.564   -7.005  1.00 0.00 ? 320 ILE A CD1  5  
ATOM   8956  H  H    . ILE B 2 62  ? 7.863   -1.994  -6.099  1.00 0.00 ? 320 ILE A H    5  
ATOM   8957  H  HA   . ILE B 2 62  ? 7.774   -1.282  -8.740  1.00 0.00 ? 320 ILE A HA   5  
ATOM   8958  H  HB   . ILE B 2 62  ? 7.288   0.633   -7.628  1.00 0.00 ? 320 ILE A HB   5  
ATOM   8959  H  HG12 . ILE B 2 62  ? 10.295  0.823   -7.643  1.00 0.00 ? 320 ILE A HG12 5  
ATOM   8960  H  HG13 . ILE B 2 62  ? 9.177   1.505   -8.806  1.00 0.00 ? 320 ILE A HG13 5  
ATOM   8961  H  HG21 . ILE B 2 62  ? 9.192   -0.170  -5.465  1.00 0.00 ? 320 ILE A HG21 5  
ATOM   8962  H  HG22 . ILE B 2 62  ? 7.472   -0.573  -5.527  1.00 0.00 ? 320 ILE A HG22 5  
ATOM   8963  H  HG23 . ILE B 2 62  ? 7.979   1.109   -5.384  1.00 0.00 ? 320 ILE A HG23 5  
ATOM   8964  H  HD11 . ILE B 2 62  ? 8.554   2.526   -6.271  1.00 0.00 ? 320 ILE A HD11 5  
ATOM   8965  H  HD12 . ILE B 2 62  ? 9.158   3.386   -7.682  1.00 0.00 ? 320 ILE A HD12 5  
ATOM   8966  H  HD13 . ILE B 2 62  ? 10.288  2.694   -6.515  1.00 0.00 ? 320 ILE A HD13 5  
ATOM   8967  N  N    . LEU B 2 63  ? 10.794  -1.672  -7.614  1.00 0.00 ? 321 LEU A N    5  
ATOM   8968  C  CA   . LEU B 2 63  ? 12.197  -1.842  -7.938  1.00 0.00 ? 321 LEU A CA   5  
ATOM   8969  C  C    . LEU B 2 63  ? 12.383  -3.045  -8.867  1.00 0.00 ? 321 LEU A C    5  
ATOM   8970  O  O    . LEU B 2 63  ? 12.939  -2.916  -9.958  1.00 0.00 ? 321 LEU A O    5  
ATOM   8971  C  CB   . LEU B 2 63  ? 12.987  -1.992  -6.630  1.00 0.00 ? 321 LEU A CB   5  
ATOM   8972  C  CG   . LEU B 2 63  ? 12.625  -0.988  -5.511  1.00 0.00 ? 321 LEU A CG   5  
ATOM   8973  C  CD1  . LEU B 2 63  ? 13.812  -0.699  -4.624  1.00 0.00 ? 321 LEU A CD1  5  
ATOM   8974  C  CD2  . LEU B 2 63  ? 12.088  0.323   -6.039  1.00 0.00 ? 321 LEU A CD2  5  
ATOM   8975  H  H    . LEU B 2 63  ? 10.491  -1.900  -6.706  1.00 0.00 ? 321 LEU A H    5  
ATOM   8976  H  HA   . LEU B 2 63  ? 12.530  -0.953  -8.450  1.00 0.00 ? 321 LEU A HA   5  
ATOM   8977  H  HB2  . LEU B 2 63  ? 12.810  -2.983  -6.245  1.00 0.00 ? 321 LEU A HB2  5  
ATOM   8978  H  HB3  . LEU B 2 63  ? 14.029  -1.906  -6.846  1.00 0.00 ? 321 LEU A HB3  5  
ATOM   8979  H  HG   . LEU B 2 63  ? 11.849  -1.424  -4.889  1.00 0.00 ? 321 LEU A HG   5  
ATOM   8980  H  HD11 . LEU B 2 63  ? 13.665  -1.174  -3.660  1.00 0.00 ? 321 LEU A HD11 5  
ATOM   8981  H  HD12 . LEU B 2 63  ? 13.909  0.368   -4.489  1.00 0.00 ? 321 LEU A HD12 5  
ATOM   8982  H  HD13 . LEU B 2 63  ? 14.708  -1.087  -5.084  1.00 0.00 ? 321 LEU A HD13 5  
ATOM   8983  H  HD21 . LEU B 2 63  ? 11.165  0.528   -5.530  1.00 0.00 ? 321 LEU A HD21 5  
ATOM   8984  H  HD22 . LEU B 2 63  ? 11.914  0.258   -7.100  1.00 0.00 ? 321 LEU A HD22 5  
ATOM   8985  H  HD23 . LEU B 2 63  ? 12.794  1.113   -5.835  1.00 0.00 ? 321 LEU A HD23 5  
ATOM   8986  N  N    . CYS B 2 64  ? 11.913  -4.214  -8.429  1.00 0.00 ? 322 CYS A N    5  
ATOM   8987  C  CA   . CYS B 2 64  ? 11.984  -5.427  -9.246  1.00 0.00 ? 322 CYS A CA   5  
ATOM   8988  C  C    . CYS B 2 64  ? 10.733  -5.560  -10.096 1.00 0.00 ? 322 CYS A C    5  
ATOM   8989  O  O    . CYS B 2 64  ? 10.788  -5.582  -11.325 1.00 0.00 ? 322 CYS A O    5  
ATOM   8990  C  CB   . CYS B 2 64  ? 12.081  -6.691  -8.391  1.00 0.00 ? 322 CYS A CB   5  
ATOM   8991  S  SG   . CYS B 2 64  ? 13.550  -6.814  -7.339  1.00 0.00 ? 322 CYS A SG   5  
ATOM   8992  H  H    . CYS B 2 64  ? 11.524  -4.263  -7.535  1.00 0.00 ? 322 CYS A H    5  
ATOM   8993  H  HA   . CYS B 2 64  ? 12.847  -5.362  -9.887  1.00 0.00 ? 322 CYS A HA   5  
ATOM   8994  H  HB2  . CYS B 2 64  ? 11.219  -6.744  -7.745  1.00 0.00 ? 322 CYS A HB2  5  
ATOM   8995  H  HB3  . CYS B 2 64  ? 12.080  -7.548  -9.047  1.00 0.00 ? 322 CYS A HB3  5  
ATOM   8996  N  N    . GLY B 2 65  ? 9.603   -5.647  -9.407  1.00 0.00 ? 323 GLY A N    5  
ATOM   8997  C  CA   . GLY B 2 65  ? 8.330   -5.817  -10.062 1.00 0.00 ? 323 GLY A CA   5  
ATOM   8998  C  C    . GLY B 2 65  ? 8.034   -7.283  -10.222 1.00 0.00 ? 323 GLY A C    5  
ATOM   8999  O  O    . GLY B 2 65  ? 7.429   -7.706  -11.207 1.00 0.00 ? 323 GLY A O    5  
ATOM   9000  H  H    . GLY B 2 65  ? 9.637   -5.586  -8.429  1.00 0.00 ? 323 GLY A H    5  
ATOM   9001  H  HA2  . GLY B 2 65  ? 7.558   -5.355  -9.464  1.00 0.00 ? 323 GLY A HA2  5  
ATOM   9002  H  HA3  . GLY B 2 65  ? 8.360   -5.353  -11.035 1.00 0.00 ? 323 GLY A HA3  5  
ATOM   9003  N  N    . THR B 2 66  ? 8.470   -8.066  -9.236  1.00 0.00 ? 324 THR A N    5  
ATOM   9004  C  CA   . THR B 2 66  ? 8.297   -9.504  -9.286  1.00 0.00 ? 324 THR A CA   5  
ATOM   9005  C  C    . THR B 2 66  ? 7.685   -10.063 -8.010  1.00 0.00 ? 324 THR A C    5  
ATOM   9006  O  O    . THR B 2 66  ? 7.236   -11.209 -7.977  1.00 0.00 ? 324 THR A O    5  
ATOM   9007  C  CB   . THR B 2 66  ? 9.652   -10.161 -9.512  1.00 0.00 ? 324 THR A CB   5  
ATOM   9008  O  OG1  . THR B 2 66  ? 9.506   -11.572 -9.686  1.00 0.00 ? 324 THR A OG1  5  
ATOM   9009  C  CG2  . THR B 2 66  ? 10.591  -9.847  -8.363  1.00 0.00 ? 324 THR A CG2  5  
ATOM   9010  H  H    . THR B 2 66  ? 8.929   -7.663  -8.454  1.00 0.00 ? 324 THR A H    5  
ATOM   9011  H  HA   . THR B 2 66  ? 7.668   -9.743  -10.125 1.00 0.00 ? 324 THR A HA   5  
ATOM   9012  H  HB   . THR B 2 66  ? 10.070  -9.742  -10.395 1.00 0.00 ? 324 THR A HB   5  
ATOM   9013  H  HG1  . THR B 2 66  ? 8.612   -11.832 -9.454  1.00 0.00 ? 324 THR A HG1  5  
ATOM   9014  H  HG21 . THR B 2 66  ? 10.714  -8.774  -8.297  1.00 0.00 ? 324 THR A HG21 5  
ATOM   9015  H  HG22 . THR B 2 66  ? 11.551  -10.311 -8.543  1.00 0.00 ? 324 THR A HG22 5  
ATOM   9016  H  HG23 . THR B 2 66  ? 10.177  -10.221 -7.442  1.00 0.00 ? 324 THR A HG23 5  
ATOM   9017  N  N    . SER B 2 67  ? 7.685   -9.248  -6.963  1.00 0.00 ? 325 SER A N    5  
ATOM   9018  C  CA   . SER B 2 67  ? 7.152   -9.645  -5.664  1.00 0.00 ? 325 SER A CA   5  
ATOM   9019  C  C    . SER B 2 67  ? 7.768   -10.962 -5.189  1.00 0.00 ? 325 SER A C    5  
ATOM   9020  O  O    . SER B 2 67  ? 7.251   -11.597 -4.273  1.00 0.00 ? 325 SER A O    5  
ATOM   9021  C  CB   . SER B 2 67  ? 5.621   -9.761  -5.695  1.00 0.00 ? 325 SER A CB   5  
ATOM   9022  O  OG   . SER B 2 67  ? 5.178   -10.541 -6.790  1.00 0.00 ? 325 SER A OG   5  
ATOM   9023  H  H    . SER B 2 67  ? 8.054   -8.346  -7.066  1.00 0.00 ? 325 SER A H    5  
ATOM   9024  H  HA   . SER B 2 67  ? 7.424   -8.870  -4.964  1.00 0.00 ? 325 SER A HA   5  
ATOM   9025  H  HB2  . SER B 2 67  ? 5.285   -10.231 -4.782  1.00 0.00 ? 325 SER A HB2  5  
ATOM   9026  H  HB3  . SER B 2 67  ? 5.185   -8.776  -5.767  1.00 0.00 ? 325 SER A HB3  5  
ATOM   9027  H  HG   . SER B 2 67  ? 5.458   -11.451 -6.670  1.00 0.00 ? 325 SER A HG   5  
ATOM   9028  N  N    . GLU B 2 68  ? 8.872   -11.369 -5.821  1.00 0.00 ? 326 GLU A N    5  
ATOM   9029  C  CA   . GLU B 2 68  ? 9.557   -12.611 -5.453  1.00 0.00 ? 326 GLU A CA   5  
ATOM   9030  C  C    . GLU B 2 68  ? 9.791   -12.711 -3.950  1.00 0.00 ? 326 GLU A C    5  
ATOM   9031  O  O    . GLU B 2 68  ? 9.061   -13.402 -3.241  1.00 0.00 ? 326 GLU A O    5  
ATOM   9032  C  CB   . GLU B 2 68  ? 10.896  -12.713 -6.175  1.00 0.00 ? 326 GLU A CB   5  
ATOM   9033  C  CG   . GLU B 2 68  ? 10.773  -13.052 -7.635  1.00 0.00 ? 326 GLU A CG   5  
ATOM   9034  C  CD   . GLU B 2 68  ? 10.575  -14.535 -7.883  1.00 0.00 ? 326 GLU A CD   5  
ATOM   9035  O  OE1  . GLU B 2 68  ? 11.585  -15.264 -7.959  1.00 0.00 ? 326 GLU A OE1  5  
ATOM   9036  O  OE2  . GLU B 2 68  ? 9.408   -14.965 -8.004  1.00 0.00 ? 326 GLU A OE2  5  
ATOM   9037  H  H    . GLU B 2 68  ? 9.225   -10.829 -6.566  1.00 0.00 ? 326 GLU A H    5  
ATOM   9038  H  HA   . GLU B 2 68  ? 8.937   -13.433 -5.764  1.00 0.00 ? 326 GLU A HA   5  
ATOM   9039  H  HB2  . GLU B 2 68  ? 11.403  -11.771 -6.092  1.00 0.00 ? 326 GLU A HB2  5  
ATOM   9040  H  HB3  . GLU B 2 68  ? 11.490  -13.473 -5.707  1.00 0.00 ? 326 GLU A HB3  5  
ATOM   9041  H  HG2  . GLU B 2 68  ? 9.928   -12.523 -8.022  1.00 0.00 ? 326 GLU A HG2  5  
ATOM   9042  H  HG3  . GLU B 2 68  ? 11.665  -12.727 -8.144  1.00 0.00 ? 326 GLU A HG3  5  
ATOM   9043  N  N    . ASN B 2 69  ? 10.819  -12.016 -3.474  1.00 0.00 ? 327 ASN A N    5  
ATOM   9044  C  CA   . ASN B 2 69  ? 11.171  -12.038 -2.061  1.00 0.00 ? 327 ASN A CA   5  
ATOM   9045  C  C    . ASN B 2 69  ? 10.307  -11.095 -1.238  1.00 0.00 ? 327 ASN A C    5  
ATOM   9046  O  O    . ASN B 2 69  ? 10.812  -10.448 -0.339  1.00 0.00 ? 327 ASN A O    5  
ATOM   9047  C  CB   . ASN B 2 69  ? 12.642  -11.683 -1.879  1.00 0.00 ? 327 ASN A CB   5  
ATOM   9048  C  CG   . ASN B 2 69  ? 13.551  -12.454 -2.804  1.00 0.00 ? 327 ASN A CG   5  
ATOM   9049  O  OD1  . ASN B 2 69  ? 13.962  -13.575 -2.507  1.00 0.00 ? 327 ASN A OD1  5  
ATOM   9050  N  ND2  . ASN B 2 69  ? 13.878  -11.844 -3.935  1.00 0.00 ? 327 ASN A ND2  5  
ATOM   9051  H  H    . ASN B 2 69  ? 11.354  -11.473 -4.090  1.00 0.00 ? 327 ASN A H    5  
ATOM   9052  H  HA   . ASN B 2 69  ? 11.024  -13.027 -1.700  1.00 0.00 ? 327 ASN A HA   5  
ATOM   9053  H  HB2  . ASN B 2 69  ? 12.771  -10.642 -2.084  1.00 0.00 ? 327 ASN A HB2  5  
ATOM   9054  H  HB3  . ASN B 2 69  ? 12.936  -11.887 -0.860  1.00 0.00 ? 327 ASN A HB3  5  
ATOM   9055  H  HD21 . ASN B 2 69  ? 13.516  -10.949 -4.100  1.00 0.00 ? 327 ASN A HD21 5  
ATOM   9056  H  HD22 . ASN B 2 69  ? 14.471  -12.308 -4.552  1.00 0.00 ? 327 ASN A HD22 5  
ATOM   9057  N  N    . ASP B 2 70  ? 9.013   -11.009 -1.558  1.00 0.00 ? 328 ASP A N    5  
ATOM   9058  C  CA   . ASP B 2 70  ? 8.084   -10.152 -0.832  1.00 0.00 ? 328 ASP A CA   5  
ATOM   9059  C  C    . ASP B 2 70  ? 8.302   -10.162 0.675   1.00 0.00 ? 328 ASP A C    5  
ATOM   9060  O  O    . ASP B 2 70  ? 7.845   -9.260  1.377   1.00 0.00 ? 328 ASP A O    5  
ATOM   9061  C  CB   . ASP B 2 70  ? 6.647   -10.517 -1.155  1.00 0.00 ? 328 ASP A CB   5  
ATOM   9062  C  CG   . ASP B 2 70  ? 6.415   -12.014 -1.213  1.00 0.00 ? 328 ASP A CG   5  
ATOM   9063  O  OD1  . ASP B 2 70  ? 6.659   -12.691 -0.191  1.00 0.00 ? 328 ASP A OD1  5  
ATOM   9064  O  OD2  . ASP B 2 70  ? 5.979   -12.510 -2.272  1.00 0.00 ? 328 ASP A OD2  5  
ATOM   9065  H  H    . ASP B 2 70  ? 8.683   -11.487 -2.332  1.00 0.00 ? 328 ASP A H    5  
ATOM   9066  H  HA   . ASP B 2 70  ? 8.251   -9.164  -1.178  1.00 0.00 ? 328 ASP A HA   5  
ATOM   9067  H  HB2  . ASP B 2 70  ? 6.006   -10.105 -0.395  1.00 0.00 ? 328 ASP A HB2  5  
ATOM   9068  H  HB3  . ASP B 2 70  ? 6.391   -10.082 -2.110  1.00 0.00 ? 328 ASP A HB3  5  
ATOM   9069  N  N    . ASP B 2 71  ? 8.992   -11.175 1.173   1.00 0.00 ? 329 ASP A N    5  
ATOM   9070  C  CA   . ASP B 2 71  ? 9.278   -11.252 2.598   1.00 0.00 ? 329 ASP A CA   5  
ATOM   9071  C  C    . ASP B 2 71  ? 10.180  -10.088 2.986   1.00 0.00 ? 329 ASP A C    5  
ATOM   9072  O  O    . ASP B 2 71  ? 10.396  -9.810  4.166   1.00 0.00 ? 329 ASP A O    5  
ATOM   9073  C  CB   . ASP B 2 71  ? 9.947   -12.582 2.951   1.00 0.00 ? 329 ASP A CB   5  
ATOM   9074  C  CG   . ASP B 2 71  ? 10.228  -12.706 4.436   1.00 0.00 ? 329 ASP A CG   5  
ATOM   9075  O  OD1  . ASP B 2 71  ? 9.327   -12.379 5.240   1.00 0.00 ? 329 ASP A OD1  5  
ATOM   9076  O  OD2  . ASP B 2 71  ? 11.347  -13.125 4.796   1.00 0.00 ? 329 ASP A OD2  5  
ATOM   9077  H  H    . ASP B 2 71  ? 9.324   -11.870 0.571   1.00 0.00 ? 329 ASP A H    5  
ATOM   9078  H  HA   . ASP B 2 71  ? 8.343   -11.168 3.133   1.00 0.00 ? 329 ASP A HA   5  
ATOM   9079  H  HB2  . ASP B 2 71  ? 9.300   -13.394 2.656   1.00 0.00 ? 329 ASP A HB2  5  
ATOM   9080  H  HB3  . ASP B 2 71  ? 10.883  -12.660 2.418   1.00 0.00 ? 329 ASP A HB3  5  
ATOM   9081  N  N    . GLN B 2 72  ? 10.697  -9.409  1.965   1.00 0.00 ? 330 GLN A N    5  
ATOM   9082  C  CA   . GLN B 2 72  ? 11.563  -8.269  2.144   1.00 0.00 ? 330 GLN A CA   5  
ATOM   9083  C  C    . GLN B 2 72  ? 10.903  -7.033  1.564   1.00 0.00 ? 330 GLN A C    5  
ATOM   9084  O  O    . GLN B 2 72  ? 11.265  -5.908  1.882   1.00 0.00 ? 330 GLN A O    5  
ATOM   9085  C  CB   . GLN B 2 72  ? 12.898  -8.509  1.456   1.00 0.00 ? 330 GLN A CB   5  
ATOM   9086  C  CG   . GLN B 2 72  ? 13.244  -9.977  1.329   1.00 0.00 ? 330 GLN A CG   5  
ATOM   9087  C  CD   . GLN B 2 72  ? 14.712  -10.216 1.101   1.00 0.00 ? 330 GLN A CD   5  
ATOM   9088  O  OE1  . GLN B 2 72  ? 15.105  -11.148 0.399   1.00 0.00 ? 330 GLN A OE1  5  
ATOM   9089  N  NE2  . GLN B 2 72  ? 15.534  -9.381  1.709   1.00 0.00 ? 330 GLN A NE2  5  
ATOM   9090  H  H    . GLN B 2 72  ? 10.485  -9.684  1.053   1.00 0.00 ? 330 GLN A H    5  
ATOM   9091  H  HA   . GLN B 2 72  ? 11.726  -8.130  3.195   1.00 0.00 ? 330 GLN A HA   5  
ATOM   9092  H  HB2  . GLN B 2 72  ? 12.857  -8.080  0.472   1.00 0.00 ? 330 GLN A HB2  5  
ATOM   9093  H  HB3  . GLN B 2 72  ? 13.677  -8.022  2.022   1.00 0.00 ? 330 GLN A HB3  5  
ATOM   9094  H  HG2  . GLN B 2 72  ? 12.968  -10.462 2.242   1.00 0.00 ? 330 GLN A HG2  5  
ATOM   9095  H  HG3  . GLN B 2 72  ? 12.686  -10.404 0.506   1.00 0.00 ? 330 GLN A HG3  5  
ATOM   9096  H  HE21 . GLN B 2 72  ? 15.149  -8.670  2.264   1.00 0.00 ? 330 GLN A HE21 5  
ATOM   9097  H  HE22 . GLN B 2 72  ? 16.486  -9.504  1.578   1.00 0.00 ? 330 GLN A HE22 5  
ATOM   9098  N  N    . LEU B 2 73  ? 9.922   -7.248  0.707   1.00 0.00 ? 331 LEU A N    5  
ATOM   9099  C  CA   . LEU B 2 73  ? 9.228   -6.156  0.089   1.00 0.00 ? 331 LEU A CA   5  
ATOM   9100  C  C    . LEU B 2 73  ? 8.717   -5.202  1.135   1.00 0.00 ? 331 LEU A C    5  
ATOM   9101  O  O    . LEU B 2 73  ? 8.172   -5.600  2.163   1.00 0.00 ? 331 LEU A O    5  
ATOM   9102  C  CB   . LEU B 2 73  ? 8.115   -6.677  -0.793  1.00 0.00 ? 331 LEU A CB   5  
ATOM   9103  C  CG   . LEU B 2 73  ? 8.614   -7.203  -2.133  1.00 0.00 ? 331 LEU A CG   5  
ATOM   9104  C  CD1  . LEU B 2 73  ? 7.469   -7.664  -2.979  1.00 0.00 ? 331 LEU A CD1  5  
ATOM   9105  C  CD2  . LEU B 2 73  ? 9.396   -6.150  -2.863  1.00 0.00 ? 331 LEU A CD2  5  
ATOM   9106  H  H    . LEU B 2 73  ? 9.649   -8.157  0.497   1.00 0.00 ? 331 LEU A H    5  
ATOM   9107  H  HA   . LEU B 2 73  ? 9.937   -5.628  -0.532  1.00 0.00 ? 331 LEU A HA   5  
ATOM   9108  H  HB2  . LEU B 2 73  ? 7.622   -7.485  -0.269  1.00 0.00 ? 331 LEU A HB2  5  
ATOM   9109  H  HB3  . LEU B 2 73  ? 7.408   -5.884  -0.973  1.00 0.00 ? 331 LEU A HB3  5  
ATOM   9110  H  HG   . LEU B 2 73  ? 9.255   -8.044  -1.955  1.00 0.00 ? 331 LEU A HG   5  
ATOM   9111  H  HD11 . LEU B 2 73  ? 6.568   -7.411  -2.483  1.00 0.00 ? 331 LEU A HD11 5  
ATOM   9112  H  HD12 . LEU B 2 73  ? 7.523   -8.733  -3.114  1.00 0.00 ? 331 LEU A HD12 5  
ATOM   9113  H  HD13 . LEU B 2 73  ? 7.504   -7.172  -3.940  1.00 0.00 ? 331 LEU A HD13 5  
ATOM   9114  H  HD21 . LEU B 2 73  ? 8.733   -5.361  -3.117  1.00 0.00 ? 331 LEU A HD21 5  
ATOM   9115  H  HD22 . LEU B 2 73  ? 9.818   -6.570  -3.761  1.00 0.00 ? 331 LEU A HD22 5  
ATOM   9116  H  HD23 . LEU B 2 73  ? 10.185  -5.774  -2.232  1.00 0.00 ? 331 LEU A HD23 5  
ATOM   9117  N  N    . LEU B 2 74  ? 8.916   -3.942  0.851   1.00 0.00 ? 332 LEU A N    5  
ATOM   9118  C  CA   . LEU B 2 74  ? 8.531   -2.885  1.751   1.00 0.00 ? 332 LEU A CA   5  
ATOM   9119  C  C    . LEU B 2 74  ? 7.358   -2.149  1.188   1.00 0.00 ? 332 LEU A C    5  
ATOM   9120  O  O    . LEU B 2 74  ? 7.441   -1.516  0.144   1.00 0.00 ? 332 LEU A O    5  
ATOM   9121  C  CB   . LEU B 2 74  ? 9.681   -1.919  1.973   1.00 0.00 ? 332 LEU A CB   5  
ATOM   9122  C  CG   . LEU B 2 74  ? 10.846  -2.431  2.779   1.00 0.00 ? 332 LEU A CG   5  
ATOM   9123  C  CD1  . LEU B 2 74  ? 11.919  -1.393  2.854   1.00 0.00 ? 332 LEU A CD1  5  
ATOM   9124  C  CD2  . LEU B 2 74  ? 10.443  -2.752  4.177   1.00 0.00 ? 332 LEU A CD2  5  
ATOM   9125  H  H    . LEU B 2 74  ? 9.309   -3.715  -0.019  1.00 0.00 ? 332 LEU A H    5  
ATOM   9126  H  HA   . LEU B 2 74  ? 8.244   -3.330  2.689   1.00 0.00 ? 332 LEU A HA   5  
ATOM   9127  H  HB2  . LEU B 2 74  ? 10.052  -1.608  1.010   1.00 0.00 ? 332 LEU A HB2  5  
ATOM   9128  H  HB3  . LEU B 2 74  ? 9.297   -1.061  2.482   1.00 0.00 ? 332 LEU A HB3  5  
ATOM   9129  H  HG   . LEU B 2 74  ? 11.260  -3.306  2.333   1.00 0.00 ? 332 LEU A HG   5  
ATOM   9130  H  HD11 . LEU B 2 74  ? 11.871  -0.908  3.823   1.00 0.00 ? 332 LEU A HD11 5  
ATOM   9131  H  HD12 . LEU B 2 74  ? 11.776  -0.672  2.074   1.00 0.00 ? 332 LEU A HD12 5  
ATOM   9132  H  HD13 . LEU B 2 74  ? 12.879  -1.861  2.739   1.00 0.00 ? 332 LEU A HD13 5  
ATOM   9133  H  HD21 . LEU B 2 74  ? 11.197  -2.318  4.812   1.00 0.00 ? 332 LEU A HD21 5  
ATOM   9134  H  HD22 . LEU B 2 74  ? 10.407  -3.824  4.316   1.00 0.00 ? 332 LEU A HD22 5  
ATOM   9135  H  HD23 . LEU B 2 74  ? 9.481   -2.315  4.397   1.00 0.00 ? 332 LEU A HD23 5  
ATOM   9136  N  N    . PHE B 2 75  ? 6.282   -2.207  1.914   1.00 0.00 ? 333 PHE A N    5  
ATOM   9137  C  CA   . PHE B 2 75  ? 5.057   -1.596  1.492   1.00 0.00 ? 333 PHE A CA   5  
ATOM   9138  C  C    . PHE B 2 75  ? 4.972   -0.174  1.987   1.00 0.00 ? 333 PHE A C    5  
ATOM   9139  O  O    . PHE B 2 75  ? 4.538   0.078   3.112   1.00 0.00 ? 333 PHE A O    5  
ATOM   9140  C  CB   . PHE B 2 75  ? 3.912   -2.445  2.030   1.00 0.00 ? 333 PHE A CB   5  
ATOM   9141  C  CG   . PHE B 2 75  ? 4.251   -3.914  1.945   1.00 0.00 ? 333 PHE A CG   5  
ATOM   9142  C  CD1  . PHE B 2 75  ? 4.947   -4.538  2.970   1.00 0.00 ? 333 PHE A CD1  5  
ATOM   9143  C  CD2  . PHE B 2 75  ? 3.923   -4.653  0.822   1.00 0.00 ? 333 PHE A CD2  5  
ATOM   9144  C  CE1  . PHE B 2 75  ? 5.308   -5.868  2.876   1.00 0.00 ? 333 PHE A CE1  5  
ATOM   9145  C  CE2  . PHE B 2 75  ? 4.290   -5.991  0.716   1.00 0.00 ? 333 PHE A CE2  5  
ATOM   9146  C  CZ   . PHE B 2 75  ? 4.985   -6.596  1.747   1.00 0.00 ? 333 PHE A CZ   5  
ATOM   9147  H  H    . PHE B 2 75  ? 6.318   -2.660  2.776   1.00 0.00 ? 333 PHE A H    5  
ATOM   9148  H  HA   . PHE B 2 75  ? 5.027   -1.602  0.414   1.00 0.00 ? 333 PHE A HA   5  
ATOM   9149  H  HB2  . PHE B 2 75  ? 3.731   -2.189  3.065   1.00 0.00 ? 333 PHE A HB2  5  
ATOM   9150  H  HB3  . PHE B 2 75  ? 3.024   -2.259  1.453   1.00 0.00 ? 333 PHE A HB3  5  
ATOM   9151  H  HD1  . PHE B 2 75  ? 5.201   -3.974  3.855   1.00 0.00 ? 333 PHE A HD1  5  
ATOM   9152  H  HD2  . PHE B 2 75  ? 3.393   -4.172  0.019   1.00 0.00 ? 333 PHE A HD2  5  
ATOM   9153  H  HE1  . PHE B 2 75  ? 5.851   -6.338  3.684   1.00 0.00 ? 333 PHE A HE1  5  
ATOM   9154  H  HE2  . PHE B 2 75  ? 4.016   -6.567  -0.164  1.00 0.00 ? 333 PHE A HE2  5  
ATOM   9155  H  HZ   . PHE B 2 75  ? 5.294   -7.633  1.665   1.00 0.00 ? 333 PHE A HZ   5  
ATOM   9156  N  N    . CYS B 2 76  ? 5.394   0.761   1.143   1.00 0.00 ? 334 CYS A N    5  
ATOM   9157  C  CA   . CYS B 2 76  ? 5.312   2.152   1.510   1.00 0.00 ? 334 CYS A CA   5  
ATOM   9158  C  C    . CYS B 2 76  ? 3.864   2.468   1.716   1.00 0.00 ? 334 CYS A C    5  
ATOM   9159  O  O    . CYS B 2 76  ? 3.104   2.557   0.758   1.00 0.00 ? 334 CYS A O    5  
ATOM   9160  C  CB   . CYS B 2 76  ? 5.875   3.077   0.438   1.00 0.00 ? 334 CYS A CB   5  
ATOM   9161  S  SG   . CYS B 2 76  ? 5.396   4.815   0.701   1.00 0.00 ? 334 CYS A SG   5  
ATOM   9162  H  H    . CYS B 2 76  ? 5.760   0.505   0.270   1.00 0.00 ? 334 CYS A H    5  
ATOM   9163  H  HA   . CYS B 2 76  ? 5.848   2.295   2.437   1.00 0.00 ? 334 CYS A HA   5  
ATOM   9164  H  HB2  . CYS B 2 76  ? 6.955   3.023   0.444   1.00 0.00 ? 334 CYS A HB2  5  
ATOM   9165  H  HB3  . CYS B 2 76  ? 5.504   2.773   -0.529  1.00 0.00 ? 334 CYS A HB3  5  
ATOM   9166  N  N    . ASP B 2 77  ? 3.462   2.619   2.953   1.00 0.00 ? 335 ASP A N    5  
ATOM   9167  C  CA   . ASP B 2 77  ? 2.067   2.892   3.211   1.00 0.00 ? 335 ASP A CA   5  
ATOM   9168  C  C    . ASP B 2 77  ? 1.746   4.364   2.936   1.00 0.00 ? 335 ASP A C    5  
ATOM   9169  O  O    . ASP B 2 77  ? 0.913   4.970   3.611   1.00 0.00 ? 335 ASP A O    5  
ATOM   9170  C  CB   . ASP B 2 77  ? 1.680   2.517   4.635   1.00 0.00 ? 335 ASP A CB   5  
ATOM   9171  C  CG   . ASP B 2 77  ? 2.115   3.551   5.657   1.00 0.00 ? 335 ASP A CG   5  
ATOM   9172  O  OD1  . ASP B 2 77  ? 3.337   3.746   5.821   1.00 0.00 ? 335 ASP A OD1  5  
ATOM   9173  O  OD2  . ASP B 2 77  ? 1.232   4.166   6.292   1.00 0.00 ? 335 ASP A OD2  5  
ATOM   9174  H  H    . ASP B 2 77  ? 4.112   2.562   3.691   1.00 0.00 ? 335 ASP A H    5  
ATOM   9175  H  HA   . ASP B 2 77  ? 1.501   2.266   2.525   1.00 0.00 ? 335 ASP A HA   5  
ATOM   9176  H  HB2  . ASP B 2 77  ? 0.606   2.419   4.676   1.00 0.00 ? 335 ASP A HB2  5  
ATOM   9177  H  HB3  . ASP B 2 77  ? 2.134   1.570   4.887   1.00 0.00 ? 335 ASP A HB3  5  
ATOM   9178  N  N    . ASP B 2 78  ? 2.414   4.928   1.931   1.00 0.00 ? 336 ASP A N    5  
ATOM   9179  C  CA   . ASP B 2 78  ? 2.217   6.319   1.554   1.00 0.00 ? 336 ASP A CA   5  
ATOM   9180  C  C    . ASP B 2 78  ? 1.945   6.430   0.053   1.00 0.00 ? 336 ASP A C    5  
ATOM   9181  O  O    . ASP B 2 78  ? 1.870   7.529   -0.497  1.00 0.00 ? 336 ASP A O    5  
ATOM   9182  C  CB   . ASP B 2 78  ? 3.451   7.139   1.934   1.00 0.00 ? 336 ASP A CB   5  
ATOM   9183  C  CG   . ASP B 2 78  ? 3.136   8.603   2.163   1.00 0.00 ? 336 ASP A CG   5  
ATOM   9184  O  OD1  . ASP B 2 78  ? 2.570   8.927   3.227   1.00 0.00 ? 336 ASP A OD1  5  
ATOM   9185  O  OD2  . ASP B 2 78  ? 3.462   9.424   1.281   1.00 0.00 ? 336 ASP A OD2  5  
ATOM   9186  H  H    . ASP B 2 78  ? 3.054   4.391   1.428   1.00 0.00 ? 336 ASP A H    5  
ATOM   9187  H  HA   . ASP B 2 78  ? 1.365   6.695   2.093   1.00 0.00 ? 336 ASP A HA   5  
ATOM   9188  H  HB2  . ASP B 2 78  ? 3.876   6.737   2.841   1.00 0.00 ? 336 ASP A HB2  5  
ATOM   9189  H  HB3  . ASP B 2 78  ? 4.178   7.066   1.141   1.00 0.00 ? 336 ASP A HB3  5  
ATOM   9190  N  N    . CYS B 2 79  ? 1.792   5.272   -0.594  1.00 0.00 ? 337 CYS A N    5  
ATOM   9191  C  CA   . CYS B 2 79  ? 1.523   5.191   -2.021  1.00 0.00 ? 337 CYS A CA   5  
ATOM   9192  C  C    . CYS B 2 79  ? 1.411   3.726   -2.437  1.00 0.00 ? 337 CYS A C    5  
ATOM   9193  O  O    . CYS B 2 79  ? 0.879   3.421   -3.498  1.00 0.00 ? 337 CYS A O    5  
ATOM   9194  C  CB   . CYS B 2 79  ? 2.601   5.904   -2.840  1.00 0.00 ? 337 CYS A CB   5  
ATOM   9195  S  SG   . CYS B 2 79  ? 4.217   5.059   -2.868  1.00 0.00 ? 337 CYS A SG   5  
ATOM   9196  H  H    . CYS B 2 79  ? 1.846   4.440   -0.090  1.00 0.00 ? 337 CYS A H    5  
ATOM   9197  H  HA   . CYS B 2 79  ? 0.570   5.672   -2.196  1.00 0.00 ? 337 CYS A HA   5  
ATOM   9198  H  HB2  . CYS B 2 79  ? 2.258   5.997   -3.859  1.00 0.00 ? 337 CYS A HB2  5  
ATOM   9199  H  HB3  . CYS B 2 79  ? 2.752   6.890   -2.434  1.00 0.00 ? 337 CYS A HB3  5  
ATOM   9200  N  N    . ASP B 2 80  ? 1.940   2.841   -1.575  1.00 0.00 ? 338 ASP A N    5  
ATOM   9201  C  CA   . ASP B 2 80  ? 1.894   1.378   -1.766  1.00 0.00 ? 338 ASP A CA   5  
ATOM   9202  C  C    . ASP B 2 80  ? 3.138   0.806   -2.460  1.00 0.00 ? 338 ASP A C    5  
ATOM   9203  O  O    . ASP B 2 80  ? 3.385   -0.397  -2.380  1.00 0.00 ? 338 ASP A O    5  
ATOM   9204  C  CB   . ASP B 2 80  ? 0.633   0.970   -2.523  1.00 0.00 ? 338 ASP A CB   5  
ATOM   9205  C  CG   . ASP B 2 80  ? 0.437   -0.532  -2.587  1.00 0.00 ? 338 ASP A CG   5  
ATOM   9206  O  OD1  . ASP B 2 80  ? 1.117   -1.187  -3.405  1.00 0.00 ? 338 ASP A OD1  5  
ATOM   9207  O  OD2  . ASP B 2 80  ? -0.404  -1.051  -1.823  1.00 0.00 ? 338 ASP A OD2  5  
ATOM   9208  H  H    . ASP B 2 80  ? 2.383   3.188   -0.776  1.00 0.00 ? 338 ASP A H    5  
ATOM   9209  H  HA   . ASP B 2 80  ? 1.844   0.942   -0.779  1.00 0.00 ? 338 ASP A HA   5  
ATOM   9210  H  HB2  . ASP B 2 80  ? -0.226  1.401   -2.032  1.00 0.00 ? 338 ASP A HB2  5  
ATOM   9211  H  HB3  . ASP B 2 80  ? 0.691   1.353   -3.528  1.00 0.00 ? 338 ASP A HB3  5  
ATOM   9212  N  N    . ARG B 2 81  ? 3.915   1.651   -3.137  1.00 0.00 ? 339 ARG A N    5  
ATOM   9213  C  CA   . ARG B 2 81  ? 5.129   1.198   -3.824  1.00 0.00 ? 339 ARG A CA   5  
ATOM   9214  C  C    . ARG B 2 81  ? 5.944   0.234   -2.952  1.00 0.00 ? 339 ARG A C    5  
ATOM   9215  O  O    . ARG B 2 81  ? 6.411   0.606   -1.875  1.00 0.00 ? 339 ARG A O    5  
ATOM   9216  C  CB   . ARG B 2 81  ? 5.974   2.407   -4.214  1.00 0.00 ? 339 ARG A CB   5  
ATOM   9217  C  CG   . ARG B 2 81  ? 5.363   3.210   -5.348  1.00 0.00 ? 339 ARG A CG   5  
ATOM   9218  C  CD   . ARG B 2 81  ? 6.201   3.122   -6.611  1.00 0.00 ? 339 ARG A CD   5  
ATOM   9219  N  NE   . ARG B 2 81  ? 5.531   3.731   -7.758  1.00 0.00 ? 339 ARG A NE   5  
ATOM   9220  C  CZ   . ARG B 2 81  ? 5.681   3.313   -9.011  1.00 0.00 ? 339 ARG A CZ   5  
ATOM   9221  N  NH1  . ARG B 2 81  ? 6.483   2.294   -9.285  1.00 0.00 ? 339 ARG A NH1  5  
ATOM   9222  N  NH2  . ARG B 2 81  ? 5.027   3.917   -9.994  1.00 0.00 ? 339 ARG A NH2  5  
ATOM   9223  H  H    . ARG B 2 81  ? 3.666   2.597   -3.184  1.00 0.00 ? 339 ARG A H    5  
ATOM   9224  H  HA   . ARG B 2 81  ? 4.832   0.682   -4.724  1.00 0.00 ? 339 ARG A HA   5  
ATOM   9225  H  HB2  . ARG B 2 81  ? 6.078   3.054   -3.356  1.00 0.00 ? 339 ARG A HB2  5  
ATOM   9226  H  HB3  . ARG B 2 81  ? 6.949   2.070   -4.524  1.00 0.00 ? 339 ARG A HB3  5  
ATOM   9227  H  HG2  . ARG B 2 81  ? 4.376   2.825   -5.558  1.00 0.00 ? 339 ARG A HG2  5  
ATOM   9228  H  HG3  . ARG B 2 81  ? 5.292   4.245   -5.044  1.00 0.00 ? 339 ARG A HG3  5  
ATOM   9229  H  HD2  . ARG B 2 81  ? 7.143   3.642   -6.442  1.00 0.00 ? 339 ARG A HD2  5  
ATOM   9230  H  HD3  . ARG B 2 81  ? 6.393   2.082   -6.824  1.00 0.00 ? 339 ARG A HD3  5  
ATOM   9231  H  HE   . ARG B 2 81  ? 4.936   4.490   -7.583  1.00 0.00 ? 339 ARG A HE   5  
ATOM   9232  H  HH11 . ARG B 2 81  ? 6.978   1.837   -8.547  1.00 0.00 ? 339 ARG A HH11 5  
ATOM   9233  H  HH12 . ARG B 2 81  ? 6.591   1.982   -10.229 1.00 0.00 ? 339 ARG A HH12 5  
ATOM   9234  H  HH21 . ARG B 2 81  ? 4.421   4.687   -9.794  1.00 0.00 ? 339 ARG A HH21 5  
ATOM   9235  H  HH22 . ARG B 2 81  ? 5.139   3.601   -10.937 1.00 0.00 ? 339 ARG A HH22 5  
ATOM   9236  N  N    . GLY B 2 82  ? 6.106   -1.008  -3.425  1.00 0.00 ? 340 GLY A N    5  
ATOM   9237  C  CA   . GLY B 2 82  ? 6.853   -2.008  -2.667  1.00 0.00 ? 340 GLY A CA   5  
ATOM   9238  C  C    . GLY B 2 82  ? 8.296   -2.156  -3.119  1.00 0.00 ? 340 GLY A C    5  
ATOM   9239  O  O    . GLY B 2 82  ? 8.574   -2.219  -4.309  1.00 0.00 ? 340 GLY A O    5  
ATOM   9240  H  H    . GLY B 2 82  ? 5.718   -1.245  -4.293  1.00 0.00 ? 340 GLY A H    5  
ATOM   9241  H  HA2  . GLY B 2 82  ? 6.841   -1.726  -1.631  1.00 0.00 ? 340 GLY A HA2  5  
ATOM   9242  H  HA3  . GLY B 2 82  ? 6.364   -2.971  -2.764  1.00 0.00 ? 340 GLY A HA3  5  
ATOM   9243  N  N    . TYR B 2 83  ? 9.223   -2.184  -2.164  1.00 0.00 ? 341 TYR A N    5  
ATOM   9244  C  CA   . TYR B 2 83  ? 10.646  -2.359  -2.464  1.00 0.00 ? 341 TYR A CA   5  
ATOM   9245  C  C    . TYR B 2 83  ? 11.222  -3.403  -1.531  1.00 0.00 ? 341 TYR A C    5  
ATOM   9246  O  O    . TYR B 2 83  ? 11.098  -3.264  -0.322  1.00 0.00 ? 341 TYR A O    5  
ATOM   9247  C  CB   . TYR B 2 83  ? 11.517  -1.133  -2.172  1.00 0.00 ? 341 TYR A CB   5  
ATOM   9248  C  CG   . TYR B 2 83  ? 11.154  0.232   -2.725  1.00 0.00 ? 341 TYR A CG   5  
ATOM   9249  C  CD1  . TYR B 2 83  ? 9.910   0.538   -3.213  1.00 0.00 ? 341 TYR A CD1  5  
ATOM   9250  C  CD2  . TYR B 2 83  ? 12.094  1.260   -2.649  1.00 0.00 ? 341 TYR A CD2  5  
ATOM   9251  C  CE1  . TYR B 2 83  ? 9.601   1.817   -3.621  1.00 0.00 ? 341 TYR A CE1  5  
ATOM   9252  C  CE2  . TYR B 2 83  ? 11.795  2.534   -3.070  1.00 0.00 ? 341 TYR A CE2  5  
ATOM   9253  C  CZ   . TYR B 2 83  ? 10.541  2.804   -3.552  1.00 0.00 ? 341 TYR A CZ   5  
ATOM   9254  O  OH   . TYR B 2 83  ? 10.209  4.071   -3.950  1.00 0.00 ? 341 TYR A OH   5  
ATOM   9255  H  H    . TYR B 2 83  ? 8.942   -2.105  -1.233  1.00 0.00 ? 341 TYR A H    5  
ATOM   9256  H  HA   . TYR B 2 83  ? 10.759  -2.671  -3.490  1.00 0.00 ? 341 TYR A HA   5  
ATOM   9257  H  HB2  . TYR B 2 83  ? 11.555  -1.027  -1.103  1.00 0.00 ? 341 TYR A HB2  5  
ATOM   9258  H  HB3  . TYR B 2 83  ? 12.515  -1.351  -2.497  1.00 0.00 ? 341 TYR A HB3  5  
ATOM   9259  H  HD1  . TYR B 2 83  ? 9.179   -0.237  -3.299  1.00 0.00 ? 341 TYR A HD1  5  
ATOM   9260  H  HD2  . TYR B 2 83  ? 13.080  1.039   -2.268  1.00 0.00 ? 341 TYR A HD2  5  
ATOM   9261  H  HE1  . TYR B 2 83  ? 8.620   2.037   -3.994  1.00 0.00 ? 341 TYR A HE1  5  
ATOM   9262  H  HE2  . TYR B 2 83  ? 12.541  3.313   -3.015  1.00 0.00 ? 341 TYR A HE2  5  
ATOM   9263  H  HH   . TYR B 2 83  ? 9.341   4.298   -3.610  1.00 0.00 ? 341 TYR A HH   5  
ATOM   9264  N  N    . HIS B 2 84  ? 11.927  -4.386  -2.045  1.00 0.00 ? 342 HIS A N    5  
ATOM   9265  C  CA   . HIS B 2 84  ? 12.518  -5.361  -1.144  1.00 0.00 ? 342 HIS A CA   5  
ATOM   9266  C  C    . HIS B 2 84  ? 13.522  -4.574  -0.316  1.00 0.00 ? 342 HIS A C    5  
ATOM   9267  O  O    . HIS B 2 84  ? 14.393  -3.977  -0.900  1.00 0.00 ? 342 HIS A O    5  
ATOM   9268  C  CB   . HIS B 2 84  ? 13.241  -6.493  -1.892  1.00 0.00 ? 342 HIS A CB   5  
ATOM   9269  C  CG   . HIS B 2 84  ? 12.374  -7.428  -2.690  1.00 0.00 ? 342 HIS A CG   5  
ATOM   9270  N  ND1  . HIS B 2 84  ? 12.231  -7.354  -4.060  1.00 0.00 ? 342 HIS A ND1  5  
ATOM   9271  C  CD2  . HIS B 2 84  ? 11.601  -8.462  -2.302  1.00 0.00 ? 342 HIS A CD2  5  
ATOM   9272  C  CE1  . HIS B 2 84  ? 11.408  -8.294  -4.483  1.00 0.00 ? 342 HIS A CE1  5  
ATOM   9273  N  NE2  . HIS B 2 84  ? 11.014  -8.987  -3.432  1.00 0.00 ? 342 HIS A NE2  5  
ATOM   9274  H  H    . HIS B 2 84  ? 12.125  -4.401  -2.999  1.00 0.00 ? 342 HIS A H    5  
ATOM   9275  H  HA   . HIS B 2 84  ? 11.746  -5.763  -0.500  1.00 0.00 ? 342 HIS A HA   5  
ATOM   9276  H  HB2  . HIS B 2 84  ? 13.954  -6.061  -2.566  1.00 0.00 ? 342 HIS A HB2  5  
ATOM   9277  H  HB3  . HIS B 2 84  ? 13.767  -7.080  -1.168  1.00 0.00 ? 342 HIS A HB3  5  
ATOM   9278  H  HD2  . HIS B 2 84  ? 11.440  -8.790  -1.288  1.00 0.00 ? 342 HIS A HD2  5  
ATOM   9279  H  HE1  . HIS B 2 84  ? 11.046  -8.409  -5.504  1.00 0.00 ? 342 HIS A HE1  5  
ATOM   9280  H  HE2  . HIS B 2 84  ? 10.363  -9.719  -3.449  1.00 0.00 ? 342 HIS A HE2  5  
ATOM   9281  N  N    . MET B 2 85  ? 13.364  -4.497  1.010   1.00 0.00 ? 343 MET A N    5  
ATOM   9282  C  CA   . MET B 2 85  ? 14.289  -3.708  1.856   1.00 0.00 ? 343 MET A CA   5  
ATOM   9283  C  C    . MET B 2 85  ? 15.696  -3.628  1.293   1.00 0.00 ? 343 MET A C    5  
ATOM   9284  O  O    . MET B 2 85  ? 16.403  -2.646  1.516   1.00 0.00 ? 343 MET A O    5  
ATOM   9285  C  CB   . MET B 2 85  ? 14.413  -4.251  3.282   1.00 0.00 ? 343 MET A CB   5  
ATOM   9286  C  CG   . MET B 2 85  ? 13.128  -4.407  4.036   1.00 0.00 ? 343 MET A CG   5  
ATOM   9287  S  SD   . MET B 2 85  ? 12.526  -6.099  4.167   1.00 0.00 ? 343 MET A SD   5  
ATOM   9288  C  CE   . MET B 2 85  ? 14.021  -6.988  4.580   1.00 0.00 ? 343 MET A CE   5  
ATOM   9289  H  H    . MET B 2 85  ? 12.600  -4.938  1.423   1.00 0.00 ? 343 MET A H    5  
ATOM   9290  H  HA   . MET B 2 85  ? 13.903  -2.699  1.894   1.00 0.00 ? 343 MET A HA   5  
ATOM   9291  H  HB2  . MET B 2 85  ? 14.920  -5.199  3.264   1.00 0.00 ? 343 MET A HB2  5  
ATOM   9292  H  HB3  . MET B 2 85  ? 15.002  -3.542  3.836   1.00 0.00 ? 343 MET A HB3  5  
ATOM   9293  H  HG2  . MET B 2 85  ? 13.277  -4.029  5.034   1.00 0.00 ? 343 MET A HG2  5  
ATOM   9294  H  HG3  . MET B 2 85  ? 12.402  -3.807  3.539   1.00 0.00 ? 343 MET A HG3  5  
ATOM   9295  H  HE1  . MET B 2 85  ? 14.694  -6.958  3.738   1.00 0.00 ? 343 MET A HE1  5  
ATOM   9296  H  HE2  . MET B 2 85  ? 13.780  -8.015  4.812   1.00 0.00 ? 343 MET A HE2  5  
ATOM   9297  H  HE3  . MET B 2 85  ? 14.491  -6.526  5.431   1.00 0.00 ? 343 MET A HE3  5  
ATOM   9298  N  N    . TYR B 2 86  ? 16.108  -4.653  0.587   1.00 0.00 ? 344 TYR A N    5  
ATOM   9299  C  CA   . TYR B 2 86  ? 17.444  -4.655  0.019   1.00 0.00 ? 344 TYR A CA   5  
ATOM   9300  C  C    . TYR B 2 86  ? 17.399  -4.235  -1.443  1.00 0.00 ? 344 TYR A C    5  
ATOM   9301  O  O    . TYR B 2 86  ? 18.247  -4.635  -2.242  1.00 0.00 ? 344 TYR A O    5  
ATOM   9302  C  CB   . TYR B 2 86  ? 18.114  -6.022  0.179   1.00 0.00 ? 344 TYR A CB   5  
ATOM   9303  C  CG   . TYR B 2 86  ? 17.520  -7.112  -0.680  1.00 0.00 ? 344 TYR A CG   5  
ATOM   9304  C  CD1  . TYR B 2 86  ? 16.203  -7.515  -0.515  1.00 0.00 ? 344 TYR A CD1  5  
ATOM   9305  C  CD2  . TYR B 2 86  ? 18.284  -7.747  -1.653  1.00 0.00 ? 344 TYR A CD2  5  
ATOM   9306  C  CE1  . TYR B 2 86  ? 15.666  -8.516  -1.293  1.00 0.00 ? 344 TYR A CE1  5  
ATOM   9307  C  CE2  . TYR B 2 86  ? 17.750  -8.750  -2.437  1.00 0.00 ? 344 TYR A CE2  5  
ATOM   9308  C  CZ   . TYR B 2 86  ? 16.439  -9.131  -2.254  1.00 0.00 ? 344 TYR A CZ   5  
ATOM   9309  O  OH   . TYR B 2 86  ? 15.901  -10.132 -3.031  1.00 0.00 ? 344 TYR A OH   5  
ATOM   9310  H  H    . TYR B 2 86  ? 15.490  -5.402  0.419   1.00 0.00 ? 344 TYR A H    5  
ATOM   9311  H  HA   . TYR B 2 86  ? 18.023  -3.921  0.563   1.00 0.00 ? 344 TYR A HA   5  
ATOM   9312  H  HB2  . TYR B 2 86  ? 19.157  -5.934  -0.080  1.00 0.00 ? 344 TYR A HB2  5  
ATOM   9313  H  HB3  . TYR B 2 86  ? 18.033  -6.332  1.211   1.00 0.00 ? 344 TYR A HB3  5  
ATOM   9314  H  HD1  . TYR B 2 86  ? 15.588  -7.031  0.236   1.00 0.00 ? 344 TYR A HD1  5  
ATOM   9315  H  HD2  . TYR B 2 86  ? 19.312  -7.444  -1.792  1.00 0.00 ? 344 TYR A HD2  5  
ATOM   9316  H  HE1  . TYR B 2 86  ? 14.637  -8.806  -1.144  1.00 0.00 ? 344 TYR A HE1  5  
ATOM   9317  H  HE2  . TYR B 2 86  ? 18.359  -9.230  -3.188  1.00 0.00 ? 344 TYR A HE2  5  
ATOM   9318  H  HH   . TYR B 2 86  ? 16.526  -10.858 -3.096  1.00 0.00 ? 344 TYR A HH   5  
ATOM   9319  N  N    . CYS B 2 87  ? 16.405  -3.415  -1.790  1.00 0.00 ? 345 CYS A N    5  
ATOM   9320  C  CA   . CYS B 2 87  ? 16.267  -2.935  -3.149  1.00 0.00 ? 345 CYS A CA   5  
ATOM   9321  C  C    . CYS B 2 87  ? 16.311  -1.431  -3.151  1.00 0.00 ? 345 CYS A C    5  
ATOM   9322  O  O    . CYS B 2 87  ? 16.696  -0.794  -4.134  1.00 0.00 ? 345 CYS A O    5  
ATOM   9323  C  CB   . CYS B 2 87  ? 14.957  -3.425  -3.783  1.00 0.00 ? 345 CYS A CB   5  
ATOM   9324  S  SG   . CYS B 2 87  ? 15.041  -5.159  -4.282  1.00 0.00 ? 345 CYS A SG   5  
ATOM   9325  H  H    . CYS B 2 87  ? 15.746  -3.115  -1.105  1.00 0.00 ? 345 CYS A H    5  
ATOM   9326  H  HA   . CYS B 2 87  ? 17.095  -3.319  -3.706  1.00 0.00 ? 345 CYS A HA   5  
ATOM   9327  H  HB2  . CYS B 2 87  ? 14.154  -3.319  -3.072  1.00 0.00 ? 345 CYS A HB2  5  
ATOM   9328  H  HB3  . CYS B 2 87  ? 14.731  -2.831  -4.663  1.00 0.00 ? 345 CYS A HB3  5  
ATOM   9329  N  N    . LEU B 2 88  ? 15.918  -0.881  -2.019  1.00 0.00 ? 346 LEU A N    5  
ATOM   9330  C  CA   . LEU B 2 88  ? 15.860  0.557   -1.831  1.00 0.00 ? 346 LEU A CA   5  
ATOM   9331  C  C    . LEU B 2 88  ? 17.178  1.241   -2.183  1.00 0.00 ? 346 LEU A C    5  
ATOM   9332  O  O    . LEU B 2 88  ? 18.161  0.593   -2.545  1.00 0.00 ? 346 LEU A O    5  
ATOM   9333  C  CB   . LEU B 2 88  ? 15.484  0.884   -0.380  1.00 0.00 ? 346 LEU A CB   5  
ATOM   9334  C  CG   . LEU B 2 88  ? 14.991  -0.308  0.437   1.00 0.00 ? 346 LEU A CG   5  
ATOM   9335  C  CD1  . LEU B 2 88  ? 14.664  0.078   1.849   1.00 0.00 ? 346 LEU A CD1  5  
ATOM   9336  C  CD2  . LEU B 2 88  ? 13.774  -0.922  -0.193  1.00 0.00 ? 346 LEU A CD2  5  
ATOM   9337  H  H    . LEU B 2 88  ? 15.642  -1.474  -1.279  1.00 0.00 ? 346 LEU A H    5  
ATOM   9338  H  HA   . LEU B 2 88  ? 15.089  0.923   -2.476  1.00 0.00 ? 346 LEU A HA   5  
ATOM   9339  H  HB2  . LEU B 2 88  ? 16.351  1.295   0.109   1.00 0.00 ? 346 LEU A HB2  5  
ATOM   9340  H  HB3  . LEU B 2 88  ? 14.708  1.633   -0.390  1.00 0.00 ? 346 LEU A HB3  5  
ATOM   9341  H  HG   . LEU B 2 88  ? 15.759  -1.057  0.465   1.00 0.00 ? 346 LEU A HG   5  
ATOM   9342  H  HD11 . LEU B 2 88  ? 13.925  -0.621  2.212   1.00 0.00 ? 346 LEU A HD11 5  
ATOM   9343  H  HD12 . LEU B 2 88  ? 14.265  1.081   1.873   1.00 0.00 ? 346 LEU A HD12 5  
ATOM   9344  H  HD13 . LEU B 2 88  ? 15.551  0.019   2.461   1.00 0.00 ? 346 LEU A HD13 5  
ATOM   9345  H  HD21 . LEU B 2 88  ? 13.741  -0.647  -1.232  1.00 0.00 ? 346 LEU A HD21 5  
ATOM   9346  H  HD22 . LEU B 2 88  ? 12.887  -0.561  0.305   1.00 0.00 ? 346 LEU A HD22 5  
ATOM   9347  H  HD23 . LEU B 2 88  ? 13.824  -1.997  -0.106  1.00 0.00 ? 346 LEU A HD23 5  
ATOM   9348  N  N    . ASN B 2 89  ? 17.180  2.563   -2.072  1.00 0.00 ? 347 ASN A N    5  
ATOM   9349  C  CA   . ASN B 2 89  ? 18.363  3.364   -2.333  1.00 0.00 ? 347 ASN A CA   5  
ATOM   9350  C  C    . ASN B 2 89  ? 19.205  3.375   -1.086  1.00 0.00 ? 347 ASN A C    5  
ATOM   9351  O  O    . ASN B 2 89  ? 20.428  3.239   -1.147  1.00 0.00 ? 347 ASN A O    5  
ATOM   9352  C  CB   . ASN B 2 89  ? 17.966  4.774   -2.728  1.00 0.00 ? 347 ASN A CB   5  
ATOM   9353  C  CG   . ASN B 2 89  ? 18.981  5.448   -3.596  1.00 0.00 ? 347 ASN A CG   5  
ATOM   9354  O  OD1  . ASN B 2 89  ? 19.841  4.808   -4.201  1.00 0.00 ? 347 ASN A OD1  5  
ATOM   9355  N  ND2  . ASN B 2 89  ? 18.869  6.755   -3.670  1.00 0.00 ? 347 ASN A ND2  5  
ATOM   9356  H  H    . ASN B 2 89  ? 16.365  3.013   -1.779  1.00 0.00 ? 347 ASN A H    5  
ATOM   9357  H  HA   . ASN B 2 89  ? 18.922  2.909   -3.121  1.00 0.00 ? 347 ASN A HA   5  
ATOM   9358  H  HB2  . ASN B 2 89  ? 17.046  4.736   -3.265  1.00 0.00 ? 347 ASN A HB2  5  
ATOM   9359  H  HB3  . ASN B 2 89  ? 17.837  5.369   -1.837  1.00 0.00 ? 347 ASN A HB3  5  
ATOM   9360  H  HD21 . ASN B 2 89  ? 18.151  7.191   -3.164  1.00 0.00 ? 347 ASN A HD21 5  
ATOM   9361  H  HD22 . ASN B 2 89  ? 19.491  7.225   -4.229  1.00 0.00 ? 347 ASN A HD22 5  
ATOM   9362  N  N    . PRO B 2 90  ? 18.554  3.571   0.073   1.00 0.00 ? 348 PRO A N    5  
ATOM   9363  C  CA   . PRO B 2 90  ? 19.172  3.519   1.360   1.00 0.00 ? 348 PRO A CA   5  
ATOM   9364  C  C    . PRO B 2 90  ? 18.613  2.335   2.147   1.00 0.00 ? 348 PRO A C    5  
ATOM   9365  O  O    . PRO B 2 90  ? 18.071  2.496   3.240   1.00 0.00 ? 348 PRO A O    5  
ATOM   9366  C  CB   . PRO B 2 90  ? 18.698  4.834   1.903   1.00 0.00 ? 348 PRO A CB   5  
ATOM   9367  C  CG   . PRO B 2 90  ? 17.291  4.947   1.427   1.00 0.00 ? 348 PRO A CG   5  
ATOM   9368  C  CD   . PRO B 2 90  ? 17.162  4.000   0.260   1.00 0.00 ? 348 PRO A CD   5  
ATOM   9369  H  HA   . PRO B 2 90  ? 20.242  3.490   1.308   1.00 0.00 ? 348 PRO A HA   5  
ATOM   9370  H  HB2  . PRO B 2 90  ? 18.754  4.839   2.968   1.00 0.00 ? 348 PRO A HB2  5  
ATOM   9371  H  HB3  . PRO B 2 90  ? 19.313  5.606   1.482   1.00 0.00 ? 348 PRO A HB3  5  
ATOM   9372  H  HG2  . PRO B 2 90  ? 16.608  4.671   2.216   1.00 0.00 ? 348 PRO A HG2  5  
ATOM   9373  H  HG3  . PRO B 2 90  ? 17.112  5.953   1.107   1.00 0.00 ? 348 PRO A HG3  5  
ATOM   9374  H  HD2  . PRO B 2 90  ? 16.524  3.166   0.511   1.00 0.00 ? 348 PRO A HD2  5  
ATOM   9375  H  HD3  . PRO B 2 90  ? 16.796  4.520   -0.603  1.00 0.00 ? 348 PRO A HD3  5  
ATOM   9376  N  N    . PRO B 2 91  ? 18.739  1.128   1.557   1.00 0.00 ? 349 PRO A N    5  
ATOM   9377  C  CA   . PRO B 2 91  ? 18.239  -0.129  2.082   1.00 0.00 ? 349 PRO A CA   5  
ATOM   9378  C  C    . PRO B 2 91  ? 18.092  -0.191  3.594   1.00 0.00 ? 349 PRO A C    5  
ATOM   9379  O  O    . PRO B 2 91  ? 18.863  0.398   4.353   1.00 0.00 ? 349 PRO A O    5  
ATOM   9380  C  CB   . PRO B 2 91  ? 19.276  -1.142  1.594   1.00 0.00 ? 349 PRO A CB   5  
ATOM   9381  C  CG   . PRO B 2 91  ? 20.156  -0.405  0.636   1.00 0.00 ? 349 PRO A CG   5  
ATOM   9382  C  CD   . PRO B 2 91  ? 19.436  0.865   0.311   1.00 0.00 ? 349 PRO A CD   5  
ATOM   9383  H  HA   . PRO B 2 91  ? 17.291  -0.374  1.630   1.00 0.00 ? 349 PRO A HA   5  
ATOM   9384  H  HB2  . PRO B 2 91  ? 19.830  -1.507  2.424   1.00 0.00 ? 349 PRO A HB2  5  
ATOM   9385  H  HB3  . PRO B 2 91  ? 18.767  -1.960  1.110   1.00 0.00 ? 349 PRO A HB3  5  
ATOM   9386  H  HG2  . PRO B 2 91  ? 21.105  -0.185  1.100   1.00 0.00 ? 349 PRO A HG2  5  
ATOM   9387  H  HG3  . PRO B 2 91  ? 20.299  -0.997  -0.246  1.00 0.00 ? 349 PRO A HG3  5  
ATOM   9388  H  HD2  . PRO B 2 91  ? 20.123  1.665   0.080   1.00 0.00 ? 349 PRO A HD2  5  
ATOM   9389  H  HD3  . PRO B 2 91  ? 18.739  0.711   -0.495  1.00 0.00 ? 349 PRO A HD3  5  
ATOM   9390  N  N    . VAL B 2 92  ? 17.088  -0.947  3.995   1.00 0.00 ? 350 VAL A N    5  
ATOM   9391  C  CA   . VAL B 2 92  ? 16.750  -1.160  5.389   1.00 0.00 ? 350 VAL A CA   5  
ATOM   9392  C  C    . VAL B 2 92  ? 16.922  -2.635  5.705   1.00 0.00 ? 350 VAL A C    5  
ATOM   9393  O  O    . VAL B 2 92  ? 17.394  -3.404  4.867   1.00 0.00 ? 350 VAL A O    5  
ATOM   9394  C  CB   . VAL B 2 92  ? 15.295  -0.717  5.637   1.00 0.00 ? 350 VAL A CB   5  
ATOM   9395  C  CG1  . VAL B 2 92  ? 14.366  -1.598  4.854   1.00 0.00 ? 350 VAL A CG1  5  
ATOM   9396  C  CG2  . VAL B 2 92  ? 14.910  -0.725  7.101   1.00 0.00 ? 350 VAL A CG2  5  
ATOM   9397  H  H    . VAL B 2 92  ? 16.552  -1.402  3.313   1.00 0.00 ? 350 VAL A H    5  
ATOM   9398  H  HA   . VAL B 2 92  ? 17.408  -0.582  6.016   1.00 0.00 ? 350 VAL A HA   5  
ATOM   9399  H  HB   . VAL B 2 92  ? 15.190  0.284   5.273   1.00 0.00 ? 350 VAL A HB   5  
ATOM   9400  H  HG11 . VAL B 2 92  ? 13.358  -1.251  4.942   1.00 0.00 ? 350 VAL A HG11 5  
ATOM   9401  H  HG12 . VAL B 2 92  ? 14.430  -2.605  5.238   1.00 0.00 ? 350 VAL A HG12 5  
ATOM   9402  H  HG13 . VAL B 2 92  ? 14.659  -1.593  3.815   1.00 0.00 ? 350 VAL A HG13 5  
ATOM   9403  H  HG21 . VAL B 2 92  ? 14.103  -1.433  7.242   1.00 0.00 ? 350 VAL A HG21 5  
ATOM   9404  H  HG22 . VAL B 2 92  ? 14.581  0.262   7.392   1.00 0.00 ? 350 VAL A HG22 5  
ATOM   9405  H  HG23 . VAL B 2 92  ? 15.759  -1.015  7.701   1.00 0.00 ? 350 VAL A HG23 5  
ATOM   9406  N  N    . ALA B 2 93  ? 16.549  -3.025  6.899   1.00 0.00 ? 351 ALA A N    5  
ATOM   9407  C  CA   . ALA B 2 93  ? 16.692  -4.416  7.311   1.00 0.00 ? 351 ALA A CA   5  
ATOM   9408  C  C    . ALA B 2 93  ? 15.361  -5.118  7.570   1.00 0.00 ? 351 ALA A C    5  
ATOM   9409  O  O    . ALA B 2 93  ? 15.227  -6.309  7.295   1.00 0.00 ? 351 ALA A O    5  
ATOM   9410  C  CB   . ALA B 2 93  ? 17.575  -4.511  8.544   1.00 0.00 ? 351 ALA A CB   5  
ATOM   9411  H  H    . ALA B 2 93  ? 16.185  -2.360  7.512   1.00 0.00 ? 351 ALA A H    5  
ATOM   9412  H  HA   . ALA B 2 93  ? 17.192  -4.931  6.512   1.00 0.00 ? 351 ALA A HA   5  
ATOM   9413  H  HB1  . ALA B 2 93  ? 16.965  -4.427  9.432   1.00 0.00 ? 351 ALA A HB1  5  
ATOM   9414  H  HB2  . ALA B 2 93  ? 18.301  -3.711  8.530   1.00 0.00 ? 351 ALA A HB2  5  
ATOM   9415  H  HB3  . ALA B 2 93  ? 18.088  -5.461  8.548   1.00 0.00 ? 351 ALA A HB3  5  
ATOM   9416  N  N    . GLU B 2 94  ? 14.388  -4.397  8.121   1.00 0.00 ? 352 GLU A N    5  
ATOM   9417  C  CA   . GLU B 2 94  ? 13.080  -4.993  8.446   1.00 0.00 ? 352 GLU A CA   5  
ATOM   9418  C  C    . GLU B 2 94  ? 12.050  -3.933  8.828   1.00 0.00 ? 352 GLU A C    5  
ATOM   9419  O  O    . GLU B 2 94  ? 10.928  -3.917  8.322   1.00 0.00 ? 352 GLU A O    5  
ATOM   9420  C  CB   . GLU B 2 94  ? 13.184  -5.998  9.614   1.00 0.00 ? 352 GLU A CB   5  
ATOM   9421  C  CG   . GLU B 2 94  ? 14.552  -6.155  10.239  1.00 0.00 ? 352 GLU A CG   5  
ATOM   9422  C  CD   . GLU B 2 94  ? 14.563  -5.846  11.725  1.00 0.00 ? 352 GLU A CD   5  
ATOM   9423  O  OE1  . GLU B 2 94  ? 13.777  -6.471  12.467  1.00 0.00 ? 352 GLU A OE1  5  
ATOM   9424  O  OE2  . GLU B 2 94  ? 15.356  -4.978  12.145  1.00 0.00 ? 352 GLU A OE2  5  
ATOM   9425  H  H    . GLU B 2 94  ? 14.540  -3.441  8.302   1.00 0.00 ? 352 GLU A H    5  
ATOM   9426  H  HA   . GLU B 2 94  ? 12.736  -5.500  7.571   1.00 0.00 ? 352 GLU A HA   5  
ATOM   9427  H  HB2  . GLU B 2 94  ? 12.522  -5.674  10.398  1.00 0.00 ? 352 GLU A HB2  5  
ATOM   9428  H  HB3  . GLU B 2 94  ? 12.872  -6.955  9.265   1.00 0.00 ? 352 GLU A HB3  5  
ATOM   9429  H  HG2  . GLU B 2 94  ? 14.867  -7.165  10.104  1.00 0.00 ? 352 GLU A HG2  5  
ATOM   9430  H  HG3  . GLU B 2 94  ? 15.232  -5.497  9.744   1.00 0.00 ? 352 GLU A HG3  5  
ATOM   9431  N  N    . PRO B 2 95  ? 12.445  -3.069  9.770   1.00 0.00 ? 353 PRO A N    5  
ATOM   9432  C  CA   . PRO B 2 95  ? 11.708  -1.948  10.317  1.00 0.00 ? 353 PRO A CA   5  
ATOM   9433  C  C    . PRO B 2 95  ? 10.422  -1.510  9.608   1.00 0.00 ? 353 PRO A C    5  
ATOM   9434  O  O    . PRO B 2 95  ? 9.404   -1.348  10.280  1.00 0.00 ? 353 PRO A O    5  
ATOM   9435  C  CB   . PRO B 2 95  ? 12.793  -0.874  10.221  1.00 0.00 ? 353 PRO A CB   5  
ATOM   9436  C  CG   . PRO B 2 95  ? 14.094  -1.638  10.326  1.00 0.00 ? 353 PRO A CG   5  
ATOM   9437  C  CD   . PRO B 2 95  ? 13.729  -3.077  10.438  1.00 0.00 ? 353 PRO A CD   5  
ATOM   9438  H  HA   . PRO B 2 95  ? 11.486  -2.108  11.360  1.00 0.00 ? 353 PRO A HA   5  
ATOM   9439  H  HB2  . PRO B 2 95  ? 12.709  -0.375  9.262   1.00 0.00 ? 353 PRO A HB2  5  
ATOM   9440  H  HB3  . PRO B 2 95  ? 12.683  -0.162  11.025  1.00 0.00 ? 353 PRO A HB3  5  
ATOM   9441  H  HG2  . PRO B 2 95  ? 14.670  -1.496  9.426   1.00 0.00 ? 353 PRO A HG2  5  
ATOM   9442  H  HG3  . PRO B 2 95  ? 14.652  -1.326  11.187  1.00 0.00 ? 353 PRO A HG3  5  
ATOM   9443  H  HD2  . PRO B 2 95  ? 14.440  -3.685  9.921   1.00 0.00 ? 353 PRO A HD2  5  
ATOM   9444  H  HD3  . PRO B 2 95  ? 13.629  -3.401  11.462  1.00 0.00 ? 353 PRO A HD3  5  
ATOM   9445  N  N    . PRO B 2 96  ? 10.405  -1.273  8.275   1.00 0.00 ? 354 PRO A N    5  
ATOM   9446  C  CA   . PRO B 2 96  ? 9.206   -0.813  7.610   1.00 0.00 ? 354 PRO A CA   5  
ATOM   9447  C  C    . PRO B 2 96  ? 8.143   -1.888  7.418   1.00 0.00 ? 354 PRO A C    5  
ATOM   9448  O  O    . PRO B 2 96  ? 7.576   -2.029  6.334   1.00 0.00 ? 354 PRO A O    5  
ATOM   9449  C  CB   . PRO B 2 96  ? 9.711   -0.295  6.270   1.00 0.00 ? 354 PRO A CB   5  
ATOM   9450  C  CG   . PRO B 2 96  ? 11.174  -0.294  6.368   1.00 0.00 ? 354 PRO A CG   5  
ATOM   9451  C  CD   . PRO B 2 96  ? 11.501  -1.373  7.315   1.00 0.00 ? 354 PRO A CD   5  
ATOM   9452  H  HA   . PRO B 2 96  ? 8.789   0.008   8.152   1.00 0.00 ? 354 PRO A HA   5  
ATOM   9453  H  HB2  . PRO B 2 96  ? 9.363   -0.916  5.468   1.00 0.00 ? 354 PRO A HB2  5  
ATOM   9454  H  HB3  . PRO B 2 96  ? 9.359   0.695   6.141   1.00 0.00 ? 354 PRO A HB3  5  
ATOM   9455  H  HG2  . PRO B 2 96  ? 11.615  -0.481  5.408   1.00 0.00 ? 354 PRO A HG2  5  
ATOM   9456  H  HG3  . PRO B 2 96  ? 11.500  0.654   6.761   1.00 0.00 ? 354 PRO A HG3  5  
ATOM   9457  H  HD2  . PRO B 2 96  ? 11.519  -2.334  6.823   1.00 0.00 ? 354 PRO A HD2  5  
ATOM   9458  H  HD3  . PRO B 2 96  ? 12.413  -1.156  7.758   1.00 0.00 ? 354 PRO A HD3  5  
ATOM   9459  N  N    . GLU B 2 97  ? 7.875   -2.644  8.476   1.00 0.00 ? 355 GLU A N    5  
ATOM   9460  C  CA   . GLU B 2 97  ? 6.857   -3.685  8.430   1.00 0.00 ? 355 GLU A CA   5  
ATOM   9461  C  C    . GLU B 2 97  ? 5.484   -3.084  8.708   1.00 0.00 ? 355 GLU A C    5  
ATOM   9462  O  O    . GLU B 2 97  ? 4.469   -3.779  8.679   1.00 0.00 ? 355 GLU A O    5  
ATOM   9463  C  CB   . GLU B 2 97  ? 7.161   -4.784  9.449   1.00 0.00 ? 355 GLU A CB   5  
ATOM   9464  C  CG   . GLU B 2 97  ? 8.481   -5.494  9.205   1.00 0.00 ? 355 GLU A CG   5  
ATOM   9465  C  CD   . GLU B 2 97  ? 8.574   -6.817  9.939   1.00 0.00 ? 355 GLU A CD   5  
ATOM   9466  O  OE1  . GLU B 2 97  ? 9.027   -6.819  11.104  1.00 0.00 ? 355 GLU A OE1  5  
ATOM   9467  O  OE2  . GLU B 2 97  ? 8.194   -7.851  9.349   1.00 0.00 ? 355 GLU A OE2  5  
ATOM   9468  H  H    . GLU B 2 97  ? 8.377   -2.502  9.302   1.00 0.00 ? 355 GLU A H    5  
ATOM   9469  H  HA   . GLU B 2 97  ? 6.859   -4.111  7.437   1.00 0.00 ? 355 GLU A HA   5  
ATOM   9470  H  HB2  . GLU B 2 97  ? 7.193   -4.343  10.433  1.00 0.00 ? 355 GLU A HB2  5  
ATOM   9471  H  HB3  . GLU B 2 97  ? 6.370   -5.518  9.417   1.00 0.00 ? 355 GLU A HB3  5  
ATOM   9472  H  HG2  . GLU B 2 97  ? 8.587   -5.679  8.146   1.00 0.00 ? 355 GLU A HG2  5  
ATOM   9473  H  HG3  . GLU B 2 97  ? 9.284   -4.856  9.541   1.00 0.00 ? 355 GLU A HG3  5  
ATOM   9474  N  N    . GLY B 2 98  ? 5.470   -1.780  8.978   1.00 0.00 ? 356 GLY A N    5  
ATOM   9475  C  CA   . GLY B 2 98  ? 4.229   -1.086  9.257   1.00 0.00 ? 356 GLY A CA   5  
ATOM   9476  C  C    . GLY B 2 98  ? 4.392   0.410   9.266   1.00 0.00 ? 356 GLY A C    5  
ATOM   9477  O  O    . GLY B 2 98  ? 4.050   1.083   10.239  1.00 0.00 ? 356 GLY A O    5  
ATOM   9478  H  H    . GLY B 2 98  ? 6.311   -1.284  8.976   1.00 0.00 ? 356 GLY A H    5  
ATOM   9479  H  HA2  . GLY B 2 98  ? 3.526   -1.330  8.486   1.00 0.00 ? 356 GLY A HA2  5  
ATOM   9480  H  HA3  . GLY B 2 98  ? 3.842   -1.409  10.212  1.00 0.00 ? 356 GLY A HA3  5  
ATOM   9481  N  N    . SER B 2 99  ? 4.902   0.915   8.154   1.00 0.00 ? 357 SER A N    5  
ATOM   9482  C  CA   . SER B 2 99  ? 5.127   2.340   7.962   1.00 0.00 ? 357 SER A CA   5  
ATOM   9483  C  C    . SER B 2 99  ? 5.877   2.563   6.650   1.00 0.00 ? 357 SER A C    5  
ATOM   9484  O  O    . SER B 2 99  ? 5.417   2.134   5.591   1.00 0.00 ? 357 SER A O    5  
ATOM   9485  C  CB   . SER B 2 99  ? 5.919   2.936   9.132   1.00 0.00 ? 357 SER A CB   5  
ATOM   9486  O  OG   . SER B 2 99  ? 5.923   4.352   9.073   1.00 0.00 ? 357 SER A OG   5  
ATOM   9487  H  H    . SER B 2 99  ? 5.132   0.300   7.427   1.00 0.00 ? 357 SER A H    5  
ATOM   9488  H  HA   . SER B 2 99  ? 4.159   2.811   7.904   1.00 0.00 ? 357 SER A HA   5  
ATOM   9489  H  HB2  . SER B 2 99  ? 5.474   2.629   10.064  1.00 0.00 ? 357 SER A HB2  5  
ATOM   9490  H  HB3  . SER B 2 99  ? 6.939   2.585   9.085   1.00 0.00 ? 357 SER A HB3  5  
ATOM   9491  H  HG   . SER B 2 99  ? 5.835   4.710   9.960   1.00 0.00 ? 357 SER A HG   5  
ATOM   9492  N  N    . TRP B 2 100 ? 7.025   3.241   6.723   1.00 0.00 ? 358 TRP A N    5  
ATOM   9493  C  CA   . TRP B 2 100 ? 7.854   3.482   5.552   1.00 0.00 ? 358 TRP A CA   5  
ATOM   9494  C  C    . TRP B 2 100 ? 7.189   4.446   4.593   1.00 0.00 ? 358 TRP A C    5  
ATOM   9495  O  O    . TRP B 2 100 ? 5.968   4.608   4.596   1.00 0.00 ? 358 TRP A O    5  
ATOM   9496  C  CB   . TRP B 2 100 ? 8.139   2.160   4.860   1.00 0.00 ? 358 TRP A CB   5  
ATOM   9497  C  CG   . TRP B 2 100 ? 9.430   2.116   4.118   1.00 0.00 ? 358 TRP A CG   5  
ATOM   9498  C  CD1  . TRP B 2 100 ? 10.672  2.460   4.562   1.00 0.00 ? 358 TRP A CD1  5  
ATOM   9499  C  CD2  . TRP B 2 100 ? 9.592   1.657   2.795   1.00 0.00 ? 358 TRP A CD2  5  
ATOM   9500  N  NE1  . TRP B 2 100 ? 11.595  2.257   3.561   1.00 0.00 ? 358 TRP A NE1  5  
ATOM   9501  C  CE2  . TRP B 2 100 ? 10.950  1.768   2.473   1.00 0.00 ? 358 TRP A CE2  5  
ATOM   9502  C  CE3  . TRP B 2 100 ? 8.711   1.168   1.847   1.00 0.00 ? 358 TRP A CE3  5  
ATOM   9503  C  CZ2  . TRP B 2 100 ? 11.441  1.407   1.242   1.00 0.00 ? 358 TRP A CZ2  5  
ATOM   9504  C  CZ3  . TRP B 2 100 ? 9.204   0.805   0.623   1.00 0.00 ? 358 TRP A CZ3  5  
ATOM   9505  C  CH2  . TRP B 2 100 ? 10.557  0.927   0.337   1.00 0.00 ? 358 TRP A CH2  5  
ATOM   9506  H  H    . TRP B 2 100 ? 7.315   3.598   7.578   1.00 0.00 ? 358 TRP A H    5  
ATOM   9507  H  HA   . TRP B 2 100 ? 8.787   3.911   5.885   1.00 0.00 ? 358 TRP A HA   5  
ATOM   9508  H  HB2  . TRP B 2 100 ? 8.157   1.385   5.598   1.00 0.00 ? 358 TRP A HB2  5  
ATOM   9509  H  HB3  . TRP B 2 100 ? 7.353   1.948   4.154   1.00 0.00 ? 358 TRP A HB3  5  
ATOM   9510  H  HD1  . TRP B 2 100 ? 10.880  2.830   5.546   1.00 0.00 ? 358 TRP A HD1  5  
ATOM   9511  H  HE1  . TRP B 2 100 ? 12.558  2.429   3.616   1.00 0.00 ? 358 TRP A HE1  5  
ATOM   9512  H  HE3  . TRP B 2 100 ? 7.668   1.054   2.070   1.00 0.00 ? 358 TRP A HE3  5  
ATOM   9513  H  HZ2  . TRP B 2 100 ? 12.485  1.471   1.002   1.00 0.00 ? 358 TRP A HZ2  5  
ATOM   9514  H  HZ3  . TRP B 2 100 ? 8.548   0.398   -0.123  1.00 0.00 ? 358 TRP A HZ3  5  
ATOM   9515  H  HH2  . TRP B 2 100 ? 10.896  0.637   -0.624  1.00 0.00 ? 358 TRP A HH2  5  
ATOM   9516  N  N    . SER B 2 101 ? 8.003   5.086   3.770   1.00 0.00 ? 359 SER A N    5  
ATOM   9517  C  CA   . SER B 2 101 ? 7.478   6.048   2.806   1.00 0.00 ? 359 SER A CA   5  
ATOM   9518  C  C    . SER B 2 101 ? 8.171   5.984   1.443   1.00 0.00 ? 359 SER A C    5  
ATOM   9519  O  O    . SER B 2 101 ? 8.040   6.906   0.647   1.00 0.00 ? 359 SER A O    5  
ATOM   9520  C  CB   . SER B 2 101 ? 7.578   7.462   3.368   1.00 0.00 ? 359 SER A CB   5  
ATOM   9521  O  OG   . SER B 2 101 ? 6.687   7.648   4.454   1.00 0.00 ? 359 SER A OG   5  
ATOM   9522  H  H    . SER B 2 101 ? 8.970   4.914   3.827   1.00 0.00 ? 359 SER A H    5  
ATOM   9523  H  HA   . SER B 2 101 ? 6.439   5.817   2.667   1.00 0.00 ? 359 SER A HA   5  
ATOM   9524  H  HB2  . SER B 2 101 ? 8.581   7.631   3.712   1.00 0.00 ? 359 SER A HB2  5  
ATOM   9525  H  HB3  . SER B 2 101 ? 7.338   8.176   2.593   1.00 0.00 ? 359 SER A HB3  5  
ATOM   9526  H  HG   . SER B 2 101 ? 6.129   6.872   4.547   1.00 0.00 ? 359 SER A HG   5  
ATOM   9527  N  N    . CYS B 2 102 ? 8.887   4.897   1.165   1.00 0.00 ? 360 CYS A N    5  
ATOM   9528  C  CA   . CYS B 2 102 ? 9.590   4.737   -0.121  1.00 0.00 ? 360 CYS A CA   5  
ATOM   9529  C  C    . CYS B 2 102 ? 10.369  6.000   -0.498  1.00 0.00 ? 360 CYS A C    5  
ATOM   9530  O  O    . CYS B 2 102 ? 10.406  6.966   0.261   1.00 0.00 ? 360 CYS A O    5  
ATOM   9531  C  CB   . CYS B 2 102 ? 8.600   4.410   -1.240  1.00 0.00 ? 360 CYS A CB   5  
ATOM   9532  S  SG   . CYS B 2 102 ? 7.812   5.870   -1.997  1.00 0.00 ? 360 CYS A SG   5  
ATOM   9533  H  H    . CYS B 2 102 ? 8.944   4.182   1.833   1.00 0.00 ? 360 CYS A H    5  
ATOM   9534  H  HA   . CYS B 2 102 ? 10.283  3.913   -0.020  1.00 0.00 ? 360 CYS A HA   5  
ATOM   9535  H  HB2  . CYS B 2 102 ? 9.118   3.883   -2.020  1.00 0.00 ? 360 CYS A HB2  5  
ATOM   9536  H  HB3  . CYS B 2 102 ? 7.821   3.778   -0.850  1.00 0.00 ? 360 CYS A HB3  5  
ATOM   9537  N  N    . HIS B 2 103 ? 11.029  5.980   -1.656  1.00 0.00 ? 361 HIS A N    5  
ATOM   9538  C  CA   . HIS B 2 103 ? 11.776  7.134   -2.111  1.00 0.00 ? 361 HIS A CA   5  
ATOM   9539  C  C    . HIS B 2 103 ? 10.863  8.181   -2.733  1.00 0.00 ? 361 HIS A C    5  
ATOM   9540  O  O    . HIS B 2 103 ? 11.091  9.373   -2.576  1.00 0.00 ? 361 HIS A O    5  
ATOM   9541  C  CB   . HIS B 2 103 ? 12.893  6.754   -3.086  1.00 0.00 ? 361 HIS A CB   5  
ATOM   9542  C  CG   . HIS B 2 103 ? 12.478  5.941   -4.277  1.00 0.00 ? 361 HIS A CG   5  
ATOM   9543  N  ND1  . HIS B 2 103 ? 13.161  4.815   -4.691  1.00 0.00 ? 361 HIS A ND1  5  
ATOM   9544  C  CD2  . HIS B 2 103 ? 11.477  6.113   -5.169  1.00 0.00 ? 361 HIS A CD2  5  
ATOM   9545  C  CE1  . HIS B 2 103 ? 12.596  4.337   -5.785  1.00 0.00 ? 361 HIS A CE1  5  
ATOM   9546  N  NE2  . HIS B 2 103 ? 11.574  5.106   -6.095  1.00 0.00 ? 361 HIS A NE2  5  
ATOM   9547  H  H    . HIS B 2 103 ? 10.981  5.198   -2.227  1.00 0.00 ? 361 HIS A H    5  
ATOM   9548  H  HA   . HIS B 2 103 ? 12.232  7.574   -1.236  1.00 0.00 ? 361 HIS A HA   5  
ATOM   9549  H  HB2  . HIS B 2 103 ? 13.325  7.660   -3.459  1.00 0.00 ? 361 HIS A HB2  5  
ATOM   9550  H  HB3  . HIS B 2 103 ? 13.649  6.197   -2.554  1.00 0.00 ? 361 HIS A HB3  5  
ATOM   9551  H  HD1  . HIS B 2 103 ? 13.944  4.426   -4.247  1.00 0.00 ? 361 HIS A HD1  5  
ATOM   9552  H  HD2  . HIS B 2 103 ? 10.717  6.876   -5.138  1.00 0.00 ? 361 HIS A HD2  5  
ATOM   9553  H  HE1  . HIS B 2 103 ? 12.908  3.458   -6.326  1.00 0.00 ? 361 HIS A HE1  5  
ATOM   9554  H  HE2  . HIS B 2 103 ? 10.941  4.939   -6.824  1.00 0.00 ? 361 HIS A HE2  5  
ATOM   9555  N  N    . LEU B 2 104 ? 9.816   7.729   -3.427  1.00 0.00 ? 362 LEU A N    5  
ATOM   9556  C  CA   . LEU B 2 104 ? 8.899   8.644   -4.101  1.00 0.00 ? 362 LEU A CA   5  
ATOM   9557  C  C    . LEU B 2 104 ? 8.335   9.671   -3.145  1.00 0.00 ? 362 LEU A C    5  
ATOM   9558  O  O    . LEU B 2 104 ? 8.407   10.880  -3.374  1.00 0.00 ? 362 LEU A O    5  
ATOM   9559  C  CB   . LEU B 2 104 ? 7.716   7.889   -4.706  1.00 0.00 ? 362 LEU A CB   5  
ATOM   9560  C  CG   . LEU B 2 104 ? 8.049   6.784   -5.684  1.00 0.00 ? 362 LEU A CG   5  
ATOM   9561  C  CD1  . LEU B 2 104 ? 6.774   6.145   -6.172  1.00 0.00 ? 362 LEU A CD1  5  
ATOM   9562  C  CD2  . LEU B 2 104 ? 8.864   7.307   -6.846  1.00 0.00 ? 362 LEU A CD2  5  
ATOM   9563  H  H    . LEU B 2 104 ? 9.661   6.764   -3.485  1.00 0.00 ? 362 LEU A H    5  
ATOM   9564  H  HA   . LEU B 2 104 ? 9.436   9.134   -4.886  1.00 0.00 ? 362 LEU A HA   5  
ATOM   9565  H  HB2  . LEU B 2 104 ? 7.143   7.455   -3.901  1.00 0.00 ? 362 LEU A HB2  5  
ATOM   9566  H  HB3  . LEU B 2 104 ? 7.092   8.604   -5.216  1.00 0.00 ? 362 LEU A HB3  5  
ATOM   9567  H  HG   . LEU B 2 104 ? 8.627   6.030   -5.178  1.00 0.00 ? 362 LEU A HG   5  
ATOM   9568  H  HD11 . LEU B 2 104 ? 6.375   5.522   -5.385  1.00 0.00 ? 362 LEU A HD11 5  
ATOM   9569  H  HD12 . LEU B 2 104 ? 6.981   5.543   -7.044  1.00 0.00 ? 362 LEU A HD12 5  
ATOM   9570  H  HD13 . LEU B 2 104 ? 6.057   6.914   -6.423  1.00 0.00 ? 362 LEU A HD13 5  
ATOM   9571  H  HD21 . LEU B 2 104 ? 9.907   7.194   -6.612  1.00 0.00 ? 362 LEU A HD21 5  
ATOM   9572  H  HD22 . LEU B 2 104 ? 8.638   8.352   -7.005  1.00 0.00 ? 362 LEU A HD22 5  
ATOM   9573  H  HD23 . LEU B 2 104 ? 8.630   6.745   -7.738  1.00 0.00 ? 362 LEU A HD23 5  
ATOM   9574  N  N    . CYS B 2 105 ? 7.816   9.165   -2.050  1.00 0.00 ? 363 CYS A N    5  
ATOM   9575  C  CA   . CYS B 2 105 ? 7.176   10.007  -1.047  1.00 0.00 ? 363 CYS A CA   5  
ATOM   9576  C  C    . CYS B 2 105 ? 8.175   10.782  -0.253  1.00 0.00 ? 363 CYS A C    5  
ATOM   9577  O  O    . CYS B 2 105 ? 7.906   11.898  0.168   1.00 0.00 ? 363 CYS A O    5  
ATOM   9578  C  CB   . CYS B 2 105 ? 6.324   9.178   -0.092  1.00 0.00 ? 363 CYS A CB   5  
ATOM   9579  S  SG   . CYS B 2 105 ? 5.003   8.218   -0.923  1.00 0.00 ? 363 CYS A SG   5  
ATOM   9580  H  H    . CYS B 2 105 ? 7.893   8.197   -1.902  1.00 0.00 ? 363 CYS A H    5  
ATOM   9581  H  HA   . CYS B 2 105 ? 6.553   10.707  -1.558  1.00 0.00 ? 363 CYS A HA   5  
ATOM   9582  H  HB2  . CYS B 2 105 ? 6.969   8.505   0.460   1.00 0.00 ? 363 CYS A HB2  5  
ATOM   9583  H  HB3  . CYS B 2 105 ? 5.846   9.847   0.609   1.00 0.00 ? 363 CYS A HB3  5  
ATOM   9584  N  N    . TRP B 2 106 ? 9.305   10.176  -0.020  1.00 0.00 ? 364 TRP A N    5  
ATOM   9585  C  CA   . TRP B 2 106 ? 10.329  10.802  0.759   1.00 0.00 ? 364 TRP A CA   5  
ATOM   9586  C  C    . TRP B 2 106 ? 10.970  11.942  0.065   1.00 0.00 ? 364 TRP A C    5  
ATOM   9587  O  O    . TRP B 2 106 ? 11.079  13.015  0.617   1.00 0.00 ? 364 TRP A O    5  
ATOM   9588  C  CB   . TRP B 2 106 ? 11.364  9.805   1.165   1.00 0.00 ? 364 TRP A CB   5  
ATOM   9589  C  CG   . TRP B 2 106 ? 11.349  9.695   2.616   1.00 0.00 ? 364 TRP A CG   5  
ATOM   9590  C  CD1  . TRP B 2 106 ? 10.244  9.545   3.358   1.00 0.00 ? 364 TRP A CD1  5  
ATOM   9591  C  CD2  . TRP B 2 106 ? 12.442  9.800   3.499   1.00 0.00 ? 364 TRP A CD2  5  
ATOM   9592  N  NE1  . TRP B 2 106 ? 10.559  9.516   4.670   1.00 0.00 ? 364 TRP A NE1  5  
ATOM   9593  C  CE2  . TRP B 2 106 ? 11.928  9.670   4.798   1.00 0.00 ? 364 TRP A CE2  5  
ATOM   9594  C  CE3  . TRP B 2 106 ? 13.804  9.977   3.309   1.00 0.00 ? 364 TRP A CE3  5  
ATOM   9595  C  CZ2  . TRP B 2 106 ? 12.750  9.719   5.922   1.00 0.00 ? 364 TRP A CZ2  5  
ATOM   9596  C  CZ3  . TRP B 2 106 ? 14.623  10.030  4.416   1.00 0.00 ? 364 TRP A CZ3  5  
ATOM   9597  C  CH2  . TRP B 2 106 ? 14.097  9.899   5.707   1.00 0.00 ? 364 TRP A CH2  5  
ATOM   9598  H  H    . TRP B 2 106 ? 9.460   9.292   -0.396  1.00 0.00 ? 364 TRP A H    5  
ATOM   9599  H  HA   . TRP B 2 106 ? 9.858   11.182  1.652   1.00 0.00 ? 364 TRP A HA   5  
ATOM   9600  H  HB2  . TRP B 2 106 ? 11.121  8.852   0.738   1.00 0.00 ? 364 TRP A HB2  5  
ATOM   9601  H  HB3  . TRP B 2 106 ? 12.343  10.126  0.848   1.00 0.00 ? 364 TRP A HB3  5  
ATOM   9602  H  HD1  . TRP B 2 106 ? 9.257   9.467   2.941   1.00 0.00 ? 364 TRP A HD1  5  
ATOM   9603  H  HE1  . TRP B 2 106 ? 9.913   9.406   5.381   1.00 0.00 ? 364 TRP A HE1  5  
ATOM   9604  H  HE3  . TRP B 2 106 ? 14.215  10.087  2.307   1.00 0.00 ? 364 TRP A HE3  5  
ATOM   9605  H  HZ2  . TRP B 2 106 ? 12.359  9.619   6.924   1.00 0.00 ? 364 TRP A HZ2  5  
ATOM   9606  H  HZ3  . TRP B 2 106 ? 15.687  10.171  4.293   1.00 0.00 ? 364 TRP A HZ3  5  
ATOM   9607  H  HH2  . TRP B 2 106 ? 14.775  9.955   6.541   1.00 0.00 ? 364 TRP A HH2  5  
ATOM   9608  N  N    . GLU B 2 107 ? 11.424  11.717  -1.125  1.00 0.00 ? 365 GLU A N    5  
ATOM   9609  C  CA   . GLU B 2 107 ? 12.050  12.783  -1.840  1.00 0.00 ? 365 GLU A CA   5  
ATOM   9610  C  C    . GLU B 2 107 ? 11.020  13.876  -2.035  1.00 0.00 ? 365 GLU A C    5  
ATOM   9611  O  O    . GLU B 2 107 ? 11.349  15.059  -2.150  1.00 0.00 ? 365 GLU A O    5  
ATOM   9612  C  CB   . GLU B 2 107 ? 12.633  12.276  -3.143  1.00 0.00 ? 365 GLU A CB   5  
ATOM   9613  C  CG   . GLU B 2 107 ? 11.601  11.812  -4.156  1.00 0.00 ? 365 GLU A CG   5  
ATOM   9614  C  CD   . GLU B 2 107 ? 12.111  11.873  -5.582  1.00 0.00 ? 365 GLU A CD   5  
ATOM   9615  O  OE1  . GLU B 2 107 ? 11.993  12.947  -6.210  1.00 0.00 ? 365 GLU A OE1  5  
ATOM   9616  O  OE2  . GLU B 2 107 ? 12.627  10.847  -6.073  1.00 0.00 ? 365 GLU A OE2  5  
ATOM   9617  H  H    . GLU B 2 107 ? 11.318  10.834  -1.532  1.00 0.00 ? 365 GLU A H    5  
ATOM   9618  H  HA   . GLU B 2 107 ? 12.847  13.155  -1.204  1.00 0.00 ? 365 GLU A HA   5  
ATOM   9619  H  HB2  . GLU B 2 107 ? 13.234  13.051  -3.591  1.00 0.00 ? 365 GLU A HB2  5  
ATOM   9620  H  HB3  . GLU B 2 107 ? 13.257  11.438  -2.894  1.00 0.00 ? 365 GLU A HB3  5  
ATOM   9621  H  HG2  . GLU B 2 107 ? 11.335  10.794  -3.934  1.00 0.00 ? 365 GLU A HG2  5  
ATOM   9622  H  HG3  . GLU B 2 107 ? 10.727  12.431  -4.072  1.00 0.00 ? 365 GLU A HG3  5  
ATOM   9623  N  N    . LEU B 2 108 ? 9.756   13.456  -2.050  1.00 0.00 ? 366 LEU A N    5  
ATOM   9624  C  CA   . LEU B 2 108 ? 8.650   14.378  -2.162  1.00 0.00 ? 366 LEU A CA   5  
ATOM   9625  C  C    . LEU B 2 108 ? 8.454   15.049  -0.814  1.00 0.00 ? 366 LEU A C    5  
ATOM   9626  O  O    . LEU B 2 108 ? 7.937   16.154  -0.716  1.00 0.00 ? 366 LEU A O    5  
ATOM   9627  C  CB   . LEU B 2 108 ? 7.397   13.654  -2.620  1.00 0.00 ? 366 LEU A CB   5  
ATOM   9628  C  CG   . LEU B 2 108 ? 6.331   14.510  -3.310  1.00 0.00 ? 366 LEU A CG   5  
ATOM   9629  C  CD1  . LEU B 2 108 ? 5.428   15.165  -2.291  1.00 0.00 ? 366 LEU A CD1  5  
ATOM   9630  C  CD2  . LEU B 2 108 ? 6.977   15.549  -4.197  1.00 0.00 ? 366 LEU A CD2  5  
ATOM   9631  H  H    . LEU B 2 108 ? 9.563   12.487  -1.972  1.00 0.00 ? 366 LEU A H    5  
ATOM   9632  H  HA   . LEU B 2 108 ? 8.910   15.113  -2.886  1.00 0.00 ? 366 LEU A HA   5  
ATOM   9633  H  HB2  . LEU B 2 108 ? 7.704   12.896  -3.307  1.00 0.00 ? 366 LEU A HB2  5  
ATOM   9634  H  HB3  . LEU B 2 108 ? 6.954   13.187  -1.763  1.00 0.00 ? 366 LEU A HB3  5  
ATOM   9635  H  HG   . LEU B 2 108 ? 5.729   13.877  -3.935  1.00 0.00 ? 366 LEU A HG   5  
ATOM   9636  H  HD11 . LEU B 2 108 ? 5.254   14.473  -1.482  1.00 0.00 ? 366 LEU A HD11 5  
ATOM   9637  H  HD12 . LEU B 2 108 ? 4.487   15.425  -2.754  1.00 0.00 ? 366 LEU A HD12 5  
ATOM   9638  H  HD13 . LEU B 2 108 ? 5.902   16.057  -1.907  1.00 0.00 ? 366 LEU A HD13 5  
ATOM   9639  H  HD21 . LEU B 2 108 ? 8.033   15.357  -4.224  1.00 0.00 ? 366 LEU A HD21 5  
ATOM   9640  H  HD22 . LEU B 2 108 ? 6.796   16.535  -3.794  1.00 0.00 ? 366 LEU A HD22 5  
ATOM   9641  H  HD23 . LEU B 2 108 ? 6.569   15.482  -5.194  1.00 0.00 ? 366 LEU A HD23 5  
ATOM   9642  N  N    . LEU B 2 109 ? 8.878   14.324  0.215   1.00 0.00 ? 367 LEU A N    5  
ATOM   9643  C  CA   . LEU B 2 109 ? 8.814   14.759  1.602   1.00 0.00 ? 367 LEU A CA   5  
ATOM   9644  C  C    . LEU B 2 109 ? 9.792   15.885  1.825   1.00 0.00 ? 367 LEU A C    5  
ATOM   9645  O  O    . LEU B 2 109 ? 9.432   16.985  2.245   1.00 0.00 ? 367 LEU A O    5  
ATOM   9646  C  CB   . LEU B 2 109 ? 9.217   13.603  2.487   1.00 0.00 ? 367 LEU A CB   5  
ATOM   9647  C  CG   . LEU B 2 109 ? 8.299   13.265  3.641   1.00 0.00 ? 367 LEU A CG   5  
ATOM   9648  C  CD1  . LEU B 2 109 ? 7.381   12.130  3.231   1.00 0.00 ? 367 LEU A CD1  5  
ATOM   9649  C  CD2  . LEU B 2 109 ? 9.129   12.892  4.860   1.00 0.00 ? 367 LEU A CD2  5  
ATOM   9650  H  H    . LEU B 2 109 ? 9.279   13.449  0.027   1.00 0.00 ? 367 LEU A H    5  
ATOM   9651  H  HA   . LEU B 2 109 ? 7.824   15.063  1.843   1.00 0.00 ? 367 LEU A HA   5  
ATOM   9652  H  HB2  . LEU B 2 109 ? 9.285   12.737  1.861   1.00 0.00 ? 367 LEU A HB2  5  
ATOM   9653  H  HB3  . LEU B 2 109 ? 10.190  13.817  2.880   1.00 0.00 ? 367 LEU A HB3  5  
ATOM   9654  H  HG   . LEU B 2 109 ? 7.694   14.122  3.885   1.00 0.00 ? 367 LEU A HG   5  
ATOM   9655  H  HD11 . LEU B 2 109 ? 7.730   11.719  2.290   1.00 0.00 ? 367 LEU A HD11 5  
ATOM   9656  H  HD12 . LEU B 2 109 ? 6.374   12.504  3.112   1.00 0.00 ? 367 LEU A HD12 5  
ATOM   9657  H  HD13 . LEU B 2 109 ? 7.394   11.360  3.989   1.00 0.00 ? 367 LEU A HD13 5  
ATOM   9658  H  HD21 . LEU B 2 109 ? 10.067  12.450  4.534   1.00 0.00 ? 367 LEU A HD21 5  
ATOM   9659  H  HD22 . LEU B 2 109 ? 8.584   12.182  5.464   1.00 0.00 ? 367 LEU A HD22 5  
ATOM   9660  H  HD23 . LEU B 2 109 ? 9.332   13.780  5.441   1.00 0.00 ? 367 LEU A HD23 5  
ATOM   9661  N  N    . LYS B 2 110 ? 11.048  15.570  1.540   1.00 0.00 ? 368 LYS A N    5  
ATOM   9662  C  CA   . LYS B 2 110 ? 12.133  16.518  1.676   1.00 0.00 ? 368 LYS A CA   5  
ATOM   9663  C  C    . LYS B 2 110 ? 11.781  17.772  0.900   1.00 0.00 ? 368 LYS A C    5  
ATOM   9664  O  O    . LYS B 2 110 ? 12.138  18.887  1.284   1.00 0.00 ? 368 LYS A O    5  
ATOM   9665  C  CB   . LYS B 2 110 ? 13.426  15.894  1.150   1.00 0.00 ? 368 LYS A CB   5  
ATOM   9666  C  CG   . LYS B 2 110 ? 13.425  14.380  1.264   1.00 0.00 ? 368 LYS A CG   5  
ATOM   9667  C  CD   . LYS B 2 110 ? 14.817  13.789  1.213   1.00 0.00 ? 368 LYS A CD   5  
ATOM   9668  C  CE   . LYS B 2 110 ? 14.756  12.276  1.196   1.00 0.00 ? 368 LYS A CE   5  
ATOM   9669  N  NZ   . LYS B 2 110 ? 14.482  11.740  -0.165  1.00 0.00 ? 368 LYS A NZ   5  
ATOM   9670  H  H    . LYS B 2 110 ? 11.243  14.661  1.213   1.00 0.00 ? 368 LYS A H    5  
ATOM   9671  H  HA   . LYS B 2 110 ? 12.243  16.754  2.725   1.00 0.00 ? 368 LYS A HA   5  
ATOM   9672  H  HB2  . LYS B 2 110 ? 13.545  16.158  0.110   1.00 0.00 ? 368 LYS A HB2  5  
ATOM   9673  H  HB3  . LYS B 2 110 ? 14.261  16.280  1.715   1.00 0.00 ? 368 LYS A HB3  5  
ATOM   9674  H  HG2  . LYS B 2 110 ? 12.969  14.106  2.204   1.00 0.00 ? 368 LYS A HG2  5  
ATOM   9675  H  HG3  . LYS B 2 110 ? 12.837  13.973  0.450   1.00 0.00 ? 368 LYS A HG3  5  
ATOM   9676  H  HD2  . LYS B 2 110 ? 15.321  14.136  0.325   1.00 0.00 ? 368 LYS A HD2  5  
ATOM   9677  H  HD3  . LYS B 2 110 ? 15.358  14.101  2.088   1.00 0.00 ? 368 LYS A HD3  5  
ATOM   9678  H  HE2  . LYS B 2 110 ? 15.700  11.885  1.546   1.00 0.00 ? 368 LYS A HE2  5  
ATOM   9679  H  HE3  . LYS B 2 110 ? 13.963  11.962  1.863   1.00 0.00 ? 368 LYS A HE3  5  
ATOM   9680  H  HZ1  . LYS B 2 110 ? 13.463  11.777  -0.364  1.00 0.00 ? 368 LYS A HZ1  5  
ATOM   9681  H  HZ2  . LYS B 2 110 ? 14.800  10.752  -0.231  1.00 0.00 ? 368 LYS A HZ2  5  
ATOM   9682  H  HZ3  . LYS B 2 110 ? 14.987  12.302  -0.880  1.00 0.00 ? 368 LYS A HZ3  5  
ATOM   9683  N  N    . GLU B 2 111 ? 11.072  17.565  -0.205  1.00 0.00 ? 369 GLU A N    5  
ATOM   9684  C  CA   . GLU B 2 111 ? 10.618  18.655  -1.042  1.00 0.00 ? 369 GLU A CA   5  
ATOM   9685  C  C    . GLU B 2 111 ? 9.450   19.377  -0.382  1.00 0.00 ? 369 GLU A C    5  
ATOM   9686  O  O    . GLU B 2 111 ? 9.364   20.605  -0.434  1.00 0.00 ? 369 GLU A O    5  
ATOM   9687  C  CB   . GLU B 2 111 ? 10.204  18.132  -2.408  1.00 0.00 ? 369 GLU A CB   5  
ATOM   9688  C  CG   . GLU B 2 111 ? 10.837  18.899  -3.551  1.00 0.00 ? 369 GLU A CG   5  
ATOM   9689  C  CD   . GLU B 2 111 ? 10.446  20.364  -3.560  1.00 0.00 ? 369 GLU A CD   5  
ATOM   9690  O  OE1  . GLU B 2 111 ? 9.373   20.690  -4.111  1.00 0.00 ? 369 GLU A OE1  5  
ATOM   9691  O  OE2  . GLU B 2 111 ? 11.213  21.186  -3.014  1.00 0.00 ? 369 GLU A OE2  5  
ATOM   9692  H  H    . GLU B 2 111 ? 10.869  16.645  -0.477  1.00 0.00 ? 369 GLU A H    5  
ATOM   9693  H  HA   . GLU B 2 111 ? 11.435  19.341  -1.169  1.00 0.00 ? 369 GLU A HA   5  
ATOM   9694  H  HB2  . GLU B 2 111 ? 10.504  17.101  -2.485  1.00 0.00 ? 369 GLU A HB2  5  
ATOM   9695  H  HB3  . GLU B 2 111 ? 9.131   18.199  -2.503  1.00 0.00 ? 369 GLU A HB3  5  
ATOM   9696  H  HG2  . GLU B 2 111 ? 11.909  18.828  -3.458  1.00 0.00 ? 369 GLU A HG2  5  
ATOM   9697  H  HG3  . GLU B 2 111 ? 10.528  18.453  -4.480  1.00 0.00 ? 369 GLU A HG3  5  
ATOM   9698  N  N    . LYS B 2 112 ? 8.544   18.614  0.242   1.00 0.00 ? 370 LYS A N    5  
ATOM   9699  C  CA   . LYS B 2 112 ? 7.401   19.187  0.903   1.00 0.00 ? 370 LYS A CA   5  
ATOM   9700  C  C    . LYS B 2 112 ? 7.818   20.163  1.998   1.00 0.00 ? 370 LYS A C    5  
ATOM   9701  O  O    . LYS B 2 112 ? 7.118   21.136  2.281   1.00 0.00 ? 370 LYS A O    5  
ATOM   9702  C  CB   . LYS B 2 112 ? 6.569   18.083  1.506   1.00 0.00 ? 370 LYS A CB   5  
ATOM   9703  C  CG   . LYS B 2 112 ? 5.621   17.437  0.524   1.00 0.00 ? 370 LYS A CG   5  
ATOM   9704  C  CD   . LYS B 2 112 ? 5.407   15.980  0.848   1.00 0.00 ? 370 LYS A CD   5  
ATOM   9705  C  CE   . LYS B 2 112 ? 4.966   15.778  2.285   1.00 0.00 ? 370 LYS A CE   5  
ATOM   9706  N  NZ   . LYS B 2 112 ? 4.802   14.338  2.622   1.00 0.00 ? 370 LYS A NZ   5  
ATOM   9707  H  H    . LYS B 2 112 ? 8.633   17.632  0.245   1.00 0.00 ? 370 LYS A H    5  
ATOM   9708  H  HA   . LYS B 2 112 ? 6.820   19.686  0.159   1.00 0.00 ? 370 LYS A HA   5  
ATOM   9709  H  HB2  . LYS B 2 112 ? 7.233   17.329  1.872   1.00 0.00 ? 370 LYS A HB2  5  
ATOM   9710  H  HB3  . LYS B 2 112 ? 6.001   18.479  2.321   1.00 0.00 ? 370 LYS A HB3  5  
ATOM   9711  H  HG2  . LYS B 2 112 ? 4.673   17.951  0.543   1.00 0.00 ? 370 LYS A HG2  5  
ATOM   9712  H  HG3  . LYS B 2 112 ? 6.056   17.503  -0.452  1.00 0.00 ? 370 LYS A HG3  5  
ATOM   9713  H  HD2  . LYS B 2 112 ? 4.655   15.576  0.187   1.00 0.00 ? 370 LYS A HD2  5  
ATOM   9714  H  HD3  . LYS B 2 112 ? 6.344   15.471  0.688   1.00 0.00 ? 370 LYS A HD3  5  
ATOM   9715  H  HE2  . LYS B 2 112 ? 5.712   16.209  2.931   1.00 0.00 ? 370 LYS A HE2  5  
ATOM   9716  H  HE3  . LYS B 2 112 ? 4.024   16.285  2.434   1.00 0.00 ? 370 LYS A HE3  5  
ATOM   9717  H  HZ1  . LYS B 2 112 ? 4.055   13.915  2.033   1.00 0.00 ? 370 LYS A HZ1  5  
ATOM   9718  H  HZ2  . LYS B 2 112 ? 4.540   14.232  3.623   1.00 0.00 ? 370 LYS A HZ2  5  
ATOM   9719  H  HZ3  . LYS B 2 112 ? 5.692   13.827  2.453   1.00 0.00 ? 370 LYS A HZ3  5  
ATOM   9720  N  N    . ALA B 2 113 ? 8.968   19.886  2.613   1.00 0.00 ? 371 ALA A N    5  
ATOM   9721  C  CA   . ALA B 2 113 ? 9.488   20.712  3.695   1.00 0.00 ? 371 ALA A CA   5  
ATOM   9722  C  C    . ALA B 2 113 ? 9.641   22.166  3.272   1.00 0.00 ? 371 ALA A C    5  
ATOM   9723  O  O    . ALA B 2 113 ? 9.388   22.523  2.122   1.00 0.00 ? 371 ALA A O    5  
ATOM   9724  C  CB   . ALA B 2 113 ? 10.829  20.175  4.161   1.00 0.00 ? 371 ALA A CB   5  
ATOM   9725  H  H    . ALA B 2 113 ? 9.485   19.106  2.324   1.00 0.00 ? 371 ALA A H    5  
ATOM   9726  H  HA   . ALA B 2 113 ? 8.797   20.651  4.523   1.00 0.00 ? 371 ALA A HA   5  
ATOM   9727  H  HB1  . ALA B 2 113 ? 11.592  20.472  3.458   1.00 0.00 ? 371 ALA A HB1  5  
ATOM   9728  H  HB2  . ALA B 2 113 ? 10.787  19.096  4.215   1.00 0.00 ? 371 ALA A HB2  5  
ATOM   9729  H  HB3  . ALA B 2 113 ? 11.061  20.576  5.136   1.00 0.00 ? 371 ALA A HB3  5  
ATOM   9730  N  N    . SER B 2 114 ? 10.069  23.000  4.213   1.00 0.00 ? 372 SER A N    5  
ATOM   9731  C  CA   . SER B 2 114 ? 10.271  24.415  3.942   1.00 0.00 ? 372 SER A CA   5  
ATOM   9732  C  C    . SER B 2 114 ? 10.988  25.093  5.106   1.00 0.00 ? 372 SER A C    5  
ATOM   9733  O  O    . SER B 2 114 ? 12.233  25.182  5.061   1.00 0.00 ? 372 SER A O    5  
ATOM   9734  C  CB   . SER B 2 114 ? 8.933   25.107  3.677   1.00 0.00 ? 372 SER A CB   5  
ATOM   9735  O  OG   . SER B 2 114 ? 9.118   26.484  3.397   1.00 0.00 ? 372 SER A OG   5  
ATOM   9736  O  OXT  . SER B 2 114 ? 10.300  25.529  6.053   1.00 0.00 ? 372 SER A OXT  5  
ATOM   9737  H  H    . SER B 2 114 ? 10.250  22.654  5.113   1.00 0.00 ? 372 SER A H    5  
ATOM   9738  H  HA   . SER B 2 114 ? 10.889  24.490  3.062   1.00 0.00 ? 372 SER A HA   5  
ATOM   9739  H  HB2  . SER B 2 114 ? 8.452   24.643  2.829   1.00 0.00 ? 372 SER A HB2  5  
ATOM   9740  H  HB3  . SER B 2 114 ? 8.301   25.010  4.548   1.00 0.00 ? 372 SER A HB3  5  
ATOM   9741  H  HG   . SER B 2 114 ? 8.671   27.010  4.066   1.00 0.00 ? 372 SER A HG   5  
HETATM 9742  ZN ZN   . ZN  C 3 .   ? -14.419 -0.665  3.708   1.00 0.00 ? 501 ZN  A ZN   5  
HETATM 9743  ZN ZN   . ZN  D 3 .   ? -4.252  -6.990  -7.352  1.00 0.00 ? 601 ZN  A ZN   5  
HETATM 9744  ZN ZN   . ZN  E 3 .   ? 5.616   6.002   -1.272  1.00 0.00 ? 701 ZN  A ZN   5  
HETATM 9745  ZN ZN   . ZN  F 3 .   ? 13.074  -5.886  -5.271  1.00 0.00 ? 801 ZN  A ZN   5  
ATOM   9746  N  N    . GLY A 1 1   ? 5.206   -8.899  23.546  1.00 0.00 ? 9   GLY B N    6  
ATOM   9747  C  CA   . GLY A 1 1   ? 3.742   -8.903  23.278  1.00 0.00 ? 9   GLY B CA   6  
ATOM   9748  C  C    . GLY A 1 1   ? 3.389   -8.202  21.981  1.00 0.00 ? 9   GLY B C    6  
ATOM   9749  O  O    . GLY A 1 1   ? 3.821   -8.618  20.906  1.00 0.00 ? 9   GLY B O    6  
ATOM   9750  H  H1   . GLY A 1 1   ? 5.407   -9.396  24.439  1.00 0.00 ? 9   GLY B H1   6  
ATOM   9751  H  H2   . GLY A 1 1   ? 5.554   -7.922  23.621  1.00 0.00 ? 9   GLY B H2   6  
ATOM   9752  H  H3   . GLY A 1 1   ? 5.713   -9.377  22.775  1.00 0.00 ? 9   GLY B H3   6  
ATOM   9753  H  HA2  . GLY A 1 1   ? 3.400   -9.926  23.226  1.00 0.00 ? 9   GLY B HA2  6  
ATOM   9754  H  HA3  . GLY A 1 1   ? 3.235   -8.408  24.092  1.00 0.00 ? 9   GLY B HA3  6  
ATOM   9755  N  N    . LEU A 1 2   ? 2.602   -7.133  22.085  1.00 0.00 ? 10  LEU B N    6  
ATOM   9756  C  CA   . LEU A 1 2   ? 2.186   -6.366  20.915  1.00 0.00 ? 10  LEU B CA   6  
ATOM   9757  C  C    . LEU A 1 2   ? 1.513   -7.275  19.888  1.00 0.00 ? 10  LEU B C    6  
ATOM   9758  O  O    . LEU A 1 2   ? 2.077   -7.563  18.832  1.00 0.00 ? 10  LEU B O    6  
ATOM   9759  C  CB   . LEU A 1 2   ? 3.393   -5.659  20.289  1.00 0.00 ? 10  LEU B CB   6  
ATOM   9760  C  CG   . LEU A 1 2   ? 3.091   -4.318  19.610  1.00 0.00 ? 10  LEU B CG   6  
ATOM   9761  C  CD1  . LEU A 1 2   ? 4.383   -3.628  19.202  1.00 0.00 ? 10  LEU B CD1  6  
ATOM   9762  C  CD2  . LEU A 1 2   ? 2.192   -4.517  18.399  1.00 0.00 ? 10  LEU B CD2  6  
ATOM   9763  H  H    . LEU A 1 2   ? 2.294   -6.853  22.972  1.00 0.00 ? 10  LEU B H    6  
ATOM   9764  H  HA   . LEU A 1 2   ? 1.474   -5.624  21.242  1.00 0.00 ? 10  LEU B HA   6  
ATOM   9765  H  HB2  . LEU A 1 2   ? 4.124   -5.488  21.066  1.00 0.00 ? 10  LEU B HB2  6  
ATOM   9766  H  HB3  . LEU A 1 2   ? 3.827   -6.319  19.551  1.00 0.00 ? 10  LEU B HB3  6  
ATOM   9767  H  HG   . LEU A 1 2   ? 2.577   -3.676  20.310  1.00 0.00 ? 10  LEU B HG   6  
ATOM   9768  H  HD11 . LEU A 1 2   ? 4.933   -4.265  18.524  1.00 0.00 ? 10  LEU B HD11 6  
ATOM   9769  H  HD12 . LEU A 1 2   ? 4.982   -3.436  20.080  1.00 0.00 ? 10  LEU B HD12 6  
ATOM   9770  H  HD13 . LEU A 1 2   ? 4.153   -2.695  18.711  1.00 0.00 ? 10  LEU B HD13 6  
ATOM   9771  H  HD21 . LEU A 1 2   ? 1.267   -4.980  18.710  1.00 0.00 ? 10  LEU B HD21 6  
ATOM   9772  H  HD22 . LEU A 1 2   ? 2.689   -5.151  17.681  1.00 0.00 ? 10  LEU B HD22 6  
ATOM   9773  H  HD23 . LEU A 1 2   ? 1.979   -3.559  17.948  1.00 0.00 ? 10  LEU B HD23 6  
ATOM   9774  N  N    . GLY A 1 3   ? 0.303   -7.726  20.210  1.00 0.00 ? 11  GLY B N    6  
ATOM   9775  C  CA   . GLY A 1 3   ? -0.428  -8.599  19.310  1.00 0.00 ? 11  GLY B CA   6  
ATOM   9776  C  C    . GLY A 1 3   ? -1.589  -7.897  18.634  1.00 0.00 ? 11  GLY B C    6  
ATOM   9777  O  O    . GLY A 1 3   ? -2.614  -8.517  18.344  1.00 0.00 ? 11  GLY B O    6  
ATOM   9778  H  H    . GLY A 1 3   ? -0.096  -7.462  21.065  1.00 0.00 ? 11  GLY B H    6  
ATOM   9779  H  HA2  . GLY A 1 3   ? 0.248   -8.963  18.550  1.00 0.00 ? 11  GLY B HA2  6  
ATOM   9780  H  HA3  . GLY A 1 3   ? -0.809  -9.440  19.871  1.00 0.00 ? 11  GLY B HA3  6  
ATOM   9781  N  N    . LYS A 1 4   ? -1.431  -6.602  18.384  1.00 0.00 ? 12  LYS B N    6  
ATOM   9782  C  CA   . LYS A 1 4   ? -2.474  -5.815  17.736  1.00 0.00 ? 12  LYS B CA   6  
ATOM   9783  C  C    . LYS A 1 4   ? -2.186  -5.653  16.248  1.00 0.00 ? 12  LYS B C    6  
ATOM   9784  O  O    . LYS A 1 4   ? -1.450  -4.754  15.841  1.00 0.00 ? 12  LYS B O    6  
ATOM   9785  C  CB   . LYS A 1 4   ? -2.589  -4.440  18.399  1.00 0.00 ? 12  LYS B CB   6  
ATOM   9786  C  CG   . LYS A 1 4   ? -3.696  -3.575  17.815  1.00 0.00 ? 12  LYS B CG   6  
ATOM   9787  C  CD   . LYS A 1 4   ? -3.773  -2.219  18.501  1.00 0.00 ? 12  LYS B CD   6  
ATOM   9788  C  CE   . LYS A 1 4   ? -4.534  -2.293  19.817  1.00 0.00 ? 12  LYS B CE   6  
ATOM   9789  N  NZ   . LYS A 1 4   ? -3.798  -3.075  20.850  1.00 0.00 ? 12  LYS B NZ   6  
ATOM   9790  H  H    . LYS A 1 4   ? -0.592  -6.164  18.640  1.00 0.00 ? 12  LYS B H    6  
ATOM   9791  H  HA   . LYS A 1 4   ? -3.409  -6.341  17.856  1.00 0.00 ? 12  LYS B HA   6  
ATOM   9792  H  HB2  . LYS A 1 4   ? -2.785  -4.577  19.451  1.00 0.00 ? 12  LYS B HB2  6  
ATOM   9793  H  HB3  . LYS A 1 4   ? -1.652  -3.916  18.280  1.00 0.00 ? 12  LYS B HB3  6  
ATOM   9794  H  HG2  . LYS A 1 4   ? -3.503  -3.424  16.763  1.00 0.00 ? 12  LYS B HG2  6  
ATOM   9795  H  HG3  . LYS A 1 4   ? -4.640  -4.085  17.939  1.00 0.00 ? 12  LYS B HG3  6  
ATOM   9796  H  HD2  . LYS A 1 4   ? -2.771  -1.870  18.697  1.00 0.00 ? 12  LYS B HD2  6  
ATOM   9797  H  HD3  . LYS A 1 4   ? -4.276  -1.524  17.844  1.00 0.00 ? 12  LYS B HD3  6  
ATOM   9798  H  HE2  . LYS A 1 4   ? -4.690  -1.290  20.184  1.00 0.00 ? 12  LYS B HE2  6  
ATOM   9799  H  HE3  . LYS A 1 4   ? -5.490  -2.762  19.638  1.00 0.00 ? 12  LYS B HE3  6  
ATOM   9800  H  HZ1  . LYS A 1 4   ? -4.286  -3.004  21.765  1.00 0.00 ? 12  LYS B HZ1  6  
ATOM   9801  H  HZ2  . LYS A 1 4   ? -2.831  -2.707  20.956  1.00 0.00 ? 12  LYS B HZ2  6  
ATOM   9802  H  HZ3  . LYS A 1 4   ? -3.748  -4.075  20.572  1.00 0.00 ? 12  LYS B HZ3  6  
ATOM   9803  N  N    . GLY A 1 5   ? -2.772  -6.532  15.439  1.00 0.00 ? 13  GLY B N    6  
ATOM   9804  C  CA   . GLY A 1 5   ? -2.568  -6.471  14.004  1.00 0.00 ? 13  GLY B CA   6  
ATOM   9805  C  C    . GLY A 1 5   ? -3.483  -7.413  13.248  1.00 0.00 ? 13  GLY B C    6  
ATOM   9806  O  O    . GLY A 1 5   ? -3.857  -8.469  13.759  1.00 0.00 ? 13  GLY B O    6  
ATOM   9807  H  H    . GLY A 1 5   ? -3.348  -7.226  15.822  1.00 0.00 ? 13  GLY B H    6  
ATOM   9808  H  HA2  . GLY A 1 5   ? -2.749  -5.462  13.667  1.00 0.00 ? 13  GLY B HA2  6  
ATOM   9809  H  HA3  . GLY A 1 5   ? -1.543  -6.733  13.787  1.00 0.00 ? 13  GLY B HA3  6  
ATOM   9810  N  N    . GLY A 1 6   ? -3.845  -7.030  12.026  1.00 0.00 ? 14  GLY B N    6  
ATOM   9811  C  CA   . GLY A 1 6   ? -4.719  -7.859  11.218  1.00 0.00 ? 14  GLY B CA   6  
ATOM   9812  C  C    . GLY A 1 6   ? -5.128  -7.186  9.922   1.00 0.00 ? 14  GLY B C    6  
ATOM   9813  O  O    . GLY A 1 6   ? -4.281  -6.703  9.172   1.00 0.00 ? 14  GLY B O    6  
ATOM   9814  H  H    . GLY A 1 6   ? -3.516  -6.178  11.672  1.00 0.00 ? 14  GLY B H    6  
ATOM   9815  H  HA2  . GLY A 1 6   ? -4.209  -8.782  10.985  1.00 0.00 ? 14  GLY B HA2  6  
ATOM   9816  H  HA3  . GLY A 1 6   ? -5.608  -8.088  11.787  1.00 0.00 ? 14  GLY B HA3  6  
ATOM   9817  N  N    . ALA A 1 7   ? -6.433  -7.155  9.664   1.00 0.00 ? 15  ALA B N    6  
ATOM   9818  C  CA   . ALA A 1 7   ? -6.966  -6.543  8.452   1.00 0.00 ? 15  ALA B CA   6  
ATOM   9819  C  C    . ALA A 1 7   ? -6.326  -7.144  7.202   1.00 0.00 ? 15  ALA B C    6  
ATOM   9820  O  O    . ALA A 1 7   ? -6.715  -8.228  6.763   1.00 0.00 ? 15  ALA B O    6  
ATOM   9821  C  CB   . ALA A 1 7   ? -6.772  -5.034  8.486   1.00 0.00 ? 15  ALA B CB   6  
ATOM   9822  H  H    . ALA A 1 7   ? -7.054  -7.557  10.307  1.00 0.00 ? 15  ALA B H    6  
ATOM   9823  H  HA   . ALA A 1 7   ? -8.028  -6.742  8.424   1.00 0.00 ? 15  ALA B HA   6  
ATOM   9824  H  HB1  . ALA A 1 7   ? -7.186  -4.638  9.402   1.00 0.00 ? 15  ALA B HB1  6  
ATOM   9825  H  HB2  . ALA A 1 7   ? -7.275  -4.587  7.641   1.00 0.00 ? 15  ALA B HB2  6  
ATOM   9826  H  HB3  . ALA A 1 7   ? -5.718  -4.805  8.440   1.00 0.00 ? 15  ALA B HB3  6  
HETATM 9827  O  OH   . ALY A 1 8   ? -5.879  -6.639  -1.027  1.00 0.00 ? 16  ALY B OH   6  
HETATM 9828  C  CH   . ALY A 1 8   ? -7.056  -6.344  -0.817  1.00 0.00 ? 16  ALY B CH   6  
HETATM 9829  C  CH3  . ALY A 1 8   ? -7.766  -5.458  -1.842  1.00 0.00 ? 16  ALY B CH3  6  
HETATM 9830  N  NZ   . ALY A 1 8   ? -7.578  -6.425  0.401   1.00 0.00 ? 16  ALY B NZ   6  
HETATM 9831  C  CE   . ALY A 1 8   ? -6.754  -6.353  1.603   1.00 0.00 ? 16  ALY B CE   6  
HETATM 9832  C  CD   . ALY A 1 8   ? -5.986  -7.643  1.848   1.00 0.00 ? 16  ALY B CD   6  
HETATM 9833  C  CG   . ALY A 1 8   ? -4.974  -7.491  2.974   1.00 0.00 ? 16  ALY B CG   6  
HETATM 9834  C  CB   . ALY A 1 8   ? -5.642  -7.120  4.292   1.00 0.00 ? 16  ALY B CB   6  
HETATM 9835  C  CA   . ALY A 1 8   ? -4.650  -6.918  5.441   1.00 0.00 ? 16  ALY B CA   6  
HETATM 9836  N  N    . ALY A 1 8   ? -5.340  -6.444  6.639   1.00 0.00 ? 16  ALY B N    6  
HETATM 9837  C  C    . ALY A 1 8   ? -3.557  -5.947  5.005   1.00 0.00 ? 16  ALY B C    6  
HETATM 9838  O  O    . ALY A 1 8   ? -2.370  -6.268  5.072   1.00 0.00 ? 16  ALY B O    6  
HETATM 9839  H  HH31 . ALY A 1 8   ? -8.830  -5.471  -1.655  1.00 0.00 ? 16  ALY B HH31 6  
HETATM 9840  H  HH32 . ALY A 1 8   ? -7.396  -4.447  -1.752  1.00 0.00 ? 16  ALY B HH32 6  
HETATM 9841  H  HH33 . ALY A 1 8   ? -7.570  -5.827  -2.837  1.00 0.00 ? 16  ALY B HH33 6  
HETATM 9842  H  HZ   . ALY A 1 8   ? -8.522  -6.187  0.507   1.00 0.00 ? 16  ALY B HZ   6  
HETATM 9843  H  HE3  . ALY A 1 8   ? -6.052  -5.536  1.497   1.00 0.00 ? 16  ALY B HE3  6  
HETATM 9844  H  HE2  . ALY A 1 8   ? -7.394  -6.169  2.451   1.00 0.00 ? 16  ALY B HE2  6  
HETATM 9845  H  HD3  . ALY A 1 8   ? -6.685  -8.424  2.109   1.00 0.00 ? 16  ALY B HD3  6  
HETATM 9846  H  HD2  . ALY A 1 8   ? -5.463  -7.915  0.942   1.00 0.00 ? 16  ALY B HD2  6  
HETATM 9847  H  HG3  . ALY A 1 8   ? -4.448  -8.426  3.101   1.00 0.00 ? 16  ALY B HG3  6  
HETATM 9848  H  HG2  . ALY A 1 8   ? -4.273  -6.716  2.708   1.00 0.00 ? 16  ALY B HG2  6  
HETATM 9849  H  HB3  . ALY A 1 8   ? -6.196  -6.205  4.146   1.00 0.00 ? 16  ALY B HB3  6  
HETATM 9850  H  HB2  . ALY A 1 8   ? -6.329  -7.909  4.558   1.00 0.00 ? 16  ALY B HB2  6  
HETATM 9851  H  HCA  . ALY A 1 8   ? -4.195  -7.868  5.679   1.00 0.00 ? 16  ALY B HCA  6  
HETATM 9852  H  H    . ALY A 1 8   ? -5.070  -5.591  7.037   1.00 0.00 ? 16  ALY B H    6  
ATOM   9853  N  N    . ARG A 1 9   ? -3.966  -4.758  4.557   1.00 0.00 ? 17  ARG B N    6  
ATOM   9854  C  CA   . ARG A 1 9   ? -3.020  -3.749  4.086   1.00 0.00 ? 17  ARG B CA   6  
ATOM   9855  C  C    . ARG A 1 9   ? -2.205  -4.303  2.918   1.00 0.00 ? 17  ARG B C    6  
ATOM   9856  O  O    . ARG A 1 9   ? -2.652  -4.288  1.771   1.00 0.00 ? 17  ARG B O    6  
ATOM   9857  C  CB   . ARG A 1 9   ? -2.088  -3.306  5.225   1.00 0.00 ? 17  ARG B CB   6  
ATOM   9858  C  CG   . ARG A 1 9   ? -0.930  -2.424  4.772   1.00 0.00 ? 17  ARG B CG   6  
ATOM   9859  C  CD   . ARG A 1 9   ? -1.270  -0.949  4.888   1.00 0.00 ? 17  ARG B CD   6  
ATOM   9860  N  NE   . ARG A 1 9   ? -1.216  -0.494  6.276   1.00 0.00 ? 17  ARG B NE   6  
ATOM   9861  C  CZ   . ARG A 1 9   ? -1.158  0.785   6.633   1.00 0.00 ? 17  ARG B CZ   6  
ATOM   9862  N  NH1  . ARG A 1 9   ? -1.169  1.736   5.712   1.00 0.00 ? 17  ARG B NH1  6  
ATOM   9863  N  NH2  . ARG A 1 9   ? -1.092  1.112   7.917   1.00 0.00 ? 17  ARG B NH2  6  
ATOM   9864  H  H    . ARG A 1 9   ? -4.925  -4.558  4.544   1.00 0.00 ? 17  ARG B H    6  
ATOM   9865  H  HA   . ARG A 1 9   ? -3.588  -2.898  3.743   1.00 0.00 ? 17  ARG B HA   6  
ATOM   9866  H  HB2  . ARG A 1 9   ? -2.668  -2.753  5.951   1.00 0.00 ? 17  ARG B HB2  6  
ATOM   9867  H  HB3  . ARG A 1 9   ? -1.679  -4.184  5.700   1.00 0.00 ? 17  ARG B HB3  6  
ATOM   9868  H  HG2  . ARG A 1 9   ? -0.071  -2.634  5.393   1.00 0.00 ? 17  ARG B HG2  6  
ATOM   9869  H  HG3  . ARG A 1 9   ? -0.693  -2.656  3.739   1.00 0.00 ? 17  ARG B HG3  6  
ATOM   9870  H  HD2  . ARG A 1 9   ? -0.562  -0.380  4.302   1.00 0.00 ? 17  ARG B HD2  6  
ATOM   9871  H  HD3  . ARG A 1 9   ? -2.266  -0.790  4.504   1.00 0.00 ? 17  ARG B HD3  6  
ATOM   9872  H  HE   . ARG A 1 9   ? -1.217  -1.178  6.977   1.00 0.00 ? 17  ARG B HE   6  
ATOM   9873  H  HH11 . ARG A 1 9   ? -1.220  1.494   4.743   1.00 0.00 ? 17  ARG B HH11 6  
ATOM   9874  H  HH12 . ARG A 1 9   ? -1.124  2.698   5.984   1.00 0.00 ? 17  ARG B HH12 6  
ATOM   9875  H  HH21 . ARG A 1 9   ? -1.087  0.397   8.617   1.00 0.00 ? 17  ARG B HH21 6  
ATOM   9876  H  HH22 . ARG A 1 9   ? -1.047  2.075   8.186   1.00 0.00 ? 17  ARG B HH22 6  
ATOM   9877  N  N    . HIS A 1 10  ? -1.013  -4.798  3.228   1.00 0.00 ? 18  HIS B N    6  
ATOM   9878  C  CA   . HIS A 1 10  ? -0.126  -5.376  2.234   1.00 0.00 ? 18  HIS B CA   6  
ATOM   9879  C  C    . HIS A 1 10  ? 0.542   -6.605  2.834   1.00 0.00 ? 18  HIS B C    6  
ATOM   9880  O  O    . HIS A 1 10  ? -0.102  -7.370  3.552   1.00 0.00 ? 18  HIS B O    6  
ATOM   9881  C  CB   . HIS A 1 10  ? 0.939   -4.365  1.790   1.00 0.00 ? 18  HIS B CB   6  
ATOM   9882  C  CG   . HIS A 1 10  ? 0.402   -3.010  1.449   1.00 0.00 ? 18  HIS B CG   6  
ATOM   9883  N  ND1  . HIS A 1 10  ? 0.822   -1.855  2.074   1.00 0.00 ? 18  HIS B ND1  6  
ATOM   9884  C  CD2  . HIS A 1 10  ? -0.520  -2.625  0.536   1.00 0.00 ? 18  HIS B CD2  6  
ATOM   9885  C  CE1  . HIS A 1 10  ? 0.180   -0.821  1.563   1.00 0.00 ? 18  HIS B CE1  6  
ATOM   9886  N  NE2  . HIS A 1 10  ? -0.640  -1.260  0.628   1.00 0.00 ? 18  HIS B NE2  6  
ATOM   9887  H  H    . HIS A 1 10  ? -0.721  -4.779  4.162   1.00 0.00 ? 18  HIS B H    6  
ATOM   9888  H  HA   . HIS A 1 10  ? -0.719  -5.673  1.382   1.00 0.00 ? 18  HIS B HA   6  
ATOM   9889  H  HB2  . HIS A 1 10  ? 1.658   -4.246  2.581   1.00 0.00 ? 18  HIS B HB2  6  
ATOM   9890  H  HB3  . HIS A 1 10  ? 1.442   -4.750  0.915   1.00 0.00 ? 18  HIS B HB3  6  
ATOM   9891  H  HD1  . HIS A 1 10  ? 1.491   -1.803  2.789   1.00 0.00 ? 18  HIS B HD1  6  
ATOM   9892  H  HD2  . HIS A 1 10  ? -1.050  -3.270  -0.148  1.00 0.00 ? 18  HIS B HD2  6  
ATOM   9893  H  HE1  . HIS A 1 10  ? 0.306   0.211   1.860   1.00 0.00 ? 18  HIS B HE1  6  
ATOM   9894  H  HE2  . HIS A 1 10  ? -1.307  -0.715  0.161   1.00 0.00 ? 18  HIS B HE2  6  
ATOM   9895  N  N    . ARG A 1 11  ? 1.828   -6.788  2.551   1.00 0.00 ? 19  ARG B N    6  
ATOM   9896  C  CA   . ARG A 1 11  ? 2.564   -7.922  3.086   1.00 0.00 ? 19  ARG B CA   6  
ATOM   9897  C  C    . ARG A 1 11  ? 1.755   -9.199  2.923   1.00 0.00 ? 19  ARG B C    6  
ATOM   9898  O  O    . ARG A 1 11  ? 1.283   -9.794  3.893   1.00 0.00 ? 19  ARG B O    6  
ATOM   9899  C  CB   . ARG A 1 11  ? 2.893   -7.674  4.552   1.00 0.00 ? 19  ARG B CB   6  
ATOM   9900  C  CG   . ARG A 1 11  ? 3.771   -8.747  5.182   1.00 0.00 ? 19  ARG B CG   6  
ATOM   9901  C  CD   . ARG A 1 11  ? 5.236   -8.569  4.819   1.00 0.00 ? 19  ARG B CD   6  
ATOM   9902  N  NE   . ARG A 1 11  ? 6.065   -9.655  5.339   1.00 0.00 ? 19  ARG B NE   6  
ATOM   9903  C  CZ   . ARG A 1 11  ? 7.115   -9.470  6.137   1.00 0.00 ? 19  ARG B CZ   6  
ATOM   9904  N  NH1  . ARG A 1 11  ? 7.454   -8.246  6.521   1.00 0.00 ? 19  ARG B NH1  6  
ATOM   9905  N  NH2  . ARG A 1 11  ? 7.822   -10.511 6.556   1.00 0.00 ? 19  ARG B NH2  6  
ATOM   9906  H  H    . ARG A 1 11  ? 2.290   -6.149  1.971   1.00 0.00 ? 19  ARG B H    6  
ATOM   9907  H  HA   . ARG A 1 11  ? 3.480   -8.014  2.525   1.00 0.00 ? 19  ARG B HA   6  
ATOM   9908  H  HB2  . ARG A 1 11  ? 3.403   -6.727  4.622   1.00 0.00 ? 19  ARG B HB2  6  
ATOM   9909  H  HB3  . ARG A 1 11  ? 1.972   -7.619  5.111   1.00 0.00 ? 19  ARG B HB3  6  
ATOM   9910  H  HG2  . ARG A 1 11  ? 3.671   -8.695  6.256   1.00 0.00 ? 19  ARG B HG2  6  
ATOM   9911  H  HG3  . ARG A 1 11  ? 3.440   -9.716  4.836   1.00 0.00 ? 19  ARG B HG3  6  
ATOM   9912  H  HD2  . ARG A 1 11  ? 5.326   -8.545  3.742   1.00 0.00 ? 19  ARG B HD2  6  
ATOM   9913  H  HD3  . ARG A 1 11  ? 5.584   -7.634  5.229   1.00 0.00 ? 19  ARG B HD3  6  
ATOM   9914  H  HE   . ARG A 1 11  ? 5.831   -10.570 5.076   1.00 0.00 ? 19  ARG B HE   6  
ATOM   9915  H  HH11 . ARG A 1 11  ? 6.921   -7.459  6.210   1.00 0.00 ? 19  ARG B HH11 6  
ATOM   9916  H  HH12 . ARG A 1 11  ? 8.242   -8.111  7.121   1.00 0.00 ? 19  ARG B HH12 6  
ATOM   9917  H  HH21 . ARG A 1 11  ? 7.567   -11.435 6.272   1.00 0.00 ? 19  ARG B HH21 6  
ATOM   9918  H  HH22 . ARG A 1 11  ? 8.610   -10.372 7.155   1.00 0.00 ? 19  ARG B HH22 6  
ATOM   9919  N  N    . LYS A 1 12  ? 1.598   -9.593  1.674   1.00 0.00 ? 20  LYS B N    6  
ATOM   9920  C  CA   . LYS A 1 12  ? 0.843   -10.779 1.305   1.00 0.00 ? 20  LYS B CA   6  
ATOM   9921  C  C    . LYS A 1 12  ? 1.231   -11.994 2.141   1.00 0.00 ? 20  LYS B C    6  
ATOM   9922  O  O    . LYS A 1 12  ? 2.318   -12.049 2.719   1.00 0.00 ? 20  LYS B O    6  
ATOM   9923  C  CB   . LYS A 1 12  ? 1.098   -11.060 -0.165  1.00 0.00 ? 20  LYS B CB   6  
ATOM   9924  C  CG   . LYS A 1 12  ? 2.555   -11.321 -0.463  1.00 0.00 ? 20  LYS B CG   6  
ATOM   9925  C  CD   . LYS A 1 12  ? 2.819   -11.280 -1.947  1.00 0.00 ? 20  LYS B CD   6  
ATOM   9926  C  CE   . LYS A 1 12  ? 4.288   -11.441 -2.244  1.00 0.00 ? 20  LYS B CE   6  
ATOM   9927  N  NZ   . LYS A 1 12  ? 4.521   -11.927 -3.632  1.00 0.00 ? 20  LYS B NZ   6  
ATOM   9928  H  H    . LYS A 1 12  ? 2.013   -9.066  0.963   1.00 0.00 ? 20  LYS B H    6  
ATOM   9929  H  HA   . LYS A 1 12  ? -0.204  -10.570 1.446   1.00 0.00 ? 20  LYS B HA   6  
ATOM   9930  H  HB2  . LYS A 1 12  ? 0.523   -11.919 -0.472  1.00 0.00 ? 20  LYS B HB2  6  
ATOM   9931  H  HB3  . LYS A 1 12  ? 0.796   -10.200 -0.742  1.00 0.00 ? 20  LYS B HB3  6  
ATOM   9932  H  HG2  . LYS A 1 12  ? 3.153   -10.564 0.021   1.00 0.00 ? 20  LYS B HG2  6  
ATOM   9933  H  HG3  . LYS A 1 12  ? 2.821   -12.289 -0.081  1.00 0.00 ? 20  LYS B HG3  6  
ATOM   9934  H  HD2  . LYS A 1 12  ? 2.269   -12.071 -2.433  1.00 0.00 ? 20  LYS B HD2  6  
ATOM   9935  H  HD3  . LYS A 1 12  ? 2.496   -10.321 -2.323  1.00 0.00 ? 20  LYS B HD3  6  
ATOM   9936  H  HE2  . LYS A 1 12  ? 4.767   -10.475 -2.117  1.00 0.00 ? 20  LYS B HE2  6  
ATOM   9937  H  HE3  . LYS A 1 12  ? 4.709   -12.148 -1.545  1.00 0.00 ? 20  LYS B HE3  6  
ATOM   9938  H  HZ1  . LYS A 1 12  ? 5.541   -12.037 -3.805  1.00 0.00 ? 20  LYS B HZ1  6  
ATOM   9939  H  HZ2  . LYS A 1 12  ? 4.136   -11.248 -4.318  1.00 0.00 ? 20  LYS B HZ2  6  
ATOM   9940  H  HZ3  . LYS A 1 12  ? 4.056   -12.847 -3.770  1.00 0.00 ? 20  LYS B HZ3  6  
ATOM   9941  N  N    . VAL A 1 13  ? 0.329   -12.969 2.194   1.00 0.00 ? 21  VAL B N    6  
ATOM   9942  C  CA   . VAL A 1 13  ? 0.562   -14.196 2.944   1.00 0.00 ? 21  VAL B CA   6  
ATOM   9943  C  C    . VAL A 1 13  ? 0.391   -15.416 2.045   1.00 0.00 ? 21  VAL B C    6  
ATOM   9944  O  O    . VAL A 1 13  ? -0.272  -15.342 1.010   1.00 0.00 ? 21  VAL B O    6  
ATOM   9945  C  CB   . VAL A 1 13  ? -0.398  -14.315 4.145   1.00 0.00 ? 21  VAL B CB   6  
ATOM   9946  C  CG1  . VAL A 1 13  ? -0.199  -13.151 5.104   1.00 0.00 ? 21  VAL B CG1  6  
ATOM   9947  C  CG2  . VAL A 1 13  ? -1.842  -14.383 3.672   1.00 0.00 ? 21  VAL B CG2  6  
ATOM   9948  H  H    . VAL A 1 13  ? -0.517  -12.859 1.713   1.00 0.00 ? 21  VAL B H    6  
ATOM   9949  H  HA   . VAL A 1 13  ? 1.575   -14.173 3.318   1.00 0.00 ? 21  VAL B HA   6  
ATOM   9950  H  HB   . VAL A 1 13  ? -0.170  -15.230 4.672   1.00 0.00 ? 21  VAL B HB   6  
ATOM   9951  H  HG11 . VAL A 1 13  ? 0.821   -13.147 5.459   1.00 0.00 ? 21  VAL B HG11 6  
ATOM   9952  H  HG12 . VAL A 1 13  ? -0.870  -13.259 5.944   1.00 0.00 ? 21  VAL B HG12 6  
ATOM   9953  H  HG13 . VAL A 1 13  ? -0.408  -12.223 4.593   1.00 0.00 ? 21  VAL B HG13 6  
ATOM   9954  H  HG21 . VAL A 1 13  ? -2.089  -13.478 3.137   1.00 0.00 ? 21  VAL B HG21 6  
ATOM   9955  H  HG22 . VAL A 1 13  ? -2.495  -14.487 4.525   1.00 0.00 ? 21  VAL B HG22 6  
ATOM   9956  H  HG23 . VAL A 1 13  ? -1.967  -15.234 3.018   1.00 0.00 ? 21  VAL B HG23 6  
ATOM   9957  N  N    . LEU A 1 14  ? 0.993   -16.533 2.445   1.00 0.00 ? 22  LEU B N    6  
ATOM   9958  C  CA   . LEU A 1 14  ? 0.912   -17.773 1.675   1.00 0.00 ? 22  LEU B CA   6  
ATOM   9959  C  C    . LEU A 1 14  ? 1.555   -17.604 0.298   1.00 0.00 ? 22  LEU B C    6  
ATOM   9960  O  O    . LEU A 1 14  ? 1.842   -16.486 -0.132  1.00 0.00 ? 22  LEU B O    6  
ATOM   9961  C  CB   . LEU A 1 14  ? -0.550  -18.215 1.525   1.00 0.00 ? 22  LEU B CB   6  
ATOM   9962  C  CG   . LEU A 1 14  ? -0.754  -19.631 0.977   1.00 0.00 ? 22  LEU B CG   6  
ATOM   9963  C  CD1  . LEU A 1 14  ? -0.164  -20.664 1.927   1.00 0.00 ? 22  LEU B CD1  6  
ATOM   9964  C  CD2  . LEU A 1 14  ? -2.232  -19.903 0.745   1.00 0.00 ? 22  LEU B CD2  6  
ATOM   9965  H  H    . LEU A 1 14  ? 1.505   -16.524 3.281   1.00 0.00 ? 22  LEU B H    6  
ATOM   9966  H  HA   . LEU A 1 14  ? 1.453   -18.532 2.218   1.00 0.00 ? 22  LEU B HA   6  
ATOM   9967  H  HB2  . LEU A 1 14  ? -1.022  -18.156 2.496   1.00 0.00 ? 22  LEU B HB2  6  
ATOM   9968  H  HB3  . LEU A 1 14  ? -1.046  -17.523 0.861   1.00 0.00 ? 22  LEU B HB3  6  
ATOM   9969  H  HG   . LEU A 1 14  ? -0.243  -19.720 0.030   1.00 0.00 ? 22  LEU B HG   6  
ATOM   9970  H  HD11 . LEU A 1 14  ? -0.623  -20.561 2.899   1.00 0.00 ? 22  LEU B HD11 6  
ATOM   9971  H  HD12 . LEU A 1 14  ? 0.901   -20.506 2.014   1.00 0.00 ? 22  LEU B HD12 6  
ATOM   9972  H  HD13 . LEU A 1 14  ? -0.351  -21.654 1.542   1.00 0.00 ? 22  LEU B HD13 6  
ATOM   9973  H  HD21 . LEU A 1 14  ? -2.354  -20.891 0.325   1.00 0.00 ? 22  LEU B HD21 6  
ATOM   9974  H  HD22 . LEU A 1 14  ? -2.629  -19.169 0.060   1.00 0.00 ? 22  LEU B HD22 6  
ATOM   9975  H  HD23 . LEU A 1 14  ? -2.762  -19.844 1.684   1.00 0.00 ? 22  LEU B HD23 6  
ATOM   9976  N  N    . ARG A 1 15  ? 1.784   -18.721 -0.385  1.00 0.00 ? 23  ARG B N    6  
ATOM   9977  C  CA   . ARG A 1 15  ? 2.395   -18.701 -1.710  1.00 0.00 ? 23  ARG B CA   6  
ATOM   9978  C  C    . ARG A 1 15  ? 1.536   -17.918 -2.697  1.00 0.00 ? 23  ARG B C    6  
ATOM   9979  O  O    . ARG A 1 15  ? 0.626   -18.525 -3.301  1.00 0.00 ? 23  ARG B O    6  
ATOM   9980  C  CB   . ARG A 1 15  ? 2.605   -20.129 -2.216  1.00 0.00 ? 23  ARG B CB   6  
ATOM   9981  C  CG   . ARG A 1 15  ? 3.360   -21.014 -1.238  1.00 0.00 ? 23  ARG B CG   6  
ATOM   9982  C  CD   . ARG A 1 15  ? 3.475   -22.440 -1.750  1.00 0.00 ? 23  ARG B CD   6  
ATOM   9983  N  NE   . ARG A 1 15  ? 4.035   -23.337 -0.743  1.00 0.00 ? 23  ARG B NE   6  
ATOM   9984  C  CZ   . ARG A 1 15  ? 3.958   -24.663 -0.810  1.00 0.00 ? 23  ARG B CZ   6  
ATOM   9985  N  NH1  . ARG A 1 15  ? 3.357   -25.246 -1.839  1.00 0.00 ? 23  ARG B NH1  6  
ATOM   9986  N  NH2  . ARG A 1 15  ? 4.485   -25.409 0.152   1.00 0.00 ? 23  ARG B NH2  6  
ATOM   9987  O  OXT  . ARG A 1 15  ? 1.782   -16.704 -2.861  1.00 0.00 ? 23  ARG B OXT  6  
ATOM   9988  H  H    . ARG A 1 15  ? 1.535   -19.582 0.012   1.00 0.00 ? 23  ARG B H    6  
ATOM   9989  H  HA   . ARG A 1 15  ? 3.356   -18.215 -1.623  1.00 0.00 ? 23  ARG B HA   6  
ATOM   9990  H  HB2  . ARG A 1 15  ? 1.641   -20.578 -2.404  1.00 0.00 ? 23  ARG B HB2  6  
ATOM   9991  H  HB3  . ARG A 1 15  ? 3.162   -20.093 -3.140  1.00 0.00 ? 23  ARG B HB3  6  
ATOM   9992  H  HG2  . ARG A 1 15  ? 4.352   -20.612 -1.098  1.00 0.00 ? 23  ARG B HG2  6  
ATOM   9993  H  HG3  . ARG A 1 15  ? 2.835   -21.020 -0.295  1.00 0.00 ? 23  ARG B HG3  6  
ATOM   9994  H  HD2  . ARG A 1 15  ? 2.492   -22.791 -2.025  1.00 0.00 ? 23  ARG B HD2  6  
ATOM   9995  H  HD3  . ARG A 1 15  ? 4.115   -22.446 -2.620  1.00 0.00 ? 23  ARG B HD3  6  
ATOM   9996  H  HE   . ARG A 1 15  ? 4.487   -22.931 0.026   1.00 0.00 ? 23  ARG B HE   6  
ATOM   9997  H  HH11 . ARG A 1 15  ? 2.959   -24.688 -2.568  1.00 0.00 ? 23  ARG B HH11 6  
ATOM   9998  H  HH12 . ARG A 1 15  ? 3.301   -26.243 -1.886  1.00 0.00 ? 23  ARG B HH12 6  
ATOM   9999  H  HH21 . ARG A 1 15  ? 4.939   -24.973 0.929   1.00 0.00 ? 23  ARG B HH21 6  
ATOM   10000 H  HH22 . ARG A 1 15  ? 4.425   -26.406 0.101   1.00 0.00 ? 23  ARG B HH22 6  
ATOM   10001 N  N    . GLY B 2 1   ? -18.369 0.454   -10.298 1.00 0.00 ? 259 GLY A N    6  
ATOM   10002 C  CA   . GLY B 2 1   ? -17.905 1.377   -9.226  1.00 0.00 ? 259 GLY A CA   6  
ATOM   10003 C  C    . GLY B 2 1   ? -17.074 0.672   -8.172  1.00 0.00 ? 259 GLY A C    6  
ATOM   10004 O  O    . GLY B 2 1   ? -16.498 1.316   -7.295  1.00 0.00 ? 259 GLY A O    6  
ATOM   10005 H  H1   . GLY B 2 1   ? -18.934 0.975   -10.999 1.00 0.00 ? 259 GLY A H1   6  
ATOM   10006 H  H2   . GLY B 2 1   ? -18.955 -0.302  -9.891  1.00 0.00 ? 259 GLY A H2   6  
ATOM   10007 H  H3   . GLY B 2 1   ? -17.552 0.023   -10.777 1.00 0.00 ? 259 GLY A H3   6  
ATOM   10008 H  HA2  . GLY B 2 1   ? -17.309 2.160   -9.673  1.00 0.00 ? 259 GLY A HA2  6  
ATOM   10009 H  HA3  . GLY B 2 1   ? -18.767 1.822   -8.751  1.00 0.00 ? 259 GLY A HA3  6  
ATOM   10010 N  N    . SER B 2 2   ? -17.014 -0.656  -8.258  1.00 0.00 ? 260 SER A N    6  
ATOM   10011 C  CA   . SER B 2 2   ? -16.250 -1.454  -7.303  1.00 0.00 ? 260 SER A CA   6  
ATOM   10012 C  C    . SER B 2 2   ? -16.694 -1.200  -5.879  1.00 0.00 ? 260 SER A C    6  
ATOM   10013 O  O    . SER B 2 2   ? -17.690 -0.521  -5.628  1.00 0.00 ? 260 SER A O    6  
ATOM   10014 C  CB   . SER B 2 2   ? -14.765 -1.158  -7.406  1.00 0.00 ? 260 SER A CB   6  
ATOM   10015 O  OG   . SER B 2 2   ? -14.207 -1.708  -8.586  1.00 0.00 ? 260 SER A OG   6  
ATOM   10016 H  H    . SER B 2 2   ? -17.494 -1.109  -8.982  1.00 0.00 ? 260 SER A H    6  
ATOM   10017 H  HA   . SER B 2 2   ? -16.405 -2.494  -7.526  1.00 0.00 ? 260 SER A HA   6  
ATOM   10018 H  HB2  . SER B 2 2   ? -14.611 -0.090  -7.409  1.00 0.00 ? 260 SER A HB2  6  
ATOM   10019 H  HB3  . SER B 2 2   ? -14.274 -1.594  -6.546  1.00 0.00 ? 260 SER A HB3  6  
ATOM   10020 H  HG   . SER B 2 2   ? -13.608 -1.072  -8.983  1.00 0.00 ? 260 SER A HG   6  
ATOM   10021 N  N    . TYR B 2 3   ? -15.935 -1.759  -4.950  1.00 0.00 ? 261 TYR A N    6  
ATOM   10022 C  CA   . TYR B 2 3   ? -16.222 -1.608  -3.543  1.00 0.00 ? 261 TYR A CA   6  
ATOM   10023 C  C    . TYR B 2 3   ? -15.044 -2.065  -2.698  1.00 0.00 ? 261 TYR A C    6  
ATOM   10024 O  O    . TYR B 2 3   ? -14.185 -2.814  -3.162  1.00 0.00 ? 261 TYR A O    6  
ATOM   10025 C  CB   . TYR B 2 3   ? -17.456 -2.425  -3.170  1.00 0.00 ? 261 TYR A CB   6  
ATOM   10026 C  CG   . TYR B 2 3   ? -17.428 -3.857  -3.656  1.00 0.00 ? 261 TYR A CG   6  
ATOM   10027 C  CD1  . TYR B 2 3   ? -16.388 -4.696  -3.313  1.00 0.00 ? 261 TYR A CD1  6  
ATOM   10028 C  CD2  . TYR B 2 3   ? -18.455 -4.373  -4.438  1.00 0.00 ? 261 TYR A CD2  6  
ATOM   10029 C  CE1  . TYR B 2 3   ? -16.353 -6.004  -3.727  1.00 0.00 ? 261 TYR A CE1  6  
ATOM   10030 C  CE2  . TYR B 2 3   ? -18.432 -5.689  -4.864  1.00 0.00 ? 261 TYR A CE2  6  
ATOM   10031 C  CZ   . TYR B 2 3   ? -17.377 -6.502  -4.505  1.00 0.00 ? 261 TYR A CZ   6  
ATOM   10032 O  OH   . TYR B 2 3   ? -17.348 -7.812  -4.922  1.00 0.00 ? 261 TYR A OH   6  
ATOM   10033 H  H    . TYR B 2 3   ? -15.167 -2.302  -5.222  1.00 0.00 ? 261 TYR A H    6  
ATOM   10034 H  HA   . TYR B 2 3   ? -16.414 -0.566  -3.346  1.00 0.00 ? 261 TYR A HA   6  
ATOM   10035 H  HB2  . TYR B 2 3   ? -17.538 -2.445  -2.102  1.00 0.00 ? 261 TYR A HB2  6  
ATOM   10036 H  HB3  . TYR B 2 3   ? -18.327 -1.960  -3.576  1.00 0.00 ? 261 TYR A HB3  6  
ATOM   10037 H  HD1  . TYR B 2 3   ? -15.583 -4.304  -2.714  1.00 0.00 ? 261 TYR A HD1  6  
ATOM   10038 H  HD2  . TYR B 2 3   ? -19.278 -3.732  -4.716  1.00 0.00 ? 261 TYR A HD2  6  
ATOM   10039 H  HE1  . TYR B 2 3   ? -15.530 -6.631  -3.433  1.00 0.00 ? 261 TYR A HE1  6  
ATOM   10040 H  HE2  . TYR B 2 3   ? -19.236 -6.073  -5.474  1.00 0.00 ? 261 TYR A HE2  6  
ATOM   10041 H  HH   . TYR B 2 3   ? -17.152 -8.383  -4.174  1.00 0.00 ? 261 TYR A HH   6  
ATOM   10042 N  N    . CYS B 2 4   ? -14.995 -1.588  -1.467  1.00 0.00 ? 262 CYS A N    6  
ATOM   10043 C  CA   . CYS B 2 4   ? -13.959 -1.986  -0.540  1.00 0.00 ? 262 CYS A CA   6  
ATOM   10044 C  C    . CYS B 2 4   ? -14.090 -3.467  -0.221  1.00 0.00 ? 262 CYS A C    6  
ATOM   10045 O  O    . CYS B 2 4   ? -15.177 -3.952  0.057   1.00 0.00 ? 262 CYS A O    6  
ATOM   10046 C  CB   . CYS B 2 4   ? -14.100 -1.166  0.728   1.00 0.00 ? 262 CYS A CB   6  
ATOM   10047 S  SG   . CYS B 2 4   ? -13.530 -1.957  2.263   1.00 0.00 ? 262 CYS A SG   6  
ATOM   10048 H  H    . CYS B 2 4   ? -15.650 -0.913  -1.182  1.00 0.00 ? 262 CYS A H    6  
ATOM   10049 H  HA   . CYS B 2 4   ? -13.000 -1.785  -0.996  1.00 0.00 ? 262 CYS A HA   6  
ATOM   10050 H  HB2  . CYS B 2 4   ? -13.547 -0.255  0.619   1.00 0.00 ? 262 CYS A HB2  6  
ATOM   10051 H  HB3  . CYS B 2 4   ? -15.144 -0.921  0.862   1.00 0.00 ? 262 CYS A HB3  6  
ATOM   10052 N  N    . ASP B 2 5   ? -12.985 -4.182  -0.271  1.00 0.00 ? 263 ASP A N    6  
ATOM   10053 C  CA   . ASP B 2 5   ? -12.996 -5.612  0.024   1.00 0.00 ? 263 ASP A CA   6  
ATOM   10054 C  C    . ASP B 2 5   ? -13.252 -5.859  1.517   1.00 0.00 ? 263 ASP A C    6  
ATOM   10055 O  O    . ASP B 2 5   ? -13.245 -6.997  1.985   1.00 0.00 ? 263 ASP A O    6  
ATOM   10056 C  CB   . ASP B 2 5   ? -11.659 -6.226  -0.394  1.00 0.00 ? 263 ASP A CB   6  
ATOM   10057 C  CG   . ASP B 2 5   ? -11.553 -7.702  -0.070  1.00 0.00 ? 263 ASP A CG   6  
ATOM   10058 O  OD1  . ASP B 2 5   ? -12.444 -8.469  -0.492  1.00 0.00 ? 263 ASP A OD1  6  
ATOM   10059 O  OD2  . ASP B 2 5   ? -10.578 -8.091  0.607   1.00 0.00 ? 263 ASP A OD2  6  
ATOM   10060 H  H    . ASP B 2 5   ? -12.145 -3.743  -0.526  1.00 0.00 ? 263 ASP A H    6  
ATOM   10061 H  HA   . ASP B 2 5   ? -13.796 -6.065  -0.553  1.00 0.00 ? 263 ASP A HA   6  
ATOM   10062 H  HB2  . ASP B 2 5   ? -11.532 -6.102  -1.460  1.00 0.00 ? 263 ASP A HB2  6  
ATOM   10063 H  HB3  . ASP B 2 5   ? -10.865 -5.705  0.120   1.00 0.00 ? 263 ASP A HB3  6  
ATOM   10064 N  N    . PHE B 2 6   ? -13.485 -4.774  2.249   1.00 0.00 ? 264 PHE A N    6  
ATOM   10065 C  CA   . PHE B 2 6   ? -13.738 -4.839  3.691   1.00 0.00 ? 264 PHE A CA   6  
ATOM   10066 C  C    . PHE B 2 6   ? -15.215 -4.548  4.027   1.00 0.00 ? 264 PHE A C    6  
ATOM   10067 O  O    . PHE B 2 6   ? -15.727 -5.055  5.024   1.00 0.00 ? 264 PHE A O    6  
ATOM   10068 C  CB   . PHE B 2 6   ? -12.805 -3.870  4.453   1.00 0.00 ? 264 PHE A CB   6  
ATOM   10069 C  CG   . PHE B 2 6   ? -11.342 -4.036  4.130   1.00 0.00 ? 264 PHE A CG   6  
ATOM   10070 C  CD1  . PHE B 2 6   ? -10.845 -3.689  2.883   1.00 0.00 ? 264 PHE A CD1  6  
ATOM   10071 C  CD2  . PHE B 2 6   ? -10.460 -4.524  5.082   1.00 0.00 ? 264 PHE A CD2  6  
ATOM   10072 C  CE1  . PHE B 2 6   ? -9.504  -3.826  2.591   1.00 0.00 ? 264 PHE A CE1  6  
ATOM   10073 C  CE2  . PHE B 2 6   ? -9.115  -4.665  4.793   1.00 0.00 ? 264 PHE A CE2  6  
ATOM   10074 C  CZ   . PHE B 2 6   ? -8.637  -4.315  3.545   1.00 0.00 ? 264 PHE A CZ   6  
ATOM   10075 H  H    . PHE B 2 6   ? -13.482 -3.908  1.807   1.00 0.00 ? 264 PHE A H    6  
ATOM   10076 H  HA   . PHE B 2 6   ? -13.517 -5.845  4.006   1.00 0.00 ? 264 PHE A HA   6  
ATOM   10077 H  HB2  . PHE B 2 6   ? -13.078 -2.860  4.214   1.00 0.00 ? 264 PHE A HB2  6  
ATOM   10078 H  HB3  . PHE B 2 6   ? -12.922 -4.009  5.511   1.00 0.00 ? 264 PHE A HB3  6  
ATOM   10079 H  HD1  . PHE B 2 6   ? -11.521 -3.309  2.133   1.00 0.00 ? 264 PHE A HD1  6  
ATOM   10080 H  HD2  . PHE B 2 6   ? -10.832 -4.798  6.058   1.00 0.00 ? 264 PHE A HD2  6  
ATOM   10081 H  HE1  . PHE B 2 6   ? -9.132  -3.551  1.613   1.00 0.00 ? 264 PHE A HE1  6  
ATOM   10082 H  HE2  . PHE B 2 6   ? -8.438  -5.048  5.544   1.00 0.00 ? 264 PHE A HE2  6  
ATOM   10083 H  HZ   . PHE B 2 6   ? -7.587  -4.423  3.315   1.00 0.00 ? 264 PHE A HZ   6  
ATOM   10084 N  N    . CYS B 2 7   ? -15.906 -3.735  3.204   1.00 0.00 ? 265 CYS A N    6  
ATOM   10085 C  CA   . CYS B 2 7   ? -17.327 -3.433  3.461   1.00 0.00 ? 265 CYS A CA   6  
ATOM   10086 C  C    . CYS B 2 7   ? -18.178 -3.636  2.214   1.00 0.00 ? 265 CYS A C    6  
ATOM   10087 O  O    . CYS B 2 7   ? -19.400 -3.763  2.292   1.00 0.00 ? 265 CYS A O    6  
ATOM   10088 C  CB   . CYS B 2 7   ? -17.528 -2.027  4.015   1.00 0.00 ? 265 CYS A CB   6  
ATOM   10089 S  SG   . CYS B 2 7   ? -16.184 -1.483  5.083   1.00 0.00 ? 265 CYS A SG   6  
ATOM   10090 H  H    . CYS B 2 7   ? -15.460 -3.344  2.418   1.00 0.00 ? 265 CYS A H    6  
ATOM   10091 H  HA   . CYS B 2 7   ? -17.660 -4.129  4.207   1.00 0.00 ? 265 CYS A HA   6  
ATOM   10092 H  HB2  . CYS B 2 7   ? -17.647 -1.317  3.226   1.00 0.00 ? 265 CYS A HB2  6  
ATOM   10093 H  HB3  . CYS B 2 7   ? -18.428 -2.024  4.612   1.00 0.00 ? 265 CYS A HB3  6  
ATOM   10094 N  N    . LEU B 2 8   ? -17.509 -3.669  1.072   1.00 0.00 ? 266 LEU A N    6  
ATOM   10095 C  CA   . LEU B 2 8   ? -18.143 -3.883  -0.209  1.00 0.00 ? 266 LEU A CA   6  
ATOM   10096 C  C    . LEU B 2 8   ? -19.141 -2.800  -0.583  1.00 0.00 ? 266 LEU A C    6  
ATOM   10097 O  O    . LEU B 2 8   ? -20.244 -3.089  -1.041  1.00 0.00 ? 266 LEU A O    6  
ATOM   10098 C  CB   . LEU B 2 8   ? -18.804 -5.226  -0.198  1.00 0.00 ? 266 LEU A CB   6  
ATOM   10099 C  CG   . LEU B 2 8   ? -17.939 -6.341  0.355   1.00 0.00 ? 266 LEU A CG   6  
ATOM   10100 C  CD1  . LEU B 2 8   ? -18.720 -7.634  0.379   1.00 0.00 ? 266 LEU A CD1  6  
ATOM   10101 C  CD2  . LEU B 2 8   ? -16.662 -6.485  -0.459  1.00 0.00 ? 266 LEU A CD2  6  
ATOM   10102 H  H    . LEU B 2 8   ? -16.553 -3.573  1.092   1.00 0.00 ? 266 LEU A H    6  
ATOM   10103 H  HA   . LEU B 2 8   ? -17.369 -3.903  -0.948  1.00 0.00 ? 266 LEU A HA   6  
ATOM   10104 H  HB2  . LEU B 2 8   ? -19.680 -5.147  0.405   1.00 0.00 ? 266 LEU A HB2  6  
ATOM   10105 H  HB3  . LEU B 2 8   ? -19.081 -5.475  -1.198  1.00 0.00 ? 266 LEU A HB3  6  
ATOM   10106 H  HG   . LEU B 2 8   ? -17.671 -6.094  1.367   1.00 0.00 ? 266 LEU A HG   6  
ATOM   10107 H  HD11 . LEU B 2 8   ? -19.629 -7.475  0.930   1.00 0.00 ? 266 LEU A HD11 6  
ATOM   10108 H  HD12 . LEU B 2 8   ? -18.135 -8.405  0.857   1.00 0.00 ? 266 LEU A HD12 6  
ATOM   10109 H  HD13 . LEU B 2 8   ? -18.958 -7.931  -0.631  1.00 0.00 ? 266 LEU A HD13 6  
ATOM   10110 H  HD21 . LEU B 2 8   ? -16.366 -5.512  -0.839  1.00 0.00 ? 266 LEU A HD21 6  
ATOM   10111 H  HD22 . LEU B 2 8   ? -16.835 -7.159  -1.285  1.00 0.00 ? 266 LEU A HD22 6  
ATOM   10112 H  HD23 . LEU B 2 8   ? -15.877 -6.880  0.170   1.00 0.00 ? 266 LEU A HD23 6  
ATOM   10113 N  N    . GLY B 2 9   ? -18.736 -1.554  -0.405  1.00 0.00 ? 267 GLY A N    6  
ATOM   10114 C  CA   . GLY B 2 9   ? -19.596 -0.439  -0.764  1.00 0.00 ? 267 GLY A CA   6  
ATOM   10115 C  C    . GLY B 2 9   ? -19.170 0.217   -2.063  1.00 0.00 ? 267 GLY A C    6  
ATOM   10116 O  O    . GLY B 2 9   ? -19.700 -0.111  -3.125  1.00 0.00 ? 267 GLY A O    6  
ATOM   10117 H  H    . GLY B 2 9   ? -17.852 -1.393  -0.014  1.00 0.00 ? 267 GLY A H    6  
ATOM   10118 H  HA2  . GLY B 2 9   ? -20.607 -0.806  -0.877  1.00 0.00 ? 267 GLY A HA2  6  
ATOM   10119 H  HA3  . GLY B 2 9   ? -19.580 0.289   0.026   1.00 0.00 ? 267 GLY A HA3  6  
ATOM   10120 N  N    . GLY B 2 10  ? -18.216 1.144   -1.991  1.00 0.00 ? 268 GLY A N    6  
ATOM   10121 C  CA   . GLY B 2 10  ? -17.750 1.799   -3.198  1.00 0.00 ? 268 GLY A CA   6  
ATOM   10122 C  C    . GLY B 2 10  ? -16.962 3.067   -2.930  1.00 0.00 ? 268 GLY A C    6  
ATOM   10123 O  O    . GLY B 2 10  ? -16.882 3.538   -1.796  1.00 0.00 ? 268 GLY A O    6  
ATOM   10124 H  H    . GLY B 2 10  ? -17.833 1.389   -1.118  1.00 0.00 ? 268 GLY A H    6  
ATOM   10125 H  HA2  . GLY B 2 10  ? -17.109 1.109   -3.737  1.00 0.00 ? 268 GLY A HA2  6  
ATOM   10126 H  HA3  . GLY B 2 10  ? -18.599 2.038   -3.817  1.00 0.00 ? 268 GLY A HA3  6  
ATOM   10127 N  N    . SER B 2 11  ? -16.376 3.612   -3.993  1.00 0.00 ? 269 SER A N    6  
ATOM   10128 C  CA   . SER B 2 11  ? -15.567 4.819   -3.902  1.00 0.00 ? 269 SER A CA   6  
ATOM   10129 C  C    . SER B 2 11  ? -16.441 6.064   -3.864  1.00 0.00 ? 269 SER A C    6  
ATOM   10130 O  O    . SER B 2 11  ? -15.951 7.191   -3.828  1.00 0.00 ? 269 SER A O    6  
ATOM   10131 C  CB   . SER B 2 11  ? -14.591 4.866   -5.066  1.00 0.00 ? 269 SER A CB   6  
ATOM   10132 O  OG   . SER B 2 11  ? -14.112 6.177   -5.294  1.00 0.00 ? 269 SER A OG   6  
ATOM   10133 H  H    . SER B 2 11  ? -16.491 3.185   -4.867  1.00 0.00 ? 269 SER A H    6  
ATOM   10134 H  HA   . SER B 2 11  ? -15.007 4.765   -2.991  1.00 0.00 ? 269 SER A HA   6  
ATOM   10135 H  HB2  . SER B 2 11  ? -13.754 4.213   -4.853  1.00 0.00 ? 269 SER A HB2  6  
ATOM   10136 H  HB3  . SER B 2 11  ? -15.089 4.521   -5.941  1.00 0.00 ? 269 SER A HB3  6  
ATOM   10137 H  HG   . SER B 2 11  ? -14.120 6.670   -4.471  1.00 0.00 ? 269 SER A HG   6  
ATOM   10138 N  N    . ASN B 2 12  ? -17.741 5.837   -3.877  1.00 0.00 ? 270 ASN A N    6  
ATOM   10139 C  CA   . ASN B 2 12  ? -18.719 6.906   -3.814  1.00 0.00 ? 270 ASN A CA   6  
ATOM   10140 C  C    . ASN B 2 12  ? -19.817 6.492   -2.858  1.00 0.00 ? 270 ASN A C    6  
ATOM   10141 O  O    . ASN B 2 12  ? -20.917 7.046   -2.869  1.00 0.00 ? 270 ASN A O    6  
ATOM   10142 C  CB   . ASN B 2 12  ? -19.293 7.197   -5.192  1.00 0.00 ? 270 ASN A CB   6  
ATOM   10143 C  CG   . ASN B 2 12  ? -20.166 6.078   -5.711  1.00 0.00 ? 270 ASN A CG   6  
ATOM   10144 O  OD1  . ASN B 2 12  ? -21.367 6.034   -5.439  1.00 0.00 ? 270 ASN A OD1  6  
ATOM   10145 N  ND2  . ASN B 2 12  ? -19.571 5.169   -6.465  1.00 0.00 ? 270 ASN A ND2  6  
ATOM   10146 H  H    . ASN B 2 12  ? -18.058 4.912   -3.934  1.00 0.00 ? 270 ASN A H    6  
ATOM   10147 H  HA   . ASN B 2 12  ? -18.241 7.796   -3.435  1.00 0.00 ? 270 ASN A HA   6  
ATOM   10148 H  HB2  . ASN B 2 12  ? -19.884 8.090   -5.139  1.00 0.00 ? 270 ASN A HB2  6  
ATOM   10149 H  HB3  . ASN B 2 12  ? -18.481 7.348   -5.886  1.00 0.00 ? 270 ASN A HB3  6  
ATOM   10150 H  HD21 . ASN B 2 12  ? -18.612 5.269   -6.642  1.00 0.00 ? 270 ASN A HD21 6  
ATOM   10151 H  HD22 . ASN B 2 12  ? -20.114 4.439   -6.816  1.00 0.00 ? 270 ASN A HD22 6  
ATOM   10152 N  N    . MET B 2 13  ? -19.495 5.506   -2.023  1.00 0.00 ? 271 MET A N    6  
ATOM   10153 C  CA   . MET B 2 13  ? -20.451 4.987   -1.058  1.00 0.00 ? 271 MET A CA   6  
ATOM   10154 C  C    . MET B 2 13  ? -19.791 4.016   -0.087  1.00 0.00 ? 271 MET A C    6  
ATOM   10155 O  O    . MET B 2 13  ? -19.084 3.100   -0.501  1.00 0.00 ? 271 MET A O    6  
ATOM   10156 C  CB   . MET B 2 13  ? -21.583 4.269   -1.788  1.00 0.00 ? 271 MET A CB   6  
ATOM   10157 C  CG   . MET B 2 13  ? -22.702 3.796   -0.877  1.00 0.00 ? 271 MET A CG   6  
ATOM   10158 S  SD   . MET B 2 13  ? -24.006 5.027   -0.685  1.00 0.00 ? 271 MET A SD   6  
ATOM   10159 C  CE   . MET B 2 13  ? -23.252 6.151   0.486   1.00 0.00 ? 271 MET A CE   6  
ATOM   10160 H  H    . MET B 2 13  ? -18.586 5.122   -2.060  1.00 0.00 ? 271 MET A H    6  
ATOM   10161 H  HA   . MET B 2 13  ? -20.855 5.823   -0.507  1.00 0.00 ? 271 MET A HA   6  
ATOM   10162 H  HB2  . MET B 2 13  ? -22.004 4.938   -2.524  1.00 0.00 ? 271 MET A HB2  6  
ATOM   10163 H  HB3  . MET B 2 13  ? -21.173 3.405   -2.293  1.00 0.00 ? 271 MET A HB3  6  
ATOM   10164 H  HG2  . MET B 2 13  ? -23.134 2.898   -1.294  1.00 0.00 ? 271 MET A HG2  6  
ATOM   10165 H  HG3  . MET B 2 13  ? -22.286 3.577   0.097   1.00 0.00 ? 271 MET A HG3  6  
ATOM   10166 H  HE1  . MET B 2 13  ? -22.260 6.421   0.150   1.00 0.00 ? 271 MET A HE1  6  
ATOM   10167 H  HE2  . MET B 2 13  ? -23.186 5.670   1.450   1.00 0.00 ? 271 MET A HE2  6  
ATOM   10168 H  HE3  . MET B 2 13  ? -23.857 7.042   0.570   1.00 0.00 ? 271 MET A HE3  6  
ATOM   10169 N  N    . ASN B 2 14  ? -20.030 4.215   1.204   1.00 0.00 ? 272 ASN A N    6  
ATOM   10170 C  CA   . ASN B 2 14  ? -19.475 3.330   2.217   1.00 0.00 ? 272 ASN A CA   6  
ATOM   10171 C  C    . ASN B 2 14  ? -20.571 2.430   2.768   1.00 0.00 ? 272 ASN A C    6  
ATOM   10172 O  O    . ASN B 2 14  ? -21.728 2.835   2.882   1.00 0.00 ? 272 ASN A O    6  
ATOM   10173 C  CB   . ASN B 2 14  ? -18.801 4.122   3.339   1.00 0.00 ? 272 ASN A CB   6  
ATOM   10174 C  CG   . ASN B 2 14  ? -17.665 4.977   2.829   1.00 0.00 ? 272 ASN A CG   6  
ATOM   10175 O  OD1  . ASN B 2 14  ? -17.074 4.678   1.795   1.00 0.00 ? 272 ASN A OD1  6  
ATOM   10176 N  ND2  . ASN B 2 14  ? -17.352 6.044   3.556   1.00 0.00 ? 272 ASN A ND2  6  
ATOM   10177 H  H    . ASN B 2 14  ? -20.591 4.969   1.479   1.00 0.00 ? 272 ASN A H    6  
ATOM   10178 H  HA   . ASN B 2 14  ? -18.734 2.709   1.735   1.00 0.00 ? 272 ASN A HA   6  
ATOM   10179 H  HB2  . ASN B 2 14  ? -19.527 4.763   3.815   1.00 0.00 ? 272 ASN A HB2  6  
ATOM   10180 H  HB3  . ASN B 2 14  ? -18.400 3.435   4.063   1.00 0.00 ? 272 ASN A HB3  6  
ATOM   10181 H  HD21 . ASN B 2 14  ? -17.869 6.215   4.371   1.00 0.00 ? 272 ASN A HD21 6  
ATOM   10182 H  HD22 . ASN B 2 14  ? -16.619 6.616   3.248   1.00 0.00 ? 272 ASN A HD22 6  
ATOM   10183 N  N    . LYS B 2 15  ? -20.197 1.208   3.102   1.00 0.00 ? 273 LYS A N    6  
ATOM   10184 C  CA   . LYS B 2 15  ? -21.140 0.220   3.605   1.00 0.00 ? 273 LYS A CA   6  
ATOM   10185 C  C    . LYS B 2 15  ? -21.202 0.200   5.111   1.00 0.00 ? 273 LYS A C    6  
ATOM   10186 O  O    . LYS B 2 15  ? -22.056 -0.457  5.705   1.00 0.00 ? 273 LYS A O    6  
ATOM   10187 C  CB   . LYS B 2 15  ? -20.717 -1.138  3.102   1.00 0.00 ? 273 LYS A CB   6  
ATOM   10188 C  CG   . LYS B 2 15  ? -21.240 -1.412  1.738   1.00 0.00 ? 273 LYS A CG   6  
ATOM   10189 C  CD   . LYS B 2 15  ? -22.249 -2.534  1.721   1.00 0.00 ? 273 LYS A CD   6  
ATOM   10190 C  CE   . LYS B 2 15  ? -22.828 -2.673  0.334   1.00 0.00 ? 273 LYS A CE   6  
ATOM   10191 N  NZ   . LYS B 2 15  ? -23.116 -4.091  -0.017  1.00 0.00 ? 273 LYS A NZ   6  
ATOM   10192 H  H    . LYS B 2 15  ? -19.254 0.959   3.008   1.00 0.00 ? 273 LYS A H    6  
ATOM   10193 H  HA   . LYS B 2 15  ? -22.114 0.452   3.209   1.00 0.00 ? 273 LYS A HA   6  
ATOM   10194 H  HB2  . LYS B 2 15  ? -19.646 -1.165  3.052   1.00 0.00 ? 273 LYS A HB2  6  
ATOM   10195 H  HB3  . LYS B 2 15  ? -21.061 -1.903  3.768   1.00 0.00 ? 273 LYS A HB3  6  
ATOM   10196 H  HG2  . LYS B 2 15  ? -21.704 -0.518  1.371   1.00 0.00 ? 273 LYS A HG2  6  
ATOM   10197 H  HG3  . LYS B 2 15  ? -20.414 -1.667  1.108   1.00 0.00 ? 273 LYS A HG3  6  
ATOM   10198 H  HD2  . LYS B 2 15  ? -21.762 -3.458  1.999   1.00 0.00 ? 273 LYS A HD2  6  
ATOM   10199 H  HD3  . LYS B 2 15  ? -23.042 -2.309  2.416   1.00 0.00 ? 273 LYS A HD3  6  
ATOM   10200 H  HE2  . LYS B 2 15  ? -23.743 -2.102  0.280   1.00 0.00 ? 273 LYS A HE2  6  
ATOM   10201 H  HE3  . LYS B 2 15  ? -22.106 -2.268  -0.363  1.00 0.00 ? 273 LYS A HE3  6  
ATOM   10202 H  HZ1  . LYS B 2 15  ? -22.252 -4.663  0.070   1.00 0.00 ? 273 LYS A HZ1  6  
ATOM   10203 H  HZ2  . LYS B 2 15  ? -23.463 -4.153  -0.996  1.00 0.00 ? 273 LYS A HZ2  6  
ATOM   10204 H  HZ3  . LYS B 2 15  ? -23.841 -4.476  0.620   1.00 0.00 ? 273 LYS A HZ3  6  
ATOM   10205 N  N    . LYS B 2 16  ? -20.293 0.920   5.719   1.00 0.00 ? 274 LYS A N    6  
ATOM   10206 C  CA   . LYS B 2 16  ? -20.218 0.967   7.163   1.00 0.00 ? 274 LYS A CA   6  
ATOM   10207 C  C    . LYS B 2 16  ? -20.302 2.402   7.673   1.00 0.00 ? 274 LYS A C    6  
ATOM   10208 O  O    . LYS B 2 16  ? -20.207 2.658   8.874   1.00 0.00 ? 274 LYS A O    6  
ATOM   10209 C  CB   . LYS B 2 16  ? -18.949 0.265   7.610   1.00 0.00 ? 274 LYS A CB   6  
ATOM   10210 C  CG   . LYS B 2 16  ? -17.886 0.412   6.588   1.00 0.00 ? 274 LYS A CG   6  
ATOM   10211 C  CD   . LYS B 2 16  ? -17.456 1.852   6.487   1.00 0.00 ? 274 LYS A CD   6  
ATOM   10212 C  CE   . LYS B 2 16  ? -16.604 2.093   5.269   1.00 0.00 ? 274 LYS A CE   6  
ATOM   10213 N  NZ   . LYS B 2 16  ? -15.205 1.640   5.472   1.00 0.00 ? 274 LYS A NZ   6  
ATOM   10214 H  H    . LYS B 2 16  ? -19.655 1.433   5.181   1.00 0.00 ? 274 LYS A H    6  
ATOM   10215 H  HA   . LYS B 2 16  ? -21.040 0.426   7.527   1.00 0.00 ? 274 LYS A HA   6  
ATOM   10216 H  HB2  . LYS B 2 16  ? -18.604 0.681   8.538   1.00 0.00 ? 274 LYS A HB2  6  
ATOM   10217 H  HB3  . LYS B 2 16  ? -19.148 -0.790  7.726   1.00 0.00 ? 274 LYS A HB3  6  
ATOM   10218 H  HG2  . LYS B 2 16  ? -17.048 -0.226  6.823   1.00 0.00 ? 274 LYS A HG2  6  
ATOM   10219 H  HG3  . LYS B 2 16  ? -18.317 0.114   5.654   1.00 0.00 ? 274 LYS A HG3  6  
ATOM   10220 H  HD2  . LYS B 2 16  ? -18.348 2.453   6.411   1.00 0.00 ? 274 LYS A HD2  6  
ATOM   10221 H  HD3  . LYS B 2 16  ? -16.902 2.124   7.374   1.00 0.00 ? 274 LYS A HD3  6  
ATOM   10222 H  HE2  . LYS B 2 16  ? -17.038 1.545   4.449   1.00 0.00 ? 274 LYS A HE2  6  
ATOM   10223 H  HE3  . LYS B 2 16  ? -16.607 3.149   5.041   1.00 0.00 ? 274 LYS A HE3  6  
ATOM   10224 H  HZ1  . LYS B 2 16  ? -14.627 1.882   4.642   1.00 0.00 ? 274 LYS A HZ1  6  
ATOM   10225 H  HZ2  . LYS B 2 16  ? -15.179 0.611   5.610   1.00 0.00 ? 274 LYS A HZ2  6  
ATOM   10226 H  HZ3  . LYS B 2 16  ? -14.798 2.101   6.312   1.00 0.00 ? 274 LYS A HZ3  6  
ATOM   10227 N  N    . SER B 2 17  ? -20.482 3.332   6.737   1.00 0.00 ? 275 SER A N    6  
ATOM   10228 C  CA   . SER B 2 17  ? -20.609 4.744   7.059   1.00 0.00 ? 275 SER A CA   6  
ATOM   10229 C  C    . SER B 2 17  ? -21.688 5.374   6.222   1.00 0.00 ? 275 SER A C    6  
ATOM   10230 O  O    . SER B 2 17  ? -22.329 6.346   6.621   1.00 0.00 ? 275 SER A O    6  
ATOM   10231 C  CB   . SER B 2 17  ? -19.316 5.496   6.781   1.00 0.00 ? 275 SER A CB   6  
ATOM   10232 O  OG   . SER B 2 17  ? -18.181 4.752   7.189   1.00 0.00 ? 275 SER A OG   6  
ATOM   10233 H  H    . SER B 2 17  ? -20.523 3.060   5.798   1.00 0.00 ? 275 SER A H    6  
ATOM   10234 H  HA   . SER B 2 17  ? -20.865 4.837   8.091   1.00 0.00 ? 275 SER A HA   6  
ATOM   10235 H  HB2  . SER B 2 17  ? -19.247 5.705   5.720   1.00 0.00 ? 275 SER A HB2  6  
ATOM   10236 H  HB3  . SER B 2 17  ? -19.338 6.425   7.316   1.00 0.00 ? 275 SER A HB3  6  
ATOM   10237 H  HG   . SER B 2 17  ? -17.436 4.968   6.624   1.00 0.00 ? 275 SER A HG   6  
ATOM   10238 N  N    . GLY B 2 18  ? -21.881 4.797   5.058   1.00 0.00 ? 276 GLY A N    6  
ATOM   10239 C  CA   . GLY B 2 18  ? -22.842 5.325   4.132   1.00 0.00 ? 276 GLY A CA   6  
ATOM   10240 C  C    . GLY B 2 18  ? -22.319 6.591   3.515   1.00 0.00 ? 276 GLY A C    6  
ATOM   10241 O  O    . GLY B 2 18  ? -23.084 7.431   3.040   1.00 0.00 ? 276 GLY A O    6  
ATOM   10242 H  H    . GLY B 2 18  ? -21.367 3.998   4.834   1.00 0.00 ? 276 GLY A H    6  
ATOM   10243 H  HA2  . GLY B 2 18  ? -23.027 4.598   3.357   1.00 0.00 ? 276 GLY A HA2  6  
ATOM   10244 H  HA3  . GLY B 2 18  ? -23.755 5.540   4.653   1.00 0.00 ? 276 GLY A HA3  6  
ATOM   10245 N  N    . ARG B 2 19  ? -20.997 6.737   3.547   1.00 0.00 ? 277 ARG A N    6  
ATOM   10246 C  CA   . ARG B 2 19  ? -20.361 7.921   2.985   1.00 0.00 ? 277 ARG A CA   6  
ATOM   10247 C  C    . ARG B 2 19  ? -19.620 7.658   1.682   1.00 0.00 ? 277 ARG A C    6  
ATOM   10248 O  O    . ARG B 2 19  ? -19.160 6.560   1.398   1.00 0.00 ? 277 ARG A O    6  
ATOM   10249 C  CB   . ARG B 2 19  ? -19.359 8.576   3.936   1.00 0.00 ? 277 ARG A CB   6  
ATOM   10250 C  CG   . ARG B 2 19  ? -19.840 8.806   5.349   1.00 0.00 ? 277 ARG A CG   6  
ATOM   10251 C  CD   . ARG B 2 19  ? -21.261 9.302   5.361   1.00 0.00 ? 277 ARG A CD   6  
ATOM   10252 N  NE   . ARG B 2 19  ? -21.952 8.989   6.607   1.00 0.00 ? 277 ARG A NE   6  
ATOM   10253 C  CZ   . ARG B 2 19  ? -23.266 9.112   6.774   1.00 0.00 ? 277 ARG A CZ   6  
ATOM   10254 N  NH1  . ARG B 2 19  ? -24.028 9.540   5.776   1.00 0.00 ? 277 ARG A NH1  6  
ATOM   10255 N  NH2  . ARG B 2 19  ? -23.818 8.806   7.940   1.00 0.00 ? 277 ARG A NH2  6  
ATOM   10256 H  H    . ARG B 2 19  ? -20.455 6.042   3.974   1.00 0.00 ? 277 ARG A H    6  
ATOM   10257 H  HA   . ARG B 2 19  ? -21.149 8.630   2.790   1.00 0.00 ? 277 ARG A HA   6  
ATOM   10258 H  HB2  . ARG B 2 19  ? -18.477 7.973   3.971   1.00 0.00 ? 277 ARG A HB2  6  
ATOM   10259 H  HB3  . ARG B 2 19  ? -19.101 9.537   3.522   1.00 0.00 ? 277 ARG A HB3  6  
ATOM   10260 H  HG2  . ARG B 2 19  ? -19.775 7.886   5.908   1.00 0.00 ? 277 ARG A HG2  6  
ATOM   10261 H  HG3  . ARG B 2 19  ? -19.209 9.556   5.795   1.00 0.00 ? 277 ARG A HG3  6  
ATOM   10262 H  HD2  . ARG B 2 19  ? -21.259 10.372  5.217   1.00 0.00 ? 277 ARG A HD2  6  
ATOM   10263 H  HD3  . ARG B 2 19  ? -21.767 8.831   4.542   1.00 0.00 ? 277 ARG A HD3  6  
ATOM   10264 H  HE   . ARG B 2 19  ? -21.410 8.670   7.359   1.00 0.00 ? 277 ARG A HE   6  
ATOM   10265 H  HH11 . ARG B 2 19  ? -23.615 9.770   4.895   1.00 0.00 ? 277 ARG A HH11 6  
ATOM   10266 H  HH12 . ARG B 2 19  ? -25.016 9.630   5.905   1.00 0.00 ? 277 ARG A HH12 6  
ATOM   10267 H  HH21 . ARG B 2 19  ? -23.247 8.483   8.695   1.00 0.00 ? 277 ARG A HH21 6  
ATOM   10268 H  HH22 . ARG B 2 19  ? -24.806 8.898   8.064   1.00 0.00 ? 277 ARG A HH22 6  
ATOM   10269 N  N    . PRO B 2 20  ? -19.533 8.712   0.875   1.00 0.00 ? 278 PRO A N    6  
ATOM   10270 C  CA   . PRO B 2 20  ? -18.813 8.719   -0.401  1.00 0.00 ? 278 PRO A CA   6  
ATOM   10271 C  C    . PRO B 2 20  ? -17.290 8.737   -0.223  1.00 0.00 ? 278 PRO A C    6  
ATOM   10272 O  O    . PRO B 2 20  ? -16.644 9.745   -0.506  1.00 0.00 ? 278 PRO A O    6  
ATOM   10273 C  CB   . PRO B 2 20  ? -19.248 10.028  -1.069  1.00 0.00 ? 278 PRO A CB   6  
ATOM   10274 C  CG   . PRO B 2 20  ? -20.368 10.557  -0.245  1.00 0.00 ? 278 PRO A CG   6  
ATOM   10275 C  CD   . PRO B 2 20  ? -20.224 9.967   1.130   1.00 0.00 ? 278 PRO A CD   6  
ATOM   10276 H  HA   . PRO B 2 20  ? -19.102 7.888   -1.020  1.00 0.00 ? 278 PRO A HA   6  
ATOM   10277 H  HB2  . PRO B 2 20  ? -18.418 10.717  -1.090  1.00 0.00 ? 278 PRO A HB2  6  
ATOM   10278 H  HB3  . PRO B 2 20  ? -19.571 9.819   -2.078  1.00 0.00 ? 278 PRO A HB3  6  
ATOM   10279 H  HG2  . PRO B 2 20  ? -20.319 11.634  -0.202  1.00 0.00 ? 278 PRO A HG2  6  
ATOM   10280 H  HG3  . PRO B 2 20  ? -21.297 10.238  -0.688  1.00 0.00 ? 278 PRO A HG3  6  
ATOM   10281 H  HD2  . PRO B 2 20  ? -19.653 10.589  1.800   1.00 0.00 ? 278 PRO A HD2  6  
ATOM   10282 H  HD3  . PRO B 2 20  ? -21.193 9.773   1.557   1.00 0.00 ? 278 PRO A HD3  6  
ATOM   10283 N  N    . GLU B 2 21  ? -16.712 7.633   0.246   1.00 0.00 ? 279 GLU A N    6  
ATOM   10284 C  CA   . GLU B 2 21  ? -15.267 7.564   0.438   1.00 0.00 ? 279 GLU A CA   6  
ATOM   10285 C  C    . GLU B 2 21  ? -14.565 7.473   -0.917  1.00 0.00 ? 279 GLU A C    6  
ATOM   10286 O  O    . GLU B 2 21  ? -14.867 8.245   -1.827  1.00 0.00 ? 279 GLU A O    6  
ATOM   10287 C  CB   . GLU B 2 21  ? -14.899 6.377   1.325   1.00 0.00 ? 279 GLU A CB   6  
ATOM   10288 C  CG   . GLU B 2 21  ? -13.521 6.506   1.943   1.00 0.00 ? 279 GLU A CG   6  
ATOM   10289 C  CD   . GLU B 2 21  ? -13.422 7.667   2.915   1.00 0.00 ? 279 GLU A CD   6  
ATOM   10290 O  OE1  . GLU B 2 21  ? -13.173 8.803   2.459   1.00 0.00 ? 279 GLU A OE1  6  
ATOM   10291 O  OE2  . GLU B 2 21  ? -13.595 7.439   4.131   1.00 0.00 ? 279 GLU A OE2  6  
ATOM   10292 H  H    . GLU B 2 21  ? -17.261 6.851   0.458   1.00 0.00 ? 279 GLU A H    6  
ATOM   10293 H  HA   . GLU B 2 21  ? -14.950 8.469   0.930   1.00 0.00 ? 279 GLU A HA   6  
ATOM   10294 H  HB2  . GLU B 2 21  ? -15.616 6.303   2.120   1.00 0.00 ? 279 GLU A HB2  6  
ATOM   10295 H  HB3  . GLU B 2 21  ? -14.933 5.468   0.745   1.00 0.00 ? 279 GLU A HB3  6  
ATOM   10296 H  HG2  . GLU B 2 21  ? -13.295 5.600   2.469   1.00 0.00 ? 279 GLU A HG2  6  
ATOM   10297 H  HG3  . GLU B 2 21  ? -12.801 6.657   1.154   1.00 0.00 ? 279 GLU A HG3  6  
ATOM   10298 N  N    . GLU B 2 22  ? -13.630 6.538   -1.043  1.00 0.00 ? 280 GLU A N    6  
ATOM   10299 C  CA   . GLU B 2 22  ? -12.895 6.339   -2.294  1.00 0.00 ? 280 GLU A CA   6  
ATOM   10300 C  C    . GLU B 2 22  ? -11.913 5.181   -2.164  1.00 0.00 ? 280 GLU A C    6  
ATOM   10301 O  O    . GLU B 2 22  ? -10.767 5.344   -1.742  1.00 0.00 ? 280 GLU A O    6  
ATOM   10302 C  CB   . GLU B 2 22  ? -12.177 7.613   -2.736  1.00 0.00 ? 280 GLU A CB   6  
ATOM   10303 C  CG   . GLU B 2 22  ? -11.786 7.600   -4.207  1.00 0.00 ? 280 GLU A CG   6  
ATOM   10304 C  CD   . GLU B 2 22  ? -12.234 8.849   -4.938  1.00 0.00 ? 280 GLU A CD   6  
ATOM   10305 O  OE1  . GLU B 2 22  ? -13.387 8.876   -5.417  1.00 0.00 ? 280 GLU A OE1  6  
ATOM   10306 O  OE2  . GLU B 2 22  ? -11.432 9.802   -5.031  1.00 0.00 ? 280 GLU A OE2  6  
ATOM   10307 H  H    . GLU B 2 22  ? -13.440 5.954   -0.280  1.00 0.00 ? 280 GLU A H    6  
ATOM   10308 H  HA   . GLU B 2 22  ? -13.619 6.077   -3.047  1.00 0.00 ? 280 GLU A HA   6  
ATOM   10309 H  HB2  . GLU B 2 22  ? -12.836 8.451   -2.574  1.00 0.00 ? 280 GLU A HB2  6  
ATOM   10310 H  HB3  . GLU B 2 22  ? -11.282 7.741   -2.145  1.00 0.00 ? 280 GLU A HB3  6  
ATOM   10311 H  HG2  . GLU B 2 22  ? -10.717 7.521   -4.286  1.00 0.00 ? 280 GLU A HG2  6  
ATOM   10312 H  HG3  . GLU B 2 22  ? -12.242 6.744   -4.677  1.00 0.00 ? 280 GLU A HG3  6  
ATOM   10313 N  N    . LEU B 2 23  ? -12.404 4.015   -2.542  1.00 0.00 ? 281 LEU A N    6  
ATOM   10314 C  CA   . LEU B 2 23  ? -11.659 2.754   -2.486  1.00 0.00 ? 281 LEU A CA   6  
ATOM   10315 C  C    . LEU B 2 23  ? -10.337 2.770   -3.244  1.00 0.00 ? 281 LEU A C    6  
ATOM   10316 O  O    . LEU B 2 23  ? -9.943  3.768   -3.847  1.00 0.00 ? 281 LEU A O    6  
ATOM   10317 C  CB   . LEU B 2 23  ? -12.511 1.660   -3.084  1.00 0.00 ? 281 LEU A CB   6  
ATOM   10318 C  CG   . LEU B 2 23  ? -13.999 1.871   -2.998  1.00 0.00 ? 281 LEU A CG   6  
ATOM   10319 C  CD1  . LEU B 2 23  ? -14.625 1.322   -4.252  1.00 0.00 ? 281 LEU A CD1  6  
ATOM   10320 C  CD2  . LEU B 2 23  ? -14.564 1.199   -1.751  1.00 0.00 ? 281 LEU A CD2  6  
ATOM   10321 H  H    . LEU B 2 23  ? -13.330 3.997   -2.874  1.00 0.00 ? 281 LEU A H    6  
ATOM   10322 H  HA   . LEU B 2 23  ? -11.474 2.508   -1.465  1.00 0.00 ? 281 LEU A HA   6  
ATOM   10323 H  HB2  . LEU B 2 23  ? -12.249 1.569   -4.125  1.00 0.00 ? 281 LEU A HB2  6  
ATOM   10324 H  HB3  . LEU B 2 23  ? -12.282 0.734   -2.594  1.00 0.00 ? 281 LEU A HB3  6  
ATOM   10325 H  HG   . LEU B 2 23  ? -14.211 2.921   -2.945  1.00 0.00 ? 281 LEU A HG   6  
ATOM   10326 H  HD11 . LEU B 2 23  ? -14.512 0.266   -4.248  1.00 0.00 ? 281 LEU A HD11 6  
ATOM   10327 H  HD12 . LEU B 2 23  ? -14.123 1.735   -5.115  1.00 0.00 ? 281 LEU A HD12 6  
ATOM   10328 H  HD13 . LEU B 2 23  ? -15.666 1.577   -4.287  1.00 0.00 ? 281 LEU A HD13 6  
ATOM   10329 H  HD21 . LEU B 2 23  ? -13.888 0.415   -1.414  1.00 0.00 ? 281 LEU A HD21 6  
ATOM   10330 H  HD22 . LEU B 2 23  ? -15.527 0.768   -1.981  1.00 0.00 ? 281 LEU A HD22 6  
ATOM   10331 H  HD23 . LEU B 2 23  ? -14.677 1.935   -0.970  1.00 0.00 ? 281 LEU A HD23 6  
ATOM   10332 N  N    . VAL B 2 24  ? -9.666  1.614   -3.193  1.00 0.00 ? 282 VAL A N    6  
ATOM   10333 C  CA   . VAL B 2 24  ? -8.411  1.391   -3.892  1.00 0.00 ? 282 VAL A CA   6  
ATOM   10334 C  C    . VAL B 2 24  ? -8.591  0.218   -4.822  1.00 0.00 ? 282 VAL A C    6  
ATOM   10335 O  O    . VAL B 2 24  ? -8.624  -0.920  -4.367  1.00 0.00 ? 282 VAL A O    6  
ATOM   10336 C  CB   . VAL B 2 24  ? -7.247  1.048   -2.960  1.00 0.00 ? 282 VAL A CB   6  
ATOM   10337 C  CG1  . VAL B 2 24  ? -6.085  1.928   -3.266  1.00 0.00 ? 282 VAL A CG1  6  
ATOM   10338 C  CG2  . VAL B 2 24  ? -7.608  1.198   -1.513  1.00 0.00 ? 282 VAL A CG2  6  
ATOM   10339 H  H    . VAL B 2 24  ? -10.046 0.876   -2.662  1.00 0.00 ? 282 VAL A H    6  
ATOM   10340 H  HA   . VAL B 2 24  ? -8.150  2.270   -4.450  1.00 0.00 ? 282 VAL A HA   6  
ATOM   10341 H  HB   . VAL B 2 24  ? -6.962  0.034   -3.137  1.00 0.00 ? 282 VAL A HB   6  
ATOM   10342 H  HG11 . VAL B 2 24  ? -6.263  2.876   -2.790  1.00 0.00 ? 282 VAL A HG11 6  
ATOM   10343 H  HG12 . VAL B 2 24  ? -6.001  2.064   -4.335  1.00 0.00 ? 282 VAL A HG12 6  
ATOM   10344 H  HG13 . VAL B 2 24  ? -5.179  1.490   -2.879  1.00 0.00 ? 282 VAL A HG13 6  
ATOM   10345 H  HG21 . VAL B 2 24  ? -7.579  2.243   -1.246  1.00 0.00 ? 282 VAL A HG21 6  
ATOM   10346 H  HG22 . VAL B 2 24  ? -6.897  0.652   -0.910  1.00 0.00 ? 282 VAL A HG22 6  
ATOM   10347 H  HG23 . VAL B 2 24  ? -8.592  0.806   -1.348  1.00 0.00 ? 282 VAL A HG23 6  
ATOM   10348 N  N    . SER B 2 25  ? -8.641  0.480   -6.114  1.00 0.00 ? 283 SER A N    6  
ATOM   10349 C  CA   . SER B 2 25  ? -8.855  -0.581  -7.087  1.00 0.00 ? 283 SER A CA   6  
ATOM   10350 C  C    . SER B 2 25  ? -7.539  -1.118  -7.623  1.00 0.00 ? 283 SER A C    6  
ATOM   10351 O  O    . SER B 2 25  ? -6.675  -0.351  -8.048  1.00 0.00 ? 283 SER A O    6  
ATOM   10352 C  CB   . SER B 2 25  ? -9.713  -0.075  -8.244  1.00 0.00 ? 283 SER A CB   6  
ATOM   10353 O  OG   . SER B 2 25  ? -9.214  1.149   -8.754  1.00 0.00 ? 283 SER A OG   6  
ATOM   10354 H  H    . SER B 2 25  ? -8.524  1.405   -6.421  1.00 0.00 ? 283 SER A H    6  
ATOM   10355 H  HA   . SER B 2 25  ? -9.385  -1.381  -6.588  1.00 0.00 ? 283 SER A HA   6  
ATOM   10356 H  HB2  . SER B 2 25  ? -9.711  -0.808  -9.038  1.00 0.00 ? 283 SER A HB2  6  
ATOM   10357 H  HB3  . SER B 2 25  ? -10.723 0.076   -7.898  1.00 0.00 ? 283 SER A HB3  6  
ATOM   10358 H  HG   . SER B 2 25  ? -9.911  1.809   -8.744  1.00 0.00 ? 283 SER A HG   6  
ATOM   10359 N  N    . CYS B 2 26  ? -7.387  -2.439  -7.603  1.00 0.00 ? 284 CYS A N    6  
ATOM   10360 C  CA   . CYS B 2 26  ? -6.171  -3.049  -8.111  1.00 0.00 ? 284 CYS A CA   6  
ATOM   10361 C  C    . CYS B 2 26  ? -6.142  -2.881  -9.624  1.00 0.00 ? 284 CYS A C    6  
ATOM   10362 O  O    . CYS B 2 26  ? -7.172  -3.014  -10.286 1.00 0.00 ? 284 CYS A O    6  
ATOM   10363 C  CB   . CYS B 2 26  ? -6.094  -4.535  -7.706  1.00 0.00 ? 284 CYS A CB   6  
ATOM   10364 S  SG   . CYS B 2 26  ? -4.751  -5.470  -8.518  1.00 0.00 ? 284 CYS A SG   6  
ATOM   10365 H  H    . CYS B 2 26  ? -8.105  -3.003  -7.251  1.00 0.00 ? 284 CYS A H    6  
ATOM   10366 H  HA   . CYS B 2 26  ? -5.334  -2.523  -7.685  1.00 0.00 ? 284 CYS A HA   6  
ATOM   10367 H  HB2  . CYS B 2 26  ? -5.933  -4.596  -6.642  1.00 0.00 ? 284 CYS A HB2  6  
ATOM   10368 H  HB3  . CYS B 2 26  ? -7.027  -5.019  -7.946  1.00 0.00 ? 284 CYS A HB3  6  
ATOM   10369 N  N    . ALA B 2 27  ? -4.971  -2.588  -10.172 1.00 0.00 ? 285 ALA A N    6  
ATOM   10370 C  CA   . ALA B 2 27  ? -4.845  -2.390  -11.610 1.00 0.00 ? 285 ALA A CA   6  
ATOM   10371 C  C    . ALA B 2 27  ? -4.627  -3.715  -12.309 1.00 0.00 ? 285 ALA A C    6  
ATOM   10372 O  O    . ALA B 2 27  ? -4.256  -3.767  -13.482 1.00 0.00 ? 285 ALA A O    6  
ATOM   10373 C  CB   . ALA B 2 27  ? -3.717  -1.423  -11.923 1.00 0.00 ? 285 ALA A CB   6  
ATOM   10374 H  H    . ALA B 2 27  ? -4.178  -2.503  -9.602  1.00 0.00 ? 285 ALA A H    6  
ATOM   10375 H  HA   . ALA B 2 27  ? -5.768  -1.956  -11.966 1.00 0.00 ? 285 ALA A HA   6  
ATOM   10376 H  HB1  . ALA B 2 27  ? -2.769  -1.906  -11.751 1.00 0.00 ? 285 ALA A HB1  6  
ATOM   10377 H  HB2  . ALA B 2 27  ? -3.801  -0.554  -11.287 1.00 0.00 ? 285 ALA A HB2  6  
ATOM   10378 H  HB3  . ALA B 2 27  ? -3.781  -1.119  -12.957 1.00 0.00 ? 285 ALA A HB3  6  
ATOM   10379 N  N    . ASP B 2 28  ? -4.865  -4.785  -11.569 1.00 0.00 ? 286 ASP A N    6  
ATOM   10380 C  CA   . ASP B 2 28  ? -4.711  -6.126  -12.094 1.00 0.00 ? 286 ASP A CA   6  
ATOM   10381 C  C    . ASP B 2 28  ? -6.008  -6.908  -11.913 1.00 0.00 ? 286 ASP A C    6  
ATOM   10382 O  O    . ASP B 2 28  ? -6.565  -7.454  -12.865 1.00 0.00 ? 286 ASP A O    6  
ATOM   10383 C  CB   . ASP B 2 28  ? -3.576  -6.845  -11.370 1.00 0.00 ? 286 ASP A CB   6  
ATOM   10384 C  CG   . ASP B 2 28  ? -3.267  -8.200  -11.976 1.00 0.00 ? 286 ASP A CG   6  
ATOM   10385 O  OD1  . ASP B 2 28  ? -2.420  -8.262  -12.894 1.00 0.00 ? 286 ASP A OD1  6  
ATOM   10386 O  OD2  . ASP B 2 28  ? -3.870  -9.200  -11.535 1.00 0.00 ? 286 ASP A OD2  6  
ATOM   10387 H  H    . ASP B 2 28  ? -5.152  -4.669  -10.641 1.00 0.00 ? 286 ASP A H    6  
ATOM   10388 H  HA   . ASP B 2 28  ? -4.472  -6.042  -13.143 1.00 0.00 ? 286 ASP A HA   6  
ATOM   10389 H  HB2  . ASP B 2 28  ? -2.684  -6.239  -11.414 1.00 0.00 ? 286 ASP A HB2  6  
ATOM   10390 H  HB3  . ASP B 2 28  ? -3.862  -6.989  -10.338 1.00 0.00 ? 286 ASP A HB3  6  
ATOM   10391 N  N    . CYS B 2 29  ? -6.471  -6.949  -10.666 1.00 0.00 ? 287 CYS A N    6  
ATOM   10392 C  CA   . CYS B 2 29  ? -7.699  -7.647  -10.304 1.00 0.00 ? 287 CYS A CA   6  
ATOM   10393 C  C    . CYS B 2 29  ? -8.919  -6.804  -10.616 1.00 0.00 ? 287 CYS A C    6  
ATOM   10394 O  O    . CYS B 2 29  ? -9.792  -7.191  -11.394 1.00 0.00 ? 287 CYS A O    6  
ATOM   10395 C  CB   . CYS B 2 29  ? -7.725  -7.937  -8.800  1.00 0.00 ? 287 CYS A CB   6  
ATOM   10396 S  SG   . CYS B 2 29  ? -6.355  -8.955  -8.185  1.00 0.00 ? 287 CYS A SG   6  
ATOM   10397 H  H    . CYS B 2 29  ? -5.970  -6.492  -9.965  1.00 0.00 ? 287 CYS A H    6  
ATOM   10398 H  HA   . CYS B 2 29  ? -7.747  -8.576  -10.851 1.00 0.00 ? 287 CYS A HA   6  
ATOM   10399 H  HB2  . CYS B 2 29  ? -7.695  -7.001  -8.265  1.00 0.00 ? 287 CYS A HB2  6  
ATOM   10400 H  HB3  . CYS B 2 29  ? -8.646  -8.449  -8.560  1.00 0.00 ? 287 CYS A HB3  6  
ATOM   10401 N  N    . GLY B 2 30  ? -8.952  -5.642  -9.987  1.00 0.00 ? 288 GLY A N    6  
ATOM   10402 C  CA   . GLY B 2 30  ? -10.068 -4.737  -10.124 1.00 0.00 ? 288 GLY A CA   6  
ATOM   10403 C  C    . GLY B 2 30  ? -10.805 -4.620  -8.807  1.00 0.00 ? 288 GLY A C    6  
ATOM   10404 O  O    . GLY B 2 30  ? -11.870 -4.006  -8.723  1.00 0.00 ? 288 GLY A O    6  
ATOM   10405 H  H    . GLY B 2 30  ? -8.192  -5.392  -9.418  1.00 0.00 ? 288 GLY A H    6  
ATOM   10406 H  HA2  . GLY B 2 30  ? -9.704  -3.764  -10.422 1.00 0.00 ? 288 GLY A HA2  6  
ATOM   10407 H  HA3  . GLY B 2 30  ? -10.745 -5.113  -10.876 1.00 0.00 ? 288 GLY A HA3  6  
ATOM   10408 N  N    . ARG B 2 31  ? -10.215 -5.220  -7.771  1.00 0.00 ? 289 ARG A N    6  
ATOM   10409 C  CA   . ARG B 2 31  ? -10.789 -5.208  -6.430  1.00 0.00 ? 289 ARG A CA   6  
ATOM   10410 C  C    . ARG B 2 31  ? -10.467 -3.895  -5.747  1.00 0.00 ? 289 ARG A C    6  
ATOM   10411 O  O    . ARG B 2 31  ? -9.359  -3.381  -5.883  1.00 0.00 ? 289 ARG A O    6  
ATOM   10412 C  CB   . ARG B 2 31  ? -10.230 -6.356  -5.599  1.00 0.00 ? 289 ARG A CB   6  
ATOM   10413 C  CG   . ARG B 2 31  ? -11.079 -6.694  -4.393  1.00 0.00 ? 289 ARG A CG   6  
ATOM   10414 C  CD   . ARG B 2 31  ? -10.420 -7.759  -3.541  1.00 0.00 ? 289 ARG A CD   6  
ATOM   10415 N  NE   . ARG B 2 31  ? -10.490 -9.078  -4.163  1.00 0.00 ? 289 ARG A NE   6  
ATOM   10416 C  CZ   . ARG B 2 31  ? -10.004 -10.183 -3.605  1.00 0.00 ? 289 ARG A CZ   6  
ATOM   10417 N  NH1  . ARG B 2 31  ? -9.402  -10.124 -2.426  1.00 0.00 ? 289 ARG A NH1  6  
ATOM   10418 N  NH2  . ARG B 2 31  ? -10.119 -11.347 -4.229  1.00 0.00 ? 289 ARG A NH2  6  
ATOM   10419 H  H    . ARG B 2 31  ? -9.355  -5.670  -7.913  1.00 0.00 ? 289 ARG A H    6  
ATOM   10420 H  HA   . ARG B 2 31  ? -11.859 -5.316  -6.511  1.00 0.00 ? 289 ARG A HA   6  
ATOM   10421 H  HB2  . ARG B 2 31  ? -10.152 -7.236  -6.219  1.00 0.00 ? 289 ARG A HB2  6  
ATOM   10422 H  HB3  . ARG B 2 31  ? -9.247  -6.082  -5.247  1.00 0.00 ? 289 ARG A HB3  6  
ATOM   10423 H  HG2  . ARG B 2 31  ? -11.217 -5.802  -3.799  1.00 0.00 ? 289 ARG A HG2  6  
ATOM   10424 H  HG3  . ARG B 2 31  ? -12.039 -7.056  -4.732  1.00 0.00 ? 289 ARG A HG3  6  
ATOM   10425 H  HD2  . ARG B 2 31  ? -9.380  -7.493  -3.398  1.00 0.00 ? 289 ARG A HD2  6  
ATOM   10426 H  HD3  . ARG B 2 31  ? -10.919 -7.791  -2.587  1.00 0.00 ? 289 ARG A HD3  6  
ATOM   10427 H  HE   . ARG B 2 31  ? -10.927 -9.145  -5.038  1.00 0.00 ? 289 ARG A HE   6  
ATOM   10428 H  HH11 . ARG B 2 31  ? -9.313  -9.248  -1.953  1.00 0.00 ? 289 ARG A HH11 6  
ATOM   10429 H  HH12 . ARG B 2 31  ? -9.037  -10.956 -2.009  1.00 0.00 ? 289 ARG A HH12 6  
ATOM   10430 H  HH21 . ARG B 2 31  ? -10.571 -11.395 -5.120  1.00 0.00 ? 289 ARG A HH21 6  
ATOM   10431 H  HH22 . ARG B 2 31  ? -9.753  -12.177 -3.809  1.00 0.00 ? 289 ARG A HH22 6  
ATOM   10432 N  N    . SER B 2 32  ? -11.415 -3.358  -4.998  1.00 0.00 ? 290 SER A N    6  
ATOM   10433 C  CA   . SER B 2 32  ? -11.187 -2.091  -4.332  1.00 0.00 ? 290 SER A CA   6  
ATOM   10434 C  C    . SER B 2 32  ? -11.236 -2.211  -2.812  1.00 0.00 ? 290 SER A C    6  
ATOM   10435 O  O    . SER B 2 32  ? -11.766 -3.179  -2.276  1.00 0.00 ? 290 SER A O    6  
ATOM   10436 C  CB   . SER B 2 32  ? -12.186 -1.059  -4.822  1.00 0.00 ? 290 SER A CB   6  
ATOM   10437 O  OG   . SER B 2 32  ? -12.167 -0.970  -6.235  1.00 0.00 ? 290 SER A OG   6  
ATOM   10438 H  H    . SER B 2 32  ? -12.275 -3.818  -4.893  1.00 0.00 ? 290 SER A H    6  
ATOM   10439 H  HA   . SER B 2 32  ? -10.207 -1.766  -4.612  1.00 0.00 ? 290 SER A HA   6  
ATOM   10440 H  HB2  . SER B 2 32  ? -13.176 -1.330  -4.499  1.00 0.00 ? 290 SER A HB2  6  
ATOM   10441 H  HB3  . SER B 2 32  ? -11.926 -0.101  -4.415  1.00 0.00 ? 290 SER A HB3  6  
ATOM   10442 H  HG   . SER B 2 32  ? -11.809 -0.119  -6.498  1.00 0.00 ? 290 SER A HG   6  
ATOM   10443 N  N    . GLY B 2 33  ? -10.653 -1.220  -2.130  1.00 0.00 ? 291 GLY A N    6  
ATOM   10444 C  CA   . GLY B 2 33  ? -10.628 -1.215  -0.671  1.00 0.00 ? 291 GLY A CA   6  
ATOM   10445 C  C    . GLY B 2 33  ? -10.747 0.183   -0.087  1.00 0.00 ? 291 GLY A C    6  
ATOM   10446 O  O    . GLY B 2 33  ? -10.272 1.133   -0.674  1.00 0.00 ? 291 GLY A O    6  
ATOM   10447 H  H    . GLY B 2 33  ? -10.216 -0.493  -2.627  1.00 0.00 ? 291 GLY A H    6  
ATOM   10448 H  HA2  . GLY B 2 33  ? -11.434 -1.825  -0.297  1.00 0.00 ? 291 GLY A HA2  6  
ATOM   10449 H  HA3  . GLY B 2 33  ? -9.685  -1.635  -0.350  1.00 0.00 ? 291 GLY A HA3  6  
ATOM   10450 N  N    . HIS B 2 34  ? -11.369 0.342   1.071   1.00 0.00 ? 292 HIS A N    6  
ATOM   10451 C  CA   . HIS B 2 34  ? -11.450 1.681   1.648   1.00 0.00 ? 292 HIS A CA   6  
ATOM   10452 C  C    . HIS B 2 34  ? -10.102 1.973   2.271   1.00 0.00 ? 292 HIS A C    6  
ATOM   10453 O  O    . HIS B 2 34  ? -9.684  1.234   3.155   1.00 0.00 ? 292 HIS A O    6  
ATOM   10454 C  CB   . HIS B 2 34  ? -12.506 1.771   2.749   1.00 0.00 ? 292 HIS A CB   6  
ATOM   10455 C  CG   . HIS B 2 34  ? -13.937 1.906   2.292   1.00 0.00 ? 292 HIS A CG   6  
ATOM   10456 N  ND1  . HIS B 2 34  ? -14.885 1.026   2.720   1.00 0.00 ? 292 HIS A ND1  6  
ATOM   10457 C  CD2  . HIS B 2 34  ? -14.563 2.745   1.429   1.00 0.00 ? 292 HIS A CD2  6  
ATOM   10458 C  CE1  . HIS B 2 34  ? -16.042 1.289   2.147   1.00 0.00 ? 292 HIS A CE1  6  
ATOM   10459 N  NE2  . HIS B 2 34  ? -15.876 2.339   1.361   1.00 0.00 ? 292 HIS A NE2  6  
ATOM   10460 H  H    . HIS B 2 34  ? -11.728 -0.432  1.554   1.00 0.00 ? 292 HIS A H    6  
ATOM   10461 H  HA   . HIS B 2 34  ? -11.664 2.385   0.859   1.00 0.00 ? 292 HIS A HA   6  
ATOM   10462 H  HB2  . HIS B 2 34  ? -12.439 0.864   3.327   1.00 0.00 ? 292 HIS A HB2  6  
ATOM   10463 H  HB3  . HIS B 2 34  ? -12.272 2.596   3.397   1.00 0.00 ? 292 HIS A HB3  6  
ATOM   10464 H  HD2  . HIS B 2 34  ? -14.119 3.555   0.874   1.00 0.00 ? 292 HIS A HD2  6  
ATOM   10465 H  HE1  . HIS B 2 34  ? -16.932 0.695   2.221   1.00 0.00 ? 292 HIS A HE1  6  
ATOM   10466 H  HE2  . HIS B 2 34  ? -16.555 2.702   0.754   1.00 0.00 ? 292 HIS A HE2  6  
ATOM   10467 N  N    . PRO B 2 35  ? -9.390  3.029   1.854   1.00 0.00 ? 293 PRO A N    6  
ATOM   10468 C  CA   . PRO B 2 35  ? -8.084  3.329   2.434   1.00 0.00 ? 293 PRO A CA   6  
ATOM   10469 C  C    . PRO B 2 35  ? -8.107  3.279   3.958   1.00 0.00 ? 293 PRO A C    6  
ATOM   10470 O  O    . PRO B 2 35  ? -7.192  2.743   4.587   1.00 0.00 ? 293 PRO A O    6  
ATOM   10471 C  CB   . PRO B 2 35  ? -7.803  4.736   1.937   1.00 0.00 ? 293 PRO A CB   6  
ATOM   10472 C  CG   . PRO B 2 35  ? -8.515  4.821   0.632   1.00 0.00 ? 293 PRO A CG   6  
ATOM   10473 C  CD   . PRO B 2 35  ? -9.737  3.957   0.754   1.00 0.00 ? 293 PRO A CD   6  
ATOM   10474 H  HA   . PRO B 2 35  ? -7.328  2.649   2.061   1.00 0.00 ? 293 PRO A HA   6  
ATOM   10475 H  HB2  . PRO B 2 35  ? -8.183  5.456   2.647   1.00 0.00 ? 293 PRO A HB2  6  
ATOM   10476 H  HB3  . PRO B 2 35  ? -6.741  4.864   1.815   1.00 0.00 ? 293 PRO A HB3  6  
ATOM   10477 H  HG2  . PRO B 2 35  ? -8.803  5.843   0.439   1.00 0.00 ? 293 PRO A HG2  6  
ATOM   10478 H  HG3  . PRO B 2 35  ? -7.877  4.456   -0.159  1.00 0.00 ? 293 PRO A HG3  6  
ATOM   10479 H  HD2  . PRO B 2 35  ? -10.597 4.562   1.001   1.00 0.00 ? 293 PRO A HD2  6  
ATOM   10480 H  HD3  . PRO B 2 35  ? -9.903  3.416   -0.168  1.00 0.00 ? 293 PRO A HD3  6  
ATOM   10481 N  N    . THR B 2 36  ? -9.164  3.824   4.551   1.00 0.00 ? 294 THR A N    6  
ATOM   10482 C  CA   . THR B 2 36  ? -9.308  3.812   5.999   1.00 0.00 ? 294 THR A CA   6  
ATOM   10483 C  C    . THR B 2 36  ? -9.402  2.375   6.500   1.00 0.00 ? 294 THR A C    6  
ATOM   10484 O  O    . THR B 2 36  ? -9.000  2.063   7.621   1.00 0.00 ? 294 THR A O    6  
ATOM   10485 C  CB   . THR B 2 36  ? -10.558 4.586   6.447   1.00 0.00 ? 294 THR A CB   6  
ATOM   10486 O  OG1  . THR B 2 36  ? -11.000 5.461   5.404   1.00 0.00 ? 294 THR A OG1  6  
ATOM   10487 C  CG2  . THR B 2 36  ? -10.258 5.389   7.694   1.00 0.00 ? 294 THR A CG2  6  
ATOM   10488 H  H    . THR B 2 36  ? -9.861  4.242   4.002   1.00 0.00 ? 294 THR A H    6  
ATOM   10489 H  HA   . THR B 2 36  ? -8.439  4.284   6.436   1.00 0.00 ? 294 THR A HA   6  
ATOM   10490 H  HB   . THR B 2 36  ? -11.338 3.879   6.679   1.00 0.00 ? 294 THR A HB   6  
ATOM   10491 H  HG1  . THR B 2 36  ? -11.589 6.125   5.770   1.00 0.00 ? 294 THR A HG1  6  
ATOM   10492 H  HG21 . THR B 2 36  ? -9.822  4.736   8.430   1.00 0.00 ? 294 THR A HG21 6  
ATOM   10493 H  HG22 . THR B 2 36  ? -11.173 5.813   8.082   1.00 0.00 ? 294 THR A HG22 6  
ATOM   10494 H  HG23 . THR B 2 36  ? -9.563  6.181   7.457   1.00 0.00 ? 294 THR A HG23 6  
ATOM   10495 N  N    . CYS B 2 37  ? -9.940  1.506   5.648   1.00 0.00 ? 295 CYS A N    6  
ATOM   10496 C  CA   . CYS B 2 37  ? -10.093 0.092   5.971   1.00 0.00 ? 295 CYS A CA   6  
ATOM   10497 C  C    . CYS B 2 37  ? -8.772  -0.650  5.847   1.00 0.00 ? 295 CYS A C    6  
ATOM   10498 O  O    . CYS B 2 37  ? -8.477  -1.536  6.647   1.00 0.00 ? 295 CYS A O    6  
ATOM   10499 C  CB   . CYS B 2 37  ? -11.169 -0.541  5.083   1.00 0.00 ? 295 CYS A CB   6  
ATOM   10500 S  SG   . CYS B 2 37  ? -12.808 0.115   5.452   1.00 0.00 ? 295 CYS A SG   6  
ATOM   10501 H  H    . CYS B 2 37  ? -10.253 1.829   4.780   1.00 0.00 ? 295 CYS A H    6  
ATOM   10502 H  HA   . CYS B 2 37  ? -10.418 0.031   6.999   1.00 0.00 ? 295 CYS A HA   6  
ATOM   10503 H  HB2  . CYS B 2 37  ? -10.956 -0.350  4.049   1.00 0.00 ? 295 CYS A HB2  6  
ATOM   10504 H  HB3  . CYS B 2 37  ? -11.198 -1.593  5.239   1.00 0.00 ? 295 CYS A HB3  6  
ATOM   10505 N  N    . LEU B 2 38  ? -7.976  -0.292  4.845   1.00 0.00 ? 296 LEU A N    6  
ATOM   10506 C  CA   . LEU B 2 38  ? -6.677  -0.937  4.670   1.00 0.00 ? 296 LEU A CA   6  
ATOM   10507 C  C    . LEU B 2 38  ? -5.662  -0.353  5.647   1.00 0.00 ? 296 LEU A C    6  
ATOM   10508 O  O    . LEU B 2 38  ? -4.498  -0.754  5.657   1.00 0.00 ? 296 LEU A O    6  
ATOM   10509 C  CB   . LEU B 2 38  ? -6.154  -0.775  3.249   1.00 0.00 ? 296 LEU A CB   6  
ATOM   10510 C  CG   . LEU B 2 38  ? -7.146  -1.094  2.142   1.00 0.00 ? 296 LEU A CG   6  
ATOM   10511 C  CD1  . LEU B 2 38  ? -7.559  0.185   1.454   1.00 0.00 ? 296 LEU A CD1  6  
ATOM   10512 C  CD2  . LEU B 2 38  ? -6.541  -2.065  1.146   1.00 0.00 ? 296 LEU A CD2  6  
ATOM   10513 H  H    . LEU B 2 38  ? -8.270  0.408   4.213   1.00 0.00 ? 296 LEU A H    6  
ATOM   10514 H  HA   . LEU B 2 38  ? -6.800  -1.986  4.879   1.00 0.00 ? 296 LEU A HA   6  
ATOM   10515 H  HB2  . LEU B 2 38  ? -5.828  0.246   3.126   1.00 0.00 ? 296 LEU A HB2  6  
ATOM   10516 H  HB3  . LEU B 2 38  ? -5.297  -1.423  3.131   1.00 0.00 ? 296 LEU A HB3  6  
ATOM   10517 H  HG   . LEU B 2 38  ? -8.028  -1.549  2.570   1.00 0.00 ? 296 LEU A HG   6  
ATOM   10518 H  HD11 . LEU B 2 38  ? -8.156  -0.038  0.584   1.00 0.00 ? 296 LEU A HD11 6  
ATOM   10519 H  HD12 . LEU B 2 38  ? -6.681  0.725   1.152   1.00 0.00 ? 296 LEU A HD12 6  
ATOM   10520 H  HD13 . LEU B 2 38  ? -8.126  0.788   2.134   1.00 0.00 ? 296 LEU A HD13 6  
ATOM   10521 H  HD21 . LEU B 2 38  ? -6.930  -1.852  0.164   1.00 0.00 ? 296 LEU A HD21 6  
ATOM   10522 H  HD22 . LEU B 2 38  ? -6.798  -3.076  1.424   1.00 0.00 ? 296 LEU A HD22 6  
ATOM   10523 H  HD23 . LEU B 2 38  ? -5.466  -1.954  1.140   1.00 0.00 ? 296 LEU A HD23 6  
ATOM   10524 N  N    . GLN B 2 39  ? -6.116  0.610   6.452   1.00 0.00 ? 297 GLN A N    6  
ATOM   10525 C  CA   . GLN B 2 39  ? -5.265  1.274   7.441   1.00 0.00 ? 297 GLN A CA   6  
ATOM   10526 C  C    . GLN B 2 39  ? -4.269  2.199   6.754   1.00 0.00 ? 297 GLN A C    6  
ATOM   10527 O  O    . GLN B 2 39  ? -3.286  2.632   7.355   1.00 0.00 ? 297 GLN A O    6  
ATOM   10528 C  CB   . GLN B 2 39  ? -4.527  0.254   8.311   1.00 0.00 ? 297 GLN A CB   6  
ATOM   10529 C  CG   . GLN B 2 39  ? -5.446  -0.629  9.131   1.00 0.00 ? 297 GLN A CG   6  
ATOM   10530 C  CD   . GLN B 2 39  ? -4.709  -1.763  9.819   1.00 0.00 ? 297 GLN A CD   6  
ATOM   10531 O  OE1  . GLN B 2 39  ? -5.267  -2.838  10.035  1.00 0.00 ? 297 GLN A OE1  6  
ATOM   10532 N  NE2  . GLN B 2 39  ? -3.450  -1.527  10.174  1.00 0.00 ? 297 GLN A NE2  6  
ATOM   10533 H  H    . GLN B 2 39  ? -7.050  0.896   6.366   1.00 0.00 ? 297 GLN A H    6  
ATOM   10534 H  HA   . GLN B 2 39  ? -5.904  1.867   8.073   1.00 0.00 ? 297 GLN A HA   6  
ATOM   10535 H  HB2  . GLN B 2 39  ? -3.926  -0.374  7.678   1.00 0.00 ? 297 GLN A HB2  6  
ATOM   10536 H  HB3  . GLN B 2 39  ? -3.883  0.785   8.994   1.00 0.00 ? 297 GLN A HB3  6  
ATOM   10537 H  HG2  . GLN B 2 39  ? -5.917  -0.019  9.885   1.00 0.00 ? 297 GLN A HG2  6  
ATOM   10538 H  HG3  . GLN B 2 39  ? -6.201  -1.047  8.481   1.00 0.00 ? 297 GLN A HG3  6  
ATOM   10539 H  HE21 . GLN B 2 39  ? -3.070  -0.647  9.974   1.00 0.00 ? 297 GLN A HE21 6  
ATOM   10540 H  HE22 . GLN B 2 39  ? -2.953  -2.244  10.619  1.00 0.00 ? 297 GLN A HE22 6  
ATOM   10541 N  N    . PHE B 2 40  ? -4.541  2.499   5.489   1.00 0.00 ? 298 PHE A N    6  
ATOM   10542 C  CA   . PHE B 2 40  ? -3.687  3.376   4.698   1.00 0.00 ? 298 PHE A CA   6  
ATOM   10543 C  C    . PHE B 2 40  ? -3.575  4.764   5.324   1.00 0.00 ? 298 PHE A C    6  
ATOM   10544 O  O    . PHE B 2 40  ? -4.049  5.007   6.434   1.00 0.00 ? 298 PHE A O    6  
ATOM   10545 C  CB   . PHE B 2 40  ? -4.258  3.543   3.289   1.00 0.00 ? 298 PHE A CB   6  
ATOM   10546 C  CG   . PHE B 2 40  ? -4.130  2.353   2.369   1.00 0.00 ? 298 PHE A CG   6  
ATOM   10547 C  CD1  . PHE B 2 40  ? -3.408  1.220   2.715   1.00 0.00 ? 298 PHE A CD1  6  
ATOM   10548 C  CD2  . PHE B 2 40  ? -4.731  2.400   1.124   1.00 0.00 ? 298 PHE A CD2  6  
ATOM   10549 C  CE1  . PHE B 2 40  ? -3.295  0.160   1.827   1.00 0.00 ? 298 PHE A CE1  6  
ATOM   10550 C  CE2  . PHE B 2 40  ? -4.617  1.355   0.236   1.00 0.00 ? 298 PHE A CE2  6  
ATOM   10551 C  CZ   . PHE B 2 40  ? -3.902  0.235   0.583   1.00 0.00 ? 298 PHE A CZ   6  
ATOM   10552 H  H    . PHE B 2 40  ? -5.341  2.116   5.073   1.00 0.00 ? 298 PHE A H    6  
ATOM   10553 H  HA   . PHE B 2 40  ? -2.706  2.933   4.633   1.00 0.00 ? 298 PHE A HA   6  
ATOM   10554 H  HB2  . PHE B 2 40  ? -5.302  3.780   3.366   1.00 0.00 ? 298 PHE A HB2  6  
ATOM   10555 H  HB3  . PHE B 2 40  ? -3.755  4.373   2.818   1.00 0.00 ? 298 PHE A HB3  6  
ATOM   10556 H  HD1  . PHE B 2 40  ? -2.936  1.163   3.685   1.00 0.00 ? 298 PHE A HD1  6  
ATOM   10557 H  HD2  . PHE B 2 40  ? -5.284  3.278   0.844   1.00 0.00 ? 298 PHE A HD2  6  
ATOM   10558 H  HE1  . PHE B 2 40  ? -2.733  -0.720  2.103   1.00 0.00 ? 298 PHE A HE1  6  
ATOM   10559 H  HE2  . PHE B 2 40  ? -5.101  1.410   -0.727  1.00 0.00 ? 298 PHE A HE2  6  
ATOM   10560 H  HZ   . PHE B 2 40  ? -3.810  -0.576  -0.121  1.00 0.00 ? 298 PHE A HZ   6  
ATOM   10561 N  N    . THR B 2 41  ? -2.943  5.671   4.583   1.00 0.00 ? 299 THR A N    6  
ATOM   10562 C  CA   . THR B 2 41  ? -2.781  7.054   5.009   1.00 0.00 ? 299 THR A CA   6  
ATOM   10563 C  C    . THR B 2 41  ? -3.266  7.981   3.903   1.00 0.00 ? 299 THR A C    6  
ATOM   10564 O  O    . THR B 2 41  ? -3.568  7.521   2.806   1.00 0.00 ? 299 THR A O    6  
ATOM   10565 C  CB   . THR B 2 41  ? -1.322  7.382   5.356   1.00 0.00 ? 299 THR A CB   6  
ATOM   10566 O  OG1  . THR B 2 41  ? -1.212  8.750   5.770   1.00 0.00 ? 299 THR A OG1  6  
ATOM   10567 C  CG2  . THR B 2 41  ? -0.408  7.132   4.168   1.00 0.00 ? 299 THR A CG2  6  
ATOM   10568 H  H    . THR B 2 41  ? -2.573  5.398   3.718   1.00 0.00 ? 299 THR A H    6  
ATOM   10569 H  HA   . THR B 2 41  ? -3.382  7.205   5.892   1.00 0.00 ? 299 THR A HA   6  
ATOM   10570 H  HB   . THR B 2 41  ? -1.019  6.745   6.169   1.00 0.00 ? 299 THR A HB   6  
ATOM   10571 H  HG1  . THR B 2 41  ? -2.034  9.028   6.180   1.00 0.00 ? 299 THR A HG1  6  
ATOM   10572 H  HG21 . THR B 2 41  ? -0.667  6.190   3.709   1.00 0.00 ? 299 THR A HG21 6  
ATOM   10573 H  HG22 . THR B 2 41  ? 0.618   7.099   4.505   1.00 0.00 ? 299 THR A HG22 6  
ATOM   10574 H  HG23 . THR B 2 41  ? -0.526  7.928   3.449   1.00 0.00 ? 299 THR A HG23 6  
ATOM   10575 N  N    . LEU B 2 42  ? -3.338  9.277   4.173   1.00 0.00 ? 300 LEU A N    6  
ATOM   10576 C  CA   . LEU B 2 42  ? -3.810  10.225  3.168   1.00 0.00 ? 300 LEU A CA   6  
ATOM   10577 C  C    . LEU B 2 42  ? -2.952  10.186  1.907   1.00 0.00 ? 300 LEU A C    6  
ATOM   10578 O  O    . LEU B 2 42  ? -3.477  10.067  0.800   1.00 0.00 ? 300 LEU A O    6  
ATOM   10579 C  CB   . LEU B 2 42  ? -3.855  11.644  3.743   1.00 0.00 ? 300 LEU A CB   6  
ATOM   10580 C  CG   . LEU B 2 42  ? -4.792  12.615  3.014   1.00 0.00 ? 300 LEU A CG   6  
ATOM   10581 C  CD1  . LEU B 2 42  ? -4.206  13.024  1.679   1.00 0.00 ? 300 LEU A CD1  6  
ATOM   10582 C  CD2  . LEU B 2 42  ? -6.160  11.991  2.812   1.00 0.00 ? 300 LEU A CD2  6  
ATOM   10583 H  H    . LEU B 2 42  ? -3.070  9.602   5.057   1.00 0.00 ? 300 LEU A H    6  
ATOM   10584 H  HA   . LEU B 2 42  ? -4.813  9.937   2.894   1.00 0.00 ? 300 LEU A HA   6  
ATOM   10585 H  HB2  . LEU B 2 42  ? -4.170  11.580  4.775   1.00 0.00 ? 300 LEU A HB2  6  
ATOM   10586 H  HB3  . LEU B 2 42  ? -2.857  12.053  3.714   1.00 0.00 ? 300 LEU A HB3  6  
ATOM   10587 H  HG   . LEU B 2 42  ? -4.919  13.498  3.612   1.00 0.00 ? 300 LEU A HG   6  
ATOM   10588 H  HD11 . LEU B 2 42  ? -4.098  12.147  1.063   1.00 0.00 ? 300 LEU A HD11 6  
ATOM   10589 H  HD12 . LEU B 2 42  ? -3.238  13.481  1.833   1.00 0.00 ? 300 LEU A HD12 6  
ATOM   10590 H  HD13 . LEU B 2 42  ? -4.865  13.728  1.193   1.00 0.00 ? 300 LEU A HD13 6  
ATOM   10591 H  HD21 . LEU B 2 42  ? -6.420  11.428  3.688   1.00 0.00 ? 300 LEU A HD21 6  
ATOM   10592 H  HD22 . LEU B 2 42  ? -6.135  11.334  1.954   1.00 0.00 ? 300 LEU A HD22 6  
ATOM   10593 H  HD23 . LEU B 2 42  ? -6.892  12.768  2.651   1.00 0.00 ? 300 LEU A HD23 6  
ATOM   10594 N  N    . ASN B 2 43  ? -1.637  10.278  2.070   1.00 0.00 ? 301 ASN A N    6  
ATOM   10595 C  CA   . ASN B 2 43  ? -0.732  10.259  0.925   1.00 0.00 ? 301 ASN A CA   6  
ATOM   10596 C  C    . ASN B 2 43  ? -0.922  8.995   0.096   1.00 0.00 ? 301 ASN A C    6  
ATOM   10597 O  O    . ASN B 2 43  ? -1.079  9.068   -1.118  1.00 0.00 ? 301 ASN A O    6  
ATOM   10598 C  CB   . ASN B 2 43  ? 0.716   10.374  1.383   1.00 0.00 ? 301 ASN A CB   6  
ATOM   10599 C  CG   . ASN B 2 43  ? 1.025   11.705  2.034   1.00 0.00 ? 301 ASN A CG   6  
ATOM   10600 O  OD1  . ASN B 2 43  ? 0.148   12.353  2.605   1.00 0.00 ? 301 ASN A OD1  6  
ATOM   10601 N  ND2  . ASN B 2 43  ? 2.285   12.115  1.955   1.00 0.00 ? 301 ASN A ND2  6  
ATOM   10602 H  H    . ASN B 2 43  ? -1.268  10.354  2.976   1.00 0.00 ? 301 ASN A H    6  
ATOM   10603 H  HA   . ASN B 2 43  ? -0.969  11.109  0.306   1.00 0.00 ? 301 ASN A HA   6  
ATOM   10604 H  HB2  . ASN B 2 43  ? 0.915   9.599   2.095   1.00 0.00 ? 301 ASN A HB2  6  
ATOM   10605 H  HB3  . ASN B 2 43  ? 1.368   10.252  0.532   1.00 0.00 ? 301 ASN A HB3  6  
ATOM   10606 H  HD21 . ASN B 2 43  ? 2.929   11.544  1.487   1.00 0.00 ? 301 ASN A HD21 6  
ATOM   10607 H  HD22 . ASN B 2 43  ? 2.519   12.968  2.370   1.00 0.00 ? 301 ASN A HD22 6  
ATOM   10608 N  N    . MET B 2 44  ? -0.898  7.836   0.751   1.00 0.00 ? 302 MET A N    6  
ATOM   10609 C  CA   . MET B 2 44  ? -1.088  6.566   0.053   1.00 0.00 ? 302 MET A CA   6  
ATOM   10610 C  C    . MET B 2 44  ? -2.420  6.545   -0.635  1.00 0.00 ? 302 MET A C    6  
ATOM   10611 O  O    . MET B 2 44  ? -2.515  6.214   -1.808  1.00 0.00 ? 302 MET A O    6  
ATOM   10612 C  CB   . MET B 2 44  ? -1.030  5.387   1.029   1.00 0.00 ? 302 MET A CB   6  
ATOM   10613 C  CG   . MET B 2 44  ? -2.202  4.431   0.921   1.00 0.00 ? 302 MET A CG   6  
ATOM   10614 S  SD   . MET B 2 44  ? -2.143  3.390   -0.533  1.00 0.00 ? 302 MET A SD   6  
ATOM   10615 C  CE   . MET B 2 44  ? -1.083  2.073   0.039   1.00 0.00 ? 302 MET A CE   6  
ATOM   10616 H  H    . MET B 2 44  ? -0.750  7.834   1.720   1.00 0.00 ? 302 MET A H    6  
ATOM   10617 H  HA   . MET B 2 44  ? -0.312  6.459   -0.689  1.00 0.00 ? 302 MET A HA   6  
ATOM   10618 H  HB2  . MET B 2 44  ? -0.132  4.830   0.850   1.00 0.00 ? 302 MET A HB2  6  
ATOM   10619 H  HB3  . MET B 2 44  ? -1.013  5.769   2.027   1.00 0.00 ? 302 MET A HB3  6  
ATOM   10620 H  HG2  . MET B 2 44  ? -2.213  3.794   1.783   1.00 0.00 ? 302 MET A HG2  6  
ATOM   10621 H  HG3  . MET B 2 44  ? -3.115  5.003   0.895   1.00 0.00 ? 302 MET A HG3  6  
ATOM   10622 H  HE1  . MET B 2 44  ? -0.122  2.479   0.282   1.00 0.00 ? 302 MET A HE1  6  
ATOM   10623 H  HE2  . MET B 2 44  ? -0.976  1.331   -0.737  1.00 0.00 ? 302 MET A HE2  6  
ATOM   10624 H  HE3  . MET B 2 44  ? -1.513  1.619   0.917   1.00 0.00 ? 302 MET A HE3  6  
ATOM   10625 N  N    . THR B 2 45  ? -3.439  6.925   0.112   1.00 0.00 ? 303 THR A N    6  
ATOM   10626 C  CA   . THR B 2 45  ? -4.785  6.913   -0.396  1.00 0.00 ? 303 THR A CA   6  
ATOM   10627 C  C    . THR B 2 45  ? -4.840  7.657   -1.705  1.00 0.00 ? 303 THR A C    6  
ATOM   10628 O  O    . THR B 2 45  ? -5.083  7.052   -2.727  1.00 0.00 ? 303 THR A O    6  
ATOM   10629 C  CB   . THR B 2 45  ? -5.737  7.584   0.610   1.00 0.00 ? 303 THR A CB   6  
ATOM   10630 O  OG1  . THR B 2 45  ? -5.768  6.845   1.834   1.00 0.00 ? 303 THR A OG1  6  
ATOM   10631 C  CG2  . THR B 2 45  ? -7.139  7.719   0.061   1.00 0.00 ? 303 THR A CG2  6  
ATOM   10632 H  H    . THR B 2 45  ? -3.273  7.214   1.029   1.00 0.00 ? 303 THR A H    6  
ATOM   10633 H  HA   . THR B 2 45  ? -5.094  5.887   -0.545  1.00 0.00 ? 303 THR A HA   6  
ATOM   10634 H  HB   . THR B 2 45  ? -5.360  8.566   0.805   1.00 0.00 ? 303 THR A HB   6  
ATOM   10635 H  HG1  . THR B 2 45  ? -5.455  5.951   1.676   1.00 0.00 ? 303 THR A HG1  6  
ATOM   10636 H  HG21 . THR B 2 45  ? -7.463  6.768   -0.327  1.00 0.00 ? 303 THR A HG21 6  
ATOM   10637 H  HG22 . THR B 2 45  ? -7.148  8.453   -0.731  1.00 0.00 ? 303 THR A HG22 6  
ATOM   10638 H  HG23 . THR B 2 45  ? -7.806  8.032   0.850   1.00 0.00 ? 303 THR A HG23 6  
ATOM   10639 N  N    . GLU B 2 46  ? -4.492  8.933   -1.676  1.00 0.00 ? 304 GLU A N    6  
ATOM   10640 C  CA   . GLU B 2 46  ? -4.512  9.764   -2.874  1.00 0.00 ? 304 GLU A CA   6  
ATOM   10641 C  C    . GLU B 2 46  ? -3.578  9.208   -3.958  1.00 0.00 ? 304 GLU A C    6  
ATOM   10642 O  O    . GLU B 2 46  ? -3.930  9.171   -5.144  1.00 0.00 ? 304 GLU A O    6  
ATOM   10643 C  CB   . GLU B 2 46  ? -4.107  11.191  -2.501  1.00 0.00 ? 304 GLU A CB   6  
ATOM   10644 C  CG   . GLU B 2 46  ? -3.810  12.072  -3.693  1.00 0.00 ? 304 GLU A CG   6  
ATOM   10645 C  CD   . GLU B 2 46  ? -3.465  13.495  -3.299  1.00 0.00 ? 304 GLU A CD   6  
ATOM   10646 O  OE1  . GLU B 2 46  ? -4.401  14.305  -3.126  1.00 0.00 ? 304 GLU A OE1  6  
ATOM   10647 O  OE2  . GLU B 2 46  ? -2.263  13.799  -3.164  1.00 0.00 ? 304 GLU A OE2  6  
ATOM   10648 H  H    . GLU B 2 46  ? -4.215  9.331   -0.826  1.00 0.00 ? 304 GLU A H    6  
ATOM   10649 H  HA   . GLU B 2 46  ? -5.530  9.770   -3.254  1.00 0.00 ? 304 GLU A HA   6  
ATOM   10650 H  HB2  . GLU B 2 46  ? -4.903  11.645  -1.932  1.00 0.00 ? 304 GLU A HB2  6  
ATOM   10651 H  HB3  . GLU B 2 46  ? -3.219  11.149  -1.889  1.00 0.00 ? 304 GLU A HB3  6  
ATOM   10652 H  HG2  . GLU B 2 46  ? -2.975  11.648  -4.222  1.00 0.00 ? 304 GLU A HG2  6  
ATOM   10653 H  HG3  . GLU B 2 46  ? -4.673  12.088  -4.335  1.00 0.00 ? 304 GLU A HG3  6  
ATOM   10654 N  N    . ALA B 2 47  ? -2.394  8.768   -3.537  1.00 0.00 ? 305 ALA A N    6  
ATOM   10655 C  CA   . ALA B 2 47  ? -1.392  8.221   -4.453  1.00 0.00 ? 305 ALA A CA   6  
ATOM   10656 C  C    . ALA B 2 47  ? -1.971  7.112   -5.308  1.00 0.00 ? 305 ALA A C    6  
ATOM   10657 O  O    . ALA B 2 47  ? -1.976  7.175   -6.535  1.00 0.00 ? 305 ALA A O    6  
ATOM   10658 C  CB   . ALA B 2 47  ? -0.206  7.668   -3.666  1.00 0.00 ? 305 ALA A CB   6  
ATOM   10659 H  H    . ALA B 2 47  ? -2.190  8.806   -2.582  1.00 0.00 ? 305 ALA A H    6  
ATOM   10660 H  HA   . ALA B 2 47  ? -1.038  9.017   -5.089  1.00 0.00 ? 305 ALA A HA   6  
ATOM   10661 H  HB1  . ALA B 2 47  ? -0.426  6.652   -3.328  1.00 0.00 ? 305 ALA A HB1  6  
ATOM   10662 H  HB2  . ALA B 2 47  ? -0.016  8.300   -2.812  1.00 0.00 ? 305 ALA A HB2  6  
ATOM   10663 H  HB3  . ALA B 2 47  ? 0.668   7.652   -4.301  1.00 0.00 ? 305 ALA A HB3  6  
ATOM   10664 N  N    . VAL B 2 48  ? -2.457  6.102   -4.625  1.00 0.00 ? 306 VAL A N    6  
ATOM   10665 C  CA   . VAL B 2 48  ? -3.025  4.928   -5.246  1.00 0.00 ? 306 VAL A CA   6  
ATOM   10666 C  C    . VAL B 2 48  ? -4.277  5.216   -6.059  1.00 0.00 ? 306 VAL A C    6  
ATOM   10667 O  O    . VAL B 2 48  ? -4.638  4.435   -6.939  1.00 0.00 ? 306 VAL A O    6  
ATOM   10668 C  CB   . VAL B 2 48  ? -3.328  3.911   -4.171  1.00 0.00 ? 306 VAL A CB   6  
ATOM   10669 C  CG1  . VAL B 2 48  ? -2.047  3.545   -3.464  1.00 0.00 ? 306 VAL A CG1  6  
ATOM   10670 C  CG2  . VAL B 2 48  ? -4.347  4.451   -3.208  1.00 0.00 ? 306 VAL A CG2  6  
ATOM   10671 H  H    . VAL B 2 48  ? -2.433  6.147   -3.649  1.00 0.00 ? 306 VAL A H    6  
ATOM   10672 H  HA   . VAL B 2 48  ? -2.289  4.498   -5.885  1.00 0.00 ? 306 VAL A HA   6  
ATOM   10673 H  HB   . VAL B 2 48  ? -3.723  3.030   -4.624  1.00 0.00 ? 306 VAL A HB   6  
ATOM   10674 H  HG11 . VAL B 2 48  ? -2.243  2.748   -2.758  1.00 0.00 ? 306 VAL A HG11 6  
ATOM   10675 H  HG12 . VAL B 2 48  ? -1.665  4.408   -2.939  1.00 0.00 ? 306 VAL A HG12 6  
ATOM   10676 H  HG13 . VAL B 2 48  ? -1.319  3.211   -4.189  1.00 0.00 ? 306 VAL A HG13 6  
ATOM   10677 H  HG21 . VAL B 2 48  ? -4.578  3.691   -2.495  1.00 0.00 ? 306 VAL A HG21 6  
ATOM   10678 H  HG22 . VAL B 2 48  ? -5.243  4.728   -3.745  1.00 0.00 ? 306 VAL A HG22 6  
ATOM   10679 H  HG23 . VAL B 2 48  ? -3.950  5.311   -2.703  1.00 0.00 ? 306 VAL A HG23 6  
ATOM   10680 N  N    . LYS B 2 49  ? -4.939  6.327   -5.775  1.00 0.00 ? 307 LYS A N    6  
ATOM   10681 C  CA   . LYS B 2 49  ? -6.145  6.670   -6.513  1.00 0.00 ? 307 LYS A CA   6  
ATOM   10682 C  C    . LYS B 2 49  ? -5.808  7.025   -7.945  1.00 0.00 ? 307 LYS A C    6  
ATOM   10683 O  O    . LYS B 2 49  ? -6.460  6.579   -8.890  1.00 0.00 ? 307 LYS A O    6  
ATOM   10684 C  CB   . LYS B 2 49  ? -6.849  7.841   -5.877  1.00 0.00 ? 307 LYS A CB   6  
ATOM   10685 C  CG   . LYS B 2 49  ? -6.737  7.764   -4.404  1.00 0.00 ? 307 LYS A CG   6  
ATOM   10686 C  CD   . LYS B 2 49  ? -7.722  8.636   -3.674  1.00 0.00 ? 307 LYS A CD   6  
ATOM   10687 C  CE   . LYS B 2 49  ? -8.612  7.780   -2.806  1.00 0.00 ? 307 LYS A CE   6  
ATOM   10688 N  NZ   . LYS B 2 49  ? -7.956  6.506   -2.400  1.00 0.00 ? 307 LYS A NZ   6  
ATOM   10689 H  H    . LYS B 2 49  ? -4.622  6.915   -5.054  1.00 0.00 ? 307 LYS A H    6  
ATOM   10690 H  HA   . LYS B 2 49  ? -6.793  5.823   -6.465  1.00 0.00 ? 307 LYS A HA   6  
ATOM   10691 H  HB2  . LYS B 2 49  ? -6.390  8.750   -6.220  1.00 0.00 ? 307 LYS A HB2  6  
ATOM   10692 H  HB3  . LYS B 2 49  ? -7.894  7.834   -6.148  1.00 0.00 ? 307 LYS A HB3  6  
ATOM   10693 H  HG2  . LYS B 2 49  ? -6.898  6.740   -4.108  1.00 0.00 ? 307 LYS A HG2  6  
ATOM   10694 H  HG3  . LYS B 2 49  ? -5.743  8.052   -4.141  1.00 0.00 ? 307 LYS A HG3  6  
ATOM   10695 H  HD2  . LYS B 2 49  ? -7.188  9.343   -3.057  1.00 0.00 ? 307 LYS A HD2  6  
ATOM   10696 H  HD3  . LYS B 2 49  ? -8.330  9.161   -4.398  1.00 0.00 ? 307 LYS A HD3  6  
ATOM   10697 H  HE2  . LYS B 2 49  ? -8.891  8.329   -1.920  1.00 0.00 ? 307 LYS A HE2  6  
ATOM   10698 H  HE3  . LYS B 2 49  ? -9.475  7.552   -3.369  1.00 0.00 ? 307 LYS A HE3  6  
ATOM   10699 H  HZ1  . LYS B 2 49  ? -6.994  6.692   -2.052  1.00 0.00 ? 307 LYS A HZ1  6  
ATOM   10700 H  HZ2  . LYS B 2 49  ? -7.899  5.857   -3.211  1.00 0.00 ? 307 LYS A HZ2  6  
ATOM   10701 H  HZ3  . LYS B 2 49  ? -8.503  6.047   -1.644  1.00 0.00 ? 307 LYS A HZ3  6  
ATOM   10702 N  N    . THR B 2 50  ? -4.769  7.841   -8.085  1.00 0.00 ? 308 THR A N    6  
ATOM   10703 C  CA   . THR B 2 50  ? -4.326  8.305   -9.392  1.00 0.00 ? 308 THR A CA   6  
ATOM   10704 C  C    . THR B 2 50  ? -3.530  7.255   -10.170 1.00 0.00 ? 308 THR A C    6  
ATOM   10705 O  O    . THR B 2 50  ? -3.673  7.172   -11.391 1.00 0.00 ? 308 THR A O    6  
ATOM   10706 C  CB   . THR B 2 50  ? -3.493  9.599   -9.286  1.00 0.00 ? 308 THR A CB   6  
ATOM   10707 O  OG1  . THR B 2 50  ? -2.776  9.822   -10.507 1.00 0.00 ? 308 THR A OG1  6  
ATOM   10708 C  CG2  . THR B 2 50  ? -2.519  9.536   -8.123  1.00 0.00 ? 308 THR A CG2  6  
ATOM   10709 H  H    . THR B 2 50  ? -4.297  8.150   -7.278  1.00 0.00 ? 308 THR A H    6  
ATOM   10710 H  HA   . THR B 2 50  ? -5.213  8.539   -9.962  1.00 0.00 ? 308 THR A HA   6  
ATOM   10711 H  HB   . THR B 2 50  ? -4.169  10.426  -9.124  1.00 0.00 ? 308 THR A HB   6  
ATOM   10712 H  HG1  . THR B 2 50  ? -1.925  9.379   -10.463 1.00 0.00 ? 308 THR A HG1  6  
ATOM   10713 H  HG21 . THR B 2 50  ? -3.072  9.500   -7.194  1.00 0.00 ? 308 THR A HG21 6  
ATOM   10714 H  HG22 . THR B 2 50  ? -1.888  10.412  -8.132  1.00 0.00 ? 308 THR A HG22 6  
ATOM   10715 H  HG23 . THR B 2 50  ? -1.908  8.651   -8.212  1.00 0.00 ? 308 THR A HG23 6  
ATOM   10716 N  N    . TYR B 2 51  ? -2.694  6.449   -9.502  1.00 0.00 ? 309 TYR A N    6  
ATOM   10717 C  CA   . TYR B 2 51  ? -1.917  5.455   -10.244 1.00 0.00 ? 309 TYR A CA   6  
ATOM   10718 C  C    . TYR B 2 51  ? -2.408  4.014   -10.024 1.00 0.00 ? 309 TYR A C    6  
ATOM   10719 O  O    . TYR B 2 51  ? -3.529  3.790   -9.567  1.00 0.00 ? 309 TYR A O    6  
ATOM   10720 C  CB   . TYR B 2 51  ? -0.406  5.623   -9.995  1.00 0.00 ? 309 TYR A CB   6  
ATOM   10721 C  CG   . TYR B 2 51  ? 0.193   4.736   -8.936  1.00 0.00 ? 309 TYR A CG   6  
ATOM   10722 C  CD1  . TYR B 2 51  ? -0.238  4.812   -7.633  1.00 0.00 ? 309 TYR A CD1  6  
ATOM   10723 C  CD2  . TYR B 2 51  ? 1.210   3.842   -9.246  1.00 0.00 ? 309 TYR A CD2  6  
ATOM   10724 C  CE1  . TYR B 2 51  ? 0.322   4.019   -6.651  1.00 0.00 ? 309 TYR A CE1  6  
ATOM   10725 C  CE2  . TYR B 2 51  ? 1.774   3.040   -8.275  1.00 0.00 ? 309 TYR A CE2  6  
ATOM   10726 C  CZ   . TYR B 2 51  ? 1.326   3.133   -6.977  1.00 0.00 ? 309 TYR A CZ   6  
ATOM   10727 O  OH   . TYR B 2 51  ? 1.886   2.340   -6.002  1.00 0.00 ? 309 TYR A OH   6  
ATOM   10728 H  H    . TYR B 2 51  ? -2.597  6.529   -8.523  1.00 0.00 ? 309 TYR A H    6  
ATOM   10729 H  HA   . TYR B 2 51  ? -2.088  5.676   -11.279 1.00 0.00 ? 309 TYR A HA   6  
ATOM   10730 H  HB2  . TYR B 2 51  ? 0.120   5.421   -10.915 1.00 0.00 ? 309 TYR A HB2  6  
ATOM   10731 H  HB3  . TYR B 2 51  ? -0.217  6.649   -9.708  1.00 0.00 ? 309 TYR A HB3  6  
ATOM   10732 H  HD1  . TYR B 2 51  ? -1.032  5.501   -7.392  1.00 0.00 ? 309 TYR A HD1  6  
ATOM   10733 H  HD2  . TYR B 2 51  ? 1.558   3.774   -10.267 1.00 0.00 ? 309 TYR A HD2  6  
ATOM   10734 H  HE1  . TYR B 2 51  ? -0.024  4.097   -5.638  1.00 0.00 ? 309 TYR A HE1  6  
ATOM   10735 H  HE2  . TYR B 2 51  ? 2.561   2.347   -8.535  1.00 0.00 ? 309 TYR A HE2  6  
ATOM   10736 H  HH   . TYR B 2 51  ? 2.841   2.345   -6.094  1.00 0.00 ? 309 TYR A HH   6  
ATOM   10737 N  N    . LYS B 2 52  ? -1.552  3.048   -10.358 1.00 0.00 ? 310 LYS A N    6  
ATOM   10738 C  CA   . LYS B 2 52  ? -1.886  1.621   -10.295 1.00 0.00 ? 310 LYS A CA   6  
ATOM   10739 C  C    . LYS B 2 52  ? -2.222  1.119   -8.895  1.00 0.00 ? 310 LYS A C    6  
ATOM   10740 O  O    . LYS B 2 52  ? -3.333  0.648   -8.654  1.00 0.00 ? 310 LYS A O    6  
ATOM   10741 C  CB   . LYS B 2 52  ? -0.728  0.806   -10.849 1.00 0.00 ? 310 LYS A CB   6  
ATOM   10742 C  CG   . LYS B 2 52  ? -0.385  1.142   -12.279 1.00 0.00 ? 310 LYS A CG   6  
ATOM   10743 C  CD   . LYS B 2 52  ? -1.078  0.220   -13.259 1.00 0.00 ? 310 LYS A CD   6  
ATOM   10744 C  CE   . LYS B 2 52  ? -0.539  -1.198  -13.182 1.00 0.00 ? 310 LYS A CE   6  
ATOM   10745 N  NZ   . LYS B 2 52  ? 0.874   -1.283  -13.646 1.00 0.00 ? 310 LYS A NZ   6  
ATOM   10746 H  H    . LYS B 2 52  ? -0.644  3.303   -10.614 1.00 0.00 ? 310 LYS A H    6  
ATOM   10747 H  HA   . LYS B 2 52  ? -2.731  1.449   -10.932 1.00 0.00 ? 310 LYS A HA   6  
ATOM   10748 H  HB2  . LYS B 2 52  ? 0.134   0.987   -10.244 1.00 0.00 ? 310 LYS A HB2  6  
ATOM   10749 H  HB3  . LYS B 2 52  ? -0.977  -0.236  -10.807 1.00 0.00 ? 310 LYS A HB3  6  
ATOM   10750 H  HG2  . LYS B 2 52  ? -0.705  2.145   -12.475 1.00 0.00 ? 310 LYS A HG2  6  
ATOM   10751 H  HG3  . LYS B 2 52  ? 0.679   1.059   -12.407 1.00 0.00 ? 310 LYS A HG3  6  
ATOM   10752 H  HD2  . LYS B 2 52  ? -2.127  0.204   -13.031 1.00 0.00 ? 310 LYS A HD2  6  
ATOM   10753 H  HD3  . LYS B 2 52  ? -0.931  0.598   -14.261 1.00 0.00 ? 310 LYS A HD3  6  
ATOM   10754 H  HE2  . LYS B 2 52  ? -0.593  -1.535  -12.158 1.00 0.00 ? 310 LYS A HE2  6  
ATOM   10755 H  HE3  . LYS B 2 52  ? -1.153  -1.831  -13.801 1.00 0.00 ? 310 LYS A HE3  6  
ATOM   10756 H  HZ1  . LYS B 2 52  ? 0.938   -1.006  -14.647 1.00 0.00 ? 310 LYS A HZ1  6  
ATOM   10757 H  HZ2  . LYS B 2 52  ? 1.226   -2.256  -13.543 1.00 0.00 ? 310 LYS A HZ2  6  
ATOM   10758 H  HZ3  . LYS B 2 52  ? 1.474   -0.647  -13.082 1.00 0.00 ? 310 LYS A HZ3  6  
ATOM   10759 N  N    . TRP B 2 53  ? -1.253  1.224   -7.988  1.00 0.00 ? 311 TRP A N    6  
ATOM   10760 C  CA   . TRP B 2 53  ? -1.392  0.727   -6.618  1.00 0.00 ? 311 TRP A CA   6  
ATOM   10761 C  C    . TRP B 2 53  ? -1.239  -0.785  -6.625  1.00 0.00 ? 311 TRP A C    6  
ATOM   10762 O  O    . TRP B 2 53  ? -0.361  -1.324  -5.955  1.00 0.00 ? 311 TRP A O    6  
ATOM   10763 C  CB   . TRP B 2 53  ? -2.724  1.141   -5.959  1.00 0.00 ? 311 TRP A CB   6  
ATOM   10764 C  CG   . TRP B 2 53  ? -3.051  0.381   -4.703  1.00 0.00 ? 311 TRP A CG   6  
ATOM   10765 C  CD1  . TRP B 2 53  ? -2.432  0.483   -3.496  1.00 0.00 ? 311 TRP A CD1  6  
ATOM   10766 C  CD2  . TRP B 2 53  ? -4.085  -0.589  -4.535  1.00 0.00 ? 311 TRP A CD2  6  
ATOM   10767 N  NE1  . TRP B 2 53  ? -3.018  -0.358  -2.586  1.00 0.00 ? 311 TRP A NE1  6  
ATOM   10768 C  CE2  . TRP B 2 53  ? -4.032  -1.030  -3.200  1.00 0.00 ? 311 TRP A CE2  6  
ATOM   10769 C  CE3  . TRP B 2 53  ? -5.049  -1.127  -5.381  1.00 0.00 ? 311 TRP A CE3  6  
ATOM   10770 C  CZ2  . TRP B 2 53  ? -4.906  -1.980  -2.693  1.00 0.00 ? 311 TRP A CZ2  6  
ATOM   10771 C  CZ3  . TRP B 2 53  ? -5.920  -2.077  -4.877  1.00 0.00 ? 311 TRP A CZ3  6  
ATOM   10772 C  CH2  . TRP B 2 53  ? -5.843  -2.495  -3.542  1.00 0.00 ? 311 TRP A CH2  6  
ATOM   10773 H  H    . TRP B 2 53  ? -0.410  1.652   -8.249  1.00 0.00 ? 311 TRP A H    6  
ATOM   10774 H  HA   . TRP B 2 53  ? -0.575  1.144   -6.044  1.00 0.00 ? 311 TRP A HA   6  
ATOM   10775 H  HB2  . TRP B 2 53  ? -2.665  2.176   -5.703  1.00 0.00 ? 311 TRP A HB2  6  
ATOM   10776 H  HB3  . TRP B 2 53  ? -3.538  1.006   -6.644  1.00 0.00 ? 311 TRP A HB3  6  
ATOM   10777 H  HD1  . TRP B 2 53  ? -1.608  1.145   -3.294  1.00 0.00 ? 311 TRP A HD1  6  
ATOM   10778 H  HE1  . TRP B 2 53  ? -2.747  -0.461  -1.649  1.00 0.00 ? 311 TRP A HE1  6  
ATOM   10779 H  HE3  . TRP B 2 53  ? -5.119  -0.811  -6.411  1.00 0.00 ? 311 TRP A HE3  6  
ATOM   10780 H  HZ2  . TRP B 2 53  ? -4.858  -2.304  -1.665  1.00 0.00 ? 311 TRP A HZ2  6  
ATOM   10781 H  HZ3  . TRP B 2 53  ? -6.675  -2.506  -5.516  1.00 0.00 ? 311 TRP A HZ3  6  
ATOM   10782 H  HH2  . TRP B 2 53  ? -6.541  -3.240  -3.192  1.00 0.00 ? 311 TRP A HH2  6  
ATOM   10783 N  N    . GLN B 2 54  ? -2.074  -1.457  -7.416  1.00 0.00 ? 312 GLN A N    6  
ATOM   10784 C  CA   . GLN B 2 54  ? -2.031  -2.910  -7.529  1.00 0.00 ? 312 GLN A CA   6  
ATOM   10785 C  C    . GLN B 2 54  ? -2.137  -3.558  -6.159  1.00 0.00 ? 312 GLN A C    6  
ATOM   10786 O  O    . GLN B 2 54  ? -1.228  -3.444  -5.337  1.00 0.00 ? 312 GLN A O    6  
ATOM   10787 C  CB   . GLN B 2 54  ? -0.738  -3.355  -8.215  1.00 0.00 ? 312 GLN A CB   6  
ATOM   10788 C  CG   . GLN B 2 54  ? -0.608  -2.867  -9.649  1.00 0.00 ? 312 GLN A CG   6  
ATOM   10789 C  CD   . GLN B 2 54  ? 0.690   -3.304  -10.300 1.00 0.00 ? 312 GLN A CD   6  
ATOM   10790 O  OE1  . GLN B 2 54  ? 0.746   -3.528  -11.509 1.00 0.00 ? 312 GLN A OE1  6  
ATOM   10791 N  NE2  . GLN B 2 54  ? 1.745   -3.424  -9.501  1.00 0.00 ? 312 GLN A NE2  6  
ATOM   10792 H  H    . GLN B 2 54  ? -2.738  -0.962  -7.937  1.00 0.00 ? 312 GLN A H    6  
ATOM   10793 H  HA   . GLN B 2 54  ? -2.873  -3.222  -8.129  1.00 0.00 ? 312 GLN A HA   6  
ATOM   10794 H  HB2  . GLN B 2 54  ? 0.103   -2.979  -7.653  1.00 0.00 ? 312 GLN A HB2  6  
ATOM   10795 H  HB3  . GLN B 2 54  ? -0.702  -4.435  -8.221  1.00 0.00 ? 312 GLN A HB3  6  
ATOM   10796 H  HG2  . GLN B 2 54  ? -1.432  -3.260  -10.226 1.00 0.00 ? 312 GLN A HG2  6  
ATOM   10797 H  HG3  . GLN B 2 54  ? -0.650  -1.787  -9.653  1.00 0.00 ? 312 GLN A HG3  6  
ATOM   10798 H  HE21 . GLN B 2 54  ? 1.629   -3.225  -8.548  1.00 0.00 ? 312 GLN A HE21 6  
ATOM   10799 H  HE22 . GLN B 2 54  ? 2.595   -3.707  -9.896  1.00 0.00 ? 312 GLN A HE22 6  
ATOM   10800 N  N    . CYS B 2 55  ? -3.247  -4.244  -5.917  1.00 0.00 ? 313 CYS A N    6  
ATOM   10801 C  CA   . CYS B 2 55  ? -3.455  -4.899  -4.637  1.00 0.00 ? 313 CYS A CA   6  
ATOM   10802 C  C    . CYS B 2 55  ? -2.211  -5.658  -4.215  1.00 0.00 ? 313 CYS A C    6  
ATOM   10803 O  O    . CYS B 2 55  ? -1.394  -6.045  -5.045  1.00 0.00 ? 313 CYS A O    6  
ATOM   10804 C  CB   . CYS B 2 55  ? -4.667  -5.839  -4.680  1.00 0.00 ? 313 CYS A CB   6  
ATOM   10805 S  SG   . CYS B 2 55  ? -4.316  -7.517  -5.307  1.00 0.00 ? 313 CYS A SG   6  
ATOM   10806 H  H    . CYS B 2 55  ? -3.935  -4.310  -6.610  1.00 0.00 ? 313 CYS A H    6  
ATOM   10807 H  HA   . CYS B 2 55  ? -3.638  -4.130  -3.902  1.00 0.00 ? 313 CYS A HA   6  
ATOM   10808 H  HB2  . CYS B 2 55  ? -5.057  -5.946  -3.680  1.00 0.00 ? 313 CYS A HB2  6  
ATOM   10809 H  HB3  . CYS B 2 55  ? -5.428  -5.406  -5.304  1.00 0.00 ? 313 CYS A HB3  6  
ATOM   10810 N  N    . ILE B 2 56  ? -2.071  -5.833  -2.919  1.00 0.00 ? 314 ILE A N    6  
ATOM   10811 C  CA   . ILE B 2 56  ? -0.941  -6.539  -2.343  1.00 0.00 ? 314 ILE A CA   6  
ATOM   10812 C  C    . ILE B 2 56  ? -0.660  -7.843  -3.087  1.00 0.00 ? 314 ILE A C    6  
ATOM   10813 O  O    . ILE B 2 56  ? 0.482   -8.141  -3.416  1.00 0.00 ? 314 ILE A O    6  
ATOM   10814 C  CB   . ILE B 2 56  ? -1.236  -6.830  -0.874  1.00 0.00 ? 314 ILE A CB   6  
ATOM   10815 C  CG1  . ILE B 2 56  ? -0.212  -7.780  -0.321  1.00 0.00 ? 314 ILE A CG1  6  
ATOM   10816 C  CG2  . ILE B 2 56  ? -2.625  -7.403  -0.715  1.00 0.00 ? 314 ILE A CG2  6  
ATOM   10817 C  CD1  . ILE B 2 56  ? 1.194   -7.243  -0.412  1.00 0.00 ? 314 ILE A CD1  6  
ATOM   10818 H  H    . ILE B 2 56  ? -2.767  -5.489  -2.319  1.00 0.00 ? 314 ILE A H    6  
ATOM   10819 H  HA   . ILE B 2 56  ? -0.051  -5.914  -2.390  1.00 0.00 ? 314 ILE A HA   6  
ATOM   10820 H  HB   . ILE B 2 56  ? -1.185  -5.902  -0.329  1.00 0.00 ? 314 ILE A HB   6  
ATOM   10821 H  HG12 . ILE B 2 56  ? -0.446  -7.970  0.705   1.00 0.00 ? 314 ILE A HG12 6  
ATOM   10822 H  HG13 . ILE B 2 56  ? -0.257  -8.701  -0.875  1.00 0.00 ? 314 ILE A HG13 6  
ATOM   10823 H  HG21 . ILE B 2 56  ? -2.670  -8.342  -1.235  1.00 0.00 ? 314 ILE A HG21 6  
ATOM   10824 H  HG22 . ILE B 2 56  ? -3.349  -6.721  -1.137  1.00 0.00 ? 314 ILE A HG22 6  
ATOM   10825 H  HG23 . ILE B 2 56  ? -2.837  -7.557  0.332   1.00 0.00 ? 314 ILE A HG23 6  
ATOM   10826 H  HD11 . ILE B 2 56  ? 1.252   -6.298  0.101   1.00 0.00 ? 314 ILE A HD11 6  
ATOM   10827 H  HD12 . ILE B 2 56  ? 1.452   -7.100  -1.453  1.00 0.00 ? 314 ILE A HD12 6  
ATOM   10828 H  HD13 . ILE B 2 56  ? 1.883   -7.942  0.035   1.00 0.00 ? 314 ILE A HD13 6  
ATOM   10829 N  N    . GLU B 2 57  ? -1.699  -8.620  -3.342  1.00 0.00 ? 315 GLU A N    6  
ATOM   10830 C  CA   . GLU B 2 57  ? -1.546  -9.880  -4.057  1.00 0.00 ? 315 GLU A CA   6  
ATOM   10831 C  C    . GLU B 2 57  ? -0.807  -9.678  -5.385  1.00 0.00 ? 315 GLU A C    6  
ATOM   10832 O  O    . GLU B 2 57  ? -0.187  -10.605 -5.906  1.00 0.00 ? 315 GLU A O    6  
ATOM   10833 C  CB   . GLU B 2 57  ? -2.913  -10.516 -4.316  1.00 0.00 ? 315 GLU A CB   6  
ATOM   10834 C  CG   . GLU B 2 57  ? -3.748  -10.694 -3.059  1.00 0.00 ? 315 GLU A CG   6  
ATOM   10835 C  CD   . GLU B 2 57  ? -5.051  -11.422 -3.325  1.00 0.00 ? 315 GLU A CD   6  
ATOM   10836 O  OE1  . GLU B 2 57  ? -6.022  -10.764 -3.753  1.00 0.00 ? 315 GLU A OE1  6  
ATOM   10837 O  OE2  . GLU B 2 57  ? -5.100  -12.651 -3.105  1.00 0.00 ? 315 GLU A OE2  6  
ATOM   10838 H  H    . GLU B 2 57  ? -2.581  -8.356  -3.023  1.00 0.00 ? 315 GLU A H    6  
ATOM   10839 H  HA   . GLU B 2 57  ? -0.968  -10.538 -3.432  1.00 0.00 ? 315 GLU A HA   6  
ATOM   10840 H  HB2  . GLU B 2 57  ? -3.464  -9.891  -5.002  1.00 0.00 ? 315 GLU A HB2  6  
ATOM   10841 H  HB3  . GLU B 2 57  ? -2.766  -11.486 -4.764  1.00 0.00 ? 315 GLU A HB3  6  
ATOM   10842 H  HG2  . GLU B 2 57  ? -3.177  -11.261 -2.339  1.00 0.00 ? 315 GLU A HG2  6  
ATOM   10843 H  HG3  . GLU B 2 57  ? -3.973  -9.720  -2.651  1.00 0.00 ? 315 GLU A HG3  6  
ATOM   10844 N  N    . CYS B 2 58  ? -0.880  -8.461  -5.923  1.00 0.00 ? 316 CYS A N    6  
ATOM   10845 C  CA   . CYS B 2 58  ? -0.230  -8.135  -7.193  1.00 0.00 ? 316 CYS A CA   6  
ATOM   10846 C  C    . CYS B 2 58  ? 0.888   -7.116  -7.032  1.00 0.00 ? 316 CYS A C    6  
ATOM   10847 O  O    . CYS B 2 58  ? 1.542   -6.759  -8.012  1.00 0.00 ? 316 CYS A O    6  
ATOM   10848 C  CB   . CYS B 2 58  ? -1.239  -7.553  -8.169  1.00 0.00 ? 316 CYS A CB   6  
ATOM   10849 S  SG   . CYS B 2 58  ? -2.661  -8.621  -8.506  1.00 0.00 ? 316 CYS A SG   6  
ATOM   10850 H  H    . CYS B 2 58  ? -1.393  -7.770  -5.464  1.00 0.00 ? 316 CYS A H    6  
ATOM   10851 H  HA   . CYS B 2 58  ? 0.177   -9.044  -7.608  1.00 0.00 ? 316 CYS A HA   6  
ATOM   10852 H  HB2  . CYS B 2 58  ? -1.617  -6.625  -7.768  1.00 0.00 ? 316 CYS A HB2  6  
ATOM   10853 H  HB3  . CYS B 2 58  ? -0.743  -7.357  -9.101  1.00 0.00 ? 316 CYS A HB3  6  
ATOM   10854 N  N    . LYS B 2 59  ? 1.106   -6.641  -5.816  1.00 0.00 ? 317 LYS A N    6  
ATOM   10855 C  CA   . LYS B 2 59  ? 2.133   -5.646  -5.585  1.00 0.00 ? 317 LYS A CA   6  
ATOM   10856 C  C    . LYS B 2 59  ? 3.484   -6.178  -6.076  1.00 0.00 ? 317 LYS A C    6  
ATOM   10857 O  O    . LYS B 2 59  ? 3.597   -7.351  -6.436  1.00 0.00 ? 317 LYS A O    6  
ATOM   10858 C  CB   . LYS B 2 59  ? 2.141   -5.229  -4.095  1.00 0.00 ? 317 LYS A CB   6  
ATOM   10859 C  CG   . LYS B 2 59  ? 3.213   -5.856  -3.281  1.00 0.00 ? 317 LYS A CG   6  
ATOM   10860 C  CD   . LYS B 2 59  ? 3.254   -7.322  -3.547  1.00 0.00 ? 317 LYS A CD   6  
ATOM   10861 C  CE   . LYS B 2 59  ? 3.607   -8.069  -2.310  1.00 0.00 ? 317 LYS A CE   6  
ATOM   10862 N  NZ   . LYS B 2 59  ? 5.035   -8.479  -2.283  1.00 0.00 ? 317 LYS A NZ   6  
ATOM   10863 H  H    . LYS B 2 59  ? 0.592   -6.984  -5.061  1.00 0.00 ? 317 LYS A H    6  
ATOM   10864 H  HA   . LYS B 2 59  ? 1.890   -4.795  -6.173  1.00 0.00 ? 317 LYS A HA   6  
ATOM   10865 H  HB2  . LYS B 2 59  ? 2.263   -4.172  -4.027  1.00 0.00 ? 317 LYS A HB2  6  
ATOM   10866 H  HB3  . LYS B 2 59  ? 1.200   -5.501  -3.640  1.00 0.00 ? 317 LYS A HB3  6  
ATOM   10867 H  HG2  . LYS B 2 59  ? 4.148   -5.416  -3.539  1.00 0.00 ? 317 LYS A HG2  6  
ATOM   10868 H  HG3  . LYS B 2 59  ? 3.003   -5.694  -2.237  1.00 0.00 ? 317 LYS A HG3  6  
ATOM   10869 H  HD2  . LYS B 2 59  ? 2.284   -7.634  -3.892  1.00 0.00 ? 317 LYS A HD2  6  
ATOM   10870 H  HD3  . LYS B 2 59  ? 3.978   -7.512  -4.314  1.00 0.00 ? 317 LYS A HD3  6  
ATOM   10871 H  HE2  . LYS B 2 59  ? 3.407   -7.431  -1.468  1.00 0.00 ? 317 LYS A HE2  6  
ATOM   10872 H  HE3  . LYS B 2 59  ? 2.978   -8.921  -2.254  1.00 0.00 ? 317 LYS A HE3  6  
ATOM   10873 H  HZ1  . LYS B 2 59  ? 5.237   -9.011  -1.413  1.00 0.00 ? 317 LYS A HZ1  6  
ATOM   10874 H  HZ2  . LYS B 2 59  ? 5.646   -7.640  -2.312  1.00 0.00 ? 317 LYS A HZ2  6  
ATOM   10875 H  HZ3  . LYS B 2 59  ? 5.250   -9.080  -3.103  1.00 0.00 ? 317 LYS A HZ3  6  
ATOM   10876 N  N    . SER B 2 60  ? 4.496   -5.331  -6.104  1.00 0.00 ? 318 SER A N    6  
ATOM   10877 C  CA   . SER B 2 60  ? 5.817   -5.757  -6.554  1.00 0.00 ? 318 SER A CA   6  
ATOM   10878 C  C    . SER B 2 60  ? 6.874   -4.744  -6.185  1.00 0.00 ? 318 SER A C    6  
ATOM   10879 O  O    . SER B 2 60  ? 6.571   -3.636  -5.741  1.00 0.00 ? 318 SER A O    6  
ATOM   10880 C  CB   . SER B 2 60  ? 5.853   -5.976  -8.063  1.00 0.00 ? 318 SER A CB   6  
ATOM   10881 O  OG   . SER B 2 60  ? 4.607   -5.669  -8.664  1.00 0.00 ? 318 SER A OG   6  
ATOM   10882 H  H    . SER B 2 60  ? 4.359   -4.407  -5.813  1.00 0.00 ? 318 SER A H    6  
ATOM   10883 H  HA   . SER B 2 60  ? 6.051   -6.686  -6.071  1.00 0.00 ? 318 SER A HA   6  
ATOM   10884 H  HB2  . SER B 2 60  ? 6.609   -5.340  -8.480  1.00 0.00 ? 318 SER A HB2  6  
ATOM   10885 H  HB3  . SER B 2 60  ? 6.105   -7.005  -8.273  1.00 0.00 ? 318 SER A HB3  6  
ATOM   10886 H  HG   . SER B 2 60  ? 4.735   -5.503  -9.601  1.00 0.00 ? 318 SER A HG   6  
ATOM   10887 N  N    . CYS B 2 61  ? 8.121   -5.137  -6.374  1.00 0.00 ? 319 CYS A N    6  
ATOM   10888 C  CA   . CYS B 2 61  ? 9.235   -4.269  -6.080  1.00 0.00 ? 319 CYS A CA   6  
ATOM   10889 C  C    . CYS B 2 61  ? 9.395   -3.224  -7.167  1.00 0.00 ? 319 CYS A C    6  
ATOM   10890 O  O    . CYS B 2 61  ? 10.019  -3.488  -8.182  1.00 0.00 ? 319 CYS A O    6  
ATOM   10891 C  CB   . CYS B 2 61  ? 10.520  -5.066  -5.992  1.00 0.00 ? 319 CYS A CB   6  
ATOM   10892 S  SG   . CYS B 2 61  ? 11.942  -4.122  -5.336  1.00 0.00 ? 319 CYS A SG   6  
ATOM   10893 H  H    . CYS B 2 61  ? 8.296   -6.040  -6.716  1.00 0.00 ? 319 CYS A H    6  
ATOM   10894 H  HA   . CYS B 2 61  ? 9.055   -3.792  -5.134  1.00 0.00 ? 319 CYS A HA   6  
ATOM   10895 H  HB2  . CYS B 2 61  ? 10.362  -5.927  -5.364  1.00 0.00 ? 319 CYS A HB2  6  
ATOM   10896 H  HB3  . CYS B 2 61  ? 10.782  -5.405  -6.975  1.00 0.00 ? 319 CYS A HB3  6  
ATOM   10897 N  N    . ILE B 2 62  ? 8.832   -2.044  -6.971  1.00 0.00 ? 320 ILE A N    6  
ATOM   10898 C  CA   . ILE B 2 62  ? 8.982   -0.978  -7.956  1.00 0.00 ? 320 ILE A CA   6  
ATOM   10899 C  C    . ILE B 2 62  ? 10.424  -0.986  -8.451  1.00 0.00 ? 320 ILE A C    6  
ATOM   10900 O  O    . ILE B 2 62  ? 10.721  -0.628  -9.591  1.00 0.00 ? 320 ILE A O    6  
ATOM   10901 C  CB   . ILE B 2 62  ? 8.649   0.394   -7.337  1.00 0.00 ? 320 ILE A CB   6  
ATOM   10902 C  CG1  . ILE B 2 62  ? 9.681   1.450   -7.749  1.00 0.00 ? 320 ILE A CG1  6  
ATOM   10903 C  CG2  . ILE B 2 62  ? 8.582   0.266   -5.838  1.00 0.00 ? 320 ILE A CG2  6  
ATOM   10904 C  CD1  . ILE B 2 62  ? 9.532   2.755   -7.028  1.00 0.00 ? 320 ILE A CD1  6  
ATOM   10905 H  H    . ILE B 2 62  ? 8.318   -1.885  -6.154  1.00 0.00 ? 320 ILE A H    6  
ATOM   10906 H  HA   . ILE B 2 62  ? 8.313   -1.170  -8.781  1.00 0.00 ? 320 ILE A HA   6  
ATOM   10907 H  HB   . ILE B 2 62  ? 7.678   0.700   -7.676  1.00 0.00 ? 320 ILE A HB   6  
ATOM   10908 H  HG12 . ILE B 2 62  ? 10.665  1.079   -7.541  1.00 0.00 ? 320 ILE A HG12 6  
ATOM   10909 H  HG13 . ILE B 2 62  ? 9.585   1.644   -8.801  1.00 0.00 ? 320 ILE A HG13 6  
ATOM   10910 H  HG21 . ILE B 2 62  ? 9.557   -0.022  -5.464  1.00 0.00 ? 320 ILE A HG21 6  
ATOM   10911 H  HG22 . ILE B 2 62  ? 7.855   -0.488  -5.572  1.00 0.00 ? 320 ILE A HG22 6  
ATOM   10912 H  HG23 . ILE B 2 62  ? 8.295   1.211   -5.406  1.00 0.00 ? 320 ILE A HG23 6  
ATOM   10913 H  HD11 . ILE B 2 62  ? 8.733   2.661   -6.319  1.00 0.00 ? 320 ILE A HD11 6  
ATOM   10914 H  HD12 . ILE B 2 62  ? 9.301   3.537   -7.736  1.00 0.00 ? 320 ILE A HD12 6  
ATOM   10915 H  HD13 . ILE B 2 62  ? 10.450  2.991   -6.511  1.00 0.00 ? 320 ILE A HD13 6  
ATOM   10916 N  N    . LEU B 2 63  ? 11.306  -1.413  -7.551  1.00 0.00 ? 321 LEU A N    6  
ATOM   10917 C  CA   . LEU B 2 63  ? 12.725  -1.522  -7.827  1.00 0.00 ? 321 LEU A CA   6  
ATOM   10918 C  C    . LEU B 2 63  ? 12.978  -2.697  -8.776  1.00 0.00 ? 321 LEU A C    6  
ATOM   10919 O  O    . LEU B 2 63  ? 13.554  -2.524  -9.851  1.00 0.00 ? 321 LEU A O    6  
ATOM   10920 C  CB   . LEU B 2 63  ? 13.471  -1.680  -6.495  1.00 0.00 ? 321 LEU A CB   6  
ATOM   10921 C  CG   . LEU B 2 63  ? 13.025  -0.726  -5.365  1.00 0.00 ? 321 LEU A CG   6  
ATOM   10922 C  CD1  . LEU B 2 63  ? 14.165  -0.421  -4.423  1.00 0.00 ? 321 LEU A CD1  6  
ATOM   10923 C  CD2  . LEU B 2 63  ? 12.456  0.578   -5.877  1.00 0.00 ? 321 LEU A CD2  6  
ATOM   10924 H  H    . LEU B 2 63  ? 10.983  -1.657  -6.655  1.00 0.00 ? 321 LEU A H    6  
ATOM   10925 H  HA   . LEU B 2 63  ? 13.045  -0.610  -8.305  1.00 0.00 ? 321 LEU A HA   6  
ATOM   10926 H  HB2  . LEU B 2 63  ? 13.321  -2.687  -6.145  1.00 0.00 ? 321 LEU A HB2  6  
ATOM   10927 H  HB3  . LEU B 2 63  ? 14.517  -1.543  -6.666  1.00 0.00 ? 321 LEU A HB3  6  
ATOM   10928 H  HG   . LEU B 2 63  ? 12.241  -1.211  -4.788  1.00 0.00 ? 321 LEU A HG   6  
ATOM   10929 H  HD11 . LEU B 2 63  ? 13.976  -0.893  -3.466  1.00 0.00 ? 321 LEU A HD11 6  
ATOM   10930 H  HD12 . LEU B 2 63  ? 14.244  0.648   -4.290  1.00 0.00 ? 321 LEU A HD12 6  
ATOM   10931 H  HD13 . LEU B 2 63  ? 15.085  -0.803  -4.839  1.00 0.00 ? 321 LEU A HD13 6  
ATOM   10932 H  HD21 . LEU B 2 63  ? 11.524  0.747   -5.374  1.00 0.00 ? 321 LEU A HD21 6  
ATOM   10933 H  HD22 . LEU B 2 63  ? 12.293  0.526   -6.941  1.00 0.00 ? 321 LEU A HD22 6  
ATOM   10934 H  HD23 . LEU B 2 63  ? 13.139  1.384   -5.653  1.00 0.00 ? 321 LEU A HD23 6  
ATOM   10935 N  N    . CYS B 2 64  ? 12.546  -3.892  -8.370  1.00 0.00 ? 322 CYS A N    6  
ATOM   10936 C  CA   . CYS B 2 64  ? 12.672  -5.085  -9.212  1.00 0.00 ? 322 CYS A CA   6  
ATOM   10937 C  C    . CYS B 2 64  ? 11.439  -5.229  -10.090 1.00 0.00 ? 322 CYS A C    6  
ATOM   10938 O  O    . CYS B 2 64  ? 11.518  -5.216  -11.318 1.00 0.00 ? 322 CYS A O    6  
ATOM   10939 C  CB   . CYS B 2 64  ? 12.785  -6.364  -8.380  1.00 0.00 ? 322 CYS A CB   6  
ATOM   10940 S  SG   . CYS B 2 64  ? 14.238  -6.472  -7.302  1.00 0.00 ? 322 CYS A SG   6  
ATOM   10941 H  H    . CYS B 2 64  ? 12.147  -3.975  -7.483  1.00 0.00 ? 322 CYS A H    6  
ATOM   10942 H  HA   . CYS B 2 64  ? 13.545  -4.980  -9.833  1.00 0.00 ? 322 CYS A HA   6  
ATOM   10943 H  HB2  . CYS B 2 64  ? 11.913  -6.454  -7.753  1.00 0.00 ? 322 CYS A HB2  6  
ATOM   10944 H  HB3  . CYS B 2 64  ? 12.819  -7.207  -9.054  1.00 0.00 ? 322 CYS A HB3  6  
ATOM   10945 N  N    . GLY B 2 65  ? 10.298  -5.367  -9.423  1.00 0.00 ? 323 GLY A N    6  
ATOM   10946 C  CA   . GLY B 2 65  ? 9.037   -5.547  -10.101 1.00 0.00 ? 323 GLY A CA   6  
ATOM   10947 C  C    . GLY B 2 65  ? 8.765   -7.012  -10.289 1.00 0.00 ? 323 GLY A C    6  
ATOM   10948 O  O    . GLY B 2 65  ? 8.159   -7.426  -11.277 1.00 0.00 ? 323 GLY A O    6  
ATOM   10949 H  H    . GLY B 2 65  ? 10.316  -5.340  -8.444  1.00 0.00 ? 323 GLY A H    6  
ATOM   10950 H  HA2  . GLY B 2 65  ? 8.249   -5.107  -9.506  1.00 0.00 ? 323 GLY A HA2  6  
ATOM   10951 H  HA3  . GLY B 2 65  ? 9.072   -5.065  -11.064 1.00 0.00 ? 323 GLY A HA3  6  
ATOM   10952 N  N    . THR B 2 66  ? 9.223   -7.801  -9.321  1.00 0.00 ? 324 THR A N    6  
ATOM   10953 C  CA   . THR B 2 66  ? 9.072   -9.238  -9.390  1.00 0.00 ? 324 THR A CA   6  
ATOM   10954 C  C    . THR B 2 66  ? 8.416   -9.795  -8.138  1.00 0.00 ? 324 THR A C    6  
ATOM   10955 O  O    . THR B 2 66  ? 7.857   -10.891 -8.147  1.00 0.00 ? 324 THR A O    6  
ATOM   10956 C  CB   . THR B 2 66  ? 10.441  -9.881  -9.572  1.00 0.00 ? 324 THR A CB   6  
ATOM   10957 O  OG1  . THR B 2 66  ? 10.316  -11.293 -9.747  1.00 0.00 ? 324 THR A OG1  6  
ATOM   10958 C  CG2  . THR B 2 66  ? 11.342  -9.555  -8.397  1.00 0.00 ? 324 THR A CG2  6  
ATOM   10959 H  H    . THR B 2 66  ? 9.679   -7.401  -8.533  1.00 0.00 ? 324 THR A H    6  
ATOM   10960 H  HA   . THR B 2 66  ? 8.473   -9.479  -10.250 1.00 0.00 ? 324 THR A HA   6  
ATOM   10961 H  HB   . THR B 2 66  ? 10.881  -9.459  -10.444 1.00 0.00 ? 324 THR A HB   6  
ATOM   10962 H  HG1  . THR B 2 66  ? 9.466   -11.584 -9.412  1.00 0.00 ? 324 THR A HG1  6  
ATOM   10963 H  HG21 . THR B 2 66  ? 11.436  -8.480  -8.320  1.00 0.00 ? 324 THR A HG21 6  
ATOM   10964 H  HG22 . THR B 2 66  ? 12.316  -9.993  -8.554  1.00 0.00 ? 324 THR A HG22 6  
ATOM   10965 H  HG23 . THR B 2 66  ? 10.912  -9.945  -7.489  1.00 0.00 ? 324 THR A HG23 6  
ATOM   10966 N  N    . SER B 2 67  ? 8.495   -9.023  -7.065  1.00 0.00 ? 325 SER A N    6  
ATOM   10967 C  CA   . SER B 2 67  ? 7.924   -9.415  -5.789  1.00 0.00 ? 325 SER A CA   6  
ATOM   10968 C  C    . SER B 2 67  ? 8.539   -10.724 -5.288  1.00 0.00 ? 325 SER A C    6  
ATOM   10969 O  O    . SER B 2 67  ? 8.029   -11.343 -4.359  1.00 0.00 ? 325 SER A O    6  
ATOM   10970 C  CB   . SER B 2 67  ? 6.402   -9.539  -5.894  1.00 0.00 ? 325 SER A CB   6  
ATOM   10971 O  OG   . SER B 2 67  ? 5.853   -10.088 -4.713  1.00 0.00 ? 325 SER A OG   6  
ATOM   10972 H  H    . SER B 2 67  ? 8.947   -8.157  -7.135  1.00 0.00 ? 325 SER A H    6  
ATOM   10973 H  HA   . SER B 2 67  ? 8.158   -8.637  -5.086  1.00 0.00 ? 325 SER A HA   6  
ATOM   10974 H  HB2  . SER B 2 67  ? 5.973   -8.559  -6.045  1.00 0.00 ? 325 SER A HB2  6  
ATOM   10975 H  HB3  . SER B 2 67  ? 6.148   -10.177 -6.728  1.00 0.00 ? 325 SER A HB3  6  
ATOM   10976 H  HG   . SER B 2 67  ? 6.030   -11.030 -4.687  1.00 0.00 ? 325 SER A HG   6  
ATOM   10977 N  N    . GLU B 2 68  ? 9.642   -11.134 -5.915  1.00 0.00 ? 326 GLU A N    6  
ATOM   10978 C  CA   . GLU B 2 68  ? 10.340  -12.367 -5.537  1.00 0.00 ? 326 GLU A CA   6  
ATOM   10979 C  C    . GLU B 2 68  ? 10.556  -12.473 -4.029  1.00 0.00 ? 326 GLU A C    6  
ATOM   10980 O  O    . GLU B 2 68  ? 9.839   -13.196 -3.336  1.00 0.00 ? 326 GLU A O    6  
ATOM   10981 C  CB   . GLU B 2 68  ? 11.693  -12.443 -6.237  1.00 0.00 ? 326 GLU A CB   6  
ATOM   10982 C  CG   . GLU B 2 68  ? 11.600  -12.771 -7.702  1.00 0.00 ? 326 GLU A CG   6  
ATOM   10983 C  CD   . GLU B 2 68  ? 11.437  -14.254 -7.966  1.00 0.00 ? 326 GLU A CD   6  
ATOM   10984 O  OE1  . GLU B 2 68  ? 12.452  -14.981 -7.916  1.00 0.00 ? 326 GLU A OE1  6  
ATOM   10985 O  OE2  . GLU B 2 68  ? 10.294  -14.690 -8.221  1.00 0.00 ? 326 GLU A OE2  6  
ATOM   10986 H  H    . GLU B 2 68  ? 9.991   -10.601 -6.667  1.00 0.00 ? 326 GLU A H    6  
ATOM   10987 H  HA   . GLU B 2 68  ? 9.739   -13.197 -5.861  1.00 0.00 ? 326 GLU A HA   6  
ATOM   10988 H  HB2  . GLU B 2 68  ? 12.184  -11.494 -6.139  1.00 0.00 ? 326 GLU A HB2  6  
ATOM   10989 H  HB3  . GLU B 2 68  ? 12.291  -13.199 -5.766  1.00 0.00 ? 326 GLU A HB3  6  
ATOM   10990 H  HG2  . GLU B 2 68  ? 10.751  -12.256 -8.098  1.00 0.00 ? 326 GLU A HG2  6  
ATOM   10991 H  HG3  . GLU B 2 68  ? 12.494  -12.422 -8.192  1.00 0.00 ? 326 GLU A HG3  6  
ATOM   10992 N  N    . ASN B 2 69  ? 11.555  -11.750 -3.531  1.00 0.00 ? 327 ASN A N    6  
ATOM   10993 C  CA   . ASN B 2 69  ? 11.900  -11.778 -2.113  1.00 0.00 ? 327 ASN A CA   6  
ATOM   10994 C  C    . ASN B 2 69  ? 10.964  -10.921 -1.269  1.00 0.00 ? 327 ASN A C    6  
ATOM   10995 O  O    . ASN B 2 69  ? 11.420  -10.257 -0.356  1.00 0.00 ? 327 ASN A O    6  
ATOM   10996 C  CB   . ASN B 2 69  ? 13.335  -11.306 -1.907  1.00 0.00 ? 327 ASN A CB   6  
ATOM   10997 C  CG   . ASN B 2 69  ? 14.141  -11.286 -3.184  1.00 0.00 ? 327 ASN A CG   6  
ATOM   10998 O  OD1  . ASN B 2 69  ? 14.079  -10.335 -3.962  1.00 0.00 ? 327 ASN A OD1  6  
ATOM   10999 N  ND2  . ASN B 2 69  ? 14.916  -12.338 -3.396  1.00 0.00 ? 327 ASN A ND2  6  
ATOM   11000 H  H    . ASN B 2 69  ? 12.074  -11.178 -4.135  1.00 0.00 ? 327 ASN A H    6  
ATOM   11001 H  HA   . ASN B 2 69  ? 11.832  -12.785 -1.773  1.00 0.00 ? 327 ASN A HA   6  
ATOM   11002 H  HB2  . ASN B 2 69  ? 13.310  -10.321 -1.502  1.00 0.00 ? 327 ASN A HB2  6  
ATOM   11003 H  HB3  . ASN B 2 69  ? 13.831  -11.959 -1.208  1.00 0.00 ? 327 ASN A HB3  6  
ATOM   11004 H  HD21 . ASN B 2 69  ? 14.920  -13.054 -2.728  1.00 0.00 ? 327 ASN A HD21 6  
ATOM   11005 H  HD22 . ASN B 2 69  ? 15.457  -12.352 -4.206  1.00 0.00 ? 327 ASN A HD22 6  
ATOM   11006 N  N    . ASP B 2 70  ? 9.666   -10.922 -1.580  1.00 0.00 ? 328 ASP A N    6  
ATOM   11007 C  CA   . ASP B 2 70  ? 8.686   -10.150 -0.822  1.00 0.00 ? 328 ASP A CA   6  
ATOM   11008 C  C    . ASP B 2 70  ? 8.908   -10.214 0.681   1.00 0.00 ? 328 ASP A C    6  
ATOM   11009 O  O    . ASP B 2 70  ? 8.414   -9.362  1.422   1.00 0.00 ? 328 ASP A O    6  
ATOM   11010 C  CB   . ASP B 2 70  ? 7.278   -10.592 -1.165  1.00 0.00 ? 328 ASP A CB   6  
ATOM   11011 C  CG   . ASP B 2 70  ? 7.156   -12.101 -1.274  1.00 0.00 ? 328 ASP A CG   6  
ATOM   11012 O  OD1  . ASP B 2 70  ? 7.085   -12.766 -0.219  1.00 0.00 ? 328 ASP A OD1  6  
ATOM   11013 O  OD2  . ASP B 2 70  ? 7.132   -12.617 -2.409  1.00 0.00 ? 328 ASP A OD2  6  
ATOM   11014 H  H    . ASP B 2 70  ? 9.365   -11.406 -2.361  1.00 0.00 ? 328 ASP A H    6  
ATOM   11015 H  HA   . ASP B 2 70  ? 8.792   -9.140  -1.129  1.00 0.00 ? 328 ASP A HA   6  
ATOM   11016 H  HB2  . ASP B 2 70  ? 6.603   -10.249 -0.392  1.00 0.00 ? 328 ASP A HB2  6  
ATOM   11017 H  HB3  . ASP B 2 70  ? 7.000   -10.141 -2.108  1.00 0.00 ? 328 ASP A HB3  6  
ATOM   11018 N  N    . ASP B 2 71  ? 9.644   -11.215 1.133   1.00 0.00 ? 329 ASP A N    6  
ATOM   11019 C  CA   . ASP B 2 71  ? 9.942   -11.346 2.552   1.00 0.00 ? 329 ASP A CA   6  
ATOM   11020 C  C    . ASP B 2 71  ? 10.785  -10.157 2.993   1.00 0.00 ? 329 ASP A C    6  
ATOM   11021 O  O    . ASP B 2 71  ? 11.012  -9.938  4.183   1.00 0.00 ? 329 ASP A O    6  
ATOM   11022 C  CB   . ASP B 2 71  ? 10.679  -12.657 2.836   1.00 0.00 ? 329 ASP A CB   6  
ATOM   11023 C  CG   . ASP B 2 71  ? 10.956  -12.853 4.314   1.00 0.00 ? 329 ASP A CG   6  
ATOM   11024 O  OD1  . ASP B 2 71  ? 9.997   -13.129 5.065   1.00 0.00 ? 329 ASP A OD1  6  
ATOM   11025 O  OD2  . ASP B 2 71  ? 12.129  -12.724 4.721   1.00 0.00 ? 329 ASP A OD2  6  
ATOM   11026 H  H    . ASP B 2 71  ? 10.005  -11.865 0.499   1.00 0.00 ? 329 ASP A H    6  
ATOM   11027 H  HA   . ASP B 2 71  ? 9.007   -11.335 3.093   1.00 0.00 ? 329 ASP A HA   6  
ATOM   11028 H  HB2  . ASP B 2 71  ? 10.078  -13.484 2.488   1.00 0.00 ? 329 ASP A HB2  6  
ATOM   11029 H  HB3  . ASP B 2 71  ? 11.621  -12.655 2.309   1.00 0.00 ? 329 ASP A HB3  6  
ATOM   11030 N  N    . GLN B 2 72  ? 11.242  -9.393  2.002   1.00 0.00 ? 330 GLN A N    6  
ATOM   11031 C  CA   . GLN B 2 72  ? 12.049  -8.218  2.226   1.00 0.00 ? 330 GLN A CA   6  
ATOM   11032 C  C    . GLN B 2 72  ? 11.355  -7.002  1.638   1.00 0.00 ? 330 GLN A C    6  
ATOM   11033 O  O    . GLN B 2 72  ? 11.664  -5.868  1.978   1.00 0.00 ? 330 GLN A O    6  
ATOM   11034 C  CB   . GLN B 2 72  ? 13.414  -8.389  1.580   1.00 0.00 ? 330 GLN A CB   6  
ATOM   11035 C  CG   . GLN B 2 72  ? 13.807  -9.840  1.411   1.00 0.00 ? 330 GLN A CG   6  
ATOM   11036 C  CD   . GLN B 2 72  ? 15.264  -10.020 1.087   1.00 0.00 ? 330 GLN A CD   6  
ATOM   11037 O  OE1  . GLN B 2 72  ? 15.644  -10.920 0.337   1.00 0.00 ? 330 GLN A OE1  6  
ATOM   11038 N  NE2  . GLN B 2 72  ? 16.092  -9.173  1.668   1.00 0.00 ? 330 GLN A NE2  6  
ATOM   11039 H  H    . GLN B 2 72  ? 11.028  -9.633  1.084   1.00 0.00 ? 330 GLN A H    6  
ATOM   11040 H  HA   . GLN B 2 72  ? 12.173  -8.088  3.283   1.00 0.00 ? 330 GLN A HA   6  
ATOM   11041 H  HB2  . GLN B 2 72  ? 13.396  -7.924  0.612   1.00 0.00 ? 330 GLN A HB2  6  
ATOM   11042 H  HB3  . GLN B 2 72  ? 14.157  -7.903  2.193   1.00 0.00 ? 330 GLN A HB3  6  
ATOM   11043 H  HG2  . GLN B 2 72  ? 13.605  -10.342 2.332   1.00 0.00 ? 330 GLN A HG2  6  
ATOM   11044 H  HG3  . GLN B 2 72  ? 13.214  -10.278 0.619   1.00 0.00 ? 330 GLN A HG3  6  
ATOM   11045 H  HE21 . GLN B 2 72  ? 15.719  -8.494  2.266   1.00 0.00 ? 330 GLN A HE21 6  
ATOM   11046 H  HE22 . GLN B 2 72  ? 17.037  -9.255  1.471   1.00 0.00 ? 330 GLN A HE22 6  
ATOM   11047 N  N    . LEU B 2 73  ? 10.409  -7.242  0.746   1.00 0.00 ? 331 LEU A N    6  
ATOM   11048 C  CA   . LEU B 2 73  ? 9.692   -6.165  0.122   1.00 0.00 ? 331 LEU A CA   6  
ATOM   11049 C  C    . LEU B 2 73  ? 9.116   -5.241  1.160   1.00 0.00 ? 331 LEU A C    6  
ATOM   11050 O  O    . LEU B 2 73  ? 8.622   -5.665  2.204   1.00 0.00 ? 331 LEU A O    6  
ATOM   11051 C  CB   . LEU B 2 73  ? 8.609   -6.707  -0.785  1.00 0.00 ? 331 LEU A CB   6  
ATOM   11052 C  CG   . LEU B 2 73  ? 9.127   -7.194  -2.132  1.00 0.00 ? 331 LEU A CG   6  
ATOM   11053 C  CD1  . LEU B 2 73  ? 7.989   -7.671  -2.983  1.00 0.00 ? 331 LEU A CD1  6  
ATOM   11054 C  CD2  . LEU B 2 73  ? 9.887   -6.106  -2.842  1.00 0.00 ? 331 LEU A CD2  6  
ATOM   11055 H  H    . LEU B 2 73  ? 10.185  -8.156  0.508   1.00 0.00 ? 331 LEU A H    6  
ATOM   11056 H  HA   . LEU B 2 73  ? 10.396  -5.606  -0.476  1.00 0.00 ? 331 LEU A HA   6  
ATOM   11057 H  HB2  . LEU B 2 73  ? 8.131   -7.537  -0.280  1.00 0.00 ? 331 LEU A HB2  6  
ATOM   11058 H  HB3  . LEU B 2 73  ? 7.879   -5.932  -0.958  1.00 0.00 ? 331 LEU A HB3  6  
ATOM   11059 H  HG   . LEU B 2 73  ? 9.788   -8.024  -1.967  1.00 0.00 ? 331 LEU A HG   6  
ATOM   11060 H  HD11 . LEU B 2 73  ? 7.085   -7.440  -2.484  1.00 0.00 ? 331 LEU A HD11 6  
ATOM   11061 H  HD12 . LEU B 2 73  ? 8.065   -8.740  -3.126  1.00 0.00 ? 331 LEU A HD12 6  
ATOM   11062 H  HD13 . LEU B 2 73  ? 8.016   -7.172  -3.941  1.00 0.00 ? 331 LEU A HD13 6  
ATOM   11063 H  HD21 . LEU B 2 73  ? 9.225   -5.297  -3.025  1.00 0.00 ? 331 LEU A HD21 6  
ATOM   11064 H  HD22 . LEU B 2 73  ? 10.269  -6.482  -3.776  1.00 0.00 ? 331 LEU A HD22 6  
ATOM   11065 H  HD23 . LEU B 2 73  ? 10.706  -5.771  -2.224  1.00 0.00 ? 331 LEU A HD23 6  
ATOM   11066 N  N    . LEU B 2 74  ? 9.200   -3.975  0.852   1.00 0.00 ? 332 LEU A N    6  
ATOM   11067 C  CA   . LEU B 2 74  ? 8.724   -2.941  1.730   1.00 0.00 ? 332 LEU A CA   6  
ATOM   11068 C  C    . LEU B 2 74  ? 7.568   -2.244  1.088   1.00 0.00 ? 332 LEU A C    6  
ATOM   11069 O  O    . LEU B 2 74  ? 7.715   -1.535  0.102   1.00 0.00 ? 332 LEU A O    6  
ATOM   11070 C  CB   . LEU B 2 74  ? 9.818   -1.930  2.028   1.00 0.00 ? 332 LEU A CB   6  
ATOM   11071 C  CG   . LEU B 2 74  ? 10.987  -2.401  2.853   1.00 0.00 ? 332 LEU A CG   6  
ATOM   11072 C  CD1  . LEU B 2 74  ? 12.050  -1.352  2.868   1.00 0.00 ? 332 LEU A CD1  6  
ATOM   11073 C  CD2  . LEU B 2 74  ? 10.590  -2.666  4.270   1.00 0.00 ? 332 LEU A CD2  6  
ATOM   11074 H  H    . LEU B 2 74  ? 9.579   -3.730  -0.021  1.00 0.00 ? 332 LEU A H    6  
ATOM   11075 H  HA   . LEU B 2 74  ? 8.384   -3.404  2.642   1.00 0.00 ? 332 LEU A HA   6  
ATOM   11076 H  HB2  . LEU B 2 74  ? 10.202  -1.566  1.089   1.00 0.00 ? 332 LEU A HB2  6  
ATOM   11077 H  HB3  . LEU B 2 74  ? 9.375   -1.109  2.549   1.00 0.00 ? 332 LEU A HB3  6  
ATOM   11078 H  HG   . LEU B 2 74  ? 11.408  -3.291  2.447   1.00 0.00 ? 332 LEU A HG   6  
ATOM   11079 H  HD11 . LEU B 2 74  ? 11.930  -0.752  3.753   1.00 0.00 ? 332 LEU A HD11 6  
ATOM   11080 H  HD12 . LEU B 2 74  ? 11.965  -0.737  1.990   1.00 0.00 ? 332 LEU A HD12 6  
ATOM   11081 H  HD13 . LEU B 2 74  ? 13.018  -1.821  2.889   1.00 0.00 ? 332 LEU A HD13 6  
ATOM   11082 H  HD21 . LEU B 2 74  ? 11.343  -2.207  4.898   1.00 0.00 ? 332 LEU A HD21 6  
ATOM   11083 H  HD22 . LEU B 2 74  ? 10.558  -3.732  4.449   1.00 0.00 ? 332 LEU A HD22 6  
ATOM   11084 H  HD23 . LEU B 2 74  ? 9.627   -2.227  4.472   1.00 0.00 ? 332 LEU A HD23 6  
ATOM   11085 N  N    . PHE B 2 75  ? 6.434   -2.424  1.687   1.00 0.00 ? 333 PHE A N    6  
ATOM   11086 C  CA   . PHE B 2 75  ? 5.213   -1.874  1.181   1.00 0.00 ? 333 PHE A CA   6  
ATOM   11087 C  C    . PHE B 2 75  ? 5.036   -0.458  1.667   1.00 0.00 ? 333 PHE A C    6  
ATOM   11088 O  O    . PHE B 2 75  ? 4.521   -0.228  2.763   1.00 0.00 ? 333 PHE A O    6  
ATOM   11089 C  CB   . PHE B 2 75  ? 4.079   -2.781  1.646   1.00 0.00 ? 333 PHE A CB   6  
ATOM   11090 C  CG   . PHE B 2 75  ? 4.495   -4.232  1.581   1.00 0.00 ? 333 PHE A CG   6  
ATOM   11091 C  CD1  . PHE B 2 75  ? 5.208   -4.810  2.622   1.00 0.00 ? 333 PHE A CD1  6  
ATOM   11092 C  CD2  . PHE B 2 75  ? 4.219   -4.999  0.466   1.00 0.00 ? 333 PHE A CD2  6  
ATOM   11093 C  CE1  . PHE B 2 75  ? 5.637   -6.120  2.547   1.00 0.00 ? 333 PHE A CE1  6  
ATOM   11094 C  CE2  . PHE B 2 75  ? 4.651   -6.313  0.377   1.00 0.00 ? 333 PHE A CE2  6  
ATOM   11095 C  CZ   . PHE B 2 75  ? 5.366   -6.873  1.422   1.00 0.00 ? 333 PHE A CZ   6  
ATOM   11096 H  H    . PHE B 2 75  ? 6.419   -2.924  2.520   1.00 0.00 ? 333 PHE A H    6  
ATOM   11097 H  HA   . PHE B 2 75  ? 5.256   -1.881  0.103   1.00 0.00 ? 333 PHE A HA   6  
ATOM   11098 H  HB2  . PHE B 2 75  ? 3.828   -2.540  2.672   1.00 0.00 ? 333 PHE A HB2  6  
ATOM   11099 H  HB3  . PHE B 2 75  ? 3.212   -2.633  1.017   1.00 0.00 ? 333 PHE A HB3  6  
ATOM   11100 H  HD1  . PHE B 2 75  ? 5.423   -4.225  3.504   1.00 0.00 ? 333 PHE A HD1  6  
ATOM   11101 H  HD2  . PHE B 2 75  ? 3.682   -4.558  -0.345  1.00 0.00 ? 333 PHE A HD2  6  
ATOM   11102 H  HE1  . PHE B 2 75  ? 6.195   -6.553  3.364   1.00 0.00 ? 333 PHE A HE1  6  
ATOM   11103 H  HE2  . PHE B 2 75  ? 4.406   -6.908  -0.501  1.00 0.00 ? 333 PHE A HE2  6  
ATOM   11104 H  HZ   . PHE B 2 75  ? 5.728   -7.892  1.355   1.00 0.00 ? 333 PHE A HZ   6  
ATOM   11105 N  N    . CYS B 2 76  ? 5.473   0.496   0.852   1.00 0.00 ? 334 CYS A N    6  
ATOM   11106 C  CA   . CYS B 2 76  ? 5.318