data_2LFG
# 
_entry.id   2LFG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LFG         
RCSB  RCSB102326   
BMRB  17752        
WWPDB D_1000102326 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 1RW5  PDB  'Human prolactin' 
unspecified 3EW3  PDB  '2:1 complex'     
unspecified 3NPZ  PDB  '2:1 complex'     
unspecified 3D48  PDB  '1:1 complex'     
unspecified 3MZG  PDB  '1:1 complex'     
unspecified 17752 BMRB .                 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LFG 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-06-30 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Dagil, R.'       1 
'Knudsen, M.J.'   2 
'Kragelund, B.B.' 3 
;O'Shea, C.
;
4 
'Teilum, K.'      5 
# 
_citation.id                        primary 
_citation.title                     
;The WSXWS Motif in Cytokine Receptors Is a Molecular Switch Involved in Receptor Activation: Insight from Structures of the Prolactin Receptor
;
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                270 
_citation.page_last                 282 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22325776 
_citation.pdbx_database_id_DOI      10.1016/j.str.2011.12.010 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Dagil, R.'       1 
primary 'Knudsen, M.J.'   2 
primary 'Olsen, J.G.'     3 
primary 
;O'Shea, C.
;
4 
primary 'Franzmann, M.'   5 
primary 'Goffin, V.'      6 
primary 'Teilum, K.'      7 
primary 'Breinholt, J.'   8 
primary 'Kragelund, B.B.' 9 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Prolactin receptor' 
_entity.formula_weight             13343.341 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'Fibronectin type-III 2 domain residues 99-210' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PRL-R 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQK
YLVQVRCKPDHGYWSAWSPATFIQIPSDFTMND
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQK
YLVQVRCKPDHGYWSAWSPATFIQIPSDFTMND
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   TYR n 
1 3   ILE n 
1 4   VAL n 
1 5   GLN n 
1 6   PRO n 
1 7   ASP n 
1 8   PRO n 
1 9   PRO n 
1 10  LEU n 
1 11  GLU n 
1 12  LEU n 
1 13  ALA n 
1 14  VAL n 
1 15  GLU n 
1 16  VAL n 
1 17  LYS n 
1 18  GLN n 
1 19  PRO n 
1 20  GLU n 
1 21  ASP n 
1 22  ARG n 
1 23  LYS n 
1 24  PRO n 
1 25  TYR n 
1 26  LEU n 
1 27  TRP n 
1 28  ILE n 
1 29  LYS n 
1 30  TRP n 
1 31  SER n 
1 32  PRO n 
1 33  PRO n 
1 34  THR n 
1 35  LEU n 
1 36  ILE n 
1 37  ASP n 
1 38  LEU n 
1 39  LYS n 
1 40  THR n 
1 41  GLY n 
1 42  TRP n 
1 43  PHE n 
1 44  THR n 
1 45  LEU n 
1 46  LEU n 
1 47  TYR n 
1 48  GLU n 
1 49  ILE n 
1 50  ARG n 
1 51  LEU n 
1 52  LYS n 
1 53  PRO n 
1 54  GLU n 
1 55  LYS n 
1 56  ALA n 
1 57  ALA n 
1 58  GLU n 
1 59  TRP n 
1 60  GLU n 
1 61  ILE n 
1 62  HIS n 
1 63  PHE n 
1 64  ALA n 
1 65  GLY n 
1 66  GLN n 
1 67  GLN n 
1 68  THR n 
1 69  GLU n 
1 70  PHE n 
1 71  LYS n 
1 72  ILE n 
1 73  LEU n 
1 74  SER n 
1 75  LEU n 
1 76  HIS n 
1 77  PRO n 
1 78  GLY n 
1 79  GLN n 
1 80  LYS n 
1 81  TYR n 
1 82  LEU n 
1 83  VAL n 
1 84  GLN n 
1 85  VAL n 
1 86  ARG n 
1 87  CYS n 
1 88  LYS n 
1 89  PRO n 
1 90  ASP n 
1 91  HIS n 
1 92  GLY n 
1 93  TYR n 
1 94  TRP n 
1 95  SER n 
1 96  ALA n 
1 97  TRP n 
1 98  SER n 
1 99  PRO n 
1 100 ALA n 
1 101 THR n 
1 102 PHE n 
1 103 ILE n 
1 104 GLN n 
1 105 ILE n 
1 106 PRO n 
1 107 SER n 
1 108 ASP n 
1 109 PHE n 
1 110 THR n 
1 111 MET n 
1 112 ASN n 
1 113 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 PRLR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET11A 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRLR_HUMAN 
_struct_ref.pdbx_db_accession          P16471 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;YIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKY
LVQVRCKPDHGYWSAWSPATFIQIPSDFTMND
;
_struct_ref.pdbx_align_begin           123 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LFG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 113 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P16471 
_struct_ref_seq.db_align_beg                  123 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  234 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       99 
_struct_ref_seq.pdbx_auth_seq_align_end       210 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2LFG 
_struct_ref_seq_dif.mon_id                       MET 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   P16471 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'INITIATING METHIONINE' 
_struct_ref_seq_dif.pdbx_auth_seq_num            98 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'            
1 2  1 '2D 1H-13C HSQC'            
1 3  1 '3D C(CO)NH'                
1 4  1 '3D HNCO'                   
1 5  1 '3D HNCA'                   
1 6  1 '3D HNCACB'                 
1 7  1 '3D HN(CO)CA'               
1 8  1 '3D H(CCO)NH'               
1 9  1 '3D CBCA(CO)NH'             
1 10 1 '3D HN(CA)CO'               
1 11 1 '3D 1H-15N NOESY'           
1 12 1 '3D 1H-15N TOCSY'           
1 13 1 '3D HCCH-TOCSY'             
1 14 1 '3D 1H-13C NOESY aliphatic' 
1 15 1 '3D 1H-13C NOESY aromatic'  
1 16 2 '2D 1H-13C HSQC aromatic'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.4 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.5 mM [U-100% 13C; U-100% 15N] protein, 10 mM sodium phosphate, 10 mM TCEP, 1 mM DSS, 0.02 % sodium azide, 90% H2O/10% D2O' 1 
'90% H2O/10% D2O' 
'0.5 mM [U-100% 13C(1)] protein, 10 mM sodium phosphate, 10 mM TCEP, 0.02 % sodium azide, 1 mM DSS, 100% D2O'                 2 
'100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Varian INOVA  1 'Varian INOVA'  
800 Bruker Avance 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2LFG 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  ? 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LFG 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0.25 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.34 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LFG 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Zimmerman, Moseley, Kulikowski and Montelione'     'chemical shift assignment' AutoAssign 2.3.0 1 
'Guntert, Mumenthaler and Wuthrich'                 'chemical shift assignment' CYANA      2.2.1 2 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        X-PLOR_NIH 2.25  3 
'Cornilescu, Delaglio and Bax'                      'geometry optimization'     TALOS      ?     4 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRDraw    ?     5 
CCPN                                                'peak picking'              CCPN       2.1.5 6 
;Linge, O'Donoghue and Nilges
;
'water refinement'          ARIA       2.3.2 7 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH ?     8 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LFG 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LFG 
_struct.title                     'Solution structure of the human prolactin receptor ecd domain d2' 
_struct.pdbx_descriptor           'Prolactin receptor' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LFG 
_struct_keywords.pdbx_keywords   'HORMONE RECEPTOR' 
_struct_keywords.text            'Extracellular domain, Cytokine receptor, Hormone receptor' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       PRO 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        106 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       THR 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        110 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        PRO 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         203 
_struct_conf.end_auth_comp_id        THR 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         207 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 10  ? LYS A 17  ? LEU A 107 LYS A 114 
A 2 TYR A 25  ? SER A 31  ? TYR A 122 SER A 128 
A 3 GLU A 69  ? ILE A 72  ? GLU A 166 ILE A 169 
B 1 GLU A 60  ? GLY A 65  ? GLU A 157 GLY A 162 
B 2 TYR A 47  ? PRO A 53  ? TYR A 144 PRO A 150 
B 3 GLN A 79  ? CYS A 87  ? GLN A 176 CYS A 184 
B 4 THR A 101 ? ILE A 105 ? THR A 198 ILE A 202 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU A 15 ? N GLU A 112 O TRP A 27  ? O TRP A 124 
A 2 3 N ILE A 28 ? N ILE A 125 O PHE A 70  ? O PHE A 167 
B 1 2 O HIS A 62 ? O HIS A 159 N ILE A 49  ? N ILE A 146 
B 2 3 N LYS A 52 ? N LYS A 149 O LEU A 82  ? O LEU A 179 
B 3 4 N TYR A 81 ? N TYR A 178 O ILE A 103 ? O ILE A 200 
# 
_atom_sites.entry_id                    2LFG 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? 30.763  0.216   -11.042 1.00 0.00 ? 98  MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? 29.658  -0.453  -10.318 1.00 0.00 ? 98  MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? 29.157  0.413   -9.169  1.00 0.00 ? 98  MET A C    1  
ATOM 4     O O    . MET A 1 1   ? 28.807  -0.092  -8.100  1.00 0.00 ? 98  MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? 30.107  -1.815  -9.783  1.00 0.00 ? 98  MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? 30.478  -2.810  -10.869 1.00 0.00 ? 98  MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? 30.943  -4.422  -10.205 1.00 0.00 ? 98  MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? 32.358  -3.979  -9.198  1.00 0.00 ? 98  MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? 31.104  -0.386  -11.815 1.00 0.00 ? 98  MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? 31.553  0.405   -10.393 1.00 0.00 ? 98  MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? 30.437  1.118   -11.441 1.00 0.00 ? 98  MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? 28.845  -0.600  -11.011 1.00 0.00 ? 98  MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? 30.967  -1.672  -9.147  1.00 0.00 ? 98  MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? 29.305  -2.239  -9.196  1.00 0.00 ? 98  MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? 29.632  -2.938  -11.526 1.00 0.00 ? 98  MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? 31.311  -2.415  -11.431 1.00 0.00 ? 98  MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? 32.768  -4.868  -8.743  1.00 0.00 ? 98  MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? 32.050  -3.289  -8.427  1.00 0.00 ? 98  MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? 33.108  -3.513  -9.819  1.00 0.00 ? 98  MET A HE3  1  
ATOM 20    N N    . TYR A 1 2   ? 29.127  1.720   -9.387  1.00 0.00 ? 99  TYR A N    1  
ATOM 21    C CA   . TYR A 1 2   ? 28.577  2.635   -8.405  1.00 0.00 ? 99  TYR A CA   1  
ATOM 22    C C    . TYR A 1 2   ? 27.059  2.553   -8.414  1.00 0.00 ? 99  TYR A C    1  
ATOM 23    O O    . TYR A 1 2   ? 26.423  2.546   -9.472  1.00 0.00 ? 99  TYR A O    1  
ATOM 24    C CB   . TYR A 1 2   ? 29.051  4.076   -8.663  1.00 0.00 ? 99  TYR A CB   1  
ATOM 25    C CG   . TYR A 1 2   ? 28.206  5.130   -7.973  1.00 0.00 ? 99  TYR A CG   1  
ATOM 26    C CD1  . TYR A 1 2   ? 27.993  5.097   -6.599  1.00 0.00 ? 99  TYR A CD1  1  
ATOM 27    C CD2  . TYR A 1 2   ? 27.598  6.140   -8.703  1.00 0.00 ? 99  TYR A CD2  1  
ATOM 28    C CE1  . TYR A 1 2   ? 27.200  6.042   -5.978  1.00 0.00 ? 99  TYR A CE1  1  
ATOM 29    C CE2  . TYR A 1 2   ? 26.801  7.087   -8.090  1.00 0.00 ? 99  TYR A CE2  1  
ATOM 30    C CZ   . TYR A 1 2   ? 26.605  7.033   -6.729  1.00 0.00 ? 99  TYR A CZ   1  
ATOM 31    O OH   . TYR A 1 2   ? 25.805  7.972   -6.118  1.00 0.00 ? 99  TYR A OH   1  
ATOM 32    H H    . TYR A 1 2   ? 29.470  2.077   -10.232 1.00 0.00 ? 99  TYR A H    1  
ATOM 33    H HA   . TYR A 1 2   ? 28.926  2.318   -7.432  1.00 0.00 ? 99  TYR A HA   1  
ATOM 34    H HB2  . TYR A 1 2   ? 30.064  4.182   -8.308  1.00 0.00 ? 99  TYR A HB2  1  
ATOM 35    H HB3  . TYR A 1 2   ? 29.024  4.271   -9.725  1.00 0.00 ? 99  TYR A HB3  1  
ATOM 36    H HD1  . TYR A 1 2   ? 28.461  4.320   -6.014  1.00 0.00 ? 99  TYR A HD1  1  
ATOM 37    H HD2  . TYR A 1 2   ? 27.752  6.181   -9.772  1.00 0.00 ? 99  TYR A HD2  1  
ATOM 38    H HE1  . TYR A 1 2   ? 27.042  5.996   -4.912  1.00 0.00 ? 99  TYR A HE1  1  
ATOM 39    H HE2  . TYR A 1 2   ? 26.333  7.862   -8.678  1.00 0.00 ? 99  TYR A HE2  1  
ATOM 40    H HH   . TYR A 1 2   ? 24.986  8.068   -6.625  1.00 0.00 ? 99  TYR A HH   1  
ATOM 41    N N    . ILE A 1 3   ? 26.497  2.475   -7.223  1.00 0.00 ? 100 ILE A N    1  
ATOM 42    C CA   . ILE A 1 3   ? 25.064  2.364   -7.044  1.00 0.00 ? 100 ILE A CA   1  
ATOM 43    C C    . ILE A 1 3   ? 24.378  3.698   -7.320  1.00 0.00 ? 100 ILE A C    1  
ATOM 44    O O    . ILE A 1 3   ? 24.348  4.589   -6.465  1.00 0.00 ? 100 ILE A O    1  
ATOM 45    C CB   . ILE A 1 3   ? 24.723  1.876   -5.616  1.00 0.00 ? 100 ILE A CB   1  
ATOM 46    C CG1  . ILE A 1 3   ? 25.240  0.447   -5.396  1.00 0.00 ? 100 ILE A CG1  1  
ATOM 47    C CG2  . ILE A 1 3   ? 23.225  1.950   -5.354  1.00 0.00 ? 100 ILE A CG2  1  
ATOM 48    C CD1  . ILE A 1 3   ? 26.709  0.365   -5.030  1.00 0.00 ? 100 ILE A CD1  1  
ATOM 49    H H    . ILE A 1 3   ? 27.070  2.495   -6.429  1.00 0.00 ? 100 ILE A H    1  
ATOM 50    H HA   . ILE A 1 3   ? 24.698  1.632   -7.749  1.00 0.00 ? 100 ILE A HA   1  
ATOM 51    H HB   . ILE A 1 3   ? 25.214  2.535   -4.916  1.00 0.00 ? 100 ILE A HB   1  
ATOM 52    H HG12 . ILE A 1 3   ? 24.677  -0.012  -4.600  1.00 0.00 ? 100 ILE A HG12 1  
ATOM 53    H HG13 . ILE A 1 3   ? 25.097  -0.118  -6.305  1.00 0.00 ? 100 ILE A HG13 1  
ATOM 54    H HG21 . ILE A 1 3   ? 23.018  1.610   -4.351  1.00 0.00 ? 100 ILE A HG21 1  
ATOM 55    H HG22 . ILE A 1 3   ? 22.703  1.326   -6.062  1.00 0.00 ? 100 ILE A HG22 1  
ATOM 56    H HG23 . ILE A 1 3   ? 22.895  2.974   -5.462  1.00 0.00 ? 100 ILE A HG23 1  
ATOM 57    H HD11 . ILE A 1 3   ? 26.986  -0.669  -4.882  1.00 0.00 ? 100 ILE A HD11 1  
ATOM 58    H HD12 . ILE A 1 3   ? 26.885  0.918   -4.120  1.00 0.00 ? 100 ILE A HD12 1  
ATOM 59    H HD13 . ILE A 1 3   ? 27.303  0.785   -5.828  1.00 0.00 ? 100 ILE A HD13 1  
ATOM 60    N N    . VAL A 1 4   ? 23.853  3.840   -8.525  1.00 0.00 ? 101 VAL A N    1  
ATOM 61    C CA   . VAL A 1 4   ? 23.109  5.028   -8.895  1.00 0.00 ? 101 VAL A CA   1  
ATOM 62    C C    . VAL A 1 4   ? 21.619  4.747   -8.785  1.00 0.00 ? 101 VAL A C    1  
ATOM 63    O O    . VAL A 1 4   ? 21.193  3.590   -8.800  1.00 0.00 ? 101 VAL A O    1  
ATOM 64    C CB   . VAL A 1 4   ? 23.437  5.514   -10.328 1.00 0.00 ? 101 VAL A CB   1  
ATOM 65    C CG1  . VAL A 1 4   ? 24.935  5.548   -10.562 1.00 0.00 ? 101 VAL A CG1  1  
ATOM 66    C CG2  . VAL A 1 4   ? 22.751  4.658   -11.380 1.00 0.00 ? 101 VAL A CG2  1  
ATOM 67    H H    . VAL A 1 4   ? 23.962  3.122   -9.183  1.00 0.00 ? 101 VAL A H    1  
ATOM 68    H HA   . VAL A 1 4   ? 23.369  5.814   -8.199  1.00 0.00 ? 101 VAL A HA   1  
ATOM 69    H HB   . VAL A 1 4   ? 23.070  6.524   -10.427 1.00 0.00 ? 101 VAL A HB   1  
ATOM 70    H HG11 . VAL A 1 4   ? 25.393  6.232   -9.862  1.00 0.00 ? 101 VAL A HG11 1  
ATOM 71    H HG12 . VAL A 1 4   ? 25.135  5.877   -11.570 1.00 0.00 ? 101 VAL A HG12 1  
ATOM 72    H HG13 . VAL A 1 4   ? 25.345  4.560   -10.418 1.00 0.00 ? 101 VAL A HG13 1  
ATOM 73    H HG21 . VAL A 1 4   ? 21.680  4.720   -11.252 1.00 0.00 ? 101 VAL A HG21 1  
ATOM 74    H HG22 . VAL A 1 4   ? 23.068  3.635   -11.271 1.00 0.00 ? 101 VAL A HG22 1  
ATOM 75    H HG23 . VAL A 1 4   ? 23.018  5.016   -12.364 1.00 0.00 ? 101 VAL A HG23 1  
ATOM 76    N N    . GLN A 1 5   ? 20.839  5.799   -8.645  1.00 0.00 ? 102 GLN A N    1  
ATOM 77    C CA   . GLN A 1 5   ? 19.399  5.670   -8.546  1.00 0.00 ? 102 GLN A CA   1  
ATOM 78    C C    . GLN A 1 5   ? 18.747  6.106   -9.854  1.00 0.00 ? 102 GLN A C    1  
ATOM 79    O O    . GLN A 1 5   ? 18.538  7.296   -10.083 1.00 0.00 ? 102 GLN A O    1  
ATOM 80    C CB   . GLN A 1 5   ? 18.888  6.522   -7.387  1.00 0.00 ? 102 GLN A CB   1  
ATOM 81    C CG   . GLN A 1 5   ? 17.393  6.410   -7.154  1.00 0.00 ? 102 GLN A CG   1  
ATOM 82    C CD   . GLN A 1 5   ? 16.932  7.225   -5.965  1.00 0.00 ? 102 GLN A CD   1  
ATOM 83    O OE1  . GLN A 1 5   ? 15.975  6.859   -5.284  1.00 0.00 ? 102 GLN A OE1  1  
ATOM 84    N NE2  . GLN A 1 5   ? 17.605  8.334   -5.707  1.00 0.00 ? 102 GLN A NE2  1  
ATOM 85    H H    . GLN A 1 5   ? 21.241  6.693   -8.622  1.00 0.00 ? 102 GLN A H    1  
ATOM 86    H HA   . GLN A 1 5   ? 19.165  4.633   -8.359  1.00 0.00 ? 102 GLN A HA   1  
ATOM 87    H HB2  . GLN A 1 5   ? 19.394  6.218   -6.482  1.00 0.00 ? 102 GLN A HB2  1  
ATOM 88    H HB3  . GLN A 1 5   ? 19.122  7.557   -7.588  1.00 0.00 ? 102 GLN A HB3  1  
ATOM 89    H HG2  . GLN A 1 5   ? 16.877  6.761   -8.034  1.00 0.00 ? 102 GLN A HG2  1  
ATOM 90    H HG3  . GLN A 1 5   ? 17.145  5.373   -6.980  1.00 0.00 ? 102 GLN A HG3  1  
ATOM 91    H HE21 . GLN A 1 5   ? 18.357  8.568   -6.291  1.00 0.00 ? 102 GLN A HE21 1  
ATOM 92    H HE22 . GLN A 1 5   ? 17.324  8.878   -4.941  1.00 0.00 ? 102 GLN A HE22 1  
ATOM 93    N N    . PRO A 1 6   ? 18.432  5.148   -10.741 1.00 0.00 ? 103 PRO A N    1  
ATOM 94    C CA   . PRO A 1 6   ? 17.833  5.458   -12.035 1.00 0.00 ? 103 PRO A CA   1  
ATOM 95    C C    . PRO A 1 6   ? 16.365  5.861   -11.912 1.00 0.00 ? 103 PRO A C    1  
ATOM 96    O O    . PRO A 1 6   ? 16.041  7.048   -11.872 1.00 0.00 ? 103 PRO A O    1  
ATOM 97    C CB   . PRO A 1 6   ? 17.991  4.160   -12.830 1.00 0.00 ? 103 PRO A CB   1  
ATOM 98    C CG   . PRO A 1 6   ? 18.077  3.077   -11.806 1.00 0.00 ? 103 PRO A CG   1  
ATOM 99    C CD   . PRO A 1 6   ? 18.641  3.700   -10.553 1.00 0.00 ? 103 PRO A CD   1  
ATOM 100   H HA   . PRO A 1 6   ? 18.373  6.252   -12.532 1.00 0.00 ? 103 PRO A HA   1  
ATOM 101   H HB2  . PRO A 1 6   ? 17.135  4.026   -13.476 1.00 0.00 ? 103 PRO A HB2  1  
ATOM 102   H HB3  . PRO A 1 6   ? 18.891  4.210   -13.425 1.00 0.00 ? 103 PRO A HB3  1  
ATOM 103   H HG2  . PRO A 1 6   ? 17.092  2.680   -11.612 1.00 0.00 ? 103 PRO A HG2  1  
ATOM 104   H HG3  . PRO A 1 6   ? 18.731  2.293   -12.159 1.00 0.00 ? 103 PRO A HG3  1  
ATOM 105   H HD2  . PRO A 1 6   ? 18.105  3.346   -9.685  1.00 0.00 ? 103 PRO A HD2  1  
ATOM 106   H HD3  . PRO A 1 6   ? 19.694  3.473   -10.462 1.00 0.00 ? 103 PRO A HD3  1  
ATOM 107   N N    . ASP A 1 7   ? 15.480  4.878   -11.822 1.00 0.00 ? 104 ASP A N    1  
ATOM 108   C CA   . ASP A 1 7   ? 14.054  5.147   -11.707 1.00 0.00 ? 104 ASP A CA   1  
ATOM 109   C C    . ASP A 1 7   ? 13.403  4.174   -10.735 1.00 0.00 ? 104 ASP A C    1  
ATOM 110   O O    . ASP A 1 7   ? 13.392  2.965   -10.969 1.00 0.00 ? 104 ASP A O    1  
ATOM 111   C CB   . ASP A 1 7   ? 13.358  5.050   -13.072 1.00 0.00 ? 104 ASP A CB   1  
ATOM 112   C CG   . ASP A 1 7   ? 13.767  6.151   -14.031 1.00 0.00 ? 104 ASP A CG   1  
ATOM 113   O OD1  . ASP A 1 7   ? 13.182  7.255   -13.970 1.00 0.00 ? 104 ASP A OD1  1  
ATOM 114   O OD2  . ASP A 1 7   ? 14.674  5.917   -14.859 1.00 0.00 ? 104 ASP A OD2  1  
ATOM 115   H H    . ASP A 1 7   ? 15.790  3.950   -11.830 1.00 0.00 ? 104 ASP A H    1  
ATOM 116   H HA   . ASP A 1 7   ? 13.937  6.149   -11.326 1.00 0.00 ? 104 ASP A HA   1  
ATOM 117   H HB2  . ASP A 1 7   ? 13.602  4.101   -13.525 1.00 0.00 ? 104 ASP A HB2  1  
ATOM 118   H HB3  . ASP A 1 7   ? 12.289  5.107   -12.925 1.00 0.00 ? 104 ASP A HB3  1  
ATOM 119   N N    . PRO A 1 8   ? 12.898  4.684   -9.605  1.00 0.00 ? 105 PRO A N    1  
ATOM 120   C CA   . PRO A 1 8   ? 12.071  3.906   -8.684  1.00 0.00 ? 105 PRO A CA   1  
ATOM 121   C C    . PRO A 1 8   ? 10.659  3.741   -9.244  1.00 0.00 ? 105 PRO A C    1  
ATOM 122   O O    . PRO A 1 8   ? 10.309  4.383   -10.236 1.00 0.00 ? 105 PRO A O    1  
ATOM 123   C CB   . PRO A 1 8   ? 12.047  4.759   -7.400  1.00 0.00 ? 105 PRO A CB   1  
ATOM 124   C CG   . PRO A 1 8   ? 13.004  5.882   -7.632  1.00 0.00 ? 105 PRO A CG   1  
ATOM 125   C CD   . PRO A 1 8   ? 13.100  6.051   -9.119  1.00 0.00 ? 105 PRO A CD   1  
ATOM 126   H HA   . PRO A 1 8   ? 12.501  2.936   -8.479  1.00 0.00 ? 105 PRO A HA   1  
ATOM 127   H HB2  . PRO A 1 8   ? 11.046  5.128   -7.233  1.00 0.00 ? 105 PRO A HB2  1  
ATOM 128   H HB3  . PRO A 1 8   ? 12.352  4.153   -6.560  1.00 0.00 ? 105 PRO A HB3  1  
ATOM 129   H HG2  . PRO A 1 8   ? 12.627  6.786   -7.176  1.00 0.00 ? 105 PRO A HG2  1  
ATOM 130   H HG3  . PRO A 1 8   ? 13.971  5.631   -7.220  1.00 0.00 ? 105 PRO A HG3  1  
ATOM 131   H HD2  . PRO A 1 8   ? 12.324  6.712   -9.479  1.00 0.00 ? 105 PRO A HD2  1  
ATOM 132   H HD3  . PRO A 1 8   ? 14.076  6.419   -9.395  1.00 0.00 ? 105 PRO A HD3  1  
ATOM 133   N N    . PRO A 1 9   ? 9.830   2.872   -8.639  1.00 0.00 ? 106 PRO A N    1  
ATOM 134   C CA   . PRO A 1 9   ? 8.440   2.709   -9.060  1.00 0.00 ? 106 PRO A CA   1  
ATOM 135   C C    . PRO A 1 9   ? 7.613   3.940   -8.727  1.00 0.00 ? 106 PRO A C    1  
ATOM 136   O O    . PRO A 1 9   ? 7.065   4.072   -7.631  1.00 0.00 ? 106 PRO A O    1  
ATOM 137   C CB   . PRO A 1 9   ? 7.952   1.497   -8.275  1.00 0.00 ? 106 PRO A CB   1  
ATOM 138   C CG   . PRO A 1 9   ? 8.850   1.415   -7.089  1.00 0.00 ? 106 PRO A CG   1  
ATOM 139   C CD   . PRO A 1 9   ? 10.176  1.986   -7.517  1.00 0.00 ? 106 PRO A CD   1  
ATOM 140   H HA   . PRO A 1 9   ? 8.371   2.508   -10.120 1.00 0.00 ? 106 PRO A HA   1  
ATOM 141   H HB2  . PRO A 1 9   ? 6.925   1.653   -7.986  1.00 0.00 ? 106 PRO A HB2  1  
ATOM 142   H HB3  . PRO A 1 9   ? 8.029   0.616   -8.891  1.00 0.00 ? 106 PRO A HB3  1  
ATOM 143   H HG2  . PRO A 1 9   ? 8.439   1.995   -6.276  1.00 0.00 ? 106 PRO A HG2  1  
ATOM 144   H HG3  . PRO A 1 9   ? 8.968   0.384   -6.790  1.00 0.00 ? 106 PRO A HG3  1  
ATOM 145   H HD2  . PRO A 1 9   ? 10.623  2.546   -6.709  1.00 0.00 ? 106 PRO A HD2  1  
ATOM 146   H HD3  . PRO A 1 9   ? 10.838  1.197   -7.841  1.00 0.00 ? 106 PRO A HD3  1  
ATOM 147   N N    . LEU A 1 10  ? 7.543   4.835   -9.688  1.00 0.00 ? 107 LEU A N    1  
ATOM 148   C CA   . LEU A 1 10  ? 6.883   6.116   -9.508  1.00 0.00 ? 107 LEU A CA   1  
ATOM 149   C C    . LEU A 1 10  ? 5.404   6.028   -9.861  1.00 0.00 ? 107 LEU A C    1  
ATOM 150   O O    . LEU A 1 10  ? 4.916   4.965   -10.254 1.00 0.00 ? 107 LEU A O    1  
ATOM 151   C CB   . LEU A 1 10  ? 7.596   7.206   -10.328 1.00 0.00 ? 107 LEU A CB   1  
ATOM 152   C CG   . LEU A 1 10  ? 8.140   6.779   -11.702 1.00 0.00 ? 107 LEU A CG   1  
ATOM 153   C CD1  . LEU A 1 10  ? 7.016   6.557   -12.701 1.00 0.00 ? 107 LEU A CD1  1  
ATOM 154   C CD2  . LEU A 1 10  ? 9.120   7.815   -12.227 1.00 0.00 ? 107 LEU A CD2  1  
ATOM 155   H H    . LEU A 1 10  ? 7.940   4.618   -10.552 1.00 0.00 ? 107 LEU A H    1  
ATOM 156   H HA   . LEU A 1 10  ? 6.961   6.370   -8.462  1.00 0.00 ? 107 LEU A HA   1  
ATOM 157   H HB2  . LEU A 1 10  ? 6.901   8.018   -10.482 1.00 0.00 ? 107 LEU A HB2  1  
ATOM 158   H HB3  . LEU A 1 10  ? 8.424   7.576   -9.741  1.00 0.00 ? 107 LEU A HB3  1  
ATOM 159   H HG   . LEU A 1 10  ? 8.673   5.846   -11.594 1.00 0.00 ? 107 LEU A HG   1  
ATOM 160   H HD11 . LEU A 1 10  ? 7.425   6.179   -13.626 1.00 0.00 ? 107 LEU A HD11 1  
ATOM 161   H HD12 . LEU A 1 10  ? 6.512   7.494   -12.887 1.00 0.00 ? 107 LEU A HD12 1  
ATOM 162   H HD13 . LEU A 1 10  ? 6.313   5.844   -12.298 1.00 0.00 ? 107 LEU A HD13 1  
ATOM 163   H HD21 . LEU A 1 10  ? 9.485   7.506   -13.195 1.00 0.00 ? 107 LEU A HD21 1  
ATOM 164   H HD22 . LEU A 1 10  ? 9.949   7.905   -11.541 1.00 0.00 ? 107 LEU A HD22 1  
ATOM 165   H HD23 . LEU A 1 10  ? 8.622   8.768   -12.317 1.00 0.00 ? 107 LEU A HD23 1  
ATOM 166   N N    . GLU A 1 11  ? 4.700   7.148   -9.708  1.00 0.00 ? 108 GLU A N    1  
ATOM 167   C CA   . GLU A 1 11  ? 3.255   7.195   -9.907  1.00 0.00 ? 108 GLU A CA   1  
ATOM 168   C C    . GLU A 1 11  ? 2.578   6.192   -8.984  1.00 0.00 ? 108 GLU A C    1  
ATOM 169   O O    . GLU A 1 11  ? 1.746   5.388   -9.415  1.00 0.00 ? 108 GLU A O    1  
ATOM 170   C CB   . GLU A 1 11  ? 2.882   6.914   -11.366 1.00 0.00 ? 108 GLU A CB   1  
ATOM 171   C CG   . GLU A 1 11  ? 3.502   7.884   -12.356 1.00 0.00 ? 108 GLU A CG   1  
ATOM 172   C CD   . GLU A 1 11  ? 3.058   7.626   -13.780 1.00 0.00 ? 108 GLU A CD   1  
ATOM 173   O OE1  . GLU A 1 11  ? 3.394   6.558   -14.330 1.00 0.00 ? 108 GLU A OE1  1  
ATOM 174   O OE2  . GLU A 1 11  ? 2.372   8.493   -14.360 1.00 0.00 ? 108 GLU A OE2  1  
ATOM 175   H H    . GLU A 1 11  ? 5.167   7.967   -9.439  1.00 0.00 ? 108 GLU A H    1  
ATOM 176   H HA   . GLU A 1 11  ? 2.919   8.188   -9.643  1.00 0.00 ? 108 GLU A HA   1  
ATOM 177   H HB2  . GLU A 1 11  ? 3.208   5.916   -11.621 1.00 0.00 ? 108 GLU A HB2  1  
ATOM 178   H HB3  . GLU A 1 11  ? 1.808   6.968   -11.466 1.00 0.00 ? 108 GLU A HB3  1  
ATOM 179   H HG2  . GLU A 1 11  ? 3.217   8.889   -12.084 1.00 0.00 ? 108 GLU A HG2  1  
ATOM 180   H HG3  . GLU A 1 11  ? 4.576   7.791   -12.307 1.00 0.00 ? 108 GLU A HG3  1  
ATOM 181   N N    . LEU A 1 12  ? 2.959   6.243   -7.715  1.00 0.00 ? 109 LEU A N    1  
ATOM 182   C CA   . LEU A 1 12  ? 2.441   5.331   -6.710  1.00 0.00 ? 109 LEU A CA   1  
ATOM 183   C C    . LEU A 1 12  ? 0.962   5.616   -6.471  1.00 0.00 ? 109 LEU A C    1  
ATOM 184   O O    . LEU A 1 12  ? 0.604   6.509   -5.703  1.00 0.00 ? 109 LEU A O    1  
ATOM 185   C CB   . LEU A 1 12  ? 3.230   5.489   -5.404  1.00 0.00 ? 109 LEU A CB   1  
ATOM 186   C CG   . LEU A 1 12  ? 3.454   4.202   -4.601  1.00 0.00 ? 109 LEU A CG   1  
ATOM 187   C CD1  . LEU A 1 12  ? 4.163   4.507   -3.290  1.00 0.00 ? 109 LEU A CD1  1  
ATOM 188   C CD2  . LEU A 1 12  ? 2.142   3.481   -4.343  1.00 0.00 ? 109 LEU A CD2  1  
ATOM 189   H H    . LEU A 1 12  ? 3.611   6.926   -7.444  1.00 0.00 ? 109 LEU A H    1  
ATOM 190   H HA   . LEU A 1 12  ? 2.554   4.323   -7.078  1.00 0.00 ? 109 LEU A HA   1  
ATOM 191   H HB2  . LEU A 1 12  ? 4.196   5.908   -5.644  1.00 0.00 ? 109 LEU A HB2  1  
ATOM 192   H HB3  . LEU A 1 12  ? 2.702   6.189   -4.775  1.00 0.00 ? 109 LEU A HB3  1  
ATOM 193   H HG   . LEU A 1 12  ? 4.089   3.541   -5.173  1.00 0.00 ? 109 LEU A HG   1  
ATOM 194   H HD11 . LEU A 1 12  ? 3.576   5.210   -2.717  1.00 0.00 ? 109 LEU A HD11 1  
ATOM 195   H HD12 . LEU A 1 12  ? 5.134   4.932   -3.496  1.00 0.00 ? 109 LEU A HD12 1  
ATOM 196   H HD13 . LEU A 1 12  ? 4.283   3.594   -2.724  1.00 0.00 ? 109 LEU A HD13 1  
ATOM 197   H HD21 . LEU A 1 12  ? 1.700   3.192   -5.286  1.00 0.00 ? 109 LEU A HD21 1  
ATOM 198   H HD22 . LEU A 1 12  ? 1.466   4.138   -3.814  1.00 0.00 ? 109 LEU A HD22 1  
ATOM 199   H HD23 . LEU A 1 12  ? 2.327   2.600   -3.746  1.00 0.00 ? 109 LEU A HD23 1  
ATOM 200   N N    . ALA A 1 13  ? 0.111   4.859   -7.138  1.00 0.00 ? 110 ALA A N    1  
ATOM 201   C CA   . ALA A 1 13  ? -1.320  5.058   -7.042  1.00 0.00 ? 110 ALA A CA   1  
ATOM 202   C C    . ALA A 1 13  ? -1.918  4.130   -6.001  1.00 0.00 ? 110 ALA A C    1  
ATOM 203   O O    . ALA A 1 13  ? -1.739  2.911   -6.057  1.00 0.00 ? 110 ALA A O    1  
ATOM 204   C CB   . ALA A 1 13  ? -1.979  4.840   -8.391  1.00 0.00 ? 110 ALA A CB   1  
ATOM 205   H H    . ALA A 1 13  ? 0.456   4.128   -7.699  1.00 0.00 ? 110 ALA A H    1  
ATOM 206   H HA   . ALA A 1 13  ? -1.495  6.080   -6.741  1.00 0.00 ? 110 ALA A HA   1  
ATOM 207   H HB1  . ALA A 1 13  ? -1.504  5.467   -9.130  1.00 0.00 ? 110 ALA A HB1  1  
ATOM 208   H HB2  . ALA A 1 13  ? -3.025  5.094   -8.321  1.00 0.00 ? 110 ALA A HB2  1  
ATOM 209   H HB3  . ALA A 1 13  ? -1.878  3.804   -8.677  1.00 0.00 ? 110 ALA A HB3  1  
ATOM 210   N N    . VAL A 1 14  ? -2.623  4.711   -5.053  1.00 0.00 ? 111 VAL A N    1  
ATOM 211   C CA   . VAL A 1 14  ? -3.213  3.948   -3.971  1.00 0.00 ? 111 VAL A CA   1  
ATOM 212   C C    . VAL A 1 14  ? -4.721  4.133   -3.978  1.00 0.00 ? 111 VAL A C    1  
ATOM 213   O O    . VAL A 1 14  ? -5.219  5.252   -3.855  1.00 0.00 ? 111 VAL A O    1  
ATOM 214   C CB   . VAL A 1 14  ? -2.663  4.383   -2.600  1.00 0.00 ? 111 VAL A CB   1  
ATOM 215   C CG1  . VAL A 1 14  ? -3.010  3.357   -1.536  1.00 0.00 ? 111 VAL A CG1  1  
ATOM 216   C CG2  . VAL A 1 14  ? -1.159  4.612   -2.658  1.00 0.00 ? 111 VAL A CG2  1  
ATOM 217   H H    . VAL A 1 14  ? -2.771  5.679   -5.093  1.00 0.00 ? 111 VAL A H    1  
ATOM 218   H HA   . VAL A 1 14  ? -2.980  2.904   -4.123  1.00 0.00 ? 111 VAL A HA   1  
ATOM 219   H HB   . VAL A 1 14  ? -3.137  5.313   -2.332  1.00 0.00 ? 111 VAL A HB   1  
ATOM 220   H HG11 . VAL A 1 14  ? -2.642  3.692   -0.579  1.00 0.00 ? 111 VAL A HG11 1  
ATOM 221   H HG12 . VAL A 1 14  ? -2.553  2.411   -1.786  1.00 0.00 ? 111 VAL A HG12 1  
ATOM 222   H HG13 . VAL A 1 14  ? -4.081  3.237   -1.489  1.00 0.00 ? 111 VAL A HG13 1  
ATOM 223   H HG21 . VAL A 1 14  ? -0.937  5.343   -3.422  1.00 0.00 ? 111 VAL A HG21 1  
ATOM 224   H HG22 . VAL A 1 14  ? -0.662  3.683   -2.894  1.00 0.00 ? 111 VAL A HG22 1  
ATOM 225   H HG23 . VAL A 1 14  ? -0.812  4.974   -1.702  1.00 0.00 ? 111 VAL A HG23 1  
ATOM 226   N N    . GLU A 1 15  ? -5.441  3.040   -4.124  1.00 0.00 ? 112 GLU A N    1  
ATOM 227   C CA   . GLU A 1 15  ? -6.889  3.093   -4.218  1.00 0.00 ? 112 GLU A CA   1  
ATOM 228   C C    . GLU A 1 15  ? -7.532  2.147   -3.215  1.00 0.00 ? 112 GLU A C    1  
ATOM 229   O O    . GLU A 1 15  ? -7.022  1.062   -2.961  1.00 0.00 ? 112 GLU A O    1  
ATOM 230   C CB   . GLU A 1 15  ? -7.335  2.733   -5.635  1.00 0.00 ? 112 GLU A CB   1  
ATOM 231   C CG   . GLU A 1 15  ? -8.838  2.797   -5.836  1.00 0.00 ? 112 GLU A CG   1  
ATOM 232   C CD   . GLU A 1 15  ? -9.395  4.196   -5.668  1.00 0.00 ? 112 GLU A CD   1  
ATOM 233   O OE1  . GLU A 1 15  ? -9.423  4.703   -4.527  1.00 0.00 ? 112 GLU A OE1  1  
ATOM 234   O OE2  . GLU A 1 15  ? -9.819  4.790   -6.680  1.00 0.00 ? 112 GLU A OE2  1  
ATOM 235   H H    . GLU A 1 15  ? -4.988  2.169   -4.167  1.00 0.00 ? 112 GLU A H    1  
ATOM 236   H HA   . GLU A 1 15  ? -7.200  4.101   -3.997  1.00 0.00 ? 112 GLU A HA   1  
ATOM 237   H HB2  . GLU A 1 15  ? -6.871  3.416   -6.330  1.00 0.00 ? 112 GLU A HB2  1  
ATOM 238   H HB3  . GLU A 1 15  ? -7.007  1.729   -5.859  1.00 0.00 ? 112 GLU A HB3  1  
ATOM 239   H HG2  . GLU A 1 15  ? -9.069  2.453   -6.832  1.00 0.00 ? 112 GLU A HG2  1  
ATOM 240   H HG3  . GLU A 1 15  ? -9.311  2.148   -5.113  1.00 0.00 ? 112 GLU A HG3  1  
ATOM 241   N N    . VAL A 1 16  ? -8.647  2.564   -2.644  1.00 0.00 ? 113 VAL A N    1  
ATOM 242   C CA   . VAL A 1 16  ? -9.390  1.713   -1.733  1.00 0.00 ? 113 VAL A CA   1  
ATOM 243   C C    . VAL A 1 16  ? -10.543 1.040   -2.476  1.00 0.00 ? 113 VAL A C    1  
ATOM 244   O O    . VAL A 1 16  ? -11.439 1.706   -2.999  1.00 0.00 ? 113 VAL A O    1  
ATOM 245   C CB   . VAL A 1 16  ? -9.915  2.502   -0.508  1.00 0.00 ? 113 VAL A CB   1  
ATOM 246   C CG1  . VAL A 1 16  ? -10.731 3.715   -0.933  1.00 0.00 ? 113 VAL A CG1  1  
ATOM 247   C CG2  . VAL A 1 16  ? -10.728 1.596   0.408   1.00 0.00 ? 113 VAL A CG2  1  
ATOM 248   H H    . VAL A 1 16  ? -8.990  3.461   -2.856  1.00 0.00 ? 113 VAL A H    1  
ATOM 249   H HA   . VAL A 1 16  ? -8.714  0.947   -1.377  1.00 0.00 ? 113 VAL A HA   1  
ATOM 250   H HB   . VAL A 1 16  ? -9.060  2.858   0.049   1.00 0.00 ? 113 VAL A HB   1  
ATOM 251   H HG11 . VAL A 1 16  ? -11.062 4.251   -0.056  1.00 0.00 ? 113 VAL A HG11 1  
ATOM 252   H HG12 . VAL A 1 16  ? -11.590 3.390   -1.502  1.00 0.00 ? 113 VAL A HG12 1  
ATOM 253   H HG13 . VAL A 1 16  ? -10.121 4.365   -1.543  1.00 0.00 ? 113 VAL A HG13 1  
ATOM 254   H HG21 . VAL A 1 16  ? -11.565 1.189   -0.140  1.00 0.00 ? 113 VAL A HG21 1  
ATOM 255   H HG22 . VAL A 1 16  ? -11.093 2.168   1.248   1.00 0.00 ? 113 VAL A HG22 1  
ATOM 256   H HG23 . VAL A 1 16  ? -10.105 0.789   0.765   1.00 0.00 ? 113 VAL A HG23 1  
ATOM 257   N N    . LYS A 1 17  ? -10.503 -0.280  -2.549  1.00 0.00 ? 114 LYS A N    1  
ATOM 258   C CA   . LYS A 1 17  ? -11.505 -1.025  -3.294  1.00 0.00 ? 114 LYS A CA   1  
ATOM 259   C C    . LYS A 1 17  ? -12.453 -1.745  -2.344  1.00 0.00 ? 114 LYS A C    1  
ATOM 260   O O    . LYS A 1 17  ? -12.019 -2.461  -1.441  1.00 0.00 ? 114 LYS A O    1  
ATOM 261   C CB   . LYS A 1 17  ? -10.839 -2.026  -4.243  1.00 0.00 ? 114 LYS A CB   1  
ATOM 262   C CG   . LYS A 1 17  ? -9.853  -1.392  -5.222  1.00 0.00 ? 114 LYS A CG   1  
ATOM 263   C CD   . LYS A 1 17  ? -10.500 -0.333  -6.110  1.00 0.00 ? 114 LYS A CD   1  
ATOM 264   C CE   . LYS A 1 17  ? -11.348 -0.941  -7.219  1.00 0.00 ? 114 LYS A CE   1  
ATOM 265   N NZ   . LYS A 1 17  ? -11.971 0.106   -8.073  1.00 0.00 ? 114 LYS A NZ   1  
ATOM 266   H H    . LYS A 1 17  ? -9.790  -0.771  -2.077  1.00 0.00 ? 114 LYS A H    1  
ATOM 267   H HA   . LYS A 1 17  ? -12.073 -0.317  -3.876  1.00 0.00 ? 114 LYS A HA   1  
ATOM 268   H HB2  . LYS A 1 17  ? -10.303 -2.756  -3.654  1.00 0.00 ? 114 LYS A HB2  1  
ATOM 269   H HB3  . LYS A 1 17  ? -11.605 -2.533  -4.809  1.00 0.00 ? 114 LYS A HB3  1  
ATOM 270   H HG2  . LYS A 1 17  ? -9.059  -0.929  -4.658  1.00 0.00 ? 114 LYS A HG2  1  
ATOM 271   H HG3  . LYS A 1 17  ? -9.440  -2.169  -5.850  1.00 0.00 ? 114 LYS A HG3  1  
ATOM 272   H HD2  . LYS A 1 17  ? -11.130 0.297   -5.501  1.00 0.00 ? 114 LYS A HD2  1  
ATOM 273   H HD3  . LYS A 1 17  ? -9.720  0.267   -6.557  1.00 0.00 ? 114 LYS A HD3  1  
ATOM 274   H HE2  . LYS A 1 17  ? -10.719 -1.566  -7.835  1.00 0.00 ? 114 LYS A HE2  1  
ATOM 275   H HE3  . LYS A 1 17  ? -12.127 -1.540  -6.777  1.00 0.00 ? 114 LYS A HE3  1  
ATOM 276   H HZ1  . LYS A 1 17  ? -12.532 -0.335  -8.830  1.00 0.00 ? 114 LYS A HZ1  1  
ATOM 277   H HZ2  . LYS A 1 17  ? -11.238 0.704   -8.507  1.00 0.00 ? 114 LYS A HZ2  1  
ATOM 278   H HZ3  . LYS A 1 17  ? -12.600 0.708   -7.503  1.00 0.00 ? 114 LYS A HZ3  1  
ATOM 279   N N    . GLN A 1 18  ? -13.744 -1.540  -2.551  1.00 0.00 ? 115 GLN A N    1  
ATOM 280   C CA   . GLN A 1 18  ? -14.769 -2.130  -1.701  1.00 0.00 ? 115 GLN A CA   1  
ATOM 281   C C    . GLN A 1 18  ? -15.703 -3.015  -2.525  1.00 0.00 ? 115 GLN A C    1  
ATOM 282   O O    . GLN A 1 18  ? -16.715 -2.547  -3.056  1.00 0.00 ? 115 GLN A O    1  
ATOM 283   C CB   . GLN A 1 18  ? -15.566 -1.027  -1.003  1.00 0.00 ? 115 GLN A CB   1  
ATOM 284   C CG   . GLN A 1 18  ? -14.732 -0.182  -0.052  1.00 0.00 ? 115 GLN A CG   1  
ATOM 285   C CD   . GLN A 1 18  ? -15.485 1.031   0.454   1.00 0.00 ? 115 GLN A CD   1  
ATOM 286   O OE1  . GLN A 1 18  ? -16.710 1.016   0.560   1.00 0.00 ? 115 GLN A OE1  1  
ATOM 287   N NE2  . GLN A 1 18  ? -14.759 2.093   0.764   1.00 0.00 ? 115 GLN A NE2  1  
ATOM 288   H H    . GLN A 1 18  ? -14.021 -0.975  -3.304  1.00 0.00 ? 115 GLN A H    1  
ATOM 289   H HA   . GLN A 1 18  ? -14.277 -2.736  -0.956  1.00 0.00 ? 115 GLN A HA   1  
ATOM 290   H HB2  . GLN A 1 18  ? -15.988 -0.375  -1.753  1.00 0.00 ? 115 GLN A HB2  1  
ATOM 291   H HB3  . GLN A 1 18  ? -16.368 -1.479  -0.439  1.00 0.00 ? 115 GLN A HB3  1  
ATOM 292   H HG2  . GLN A 1 18  ? -14.445 -0.788  0.794   1.00 0.00 ? 115 GLN A HG2  1  
ATOM 293   H HG3  . GLN A 1 18  ? -13.846 0.154   -0.571  1.00 0.00 ? 115 GLN A HG3  1  
ATOM 294   H HE21 . GLN A 1 18  ? -13.789 2.039   0.651   1.00 0.00 ? 115 GLN A HE21 1  
ATOM 295   H HE22 . GLN A 1 18  ? -15.225 2.893   1.090   1.00 0.00 ? 115 GLN A HE22 1  
ATOM 296   N N    . PRO A 1 19  ? -15.360 -4.303  -2.663  1.00 0.00 ? 116 PRO A N    1  
ATOM 297   C CA   . PRO A 1 19  ? -16.164 -5.271  -3.412  1.00 0.00 ? 116 PRO A CA   1  
ATOM 298   C C    . PRO A 1 19  ? -17.438 -5.654  -2.666  1.00 0.00 ? 116 PRO A C    1  
ATOM 299   O O    . PRO A 1 19  ? -17.493 -5.610  -1.437  1.00 0.00 ? 116 PRO A O    1  
ATOM 300   C CB   . PRO A 1 19  ? -15.238 -6.491  -3.545  1.00 0.00 ? 116 PRO A CB   1  
ATOM 301   C CG   . PRO A 1 19  ? -13.897 -6.033  -3.080  1.00 0.00 ? 116 PRO A CG   1  
ATOM 302   C CD   . PRO A 1 19  ? -14.158 -4.927  -2.106  1.00 0.00 ? 116 PRO A CD   1  
ATOM 303   H HA   . PRO A 1 19  ? -16.418 -4.898  -4.392  1.00 0.00 ? 116 PRO A HA   1  
ATOM 304   H HB2  . PRO A 1 19  ? -15.614 -7.295  -2.929  1.00 0.00 ? 116 PRO A HB2  1  
ATOM 305   H HB3  . PRO A 1 19  ? -15.209 -6.809  -4.576  1.00 0.00 ? 116 PRO A HB3  1  
ATOM 306   H HG2  . PRO A 1 19  ? -13.377 -6.846  -2.596  1.00 0.00 ? 116 PRO A HG2  1  
ATOM 307   H HG3  . PRO A 1 19  ? -13.324 -5.666  -3.919  1.00 0.00 ? 116 PRO A HG3  1  
ATOM 308   H HD2  . PRO A 1 19  ? -14.346 -5.324  -1.119  1.00 0.00 ? 116 PRO A HD2  1  
ATOM 309   H HD3  . PRO A 1 19  ? -13.333 -4.231  -2.089  1.00 0.00 ? 116 PRO A HD3  1  
ATOM 310   N N    . GLU A 1 20  ? -18.460 -6.026  -3.430  1.00 0.00 ? 117 GLU A N    1  
ATOM 311   C CA   . GLU A 1 20  ? -19.754 -6.397  -2.870  1.00 0.00 ? 117 GLU A CA   1  
ATOM 312   C C    . GLU A 1 20  ? -19.692 -7.771  -2.208  1.00 0.00 ? 117 GLU A C    1  
ATOM 313   O O    . GLU A 1 20  ? -20.367 -8.023  -1.209  1.00 0.00 ? 117 GLU A O    1  
ATOM 314   C CB   . GLU A 1 20  ? -20.826 -6.402  -3.967  1.00 0.00 ? 117 GLU A CB   1  
ATOM 315   C CG   . GLU A 1 20  ? -20.529 -7.369  -5.105  1.00 0.00 ? 117 GLU A CG   1  
ATOM 316   C CD   . GLU A 1 20  ? -21.682 -7.510  -6.075  1.00 0.00 ? 117 GLU A CD   1  
ATOM 317   O OE1  . GLU A 1 20  ? -22.726 -8.071  -5.683  1.00 0.00 ? 117 GLU A OE1  1  
ATOM 318   O OE2  . GLU A 1 20  ? -21.546 -7.072  -7.236  1.00 0.00 ? 117 GLU A OE2  1  
ATOM 319   H H    . GLU A 1 20  ? -18.341 -6.047  -4.403  1.00 0.00 ? 117 GLU A H    1  
ATOM 320   H HA   . GLU A 1 20  ? -20.018 -5.663  -2.125  1.00 0.00 ? 117 GLU A HA   1  
ATOM 321   H HB2  . GLU A 1 20  ? -21.773 -6.678  -3.528  1.00 0.00 ? 117 GLU A HB2  1  
ATOM 322   H HB3  . GLU A 1 20  ? -20.907 -5.407  -4.380  1.00 0.00 ? 117 GLU A HB3  1  
ATOM 323   H HG2  . GLU A 1 20  ? -19.667 -7.012  -5.647  1.00 0.00 ? 117 GLU A HG2  1  
ATOM 324   H HG3  . GLU A 1 20  ? -20.311 -8.340  -4.685  1.00 0.00 ? 117 GLU A HG3  1  
ATOM 325   N N    . ASP A 1 21  ? -18.880 -8.654  -2.769  1.00 0.00 ? 118 ASP A N    1  
ATOM 326   C CA   . ASP A 1 21  ? -18.780 -10.021 -2.278  1.00 0.00 ? 118 ASP A CA   1  
ATOM 327   C C    . ASP A 1 21  ? -17.492 -10.211 -1.492  1.00 0.00 ? 118 ASP A C    1  
ATOM 328   O O    . ASP A 1 21  ? -17.507 -10.719 -0.371  1.00 0.00 ? 118 ASP A O    1  
ATOM 329   C CB   . ASP A 1 21  ? -18.831 -11.008 -3.445  1.00 0.00 ? 118 ASP A CB   1  
ATOM 330   C CG   . ASP A 1 21  ? -18.886 -12.452 -2.989  1.00 0.00 ? 118 ASP A CG   1  
ATOM 331   O OD1  . ASP A 1 21  ? -20.006 -12.976 -2.801  1.00 0.00 ? 118 ASP A OD1  1  
ATOM 332   O OD2  . ASP A 1 21  ? -17.817 -13.078 -2.836  1.00 0.00 ? 118 ASP A OD2  1  
ATOM 333   H H    . ASP A 1 21  ? -18.330 -8.378  -3.533  1.00 0.00 ? 118 ASP A H    1  
ATOM 334   H HA   . ASP A 1 21  ? -19.619 -10.203 -1.624  1.00 0.00 ? 118 ASP A HA   1  
ATOM 335   H HB2  . ASP A 1 21  ? -19.708 -10.806 -4.039  1.00 0.00 ? 118 ASP A HB2  1  
ATOM 336   H HB3  . ASP A 1 21  ? -17.950 -10.878 -4.055  1.00 0.00 ? 118 ASP A HB3  1  
ATOM 337   N N    . ARG A 1 22  ? -16.385 -9.781  -2.083  1.00 0.00 ? 119 ARG A N    1  
ATOM 338   C CA   . ARG A 1 22  ? -15.077 -9.905  -1.451  1.00 0.00 ? 119 ARG A CA   1  
ATOM 339   C C    . ARG A 1 22  ? -14.902 -8.856  -0.362  1.00 0.00 ? 119 ARG A C    1  
ATOM 340   O O    . ARG A 1 22  ? -15.679 -7.905  -0.266  1.00 0.00 ? 119 ARG A O    1  
ATOM 341   C CB   . ARG A 1 22  ? -13.958 -9.751  -2.486  1.00 0.00 ? 119 ARG A CB   1  
ATOM 342   C CG   . ARG A 1 22  ? -13.923 -10.848 -3.533  1.00 0.00 ? 119 ARG A CG   1  
ATOM 343   C CD   . ARG A 1 22  ? -12.728 -10.683 -4.461  1.00 0.00 ? 119 ARG A CD   1  
ATOM 344   N NE   . ARG A 1 22  ? -11.454 -10.853 -3.759  1.00 0.00 ? 119 ARG A NE   1  
ATOM 345   C CZ   . ARG A 1 22  ? -10.268 -10.490 -4.255  1.00 0.00 ? 119 ARG A CZ   1  
ATOM 346   N NH1  . ARG A 1 22  ? -10.189 -9.881  -5.434  1.00 0.00 ? 119 ARG A NH1  1  
ATOM 347   N NH2  . ARG A 1 22  ? -9.160  -10.730 -3.565  1.00 0.00 ? 119 ARG A NH2  1  
ATOM 348   H H    . ARG A 1 22  ? -16.450 -9.361  -2.966  1.00 0.00 ? 119 ARG A H    1  
ATOM 349   H HA   . ARG A 1 22  ? -15.013 -10.886 -1.007  1.00 0.00 ? 119 ARG A HA   1  
ATOM 350   H HB2  . ARG A 1 22  ? -14.085 -8.808  -2.995  1.00 0.00 ? 119 ARG A HB2  1  
ATOM 351   H HB3  . ARG A 1 22  ? -13.008 -9.744  -1.973  1.00 0.00 ? 119 ARG A HB3  1  
ATOM 352   H HG2  . ARG A 1 22  ? -13.854 -11.805 -3.037  1.00 0.00 ? 119 ARG A HG2  1  
ATOM 353   H HG3  . ARG A 1 22  ? -14.830 -10.806 -4.117  1.00 0.00 ? 119 ARG A HG3  1  
ATOM 354   H HD2  . ARG A 1 22  ? -12.796 -11.420 -5.248  1.00 0.00 ? 119 ARG A HD2  1  
ATOM 355   H HD3  . ARG A 1 22  ? -12.761 -9.694  -4.892  1.00 0.00 ? 119 ARG A HD3  1  
ATOM 356   H HE   . ARG A 1 22  ? -11.483 -11.282 -2.872  1.00 0.00 ? 119 ARG A HE   1  
ATOM 357   H HH11 . ARG A 1 22  ? -11.021 -9.687  -5.959  1.00 0.00 ? 119 ARG A HH11 1  
ATOM 358   H HH12 . ARG A 1 22  ? -9.294  -9.618  -5.808  1.00 0.00 ? 119 ARG A HH12 1  
ATOM 359   H HH21 . ARG A 1 22  ? -9.209  -11.185 -2.671  1.00 0.00 ? 119 ARG A HH21 1  
ATOM 360   H HH22 . ARG A 1 22  ? -8.267  -10.454 -3.930  1.00 0.00 ? 119 ARG A HH22 1  
ATOM 361   N N    . LYS A 1 23  ? -13.874 -9.039  0.453   1.00 0.00 ? 120 LYS A N    1  
ATOM 362   C CA   . LYS A 1 23  ? -13.561 -8.103  1.520   1.00 0.00 ? 120 LYS A CA   1  
ATOM 363   C C    . LYS A 1 23  ? -12.923 -6.843  0.956   1.00 0.00 ? 120 LYS A C    1  
ATOM 364   O O    . LYS A 1 23  ? -12.156 -6.908  -0.005  1.00 0.00 ? 120 LYS A O    1  
ATOM 365   C CB   . LYS A 1 23  ? -12.616 -8.744  2.530   1.00 0.00 ? 120 LYS A CB   1  
ATOM 366   C CG   . LYS A 1 23  ? -13.266 -9.831  3.365   1.00 0.00 ? 120 LYS A CG   1  
ATOM 367   C CD   . LYS A 1 23  ? -12.279 -10.438 4.342   1.00 0.00 ? 120 LYS A CD   1  
ATOM 368   C CE   . LYS A 1 23  ? -11.133 -11.116 3.614   1.00 0.00 ? 120 LYS A CE   1  
ATOM 369   N NZ   . LYS A 1 23  ? -10.262 -11.889 4.540   1.00 0.00 ? 120 LYS A NZ   1  
ATOM 370   H H    . LYS A 1 23  ? -13.300 -9.824  0.325   1.00 0.00 ? 120 LYS A H    1  
ATOM 371   H HA   . LYS A 1 23  ? -14.480 -7.845  2.017   1.00 0.00 ? 120 LYS A HA   1  
ATOM 372   H HB2  . LYS A 1 23  ? -11.783 -9.178  1.998   1.00 0.00 ? 120 LYS A HB2  1  
ATOM 373   H HB3  . LYS A 1 23  ? -12.248 -7.979  3.197   1.00 0.00 ? 120 LYS A HB3  1  
ATOM 374   H HG2  . LYS A 1 23  ? -14.090 -9.404  3.918   1.00 0.00 ? 120 LYS A HG2  1  
ATOM 375   H HG3  . LYS A 1 23  ? -13.633 -10.606 2.708   1.00 0.00 ? 120 LYS A HG3  1  
ATOM 376   H HD2  . LYS A 1 23  ? -11.881 -9.654  4.969   1.00 0.00 ? 120 LYS A HD2  1  
ATOM 377   H HD3  . LYS A 1 23  ? -12.789 -11.165 4.952   1.00 0.00 ? 120 LYS A HD3  1  
ATOM 378   H HE2  . LYS A 1 23  ? -11.544 -11.785 2.874   1.00 0.00 ? 120 LYS A HE2  1  
ATOM 379   H HE3  . LYS A 1 23  ? -10.542 -10.357 3.123   1.00 0.00 ? 120 LYS A HE3  1  
ATOM 380   H HZ1  . LYS A 1 23  ? -9.463  -12.305 4.019   1.00 0.00 ? 120 LYS A HZ1  1  
ATOM 381   H HZ2  . LYS A 1 23  ? -10.806 -12.657 4.986   1.00 0.00 ? 120 LYS A HZ2  1  
ATOM 382   H HZ3  . LYS A 1 23  ? -9.890  -11.268 5.285   1.00 0.00 ? 120 LYS A HZ3  1  
ATOM 383   N N    . PRO A 1 24  ? -13.243 -5.680  1.543   1.00 0.00 ? 121 PRO A N    1  
ATOM 384   C CA   . PRO A 1 24  ? -12.648 -4.406  1.143   1.00 0.00 ? 121 PRO A CA   1  
ATOM 385   C C    . PRO A 1 24  ? -11.146 -4.393  1.400   1.00 0.00 ? 121 PRO A C    1  
ATOM 386   O O    . PRO A 1 24  ? -10.680 -4.869  2.440   1.00 0.00 ? 121 PRO A O    1  
ATOM 387   C CB   . PRO A 1 24  ? -13.362 -3.373  2.021   1.00 0.00 ? 121 PRO A CB   1  
ATOM 388   C CG   . PRO A 1 24  ? -13.904 -4.148  3.174   1.00 0.00 ? 121 PRO A CG   1  
ATOM 389   C CD   . PRO A 1 24  ? -14.204 -5.522  2.647   1.00 0.00 ? 121 PRO A CD   1  
ATOM 390   H HA   . PRO A 1 24  ? -12.835 -4.192  0.100   1.00 0.00 ? 121 PRO A HA   1  
ATOM 391   H HB2  . PRO A 1 24  ? -12.654 -2.624  2.346   1.00 0.00 ? 121 PRO A HB2  1  
ATOM 392   H HB3  . PRO A 1 24  ? -14.154 -2.905  1.456   1.00 0.00 ? 121 PRO A HB3  1  
ATOM 393   H HG2  . PRO A 1 24  ? -13.165 -4.201  3.961   1.00 0.00 ? 121 PRO A HG2  1  
ATOM 394   H HG3  . PRO A 1 24  ? -14.807 -3.681  3.538   1.00 0.00 ? 121 PRO A HG3  1  
ATOM 395   H HD2  . PRO A 1 24  ? -14.037 -6.266  3.413   1.00 0.00 ? 121 PRO A HD2  1  
ATOM 396   H HD3  . PRO A 1 24  ? -15.220 -5.573  2.284   1.00 0.00 ? 121 PRO A HD3  1  
ATOM 397   N N    . TYR A 1 25  ? -10.394 -3.852  0.454   1.00 0.00 ? 122 TYR A N    1  
ATOM 398   C CA   . TYR A 1 25  ? -8.943  -3.897  0.522   1.00 0.00 ? 122 TYR A CA   1  
ATOM 399   C C    . TYR A 1 25  ? -8.325  -2.633  -0.056  1.00 0.00 ? 122 TYR A C    1  
ATOM 400   O O    . TYR A 1 25  ? -8.968  -1.899  -0.813  1.00 0.00 ? 122 TYR A O    1  
ATOM 401   C CB   . TYR A 1 25  ? -8.420  -5.122  -0.239  1.00 0.00 ? 122 TYR A CB   1  
ATOM 402   C CG   . TYR A 1 25  ? -8.807  -5.157  -1.706  1.00 0.00 ? 122 TYR A CG   1  
ATOM 403   C CD1  . TYR A 1 25  ? -10.010 -5.721  -2.114  1.00 0.00 ? 122 TYR A CD1  1  
ATOM 404   C CD2  . TYR A 1 25  ? -7.967  -4.632  -2.681  1.00 0.00 ? 122 TYR A CD2  1  
ATOM 405   C CE1  . TYR A 1 25  ? -10.364 -5.759  -3.448  1.00 0.00 ? 122 TYR A CE1  1  
ATOM 406   C CE2  . TYR A 1 25  ? -8.315  -4.667  -4.017  1.00 0.00 ? 122 TYR A CE2  1  
ATOM 407   C CZ   . TYR A 1 25  ? -9.514  -5.232  -4.395  1.00 0.00 ? 122 TYR A CZ   1  
ATOM 408   O OH   . TYR A 1 25  ? -9.866  -5.265  -5.727  1.00 0.00 ? 122 TYR A OH   1  
ATOM 409   H H    . TYR A 1 25  ? -10.825 -3.403  -0.308  1.00 0.00 ? 122 TYR A H    1  
ATOM 410   H HA   . TYR A 1 25  ? -8.660  -3.982  1.560   1.00 0.00 ? 122 TYR A HA   1  
ATOM 411   H HB2  . TYR A 1 25  ? -7.342  -5.137  -0.184  1.00 0.00 ? 122 TYR A HB2  1  
ATOM 412   H HB3  . TYR A 1 25  ? -8.809  -6.016  0.226   1.00 0.00 ? 122 TYR A HB3  1  
ATOM 413   H HD1  . TYR A 1 25  ? -10.676 -6.133  -1.369  1.00 0.00 ? 122 TYR A HD1  1  
ATOM 414   H HD2  . TYR A 1 25  ? -7.027  -4.190  -2.382  1.00 0.00 ? 122 TYR A HD2  1  
ATOM 415   H HE1  . TYR A 1 25  ? -11.304 -6.202  -3.744  1.00 0.00 ? 122 TYR A HE1  1  
ATOM 416   H HE2  . TYR A 1 25  ? -7.649  -4.256  -4.759  1.00 0.00 ? 122 TYR A HE2  1  
ATOM 417   H HH   . TYR A 1 25  ? -10.777 -4.964  -5.826  1.00 0.00 ? 122 TYR A HH   1  
ATOM 418   N N    . LEU A 1 26  ? -7.080  -2.382  0.311   1.00 0.00 ? 123 LEU A N    1  
ATOM 419   C CA   . LEU A 1 26  ? -6.327  -1.277  -0.252  1.00 0.00 ? 123 LEU A CA   1  
ATOM 420   C C    . LEU A 1 26  ? -5.512  -1.783  -1.429  1.00 0.00 ? 123 LEU A C    1  
ATOM 421   O O    . LEU A 1 26  ? -4.703  -2.700  -1.285  1.00 0.00 ? 123 LEU A O    1  
ATOM 422   C CB   . LEU A 1 26  ? -5.405  -0.652  0.797   1.00 0.00 ? 123 LEU A CB   1  
ATOM 423   C CG   . LEU A 1 26  ? -4.731  0.654   0.380   1.00 0.00 ? 123 LEU A CG   1  
ATOM 424   C CD1  . LEU A 1 26  ? -5.767  1.754   0.208   1.00 0.00 ? 123 LEU A CD1  1  
ATOM 425   C CD2  . LEU A 1 26  ? -3.680  1.059   1.404   1.00 0.00 ? 123 LEU A CD2  1  
ATOM 426   H H    . LEU A 1 26  ? -6.652  -2.964  0.979   1.00 0.00 ? 123 LEU A H    1  
ATOM 427   H HA   . LEU A 1 26  ? -7.030  -0.536  -0.601  1.00 0.00 ? 123 LEU A HA   1  
ATOM 428   H HB2  . LEU A 1 26  ? -5.986  -0.459  1.684   1.00 0.00 ? 123 LEU A HB2  1  
ATOM 429   H HB3  . LEU A 1 26  ? -4.634  -1.367  1.039   1.00 0.00 ? 123 LEU A HB3  1  
ATOM 430   H HG   . LEU A 1 26  ? -4.238  0.510   -0.570  1.00 0.00 ? 123 LEU A HG   1  
ATOM 431   H HD11 . LEU A 1 26  ? -6.421  1.508   -0.614  1.00 0.00 ? 123 LEU A HD11 1  
ATOM 432   H HD12 . LEU A 1 26  ? -5.268  2.689   0.005   1.00 0.00 ? 123 LEU A HD12 1  
ATOM 433   H HD13 . LEU A 1 26  ? -6.347  1.846   1.114   1.00 0.00 ? 123 LEU A HD13 1  
ATOM 434   H HD21 . LEU A 1 26  ? -3.225  1.991   1.104   1.00 0.00 ? 123 LEU A HD21 1  
ATOM 435   H HD22 . LEU A 1 26  ? -2.923  0.292   1.465   1.00 0.00 ? 123 LEU A HD22 1  
ATOM 436   H HD23 . LEU A 1 26  ? -4.147  1.181   2.370   1.00 0.00 ? 123 LEU A HD23 1  
ATOM 437   N N    . TRP A 1 27  ? -5.742  -1.192  -2.582  1.00 0.00 ? 124 TRP A N    1  
ATOM 438   C CA   . TRP A 1 27  ? -5.107  -1.623  -3.810  1.00 0.00 ? 124 TRP A CA   1  
ATOM 439   C C    . TRP A 1 27  ? -3.973  -0.672  -4.173  1.00 0.00 ? 124 TRP A C    1  
ATOM 440   O O    . TRP A 1 27  ? -4.206  0.451   -4.627  1.00 0.00 ? 124 TRP A O    1  
ATOM 441   C CB   . TRP A 1 27  ? -6.157  -1.677  -4.924  1.00 0.00 ? 124 TRP A CB   1  
ATOM 442   C CG   . TRP A 1 27  ? -5.668  -2.260  -6.213  1.00 0.00 ? 124 TRP A CG   1  
ATOM 443   C CD1  . TRP A 1 27  ? -4.759  -3.267  -6.375  1.00 0.00 ? 124 TRP A CD1  1  
ATOM 444   C CD2  . TRP A 1 27  ? -6.088  -1.882  -7.528  1.00 0.00 ? 124 TRP A CD2  1  
ATOM 445   N NE1  . TRP A 1 27  ? -4.582  -3.529  -7.711  1.00 0.00 ? 124 TRP A NE1  1  
ATOM 446   C CE2  . TRP A 1 27  ? -5.387  -2.692  -8.439  1.00 0.00 ? 124 TRP A CE2  1  
ATOM 447   C CE3  . TRP A 1 27  ? -6.989  -0.934  -8.023  1.00 0.00 ? 124 TRP A CE3  1  
ATOM 448   C CZ2  . TRP A 1 27  ? -5.559  -2.581  -9.817  1.00 0.00 ? 124 TRP A CZ2  1  
ATOM 449   C CZ3  . TRP A 1 27  ? -7.160  -0.827  -9.389  1.00 0.00 ? 124 TRP A CZ3  1  
ATOM 450   C CH2  . TRP A 1 27  ? -6.447  -1.646  -10.273 1.00 0.00 ? 124 TRP A CH2  1  
ATOM 451   H H    . TRP A 1 27  ? -6.355  -0.423  -2.610  1.00 0.00 ? 124 TRP A H    1  
ATOM 452   H HA   . TRP A 1 27  ? -4.703  -2.610  -3.653  1.00 0.00 ? 124 TRP A HA   1  
ATOM 453   H HB2  . TRP A 1 27  ? -6.989  -2.276  -4.589  1.00 0.00 ? 124 TRP A HB2  1  
ATOM 454   H HB3  . TRP A 1 27  ? -6.505  -0.674  -5.124  1.00 0.00 ? 124 TRP A HB3  1  
ATOM 455   H HD1  . TRP A 1 27  ? -4.257  -3.770  -5.562  1.00 0.00 ? 124 TRP A HD1  1  
ATOM 456   H HE1  . TRP A 1 27  ? -3.977  -4.212  -8.087  1.00 0.00 ? 124 TRP A HE1  1  
ATOM 457   H HE3  . TRP A 1 27  ? -7.548  -0.293  -7.356  1.00 0.00 ? 124 TRP A HE3  1  
ATOM 458   H HZ2  . TRP A 1 27  ? -5.016  -3.202  -10.512 1.00 0.00 ? 124 TRP A HZ2  1  
ATOM 459   H HZ3  . TRP A 1 27  ? -7.851  -0.100  -9.789  1.00 0.00 ? 124 TRP A HZ3  1  
ATOM 460   H HH2  . TRP A 1 27  ? -6.611  -1.527  -11.334 1.00 0.00 ? 124 TRP A HH2  1  
ATOM 461   N N    . ILE A 1 28  ? -2.750  -1.119  -3.945  1.00 0.00 ? 125 ILE A N    1  
ATOM 462   C CA   . ILE A 1 28  ? -1.577  -0.316  -4.237  1.00 0.00 ? 125 ILE A CA   1  
ATOM 463   C C    . ILE A 1 28  ? -0.988  -0.729  -5.577  1.00 0.00 ? 125 ILE A C    1  
ATOM 464   O O    . ILE A 1 28  ? -0.635  -1.893  -5.773  1.00 0.00 ? 125 ILE A O    1  
ATOM 465   C CB   . ILE A 1 28  ? -0.478  -0.460  -3.154  1.00 0.00 ? 125 ILE A CB   1  
ATOM 466   C CG1  . ILE A 1 28  ? -1.043  -0.254  -1.746  1.00 0.00 ? 125 ILE A CG1  1  
ATOM 467   C CG2  . ILE A 1 28  ? 0.650   0.523   -3.407  1.00 0.00 ? 125 ILE A CG2  1  
ATOM 468   C CD1  . ILE A 1 28  ? -1.507  -1.534  -1.090  1.00 0.00 ? 125 ILE A CD1  1  
ATOM 469   H H    . ILE A 1 28  ? -2.631  -2.025  -3.580  1.00 0.00 ? 125 ILE A H    1  
ATOM 470   H HA   . ILE A 1 28  ? -1.879  0.720   -4.286  1.00 0.00 ? 125 ILE A HA   1  
ATOM 471   H HB   . ILE A 1 28  ? -0.069  -1.457  -3.224  1.00 0.00 ? 125 ILE A HB   1  
ATOM 472   H HG12 . ILE A 1 28  ? -0.282  0.184   -1.118  1.00 0.00 ? 125 ILE A HG12 1  
ATOM 473   H HG13 . ILE A 1 28  ? -1.888  0.416   -1.800  1.00 0.00 ? 125 ILE A HG13 1  
ATOM 474   H HG21 . ILE A 1 28  ? 1.417   0.394   -2.657  1.00 0.00 ? 125 ILE A HG21 1  
ATOM 475   H HG22 . ILE A 1 28  ? 0.266   1.531   -3.360  1.00 0.00 ? 125 ILE A HG22 1  
ATOM 476   H HG23 . ILE A 1 28  ? 1.070   0.344   -4.385  1.00 0.00 ? 125 ILE A HG23 1  
ATOM 477   H HD11 . ILE A 1 28  ? -2.317  -1.959  -1.663  1.00 0.00 ? 125 ILE A HD11 1  
ATOM 478   H HD12 . ILE A 1 28  ? -1.846  -1.322  -0.088  1.00 0.00 ? 125 ILE A HD12 1  
ATOM 479   H HD13 . ILE A 1 28  ? -0.685  -2.237  -1.053  1.00 0.00 ? 125 ILE A HD13 1  
ATOM 480   N N    . LYS A 1 29  ? -0.898  0.213   -6.499  1.00 0.00 ? 126 LYS A N    1  
ATOM 481   C CA   . LYS A 1 29  ? -0.289  -0.052  -7.789  1.00 0.00 ? 126 LYS A CA   1  
ATOM 482   C C    . LYS A 1 29  ? 0.668   1.067   -8.165  1.00 0.00 ? 126 LYS A C    1  
ATOM 483   O O    . LYS A 1 29  ? 0.432   2.237   -7.873  1.00 0.00 ? 126 LYS A O    1  
ATOM 484   C CB   . LYS A 1 29  ? -1.350  -0.256  -8.872  1.00 0.00 ? 126 LYS A CB   1  
ATOM 485   C CG   . LYS A 1 29  ? -2.367  0.862   -8.958  1.00 0.00 ? 126 LYS A CG   1  
ATOM 486   C CD   . LYS A 1 29  ? -3.419  0.561   -10.013 1.00 0.00 ? 126 LYS A CD   1  
ATOM 487   C CE   . LYS A 1 29  ? -4.625  1.480   -9.898  1.00 0.00 ? 126 LYS A CE   1  
ATOM 488   N NZ   . LYS A 1 29  ? -4.283  2.904   -10.141 1.00 0.00 ? 126 LYS A NZ   1  
ATOM 489   H H    . LYS A 1 29  ? -1.243  1.116   -6.306  1.00 0.00 ? 126 LYS A H    1  
ATOM 490   H HA   . LYS A 1 29  ? 0.280   -0.963  -7.692  1.00 0.00 ? 126 LYS A HA   1  
ATOM 491   H HB2  . LYS A 1 29  ? -0.858  -0.336  -9.829  1.00 0.00 ? 126 LYS A HB2  1  
ATOM 492   H HB3  . LYS A 1 29  ? -1.877  -1.177  -8.672  1.00 0.00 ? 126 LYS A HB3  1  
ATOM 493   H HG2  . LYS A 1 29  ? -2.847  0.973   -7.998  1.00 0.00 ? 126 LYS A HG2  1  
ATOM 494   H HG3  . LYS A 1 29  ? -1.854  1.774   -9.218  1.00 0.00 ? 126 LYS A HG3  1  
ATOM 495   H HD2  . LYS A 1 29  ? -2.978  0.688   -10.990 1.00 0.00 ? 126 LYS A HD2  1  
ATOM 496   H HD3  . LYS A 1 29  ? -3.746  -0.462  -9.896  1.00 0.00 ? 126 LYS A HD3  1  
ATOM 497   H HE2  . LYS A 1 29  ? -5.363  1.169   -10.623 1.00 0.00 ? 126 LYS A HE2  1  
ATOM 498   H HE3  . LYS A 1 29  ? -5.038  1.382   -8.905  1.00 0.00 ? 126 LYS A HE3  1  
ATOM 499   H HZ1  . LYS A 1 29  ? -5.150  3.482   -10.147 1.00 0.00 ? 126 LYS A HZ1  1  
ATOM 500   H HZ2  . LYS A 1 29  ? -3.811  3.009   -11.059 1.00 0.00 ? 126 LYS A HZ2  1  
ATOM 501   H HZ3  . LYS A 1 29  ? -3.655  3.258   -9.396  1.00 0.00 ? 126 LYS A HZ3  1  
ATOM 502   N N    . TRP A 1 30  ? 1.746   0.691   -8.813  1.00 0.00 ? 127 TRP A N    1  
ATOM 503   C CA   . TRP A 1 30  ? 2.828   1.608   -9.128  1.00 0.00 ? 127 TRP A CA   1  
ATOM 504   C C    . TRP A 1 30  ? 3.227   1.451   -10.588 1.00 0.00 ? 127 TRP A C    1  
ATOM 505   O O    . TRP A 1 30  ? 2.864   0.464   -11.232 1.00 0.00 ? 127 TRP A O    1  
ATOM 506   C CB   . TRP A 1 30  ? 4.024   1.316   -8.219  1.00 0.00 ? 127 TRP A CB   1  
ATOM 507   C CG   . TRP A 1 30  ? 4.331   -0.147  -8.118  1.00 0.00 ? 127 TRP A CG   1  
ATOM 508   C CD1  . TRP A 1 30  ? 5.129   -0.879  -8.947  1.00 0.00 ? 127 TRP A CD1  1  
ATOM 509   C CD2  . TRP A 1 30  ? 3.826   -1.058  -7.137  1.00 0.00 ? 127 TRP A CD2  1  
ATOM 510   N NE1  . TRP A 1 30  ? 5.145   -2.191  -8.545  1.00 0.00 ? 127 TRP A NE1  1  
ATOM 511   C CE2  . TRP A 1 30  ? 4.355   -2.325  -7.434  1.00 0.00 ? 127 TRP A CE2  1  
ATOM 512   C CE3  . TRP A 1 30  ? 2.977   -0.924  -6.034  1.00 0.00 ? 127 TRP A CE3  1  
ATOM 513   C CZ2  . TRP A 1 30  ? 4.061   -3.450  -6.672  1.00 0.00 ? 127 TRP A CZ2  1  
ATOM 514   C CZ3  . TRP A 1 30  ? 2.686   -2.041  -5.280  1.00 0.00 ? 127 TRP A CZ3  1  
ATOM 515   C CH2  . TRP A 1 30  ? 3.225   -3.290  -5.600  1.00 0.00 ? 127 TRP A CH2  1  
ATOM 516   H H    . TRP A 1 30  ? 1.818   -0.241  -9.103  1.00 0.00 ? 127 TRP A H    1  
ATOM 517   H HA   . TRP A 1 30  ? 2.483   2.615   -8.952  1.00 0.00 ? 127 TRP A HA   1  
ATOM 518   H HB2  . TRP A 1 30  ? 4.898   1.817   -8.610  1.00 0.00 ? 127 TRP A HB2  1  
ATOM 519   H HB3  . TRP A 1 30  ? 3.816   1.685   -7.226  1.00 0.00 ? 127 TRP A HB3  1  
ATOM 520   H HD1  . TRP A 1 30  ? 5.659   -0.474  -9.796  1.00 0.00 ? 127 TRP A HD1  1  
ATOM 521   H HE1  . TRP A 1 30  ? 5.643   -2.915  -8.980  1.00 0.00 ? 127 TRP A HE1  1  
ATOM 522   H HE3  . TRP A 1 30  ? 2.553   0.032   -5.768  1.00 0.00 ? 127 TRP A HE3  1  
ATOM 523   H HZ2  . TRP A 1 30  ? 4.468   -4.421  -6.911  1.00 0.00 ? 127 TRP A HZ2  1  
ATOM 524   H HZ3  . TRP A 1 30  ? 2.029   -1.956  -4.426  1.00 0.00 ? 127 TRP A HZ3  1  
ATOM 525   H HH2  . TRP A 1 30  ? 2.967   -4.136  -4.981  1.00 0.00 ? 127 TRP A HH2  1  
ATOM 526   N N    . SER A 1 31  ? 3.958   2.418   -11.110 1.00 0.00 ? 128 SER A N    1  
ATOM 527   C CA   . SER A 1 31  ? 4.445   2.343   -12.474 1.00 0.00 ? 128 SER A CA   1  
ATOM 528   C C    . SER A 1 31  ? 5.882   1.836   -12.491 1.00 0.00 ? 128 SER A C    1  
ATOM 529   O O    . SER A 1 31  ? 6.727   2.317   -11.734 1.00 0.00 ? 128 SER A O    1  
ATOM 530   C CB   . SER A 1 31  ? 4.368   3.714   -13.140 1.00 0.00 ? 128 SER A CB   1  
ATOM 531   O OG   . SER A 1 31  ? 3.034   4.198   -13.173 1.00 0.00 ? 128 SER A OG   1  
ATOM 532   H H    . SER A 1 31  ? 4.185   3.205   -10.565 1.00 0.00 ? 128 SER A H    1  
ATOM 533   H HA   . SER A 1 31  ? 3.821   1.648   -13.013 1.00 0.00 ? 128 SER A HA   1  
ATOM 534   H HB2  . SER A 1 31  ? 4.975   4.413   -12.587 1.00 0.00 ? 128 SER A HB2  1  
ATOM 535   H HB3  . SER A 1 31  ? 4.736   3.640   -14.152 1.00 0.00 ? 128 SER A HB3  1  
ATOM 536   H HG   . SER A 1 31  ? 3.040   5.110   -13.518 1.00 0.00 ? 128 SER A HG   1  
ATOM 537   N N    . PRO A 1 32  ? 6.171   0.842   -13.345 1.00 0.00 ? 129 PRO A N    1  
ATOM 538   C CA   . PRO A 1 32  ? 7.523   0.303   -13.494 1.00 0.00 ? 129 PRO A CA   1  
ATOM 539   C C    . PRO A 1 32  ? 8.478   1.341   -14.077 1.00 0.00 ? 129 PRO A C    1  
ATOM 540   O O    . PRO A 1 32  ? 8.064   2.214   -14.846 1.00 0.00 ? 129 PRO A O    1  
ATOM 541   C CB   . PRO A 1 32  ? 7.339   -0.869  -14.466 1.00 0.00 ? 129 PRO A CB   1  
ATOM 542   C CG   . PRO A 1 32  ? 6.083   -0.565  -15.203 1.00 0.00 ? 129 PRO A CG   1  
ATOM 543   C CD   . PRO A 1 32  ? 5.205   0.171   -14.233 1.00 0.00 ? 129 PRO A CD   1  
ATOM 544   H HA   . PRO A 1 32  ? 7.913   -0.057  -12.553 1.00 0.00 ? 129 PRO A HA   1  
ATOM 545   H HB2  . PRO A 1 32  ? 8.186   -0.921  -15.133 1.00 0.00 ? 129 PRO A HB2  1  
ATOM 546   H HB3  . PRO A 1 32  ? 7.256   -1.791  -13.909 1.00 0.00 ? 129 PRO A HB3  1  
ATOM 547   H HG2  . PRO A 1 32  ? 6.301   0.058   -16.058 1.00 0.00 ? 129 PRO A HG2  1  
ATOM 548   H HG3  . PRO A 1 32  ? 5.608   -1.483  -15.517 1.00 0.00 ? 129 PRO A HG3  1  
ATOM 549   H HD2  . PRO A 1 32  ? 4.592   0.893   -14.752 1.00 0.00 ? 129 PRO A HD2  1  
ATOM 550   H HD3  . PRO A 1 32  ? 4.589   -0.522  -13.679 1.00 0.00 ? 129 PRO A HD3  1  
ATOM 551   N N    . PRO A 1 33  ? 9.768   1.266   -13.705 1.00 0.00 ? 130 PRO A N    1  
ATOM 552   C CA   . PRO A 1 33  ? 10.793  2.203   -14.176 1.00 0.00 ? 130 PRO A CA   1  
ATOM 553   C C    . PRO A 1 33  ? 10.869  2.256   -15.696 1.00 0.00 ? 130 PRO A C    1  
ATOM 554   O O    . PRO A 1 33  ? 10.785  1.225   -16.368 1.00 0.00 ? 130 PRO A O    1  
ATOM 555   C CB   . PRO A 1 33  ? 12.102  1.643   -13.602 1.00 0.00 ? 130 PRO A CB   1  
ATOM 556   C CG   . PRO A 1 33  ? 11.784  0.250   -13.185 1.00 0.00 ? 130 PRO A CG   1  
ATOM 557   C CD   . PRO A 1 33  ? 10.335  0.261   -12.797 1.00 0.00 ? 130 PRO A CD   1  
ATOM 558   H HA   . PRO A 1 33  ? 10.623  3.197   -13.789 1.00 0.00 ? 130 PRO A HA   1  
ATOM 559   H HB2  . PRO A 1 33  ? 12.866  1.661   -14.365 1.00 0.00 ? 130 PRO A HB2  1  
ATOM 560   H HB3  . PRO A 1 33  ? 12.414  2.244   -12.761 1.00 0.00 ? 130 PRO A HB3  1  
ATOM 561   H HG2  . PRO A 1 33  ? 11.948  -0.426  -14.011 1.00 0.00 ? 130 PRO A HG2  1  
ATOM 562   H HG3  . PRO A 1 33  ? 12.397  -0.030  -12.341 1.00 0.00 ? 130 PRO A HG3  1  
ATOM 563   H HD2  . PRO A 1 33  ? 9.890   -0.709  -12.963 1.00 0.00 ? 130 PRO A HD2  1  
ATOM 564   H HD3  . PRO A 1 33  ? 10.219  0.563   -11.767 1.00 0.00 ? 130 PRO A HD3  1  
ATOM 565   N N    . THR A 1 34  ? 11.023  3.461   -16.224 1.00 0.00 ? 131 THR A N    1  
ATOM 566   C CA   . THR A 1 34  ? 11.085  3.676   -17.658 1.00 0.00 ? 131 THR A CA   1  
ATOM 567   C C    . THR A 1 34  ? 12.367  3.077   -18.241 1.00 0.00 ? 131 THR A C    1  
ATOM 568   O O    . THR A 1 34  ? 13.400  3.041   -17.568 1.00 0.00 ? 131 THR A O    1  
ATOM 569   C CB   . THR A 1 34  ? 11.020  5.184   -17.964 1.00 0.00 ? 131 THR A CB   1  
ATOM 570   O OG1  . THR A 1 34  ? 9.979   5.783   -17.180 1.00 0.00 ? 131 THR A OG1  1  
ATOM 571   C CG2  . THR A 1 34  ? 10.748  5.440   -19.438 1.00 0.00 ? 131 THR A CG2  1  
ATOM 572   H H    . THR A 1 34  ? 11.103  4.234   -15.630 1.00 0.00 ? 131 THR A H    1  
ATOM 573   H HA   . THR A 1 34  ? 10.230  3.195   -18.110 1.00 0.00 ? 131 THR A HA   1  
ATOM 574   H HB   . THR A 1 34  ? 11.967  5.633   -17.701 1.00 0.00 ? 131 THR A HB   1  
ATOM 575   H HG1  . THR A 1 34  ? 9.235   5.168   -17.115 1.00 0.00 ? 131 THR A HG1  1  
ATOM 576   H HG21 . THR A 1 34  ? 10.786  6.501   -19.633 1.00 0.00 ? 131 THR A HG21 1  
ATOM 577   H HG22 . THR A 1 34  ? 9.770   5.061   -19.695 1.00 0.00 ? 131 THR A HG22 1  
ATOM 578   H HG23 . THR A 1 34  ? 11.495  4.937   -20.034 1.00 0.00 ? 131 THR A HG23 1  
ATOM 579   N N    . LEU A 1 35  ? 12.284  2.614   -19.491 1.00 0.00 ? 132 LEU A N    1  
ATOM 580   C CA   . LEU A 1 35  ? 13.399  1.962   -20.177 1.00 0.00 ? 132 LEU A CA   1  
ATOM 581   C C    . LEU A 1 35  ? 13.790  0.657   -19.487 1.00 0.00 ? 132 LEU A C    1  
ATOM 582   O O    . LEU A 1 35  ? 13.082  0.182   -18.594 1.00 0.00 ? 132 LEU A O    1  
ATOM 583   C CB   . LEU A 1 35  ? 14.596  2.910   -20.266 1.00 0.00 ? 132 LEU A CB   1  
ATOM 584   C CG   . LEU A 1 35  ? 14.322  4.215   -21.011 1.00 0.00 ? 132 LEU A CG   1  
ATOM 585   C CD1  . LEU A 1 35  ? 15.472  5.182   -20.824 1.00 0.00 ? 132 LEU A CD1  1  
ATOM 586   C CD2  . LEU A 1 35  ? 14.087  3.949   -22.490 1.00 0.00 ? 132 LEU A CD2  1  
ATOM 587   H H    . LEU A 1 35  ? 11.445  2.730   -19.976 1.00 0.00 ? 132 LEU A H    1  
ATOM 588   H HA   . LEU A 1 35  ? 13.069  1.727   -21.178 1.00 0.00 ? 132 LEU A HA   1  
ATOM 589   H HB2  . LEU A 1 35  ? 14.914  3.151   -19.262 1.00 0.00 ? 132 LEU A HB2  1  
ATOM 590   H HB3  . LEU A 1 35  ? 15.402  2.396   -20.769 1.00 0.00 ? 132 LEU A HB3  1  
ATOM 591   H HG   . LEU A 1 35  ? 13.431  4.673   -20.607 1.00 0.00 ? 132 LEU A HG   1  
ATOM 592   H HD11 . LEU A 1 35  ? 15.593  5.392   -19.773 1.00 0.00 ? 132 LEU A HD11 1  
ATOM 593   H HD12 . LEU A 1 35  ? 15.259  6.099   -21.353 1.00 0.00 ? 132 LEU A HD12 1  
ATOM 594   H HD13 . LEU A 1 35  ? 16.378  4.743   -21.211 1.00 0.00 ? 132 LEU A HD13 1  
ATOM 595   H HD21 . LEU A 1 35  ? 13.916  4.885   -23.002 1.00 0.00 ? 132 LEU A HD21 1  
ATOM 596   H HD22 . LEU A 1 35  ? 13.224  3.311   -22.608 1.00 0.00 ? 132 LEU A HD22 1  
ATOM 597   H HD23 . LEU A 1 35  ? 14.954  3.463   -22.910 1.00 0.00 ? 132 LEU A HD23 1  
ATOM 598   N N    . ILE A 1 36  ? 14.917  0.089   -19.918 1.00 0.00 ? 133 ILE A N    1  
ATOM 599   C CA   . ILE A 1 36  ? 15.437  -1.175  -19.396 1.00 0.00 ? 133 ILE A CA   1  
ATOM 600   C C    . ILE A 1 36  ? 14.512  -2.358  -19.698 1.00 0.00 ? 133 ILE A C    1  
ATOM 601   O O    . ILE A 1 36  ? 14.843  -3.207  -20.528 1.00 0.00 ? 133 ILE A O    1  
ATOM 602   C CB   . ILE A 1 36  ? 15.693  -1.091  -17.881 1.00 0.00 ? 133 ILE A CB   1  
ATOM 603   C CG1  . ILE A 1 36  ? 16.555  0.136   -17.577 1.00 0.00 ? 133 ILE A CG1  1  
ATOM 604   C CG2  . ILE A 1 36  ? 16.377  -2.360  -17.387 1.00 0.00 ? 133 ILE A CG2  1  
ATOM 605   C CD1  . ILE A 1 36  ? 16.547  0.535   -16.125 1.00 0.00 ? 133 ILE A CD1  1  
ATOM 606   H H    . ILE A 1 36  ? 15.438  0.552   -20.601 1.00 0.00 ? 133 ILE A H    1  
ATOM 607   H HA   . ILE A 1 36  ? 16.387  -1.356  -19.880 1.00 0.00 ? 133 ILE A HA   1  
ATOM 608   H HB   . ILE A 1 36  ? 14.741  -0.998  -17.378 1.00 0.00 ? 133 ILE A HB   1  
ATOM 609   H HG12 . ILE A 1 36  ? 17.577  -0.072  -17.856 1.00 0.00 ? 133 ILE A HG12 1  
ATOM 610   H HG13 . ILE A 1 36  ? 16.193  0.974   -18.155 1.00 0.00 ? 133 ILE A HG13 1  
ATOM 611   H HG21 . ILE A 1 36  ? 16.547  -2.287  -16.323 1.00 0.00 ? 133 ILE A HG21 1  
ATOM 612   H HG22 . ILE A 1 36  ? 17.322  -2.481  -17.895 1.00 0.00 ? 133 ILE A HG22 1  
ATOM 613   H HG23 . ILE A 1 36  ? 15.747  -3.212  -17.593 1.00 0.00 ? 133 ILE A HG23 1  
ATOM 614   H HD11 . ILE A 1 36  ? 15.538  0.779   -15.830 1.00 0.00 ? 133 ILE A HD11 1  
ATOM 615   H HD12 . ILE A 1 36  ? 17.181  1.396   -15.988 1.00 0.00 ? 133 ILE A HD12 1  
ATOM 616   H HD13 . ILE A 1 36  ? 16.912  -0.284  -15.525 1.00 0.00 ? 133 ILE A HD13 1  
ATOM 617   N N    . ASP A 1 37  ? 13.359  -2.395  -19.031 1.00 0.00 ? 134 ASP A N    1  
ATOM 618   C CA   . ASP A 1 37  ? 12.430  -3.522  -19.116 1.00 0.00 ? 134 ASP A CA   1  
ATOM 619   C C    . ASP A 1 37  ? 13.115  -4.814  -18.694 1.00 0.00 ? 134 ASP A C    1  
ATOM 620   O O    . ASP A 1 37  ? 13.655  -5.553  -19.523 1.00 0.00 ? 134 ASP A O    1  
ATOM 621   C CB   . ASP A 1 37  ? 11.834  -3.672  -20.523 1.00 0.00 ? 134 ASP A CB   1  
ATOM 622   C CG   . ASP A 1 37  ? 10.760  -2.643  -20.817 1.00 0.00 ? 134 ASP A CG   1  
ATOM 623   O OD1  . ASP A 1 37  ? 9.590   -2.869  -20.443 1.00 0.00 ? 134 ASP A OD1  1  
ATOM 624   O OD2  . ASP A 1 37  ? 11.076  -1.599  -21.426 1.00 0.00 ? 134 ASP A OD2  1  
ATOM 625   H H    . ASP A 1 37  ? 13.121  -1.626  -18.466 1.00 0.00 ? 134 ASP A H    1  
ATOM 626   H HA   . ASP A 1 37  ? 11.627  -3.326  -18.422 1.00 0.00 ? 134 ASP A HA   1  
ATOM 627   H HB2  . ASP A 1 37  ? 12.620  -3.559  -21.253 1.00 0.00 ? 134 ASP A HB2  1  
ATOM 628   H HB3  . ASP A 1 37  ? 11.399  -4.656  -20.618 1.00 0.00 ? 134 ASP A HB3  1  
ATOM 629   N N    . LEU A 1 38  ? 13.090  -5.081  -17.395 1.00 0.00 ? 135 LEU A N    1  
ATOM 630   C CA   . LEU A 1 38  ? 13.719  -6.273  -16.833 1.00 0.00 ? 135 LEU A CA   1  
ATOM 631   C C    . LEU A 1 38  ? 12.848  -7.507  -17.071 1.00 0.00 ? 135 LEU A C    1  
ATOM 632   O O    . LEU A 1 38  ? 12.610  -8.304  -16.164 1.00 0.00 ? 135 LEU A O    1  
ATOM 633   C CB   . LEU A 1 38  ? 13.977  -6.100  -15.327 1.00 0.00 ? 135 LEU A CB   1  
ATOM 634   C CG   . LEU A 1 38  ? 14.908  -4.944  -14.931 1.00 0.00 ? 135 LEU A CG   1  
ATOM 635   C CD1  . LEU A 1 38  ? 14.154  -3.622  -14.889 1.00 0.00 ? 135 LEU A CD1  1  
ATOM 636   C CD2  . LEU A 1 38  ? 15.564  -5.226  -13.588 1.00 0.00 ? 135 LEU A CD2  1  
ATOM 637   H H    . LEU A 1 38  ? 12.631  -4.455  -16.792 1.00 0.00 ? 135 LEU A H    1  
ATOM 638   H HA   . LEU A 1 38  ? 14.662  -6.415  -17.334 1.00 0.00 ? 135 LEU A HA   1  
ATOM 639   H HB2  . LEU A 1 38  ? 13.026  -5.945  -14.841 1.00 0.00 ? 135 LEU A HB2  1  
ATOM 640   H HB3  . LEU A 1 38  ? 14.404  -7.018  -14.952 1.00 0.00 ? 135 LEU A HB3  1  
ATOM 641   H HG   . LEU A 1 38  ? 15.690  -4.856  -15.671 1.00 0.00 ? 135 LEU A HG   1  
ATOM 642   H HD11 . LEU A 1 38  ? 13.791  -3.383  -15.877 1.00 0.00 ? 135 LEU A HD11 1  
ATOM 643   H HD12 . LEU A 1 38  ? 14.817  -2.840  -14.549 1.00 0.00 ? 135 LEU A HD12 1  
ATOM 644   H HD13 . LEU A 1 38  ? 13.319  -3.705  -14.210 1.00 0.00 ? 135 LEU A HD13 1  
ATOM 645   H HD21 . LEU A 1 38  ? 16.191  -4.392  -13.311 1.00 0.00 ? 135 LEU A HD21 1  
ATOM 646   H HD22 . LEU A 1 38  ? 16.165  -6.119  -13.661 1.00 0.00 ? 135 LEU A HD22 1  
ATOM 647   H HD23 . LEU A 1 38  ? 14.802  -5.367  -12.837 1.00 0.00 ? 135 LEU A HD23 1  
ATOM 648   N N    . LYS A 1 39  ? 12.379  -7.657  -18.298 1.00 0.00 ? 136 LYS A N    1  
ATOM 649   C CA   . LYS A 1 39  ? 11.476  -8.741  -18.647 1.00 0.00 ? 136 LYS A CA   1  
ATOM 650   C C    . LYS A 1 39  ? 12.228  -9.878  -19.332 1.00 0.00 ? 136 LYS A C    1  
ATOM 651   O O    . LYS A 1 39  ? 11.850  -11.043 -19.218 1.00 0.00 ? 136 LYS A O    1  
ATOM 652   C CB   . LYS A 1 39  ? 10.368  -8.215  -19.557 1.00 0.00 ? 136 LYS A CB   1  
ATOM 653   C CG   . LYS A 1 39  ? 9.557   -7.094  -18.930 1.00 0.00 ? 136 LYS A CG   1  
ATOM 654   C CD   . LYS A 1 39  ? 8.524   -6.540  -19.894 1.00 0.00 ? 136 LYS A CD   1  
ATOM 655   C CE   . LYS A 1 39  ? 7.693   -5.450  -19.240 1.00 0.00 ? 136 LYS A CE   1  
ATOM 656   N NZ   . LYS A 1 39  ? 6.619   -4.948  -20.137 1.00 0.00 ? 136 LYS A NZ   1  
ATOM 657   H H    . LYS A 1 39  ? 12.646  -7.015  -18.992 1.00 0.00 ? 136 LYS A H    1  
ATOM 658   H HA   . LYS A 1 39  ? 11.034  -9.112  -17.735 1.00 0.00 ? 136 LYS A HA   1  
ATOM 659   H HB2  . LYS A 1 39  ? 10.812  -7.843  -20.467 1.00 0.00 ? 136 LYS A HB2  1  
ATOM 660   H HB3  . LYS A 1 39  ? 9.698   -9.026  -19.797 1.00 0.00 ? 136 LYS A HB3  1  
ATOM 661   H HG2  . LYS A 1 39  ? 9.049   -7.475  -18.056 1.00 0.00 ? 136 LYS A HG2  1  
ATOM 662   H HG3  . LYS A 1 39  ? 10.227  -6.298  -18.639 1.00 0.00 ? 136 LYS A HG3  1  
ATOM 663   H HD2  . LYS A 1 39  ? 9.031   -6.128  -20.754 1.00 0.00 ? 136 LYS A HD2  1  
ATOM 664   H HD3  . LYS A 1 39  ? 7.871   -7.341  -20.206 1.00 0.00 ? 136 LYS A HD3  1  
ATOM 665   H HE2  . LYS A 1 39  ? 7.244   -5.849  -18.344 1.00 0.00 ? 136 LYS A HE2  1  
ATOM 666   H HE3  . LYS A 1 39  ? 8.345   -4.629  -18.979 1.00 0.00 ? 136 LYS A HE3  1  
ATOM 667   H HZ1  . LYS A 1 39  ? 5.989   -5.729  -20.413 1.00 0.00 ? 136 LYS A HZ1  1  
ATOM 668   H HZ2  . LYS A 1 39  ? 7.031   -4.531  -20.996 1.00 0.00 ? 136 LYS A HZ2  1  
ATOM 669   H HZ3  . LYS A 1 39  ? 6.054   -4.222  -19.650 1.00 0.00 ? 136 LYS A HZ3  1  
ATOM 670   N N    . THR A 1 40  ? 13.301  -9.537  -20.034 1.00 0.00 ? 137 THR A N    1  
ATOM 671   C CA   . THR A 1 40  ? 14.091  -10.531 -20.746 1.00 0.00 ? 137 THR A CA   1  
ATOM 672   C C    . THR A 1 40  ? 15.059  -11.244 -19.797 1.00 0.00 ? 137 THR A C    1  
ATOM 673   O O    . THR A 1 40  ? 15.754  -10.606 -19.000 1.00 0.00 ? 137 THR A O    1  
ATOM 674   C CB   . THR A 1 40  ? 14.866  -9.895  -21.926 1.00 0.00 ? 137 THR A CB   1  
ATOM 675   O OG1  . THR A 1 40  ? 15.645  -10.889 -22.605 1.00 0.00 ? 137 THR A OG1  1  
ATOM 676   C CG2  . THR A 1 40  ? 15.774  -8.768  -21.456 1.00 0.00 ? 137 THR A CG2  1  
ATOM 677   H H    . THR A 1 40  ? 13.568  -8.597  -20.075 1.00 0.00 ? 137 THR A H    1  
ATOM 678   H HA   . THR A 1 40  ? 13.406  -11.262 -21.151 1.00 0.00 ? 137 THR A HA   1  
ATOM 679   H HB   . THR A 1 40  ? 14.148  -9.484  -22.621 1.00 0.00 ? 137 THR A HB   1  
ATOM 680   H HG1  . THR A 1 40  ? 15.066  -11.411 -23.176 1.00 0.00 ? 137 THR A HG1  1  
ATOM 681   H HG21 . THR A 1 40  ? 15.176  -7.989  -21.007 1.00 0.00 ? 137 THR A HG21 1  
ATOM 682   H HG22 . THR A 1 40  ? 16.316  -8.367  -22.299 1.00 0.00 ? 137 THR A HG22 1  
ATOM 683   H HG23 . THR A 1 40  ? 16.472  -9.150  -20.727 1.00 0.00 ? 137 THR A HG23 1  
ATOM 684   N N    . GLY A 1 41  ? 15.082  -12.573 -19.878 1.00 0.00 ? 138 GLY A N    1  
ATOM 685   C CA   . GLY A 1 41  ? 15.932  -13.368 -19.006 1.00 0.00 ? 138 GLY A CA   1  
ATOM 686   C C    . GLY A 1 41  ? 15.386  -13.441 -17.594 1.00 0.00 ? 138 GLY A C    1  
ATOM 687   O O    . GLY A 1 41  ? 14.534  -12.633 -17.215 1.00 0.00 ? 138 GLY A O    1  
ATOM 688   H H    . GLY A 1 41  ? 14.509  -13.021 -20.534 1.00 0.00 ? 138 GLY A H    1  
ATOM 689   H HA2  . GLY A 1 41  ? 16.006  -14.369 -19.406 1.00 0.00 ? 138 GLY A HA2  1  
ATOM 690   H HA3  . GLY A 1 41  ? 16.918  -12.928 -18.979 1.00 0.00 ? 138 GLY A HA3  1  
ATOM 691   N N    . TRP A 1 42  ? 15.859  -14.398 -16.805 1.00 0.00 ? 139 TRP A N    1  
ATOM 692   C CA   . TRP A 1 42  ? 15.419  -14.507 -15.428 1.00 0.00 ? 139 TRP A CA   1  
ATOM 693   C C    . TRP A 1 42  ? 16.151  -13.499 -14.553 1.00 0.00 ? 139 TRP A C    1  
ATOM 694   O O    . TRP A 1 42  ? 17.043  -13.834 -13.776 1.00 0.00 ? 139 TRP A O    1  
ATOM 695   C CB   . TRP A 1 42  ? 15.579  -15.925 -14.889 1.00 0.00 ? 139 TRP A CB   1  
ATOM 696   C CG   . TRP A 1 42  ? 15.114  -16.042 -13.472 1.00 0.00 ? 139 TRP A CG   1  
ATOM 697   C CD1  . TRP A 1 42  ? 15.900  -16.238 -12.391 1.00 0.00 ? 139 TRP A CD1  1  
ATOM 698   C CD2  . TRP A 1 42  ? 13.772  -15.922 -12.980 1.00 0.00 ? 139 TRP A CD2  1  
ATOM 699   N NE1  . TRP A 1 42  ? 15.142  -16.273 -11.246 1.00 0.00 ? 139 TRP A NE1  1  
ATOM 700   C CE2  . TRP A 1 42  ? 13.829  -16.080 -11.582 1.00 0.00 ? 139 TRP A CE2  1  
ATOM 701   C CE3  . TRP A 1 42  ? 12.531  -15.704 -13.582 1.00 0.00 ? 139 TRP A CE3  1  
ATOM 702   C CZ2  . TRP A 1 42  ? 12.693  -16.025 -10.780 1.00 0.00 ? 139 TRP A CZ2  1  
ATOM 703   C CZ3  . TRP A 1 42  ? 11.404  -15.649 -12.784 1.00 0.00 ? 139 TRP A CZ3  1  
ATOM 704   C CH2  . TRP A 1 42  ? 11.492  -15.808 -11.396 1.00 0.00 ? 139 TRP A CH2  1  
ATOM 705   H H    . TRP A 1 42  ? 16.513  -15.040 -17.153 1.00 0.00 ? 139 TRP A H    1  
ATOM 706   H HA   . TRP A 1 42  ? 14.374  -14.261 -15.403 1.00 0.00 ? 139 TRP A HA   1  
ATOM 707   H HB2  . TRP A 1 42  ? 15.000  -16.606 -15.495 1.00 0.00 ? 139 TRP A HB2  1  
ATOM 708   H HB3  . TRP A 1 42  ? 16.621  -16.206 -14.927 1.00 0.00 ? 139 TRP A HB3  1  
ATOM 709   H HD1  . TRP A 1 42  ? 16.965  -16.352 -12.450 1.00 0.00 ? 139 TRP A HD1  1  
ATOM 710   H HE1  . TRP A 1 42  ? 15.488  -16.411 -10.333 1.00 0.00 ? 139 TRP A HE1  1  
ATOM 711   H HE3  . TRP A 1 42  ? 12.443  -15.578 -14.649 1.00 0.00 ? 139 TRP A HE3  1  
ATOM 712   H HZ2  . TRP A 1 42  ? 12.744  -16.145 -9.708  1.00 0.00 ? 139 TRP A HZ2  1  
ATOM 713   H HZ3  . TRP A 1 42  ? 10.436  -15.480 -13.233 1.00 0.00 ? 139 TRP A HZ3  1  
ATOM 714   H HH2  . TRP A 1 42  ? 10.585  -15.759 -10.813 1.00 0.00 ? 139 TRP A HH2  1  
ATOM 715   N N    . PHE A 1 43  ? 15.787  -12.250 -14.735 1.00 0.00 ? 140 PHE A N    1  
ATOM 716   C CA   . PHE A 1 43  ? 16.197  -11.188 -13.849 1.00 0.00 ? 140 PHE A CA   1  
ATOM 717   C C    . PHE A 1 43  ? 15.062  -10.189 -13.777 1.00 0.00 ? 140 PHE A C    1  
ATOM 718   O O    . PHE A 1 43  ? 15.089  -9.135  -14.413 1.00 0.00 ? 140 PHE A O    1  
ATOM 719   C CB   . PHE A 1 43  ? 17.489  -10.515 -14.320 1.00 0.00 ? 140 PHE A CB   1  
ATOM 720   C CG   . PHE A 1 43  ? 18.071  -9.587  -13.291 1.00 0.00 ? 140 PHE A CG   1  
ATOM 721   C CD1  . PHE A 1 43  ? 18.944  -10.063 -12.327 1.00 0.00 ? 140 PHE A CD1  1  
ATOM 722   C CD2  . PHE A 1 43  ? 17.737  -8.244  -13.281 1.00 0.00 ? 140 PHE A CD2  1  
ATOM 723   C CE1  . PHE A 1 43  ? 19.472  -9.216  -11.373 1.00 0.00 ? 140 PHE A CE1  1  
ATOM 724   C CE2  . PHE A 1 43  ? 18.261  -7.392  -12.330 1.00 0.00 ? 140 PHE A CE2  1  
ATOM 725   C CZ   . PHE A 1 43  ? 19.129  -7.879  -11.374 1.00 0.00 ? 140 PHE A CZ   1  
ATOM 726   H H    . PHE A 1 43  ? 15.214  -12.032 -15.504 1.00 0.00 ? 140 PHE A H    1  
ATOM 727   H HA   . PHE A 1 43  ? 16.351  -11.614 -12.868 1.00 0.00 ? 140 PHE A HA   1  
ATOM 728   H HB2  . PHE A 1 43  ? 18.225  -11.274 -14.542 1.00 0.00 ? 140 PHE A HB2  1  
ATOM 729   H HB3  . PHE A 1 43  ? 17.286  -9.941  -15.212 1.00 0.00 ? 140 PHE A HB3  1  
ATOM 730   H HD1  . PHE A 1 43  ? 19.212  -11.109 -12.325 1.00 0.00 ? 140 PHE A HD1  1  
ATOM 731   H HD2  . PHE A 1 43  ? 17.053  -7.864  -14.027 1.00 0.00 ? 140 PHE A HD2  1  
ATOM 732   H HE1  . PHE A 1 43  ? 20.151  -9.600  -10.625 1.00 0.00 ? 140 PHE A HE1  1  
ATOM 733   H HE2  . PHE A 1 43  ? 17.992  -6.346  -12.334 1.00 0.00 ? 140 PHE A HE2  1  
ATOM 734   H HZ   . PHE A 1 43  ? 19.539  -7.214  -10.629 1.00 0.00 ? 140 PHE A HZ   1  
ATOM 735   N N    . THR A 1 44  ? 14.036  -10.568 -13.041 1.00 0.00 ? 141 THR A N    1  
ATOM 736   C CA   . THR A 1 44  ? 12.848  -9.758  -12.921 1.00 0.00 ? 141 THR A CA   1  
ATOM 737   C C    . THR A 1 44  ? 13.015  -8.737  -11.805 1.00 0.00 ? 141 THR A C    1  
ATOM 738   O O    . THR A 1 44  ? 13.816  -8.924  -10.885 1.00 0.00 ? 141 THR A O    1  
ATOM 739   C CB   . THR A 1 44  ? 11.601  -10.637 -12.665 1.00 0.00 ? 141 THR A CB   1  
ATOM 740   O OG1  . THR A 1 44  ? 10.417  -9.834  -12.609 1.00 0.00 ? 141 THR A OG1  1  
ATOM 741   C CG2  . THR A 1 44  ? 11.745  -11.426 -11.374 1.00 0.00 ? 141 THR A CG2  1  
ATOM 742   H H    . THR A 1 44  ? 14.083  -11.418 -12.560 1.00 0.00 ? 141 THR A H    1  
ATOM 743   H HA   . THR A 1 44  ? 12.710  -9.235  -13.854 1.00 0.00 ? 141 THR A HA   1  
ATOM 744   H HB   . THR A 1 44  ? 11.506  -11.338 -13.479 1.00 0.00 ? 141 THR A HB   1  
ATOM 745   H HG1  . THR A 1 44  ? 10.456  -9.155  -13.292 1.00 0.00 ? 141 THR A HG1  1  
ATOM 746   H HG21 . THR A 1 44  ? 12.604  -12.076 -11.445 1.00 0.00 ? 141 THR A HG21 1  
ATOM 747   H HG22 . THR A 1 44  ? 10.856  -12.018 -11.213 1.00 0.00 ? 141 THR A HG22 1  
ATOM 748   H HG23 . THR A 1 44  ? 11.878  -10.742 -10.550 1.00 0.00 ? 141 THR A HG23 1  
ATOM 749   N N    . LEU A 1 45  ? 12.272  -7.651  -11.906 1.00 0.00 ? 142 LEU A N    1  
ATOM 750   C CA   . LEU A 1 45  ? 12.346  -6.583  -10.935 1.00 0.00 ? 142 LEU A CA   1  
ATOM 751   C C    . LEU A 1 45  ? 11.298  -6.791  -9.851  1.00 0.00 ? 142 LEU A C    1  
ATOM 752   O O    . LEU A 1 45  ? 10.100  -6.662  -10.105 1.00 0.00 ? 142 LEU A O    1  
ATOM 753   C CB   . LEU A 1 45  ? 12.125  -5.246  -11.638 1.00 0.00 ? 142 LEU A CB   1  
ATOM 754   C CG   . LEU A 1 45  ? 12.381  -4.010  -10.789 1.00 0.00 ? 142 LEU A CG   1  
ATOM 755   C CD1  . LEU A 1 45  ? 13.830  -3.965  -10.341 1.00 0.00 ? 142 LEU A CD1  1  
ATOM 756   C CD2  . LEU A 1 45  ? 12.028  -2.759  -11.570 1.00 0.00 ? 142 LEU A CD2  1  
ATOM 757   H H    . LEU A 1 45  ? 11.644  -7.571  -12.654 1.00 0.00 ? 142 LEU A H    1  
ATOM 758   H HA   . LEU A 1 45  ? 13.329  -6.596  -10.490 1.00 0.00 ? 142 LEU A HA   1  
ATOM 759   H HB2  . LEU A 1 45  ? 12.776  -5.205  -12.497 1.00 0.00 ? 142 LEU A HB2  1  
ATOM 760   H HB3  . LEU A 1 45  ? 11.103  -5.211  -11.981 1.00 0.00 ? 142 LEU A HB3  1  
ATOM 761   H HG   . LEU A 1 45  ? 11.756  -4.048  -9.910  1.00 0.00 ? 142 LEU A HG   1  
ATOM 762   H HD11 . LEU A 1 45  ? 14.042  -4.820  -9.718  1.00 0.00 ? 142 LEU A HD11 1  
ATOM 763   H HD12 . LEU A 1 45  ? 14.005  -3.059  -9.781  1.00 0.00 ? 142 LEU A HD12 1  
ATOM 764   H HD13 . LEU A 1 45  ? 14.475  -3.981  -11.208 1.00 0.00 ? 142 LEU A HD13 1  
ATOM 765   H HD21 . LEU A 1 45  ? 12.652  -2.695  -12.448 1.00 0.00 ? 142 LEU A HD21 1  
ATOM 766   H HD22 . LEU A 1 45  ? 12.190  -1.890  -10.949 1.00 0.00 ? 142 LEU A HD22 1  
ATOM 767   H HD23 . LEU A 1 45  ? 10.992  -2.801  -11.867 1.00 0.00 ? 142 LEU A HD23 1  
ATOM 768   N N    . LEU A 1 46  ? 11.752  -7.111  -8.647  1.00 0.00 ? 143 LEU A N    1  
ATOM 769   C CA   . LEU A 1 46  ? 10.845  -7.386  -7.544  1.00 0.00 ? 143 LEU A CA   1  
ATOM 770   C C    . LEU A 1 46  ? 10.575  -6.118  -6.744  1.00 0.00 ? 143 LEU A C    1  
ATOM 771   O O    . LEU A 1 46  ? 11.458  -5.269  -6.583  1.00 0.00 ? 143 LEU A O    1  
ATOM 772   C CB   . LEU A 1 46  ? 11.421  -8.470  -6.628  1.00 0.00 ? 143 LEU A CB   1  
ATOM 773   C CG   . LEU A 1 46  ? 11.891  -9.749  -7.329  1.00 0.00 ? 143 LEU A CG   1  
ATOM 774   C CD1  . LEU A 1 46  ? 12.405  -10.761 -6.318  1.00 0.00 ? 143 LEU A CD1  1  
ATOM 775   C CD2  . LEU A 1 46  ? 10.774  -10.355 -8.167  1.00 0.00 ? 143 LEU A CD2  1  
ATOM 776   H H    . LEU A 1 46  ? 12.720  -7.166  -8.498  1.00 0.00 ? 143 LEU A H    1  
ATOM 777   H HA   . LEU A 1 46  ? 9.914   -7.737  -7.963  1.00 0.00 ? 143 LEU A HA   1  
ATOM 778   H HB2  . LEU A 1 46  ? 12.259  -8.051  -6.094  1.00 0.00 ? 143 LEU A HB2  1  
ATOM 779   H HB3  . LEU A 1 46  ? 10.660  -8.742  -5.911  1.00 0.00 ? 143 LEU A HB3  1  
ATOM 780   H HG   . LEU A 1 46  ? 12.705  -9.503  -7.986  1.00 0.00 ? 143 LEU A HG   1  
ATOM 781   H HD11 . LEU A 1 46  ? 12.742  -11.647 -6.835  1.00 0.00 ? 143 LEU A HD11 1  
ATOM 782   H HD12 . LEU A 1 46  ? 11.611  -11.023 -5.634  1.00 0.00 ? 143 LEU A HD12 1  
ATOM 783   H HD13 . LEU A 1 46  ? 13.229  -10.331 -5.766  1.00 0.00 ? 143 LEU A HD13 1  
ATOM 784   H HD21 . LEU A 1 46  ? 9.924   -10.571 -7.537  1.00 0.00 ? 143 LEU A HD21 1  
ATOM 785   H HD22 . LEU A 1 46  ? 11.123  -11.269 -8.626  1.00 0.00 ? 143 LEU A HD22 1  
ATOM 786   H HD23 . LEU A 1 46  ? 10.483  -9.656  -8.938  1.00 0.00 ? 143 LEU A HD23 1  
ATOM 787   N N    . TYR A 1 47  ? 9.353   -5.991  -6.249  1.00 0.00 ? 144 TYR A N    1  
ATOM 788   C CA   . TYR A 1 47  ? 8.946   -4.810  -5.501  1.00 0.00 ? 144 TYR A CA   1  
ATOM 789   C C    . TYR A 1 47  ? 8.620   -5.166  -4.057  1.00 0.00 ? 144 TYR A C    1  
ATOM 790   O O    . TYR A 1 47  ? 8.105   -6.251  -3.775  1.00 0.00 ? 144 TYR A O    1  
ATOM 791   C CB   . TYR A 1 47  ? 7.720   -4.169  -6.151  1.00 0.00 ? 144 TYR A CB   1  
ATOM 792   C CG   . TYR A 1 47  ? 7.876   -3.915  -7.631  1.00 0.00 ? 144 TYR A CG   1  
ATOM 793   C CD1  . TYR A 1 47  ? 8.431   -2.733  -8.101  1.00 0.00 ? 144 TYR A CD1  1  
ATOM 794   C CD2  . TYR A 1 47  ? 7.469   -4.863  -8.560  1.00 0.00 ? 144 TYR A CD2  1  
ATOM 795   C CE1  . TYR A 1 47  ? 8.576   -2.503  -9.456  1.00 0.00 ? 144 TYR A CE1  1  
ATOM 796   C CE2  . TYR A 1 47  ? 7.611   -4.642  -9.912  1.00 0.00 ? 144 TYR A CE2  1  
ATOM 797   C CZ   . TYR A 1 47  ? 8.164   -3.462  -10.356 1.00 0.00 ? 144 TYR A CZ   1  
ATOM 798   O OH   . TYR A 1 47  ? 8.305   -3.239  -11.706 1.00 0.00 ? 144 TYR A OH   1  
ATOM 799   H H    . TYR A 1 47  ? 8.701   -6.712  -6.399  1.00 0.00 ? 144 TYR A H    1  
ATOM 800   H HA   . TYR A 1 47  ? 9.764   -4.105  -5.514  1.00 0.00 ? 144 TYR A HA   1  
ATOM 801   H HB2  . TYR A 1 47  ? 6.869   -4.820  -6.015  1.00 0.00 ? 144 TYR A HB2  1  
ATOM 802   H HB3  . TYR A 1 47  ? 7.521   -3.222  -5.669  1.00 0.00 ? 144 TYR A HB3  1  
ATOM 803   H HD1  . TYR A 1 47  ? 8.753   -1.985  -7.391  1.00 0.00 ? 144 TYR A HD1  1  
ATOM 804   H HD2  . TYR A 1 47  ? 7.035   -5.789  -8.209  1.00 0.00 ? 144 TYR A HD2  1  
ATOM 805   H HE1  . TYR A 1 47  ? 9.009   -1.577  -9.804  1.00 0.00 ? 144 TYR A HE1  1  
ATOM 806   H HE2  . TYR A 1 47  ? 7.287   -5.391  -10.616 1.00 0.00 ? 144 TYR A HE2  1  
ATOM 807   H HH   . TYR A 1 47  ? 9.188   -2.905  -11.883 1.00 0.00 ? 144 TYR A HH   1  
ATOM 808   N N    . GLU A 1 48  ? 8.915   -4.246  -3.151  1.00 0.00 ? 145 GLU A N    1  
ATOM 809   C CA   . GLU A 1 48  ? 8.594   -4.425  -1.744  1.00 0.00 ? 145 GLU A CA   1  
ATOM 810   C C    . GLU A 1 48  ? 7.791   -3.230  -1.247  1.00 0.00 ? 145 GLU A C    1  
ATOM 811   O O    . GLU A 1 48  ? 8.136   -2.083  -1.537  1.00 0.00 ? 145 GLU A O    1  
ATOM 812   C CB   . GLU A 1 48  ? 9.873   -4.587  -0.923  1.00 0.00 ? 145 GLU A CB   1  
ATOM 813   C CG   . GLU A 1 48  ? 9.627   -5.031  0.510   1.00 0.00 ? 145 GLU A CG   1  
ATOM 814   C CD   . GLU A 1 48  ? 10.916  -5.296  1.257   1.00 0.00 ? 145 GLU A CD   1  
ATOM 815   O OE1  . GLU A 1 48  ? 11.486  -4.349  1.836   1.00 0.00 ? 145 GLU A OE1  1  
ATOM 816   O OE2  . GLU A 1 48  ? 11.370  -6.459  1.269   1.00 0.00 ? 145 GLU A OE2  1  
ATOM 817   H H    . GLU A 1 48  ? 9.358   -3.418  -3.435  1.00 0.00 ? 145 GLU A H    1  
ATOM 818   H HA   . GLU A 1 48  ? 7.993   -5.318  -1.649  1.00 0.00 ? 145 GLU A HA   1  
ATOM 819   H HB2  . GLU A 1 48  ? 10.505  -5.319  -1.402  1.00 0.00 ? 145 GLU A HB2  1  
ATOM 820   H HB3  . GLU A 1 48  ? 10.391  -3.640  -0.898  1.00 0.00 ? 145 GLU A HB3  1  
ATOM 821   H HG2  . GLU A 1 48  ? 9.075   -4.260  1.028   1.00 0.00 ? 145 GLU A HG2  1  
ATOM 822   H HG3  . GLU A 1 48  ? 9.044   -5.940  0.496   1.00 0.00 ? 145 GLU A HG3  1  
ATOM 823   N N    . ILE A 1 49  ? 6.715   -3.504  -0.521  1.00 0.00 ? 146 ILE A N    1  
ATOM 824   C CA   . ILE A 1 49  ? 5.824   -2.457  -0.040  1.00 0.00 ? 146 ILE A CA   1  
ATOM 825   C C    . ILE A 1 49  ? 5.789   -2.451  1.479   1.00 0.00 ? 146 ILE A C    1  
ATOM 826   O O    . ILE A 1 49  ? 5.516   -3.474  2.102   1.00 0.00 ? 146 ILE A O    1  
ATOM 827   C CB   . ILE A 1 49  ? 4.371   -2.640  -0.553  1.00 0.00 ? 146 ILE A CB   1  
ATOM 828   C CG1  . ILE A 1 49  ? 4.324   -2.766  -2.076  1.00 0.00 ? 146 ILE A CG1  1  
ATOM 829   C CG2  . ILE A 1 49  ? 3.484   -1.487  -0.103  1.00 0.00 ? 146 ILE A CG2  1  
ATOM 830   C CD1  . ILE A 1 49  ? 4.544   -4.175  -2.576  1.00 0.00 ? 146 ILE A CD1  1  
ATOM 831   H H    . ILE A 1 49  ? 6.516   -4.440  -0.291  1.00 0.00 ? 146 ILE A H    1  
ATOM 832   H HA   . ILE A 1 49  ? 6.197   -1.506  -0.391  1.00 0.00 ? 146 ILE A HA   1  
ATOM 833   H HB   . ILE A 1 49  ? 3.979   -3.544  -0.115  1.00 0.00 ? 146 ILE A HB   1  
ATOM 834   H HG12 . ILE A 1 49  ? 3.357   -2.439  -2.427  1.00 0.00 ? 146 ILE A HG12 1  
ATOM 835   H HG13 . ILE A 1 49  ? 5.089   -2.138  -2.505  1.00 0.00 ? 146 ILE A HG13 1  
ATOM 836   H HG21 . ILE A 1 49  ? 3.495   -1.423  0.975   1.00 0.00 ? 146 ILE A HG21 1  
ATOM 837   H HG22 . ILE A 1 49  ? 2.473   -1.659  -0.444  1.00 0.00 ? 146 ILE A HG22 1  
ATOM 838   H HG23 . ILE A 1 49  ? 3.853   -0.563  -0.524  1.00 0.00 ? 146 ILE A HG23 1  
ATOM 839   H HD11 . ILE A 1 49  ? 5.482   -4.552  -2.197  1.00 0.00 ? 146 ILE A HD11 1  
ATOM 840   H HD12 . ILE A 1 49  ? 4.566   -4.174  -3.656  1.00 0.00 ? 146 ILE A HD12 1  
ATOM 841   H HD13 . ILE A 1 49  ? 3.737   -4.808  -2.235  1.00 0.00 ? 146 ILE A HD13 1  
ATOM 842   N N    . ARG A 1 50  ? 6.065   -1.309  2.077   1.00 0.00 ? 147 ARG A N    1  
ATOM 843   C CA   . ARG A 1 50  ? 5.917   -1.168  3.514   1.00 0.00 ? 147 ARG A CA   1  
ATOM 844   C C    . ARG A 1 50  ? 4.789   -0.194  3.806   1.00 0.00 ? 147 ARG A C    1  
ATOM 845   O O    . ARG A 1 50  ? 4.659   0.835   3.138   1.00 0.00 ? 147 ARG A O    1  
ATOM 846   C CB   . ARG A 1 50  ? 7.217   -0.701  4.185   1.00 0.00 ? 147 ARG A CB   1  
ATOM 847   C CG   . ARG A 1 50  ? 7.548   0.768   3.973   1.00 0.00 ? 147 ARG A CG   1  
ATOM 848   C CD   . ARG A 1 50  ? 8.675   1.213   4.889   1.00 0.00 ? 147 ARG A CD   1  
ATOM 849   N NE   . ARG A 1 50  ? 8.887   2.658   4.847   1.00 0.00 ? 147 ARG A NE   1  
ATOM 850   C CZ   . ARG A 1 50  ? 9.747   3.302   5.636   1.00 0.00 ? 147 ARG A CZ   1  
ATOM 851   N NH1  . ARG A 1 50  ? 10.476  2.631   6.521   1.00 0.00 ? 147 ARG A NH1  1  
ATOM 852   N NH2  . ARG A 1 50  ? 9.877   4.618   5.543   1.00 0.00 ? 147 ARG A NH2  1  
ATOM 853   H H    . ARG A 1 50  ? 6.352   -0.540  1.537   1.00 0.00 ? 147 ARG A H    1  
ATOM 854   H HA   . ARG A 1 50  ? 5.645   -2.136  3.910   1.00 0.00 ? 147 ARG A HA   1  
ATOM 855   H HB2  . ARG A 1 50  ? 7.138   -0.875  5.248   1.00 0.00 ? 147 ARG A HB2  1  
ATOM 856   H HB3  . ARG A 1 50  ? 8.036   -1.289  3.797   1.00 0.00 ? 147 ARG A HB3  1  
ATOM 857   H HG2  . ARG A 1 50  ? 7.850   0.915   2.946   1.00 0.00 ? 147 ARG A HG2  1  
ATOM 858   H HG3  . ARG A 1 50  ? 6.670   1.360   4.181   1.00 0.00 ? 147 ARG A HG3  1  
ATOM 859   H HD2  . ARG A 1 50  ? 8.432   0.925   5.901   1.00 0.00 ? 147 ARG A HD2  1  
ATOM 860   H HD3  . ARG A 1 50  ? 9.585   0.717   4.585   1.00 0.00 ? 147 ARG A HD3  1  
ATOM 861   H HE   . ARG A 1 50  ? 8.358   3.173   4.200   1.00 0.00 ? 147 ARG A HE   1  
ATOM 862   H HH11 . ARG A 1 50  ? 10.385  1.633   6.605   1.00 0.00 ? 147 ARG A HH11 1  
ATOM 863   H HH12 . ARG A 1 50  ? 11.124  3.119   7.111   1.00 0.00 ? 147 ARG A HH12 1  
ATOM 864   H HH21 . ARG A 1 50  ? 9.330   5.137   4.882   1.00 0.00 ? 147 ARG A HH21 1  
ATOM 865   H HH22 . ARG A 1 50  ? 10.529  5.103   6.135   1.00 0.00 ? 147 ARG A HH22 1  
ATOM 866   N N    . LEU A 1 51  ? 3.959   -0.530  4.775   1.00 0.00 ? 148 LEU A N    1  
ATOM 867   C CA   . LEU A 1 51  ? 2.839   0.320   5.132   1.00 0.00 ? 148 LEU A CA   1  
ATOM 868   C C    . LEU A 1 51  ? 2.529   0.205   6.613   1.00 0.00 ? 148 LEU A C    1  
ATOM 869   O O    . LEU A 1 51  ? 2.940   -0.753  7.269   1.00 0.00 ? 148 LEU A O    1  
ATOM 870   C CB   . LEU A 1 51  ? 1.590   0.016   4.260   1.00 0.00 ? 148 LEU A CB   1  
ATOM 871   C CG   . LEU A 1 51  ? 0.848   -1.332  4.448   1.00 0.00 ? 148 LEU A CG   1  
ATOM 872   C CD1  . LEU A 1 51  ? 1.795   -2.521  4.446   1.00 0.00 ? 148 LEU A CD1  1  
ATOM 873   C CD2  . LEU A 1 51  ? -0.015  -1.328  5.704   1.00 0.00 ? 148 LEU A CD2  1  
ATOM 874   H H    . LEU A 1 51  ? 4.101   -1.370  5.268   1.00 0.00 ? 148 LEU A H    1  
ATOM 875   H HA   . LEU A 1 51  ? 3.146   1.338   4.938   1.00 0.00 ? 148 LEU A HA   1  
ATOM 876   H HB2  . LEU A 1 51  ? 0.873   0.802   4.437   1.00 0.00 ? 148 LEU A HB2  1  
ATOM 877   H HB3  . LEU A 1 51  ? 1.897   0.078   3.225   1.00 0.00 ? 148 LEU A HB3  1  
ATOM 878   H HG   . LEU A 1 51  ? 0.183   -1.463  3.607   1.00 0.00 ? 148 LEU A HG   1  
ATOM 879   H HD11 . LEU A 1 51  ? 1.229   -3.433  4.560   1.00 0.00 ? 148 LEU A HD11 1  
ATOM 880   H HD12 . LEU A 1 51  ? 2.494   -2.426  5.264   1.00 0.00 ? 148 LEU A HD12 1  
ATOM 881   H HD13 . LEU A 1 51  ? 2.337   -2.548  3.511   1.00 0.00 ? 148 LEU A HD13 1  
ATOM 882   H HD21 . LEU A 1 51  ? 0.607   -1.147  6.568   1.00 0.00 ? 148 LEU A HD21 1  
ATOM 883   H HD22 . LEU A 1 51  ? -0.505  -2.285  5.807   1.00 0.00 ? 148 LEU A HD22 1  
ATOM 884   H HD23 . LEU A 1 51  ? -0.760  -0.549  5.626   1.00 0.00 ? 148 LEU A HD23 1  
ATOM 885   N N    . LYS A 1 52  ? 1.833   1.202   7.134   1.00 0.00 ? 149 LYS A N    1  
ATOM 886   C CA   . LYS A 1 52  ? 1.390   1.197   8.519   1.00 0.00 ? 149 LYS A CA   1  
ATOM 887   C C    . LYS A 1 52  ? 0.419   2.348   8.745   1.00 0.00 ? 149 LYS A C    1  
ATOM 888   O O    . LYS A 1 52  ? 0.542   3.402   8.116   1.00 0.00 ? 149 LYS A O    1  
ATOM 889   C CB   . LYS A 1 52  ? 2.581   1.324   9.481   1.00 0.00 ? 149 LYS A CB   1  
ATOM 890   C CG   . LYS A 1 52  ? 3.153   2.730   9.581   1.00 0.00 ? 149 LYS A CG   1  
ATOM 891   C CD   . LYS A 1 52  ? 4.242   2.813   10.637  1.00 0.00 ? 149 LYS A CD   1  
ATOM 892   C CE   . LYS A 1 52  ? 4.651   4.251   10.902  1.00 0.00 ? 149 LYS A CE   1  
ATOM 893   N NZ   . LYS A 1 52  ? 3.545   5.043   11.507  1.00 0.00 ? 149 LYS A NZ   1  
ATOM 894   H H    . LYS A 1 52  ? 1.610   1.972   6.566   1.00 0.00 ? 149 LYS A H    1  
ATOM 895   H HA   . LYS A 1 52  ? 0.879   0.264   8.704   1.00 0.00 ? 149 LYS A HA   1  
ATOM 896   H HB2  . LYS A 1 52  ? 2.265   1.019   10.467  1.00 0.00 ? 149 LYS A HB2  1  
ATOM 897   H HB3  . LYS A 1 52  ? 3.368   0.664   9.147   1.00 0.00 ? 149 LYS A HB3  1  
ATOM 898   H HG2  . LYS A 1 52  ? 3.569   3.009   8.624   1.00 0.00 ? 149 LYS A HG2  1  
ATOM 899   H HG3  . LYS A 1 52  ? 2.358   3.414   9.842   1.00 0.00 ? 149 LYS A HG3  1  
ATOM 900   H HD2  . LYS A 1 52  ? 3.875   2.379   11.555  1.00 0.00 ? 149 LYS A HD2  1  
ATOM 901   H HD3  . LYS A 1 52  ? 5.104   2.259   10.294  1.00 0.00 ? 149 LYS A HD3  1  
ATOM 902   H HE2  . LYS A 1 52  ? 5.493   4.254   11.578  1.00 0.00 ? 149 LYS A HE2  1  
ATOM 903   H HE3  . LYS A 1 52  ? 4.940   4.708   9.967   1.00 0.00 ? 149 LYS A HE3  1  
ATOM 904   H HZ1  . LYS A 1 52  ? 3.846   6.029   11.649  1.00 0.00 ? 149 LYS A HZ1  1  
ATOM 905   H HZ2  . LYS A 1 52  ? 3.281   4.640   12.431  1.00 0.00 ? 149 LYS A HZ2  1  
ATOM 906   H HZ3  . LYS A 1 52  ? 2.713   5.034   10.886  1.00 0.00 ? 149 LYS A HZ3  1  
ATOM 907   N N    . PRO A 1 53  ? -0.584  2.150   9.608   1.00 0.00 ? 150 PRO A N    1  
ATOM 908   C CA   . PRO A 1 53  ? -1.496  3.221   10.000  1.00 0.00 ? 150 PRO A CA   1  
ATOM 909   C C    . PRO A 1 53  ? -0.822  4.270   10.886  1.00 0.00 ? 150 PRO A C    1  
ATOM 910   O O    . PRO A 1 53  ? 0.341   4.114   11.273  1.00 0.00 ? 150 PRO A O    1  
ATOM 911   C CB   . PRO A 1 53  ? -2.602  2.500   10.770  1.00 0.00 ? 150 PRO A CB   1  
ATOM 912   C CG   . PRO A 1 53  ? -1.984  1.232   11.245  1.00 0.00 ? 150 PRO A CG   1  
ATOM 913   C CD   . PRO A 1 53  ? -0.936  0.861   10.231  1.00 0.00 ? 150 PRO A CD   1  
ATOM 914   H HA   . PRO A 1 53  ? -1.920  3.709   9.135   1.00 0.00 ? 150 PRO A HA   1  
ATOM 915   H HB2  . PRO A 1 53  ? -2.924  3.115   11.598  1.00 0.00 ? 150 PRO A HB2  1  
ATOM 916   H HB3  . PRO A 1 53  ? -3.437  2.309   10.112  1.00 0.00 ? 150 PRO A HB3  1  
ATOM 917   H HG2  . PRO A 1 53  ? -1.531  1.388   12.212  1.00 0.00 ? 150 PRO A HG2  1  
ATOM 918   H HG3  . PRO A 1 53  ? -2.736  0.459   11.305  1.00 0.00 ? 150 PRO A HG3  1  
ATOM 919   H HD2  . PRO A 1 53  ? -0.077  0.423   10.718  1.00 0.00 ? 150 PRO A HD2  1  
ATOM 920   H HD3  . PRO A 1 53  ? -1.343  0.179   9.500   1.00 0.00 ? 150 PRO A HD3  1  
ATOM 921   N N    . GLU A 1 54  ? -1.547  5.328   11.207  1.00 0.00 ? 151 GLU A N    1  
ATOM 922   C CA   . GLU A 1 54  ? -1.003  6.414   12.014  1.00 0.00 ? 151 GLU A CA   1  
ATOM 923   C C    . GLU A 1 54  ? -0.596  5.942   13.410  1.00 0.00 ? 151 GLU A C    1  
ATOM 924   O O    . GLU A 1 54  ? 0.477   6.295   13.905  1.00 0.00 ? 151 GLU A O    1  
ATOM 925   C CB   . GLU A 1 54  ? -2.017  7.557   12.113  1.00 0.00 ? 151 GLU A CB   1  
ATOM 926   C CG   . GLU A 1 54  ? -3.424  7.102   12.457  1.00 0.00 ? 151 GLU A CG   1  
ATOM 927   C CD   . GLU A 1 54  ? -4.413  8.243   12.467  1.00 0.00 ? 151 GLU A CD   1  
ATOM 928   O OE1  . GLU A 1 54  ? -4.939  8.584   11.391  1.00 0.00 ? 151 GLU A OE1  1  
ATOM 929   O OE2  . GLU A 1 54  ? -4.663  8.809   13.549  1.00 0.00 ? 151 GLU A OE2  1  
ATOM 930   H H    . GLU A 1 54  ? -2.468  5.392   10.874  1.00 0.00 ? 151 GLU A H    1  
ATOM 931   H HA   . GLU A 1 54  ? -0.121  6.777   11.511  1.00 0.00 ? 151 GLU A HA   1  
ATOM 932   H HB2  . GLU A 1 54  ? -1.693  8.242   12.883  1.00 0.00 ? 151 GLU A HB2  1  
ATOM 933   H HB3  . GLU A 1 54  ? -2.050  8.079   11.169  1.00 0.00 ? 151 GLU A HB3  1  
ATOM 934   H HG2  . GLU A 1 54  ? -3.743  6.376   11.725  1.00 0.00 ? 151 GLU A HG2  1  
ATOM 935   H HG3  . GLU A 1 54  ? -3.412  6.646   13.434  1.00 0.00 ? 151 GLU A HG3  1  
ATOM 936   N N    . LYS A 1 55  ? -1.435  5.129   14.035  1.00 0.00 ? 152 LYS A N    1  
ATOM 937   C CA   . LYS A 1 55  ? -1.176  4.673   15.393  1.00 0.00 ? 152 LYS A CA   1  
ATOM 938   C C    . LYS A 1 55  ? -0.292  3.434   15.401  1.00 0.00 ? 152 LYS A C    1  
ATOM 939   O O    . LYS A 1 55  ? -0.211  2.717   16.397  1.00 0.00 ? 152 LYS A O    1  
ATOM 940   C CB   . LYS A 1 55  ? -2.492  4.406   16.112  1.00 0.00 ? 152 LYS A CB   1  
ATOM 941   C CG   . LYS A 1 55  ? -3.310  5.667   16.309  1.00 0.00 ? 152 LYS A CG   1  
ATOM 942   C CD   . LYS A 1 55  ? -4.702  5.360   16.812  1.00 0.00 ? 152 LYS A CD   1  
ATOM 943   C CE   . LYS A 1 55  ? -5.542  6.622   16.895  1.00 0.00 ? 152 LYS A CE   1  
ATOM 944   N NZ   . LYS A 1 55  ? -5.037  7.570   17.922  1.00 0.00 ? 152 LYS A NZ   1  
ATOM 945   H H    . LYS A 1 55  ? -2.250  4.829   13.576  1.00 0.00 ? 152 LYS A H    1  
ATOM 946   H HA   . LYS A 1 55  ? -0.657  5.468   15.908  1.00 0.00 ? 152 LYS A HA   1  
ATOM 947   H HB2  . LYS A 1 55  ? -3.075  3.707   15.531  1.00 0.00 ? 152 LYS A HB2  1  
ATOM 948   H HB3  . LYS A 1 55  ? -2.286  3.979   17.081  1.00 0.00 ? 152 LYS A HB3  1  
ATOM 949   H HG2  . LYS A 1 55  ? -2.811  6.298   17.028  1.00 0.00 ? 152 LYS A HG2  1  
ATOM 950   H HG3  . LYS A 1 55  ? -3.384  6.186   15.365  1.00 0.00 ? 152 LYS A HG3  1  
ATOM 951   H HD2  . LYS A 1 55  ? -5.172  4.668   16.131  1.00 0.00 ? 152 LYS A HD2  1  
ATOM 952   H HD3  . LYS A 1 55  ? -4.633  4.916   17.794  1.00 0.00 ? 152 LYS A HD3  1  
ATOM 953   H HE2  . LYS A 1 55  ? -5.516  7.111   15.931  1.00 0.00 ? 152 LYS A HE2  1  
ATOM 954   H HE3  . LYS A 1 55  ? -6.558  6.350   17.133  1.00 0.00 ? 152 LYS A HE3  1  
ATOM 955   H HZ1  . LYS A 1 55  ? -4.109  7.945   17.641  1.00 0.00 ? 152 LYS A HZ1  1  
ATOM 956   H HZ2  . LYS A 1 55  ? -4.941  7.088   18.839  1.00 0.00 ? 152 LYS A HZ2  1  
ATOM 957   H HZ3  . LYS A 1 55  ? -5.699  8.363   18.034  1.00 0.00 ? 152 LYS A HZ3  1  
ATOM 958   N N    . ALA A 1 56  ? 0.368   3.186   14.284  1.00 0.00 ? 153 ALA A N    1  
ATOM 959   C CA   . ALA A 1 56  ? 1.319   2.098   14.191  1.00 0.00 ? 153 ALA A CA   1  
ATOM 960   C C    . ALA A 1 56  ? 2.720   2.605   14.481  1.00 0.00 ? 153 ALA A C    1  
ATOM 961   O O    . ALA A 1 56  ? 3.215   3.511   13.807  1.00 0.00 ? 153 ALA A O    1  
ATOM 962   C CB   . ALA A 1 56  ? 1.263   1.469   12.817  1.00 0.00 ? 153 ALA A CB   1  
ATOM 963   H H    . ALA A 1 56  ? 0.212   3.754   13.500  1.00 0.00 ? 153 ALA A H    1  
ATOM 964   H HA   . ALA A 1 56  ? 1.050   1.351   14.923  1.00 0.00 ? 153 ALA A HA   1  
ATOM 965   H HB1  . ALA A 1 56  ? 2.062   0.750   12.717  1.00 0.00 ? 153 ALA A HB1  1  
ATOM 966   H HB2  . ALA A 1 56  ? 1.376   2.239   12.066  1.00 0.00 ? 153 ALA A HB2  1  
ATOM 967   H HB3  . ALA A 1 56  ? 0.314   0.974   12.687  1.00 0.00 ? 153 ALA A HB3  1  
ATOM 968   N N    . ALA A 1 57  ? 3.352   2.021   15.484  1.00 0.00 ? 154 ALA A N    1  
ATOM 969   C CA   . ALA A 1 57  ? 4.692   2.419   15.880  1.00 0.00 ? 154 ALA A CA   1  
ATOM 970   C C    . ALA A 1 57  ? 5.739   1.740   15.010  1.00 0.00 ? 154 ALA A C    1  
ATOM 971   O O    . ALA A 1 57  ? 6.861   2.229   14.876  1.00 0.00 ? 154 ALA A O    1  
ATOM 972   C CB   . ALA A 1 57  ? 4.927   2.087   17.345  1.00 0.00 ? 154 ALA A CB   1  
ATOM 973   H H    . ALA A 1 57  ? 2.904   1.297   15.973  1.00 0.00 ? 154 ALA A H    1  
ATOM 974   H HA   . ALA A 1 57  ? 4.773   3.489   15.758  1.00 0.00 ? 154 ALA A HA   1  
ATOM 975   H HB1  . ALA A 1 57  ? 4.876   1.017   17.483  1.00 0.00 ? 154 ALA A HB1  1  
ATOM 976   H HB2  . ALA A 1 57  ? 4.170   2.565   17.949  1.00 0.00 ? 154 ALA A HB2  1  
ATOM 977   H HB3  . ALA A 1 57  ? 5.903   2.442   17.643  1.00 0.00 ? 154 ALA A HB3  1  
ATOM 978   N N    . GLU A 1 58  ? 5.362   0.619   14.411  1.00 0.00 ? 155 GLU A N    1  
ATOM 979   C CA   . GLU A 1 58  ? 6.286   -0.167  13.607  1.00 0.00 ? 155 GLU A CA   1  
ATOM 980   C C    . GLU A 1 58  ? 5.779   -0.308  12.179  1.00 0.00 ? 155 GLU A C    1  
ATOM 981   O O    . GLU A 1 58  ? 4.577   -0.202  11.922  1.00 0.00 ? 155 GLU A O    1  
ATOM 982   C CB   . GLU A 1 58  ? 6.472   -1.547  14.232  1.00 0.00 ? 155 GLU A CB   1  
ATOM 983   C CG   . GLU A 1 58  ? 7.039   -1.503  15.639  1.00 0.00 ? 155 GLU A CG   1  
ATOM 984   C CD   . GLU A 1 58  ? 7.286   -2.882  16.202  1.00 0.00 ? 155 GLU A CD   1  
ATOM 985   O OE1  . GLU A 1 58  ? 6.316   -3.530  16.641  1.00 0.00 ? 155 GLU A OE1  1  
ATOM 986   O OE2  . GLU A 1 58  ? 8.450   -3.328  16.208  1.00 0.00 ? 155 GLU A OE2  1  
ATOM 987   H H    . GLU A 1 58  ? 4.434   0.315   14.506  1.00 0.00 ? 155 GLU A H    1  
ATOM 988   H HA   . GLU A 1 58  ? 7.236   0.345   13.594  1.00 0.00 ? 155 GLU A HA   1  
ATOM 989   H HB2  . GLU A 1 58  ? 5.513   -2.042  14.270  1.00 0.00 ? 155 GLU A HB2  1  
ATOM 990   H HB3  . GLU A 1 58  ? 7.142   -2.124  13.613  1.00 0.00 ? 155 GLU A HB3  1  
ATOM 991   H HG2  . GLU A 1 58  ? 7.974   -0.965  15.621  1.00 0.00 ? 155 GLU A HG2  1  
ATOM 992   H HG3  . GLU A 1 58  ? 6.339   -0.988  16.280  1.00 0.00 ? 155 GLU A HG3  1  
ATOM 993   N N    . TRP A 1 59  ? 6.701   -0.549  11.257  1.00 0.00 ? 156 TRP A N    1  
ATOM 994   C CA   . TRP A 1 59  ? 6.364   -0.679  9.847   1.00 0.00 ? 156 TRP A CA   1  
ATOM 995   C C    . TRP A 1 59  ? 6.068   -2.122  9.480   1.00 0.00 ? 156 TRP A C    1  
ATOM 996   O O    . TRP A 1 59  ? 6.731   -3.050  9.950   1.00 0.00 ? 156 TRP A O    1  
ATOM 997   C CB   . TRP A 1 59  ? 7.501   -0.155  8.970   1.00 0.00 ? 156 TRP A CB   1  
ATOM 998   C CG   . TRP A 1 59  ? 7.559   1.335   8.900   1.00 0.00 ? 156 TRP A CG   1  
ATOM 999   C CD1  . TRP A 1 59  ? 8.360   2.165   9.627   1.00 0.00 ? 156 TRP A CD1  1  
ATOM 1000  C CD2  . TRP A 1 59  ? 6.776   2.174   8.048   1.00 0.00 ? 156 TRP A CD2  1  
ATOM 1001  N NE1  . TRP A 1 59  ? 8.122   3.471   9.277   1.00 0.00 ? 156 TRP A NE1  1  
ATOM 1002  C CE2  . TRP A 1 59  ? 7.153   3.502   8.310   1.00 0.00 ? 156 TRP A CE2  1  
ATOM 1003  C CE3  . TRP A 1 59  ? 5.790   1.928   7.088   1.00 0.00 ? 156 TRP A CE3  1  
ATOM 1004  C CZ2  . TRP A 1 59  ? 6.582   4.582   7.646   1.00 0.00 ? 156 TRP A CZ2  1  
ATOM 1005  C CZ3  . TRP A 1 59  ? 5.223   3.001   6.430   1.00 0.00 ? 156 TRP A CZ3  1  
ATOM 1006  C CH2  . TRP A 1 59  ? 5.622   4.313   6.711   1.00 0.00 ? 156 TRP A CH2  1  
ATOM 1007  H H    . TRP A 1 59  ? 7.636   -0.655  11.534  1.00 0.00 ? 156 TRP A H    1  
ATOM 1008  H HA   . TRP A 1 59  ? 5.481   -0.087  9.662   1.00 0.00 ? 156 TRP A HA   1  
ATOM 1009  H HB2  . TRP A 1 59  ? 8.442   -0.505  9.366   1.00 0.00 ? 156 TRP A HB2  1  
ATOM 1010  H HB3  . TRP A 1 59  ? 7.376   -0.534  7.966   1.00 0.00 ? 156 TRP A HB3  1  
ATOM 1011  H HD1  . TRP A 1 59  ? 9.072   1.830   10.366  1.00 0.00 ? 156 TRP A HD1  1  
ATOM 1012  H HE1  . TRP A 1 59  ? 8.572   4.255   9.659   1.00 0.00 ? 156 TRP A HE1  1  
ATOM 1013  H HE3  . TRP A 1 59  ? 5.468   0.919   6.860   1.00 0.00 ? 156 TRP A HE3  1  
ATOM 1014  H HZ2  . TRP A 1 59  ? 6.876   5.600   7.851   1.00 0.00 ? 156 TRP A HZ2  1  
ATOM 1015  H HZ3  . TRP A 1 59  ? 4.460   2.832   5.684   1.00 0.00 ? 156 TRP A HZ3  1  
ATOM 1016  H HH2  . TRP A 1 59  ? 5.150   5.122   6.174   1.00 0.00 ? 156 TRP A HH2  1  
ATOM 1017  N N    . GLU A 1 60  ? 5.070   -2.307  8.637   1.00 0.00 ? 157 GLU A N    1  
ATOM 1018  C CA   . GLU A 1 60  ? 4.718   -3.624  8.156   1.00 0.00 ? 157 GLU A CA   1  
ATOM 1019  C C    . GLU A 1 60  ? 5.202   -3.797  6.721   1.00 0.00 ? 157 GLU A C    1  
ATOM 1020  O O    . GLU A 1 60  ? 4.655   -3.199  5.793   1.00 0.00 ? 157 GLU A O    1  
ATOM 1021  C CB   . GLU A 1 60  ? 3.207   -3.824  8.242   1.00 0.00 ? 157 GLU A CB   1  
ATOM 1022  C CG   . GLU A 1 60  ? 2.771   -5.259  8.013   1.00 0.00 ? 157 GLU A CG   1  
ATOM 1023  C CD   . GLU A 1 60  ? 3.338   -6.212  9.045   1.00 0.00 ? 157 GLU A CD   1  
ATOM 1024  O OE1  . GLU A 1 60  ? 4.523   -6.592  8.926   1.00 0.00 ? 157 GLU A OE1  1  
ATOM 1025  O OE2  . GLU A 1 60  ? 2.603   -6.586  9.979   1.00 0.00 ? 157 GLU A OE2  1  
ATOM 1026  H H    . GLU A 1 60  ? 4.549   -1.532  8.330   1.00 0.00 ? 157 GLU A H    1  
ATOM 1027  H HA   . GLU A 1 60  ? 5.210   -4.352  8.783   1.00 0.00 ? 157 GLU A HA   1  
ATOM 1028  H HB2  . GLU A 1 60  ? 2.871   -3.519  9.222   1.00 0.00 ? 157 GLU A HB2  1  
ATOM 1029  H HB3  . GLU A 1 60  ? 2.732   -3.202  7.498   1.00 0.00 ? 157 GLU A HB3  1  
ATOM 1030  H HG2  . GLU A 1 60  ? 1.693   -5.306  8.058   1.00 0.00 ? 157 GLU A HG2  1  
ATOM 1031  H HG3  . GLU A 1 60  ? 3.104   -5.571  7.034   1.00 0.00 ? 157 GLU A HG3  1  
ATOM 1032  N N    . ILE A 1 61  ? 6.243   -4.595  6.548   1.00 0.00 ? 158 ILE A N    1  
ATOM 1033  C CA   . ILE A 1 61  ? 6.813   -4.836  5.231   1.00 0.00 ? 158 ILE A CA   1  
ATOM 1034  C C    . ILE A 1 61  ? 6.126   -6.020  4.558   1.00 0.00 ? 158 ILE A C    1  
ATOM 1035  O O    . ILE A 1 61  ? 5.963   -7.085  5.155   1.00 0.00 ? 158 ILE A O    1  
ATOM 1036  C CB   . ILE A 1 61  ? 8.347   -5.083  5.297   1.00 0.00 ? 158 ILE A CB   1  
ATOM 1037  C CG1  . ILE A 1 61  ? 9.118   -3.763  5.426   1.00 0.00 ? 158 ILE A CG1  1  
ATOM 1038  C CG2  . ILE A 1 61  ? 8.833   -5.843  4.071   1.00 0.00 ? 158 ILE A CG2  1  
ATOM 1039  C CD1  . ILE A 1 61  ? 8.900   -3.033  6.731   1.00 0.00 ? 158 ILE A CD1  1  
ATOM 1040  H H    . ILE A 1 61  ? 6.637   -5.043  7.327   1.00 0.00 ? 158 ILE A H    1  
ATOM 1041  H HA   . ILE A 1 61  ? 6.640   -3.952  4.634   1.00 0.00 ? 158 ILE A HA   1  
ATOM 1042  H HB   . ILE A 1 61  ? 8.549   -5.691  6.165   1.00 0.00 ? 158 ILE A HB   1  
ATOM 1043  H HG12 . ILE A 1 61  ? 10.174  -3.965  5.339   1.00 0.00 ? 158 ILE A HG12 1  
ATOM 1044  H HG13 . ILE A 1 61  ? 8.820   -3.103  4.624   1.00 0.00 ? 158 ILE A HG13 1  
ATOM 1045  H HG21 . ILE A 1 61  ? 9.898   -6.000  4.146   1.00 0.00 ? 158 ILE A HG21 1  
ATOM 1046  H HG22 . ILE A 1 61  ? 8.617   -5.267  3.183   1.00 0.00 ? 158 ILE A HG22 1  
ATOM 1047  H HG23 . ILE A 1 61  ? 8.331   -6.797  4.014   1.00 0.00 ? 158 ILE A HG23 1  
ATOM 1048  H HD11 . ILE A 1 61  ? 7.848   -2.829  6.858   1.00 0.00 ? 158 ILE A HD11 1  
ATOM 1049  H HD12 . ILE A 1 61  ? 9.449   -2.103  6.715   1.00 0.00 ? 158 ILE A HD12 1  
ATOM 1050  H HD13 . ILE A 1 61  ? 9.251   -3.644  7.548   1.00 0.00 ? 158 ILE A HD13 1  
ATOM 1051  N N    . HIS A 1 62  ? 5.697   -5.807  3.326   1.00 0.00 ? 159 HIS A N    1  
ATOM 1052  C CA   . HIS A 1 62  ? 5.100   -6.854  2.516   1.00 0.00 ? 159 HIS A CA   1  
ATOM 1053  C C    . HIS A 1 62  ? 5.794   -6.923  1.161   1.00 0.00 ? 159 HIS A C    1  
ATOM 1054  O O    . HIS A 1 62  ? 5.717   -5.986  0.365   1.00 0.00 ? 159 HIS A O    1  
ATOM 1055  C CB   . HIS A 1 62  ? 3.607   -6.600  2.304   1.00 0.00 ? 159 HIS A CB   1  
ATOM 1056  C CG   . HIS A 1 62  ? 2.753   -6.795  3.521   1.00 0.00 ? 159 HIS A CG   1  
ATOM 1057  N ND1  . HIS A 1 62  ? 2.012   -7.936  3.746   1.00 0.00 ? 159 HIS A ND1  1  
ATOM 1058  C CD2  . HIS A 1 62  ? 2.482   -5.967  4.557   1.00 0.00 ? 159 HIS A CD2  1  
ATOM 1059  C CE1  . HIS A 1 62  ? 1.319   -7.797  4.861   1.00 0.00 ? 159 HIS A CE1  1  
ATOM 1060  N NE2  . HIS A 1 62  ? 1.589   -6.615  5.373   1.00 0.00 ? 159 HIS A NE2  1  
ATOM 1061  H H    . HIS A 1 62  ? 5.787   -4.904  2.939   1.00 0.00 ? 159 HIS A H    1  
ATOM 1062  H HA   . HIS A 1 62  ? 5.232   -7.793  3.030   1.00 0.00 ? 159 HIS A HA   1  
ATOM 1063  H HB2  . HIS A 1 62  ? 3.471   -5.582  1.970   1.00 0.00 ? 159 HIS A HB2  1  
ATOM 1064  H HB3  . HIS A 1 62  ? 3.247   -7.270  1.536   1.00 0.00 ? 159 HIS A HB3  1  
ATOM 1065  H HD1  . HIS A 1 62  ? 2.001   -8.739  3.175   1.00 0.00 ? 159 HIS A HD1  1  
ATOM 1066  H HD2  . HIS A 1 62  ? 2.898   -4.983  4.716   1.00 0.00 ? 159 HIS A HD2  1  
ATOM 1067  H HE1  . HIS A 1 62  ? 0.639   -8.524  5.277   1.00 0.00 ? 159 HIS A HE1  1  
ATOM 1068  H HE2  . HIS A 1 62  ? 1.098   -6.204  6.121   1.00 0.00 ? 159 HIS A HE2  1  
ATOM 1069  N N    . PHE A 1 63  ? 6.477   -8.023  0.907   1.00 0.00 ? 160 PHE A N    1  
ATOM 1070  C CA   . PHE A 1 63  ? 7.164   -8.218  -0.360  1.00 0.00 ? 160 PHE A CA   1  
ATOM 1071  C C    . PHE A 1 63  ? 6.183   -8.743  -1.405  1.00 0.00 ? 160 PHE A C    1  
ATOM 1072  O O    . PHE A 1 63  ? 5.641   -9.839  -1.259  1.00 0.00 ? 160 PHE A O    1  
ATOM 1073  C CB   . PHE A 1 63  ? 8.326   -9.196  -0.181  1.00 0.00 ? 160 PHE A CB   1  
ATOM 1074  C CG   . PHE A 1 63  ? 9.298   -9.175  -1.320  1.00 0.00 ? 160 PHE A CG   1  
ATOM 1075  C CD1  . PHE A 1 63  ? 10.123  -8.081  -1.506  1.00 0.00 ? 160 PHE A CD1  1  
ATOM 1076  C CD2  . PHE A 1 63  ? 9.389   -10.237 -2.203  1.00 0.00 ? 160 PHE A CD2  1  
ATOM 1077  C CE1  . PHE A 1 63  ? 11.020  -8.039  -2.549  1.00 0.00 ? 160 PHE A CE1  1  
ATOM 1078  C CE2  . PHE A 1 63  ? 10.287  -10.205 -3.252  1.00 0.00 ? 160 PHE A CE2  1  
ATOM 1079  C CZ   . PHE A 1 63  ? 11.104  -9.104  -3.426  1.00 0.00 ? 160 PHE A CZ   1  
ATOM 1080  H H    . PHE A 1 63  ? 6.524   -8.726  1.591   1.00 0.00 ? 160 PHE A H    1  
ATOM 1081  H HA   . PHE A 1 63  ? 7.552   -7.263  -0.688  1.00 0.00 ? 160 PHE A HA   1  
ATOM 1082  H HB2  . PHE A 1 63  ? 8.865   -8.944  0.721   1.00 0.00 ? 160 PHE A HB2  1  
ATOM 1083  H HB3  . PHE A 1 63  ? 7.935   -10.199 -0.093  1.00 0.00 ? 160 PHE A HB3  1  
ATOM 1084  H HD1  . PHE A 1 63  ? 10.058  -7.249  -0.820  1.00 0.00 ? 160 PHE A HD1  1  
ATOM 1085  H HD2  . PHE A 1 63  ? 8.750   -11.097 -2.066  1.00 0.00 ? 160 PHE A HD2  1  
ATOM 1086  H HE1  . PHE A 1 63  ? 11.653  -7.174  -2.678  1.00 0.00 ? 160 PHE A HE1  1  
ATOM 1087  H HE2  . PHE A 1 63  ? 10.350  -11.039 -3.934  1.00 0.00 ? 160 PHE A HE2  1  
ATOM 1088  H HZ   . PHE A 1 63  ? 11.807  -9.076  -4.251  1.00 0.00 ? 160 PHE A HZ   1  
ATOM 1089  N N    . ALA A 1 64  ? 5.945   -7.954  -2.447  1.00 0.00 ? 161 ALA A N    1  
ATOM 1090  C CA   . ALA A 1 64  ? 4.994   -8.336  -3.485  1.00 0.00 ? 161 ALA A CA   1  
ATOM 1091  C C    . ALA A 1 64  ? 5.622   -9.304  -4.470  1.00 0.00 ? 161 ALA A C    1  
ATOM 1092  O O    . ALA A 1 64  ? 5.011   -10.301 -4.848  1.00 0.00 ? 161 ALA A O    1  
ATOM 1093  C CB   . ALA A 1 64  ? 4.472   -7.113  -4.221  1.00 0.00 ? 161 ALA A CB   1  
ATOM 1094  H H    . ALA A 1 64  ? 6.423   -7.100  -2.523  1.00 0.00 ? 161 ALA A H    1  
ATOM 1095  H HA   . ALA A 1 64  ? 4.157   -8.822  -3.005  1.00 0.00 ? 161 ALA A HA   1  
ATOM 1096  H HB1  . ALA A 1 64  ? 3.993   -6.447  -3.519  1.00 0.00 ? 161 ALA A HB1  1  
ATOM 1097  H HB2  . ALA A 1 64  ? 3.758   -7.421  -4.969  1.00 0.00 ? 161 ALA A HB2  1  
ATOM 1098  H HB3  . ALA A 1 64  ? 5.296   -6.602  -4.697  1.00 0.00 ? 161 ALA A HB3  1  
ATOM 1099  N N    . GLY A 1 65  ? 6.845   -9.005  -4.880  1.00 0.00 ? 162 GLY A N    1  
ATOM 1100  C CA   . GLY A 1 65  ? 7.538   -9.861  -5.816  1.00 0.00 ? 162 GLY A CA   1  
ATOM 1101  C C    . GLY A 1 65  ? 7.538   -9.296  -7.220  1.00 0.00 ? 162 GLY A C    1  
ATOM 1102  O O    . GLY A 1 65  ? 7.895   -8.137  -7.423  1.00 0.00 ? 162 GLY A O    1  
ATOM 1103  H H    . GLY A 1 65  ? 7.279   -8.190  -4.549  1.00 0.00 ? 162 GLY A H    1  
ATOM 1104  H HA2  . GLY A 1 65  ? 8.561   -9.981  -5.489  1.00 0.00 ? 162 GLY A HA2  1  
ATOM 1105  H HA3  . GLY A 1 65  ? 7.058   -10.827 -5.828  1.00 0.00 ? 162 GLY A HA3  1  
ATOM 1106  N N    . GLN A 1 66  ? 7.115   -10.110 -8.177  1.00 0.00 ? 163 GLN A N    1  
ATOM 1107  C CA   . GLN A 1 66  ? 7.174   -9.746  -9.589  1.00 0.00 ? 163 GLN A CA   1  
ATOM 1108  C C    . GLN A 1 66  ? 5.933   -8.959  -10.004 1.00 0.00 ? 163 GLN A C    1  
ATOM 1109  O O    . GLN A 1 66  ? 5.940   -8.248  -11.010 1.00 0.00 ? 163 GLN A O    1  
ATOM 1110  C CB   . GLN A 1 66  ? 7.309   -11.015 -10.438 1.00 0.00 ? 163 GLN A CB   1  
ATOM 1111  C CG   . GLN A 1 66  ? 7.472   -10.750 -11.925 1.00 0.00 ? 163 GLN A CG   1  
ATOM 1112  C CD   . GLN A 1 66  ? 7.676   -12.018 -12.732 1.00 0.00 ? 163 GLN A CD   1  
ATOM 1113  O OE1  . GLN A 1 66  ? 7.180   -13.088 -12.375 1.00 0.00 ? 163 GLN A OE1  1  
ATOM 1114  N NE2  . GLN A 1 66  ? 8.421   -11.908 -13.820 1.00 0.00 ? 163 GLN A NE2  1  
ATOM 1115  H H    . GLN A 1 66  ? 6.736   -10.981 -7.927  1.00 0.00 ? 163 GLN A H    1  
ATOM 1116  H HA   . GLN A 1 66  ? 8.047   -9.128  -9.738  1.00 0.00 ? 163 GLN A HA   1  
ATOM 1117  H HB2  . GLN A 1 66  ? 8.172   -11.569 -10.098 1.00 0.00 ? 163 GLN A HB2  1  
ATOM 1118  H HB3  . GLN A 1 66  ? 6.427   -11.621 -10.297 1.00 0.00 ? 163 GLN A HB3  1  
ATOM 1119  H HG2  . GLN A 1 66  ? 6.585   -10.253 -12.288 1.00 0.00 ? 163 GLN A HG2  1  
ATOM 1120  H HG3  . GLN A 1 66  ? 8.328   -10.107 -12.070 1.00 0.00 ? 163 GLN A HG3  1  
ATOM 1121  H HE21 . GLN A 1 66  ? 8.792   -11.027 -14.037 1.00 0.00 ? 163 GLN A HE21 1  
ATOM 1122  H HE22 . GLN A 1 66  ? 8.573   -12.710 -14.363 1.00 0.00 ? 163 GLN A HE22 1  
ATOM 1123  N N    . GLN A 1 67  ? 4.876   -9.080  -9.214  1.00 0.00 ? 164 GLN A N    1  
ATOM 1124  C CA   . GLN A 1 67  ? 3.617   -8.419  -9.510  1.00 0.00 ? 164 GLN A CA   1  
ATOM 1125  C C    . GLN A 1 67  ? 3.720   -6.931  -9.205  1.00 0.00 ? 164 GLN A C    1  
ATOM 1126  O O    . GLN A 1 67  ? 4.412   -6.523  -8.272  1.00 0.00 ? 164 GLN A O    1  
ATOM 1127  C CB   . GLN A 1 67  ? 2.485   -9.059  -8.706  1.00 0.00 ? 164 GLN A CB   1  
ATOM 1128  C CG   . GLN A 1 67  ? 2.709   -9.023  -7.203  1.00 0.00 ? 164 GLN A CG   1  
ATOM 1129  C CD   . GLN A 1 67  ? 1.668   -9.811  -6.440  1.00 0.00 ? 164 GLN A CD   1  
ATOM 1130  O OE1  . GLN A 1 67  ? 0.522   -9.937  -6.871  1.00 0.00 ? 164 GLN A OE1  1  
ATOM 1131  N NE2  . GLN A 1 67  ? 2.063   -10.359 -5.304  1.00 0.00 ? 164 GLN A NE2  1  
ATOM 1132  H H    . GLN A 1 67  ? 4.951   -9.611  -8.400  1.00 0.00 ? 164 GLN A H    1  
ATOM 1133  H HA   . GLN A 1 67  ? 3.417   -8.545  -10.564 1.00 0.00 ? 164 GLN A HA   1  
ATOM 1134  H HB2  . GLN A 1 67  ? 1.565   -8.538  -8.924  1.00 0.00 ? 164 GLN A HB2  1  
ATOM 1135  H HB3  . GLN A 1 67  ? 2.384   -10.091 -9.008  1.00 0.00 ? 164 GLN A HB3  1  
ATOM 1136  H HG2  . GLN A 1 67  ? 3.682   -9.439  -6.988  1.00 0.00 ? 164 GLN A HG2  1  
ATOM 1137  H HG3  . GLN A 1 67  ? 2.677   -7.996  -6.872  1.00 0.00 ? 164 GLN A HG3  1  
ATOM 1138  H HE21 . GLN A 1 67  ? 2.998   -10.232 -5.027  1.00 0.00 ? 164 GLN A HE21 1  
ATOM 1139  H HE22 . GLN A 1 67  ? 1.407   -10.868 -4.782  1.00 0.00 ? 164 GLN A HE22 1  
ATOM 1140  N N    . THR A 1 68  ? 3.029   -6.126  -9.989  1.00 0.00 ? 165 THR A N    1  
ATOM 1141  C CA   . THR A 1 68  ? 3.136   -4.686  -9.875  1.00 0.00 ? 165 THR A CA   1  
ATOM 1142  C C    . THR A 1 68  ? 1.912   -4.083  -9.196  1.00 0.00 ? 165 THR A C    1  
ATOM 1143  O O    . THR A 1 68  ? 1.534   -2.938  -9.459  1.00 0.00 ? 165 THR A O    1  
ATOM 1144  C CB   . THR A 1 68  ? 3.345   -4.056  -11.258 1.00 0.00 ? 165 THR A CB   1  
ATOM 1145  O OG1  . THR A 1 68  ? 2.373   -4.569  -12.182 1.00 0.00 ? 165 THR A OG1  1  
ATOM 1146  C CG2  . THR A 1 68  ? 4.742   -4.358  -11.772 1.00 0.00 ? 165 THR A CG2  1  
ATOM 1147  H H    . THR A 1 68  ? 2.426   -6.509  -10.662 1.00 0.00 ? 165 THR A H    1  
ATOM 1148  H HA   . THR A 1 68  ? 4.007   -4.469  -9.274  1.00 0.00 ? 165 THR A HA   1  
ATOM 1149  H HB   . THR A 1 68  ? 3.229   -2.986  -11.170 1.00 0.00 ? 165 THR A HB   1  
ATOM 1150  H HG1  . THR A 1 68  ? 1.993   -3.839  -12.686 1.00 0.00 ? 165 THR A HG1  1  
ATOM 1151  H HG21 . THR A 1 68  ? 4.838   -4.006  -12.788 1.00 0.00 ? 165 THR A HG21 1  
ATOM 1152  H HG22 . THR A 1 68  ? 4.911   -5.426  -11.743 1.00 0.00 ? 165 THR A HG22 1  
ATOM 1153  H HG23 . THR A 1 68  ? 5.471   -3.862  -11.148 1.00 0.00 ? 165 THR A HG23 1  
ATOM 1154  N N    . GLU A 1 69  ? 1.307   -4.864  -8.314  1.00 0.00 ? 166 GLU A N    1  
ATOM 1155  C CA   . GLU A 1 69  ? 0.179   -4.407  -7.523  1.00 0.00 ? 166 GLU A CA   1  
ATOM 1156  C C    . GLU A 1 69  ? 0.064   -5.251  -6.263  1.00 0.00 ? 166 GLU A C    1  
ATOM 1157  O O    . GLU A 1 69  ? 0.313   -6.458  -6.291  1.00 0.00 ? 166 GLU A O    1  
ATOM 1158  C CB   . GLU A 1 69  ? -1.120  -4.474  -8.329  1.00 0.00 ? 166 GLU A CB   1  
ATOM 1159  C CG   . GLU A 1 69  ? -1.473  -5.870  -8.810  1.00 0.00 ? 166 GLU A CG   1  
ATOM 1160  C CD   . GLU A 1 69  ? -2.803  -5.912  -9.522  1.00 0.00 ? 166 GLU A CD   1  
ATOM 1161  O OE1  . GLU A 1 69  ? -3.843  -5.991  -8.840  1.00 0.00 ? 166 GLU A OE1  1  
ATOM 1162  O OE2  . GLU A 1 69  ? -2.817  -5.858  -10.767 1.00 0.00 ? 166 GLU A OE2  1  
ATOM 1163  H H    . GLU A 1 69  ? 1.637   -5.781  -8.185  1.00 0.00 ? 166 GLU A H    1  
ATOM 1164  H HA   . GLU A 1 69  ? 0.367   -3.382  -7.239  1.00 0.00 ? 166 GLU A HA   1  
ATOM 1165  H HB2  . GLU A 1 69  ? -1.931  -4.115  -7.713  1.00 0.00 ? 166 GLU A HB2  1  
ATOM 1166  H HB3  . GLU A 1 69  ? -1.026  -3.833  -9.193  1.00 0.00 ? 166 GLU A HB3  1  
ATOM 1167  H HG2  . GLU A 1 69  ? -0.707  -6.208  -9.491  1.00 0.00 ? 166 GLU A HG2  1  
ATOM 1168  H HG3  . GLU A 1 69  ? -1.516  -6.532  -7.957  1.00 0.00 ? 166 GLU A HG3  1  
ATOM 1169  N N    . PHE A 1 70  ? -0.296  -4.622  -5.161  1.00 0.00 ? 167 PHE A N    1  
ATOM 1170  C CA   . PHE A 1 70  ? -0.411  -5.324  -3.897  1.00 0.00 ? 167 PHE A CA   1  
ATOM 1171  C C    . PHE A 1 70  ? -1.678  -4.893  -3.168  1.00 0.00 ? 167 PHE A C    1  
ATOM 1172  O O    . PHE A 1 70  ? -2.149  -3.770  -3.347  1.00 0.00 ? 167 PHE A O    1  
ATOM 1173  C CB   . PHE A 1 70  ? 0.824   -5.063  -3.036  1.00 0.00 ? 167 PHE A CB   1  
ATOM 1174  C CG   . PHE A 1 70  ? 0.945   -6.003  -1.876  1.00 0.00 ? 167 PHE A CG   1  
ATOM 1175  C CD1  . PHE A 1 70  ? 1.230   -7.343  -2.084  1.00 0.00 ? 167 PHE A CD1  1  
ATOM 1176  C CD2  . PHE A 1 70  ? 0.763   -5.552  -0.583  1.00 0.00 ? 167 PHE A CD2  1  
ATOM 1177  C CE1  . PHE A 1 70  ? 1.332   -8.216  -1.020  1.00 0.00 ? 167 PHE A CE1  1  
ATOM 1178  C CE2  . PHE A 1 70  ? 0.862   -6.419  0.483   1.00 0.00 ? 167 PHE A CE2  1  
ATOM 1179  C CZ   . PHE A 1 70  ? 1.146   -7.753  0.266   1.00 0.00 ? 167 PHE A CZ   1  
ATOM 1180  H H    . PHE A 1 70  ? -0.494  -3.657  -5.199  1.00 0.00 ? 167 PHE A H    1  
ATOM 1181  H HA   . PHE A 1 70  ? -0.472  -6.380  -4.109  1.00 0.00 ? 167 PHE A HA   1  
ATOM 1182  H HB2  . PHE A 1 70  ? 1.709   -5.171  -3.645  1.00 0.00 ? 167 PHE A HB2  1  
ATOM 1183  H HB3  . PHE A 1 70  ? 0.779   -4.056  -2.648  1.00 0.00 ? 167 PHE A HB3  1  
ATOM 1184  H HD1  . PHE A 1 70  ? 1.376   -7.704  -3.092  1.00 0.00 ? 167 PHE A HD1  1  
ATOM 1185  H HD2  . PHE A 1 70  ? 0.541   -4.510  -0.411  1.00 0.00 ? 167 PHE A HD2  1  
ATOM 1186  H HE1  . PHE A 1 70  ? 1.554   -9.258  -1.194  1.00 0.00 ? 167 PHE A HE1  1  
ATOM 1187  H HE2  . PHE A 1 70  ? 0.722   -6.052  1.489   1.00 0.00 ? 167 PHE A HE2  1  
ATOM 1188  H HZ   . PHE A 1 70  ? 1.223   -8.433  1.101   1.00 0.00 ? 167 PHE A HZ   1  
ATOM 1189  N N    . LYS A 1 71  ? -2.240  -5.791  -2.367  1.00 0.00 ? 168 LYS A N    1  
ATOM 1190  C CA   . LYS A 1 71  ? -3.485  -5.512  -1.661  1.00 0.00 ? 168 LYS A CA   1  
ATOM 1191  C C    . LYS A 1 71  ? -3.299  -5.677  -0.155  1.00 0.00 ? 168 LYS A C    1  
ATOM 1192  O O    . LYS A 1 71  ? -2.662  -6.631  0.302   1.00 0.00 ? 168 LYS A O    1  
ATOM 1193  C CB   . LYS A 1 71  ? -4.617  -6.443  -2.135  1.00 0.00 ? 168 LYS A CB   1  
ATOM 1194  C CG   . LYS A 1 71  ? -4.987  -6.321  -3.613  1.00 0.00 ? 168 LYS A CG   1  
ATOM 1195  C CD   . LYS A 1 71  ? -3.942  -6.956  -4.519  1.00 0.00 ? 168 LYS A CD   1  
ATOM 1196  C CE   . LYS A 1 71  ? -4.418  -7.058  -5.960  1.00 0.00 ? 168 LYS A CE   1  
ATOM 1197  N NZ   . LYS A 1 71  ? -5.479  -8.088  -6.131  1.00 0.00 ? 168 LYS A NZ   1  
ATOM 1198  H H    . LYS A 1 71  ? -1.805  -6.661  -2.241  1.00 0.00 ? 168 LYS A H    1  
ATOM 1199  H HA   . LYS A 1 71  ? -3.761  -4.489  -1.868  1.00 0.00 ? 168 LYS A HA   1  
ATOM 1200  H HB2  . LYS A 1 71  ? -4.321  -7.464  -1.950  1.00 0.00 ? 168 LYS A HB2  1  
ATOM 1201  H HB3  . LYS A 1 71  ? -5.501  -6.229  -1.550  1.00 0.00 ? 168 LYS A HB3  1  
ATOM 1202  H HG2  . LYS A 1 71  ? -5.934  -6.810  -3.778  1.00 0.00 ? 168 LYS A HG2  1  
ATOM 1203  H HG3  . LYS A 1 71  ? -5.075  -5.273  -3.863  1.00 0.00 ? 168 LYS A HG3  1  
ATOM 1204  H HD2  . LYS A 1 71  ? -3.045  -6.355  -4.491  1.00 0.00 ? 168 LYS A HD2  1  
ATOM 1205  H HD3  . LYS A 1 71  ? -3.721  -7.947  -4.152  1.00 0.00 ? 168 LYS A HD3  1  
ATOM 1206  H HE2  . LYS A 1 71  ? -4.810  -6.099  -6.265  1.00 0.00 ? 168 LYS A HE2  1  
ATOM 1207  H HE3  . LYS A 1 71  ? -3.575  -7.315  -6.585  1.00 0.00 ? 168 LYS A HE3  1  
ATOM 1208  H HZ1  . LYS A 1 71  ? -6.325  -7.830  -5.585  1.00 0.00 ? 168 LYS A HZ1  1  
ATOM 1209  H HZ2  . LYS A 1 71  ? -5.138  -9.014  -5.803  1.00 0.00 ? 168 LYS A HZ2  1  
ATOM 1210  H HZ3  . LYS A 1 71  ? -5.743  -8.168  -7.133  1.00 0.00 ? 168 LYS A HZ3  1  
ATOM 1211  N N    . ILE A 1 72  ? -3.846  -4.742  0.610   1.00 0.00 ? 169 ILE A N    1  
ATOM 1212  C CA   . ILE A 1 72  ? -3.825  -4.835  2.066   1.00 0.00 ? 169 ILE A CA   1  
ATOM 1213  C C    . ILE A 1 72  ? -5.231  -5.109  2.584   1.00 0.00 ? 169 ILE A C    1  
ATOM 1214  O O    . ILE A 1 72  ? -6.177  -4.408  2.223   1.00 0.00 ? 169 ILE A O    1  
ATOM 1215  C CB   . ILE A 1 72  ? -3.291  -3.544  2.731   1.00 0.00 ? 169 ILE A CB   1  
ATOM 1216  C CG1  . ILE A 1 72  ? -1.955  -3.122  2.114   1.00 0.00 ? 169 ILE A CG1  1  
ATOM 1217  C CG2  . ILE A 1 72  ? -3.131  -3.750  4.233   1.00 0.00 ? 169 ILE A CG2  1  
ATOM 1218  C CD1  . ILE A 1 72  ? -0.831  -4.107  2.353   1.00 0.00 ? 169 ILE A CD1  1  
ATOM 1219  H H    . ILE A 1 72  ? -4.277  -3.967  0.183   1.00 0.00 ? 169 ILE A H    1  
ATOM 1220  H HA   . ILE A 1 72  ? -3.182  -5.657  2.341   1.00 0.00 ? 169 ILE A HA   1  
ATOM 1221  H HB   . ILE A 1 72  ? -4.016  -2.759  2.575   1.00 0.00 ? 169 ILE A HB   1  
ATOM 1222  H HG12 . ILE A 1 72  ? -2.078  -3.017  1.047   1.00 0.00 ? 169 ILE A HG12 1  
ATOM 1223  H HG13 . ILE A 1 72  ? -1.660  -2.172  2.532   1.00 0.00 ? 169 ILE A HG13 1  
ATOM 1224  H HG21 . ILE A 1 72  ? -4.086  -4.015  4.664   1.00 0.00 ? 169 ILE A HG21 1  
ATOM 1225  H HG22 . ILE A 1 72  ? -2.773  -2.837  4.685   1.00 0.00 ? 169 ILE A HG22 1  
ATOM 1226  H HG23 . ILE A 1 72  ? -2.421  -4.545  4.414   1.00 0.00 ? 169 ILE A HG23 1  
ATOM 1227  H HD11 . ILE A 1 72  ? 0.076   -3.733  1.901   1.00 0.00 ? 169 ILE A HD11 1  
ATOM 1228  H HD12 . ILE A 1 72  ? -1.087  -5.059  1.914   1.00 0.00 ? 169 ILE A HD12 1  
ATOM 1229  H HD13 . ILE A 1 72  ? -0.679  -4.229  3.415   1.00 0.00 ? 169 ILE A HD13 1  
ATOM 1230  N N    . LEU A 1 73  ? -5.362  -6.132  3.418   1.00 0.00 ? 170 LEU A N    1  
ATOM 1231  C CA   . LEU A 1 73  ? -6.659  -6.527  3.956   1.00 0.00 ? 170 LEU A CA   1  
ATOM 1232  C C    . LEU A 1 73  ? -6.843  -6.007  5.376   1.00 0.00 ? 170 LEU A C    1  
ATOM 1233  O O    . LEU A 1 73  ? -7.952  -5.650  5.778   1.00 0.00 ? 170 LEU A O    1  
ATOM 1234  C CB   . LEU A 1 73  ? -6.815  -8.056  3.947   1.00 0.00 ? 170 LEU A CB   1  
ATOM 1235  C CG   . LEU A 1 73  ? -7.096  -8.706  2.583   1.00 0.00 ? 170 LEU A CG   1  
ATOM 1236  C CD1  . LEU A 1 73  ? -8.341  -8.109  1.951   1.00 0.00 ? 170 LEU A CD1  1  
ATOM 1237  C CD2  . LEU A 1 73  ? -5.902  -8.571  1.648   1.00 0.00 ? 170 LEU A CD2  1  
ATOM 1238  H H    . LEU A 1 73  ? -4.564  -6.637  3.682   1.00 0.00 ? 170 LEU A H    1  
ATOM 1239  H HA   . LEU A 1 73  ? -7.421  -6.094  3.328   1.00 0.00 ? 170 LEU A HA   1  
ATOM 1240  H HB2  . LEU A 1 73  ? -5.906  -8.486  4.341   1.00 0.00 ? 170 LEU A HB2  1  
ATOM 1241  H HB3  . LEU A 1 73  ? -7.626  -8.312  4.612   1.00 0.00 ? 170 LEU A HB3  1  
ATOM 1242  H HG   . LEU A 1 73  ? -7.280  -9.761  2.734   1.00 0.00 ? 170 LEU A HG   1  
ATOM 1243  H HD11 . LEU A 1 73  ? -9.184  -8.249  2.612   1.00 0.00 ? 170 LEU A HD11 1  
ATOM 1244  H HD12 . LEU A 1 73  ? -8.537  -8.599  1.010   1.00 0.00 ? 170 LEU A HD12 1  
ATOM 1245  H HD13 . LEU A 1 73  ? -8.188  -7.055  1.782   1.00 0.00 ? 170 LEU A HD13 1  
ATOM 1246  H HD21 . LEU A 1 73  ? -5.680  -7.525  1.497   1.00 0.00 ? 170 LEU A HD21 1  
ATOM 1247  H HD22 . LEU A 1 73  ? -6.134  -9.031  0.698   1.00 0.00 ? 170 LEU A HD22 1  
ATOM 1248  H HD23 . LEU A 1 73  ? -5.045  -9.062  2.085   1.00 0.00 ? 170 LEU A HD23 1  
ATOM 1249  N N    . SER A 1 74  ? -5.753  -5.970  6.130   1.00 0.00 ? 171 SER A N    1  
ATOM 1250  C CA   . SER A 1 74  ? -5.793  -5.532  7.517   1.00 0.00 ? 171 SER A CA   1  
ATOM 1251  C C    . SER A 1 74  ? -5.809  -4.007  7.605   1.00 0.00 ? 171 SER A C    1  
ATOM 1252  O O    . SER A 1 74  ? -4.771  -3.370  7.801   1.00 0.00 ? 171 SER A O    1  
ATOM 1253  C CB   . SER A 1 74  ? -4.586  -6.098  8.263   1.00 0.00 ? 171 SER A CB   1  
ATOM 1254  O OG   . SER A 1 74  ? -4.503  -7.504  8.087   1.00 0.00 ? 171 SER A OG   1  
ATOM 1255  H H    . SER A 1 74  ? -4.895  -6.245  5.742   1.00 0.00 ? 171 SER A H    1  
ATOM 1256  H HA   . SER A 1 74  ? -6.697  -5.917  7.963   1.00 0.00 ? 171 SER A HA   1  
ATOM 1257  H HB2  . SER A 1 74  ? -3.684  -5.643  7.882   1.00 0.00 ? 171 SER A HB2  1  
ATOM 1258  H HB3  . SER A 1 74  ? -4.682  -5.883  9.317   1.00 0.00 ? 171 SER A HB3  1  
ATOM 1259  H HG   . SER A 1 74  ? -5.386  -7.856  7.923   1.00 0.00 ? 171 SER A HG   1  
ATOM 1260  N N    . LEU A 1 75  ? -6.993  -3.428  7.459   1.00 0.00 ? 172 LEU A N    1  
ATOM 1261  C CA   . LEU A 1 75  ? -7.140  -1.981  7.436   1.00 0.00 ? 172 LEU A CA   1  
ATOM 1262  C C    . LEU A 1 75  ? -8.154  -1.502  8.466   1.00 0.00 ? 172 LEU A C    1  
ATOM 1263  O O    . LEU A 1 75  ? -9.131  -2.192  8.771   1.00 0.00 ? 172 LEU A O    1  
ATOM 1264  C CB   . LEU A 1 75  ? -7.571  -1.520  6.045   1.00 0.00 ? 172 LEU A CB   1  
ATOM 1265  C CG   . LEU A 1 75  ? -6.586  -1.837  4.922   1.00 0.00 ? 172 LEU A CG   1  
ATOM 1266  C CD1  . LEU A 1 75  ? -7.224  -1.571  3.575   1.00 0.00 ? 172 LEU A CD1  1  
ATOM 1267  C CD2  . LEU A 1 75  ? -5.319  -1.012  5.075   1.00 0.00 ? 172 LEU A CD2  1  
ATOM 1268  H H    . LEU A 1 75  ? -7.790  -3.993  7.364   1.00 0.00 ? 172 LEU A H    1  
ATOM 1269  H HA   . LEU A 1 75  ? -6.179  -1.547  7.665   1.00 0.00 ? 172 LEU A HA   1  
ATOM 1270  H HB2  . LEU A 1 75  ? -8.517  -1.987  5.811   1.00 0.00 ? 172 LEU A HB2  1  
ATOM 1271  H HB3  . LEU A 1 75  ? -7.715  -0.450  6.074   1.00 0.00 ? 172 LEU A HB3  1  
ATOM 1272  H HG   . LEU A 1 75  ? -6.316  -2.882  4.968   1.00 0.00 ? 172 LEU A HG   1  
ATOM 1273  H HD11 . LEU A 1 75  ? -6.577  -1.940  2.794   1.00 0.00 ? 172 LEU A HD11 1  
ATOM 1274  H HD12 . LEU A 1 75  ? -7.372  -0.509  3.450   1.00 0.00 ? 172 LEU A HD12 1  
ATOM 1275  H HD13 . LEU A 1 75  ? -8.176  -2.076  3.521   1.00 0.00 ? 172 LEU A HD13 1  
ATOM 1276  H HD21 . LEU A 1 75  ? -4.846  -1.248  6.016   1.00 0.00 ? 172 LEU A HD21 1  
ATOM 1277  H HD22 . LEU A 1 75  ? -5.568  0.039   5.050   1.00 0.00 ? 172 LEU A HD22 1  
ATOM 1278  H HD23 . LEU A 1 75  ? -4.642  -1.241  4.265   1.00 0.00 ? 172 LEU A HD23 1  
ATOM 1279  N N    . HIS A 1 76  ? -7.908  -0.316  8.997   1.00 0.00 ? 173 HIS A N    1  
ATOM 1280  C CA   . HIS A 1 76  ? -8.810  0.318   9.946   1.00 0.00 ? 173 HIS A CA   1  
ATOM 1281  C C    . HIS A 1 76  ? -9.575  1.449   9.267   1.00 0.00 ? 173 HIS A C    1  
ATOM 1282  O O    . HIS A 1 76  ? -8.970  2.397   8.770   1.00 0.00 ? 173 HIS A O    1  
ATOM 1283  C CB   . HIS A 1 76  ? -8.030  0.871   11.144  1.00 0.00 ? 173 HIS A CB   1  
ATOM 1284  C CG   . HIS A 1 76  ? -7.416  -0.183  12.017  1.00 0.00 ? 173 HIS A CG   1  
ATOM 1285  N ND1  . HIS A 1 76  ? -7.988  -0.609  13.195  1.00 0.00 ? 173 HIS A ND1  1  
ATOM 1286  C CD2  . HIS A 1 76  ? -6.269  -0.891  11.884  1.00 0.00 ? 173 HIS A CD2  1  
ATOM 1287  C CE1  . HIS A 1 76  ? -7.222  -1.529  13.748  1.00 0.00 ? 173 HIS A CE1  1  
ATOM 1288  N NE2  . HIS A 1 76  ? -6.174  -1.720  12.973  1.00 0.00 ? 173 HIS A NE2  1  
ATOM 1289  H H    . HIS A 1 76  ? -7.081  0.155   8.741   1.00 0.00 ? 173 HIS A H    1  
ATOM 1290  H HA   . HIS A 1 76  ? -9.510  -0.426  10.292  1.00 0.00 ? 173 HIS A HA   1  
ATOM 1291  H HB2  . HIS A 1 76  ? -7.233  1.504   10.781  1.00 0.00 ? 173 HIS A HB2  1  
ATOM 1292  H HB3  . HIS A 1 76  ? -8.698  1.462   11.754  1.00 0.00 ? 173 HIS A HB3  1  
ATOM 1293  H HD1  . HIS A 1 76  ? -8.836  -0.283  13.572  1.00 0.00 ? 173 HIS A HD1  1  
ATOM 1294  H HD2  . HIS A 1 76  ? -5.561  -0.816  11.071  1.00 0.00 ? 173 HIS A HD2  1  
ATOM 1295  H HE1  . HIS A 1 76  ? -7.421  -2.041  14.679  1.00 0.00 ? 173 HIS A HE1  1  
ATOM 1296  H HE2  . HIS A 1 76  ? -5.399  -2.282  13.197  1.00 0.00 ? 173 HIS A HE2  1  
ATOM 1297  N N    . PRO A 1 77  ? -10.913 1.352   9.220   1.00 0.00 ? 174 PRO A N    1  
ATOM 1298  C CA   . PRO A 1 77  ? -11.765 2.381   8.613   1.00 0.00 ? 174 PRO A CA   1  
ATOM 1299  C C    . PRO A 1 77  ? -11.603 3.745   9.277   1.00 0.00 ? 174 PRO A C    1  
ATOM 1300  O O    . PRO A 1 77  ? -11.730 3.872   10.496  1.00 0.00 ? 174 PRO A O    1  
ATOM 1301  C CB   . PRO A 1 77  ? -13.189 1.857   8.836   1.00 0.00 ? 174 PRO A CB   1  
ATOM 1302  C CG   . PRO A 1 77  ? -13.032 0.395   9.067   1.00 0.00 ? 174 PRO A CG   1  
ATOM 1303  C CD   . PRO A 1 77  ? -11.703 0.225   9.743   1.00 0.00 ? 174 PRO A CD   1  
ATOM 1304  H HA   . PRO A 1 77  ? -11.575 2.477   7.554   1.00 0.00 ? 174 PRO A HA   1  
ATOM 1305  H HB2  . PRO A 1 77  ? -13.623 2.348   9.696   1.00 0.00 ? 174 PRO A HB2  1  
ATOM 1306  H HB3  . PRO A 1 77  ? -13.790 2.056   7.962   1.00 0.00 ? 174 PRO A HB3  1  
ATOM 1307  H HG2  . PRO A 1 77  ? -13.826 0.035   9.704   1.00 0.00 ? 174 PRO A HG2  1  
ATOM 1308  H HG3  . PRO A 1 77  ? -13.040 -0.129  8.124   1.00 0.00 ? 174 PRO A HG3  1  
ATOM 1309  H HD2  . PRO A 1 77  ? -11.812 0.294   10.815  1.00 0.00 ? 174 PRO A HD2  1  
ATOM 1310  H HD3  . PRO A 1 77  ? -11.258 -0.719  9.466   1.00 0.00 ? 174 PRO A HD3  1  
ATOM 1311  N N    . GLY A 1 78  ? -11.314 4.755   8.469   1.00 0.00 ? 175 GLY A N    1  
ATOM 1312  C CA   . GLY A 1 78  ? -11.202 6.107   8.975   1.00 0.00 ? 175 GLY A CA   1  
ATOM 1313  C C    . GLY A 1 78  ? -9.862  6.377   9.622   1.00 0.00 ? 175 GLY A C    1  
ATOM 1314  O O    . GLY A 1 78  ? -9.798  6.969   10.698  1.00 0.00 ? 175 GLY A O    1  
ATOM 1315  H H    . GLY A 1 78  ? -11.170 4.581   7.514   1.00 0.00 ? 175 GLY A H    1  
ATOM 1316  H HA2  . GLY A 1 78  ? -11.339 6.797   8.157   1.00 0.00 ? 175 GLY A HA2  1  
ATOM 1317  H HA3  . GLY A 1 78  ? -11.981 6.272   9.705   1.00 0.00 ? 175 GLY A HA3  1  
ATOM 1318  N N    . GLN A 1 79  ? -8.786  5.960   8.973   1.00 0.00 ? 176 GLN A N    1  
ATOM 1319  C CA   . GLN A 1 79  ? -7.459  6.118   9.548   1.00 0.00 ? 176 GLN A CA   1  
ATOM 1320  C C    . GLN A 1 79  ? -6.412  6.357   8.461   1.00 0.00 ? 176 GLN A C    1  
ATOM 1321  O O    . GLN A 1 79  ? -6.552  5.885   7.331   1.00 0.00 ? 176 GLN A O    1  
ATOM 1322  C CB   . GLN A 1 79  ? -7.120  4.877   10.373  1.00 0.00 ? 176 GLN A CB   1  
ATOM 1323  C CG   . GLN A 1 79  ? -5.907  5.042   11.270  1.00 0.00 ? 176 GLN A CG   1  
ATOM 1324  C CD   . GLN A 1 79  ? -5.825  3.982   12.354  1.00 0.00 ? 176 GLN A CD   1  
ATOM 1325  O OE1  . GLN A 1 79  ? -4.736  3.602   12.787  1.00 0.00 ? 176 GLN A OE1  1  
ATOM 1326  N NE2  . GLN A 1 79  ? -6.975  3.509   12.812  1.00 0.00 ? 176 GLN A NE2  1  
ATOM 1327  H H    . GLN A 1 79  ? -8.885  5.540   8.090   1.00 0.00 ? 176 GLN A H    1  
ATOM 1328  H HA   . GLN A 1 79  ? -7.483  6.977   10.201  1.00 0.00 ? 176 GLN A HA   1  
ATOM 1329  H HB2  . GLN A 1 79  ? -7.968  4.634   10.992  1.00 0.00 ? 176 GLN A HB2  1  
ATOM 1330  H HB3  . GLN A 1 79  ? -6.933  4.056   9.699   1.00 0.00 ? 176 GLN A HB3  1  
ATOM 1331  H HG2  . GLN A 1 79  ? -5.017  4.979   10.662  1.00 0.00 ? 176 GLN A HG2  1  
ATOM 1332  H HG3  . GLN A 1 79  ? -5.952  6.014   11.740  1.00 0.00 ? 176 GLN A HG3  1  
ATOM 1333  H HE21 . GLN A 1 79  ? -7.808  3.864   12.435  1.00 0.00 ? 176 GLN A HE21 1  
ATOM 1334  H HE22 . GLN A 1 79  ? -6.948  2.823   13.514  1.00 0.00 ? 176 GLN A HE22 1  
ATOM 1335  N N    . LYS A 1 80  ? -5.375  7.112   8.811   1.00 0.00 ? 177 LYS A N    1  
ATOM 1336  C CA   . LYS A 1 80  ? -4.301  7.442   7.883   1.00 0.00 ? 177 LYS A CA   1  
ATOM 1337  C C    . LYS A 1 80  ? -3.303  6.297   7.776   1.00 0.00 ? 177 LYS A C    1  
ATOM 1338  O O    . LYS A 1 80  ? -2.892  5.728   8.787   1.00 0.00 ? 177 LYS A O    1  
ATOM 1339  C CB   . LYS A 1 80  ? -3.582  8.706   8.354   1.00 0.00 ? 177 LYS A CB   1  
ATOM 1340  C CG   . LYS A 1 80  ? -2.367  9.072   7.518   1.00 0.00 ? 177 LYS A CG   1  
ATOM 1341  C CD   . LYS A 1 80  ? -1.565  10.192  8.159   1.00 0.00 ? 177 LYS A CD   1  
ATOM 1342  C CE   . LYS A 1 80  ? -2.064  11.579  7.763   1.00 0.00 ? 177 LYS A CE   1  
ATOM 1343  N NZ   . LYS A 1 80  ? -3.454  11.843  8.217   1.00 0.00 ? 177 LYS A NZ   1  
ATOM 1344  H H    . LYS A 1 80  ? -5.325  7.457   9.731   1.00 0.00 ? 177 LYS A H    1  
ATOM 1345  H HA   . LYS A 1 80  ? -4.734  7.626   6.914   1.00 0.00 ? 177 LYS A HA   1  
ATOM 1346  H HB2  . LYS A 1 80  ? -4.276  9.532   8.321   1.00 0.00 ? 177 LYS A HB2  1  
ATOM 1347  H HB3  . LYS A 1 80  ? -3.260  8.561   9.375   1.00 0.00 ? 177 LYS A HB3  1  
ATOM 1348  H HG2  . LYS A 1 80  ? -1.735  8.202   7.419   1.00 0.00 ? 177 LYS A HG2  1  
ATOM 1349  H HG3  . LYS A 1 80  ? -2.698  9.391   6.540   1.00 0.00 ? 177 LYS A HG3  1  
ATOM 1350  H HD2  . LYS A 1 80  ? -1.642  10.093  9.230   1.00 0.00 ? 177 LYS A HD2  1  
ATOM 1351  H HD3  . LYS A 1 80  ? -0.532  10.093  7.862   1.00 0.00 ? 177 LYS A HD3  1  
ATOM 1352  H HE2  . LYS A 1 80  ? -1.410  12.318  8.200   1.00 0.00 ? 177 LYS A HE2  1  
ATOM 1353  H HE3  . LYS A 1 80  ? -2.026  11.662  6.686   1.00 0.00 ? 177 LYS A HE3  1  
ATOM 1354  H HZ1  . LYS A 1 80  ? -3.543  11.662  9.236   1.00 0.00 ? 177 LYS A HZ1  1  
ATOM 1355  H HZ2  . LYS A 1 80  ? -4.122  11.228  7.706   1.00 0.00 ? 177 LYS A HZ2  1  
ATOM 1356  H HZ3  . LYS A 1 80  ? -3.709  12.834  8.032   1.00 0.00 ? 177 LYS A HZ3  1  
ATOM 1357  N N    . TYR A 1 81  ? -2.924  5.963   6.552   1.00 0.00 ? 178 TYR A N    1  
ATOM 1358  C CA   . TYR A 1 81  ? -1.915  4.944   6.311   1.00 0.00 ? 178 TYR A CA   1  
ATOM 1359  C C    . TYR A 1 81  ? -0.770  5.509   5.484   1.00 0.00 ? 178 TYR A C    1  
ATOM 1360  O O    . TYR A 1 81  ? -0.979  6.337   4.593   1.00 0.00 ? 178 TYR A O    1  
ATOM 1361  C CB   . TYR A 1 81  ? -2.521  3.730   5.601   1.00 0.00 ? 178 TYR A CB   1  
ATOM 1362  C CG   . TYR A 1 81  ? -3.243  2.778   6.523   1.00 0.00 ? 178 TYR A CG   1  
ATOM 1363  C CD1  . TYR A 1 81  ? -4.395  3.161   7.196   1.00 0.00 ? 178 TYR A CD1  1  
ATOM 1364  C CD2  . TYR A 1 81  ? -2.769  1.488   6.716   1.00 0.00 ? 178 TYR A CD2  1  
ATOM 1365  C CE1  . TYR A 1 81  ? -5.053  2.286   8.037   1.00 0.00 ? 178 TYR A CE1  1  
ATOM 1366  C CE2  . TYR A 1 81  ? -3.422  0.608   7.553   1.00 0.00 ? 178 TYR A CE2  1  
ATOM 1367  C CZ   . TYR A 1 81  ? -4.562  1.012   8.212   1.00 0.00 ? 178 TYR A CZ   1  
ATOM 1368  O OH   . TYR A 1 81  ? -5.215  0.139   9.046   1.00 0.00 ? 178 TYR A OH   1  
ATOM 1369  H H    . TYR A 1 81  ? -3.338  6.414   5.780   1.00 0.00 ? 178 TYR A H    1  
ATOM 1370  H HA   . TYR A 1 81  ? -1.528  4.631   7.269   1.00 0.00 ? 178 TYR A HA   1  
ATOM 1371  H HB2  . TYR A 1 81  ? -3.227  4.071   4.860   1.00 0.00 ? 178 TYR A HB2  1  
ATOM 1372  H HB3  . TYR A 1 81  ? -1.731  3.180   5.109   1.00 0.00 ? 178 TYR A HB3  1  
ATOM 1373  H HD1  . TYR A 1 81  ? -4.777  4.161   7.057   1.00 0.00 ? 178 TYR A HD1  1  
ATOM 1374  H HD2  . TYR A 1 81  ? -1.875  1.175   6.198   1.00 0.00 ? 178 TYR A HD2  1  
ATOM 1375  H HE1  . TYR A 1 81  ? -5.947  2.602   8.552   1.00 0.00 ? 178 TYR A HE1  1  
ATOM 1376  H HE2  . TYR A 1 81  ? -3.037  -0.392  7.691   1.00 0.00 ? 178 TYR A HE2  1  
ATOM 1377  H HH   . TYR A 1 81  ? -4.563  -0.415  9.497   1.00 0.00 ? 178 TYR A HH   1  
ATOM 1378  N N    . LEU A 1 82  ? 0.439   5.078   5.801   1.00 0.00 ? 179 LEU A N    1  
ATOM 1379  C CA   . LEU A 1 82  ? 1.615   5.463   5.036   1.00 0.00 ? 179 LEU A CA   1  
ATOM 1380  C C    . LEU A 1 82  ? 2.079   4.276   4.214   1.00 0.00 ? 179 LEU A C    1  
ATOM 1381  O O    . LEU A 1 82  ? 2.183   3.168   4.738   1.00 0.00 ? 179 LEU A O    1  
ATOM 1382  C CB   . LEU A 1 82  ? 2.757   5.920   5.952   1.00 0.00 ? 179 LEU A CB   1  
ATOM 1383  C CG   . LEU A 1 82  ? 2.452   7.089   6.894   1.00 0.00 ? 179 LEU A CG   1  
ATOM 1384  C CD1  . LEU A 1 82  ? 1.682   8.177   6.172   1.00 0.00 ? 179 LEU A CD1  1  
ATOM 1385  C CD2  . LEU A 1 82  ? 1.701   6.615   8.129   1.00 0.00 ? 179 LEU A CD2  1  
ATOM 1386  H H    . LEU A 1 82  ? 0.546   4.478   6.572   1.00 0.00 ? 179 LEU A H    1  
ATOM 1387  H HA   . LEU A 1 82  ? 1.340   6.271   4.372   1.00 0.00 ? 179 LEU A HA   1  
ATOM 1388  H HB2  . LEU A 1 82  ? 3.058   5.075   6.555   1.00 0.00 ? 179 LEU A HB2  1  
ATOM 1389  H HB3  . LEU A 1 82  ? 3.591   6.204   5.328   1.00 0.00 ? 179 LEU A HB3  1  
ATOM 1390  H HG   . LEU A 1 82  ? 3.387   7.517   7.222   1.00 0.00 ? 179 LEU A HG   1  
ATOM 1391  H HD11 . LEU A 1 82  ? 2.255   8.519   5.322   1.00 0.00 ? 179 LEU A HD11 1  
ATOM 1392  H HD12 . LEU A 1 82  ? 1.510   9.004   6.845   1.00 0.00 ? 179 LEU A HD12 1  
ATOM 1393  H HD13 . LEU A 1 82  ? 0.734   7.785   5.834   1.00 0.00 ? 179 LEU A HD13 1  
ATOM 1394  H HD21 . LEU A 1 82  ? 2.316   5.917   8.678   1.00 0.00 ? 179 LEU A HD21 1  
ATOM 1395  H HD22 . LEU A 1 82  ? 0.784   6.129   7.829   1.00 0.00 ? 179 LEU A HD22 1  
ATOM 1396  H HD23 . LEU A 1 82  ? 1.469   7.462   8.757   1.00 0.00 ? 179 LEU A HD23 1  
ATOM 1397  N N    . VAL A 1 83  ? 2.351   4.496   2.938   1.00 0.00 ? 180 VAL A N    1  
ATOM 1398  C CA   . VAL A 1 83  ? 2.744   3.405   2.051   1.00 0.00 ? 180 VAL A CA   1  
ATOM 1399  C C    . VAL A 1 83  ? 3.975   3.768   1.230   1.00 0.00 ? 180 VAL A C    1  
ATOM 1400  O O    . VAL A 1 83  ? 4.140   4.914   0.804   1.00 0.00 ? 180 VAL A O    1  
ATOM 1401  C CB   . VAL A 1 83  ? 1.601   2.990   1.092   1.00 0.00 ? 180 VAL A CB   1  
ATOM 1402  C CG1  . VAL A 1 83  ? 0.415   2.435   1.863   1.00 0.00 ? 180 VAL A CG1  1  
ATOM 1403  C CG2  . VAL A 1 83  ? 1.164   4.156   0.224   1.00 0.00 ? 180 VAL A CG2  1  
ATOM 1404  H H    . VAL A 1 83  ? 2.299   5.414   2.585   1.00 0.00 ? 180 VAL A H    1  
ATOM 1405  H HA   . VAL A 1 83  ? 2.986   2.553   2.669   1.00 0.00 ? 180 VAL A HA   1  
ATOM 1406  H HB   . VAL A 1 83  ? 1.972   2.209   0.443   1.00 0.00 ? 180 VAL A HB   1  
ATOM 1407  H HG11 . VAL A 1 83  ? 0.718   1.546   2.395   1.00 0.00 ? 180 VAL A HG11 1  
ATOM 1408  H HG12 . VAL A 1 83  ? -0.379  2.189   1.173   1.00 0.00 ? 180 VAL A HG12 1  
ATOM 1409  H HG13 . VAL A 1 83  ? 0.065   3.175   2.566   1.00 0.00 ? 180 VAL A HG13 1  
ATOM 1410  H HG21 . VAL A 1 83  ? 0.862   4.981   0.852   1.00 0.00 ? 180 VAL A HG21 1  
ATOM 1411  H HG22 . VAL A 1 83  ? 0.333   3.851   -0.395  1.00 0.00 ? 180 VAL A HG22 1  
ATOM 1412  H HG23 . VAL A 1 83  ? 1.986   4.462   -0.405  1.00 0.00 ? 180 VAL A HG23 1  
ATOM 1413  N N    . GLN A 1 84  ? 4.844   2.785   1.035   1.00 0.00 ? 181 GLN A N    1  
ATOM 1414  C CA   . GLN A 1 84  ? 6.021   2.947   0.191   1.00 0.00 ? 181 GLN A CA   1  
ATOM 1415  C C    . GLN A 1 84  ? 6.315   1.661   -0.567  1.00 0.00 ? 181 GLN A C    1  
ATOM 1416  O O    . GLN A 1 84  ? 6.207   0.570   -0.010  1.00 0.00 ? 181 GLN A O    1  
ATOM 1417  C CB   . GLN A 1 84  ? 7.260   3.319   1.008   1.00 0.00 ? 181 GLN A CB   1  
ATOM 1418  C CG   . GLN A 1 84  ? 7.204   4.684   1.662   1.00 0.00 ? 181 GLN A CG   1  
ATOM 1419  C CD   . GLN A 1 84  ? 8.587   5.248   1.914   1.00 0.00 ? 181 GLN A CD   1  
ATOM 1420  O OE1  . GLN A 1 84  ? 9.520   4.974   1.165   1.00 0.00 ? 181 GLN A OE1  1  
ATOM 1421  N NE2  . GLN A 1 84  ? 8.733   6.034   2.966   1.00 0.00 ? 181 GLN A NE2  1  
ATOM 1422  H H    . GLN A 1 84  ? 4.688   1.918   1.474   1.00 0.00 ? 181 GLN A H    1  
ATOM 1423  H HA   . GLN A 1 84  ? 5.817   3.734   -0.519  1.00 0.00 ? 181 GLN A HA   1  
ATOM 1424  H HB2  . GLN A 1 84  ? 7.394   2.582   1.785   1.00 0.00 ? 181 GLN A HB2  1  
ATOM 1425  H HB3  . GLN A 1 84  ? 8.121   3.294   0.355   1.00 0.00 ? 181 GLN A HB3  1  
ATOM 1426  H HG2  . GLN A 1 84  ? 6.669   5.358   1.011   1.00 0.00 ? 181 GLN A HG2  1  
ATOM 1427  H HG3  . GLN A 1 84  ? 6.684   4.601   2.605   1.00 0.00 ? 181 GLN A HG3  1  
ATOM 1428  H HE21 . GLN A 1 84  ? 7.947   6.213   3.529   1.00 0.00 ? 181 GLN A HE21 1  
ATOM 1429  H HE22 . GLN A 1 84  ? 9.623   6.420   3.136   1.00 0.00 ? 181 GLN A HE22 1  
ATOM 1430  N N    . VAL A 1 85  ? 6.690   1.799   -1.829  1.00 0.00 ? 182 VAL A N    1  
ATOM 1431  C CA   . VAL A 1 85  ? 7.123   0.667   -2.634  1.00 0.00 ? 182 VAL A CA   1  
ATOM 1432  C C    . VAL A 1 85  ? 8.405   1.030   -3.373  1.00 0.00 ? 182 VAL A C    1  
ATOM 1433  O O    . VAL A 1 85  ? 8.554   2.156   -3.850  1.00 0.00 ? 182 VAL A O    1  
ATOM 1434  C CB   . VAL A 1 85  ? 6.036   0.225   -3.649  1.00 0.00 ? 182 VAL A CB   1  
ATOM 1435  C CG1  . VAL A 1 85  ? 5.659   1.363   -4.587  1.00 0.00 ? 182 VAL A CG1  1  
ATOM 1436  C CG2  . VAL A 1 85  ? 6.498   -0.990  -4.445  1.00 0.00 ? 182 VAL A CG2  1  
ATOM 1437  H H    . VAL A 1 85  ? 6.683   2.691   -2.235  1.00 0.00 ? 182 VAL A H    1  
ATOM 1438  H HA   . VAL A 1 85  ? 7.327   -0.160  -1.966  1.00 0.00 ? 182 VAL A HA   1  
ATOM 1439  H HB   . VAL A 1 85  ? 5.151   -0.055  -3.094  1.00 0.00 ? 182 VAL A HB   1  
ATOM 1440  H HG11 . VAL A 1 85  ? 4.895   1.027   -5.274  1.00 0.00 ? 182 VAL A HG11 1  
ATOM 1441  H HG12 . VAL A 1 85  ? 6.531   1.673   -5.144  1.00 0.00 ? 182 VAL A HG12 1  
ATOM 1442  H HG13 . VAL A 1 85  ? 5.285   2.195   -4.012  1.00 0.00 ? 182 VAL A HG13 1  
ATOM 1443  H HG21 . VAL A 1 85  ? 7.388   -0.737  -5.002  1.00 0.00 ? 182 VAL A HG21 1  
ATOM 1444  H HG22 . VAL A 1 85  ? 5.718   -1.289  -5.130  1.00 0.00 ? 182 VAL A HG22 1  
ATOM 1445  H HG23 . VAL A 1 85  ? 6.716   -1.803  -3.769  1.00 0.00 ? 182 VAL A HG23 1  
ATOM 1446  N N    . ARG A 1 86  ? 9.347   0.102   -3.442  1.00 0.00 ? 183 ARG A N    1  
ATOM 1447  C CA   . ARG A 1 86  ? 10.578  0.354   -4.169  1.00 0.00 ? 183 ARG A CA   1  
ATOM 1448  C C    . ARG A 1 86  ? 11.099  -0.926  -4.811  1.00 0.00 ? 183 ARG A C    1  
ATOM 1449  O O    . ARG A 1 86  ? 10.908  -2.024  -4.283  1.00 0.00 ? 183 ARG A O    1  
ATOM 1450  C CB   . ARG A 1 86  ? 11.640  0.957   -3.246  1.00 0.00 ? 183 ARG A CB   1  
ATOM 1451  C CG   . ARG A 1 86  ? 12.637  1.833   -3.987  1.00 0.00 ? 183 ARG A CG   1  
ATOM 1452  C CD   . ARG A 1 86  ? 13.732  2.358   -3.075  1.00 0.00 ? 183 ARG A CD   1  
ATOM 1453  N NE   . ARG A 1 86  ? 14.572  3.346   -3.754  1.00 0.00 ? 183 ARG A NE   1  
ATOM 1454  C CZ   . ARG A 1 86  ? 15.471  3.051   -4.697  1.00 0.00 ? 183 ARG A CZ   1  
ATOM 1455  N NH1  . ARG A 1 86  ? 15.618  1.802   -5.127  1.00 0.00 ? 183 ARG A NH1  1  
ATOM 1456  N NH2  . ARG A 1 86  ? 16.210  4.012   -5.230  1.00 0.00 ? 183 ARG A NH2  1  
ATOM 1457  H H    . ARG A 1 86  ? 9.214   -0.761  -2.991  1.00 0.00 ? 183 ARG A H    1  
ATOM 1458  H HA   . ARG A 1 86  ? 10.355  1.064   -4.952  1.00 0.00 ? 183 ARG A HA   1  
ATOM 1459  H HB2  . ARG A 1 86  ? 11.150  1.558   -2.493  1.00 0.00 ? 183 ARG A HB2  1  
ATOM 1460  H HB3  . ARG A 1 86  ? 12.181  0.157   -2.763  1.00 0.00 ? 183 ARG A HB3  1  
ATOM 1461  H HG2  . ARG A 1 86  ? 13.094  1.253   -4.772  1.00 0.00 ? 183 ARG A HG2  1  
ATOM 1462  H HG3  . ARG A 1 86  ? 12.111  2.672   -4.418  1.00 0.00 ? 183 ARG A HG3  1  
ATOM 1463  H HD2  . ARG A 1 86  ? 13.275  2.820   -2.211  1.00 0.00 ? 183 ARG A HD2  1  
ATOM 1464  H HD3  . ARG A 1 86  ? 14.349  1.530   -2.757  1.00 0.00 ? 183 ARG A HD3  1  
ATOM 1465  H HE   . ARG A 1 86  ? 14.464  4.288   -3.481  1.00 0.00 ? 183 ARG A HE   1  
ATOM 1466  H HH11 . ARG A 1 86  ? 15.054  1.066   -4.749  1.00 0.00 ? 183 ARG A HH11 1  
ATOM 1467  H HH12 . ARG A 1 86  ? 16.299  1.589   -5.834  1.00 0.00 ? 183 ARG A HH12 1  
ATOM 1468  H HH21 . ARG A 1 86  ? 16.097  4.965   -4.930  1.00 0.00 ? 183 ARG A HH21 1  
ATOM 1469  H HH22 . ARG A 1 86  ? 16.889  3.791   -5.936  1.00 0.00 ? 183 ARG A HH22 1  
ATOM 1470  N N    . CYS A 1 87  ? 11.732  -0.771  -5.965  1.00 0.00 ? 184 CYS A N    1  
ATOM 1471  C CA   . CYS A 1 87  ? 12.305  -1.889  -6.693  1.00 0.00 ? 184 CYS A CA   1  
ATOM 1472  C C    . CYS A 1 87  ? 13.828  -1.831  -6.640  1.00 0.00 ? 184 CYS A C    1  
ATOM 1473  O O    . CYS A 1 87  ? 14.398  -0.819  -6.224  1.00 0.00 ? 184 CYS A O    1  
ATOM 1474  C CB   . CYS A 1 87  ? 11.827  -1.853  -8.139  1.00 0.00 ? 184 CYS A CB   1  
ATOM 1475  S SG   . CYS A 1 87  ? 12.176  -0.297  -8.992  1.00 0.00 ? 184 CYS A SG   1  
ATOM 1476  H H    . CYS A 1 87  ? 11.819  0.127   -6.344  1.00 0.00 ? 184 CYS A H    1  
ATOM 1477  H HA   . CYS A 1 87  ? 11.968  -2.803  -6.229  1.00 0.00 ? 184 CYS A HA   1  
ATOM 1478  H HB2  . CYS A 1 87  ? 12.313  -2.643  -8.689  1.00 0.00 ? 184 CYS A HB2  1  
ATOM 1479  H HB3  . CYS A 1 87  ? 10.759  -2.009  -8.162  1.00 0.00 ? 184 CYS A HB3  1  
ATOM 1480  H HG   . CYS A 1 87  ? 13.416  -0.354  -9.457  1.00 0.00 ? 184 CYS A HG   1  
ATOM 1481  N N    . LYS A 1 88  ? 14.484  -2.902  -7.075  1.00 0.00 ? 185 LYS A N    1  
ATOM 1482  C CA   . LYS A 1 88  ? 15.940  -2.978  -7.018  1.00 0.00 ? 185 LYS A CA   1  
ATOM 1483  C C    . LYS A 1 88  ? 16.541  -3.278  -8.395  1.00 0.00 ? 185 LYS A C    1  
ATOM 1484  O O    . LYS A 1 88  ? 16.686  -4.436  -8.791  1.00 0.00 ? 185 LYS A O    1  
ATOM 1485  C CB   . LYS A 1 88  ? 16.379  -4.028  -5.990  1.00 0.00 ? 185 LYS A CB   1  
ATOM 1486  C CG   . LYS A 1 88  ? 15.754  -5.399  -6.197  1.00 0.00 ? 185 LYS A CG   1  
ATOM 1487  C CD   . LYS A 1 88  ? 16.155  -6.369  -5.100  1.00 0.00 ? 185 LYS A CD   1  
ATOM 1488  C CE   . LYS A 1 88  ? 15.476  -6.040  -3.779  1.00 0.00 ? 185 LYS A CE   1  
ATOM 1489  N NZ   . LYS A 1 88  ? 15.844  -7.003  -2.711  1.00 0.00 ? 185 LYS A NZ   1  
ATOM 1490  H H    . LYS A 1 88  ? 13.980  -3.657  -7.450  1.00 0.00 ? 185 LYS A H    1  
ATOM 1491  H HA   . LYS A 1 88  ? 16.299  -2.011  -6.696  1.00 0.00 ? 185 LYS A HA   1  
ATOM 1492  H HB2  . LYS A 1 88  ? 17.452  -4.137  -6.040  1.00 0.00 ? 185 LYS A HB2  1  
ATOM 1493  H HB3  . LYS A 1 88  ? 16.109  -3.680  -5.004  1.00 0.00 ? 185 LYS A HB3  1  
ATOM 1494  H HG2  . LYS A 1 88  ? 14.680  -5.297  -6.198  1.00 0.00 ? 185 LYS A HG2  1  
ATOM 1495  H HG3  . LYS A 1 88  ? 16.081  -5.791  -7.149  1.00 0.00 ? 185 LYS A HG3  1  
ATOM 1496  H HD2  . LYS A 1 88  ? 15.876  -7.368  -5.397  1.00 0.00 ? 185 LYS A HD2  1  
ATOM 1497  H HD3  . LYS A 1 88  ? 17.226  -6.316  -4.966  1.00 0.00 ? 185 LYS A HD3  1  
ATOM 1498  H HE2  . LYS A 1 88  ? 15.771  -5.048  -3.472  1.00 0.00 ? 185 LYS A HE2  1  
ATOM 1499  H HE3  . LYS A 1 88  ? 14.407  -6.068  -3.922  1.00 0.00 ? 185 LYS A HE3  1  
ATOM 1500  H HZ1  . LYS A 1 88  ? 15.643  -7.974  -3.020  1.00 0.00 ? 185 LYS A HZ1  1  
ATOM 1501  H HZ2  . LYS A 1 88  ? 15.298  -6.806  -1.848  1.00 0.00 ? 185 LYS A HZ2  1  
ATOM 1502  H HZ3  . LYS A 1 88  ? 16.857  -6.925  -2.491  1.00 0.00 ? 185 LYS A HZ3  1  
ATOM 1503  N N    . PRO A 1 89  ? 16.866  -2.223  -9.156  1.00 0.00 ? 186 PRO A N    1  
ATOM 1504  C CA   . PRO A 1 89  ? 17.509  -2.351  -10.467 1.00 0.00 ? 186 PRO A CA   1  
ATOM 1505  C C    . PRO A 1 89  ? 18.884  -3.010  -10.383 1.00 0.00 ? 186 PRO A C    1  
ATOM 1506  O O    . PRO A 1 89  ? 19.519  -2.986  -9.326  1.00 0.00 ? 186 PRO A O    1  
ATOM 1507  C CB   . PRO A 1 89  ? 17.644  -0.904  -10.956 1.00 0.00 ? 186 PRO A CB   1  
ATOM 1508  C CG   . PRO A 1 89  ? 16.676  -0.126  -10.134 1.00 0.00 ? 186 PRO A CG   1  
ATOM 1509  C CD   . PRO A 1 89  ? 16.618  -0.820  -8.804  1.00 0.00 ? 186 PRO A CD   1  
ATOM 1510  H HA   . PRO A 1 89  ? 16.889  -2.908  -11.155 1.00 0.00 ? 186 PRO A HA   1  
ATOM 1511  H HB2  . PRO A 1 89  ? 18.657  -0.563  -10.801 1.00 0.00 ? 186 PRO A HB2  1  
ATOM 1512  H HB3  . PRO A 1 89  ? 17.399  -0.851  -12.007 1.00 0.00 ? 186 PRO A HB3  1  
ATOM 1513  H HG2  . PRO A 1 89  ? 17.028  0.888   -10.014 1.00 0.00 ? 186 PRO A HG2  1  
ATOM 1514  H HG3  . PRO A 1 89  ? 15.705  -0.134  -10.605 1.00 0.00 ? 186 PRO A HG3  1  
ATOM 1515  H HD2  . PRO A 1 89  ? 17.387  -0.446  -8.145  1.00 0.00 ? 186 PRO A HD2  1  
ATOM 1516  H HD3  . PRO A 1 89  ? 15.643  -0.703  -8.356  1.00 0.00 ? 186 PRO A HD3  1  
ATOM 1517  N N    . ASP A 1 90  ? 19.342  -3.580  -11.491 1.00 0.00 ? 187 ASP A N    1  
ATOM 1518  C CA   . ASP A 1 90  ? 20.566  -4.388  -11.501 1.00 0.00 ? 187 ASP A CA   1  
ATOM 1519  C C    . ASP A 1 90  ? 21.756  -3.630  -10.919 1.00 0.00 ? 187 ASP A C    1  
ATOM 1520  O O    . ASP A 1 90  ? 22.465  -4.138  -10.047 1.00 0.00 ? 187 ASP A O    1  
ATOM 1521  C CB   . ASP A 1 90  ? 20.897  -4.840  -12.928 1.00 0.00 ? 187 ASP A CB   1  
ATOM 1522  C CG   . ASP A 1 90  ? 22.139  -5.714  -12.992 1.00 0.00 ? 187 ASP A CG   1  
ATOM 1523  O OD1  . ASP A 1 90  ? 22.009  -6.950  -12.882 1.00 0.00 ? 187 ASP A OD1  1  
ATOM 1524  O OD2  . ASP A 1 90  ? 23.250  -5.172  -13.163 1.00 0.00 ? 187 ASP A OD2  1  
ATOM 1525  H H    . ASP A 1 90  ? 18.849  -3.450  -12.329 1.00 0.00 ? 187 ASP A H    1  
ATOM 1526  H HA   . ASP A 1 90  ? 20.386  -5.262  -10.895 1.00 0.00 ? 187 ASP A HA   1  
ATOM 1527  H HB2  . ASP A 1 90  ? 20.065  -5.404  -13.322 1.00 0.00 ? 187 ASP A HB2  1  
ATOM 1528  H HB3  . ASP A 1 90  ? 21.060  -3.969  -13.546 1.00 0.00 ? 187 ASP A HB3  1  
ATOM 1529  N N    . HIS A 1 91  ? 21.955  -2.408  -11.388 1.00 0.00 ? 188 HIS A N    1  
ATOM 1530  C CA   . HIS A 1 91  ? 23.124  -1.624  -11.011 1.00 0.00 ? 188 HIS A CA   1  
ATOM 1531  C C    . HIS A 1 91  ? 22.811  -0.644  -9.883  1.00 0.00 ? 188 HIS A C    1  
ATOM 1532  O O    . HIS A 1 91  ? 23.627  0.225   -9.568  1.00 0.00 ? 188 HIS A O    1  
ATOM 1533  C CB   . HIS A 1 91  ? 23.659  -0.848  -12.217 1.00 0.00 ? 188 HIS A CB   1  
ATOM 1534  C CG   . HIS A 1 91  ? 24.244  -1.700  -13.296 1.00 0.00 ? 188 HIS A CG   1  
ATOM 1535  N ND1  . HIS A 1 91  ? 25.596  -1.931  -13.417 1.00 0.00 ? 188 HIS A ND1  1  
ATOM 1536  C CD2  . HIS A 1 91  ? 23.660  -2.352  -14.328 1.00 0.00 ? 188 HIS A CD2  1  
ATOM 1537  C CE1  . HIS A 1 91  ? 25.818  -2.684  -14.475 1.00 0.00 ? 188 HIS A CE1  1  
ATOM 1538  N NE2  . HIS A 1 91  ? 24.661  -2.955  -15.045 1.00 0.00 ? 188 HIS A NE2  1  
ATOM 1539  H H    . HIS A 1 91  ? 21.295  -2.019  -12.002 1.00 0.00 ? 188 HIS A H    1  
ATOM 1540  H HA   . HIS A 1 91  ? 23.886  -2.309  -10.673 1.00 0.00 ? 188 HIS A HA   1  
ATOM 1541  H HB2  . HIS A 1 91  ? 22.852  -0.281  -12.653 1.00 0.00 ? 188 HIS A HB2  1  
ATOM 1542  H HB3  . HIS A 1 91  ? 24.427  -0.169  -11.881 1.00 0.00 ? 188 HIS A HB3  1  
ATOM 1543  H HD1  . HIS A 1 91  ? 26.296  -1.592  -12.811 1.00 0.00 ? 188 HIS A HD1  1  
ATOM 1544  H HD2  . HIS A 1 91  ? 22.602  -2.393  -14.544 1.00 0.00 ? 188 HIS A HD2  1  
ATOM 1545  H HE1  . HIS A 1 91  ? 26.784  -3.019  -14.819 1.00 0.00 ? 188 HIS A HE1  1  
ATOM 1546  H HE2  . HIS A 1 91  ? 24.551  -3.402  -15.913 1.00 0.00 ? 188 HIS A HE2  1  
ATOM 1547  N N    . GLY A 1 92  ? 21.643  -0.786  -9.270  1.00 0.00 ? 189 GLY A N    1  
ATOM 1548  C CA   . GLY A 1 92  ? 21.244  0.153   -8.243  1.00 0.00 ? 189 GLY A CA   1  
ATOM 1549  C C    . GLY A 1 92  ? 20.361  -0.467  -7.180  1.00 0.00 ? 189 GLY A C    1  
ATOM 1550  O O    . GLY A 1 92  ? 19.151  -0.245  -7.163  1.00 0.00 ? 189 GLY A O    1  
ATOM 1551  H H    . GLY A 1 92  ? 21.056  -1.537  -9.508  1.00 0.00 ? 189 GLY A H    1  
ATOM 1552  H HA2  . GLY A 1 92  ? 22.131  0.545   -7.770  1.00 0.00 ? 189 GLY A HA2  1  
ATOM 1553  H HA3  . GLY A 1 92  ? 20.709  0.968   -8.707  1.00 0.00 ? 189 GLY A HA3  1  
ATOM 1554  N N    . TYR A 1 93  ? 20.964  -1.241  -6.288  1.00 0.00 ? 190 TYR A N    1  
ATOM 1555  C CA   . TYR A 1 93  ? 20.233  -1.850  -5.186  1.00 0.00 ? 190 TYR A CA   1  
ATOM 1556  C C    . TYR A 1 93  ? 19.945  -0.811  -4.110  1.00 0.00 ? 190 TYR A C    1  
ATOM 1557  O O    . TYR A 1 93  ? 20.676  0.174   -3.974  1.00 0.00 ? 190 TYR A O    1  
ATOM 1558  C CB   . TYR A 1 93  ? 21.027  -3.017  -4.596  1.00 0.00 ? 190 TYR A CB   1  
ATOM 1559  C CG   . TYR A 1 93  ? 21.220  -4.167  -5.558  1.00 0.00 ? 190 TYR A CG   1  
ATOM 1560  C CD1  . TYR A 1 93  ? 20.268  -5.172  -5.668  1.00 0.00 ? 190 TYR A CD1  1  
ATOM 1561  C CD2  . TYR A 1 93  ? 22.353  -4.246  -6.357  1.00 0.00 ? 190 TYR A CD2  1  
ATOM 1562  C CE1  . TYR A 1 93  ? 20.439  -6.223  -6.548  1.00 0.00 ? 190 TYR A CE1  1  
ATOM 1563  C CE2  . TYR A 1 93  ? 22.531  -5.294  -7.238  1.00 0.00 ? 190 TYR A CE2  1  
ATOM 1564  C CZ   . TYR A 1 93  ? 21.572  -6.280  -7.330  1.00 0.00 ? 190 TYR A CZ   1  
ATOM 1565  O OH   . TYR A 1 93  ? 21.746  -7.325  -8.211  1.00 0.00 ? 190 TYR A OH   1  
ATOM 1566  H H    . TYR A 1 93  ? 21.924  -1.399  -6.367  1.00 0.00 ? 190 TYR A H    1  
ATOM 1567  H HA   . TYR A 1 93  ? 19.296  -2.220  -5.574  1.00 0.00 ? 190 TYR A HA   1  
ATOM 1568  H HB2  . TYR A 1 93  ? 22.004  -2.666  -4.300  1.00 0.00 ? 190 TYR A HB2  1  
ATOM 1569  H HB3  . TYR A 1 93  ? 20.507  -3.393  -3.727  1.00 0.00 ? 190 TYR A HB3  1  
ATOM 1570  H HD1  . TYR A 1 93  ? 19.381  -5.124  -5.054  1.00 0.00 ? 190 TYR A HD1  1  
ATOM 1571  H HD2  . TYR A 1 93  ? 23.103  -3.474  -6.283  1.00 0.00 ? 190 TYR A HD2  1  
ATOM 1572  H HE1  . TYR A 1 93  ? 19.688  -6.996  -6.618  1.00 0.00 ? 190 TYR A HE1  1  
ATOM 1573  H HE2  . TYR A 1 93  ? 23.418  -5.338  -7.852  1.00 0.00 ? 190 TYR A HE2  1  
ATOM 1574  H HH   . TYR A 1 93  ? 20.897  -7.550  -8.608  1.00 0.00 ? 190 TYR A HH   1  
ATOM 1575  N N    . TRP A 1 94  ? 18.889  -1.032  -3.346  1.00 0.00 ? 191 TRP A N    1  
ATOM 1576  C CA   . TRP A 1 94  ? 18.457  -0.063  -2.345  1.00 0.00 ? 191 TRP A CA   1  
ATOM 1577  C C    . TRP A 1 94  ? 18.537  -0.640  -0.938  1.00 0.00 ? 191 TRP A C    1  
ATOM 1578  O O    . TRP A 1 94  ? 18.513  -1.857  -0.746  1.00 0.00 ? 191 TRP A O    1  
ATOM 1579  C CB   . TRP A 1 94  ? 17.026  0.409   -2.632  1.00 0.00 ? 191 TRP A CB   1  
ATOM 1580  C CG   . TRP A 1 94  ? 16.015  -0.699  -2.672  1.00 0.00 ? 191 TRP A CG   1  
ATOM 1581  C CD1  . TRP A 1 94  ? 15.897  -1.653  -3.635  1.00 0.00 ? 191 TRP A CD1  1  
ATOM 1582  C CD2  . TRP A 1 94  ? 14.973  -0.960  -1.720  1.00 0.00 ? 191 TRP A CD2  1  
ATOM 1583  N NE1  . TRP A 1 94  ? 14.860  -2.498  -3.340  1.00 0.00 ? 191 TRP A NE1  1  
ATOM 1584  C CE2  . TRP A 1 94  ? 14.278  -2.096  -2.172  1.00 0.00 ? 191 TRP A CE2  1  
ATOM 1585  C CE3  . TRP A 1 94  ? 14.562  -0.352  -0.529  1.00 0.00 ? 191 TRP A CE3  1  
ATOM 1586  C CZ2  . TRP A 1 94  ? 13.200  -2.636  -1.481  1.00 0.00 ? 191 TRP A CZ2  1  
ATOM 1587  C CZ3  . TRP A 1 94  ? 13.491  -0.891  0.154   1.00 0.00 ? 191 TRP A CZ3  1  
ATOM 1588  C CH2  . TRP A 1 94  ? 12.823  -2.024  -0.324  1.00 0.00 ? 191 TRP A CH2  1  
ATOM 1589  H H    . TRP A 1 94  ? 18.393  -1.871  -3.450  1.00 0.00 ? 191 TRP A H    1  
ATOM 1590  H HA   . TRP A 1 94  ? 19.120  0.787   -2.406  1.00 0.00 ? 191 TRP A HA   1  
ATOM 1591  H HB2  . TRP A 1 94  ? 16.723  1.103   -1.863  1.00 0.00 ? 191 TRP A HB2  1  
ATOM 1592  H HB3  . TRP A 1 94  ? 17.008  0.912   -3.588  1.00 0.00 ? 191 TRP A HB3  1  
ATOM 1593  H HD1  . TRP A 1 94  ? 16.540  -1.726  -4.500  1.00 0.00 ? 191 TRP A HD1  1  
ATOM 1594  H HE1  . TRP A 1 94  ? 14.577  -3.269  -3.881  1.00 0.00 ? 191 TRP A HE1  1  
ATOM 1595  H HE3  . TRP A 1 94  ? 15.058  0.524   -0.145  1.00 0.00 ? 191 TRP A HE3  1  
ATOM 1596  H HZ2  . TRP A 1 94  ? 12.674  -3.510  -1.835  1.00 0.00 ? 191 TRP A HZ2  1  
ATOM 1597  H HZ3  . TRP A 1 94  ? 13.158  -0.436  1.076   1.00 0.00 ? 191 TRP A HZ3  1  
ATOM 1598  H HH2  . TRP A 1 94  ? 11.992  -2.412  0.243   1.00 0.00 ? 191 TRP A HH2  1  
ATOM 1599  N N    . SER A 1 95  ? 18.649  0.246   0.036   1.00 0.00 ? 192 SER A N    1  
ATOM 1600  C CA   . SER A 1 95  ? 18.664  -0.133  1.441   1.00 0.00 ? 192 SER A CA   1  
ATOM 1601  C C    . SER A 1 95  ? 17.989  0.956   2.270   1.00 0.00 ? 192 SER A C    1  
ATOM 1602  O O    . SER A 1 95  ? 18.111  0.998   3.497   1.00 0.00 ? 192 SER A O    1  
ATOM 1603  C CB   . SER A 1 95  ? 20.103  -0.352  1.910   1.00 0.00 ? 192 SER A CB   1  
ATOM 1604  O OG   . SER A 1 95  ? 20.741  -1.340  1.118   1.00 0.00 ? 192 SER A OG   1  
ATOM 1605  H H    . SER A 1 95  ? 18.733  1.198   -0.197  1.00 0.00 ? 192 SER A H    1  
ATOM 1606  H HA   . SER A 1 95  ? 18.112  -1.055  1.549   1.00 0.00 ? 192 SER A HA   1  
ATOM 1607  H HB2  . SER A 1 95  ? 20.654  0.573   1.825   1.00 0.00 ? 192 SER A HB2  1  
ATOM 1608  H HB3  . SER A 1 95  ? 20.100  -0.678  2.940   1.00 0.00 ? 192 SER A HB3  1  
ATOM 1609  H HG   . SER A 1 95  ? 20.084  -1.755  0.540   1.00 0.00 ? 192 SER A HG   1  
ATOM 1610  N N    . ALA A 1 96  ? 17.273  1.835   1.580   1.00 0.00 ? 193 ALA A N    1  
ATOM 1611  C CA   . ALA A 1 96  ? 16.608  2.962   2.215   1.00 0.00 ? 193 ALA A CA   1  
ATOM 1612  C C    . ALA A 1 96  ? 15.337  3.325   1.458   1.00 0.00 ? 193 ALA A C    1  
ATOM 1613  O O    . ALA A 1 96  ? 15.191  2.999   0.278   1.00 0.00 ? 193 ALA A O    1  
ATOM 1614  C CB   . ALA A 1 96  ? 17.544  4.158   2.276   1.00 0.00 ? 193 ALA A CB   1  
ATOM 1615  H H    . ALA A 1 96  ? 17.180  1.720   0.610   1.00 0.00 ? 193 ALA A H    1  
ATOM 1616  H HA   . ALA A 1 96  ? 16.351  2.678   3.224   1.00 0.00 ? 193 ALA A HA   1  
ATOM 1617  H HB1  . ALA A 1 96  ? 17.797  4.469   1.274   1.00 0.00 ? 193 ALA A HB1  1  
ATOM 1618  H HB2  . ALA A 1 96  ? 18.444  3.884   2.807   1.00 0.00 ? 193 ALA A HB2  1  
ATOM 1619  H HB3  . ALA A 1 96  ? 17.055  4.970   2.792   1.00 0.00 ? 193 ALA A HB3  1  
ATOM 1620  N N    . TRP A 1 97  ? 14.428  4.001   2.143   1.00 0.00 ? 194 TRP A N    1  
ATOM 1621  C CA   . TRP A 1 97  ? 13.145  4.378   1.566   1.00 0.00 ? 194 TRP A CA   1  
ATOM 1622  C C    . TRP A 1 97  ? 13.115  5.877   1.273   1.00 0.00 ? 194 TRP A C    1  
ATOM 1623  O O    . TRP A 1 97  ? 14.096  6.579   1.530   1.00 0.00 ? 194 TRP A O    1  
ATOM 1624  C CB   . TRP A 1 97  ? 12.017  4.001   2.526   1.00 0.00 ? 194 TRP A CB   1  
ATOM 1625  C CG   . TRP A 1 97  ? 11.955  2.534   2.832   1.00 0.00 ? 194 TRP A CG   1  
ATOM 1626  C CD1  . TRP A 1 97  ? 12.632  1.878   3.818   1.00 0.00 ? 194 TRP A CD1  1  
ATOM 1627  C CD2  . TRP A 1 97  ? 11.173  1.543   2.154   1.00 0.00 ? 194 TRP A CD2  1  
ATOM 1628  N NE1  . TRP A 1 97  ? 12.314  0.543   3.799   1.00 0.00 ? 194 TRP A NE1  1  
ATOM 1629  C CE2  . TRP A 1 97  ? 11.422  0.311   2.788   1.00 0.00 ? 194 TRP A CE2  1  
ATOM 1630  C CE3  . TRP A 1 97  ? 10.284  1.576   1.076   1.00 0.00 ? 194 TRP A CE3  1  
ATOM 1631  C CZ2  . TRP A 1 97  ? 10.814  -0.874  2.382   1.00 0.00 ? 194 TRP A CZ2  1  
ATOM 1632  C CZ3  . TRP A 1 97  ? 9.682   0.398   0.671   1.00 0.00 ? 194 TRP A CZ3  1  
ATOM 1633  C CH2  . TRP A 1 97  ? 9.948   -0.812  1.324   1.00 0.00 ? 194 TRP A CH2  1  
ATOM 1634  H H    . TRP A 1 97  ? 14.627  4.265   3.065   1.00 0.00 ? 194 TRP A H    1  
ATOM 1635  H HA   . TRP A 1 97  ? 13.021  3.836   0.641   1.00 0.00 ? 194 TRP A HA   1  
ATOM 1636  H HB2  . TRP A 1 97  ? 12.155  4.528   3.457   1.00 0.00 ? 194 TRP A HB2  1  
ATOM 1637  H HB3  . TRP A 1 97  ? 11.072  4.291   2.091   1.00 0.00 ? 194 TRP A HB3  1  
ATOM 1638  H HD1  . TRP A 1 97  ? 13.315  2.353   4.507   1.00 0.00 ? 194 TRP A HD1  1  
ATOM 1639  H HE1  . TRP A 1 97  ? 12.671  -0.136  4.413   1.00 0.00 ? 194 TRP A HE1  1  
ATOM 1640  H HE3  . TRP A 1 97  ? 10.066  2.499   0.560   1.00 0.00 ? 194 TRP A HE3  1  
ATOM 1641  H HZ2  . TRP A 1 97  ? 11.009  -1.815  2.875   1.00 0.00 ? 194 TRP A HZ2  1  
ATOM 1642  H HZ3  . TRP A 1 97  ? 8.991   0.405   -0.160  1.00 0.00 ? 194 TRP A HZ3  1  
ATOM 1643  H HH2  . TRP A 1 97  ? 9.455   -1.707  0.974   1.00 0.00 ? 194 TRP A HH2  1  
ATOM 1644  N N    . SER A 1 98  ? 11.993  6.368   0.748   1.00 0.00 ? 195 SER A N    1  
ATOM 1645  C CA   . SER A 1 98  ? 11.885  7.772   0.353   1.00 0.00 ? 195 SER A CA   1  
ATOM 1646  C C    . SER A 1 98  ? 10.444  8.169   -0.030  1.00 0.00 ? 195 SER A C    1  
ATOM 1647  O O    . SER A 1 98  ? 9.906   9.125   0.534   1.00 0.00 ? 195 SER A O    1  
ATOM 1648  C CB   . SER A 1 98  ? 12.856  8.077   -0.801  1.00 0.00 ? 195 SER A CB   1  
ATOM 1649  O OG   . SER A 1 98  ? 12.766  9.430   -1.218  1.00 0.00 ? 195 SER A OG   1  
ATOM 1650  H H    . SER A 1 98  ? 11.214  5.779   0.639   1.00 0.00 ? 195 SER A H    1  
ATOM 1651  H HA   . SER A 1 98  ? 12.179  8.364   1.208   1.00 0.00 ? 195 SER A HA   1  
ATOM 1652  H HB2  . SER A 1 98  ? 13.867  7.886   -0.475  1.00 0.00 ? 195 SER A HB2  1  
ATOM 1653  H HB3  . SER A 1 98  ? 12.625  7.440   -1.640  1.00 0.00 ? 195 SER A HB3  1  
ATOM 1654  H HG   . SER A 1 98  ? 12.633  9.459   -2.175  1.00 0.00 ? 195 SER A HG   1  
ATOM 1655  N N    . PRO A 1 99  ? 9.786   7.464   -0.987  1.00 0.00 ? 196 PRO A N    1  
ATOM 1656  C CA   . PRO A 1 99  ? 8.454   7.863   -1.478  1.00 0.00 ? 196 PRO A CA   1  
ATOM 1657  C C    . PRO A 1 99  ? 7.317   7.542   -0.502  1.00 0.00 ? 196 PRO A C    1  
ATOM 1658  O O    . PRO A 1 99  ? 6.489   6.666   -0.760  1.00 0.00 ? 196 PRO A O    1  
ATOM 1659  C CB   . PRO A 1 99  ? 8.300   7.046   -2.759  1.00 0.00 ? 196 PRO A CB   1  
ATOM 1660  C CG   . PRO A 1 99  ? 9.096   5.814   -2.512  1.00 0.00 ? 196 PRO A CG   1  
ATOM 1661  C CD   . PRO A 1 99  ? 10.270  6.245   -1.676  1.00 0.00 ? 196 PRO A CD   1  
ATOM 1662  H HA   . PRO A 1 99  ? 8.426   8.915   -1.719  1.00 0.00 ? 196 PRO A HA   1  
ATOM 1663  H HB2  . PRO A 1 99  ? 7.256   6.820   -2.920  1.00 0.00 ? 196 PRO A HB2  1  
ATOM 1664  H HB3  . PRO A 1 99  ? 8.688   7.606   -3.594  1.00 0.00 ? 196 PRO A HB3  1  
ATOM 1665  H HG2  . PRO A 1 99  ? 8.498   5.091   -1.977  1.00 0.00 ? 196 PRO A HG2  1  
ATOM 1666  H HG3  . PRO A 1 99  ? 9.436   5.402   -3.451  1.00 0.00 ? 196 PRO A HG3  1  
ATOM 1667  H HD2  . PRO A 1 99  ? 10.526  5.475   -0.963  1.00 0.00 ? 196 PRO A HD2  1  
ATOM 1668  H HD3  . PRO A 1 99  ? 11.115  6.471   -2.308  1.00 0.00 ? 196 PRO A HD3  1  
ATOM 1669  N N    . ALA A 1 100 ? 7.273   8.261   0.610   1.00 0.00 ? 197 ALA A N    1  
ATOM 1670  C CA   . ALA A 1 100 ? 6.218   8.076   1.598   1.00 0.00 ? 197 ALA A CA   1  
ATOM 1671  C C    . ALA A 1 100 ? 4.908   8.676   1.111   1.00 0.00 ? 197 ALA A C    1  
ATOM 1672  O O    . ALA A 1 100 ? 4.744   9.896   1.082   1.00 0.00 ? 197 ALA A O    1  
ATOM 1673  C CB   . ALA A 1 100 ? 6.615   8.691   2.930   1.00 0.00 ? 197 ALA A CB   1  
ATOM 1674  H H    . ALA A 1 100 ? 7.972   8.931   0.771   1.00 0.00 ? 197 ALA A H    1  
ATOM 1675  H HA   . ALA A 1 100 ? 6.081   7.016   1.746   1.00 0.00 ? 197 ALA A HA   1  
ATOM 1676  H HB1  . ALA A 1 100 ? 5.856   8.467   3.667   1.00 0.00 ? 197 ALA A HB1  1  
ATOM 1677  H HB2  . ALA A 1 100 ? 6.706   9.760   2.820   1.00 0.00 ? 197 ALA A HB2  1  
ATOM 1678  H HB3  . ALA A 1 100 ? 7.561   8.278   3.250   1.00 0.00 ? 197 ALA A HB3  1  
ATOM 1679  N N    . THR A 1 101 ? 3.985   7.818   0.717   1.00 0.00 ? 198 THR A N    1  
ATOM 1680  C CA   . THR A 1 101 ? 2.692   8.266   0.236   1.00 0.00 ? 198 THR A CA   1  
ATOM 1681  C C    . THR A 1 101 ? 1.649   8.186   1.348   1.00 0.00 ? 198 THR A C    1  
ATOM 1682  O O    . THR A 1 101 ? 1.554   7.178   2.053   1.00 0.00 ? 198 THR A O    1  
ATOM 1683  C CB   . THR A 1 101 ? 2.237   7.425   -0.970  1.00 0.00 ? 198 THR A CB   1  
ATOM 1684  O OG1  . THR A 1 101 ? 3.276   7.400   -1.959  1.00 0.00 ? 198 THR A OG1  1  
ATOM 1685  C CG2  . THR A 1 101 ? 0.962   7.987   -1.584  1.00 0.00 ? 198 THR A CG2  1  
ATOM 1686  H H    . THR A 1 101 ? 4.176   6.853   0.753   1.00 0.00 ? 198 THR A H    1  
ATOM 1687  H HA   . THR A 1 101 ? 2.790   9.294   -0.081  1.00 0.00 ? 198 THR A HA   1  
ATOM 1688  H HB   . THR A 1 101 ? 2.045   6.418   -0.635  1.00 0.00 ? 198 THR A HB   1  
ATOM 1689  H HG1  . THR A 1 101 ? 4.110   7.155   -1.540  1.00 0.00 ? 198 THR A HG1  1  
ATOM 1690  H HG21 . THR A 1 101 ? 0.667   7.377   -2.424  1.00 0.00 ? 198 THR A HG21 1  
ATOM 1691  H HG22 . THR A 1 101 ? 1.139   8.999   -1.917  1.00 0.00 ? 198 THR A HG22 1  
ATOM 1692  H HG23 . THR A 1 101 ? 0.175   7.984   -0.843  1.00 0.00 ? 198 THR A HG23 1  
ATOM 1693  N N    . PHE A 1 102 ? 0.889   9.260   1.510   1.00 0.00 ? 199 PHE A N    1  
ATOM 1694  C CA   . PHE A 1 102 ? -0.146  9.334   2.529   1.00 0.00 ? 199 PHE A CA   1  
ATOM 1695  C C    . PHE A 1 102 ? -1.499  8.978   1.934   1.00 0.00 ? 199 PHE A C    1  
ATOM 1696  O O    . PHE A 1 102 ? -1.967  9.633   1.001   1.00 0.00 ? 199 PHE A O    1  
ATOM 1697  C CB   . PHE A 1 102 ? -0.207  10.742  3.131   1.00 0.00 ? 199 PHE A CB   1  
ATOM 1698  C CG   . PHE A 1 102 ? 0.996   11.116  3.949   1.00 0.00 ? 199 PHE A CG   1  
ATOM 1699  C CD1  . PHE A 1 102 ? 2.238   11.278  3.356   1.00 0.00 ? 199 PHE A CD1  1  
ATOM 1700  C CD2  . PHE A 1 102 ? 0.880   11.306  5.314   1.00 0.00 ? 199 PHE A CD2  1  
ATOM 1701  C CE1  . PHE A 1 102 ? 3.342   11.622  4.112   1.00 0.00 ? 199 PHE A CE1  1  
ATOM 1702  C CE2  . PHE A 1 102 ? 1.980   11.651  6.075   1.00 0.00 ? 199 PHE A CE2  1  
ATOM 1703  C CZ   . PHE A 1 102 ? 3.212   11.809  5.473   1.00 0.00 ? 199 PHE A CZ   1  
ATOM 1704  H H    . PHE A 1 102 ? 1.022   10.031  0.916   1.00 0.00 ? 199 PHE A H    1  
ATOM 1705  H HA   . PHE A 1 102 ? 0.096   8.624   3.307   1.00 0.00 ? 199 PHE A HA   1  
ATOM 1706  H HB2  . PHE A 1 102 ? -0.298  11.461  2.332   1.00 0.00 ? 199 PHE A HB2  1  
ATOM 1707  H HB3  . PHE A 1 102 ? -1.076  10.812  3.769   1.00 0.00 ? 199 PHE A HB3  1  
ATOM 1708  H HD1  . PHE A 1 102 ? 2.339   11.130  2.291   1.00 0.00 ? 199 PHE A HD1  1  
ATOM 1709  H HD2  . PHE A 1 102 ? -0.083  11.179  5.785   1.00 0.00 ? 199 PHE A HD2  1  
ATOM 1710  H HE1  . PHE A 1 102 ? 4.304   11.744  3.639   1.00 0.00 ? 199 PHE A HE1  1  
ATOM 1711  H HE2  . PHE A 1 102 ? 1.875   11.796  7.140   1.00 0.00 ? 199 PHE A HE2  1  
ATOM 1712  H HZ   . PHE A 1 102 ? 4.073   12.077  6.067   1.00 0.00 ? 199 PHE A HZ   1  
ATOM 1713  N N    . ILE A 1 103 ? -2.123  7.943   2.466   1.00 0.00 ? 200 ILE A N    1  
ATOM 1714  C CA   . ILE A 1 103 ? -3.432  7.527   1.995   1.00 0.00 ? 200 ILE A CA   1  
ATOM 1715  C C    . ILE A 1 103 ? -4.412  7.427   3.161   1.00 0.00 ? 200 ILE A C    1  
ATOM 1716  O O    . ILE A 1 103 ? -4.100  6.861   4.211   1.00 0.00 ? 200 ILE A O    1  
ATOM 1717  C CB   . ILE A 1 103 ? -3.366  6.181   1.227   1.00 0.00 ? 200 ILE A CB   1  
ATOM 1718  C CG1  . ILE A 1 103 ? -4.758  5.756   0.745   1.00 0.00 ? 200 ILE A CG1  1  
ATOM 1719  C CG2  . ILE A 1 103 ? -2.744  5.090   2.086   1.00 0.00 ? 200 ILE A CG2  1  
ATOM 1720  C CD1  . ILE A 1 103 ? -5.372  6.705   -0.263  1.00 0.00 ? 200 ILE A CD1  1  
ATOM 1721  H H    . ILE A 1 103 ? -1.694  7.446   3.200   1.00 0.00 ? 200 ILE A H    1  
ATOM 1722  H HA   . ILE A 1 103 ? -3.789  8.286   1.312   1.00 0.00 ? 200 ILE A HA   1  
ATOM 1723  H HB   . ILE A 1 103 ? -2.730  6.324   0.366   1.00 0.00 ? 200 ILE A HB   1  
ATOM 1724  H HG12 . ILE A 1 103 ? -4.690  4.783   0.284   1.00 0.00 ? 200 ILE A HG12 1  
ATOM 1725  H HG13 . ILE A 1 103 ? -5.424  5.700   1.595   1.00 0.00 ? 200 ILE A HG13 1  
ATOM 1726  H HG21 . ILE A 1 103 ? -2.712  4.166   1.528   1.00 0.00 ? 200 ILE A HG21 1  
ATOM 1727  H HG22 . ILE A 1 103 ? -3.338  4.952   2.976   1.00 0.00 ? 200 ILE A HG22 1  
ATOM 1728  H HG23 . ILE A 1 103 ? -1.741  5.379   2.363   1.00 0.00 ? 200 ILE A HG23 1  
ATOM 1729  H HD11 . ILE A 1 103 ? -4.719  6.792   -1.119  1.00 0.00 ? 200 ILE A HD11 1  
ATOM 1730  H HD12 . ILE A 1 103 ? -5.503  7.677   0.190   1.00 0.00 ? 200 ILE A HD12 1  
ATOM 1731  H HD13 . ILE A 1 103 ? -6.331  6.323   -0.580  1.00 0.00 ? 200 ILE A HD13 1  
ATOM 1732  N N    . GLN A 1 104 ? -5.582  8.013   2.985   1.00 0.00 ? 201 GLN A N    1  
ATOM 1733  C CA   . GLN A 1 104 ? -6.619  7.965   3.999   1.00 0.00 ? 201 GLN A CA   1  
ATOM 1734  C C    . GLN A 1 104 ? -7.589  6.833   3.718   1.00 0.00 ? 201 GLN A C    1  
ATOM 1735  O O    . GLN A 1 104 ? -8.222  6.797   2.663   1.00 0.00 ? 201 GLN A O    1  
ATOM 1736  C CB   . GLN A 1 104 ? -7.381  9.291   4.050   1.00 0.00 ? 201 GLN A CB   1  
ATOM 1737  C CG   . GLN A 1 104 ? -6.555  10.450  4.576   1.00 0.00 ? 201 GLN A CG   1  
ATOM 1738  C CD   . GLN A 1 104 ? -6.158  10.283  6.031   1.00 0.00 ? 201 GLN A CD   1  
ATOM 1739  O OE1  . GLN A 1 104 ? -5.090  10.727  6.444   1.00 0.00 ? 201 GLN A OE1  1  
ATOM 1740  N NE2  . GLN A 1 104 ? -7.018  9.662   6.826   1.00 0.00 ? 201 GLN A NE2  1  
ATOM 1741  H H    . GLN A 1 104 ? -5.755  8.494   2.147   1.00 0.00 ? 201 GLN A H    1  
ATOM 1742  H HA   . GLN A 1 104 ? -6.146  7.792   4.954   1.00 0.00 ? 201 GLN A HA   1  
ATOM 1743  H HB2  . GLN A 1 104 ? -7.712  9.538   3.052   1.00 0.00 ? 201 GLN A HB2  1  
ATOM 1744  H HB3  . GLN A 1 104 ? -8.246  9.172   4.684   1.00 0.00 ? 201 GLN A HB3  1  
ATOM 1745  H HG2  . GLN A 1 104 ? -5.656  10.532  3.982   1.00 0.00 ? 201 GLN A HG2  1  
ATOM 1746  H HG3  . GLN A 1 104 ? -7.132  11.358  4.479   1.00 0.00 ? 201 GLN A HG3  1  
ATOM 1747  H HE21 . GLN A 1 104 ? -7.861  9.343   6.442   1.00 0.00 ? 201 GLN A HE21 1  
ATOM 1748  H HE22 . GLN A 1 104 ? -6.781  9.557   7.771   1.00 0.00 ? 201 GLN A HE22 1  
ATOM 1749  N N    . ILE A 1 105 ? -7.695  5.905   4.652   1.00 0.00 ? 202 ILE A N    1  
ATOM 1750  C CA   . ILE A 1 105 ? -8.697  4.861   4.560   1.00 0.00 ? 202 ILE A CA   1  
ATOM 1751  C C    . ILE A 1 105 ? -10.031 5.425   5.021   1.00 0.00 ? 202 ILE A C    1  
ATOM 1752  O O    . ILE A 1 105 ? -10.157 5.851   6.165   1.00 0.00 ? 202 ILE A O    1  
ATOM 1753  C CB   . ILE A 1 105 ? -8.332  3.630   5.421   1.00 0.00 ? 202 ILE A CB   1  
ATOM 1754  C CG1  . ILE A 1 105 ? -6.954  3.088   5.031   1.00 0.00 ? 202 ILE A CG1  1  
ATOM 1755  C CG2  . ILE A 1 105 ? -9.390  2.541   5.283   1.00 0.00 ? 202 ILE A CG2  1  
ATOM 1756  C CD1  . ILE A 1 105 ? -6.848  2.659   3.584   1.00 0.00 ? 202 ILE A CD1  1  
ATOM 1757  H H    . ILE A 1 105 ? -7.091  5.926   5.427   1.00 0.00 ? 202 ILE A H    1  
ATOM 1758  H HA   . ILE A 1 105 ? -8.776  4.554   3.527   1.00 0.00 ? 202 ILE A HA   1  
ATOM 1759  H HB   . ILE A 1 105 ? -8.307  3.940   6.455   1.00 0.00 ? 202 ILE A HB   1  
ATOM 1760  H HG12 . ILE A 1 105 ? -6.213  3.854   5.202   1.00 0.00 ? 202 ILE A HG12 1  
ATOM 1761  H HG13 . ILE A 1 105 ? -6.726  2.232   5.649   1.00 0.00 ? 202 ILE A HG13 1  
ATOM 1762  H HG21 . ILE A 1 105 ? -9.453  2.227   4.250   1.00 0.00 ? 202 ILE A HG21 1  
ATOM 1763  H HG22 . ILE A 1 105 ? -10.348 2.927   5.599   1.00 0.00 ? 202 ILE A HG22 1  
ATOM 1764  H HG23 . ILE A 1 105 ? -9.122  1.696   5.900   1.00 0.00 ? 202 ILE A HG23 1  
ATOM 1765  H HD11 . ILE A 1 105 ? -5.871  2.237   3.404   1.00 0.00 ? 202 ILE A HD11 1  
ATOM 1766  H HD12 . ILE A 1 105 ? -6.994  3.516   2.943   1.00 0.00 ? 202 ILE A HD12 1  
ATOM 1767  H HD13 . ILE A 1 105 ? -7.605  1.919   3.373   1.00 0.00 ? 202 ILE A HD13 1  
ATOM 1768  N N    . PRO A 1 106 ? -11.033 5.457   4.136   1.00 0.00 ? 203 PRO A N    1  
ATOM 1769  C CA   . PRO A 1 106 ? -12.338 6.049   4.444   1.00 0.00 ? 203 PRO A CA   1  
ATOM 1770  C C    . PRO A 1 106 ? -13.049 5.316   5.574   1.00 0.00 ? 203 PRO A C    1  
ATOM 1771  O O    . PRO A 1 106 ? -12.868 4.113   5.764   1.00 0.00 ? 203 PRO A O    1  
ATOM 1772  C CB   . PRO A 1 106 ? -13.119 5.892   3.134   1.00 0.00 ? 203 PRO A CB   1  
ATOM 1773  C CG   . PRO A 1 106 ? -12.434 4.791   2.405   1.00 0.00 ? 203 PRO A CG   1  
ATOM 1774  C CD   . PRO A 1 106 ? -10.985 4.905   2.772   1.00 0.00 ? 203 PRO A CD   1  
ATOM 1775  H HA   . PRO A 1 106 ? -12.249 7.096   4.693   1.00 0.00 ? 203 PRO A HA   1  
ATOM 1776  H HB2  . PRO A 1 106 ? -14.147 5.640   3.354   1.00 0.00 ? 203 PRO A HB2  1  
ATOM 1777  H HB3  . PRO A 1 106 ? -13.082 6.817   2.577   1.00 0.00 ? 203 PRO A HB3  1  
ATOM 1778  H HG2  . PRO A 1 106 ? -12.828 3.837   2.723   1.00 0.00 ? 203 PRO A HG2  1  
ATOM 1779  H HG3  . PRO A 1 106 ? -12.563 4.916   1.341   1.00 0.00 ? 203 PRO A HG3  1  
ATOM 1780  H HD2  . PRO A 1 106 ? -10.517 3.931   2.764   1.00 0.00 ? 203 PRO A HD2  1  
ATOM 1781  H HD3  . PRO A 1 106 ? -10.475 5.579   2.100   1.00 0.00 ? 203 PRO A HD3  1  
ATOM 1782  N N    . SER A 1 107 ? -13.852 6.052   6.330   1.00 0.00 ? 204 SER A N    1  
ATOM 1783  C CA   . SER A 1 107 ? -14.657 5.472   7.395   1.00 0.00 ? 204 SER A CA   1  
ATOM 1784  C C    . SER A 1 107 ? -15.766 4.619   6.792   1.00 0.00 ? 204 SER A C    1  
ATOM 1785  O O    . SER A 1 107 ? -16.356 3.771   7.460   1.00 0.00 ? 204 SER A O    1  
ATOM 1786  C CB   . SER A 1 107 ? -15.248 6.578   8.270   1.00 0.00 ? 204 SER A CB   1  
ATOM 1787  O OG   . SER A 1 107 ? -14.225 7.405   8.801   1.00 0.00 ? 204 SER A OG   1  
ATOM 1788  H H    . SER A 1 107 ? -13.904 7.020   6.169   1.00 0.00 ? 204 SER A H    1  
ATOM 1789  H HA   . SER A 1 107 ? -14.016 4.844   7.997   1.00 0.00 ? 204 SER A HA   1  
ATOM 1790  H HB2  . SER A 1 107 ? -15.913 7.187   7.676   1.00 0.00 ? 204 SER A HB2  1  
ATOM 1791  H HB3  . SER A 1 107 ? -15.798 6.135   9.087   1.00 0.00 ? 204 SER A HB3  1  
ATOM 1792  H HG   . SER A 1 107 ? -14.215 7.319   9.763   1.00 0.00 ? 204 SER A HG   1  
ATOM 1793  N N    . ASP A 1 108 ? -16.018 4.848   5.507   1.00 0.00 ? 205 ASP A N    1  
ATOM 1794  C CA   . ASP A 1 108 ? -16.991 4.074   4.747   1.00 0.00 ? 205 ASP A CA   1  
ATOM 1795  C C    . ASP A 1 108 ? -16.377 2.764   4.271   1.00 0.00 ? 205 ASP A C    1  
ATOM 1796  O O    . ASP A 1 108 ? -16.962 2.061   3.452   1.00 0.00 ? 205 ASP A O    1  
ATOM 1797  C CB   . ASP A 1 108 ? -17.482 4.871   3.534   1.00 0.00 ? 205 ASP A CB   1  
ATOM 1798  C CG   . ASP A 1 108 ? -18.326 6.071   3.907   1.00 0.00 ? 205 ASP A CG   1  
ATOM 1799  O OD1  . ASP A 1 108 ? -17.767 7.069   4.413   1.00 0.00 ? 205 ASP A OD1  1  
ATOM 1800  O OD2  . ASP A 1 108 ? -19.550 6.035   3.675   1.00 0.00 ? 205 ASP A OD2  1  
ATOM 1801  H H    . ASP A 1 108 ? -15.535 5.573   5.056   1.00 0.00 ? 205 ASP A H    1  
ATOM 1802  H HA   . ASP A 1 108 ? -17.829 3.858   5.394   1.00 0.00 ? 205 ASP A HA   1  
ATOM 1803  H HB2  . ASP A 1 108 ? -16.627 5.222   2.978   1.00 0.00 ? 205 ASP A HB2  1  
ATOM 1804  H HB3  . ASP A 1 108 ? -18.072 4.222   2.902   1.00 0.00 ? 205 ASP A HB3  1  
ATOM 1805  N N    . PHE A 1 109 ? -15.182 2.458   4.773   1.00 0.00 ? 206 PHE A N    1  
ATOM 1806  C CA   . PHE A 1 109 ? -14.481 1.230   4.416   1.00 0.00 ? 206 PHE A CA   1  
ATOM 1807  C C    . PHE A 1 109 ? -15.336 0.016   4.750   1.00 0.00 ? 206 PHE A C    1  
ATOM 1808  O O    . PHE A 1 109 ? -15.473 -0.906  3.948   1.00 0.00 ? 206 PHE A O    1  
ATOM 1809  C CB   . PHE A 1 109 ? -13.150 1.155   5.165   1.00 0.00 ? 206 PHE A CB   1  
ATOM 1810  C CG   . PHE A 1 109 ? -12.267 0.026   4.728   1.00 0.00 ? 206 PHE A CG   1  
ATOM 1811  C CD1  . PHE A 1 109 ? -11.512 0.140   3.576   1.00 0.00 ? 206 PHE A CD1  1  
ATOM 1812  C CD2  . PHE A 1 109 ? -12.191 -1.145  5.465   1.00 0.00 ? 206 PHE A CD2  1  
ATOM 1813  C CE1  . PHE A 1 109 ? -10.695 -0.890  3.164   1.00 0.00 ? 206 PHE A CE1  1  
ATOM 1814  C CE2  . PHE A 1 109 ? -11.376 -2.181  5.057   1.00 0.00 ? 206 PHE A CE2  1  
ATOM 1815  C CZ   . PHE A 1 109 ? -10.627 -2.052  3.904   1.00 0.00 ? 206 PHE A CZ   1  
ATOM 1816  H H    . PHE A 1 109 ? -14.761 3.080   5.402   1.00 0.00 ? 206 PHE A H    1  
ATOM 1817  H HA   . PHE A 1 109 ? -14.290 1.247   3.354   1.00 0.00 ? 206 PHE A HA   1  
ATOM 1818  H HB2  . PHE A 1 109 ? -12.608 2.076   5.011   1.00 0.00 ? 206 PHE A HB2  1  
ATOM 1819  H HB3  . PHE A 1 109 ? -13.347 1.034   6.220   1.00 0.00 ? 206 PHE A HB3  1  
ATOM 1820  H HD1  . PHE A 1 109 ? -11.564 1.049   2.995   1.00 0.00 ? 206 PHE A HD1  1  
ATOM 1821  H HD2  . PHE A 1 109 ? -12.778 -1.244  6.365   1.00 0.00 ? 206 PHE A HD2  1  
ATOM 1822  H HE1  . PHE A 1 109 ? -10.108 -0.787  2.264   1.00 0.00 ? 206 PHE A HE1  1  
ATOM 1823  H HE2  . PHE A 1 109 ? -11.323 -3.089  5.638   1.00 0.00 ? 206 PHE A HE2  1  
ATOM 1824  H HZ   . PHE A 1 109 ? -9.989  -2.860  3.580   1.00 0.00 ? 206 PHE A HZ   1  
ATOM 1825  N N    . THR A 1 110 ? -15.904 0.027   5.943   1.00 0.00 ? 207 THR A N    1  
ATOM 1826  C CA   . THR A 1 110 ? -16.835 -0.999  6.352   1.00 0.00 ? 207 THR A CA   1  
ATOM 1827  C C    . THR A 1 110 ? -18.246 -0.603  5.939   1.00 0.00 ? 207 THR A C    1  
ATOM 1828  O O    . THR A 1 110 ? -18.634 0.561   6.069   1.00 0.00 ? 207 THR A O    1  
ATOM 1829  C CB   . THR A 1 110 ? -16.767 -1.226  7.873   1.00 0.00 ? 207 THR A CB   1  
ATOM 1830  O OG1  . THR A 1 110 ? -16.589 0.030   8.545   1.00 0.00 ? 207 THR A OG1  1  
ATOM 1831  C CG2  . THR A 1 110 ? -15.626 -2.168  8.232   1.00 0.00 ? 207 THR A CG2  1  
ATOM 1832  H H    . THR A 1 110 ? -15.702 0.756   6.565   1.00 0.00 ? 207 THR A H    1  
ATOM 1833  H HA   . THR A 1 110 ? -16.564 -1.920  5.852   1.00 0.00 ? 207 THR A HA   1  
ATOM 1834  H HB   . THR A 1 110 ? -17.696 -1.669  8.198   1.00 0.00 ? 207 THR A HB   1  
ATOM 1835  H HG1  . THR A 1 110 ? -17.006 -0.009  9.412   1.00 0.00 ? 207 THR A HG1  1  
ATOM 1836  H HG21 . THR A 1 110 ? -15.596 -2.306  9.302   1.00 0.00 ? 207 THR A HG21 1  
ATOM 1837  H HG22 . THR A 1 110 ? -14.691 -1.745  7.896   1.00 0.00 ? 207 THR A HG22 1  
ATOM 1838  H HG23 . THR A 1 110 ? -15.782 -3.123  7.751   1.00 0.00 ? 207 THR A HG23 1  
ATOM 1839  N N    . MET A 1 111 ? -19.005 -1.562  5.431   1.00 0.00 ? 208 MET A N    1  
ATOM 1840  C CA   . MET A 1 111 ? -20.342 -1.288  4.921   1.00 0.00 ? 208 MET A CA   1  
ATOM 1841  C C    . MET A 1 111 ? -21.342 -1.132  6.063   1.00 0.00 ? 208 MET A C    1  
ATOM 1842  O O    . MET A 1 111 ? -22.284 -1.911  6.199   1.00 0.00 ? 208 MET A O    1  
ATOM 1843  C CB   . MET A 1 111 ? -20.780 -2.396  3.962   1.00 0.00 ? 208 MET A CB   1  
ATOM 1844  C CG   . MET A 1 111 ? -19.951 -2.433  2.691   1.00 0.00 ? 208 MET A CG   1  
ATOM 1845  S SD   . MET A 1 111 ? -20.511 -3.673  1.510   1.00 0.00 ? 208 MET A SD   1  
ATOM 1846  C CE   . MET A 1 111 ? -19.374 -3.342  0.171   1.00 0.00 ? 208 MET A CE   1  
ATOM 1847  H H    . MET A 1 111 ? -18.662 -2.479  5.405   1.00 0.00 ? 208 MET A H    1  
ATOM 1848  H HA   . MET A 1 111 ? -20.295 -0.359  4.371   1.00 0.00 ? 208 MET A HA   1  
ATOM 1849  H HB2  . MET A 1 111 ? -20.684 -3.350  4.460   1.00 0.00 ? 208 MET A HB2  1  
ATOM 1850  H HB3  . MET A 1 111 ? -21.813 -2.240  3.691   1.00 0.00 ? 208 MET A HB3  1  
ATOM 1851  H HG2  . MET A 1 111 ? -20.002 -1.464  2.218   1.00 0.00 ? 208 MET A HG2  1  
ATOM 1852  H HG3  . MET A 1 111 ? -18.925 -2.648  2.954   1.00 0.00 ? 208 MET A HG3  1  
ATOM 1853  H HE1  . MET A 1 111 ? -19.482 -2.314  -0.143  1.00 0.00 ? 208 MET A HE1  1  
ATOM 1854  H HE2  . MET A 1 111 ? -19.589 -3.999  -0.658  1.00 0.00 ? 208 MET A HE2  1  
ATOM 1855  H HE3  . MET A 1 111 ? -18.363 -3.508  0.511   1.00 0.00 ? 208 MET A HE3  1  
ATOM 1856  N N    . ASN A 1 112 ? -21.126 -0.113  6.883   1.00 0.00 ? 209 ASN A N    1  
ATOM 1857  C CA   . ASN A 1 112 ? -22.001 0.172   8.010   1.00 0.00 ? 209 ASN A CA   1  
ATOM 1858  C C    . ASN A 1 112 ? -23.166 1.036   7.538   1.00 0.00 ? 209 ASN A C    1  
ATOM 1859  O O    . ASN A 1 112 ? -23.301 2.199   7.924   1.00 0.00 ? 209 ASN A O    1  
ATOM 1860  C CB   . ASN A 1 112 ? -21.213 0.883   9.119   1.00 0.00 ? 209 ASN A CB   1  
ATOM 1861  C CG   . ASN A 1 112 ? -21.914 0.844   10.467  1.00 0.00 ? 209 ASN A CG   1  
ATOM 1862  O OD1  . ASN A 1 112 ? -23.141 0.791   10.551  1.00 0.00 ? 209 ASN A OD1  1  
ATOM 1863  N ND2  . ASN A 1 112 ? -21.133 0.858   11.535  1.00 0.00 ? 209 ASN A ND2  1  
ATOM 1864  H H    . ASN A 1 112 ? -20.349 0.469   6.721   1.00 0.00 ? 209 ASN A H    1  
ATOM 1865  H HA   . ASN A 1 112 ? -22.383 -0.765  8.385   1.00 0.00 ? 209 ASN A HA   1  
ATOM 1866  H HB2  . ASN A 1 112 ? -20.249 0.409   9.226   1.00 0.00 ? 209 ASN A HB2  1  
ATOM 1867  H HB3  . ASN A 1 112 ? -21.070 1.918   8.840   1.00 0.00 ? 209 ASN A HB3  1  
ATOM 1868  H HD21 . ASN A 1 112 ? -20.160 0.893   11.399  1.00 0.00 ? 209 ASN A HD21 1  
ATOM 1869  H HD22 . ASN A 1 112 ? -21.556 0.834   12.421  1.00 0.00 ? 209 ASN A HD22 1  
ATOM 1870  N N    . ASP A 1 113 ? -23.996 0.457   6.685   1.00 0.00 ? 210 ASP A N    1  
ATOM 1871  C CA   . ASP A 1 113 ? -25.096 1.179   6.066   1.00 0.00 ? 210 ASP A CA   1  
ATOM 1872  C C    . ASP A 1 113 ? -26.400 0.416   6.243   1.00 0.00 ? 210 ASP A C    1  
ATOM 1873  O O    . ASP A 1 113 ? -26.573 -0.631  5.588   1.00 0.00 ? 210 ASP A O    1  
ATOM 1874  C CB   . ASP A 1 113 ? -24.809 1.400   4.580   1.00 0.00 ? 210 ASP A CB   1  
ATOM 1875  C CG   . ASP A 1 113 ? -25.940 2.110   3.866   1.00 0.00 ? 210 ASP A CG   1  
ATOM 1876  O OD1  . ASP A 1 113 ? -26.111 3.329   4.080   1.00 0.00 ? 210 ASP A OD1  1  
ATOM 1877  O OD2  . ASP A 1 113 ? -26.647 1.461   3.067   1.00 0.00 ? 210 ASP A OD2  1  
ATOM 1878  O OXT  . ASP A 1 113 ? -27.245 0.862   7.042   1.00 0.00 ? 210 ASP A OXT  1  
ATOM 1879  H H    . ASP A 1 113 ? -23.867 -0.491  6.466   1.00 0.00 ? 210 ASP A H    1  
ATOM 1880  H HA   . ASP A 1 113 ? -25.182 2.138   6.555   1.00 0.00 ? 210 ASP A HA   1  
ATOM 1881  H HB2  . ASP A 1 113 ? -23.915 1.997   4.477   1.00 0.00 ? 210 ASP A HB2  1  
ATOM 1882  H HB3  . ASP A 1 113 ? -24.652 0.444   4.105   1.00 0.00 ? 210 ASP A HB3  1  
ATOM 1883  N N    . MET A 1 1   ? 28.280  10.374  -3.804  1.00 0.00 ? 98  MET A N    2  
ATOM 1884  C CA   . MET A 1 1   ? 27.640  9.822   -5.016  1.00 0.00 ? 98  MET A CA   2  
ATOM 1885  C C    . MET A 1 1   ? 26.693  8.689   -4.655  1.00 0.00 ? 98  MET A C    2  
ATOM 1886  O O    . MET A 1 1   ? 26.529  8.345   -3.483  1.00 0.00 ? 98  MET A O    2  
ATOM 1887  C CB   . MET A 1 1   ? 28.691  9.308   -6.004  1.00 0.00 ? 98  MET A CB   2  
ATOM 1888  C CG   . MET A 1 1   ? 29.480  10.406  -6.696  1.00 0.00 ? 98  MET A CG   2  
ATOM 1889  S SD   . MET A 1 1   ? 30.711  9.755   -7.846  1.00 0.00 ? 98  MET A SD   2  
ATOM 1890  C CE   . MET A 1 1   ? 29.671  8.812   -8.961  1.00 0.00 ? 98  MET A CE   2  
ATOM 1891  H H1   . MET A 1 1   ? 28.960  11.117  -4.060  1.00 0.00 ? 98  MET A H1   2  
ATOM 1892  H H2   . MET A 1 1   ? 28.779  9.621   -3.287  1.00 0.00 ? 98  MET A H2   2  
ATOM 1893  H H3   . MET A 1 1   ? 27.560  10.784  -3.179  1.00 0.00 ? 98  MET A H3   2  
ATOM 1894  H HA   . MET A 1 1   ? 27.072  10.609  -5.487  1.00 0.00 ? 98  MET A HA   2  
ATOM 1895  H HB2  . MET A 1 1   ? 29.387  8.678   -5.474  1.00 0.00 ? 98  MET A HB2  2  
ATOM 1896  H HB3  . MET A 1 1   ? 28.196  8.720   -6.762  1.00 0.00 ? 98  MET A HB3  2  
ATOM 1897  H HG2  . MET A 1 1   ? 28.794  11.034  -7.244  1.00 0.00 ? 98  MET A HG2  2  
ATOM 1898  H HG3  . MET A 1 1   ? 29.985  10.995  -5.945  1.00 0.00 ? 98  MET A HG3  2  
ATOM 1899  H HE1  . MET A 1 1   ? 30.280  8.375   -9.739  1.00 0.00 ? 98  MET A HE1  2  
ATOM 1900  H HE2  . MET A 1 1   ? 28.936  9.465   -9.407  1.00 0.00 ? 98  MET A HE2  2  
ATOM 1901  H HE3  . MET A 1 1   ? 29.172  8.027   -8.412  1.00 0.00 ? 98  MET A HE3  2  
ATOM 1902  N N    . TYR A 1 2   ? 26.068  8.128   -5.676  1.00 0.00 ? 99  TYR A N    2  
ATOM 1903  C CA   . TYR A 1 2   ? 25.188  6.985   -5.532  1.00 0.00 ? 99  TYR A CA   2  
ATOM 1904  C C    . TYR A 1 2   ? 25.476  6.014   -6.665  1.00 0.00 ? 99  TYR A C    2  
ATOM 1905  O O    . TYR A 1 2   ? 25.750  6.445   -7.787  1.00 0.00 ? 99  TYR A O    2  
ATOM 1906  C CB   . TYR A 1 2   ? 23.720  7.439   -5.564  1.00 0.00 ? 99  TYR A CB   2  
ATOM 1907  C CG   . TYR A 1 2   ? 22.703  6.330   -5.378  1.00 0.00 ? 99  TYR A CG   2  
ATOM 1908  C CD1  . TYR A 1 2   ? 22.344  5.531   -6.445  1.00 0.00 ? 99  TYR A CD1  2  
ATOM 1909  C CD2  . TYR A 1 2   ? 22.093  6.097   -4.153  1.00 0.00 ? 99  TYR A CD2  2  
ATOM 1910  C CE1  . TYR A 1 2   ? 21.416  4.527   -6.318  1.00 0.00 ? 99  TYR A CE1  2  
ATOM 1911  C CE2  . TYR A 1 2   ? 21.151  5.093   -4.008  1.00 0.00 ? 99  TYR A CE2  2  
ATOM 1912  C CZ   . TYR A 1 2   ? 20.817  4.308   -5.095  1.00 0.00 ? 99  TYR A CZ   2  
ATOM 1913  O OH   . TYR A 1 2   ? 19.878  3.313   -4.961  1.00 0.00 ? 99  TYR A OH   2  
ATOM 1914  H H    . TYR A 1 2   ? 26.207  8.498   -6.576  1.00 0.00 ? 99  TYR A H    2  
ATOM 1915  H HA   . TYR A 1 2   ? 25.398  6.499   -4.588  1.00 0.00 ? 99  TYR A HA   2  
ATOM 1916  H HB2  . TYR A 1 2   ? 23.560  8.163   -4.784  1.00 0.00 ? 99  TYR A HB2  2  
ATOM 1917  H HB3  . TYR A 1 2   ? 23.524  7.903   -6.521  1.00 0.00 ? 99  TYR A HB3  2  
ATOM 1918  H HD1  . TYR A 1 2   ? 22.812  5.704   -7.402  1.00 0.00 ? 99  TYR A HD1  2  
ATOM 1919  H HD2  . TYR A 1 2   ? 22.360  6.712   -3.305  1.00 0.00 ? 99  TYR A HD2  2  
ATOM 1920  H HE1  . TYR A 1 2   ? 21.166  3.917   -7.179  1.00 0.00 ? 99  TYR A HE1  2  
ATOM 1921  H HE2  . TYR A 1 2   ? 20.685  4.924   -3.050  1.00 0.00 ? 99  TYR A HE2  2  
ATOM 1922  H HH   . TYR A 1 2   ? 20.213  2.505   -5.363  1.00 0.00 ? 99  TYR A HH   2  
ATOM 1923  N N    . ILE A 1 3   ? 25.449  4.726   -6.355  1.00 0.00 ? 100 ILE A N    2  
ATOM 1924  C CA   . ILE A 1 3   ? 25.794  3.671   -7.311  1.00 0.00 ? 100 ILE A CA   2  
ATOM 1925  C C    . ILE A 1 3   ? 25.192  3.912   -8.693  1.00 0.00 ? 100 ILE A C    2  
ATOM 1926  O O    . ILE A 1 3   ? 25.900  3.944   -9.701  1.00 0.00 ? 100 ILE A O    2  
ATOM 1927  C CB   . ILE A 1 3   ? 25.321  2.303   -6.781  1.00 0.00 ? 100 ILE A CB   2  
ATOM 1928  C CG1  . ILE A 1 3   ? 25.940  2.032   -5.412  1.00 0.00 ? 100 ILE A CG1  2  
ATOM 1929  C CG2  . ILE A 1 3   ? 25.683  1.192   -7.756  1.00 0.00 ? 100 ILE A CG2  2  
ATOM 1930  C CD1  . ILE A 1 3   ? 25.208  0.981   -4.614  1.00 0.00 ? 100 ILE A CD1  2  
ATOM 1931  H H    . ILE A 1 3   ? 25.198  4.471   -5.441  1.00 0.00 ? 100 ILE A H    2  
ATOM 1932  H HA   . ILE A 1 3   ? 26.858  3.646   -7.401  1.00 0.00 ? 100 ILE A HA   2  
ATOM 1933  H HB   . ILE A 1 3   ? 24.247  2.329   -6.684  1.00 0.00 ? 100 ILE A HB   2  
ATOM 1934  H HG12 . ILE A 1 3   ? 26.958  1.696   -5.544  1.00 0.00 ? 100 ILE A HG12 2  
ATOM 1935  H HG13 . ILE A 1 3   ? 25.940  2.944   -4.840  1.00 0.00 ? 100 ILE A HG13 2  
ATOM 1936  H HG21 . ILE A 1 3   ? 25.237  1.399   -8.717  1.00 0.00 ? 100 ILE A HG21 2  
ATOM 1937  H HG22 . ILE A 1 3   ? 25.310  0.250   -7.381  1.00 0.00 ? 100 ILE A HG22 2  
ATOM 1938  H HG23 . ILE A 1 3   ? 26.757  1.139   -7.860  1.00 0.00 ? 100 ILE A HG23 2  
ATOM 1939  H HD11 . ILE A 1 3   ? 25.713  0.830   -3.672  1.00 0.00 ? 100 ILE A HD11 2  
ATOM 1940  H HD12 . ILE A 1 3   ? 25.189  0.054   -5.167  1.00 0.00 ? 100 ILE A HD12 2  
ATOM 1941  H HD13 . ILE A 1 3   ? 24.198  1.315   -4.431  1.00 0.00 ? 100 ILE A HD13 2  
ATOM 1942  N N    . VAL A 1 4   ? 23.894  4.109   -8.714  1.00 0.00 ? 101 VAL A N    2  
ATOM 1943  C CA   . VAL A 1 4   ? 23.147  4.226   -9.958  1.00 0.00 ? 101 VAL A CA   2  
ATOM 1944  C C    . VAL A 1 4   ? 22.510  5.606   -10.095 1.00 0.00 ? 101 VAL A C    2  
ATOM 1945  O O    . VAL A 1 4   ? 22.304  6.303   -9.110  1.00 0.00 ? 101 VAL A O    2  
ATOM 1946  C CB   . VAL A 1 4   ? 22.034  3.161   -10.032 1.00 0.00 ? 101 VAL A CB   2  
ATOM 1947  C CG1  . VAL A 1 4   ? 21.514  2.997   -11.450 1.00 0.00 ? 101 VAL A CG1  2  
ATOM 1948  C CG2  . VAL A 1 4   ? 22.530  1.839   -9.489  1.00 0.00 ? 101 VAL A CG2  2  
ATOM 1949  H H    . VAL A 1 4   ? 23.426  4.186   -7.864  1.00 0.00 ? 101 VAL A H    2  
ATOM 1950  H HA   . VAL A 1 4   ? 23.824  4.065   -10.772 1.00 0.00 ? 101 VAL A HA   2  
ATOM 1951  H HB   . VAL A 1 4   ? 21.214  3.490   -9.411  1.00 0.00 ? 101 VAL A HB   2  
ATOM 1952  H HG11 . VAL A 1 4   ? 21.164  3.951   -11.817 1.00 0.00 ? 101 VAL A HG11 2  
ATOM 1953  H HG12 . VAL A 1 4   ? 20.699  2.289   -11.456 1.00 0.00 ? 101 VAL A HG12 2  
ATOM 1954  H HG13 . VAL A 1 4   ? 22.309  2.637   -12.086 1.00 0.00 ? 101 VAL A HG13 2  
ATOM 1955  H HG21 . VAL A 1 4   ? 21.742  1.110   -9.554  1.00 0.00 ? 101 VAL A HG21 2  
ATOM 1956  H HG22 . VAL A 1 4   ? 22.826  1.965   -8.457  1.00 0.00 ? 101 VAL A HG22 2  
ATOM 1957  H HG23 . VAL A 1 4   ? 23.379  1.509   -10.070 1.00 0.00 ? 101 VAL A HG23 2  
ATOM 1958  N N    . GLN A 1 5   ? 22.219  6.009   -11.318 1.00 0.00 ? 102 GLN A N    2  
ATOM 1959  C CA   . GLN A 1 5   ? 21.386  7.180   -11.543 1.00 0.00 ? 102 GLN A CA   2  
ATOM 1960  C C    . GLN A 1 5   ? 20.126  6.768   -12.303 1.00 0.00 ? 102 GLN A C    2  
ATOM 1961  O O    . GLN A 1 5   ? 19.993  7.005   -13.505 1.00 0.00 ? 102 GLN A O    2  
ATOM 1962  C CB   . GLN A 1 5   ? 22.160  8.272   -12.288 1.00 0.00 ? 102 GLN A CB   2  
ATOM 1963  C CG   . GLN A 1 5   ? 22.889  7.790   -13.529 1.00 0.00 ? 102 GLN A CG   2  
ATOM 1964  C CD   . GLN A 1 5   ? 23.657  8.903   -14.212 1.00 0.00 ? 102 GLN A CD   2  
ATOM 1965  O OE1  . GLN A 1 5   ? 24.705  8.671   -14.811 1.00 0.00 ? 102 GLN A OE1  2  
ATOM 1966  N NE2  . GLN A 1 5   ? 23.141  10.117  -14.133 1.00 0.00 ? 102 GLN A NE2  2  
ATOM 1967  H H    . GLN A 1 5   ? 22.571  5.512   -12.087 1.00 0.00 ? 102 GLN A H    2  
ATOM 1968  H HA   . GLN A 1 5   ? 21.091  7.558   -10.575 1.00 0.00 ? 102 GLN A HA   2  
ATOM 1969  H HB2  . GLN A 1 5   ? 21.466  9.043   -12.585 1.00 0.00 ? 102 GLN A HB2  2  
ATOM 1970  H HB3  . GLN A 1 5   ? 22.888  8.700   -11.614 1.00 0.00 ? 102 GLN A HB3  2  
ATOM 1971  H HG2  . GLN A 1 5   ? 23.584  7.013   -13.244 1.00 0.00 ? 102 GLN A HG2  2  
ATOM 1972  H HG3  . GLN A 1 5   ? 22.167  7.389   -14.224 1.00 0.00 ? 102 GLN A HG3  2  
ATOM 1973  H HE21 . GLN A 1 5   ? 22.299  10.234  -13.643 1.00 0.00 ? 102 GLN A HE21 2  
ATOM 1974  H HE22 . GLN A 1 5   ? 23.617  10.853  -14.571 1.00 0.00 ? 102 GLN A HE22 2  
ATOM 1975  N N    . PRO A 1 6   ? 19.190  6.106   -11.605 1.00 0.00 ? 103 PRO A N    2  
ATOM 1976  C CA   . PRO A 1 6   ? 17.995  5.545   -12.198 1.00 0.00 ? 103 PRO A CA   2  
ATOM 1977  C C    . PRO A 1 6   ? 16.757  6.404   -11.967 1.00 0.00 ? 103 PRO A C    2  
ATOM 1978  O O    . PRO A 1 6   ? 16.850  7.593   -11.648 1.00 0.00 ? 103 PRO A O    2  
ATOM 1979  C CB   . PRO A 1 6   ? 17.880  4.238   -11.420 1.00 0.00 ? 103 PRO A CB   2  
ATOM 1980  C CG   . PRO A 1 6   ? 18.371  4.573   -10.042 1.00 0.00 ? 103 PRO A CG   2  
ATOM 1981  C CD   . PRO A 1 6   ? 19.215  5.826   -10.163 1.00 0.00 ? 103 PRO A CD   2  
ATOM 1982  H HA   . PRO A 1 6   ? 18.117  5.339   -13.249 1.00 0.00 ? 103 PRO A HA   2  
ATOM 1983  H HB2  . PRO A 1 6   ? 16.849  3.913   -11.406 1.00 0.00 ? 103 PRO A HB2  2  
ATOM 1984  H HB3  . PRO A 1 6   ? 18.495  3.482   -11.885 1.00 0.00 ? 103 PRO A HB3  2  
ATOM 1985  H HG2  . PRO A 1 6   ? 17.530  4.754   -9.390  1.00 0.00 ? 103 PRO A HG2  2  
ATOM 1986  H HG3  . PRO A 1 6   ? 18.969  3.758   -9.660  1.00 0.00 ? 103 PRO A HG3  2  
ATOM 1987  H HD2  . PRO A 1 6   ? 18.769  6.636   -9.604  1.00 0.00 ? 103 PRO A HD2  2  
ATOM 1988  H HD3  . PRO A 1 6   ? 20.222  5.638   -9.822  1.00 0.00 ? 103 PRO A HD3  2  
ATOM 1989  N N    . ASP A 1 7   ? 15.600  5.784   -12.131 1.00 0.00 ? 104 ASP A N    2  
ATOM 1990  C CA   . ASP A 1 7   ? 14.325  6.419   -11.847 1.00 0.00 ? 104 ASP A CA   2  
ATOM 1991  C C    . ASP A 1 7   ? 13.370  5.375   -11.287 1.00 0.00 ? 104 ASP A C    2  
ATOM 1992  O O    . ASP A 1 7   ? 12.808  4.578   -12.042 1.00 0.00 ? 104 ASP A O    2  
ATOM 1993  C CB   . ASP A 1 7   ? 13.740  7.059   -13.109 1.00 0.00 ? 104 ASP A CB   2  
ATOM 1994  C CG   . ASP A 1 7   ? 12.413  7.751   -12.853 1.00 0.00 ? 104 ASP A CG   2  
ATOM 1995  O OD1  . ASP A 1 7   ? 12.393  8.769   -12.125 1.00 0.00 ? 104 ASP A OD1  2  
ATOM 1996  O OD2  . ASP A 1 7   ? 11.387  7.297   -13.396 1.00 0.00 ? 104 ASP A OD2  2  
ATOM 1997  H H    . ASP A 1 7   ? 15.603  4.855   -12.450 1.00 0.00 ? 104 ASP A H    2  
ATOM 1998  H HA   . ASP A 1 7   ? 14.489  7.183   -11.102 1.00 0.00 ? 104 ASP A HA   2  
ATOM 1999  H HB2  . ASP A 1 7   ? 14.437  7.789   -13.489 1.00 0.00 ? 104 ASP A HB2  2  
ATOM 2000  H HB3  . ASP A 1 7   ? 13.588  6.292   -13.853 1.00 0.00 ? 104 ASP A HB3  2  
ATOM 2001  N N    . PRO A 1 8   ? 13.219  5.343   -9.950  1.00 0.00 ? 105 PRO A N    2  
ATOM 2002  C CA   . PRO A 1 8   ? 12.393  4.343   -9.249  1.00 0.00 ? 105 PRO A CA   2  
ATOM 2003  C C    . PRO A 1 8   ? 10.922  4.388   -9.674  1.00 0.00 ? 105 PRO A C    2  
ATOM 2004  O O    . PRO A 1 8   ? 10.509  5.302   -10.390 1.00 0.00 ? 105 PRO A O    2  
ATOM 2005  C CB   . PRO A 1 8   ? 12.534  4.737   -7.769  1.00 0.00 ? 105 PRO A CB   2  
ATOM 2006  C CG   . PRO A 1 8   ? 13.771  5.562   -7.700  1.00 0.00 ? 105 PRO A CG   2  
ATOM 2007  C CD   . PRO A 1 8   ? 13.845  6.288   -9.009  1.00 0.00 ? 105 PRO A CD   2  
ATOM 2008  H HA   . PRO A 1 8   ? 12.777  3.345   -9.395  1.00 0.00 ? 105 PRO A HA   2  
ATOM 2009  H HB2  . PRO A 1 8   ? 11.667  5.302   -7.461  1.00 0.00 ? 105 PRO A HB2  2  
ATOM 2010  H HB3  . PRO A 1 8   ? 12.623  3.847   -7.163  1.00 0.00 ? 105 PRO A HB3  2  
ATOM 2011  H HG2  . PRO A 1 8   ? 13.699  6.265   -6.884  1.00 0.00 ? 105 PRO A HG2  2  
ATOM 2012  H HG3  . PRO A 1 8   ? 14.633  4.924   -7.575  1.00 0.00 ? 105 PRO A HG3  2  
ATOM 2013  H HD2  . PRO A 1 8   ? 13.289  7.212   -8.961  1.00 0.00 ? 105 PRO A HD2  2  
ATOM 2014  H HD3  . PRO A 1 8   ? 14.875  6.476   -9.278  1.00 0.00 ? 105 PRO A HD3  2  
ATOM 2015  N N    . PRO A 1 9   ? 10.114  3.394   -9.249  1.00 0.00 ? 106 PRO A N    2  
ATOM 2016  C CA   . PRO A 1 9   ? 8.683   3.350   -9.555  1.00 0.00 ? 106 PRO A CA   2  
ATOM 2017  C C    . PRO A 1 9   ? 7.992   4.666   -9.229  1.00 0.00 ? 106 PRO A C    2  
ATOM 2018  O O    . PRO A 1 9   ? 8.194   5.247   -8.158  1.00 0.00 ? 106 PRO A O    2  
ATOM 2019  C CB   . PRO A 1 9   ? 8.139   2.218   -8.669  1.00 0.00 ? 106 PRO A CB   2  
ATOM 2020  C CG   . PRO A 1 9   ? 9.252   1.864   -7.737  1.00 0.00 ? 106 PRO A CG   2  
ATOM 2021  C CD   . PRO A 1 9   ? 10.519  2.237   -8.445  1.00 0.00 ? 106 PRO A CD   2  
ATOM 2022  H HA   . PRO A 1 9   ? 8.513   3.109   -10.596 1.00 0.00 ? 106 PRO A HA   2  
ATOM 2023  H HB2  . PRO A 1 9   ? 7.272   2.570   -8.130  1.00 0.00 ? 106 PRO A HB2  2  
ATOM 2024  H HB3  . PRO A 1 9   ? 7.865   1.377   -9.288  1.00 0.00 ? 106 PRO A HB3  2  
ATOM 2025  H HG2  . PRO A 1 9   ? 9.156   2.426   -6.820  1.00 0.00 ? 106 PRO A HG2  2  
ATOM 2026  H HG3  . PRO A 1 9   ? 9.235   0.804   -7.532  1.00 0.00 ? 106 PRO A HG3  2  
ATOM 2027  H HD2  . PRO A 1 9   ? 11.285  2.508   -7.734  1.00 0.00 ? 106 PRO A HD2  2  
ATOM 2028  H HD3  . PRO A 1 9   ? 10.855  1.427   -9.075  1.00 0.00 ? 106 PRO A HD3  2  
ATOM 2029  N N    . LEU A 1 10  ? 7.186   5.131   -10.162 1.00 0.00 ? 107 LEU A N    2  
ATOM 2030  C CA   . LEU A 1 10  ? 6.515   6.409   -10.031 1.00 0.00 ? 107 LEU A CA   2  
ATOM 2031  C C    . LEU A 1 10  ? 5.013   6.213   -10.129 1.00 0.00 ? 107 LEU A C    2  
ATOM 2032  O O    . LEU A 1 10  ? 4.549   5.089   -10.312 1.00 0.00 ? 107 LEU A O    2  
ATOM 2033  C CB   . LEU A 1 10  ? 6.995   7.392   -11.111 1.00 0.00 ? 107 LEU A CB   2  
ATOM 2034  C CG   . LEU A 1 10  ? 6.843   6.920   -12.566 1.00 0.00 ? 107 LEU A CG   2  
ATOM 2035  C CD1  . LEU A 1 10  ? 6.765   8.111   -13.503 1.00 0.00 ? 107 LEU A CD1  2  
ATOM 2036  C CD2  . LEU A 1 10  ? 8.007   6.024   -12.977 1.00 0.00 ? 107 LEU A CD2  2  
ATOM 2037  H H    . LEU A 1 10  ? 7.021   4.585   -10.961 1.00 0.00 ? 107 LEU A H    2  
ATOM 2038  H HA   . LEU A 1 10  ? 6.750   6.810   -9.058  1.00 0.00 ? 107 LEU A HA   2  
ATOM 2039  H HB2  . LEU A 1 10  ? 6.440   8.313   -10.998 1.00 0.00 ? 107 LEU A HB2  2  
ATOM 2040  H HB3  . LEU A 1 10  ? 8.040   7.602   -10.934 1.00 0.00 ? 107 LEU A HB3  2  
ATOM 2041  H HG   . LEU A 1 10  ? 5.930   6.355   -12.663 1.00 0.00 ? 107 LEU A HG   2  
ATOM 2042  H HD11 . LEU A 1 10  ? 5.908   8.714   -13.246 1.00 0.00 ? 107 LEU A HD11 2  
ATOM 2043  H HD12 . LEU A 1 10  ? 6.669   7.762   -14.519 1.00 0.00 ? 107 LEU A HD12 2  
ATOM 2044  H HD13 . LEU A 1 10  ? 7.663   8.701   -13.409 1.00 0.00 ? 107 LEU A HD13 2  
ATOM 2045  H HD21 . LEU A 1 10  ? 8.931   6.576   -12.897 1.00 0.00 ? 107 LEU A HD21 2  
ATOM 2046  H HD22 . LEU A 1 10  ? 7.868   5.701   -13.997 1.00 0.00 ? 107 LEU A HD22 2  
ATOM 2047  H HD23 . LEU A 1 10  ? 8.046   5.162   -12.329 1.00 0.00 ? 107 LEU A HD23 2  
ATOM 2048  N N    . GLU A 1 11  ? 4.263   7.302   -9.996  1.00 0.00 ? 108 GLU A N    2  
ATOM 2049  C CA   . GLU A 1 11  ? 2.807   7.263   -10.111 1.00 0.00 ? 108 GLU A CA   2  
ATOM 2050  C C    . GLU A 1 11  ? 2.203   6.272   -9.119  1.00 0.00 ? 108 GLU A C    2  
ATOM 2051  O O    . GLU A 1 11  ? 1.363   5.442   -9.479  1.00 0.00 ? 108 GLU A O    2  
ATOM 2052  C CB   . GLU A 1 11  ? 2.393   6.899   -11.540 1.00 0.00 ? 108 GLU A CB   2  
ATOM 2053  C CG   . GLU A 1 11  ? 2.882   7.888   -12.583 1.00 0.00 ? 108 GLU A CG   2  
ATOM 2054  C CD   . GLU A 1 11  ? 2.442   7.516   -13.980 1.00 0.00 ? 108 GLU A CD   2  
ATOM 2055  O OE1  . GLU A 1 11  ? 1.247   7.694   -14.295 1.00 0.00 ? 108 GLU A OE1  2  
ATOM 2056  O OE2  . GLU A 1 11  ? 3.282   7.041   -14.768 1.00 0.00 ? 108 GLU A OE2  2  
ATOM 2057  H H    . GLU A 1 11  ? 4.700   8.159   -9.807  1.00 0.00 ? 108 GLU A H    2  
ATOM 2058  H HA   . GLU A 1 11  ? 2.433   8.249   -9.881  1.00 0.00 ? 108 GLU A HA   2  
ATOM 2059  H HB2  . GLU A 1 11  ? 2.794   5.927   -11.783 1.00 0.00 ? 108 GLU A HB2  2  
ATOM 2060  H HB3  . GLU A 1 11  ? 1.316   6.858   -11.592 1.00 0.00 ? 108 GLU A HB3  2  
ATOM 2061  H HG2  . GLU A 1 11  ? 2.490   8.864   -12.346 1.00 0.00 ? 108 GLU A HG2  2  
ATOM 2062  H HG3  . GLU A 1 11  ? 3.962   7.917   -12.555 1.00 0.00 ? 108 GLU A HG3  2  
ATOM 2063  N N    . LEU A 1 12  ? 2.650   6.355   -7.873  1.00 0.00 ? 109 LEU A N    2  
ATOM 2064  C CA   . LEU A 1 12  ? 2.146   5.491   -6.819  1.00 0.00 ? 109 LEU A CA   2  
ATOM 2065  C C    . LEU A 1 12  ? 0.747   5.930   -6.409  1.00 0.00 ? 109 LEU A C    2  
ATOM 2066  O O    . LEU A 1 12  ? 0.580   6.846   -5.605  1.00 0.00 ? 109 LEU A O    2  
ATOM 2067  C CB   . LEU A 1 12  ? 3.084   5.518   -5.607  1.00 0.00 ? 109 LEU A CB   2  
ATOM 2068  C CG   . LEU A 1 12  ? 2.693   4.583   -4.459  1.00 0.00 ? 109 LEU A CG   2  
ATOM 2069  C CD1  . LEU A 1 12  ? 2.761   3.133   -4.904  1.00 0.00 ? 109 LEU A CD1  2  
ATOM 2070  C CD2  . LEU A 1 12  ? 3.590   4.812   -3.252  1.00 0.00 ? 109 LEU A CD2  2  
ATOM 2071  H H    . LEU A 1 12  ? 3.337   7.020   -7.655  1.00 0.00 ? 109 LEU A H    2  
ATOM 2072  H HA   . LEU A 1 12  ? 2.097   4.485   -7.208  1.00 0.00 ? 109 LEU A HA   2  
ATOM 2073  H HB2  . LEU A 1 12  ? 4.076   5.250   -5.941  1.00 0.00 ? 109 LEU A HB2  2  
ATOM 2074  H HB3  . LEU A 1 12  ? 3.112   6.527   -5.225  1.00 0.00 ? 109 LEU A HB3  2  
ATOM 2075  H HG   . LEU A 1 12  ? 1.676   4.794   -4.164  1.00 0.00 ? 109 LEU A HG   2  
ATOM 2076  H HD11 . LEU A 1 12  ? 3.761   2.905   -5.240  1.00 0.00 ? 109 LEU A HD11 2  
ATOM 2077  H HD12 . LEU A 1 12  ? 2.064   2.972   -5.713  1.00 0.00 ? 109 LEU A HD12 2  
ATOM 2078  H HD13 . LEU A 1 12  ? 2.505   2.489   -4.076  1.00 0.00 ? 109 LEU A HD13 2  
ATOM 2079  H HD21 . LEU A 1 12  ? 3.486   5.832   -2.915  1.00 0.00 ? 109 LEU A HD21 2  
ATOM 2080  H HD22 . LEU A 1 12  ? 4.617   4.627   -3.527  1.00 0.00 ? 109 LEU A HD22 2  
ATOM 2081  H HD23 . LEU A 1 12  ? 3.304   4.139   -2.458  1.00 0.00 ? 109 LEU A HD23 2  
ATOM 2082  N N    . ALA A 1 13  ? -0.256  5.289   -6.980  1.00 0.00 ? 110 ALA A N    2  
ATOM 2083  C CA   . ALA A 1 13  ? -1.634  5.620   -6.678  1.00 0.00 ? 110 ALA A CA   2  
ATOM 2084  C C    . ALA A 1 13  ? -2.227  4.595   -5.734  1.00 0.00 ? 110 ALA A C    2  
ATOM 2085  O O    . ALA A 1 13  ? -2.195  3.392   -6.001  1.00 0.00 ? 110 ALA A O    2  
ATOM 2086  C CB   . ALA A 1 13  ? -2.463  5.711   -7.947  1.00 0.00 ? 110 ALA A CB   2  
ATOM 2087  H H    . ALA A 1 13  ? -0.062  4.554   -7.608  1.00 0.00 ? 110 ALA A H    2  
ATOM 2088  H HA   . ALA A 1 13  ? -1.646  6.587   -6.197  1.00 0.00 ? 110 ALA A HA   2  
ATOM 2089  H HB1  . ALA A 1 13  ? -2.017  6.430   -8.617  1.00 0.00 ? 110 ALA A HB1  2  
ATOM 2090  H HB2  . ALA A 1 13  ? -3.465  6.025   -7.697  1.00 0.00 ? 110 ALA A HB2  2  
ATOM 2091  H HB3  . ALA A 1 13  ? -2.497  4.744   -8.425  1.00 0.00 ? 110 ALA A HB3  2  
ATOM 2092  N N    . VAL A 1 14  ? -2.755  5.077   -4.627  1.00 0.00 ? 111 VAL A N    2  
ATOM 2093  C CA   . VAL A 1 14  ? -3.346  4.213   -3.627  1.00 0.00 ? 111 VAL A CA   2  
ATOM 2094  C C    . VAL A 1 14  ? -4.853  4.406   -3.602  1.00 0.00 ? 111 VAL A C    2  
ATOM 2095  O O    . VAL A 1 14  ? -5.344  5.503   -3.338  1.00 0.00 ? 111 VAL A O    2  
ATOM 2096  C CB   . VAL A 1 14  ? -2.784  4.504   -2.225  1.00 0.00 ? 111 VAL A CB   2  
ATOM 2097  C CG1  . VAL A 1 14  ? -3.159  3.399   -1.254  1.00 0.00 ? 111 VAL A CG1  2  
ATOM 2098  C CG2  . VAL A 1 14  ? -1.276  4.696   -2.274  1.00 0.00 ? 111 VAL A CG2  2  
ATOM 2099  H H    . VAL A 1 14  ? -2.750  6.046   -4.479  1.00 0.00 ? 111 VAL A H    2  
ATOM 2100  H HA   . VAL A 1 14  ? -3.121  3.188   -3.884  1.00 0.00 ? 111 VAL A HA   2  
ATOM 2101  H HB   . VAL A 1 14  ? -3.231  5.419   -1.873  1.00 0.00 ? 111 VAL A HB   2  
ATOM 2102  H HG11 . VAL A 1 14  ? -4.234  3.351   -1.165  1.00 0.00 ? 111 VAL A HG11 2  
ATOM 2103  H HG12 . VAL A 1 14  ? -2.725  3.605   -0.287  1.00 0.00 ? 111 VAL A HG12 2  
ATOM 2104  H HG13 . VAL A 1 14  ? -2.786  2.456   -1.623  1.00 0.00 ? 111 VAL A HG13 2  
ATOM 2105  H HG21 . VAL A 1 14  ? -1.034  5.463   -2.997  1.00 0.00 ? 111 VAL A HG21 2  
ATOM 2106  H HG22 . VAL A 1 14  ? -0.804  3.769   -2.563  1.00 0.00 ? 111 VAL A HG22 2  
ATOM 2107  H HG23 . VAL A 1 14  ? -0.920  4.996   -1.301  1.00 0.00 ? 111 VAL A HG23 2  
ATOM 2108  N N    . GLU A 1 15  ? -5.577  3.346   -3.885  1.00 0.00 ? 112 GLU A N    2  
ATOM 2109  C CA   . GLU A 1 15  ? -7.027  3.402   -3.922  1.00 0.00 ? 112 GLU A CA   2  
ATOM 2110  C C    . GLU A 1 15  ? -7.616  2.293   -3.063  1.00 0.00 ? 112 GLU A C    2  
ATOM 2111  O O    . GLU A 1 15  ? -7.046  1.209   -2.963  1.00 0.00 ? 112 GLU A O    2  
ATOM 2112  C CB   . GLU A 1 15  ? -7.523  3.283   -5.367  1.00 0.00 ? 112 GLU A CB   2  
ATOM 2113  C CG   . GLU A 1 15  ? -9.036  3.349   -5.505  1.00 0.00 ? 112 GLU A CG   2  
ATOM 2114  C CD   . GLU A 1 15  ? -9.619  4.639   -4.962  1.00 0.00 ? 112 GLU A CD   2  
ATOM 2115  O OE1  . GLU A 1 15  ? -9.689  5.630   -5.718  1.00 0.00 ? 112 GLU A OE1  2  
ATOM 2116  O OE2  . GLU A 1 15  ? -10.015 4.668   -3.777  1.00 0.00 ? 112 GLU A OE2  2  
ATOM 2117  H H    . GLU A 1 15  ? -5.126  2.495   -4.067  1.00 0.00 ? 112 GLU A H    2  
ATOM 2118  H HA   . GLU A 1 15  ? -7.334  4.357   -3.521  1.00 0.00 ? 112 GLU A HA   2  
ATOM 2119  H HB2  . GLU A 1 15  ? -7.096  4.087   -5.949  1.00 0.00 ? 112 GLU A HB2  2  
ATOM 2120  H HB3  . GLU A 1 15  ? -7.187  2.340   -5.774  1.00 0.00 ? 112 GLU A HB3  2  
ATOM 2121  H HG2  . GLU A 1 15  ? -9.293  3.267   -6.549  1.00 0.00 ? 112 GLU A HG2  2  
ATOM 2122  H HG3  . GLU A 1 15  ? -9.468  2.519   -4.963  1.00 0.00 ? 112 GLU A HG3  2  
ATOM 2123  N N    . VAL A 1 16  ? -8.746  2.571   -2.436  1.00 0.00 ? 113 VAL A N    2  
ATOM 2124  C CA   . VAL A 1 16  ? -9.416  1.591   -1.603  1.00 0.00 ? 113 VAL A CA   2  
ATOM 2125  C C    . VAL A 1 16  ? -10.600 0.981   -2.349  1.00 0.00 ? 113 VAL A C    2  
ATOM 2126  O O    . VAL A 1 16  ? -11.544 1.676   -2.729  1.00 0.00 ? 113 VAL A O    2  
ATOM 2127  C CB   . VAL A 1 16  ? -9.871  2.209   -0.258  1.00 0.00 ? 113 VAL A CB   2  
ATOM 2128  C CG1  . VAL A 1 16  ? -10.743 3.439   -0.474  1.00 0.00 ? 113 VAL A CG1  2  
ATOM 2129  C CG2  . VAL A 1 16  ? -10.593 1.177   0.593   1.00 0.00 ? 113 VAL A CG2  2  
ATOM 2130  H H    . VAL A 1 16  ? -9.156  3.458   -2.557  1.00 0.00 ? 113 VAL A H    2  
ATOM 2131  H HA   . VAL A 1 16  ? -8.705  0.806   -1.389  1.00 0.00 ? 113 VAL A HA   2  
ATOM 2132  H HB   . VAL A 1 16  ? -8.988  2.523   0.278   1.00 0.00 ? 113 VAL A HB   2  
ATOM 2133  H HG11 . VAL A 1 16  ? -10.184 4.186   -1.017  1.00 0.00 ? 113 VAL A HG11 2  
ATOM 2134  H HG12 . VAL A 1 16  ? -11.044 3.840   0.483   1.00 0.00 ? 113 VAL A HG12 2  
ATOM 2135  H HG13 . VAL A 1 16  ? -11.620 3.163   -1.040  1.00 0.00 ? 113 VAL A HG13 2  
ATOM 2136  H HG21 . VAL A 1 16  ? -10.911 1.631   1.519   1.00 0.00 ? 113 VAL A HG21 2  
ATOM 2137  H HG22 . VAL A 1 16  ? -9.926  0.355   0.804   1.00 0.00 ? 113 VAL A HG22 2  
ATOM 2138  H HG23 . VAL A 1 16  ? -11.457 0.810   0.057   1.00 0.00 ? 113 VAL A HG23 2  
ATOM 2139  N N    . LYS A 1 17  ? -10.538 -0.319  -2.576  1.00 0.00 ? 114 LYS A N    2  
ATOM 2140  C CA   . LYS A 1 17  ? -11.576 -1.006  -3.325  1.00 0.00 ? 114 LYS A CA   2  
ATOM 2141  C C    . LYS A 1 17  ? -12.557 -1.671  -2.375  1.00 0.00 ? 114 LYS A C    2  
ATOM 2142  O O    . LYS A 1 17  ? -12.159 -2.380  -1.448  1.00 0.00 ? 114 LYS A O    2  
ATOM 2143  C CB   . LYS A 1 17  ? -10.964 -2.046  -4.269  1.00 0.00 ? 114 LYS A CB   2  
ATOM 2144  C CG   . LYS A 1 17  ? -9.913  -1.477  -5.217  1.00 0.00 ? 114 LYS A CG   2  
ATOM 2145  C CD   . LYS A 1 17  ? -10.432 -0.292  -6.031  1.00 0.00 ? 114 LYS A CD   2  
ATOM 2146  C CE   . LYS A 1 17  ? -11.450 -0.710  -7.083  1.00 0.00 ? 114 LYS A CE   2  
ATOM 2147  N NZ   . LYS A 1 17  ? -11.880 0.441   -7.922  1.00 0.00 ? 114 LYS A NZ   2  
ATOM 2148  H H    . LYS A 1 17  ? -9.781  -0.837  -2.217  1.00 0.00 ? 114 LYS A H    2  
ATOM 2149  H HA   . LYS A 1 17  ? -12.106 -0.269  -3.909  1.00 0.00 ? 114 LYS A HA   2  
ATOM 2150  H HB2  . LYS A 1 17  ? -10.496 -2.817  -3.674  1.00 0.00 ? 114 LYS A HB2  2  
ATOM 2151  H HB3  . LYS A 1 17  ? -11.751 -2.492  -4.857  1.00 0.00 ? 114 LYS A HB3  2  
ATOM 2152  H HG2  . LYS A 1 17  ? -9.064  -1.149  -4.637  1.00 0.00 ? 114 LYS A HG2  2  
ATOM 2153  H HG3  . LYS A 1 17  ? -9.600  -2.257  -5.897  1.00 0.00 ? 114 LYS A HG3  2  
ATOM 2154  H HD2  . LYS A 1 17  ? -10.898 0.411   -5.360  1.00 0.00 ? 114 LYS A HD2  2  
ATOM 2155  H HD3  . LYS A 1 17  ? -9.596  0.184   -6.523  1.00 0.00 ? 114 LYS A HD3  2  
ATOM 2156  H HE2  . LYS A 1 17  ? -11.006 -1.461  -7.720  1.00 0.00 ? 114 LYS A HE2  2  
ATOM 2157  H HE3  . LYS A 1 17  ? -12.315 -1.124  -6.589  1.00 0.00 ? 114 LYS A HE3  2  
ATOM 2158  H HZ1  . LYS A 1 17  ? -12.590 0.133   -8.618  1.00 0.00 ? 114 LYS A HZ1  2  
ATOM 2159  H HZ2  . LYS A 1 17  ? -11.065 0.841   -8.431  1.00 0.00 ? 114 LYS A HZ2  2  
ATOM 2160  H HZ3  . LYS A 1 17  ? -12.298 1.183   -7.326  1.00 0.00 ? 114 LYS A HZ3  2  
ATOM 2161  N N    . GLN A 1 18  ? -13.838 -1.426  -2.602  1.00 0.00 ? 115 GLN A N    2  
ATOM 2162  C CA   . GLN A 1 18  ? -14.889 -1.985  -1.767  1.00 0.00 ? 115 GLN A CA   2  
ATOM 2163  C C    . GLN A 1 18  ? -15.822 -2.851  -2.608  1.00 0.00 ? 115 GLN A C    2  
ATOM 2164  O O    . GLN A 1 18  ? -16.837 -2.380  -3.124  1.00 0.00 ? 115 GLN A O    2  
ATOM 2165  C CB   . GLN A 1 18  ? -15.668 -0.863  -1.086  1.00 0.00 ? 115 GLN A CB   2  
ATOM 2166  C CG   . GLN A 1 18  ? -14.791 0.045   -0.240  1.00 0.00 ? 115 GLN A CG   2  
ATOM 2167  C CD   . GLN A 1 18  ? -15.552 1.215   0.345   1.00 0.00 ? 115 GLN A CD   2  
ATOM 2168  O OE1  . GLN A 1 18  ? -16.519 1.703   -0.242  1.00 0.00 ? 115 GLN A OE1  2  
ATOM 2169  N NE2  . GLN A 1 18  ? -15.120 1.676   1.504   1.00 0.00 ? 115 GLN A NE2  2  
ATOM 2170  H H    . GLN A 1 18  ? -14.086 -0.852  -3.357  1.00 0.00 ? 115 GLN A H    2  
ATOM 2171  H HA   . GLN A 1 18  ? -14.423 -2.600  -1.012  1.00 0.00 ? 115 GLN A HA   2  
ATOM 2172  H HB2  . GLN A 1 18  ? -16.151 -0.261  -1.842  1.00 0.00 ? 115 GLN A HB2  2  
ATOM 2173  H HB3  . GLN A 1 18  ? -16.422 -1.297  -0.447  1.00 0.00 ? 115 GLN A HB3  2  
ATOM 2174  H HG2  . GLN A 1 18  ? -14.372 -0.535  0.570   1.00 0.00 ? 115 GLN A HG2  2  
ATOM 2175  H HG3  . GLN A 1 18  ? -13.991 0.426   -0.857  1.00 0.00 ? 115 GLN A HG3  2  
ATOM 2176  H HE21 . GLN A 1 18  ? -14.342 1.244   1.911   1.00 0.00 ? 115 GLN A HE21 2  
ATOM 2177  H HE22 . GLN A 1 18  ? -15.605 2.423   1.916   1.00 0.00 ? 115 GLN A HE22 2  
ATOM 2178  N N    . PRO A 1 19  ? -15.463 -4.128  -2.775  1.00 0.00 ? 116 PRO A N    2  
ATOM 2179  C CA   . PRO A 1 19  ? -16.220 -5.078  -3.590  1.00 0.00 ? 116 PRO A CA   2  
ATOM 2180  C C    . PRO A 1 19  ? -17.489 -5.567  -2.895  1.00 0.00 ? 116 PRO A C    2  
ATOM 2181  O O    . PRO A 1 19  ? -17.657 -5.410  -1.684  1.00 0.00 ? 116 PRO A O    2  
ATOM 2182  C CB   . PRO A 1 19  ? -15.239 -6.243  -3.793  1.00 0.00 ? 116 PRO A CB   2  
ATOM 2183  C CG   . PRO A 1 19  ? -13.935 -5.773  -3.237  1.00 0.00 ? 116 PRO A CG   2  
ATOM 2184  C CD   . PRO A 1 19  ? -14.277 -4.757  -2.200  1.00 0.00 ? 116 PRO A CD   2  
ATOM 2185  H HA   . PRO A 1 19  ? -16.479 -4.654  -4.547  1.00 0.00 ? 116 PRO A HA   2  
ATOM 2186  H HB2  . PRO A 1 19  ? -15.601 -7.113  -3.265  1.00 0.00 ? 116 PRO A HB2  2  
ATOM 2187  H HB3  . PRO A 1 19  ? -15.158 -6.466  -4.846  1.00 0.00 ? 116 PRO A HB3  2  
ATOM 2188  H HG2  . PRO A 1 19  ? -13.403 -6.599  -2.790  1.00 0.00 ? 116 PRO A HG2  2  
ATOM 2189  H HG3  . PRO A 1 19  ? -13.343 -5.324  -4.020  1.00 0.00 ? 116 PRO A HG3  2  
ATOM 2190  H HD2  . PRO A 1 19  ? -14.505 -5.233  -1.256  1.00 0.00 ? 116 PRO A HD2  2  
ATOM 2191  H HD3  . PRO A 1 19  ? -13.475 -4.042  -2.088  1.00 0.00 ? 116 PRO A HD3  2  
ATOM 2192  N N    . GLU A 1 20  ? -18.371 -6.164  -3.686  1.00 0.00 ? 117 GLU A N    2  
ATOM 2193  C CA   . GLU A 1 20  ? -19.666 -6.628  -3.204  1.00 0.00 ? 117 GLU A CA   2  
ATOM 2194  C C    . GLU A 1 20  ? -19.598 -8.079  -2.735  1.00 0.00 ? 117 GLU A C    2  
ATOM 2195  O O    . GLU A 1 20  ? -20.253 -8.462  -1.764  1.00 0.00 ? 117 GLU A O    2  
ATOM 2196  C CB   . GLU A 1 20  ? -20.711 -6.483  -4.318  1.00 0.00 ? 117 GLU A CB   2  
ATOM 2197  C CG   . GLU A 1 20  ? -20.287 -7.119  -5.633  1.00 0.00 ? 117 GLU A CG   2  
ATOM 2198  C CD   . GLU A 1 20  ? -21.298 -6.920  -6.740  1.00 0.00 ? 117 GLU A CD   2  
ATOM 2199  O OE1  . GLU A 1 20  ? -21.213 -5.901  -7.452  1.00 0.00 ? 117 GLU A OE1  2  
ATOM 2200  O OE2  . GLU A 1 20  ? -22.179 -7.787  -6.910  1.00 0.00 ? 117 GLU A OE2  2  
ATOM 2201  H H    . GLU A 1 20  ? -18.142 -6.297  -4.631  1.00 0.00 ? 117 GLU A H    2  
ATOM 2202  H HA   . GLU A 1 20  ? -19.953 -6.005  -2.371  1.00 0.00 ? 117 GLU A HA   2  
ATOM 2203  H HB2  . GLU A 1 20  ? -21.627 -6.954  -3.997  1.00 0.00 ? 117 GLU A HB2  2  
ATOM 2204  H HB3  . GLU A 1 20  ? -20.895 -5.434  -4.491  1.00 0.00 ? 117 GLU A HB3  2  
ATOM 2205  H HG2  . GLU A 1 20  ? -19.352 -6.679  -5.945  1.00 0.00 ? 117 GLU A HG2  2  
ATOM 2206  H HG3  . GLU A 1 20  ? -20.149 -8.179  -5.478  1.00 0.00 ? 117 GLU A HG3  2  
ATOM 2207  N N    . ASP A 1 21  ? -18.808 -8.880  -3.431  1.00 0.00 ? 118 ASP A N    2  
ATOM 2208  C CA   . ASP A 1 21  ? -18.676 -10.296 -3.112  1.00 0.00 ? 118 ASP A CA   2  
ATOM 2209  C C    . ASP A 1 21  ? -17.477 -10.534 -2.206  1.00 0.00 ? 118 ASP A C    2  
ATOM 2210  O O    . ASP A 1 21  ? -17.594 -11.160 -1.155  1.00 0.00 ? 118 ASP A O    2  
ATOM 2211  C CB   . ASP A 1 21  ? -18.538 -11.114 -4.396  1.00 0.00 ? 118 ASP A CB   2  
ATOM 2212  C CG   . ASP A 1 21  ? -18.188 -12.563 -4.125  1.00 0.00 ? 118 ASP A CG   2  
ATOM 2213  O OD1  . ASP A 1 21  ? -19.095 -13.350 -3.785  1.00 0.00 ? 118 ASP A OD1  2  
ATOM 2214  O OD2  . ASP A 1 21  ? -17.001 -12.929 -4.262  1.00 0.00 ? 118 ASP A OD2  2  
ATOM 2215  H H    . ASP A 1 21  ? -18.301 -8.511  -4.184  1.00 0.00 ? 118 ASP A H    2  
ATOM 2216  H HA   . ASP A 1 21  ? -19.570 -10.604 -2.593  1.00 0.00 ? 118 ASP A HA   2  
ATOM 2217  H HB2  . ASP A 1 21  ? -19.474 -11.081 -4.934  1.00 0.00 ? 118 ASP A HB2  2  
ATOM 2218  H HB3  . ASP A 1 21  ? -17.760 -10.682 -5.007  1.00 0.00 ? 118 ASP A HB3  2  
ATOM 2219  N N    . ARG A 1 22  ? -16.327 -10.024 -2.615  1.00 0.00 ? 119 ARG A N    2  
ATOM 2220  C CA   . ARG A 1 22  ? -15.122 -10.147 -1.812  1.00 0.00 ? 119 ARG A CA   2  
ATOM 2221  C C    . ARG A 1 22  ? -14.986 -8.951  -0.876  1.00 0.00 ? 119 ARG A C    2  
ATOM 2222  O O    . ARG A 1 22  ? -15.637 -7.925  -1.072  1.00 0.00 ? 119 ARG A O    2  
ATOM 2223  C CB   . ARG A 1 22  ? -13.889 -10.305 -2.690  1.00 0.00 ? 119 ARG A CB   2  
ATOM 2224  C CG   . ARG A 1 22  ? -13.824 -9.316  -3.819  1.00 0.00 ? 119 ARG A CG   2  
ATOM 2225  C CD   . ARG A 1 22  ? -12.674 -9.634  -4.746  1.00 0.00 ? 119 ARG A CD   2  
ATOM 2226  N NE   . ARG A 1 22  ? -11.372 -9.448  -4.105  1.00 0.00 ? 119 ARG A NE   2  
ATOM 2227  C CZ   . ARG A 1 22  ? -10.231 -9.265  -4.770  1.00 0.00 ? 119 ARG A CZ   2  
ATOM 2228  N NH1  . ARG A 1 22  ? -10.233 -9.168  -6.095  1.00 0.00 ? 119 ARG A NH1  2  
ATOM 2229  N NH2  . ARG A 1 22  ? -9.085  -9.157  -4.108  1.00 0.00 ? 119 ARG A NH2  2  
ATOM 2230  H H    . ARG A 1 22  ? -16.292 -9.545  -3.467  1.00 0.00 ? 119 ARG A H    2  
ATOM 2231  H HA   . ARG A 1 22  ? -15.223 -11.033 -1.226  1.00 0.00 ? 119 ARG A HA   2  
ATOM 2232  H HB2  . ARG A 1 22  ? -13.009 -10.181 -2.080  1.00 0.00 ? 119 ARG A HB2  2  
ATOM 2233  H HB3  . ARG A 1 22  ? -13.887 -11.299 -3.111  1.00 0.00 ? 119 ARG A HB3  2  
ATOM 2234  H HG2  . ARG A 1 22  ? -14.749 -9.358  -4.371  1.00 0.00 ? 119 ARG A HG2  2  
ATOM 2235  H HG3  . ARG A 1 22  ? -13.689 -8.331  -3.410  1.00 0.00 ? 119 ARG A HG3  2  
ATOM 2236  H HD2  . ARG A 1 22  ? -12.769 -10.665 -5.046  1.00 0.00 ? 119 ARG A HD2  2  
ATOM 2237  H HD3  . ARG A 1 22  ? -12.740 -8.996  -5.613  1.00 0.00 ? 119 ARG A HD3  2  
ATOM 2238  H HE   . ARG A 1 22  ? -11.345 -9.482  -3.121  1.00 0.00 ? 119 ARG A HE   2  
ATOM 2239  H HH11 . ARG A 1 22  ? -11.094 -9.232  -6.605  1.00 0.00 ? 119 ARG A HH11 2  
ATOM 2240  H HH12 . ARG A 1 22  ? -9.371  -9.026  -6.591  1.00 0.00 ? 119 ARG A HH12 2  
ATOM 2241  H HH21 . ARG A 1 22  ? -9.074  -9.210  -3.102  1.00 0.00 ? 119 ARG A HH21 2  
ATOM 2242  H HH22 . ARG A 1 22  ? -8.224  -9.037  -4.606  1.00 0.00 ? 119 ARG A HH22 2  
ATOM 2243  N N    . LYS A 1 23  ? -14.155 -9.094  0.145   1.00 0.00 ? 120 LYS A N    2  
ATOM 2244  C CA   . LYS A 1 23  ? -14.027 -8.073  1.179   1.00 0.00 ? 120 LYS A CA   2  
ATOM 2245  C C    . LYS A 1 23  ? -13.137 -6.919  0.716   1.00 0.00 ? 120 LYS A C    2  
ATOM 2246  O O    . LYS A 1 23  ? -12.258 -7.103  -0.126  1.00 0.00 ? 120 LYS A O    2  
ATOM 2247  C CB   . LYS A 1 23  ? -13.476 -8.700  2.464   1.00 0.00 ? 120 LYS A CB   2  
ATOM 2248  C CG   . LYS A 1 23  ? -14.342 -9.831  3.006   1.00 0.00 ? 120 LYS A CG   2  
ATOM 2249  C CD   . LYS A 1 23  ? -15.799 -9.408  3.134   1.00 0.00 ? 120 LYS A CD   2  
ATOM 2250  C CE   . LYS A 1 23  ? -16.682 -10.554 3.604   1.00 0.00 ? 120 LYS A CE   2  
ATOM 2251  N NZ   . LYS A 1 23  ? -16.396 -10.944 5.010   1.00 0.00 ? 120 LYS A NZ   2  
ATOM 2252  H H    . LYS A 1 23  ? -13.612 -9.908  0.208   1.00 0.00 ? 120 LYS A H    2  
ATOM 2253  H HA   . LYS A 1 23  ? -15.013 -7.684  1.378   1.00 0.00 ? 120 LYS A HA   2  
ATOM 2254  H HB2  . LYS A 1 23  ? -12.490 -9.094  2.266   1.00 0.00 ? 120 LYS A HB2  2  
ATOM 2255  H HB3  . LYS A 1 23  ? -13.403 -7.936  3.224   1.00 0.00 ? 120 LYS A HB3  2  
ATOM 2256  H HG2  . LYS A 1 23  ? -14.281 -10.673 2.334   1.00 0.00 ? 120 LYS A HG2  2  
ATOM 2257  H HG3  . LYS A 1 23  ? -13.974 -10.119 3.980   1.00 0.00 ? 120 LYS A HG3  2  
ATOM 2258  H HD2  . LYS A 1 23  ? -15.868 -8.601  3.844   1.00 0.00 ? 120 LYS A HD2  2  
ATOM 2259  H HD3  . LYS A 1 23  ? -16.150 -9.072  2.169   1.00 0.00 ? 120 LYS A HD3  2  
ATOM 2260  H HE2  . LYS A 1 23  ? -17.715 -10.248 3.530   1.00 0.00 ? 120 LYS A HE2  2  
ATOM 2261  H HE3  . LYS A 1 23  ? -16.514 -11.406 2.962   1.00 0.00 ? 120 LYS A HE3  2  
ATOM 2262  H HZ1  . LYS A 1 23  ? -16.549 -10.132 5.643   1.00 0.00 ? 120 LYS A HZ1  2  
ATOM 2263  H HZ2  . LYS A 1 23  ? -15.409 -11.259 5.102   1.00 0.00 ? 120 LYS A HZ2  2  
ATOM 2264  H HZ3  . LYS A 1 23  ? -17.025 -11.718 5.302   1.00 0.00 ? 120 LYS A HZ3  2  
ATOM 2265  N N    . PRO A 1 24  ? -13.378 -5.708  1.261   1.00 0.00 ? 121 PRO A N    2  
ATOM 2266  C CA   . PRO A 1 24  ? -12.642 -4.490  0.885   1.00 0.00 ? 121 PRO A CA   2  
ATOM 2267  C C    . PRO A 1 24  ? -11.144 -4.588  1.150   1.00 0.00 ? 121 PRO A C    2  
ATOM 2268  O O    . PRO A 1 24  ? -10.705 -5.282  2.072   1.00 0.00 ? 121 PRO A O    2  
ATOM 2269  C CB   . PRO A 1 24  ? -13.266 -3.403  1.767   1.00 0.00 ? 121 PRO A CB   2  
ATOM 2270  C CG   . PRO A 1 24  ? -13.896 -4.146  2.890   1.00 0.00 ? 121 PRO A CG   2  
ATOM 2271  C CD   . PRO A 1 24  ? -14.389 -5.428  2.292   1.00 0.00 ? 121 PRO A CD   2  
ATOM 2272  H HA   . PRO A 1 24  ? -12.801 -4.241  -0.154  1.00 0.00 ? 121 PRO A HA   2  
ATOM 2273  H HB2  . PRO A 1 24  ? -12.494 -2.734  2.118   1.00 0.00 ? 121 PRO A HB2  2  
ATOM 2274  H HB3  . PRO A 1 24  ? -13.999 -2.850  1.199   1.00 0.00 ? 121 PRO A HB3  2  
ATOM 2275  H HG2  . PRO A 1 24  ? -13.162 -4.346  3.656   1.00 0.00 ? 121 PRO A HG2  2  
ATOM 2276  H HG3  . PRO A 1 24  ? -14.720 -3.578  3.294   1.00 0.00 ? 121 PRO A HG3  2  
ATOM 2277  H HD2  . PRO A 1 24  ? -14.414 -6.208  3.037   1.00 0.00 ? 121 PRO A HD2  2  
ATOM 2278  H HD3  . PRO A 1 24  ? -15.365 -5.292  1.849   1.00 0.00 ? 121 PRO A HD3  2  
ATOM 2279  N N    . TYR A 1 25  ? -10.370 -3.863  0.351   1.00 0.00 ? 122 TYR A N    2  
ATOM 2280  C CA   . TYR A 1 25  ? -8.915  -3.934  0.409   1.00 0.00 ? 122 TYR A CA   2  
ATOM 2281  C C    . TYR A 1 25  ? -8.289  -2.716  -0.259  1.00 0.00 ? 122 TYR A C    2  
ATOM 2282  O O    . TYR A 1 25  ? -8.932  -2.040  -1.067  1.00 0.00 ? 122 TYR A O    2  
ATOM 2283  C CB   . TYR A 1 25  ? -8.425  -5.214  -0.285  1.00 0.00 ? 122 TYR A CB   2  
ATOM 2284  C CG   . TYR A 1 25  ? -8.833  -5.324  -1.742  1.00 0.00 ? 122 TYR A CG   2  
ATOM 2285  C CD1  . TYR A 1 25  ? -10.103 -5.758  -2.093  1.00 0.00 ? 122 TYR A CD1  2  
ATOM 2286  C CD2  . TYR A 1 25  ? -7.950  -4.990  -2.763  1.00 0.00 ? 122 TYR A CD2  2  
ATOM 2287  C CE1  . TYR A 1 25  ? -10.483 -5.859  -3.415  1.00 0.00 ? 122 TYR A CE1  2  
ATOM 2288  C CE2  . TYR A 1 25  ? -8.326  -5.085  -4.089  1.00 0.00 ? 122 TYR A CE2  2  
ATOM 2289  C CZ   . TYR A 1 25  ? -9.593  -5.521  -4.409  1.00 0.00 ? 122 TYR A CZ   2  
ATOM 2290  O OH   . TYR A 1 25  ? -9.974  -5.614  -5.727  1.00 0.00 ? 122 TYR A OH   2  
ATOM 2291  H H    . TYR A 1 25  ? -10.792 -3.252  -0.297  1.00 0.00 ? 122 TYR A H    2  
ATOM 2292  H HA   . TYR A 1 25  ? -8.620  -3.959  1.447   1.00 0.00 ? 122 TYR A HA   2  
ATOM 2293  H HB2  . TYR A 1 25  ? -7.347  -5.247  -0.243  1.00 0.00 ? 122 TYR A HB2  2  
ATOM 2294  H HB3  . TYR A 1 25  ? -8.826  -6.071  0.235   1.00 0.00 ? 122 TYR A HB3  2  
ATOM 2295  H HD1  . TYR A 1 25  ? -10.802 -6.023  -1.313  1.00 0.00 ? 122 TYR A HD1  2  
ATOM 2296  H HD2  . TYR A 1 25  ? -6.956  -4.653  -2.508  1.00 0.00 ? 122 TYR A HD2  2  
ATOM 2297  H HE1  . TYR A 1 25  ? -11.475 -6.201  -3.667  1.00 0.00 ? 122 TYR A HE1  2  
ATOM 2298  H HE2  . TYR A 1 25  ? -7.626  -4.822  -4.869  1.00 0.00 ? 122 TYR A HE2  2  
ATOM 2299  H HH   . TYR A 1 25  ? -9.293  -6.080  -6.225  1.00 0.00 ? 122 TYR A HH   2  
ATOM 2300  N N    . LEU A 1 26  ? -7.042  -2.428  0.092   1.00 0.00 ? 123 LEU A N    2  
ATOM 2301  C CA   . LEU A 1 26  ? -6.287  -1.382  -0.582  1.00 0.00 ? 123 LEU A CA   2  
ATOM 2302  C C    . LEU A 1 26  ? -5.673  -1.919  -1.857  1.00 0.00 ? 123 LEU A C    2  
ATOM 2303  O O    . LEU A 1 26  ? -5.180  -3.046  -1.895  1.00 0.00 ? 123 LEU A O    2  
ATOM 2304  C CB   . LEU A 1 26  ? -5.173  -0.818  0.303   1.00 0.00 ? 123 LEU A CB   2  
ATOM 2305  C CG   . LEU A 1 26  ? -5.513  0.458   1.074   1.00 0.00 ? 123 LEU A CG   2  
ATOM 2306  C CD1  . LEU A 1 26  ? -4.304  0.923   1.873   1.00 0.00 ? 123 LEU A CD1  2  
ATOM 2307  C CD2  . LEU A 1 26  ? -5.978  1.556   0.129   1.00 0.00 ? 123 LEU A CD2  2  
ATOM 2308  H H    . LEU A 1 26  ? -6.621  -2.937  0.819   1.00 0.00 ? 123 LEU A H    2  
ATOM 2309  H HA   . LEU A 1 26  ? -6.974  -0.589  -0.835  1.00 0.00 ? 123 LEU A HA   2  
ATOM 2310  H HB2  . LEU A 1 26  ? -4.897  -1.576  1.017   1.00 0.00 ? 123 LEU A HB2  2  
ATOM 2311  H HB3  . LEU A 1 26  ? -4.319  -0.613  -0.324  1.00 0.00 ? 123 LEU A HB3  2  
ATOM 2312  H HG   . LEU A 1 26  ? -6.314  0.249   1.763   1.00 0.00 ? 123 LEU A HG   2  
ATOM 2313  H HD11 . LEU A 1 26  ? -3.474  1.094   1.202   1.00 0.00 ? 123 LEU A HD11 2  
ATOM 2314  H HD12 . LEU A 1 26  ? -4.035  0.165   2.593   1.00 0.00 ? 123 LEU A HD12 2  
ATOM 2315  H HD13 . LEU A 1 26  ? -4.543  1.840   2.388   1.00 0.00 ? 123 LEU A HD13 2  
ATOM 2316  H HD21 . LEU A 1 26  ? -5.257  1.680   -0.664  1.00 0.00 ? 123 LEU A HD21 2  
ATOM 2317  H HD22 . LEU A 1 26  ? -6.074  2.483   0.675   1.00 0.00 ? 123 LEU A HD22 2  
ATOM 2318  H HD23 . LEU A 1 26  ? -6.935  1.287   -0.292  1.00 0.00 ? 123 LEU A HD23 2  
ATOM 2319  N N    . TRP A 1 27  ? -5.708  -1.104  -2.889  1.00 0.00 ? 124 TRP A N    2  
ATOM 2320  C CA   . TRP A 1 27  ? -5.129  -1.456  -4.167  1.00 0.00 ? 124 TRP A CA   2  
ATOM 2321  C C    . TRP A 1 27  ? -4.016  -0.475  -4.497  1.00 0.00 ? 124 TRP A C    2  
ATOM 2322  O O    . TRP A 1 27  ? -4.261  0.611   -5.025  1.00 0.00 ? 124 TRP A O    2  
ATOM 2323  C CB   . TRP A 1 27  ? -6.212  -1.446  -5.250  1.00 0.00 ? 124 TRP A CB   2  
ATOM 2324  C CG   . TRP A 1 27  ? -5.793  -2.068  -6.549  1.00 0.00 ? 124 TRP A CG   2  
ATOM 2325  C CD1  . TRP A 1 27  ? -4.767  -2.946  -6.754  1.00 0.00 ? 124 TRP A CD1  2  
ATOM 2326  C CD2  . TRP A 1 27  ? -6.408  -1.867  -7.824  1.00 0.00 ? 124 TRP A CD2  2  
ATOM 2327  N NE1  . TRP A 1 27  ? -4.711  -3.305  -8.079  1.00 0.00 ? 124 TRP A NE1  2  
ATOM 2328  C CE2  . TRP A 1 27  ? -5.708  -2.653  -8.756  1.00 0.00 ? 124 TRP A CE2  2  
ATOM 2329  C CE3  . TRP A 1 27  ? -7.486  -1.097  -8.268  1.00 0.00 ? 124 TRP A CE3  2  
ATOM 2330  C CZ2  . TRP A 1 27  ? -6.052  -2.693  -10.105 1.00 0.00 ? 124 TRP A CZ2  2  
ATOM 2331  C CZ3  . TRP A 1 27  ? -7.825  -1.136  -9.606  1.00 0.00 ? 124 TRP A CZ3  2  
ATOM 2332  C CH2  . TRP A 1 27  ? -7.112  -1.929  -10.511 1.00 0.00 ? 124 TRP A CH2  2  
ATOM 2333  H H    . TRP A 1 27  ? -6.137  -0.223  -2.786  1.00 0.00 ? 124 TRP A H    2  
ATOM 2334  H HA   . TRP A 1 27  ? -4.711  -2.449  -4.086  1.00 0.00 ? 124 TRP A HA   2  
ATOM 2335  H HB2  . TRP A 1 27  ? -7.073  -1.988  -4.889  1.00 0.00 ? 124 TRP A HB2  2  
ATOM 2336  H HB3  . TRP A 1 27  ? -6.497  -0.422  -5.448  1.00 0.00 ? 124 TRP A HB3  2  
ATOM 2337  H HD1  . TRP A 1 27  ? -4.106  -3.304  -5.977  1.00 0.00 ? 124 TRP A HD1  2  
ATOM 2338  H HE1  . TRP A 1 27  ? -4.061  -3.932  -8.479  1.00 0.00 ? 124 TRP A HE1  2  
ATOM 2339  H HE3  . TRP A 1 27  ? -8.048  -0.479  -7.586  1.00 0.00 ? 124 TRP A HE3  2  
ATOM 2340  H HZ2  . TRP A 1 27  ? -5.511  -3.299  -10.814 1.00 0.00 ? 124 TRP A HZ2  2  
ATOM 2341  H HZ3  . TRP A 1 27  ? -8.655  -0.547  -9.966  1.00 0.00 ? 124 TRP A HZ3  2  
ATOM 2342  H HH2  . TRP A 1 27  ? -7.413  -1.929  -11.548 1.00 0.00 ? 124 TRP A HH2  2  
ATOM 2343  N N    . ILE A 1 28  ? -2.797  -0.851  -4.150  1.00 0.00 ? 125 ILE A N    2  
ATOM 2344  C CA   . ILE A 1 28  ? -1.646  0.003   -4.373  1.00 0.00 ? 125 ILE A CA   2  
ATOM 2345  C C    . ILE A 1 28  ? -1.071  -0.264  -5.757  1.00 0.00 ? 125 ILE A C    2  
ATOM 2346  O O    . ILE A 1 28  ? -0.670  -1.389  -6.059  1.00 0.00 ? 125 ILE A O    2  
ATOM 2347  C CB   . ILE A 1 28  ? -0.535  -0.218  -3.315  1.00 0.00 ? 125 ILE A CB   2  
ATOM 2348  C CG1  . ILE A 1 28  ? -1.083  -0.097  -1.888  1.00 0.00 ? 125 ILE A CG1  2  
ATOM 2349  C CG2  . ILE A 1 28  ? 0.592   0.778   -3.517  1.00 0.00 ? 125 ILE A CG2  2  
ATOM 2350  C CD1  . ILE A 1 28  ? -1.640  -1.389  -1.329  1.00 0.00 ? 125 ILE A CD1  2  
ATOM 2351  H H    . ILE A 1 28  ? -2.667  -1.735  -3.744  1.00 0.00 ? 125 ILE A H    2  
ATOM 2352  H HA   . ILE A 1 28  ? -1.974  1.031   -4.319  1.00 0.00 ? 125 ILE A HA   2  
ATOM 2353  H HB   . ILE A 1 28  ? -0.132  -1.211  -3.454  1.00 0.00 ? 125 ILE A HB   2  
ATOM 2354  H HG12 . ILE A 1 28  ? -0.290  0.229   -1.233  1.00 0.00 ? 125 ILE A HG12 2  
ATOM 2355  H HG13 . ILE A 1 28  ? -1.875  0.636   -1.877  1.00 0.00 ? 125 ILE A HG13 2  
ATOM 2356  H HG21 . ILE A 1 28  ? 0.213   1.780   -3.387  1.00 0.00 ? 125 ILE A HG21 2  
ATOM 2357  H HG22 . ILE A 1 28  ? 0.991   0.670   -4.514  1.00 0.00 ? 125 ILE A HG22 2  
ATOM 2358  H HG23 . ILE A 1 28  ? 1.371   0.591   -2.794  1.00 0.00 ? 125 ILE A HG23 2  
ATOM 2359  H HD11 . ILE A 1 28  ? -2.484  -1.705  -1.925  1.00 0.00 ? 125 ILE A HD11 2  
ATOM 2360  H HD12 . ILE A 1 28  ? -1.959  -1.232  -0.311  1.00 0.00 ? 125 ILE A HD12 2  
ATOM 2361  H HD13 . ILE A 1 28  ? -0.874  -2.152  -1.357  1.00 0.00 ? 125 ILE A HD13 2  
ATOM 2362  N N    . LYS A 1 29  ? -1.053  0.759   -6.598  1.00 0.00 ? 126 LYS A N    2  
ATOM 2363  C CA   . LYS A 1 29  ? -0.525  0.620   -7.947  1.00 0.00 ? 126 LYS A CA   2  
ATOM 2364  C C    . LYS A 1 29  ? 0.596   1.610   -8.196  1.00 0.00 ? 126 LYS A C    2  
ATOM 2365  O O    . LYS A 1 29  ? 0.537   2.758   -7.759  1.00 0.00 ? 126 LYS A O    2  
ATOM 2366  C CB   . LYS A 1 29  ? -1.622  0.825   -8.990  1.00 0.00 ? 126 LYS A CB   2  
ATOM 2367  C CG   . LYS A 1 29  ? -2.692  -0.249  -8.970  1.00 0.00 ? 126 LYS A CG   2  
ATOM 2368  C CD   . LYS A 1 29  ? -3.650  -0.132  -10.151 1.00 0.00 ? 126 LYS A CD   2  
ATOM 2369  C CE   . LYS A 1 29  ? -4.485  1.142   -10.111 1.00 0.00 ? 126 LYS A CE   2  
ATOM 2370  N NZ   . LYS A 1 29  ? -3.762  2.324   -10.664 1.00 0.00 ? 126 LYS A NZ   2  
ATOM 2371  H H    . LYS A 1 29  ? -1.397  1.633   -6.304  1.00 0.00 ? 126 LYS A H    2  
ATOM 2372  H HA   . LYS A 1 29  ? -0.132  -0.381  -8.044  1.00 0.00 ? 126 LYS A HA   2  
ATOM 2373  H HB2  . LYS A 1 29  ? -2.098  1.778   -8.808  1.00 0.00 ? 126 LYS A HB2  2  
ATOM 2374  H HB3  . LYS A 1 29  ? -1.173  0.838   -9.971  1.00 0.00 ? 126 LYS A HB3  2  
ATOM 2375  H HG2  . LYS A 1 29  ? -2.213  -1.215  -9.006  1.00 0.00 ? 126 LYS A HG2  2  
ATOM 2376  H HG3  . LYS A 1 29  ? -3.255  -0.161  -8.053  1.00 0.00 ? 126 LYS A HG3  2  
ATOM 2377  H HD2  . LYS A 1 29  ? -3.076  -0.140  -11.064 1.00 0.00 ? 126 LYS A HD2  2  
ATOM 2378  H HD3  . LYS A 1 29  ? -4.315  -0.985  -10.141 1.00 0.00 ? 126 LYS A HD3  2  
ATOM 2379  H HE2  . LYS A 1 29  ? -5.383  0.983   -10.689 1.00 0.00 ? 126 LYS A HE2  2  
ATOM 2380  H HE3  . LYS A 1 29  ? -4.753  1.345   -9.084  1.00 0.00 ? 126 LYS A HE3  2  
ATOM 2381  H HZ1  . LYS A 1 29  ? -2.906  2.520   -10.110 1.00 0.00 ? 126 LYS A HZ1  2  
ATOM 2382  H HZ2  . LYS A 1 29  ? -4.379  3.161   -10.635 1.00 0.00 ? 126 LYS A HZ2  2  
ATOM 2383  H HZ3  . LYS A 1 29  ? -3.489  2.147   -11.651 1.00 0.00 ? 126 LYS A HZ3  2  
ATOM 2384  N N    . TRP A 1 30  ? 1.610   1.160   -8.907  1.00 0.00 ? 127 TRP A N    2  
ATOM 2385  C CA   . TRP A 1 30  ? 2.744   2.000   -9.247  1.00 0.00 ? 127 TRP A CA   2  
ATOM 2386  C C    . TRP A 1 30  ? 3.161   1.754   -10.688 1.00 0.00 ? 127 TRP A C    2  
ATOM 2387  O O    . TRP A 1 30  ? 2.935   0.671   -11.237 1.00 0.00 ? 127 TRP A O    2  
ATOM 2388  C CB   . TRP A 1 30  ? 3.917   1.726   -8.296  1.00 0.00 ? 127 TRP A CB   2  
ATOM 2389  C CG   . TRP A 1 30  ? 4.276   0.275   -8.191  1.00 0.00 ? 127 TRP A CG   2  
ATOM 2390  C CD1  . TRP A 1 30  ? 5.139   -0.416  -8.991  1.00 0.00 ? 127 TRP A CD1  2  
ATOM 2391  C CD2  . TRP A 1 30  ? 3.777   -0.662  -7.232  1.00 0.00 ? 127 TRP A CD2  2  
ATOM 2392  N NE1  . TRP A 1 30  ? 5.197   -1.728  -8.593  1.00 0.00 ? 127 TRP A NE1  2  
ATOM 2393  C CE2  . TRP A 1 30  ? 4.372   -1.902  -7.515  1.00 0.00 ? 127 TRP A CE2  2  
ATOM 2394  C CE3  . TRP A 1 30  ? 2.883   -0.573  -6.161  1.00 0.00 ? 127 TRP A CE3  2  
ATOM 2395  C CZ2  . TRP A 1 30  ? 4.101   -3.045  -6.768  1.00 0.00 ? 127 TRP A CZ2  2  
ATOM 2396  C CZ3  . TRP A 1 30  ? 2.615   -1.706  -5.422  1.00 0.00 ? 127 TRP A CZ3  2  
ATOM 2397  C CH2  . TRP A 1 30  ? 3.222   -2.928  -5.728  1.00 0.00 ? 127 TRP A CH2  2  
ATOM 2398  H H    . TRP A 1 30  ? 1.600   0.227   -9.215  1.00 0.00 ? 127 TRP A H    2  
ATOM 2399  H HA   . TRP A 1 30  ? 2.439   3.030   -9.141  1.00 0.00 ? 127 TRP A HA   2  
ATOM 2400  H HB2  . TRP A 1 30  ? 4.789   2.260   -8.645  1.00 0.00 ? 127 TRP A HB2  2  
ATOM 2401  H HB3  . TRP A 1 30  ? 3.658   2.078   -7.308  1.00 0.00 ? 127 TRP A HB3  2  
ATOM 2402  H HD1  . TRP A 1 30  ? 5.683   0.017   -9.817  1.00 0.00 ? 127 TRP A HD1  2  
ATOM 2403  H HE1  . TRP A 1 30  ? 5.744   -2.425  -9.011  1.00 0.00 ? 127 TRP A HE1  2  
ATOM 2404  H HE3  . TRP A 1 30  ? 2.408   0.362   -5.906  1.00 0.00 ? 127 TRP A HE3  2  
ATOM 2405  H HZ2  . TRP A 1 30  ? 4.560   -3.996  -6.994  1.00 0.00 ? 127 TRP A HZ2  2  
ATOM 2406  H HZ3  . TRP A 1 30  ? 1.924   -1.657  -4.594  1.00 0.00 ? 127 TRP A HZ3  2  
ATOM 2407  H HH2  . TRP A 1 30  ? 2.979   -3.790  -5.124  1.00 0.00 ? 127 TRP A HH2  2  
ATOM 2408  N N    . SER A 1 31  ? 3.738   2.767   -11.301 1.00 0.00 ? 128 SER A N    2  
ATOM 2409  C CA   . SER A 1 31  ? 4.237   2.666   -12.657 1.00 0.00 ? 128 SER A CA   2  
ATOM 2410  C C    . SER A 1 31  ? 5.684   2.184   -12.623 1.00 0.00 ? 128 SER A C    2  
ATOM 2411  O O    . SER A 1 31  ? 6.516   2.761   -11.916 1.00 0.00 ? 128 SER A O    2  
ATOM 2412  C CB   . SER A 1 31  ? 4.137   4.030   -13.345 1.00 0.00 ? 128 SER A CB   2  
ATOM 2413  O OG   . SER A 1 31  ? 4.456   3.949   -14.724 1.00 0.00 ? 128 SER A OG   2  
ATOM 2414  H H    . SER A 1 31  ? 3.846   3.621   -10.819 1.00 0.00 ? 128 SER A H    2  
ATOM 2415  H HA   . SER A 1 31  ? 3.632   1.948   -13.190 1.00 0.00 ? 128 SER A HA   2  
ATOM 2416  H HB2  . SER A 1 31  ? 3.130   4.403   -13.248 1.00 0.00 ? 128 SER A HB2  2  
ATOM 2417  H HB3  . SER A 1 31  ? 4.821   4.717   -12.871 1.00 0.00 ? 128 SER A HB3  2  
ATOM 2418  H HG   . SER A 1 31  ? 4.055   4.698   -15.184 1.00 0.00 ? 128 SER A HG   2  
ATOM 2419  N N    . PRO A 1 32  ? 5.984   1.098   -13.360 1.00 0.00 ? 129 PRO A N    2  
ATOM 2420  C CA   . PRO A 1 32  ? 7.326   0.502   -13.412 1.00 0.00 ? 129 PRO A CA   2  
ATOM 2421  C C    . PRO A 1 32  ? 8.425   1.537   -13.652 1.00 0.00 ? 129 PRO A C    2  
ATOM 2422  O O    . PRO A 1 32  ? 8.259   2.452   -14.461 1.00 0.00 ? 129 PRO A O    2  
ATOM 2423  C CB   . PRO A 1 32  ? 7.233   -0.456  -14.598 1.00 0.00 ? 129 PRO A CB   2  
ATOM 2424  C CG   . PRO A 1 32  ? 5.799   -0.850  -14.649 1.00 0.00 ? 129 PRO A CG   2  
ATOM 2425  C CD   . PRO A 1 32  ? 5.023   0.359   -14.205 1.00 0.00 ? 129 PRO A CD   2  
ATOM 2426  H HA   . PRO A 1 32  ? 7.545   -0.054  -12.514 1.00 0.00 ? 129 PRO A HA   2  
ATOM 2427  H HB2  . PRO A 1 32  ? 7.537   0.054   -15.501 1.00 0.00 ? 129 PRO A HB2  2  
ATOM 2428  H HB3  . PRO A 1 32  ? 7.871   -1.310  -14.427 1.00 0.00 ? 129 PRO A HB3  2  
ATOM 2429  H HG2  . PRO A 1 32  ? 5.528   -1.121  -15.658 1.00 0.00 ? 129 PRO A HG2  2  
ATOM 2430  H HG3  . PRO A 1 32  ? 5.623   -1.675  -13.977 1.00 0.00 ? 129 PRO A HG3  2  
ATOM 2431  H HD2  . PRO A 1 32  ? 4.726   0.951   -15.059 1.00 0.00 ? 129 PRO A HD2  2  
ATOM 2432  H HD3  . PRO A 1 32  ? 4.157   0.059   -13.632 1.00 0.00 ? 129 PRO A HD3  2  
ATOM 2433  N N    . PRO A 1 33  ? 9.562   1.387   -12.950 1.00 0.00 ? 130 PRO A N    2  
ATOM 2434  C CA   . PRO A 1 33  ? 10.696  2.317   -13.028 1.00 0.00 ? 130 PRO A CA   2  
ATOM 2435  C C    . PRO A 1 33  ? 11.129  2.598   -14.465 1.00 0.00 ? 130 PRO A C    2  
ATOM 2436  O O    . PRO A 1 33  ? 11.188  1.693   -15.303 1.00 0.00 ? 130 PRO A O    2  
ATOM 2437  C CB   . PRO A 1 33  ? 11.821  1.593   -12.268 1.00 0.00 ? 130 PRO A CB   2  
ATOM 2438  C CG   . PRO A 1 33  ? 11.333  0.198   -12.053 1.00 0.00 ? 130 PRO A CG   2  
ATOM 2439  C CD   . PRO A 1 33  ? 9.839   0.287   -12.021 1.00 0.00 ? 130 PRO A CD   2  
ATOM 2440  H HA   . PRO A 1 33  ? 10.470  3.250   -12.533 1.00 0.00 ? 130 PRO A HA   2  
ATOM 2441  H HB2  . PRO A 1 33  ? 12.722  1.605   -12.863 1.00 0.00 ? 130 PRO A HB2  2  
ATOM 2442  H HB3  . PRO A 1 33  ? 12.000  2.094   -11.328 1.00 0.00 ? 130 PRO A HB3  2  
ATOM 2443  H HG2  . PRO A 1 33  ? 11.653  -0.433  -12.868 1.00 0.00 ? 130 PRO A HG2  2  
ATOM 2444  H HG3  . PRO A 1 33  ? 11.707  -0.181  -11.115 1.00 0.00 ? 130 PRO A HG3  2  
ATOM 2445  H HD2  . PRO A 1 33  ? 9.399   -0.637  -12.367 1.00 0.00 ? 130 PRO A HD2  2  
ATOM 2446  H HD3  . PRO A 1 33  ? 9.494   0.525   -11.026 1.00 0.00 ? 130 PRO A HD3  2  
ATOM 2447  N N    . THR A 1 34  ? 11.425  3.865   -14.741 1.00 0.00 ? 131 THR A N    2  
ATOM 2448  C CA   . THR A 1 34  ? 11.826  4.290   -16.072 1.00 0.00 ? 131 THR A CA   2  
ATOM 2449  C C    . THR A 1 34  ? 13.226  3.785   -16.400 1.00 0.00 ? 131 THR A C    2  
ATOM 2450  O O    . THR A 1 34  ? 13.498  3.358   -17.521 1.00 0.00 ? 131 THR A O    2  
ATOM 2451  C CB   . THR A 1 34  ? 11.796  5.826   -16.188 1.00 0.00 ? 131 THR A CB   2  
ATOM 2452  O OG1  . THR A 1 34  ? 10.541  6.323   -15.704 1.00 0.00 ? 131 THR A OG1  2  
ATOM 2453  C CG2  . THR A 1 34  ? 11.999  6.273   -17.629 1.00 0.00 ? 131 THR A CG2  2  
ATOM 2454  H H    . THR A 1 34  ? 11.368  4.535   -14.026 1.00 0.00 ? 131 THR A H    2  
ATOM 2455  H HA   . THR A 1 34  ? 11.126  3.878   -16.783 1.00 0.00 ? 131 THR A HA   2  
ATOM 2456  H HB   . THR A 1 34  ? 12.593  6.233   -15.585 1.00 0.00 ? 131 THR A HB   2  
ATOM 2457  H HG1  . THR A 1 34  ? 10.671  6.702   -14.816 1.00 0.00 ? 131 THR A HG1  2  
ATOM 2458  H HG21 . THR A 1 34  ? 12.964  5.936   -17.977 1.00 0.00 ? 131 THR A HG21 2  
ATOM 2459  H HG22 . THR A 1 34  ? 11.955  7.351   -17.681 1.00 0.00 ? 131 THR A HG22 2  
ATOM 2460  H HG23 . THR A 1 34  ? 11.224  5.851   -18.250 1.00 0.00 ? 131 THR A HG23 2  
ATOM 2461  N N    . LEU A 1 35  ? 14.106  3.822   -15.411 1.00 0.00 ? 132 LEU A N    2  
ATOM 2462  C CA   . LEU A 1 35  ? 15.474  3.365   -15.593 1.00 0.00 ? 132 LEU A CA   2  
ATOM 2463  C C    . LEU A 1 35  ? 15.756  2.203   -14.657 1.00 0.00 ? 132 LEU A C    2  
ATOM 2464  O O    . LEU A 1 35  ? 15.935  2.396   -13.454 1.00 0.00 ? 132 LEU A O    2  
ATOM 2465  C CB   . LEU A 1 35  ? 16.462  4.502   -15.329 1.00 0.00 ? 132 LEU A CB   2  
ATOM 2466  C CG   . LEU A 1 35  ? 16.252  5.766   -16.168 1.00 0.00 ? 132 LEU A CG   2  
ATOM 2467  C CD1  . LEU A 1 35  ? 17.301  6.812   -15.823 1.00 0.00 ? 132 LEU A CD1  2  
ATOM 2468  C CD2  . LEU A 1 35  ? 16.297  5.441   -17.653 1.00 0.00 ? 132 LEU A CD2  2  
ATOM 2469  H H    . LEU A 1 35  ? 13.825  4.151   -14.532 1.00 0.00 ? 132 LEU A H    2  
ATOM 2470  H HA   . LEU A 1 35  ? 15.581  3.030   -16.614 1.00 0.00 ? 132 LEU A HA   2  
ATOM 2471  H HB2  . LEU A 1 35  ? 16.390  4.774   -14.286 1.00 0.00 ? 132 LEU A HB2  2  
ATOM 2472  H HB3  . LEU A 1 35  ? 17.460  4.134   -15.519 1.00 0.00 ? 132 LEU A HB3  2  
ATOM 2473  H HG   . LEU A 1 35  ? 15.281  6.182   -15.944 1.00 0.00 ? 132 LEU A HG   2  
ATOM 2474  H HD11 . LEU A 1 35  ? 18.284  6.419   -16.034 1.00 0.00 ? 132 LEU A HD11 2  
ATOM 2475  H HD12 . LEU A 1 35  ? 17.230  7.062   -14.774 1.00 0.00 ? 132 LEU A HD12 2  
ATOM 2476  H HD13 . LEU A 1 35  ? 17.133  7.698   -16.418 1.00 0.00 ? 132 LEU A HD13 2  
ATOM 2477  H HD21 . LEU A 1 35  ? 16.134  6.342   -18.224 1.00 0.00 ? 132 LEU A HD21 2  
ATOM 2478  H HD22 . LEU A 1 35  ? 15.525  4.722   -17.888 1.00 0.00 ? 132 LEU A HD22 2  
ATOM 2479  H HD23 . LEU A 1 35  ? 17.262  5.026   -17.900 1.00 0.00 ? 132 LEU A HD23 2  
ATOM 2480  N N    . ILE A 1 36  ? 15.786  1.001   -15.212 1.00 0.00 ? 133 ILE A N    2  
ATOM 2481  C CA   . ILE A 1 36  ? 15.953  -0.207  -14.414 1.00 0.00 ? 133 ILE A CA   2  
ATOM 2482  C C    . ILE A 1 36  ? 17.395  -0.711  -14.477 1.00 0.00 ? 133 ILE A C    2  
ATOM 2483  O O    . ILE A 1 36  ? 17.839  -1.466  -13.605 1.00 0.00 ? 133 ILE A O    2  
ATOM 2484  C CB   . ILE A 1 36  ? 14.995  -1.328  -14.886 1.00 0.00 ? 133 ILE A CB   2  
ATOM 2485  C CG1  . ILE A 1 36  ? 13.580  -0.772  -15.072 1.00 0.00 ? 133 ILE A CG1  2  
ATOM 2486  C CG2  . ILE A 1 36  ? 14.982  -2.475  -13.885 1.00 0.00 ? 133 ILE A CG2  2  
ATOM 2487  C CD1  . ILE A 1 36  ? 12.581  -1.797  -15.568 1.00 0.00 ? 133 ILE A CD1  2  
ATOM 2488  H H    . ILE A 1 36  ? 15.688  0.922   -16.186 1.00 0.00 ? 133 ILE A H    2  
ATOM 2489  H HA   . ILE A 1 36  ? 15.712  0.035   -13.389 1.00 0.00 ? 133 ILE A HA   2  
ATOM 2490  H HB   . ILE A 1 36  ? 15.356  -1.708  -15.830 1.00 0.00 ? 133 ILE A HB   2  
ATOM 2491  H HG12 . ILE A 1 36  ? 13.223  -0.394  -14.128 1.00 0.00 ? 133 ILE A HG12 2  
ATOM 2492  H HG13 . ILE A 1 36  ? 13.610  0.036   -15.789 1.00 0.00 ? 133 ILE A HG13 2  
ATOM 2493  H HG21 . ILE A 1 36  ? 15.977  -2.884  -13.792 1.00 0.00 ? 133 ILE A HG21 2  
ATOM 2494  H HG22 . ILE A 1 36  ? 14.306  -3.245  -14.227 1.00 0.00 ? 133 ILE A HG22 2  
ATOM 2495  H HG23 . ILE A 1 36  ? 14.653  -2.108  -12.924 1.00 0.00 ? 133 ILE A HG23 2  
ATOM 2496  H HD11 . ILE A 1 36  ? 11.613  -1.331  -15.679 1.00 0.00 ? 133 ILE A HD11 2  
ATOM 2497  H HD12 . ILE A 1 36  ? 12.511  -2.606  -14.856 1.00 0.00 ? 133 ILE A HD12 2  
ATOM 2498  H HD13 . ILE A 1 36  ? 12.905  -2.185  -16.522 1.00 0.00 ? 133 ILE A HD13 2  
ATOM 2499  N N    . ASP A 1 37  ? 18.118  -0.288  -15.523 1.00 0.00 ? 134 ASP A N    2  
ATOM 2500  C CA   . ASP A 1 37  ? 19.529  -0.657  -15.709 1.00 0.00 ? 134 ASP A CA   2  
ATOM 2501  C C    . ASP A 1 37  ? 19.653  -2.140  -16.076 1.00 0.00 ? 134 ASP A C    2  
ATOM 2502  O O    . ASP A 1 37  ? 20.735  -2.725  -16.070 1.00 0.00 ? 134 ASP A O    2  
ATOM 2503  C CB   . ASP A 1 37  ? 20.336  -0.298  -14.443 1.00 0.00 ? 134 ASP A CB   2  
ATOM 2504  C CG   . ASP A 1 37  ? 21.793  -0.717  -14.488 1.00 0.00 ? 134 ASP A CG   2  
ATOM 2505  O OD1  . ASP A 1 37  ? 22.594  -0.035  -15.166 1.00 0.00 ? 134 ASP A OD1  2  
ATOM 2506  O OD2  . ASP A 1 37  ? 22.151  -1.715  -13.817 1.00 0.00 ? 134 ASP A OD2  2  
ATOM 2507  H H    . ASP A 1 37  ? 17.689  0.287   -16.191 1.00 0.00 ? 134 ASP A H    2  
ATOM 2508  H HA   . ASP A 1 37  ? 19.908  -0.079  -16.535 1.00 0.00 ? 134 ASP A HA   2  
ATOM 2509  H HB2  . ASP A 1 37  ? 20.302  0.772   -14.303 1.00 0.00 ? 134 ASP A HB2  2  
ATOM 2510  H HB3  . ASP A 1 37  ? 19.872  -0.772  -13.592 1.00 0.00 ? 134 ASP A HB3  2  
ATOM 2511  N N    . LEU A 1 38  ? 18.529  -2.735  -16.444 1.00 0.00 ? 135 LEU A N    2  
ATOM 2512  C CA   . LEU A 1 38  ? 18.486  -4.145  -16.789 1.00 0.00 ? 135 LEU A CA   2  
ATOM 2513  C C    . LEU A 1 38  ? 17.954  -4.332  -18.199 1.00 0.00 ? 135 LEU A C    2  
ATOM 2514  O O    . LEU A 1 38  ? 17.038  -3.628  -18.622 1.00 0.00 ? 135 LEU A O    2  
ATOM 2515  C CB   . LEU A 1 38  ? 17.599  -4.898  -15.800 1.00 0.00 ? 135 LEU A CB   2  
ATOM 2516  C CG   . LEU A 1 38  ? 17.991  -4.743  -14.333 1.00 0.00 ? 135 LEU A CG   2  
ATOM 2517  C CD1  . LEU A 1 38  ? 17.049  -5.533  -13.443 1.00 0.00 ? 135 LEU A CD1  2  
ATOM 2518  C CD2  . LEU A 1 38  ? 19.427  -5.185  -14.122 1.00 0.00 ? 135 LEU A CD2  2  
ATOM 2519  H H    . LEU A 1 38  ? 17.705  -2.209  -16.489 1.00 0.00 ? 135 LEU A H    2  
ATOM 2520  H HA   . LEU A 1 38  ? 19.490  -4.536  -16.735 1.00 0.00 ? 135 LEU A HA   2  
ATOM 2521  H HB2  . LEU A 1 38  ? 16.585  -4.546  -15.921 1.00 0.00 ? 135 LEU A HB2  2  
ATOM 2522  H HB3  . LEU A 1 38  ? 17.630  -5.948  -16.049 1.00 0.00 ? 135 LEU A HB3  2  
ATOM 2523  H HG   . LEU A 1 38  ? 17.917  -3.702  -14.055 1.00 0.00 ? 135 LEU A HG   2  
ATOM 2524  H HD11 . LEU A 1 38  ? 17.267  -5.320  -12.408 1.00 0.00 ? 135 LEU A HD11 2  
ATOM 2525  H HD12 . LEU A 1 38  ? 17.181  -6.588  -13.629 1.00 0.00 ? 135 LEU A HD12 2  
ATOM 2526  H HD13 . LEU A 1 38  ? 16.027  -5.254  -13.664 1.00 0.00 ? 135 LEU A HD13 2  
ATOM 2527  H HD21 . LEU A 1 38  ? 19.555  -6.189  -14.497 1.00 0.00 ? 135 LEU A HD21 2  
ATOM 2528  H HD22 . LEU A 1 38  ? 19.662  -5.159  -13.069 1.00 0.00 ? 135 LEU A HD22 2  
ATOM 2529  H HD23 . LEU A 1 38  ? 20.088  -4.512  -14.654 1.00 0.00 ? 135 LEU A HD23 2  
ATOM 2530  N N    . LYS A 1 39  ? 18.537  -5.274  -18.923 1.00 0.00 ? 136 LYS A N    2  
ATOM 2531  C CA   . LYS A 1 39  ? 18.073  -5.603  -20.262 1.00 0.00 ? 136 LYS A CA   2  
ATOM 2532  C C    . LYS A 1 39  ? 17.006  -6.681  -20.185 1.00 0.00 ? 136 LYS A C    2  
ATOM 2533  O O    . LYS A 1 39  ? 17.024  -7.517  -19.284 1.00 0.00 ? 136 LYS A O    2  
ATOM 2534  C CB   . LYS A 1 39  ? 19.228  -6.078  -21.137 1.00 0.00 ? 136 LYS A CB   2  
ATOM 2535  C CG   . LYS A 1 39  ? 20.258  -5.001  -21.425 1.00 0.00 ? 136 LYS A CG   2  
ATOM 2536  C CD   . LYS A 1 39  ? 21.331  -5.501  -22.376 1.00 0.00 ? 136 LYS A CD   2  
ATOM 2537  C CE   . LYS A 1 39  ? 20.766  -5.810  -23.754 1.00 0.00 ? 136 LYS A CE   2  
ATOM 2538  N NZ   . LYS A 1 39  ? 21.819  -6.271  -24.695 1.00 0.00 ? 136 LYS A NZ   2  
ATOM 2539  H H    . LYS A 1 39  ? 19.295  -5.771  -18.545 1.00 0.00 ? 136 LYS A H    2  
ATOM 2540  H HA   . LYS A 1 39  ? 17.642  -4.712  -20.693 1.00 0.00 ? 136 LYS A HA   2  
ATOM 2541  H HB2  . LYS A 1 39  ? 19.726  -6.898  -20.641 1.00 0.00 ? 136 LYS A HB2  2  
ATOM 2542  H HB3  . LYS A 1 39  ? 18.829  -6.427  -22.076 1.00 0.00 ? 136 LYS A HB3  2  
ATOM 2543  H HG2  . LYS A 1 39  ? 19.761  -4.153  -21.872 1.00 0.00 ? 136 LYS A HG2  2  
ATOM 2544  H HG3  . LYS A 1 39  ? 20.722  -4.701  -20.497 1.00 0.00 ? 136 LYS A HG3  2  
ATOM 2545  H HD2  . LYS A 1 39  ? 22.094  -4.745  -22.472 1.00 0.00 ? 136 LYS A HD2  2  
ATOM 2546  H HD3  . LYS A 1 39  ? 21.761  -6.401  -21.966 1.00 0.00 ? 136 LYS A HD3  2  
ATOM 2547  H HE2  . LYS A 1 39  ? 20.022  -6.584  -23.659 1.00 0.00 ? 136 LYS A HE2  2  
ATOM 2548  H HE3  . LYS A 1 39  ? 20.306  -4.917  -24.151 1.00 0.00 ? 136 LYS A HE3  2  
ATOM 2549  H HZ1  . LYS A 1 39  ? 21.405  -6.477  -25.625 1.00 0.00 ? 136 LYS A HZ1  2  
ATOM 2550  H HZ2  . LYS A 1 39  ? 22.272  -7.135  -24.333 1.00 0.00 ? 136 LYS A HZ2  2  
ATOM 2551  H HZ3  . LYS A 1 39  ? 22.546  -5.536  -24.808 1.00 0.00 ? 136 LYS A HZ3  2  
ATOM 2552  N N    . THR A 1 40  ? 16.093  -6.668  -21.141 1.00 0.00 ? 137 THR A N    2  
ATOM 2553  C CA   . THR A 1 40  ? 14.951  -7.564  -21.110 1.00 0.00 ? 137 THR A CA   2  
ATOM 2554  C C    . THR A 1 40  ? 15.313  -8.939  -21.672 1.00 0.00 ? 137 THR A C    2  
ATOM 2555  O O    . THR A 1 40  ? 16.282  -9.078  -22.420 1.00 0.00 ? 137 THR A O    2  
ATOM 2556  C CB   . THR A 1 40  ? 13.750  -6.978  -21.884 1.00 0.00 ? 137 THR A CB   2  
ATOM 2557  O OG1  . THR A 1 40  ? 12.570  -7.746  -21.613 1.00 0.00 ? 137 THR A OG1  2  
ATOM 2558  C CG2  . THR A 1 40  ? 14.011  -6.964  -23.386 1.00 0.00 ? 137 THR A CG2  2  
ATOM 2559  H H    . THR A 1 40  ? 16.200  -6.047  -21.895 1.00 0.00 ? 137 THR A H    2  
ATOM 2560  H HA   . THR A 1 40  ? 14.657  -7.682  -20.078 1.00 0.00 ? 137 THR A HA   2  
ATOM 2561  H HB   . THR A 1 40  ? 13.590  -5.962  -21.554 1.00 0.00 ? 137 THR A HB   2  
ATOM 2562  H HG1  . THR A 1 40  ? 12.020  -7.779  -22.406 1.00 0.00 ? 137 THR A HG1  2  
ATOM 2563  H HG21 . THR A 1 40  ? 14.868  -6.344  -23.596 1.00 0.00 ? 137 THR A HG21 2  
ATOM 2564  H HG22 . THR A 1 40  ? 13.146  -6.569  -23.899 1.00 0.00 ? 137 THR A HG22 2  
ATOM 2565  H HG23 . THR A 1 40  ? 14.203  -7.970  -23.726 1.00 0.00 ? 137 THR A HG23 2  
ATOM 2566  N N    . GLY A 1 41  ? 14.535  -9.947  -21.305 1.00 0.00 ? 138 GLY A N    2  
ATOM 2567  C CA   . GLY A 1 41  ? 14.797  -11.292 -21.767 1.00 0.00 ? 138 GLY A CA   2  
ATOM 2568  C C    . GLY A 1 41  ? 14.500  -12.330 -20.707 1.00 0.00 ? 138 GLY A C    2  
ATOM 2569  O O    . GLY A 1 41  ? 13.599  -13.153 -20.870 1.00 0.00 ? 138 GLY A O    2  
ATOM 2570  H H    . GLY A 1 41  ? 13.764  -9.774  -20.725 1.00 0.00 ? 138 GLY A H    2  
ATOM 2571  H HA2  . GLY A 1 41  ? 14.185  -11.492 -22.634 1.00 0.00 ? 138 GLY A HA2  2  
ATOM 2572  H HA3  . GLY A 1 41  ? 15.837  -11.369 -22.048 1.00 0.00 ? 138 GLY A HA3  2  
ATOM 2573  N N    . TRP A 1 42  ? 15.249  -12.287 -19.614 1.00 0.00 ? 139 TRP A N    2  
ATOM 2574  C CA   . TRP A 1 42  ? 15.084  -13.262 -18.544 1.00 0.00 ? 139 TRP A CA   2  
ATOM 2575  C C    . TRP A 1 42  ? 15.175  -12.610 -17.168 1.00 0.00 ? 139 TRP A C    2  
ATOM 2576  O O    . TRP A 1 42  ? 15.076  -13.288 -16.145 1.00 0.00 ? 139 TRP A O    2  
ATOM 2577  C CB   . TRP A 1 42  ? 16.142  -14.364 -18.665 1.00 0.00 ? 139 TRP A CB   2  
ATOM 2578  C CG   . TRP A 1 42  ? 17.551  -13.854 -18.622 1.00 0.00 ? 139 TRP A CG   2  
ATOM 2579  C CD1  . TRP A 1 42  ? 18.244  -13.286 -19.651 1.00 0.00 ? 139 TRP A CD1  2  
ATOM 2580  C CD2  . TRP A 1 42  ? 18.443  -13.874 -17.500 1.00 0.00 ? 139 TRP A CD2  2  
ATOM 2581  N NE1  . TRP A 1 42  ? 19.508  -12.945 -19.237 1.00 0.00 ? 139 TRP A NE1  2  
ATOM 2582  C CE2  . TRP A 1 42  ? 19.656  -13.298 -17.922 1.00 0.00 ? 139 TRP A CE2  2  
ATOM 2583  C CE3  . TRP A 1 42  ? 18.334  -14.320 -16.181 1.00 0.00 ? 139 TRP A CE3  2  
ATOM 2584  C CZ2  . TRP A 1 42  ? 20.750  -13.158 -17.072 1.00 0.00 ? 139 TRP A CZ2  2  
ATOM 2585  C CZ3  . TRP A 1 42  ? 19.420  -14.181 -15.339 1.00 0.00 ? 139 TRP A CZ3  2  
ATOM 2586  C CH2  . TRP A 1 42  ? 20.615  -13.605 -15.787 1.00 0.00 ? 139 TRP A CH2  2  
ATOM 2587  H H    . TRP A 1 42  ? 15.939  -11.594 -19.532 1.00 0.00 ? 139 TRP A H    2  
ATOM 2588  H HA   . TRP A 1 42  ? 14.109  -13.706 -18.654 1.00 0.00 ? 139 TRP A HA   2  
ATOM 2589  H HB2  . TRP A 1 42  ? 16.017  -15.063 -17.852 1.00 0.00 ? 139 TRP A HB2  2  
ATOM 2590  H HB3  . TRP A 1 42  ? 16.003  -14.882 -19.602 1.00 0.00 ? 139 TRP A HB3  2  
ATOM 2591  H HD1  . TRP A 1 42  ? 17.838  -13.130 -20.638 1.00 0.00 ? 139 TRP A HD1  2  
ATOM 2592  H HE1  . TRP A 1 42  ? 20.196  -12.517 -19.796 1.00 0.00 ? 139 TRP A HE1  2  
ATOM 2593  H HE3  . TRP A 1 42  ? 17.420  -14.766 -15.815 1.00 0.00 ? 139 TRP A HE3  2  
ATOM 2594  H HZ2  . TRP A 1 42  ? 21.679  -12.716 -17.402 1.00 0.00 ? 139 TRP A HZ2  2  
ATOM 2595  H HZ3  . TRP A 1 42  ? 19.353  -14.522 -14.316 1.00 0.00 ? 139 TRP A HZ3  2  
ATOM 2596  H HH2  . TRP A 1 42  ? 21.439  -13.518 -15.093 1.00 0.00 ? 139 TRP A HH2  2  
ATOM 2597  N N    . PHE A 1 43  ? 15.360  -11.300 -17.134 1.00 0.00 ? 140 PHE A N    2  
ATOM 2598  C CA   . PHE A 1 43  ? 15.522  -10.600 -15.871 1.00 0.00 ? 140 PHE A CA   2  
ATOM 2599  C C    . PHE A 1 43  ? 14.174  -10.417 -15.188 1.00 0.00 ? 140 PHE A C    2  
ATOM 2600  O O    . PHE A 1 43  ? 13.123  -10.465 -15.834 1.00 0.00 ? 140 PHE A O    2  
ATOM 2601  C CB   . PHE A 1 43  ? 16.189  -9.235  -16.085 1.00 0.00 ? 140 PHE A CB   2  
ATOM 2602  C CG   . PHE A 1 43  ? 15.223  -8.102  -16.313 1.00 0.00 ? 140 PHE A CG   2  
ATOM 2603  C CD1  . PHE A 1 43  ? 14.617  -7.913  -17.544 1.00 0.00 ? 140 PHE A CD1  2  
ATOM 2604  C CD2  . PHE A 1 43  ? 14.929  -7.220  -15.288 1.00 0.00 ? 140 PHE A CD2  2  
ATOM 2605  C CE1  . PHE A 1 43  ? 13.741  -6.862  -17.745 1.00 0.00 ? 140 PHE A CE1  2  
ATOM 2606  C CE2  . PHE A 1 43  ? 14.055  -6.173  -15.480 1.00 0.00 ? 140 PHE A CE2  2  
ATOM 2607  C CZ   . PHE A 1 43  ? 13.460  -5.992  -16.709 1.00 0.00 ? 140 PHE A CZ   2  
ATOM 2608  H H    . PHE A 1 43  ? 15.386  -10.794 -17.970 1.00 0.00 ? 140 PHE A H    2  
ATOM 2609  H HA   . PHE A 1 43  ? 16.154  -11.205 -15.237 1.00 0.00 ? 140 PHE A HA   2  
ATOM 2610  H HB2  . PHE A 1 43  ? 16.779  -8.993  -15.214 1.00 0.00 ? 140 PHE A HB2  2  
ATOM 2611  H HB3  . PHE A 1 43  ? 16.841  -9.295  -16.944 1.00 0.00 ? 140 PHE A HB3  2  
ATOM 2612  H HD1  . PHE A 1 43  ? 14.837  -8.595  -18.351 1.00 0.00 ? 140 PHE A HD1  2  
ATOM 2613  H HD2  . PHE A 1 43  ? 15.392  -7.360  -14.323 1.00 0.00 ? 140 PHE A HD2  2  
ATOM 2614  H HE1  . PHE A 1 43  ? 13.275  -6.723  -18.709 1.00 0.00 ? 140 PHE A HE1  2  
ATOM 2615  H HE2  . PHE A 1 43  ? 13.838  -5.494  -14.670 1.00 0.00 ? 140 PHE A HE2  2  
ATOM 2616  H HZ   . PHE A 1 43  ? 12.781  -5.170  -16.859 1.00 0.00 ? 140 PHE A HZ   2  
ATOM 2617  N N    . THR A 1 44  ? 14.208  -10.233 -13.881 1.00 0.00 ? 141 THR A N    2  
ATOM 2618  C CA   . THR A 1 44  ? 13.015  -9.916  -13.113 1.00 0.00 ? 141 THR A CA   2  
ATOM 2619  C C    . THR A 1 44  ? 13.403  -9.203  -11.824 1.00 0.00 ? 141 THR A C    2  
ATOM 2620  O O    . THR A 1 44  ? 14.318  -9.632  -11.119 1.00 0.00 ? 141 THR A O    2  
ATOM 2621  C CB   . THR A 1 44  ? 12.199  -11.176 -12.758 1.00 0.00 ? 141 THR A CB   2  
ATOM 2622  O OG1  . THR A 1 44  ? 12.056  -12.019 -13.911 1.00 0.00 ? 141 THR A OG1  2  
ATOM 2623  C CG2  . THR A 1 44  ? 10.822  -10.796 -12.242 1.00 0.00 ? 141 THR A CG2  2  
ATOM 2624  H H    . THR A 1 44  ? 15.068  -10.312 -13.413 1.00 0.00 ? 141 THR A H    2  
ATOM 2625  H HA   . THR A 1 44  ? 12.396  -9.260  -13.707 1.00 0.00 ? 141 THR A HA   2  
ATOM 2626  H HB   . THR A 1 44  ? 12.717  -11.713 -11.983 1.00 0.00 ? 141 THR A HB   2  
ATOM 2627  H HG1  . THR A 1 44  ? 12.380  -11.545 -14.691 1.00 0.00 ? 141 THR A HG1  2  
ATOM 2628  H HG21 . THR A 1 44  ? 10.298  -10.232 -12.999 1.00 0.00 ? 141 THR A HG21 2  
ATOM 2629  H HG22 . THR A 1 44  ? 10.923  -10.194 -11.351 1.00 0.00 ? 141 THR A HG22 2  
ATOM 2630  H HG23 . THR A 1 44  ? 10.264  -11.692 -12.011 1.00 0.00 ? 141 THR A HG23 2  
ATOM 2631  N N    . LEU A 1 45  ? 12.719  -8.115  -11.534 1.00 0.00 ? 142 LEU A N    2  
ATOM 2632  C CA   . LEU A 1 45  ? 12.952  -7.369  -10.308 1.00 0.00 ? 142 LEU A CA   2  
ATOM 2633  C C    . LEU A 1 45  ? 11.703  -7.424  -9.438  1.00 0.00 ? 142 LEU A C    2  
ATOM 2634  O O    . LEU A 1 45  ? 10.581  -7.447  -9.948  1.00 0.00 ? 142 LEU A O    2  
ATOM 2635  C CB   . LEU A 1 45  ? 13.345  -5.909  -10.606 1.00 0.00 ? 142 LEU A CB   2  
ATOM 2636  C CG   . LEU A 1 45  ? 12.215  -4.959  -11.041 1.00 0.00 ? 142 LEU A CG   2  
ATOM 2637  C CD1  . LEU A 1 45  ? 12.727  -3.530  -11.080 1.00 0.00 ? 142 LEU A CD1  2  
ATOM 2638  C CD2  . LEU A 1 45  ? 11.649  -5.341  -12.403 1.00 0.00 ? 142 LEU A CD2  2  
ATOM 2639  H H    . LEU A 1 45  ? 12.031  -7.810  -12.153 1.00 0.00 ? 142 LEU A H    2  
ATOM 2640  H HA   . LEU A 1 45  ? 13.762  -7.850  -9.779  1.00 0.00 ? 142 LEU A HA   2  
ATOM 2641  H HB2  . LEU A 1 45  ? 13.798  -5.501  -9.716  1.00 0.00 ? 142 LEU A HB2  2  
ATOM 2642  H HB3  . LEU A 1 45  ? 14.090  -5.920  -11.388 1.00 0.00 ? 142 LEU A HB3  2  
ATOM 2643  H HG   . LEU A 1 45  ? 11.413  -5.007  -10.317 1.00 0.00 ? 142 LEU A HG   2  
ATOM 2644  H HD11 . LEU A 1 45  ? 11.918  -2.863  -11.344 1.00 0.00 ? 142 LEU A HD11 2  
ATOM 2645  H HD12 . LEU A 1 45  ? 13.512  -3.451  -11.816 1.00 0.00 ? 142 LEU A HD12 2  
ATOM 2646  H HD13 . LEU A 1 45  ? 13.114  -3.258  -10.110 1.00 0.00 ? 142 LEU A HD13 2  
ATOM 2647  H HD21 . LEU A 1 45  ? 10.973  -4.570  -12.741 1.00 0.00 ? 142 LEU A HD21 2  
ATOM 2648  H HD22 . LEU A 1 45  ? 11.118  -6.276  -12.323 1.00 0.00 ? 142 LEU A HD22 2  
ATOM 2649  H HD23 . LEU A 1 45  ? 12.458  -5.446  -13.111 1.00 0.00 ? 142 LEU A HD23 2  
ATOM 2650  N N    . LEU A 1 46  ? 11.894  -7.477  -8.132  1.00 0.00 ? 143 LEU A N    2  
ATOM 2651  C CA   . LEU A 1 46  ? 10.772  -7.565  -7.216  1.00 0.00 ? 143 LEU A CA   2  
ATOM 2652  C C    . LEU A 1 46  ? 10.446  -6.194  -6.647  1.00 0.00 ? 143 LEU A C    2  
ATOM 2653  O O    . LEU A 1 46  ? 11.339  -5.372  -6.423  1.00 0.00 ? 143 LEU A O    2  
ATOM 2654  C CB   . LEU A 1 46  ? 11.055  -8.552  -6.074  1.00 0.00 ? 143 LEU A CB   2  
ATOM 2655  C CG   . LEU A 1 46  ? 11.385  -9.998  -6.484  1.00 0.00 ? 143 LEU A CG   2  
ATOM 2656  C CD1  . LEU A 1 46  ? 10.485  -10.468 -7.617  1.00 0.00 ? 143 LEU A CD1  2  
ATOM 2657  C CD2  . LEU A 1 46  ? 12.853  -10.138 -6.860  1.00 0.00 ? 143 LEU A CD2  2  
ATOM 2658  H H    . LEU A 1 46  ? 12.810  -7.451  -7.775  1.00 0.00 ? 143 LEU A H    2  
ATOM 2659  H HA   . LEU A 1 46  ? 9.918   -7.917  -7.777  1.00 0.00 ? 143 LEU A HA   2  
ATOM 2660  H HB2  . LEU A 1 46  ? 11.885  -8.169  -5.501  1.00 0.00 ? 143 LEU A HB2  2  
ATOM 2661  H HB3  . LEU A 1 46  ? 10.186  -8.577  -5.433  1.00 0.00 ? 143 LEU A HB3  2  
ATOM 2662  H HG   . LEU A 1 46  ? 11.200  -10.644 -5.640  1.00 0.00 ? 143 LEU A HG   2  
ATOM 2663  H HD11 . LEU A 1 46  ? 9.452   -10.390 -7.314  1.00 0.00 ? 143 LEU A HD11 2  
ATOM 2664  H HD12 . LEU A 1 46  ? 10.714  -11.497 -7.854  1.00 0.00 ? 143 LEU A HD12 2  
ATOM 2665  H HD13 . LEU A 1 46  ? 10.653  -9.853  -8.490  1.00 0.00 ? 143 LEU A HD13 2  
ATOM 2666  H HD21 . LEU A 1 46  ? 13.065  -11.166 -7.110  1.00 0.00 ? 143 LEU A HD21 2  
ATOM 2667  H HD22 . LEU A 1 46  ? 13.469  -9.834  -6.025  1.00 0.00 ? 143 LEU A HD22 2  
ATOM 2668  H HD23 . LEU A 1 46  ? 13.067  -9.509  -7.712  1.00 0.00 ? 143 LEU A HD23 2  
ATOM 2669  N N    . TYR A 1 47  ? 9.165   -5.952  -6.415  1.00 0.00 ? 144 TYR A N    2  
ATOM 2670  C CA   . TYR A 1 47  ? 8.714   -4.678  -5.891  1.00 0.00 ? 144 TYR A CA   2  
ATOM 2671  C C    . TYR A 1 47  ? 8.402   -4.791  -4.408  1.00 0.00 ? 144 TYR A C    2  
ATOM 2672  O O    . TYR A 1 47  ? 7.975   -5.845  -3.925  1.00 0.00 ? 144 TYR A O    2  
ATOM 2673  C CB   . TYR A 1 47  ? 7.499   -4.183  -6.670  1.00 0.00 ? 144 TYR A CB   2  
ATOM 2674  C CG   . TYR A 1 47  ? 7.824   -3.836  -8.104  1.00 0.00 ? 144 TYR A CG   2  
ATOM 2675  C CD1  . TYR A 1 47  ? 8.273   -2.567  -8.444  1.00 0.00 ? 144 TYR A CD1  2  
ATOM 2676  C CD2  . TYR A 1 47  ? 7.692   -4.778  -9.117  1.00 0.00 ? 144 TYR A CD2  2  
ATOM 2677  C CE1  . TYR A 1 47  ? 8.579   -2.245  -9.751  1.00 0.00 ? 144 TYR A CE1  2  
ATOM 2678  C CE2  . TYR A 1 47  ? 7.997   -4.465  -10.427 1.00 0.00 ? 144 TYR A CE2  2  
ATOM 2679  C CZ   . TYR A 1 47  ? 8.439   -3.196  -10.739 1.00 0.00 ? 144 TYR A CZ   2  
ATOM 2680  O OH   . TYR A 1 47  ? 8.741   -2.877  -12.042 1.00 0.00 ? 144 TYR A OH   2  
ATOM 2681  H H    . TYR A 1 47  ? 8.507   -6.649  -6.599  1.00 0.00 ? 144 TYR A H    2  
ATOM 2682  H HA   . TYR A 1 47  ? 9.519   -3.970  -6.016  1.00 0.00 ? 144 TYR A HA   2  
ATOM 2683  H HB2  . TYR A 1 47  ? 6.743   -4.954  -6.676  1.00 0.00 ? 144 TYR A HB2  2  
ATOM 2684  H HB3  . TYR A 1 47  ? 7.105   -3.298  -6.192  1.00 0.00 ? 144 TYR A HB3  2  
ATOM 2685  H HD1  . TYR A 1 47  ? 8.383   -1.824  -7.668  1.00 0.00 ? 144 TYR A HD1  2  
ATOM 2686  H HD2  . TYR A 1 47  ? 7.343   -5.770  -8.869  1.00 0.00 ? 144 TYR A HD2  2  
ATOM 2687  H HE1  . TYR A 1 47  ? 8.925   -1.252  -9.995  1.00 0.00 ? 144 TYR A HE1  2  
ATOM 2688  H HE2  . TYR A 1 47  ? 7.887   -5.209  -11.201 1.00 0.00 ? 144 TYR A HE2  2  
ATOM 2689  H HH   . TYR A 1 47  ? 8.119   -3.318  -12.632 1.00 0.00 ? 144 TYR A HH   2  
ATOM 2690  N N    . GLU A 1 48  ? 8.611   -3.696  -3.704  1.00 0.00 ? 145 GLU A N    2  
ATOM 2691  C CA   . GLU A 1 48  ? 8.598   -3.690  -2.252  1.00 0.00 ? 145 GLU A CA   2  
ATOM 2692  C C    . GLU A 1 48  ? 7.743   -2.529  -1.746  1.00 0.00 ? 145 GLU A C    2  
ATOM 2693  O O    . GLU A 1 48  ? 7.867   -1.410  -2.241  1.00 0.00 ? 145 GLU A O    2  
ATOM 2694  C CB   . GLU A 1 48  ? 10.045  -3.542  -1.791  1.00 0.00 ? 145 GLU A CB   2  
ATOM 2695  C CG   . GLU A 1 48  ? 10.338  -4.027  -0.390  1.00 0.00 ? 145 GLU A CG   2  
ATOM 2696  C CD   . GLU A 1 48  ? 11.829  -4.012  -0.120  1.00 0.00 ? 145 GLU A CD   2  
ATOM 2697  O OE1  . GLU A 1 48  ? 12.399  -2.909  0.030   1.00 0.00 ? 145 GLU A OE1  2  
ATOM 2698  O OE2  . GLU A 1 48  ? 12.447  -5.102  -0.111  1.00 0.00 ? 145 GLU A OE2  2  
ATOM 2699  H H    . GLU A 1 48  ? 8.787   -2.853  -4.177  1.00 0.00 ? 145 GLU A H    2  
ATOM 2700  H HA   . GLU A 1 48  ? 8.194   -4.626  -1.900  1.00 0.00 ? 145 GLU A HA   2  
ATOM 2701  H HB2  . GLU A 1 48  ? 10.678  -4.094  -2.468  1.00 0.00 ? 145 GLU A HB2  2  
ATOM 2702  H HB3  . GLU A 1 48  ? 10.313  -2.497  -1.844  1.00 0.00 ? 145 GLU A HB3  2  
ATOM 2703  H HG2  . GLU A 1 48  ? 9.844   -3.380  0.321   1.00 0.00 ? 145 GLU A HG2  2  
ATOM 2704  H HG3  . GLU A 1 48  ? 9.972   -5.038  -0.282  1.00 0.00 ? 145 GLU A HG3  2  
ATOM 2705  N N    . ILE A 1 49  ? 6.869   -2.792  -0.781  1.00 0.00 ? 146 ILE A N    2  
ATOM 2706  C CA   . ILE A 1 49  ? 5.970   -1.757  -0.271  1.00 0.00 ? 146 ILE A CA   2  
ATOM 2707  C C    . ILE A 1 49  ? 6.076   -1.649  1.247   1.00 0.00 ? 146 ILE A C    2  
ATOM 2708  O O    . ILE A 1 49  ? 5.817   -2.610  1.967   1.00 0.00 ? 146 ILE A O    2  
ATOM 2709  C CB   . ILE A 1 49  ? 4.485   -2.019  -0.640  1.00 0.00 ? 146 ILE A CB   2  
ATOM 2710  C CG1  . ILE A 1 49  ? 4.308   -2.253  -2.145  1.00 0.00 ? 146 ILE A CG1  2  
ATOM 2711  C CG2  . ILE A 1 49  ? 3.607   -0.856  -0.200  1.00 0.00 ? 146 ILE A CG2  2  
ATOM 2712  C CD1  . ILE A 1 49  ? 4.520   -3.688  -2.573  1.00 0.00 ? 146 ILE A CD1  2  
ATOM 2713  H H    . ILE A 1 49  ? 6.831   -3.697  -0.395  1.00 0.00 ? 146 ILE A H    2  
ATOM 2714  H HA   . ILE A 1 49  ? 6.268   -0.815  -0.709  1.00 0.00 ? 146 ILE A HA   2  
ATOM 2715  H HB   . ILE A 1 49  ? 4.162   -2.898  -0.107  1.00 0.00 ? 146 ILE A HB   2  
ATOM 2716  H HG12 . ILE A 1 49  ? 3.307   -1.970  -2.430  1.00 0.00 ? 146 ILE A HG12 2  
ATOM 2717  H HG13 . ILE A 1 49  ? 5.017   -1.638  -2.682  1.00 0.00 ? 146 ILE A HG13 2  
ATOM 2718  H HG21 . ILE A 1 49  ? 3.727   -0.694  0.861   1.00 0.00 ? 146 ILE A HG21 2  
ATOM 2719  H HG22 . ILE A 1 49  ? 2.574   -1.085  -0.415  1.00 0.00 ? 146 ILE A HG22 2  
ATOM 2720  H HG23 . ILE A 1 49  ? 3.896   0.036   -0.739  1.00 0.00 ? 146 ILE A HG23 2  
ATOM 2721  H HD11 . ILE A 1 49  ? 3.778   -4.317  -2.104  1.00 0.00 ? 146 ILE A HD11 2  
ATOM 2722  H HD12 . ILE A 1 49  ? 5.508   -4.012  -2.277  1.00 0.00 ? 146 ILE A HD12 2  
ATOM 2723  H HD13 . ILE A 1 49  ? 4.425   -3.758  -3.645  1.00 0.00 ? 146 ILE A HD13 2  
ATOM 2724  N N    . ARG A 1 50  ? 6.449   -0.475  1.727   1.00 0.00 ? 147 ARG A N    2  
ATOM 2725  C CA   . ARG A 1 50  ? 6.562   -0.233  3.160   1.00 0.00 ? 147 ARG A CA   2  
ATOM 2726  C C    . ARG A 1 50  ? 5.374   0.588   3.624   1.00 0.00 ? 147 ARG A C    2  
ATOM 2727  O O    . ARG A 1 50  ? 5.165   1.701   3.143   1.00 0.00 ? 147 ARG A O    2  
ATOM 2728  C CB   . ARG A 1 50  ? 7.863   0.506   3.481   1.00 0.00 ? 147 ARG A CB   2  
ATOM 2729  C CG   . ARG A 1 50  ? 8.194   0.564   4.963   1.00 0.00 ? 147 ARG A CG   2  
ATOM 2730  C CD   . ARG A 1 50  ? 9.502   1.303   5.217   1.00 0.00 ? 147 ARG A CD   2  
ATOM 2731  N NE   . ARG A 1 50  ? 9.293   2.647   5.763   1.00 0.00 ? 147 ARG A NE   2  
ATOM 2732  C CZ   . ARG A 1 50  ? 9.261   3.763   5.034   1.00 0.00 ? 147 ARG A CZ   2  
ATOM 2733  N NH1  . ARG A 1 50  ? 9.397   3.703   3.720   1.00 0.00 ? 147 ARG A NH1  2  
ATOM 2734  N NH2  . ARG A 1 50  ? 9.106   4.942   5.627   1.00 0.00 ? 147 ARG A NH2  2  
ATOM 2735  H H    . ARG A 1 50  ? 6.632   0.256   1.098   1.00 0.00 ? 147 ARG A H    2  
ATOM 2736  H HA   . ARG A 1 50  ? 6.552   -1.188  3.667   1.00 0.00 ? 147 ARG A HA   2  
ATOM 2737  H HB2  . ARG A 1 50  ? 8.678   0.011   2.973   1.00 0.00 ? 147 ARG A HB2  2  
ATOM 2738  H HB3  . ARG A 1 50  ? 7.786   1.519   3.112   1.00 0.00 ? 147 ARG A HB3  2  
ATOM 2739  H HG2  . ARG A 1 50  ? 7.398   1.077   5.479   1.00 0.00 ? 147 ARG A HG2  2  
ATOM 2740  H HG3  . ARG A 1 50  ? 8.280   -0.443  5.344   1.00 0.00 ? 147 ARG A HG3  2  
ATOM 2741  H HD2  . ARG A 1 50  ? 10.090  0.731   5.919   1.00 0.00 ? 147 ARG A HD2  2  
ATOM 2742  H HD3  . ARG A 1 50  ? 10.040  1.385   4.284   1.00 0.00 ? 147 ARG A HD3  2  
ATOM 2743  H HE   . ARG A 1 50  ? 9.190   2.718   6.741   1.00 0.00 ? 147 ARG A HE   2  
ATOM 2744  H HH11 . ARG A 1 50  ? 9.523   2.820   3.267   1.00 0.00 ? 147 ARG A HH11 2  
ATOM 2745  H HH12 . ARG A 1 50  ? 9.381   4.544   3.174   1.00 0.00 ? 147 ARG A HH12 2  
ATOM 2746  H HH21 . ARG A 1 50  ? 9.016   4.998   6.625   1.00 0.00 ? 147 ARG A HH21 2  
ATOM 2747  H HH22 . ARG A 1 50  ? 9.071   5.788   5.080   1.00 0.00 ? 147 ARG A HH22 2  
ATOM 2748  N N    . LEU A 1 51  ? 4.597   0.047   4.545   1.00 0.00 ? 148 LEU A N    2  
ATOM 2749  C CA   . LEU A 1 51  ? 3.389   0.715   4.982   1.00 0.00 ? 148 LEU A CA   2  
ATOM 2750  C C    . LEU A 1 51  ? 3.145   0.520   6.471   1.00 0.00 ? 148 LEU A C    2  
ATOM 2751  O O    . LEU A 1 51  ? 3.688   -0.399  7.087   1.00 0.00 ? 148 LEU A O    2  
ATOM 2752  C CB   . LEU A 1 51  ? 2.201   0.201   4.166   1.00 0.00 ? 148 LEU A CB   2  
ATOM 2753  C CG   . LEU A 1 51  ? 1.921   -1.296  4.280   1.00 0.00 ? 148 LEU A CG   2  
ATOM 2754  C CD1  . LEU A 1 51  ? 0.835   -1.564  5.310   1.00 0.00 ? 148 LEU A CD1  2  
ATOM 2755  C CD2  . LEU A 1 51  ? 1.541   -1.860  2.925   1.00 0.00 ? 148 LEU A CD2  2  
ATOM 2756  H H    . LEU A 1 51  ? 4.835   -0.825  4.933   1.00 0.00 ? 148 LEU A H    2  
ATOM 2757  H HA   . LEU A 1 51  ? 3.510   1.770   4.789   1.00 0.00 ? 148 LEU A HA   2  
ATOM 2758  H HB2  . LEU A 1 51  ? 1.318   0.737   4.483   1.00 0.00 ? 148 LEU A HB2  2  
ATOM 2759  H HB3  . LEU A 1 51  ? 2.385   0.431   3.127   1.00 0.00 ? 148 LEU A HB3  2  
ATOM 2760  H HG   . LEU A 1 51  ? 2.819   -1.801  4.605   1.00 0.00 ? 148 LEU A HG   2  
ATOM 2761  H HD11 . LEU A 1 51  ? 0.603   -2.619  5.323   1.00 0.00 ? 148 LEU A HD11 2  
ATOM 2762  H HD12 . LEU A 1 51  ? -0.052  -1.001  5.056   1.00 0.00 ? 148 LEU A HD12 2  
ATOM 2763  H HD13 . LEU A 1 51  ? 1.187   -1.262  6.286   1.00 0.00 ? 148 LEU A HD13 2  
ATOM 2764  H HD21 . LEU A 1 51  ? 1.333   -2.914  3.020   1.00 0.00 ? 148 LEU A HD21 2  
ATOM 2765  H HD22 . LEU A 1 51  ? 2.361   -1.715  2.236   1.00 0.00 ? 148 LEU A HD22 2  
ATOM 2766  H HD23 . LEU A 1 51  ? 0.664   -1.350  2.555   1.00 0.00 ? 148 LEU A HD23 2  
ATOM 2767  N N    . LYS A 1 52  ? 2.343   1.408   7.039   1.00 0.00 ? 149 LYS A N    2  
ATOM 2768  C CA   . LYS A 1 52  ? 1.924   1.311   8.430   1.00 0.00 ? 149 LYS A CA   2  
ATOM 2769  C C    . LYS A 1 52  ? 0.815   2.323   8.694   1.00 0.00 ? 149 LYS A C    2  
ATOM 2770  O O    . LYS A 1 52  ? 0.771   3.380   8.058   1.00 0.00 ? 149 LYS A O    2  
ATOM 2771  C CB   . LYS A 1 52  ? 3.093   1.584   9.388   1.00 0.00 ? 149 LYS A CB   2  
ATOM 2772  C CG   . LYS A 1 52  ? 3.530   3.039   9.418   1.00 0.00 ? 149 LYS A CG   2  
ATOM 2773  C CD   . LYS A 1 52  ? 4.364   3.351   10.648  1.00 0.00 ? 149 LYS A CD   2  
ATOM 2774  C CE   . LYS A 1 52  ? 4.665   4.836   10.740  1.00 0.00 ? 149 LYS A CE   2  
ATOM 2775  N NZ   . LYS A 1 52  ? 5.296   5.202   12.035  1.00 0.00 ? 149 LYS A NZ   2  
ATOM 2776  H H    . LYS A 1 52  ? 2.022   2.166   6.500   1.00 0.00 ? 149 LYS A H    2  
ATOM 2777  H HA   . LYS A 1 52  ? 1.543   0.316   8.600   1.00 0.00 ? 149 LYS A HA   2  
ATOM 2778  H HB2  . LYS A 1 52  ? 2.800   1.296   10.386  1.00 0.00 ? 149 LYS A HB2  2  
ATOM 2779  H HB3  . LYS A 1 52  ? 3.937   0.983   9.084   1.00 0.00 ? 149 LYS A HB3  2  
ATOM 2780  H HG2  . LYS A 1 52  ? 4.117   3.247   8.537   1.00 0.00 ? 149 LYS A HG2  2  
ATOM 2781  H HG3  . LYS A 1 52  ? 2.651   3.667   9.422   1.00 0.00 ? 149 LYS A HG3  2  
ATOM 2782  H HD2  . LYS A 1 52  ? 3.819   3.048   11.529  1.00 0.00 ? 149 LYS A HD2  2  
ATOM 2783  H HD3  . LYS A 1 52  ? 5.294   2.804   10.590  1.00 0.00 ? 149 LYS A HD3  2  
ATOM 2784  H HE2  . LYS A 1 52  ? 5.337   5.101   9.936   1.00 0.00 ? 149 LYS A HE2  2  
ATOM 2785  H HE3  . LYS A 1 52  ? 3.742   5.385   10.629  1.00 0.00 ? 149 LYS A HE3  2  
ATOM 2786  H HZ1  . LYS A 1 52  ? 4.673   4.927   12.824  1.00 0.00 ? 149 LYS A HZ1  2  
ATOM 2787  H HZ2  . LYS A 1 52  ? 5.457   6.230   12.076  1.00 0.00 ? 149 LYS A HZ2  2  
ATOM 2788  H HZ3  . LYS A 1 52  ? 6.208   4.716   12.143  1.00 0.00 ? 149 LYS A HZ3  2  
ATOM 2789  N N    . PRO A 1 53  ? -0.115  2.006   9.604   1.00 0.00 ? 150 PRO A N    2  
ATOM 2790  C CA   . PRO A 1 53  ? -1.126  2.958   10.047  1.00 0.00 ? 150 PRO A CA   2  
ATOM 2791  C C    . PRO A 1 53  ? -0.535  4.062   10.920  1.00 0.00 ? 150 PRO A C    2  
ATOM 2792  O O    . PRO A 1 53  ? 0.603   3.955   11.380  1.00 0.00 ? 150 PRO A O    2  
ATOM 2793  C CB   . PRO A 1 53  ? -2.107  2.112   10.857  1.00 0.00 ? 150 PRO A CB   2  
ATOM 2794  C CG   . PRO A 1 53  ? -1.336  0.909   11.279  1.00 0.00 ? 150 PRO A CG   2  
ATOM 2795  C CD   . PRO A 1 53  ? -0.275  0.685   10.235  1.00 0.00 ? 150 PRO A CD   2  
ATOM 2796  H HA   . PRO A 1 53  ? -1.641  3.404   9.209   1.00 0.00 ? 150 PRO A HA   2  
ATOM 2797  H HB2  . PRO A 1 53  ? -2.446  2.680   11.713  1.00 0.00 ? 150 PRO A HB2  2  
ATOM 2798  H HB3  . PRO A 1 53  ? -2.951  1.844   10.240  1.00 0.00 ? 150 PRO A HB3  2  
ATOM 2799  H HG2  . PRO A 1 53  ? -0.881  1.087   12.241  1.00 0.00 ? 150 PRO A HG2  2  
ATOM 2800  H HG3  . PRO A 1 53  ? -1.995  0.056   11.330  1.00 0.00 ? 150 PRO A HG3  2  
ATOM 2801  H HD2  . PRO A 1 53  ? 0.647   0.367   10.698  1.00 0.00 ? 150 PRO A HD2  2  
ATOM 2802  H HD3  . PRO A 1 53  ? -0.607  -0.047  9.514   1.00 0.00 ? 150 PRO A HD3  2  
ATOM 2803  N N    . GLU A 1 54  ? -1.305  5.110   11.149  1.00 0.00 ? 151 GLU A N    2  
ATOM 2804  C CA   . GLU A 1 54  ? -0.846  6.246   11.940  1.00 0.00 ? 151 GLU A CA   2  
ATOM 2805  C C    . GLU A 1 54  ? -0.419  5.830   13.351  1.00 0.00 ? 151 GLU A C    2  
ATOM 2806  O O    . GLU A 1 54  ? 0.606   6.289   13.857  1.00 0.00 ? 151 GLU A O    2  
ATOM 2807  C CB   . GLU A 1 54  ? -1.943  7.312   12.004  1.00 0.00 ? 151 GLU A CB   2  
ATOM 2808  C CG   . GLU A 1 54  ? -3.299  6.762   12.410  1.00 0.00 ? 151 GLU A CG   2  
ATOM 2809  C CD   . GLU A 1 54  ? -4.407  7.781   12.285  1.00 0.00 ? 151 GLU A CD   2  
ATOM 2810  O OE1  . GLU A 1 54  ? -4.371  8.799   13.005  1.00 0.00 ? 151 GLU A OE1  2  
ATOM 2811  O OE2  . GLU A 1 54  ? -5.333  7.557   11.481  1.00 0.00 ? 151 GLU A OE2  2  
ATOM 2812  H H    . GLU A 1 54  ? -2.205  5.135   10.754  1.00 0.00 ? 151 GLU A H    2  
ATOM 2813  H HA   . GLU A 1 54  ? 0.014   6.659   11.437  1.00 0.00 ? 151 GLU A HA   2  
ATOM 2814  H HB2  . GLU A 1 54  ? -1.659  8.063   12.725  1.00 0.00 ? 151 GLU A HB2  2  
ATOM 2815  H HB3  . GLU A 1 54  ? -2.041  7.774   11.032  1.00 0.00 ? 151 GLU A HB3  2  
ATOM 2816  H HG2  . GLU A 1 54  ? -3.535  5.919   11.778  1.00 0.00 ? 151 GLU A HG2  2  
ATOM 2817  H HG3  . GLU A 1 54  ? -3.244  6.436   13.435  1.00 0.00 ? 151 GLU A HG3  2  
ATOM 2818  N N    . LYS A 1 55  ? -1.182  4.936   13.968  1.00 0.00 ? 152 LYS A N    2  
ATOM 2819  C CA   . LYS A 1 55  ? -0.913  4.522   15.339  1.00 0.00 ? 152 LYS A CA   2  
ATOM 2820  C C    . LYS A 1 55  ? 0.113   3.398   15.394  1.00 0.00 ? 152 LYS A C    2  
ATOM 2821  O O    . LYS A 1 55  ? 0.239   2.706   16.404  1.00 0.00 ? 152 LYS A O    2  
ATOM 2822  C CB   . LYS A 1 55  ? -2.212  4.089   16.010  1.00 0.00 ? 152 LYS A CB   2  
ATOM 2823  C CG   . LYS A 1 55  ? -3.233  5.206   16.072  1.00 0.00 ? 152 LYS A CG   2  
ATOM 2824  C CD   . LYS A 1 55  ? -4.573  4.723   16.582  1.00 0.00 ? 152 LYS A CD   2  
ATOM 2825  C CE   . LYS A 1 55  ? -5.597  5.844   16.553  1.00 0.00 ? 152 LYS A CE   2  
ATOM 2826  N NZ   . LYS A 1 55  ? -6.918  5.412   17.078  1.00 0.00 ? 152 LYS A NZ   2  
ATOM 2827  H H    . LYS A 1 55  ? -1.948  4.549   13.495  1.00 0.00 ? 152 LYS A H    2  
ATOM 2828  H HA   . LYS A 1 55  ? -0.517  5.375   15.869  1.00 0.00 ? 152 LYS A HA   2  
ATOM 2829  H HB2  . LYS A 1 55  ? -2.637  3.266   15.455  1.00 0.00 ? 152 LYS A HB2  2  
ATOM 2830  H HB3  . LYS A 1 55  ? -1.999  3.765   17.018  1.00 0.00 ? 152 LYS A HB3  2  
ATOM 2831  H HG2  . LYS A 1 55  ? -2.867  5.975   16.733  1.00 0.00 ? 152 LYS A HG2  2  
ATOM 2832  H HG3  . LYS A 1 55  ? -3.362  5.613   15.083  1.00 0.00 ? 152 LYS A HG3  2  
ATOM 2833  H HD2  . LYS A 1 55  ? -4.914  3.914   15.953  1.00 0.00 ? 152 LYS A HD2  2  
ATOM 2834  H HD3  . LYS A 1 55  ? -4.457  4.374   17.596  1.00 0.00 ? 152 LYS A HD3  2  
ATOM 2835  H HE2  . LYS A 1 55  ? -5.231  6.662   17.155  1.00 0.00 ? 152 LYS A HE2  2  
ATOM 2836  H HE3  . LYS A 1 55  ? -5.714  6.177   15.531  1.00 0.00 ? 152 LYS A HE3  2  
ATOM 2837  H HZ1  . LYS A 1 55  ? -6.847  5.179   18.088  1.00 0.00 ? 152 LYS A HZ1  2  
ATOM 2838  H HZ2  . LYS A 1 55  ? -7.254  4.574   16.561  1.00 0.00 ? 152 LYS A HZ2  2  
ATOM 2839  H HZ3  . LYS A 1 55  ? -7.616  6.175   16.959  1.00 0.00 ? 152 LYS A HZ3  2  
ATOM 2840  N N    . ALA A 1 56  ? 0.837   3.213   14.304  1.00 0.00 ? 153 ALA A N    2  
ATOM 2841  C CA   . ALA A 1 56  ? 1.894   2.219   14.250  1.00 0.00 ? 153 ALA A CA   2  
ATOM 2842  C C    . ALA A 1 56  ? 3.255   2.876   14.418  1.00 0.00 ? 153 ALA A C    2  
ATOM 2843  O O    . ALA A 1 56  ? 3.585   3.837   13.721  1.00 0.00 ? 153 ALA A O    2  
ATOM 2844  C CB   . ALA A 1 56  ? 1.835   1.473   12.932  1.00 0.00 ? 153 ALA A CB   2  
ATOM 2845  H H    . ALA A 1 56  ? 0.657   3.763   13.510  1.00 0.00 ? 153 ALA A H    2  
ATOM 2846  H HA   . ALA A 1 56  ? 1.735   1.513   15.051  1.00 0.00 ? 153 ALA A HA   2  
ATOM 2847  H HB1  . ALA A 1 56  ? 2.712   0.851   12.830  1.00 0.00 ? 153 ALA A HB1  2  
ATOM 2848  H HB2  . ALA A 1 56  ? 1.803   2.188   12.119  1.00 0.00 ? 153 ALA A HB2  2  
ATOM 2849  H HB3  . ALA A 1 56  ? 0.951   0.856   12.905  1.00 0.00 ? 153 ALA A HB3  2  
ATOM 2850  N N    . ALA A 1 57  ? 4.041   2.358   15.348  1.00 0.00 ? 154 ALA A N    2  
ATOM 2851  C CA   . ALA A 1 57  ? 5.389   2.855   15.571  1.00 0.00 ? 154 ALA A CA   2  
ATOM 2852  C C    . ALA A 1 57  ? 6.365   2.175   14.627  1.00 0.00 ? 154 ALA A C    2  
ATOM 2853  O O    . ALA A 1 57  ? 7.334   2.778   14.167  1.00 0.00 ? 154 ALA A O    2  
ATOM 2854  C CB   . ALA A 1 57  ? 5.810   2.623   17.013  1.00 0.00 ? 154 ALA A CB   2  
ATOM 2855  H H    . ALA A 1 57  ? 3.707   1.618   15.900  1.00 0.00 ? 154 ALA A H    2  
ATOM 2856  H HA   . ALA A 1 57  ? 5.393   3.919   15.380  1.00 0.00 ? 154 ALA A HA   2  
ATOM 2857  H HB1  . ALA A 1 57  ? 6.796   3.034   17.172  1.00 0.00 ? 154 ALA A HB1  2  
ATOM 2858  H HB2  . ALA A 1 57  ? 5.826   1.561   17.214  1.00 0.00 ? 154 ALA A HB2  2  
ATOM 2859  H HB3  . ALA A 1 57  ? 5.107   3.105   17.676  1.00 0.00 ? 154 ALA A HB3  2  
ATOM 2860  N N    . GLU A 1 58  ? 6.097   0.913   14.333  1.00 0.00 ? 155 GLU A N    2  
ATOM 2861  C CA   . GLU A 1 58  ? 6.969   0.130   13.477  1.00 0.00 ? 155 GLU A CA   2  
ATOM 2862  C C    . GLU A 1 58  ? 6.376   -0.003  12.083  1.00 0.00 ? 155 GLU A C    2  
ATOM 2863  O O    . GLU A 1 58  ? 5.155   -0.053  11.916  1.00 0.00 ? 155 GLU A O    2  
ATOM 2864  C CB   . GLU A 1 58  ? 7.200   -1.251  14.079  1.00 0.00 ? 155 GLU A CB   2  
ATOM 2865  C CG   . GLU A 1 58  ? 7.815   -1.219  15.464  1.00 0.00 ? 155 GLU A CG   2  
ATOM 2866  C CD   . GLU A 1 58  ? 8.177   -2.599  15.964  1.00 0.00 ? 155 GLU A CD   2  
ATOM 2867  O OE1  . GLU A 1 58  ? 7.268   -3.343  16.390  1.00 0.00 ? 155 GLU A OE1  2  
ATOM 2868  O OE2  . GLU A 1 58  ? 9.376   -2.942  15.944  1.00 0.00 ? 155 GLU A OE2  2  
ATOM 2869  H H    . GLU A 1 58  ? 5.287   0.498   14.698  1.00 0.00 ? 155 GLU A H    2  
ATOM 2870  H HA   . GLU A 1 58  ? 7.914   0.647   13.407  1.00 0.00 ? 155 GLU A HA   2  
ATOM 2871  H HB2  . GLU A 1 58  ? 6.253   -1.760  14.146  1.00 0.00 ? 155 GLU A HB2  2  
ATOM 2872  H HB3  . GLU A 1 58  ? 7.856   -1.810  13.430  1.00 0.00 ? 155 GLU A HB3  2  
ATOM 2873  H HG2  . GLU A 1 58  ? 8.711   -0.617  15.434  1.00 0.00 ? 155 GLU A HG2  2  
ATOM 2874  H HG3  . GLU A 1 58  ? 7.108   -0.777  16.151  1.00 0.00 ? 155 GLU A HG3  2  
ATOM 2875  N N    . TRP A 1 59  ? 7.248   -0.065  11.091  1.00 0.00 ? 156 TRP A N    2  
ATOM 2876  C CA   . TRP A 1 59  ? 6.835   -0.155  9.701   1.00 0.00 ? 156 TRP A CA   2  
ATOM 2877  C C    . TRP A 1 59  ? 6.696   -1.600  9.254   1.00 0.00 ? 156 TRP A C    2  
ATOM 2878  O O    . TRP A 1 59  ? 7.408   -2.483  9.734   1.00 0.00 ? 156 TRP A O    2  
ATOM 2879  C CB   . TRP A 1 59  ? 7.846   0.551   8.807   1.00 0.00 ? 156 TRP A CB   2  
ATOM 2880  C CG   . TRP A 1 59  ? 7.731   2.039   8.828   1.00 0.00 ? 156 TRP A CG   2  
ATOM 2881  C CD1  . TRP A 1 59  ? 8.366   2.906   9.667   1.00 0.00 ? 156 TRP A CD1  2  
ATOM 2882  C CD2  . TRP A 1 59  ? 6.928   2.833   7.957   1.00 0.00 ? 156 TRP A CD2  2  
ATOM 2883  N NE1  . TRP A 1 59  ? 8.011   4.197   9.360   1.00 0.00 ? 156 TRP A NE1  2  
ATOM 2884  C CE2  . TRP A 1 59  ? 7.130   4.177   8.313   1.00 0.00 ? 156 TRP A CE2  2  
ATOM 2885  C CE3  . TRP A 1 59  ? 6.061   2.534   6.905   1.00 0.00 ? 156 TRP A CE3  2  
ATOM 2886  C CZ2  . TRP A 1 59  ? 6.496   5.223   7.651   1.00 0.00 ? 156 TRP A CZ2  2  
ATOM 2887  C CZ3  . TRP A 1 59  ? 5.431   3.574   6.249   1.00 0.00 ? 156 TRP A CZ3  2  
ATOM 2888  C CH2  . TRP A 1 59  ? 5.654   4.904   6.624   1.00 0.00 ? 156 TRP A CH2  2  
ATOM 2889  H H    . TRP A 1 59  ? 8.208   -0.057  11.302  1.00 0.00 ? 156 TRP A H    2  
ATOM 2890  H HA   . TRP A 1 59  ? 5.880   0.335   9.605   1.00 0.00 ? 156 TRP A HA   2  
ATOM 2891  H HB2  . TRP A 1 59  ? 8.843   0.292   9.131   1.00 0.00 ? 156 TRP A HB2  2  
ATOM 2892  H HB3  . TRP A 1 59  ? 7.709   0.219   7.788   1.00 0.00 ? 156 TRP A HB3  2  
ATOM 2893  H HD1  . TRP A 1 59  ? 9.047   2.607   10.450  1.00 0.00 ? 156 TRP A HD1  2  
ATOM 2894  H HE1  . TRP A 1 59  ? 8.341   5.003   9.816   1.00 0.00 ? 156 TRP A HE1  2  
ATOM 2895  H HE3  . TRP A 1 59  ? 5.874   1.509   6.609   1.00 0.00 ? 156 TRP A HE3  2  
ATOM 2896  H HZ2  . TRP A 1 59  ? 6.655   6.255   7.926   1.00 0.00 ? 156 TRP A HZ2  2  
ATOM 2897  H HZ3  . TRP A 1 59  ? 4.758   3.364   5.432   1.00 0.00 ? 156 TRP A HZ3  2  
ATOM 2898  H HH2  . TRP A 1 59  ? 5.142   5.684   6.083   1.00 0.00 ? 156 TRP A HH2  2  
ATOM 2899  N N    . GLU A 1 60  ? 5.775   -1.828  8.335   1.00 0.00 ? 157 GLU A N    2  
ATOM 2900  C CA   . GLU A 1 60  ? 5.601   -3.134  7.730   1.00 0.00 ? 157 GLU A CA   2  
ATOM 2901  C C    . GLU A 1 60  ? 6.106   -3.134  6.295   1.00 0.00 ? 157 GLU A C    2  
ATOM 2902  O O    . GLU A 1 60  ? 5.552   -2.452  5.432   1.00 0.00 ? 157 GLU A O    2  
ATOM 2903  C CB   . GLU A 1 60  ? 4.133   -3.546  7.749   1.00 0.00 ? 157 GLU A CB   2  
ATOM 2904  C CG   . GLU A 1 60  ? 3.652   -4.028  9.103   1.00 0.00 ? 157 GLU A CG   2  
ATOM 2905  C CD   . GLU A 1 60  ? 2.265   -4.632  9.040   1.00 0.00 ? 157 GLU A CD   2  
ATOM 2906  O OE1  . GLU A 1 60  ? 2.046   -5.537  8.204   1.00 0.00 ? 157 GLU A OE1  2  
ATOM 2907  O OE2  . GLU A 1 60  ? 1.386   -4.209  9.816   1.00 0.00 ? 157 GLU A OE2  2  
ATOM 2908  H H    . GLU A 1 60  ? 5.182   -1.093  8.055   1.00 0.00 ? 157 GLU A H    2  
ATOM 2909  H HA   . GLU A 1 60  ? 6.175   -3.847  8.302   1.00 0.00 ? 157 GLU A HA   2  
ATOM 2910  H HB2  . GLU A 1 60  ? 3.534   -2.694  7.460   1.00 0.00 ? 157 GLU A HB2  2  
ATOM 2911  H HB3  . GLU A 1 60  ? 3.984   -4.340  7.033   1.00 0.00 ? 157 GLU A HB3  2  
ATOM 2912  H HG2  . GLU A 1 60  ? 4.341   -4.777  9.464   1.00 0.00 ? 157 GLU A HG2  2  
ATOM 2913  H HG3  . GLU A 1 60  ? 3.638   -3.192  9.786   1.00 0.00 ? 157 GLU A HG3  2  
ATOM 2914  N N    . ILE A 1 61  ? 7.158   -3.891  6.047   1.00 0.00 ? 158 ILE A N    2  
ATOM 2915  C CA   . ILE A 1 61  ? 7.680   -4.044  4.697   1.00 0.00 ? 158 ILE A CA   2  
ATOM 2916  C C    . ILE A 1 61  ? 7.022   -5.247  4.036   1.00 0.00 ? 158 ILE A C    2  
ATOM 2917  O O    . ILE A 1 61  ? 7.229   -6.388  4.446   1.00 0.00 ? 158 ILE A O    2  
ATOM 2918  C CB   . ILE A 1 61  ? 9.226   -4.206  4.663   1.00 0.00 ? 158 ILE A CB   2  
ATOM 2919  C CG1  . ILE A 1 61  ? 9.933   -2.879  4.977   1.00 0.00 ? 158 ILE A CG1  2  
ATOM 2920  C CG2  . ILE A 1 61  ? 9.682   -4.720  3.303   1.00 0.00 ? 158 ILE A CG2  2  
ATOM 2921  C CD1  . ILE A 1 61  ? 9.772   -2.401  6.402   1.00 0.00 ? 158 ILE A CD1  2  
ATOM 2922  H H    . ILE A 1 61  ? 7.588   -4.372  6.789   1.00 0.00 ? 158 ILE A H    2  
ATOM 2923  H HA   . ILE A 1 61  ? 7.419   -3.156  4.139   1.00 0.00 ? 158 ILE A HA   2  
ATOM 2924  H HB   . ILE A 1 61  ? 9.503   -4.938  5.408   1.00 0.00 ? 158 ILE A HB   2  
ATOM 2925  H HG12 . ILE A 1 61  ? 10.989  -2.993  4.788   1.00 0.00 ? 158 ILE A HG12 2  
ATOM 2926  H HG13 . ILE A 1 61  ? 9.540   -2.112  4.324   1.00 0.00 ? 158 ILE A HG13 2  
ATOM 2927  H HG21 . ILE A 1 61  ? 9.223   -5.678  3.109   1.00 0.00 ? 158 ILE A HG21 2  
ATOM 2928  H HG22 . ILE A 1 61  ? 10.756  -4.827  3.301   1.00 0.00 ? 158 ILE A HG22 2  
ATOM 2929  H HG23 . ILE A 1 61  ? 9.388   -4.019  2.537   1.00 0.00 ? 158 ILE A HG23 2  
ATOM 2930  H HD11 . ILE A 1 61  ? 8.723   -2.262  6.620   1.00 0.00 ? 158 ILE A HD11 2  
ATOM 2931  H HD12 . ILE A 1 61  ? 10.291  -1.462  6.526   1.00 0.00 ? 158 ILE A HD12 2  
ATOM 2932  H HD13 . ILE A 1 61  ? 10.187  -3.135  7.076   1.00 0.00 ? 158 ILE A HD13 2  
ATOM 2933  N N    . HIS A 1 62  ? 6.208   -4.982  3.032   1.00 0.00 ? 159 HIS A N    2  
ATOM 2934  C CA   . HIS A 1 62  ? 5.470   -6.030  2.348   1.00 0.00 ? 159 HIS A CA   2  
ATOM 2935  C C    . HIS A 1 62  ? 6.066   -6.282  0.975   1.00 0.00 ? 159 HIS A C    2  
ATOM 2936  O O    . HIS A 1 62  ? 6.591   -5.369  0.337   1.00 0.00 ? 159 HIS A O    2  
ATOM 2937  C CB   . HIS A 1 62  ? 3.988   -5.665  2.229   1.00 0.00 ? 159 HIS A CB   2  
ATOM 2938  C CG   . HIS A 1 62  ? 3.224   -5.811  3.510   1.00 0.00 ? 159 HIS A CG   2  
ATOM 2939  N ND1  . HIS A 1 62  ? 2.286   -6.799  3.720   1.00 0.00 ? 159 HIS A ND1  2  
ATOM 2940  C CD2  . HIS A 1 62  ? 3.257   -5.080  4.650   1.00 0.00 ? 159 HIS A CD2  2  
ATOM 2941  C CE1  . HIS A 1 62  ? 1.776   -6.670  4.930   1.00 0.00 ? 159 HIS A CE1  2  
ATOM 2942  N NE2  . HIS A 1 62  ? 2.347   -5.636  5.517   1.00 0.00 ? 159 HIS A NE2  2  
ATOM 2943  H H    . HIS A 1 62  ? 6.123   -4.053  2.713   1.00 0.00 ? 159 HIS A H    2  
ATOM 2944  H HA   . HIS A 1 62  ? 5.563   -6.930  2.936   1.00 0.00 ? 159 HIS A HA   2  
ATOM 2945  H HB2  . HIS A 1 62  ? 3.902   -4.637  1.909   1.00 0.00 ? 159 HIS A HB2  2  
ATOM 2946  H HB3  . HIS A 1 62  ? 3.527   -6.305  1.491   1.00 0.00 ? 159 HIS A HB3  2  
ATOM 2947  H HD1  . HIS A 1 62  ? 2.030   -7.499  3.077   1.00 0.00 ? 159 HIS A HD1  2  
ATOM 2948  H HD2  . HIS A 1 62  ? 3.882   -4.218  4.839   1.00 0.00 ? 159 HIS A HD2  2  
ATOM 2949  H HE1  . HIS A 1 62  ? 1.017   -7.302  5.366   1.00 0.00 ? 159 HIS A HE1  2  
ATOM 2950  H HE2  . HIS A 1 62  ? 2.268   -5.421  6.479   1.00 0.00 ? 159 HIS A HE2  2  
ATOM 2951  N N    . PHE A 1 63  ? 5.975   -7.521  0.524   1.00 0.00 ? 160 PHE A N    2  
ATOM 2952  C CA   . PHE A 1 63  ? 6.602   -7.925  -0.721  1.00 0.00 ? 160 PHE A CA   2  
ATOM 2953  C C    . PHE A 1 63  ? 5.551   -8.190  -1.789  1.00 0.00 ? 160 PHE A C    2  
ATOM 2954  O O    . PHE A 1 63  ? 4.646   -9.003  -1.596  1.00 0.00 ? 160 PHE A O    2  
ATOM 2955  C CB   . PHE A 1 63  ? 7.441   -9.178  -0.481  1.00 0.00 ? 160 PHE A CB   2  
ATOM 2956  C CG   . PHE A 1 63  ? 8.779   -9.140  -1.158  1.00 0.00 ? 160 PHE A CG   2  
ATOM 2957  C CD1  . PHE A 1 63  ? 9.753   -8.257  -0.725  1.00 0.00 ? 160 PHE A CD1  2  
ATOM 2958  C CD2  . PHE A 1 63  ? 9.062   -9.981  -2.220  1.00 0.00 ? 160 PHE A CD2  2  
ATOM 2959  C CE1  . PHE A 1 63  ? 10.988  -8.211  -1.336  1.00 0.00 ? 160 PHE A CE1  2  
ATOM 2960  C CE2  . PHE A 1 63  ? 10.297  -9.941  -2.838  1.00 0.00 ? 160 PHE A CE2  2  
ATOM 2961  C CZ   . PHE A 1 63  ? 11.261  -9.055  -2.396  1.00 0.00 ? 160 PHE A CZ   2  
ATOM 2962  H H    . PHE A 1 63  ? 5.468   -8.184  1.042   1.00 0.00 ? 160 PHE A H    2  
ATOM 2963  H HA   . PHE A 1 63  ? 7.246   -7.124  -1.050  1.00 0.00 ? 160 PHE A HA   2  
ATOM 2964  H HB2  . PHE A 1 63  ? 7.608   -9.295  0.578   1.00 0.00 ? 160 PHE A HB2  2  
ATOM 2965  H HB3  . PHE A 1 63  ? 6.904   -10.039 -0.853  1.00 0.00 ? 160 PHE A HB3  2  
ATOM 2966  H HD1  . PHE A 1 63  ? 9.540   -7.598  0.104   1.00 0.00 ? 160 PHE A HD1  2  
ATOM 2967  H HD2  . PHE A 1 63  ? 8.308   -10.673 -2.565  1.00 0.00 ? 160 PHE A HD2  2  
ATOM 2968  H HE1  . PHE A 1 63  ? 11.740  -7.517  -0.986  1.00 0.00 ? 160 PHE A HE1  2  
ATOM 2969  H HE2  . PHE A 1 63  ? 10.508  -10.601 -3.666  1.00 0.00 ? 160 PHE A HE2  2  
ATOM 2970  H HZ   . PHE A 1 63  ? 12.226  -9.022  -2.877  1.00 0.00 ? 160 PHE A HZ   2  
ATOM 2971  N N    . ALA A 1 64  ? 5.669   -7.488  -2.910  1.00 0.00 ? 161 ALA A N    2  
ATOM 2972  C CA   . ALA A 1 64  ? 4.738   -7.656  -4.019  1.00 0.00 ? 161 ALA A CA   2  
ATOM 2973  C C    . ALA A 1 64  ? 5.084   -8.898  -4.825  1.00 0.00 ? 161 ALA A C    2  
ATOM 2974  O O    . ALA A 1 64  ? 4.228   -9.744  -5.072  1.00 0.00 ? 161 ALA A O    2  
ATOM 2975  C CB   . ALA A 1 64  ? 4.759   -6.427  -4.914  1.00 0.00 ? 161 ALA A CB   2  
ATOM 2976  H H    . ALA A 1 64  ? 6.404   -6.839  -2.992  1.00 0.00 ? 161 ALA A H    2  
ATOM 2977  H HA   . ALA A 1 64  ? 3.744   -7.763  -3.611  1.00 0.00 ? 161 ALA A HA   2  
ATOM 2978  H HB1  . ALA A 1 64  ? 4.058   -6.560  -5.725  1.00 0.00 ? 161 ALA A HB1  2  
ATOM 2979  H HB2  . ALA A 1 64  ? 5.752   -6.294  -5.317  1.00 0.00 ? 161 ALA A HB2  2  
ATOM 2980  H HB3  . ALA A 1 64  ? 4.483   -5.559  -4.338  1.00 0.00 ? 161 ALA A HB3  2  
ATOM 2981  N N    . GLY A 1 65  ? 6.339   -9.005  -5.229  1.00 0.00 ? 162 GLY A N    2  
ATOM 2982  C CA   . GLY A 1 65  ? 6.768   -10.156 -5.995  1.00 0.00 ? 162 GLY A CA   2  
ATOM 2983  C C    . GLY A 1 65  ? 6.440   -10.031 -7.470  1.00 0.00 ? 162 GLY A C    2  
ATOM 2984  O O    . GLY A 1 65  ? 5.437   -10.578 -7.937  1.00 0.00 ? 162 GLY A O    2  
ATOM 2985  H H    . GLY A 1 65  ? 6.979   -8.300  -5.001  1.00 0.00 ? 162 GLY A H    2  
ATOM 2986  H HA2  . GLY A 1 65  ? 7.836   -10.270 -5.884  1.00 0.00 ? 162 GLY A HA2  2  
ATOM 2987  H HA3  . GLY A 1 65  ? 6.281   -11.036 -5.603  1.00 0.00 ? 162 GLY A HA3  2  
ATOM 2988  N N    . GLN A 1 66  ? 7.281   -9.277  -8.185  1.00 0.00 ? 163 GLN A N    2  
ATOM 2989  C CA   . GLN A 1 66  ? 7.200   -9.109  -9.644  1.00 0.00 ? 163 GLN A CA   2  
ATOM 2990  C C    . GLN A 1 66  ? 6.018   -8.232  -10.071 1.00 0.00 ? 163 GLN A C    2  
ATOM 2991  O O    . GLN A 1 66  ? 6.171   -7.340  -10.905 1.00 0.00 ? 163 GLN A O    2  
ATOM 2992  C CB   . GLN A 1 66  ? 7.123   -10.465 -10.353 1.00 0.00 ? 163 GLN A CB   2  
ATOM 2993  C CG   . GLN A 1 66  ? 7.397   -10.374 -11.844 1.00 0.00 ? 163 GLN A CG   2  
ATOM 2994  C CD   . GLN A 1 66  ? 7.102   -11.664 -12.582 1.00 0.00 ? 163 GLN A CD   2  
ATOM 2995  O OE1  . GLN A 1 66  ? 7.185   -12.755 -12.021 1.00 0.00 ? 163 GLN A OE1  2  
ATOM 2996  N NE2  . GLN A 1 66  ? 6.775   -11.546 -13.858 1.00 0.00 ? 163 GLN A NE2  2  
ATOM 2997  H H    . GLN A 1 66  ? 7.998   -8.815  -7.711  1.00 0.00 ? 163 GLN A H    2  
ATOM 2998  H HA   . GLN A 1 66  ? 8.111   -8.618  -9.952  1.00 0.00 ? 163 GLN A HA   2  
ATOM 2999  H HB2  . GLN A 1 66  ? 7.851   -11.132 -9.913  1.00 0.00 ? 163 GLN A HB2  2  
ATOM 3000  H HB3  . GLN A 1 66  ? 6.136   -10.879 -10.213 1.00 0.00 ? 163 GLN A HB3  2  
ATOM 3001  H HG2  . GLN A 1 66  ? 6.781   -9.593  -12.262 1.00 0.00 ? 163 GLN A HG2  2  
ATOM 3002  H HG3  . GLN A 1 66  ? 8.440   -10.126 -11.989 1.00 0.00 ? 163 GLN A HG3  2  
ATOM 3003  H HE21 . GLN A 1 66  ? 6.747   -10.644 -14.247 1.00 0.00 ? 163 GLN A HE21 2  
ATOM 3004  H HE22 . GLN A 1 66  ? 6.577   -12.360 -14.363 1.00 0.00 ? 163 GLN A HE22 2  
ATOM 3005  N N    . GLN A 1 67  ? 4.849   -8.493  -9.502  1.00 0.00 ? 164 GLN A N    2  
ATOM 3006  C CA   . GLN A 1 67  ? 3.630   -7.782  -9.860  1.00 0.00 ? 164 GLN A CA   2  
ATOM 3007  C C    . GLN A 1 67  ? 3.717   -6.320  -9.450  1.00 0.00 ? 164 GLN A C    2  
ATOM 3008  O O    . GLN A 1 67  ? 4.362   -5.976  -8.456  1.00 0.00 ? 164 GLN A O    2  
ATOM 3009  C CB   . GLN A 1 67  ? 2.418   -8.451  -9.204  1.00 0.00 ? 164 GLN A CB   2  
ATOM 3010  C CG   . GLN A 1 67  ? 2.503   -8.512  -7.685  1.00 0.00 ? 164 GLN A CG   2  
ATOM 3011  C CD   . GLN A 1 67  ? 1.331   -9.235  -7.045  1.00 0.00 ? 164 GLN A CD   2  
ATOM 3012  O OE1  . GLN A 1 67  ? 0.924   -8.909  -5.931  1.00 0.00 ? 164 GLN A OE1  2  
ATOM 3013  N NE2  . GLN A 1 67  ? 0.790   -10.233 -7.728  1.00 0.00 ? 164 GLN A NE2  2  
ATOM 3014  H H    . GLN A 1 67  ? 4.806   -9.183  -8.811  1.00 0.00 ? 164 GLN A H    2  
ATOM 3015  H HA   . GLN A 1 67  ? 3.520   -7.837  -10.932 1.00 0.00 ? 164 GLN A HA   2  
ATOM 3016  H HB2  . GLN A 1 67  ? 1.528   -7.900  -9.470  1.00 0.00 ? 164 GLN A HB2  2  
ATOM 3017  H HB3  . GLN A 1 67  ? 2.334   -9.458  -9.579  1.00 0.00 ? 164 GLN A HB3  2  
ATOM 3018  H HG2  . GLN A 1 67  ? 3.411   -9.027  -7.413  1.00 0.00 ? 164 GLN A HG2  2  
ATOM 3019  H HG3  . GLN A 1 67  ? 2.535   -7.502  -7.302  1.00 0.00 ? 164 GLN A HG3  2  
ATOM 3020  H HE21 . GLN A 1 67  ? 1.165   -10.458 -8.604  1.00 0.00 ? 164 GLN A HE21 2  
ATOM 3021  H HE22 . GLN A 1 67  ? 0.035   -10.713 -7.323  1.00 0.00 ? 164 GLN A HE22 2  
ATOM 3022  N N    . THR A 1 68  ? 3.071   -5.464  -10.217 1.00 0.00 ? 165 THR A N    2  
ATOM 3023  C CA   . THR A 1 68  ? 3.140   -4.035  -9.988  1.00 0.00 ? 165 THR A CA   2  
ATOM 3024  C C    . THR A 1 68  ? 1.863   -3.516  -9.340  1.00 0.00 ? 165 THR A C    2  
ATOM 3025  O O    . THR A 1 68  ? 1.400   -2.411  -9.630  1.00 0.00 ? 165 THR A O    2  
ATOM 3026  C CB   . THR A 1 68  ? 3.419   -3.295  -11.305 1.00 0.00 ? 165 THR A CB   2  
ATOM 3027  O OG1  . THR A 1 68  ? 2.420   -3.626  -12.282 1.00 0.00 ? 165 THR A OG1  2  
ATOM 3028  C CG2  . THR A 1 68  ? 4.793   -3.675  -11.832 1.00 0.00 ? 165 THR A CG2  2  
ATOM 3029  H H    . THR A 1 68  ? 2.531   -5.802  -10.965 1.00 0.00 ? 165 THR A H    2  
ATOM 3030  H HA   . THR A 1 68  ? 3.967   -3.851  -9.318  1.00 0.00 ? 165 THR A HA   2  
ATOM 3031  H HB   . THR A 1 68  ? 3.400   -2.232  -11.116 1.00 0.00 ? 165 THR A HB   2  
ATOM 3032  H HG1  . THR A 1 68  ? 1.544   -3.533  -11.888 1.00 0.00 ? 165 THR A HG1  2  
ATOM 3033  H HG21 . THR A 1 68  ? 4.939   -3.241  -12.809 1.00 0.00 ? 165 THR A HG21 2  
ATOM 3034  H HG22 . THR A 1 68  ? 4.865   -4.754  -11.900 1.00 0.00 ? 165 THR A HG22 2  
ATOM 3035  H HG23 . THR A 1 68  ? 5.553   -3.308  -11.157 1.00 0.00 ? 165 THR A HG23 2  
ATOM 3036  N N    . GLU A 1 69  ? 1.306   -4.335  -8.460  1.00 0.00 ? 166 GLU A N    2  
ATOM 3037  C CA   . GLU A 1 69  ? 0.129   -3.972  -7.690  1.00 0.00 ? 166 GLU A CA   2  
ATOM 3038  C C    . GLU A 1 69  ? 0.067   -4.833  -6.434  1.00 0.00 ? 166 GLU A C    2  
ATOM 3039  O O    . GLU A 1 69  ? 0.387   -6.020  -6.476  1.00 0.00 ? 166 GLU A O    2  
ATOM 3040  C CB   . GLU A 1 69  ? -1.142  -4.150  -8.525  1.00 0.00 ? 166 GLU A CB   2  
ATOM 3041  C CG   . GLU A 1 69  ? -1.350  -5.566  -9.038  1.00 0.00 ? 166 GLU A CG   2  
ATOM 3042  C CD   . GLU A 1 69  ? -2.633  -5.710  -9.820  1.00 0.00 ? 166 GLU A CD   2  
ATOM 3043  O OE1  . GLU A 1 69  ? -3.712  -5.708  -9.191  1.00 0.00 ? 166 GLU A OE1  2  
ATOM 3044  O OE2  . GLU A 1 69  ? -2.569  -5.824  -11.062 1.00 0.00 ? 166 GLU A OE2  2  
ATOM 3045  H H    . GLU A 1 69  ? 1.707   -5.221  -8.317  1.00 0.00 ? 166 GLU A H    2  
ATOM 3046  H HA   . GLU A 1 69  ? 0.224   -2.936  -7.402  1.00 0.00 ? 166 GLU A HA   2  
ATOM 3047  H HB2  . GLU A 1 69  ? -1.995  -3.883  -7.919  1.00 0.00 ? 166 GLU A HB2  2  
ATOM 3048  H HB3  . GLU A 1 69  ? -1.095  -3.486  -9.375  1.00 0.00 ? 166 GLU A HB3  2  
ATOM 3049  H HG2  . GLU A 1 69  ? -0.522  -5.828  -9.680  1.00 0.00 ? 166 GLU A HG2  2  
ATOM 3050  H HG3  . GLU A 1 69  ? -1.379  -6.240  -8.195  1.00 0.00 ? 166 GLU A HG3  2  
ATOM 3051  N N    . PHE A 1 70  ? -0.321  -4.237  -5.319  1.00 0.00 ? 167 PHE A N    2  
ATOM 3052  C CA   . PHE A 1 70  ? -0.382  -4.963  -4.057  1.00 0.00 ? 167 PHE A CA   2  
ATOM 3053  C C    . PHE A 1 70  ? -1.717  -4.708  -3.363  1.00 0.00 ? 167 PHE A C    2  
ATOM 3054  O O    . PHE A 1 70  ? -2.317  -3.645  -3.537  1.00 0.00 ? 167 PHE A O    2  
ATOM 3055  C CB   . PHE A 1 70  ? 0.788   -4.543  -3.161  1.00 0.00 ? 167 PHE A CB   2  
ATOM 3056  C CG   . PHE A 1 70  ? 1.023   -5.459  -1.997  1.00 0.00 ? 167 PHE A CG   2  
ATOM 3057  C CD1  . PHE A 1 70  ? 1.351   -6.790  -2.204  1.00 0.00 ? 167 PHE A CD1  2  
ATOM 3058  C CD2  . PHE A 1 70  ? 0.928   -4.991  -0.700  1.00 0.00 ? 167 PHE A CD2  2  
ATOM 3059  C CE1  . PHE A 1 70  ? 1.577   -7.635  -1.136  1.00 0.00 ? 167 PHE A CE1  2  
ATOM 3060  C CE2  . PHE A 1 70  ? 1.152   -5.831  0.373   1.00 0.00 ? 167 PHE A CE2  2  
ATOM 3061  C CZ   . PHE A 1 70  ? 1.476   -7.156  0.154   1.00 0.00 ? 167 PHE A CZ   2  
ATOM 3062  H H    . PHE A 1 70  ? -0.563  -3.285  -5.339  1.00 0.00 ? 167 PHE A H    2  
ATOM 3063  H HA   . PHE A 1 70  ? -0.296  -6.015  -4.275  1.00 0.00 ? 167 PHE A HA   2  
ATOM 3064  H HB2  . PHE A 1 70  ? 1.691   -4.520  -3.750  1.00 0.00 ? 167 PHE A HB2  2  
ATOM 3065  H HB3  . PHE A 1 70  ? 0.595   -3.554  -2.771  1.00 0.00 ? 167 PHE A HB3  2  
ATOM 3066  H HD1  . PHE A 1 70  ? 1.428   -7.164  -3.214  1.00 0.00 ? 167 PHE A HD1  2  
ATOM 3067  H HD2  . PHE A 1 70  ? 0.675   -3.955  -0.527  1.00 0.00 ? 167 PHE A HD2  2  
ATOM 3068  H HE1  . PHE A 1 70  ? 1.830   -8.671  -1.311  1.00 0.00 ? 167 PHE A HE1  2  
ATOM 3069  H HE2  . PHE A 1 70  ? 1.073   -5.451  1.384   1.00 0.00 ? 167 PHE A HE2  2  
ATOM 3070  H HZ   . PHE A 1 70  ? 1.652   -7.815  0.991   1.00 0.00 ? 167 PHE A HZ   2  
ATOM 3071  N N    . LYS A 1 71  ? -2.193  -5.688  -2.598  1.00 0.00 ? 168 LYS A N    2  
ATOM 3072  C CA   . LYS A 1 71  ? -3.460  -5.560  -1.885  1.00 0.00 ? 168 LYS A CA   2  
ATOM 3073  C C    . LYS A 1 71  ? -3.230  -5.615  -0.378  1.00 0.00 ? 168 LYS A C    2  
ATOM 3074  O O    . LYS A 1 71  ? -2.365  -6.351  0.095   1.00 0.00 ? 168 LYS A O    2  
ATOM 3075  C CB   . LYS A 1 71  ? -4.433  -6.683  -2.271  1.00 0.00 ? 168 LYS A CB   2  
ATOM 3076  C CG   . LYS A 1 71  ? -4.532  -6.963  -3.765  1.00 0.00 ? 168 LYS A CG   2  
ATOM 3077  C CD   . LYS A 1 71  ? -4.932  -5.740  -4.562  1.00 0.00 ? 168 LYS A CD   2  
ATOM 3078  C CE   . LYS A 1 71  ? -5.085  -6.077  -6.037  1.00 0.00 ? 168 LYS A CE   2  
ATOM 3079  N NZ   . LYS A 1 71  ? -3.815  -6.571  -6.632  1.00 0.00 ? 168 LYS A NZ   2  
ATOM 3080  H H    . LYS A 1 71  ? -1.675  -6.519  -2.504  1.00 0.00 ? 168 LYS A H    2  
ATOM 3081  H HA   . LYS A 1 71  ? -3.896  -4.607  -2.142  1.00 0.00 ? 168 LYS A HA   2  
ATOM 3082  H HB2  . LYS A 1 71  ? -4.117  -7.593  -1.784  1.00 0.00 ? 168 LYS A HB2  2  
ATOM 3083  H HB3  . LYS A 1 71  ? -5.419  -6.423  -1.912  1.00 0.00 ? 168 LYS A HB3  2  
ATOM 3084  H HG2  . LYS A 1 71  ? -3.577  -7.304  -4.118  1.00 0.00 ? 168 LYS A HG2  2  
ATOM 3085  H HG3  . LYS A 1 71  ? -5.271  -7.734  -3.921  1.00 0.00 ? 168 LYS A HG3  2  
ATOM 3086  H HD2  . LYS A 1 71  ? -5.872  -5.367  -4.186  1.00 0.00 ? 168 LYS A HD2  2  
ATOM 3087  H HD3  . LYS A 1 71  ? -4.171  -4.983  -4.451  1.00 0.00 ? 168 LYS A HD3  2  
ATOM 3088  H HE2  . LYS A 1 71  ? -5.840  -6.840  -6.141  1.00 0.00 ? 168 LYS A HE2  2  
ATOM 3089  H HE3  . LYS A 1 71  ? -5.398  -5.187  -6.565  1.00 0.00 ? 168 LYS A HE3  2  
ATOM 3090  H HZ1  . LYS A 1 71  ? -3.617  -7.540  -6.309  1.00 0.00 ? 168 LYS A HZ1  2  
ATOM 3091  H HZ2  . LYS A 1 71  ? -3.025  -5.958  -6.355  1.00 0.00 ? 168 LYS A HZ2  2  
ATOM 3092  H HZ3  . LYS A 1 71  ? -3.882  -6.570  -7.675  1.00 0.00 ? 168 LYS A HZ3  2  
ATOM 3093  N N    . ILE A 1 72  ? -4.003  -4.839  0.372   1.00 0.00 ? 169 ILE A N    2  
ATOM 3094  C CA   . ILE A 1 72  ? -3.940  -4.883  1.829   1.00 0.00 ? 169 ILE A CA   2  
ATOM 3095  C C    . ILE A 1 72  ? -5.317  -5.184  2.407   1.00 0.00 ? 169 ILE A C    2  
ATOM 3096  O O    . ILE A 1 72  ? -6.276  -4.458  2.146   1.00 0.00 ? 169 ILE A O    2  
ATOM 3097  C CB   . ILE A 1 72  ? -3.431  -3.558  2.441   1.00 0.00 ? 169 ILE A CB   2  
ATOM 3098  C CG1  . ILE A 1 72  ? -2.094  -3.149  1.826   1.00 0.00 ? 169 ILE A CG1  2  
ATOM 3099  C CG2  . ILE A 1 72  ? -3.285  -3.697  3.950   1.00 0.00 ? 169 ILE A CG2  2  
ATOM 3100  C CD1  . ILE A 1 72  ? -0.962  -4.089  2.167   1.00 0.00 ? 169 ILE A CD1  2  
ATOM 3101  H H    . ILE A 1 72  ? -4.630  -4.224  -0.064  1.00 0.00 ? 169 ILE A H    2  
ATOM 3102  H HA   . ILE A 1 72  ? -3.259  -5.674  2.112   1.00 0.00 ? 169 ILE A HA   2  
ATOM 3103  H HB   . ILE A 1 72  ? -4.163  -2.791  2.246   1.00 0.00 ? 169 ILE A HB   2  
ATOM 3104  H HG12 . ILE A 1 72  ? -2.192  -3.126  0.750   1.00 0.00 ? 169 ILE A HG12 2  
ATOM 3105  H HG13 . ILE A 1 72  ? -1.827  -2.164  2.180   1.00 0.00 ? 169 ILE A HG13 2  
ATOM 3106  H HG21 . ILE A 1 72  ? -4.236  -3.974  4.381   1.00 0.00 ? 169 ILE A HG21 2  
ATOM 3107  H HG22 . ILE A 1 72  ? -2.959  -2.756  4.369   1.00 0.00 ? 169 ILE A HG22 2  
ATOM 3108  H HG23 . ILE A 1 72  ? -2.552  -4.460  4.171   1.00 0.00 ? 169 ILE A HG23 2  
ATOM 3109  H HD11 . ILE A 1 72  ? -0.053  -3.739  1.703   1.00 0.00 ? 169 ILE A HD11 2  
ATOM 3110  H HD12 . ILE A 1 72  ? -1.194  -5.079  1.802   1.00 0.00 ? 169 ILE A HD12 2  
ATOM 3111  H HD13 . ILE A 1 72  ? -0.832  -4.121  3.238   1.00 0.00 ? 169 ILE A HD13 2  
ATOM 3112  N N    . LEU A 1 73  ? -5.407  -6.258  3.178   1.00 0.00 ? 170 LEU A N    2  
ATOM 3113  C CA   . LEU A 1 73  ? -6.657  -6.641  3.823   1.00 0.00 ? 170 LEU A CA   2  
ATOM 3114  C C    . LEU A 1 73  ? -6.711  -6.088  5.243   1.00 0.00 ? 170 LEU A C    2  
ATOM 3115  O O    . LEU A 1 73  ? -7.782  -5.744  5.750   1.00 0.00 ? 170 LEU A O    2  
ATOM 3116  C CB   . LEU A 1 73  ? -6.811  -8.172  3.861   1.00 0.00 ? 170 LEU A CB   2  
ATOM 3117  C CG   . LEU A 1 73  ? -7.127  -8.868  2.526   1.00 0.00 ? 170 LEU A CG   2  
ATOM 3118  C CD1  . LEU A 1 73  ? -8.372  -8.272  1.889   1.00 0.00 ? 170 LEU A CD1  2  
ATOM 3119  C CD2  . LEU A 1 73  ? -5.944  -8.799  1.568   1.00 0.00 ? 170 LEU A CD2  2  
ATOM 3120  H H    . LEU A 1 73  ? -4.609  -6.812  3.319   1.00 0.00 ? 170 LEU A H    2  
ATOM 3121  H HA   . LEU A 1 73  ? -7.469  -6.218  3.252   1.00 0.00 ? 170 LEU A HA   2  
ATOM 3122  H HB2  . LEU A 1 73  ? -5.892  -8.588  4.244   1.00 0.00 ? 170 LEU A HB2  2  
ATOM 3123  H HB3  . LEU A 1 73  ? -7.605  -8.408  4.555   1.00 0.00 ? 170 LEU A HB3  2  
ATOM 3124  H HG   . LEU A 1 73  ? -7.331  -9.911  2.722   1.00 0.00 ? 170 LEU A HG   2  
ATOM 3125  H HD11 . LEU A 1 73  ? -9.213  -8.401  2.554   1.00 0.00 ? 170 LEU A HD11 2  
ATOM 3126  H HD12 . LEU A 1 73  ? -8.573  -8.775  0.954   1.00 0.00 ? 170 LEU A HD12 2  
ATOM 3127  H HD13 . LEU A 1 73  ? -8.214  -7.222  1.706   1.00 0.00 ? 170 LEU A HD13 2  
ATOM 3128  H HD21 . LEU A 1 73  ? -5.088  -9.279  2.019   1.00 0.00 ? 170 LEU A HD21 2  
ATOM 3129  H HD22 . LEU A 1 73  ? -5.708  -7.766  1.360   1.00 0.00 ? 170 LEU A HD22 2  
ATOM 3130  H HD23 . LEU A 1 73  ? -6.197  -9.304  0.648   1.00 0.00 ? 170 LEU A HD23 2  
ATOM 3131  N N    . SER A 1 74  ? -5.546  -6.003  5.875   1.00 0.00 ? 171 SER A N    2  
ATOM 3132  C CA   . SER A 1 74  ? -5.445  -5.510  7.242   1.00 0.00 ? 171 SER A CA   2  
ATOM 3133  C C    . SER A 1 74  ? -5.536  -3.986  7.278   1.00 0.00 ? 171 SER A C    2  
ATOM 3134  O O    . SER A 1 74  ? -4.519  -3.291  7.292   1.00 0.00 ? 171 SER A O    2  
ATOM 3135  C CB   . SER A 1 74  ? -4.126  -5.978  7.862   1.00 0.00 ? 171 SER A CB   2  
ATOM 3136  O OG   . SER A 1 74  ? -3.969  -7.381  7.713   1.00 0.00 ? 171 SER A OG   2  
ATOM 3137  H H    . SER A 1 74  ? -4.730  -6.280  5.409   1.00 0.00 ? 171 SER A H    2  
ATOM 3138  H HA   . SER A 1 74  ? -6.266  -5.923  7.807   1.00 0.00 ? 171 SER A HA   2  
ATOM 3139  H HB2  . SER A 1 74  ? -3.303  -5.481  7.371   1.00 0.00 ? 171 SER A HB2  2  
ATOM 3140  H HB3  . SER A 1 74  ? -4.119  -5.736  8.913   1.00 0.00 ? 171 SER A HB3  2  
ATOM 3141  H HG   . SER A 1 74  ? -4.833  -7.775  7.525   1.00 0.00 ? 171 SER A HG   2  
ATOM 3142  N N    . LEU A 1 75  ? -6.761  -3.479  7.277   1.00 0.00 ? 172 LEU A N    2  
ATOM 3143  C CA   . LEU A 1 75  ? -7.000  -2.044  7.295   1.00 0.00 ? 172 LEU A CA   2  
ATOM 3144  C C    . LEU A 1 75  ? -8.053  -1.685  8.333   1.00 0.00 ? 172 LEU A C    2  
ATOM 3145  O O    . LEU A 1 75  ? -8.992  -2.447  8.568   1.00 0.00 ? 172 LEU A O    2  
ATOM 3146  C CB   . LEU A 1 75  ? -7.458  -1.566  5.916   1.00 0.00 ? 172 LEU A CB   2  
ATOM 3147  C CG   . LEU A 1 75  ? -6.443  -1.756  4.789   1.00 0.00 ? 172 LEU A CG   2  
ATOM 3148  C CD1  . LEU A 1 75  ? -7.081  -1.454  3.447   1.00 0.00 ? 172 LEU A CD1  2  
ATOM 3149  C CD2  . LEU A 1 75  ? -5.228  -0.868  5.012   1.00 0.00 ? 172 LEU A CD2  2  
ATOM 3150  H H    . LEU A 1 75  ? -7.529  -4.090  7.260   1.00 0.00 ? 172 LEU A H    2  
ATOM 3151  H HA   . LEU A 1 75  ? -6.073  -1.554  7.550   1.00 0.00 ? 172 LEU A HA   2  
ATOM 3152  H HB2  . LEU A 1 75  ? -8.359  -2.100  5.654   1.00 0.00 ? 172 LEU A HB2  2  
ATOM 3153  H HB3  . LEU A 1 75  ? -7.691  -0.513  5.985   1.00 0.00 ? 172 LEU A HB3  2  
ATOM 3154  H HG   . LEU A 1 75  ? -6.111  -2.784  4.779   1.00 0.00 ? 172 LEU A HG   2  
ATOM 3155  H HD11 . LEU A 1 75  ? -6.354  -1.598  2.663   1.00 0.00 ? 172 LEU A HD11 2  
ATOM 3156  H HD12 . LEU A 1 75  ? -7.426  -0.430  3.434   1.00 0.00 ? 172 LEU A HD12 2  
ATOM 3157  H HD13 . LEU A 1 75  ? -7.918  -2.117  3.289   1.00 0.00 ? 172 LEU A HD13 2  
ATOM 3158  H HD21 . LEU A 1 75  ? -4.769  -1.115  5.958   1.00 0.00 ? 172 LEU A HD21 2  
ATOM 3159  H HD22 . LEU A 1 75  ? -5.534  0.167   5.021   1.00 0.00 ? 172 LEU A HD22 2  
ATOM 3160  H HD23 . LEU A 1 75  ? -4.516  -1.026  4.215   1.00 0.00 ? 172 LEU A HD23 2  
ATOM 3161  N N    . HIS A 1 76  ? -7.888  -0.526  8.950   1.00 0.00 ? 173 HIS A N    2  
ATOM 3162  C CA   . HIS A 1 76  ? -8.847  -0.028  9.927   1.00 0.00 ? 173 HIS A CA   2  
ATOM 3163  C C    . HIS A 1 76  ? -9.726  1.048   9.303   1.00 0.00 ? 173 HIS A C    2  
ATOM 3164  O O    . HIS A 1 76  ? -9.220  2.046   8.792   1.00 0.00 ? 173 HIS A O    2  
ATOM 3165  C CB   . HIS A 1 76  ? -8.133  0.544   11.159  1.00 0.00 ? 173 HIS A CB   2  
ATOM 3166  C CG   . HIS A 1 76  ? -7.506  -0.493  12.036  1.00 0.00 ? 173 HIS A CG   2  
ATOM 3167  N ND1  . HIS A 1 76  ? -8.134  -1.019  13.142  1.00 0.00 ? 173 HIS A ND1  2  
ATOM 3168  C CD2  . HIS A 1 76  ? -6.297  -1.095  11.972  1.00 0.00 ? 173 HIS A CD2  2  
ATOM 3169  C CE1  . HIS A 1 76  ? -7.338  -1.898  13.720  1.00 0.00 ? 173 HIS A CE1  2  
ATOM 3170  N NE2  . HIS A 1 76  ? -6.216  -1.964  13.030  1.00 0.00 ? 173 HIS A NE2  2  
ATOM 3171  H H    . HIS A 1 76  ? -7.098  0.018   8.736   1.00 0.00 ? 173 HIS A H    2  
ATOM 3172  H HA   . HIS A 1 76  ? -9.467  -0.856  10.233  1.00 0.00 ? 173 HIS A HA   2  
ATOM 3173  H HB2  . HIS A 1 76  ? -7.353  1.218   10.835  1.00 0.00 ? 173 HIS A HB2  2  
ATOM 3174  H HB3  . HIS A 1 76  ? -8.848  1.095   11.755  1.00 0.00 ? 173 HIS A HB3  2  
ATOM 3175  H HD1  . HIS A 1 76  ? -9.037  -0.789  13.452  1.00 0.00 ? 173 HIS A HD1  2  
ATOM 3176  H HD2  . HIS A 1 76  ? -5.538  -0.923  11.224  1.00 0.00 ? 173 HIS A HD2  2  
ATOM 3177  H HE1  . HIS A 1 76  ? -7.569  -2.470  14.606  1.00 0.00 ? 173 HIS A HE1  2  
ATOM 3178  H HE2  . HIS A 1 76  ? -5.547  -2.677  13.123  1.00 0.00 ? 173 HIS A HE2  2  
ATOM 3179  N N    . PRO A 1 77  ? -11.053 0.843   9.311   1.00 0.00 ? 174 PRO A N    2  
ATOM 3180  C CA   . PRO A 1 77  ? -12.005 1.842   8.825   1.00 0.00 ? 174 PRO A CA   2  
ATOM 3181  C C    . PRO A 1 77  ? -11.897 3.148   9.603   1.00 0.00 ? 174 PRO A C    2  
ATOM 3182  O O    . PRO A 1 77  ? -12.210 3.202   10.793  1.00 0.00 ? 174 PRO A O    2  
ATOM 3183  C CB   . PRO A 1 77  ? -13.374 1.195   9.064   1.00 0.00 ? 174 PRO A CB   2  
ATOM 3184  C CG   . PRO A 1 77  ? -13.101 -0.263  9.193   1.00 0.00 ? 174 PRO A CG   2  
ATOM 3185  C CD   . PRO A 1 77  ? -11.724 -0.379  9.779   1.00 0.00 ? 174 PRO A CD   2  
ATOM 3186  H HA   . PRO A 1 77  ? -11.871 2.037   7.771   1.00 0.00 ? 174 PRO A HA   2  
ATOM 3187  H HB2  . PRO A 1 77  ? -13.812 1.596   9.966   1.00 0.00 ? 174 PRO A HB2  2  
ATOM 3188  H HB3  . PRO A 1 77  ? -14.021 1.400   8.224   1.00 0.00 ? 174 PRO A HB3  2  
ATOM 3189  H HG2  . PRO A 1 77  ? -13.827 -0.715  9.853   1.00 0.00 ? 174 PRO A HG2  2  
ATOM 3190  H HG3  . PRO A 1 77  ? -13.135 -0.732  8.222   1.00 0.00 ? 174 PRO A HG3  2  
ATOM 3191  H HD2  . PRO A 1 77  ? -11.773 -0.404  10.855  1.00 0.00 ? 174 PRO A HD2  2  
ATOM 3192  H HD3  . PRO A 1 77  ? -11.228 -1.260  9.400   1.00 0.00 ? 174 PRO A HD3  2  
ATOM 3193  N N    . GLY A 1 78  ? -11.447 4.195   8.928   1.00 0.00 ? 175 GLY A N    2  
ATOM 3194  C CA   . GLY A 1 78  ? -11.255 5.470   9.582   1.00 0.00 ? 175 GLY A CA   2  
ATOM 3195  C C    . GLY A 1 78  ? -9.867  5.593   10.168  1.00 0.00 ? 175 GLY A C    2  
ATOM 3196  O O    . GLY A 1 78  ? -9.701  6.031   11.308  1.00 0.00 ? 175 GLY A O    2  
ATOM 3197  H H    . GLY A 1 78  ? -11.235 4.100   7.975   1.00 0.00 ? 175 GLY A H    2  
ATOM 3198  H HA2  . GLY A 1 78  ? -11.402 6.261   8.861   1.00 0.00 ? 175 GLY A HA2  2  
ATOM 3199  H HA3  . GLY A 1 78  ? -11.980 5.575   10.373  1.00 0.00 ? 175 GLY A HA3  2  
ATOM 3200  N N    . GLN A 1 79  ? -8.867  5.194   9.393   1.00 0.00 ? 176 GLN A N    2  
ATOM 3201  C CA   . GLN A 1 79  ? -7.488  5.250   9.843   1.00 0.00 ? 176 GLN A CA   2  
ATOM 3202  C C    . GLN A 1 79  ? -6.578  5.678   8.697   1.00 0.00 ? 176 GLN A C    2  
ATOM 3203  O O    . GLN A 1 79  ? -6.846  5.376   7.533   1.00 0.00 ? 176 GLN A O    2  
ATOM 3204  C CB   . GLN A 1 79  ? -7.047  3.882   10.366  1.00 0.00 ? 176 GLN A CB   2  
ATOM 3205  C CG   . GLN A 1 79  ? -6.002  3.966   11.463  1.00 0.00 ? 176 GLN A CG   2  
ATOM 3206  C CD   . GLN A 1 79  ? -6.598  4.417   12.781  1.00 0.00 ? 176 GLN A CD   2  
ATOM 3207  O OE1  . GLN A 1 79  ? -6.997  3.597   13.607  1.00 0.00 ? 176 GLN A OE1  2  
ATOM 3208  N NE2  . GLN A 1 79  ? -6.681  5.718   12.983  1.00 0.00 ? 176 GLN A NE2  2  
ATOM 3209  H H    . GLN A 1 79  ? -9.059  4.853   8.495   1.00 0.00 ? 176 GLN A H    2  
ATOM 3210  H HA   . GLN A 1 79  ? -7.423  5.974   10.639  1.00 0.00 ? 176 GLN A HA   2  
ATOM 3211  H HB2  . GLN A 1 79  ? -7.909  3.363   10.758  1.00 0.00 ? 176 GLN A HB2  2  
ATOM 3212  H HB3  . GLN A 1 79  ? -6.635  3.313   9.548   1.00 0.00 ? 176 GLN A HB3  2  
ATOM 3213  H HG2  . GLN A 1 79  ? -5.557  2.992   11.598  1.00 0.00 ? 176 GLN A HG2  2  
ATOM 3214  H HG3  . GLN A 1 79  ? -5.243  4.675   11.166  1.00 0.00 ? 176 GLN A HG3  2  
ATOM 3215  H HE21 . GLN A 1 79  ? -6.348  6.324   12.276  1.00 0.00 ? 176 GLN A HE21 2  
ATOM 3216  H HE22 . GLN A 1 79  ? -7.090  6.033   13.815  1.00 0.00 ? 176 GLN A HE22 2  
ATOM 3217  N N    . LYS A 1 80  ? -5.516  6.392   9.031   1.00 0.00 ? 177 LYS A N    2  
ATOM 3218  C CA   . LYS A 1 80  ? -4.546  6.837   8.048   1.00 0.00 ? 177 LYS A CA   2  
ATOM 3219  C C    . LYS A 1 80  ? -3.423  5.817   7.908   1.00 0.00 ? 177 LYS A C    2  
ATOM 3220  O O    . LYS A 1 80  ? -2.950  5.267   8.903   1.00 0.00 ? 177 LYS A O    2  
ATOM 3221  C CB   . LYS A 1 80  ? -3.975  8.185   8.481   1.00 0.00 ? 177 LYS A CB   2  
ATOM 3222  C CG   . LYS A 1 80  ? -3.102  8.854   7.439   1.00 0.00 ? 177 LYS A CG   2  
ATOM 3223  C CD   . LYS A 1 80  ? -2.574  10.179  7.955   1.00 0.00 ? 177 LYS A CD   2  
ATOM 3224  C CE   . LYS A 1 80  ? -2.022  11.037  6.833   1.00 0.00 ? 177 LYS A CE   2  
ATOM 3225  N NZ   . LYS A 1 80  ? -1.487  12.326  7.338   1.00 0.00 ? 177 LYS A NZ   2  
ATOM 3226  H H    . LYS A 1 80  ? -5.384  6.646   9.976   1.00 0.00 ? 177 LYS A H    2  
ATOM 3227  H HA   . LYS A 1 80  ? -5.048  6.950   7.099   1.00 0.00 ? 177 LYS A HA   2  
ATOM 3228  H HB2  . LYS A 1 80  ? -4.794  8.850   8.709   1.00 0.00 ? 177 LYS A HB2  2  
ATOM 3229  H HB3  . LYS A 1 80  ? -3.384  8.040   9.372   1.00 0.00 ? 177 LYS A HB3  2  
ATOM 3230  H HG2  . LYS A 1 80  ? -2.269  8.207   7.208   1.00 0.00 ? 177 LYS A HG2  2  
ATOM 3231  H HG3  . LYS A 1 80  ? -3.687  9.030   6.548   1.00 0.00 ? 177 LYS A HG3  2  
ATOM 3232  H HD2  . LYS A 1 80  ? -3.378  10.711  8.438   1.00 0.00 ? 177 LYS A HD2  2  
ATOM 3233  H HD3  . LYS A 1 80  ? -1.787  9.987   8.669   1.00 0.00 ? 177 LYS A HD3  2  
ATOM 3234  H HE2  . LYS A 1 80  ? -1.230  10.497  6.340   1.00 0.00 ? 177 LYS A HE2  2  
ATOM 3235  H HE3  . LYS A 1 80  ? -2.814  11.237  6.126   1.00 0.00 ? 177 LYS A HE3  2  
ATOM 3236  H HZ1  . LYS A 1 80  ? -1.178  12.921  6.545   1.00 0.00 ? 177 LYS A HZ1  2  
ATOM 3237  H HZ2  . LYS A 1 80  ? -0.679  12.157  7.968   1.00 0.00 ? 177 LYS A HZ2  2  
ATOM 3238  H HZ3  . LYS A 1 80  ? -2.222  12.836  7.869   1.00 0.00 ? 177 LYS A HZ3  2  
ATOM 3239  N N    . TYR A 1 81  ? -3.011  5.556   6.675   1.00 0.00 ? 178 TYR A N    2  
ATOM 3240  C CA   . TYR A 1 81  ? -1.899  4.655   6.412   1.00 0.00 ? 178 TYR A CA   2  
ATOM 3241  C C    . TYR A 1 81  ? -0.840  5.348   5.566   1.00 0.00 ? 178 TYR A C    2  
ATOM 3242  O O    . TYR A 1 81  ? -1.157  6.122   4.659   1.00 0.00 ? 178 TYR A O    2  
ATOM 3243  C CB   . TYR A 1 81  ? -2.374  3.372   5.714   1.00 0.00 ? 178 TYR A CB   2  
ATOM 3244  C CG   . TYR A 1 81  ? -3.093  2.403   6.626   1.00 0.00 ? 178 TYR A CG   2  
ATOM 3245  C CD1  . TYR A 1 81  ? -4.390  2.647   7.053   1.00 0.00 ? 178 TYR A CD1  2  
ATOM 3246  C CD2  . TYR A 1 81  ? -2.468  1.240   7.053   1.00 0.00 ? 178 TYR A CD2  2  
ATOM 3247  C CE1  . TYR A 1 81  ? -5.045  1.759   7.884   1.00 0.00 ? 178 TYR A CE1  2  
ATOM 3248  C CE2  . TYR A 1 81  ? -3.117  0.348   7.883   1.00 0.00 ? 178 TYR A CE2  2  
ATOM 3249  C CZ   . TYR A 1 81  ? -4.403  0.613   8.297   1.00 0.00 ? 178 TYR A CZ   2  
ATOM 3250  O OH   . TYR A 1 81  ? -5.051  -0.275  9.123   1.00 0.00 ? 178 TYR A OH   2  
ATOM 3251  H H    . TYR A 1 81  ? -3.470  5.983   5.916   1.00 0.00 ? 178 TYR A H    2  
ATOM 3252  H HA   . TYR A 1 81  ? -1.460  4.392   7.363   1.00 0.00 ? 178 TYR A HA   2  
ATOM 3253  H HB2  . TYR A 1 81  ? -3.051  3.634   4.917   1.00 0.00 ? 178 TYR A HB2  2  
ATOM 3254  H HB3  . TYR A 1 81  ? -1.517  2.859   5.297   1.00 0.00 ? 178 TYR A HB3  2  
ATOM 3255  H HD1  . TYR A 1 81  ? -4.889  3.549   6.731   1.00 0.00 ? 178 TYR A HD1  2  
ATOM 3256  H HD2  . TYR A 1 81  ? -1.459  1.035   6.727   1.00 0.00 ? 178 TYR A HD2  2  
ATOM 3257  H HE1  . TYR A 1 81  ? -6.054  1.965   8.204   1.00 0.00 ? 178 TYR A HE1  2  
ATOM 3258  H HE2  . TYR A 1 81  ? -2.613  -0.551  8.207   1.00 0.00 ? 178 TYR A HE2  2  
ATOM 3259  H HH   . TYR A 1 81  ? -4.411  -0.677  9.725   1.00 0.00 ? 178 TYR A HH   2  
ATOM 3260  N N    . LEU A 1 82  ? 0.412   5.086   5.892   1.00 0.00 ? 179 LEU A N    2  
ATOM 3261  C CA   . LEU A 1 82  ? 1.539   5.622   5.147   1.00 0.00 ? 179 LEU A CA   2  
ATOM 3262  C C    . LEU A 1 82  ? 2.128   4.510   4.291   1.00 0.00 ? 179 LEU A C    2  
ATOM 3263  O O    . LEU A 1 82  ? 2.353   3.411   4.791   1.00 0.00 ? 179 LEU A O    2  
ATOM 3264  C CB   . LEU A 1 82  ? 2.625   6.160   6.095   1.00 0.00 ? 179 LEU A CB   2  
ATOM 3265  C CG   . LEU A 1 82  ? 2.234   7.316   7.031   1.00 0.00 ? 179 LEU A CG   2  
ATOM 3266  C CD1  . LEU A 1 82  ? 1.259   6.868   8.111   1.00 0.00 ? 179 LEU A CD1  2  
ATOM 3267  C CD2  . LEU A 1 82  ? 3.481   7.910   7.670   1.00 0.00 ? 179 LEU A CD2  2  
ATOM 3268  H H    . LEU A 1 82  ? 0.589   4.503   6.665   1.00 0.00 ? 179 LEU A H    2  
ATOM 3269  H HA   . LEU A 1 82  ? 1.183   6.418   4.508   1.00 0.00 ? 179 LEU A HA   2  
ATOM 3270  H HB2  . LEU A 1 82  ? 2.965   5.340   6.708   1.00 0.00 ? 179 LEU A HB2  2  
ATOM 3271  H HB3  . LEU A 1 82  ? 3.453   6.490   5.488   1.00 0.00 ? 179 LEU A HB3  2  
ATOM 3272  H HG   . LEU A 1 82  ? 1.757   8.093   6.452   1.00 0.00 ? 179 LEU A HG   2  
ATOM 3273  H HD11 . LEU A 1 82  ? 0.365   6.475   7.649   1.00 0.00 ? 179 LEU A HD11 2  
ATOM 3274  H HD12 . LEU A 1 82  ? 1.000   7.711   8.735   1.00 0.00 ? 179 LEU A HD12 2  
ATOM 3275  H HD13 . LEU A 1 82  ? 1.719   6.100   8.716   1.00 0.00 ? 179 LEU A HD13 2  
ATOM 3276  H HD21 . LEU A 1 82  ? 3.197   8.712   8.335   1.00 0.00 ? 179 LEU A HD21 2  
ATOM 3277  H HD22 . LEU A 1 82  ? 4.133   8.293   6.900   1.00 0.00 ? 179 LEU A HD22 2  
ATOM 3278  H HD23 . LEU A 1 82  ? 3.997   7.143   8.229   1.00 0.00 ? 179 LEU A HD23 2  
ATOM 3279  N N    . VAL A 1 83  ? 2.372   4.781   3.016   1.00 0.00 ? 180 VAL A N    2  
ATOM 3280  C CA   . VAL A 1 83  ? 2.851   3.746   2.103   1.00 0.00 ? 180 VAL A CA   2  
ATOM 3281  C C    . VAL A 1 83  ? 3.990   4.253   1.223   1.00 0.00 ? 180 VAL A C    2  
ATOM 3282  O O    . VAL A 1 83  ? 4.043   5.435   0.872   1.00 0.00 ? 180 VAL A O    2  
ATOM 3283  C CB   . VAL A 1 83  ? 1.721   3.203   1.192   1.00 0.00 ? 180 VAL A CB   2  
ATOM 3284  C CG1  . VAL A 1 83  ? 0.611   2.564   2.011   1.00 0.00 ? 180 VAL A CG1  2  
ATOM 3285  C CG2  . VAL A 1 83  ? 1.161   4.302   0.305   1.00 0.00 ? 180 VAL A CG2  2  
ATOM 3286  H H    . VAL A 1 83  ? 2.240   5.700   2.681   1.00 0.00 ? 180 VAL A H    2  
ATOM 3287  H HA   . VAL A 1 83  ? 3.220   2.926   2.702   1.00 0.00 ? 180 VAL A HA   2  
ATOM 3288  H HB   . VAL A 1 83  ? 2.144   2.441   0.553   1.00 0.00 ? 180 VAL A HB   2  
ATOM 3289  H HG11 . VAL A 1 83  ? 0.202   3.293   2.695   1.00 0.00 ? 180 VAL A HG11 2  
ATOM 3290  H HG12 . VAL A 1 83  ? 1.011   1.732   2.568   1.00 0.00 ? 180 VAL A HG12 2  
ATOM 3291  H HG13 . VAL A 1 83  ? -0.168  2.213   1.349   1.00 0.00 ? 180 VAL A HG13 2  
ATOM 3292  H HG21 . VAL A 1 83  ? 1.940   4.672   -0.344  1.00 0.00 ? 180 VAL A HG21 2  
ATOM 3293  H HG22 . VAL A 1 83  ? 0.788   5.109   0.919   1.00 0.00 ? 180 VAL A HG22 2  
ATOM 3294  H HG23 . VAL A 1 83  ? 0.355   3.903   -0.292  1.00 0.00 ? 180 VAL A HG23 2  
ATOM 3295  N N    . GLN A 1 84  ? 4.906   3.352   0.889   1.00 0.00 ? 181 GLN A N    2  
ATOM 3296  C CA   . GLN A 1 84  ? 6.008   3.652   -0.019  1.00 0.00 ? 181 GLN A CA   2  
ATOM 3297  C C    . GLN A 1 84  ? 6.316   2.448   -0.894  1.00 0.00 ? 181 GLN A C    2  
ATOM 3298  O O    . GLN A 1 84  ? 6.079   1.311   -0.492  1.00 0.00 ? 181 GLN A O    2  
ATOM 3299  C CB   . GLN A 1 84  ? 7.270   4.045   0.748   1.00 0.00 ? 181 GLN A CB   2  
ATOM 3300  C CG   . GLN A 1 84  ? 7.155   5.367   1.477   1.00 0.00 ? 181 GLN A CG   2  
ATOM 3301  C CD   . GLN A 1 84  ? 8.500   5.945   1.846   1.00 0.00 ? 181 GLN A CD   2  
ATOM 3302  O OE1  . GLN A 1 84  ? 9.490   5.732   1.150   1.00 0.00 ? 181 GLN A OE1  2  
ATOM 3303  N NE2  . GLN A 1 84  ? 8.554   6.666   2.950   1.00 0.00 ? 181 GLN A NE2  2  
ATOM 3304  H H    . GLN A 1 84  ? 4.839   2.448   1.272   1.00 0.00 ? 181 GLN A H    2  
ATOM 3305  H HA   . GLN A 1 84  ? 5.706   4.475   -0.649  1.00 0.00 ? 181 GLN A HA   2  
ATOM 3306  H HB2  . GLN A 1 84  ? 7.491   3.276   1.475   1.00 0.00 ? 181 GLN A HB2  2  
ATOM 3307  H HB3  . GLN A 1 84  ? 8.092   4.114   0.052   1.00 0.00 ? 181 GLN A HB3  2  
ATOM 3308  H HG2  . GLN A 1 84  ? 6.647   6.063   0.831   1.00 0.00 ? 181 GLN A HG2  2  
ATOM 3309  H HG3  . GLN A 1 84  ? 6.577   5.221   2.378   1.00 0.00 ? 181 GLN A HG3  2  
ATOM 3310  H HE21 . GLN A 1 84  ? 7.728   6.788   3.469   1.00 0.00 ? 181 GLN A HE21 2  
ATOM 3311  H HE22 . GLN A 1 84  ? 9.416   7.066   3.202   1.00 0.00 ? 181 GLN A HE22 2  
ATOM 3312  N N    . VAL A 1 85  ? 6.862   2.698   -2.076  1.00 0.00 ? 182 VAL A N    2  
ATOM 3313  C CA   . VAL A 1 85  ? 7.193   1.623   -2.999  1.00 0.00 ? 182 VAL A CA   2  
ATOM 3314  C C    . VAL A 1 85  ? 8.668   1.682   -3.404  1.00 0.00 ? 182 VAL A C    2  
ATOM 3315  O O    . VAL A 1 85  ? 9.236   2.761   -3.586  1.00 0.00 ? 182 VAL A O    2  
ATOM 3316  C CB   . VAL A 1 85  ? 6.297   1.667   -4.261  1.00 0.00 ? 182 VAL A CB   2  
ATOM 3317  C CG1  . VAL A 1 85  ? 6.522   2.945   -5.058  1.00 0.00 ? 182 VAL A CG1  2  
ATOM 3318  C CG2  . VAL A 1 85  ? 6.525   0.440   -5.133  1.00 0.00 ? 182 VAL A CG2  2  
ATOM 3319  H H    . VAL A 1 85  ? 7.047   3.624   -2.334  1.00 0.00 ? 182 VAL A H    2  
ATOM 3320  H HA   . VAL A 1 85  ? 7.013   0.687   -2.490  1.00 0.00 ? 182 VAL A HA   2  
ATOM 3321  H HB   . VAL A 1 85  ? 5.265   1.656   -3.936  1.00 0.00 ? 182 VAL A HB   2  
ATOM 3322  H HG11 . VAL A 1 85  ? 6.297   3.801   -4.439  1.00 0.00 ? 182 VAL A HG11 2  
ATOM 3323  H HG12 . VAL A 1 85  ? 5.878   2.949   -5.925  1.00 0.00 ? 182 VAL A HG12 2  
ATOM 3324  H HG13 . VAL A 1 85  ? 7.554   2.992   -5.376  1.00 0.00 ? 182 VAL A HG13 2  
ATOM 3325  H HG21 . VAL A 1 85  ? 5.895   0.499   -6.008  1.00 0.00 ? 182 VAL A HG21 2  
ATOM 3326  H HG22 . VAL A 1 85  ? 6.282   -0.450  -4.572  1.00 0.00 ? 182 VAL A HG22 2  
ATOM 3327  H HG23 . VAL A 1 85  ? 7.561   0.403   -5.436  1.00 0.00 ? 182 VAL A HG23 2  
ATOM 3328  N N    . ARG A 1 86  ? 9.288   0.515   -3.502  1.00 0.00 ? 183 ARG A N    2  
ATOM 3329  C CA   . ARG A 1 86  ? 10.658  0.399   -3.975  1.00 0.00 ? 183 ARG A CA   2  
ATOM 3330  C C    . ARG A 1 86  ? 10.784  -0.710  -5.003  1.00 0.00 ? 183 ARG A C    2  
ATOM 3331  O O    . ARG A 1 86  ? 9.905   -1.562  -5.137  1.00 0.00 ? 183 ARG A O    2  
ATOM 3332  C CB   . ARG A 1 86  ? 11.632  0.090   -2.835  1.00 0.00 ? 183 ARG A CB   2  
ATOM 3333  C CG   . ARG A 1 86  ? 12.088  1.293   -2.034  1.00 0.00 ? 183 ARG A CG   2  
ATOM 3334  C CD   . ARG A 1 86  ? 13.220  0.912   -1.091  1.00 0.00 ? 183 ARG A CD   2  
ATOM 3335  N NE   . ARG A 1 86  ? 14.452  0.587   -1.815  1.00 0.00 ? 183 ARG A NE   2  
ATOM 3336  C CZ   . ARG A 1 86  ? 15.007  -0.626  -1.859  1.00 0.00 ? 183 ARG A CZ   2  
ATOM 3337  N NH1  . ARG A 1 86  ? 14.449  -1.655  -1.227  1.00 0.00 ? 183 ARG A NH1  2  
ATOM 3338  N NH2  . ARG A 1 86  ? 16.129  -0.809  -2.548  1.00 0.00 ? 183 ARG A NH2  2  
ATOM 3339  H H    . ARG A 1 86  ? 8.802   -0.304  -3.244  1.00 0.00 ? 183 ARG A H    2  
ATOM 3340  H HA   . ARG A 1 86  ? 10.935  1.336   -4.433  1.00 0.00 ? 183 ARG A HA   2  
ATOM 3341  H HB2  . ARG A 1 86  ? 11.155  -0.598  -2.154  1.00 0.00 ? 183 ARG A HB2  2  
ATOM 3342  H HB3  . ARG A 1 86  ? 12.507  -0.387  -3.252  1.00 0.00 ? 183 ARG A HB3  2  
ATOM 3343  H HG2  . ARG A 1 86  ? 12.438  2.058   -2.712  1.00 0.00 ? 183 ARG A HG2  2  
ATOM 3344  H HG3  . ARG A 1 86  ? 11.259  1.669   -1.455  1.00 0.00 ? 183 ARG A HG3  2  
ATOM 3345  H HD2  . ARG A 1 86  ? 13.412  1.740   -0.425  1.00 0.00 ? 183 ARG A HD2  2  
ATOM 3346  H HD3  . ARG A 1 86  ? 12.915  0.051   -0.515  1.00 0.00 ? 183 ARG A HD3  2  
ATOM 3347  H HE   . ARG A 1 86  ? 14.895  1.327   -2.297  1.00 0.00 ? 183 ARG A HE   2  
ATOM 3348  H HH11 . ARG A 1 86  ? 13.592  -1.540  -0.702  1.00 0.00 ? 183 ARG A HH11 2  
ATOM 3349  H HH12 . ARG A 1 86  ? 14.875  -2.560  -1.262  1.00 0.00 ? 183 ARG A HH12 2  
ATOM 3350  H HH21 . ARG A 1 86  ? 16.555  -0.041  -3.036  1.00 0.00 ? 183 ARG A HH21 2  
ATOM 3351  H HH22 . ARG A 1 86  ? 16.558  -1.715  -2.584  1.00 0.00 ? 183 ARG A HH22 2  
ATOM 3352  N N    . CYS A 1 87  ? 11.887  -0.676  -5.721  1.00 0.00 ? 184 CYS A N    2  
ATOM 3353  C CA   . CYS A 1 87  ? 12.303  -1.775  -6.560  1.00 0.00 ? 184 CYS A CA   2  
ATOM 3354  C C    . CYS A 1 87  ? 13.811  -1.903  -6.433  1.00 0.00 ? 184 CYS A C    2  
ATOM 3355  O O    . CYS A 1 87  ? 14.532  -0.918  -6.607  1.00 0.00 ? 184 CYS A O    2  
ATOM 3356  C CB   . CYS A 1 87  ? 11.907  -1.532  -8.020  1.00 0.00 ? 184 CYS A CB   2  
ATOM 3357  S SG   . CYS A 1 87  ? 12.744  -0.124  -8.787  1.00 0.00 ? 184 CYS A SG   2  
ATOM 3358  H H    . CYS A 1 87  ? 12.448  0.125   -5.688  1.00 0.00 ? 184 CYS A H    2  
ATOM 3359  H HA   . CYS A 1 87  ? 11.834  -2.680  -6.199  1.00 0.00 ? 184 CYS A HA   2  
ATOM 3360  H HB2  . CYS A 1 87  ? 12.141  -2.410  -8.600  1.00 0.00 ? 184 CYS A HB2  2  
ATOM 3361  H HB3  . CYS A 1 87  ? 10.842  -1.348  -8.068  1.00 0.00 ? 184 CYS A HB3  2  
ATOM 3362  H HG   . CYS A 1 87  ? 13.969  -0.059  -8.280  1.00 0.00 ? 184 CYS A HG   2  
ATOM 3363  N N    . LYS A 1 88  ? 14.296  -3.079  -6.088  1.00 0.00 ? 185 LYS A N    2  
ATOM 3364  C CA   . LYS A 1 88  ? 15.722  -3.254  -5.889  1.00 0.00 ? 185 LYS A CA   2  
ATOM 3365  C C    . LYS A 1 88  ? 16.285  -4.291  -6.855  1.00 0.00 ? 185 LYS A C    2  
ATOM 3366  O O    . LYS A 1 88  ? 16.318  -5.486  -6.563  1.00 0.00 ? 185 LYS A O    2  
ATOM 3367  C CB   . LYS A 1 88  ? 16.035  -3.591  -4.425  1.00 0.00 ? 185 LYS A CB   2  
ATOM 3368  C CG   . LYS A 1 88  ? 15.297  -4.792  -3.865  1.00 0.00 ? 185 LYS A CG   2  
ATOM 3369  C CD   . LYS A 1 88  ? 15.571  -4.931  -2.380  1.00 0.00 ? 185 LYS A CD   2  
ATOM 3370  C CE   . LYS A 1 88  ? 15.241  -6.316  -1.868  1.00 0.00 ? 185 LYS A CE   2  
ATOM 3371  N NZ   . LYS A 1 88  ? 13.780  -6.589  -1.870  1.00 0.00 ? 185 LYS A NZ   2  
ATOM 3372  H H    . LYS A 1 88  ? 13.691  -3.847  -5.984  1.00 0.00 ? 185 LYS A H    2  
ATOM 3373  H HA   . LYS A 1 88  ? 16.184  -2.310  -6.116  1.00 0.00 ? 185 LYS A HA   2  
ATOM 3374  H HB2  . LYS A 1 88  ? 17.094  -3.779  -4.333  1.00 0.00 ? 185 LYS A HB2  2  
ATOM 3375  H HB3  . LYS A 1 88  ? 15.786  -2.733  -3.817  1.00 0.00 ? 185 LYS A HB3  2  
ATOM 3376  H HG2  . LYS A 1 88  ? 14.237  -4.662  -4.019  1.00 0.00 ? 185 LYS A HG2  2  
ATOM 3377  H HG3  . LYS A 1 88  ? 15.635  -5.683  -4.372  1.00 0.00 ? 185 LYS A HG3  2  
ATOM 3378  H HD2  . LYS A 1 88  ? 16.615  -4.734  -2.200  1.00 0.00 ? 185 LYS A HD2  2  
ATOM 3379  H HD3  . LYS A 1 88  ? 14.971  -4.210  -1.848  1.00 0.00 ? 185 LYS A HD3  2  
ATOM 3380  H HE2  . LYS A 1 88  ? 15.732  -7.035  -2.505  1.00 0.00 ? 185 LYS A HE2  2  
ATOM 3381  H HE3  . LYS A 1 88  ? 15.618  -6.409  -0.862  1.00 0.00 ? 185 LYS A HE3  2  
ATOM 3382  H HZ1  . LYS A 1 88  ? 13.280  -5.894  -1.266  1.00 0.00 ? 185 LYS A HZ1  2  
ATOM 3383  H HZ2  . LYS A 1 88  ? 13.599  -7.543  -1.499  1.00 0.00 ? 185 LYS A HZ2  2  
ATOM 3384  H HZ3  . LYS A 1 88  ? 13.406  -6.532  -2.836  1.00 0.00 ? 185 LYS A HZ3  2  
ATOM 3385  N N    . PRO A 1 89  ? 16.723  -3.833  -8.040  1.00 0.00 ? 186 PRO A N    2  
ATOM 3386  C CA   . PRO A 1 89  ? 17.249  -4.714  -9.085  1.00 0.00 ? 186 PRO A CA   2  
ATOM 3387  C C    . PRO A 1 89  ? 18.546  -5.400  -8.667  1.00 0.00 ? 186 PRO A C    2  
ATOM 3388  O O    . PRO A 1 89  ? 19.187  -5.024  -7.682  1.00 0.00 ? 186 PRO A O    2  
ATOM 3389  C CB   . PRO A 1 89  ? 17.501  -3.767  -10.261 1.00 0.00 ? 186 PRO A CB   2  
ATOM 3390  C CG   . PRO A 1 89  ? 17.653  -2.422  -9.645  1.00 0.00 ? 186 PRO A CG   2  
ATOM 3391  C CD   . PRO A 1 89  ? 16.743  -2.417  -8.453  1.00 0.00 ? 186 PRO A CD   2  
ATOM 3392  H HA   . PRO A 1 89  ? 16.526  -5.463  -9.371  1.00 0.00 ? 186 PRO A HA   2  
ATOM 3393  H HB2  . PRO A 1 89  ? 18.398  -4.068  -10.781 1.00 0.00 ? 186 PRO A HB2  2  
ATOM 3394  H HB3  . PRO A 1 89  ? 16.660  -3.796  -10.938 1.00 0.00 ? 186 PRO A HB3  2  
ATOM 3395  H HG2  . PRO A 1 89  ? 18.677  -2.273  -9.336  1.00 0.00 ? 186 PRO A HG2  2  
ATOM 3396  H HG3  . PRO A 1 89  ? 17.355  -1.659  -10.348 1.00 0.00 ? 186 PRO A HG3  2  
ATOM 3397  H HD2  . PRO A 1 89  ? 17.148  -1.792  -7.673  1.00 0.00 ? 186 PRO A HD2  2  
ATOM 3398  H HD3  . PRO A 1 89  ? 15.755  -2.083  -8.732  1.00 0.00 ? 186 PRO A HD3  2  
ATOM 3399  N N    . ASP A 1 90  ? 18.918  -6.405  -9.450  1.00 0.00 ? 187 ASP A N    2  
ATOM 3400  C CA   . ASP A 1 90  ? 20.038  -7.291  -9.146  1.00 0.00 ? 187 ASP A CA   2  
ATOM 3401  C C    . ASP A 1 90  ? 21.360  -6.537  -9.041  1.00 0.00 ? 187 ASP A C    2  
ATOM 3402  O O    . ASP A 1 90  ? 22.287  -6.994  -8.378  1.00 0.00 ? 187 ASP A O    2  
ATOM 3403  C CB   . ASP A 1 90  ? 20.141  -8.368  -10.229 1.00 0.00 ? 187 ASP A CB   2  
ATOM 3404  C CG   . ASP A 1 90  ? 21.120  -9.470  -9.879  1.00 0.00 ? 187 ASP A CG   2  
ATOM 3405  O OD1  . ASP A 1 90  ? 20.722  -10.416 -9.167  1.00 0.00 ? 187 ASP A OD1  2  
ATOM 3406  O OD2  . ASP A 1 90  ? 22.280  -9.415  -10.339 1.00 0.00 ? 187 ASP A OD2  2  
ATOM 3407  H H    . ASP A 1 90  ? 18.402  -6.572  -10.270 1.00 0.00 ? 187 ASP A H    2  
ATOM 3408  H HA   . ASP A 1 90  ? 19.835  -7.768  -8.201  1.00 0.00 ? 187 ASP A HA   2  
ATOM 3409  H HB2  . ASP A 1 90  ? 19.170  -8.815  -10.375 1.00 0.00 ? 187 ASP A HB2  2  
ATOM 3410  H HB3  . ASP A 1 90  ? 20.462  -7.909  -11.152 1.00 0.00 ? 187 ASP A HB3  2  
ATOM 3411  N N    . HIS A 1 91  ? 21.449  -5.381  -9.689  1.00 0.00 ? 188 HIS A N    2  
ATOM 3412  C CA   . HIS A 1 91  ? 22.682  -4.598  -9.676  1.00 0.00 ? 188 HIS A CA   2  
ATOM 3413  C C    . HIS A 1 91  ? 22.665  -3.566  -8.555  1.00 0.00 ? 188 HIS A C    2  
ATOM 3414  O O    . HIS A 1 91  ? 23.585  -2.759  -8.434  1.00 0.00 ? 188 HIS A O    2  
ATOM 3415  C CB   . HIS A 1 91  ? 22.896  -3.869  -11.009 1.00 0.00 ? 188 HIS A CB   2  
ATOM 3416  C CG   . HIS A 1 91  ? 23.027  -4.763  -12.204 1.00 0.00 ? 188 HIS A CG   2  
ATOM 3417  N ND1  . HIS A 1 91  ? 22.819  -4.321  -13.493 1.00 0.00 ? 188 HIS A ND1  2  
ATOM 3418  C CD2  . HIS A 1 91  ? 23.352  -6.073  -12.304 1.00 0.00 ? 188 HIS A CD2  2  
ATOM 3419  C CE1  . HIS A 1 91  ? 23.007  -5.321  -14.332 1.00 0.00 ? 188 HIS A CE1  2  
ATOM 3420  N NE2  . HIS A 1 91  ? 23.331  -6.394  -13.639 1.00 0.00 ? 188 HIS A NE2  2  
ATOM 3421  H H    . HIS A 1 91  ? 20.667  -5.043  -10.176 1.00 0.00 ? 188 HIS A H    2  
ATOM 3422  H HA   . HIS A 1 91  ? 23.506  -5.277  -9.512  1.00 0.00 ? 188 HIS A HA   2  
ATOM 3423  H HB2  . HIS A 1 91  ? 22.059  -3.214  -11.183 1.00 0.00 ? 188 HIS A HB2  2  
ATOM 3424  H HB3  . HIS A 1 91  ? 23.796  -3.276  -10.941 1.00 0.00 ? 188 HIS A HB3  2  
ATOM 3425  H HD1  . HIS A 1 91  ? 22.577  -3.396  -13.755 1.00 0.00 ? 188 HIS A HD1  2  
ATOM 3426  H HD2  . HIS A 1 91  ? 23.584  -6.741  -11.488 1.00 0.00 ? 188 HIS A HD2  2  
ATOM 3427  H HE1  . HIS A 1 91  ? 22.914  -5.268  -15.407 1.00 0.00 ? 188 HIS A HE1  2  
ATOM 3428  H HE2  . HIS A 1 91  ? 23.390  -7.304  -14.005 1.00 0.00 ? 188 HIS A HE2  2  
ATOM 3429  N N    . GLY A 1 92  ? 21.626  -3.588  -7.734  1.00 0.00 ? 189 GLY A N    2  
ATOM 3430  C CA   . GLY A 1 92  ? 21.483  -2.565  -6.726  1.00 0.00 ? 189 GLY A CA   2  
ATOM 3431  C C    . GLY A 1 92  ? 21.160  -3.109  -5.358  1.00 0.00 ? 189 GLY A C    2  
ATOM 3432  O O    . GLY A 1 92  ? 20.929  -4.305  -5.187  1.00 0.00 ? 189 GLY A O    2  
ATOM 3433  H H    . GLY A 1 92  ? 20.960  -4.307  -7.806  1.00 0.00 ? 189 GLY A H    2  
ATOM 3434  H HA2  . GLY A 1 92  ? 22.404  -2.010  -6.663  1.00 0.00 ? 189 GLY A HA2  2  
ATOM 3435  H HA3  . GLY A 1 92  ? 20.692  -1.894  -7.024  1.00 0.00 ? 189 GLY A HA3  2  
ATOM 3436  N N    . TYR A 1 93  ? 21.138  -2.215  -4.388  1.00 0.00 ? 190 TYR A N    2  
ATOM 3437  C CA   . TYR A 1 93  ? 20.864  -2.566  -3.009  1.00 0.00 ? 190 TYR A CA   2  
ATOM 3438  C C    . TYR A 1 93  ? 19.770  -1.642  -2.456  1.00 0.00 ? 190 TYR A C    2  
ATOM 3439  O O    . TYR A 1 93  ? 19.255  -0.785  -3.182  1.00 0.00 ? 190 TYR A O    2  
ATOM 3440  C CB   . TYR A 1 93  ? 22.171  -2.460  -2.198  1.00 0.00 ? 190 TYR A CB   2  
ATOM 3441  C CG   . TYR A 1 93  ? 22.058  -2.818  -0.729  1.00 0.00 ? 190 TYR A CG   2  
ATOM 3442  C CD1  . TYR A 1 93  ? 21.764  -4.113  -0.322  1.00 0.00 ? 190 TYR A CD1  2  
ATOM 3443  C CD2  . TYR A 1 93  ? 22.251  -1.850  0.250   1.00 0.00 ? 190 TYR A CD2  2  
ATOM 3444  C CE1  . TYR A 1 93  ? 21.663  -4.433  1.020   1.00 0.00 ? 190 TYR A CE1  2  
ATOM 3445  C CE2  . TYR A 1 93  ? 22.153  -2.162  1.591   1.00 0.00 ? 190 TYR A CE2  2  
ATOM 3446  C CZ   . TYR A 1 93  ? 21.858  -3.453  1.971   1.00 0.00 ? 190 TYR A CZ   2  
ATOM 3447  O OH   . TYR A 1 93  ? 21.756  -3.760  3.307   1.00 0.00 ? 190 TYR A OH   2  
ATOM 3448  H H    . TYR A 1 93  ? 21.312  -1.276  -4.610  1.00 0.00 ? 190 TYR A H    2  
ATOM 3449  H HA   . TYR A 1 93  ? 20.510  -3.584  -2.986  1.00 0.00 ? 190 TYR A HA   2  
ATOM 3450  H HB2  . TYR A 1 93  ? 22.903  -3.121  -2.634  1.00 0.00 ? 190 TYR A HB2  2  
ATOM 3451  H HB3  . TYR A 1 93  ? 22.536  -1.445  -2.261  1.00 0.00 ? 190 TYR A HB3  2  
ATOM 3452  H HD1  . TYR A 1 93  ? 21.611  -4.877  -1.070  1.00 0.00 ? 190 TYR A HD1  2  
ATOM 3453  H HD2  . TYR A 1 93  ? 22.482  -0.839  -0.050  1.00 0.00 ? 190 TYR A HD2  2  
ATOM 3454  H HE1  . TYR A 1 93  ? 21.434  -5.445  1.318   1.00 0.00 ? 190 TYR A HE1  2  
ATOM 3455  H HE2  . TYR A 1 93  ? 22.307  -1.395  2.335   1.00 0.00 ? 190 TYR A HE2  2  
ATOM 3456  H HH   . TYR A 1 93  ? 21.302  -3.037  3.762   1.00 0.00 ? 190 TYR A HH   2  
ATOM 3457  N N    . TRP A 1 94  ? 19.388  -1.851  -1.202  1.00 0.00 ? 191 TRP A N    2  
ATOM 3458  C CA   . TRP A 1 94  ? 18.444  -0.981  -0.506  1.00 0.00 ? 191 TRP A CA   2  
ATOM 3459  C C    . TRP A 1 94  ? 18.797  0.500   -0.654  1.00 0.00 ? 191 TRP A C    2  
ATOM 3460  O O    . TRP A 1 94  ? 19.968  0.879   -0.648  1.00 0.00 ? 191 TRP A O    2  
ATOM 3461  C CB   . TRP A 1 94  ? 18.394  -1.349  0.974   1.00 0.00 ? 191 TRP A CB   2  
ATOM 3462  C CG   . TRP A 1 94  ? 17.636  -2.607  1.242   1.00 0.00 ? 191 TRP A CG   2  
ATOM 3463  C CD1  . TRP A 1 94  ? 18.063  -3.888  1.037   1.00 0.00 ? 191 TRP A CD1  2  
ATOM 3464  C CD2  . TRP A 1 94  ? 16.312  -2.704  1.772   1.00 0.00 ? 191 TRP A CD2  2  
ATOM 3465  N NE1  . TRP A 1 94  ? 17.081  -4.774  1.398   1.00 0.00 ? 191 TRP A NE1  2  
ATOM 3466  C CE2  . TRP A 1 94  ? 15.996  -4.072  1.854   1.00 0.00 ? 191 TRP A CE2  2  
ATOM 3467  C CE3  . TRP A 1 94  ? 15.361  -1.763  2.184   1.00 0.00 ? 191 TRP A CE3  2  
ATOM 3468  C CZ2  . TRP A 1 94  ? 14.770  -4.525  2.332   1.00 0.00 ? 191 TRP A CZ2  2  
ATOM 3469  C CZ3  . TRP A 1 94  ? 14.142  -2.216  2.658   1.00 0.00 ? 191 TRP A CZ3  2  
ATOM 3470  C CH2  . TRP A 1 94  ? 13.859  -3.587  2.729   1.00 0.00 ? 191 TRP A CH2  2  
ATOM 3471  H H    . TRP A 1 94  ? 19.739  -2.635  -0.732  1.00 0.00 ? 191 TRP A H    2  
ATOM 3472  H HA   . TRP A 1 94  ? 17.467  -1.146  -0.935  1.00 0.00 ? 191 TRP A HA   2  
ATOM 3473  H HB2  . TRP A 1 94  ? 19.402  -1.484  1.338   1.00 0.00 ? 191 TRP A HB2  2  
ATOM 3474  H HB3  . TRP A 1 94  ? 17.922  -0.550  1.522   1.00 0.00 ? 191 TRP A HB3  2  
ATOM 3475  H HD1  . TRP A 1 94  ? 19.033  -4.150  0.641   1.00 0.00 ? 191 TRP A HD1  2  
ATOM 3476  H HE1  . TRP A 1 94  ? 17.148  -5.756  1.341   1.00 0.00 ? 191 TRP A HE1  2  
ATOM 3477  H HE3  . TRP A 1 94  ? 15.566  -0.698  2.134   1.00 0.00 ? 191 TRP A HE3  2  
ATOM 3478  H HZ2  . TRP A 1 94  ? 14.536  -5.576  2.395   1.00 0.00 ? 191 TRP A HZ2  2  
ATOM 3479  H HZ3  . TRP A 1 94  ? 13.394  -1.507  2.981   1.00 0.00 ? 191 TRP A HZ3  2  
ATOM 3480  H HH2  . TRP A 1 94  ? 12.894  -3.898  3.102   1.00 0.00 ? 191 TRP A HH2  2  
ATOM 3481  N N    . SER A 1 95  ? 17.768  1.328   -0.794  1.00 0.00 ? 192 SER A N    2  
ATOM 3482  C CA   . SER A 1 95  ? 17.951  2.764   -0.931  1.00 0.00 ? 192 SER A CA   2  
ATOM 3483  C C    . SER A 1 95  ? 17.258  3.514   0.209   1.00 0.00 ? 192 SER A C    2  
ATOM 3484  O O    . SER A 1 95  ? 17.124  4.737   0.169   1.00 0.00 ? 192 SER A O    2  
ATOM 3485  C CB   . SER A 1 95  ? 17.420  3.229   -2.290  1.00 0.00 ? 192 SER A CB   2  
ATOM 3486  O OG   . SER A 1 95  ? 16.107  2.734   -2.531  1.00 0.00 ? 192 SER A OG   2  
ATOM 3487  H H    . SER A 1 95  ? 16.862  0.962   -0.816  1.00 0.00 ? 192 SER A H    2  
ATOM 3488  H HA   . SER A 1 95  ? 19.010  2.967   -0.881  1.00 0.00 ? 192 SER A HA   2  
ATOM 3489  H HB2  . SER A 1 95  ? 17.392  4.308   -2.313  1.00 0.00 ? 192 SER A HB2  2  
ATOM 3490  H HB3  . SER A 1 95  ? 18.076  2.870   -3.071  1.00 0.00 ? 192 SER A HB3  2  
ATOM 3491  H HG   . SER A 1 95  ? 15.688  3.284   -3.204  1.00 0.00 ? 192 SER A HG   2  
ATOM 3492  N N    . ALA A 1 96  ? 16.798  2.752   1.209   1.00 0.00 ? 193 ALA A N    2  
ATOM 3493  C CA   . ALA A 1 96  ? 16.203  3.306   2.433   1.00 0.00 ? 193 ALA A CA   2  
ATOM 3494  C C    . ALA A 1 96  ? 14.943  4.123   2.169   1.00 0.00 ? 193 ALA A C    2  
ATOM 3495  O O    . ALA A 1 96  ? 14.552  4.962   2.981   1.00 0.00 ? 193 ALA A O    2  
ATOM 3496  C CB   . ALA A 1 96  ? 17.223  4.136   3.174   1.00 0.00 ? 193 ALA A CB   2  
ATOM 3497  H H    . ALA A 1 96  ? 16.876  1.781   1.128   1.00 0.00 ? 193 ALA A H    2  
ATOM 3498  H HA   . ALA A 1 96  ? 15.934  2.475   3.064   1.00 0.00 ? 193 ALA A HA   2  
ATOM 3499  H HB1  . ALA A 1 96  ? 17.490  4.986   2.568   1.00 0.00 ? 193 ALA A HB1  2  
ATOM 3500  H HB2  . ALA A 1 96  ? 18.099  3.537   3.366   1.00 0.00 ? 193 ALA A HB2  2  
ATOM 3501  H HB3  . ALA A 1 96  ? 16.800  4.473   4.107   1.00 0.00 ? 193 ALA A HB3  2  
ATOM 3502  N N    . TRP A 1 97  ? 14.331  3.858   1.027   1.00 0.00 ? 194 TRP A N    2  
ATOM 3503  C CA   . TRP A 1 97  ? 13.023  4.425   0.663   1.00 0.00 ? 194 TRP A CA   2  
ATOM 3504  C C    . TRP A 1 97  ? 13.115  5.932   0.396   1.00 0.00 ? 194 TRP A C    2  
ATOM 3505  O O    . TRP A 1 97  ? 14.159  6.549   0.620   1.00 0.00 ? 194 TRP A O    2  
ATOM 3506  C CB   . TRP A 1 97  ? 11.992  4.137   1.760   1.00 0.00 ? 194 TRP A CB   2  
ATOM 3507  C CG   . TRP A 1 97  ? 11.860  2.679   2.092   1.00 0.00 ? 194 TRP A CG   2  
ATOM 3508  C CD1  . TRP A 1 97  ? 12.555  1.993   3.046   1.00 0.00 ? 194 TRP A CD1  2  
ATOM 3509  C CD2  . TRP A 1 97  ? 10.981  1.727   1.479   1.00 0.00 ? 194 TRP A CD2  2  
ATOM 3510  N NE1  . TRP A 1 97  ? 12.168  0.679   3.059   1.00 0.00 ? 194 TRP A NE1  2  
ATOM 3511  C CE2  . TRP A 1 97  ? 11.206  0.488   2.108   1.00 0.00 ? 194 TRP A CE2  2  
ATOM 3512  C CE3  . TRP A 1 97  ? 10.029  1.802   0.461   1.00 0.00 ? 194 TRP A CE3  2  
ATOM 3513  C CZ2  . TRP A 1 97  ? 10.514  -0.665  1.752   1.00 0.00 ? 194 TRP A CZ2  2  
ATOM 3514  C CZ3  . TRP A 1 97  ? 9.343   0.657   0.107   1.00 0.00 ? 194 TRP A CZ3  2  
ATOM 3515  C CH2  . TRP A 1 97  ? 9.589   -0.563  0.750   1.00 0.00 ? 194 TRP A CH2  2  
ATOM 3516  H H    . TRP A 1 97  ? 14.787  3.275   0.400   1.00 0.00 ? 194 TRP A H    2  
ATOM 3517  H HA   . TRP A 1 97  ? 12.703  3.939   -0.248  1.00 0.00 ? 194 TRP A HA   2  
ATOM 3518  H HB2  . TRP A 1 97  ? 12.282  4.657   2.660   1.00 0.00 ? 194 TRP A HB2  2  
ATOM 3519  H HB3  . TRP A 1 97  ? 11.025  4.496   1.439   1.00 0.00 ? 194 TRP A HB3  2  
ATOM 3520  H HD1  . TRP A 1 97  ? 13.303  2.435   3.688   1.00 0.00 ? 194 TRP A HD1  2  
ATOM 3521  H HE1  . TRP A 1 97  ? 12.525  -0.015  3.661   1.00 0.00 ? 194 TRP A HE1  2  
ATOM 3522  H HE3  . TRP A 1 97  ? 9.827   2.732   -0.048  1.00 0.00 ? 194 TRP A HE3  2  
ATOM 3523  H HZ2  . TRP A 1 97  ? 10.691  -1.612  2.242   1.00 0.00 ? 194 TRP A HZ2  2  
ATOM 3524  H HZ3  . TRP A 1 97  ? 8.604   0.694   -0.681  1.00 0.00 ? 194 TRP A HZ3  2  
ATOM 3525  H HH2  . TRP A 1 97  ? 9.029   -1.433  0.439   1.00 0.00 ? 194 TRP A HH2  2  
ATOM 3526  N N    . SER A 1 98  ? 12.026  6.521   -0.102  1.00 0.00 ? 195 SER A N    2  
ATOM 3527  C CA   . SER A 1 98  ? 12.020  7.937   -0.476  1.00 0.00 ? 195 SER A CA   2  
ATOM 3528  C C    . SER A 1 98  ? 10.596  8.530   -0.545  1.00 0.00 ? 195 SER A C    2  
ATOM 3529  O O    . SER A 1 98  ? 10.309  9.501   0.153   1.00 0.00 ? 195 SER A O    2  
ATOM 3530  C CB   . SER A 1 98  ? 12.745  8.155   -1.817  1.00 0.00 ? 195 SER A CB   2  
ATOM 3531  O OG   . SER A 1 98  ? 14.077  7.672   -1.765  1.00 0.00 ? 195 SER A OG   2  
ATOM 3532  H H    . SER A 1 98  ? 11.200  6.000   -0.197  1.00 0.00 ? 195 SER A H    2  
ATOM 3533  H HA   . SER A 1 98  ? 12.565  8.467   0.292   1.00 0.00 ? 195 SER A HA   2  
ATOM 3534  H HB2  . SER A 1 98  ? 12.219  7.634   -2.600  1.00 0.00 ? 195 SER A HB2  2  
ATOM 3535  H HB3  . SER A 1 98  ? 12.767  9.210   -2.041  1.00 0.00 ? 195 SER A HB3  2  
ATOM 3536  H HG   . SER A 1 98  ? 14.263  7.361   -0.868  1.00 0.00 ? 195 SER A HG   2  
ATOM 3537  N N    . PRO A 1 99  ? 9.679   7.972   -1.372  1.00 0.00 ? 196 PRO A N    2  
ATOM 3538  C CA   . PRO A 1 99  ? 8.386   8.597   -1.649  1.00 0.00 ? 196 PRO A CA   2  
ATOM 3539  C C    . PRO A 1 99  ? 7.281   8.174   -0.679  1.00 0.00 ? 196 PRO A C    2  
ATOM 3540  O O    . PRO A 1 99  ? 6.587   7.181   -0.910  1.00 0.00 ? 196 PRO A O    2  
ATOM 3541  C CB   . PRO A 1 99  ? 8.062   8.102   -3.069  1.00 0.00 ? 196 PRO A CB   2  
ATOM 3542  C CG   . PRO A 1 99  ? 9.035   6.994   -3.369  1.00 0.00 ? 196 PRO A CG   2  
ATOM 3543  C CD   . PRO A 1 99  ? 9.784   6.704   -2.096  1.00 0.00 ? 196 PRO A CD   2  
ATOM 3544  H HA   . PRO A 1 99  ? 8.463   9.672   -1.654  1.00 0.00 ? 196 PRO A HA   2  
ATOM 3545  H HB2  . PRO A 1 99  ? 7.044   7.743   -3.098  1.00 0.00 ? 196 PRO A HB2  2  
ATOM 3546  H HB3  . PRO A 1 99  ? 8.174   8.919   -3.767  1.00 0.00 ? 196 PRO A HB3  2  
ATOM 3547  H HG2  . PRO A 1 99  ? 8.497   6.115   -3.691  1.00 0.00 ? 196 PRO A HG2  2  
ATOM 3548  H HG3  . PRO A 1 99  ? 9.722   7.313   -4.141  1.00 0.00 ? 196 PRO A HG3  2  
ATOM 3549  H HD2  . PRO A 1 99  ? 9.306   5.905   -1.549  1.00 0.00 ? 196 PRO A HD2  2  
ATOM 3550  H HD3  . PRO A 1 99  ? 10.812  6.459   -2.305  1.00 0.00 ? 196 PRO A HD3  2  
ATOM 3551  N N    . ALA A 1 100 ? 7.108   8.936   0.397   1.00 0.00 ? 197 ALA A N    2  
ATOM 3552  C CA   . ALA A 1 100 ? 6.070   8.647   1.380   1.00 0.00 ? 197 ALA A CA   2  
ATOM 3553  C C    . ALA A 1 100 ? 4.710   9.134   0.897   1.00 0.00 ? 197 ALA A C    2  
ATOM 3554  O O    . ALA A 1 100 ? 4.501   10.328  0.691   1.00 0.00 ? 197 ALA A O    2  
ATOM 3555  C CB   . ALA A 1 100 ? 6.409   9.265   2.726   1.00 0.00 ? 197 ALA A CB   2  
ATOM 3556  H H    . ALA A 1 100 ? 7.687   9.719   0.528   1.00 0.00 ? 197 ALA A H    2  
ATOM 3557  H HA   . ALA A 1 100 ? 6.024   7.580   1.510   1.00 0.00 ? 197 ALA A HA   2  
ATOM 3558  H HB1  . ALA A 1 100 ? 5.624   9.033   3.432   1.00 0.00 ? 197 ALA A HB1  2  
ATOM 3559  H HB2  . ALA A 1 100 ? 6.494   10.336  2.622   1.00 0.00 ? 197 ALA A HB2  2  
ATOM 3560  H HB3  . ALA A 1 100 ? 7.345   8.859   3.084   1.00 0.00 ? 197 ALA A HB3  2  
ATOM 3561  N N    . THR A 1 101 ? 3.799   8.197   0.702   1.00 0.00 ? 198 THR A N    2  
ATOM 3562  C CA   . THR A 1 101 ? 2.443   8.517   0.287   1.00 0.00 ? 198 THR A CA   2  
ATOM 3563  C C    . THR A 1 101 ? 1.474   8.259   1.440   1.00 0.00 ? 198 THR A C    2  
ATOM 3564  O O    . THR A 1 101 ? 1.633   7.290   2.185   1.00 0.00 ? 198 THR A O    2  
ATOM 3565  C CB   . THR A 1 101 ? 2.043   7.678   -0.941  1.00 0.00 ? 198 THR A CB   2  
ATOM 3566  O OG1  . THR A 1 101 ? 3.044   7.811   -1.958  1.00 0.00 ? 198 THR A OG1  2  
ATOM 3567  C CG2  . THR A 1 101 ? 0.694   8.112   -1.492  1.00 0.00 ? 198 THR A CG2  2  
ATOM 3568  H H    . THR A 1 101 ? 4.041   7.254   0.844   1.00 0.00 ? 198 THR A H    2  
ATOM 3569  H HA   . THR A 1 101 ? 2.408   9.563   0.019   1.00 0.00 ? 198 THR A HA   2  
ATOM 3570  H HB   . THR A 1 101 ? 1.978   6.641   -0.644  1.00 0.00 ? 198 THR A HB   2  
ATOM 3571  H HG1  . THR A 1 101 ? 3.908   7.606   -1.581  1.00 0.00 ? 198 THR A HG1  2  
ATOM 3572  H HG21 . THR A 1 101 ? 0.752   9.139   -1.818  1.00 0.00 ? 198 THR A HG21 2  
ATOM 3573  H HG22 . THR A 1 101 ? -0.056  8.021   -0.720  1.00 0.00 ? 198 THR A HG22 2  
ATOM 3574  H HG23 . THR A 1 101 ? 0.427   7.483   -2.329  1.00 0.00 ? 198 THR A HG23 2  
ATOM 3575  N N    . PHE A 1 102 ? 0.489   9.130   1.596   1.00 0.00 ? 199 PHE A N    2  
ATOM 3576  C CA   . PHE A 1 102 ? -0.448  9.033   2.707   1.00 0.00 ? 199 PHE A CA   2  
ATOM 3577  C C    . PHE A 1 102 ? -1.860  8.756   2.200   1.00 0.00 ? 199 PHE A C    2  
ATOM 3578  O O    . PHE A 1 102 ? -2.362  9.466   1.329   1.00 0.00 ? 199 PHE A O    2  
ATOM 3579  C CB   . PHE A 1 102 ? -0.429  10.330  3.519   1.00 0.00 ? 199 PHE A CB   2  
ATOM 3580  C CG   . PHE A 1 102 ? 0.922   10.673  4.088   1.00 0.00 ? 199 PHE A CG   2  
ATOM 3581  C CD1  . PHE A 1 102 ? 1.869   11.331  3.318   1.00 0.00 ? 199 PHE A CD1  2  
ATOM 3582  C CD2  . PHE A 1 102 ? 1.242   10.342  5.393   1.00 0.00 ? 199 PHE A CD2  2  
ATOM 3583  C CE1  . PHE A 1 102 ? 3.107   11.650  3.841   1.00 0.00 ? 199 PHE A CE1  2  
ATOM 3584  C CE2  . PHE A 1 102 ? 2.478   10.659  5.920   1.00 0.00 ? 199 PHE A CE2  2  
ATOM 3585  C CZ   . PHE A 1 102 ? 3.412   11.314  5.143   1.00 0.00 ? 199 PHE A CZ   2  
ATOM 3586  H H    . PHE A 1 102 ? 0.385   9.858   0.944   1.00 0.00 ? 199 PHE A H    2  
ATOM 3587  H HA   . PHE A 1 102 ? -0.136  8.216   3.339   1.00 0.00 ? 199 PHE A HA   2  
ATOM 3588  H HB2  . PHE A 1 102 ? -0.737  11.147  2.886   1.00 0.00 ? 199 PHE A HB2  2  
ATOM 3589  H HB3  . PHE A 1 102 ? -1.123  10.240  4.341   1.00 0.00 ? 199 PHE A HB3  2  
ATOM 3590  H HD1  . PHE A 1 102 ? 1.633   11.593  2.298   1.00 0.00 ? 199 PHE A HD1  2  
ATOM 3591  H HD2  . PHE A 1 102 ? 0.516   9.828   6.003   1.00 0.00 ? 199 PHE A HD2  2  
ATOM 3592  H HE1  . PHE A 1 102 ? 3.835   12.162  3.230   1.00 0.00 ? 199 PHE A HE1  2  
ATOM 3593  H HE2  . PHE A 1 102 ? 2.712   10.394  6.940   1.00 0.00 ? 199 PHE A HE2  2  
ATOM 3594  H HZ   . PHE A 1 102 ? 4.379   11.562  5.554   1.00 0.00 ? 199 PHE A HZ   2  
ATOM 3595  N N    . ILE A 1 103 ? -2.496  7.727   2.740   1.00 0.00 ? 200 ILE A N    2  
ATOM 3596  C CA   . ILE A 1 103 ? -3.840  7.355   2.318   1.00 0.00 ? 200 ILE A CA   2  
ATOM 3597  C C    . ILE A 1 103 ? -4.796  7.292   3.512   1.00 0.00 ? 200 ILE A C    2  
ATOM 3598  O O    . ILE A 1 103 ? -4.450  6.775   4.577   1.00 0.00 ? 200 ILE A O    2  
ATOM 3599  C CB   . ILE A 1 103 ? -3.834  5.996   1.566   1.00 0.00 ? 200 ILE A CB   2  
ATOM 3600  C CG1  . ILE A 1 103 ? -5.250  5.594   1.134   1.00 0.00 ? 200 ILE A CG1  2  
ATOM 3601  C CG2  . ILE A 1 103 ? -3.212  4.901   2.422   1.00 0.00 ? 200 ILE A CG2  2  
ATOM 3602  C CD1  . ILE A 1 103 ? -5.862  6.523   0.108   1.00 0.00 ? 200 ILE A CD1  2  
ATOM 3603  H H    . ILE A 1 103 ? -2.051  7.199   3.443   1.00 0.00 ? 200 ILE A H    2  
ATOM 3604  H HA   . ILE A 1 103 ? -4.192  8.115   1.634   1.00 0.00 ? 200 ILE A HA   2  
ATOM 3605  H HB   . ILE A 1 103 ? -3.221  6.110   0.684   1.00 0.00 ? 200 ILE A HB   2  
ATOM 3606  H HG12 . ILE A 1 103 ? -5.221  4.604   0.705   1.00 0.00 ? 200 ILE A HG12 2  
ATOM 3607  H HG13 . ILE A 1 103 ? -5.894  5.587   2.001   1.00 0.00 ? 200 ILE A HG13 2  
ATOM 3608  H HG21 . ILE A 1 103 ? -2.193  5.167   2.664   1.00 0.00 ? 200 ILE A HG21 2  
ATOM 3609  H HG22 . ILE A 1 103 ? -3.220  3.968   1.877   1.00 0.00 ? 200 ILE A HG22 2  
ATOM 3610  H HG23 . ILE A 1 103 ? -3.782  4.790   3.333   1.00 0.00 ? 200 ILE A HG23 2  
ATOM 3611  H HD11 . ILE A 1 103 ? -5.944  7.515   0.526   1.00 0.00 ? 200 ILE A HD11 2  
ATOM 3612  H HD12 . ILE A 1 103 ? -6.844  6.164   -0.162  1.00 0.00 ? 200 ILE A HD12 2  
ATOM 3613  H HD13 . ILE A 1 103 ? -5.235  6.552   -0.769  1.00 0.00 ? 200 ILE A HD13 2  
ATOM 3614  N N    . GLN A 1 104 ? -5.985  7.856   3.335   1.00 0.00 ? 201 GLN A N    2  
ATOM 3615  C CA   . GLN A 1 104 ? -7.024  7.798   4.356   1.00 0.00 ? 201 GLN A CA   2  
ATOM 3616  C C    . GLN A 1 104 ? -7.991  6.659   4.065   1.00 0.00 ? 201 GLN A C    2  
ATOM 3617  O O    . GLN A 1 104 ? -8.645  6.645   3.021   1.00 0.00 ? 201 GLN A O    2  
ATOM 3618  C CB   . GLN A 1 104 ? -7.805  9.115   4.412   1.00 0.00 ? 201 GLN A CB   2  
ATOM 3619  C CG   . GLN A 1 104 ? -7.005  10.299  4.923   1.00 0.00 ? 201 GLN A CG   2  
ATOM 3620  C CD   . GLN A 1 104 ? -6.583  10.162  6.376   1.00 0.00 ? 201 GLN A CD   2  
ATOM 3621  O OE1  . GLN A 1 104 ? -5.547  10.686  6.776   1.00 0.00 ? 201 GLN A OE1  2  
ATOM 3622  N NE2  . GLN A 1 104 ? -7.384  9.471   7.179   1.00 0.00 ? 201 GLN A NE2  2  
ATOM 3623  H H    . GLN A 1 104 ? -6.171  8.326   2.493   1.00 0.00 ? 201 GLN A H    2  
ATOM 3624  H HA   . GLN A 1 104 ? -6.549  7.624   5.309   1.00 0.00 ? 201 GLN A HA   2  
ATOM 3625  H HB2  . GLN A 1 104 ? -8.152  9.352   3.417   1.00 0.00 ? 201 GLN A HB2  2  
ATOM 3626  H HB3  . GLN A 1 104 ? -8.662  8.982   5.055   1.00 0.00 ? 201 GLN A HB3  2  
ATOM 3627  H HG2  . GLN A 1 104 ? -6.116  10.401  4.319   1.00 0.00 ? 201 GLN A HG2  2  
ATOM 3628  H HG3  . GLN A 1 104 ? -7.608  11.190  4.823   1.00 0.00 ? 201 GLN A HG3  2  
ATOM 3629  H HE21 . GLN A 1 104 ? -8.206  9.087   6.806   1.00 0.00 ? 201 GLN A HE21 2  
ATOM 3630  H HE22 . GLN A 1 104 ? -7.122  9.372   8.122   1.00 0.00 ? 201 GLN A HE22 2  
ATOM 3631  N N    . ILE A 1 105 ? -8.079  5.709   4.981   1.00 0.00 ? 202 ILE A N    2  
ATOM 3632  C CA   . ILE A 1 105 ? -9.049  4.633   4.860   1.00 0.00 ? 202 ILE A CA   2  
ATOM 3633  C C    . ILE A 1 105 ? -10.390 5.100   5.413   1.00 0.00 ? 202 ILE A C    2  
ATOM 3634  O O    . ILE A 1 105 ? -10.485 5.474   6.581   1.00 0.00 ? 202 ILE A O    2  
ATOM 3635  C CB   . ILE A 1 105 ? -8.595  3.362   5.614   1.00 0.00 ? 202 ILE A CB   2  
ATOM 3636  C CG1  . ILE A 1 105 ? -7.229  2.899   5.103   1.00 0.00 ? 202 ILE A CG1  2  
ATOM 3637  C CG2  . ILE A 1 105 ? -9.623  2.244   5.464   1.00 0.00 ? 202 ILE A CG2  2  
ATOM 3638  C CD1  . ILE A 1 105 ? -7.208  2.581   3.625   1.00 0.00 ? 202 ILE A CD1  2  
ATOM 3639  H H    . ILE A 1 105 ? -7.479  5.730   5.762   1.00 0.00 ? 202 ILE A H    2  
ATOM 3640  H HA   . ILE A 1 105 ? -9.160  4.396   3.813   1.00 0.00 ? 202 ILE A HA   2  
ATOM 3641  H HB   . ILE A 1 105 ? -8.514  3.603   6.663   1.00 0.00 ? 202 ILE A HB   2  
ATOM 3642  H HG12 . ILE A 1 105 ? -6.503  3.676   5.283   1.00 0.00 ? 202 ILE A HG12 2  
ATOM 3643  H HG13 . ILE A 1 105 ? -6.936  2.007   5.639   1.00 0.00 ? 202 ILE A HG13 2  
ATOM 3644  H HG21 . ILE A 1 105 ? -9.700  1.960   4.424   1.00 0.00 ? 202 ILE A HG21 2  
ATOM 3645  H HG22 . ILE A 1 105 ? -10.585 2.590   5.814   1.00 0.00 ? 202 ILE A HG22 2  
ATOM 3646  H HG23 . ILE A 1 105 ? -9.313  1.389   6.048   1.00 0.00 ? 202 ILE A HG23 2  
ATOM 3647  H HD11 . ILE A 1 105 ? -6.237  2.200   3.355   1.00 0.00 ? 202 ILE A HD11 2  
ATOM 3648  H HD12 . ILE A 1 105 ? -7.413  3.479   3.062   1.00 0.00 ? 202 ILE A HD12 2  
ATOM 3649  H HD13 . ILE A 1 105 ? -7.961  1.839   3.407   1.00 0.00 ? 202 ILE A HD13 2  
ATOM 3650  N N    . PRO A 1 106 ? -11.438 5.107   4.577   1.00 0.00 ? 203 PRO A N    2  
ATOM 3651  C CA   . PRO A 1 106 ? -12.766 5.577   4.981   1.00 0.00 ? 203 PRO A CA   2  
ATOM 3652  C C    . PRO A 1 106 ? -13.371 4.718   6.087   1.00 0.00 ? 203 PRO A C    2  
ATOM 3653  O O    . PRO A 1 106 ? -13.081 3.527   6.198   1.00 0.00 ? 203 PRO A O    2  
ATOM 3654  C CB   . PRO A 1 106 ? -13.598 5.459   3.699   1.00 0.00 ? 203 PRO A CB   2  
ATOM 3655  C CG   . PRO A 1 106 ? -12.870 4.473   2.852   1.00 0.00 ? 203 PRO A CG   2  
ATOM 3656  C CD   . PRO A 1 106 ? -11.415 4.650   3.176   1.00 0.00 ? 203 PRO A CD   2  
ATOM 3657  H HA   . PRO A 1 106 ? -12.738 6.607   5.302   1.00 0.00 ? 203 PRO A HA   2  
ATOM 3658  H HB2  . PRO A 1 106 ? -14.591 5.110   3.944   1.00 0.00 ? 203 PRO A HB2  2  
ATOM 3659  H HB3  . PRO A 1 106 ? -13.658 6.423   3.217   1.00 0.00 ? 203 PRO A HB3  2  
ATOM 3660  H HG2  . PRO A 1 106 ? -13.191 3.471   3.096   1.00 0.00 ? 203 PRO A HG2  2  
ATOM 3661  H HG3  . PRO A 1 106 ? -13.051 4.682   1.808   1.00 0.00 ? 203 PRO A HG3  2  
ATOM 3662  H HD2  . PRO A 1 106 ? -10.891 3.711   3.082   1.00 0.00 ? 203 PRO A HD2  2  
ATOM 3663  H HD3  . PRO A 1 106 ? -10.973 5.398   2.534   1.00 0.00 ? 203 PRO A HD3  2  
ATOM 3664  N N    . SER A 1 107 ? -14.215 5.337   6.908   1.00 0.00 ? 204 SER A N    2  
ATOM 3665  C CA   . SER A 1 107 ? -14.886 4.639   7.995   1.00 0.00 ? 204 SER A CA   2  
ATOM 3666  C C    . SER A 1 107 ? -15.920 3.673   7.435   1.00 0.00 ? 204 SER A C    2  
ATOM 3667  O O    . SER A 1 107 ? -16.323 2.720   8.096   1.00 0.00 ? 204 SER A O    2  
ATOM 3668  C CB   . SER A 1 107 ? -15.553 5.646   8.932   1.00 0.00 ? 204 SER A CB   2  
ATOM 3669  O OG   . SER A 1 107 ? -14.620 6.621   9.373   1.00 0.00 ? 204 SER A OG   2  
ATOM 3670  H H    . SER A 1 107 ? -14.398 6.292   6.773   1.00 0.00 ? 204 SER A H    2  
ATOM 3671  H HA   . SER A 1 107 ? -14.143 4.079   8.544   1.00 0.00 ? 204 SER A HA   2  
ATOM 3672  H HB2  . SER A 1 107 ? -16.357 6.143   8.409   1.00 0.00 ? 204 SER A HB2  2  
ATOM 3673  H HB3  . SER A 1 107 ? -15.948 5.128   9.792   1.00 0.00 ? 204 SER A HB3  2  
ATOM 3674  H HG   . SER A 1 107 ? -14.302 6.380   10.256  1.00 0.00 ? 204 SER A HG   2  
ATOM 3675  N N    . ASP A 1 108 ? -16.325 3.924   6.196   1.00 0.00 ? 205 ASP A N    2  
ATOM 3676  C CA   . ASP A 1 108 ? -17.249 3.045   5.491   1.00 0.00 ? 205 ASP A CA   2  
ATOM 3677  C C    . ASP A 1 108 ? -16.468 1.952   4.761   1.00 0.00 ? 205 ASP A C    2  
ATOM 3678  O O    . ASP A 1 108 ? -16.898 1.426   3.739   1.00 0.00 ? 205 ASP A O    2  
ATOM 3679  C CB   . ASP A 1 108 ? -18.099 3.861   4.506   1.00 0.00 ? 205 ASP A CB   2  
ATOM 3680  C CG   . ASP A 1 108 ? -19.203 3.052   3.848   1.00 0.00 ? 205 ASP A CG   2  
ATOM 3681  O OD1  . ASP A 1 108 ? -20.014 2.434   4.574   1.00 0.00 ? 205 ASP A OD1  2  
ATOM 3682  O OD2  . ASP A 1 108 ? -19.265 3.031   2.598   1.00 0.00 ? 205 ASP A OD2  2  
ATOM 3683  H H    . ASP A 1 108 ? -15.999 4.730   5.746   1.00 0.00 ? 205 ASP A H    2  
ATOM 3684  H HA   . ASP A 1 108 ? -17.896 2.584   6.222   1.00 0.00 ? 205 ASP A HA   2  
ATOM 3685  H HB2  . ASP A 1 108 ? -18.555 4.684   5.034   1.00 0.00 ? 205 ASP A HB2  2  
ATOM 3686  H HB3  . ASP A 1 108 ? -17.457 4.251   3.731   1.00 0.00 ? 205 ASP A HB3  2  
ATOM 3687  N N    . PHE A 1 109 ? -15.291 1.635   5.289   1.00 0.00 ? 206 PHE A N    2  
ATOM 3688  C CA   . PHE A 1 109 ? -14.474 0.558   4.752   1.00 0.00 ? 206 PHE A CA   2  
ATOM 3689  C C    . PHE A 1 109 ? -15.178 -0.772  4.965   1.00 0.00 ? 206 PHE A C    2  
ATOM 3690  O O    . PHE A 1 109 ? -15.237 -1.611  4.068   1.00 0.00 ? 206 PHE A O    2  
ATOM 3691  C CB   . PHE A 1 109 ? -13.106 0.546   5.440   1.00 0.00 ? 206 PHE A CB   2  
ATOM 3692  C CG   . PHE A 1 109 ? -12.175 -0.522  4.941   1.00 0.00 ? 206 PHE A CG   2  
ATOM 3693  C CD1  . PHE A 1 109 ? -11.452 -0.331  3.778   1.00 0.00 ? 206 PHE A CD1  2  
ATOM 3694  C CD2  . PHE A 1 109 ? -12.015 -1.708  5.639   1.00 0.00 ? 206 PHE A CD2  2  
ATOM 3695  C CE1  . PHE A 1 109 ? -10.588 -1.303  3.317   1.00 0.00 ? 206 PHE A CE1  2  
ATOM 3696  C CE2  . PHE A 1 109 ? -11.152 -2.684  5.183   1.00 0.00 ? 206 PHE A CE2  2  
ATOM 3697  C CZ   . PHE A 1 109 ? -10.438 -2.481  4.021   1.00 0.00 ? 206 PHE A CZ   2  
ATOM 3698  H H    . PHE A 1 109 ? -14.967 2.138   6.065   1.00 0.00 ? 206 PHE A H    2  
ATOM 3699  H HA   . PHE A 1 109 ? -14.342 0.726   3.694   1.00 0.00 ? 206 PHE A HA   2  
ATOM 3700  H HB2  . PHE A 1 109 ? -12.628 1.500   5.283   1.00 0.00 ? 206 PHE A HB2  2  
ATOM 3701  H HB3  . PHE A 1 109 ? -13.250 0.392   6.498   1.00 0.00 ? 206 PHE A HB3  2  
ATOM 3702  H HD1  . PHE A 1 109 ? -11.569 0.589   3.226   1.00 0.00 ? 206 PHE A HD1  2  
ATOM 3703  H HD2  . PHE A 1 109 ? -12.574 -1.867  6.550   1.00 0.00 ? 206 PHE A HD2  2  
ATOM 3704  H HE1  . PHE A 1 109 ? -10.028 -1.139  2.410   1.00 0.00 ? 206 PHE A HE1  2  
ATOM 3705  H HE2  . PHE A 1 109 ? -11.038 -3.605  5.737   1.00 0.00 ? 206 PHE A HE2  2  
ATOM 3706  H HZ   . PHE A 1 109 ? -9.763  -3.243  3.661   1.00 0.00 ? 206 PHE A HZ   2  
ATOM 3707  N N    . THR A 1 110 ? -15.719 -0.944  6.156   1.00 0.00 ? 207 THR A N    2  
ATOM 3708  C CA   . THR A 1 110 ? -16.448 -2.145  6.499   1.00 0.00 ? 207 THR A CA   2  
ATOM 3709  C C    . THR A 1 110 ? -17.922 -1.817  6.704   1.00 0.00 ? 207 THR A C    2  
ATOM 3710  O O    . THR A 1 110 ? -18.264 -0.759  7.238   1.00 0.00 ? 207 THR A O    2  
ATOM 3711  C CB   . THR A 1 110 ? -15.876 -2.783  7.781   1.00 0.00 ? 207 THR A CB   2  
ATOM 3712  O OG1  . THR A 1 110 ? -14.459 -2.962  7.641   1.00 0.00 ? 207 THR A OG1  2  
ATOM 3713  C CG2  . THR A 1 110 ? -16.531 -4.127  8.071   1.00 0.00 ? 207 THR A CG2  2  
ATOM 3714  H H    . THR A 1 110 ? -15.634 -0.235  6.826   1.00 0.00 ? 207 THR A H    2  
ATOM 3715  H HA   . THR A 1 110 ? -16.347 -2.850  5.687   1.00 0.00 ? 207 THR A HA   2  
ATOM 3716  H HB   . THR A 1 110 ? -16.067 -2.118  8.609   1.00 0.00 ? 207 THR A HB   2  
ATOM 3717  H HG1  . THR A 1 110 ? -14.274 -3.422  6.810   1.00 0.00 ? 207 THR A HG1  2  
ATOM 3718  H HG21 . THR A 1 110 ? -16.117 -4.540  8.980   1.00 0.00 ? 207 THR A HG21 2  
ATOM 3719  H HG22 . THR A 1 110 ? -16.345 -4.802  7.251   1.00 0.00 ? 207 THR A HG22 2  
ATOM 3720  H HG23 . THR A 1 110 ? -17.595 -3.991  8.191   1.00 0.00 ? 207 THR A HG23 2  
ATOM 3721  N N    . MET A 1 111 ? -18.784 -2.714  6.251   1.00 0.00 ? 208 MET A N    2  
ATOM 3722  C CA   . MET A 1 111 ? -20.218 -2.554  6.425   1.00 0.00 ? 208 MET A CA   2  
ATOM 3723  C C    . MET A 1 111 ? -20.601 -2.786  7.884   1.00 0.00 ? 208 MET A C    2  
ATOM 3724  O O    . MET A 1 111 ? -20.323 -3.843  8.454   1.00 0.00 ? 208 MET A O    2  
ATOM 3725  C CB   . MET A 1 111 ? -20.977 -3.514  5.498   1.00 0.00 ? 208 MET A CB   2  
ATOM 3726  C CG   . MET A 1 111 ? -20.593 -4.979  5.670   1.00 0.00 ? 208 MET A CG   2  
ATOM 3727  S SD   . MET A 1 111 ? -21.307 -6.044  4.403   1.00 0.00 ? 208 MET A SD   2  
ATOM 3728  C CE   . MET A 1 111 ? -23.055 -5.815  4.718   1.00 0.00 ? 208 MET A CE   2  
ATOM 3729  H H    . MET A 1 111 ? -18.443 -3.506  5.787   1.00 0.00 ? 208 MET A H    2  
ATOM 3730  H HA   . MET A 1 111 ? -20.470 -1.537  6.159   1.00 0.00 ? 208 MET A HA   2  
ATOM 3731  H HB2  . MET A 1 111 ? -22.035 -3.418  5.691   1.00 0.00 ? 208 MET A HB2  2  
ATOM 3732  H HB3  . MET A 1 111 ? -20.781 -3.232  4.473   1.00 0.00 ? 208 MET A HB3  2  
ATOM 3733  H HG2  . MET A 1 111 ? -19.518 -5.063  5.625   1.00 0.00 ? 208 MET A HG2  2  
ATOM 3734  H HG3  . MET A 1 111 ? -20.936 -5.313  6.637   1.00 0.00 ? 208 MET A HG3  2  
ATOM 3735  H HE1  . MET A 1 111 ? -23.311 -4.774  4.585   1.00 0.00 ? 208 MET A HE1  2  
ATOM 3736  H HE2  . MET A 1 111 ? -23.280 -6.115  5.730   1.00 0.00 ? 208 MET A HE2  2  
ATOM 3737  H HE3  . MET A 1 111 ? -23.627 -6.417  4.028   1.00 0.00 ? 208 MET A HE3  2  
ATOM 3738  N N    . ASN A 1 112 ? -21.222 -1.786  8.491   1.00 0.00 ? 209 ASN A N    2  
ATOM 3739  C CA   . ASN A 1 112 ? -21.597 -1.860  9.898   1.00 0.00 ? 209 ASN A CA   2  
ATOM 3740  C C    . ASN A 1 112 ? -23.076 -2.181  10.051  1.00 0.00 ? 209 ASN A C    2  
ATOM 3741  O O    . ASN A 1 112 ? -23.821 -1.418  10.666  1.00 0.00 ? 209 ASN A O    2  
ATOM 3742  C CB   . ASN A 1 112 ? -21.278 -0.546  10.622  1.00 0.00 ? 209 ASN A CB   2  
ATOM 3743  C CG   . ASN A 1 112 ? -19.798 -0.350  10.889  1.00 0.00 ? 209 ASN A CG   2  
ATOM 3744  O OD1  . ASN A 1 112 ? -18.942 -0.807  10.131  1.00 0.00 ? 209 ASN A OD1  2  
ATOM 3745  N ND2  . ASN A 1 112 ? -19.485 0.332   11.978  1.00 0.00 ? 209 ASN A ND2  2  
ATOM 3746  H H    . ASN A 1 112 ? -21.441 -0.978  7.980   1.00 0.00 ? 209 ASN A H    2  
ATOM 3747  H HA   . ASN A 1 112 ? -21.022 -2.655  10.351  1.00 0.00 ? 209 ASN A HA   2  
ATOM 3748  H HB2  . ASN A 1 112 ? -21.624 0.279   10.017  1.00 0.00 ? 209 ASN A HB2  2  
ATOM 3749  H HB3  . ASN A 1 112 ? -21.799 -0.534  11.567  1.00 0.00 ? 209 ASN A HB3  2  
ATOM 3750  H HD21 . ASN A 1 112 ? -20.217 0.664   12.542  1.00 0.00 ? 209 ASN A HD21 2  
ATOM 3751  H HD22 . ASN A 1 112 ? -18.537 0.481   12.176  1.00 0.00 ? 209 ASN A HD22 2  
ATOM 3752  N N    . ASP A 1 113 ? -23.485 -3.306  9.474   1.00 0.00 ? 210 ASP A N    2  
ATOM 3753  C CA   . ASP A 1 113 ? -24.864 -3.791  9.572   1.00 0.00 ? 210 ASP A CA   2  
ATOM 3754  C C    . ASP A 1 113 ? -25.846 -2.760  9.020   1.00 0.00 ? 210 ASP A C    2  
ATOM 3755  O O    . ASP A 1 113 ? -26.481 -2.039  9.813   1.00 0.00 ? 210 ASP A O    2  
ATOM 3756  C CB   . ASP A 1 113 ? -25.207 -4.139  11.024  1.00 0.00 ? 210 ASP A CB   2  
ATOM 3757  C CG   . ASP A 1 113 ? -26.484 -4.944  11.146  1.00 0.00 ? 210 ASP A CG   2  
ATOM 3758  O OD1  . ASP A 1 113 ? -26.490 -6.117  10.721  1.00 0.00 ? 210 ASP A OD1  2  
ATOM 3759  O OD2  . ASP A 1 113 ? -27.482 -4.420  11.684  1.00 0.00 ? 210 ASP A OD2  2  
ATOM 3760  O OXT  . ASP A 1 113 ? -25.956 -2.652  7.782   1.00 0.00 ? 210 ASP A OXT  2  
ATOM 3761  H H    . ASP A 1 113 ? -22.840 -3.831  8.958   1.00 0.00 ? 210 ASP A H    2  
ATOM 3762  H HA   . ASP A 1 113 ? -24.937 -4.687  8.973   1.00 0.00 ? 210 ASP A HA   2  
ATOM 3763  H HB2  . ASP A 1 113 ? -24.400 -4.715  11.449  1.00 0.00 ? 210 ASP A HB2  2  
ATOM 3764  H HB3  . ASP A 1 113 ? -25.324 -3.224  11.588  1.00 0.00 ? 210 ASP A HB3  2  
ATOM 3765  N N    . MET A 1 1   ? 30.771  6.847   -10.208 1.00 0.00 ? 98  MET A N    3  
ATOM 3766  C CA   . MET A 1 1   ? 31.505  6.255   -9.065  1.00 0.00 ? 98  MET A CA   3  
ATOM 3767  C C    . MET A 1 1   ? 30.540  5.794   -7.979  1.00 0.00 ? 98  MET A C    3  
ATOM 3768  O O    . MET A 1 1   ? 30.921  5.051   -7.073  1.00 0.00 ? 98  MET A O    3  
ATOM 3769  C CB   . MET A 1 1   ? 32.497  7.268   -8.481  1.00 0.00 ? 98  MET A CB   3  
ATOM 3770  C CG   . MET A 1 1   ? 31.836  8.467   -7.816  1.00 0.00 ? 98  MET A CG   3  
ATOM 3771  S SD   . MET A 1 1   ? 33.029  9.672   -7.206  1.00 0.00 ? 98  MET A SD   3  
ATOM 3772  C CE   . MET A 1 1   ? 31.929  10.907  -6.521  1.00 0.00 ? 98  MET A CE   3  
ATOM 3773  H H1   . MET A 1 1   ? 30.103  6.155   -10.602 1.00 0.00 ? 98  MET A H1   3  
ATOM 3774  H H2   . MET A 1 1   ? 31.438  7.129   -10.954 1.00 0.00 ? 98  MET A H2   3  
ATOM 3775  H H3   . MET A 1 1   ? 30.243  7.688   -9.902  1.00 0.00 ? 98  MET A H3   3  
ATOM 3776  H HA   . MET A 1 1   ? 32.051  5.398   -9.428  1.00 0.00 ? 98  MET A HA   3  
ATOM 3777  H HB2  . MET A 1 1   ? 33.111  6.769   -7.746  1.00 0.00 ? 98  MET A HB2  3  
ATOM 3778  H HB3  . MET A 1 1   ? 33.131  7.632   -9.278  1.00 0.00 ? 98  MET A HB3  3  
ATOM 3779  H HG2  . MET A 1 1   ? 31.192  8.952   -8.534  1.00 0.00 ? 98  MET A HG2  3  
ATOM 3780  H HG3  . MET A 1 1   ? 31.243  8.116   -6.984  1.00 0.00 ? 98  MET A HG3  3  
ATOM 3781  H HE1  . MET A 1 1   ? 32.511  11.715  -6.101  1.00 0.00 ? 98  MET A HE1  3  
ATOM 3782  H HE2  . MET A 1 1   ? 31.323  10.460  -5.748  1.00 0.00 ? 98  MET A HE2  3  
ATOM 3783  H HE3  . MET A 1 1   ? 31.290  11.292  -7.301  1.00 0.00 ? 98  MET A HE3  3  
ATOM 3784  N N    . TYR A 1 2   ? 29.292  6.238   -8.067  1.00 0.00 ? 99  TYR A N    3  
ATOM 3785  C CA   . TYR A 1 2   ? 28.278  5.864   -7.096  1.00 0.00 ? 99  TYR A CA   3  
ATOM 3786  C C    . TYR A 1 2   ? 27.099  5.190   -7.782  1.00 0.00 ? 99  TYR A C    3  
ATOM 3787  O O    . TYR A 1 2   ? 26.651  5.610   -8.853  1.00 0.00 ? 99  TYR A O    3  
ATOM 3788  C CB   . TYR A 1 2   ? 27.812  7.095   -6.304  1.00 0.00 ? 99  TYR A CB   3  
ATOM 3789  C CG   . TYR A 1 2   ? 26.545  6.868   -5.503  1.00 0.00 ? 99  TYR A CG   3  
ATOM 3790  C CD1  . TYR A 1 2   ? 26.457  5.838   -4.574  1.00 0.00 ? 99  TYR A CD1  3  
ATOM 3791  C CD2  . TYR A 1 2   ? 25.431  7.673   -5.695  1.00 0.00 ? 99  TYR A CD2  3  
ATOM 3792  C CE1  . TYR A 1 2   ? 25.295  5.619   -3.861  1.00 0.00 ? 99  TYR A CE1  3  
ATOM 3793  C CE2  . TYR A 1 2   ? 24.266  7.463   -4.984  1.00 0.00 ? 99  TYR A CE2  3  
ATOM 3794  C CZ   . TYR A 1 2   ? 24.201  6.435   -4.069  1.00 0.00 ? 99  TYR A CZ   3  
ATOM 3795  O OH   . TYR A 1 2   ? 23.040  6.226   -3.355  1.00 0.00 ? 99  TYR A OH   3  
ATOM 3796  H H    . TYR A 1 2   ? 29.040  6.828   -8.809  1.00 0.00 ? 99  TYR A H    3  
ATOM 3797  H HA   . TYR A 1 2   ? 28.724  5.156   -6.413  1.00 0.00 ? 99  TYR A HA   3  
ATOM 3798  H HB2  . TYR A 1 2   ? 28.591  7.385   -5.614  1.00 0.00 ? 99  TYR A HB2  3  
ATOM 3799  H HB3  . TYR A 1 2   ? 27.629  7.908   -6.991  1.00 0.00 ? 99  TYR A HB3  3  
ATOM 3800  H HD1  . TYR A 1 2   ? 27.315  5.204   -4.411  1.00 0.00 ? 99  TYR A HD1  3  
ATOM 3801  H HD2  . TYR A 1 2   ? 25.483  8.477   -6.413  1.00 0.00 ? 99  TYR A HD2  3  
ATOM 3802  H HE1  . TYR A 1 2   ? 25.243  4.805   -3.155  1.00 0.00 ? 99  TYR A HE1  3  
ATOM 3803  H HE2  . TYR A 1 2   ? 23.407  8.097   -5.155  1.00 0.00 ? 99  TYR A HE2  3  
ATOM 3804  H HH   . TYR A 1 2   ? 22.277  6.374   -3.933  1.00 0.00 ? 99  TYR A HH   3  
ATOM 3805  N N    . ILE A 1 3   ? 26.624  4.130   -7.155  1.00 0.00 ? 100 ILE A N    3  
ATOM 3806  C CA   . ILE A 1 3   ? 25.490  3.374   -7.642  1.00 0.00 ? 100 ILE A CA   3  
ATOM 3807  C C    . ILE A 1 3   ? 24.178  4.048   -7.254  1.00 0.00 ? 100 ILE A C    3  
ATOM 3808  O O    . ILE A 1 3   ? 23.812  4.091   -6.080  1.00 0.00 ? 100 ILE A O    3  
ATOM 3809  C CB   . ILE A 1 3   ? 25.528  1.950   -7.073  1.00 0.00 ? 100 ILE A CB   3  
ATOM 3810  C CG1  . ILE A 1 3   ? 26.770  1.222   -7.587  1.00 0.00 ? 100 ILE A CG1  3  
ATOM 3811  C CG2  . ILE A 1 3   ? 24.263  1.194   -7.437  1.00 0.00 ? 100 ILE A CG2  3  
ATOM 3812  C CD1  . ILE A 1 3   ? 27.069  -0.057  -6.845  1.00 0.00 ? 100 ILE A CD1  3  
ATOM 3813  H H    . ILE A 1 3   ? 27.061  3.840   -6.323  1.00 0.00 ? 100 ILE A H    3  
ATOM 3814  H HA   . ILE A 1 3   ? 25.556  3.317   -8.719  1.00 0.00 ? 100 ILE A HA   3  
ATOM 3815  H HB   . ILE A 1 3   ? 25.581  2.021   -5.995  1.00 0.00 ? 100 ILE A HB   3  
ATOM 3816  H HG12 . ILE A 1 3   ? 26.631  0.975   -8.627  1.00 0.00 ? 100 ILE A HG12 3  
ATOM 3817  H HG13 . ILE A 1 3   ? 27.627  1.872   -7.486  1.00 0.00 ? 100 ILE A HG13 3  
ATOM 3818  H HG21 . ILE A 1 3   ? 24.137  1.196   -8.508  1.00 0.00 ? 100 ILE A HG21 3  
ATOM 3819  H HG22 . ILE A 1 3   ? 23.416  1.675   -6.971  1.00 0.00 ? 100 ILE A HG22 3  
ATOM 3820  H HG23 . ILE A 1 3   ? 24.338  0.176   -7.083  1.00 0.00 ? 100 ILE A HG23 3  
ATOM 3821  H HD11 . ILE A 1 3   ? 27.282  0.174   -5.812  1.00 0.00 ? 100 ILE A HD11 3  
ATOM 3822  H HD12 . ILE A 1 3   ? 27.925  -0.538  -7.291  1.00 0.00 ? 100 ILE A HD12 3  
ATOM 3823  H HD13 . ILE A 1 3   ? 26.213  -0.712  -6.900  1.00 0.00 ? 100 ILE A HD13 3  
ATOM 3824  N N    . VAL A 1 4   ? 23.477  4.556   -8.246  1.00 0.00 ? 101 VAL A N    3  
ATOM 3825  C CA   . VAL A 1 4   ? 22.244  5.291   -8.023  1.00 0.00 ? 101 VAL A CA   3  
ATOM 3826  C C    . VAL A 1 4   ? 21.038  4.467   -8.465  1.00 0.00 ? 101 VAL A C    3  
ATOM 3827  O O    . VAL A 1 4   ? 21.182  3.513   -9.233  1.00 0.00 ? 101 VAL A O    3  
ATOM 3828  C CB   . VAL A 1 4   ? 22.245  6.639   -8.781  1.00 0.00 ? 101 VAL A CB   3  
ATOM 3829  C CG1  . VAL A 1 4   ? 23.481  7.451   -8.442  1.00 0.00 ? 101 VAL A CG1  3  
ATOM 3830  C CG2  . VAL A 1 4   ? 22.137  6.427   -10.286 1.00 0.00 ? 101 VAL A CG2  3  
ATOM 3831  H H    . VAL A 1 4   ? 23.789  4.419   -9.165  1.00 0.00 ? 101 VAL A H    3  
ATOM 3832  H HA   . VAL A 1 4   ? 22.162  5.495   -6.965  1.00 0.00 ? 101 VAL A HA   3  
ATOM 3833  H HB   . VAL A 1 4   ? 21.387  7.202   -8.458  1.00 0.00 ? 101 VAL A HB   3  
ATOM 3834  H HG11 . VAL A 1 4   ? 24.365  6.897   -8.724  1.00 0.00 ? 101 VAL A HG11 3  
ATOM 3835  H HG12 . VAL A 1 4   ? 23.504  7.648   -7.381  1.00 0.00 ? 101 VAL A HG12 3  
ATOM 3836  H HG13 . VAL A 1 4   ? 23.456  8.387   -8.979  1.00 0.00 ? 101 VAL A HG13 3  
ATOM 3837  H HG21 . VAL A 1 4   ? 22.958  5.810   -10.624 1.00 0.00 ? 101 VAL A HG21 3  
ATOM 3838  H HG22 . VAL A 1 4   ? 22.174  7.382   -10.788 1.00 0.00 ? 101 VAL A HG22 3  
ATOM 3839  H HG23 . VAL A 1 4   ? 21.202  5.936   -10.515 1.00 0.00 ? 101 VAL A HG23 3  
ATOM 3840  N N    . GLN A 1 5   ? 19.867  4.805   -7.941  1.00 0.00 ? 102 GLN A N    3  
ATOM 3841  C CA   . GLN A 1 5   ? 18.621  4.195   -8.391  1.00 0.00 ? 102 GLN A CA   3  
ATOM 3842  C C    . GLN A 1 5   ? 17.929  5.120   -9.387  1.00 0.00 ? 102 GLN A C    3  
ATOM 3843  O O    . GLN A 1 5   ? 17.143  5.988   -8.997  1.00 0.00 ? 102 GLN A O    3  
ATOM 3844  C CB   . GLN A 1 5   ? 17.670  3.915   -7.219  1.00 0.00 ? 102 GLN A CB   3  
ATOM 3845  C CG   . GLN A 1 5   ? 18.131  2.822   -6.266  1.00 0.00 ? 102 GLN A CG   3  
ATOM 3846  C CD   . GLN A 1 5   ? 19.278  3.251   -5.375  1.00 0.00 ? 102 GLN A CD   3  
ATOM 3847  O OE1  . GLN A 1 5   ? 19.428  4.428   -5.056  1.00 0.00 ? 102 GLN A OE1  3  
ATOM 3848  N NE2  . GLN A 1 5   ? 20.081  2.295   -4.944  1.00 0.00 ? 102 GLN A NE2  3  
ATOM 3849  H H    . GLN A 1 5   ? 19.836  5.491   -7.238  1.00 0.00 ? 102 GLN A H    3  
ATOM 3850  H HA   . GLN A 1 5   ? 18.863  3.266   -8.885  1.00 0.00 ? 102 GLN A HA   3  
ATOM 3851  H HB2  . GLN A 1 5   ? 17.551  4.824   -6.650  1.00 0.00 ? 102 GLN A HB2  3  
ATOM 3852  H HB3  . GLN A 1 5   ? 16.708  3.629   -7.619  1.00 0.00 ? 102 GLN A HB3  3  
ATOM 3853  H HG2  . GLN A 1 5   ? 17.300  2.539   -5.640  1.00 0.00 ? 102 GLN A HG2  3  
ATOM 3854  H HG3  . GLN A 1 5   ? 18.446  1.967   -6.847  1.00 0.00 ? 102 GLN A HG3  3  
ATOM 3855  H HE21 . GLN A 1 5   ? 19.890  1.374   -5.214  1.00 0.00 ? 102 GLN A HE21 3  
ATOM 3856  H HE22 . GLN A 1 5   ? 20.837  2.549   -4.370  1.00 0.00 ? 102 GLN A HE22 3  
ATOM 3857  N N    . PRO A 1 6   ? 18.199  4.948   -10.689 1.00 0.00 ? 103 PRO A N    3  
ATOM 3858  C CA   . PRO A 1 6   ? 17.669  5.829   -11.722 1.00 0.00 ? 103 PRO A CA   3  
ATOM 3859  C C    . PRO A 1 6   ? 16.256  5.444   -12.145 1.00 0.00 ? 103 PRO A C    3  
ATOM 3860  O O    . PRO A 1 6   ? 15.586  6.188   -12.860 1.00 0.00 ? 103 PRO A O    3  
ATOM 3861  C CB   . PRO A 1 6   ? 18.651  5.626   -12.872 1.00 0.00 ? 103 PRO A CB   3  
ATOM 3862  C CG   . PRO A 1 6   ? 19.122  4.217   -12.729 1.00 0.00 ? 103 PRO A CG   3  
ATOM 3863  C CD   . PRO A 1 6   ? 19.040  3.877   -11.261 1.00 0.00 ? 103 PRO A CD   3  
ATOM 3864  H HA   . PRO A 1 6   ? 17.683  6.862   -11.409 1.00 0.00 ? 103 PRO A HA   3  
ATOM 3865  H HB2  . PRO A 1 6   ? 18.142  5.780   -13.814 1.00 0.00 ? 103 PRO A HB2  3  
ATOM 3866  H HB3  . PRO A 1 6   ? 19.468  6.326   -12.780 1.00 0.00 ? 103 PRO A HB3  3  
ATOM 3867  H HG2  . PRO A 1 6   ? 18.484  3.560   -13.299 1.00 0.00 ? 103 PRO A HG2  3  
ATOM 3868  H HG3  . PRO A 1 6   ? 20.143  4.137   -13.073 1.00 0.00 ? 103 PRO A HG3  3  
ATOM 3869  H HD2  . PRO A 1 6   ? 18.574  2.912   -11.125 1.00 0.00 ? 103 PRO A HD2  3  
ATOM 3870  H HD3  . PRO A 1 6   ? 20.025  3.884   -10.817 1.00 0.00 ? 103 PRO A HD3  3  
ATOM 3871  N N    . ASP A 1 7   ? 15.800  4.286   -11.688 1.00 0.00 ? 104 ASP A N    3  
ATOM 3872  C CA   . ASP A 1 7   ? 14.485  3.786   -12.062 1.00 0.00 ? 104 ASP A CA   3  
ATOM 3873  C C    . ASP A 1 7   ? 13.665  3.430   -10.827 1.00 0.00 ? 104 ASP A C    3  
ATOM 3874  O O    . ASP A 1 7   ? 13.555  2.260   -10.457 1.00 0.00 ? 104 ASP A O    3  
ATOM 3875  C CB   . ASP A 1 7   ? 14.612  2.563   -12.973 1.00 0.00 ? 104 ASP A CB   3  
ATOM 3876  C CG   . ASP A 1 7   ? 15.341  2.871   -14.260 1.00 0.00 ? 104 ASP A CG   3  
ATOM 3877  O OD1  . ASP A 1 7   ? 14.730  3.488   -15.158 1.00 0.00 ? 104 ASP A OD1  3  
ATOM 3878  O OD2  . ASP A 1 7   ? 16.524  2.491   -14.381 1.00 0.00 ? 104 ASP A OD2  3  
ATOM 3879  H H    . ASP A 1 7   ? 16.359  3.758   -11.083 1.00 0.00 ? 104 ASP A H    3  
ATOM 3880  H HA   . ASP A 1 7   ? 13.976  4.571   -12.601 1.00 0.00 ? 104 ASP A HA   3  
ATOM 3881  H HB2  . ASP A 1 7   ? 15.150  1.786   -12.452 1.00 0.00 ? 104 ASP A HB2  3  
ATOM 3882  H HB3  . ASP A 1 7   ? 13.623  2.207   -13.222 1.00 0.00 ? 104 ASP A HB3  3  
ATOM 3883  N N    . PRO A 1 8   ? 13.091  4.441   -10.164 1.00 0.00 ? 105 PRO A N    3  
ATOM 3884  C CA   . PRO A 1 8   ? 12.230  4.247   -9.006  1.00 0.00 ? 105 PRO A CA   3  
ATOM 3885  C C    . PRO A 1 8   ? 10.786  3.976   -9.422  1.00 0.00 ? 105 PRO A C    3  
ATOM 3886  O O    . PRO A 1 8   ? 10.356  4.389   -10.502 1.00 0.00 ? 105 PRO A O    3  
ATOM 3887  C CB   . PRO A 1 8   ? 12.327  5.589   -8.256  1.00 0.00 ? 105 PRO A CB   3  
ATOM 3888  C CG   . PRO A 1 8   ? 13.169  6.492   -9.111  1.00 0.00 ? 105 PRO A CG   3  
ATOM 3889  C CD   . PRO A 1 8   ? 13.231  5.863   -10.473 1.00 0.00 ? 105 PRO A CD   3  
ATOM 3890  H HA   . PRO A 1 8   ? 12.585  3.445   -8.374  1.00 0.00 ? 105 PRO A HA   3  
ATOM 3891  H HB2  . PRO A 1 8   ? 11.336  5.996   -8.121  1.00 0.00 ? 105 PRO A HB2  3  
ATOM 3892  H HB3  . PRO A 1 8   ? 12.784  5.427   -7.291  1.00 0.00 ? 105 PRO A HB3  3  
ATOM 3893  H HG2  . PRO A 1 8   ? 12.711  7.468   -9.172  1.00 0.00 ? 105 PRO A HG2  3  
ATOM 3894  H HG3  . PRO A 1 8   ? 14.161  6.572   -8.691  1.00 0.00 ? 105 PRO A HG3  3  
ATOM 3895  H HD2  . PRO A 1 8   ? 12.415  6.210   -11.091 1.00 0.00 ? 105 PRO A HD2  3  
ATOM 3896  H HD3  . PRO A 1 8   ? 14.181  6.065   -10.944 1.00 0.00 ? 105 PRO A HD3  3  
ATOM 3897  N N    . PRO A 1 9   ? 10.022  3.262   -8.583  1.00 0.00 ? 106 PRO A N    3  
ATOM 3898  C CA   . PRO A 1 9   ? 8.605   3.014   -8.838  1.00 0.00 ? 106 PRO A CA   3  
ATOM 3899  C C    . PRO A 1 9   ? 7.783   4.288   -8.698  1.00 0.00 ? 106 PRO A C    3  
ATOM 3900  O O    . PRO A 1 9   ? 7.374   4.675   -7.600  1.00 0.00 ? 106 PRO A O    3  
ATOM 3901  C CB   . PRO A 1 9   ? 8.212   1.995   -7.775  1.00 0.00 ? 106 PRO A CB   3  
ATOM 3902  C CG   . PRO A 1 9   ? 9.206   2.177   -6.678  1.00 0.00 ? 106 PRO A CG   3  
ATOM 3903  C CD   . PRO A 1 9   ? 10.481  2.633   -7.333  1.00 0.00 ? 106 PRO A CD   3  
ATOM 3904  H HA   . PRO A 1 9   ? 8.450   2.594   -9.822  1.00 0.00 ? 106 PRO A HA   3  
ATOM 3905  H HB2  . PRO A 1 9   ? 7.207   2.205   -7.440  1.00 0.00 ? 106 PRO A HB2  3  
ATOM 3906  H HB3  . PRO A 1 9   ? 8.259   1.003   -8.194  1.00 0.00 ? 106 PRO A HB3  3  
ATOM 3907  H HG2  . PRO A 1 9   ? 8.854   2.927   -5.985  1.00 0.00 ? 106 PRO A HG2  3  
ATOM 3908  H HG3  . PRO A 1 9   ? 9.362   1.238   -6.167  1.00 0.00 ? 106 PRO A HG3  3  
ATOM 3909  H HD2  . PRO A 1 9   ? 10.990  3.350   -6.707  1.00 0.00 ? 106 PRO A HD2  3  
ATOM 3910  H HD3  . PRO A 1 9   ? 11.121  1.789   -7.540  1.00 0.00 ? 106 PRO A HD3  3  
ATOM 3911  N N    . LEU A 1 10  ? 7.565   4.938   -9.822  1.00 0.00 ? 107 LEU A N    3  
ATOM 3912  C CA   . LEU A 1 10  ? 6.853   6.205   -9.856  1.00 0.00 ? 107 LEU A CA   3  
ATOM 3913  C C    . LEU A 1 10  ? 5.357   5.977   -10.043 1.00 0.00 ? 107 LEU A C    3  
ATOM 3914  O O    . LEU A 1 10  ? 4.919   4.842   -10.230 1.00 0.00 ? 107 LEU A O    3  
ATOM 3915  C CB   . LEU A 1 10  ? 7.399   7.119   -10.969 1.00 0.00 ? 107 LEU A CB   3  
ATOM 3916  C CG   . LEU A 1 10  ? 7.080   6.712   -12.419 1.00 0.00 ? 107 LEU A CG   3  
ATOM 3917  C CD1  . LEU A 1 10  ? 7.389   7.863   -13.360 1.00 0.00 ? 107 LEU A CD1  3  
ATOM 3918  C CD2  . LEU A 1 10  ? 7.866   5.478   -12.845 1.00 0.00 ? 107 LEU A CD2  3  
ATOM 3919  H H    . LEU A 1 10  ? 7.895   4.548   -10.652 1.00 0.00 ? 107 LEU A H    3  
ATOM 3920  H HA   . LEU A 1 10  ? 7.006   6.690   -8.904  1.00 0.00 ? 107 LEU A HA   3  
ATOM 3921  H HB2  . LEU A 1 10  ? 7.004   8.110   -10.808 1.00 0.00 ? 107 LEU A HB2  3  
ATOM 3922  H HB3  . LEU A 1 10  ? 8.473   7.163   -10.864 1.00 0.00 ? 107 LEU A HB3  3  
ATOM 3923  H HG   . LEU A 1 10  ? 6.026   6.486   -12.501 1.00 0.00 ? 107 LEU A HG   3  
ATOM 3924  H HD11 . LEU A 1 10  ? 7.186   7.561   -14.375 1.00 0.00 ? 107 LEU A HD11 3  
ATOM 3925  H HD12 . LEU A 1 10  ? 8.430   8.135   -13.266 1.00 0.00 ? 107 LEU A HD12 3  
ATOM 3926  H HD13 . LEU A 1 10  ? 6.771   8.712   -13.106 1.00 0.00 ? 107 LEU A HD13 3  
ATOM 3927  H HD21 . LEU A 1 10  ? 7.814   5.374   -13.919 1.00 0.00 ? 107 LEU A HD21 3  
ATOM 3928  H HD22 . LEU A 1 10  ? 7.446   4.601   -12.378 1.00 0.00 ? 107 LEU A HD22 3  
ATOM 3929  H HD23 . LEU A 1 10  ? 8.898   5.588   -12.545 1.00 0.00 ? 107 LEU A HD23 3  
ATOM 3930  N N    . GLU A 1 11  ? 4.587   7.064   -9.986  1.00 0.00 ? 108 GLU A N    3  
ATOM 3931  C CA   . GLU A 1 11  ? 3.135   7.009   -10.124 1.00 0.00 ? 108 GLU A CA   3  
ATOM 3932  C C    . GLU A 1 11  ? 2.532   6.012   -9.138  1.00 0.00 ? 108 GLU A C    3  
ATOM 3933  O O    . GLU A 1 11  ? 1.773   5.119   -9.520  1.00 0.00 ? 108 GLU A O    3  
ATOM 3934  C CB   . GLU A 1 11  ? 2.741   6.650   -11.561 1.00 0.00 ? 108 GLU A CB   3  
ATOM 3935  C CG   . GLU A 1 11  ? 3.177   7.686   -12.587 1.00 0.00 ? 108 GLU A CG   3  
ATOM 3936  C CD   . GLU A 1 11  ? 2.561   9.049   -12.339 1.00 0.00 ? 108 GLU A CD   3  
ATOM 3937  O OE1  . GLU A 1 11  ? 1.428   9.290   -12.806 1.00 0.00 ? 108 GLU A OE1  3  
ATOM 3938  O OE2  . GLU A 1 11  ? 3.205   9.887   -11.677 1.00 0.00 ? 108 GLU A OE2  3  
ATOM 3939  H H    . GLU A 1 11  ? 5.013   7.936   -9.847  1.00 0.00 ? 108 GLU A H    3  
ATOM 3940  H HA   . GLU A 1 11  ? 2.749   7.989   -9.895  1.00 0.00 ? 108 GLU A HA   3  
ATOM 3941  H HB2  . GLU A 1 11  ? 3.195   5.706   -11.819 1.00 0.00 ? 108 GLU A HB2  3  
ATOM 3942  H HB3  . GLU A 1 11  ? 1.667   6.550   -11.614 1.00 0.00 ? 108 GLU A HB3  3  
ATOM 3943  H HG2  . GLU A 1 11  ? 4.251   7.783   -12.549 1.00 0.00 ? 108 GLU A HG2  3  
ATOM 3944  H HG3  . GLU A 1 11  ? 2.881   7.347   -13.569 1.00 0.00 ? 108 GLU A HG3  3  
ATOM 3945  N N    . LEU A 1 12  ? 2.890   6.166   -7.871  1.00 0.00 ? 109 LEU A N    3  
ATOM 3946  C CA   . LEU A 1 12  ? 2.384   5.293   -6.824  1.00 0.00 ? 109 LEU A CA   3  
ATOM 3947  C C    . LEU A 1 12  ? 0.969   5.707   -6.433  1.00 0.00 ? 109 LEU A C    3  
ATOM 3948  O O    . LEU A 1 12  ? 0.775   6.621   -5.631  1.00 0.00 ? 109 LEU A O    3  
ATOM 3949  C CB   . LEU A 1 12  ? 3.311   5.334   -5.602  1.00 0.00 ? 109 LEU A CB   3  
ATOM 3950  C CG   . LEU A 1 12  ? 2.899   4.431   -4.436  1.00 0.00 ? 109 LEU A CG   3  
ATOM 3951  C CD1  . LEU A 1 12  ? 2.859   2.976   -4.869  1.00 0.00 ? 109 LEU A CD1  3  
ATOM 3952  C CD2  . LEU A 1 12  ? 3.853   4.606   -3.265  1.00 0.00 ? 109 LEU A CD2  3  
ATOM 3953  H H    . LEU A 1 12  ? 3.509   6.890   -7.633  1.00 0.00 ? 109 LEU A H    3  
ATOM 3954  H HA   . LEU A 1 12  ? 2.358   4.287   -7.216  1.00 0.00 ? 109 LEU A HA   3  
ATOM 3955  H HB2  . LEU A 1 12  ? 4.302   5.043   -5.921  1.00 0.00 ? 109 LEU A HB2  3  
ATOM 3956  H HB3  . LEU A 1 12  ? 3.352   6.351   -5.242  1.00 0.00 ? 109 LEU A HB3  3  
ATOM 3957  H HG   . LEU A 1 12  ? 1.908   4.708   -4.106  1.00 0.00 ? 109 LEU A HG   3  
ATOM 3958  H HD11 . LEU A 1 12  ? 2.569   2.359   -4.031  1.00 0.00 ? 109 LEU A HD11 3  
ATOM 3959  H HD12 . LEU A 1 12  ? 3.837   2.677   -5.213  1.00 0.00 ? 109 LEU A HD12 3  
ATOM 3960  H HD13 . LEU A 1 12  ? 2.143   2.857   -5.669  1.00 0.00 ? 109 LEU A HD13 3  
ATOM 3961  H HD21 . LEU A 1 12  ? 3.557   3.951   -2.459  1.00 0.00 ? 109 LEU A HD21 3  
ATOM 3962  H HD22 . LEU A 1 12  ? 3.824   5.631   -2.926  1.00 0.00 ? 109 LEU A HD22 3  
ATOM 3963  H HD23 . LEU A 1 12  ? 4.857   4.359   -3.579  1.00 0.00 ? 109 LEU A HD23 3  
ATOM 3964  N N    . ALA A 1 13  ? -0.013  5.039   -7.015  1.00 0.00 ? 110 ALA A N    3  
ATOM 3965  C CA   . ALA A 1 13  ? -1.405  5.348   -6.746  1.00 0.00 ? 110 ALA A CA   3  
ATOM 3966  C C    . ALA A 1 13  ? -1.981  4.364   -5.744  1.00 0.00 ? 110 ALA A C    3  
ATOM 3967  O O    . ALA A 1 13  ? -1.859  3.148   -5.912  1.00 0.00 ? 110 ALA A O    3  
ATOM 3968  C CB   . ALA A 1 13  ? -2.213  5.334   -8.033  1.00 0.00 ? 110 ALA A CB   3  
ATOM 3969  H H    . ALA A 1 13  ? 0.206   4.303   -7.630  1.00 0.00 ? 110 ALA A H    3  
ATOM 3970  H HA   . ALA A 1 13  ? -1.452  6.344   -6.328  1.00 0.00 ? 110 ALA A HA   3  
ATOM 3971  H HB1  . ALA A 1 13  ? -1.783  6.032   -8.736  1.00 0.00 ? 110 ALA A HB1  3  
ATOM 3972  H HB2  . ALA A 1 13  ? -3.232  5.619   -7.821  1.00 0.00 ? 110 ALA A HB2  3  
ATOM 3973  H HB3  . ALA A 1 13  ? -2.198  4.341   -8.457  1.00 0.00 ? 110 ALA A HB3  3  
ATOM 3974  N N    . VAL A 1 14  ? -2.599  4.891   -4.701  1.00 0.00 ? 111 VAL A N    3  
ATOM 3975  C CA   . VAL A 1 14  ? -3.168  4.066   -3.658  1.00 0.00 ? 111 VAL A CA   3  
ATOM 3976  C C    . VAL A 1 14  ? -4.670  4.266   -3.624  1.00 0.00 ? 111 VAL A C    3  
ATOM 3977  O O    . VAL A 1 14  ? -5.149  5.365   -3.343  1.00 0.00 ? 111 VAL A O    3  
ATOM 3978  C CB   . VAL A 1 14  ? -2.589  4.416   -2.276  1.00 0.00 ? 111 VAL A CB   3  
ATOM 3979  C CG1  . VAL A 1 14  ? -2.767  3.256   -1.312  1.00 0.00 ? 111 VAL A CG1  3  
ATOM 3980  C CG2  . VAL A 1 14  ? -1.127  4.816   -2.385  1.00 0.00 ? 111 VAL A CG2  3  
ATOM 3981  H H    . VAL A 1 14  ? -2.685  5.866   -4.633  1.00 0.00 ? 111 VAL A H    3  
ATOM 3982  H HA   . VAL A 1 14  ? -2.947  3.032   -3.879  1.00 0.00 ? 111 VAL A HA   3  
ATOM 3983  H HB   . VAL A 1 14  ? -3.142  5.258   -1.889  1.00 0.00 ? 111 VAL A HB   3  
ATOM 3984  H HG11 . VAL A 1 14  ? -3.817  3.030   -1.212  1.00 0.00 ? 111 VAL A HG11 3  
ATOM 3985  H HG12 . VAL A 1 14  ? -2.361  3.521   -0.349  1.00 0.00 ? 111 VAL A HG12 3  
ATOM 3986  H HG13 . VAL A 1 14  ? -2.247  2.391   -1.695  1.00 0.00 ? 111 VAL A HG13 3  
ATOM 3987  H HG21 . VAL A 1 14  ? -0.768  5.135   -1.419  1.00 0.00 ? 111 VAL A HG21 3  
ATOM 3988  H HG22 . VAL A 1 14  ? -1.029  5.628   -3.091  1.00 0.00 ? 111 VAL A HG22 3  
ATOM 3989  H HG23 . VAL A 1 14  ? -0.548  3.970   -2.726  1.00 0.00 ? 111 VAL A HG23 3  
ATOM 3990  N N    . GLU A 1 15  ? -5.405  3.216   -3.918  1.00 0.00 ? 112 GLU A N    3  
ATOM 3991  C CA   . GLU A 1 15  ? -6.849  3.309   -3.987  1.00 0.00 ? 112 GLU A CA   3  
ATOM 3992  C C    . GLU A 1 15  ? -7.500  2.285   -3.071  1.00 0.00 ? 112 GLU A C    3  
ATOM 3993  O O    . GLU A 1 15  ? -7.148  1.106   -3.088  1.00 0.00 ? 112 GLU A O    3  
ATOM 3994  C CB   . GLU A 1 15  ? -7.327  3.116   -5.430  1.00 0.00 ? 112 GLU A CB   3  
ATOM 3995  C CG   . GLU A 1 15  ? -8.834  3.231   -5.591  1.00 0.00 ? 112 GLU A CG   3  
ATOM 3996  C CD   . GLU A 1 15  ? -9.283  3.195   -7.038  1.00 0.00 ? 112 GLU A CD   3  
ATOM 3997  O OE1  . GLU A 1 15  ? -8.430  3.314   -7.940  1.00 0.00 ? 112 GLU A OE1  3  
ATOM 3998  O OE2  . GLU A 1 15  ? -10.501 3.054   -7.279  1.00 0.00 ? 112 GLU A OE2  3  
ATOM 3999  H H    . GLU A 1 15  ? -4.967  2.352   -4.079  1.00 0.00 ? 112 GLU A H    3  
ATOM 4000  H HA   . GLU A 1 15  ? -7.131  4.296   -3.657  1.00 0.00 ? 112 GLU A HA   3  
ATOM 4001  H HB2  . GLU A 1 15  ? -6.859  3.863   -6.054  1.00 0.00 ? 112 GLU A HB2  3  
ATOM 4002  H HB3  . GLU A 1 15  ? -7.023  2.136   -5.770  1.00 0.00 ? 112 GLU A HB3  3  
ATOM 4003  H HG2  . GLU A 1 15  ? -9.298  2.406   -5.070  1.00 0.00 ? 112 GLU A HG2  3  
ATOM 4004  H HG3  . GLU A 1 15  ? -9.160  4.162   -5.151  1.00 0.00 ? 112 GLU A HG3  3  
ATOM 4005  N N    . VAL A 1 16  ? -8.435  2.742   -2.256  1.00 0.00 ? 113 VAL A N    3  
ATOM 4006  C CA   . VAL A 1 16  ? -9.186  1.848   -1.395  1.00 0.00 ? 113 VAL A CA   3  
ATOM 4007  C C    . VAL A 1 16  ? -10.256 1.121   -2.208  1.00 0.00 ? 113 VAL A C    3  
ATOM 4008  O O    . VAL A 1 16  ? -11.150 1.742   -2.787  1.00 0.00 ? 113 VAL A O    3  
ATOM 4009  C CB   . VAL A 1 16  ? -9.826  2.596   -0.197  1.00 0.00 ? 113 VAL A CB   3  
ATOM 4010  C CG1  . VAL A 1 16  ? -10.664 3.778   -0.660  1.00 0.00 ? 113 VAL A CG1  3  
ATOM 4011  C CG2  . VAL A 1 16  ? -10.660 1.645   0.645   1.00 0.00 ? 113 VAL A CG2  3  
ATOM 4012  H H    . VAL A 1 16  ? -8.629  3.705   -2.241  1.00 0.00 ? 113 VAL A H    3  
ATOM 4013  H HA   . VAL A 1 16  ? -8.493  1.113   -1.003  1.00 0.00 ? 113 VAL A HA   3  
ATOM 4014  H HB   . VAL A 1 16  ? -9.028  2.979   0.423   1.00 0.00 ? 113 VAL A HB   3  
ATOM 4015  H HG11 . VAL A 1 16  ? -11.087 4.278   0.199   1.00 0.00 ? 113 VAL A HG11 3  
ATOM 4016  H HG12 . VAL A 1 16  ? -11.461 3.426   -1.300  1.00 0.00 ? 113 VAL A HG12 3  
ATOM 4017  H HG13 . VAL A 1 16  ? -10.042 4.468   -1.208  1.00 0.00 ? 113 VAL A HG13 3  
ATOM 4018  H HG21 . VAL A 1 16  ? -11.437 1.209   0.033   1.00 0.00 ? 113 VAL A HG21 3  
ATOM 4019  H HG22 . VAL A 1 16  ? -11.108 2.187   1.463   1.00 0.00 ? 113 VAL A HG22 3  
ATOM 4020  H HG23 . VAL A 1 16  ? -10.027 0.862   1.035   1.00 0.00 ? 113 VAL A HG23 3  
ATOM 4021  N N    . LYS A 1 17  ? -10.144 -0.192  -2.276  1.00 0.00 ? 114 LYS A N    3  
ATOM 4022  C CA   . LYS A 1 17  ? -11.053 -0.987  -3.079  1.00 0.00 ? 114 LYS A CA   3  
ATOM 4023  C C    . LYS A 1 17  ? -12.099 -1.666  -2.220  1.00 0.00 ? 114 LYS A C    3  
ATOM 4024  O O    . LYS A 1 17  ? -11.780 -2.423  -1.303  1.00 0.00 ? 114 LYS A O    3  
ATOM 4025  C CB   . LYS A 1 17  ? -10.288 -2.023  -3.898  1.00 0.00 ? 114 LYS A CB   3  
ATOM 4026  C CG   . LYS A 1 17  ? -9.668  -1.446  -5.155  1.00 0.00 ? 114 LYS A CG   3  
ATOM 4027  C CD   . LYS A 1 17  ? -10.740 -1.051  -6.159  1.00 0.00 ? 114 LYS A CD   3  
ATOM 4028  C CE   . LYS A 1 17  ? -10.187 -0.117  -7.213  1.00 0.00 ? 114 LYS A CE   3  
ATOM 4029  N NZ   . LYS A 1 17  ? -11.213 0.262   -8.218  1.00 0.00 ? 114 LYS A NZ   3  
ATOM 4030  H H    . LYS A 1 17  ? -9.441  -0.646  -1.758  1.00 0.00 ? 114 LYS A H    3  
ATOM 4031  H HA   . LYS A 1 17  ? -11.554 -0.314  -3.759  1.00 0.00 ? 114 LYS A HA   3  
ATOM 4032  H HB2  . LYS A 1 17  ? -9.499  -2.437  -3.289  1.00 0.00 ? 114 LYS A HB2  3  
ATOM 4033  H HB3  . LYS A 1 17  ? -10.966 -2.814  -4.185  1.00 0.00 ? 114 LYS A HB3  3  
ATOM 4034  H HG2  . LYS A 1 17  ? -9.092  -0.572  -4.893  1.00 0.00 ? 114 LYS A HG2  3  
ATOM 4035  H HG3  . LYS A 1 17  ? -9.022  -2.188  -5.602  1.00 0.00 ? 114 LYS A HG3  3  
ATOM 4036  H HD2  . LYS A 1 17  ? -11.114 -1.941  -6.641  1.00 0.00 ? 114 LYS A HD2  3  
ATOM 4037  H HD3  . LYS A 1 17  ? -11.545 -0.556  -5.639  1.00 0.00 ? 114 LYS A HD3  3  
ATOM 4038  H HE2  . LYS A 1 17  ? -9.835  0.777   -6.720  1.00 0.00 ? 114 LYS A HE2  3  
ATOM 4039  H HE3  . LYS A 1 17  ? -9.362  -0.602  -7.712  1.00 0.00 ? 114 LYS A HE3  3  
ATOM 4040  H HZ1  . LYS A 1 17  ? -12.038 0.686   -7.747  1.00 0.00 ? 114 LYS A HZ1  3  
ATOM 4041  H HZ2  . LYS A 1 17  ? -11.524 -0.578  -8.746  1.00 0.00 ? 114 LYS A HZ2  3  
ATOM 4042  H HZ3  . LYS A 1 17  ? -10.821 0.952   -8.888  1.00 0.00 ? 114 LYS A HZ3  3  
ATOM 4043  N N    . GLN A 1 18  ? -13.348 -1.384  -2.528  1.00 0.00 ? 115 GLN A N    3  
ATOM 4044  C CA   . GLN A 1 18  ? -14.472 -1.993  -1.837  1.00 0.00 ? 115 GLN A CA   3  
ATOM 4045  C C    . GLN A 1 18  ? -15.395 -2.662  -2.846  1.00 0.00 ? 115 GLN A C    3  
ATOM 4046  O O    . GLN A 1 18  ? -16.454 -2.134  -3.185  1.00 0.00 ? 115 GLN A O    3  
ATOM 4047  C CB   . GLN A 1 18  ? -15.228 -0.943  -1.024  1.00 0.00 ? 115 GLN A CB   3  
ATOM 4048  C CG   . GLN A 1 18  ? -14.417 -0.383  0.129   1.00 0.00 ? 115 GLN A CG   3  
ATOM 4049  C CD   . GLN A 1 18  ? -15.138 0.725   0.858   1.00 0.00 ? 115 GLN A CD   3  
ATOM 4050  O OE1  . GLN A 1 18  ? -14.976 1.905   0.543   1.00 0.00 ? 115 GLN A OE1  3  
ATOM 4051  N NE2  . GLN A 1 18  ? -15.955 0.356   1.826   1.00 0.00 ? 115 GLN A NE2  3  
ATOM 4052  H H    . GLN A 1 18  ? -13.524 -0.749  -3.257  1.00 0.00 ? 115 GLN A H    3  
ATOM 4053  H HA   . GLN A 1 18  ? -14.081 -2.746  -1.166  1.00 0.00 ? 115 GLN A HA   3  
ATOM 4054  H HB2  . GLN A 1 18  ? -15.502 -0.126  -1.676  1.00 0.00 ? 115 GLN A HB2  3  
ATOM 4055  H HB3  . GLN A 1 18  ? -16.126 -1.389  -0.624  1.00 0.00 ? 115 GLN A HB3  3  
ATOM 4056  H HG2  . GLN A 1 18  ? -14.213 -1.179  0.828   1.00 0.00 ? 115 GLN A HG2  3  
ATOM 4057  H HG3  . GLN A 1 18  ? -13.485 0.005   -0.256  1.00 0.00 ? 115 GLN A HG3  3  
ATOM 4058  H HE21 . GLN A 1 18  ? -16.048 -0.606  2.015   1.00 0.00 ? 115 GLN A HE21 3  
ATOM 4059  H HE22 . GLN A 1 18  ? -16.429 1.054   2.330   1.00 0.00 ? 115 GLN A HE22 3  
ATOM 4060  N N    . PRO A 1 19  ? -14.984 -3.830  -3.358  1.00 0.00 ? 116 PRO A N    3  
ATOM 4061  C CA   . PRO A 1 19  ? -15.714 -4.554  -4.399  1.00 0.00 ? 116 PRO A CA   3  
ATOM 4062  C C    . PRO A 1 19  ? -16.950 -5.271  -3.864  1.00 0.00 ? 116 PRO A C    3  
ATOM 4063  O O    . PRO A 1 19  ? -17.261 -5.194  -2.673  1.00 0.00 ? 116 PRO A O    3  
ATOM 4064  C CB   . PRO A 1 19  ? -14.686 -5.575  -4.918  1.00 0.00 ? 116 PRO A CB   3  
ATOM 4065  C CG   . PRO A 1 19  ? -13.393 -5.211  -4.263  1.00 0.00 ? 116 PRO A CG   3  
ATOM 4066  C CD   . PRO A 1 19  ? -13.768 -4.549  -2.976  1.00 0.00 ? 116 PRO A CD   3  
ATOM 4067  H HA   . PRO A 1 19  ? -16.005 -3.895  -5.203  1.00 0.00 ? 116 PRO A HA   3  
ATOM 4068  H HB2  . PRO A 1 19  ? -15.001 -6.570  -4.643  1.00 0.00 ? 116 PRO A HB2  3  
ATOM 4069  H HB3  . PRO A 1 19  ? -14.617 -5.501  -5.992  1.00 0.00 ? 116 PRO A HB3  3  
ATOM 4070  H HG2  . PRO A 1 19  ? -12.811 -6.099  -4.073  1.00 0.00 ? 116 PRO A HG2  3  
ATOM 4071  H HG3  . PRO A 1 19  ? -12.843 -4.526  -4.890  1.00 0.00 ? 116 PRO A HG3  3  
ATOM 4072  H HD2  . PRO A 1 19  ? -13.972 -5.286  -2.210  1.00 0.00 ? 116 PRO A HD2  3  
ATOM 4073  H HD3  . PRO A 1 19  ? -12.996 -3.865  -2.657  1.00 0.00 ? 116 PRO A HD3  3  
ATOM 4074  N N    . GLU A 1 20  ? -17.652 -5.965  -4.747  1.00 0.00 ? 117 GLU A N    3  
ATOM 4075  C CA   . GLU A 1 20  ? -18.850 -6.698  -4.367  1.00 0.00 ? 117 GLU A CA   3  
ATOM 4076  C C    . GLU A 1 20  ? -18.504 -8.122  -3.944  1.00 0.00 ? 117 GLU A C    3  
ATOM 4077  O O    . GLU A 1 20  ? -18.693 -8.502  -2.788  1.00 0.00 ? 117 GLU A O    3  
ATOM 4078  C CB   . GLU A 1 20  ? -19.847 -6.723  -5.529  1.00 0.00 ? 117 GLU A CB   3  
ATOM 4079  C CG   . GLU A 1 20  ? -21.073 -7.581  -5.263  1.00 0.00 ? 117 GLU A CG   3  
ATOM 4080  C CD   . GLU A 1 20  ? -22.070 -7.540  -6.400  1.00 0.00 ? 117 GLU A CD   3  
ATOM 4081  O OE1  . GLU A 1 20  ? -22.945 -6.648  -6.396  1.00 0.00 ? 117 GLU A OE1  3  
ATOM 4082  O OE2  . GLU A 1 20  ? -21.988 -8.402  -7.302  1.00 0.00 ? 117 GLU A OE2  3  
ATOM 4083  H H    . GLU A 1 20  ? -17.355 -5.985  -5.682  1.00 0.00 ? 117 GLU A H    3  
ATOM 4084  H HA   . GLU A 1 20  ? -19.299 -6.185  -3.530  1.00 0.00 ? 117 GLU A HA   3  
ATOM 4085  H HB2  . GLU A 1 20  ? -20.177 -5.714  -5.729  1.00 0.00 ? 117 GLU A HB2  3  
ATOM 4086  H HB3  . GLU A 1 20  ? -19.348 -7.109  -6.406  1.00 0.00 ? 117 GLU A HB3  3  
ATOM 4087  H HG2  . GLU A 1 20  ? -20.754 -8.604  -5.123  1.00 0.00 ? 117 GLU A HG2  3  
ATOM 4088  H HG3  . GLU A 1 20  ? -21.556 -7.229  -4.364  1.00 0.00 ? 117 GLU A HG3  3  
ATOM 4089  N N    . ASP A 1 21  ? -17.990 -8.900  -4.887  1.00 0.00 ? 118 ASP A N    3  
ATOM 4090  C CA   . ASP A 1 21  ? -17.668 -10.302 -4.640  1.00 0.00 ? 118 ASP A CA   3  
ATOM 4091  C C    . ASP A 1 21  ? -16.444 -10.416 -3.747  1.00 0.00 ? 118 ASP A C    3  
ATOM 4092  O O    . ASP A 1 21  ? -16.365 -11.290 -2.884  1.00 0.00 ? 118 ASP A O    3  
ATOM 4093  C CB   . ASP A 1 21  ? -17.414 -11.020 -5.969  1.00 0.00 ? 118 ASP A CB   3  
ATOM 4094  C CG   . ASP A 1 21  ? -17.105 -12.497 -5.799  1.00 0.00 ? 118 ASP A CG   3  
ATOM 4095  O OD1  . ASP A 1 21  ? -15.915 -12.850 -5.645  1.00 0.00 ? 118 ASP A OD1  3  
ATOM 4096  O OD2  . ASP A 1 21  ? -18.049 -13.316 -5.842  1.00 0.00 ? 118 ASP A OD2  3  
ATOM 4097  H H    . ASP A 1 21  ? -17.812 -8.519  -5.773  1.00 0.00 ? 118 ASP A H    3  
ATOM 4098  H HA   . ASP A 1 21  ? -18.511 -10.758 -4.145  1.00 0.00 ? 118 ASP A HA   3  
ATOM 4099  H HB2  . ASP A 1 21  ? -18.292 -10.927 -6.589  1.00 0.00 ? 118 ASP A HB2  3  
ATOM 4100  H HB3  . ASP A 1 21  ? -16.579 -10.551 -6.466  1.00 0.00 ? 118 ASP A HB3  3  
ATOM 4101  N N    . ARG A 1 22  ? -15.503 -9.514  -3.952  1.00 0.00 ? 119 ARG A N    3  
ATOM 4102  C CA   . ARG A 1 22  ? -14.260 -9.514  -3.199  1.00 0.00 ? 119 ARG A CA   3  
ATOM 4103  C C    . ARG A 1 22  ? -14.412 -8.710  -1.914  1.00 0.00 ? 119 ARG A C    3  
ATOM 4104  O O    . ARG A 1 22  ? -15.274 -7.833  -1.814  1.00 0.00 ? 119 ARG A O    3  
ATOM 4105  C CB   . ARG A 1 22  ? -13.142 -8.911  -4.045  1.00 0.00 ? 119 ARG A CB   3  
ATOM 4106  C CG   . ARG A 1 22  ? -12.933 -9.610  -5.374  1.00 0.00 ? 119 ARG A CG   3  
ATOM 4107  C CD   . ARG A 1 22  ? -11.936 -8.857  -6.235  1.00 0.00 ? 119 ARG A CD   3  
ATOM 4108  N NE   . ARG A 1 22  ? -11.813 -9.440  -7.568  1.00 0.00 ? 119 ARG A NE   3  
ATOM 4109  C CZ   . ARG A 1 22  ? -12.109 -8.791  -8.696  1.00 0.00 ? 119 ARG A CZ   3  
ATOM 4110  N NH1  . ARG A 1 22  ? -12.611 -7.561  -8.653  1.00 0.00 ? 119 ARG A NH1  3  
ATOM 4111  N NH2  . ARG A 1 22  ? -11.921 -9.379  -9.869  1.00 0.00 ? 119 ARG A NH2  3  
ATOM 4112  H H    . ARG A 1 22  ? -15.651 -8.820  -4.630  1.00 0.00 ? 119 ARG A H    3  
ATOM 4113  H HA   . ARG A 1 22  ? -14.014 -10.535 -2.955  1.00 0.00 ? 119 ARG A HA   3  
ATOM 4114  H HB2  . ARG A 1 22  ? -13.377 -7.879  -4.243  1.00 0.00 ? 119 ARG A HB2  3  
ATOM 4115  H HB3  . ARG A 1 22  ? -12.218 -8.962  -3.487  1.00 0.00 ? 119 ARG A HB3  3  
ATOM 4116  H HG2  . ARG A 1 22  ? -12.558 -10.606 -5.192  1.00 0.00 ? 119 ARG A HG2  3  
ATOM 4117  H HG3  . ARG A 1 22  ? -13.878 -9.665  -5.895  1.00 0.00 ? 119 ARG A HG3  3  
ATOM 4118  H HD2  . ARG A 1 22  ? -12.262 -7.833  -6.328  1.00 0.00 ? 119 ARG A HD2  3  
ATOM 4119  H HD3  . ARG A 1 22  ? -10.971 -8.883  -5.750  1.00 0.00 ? 119 ARG A HD3  3  
ATOM 4120  H HE   . ARG A 1 22  ? -11.473 -10.366 -7.623  1.00 0.00 ? 119 ARG A HE   3  
ATOM 4121  H HH11 . ARG A 1 22  ? -12.772 -7.111  -7.774  1.00 0.00 ? 119 ARG A HH11 3  
ATOM 4122  H HH12 . ARG A 1 22  ? -12.828 -7.076  -9.503  1.00 0.00 ? 119 ARG A HH12 3  
ATOM 4123  H HH21 . ARG A 1 22  ? -11.557 -10.314 -9.915  1.00 0.00 ? 119 ARG A HH21 3  
ATOM 4124  H HH22 . ARG A 1 22  ? -12.141 -8.891  -10.717 1.00 0.00 ? 119 ARG A HH22 3  
ATOM 4125  N N    . LYS A 1 23  ? -13.570 -9.018  -0.939  1.00 0.00 ? 120 LYS A N    3  
ATOM 4126  C CA   . LYS A 1 23  ? -13.544 -8.285  0.319   1.00 0.00 ? 120 LYS A CA   3  
ATOM 4127  C C    . LYS A 1 23  ? -12.869 -6.934  0.122   1.00 0.00 ? 120 LYS A C    3  
ATOM 4128  O O    . LYS A 1 23  ? -12.048 -6.779  -0.781  1.00 0.00 ? 120 LYS A O    3  
ATOM 4129  C CB   . LYS A 1 23  ? -12.792 -9.083  1.379   1.00 0.00 ? 120 LYS A CB   3  
ATOM 4130  C CG   . LYS A 1 23  ? -13.450 -10.403 1.737   1.00 0.00 ? 120 LYS A CG   3  
ATOM 4131  C CD   . LYS A 1 23  ? -12.667 -11.129 2.817   1.00 0.00 ? 120 LYS A CD   3  
ATOM 4132  C CE   . LYS A 1 23  ? -11.222 -11.338 2.399   1.00 0.00 ? 120 LYS A CE   3  
ATOM 4133  N NZ   . LYS A 1 23  ? -10.453 -12.115 3.405   1.00 0.00 ? 120 LYS A NZ   3  
ATOM 4134  H H    . LYS A 1 23  ? -12.938 -9.756  -1.073  1.00 0.00 ? 120 LYS A H    3  
ATOM 4135  H HA   . LYS A 1 23  ? -14.558 -8.133  0.645   1.00 0.00 ? 120 LYS A HA   3  
ATOM 4136  H HB2  . LYS A 1 23  ? -11.798 -9.289  1.013   1.00 0.00 ? 120 LYS A HB2  3  
ATOM 4137  H HB3  . LYS A 1 23  ? -12.718 -8.488  2.276   1.00 0.00 ? 120 LYS A HB3  3  
ATOM 4138  H HG2  . LYS A 1 23  ? -14.450 -10.212 2.097   1.00 0.00 ? 120 LYS A HG2  3  
ATOM 4139  H HG3  . LYS A 1 23  ? -13.493 -11.025 0.855   1.00 0.00 ? 120 LYS A HG3  3  
ATOM 4140  H HD2  . LYS A 1 23  ? -12.689 -10.542 3.722   1.00 0.00 ? 120 LYS A HD2  3  
ATOM 4141  H HD3  . LYS A 1 23  ? -13.124 -12.091 2.996   1.00 0.00 ? 120 LYS A HD3  3  
ATOM 4142  H HE2  . LYS A 1 23  ? -11.207 -11.865 1.457   1.00 0.00 ? 120 LYS A HE2  3  
ATOM 4143  H HE3  . LYS A 1 23  ? -10.759 -10.369 2.273   1.00 0.00 ? 120 LYS A HE3  3  
ATOM 4144  H HZ1  . LYS A 1 23  ? -10.880 -13.055 3.537   1.00 0.00 ? 120 LYS A HZ1  3  
ATOM 4145  H HZ2  . LYS A 1 23  ? -10.448 -11.618 4.317   1.00 0.00 ? 120 LYS A HZ2  3  
ATOM 4146  H HZ3  . LYS A 1 23  ? -9.470  -12.238 3.087   1.00 0.00 ? 120 LYS A HZ3  3  
ATOM 4147  N N    . PRO A 1 24  ? -13.212 -5.937  0.953   1.00 0.00 ? 121 PRO A N    3  
ATOM 4148  C CA   . PRO A 1 24  ? -12.587 -4.614  0.889   1.00 0.00 ? 121 PRO A CA   3  
ATOM 4149  C C    . PRO A 1 24  ? -11.102 -4.681  1.224   1.00 0.00 ? 121 PRO A C    3  
ATOM 4150  O O    . PRO A 1 24  ? -10.701 -5.324  2.198   1.00 0.00 ? 121 PRO A O    3  
ATOM 4151  C CB   . PRO A 1 24  ? -13.345 -3.799  1.945   1.00 0.00 ? 121 PRO A CB   3  
ATOM 4152  C CG   . PRO A 1 24  ? -13.930 -4.813  2.866   1.00 0.00 ? 121 PRO A CG   3  
ATOM 4153  C CD   . PRO A 1 24  ? -14.230 -6.014  2.016   1.00 0.00 ? 121 PRO A CD   3  
ATOM 4154  H HA   . PRO A 1 24  ? -12.717 -4.164  -0.084  1.00 0.00 ? 121 PRO A HA   3  
ATOM 4155  H HB2  . PRO A 1 24  ? -12.658 -3.145  2.461   1.00 0.00 ? 121 PRO A HB2  3  
ATOM 4156  H HB3  . PRO A 1 24  ? -14.115 -3.213  1.465   1.00 0.00 ? 121 PRO A HB3  3  
ATOM 4157  H HG2  . PRO A 1 24  ? -13.215 -5.065  3.635   1.00 0.00 ? 121 PRO A HG2  3  
ATOM 4158  H HG3  . PRO A 1 24  ? -14.838 -4.430  3.306   1.00 0.00 ? 121 PRO A HG3  3  
ATOM 4159  H HD2  . PRO A 1 24  ? -14.119 -6.921  2.591   1.00 0.00 ? 121 PRO A HD2  3  
ATOM 4160  H HD3  . PRO A 1 24  ? -15.225 -5.946  1.602   1.00 0.00 ? 121 PRO A HD3  3  
ATOM 4161  N N    . TYR A 1 25  ? -10.292 -4.019  0.411   1.00 0.00 ? 122 TYR A N    3  
ATOM 4162  C CA   . TYR A 1 25  ? -8.848  -4.067  0.566   1.00 0.00 ? 122 TYR A CA   3  
ATOM 4163  C C    . TYR A 1 25  ? -8.216  -2.779  0.058   1.00 0.00 ? 122 TYR A C    3  
ATOM 4164  O O    . TYR A 1 25  ? -8.862  -1.980  -0.621  1.00 0.00 ? 122 TYR A O    3  
ATOM 4165  C CB   . TYR A 1 25  ? -8.272  -5.271  -0.192  1.00 0.00 ? 122 TYR A CB   3  
ATOM 4166  C CG   . TYR A 1 25  ? -8.471  -5.226  -1.695  1.00 0.00 ? 122 TYR A CG   3  
ATOM 4167  C CD1  . TYR A 1 25  ? -9.620  -5.740  -2.279  1.00 0.00 ? 122 TYR A CD1  3  
ATOM 4168  C CD2  . TYR A 1 25  ? -7.505  -4.676  -2.526  1.00 0.00 ? 122 TYR A CD2  3  
ATOM 4169  C CE1  . TYR A 1 25  ? -9.801  -5.708  -3.646  1.00 0.00 ? 122 TYR A CE1  3  
ATOM 4170  C CE2  . TYR A 1 25  ? -7.679  -4.639  -3.895  1.00 0.00 ? 122 TYR A CE2  3  
ATOM 4171  C CZ   . TYR A 1 25  ? -8.828  -5.156  -4.450  1.00 0.00 ? 122 TYR A CZ   3  
ATOM 4172  O OH   . TYR A 1 25  ? -9.003  -5.119  -5.814  1.00 0.00 ? 122 TYR A OH   3  
ATOM 4173  H H    . TYR A 1 25  ? -10.679 -3.472  -0.312  1.00 0.00 ? 122 TYR A H    3  
ATOM 4174  H HA   . TYR A 1 25  ? -8.629  -4.173  1.618   1.00 0.00 ? 122 TYR A HA   3  
ATOM 4175  H HB2  . TYR A 1 25  ? -7.211  -5.328  -0.006  1.00 0.00 ? 122 TYR A HB2  3  
ATOM 4176  H HB3  . TYR A 1 25  ? -8.741  -6.172  0.175   1.00 0.00 ? 122 TYR A HB3  3  
ATOM 4177  H HD1  . TYR A 1 25  ? -10.382 -6.171  -1.646  1.00 0.00 ? 122 TYR A HD1  3  
ATOM 4178  H HD2  . TYR A 1 25  ? -6.604  -4.270  -2.088  1.00 0.00 ? 122 TYR A HD2  3  
ATOM 4179  H HE1  . TYR A 1 25  ? -10.704 -6.111  -4.081  1.00 0.00 ? 122 TYR A HE1  3  
ATOM 4180  H HE2  . TYR A 1 25  ? -6.915  -4.208  -4.525  1.00 0.00 ? 122 TYR A HE2  3  
ATOM 4181  H HH   . TYR A 1 25  ? -8.178  -5.371  -6.249  1.00 0.00 ? 122 TYR A HH   3  
ATOM 4182  N N    . LEU A 1 26  ? -6.955  -2.576  0.395   1.00 0.00 ? 123 LEU A N    3  
ATOM 4183  C CA   . LEU A 1 26  ? -6.220  -1.427  -0.100  1.00 0.00 ? 123 LEU A CA   3  
ATOM 4184  C C    . LEU A 1 26  ? -5.419  -1.829  -1.327  1.00 0.00 ? 123 LEU A C    3  
ATOM 4185  O O    . LEU A 1 26  ? -4.616  -2.762  -1.272  1.00 0.00 ? 123 LEU A O    3  
ATOM 4186  C CB   . LEU A 1 26  ? -5.293  -0.867  0.980   1.00 0.00 ? 123 LEU A CB   3  
ATOM 4187  C CG   . LEU A 1 26  ? -4.599  0.446   0.619   1.00 0.00 ? 123 LEU A CG   3  
ATOM 4188  C CD1  . LEU A 1 26  ? -5.624  1.549   0.404   1.00 0.00 ? 123 LEU A CD1  3  
ATOM 4189  C CD2  . LEU A 1 26  ? -3.606  0.840   1.701   1.00 0.00 ? 123 LEU A CD2  3  
ATOM 4190  H H    . LEU A 1 26  ? -6.506  -3.222  0.984   1.00 0.00 ? 123 LEU A H    3  
ATOM 4191  H HA   . LEU A 1 26  ? -6.938  -0.670  -0.381  1.00 0.00 ? 123 LEU A HA   3  
ATOM 4192  H HB2  . LEU A 1 26  ? -5.873  -0.710  1.877   1.00 0.00 ? 123 LEU A HB2  3  
ATOM 4193  H HB3  . LEU A 1 26  ? -4.532  -1.603  1.187   1.00 0.00 ? 123 LEU A HB3  3  
ATOM 4194  H HG   . LEU A 1 26  ? -4.054  0.315   -0.306  1.00 0.00 ? 123 LEU A HG   3  
ATOM 4195  H HD11 . LEU A 1 26  ? -6.249  1.633   1.280   1.00 0.00 ? 123 LEU A HD11 3  
ATOM 4196  H HD12 . LEU A 1 26  ? -6.235  1.313   -0.454  1.00 0.00 ? 123 LEU A HD12 3  
ATOM 4197  H HD13 . LEU A 1 26  ? -5.114  2.485   0.235   1.00 0.00 ? 123 LEU A HD13 3  
ATOM 4198  H HD21 . LEU A 1 26  ? -3.122  1.767   1.426   1.00 0.00 ? 123 LEU A HD21 3  
ATOM 4199  H HD22 . LEU A 1 26  ? -2.863  0.064   1.807   1.00 0.00 ? 123 LEU A HD22 3  
ATOM 4200  H HD23 . LEU A 1 26  ? -4.128  0.972   2.637   1.00 0.00 ? 123 LEU A HD23 3  
ATOM 4201  N N    . TRP A 1 27  ? -5.652  -1.136  -2.426  1.00 0.00 ? 124 TRP A N    3  
ATOM 4202  C CA   . TRP A 1 27  ? -5.016  -1.462  -3.688  1.00 0.00 ? 124 TRP A CA   3  
ATOM 4203  C C    . TRP A 1 27  ? -3.884  -0.479  -3.978  1.00 0.00 ? 124 TRP A C    3  
ATOM 4204  O O    . TRP A 1 27  ? -4.123  0.686   -4.300  1.00 0.00 ? 124 TRP A O    3  
ATOM 4205  C CB   . TRP A 1 27  ? -6.065  -1.433  -4.802  1.00 0.00 ? 124 TRP A CB   3  
ATOM 4206  C CG   . TRP A 1 27  ? -5.587  -1.960  -6.120  1.00 0.00 ? 124 TRP A CG   3  
ATOM 4207  C CD1  . TRP A 1 27  ? -4.796  -3.053  -6.336  1.00 0.00 ? 124 TRP A CD1  3  
ATOM 4208  C CD2  . TRP A 1 27  ? -5.898  -1.426  -7.409  1.00 0.00 ? 124 TRP A CD2  3  
ATOM 4209  N NE1  . TRP A 1 27  ? -4.587  -3.221  -7.683  1.00 0.00 ? 124 TRP A NE1  3  
ATOM 4210  C CE2  . TRP A 1 27  ? -5.254  -2.235  -8.363  1.00 0.00 ? 124 TRP A CE2  3  
ATOM 4211  C CE3  . TRP A 1 27  ? -6.658  -0.338  -7.849  1.00 0.00 ? 124 TRP A CE3  3  
ATOM 4212  C CZ2  . TRP A 1 27  ? -5.349  -1.988  -9.731  1.00 0.00 ? 124 TRP A CZ2  3  
ATOM 4213  C CZ3  . TRP A 1 27  ? -6.751  -0.096  -9.205  1.00 0.00 ? 124 TRP A CZ3  3  
ATOM 4214  C CH2  . TRP A 1 27  ? -6.101  -0.917  -10.132 1.00 0.00 ? 124 TRP A CH2  3  
ATOM 4215  H H    . TRP A 1 27  ? -6.272  -0.373  -2.391  1.00 0.00 ? 124 TRP A H    3  
ATOM 4216  H HA   . TRP A 1 27  ? -4.607  -2.456  -3.611  1.00 0.00 ? 124 TRP A HA   3  
ATOM 4217  H HB2  . TRP A 1 27  ? -6.913  -2.027  -4.499  1.00 0.00 ? 124 TRP A HB2  3  
ATOM 4218  H HB3  . TRP A 1 27  ? -6.389  -0.412  -4.951  1.00 0.00 ? 124 TRP A HB3  3  
ATOM 4219  H HD1  . TRP A 1 27  ? -4.394  -3.679  -5.553  1.00 0.00 ? 124 TRP A HD1  3  
ATOM 4220  H HE1  . TRP A 1 27  ? -4.052  -3.933  -8.090  1.00 0.00 ? 124 TRP A HE1  3  
ATOM 4221  H HE3  . TRP A 1 27  ? -7.167  0.306   -7.149  1.00 0.00 ? 124 TRP A HE3  3  
ATOM 4222  H HZ2  . TRP A 1 27  ? -4.853  -2.609  -10.460 1.00 0.00 ? 124 TRP A HZ2  3  
ATOM 4223  H HZ3  . TRP A 1 27  ? -7.335  0.739   -9.563  1.00 0.00 ? 124 TRP A HZ3  3  
ATOM 4224  H HH2  . TRP A 1 27  ? -6.202  -0.691  -11.184 1.00 0.00 ? 124 TRP A HH2  3  
ATOM 4225  N N    . ILE A 1 28  ? -2.656  -0.953  -3.835  1.00 0.00 ? 125 ILE A N    3  
ATOM 4226  C CA   . ILE A 1 28  ? -1.482  -0.125  -4.066  1.00 0.00 ? 125 ILE A CA   3  
ATOM 4227  C C    . ILE A 1 28  ? -0.824  -0.523  -5.377  1.00 0.00 ? 125 ILE A C    3  
ATOM 4228  O O    . ILE A 1 28  ? -0.386  -1.662  -5.529  1.00 0.00 ? 125 ILE A O    3  
ATOM 4229  C CB   . ILE A 1 28  ? -0.428  -0.269  -2.938  1.00 0.00 ? 125 ILE A CB   3  
ATOM 4230  C CG1  . ILE A 1 28  ? -1.070  -0.191  -1.552  1.00 0.00 ? 125 ILE A CG1  3  
ATOM 4231  C CG2  . ILE A 1 28  ? 0.646   0.799   -3.076  1.00 0.00 ? 125 ILE A CG2  3  
ATOM 4232  C CD1  . ILE A 1 28  ? -1.510  -1.534  -1.013  1.00 0.00 ? 125 ILE A CD1  3  
ATOM 4233  H H    . ILE A 1 28  ? -2.534  -1.894  -3.576  1.00 0.00 ? 125 ILE A H    3  
ATOM 4234  H HA   . ILE A 1 28  ? -1.795  0.907   -4.120  1.00 0.00 ? 125 ILE A HA   3  
ATOM 4235  H HB   . ILE A 1 28  ? 0.048   -1.232  -3.050  1.00 0.00 ? 125 ILE A HB   3  
ATOM 4236  H HG12 . ILE A 1 28  ? -0.361  0.228   -0.856  1.00 0.00 ? 125 ILE A HG12 3  
ATOM 4237  H HG13 . ILE A 1 28  ? -1.940  0.447   -1.602  1.00 0.00 ? 125 ILE A HG13 3  
ATOM 4238  H HG21 . ILE A 1 28  ? 0.192   1.776   -3.015  1.00 0.00 ? 125 ILE A HG21 3  
ATOM 4239  H HG22 . ILE A 1 28  ? 1.141   0.689   -4.031  1.00 0.00 ? 125 ILE A HG22 3  
ATOM 4240  H HG23 . ILE A 1 28  ? 1.369   0.687   -2.282  1.00 0.00 ? 125 ILE A HG23 3  
ATOM 4241  H HD11 . ILE A 1 28  ? -1.938  -1.405  -0.030  1.00 0.00 ? 125 ILE A HD11 3  
ATOM 4242  H HD12 . ILE A 1 28  ? -0.657  -2.196  -0.953  1.00 0.00 ? 125 ILE A HD12 3  
ATOM 4243  H HD13 . ILE A 1 28  ? -2.250  -1.962  -1.674  1.00 0.00 ? 125 ILE A HD13 3  
ATOM 4244  N N    . LYS A 1 29  ? -0.754  0.396   -6.325  1.00 0.00 ? 126 LYS A N    3  
ATOM 4245  C CA   . LYS A 1 29  ? -0.114  0.098   -7.595  1.00 0.00 ? 126 LYS A CA   3  
ATOM 4246  C C    . LYS A 1 29  ? 0.873   1.190   -7.985  1.00 0.00 ? 126 LYS A C    3  
ATOM 4247  O O    . LYS A 1 29  ? 0.633   2.380   -7.773  1.00 0.00 ? 126 LYS A O    3  
ATOM 4248  C CB   . LYS A 1 29  ? -1.150  -0.121  -8.696  1.00 0.00 ? 126 LYS A CB   3  
ATOM 4249  C CG   . LYS A 1 29  ? -2.024  1.083   -8.970  1.00 0.00 ? 126 LYS A CG   3  
ATOM 4250  C CD   . LYS A 1 29  ? -3.065  0.766   -10.027 1.00 0.00 ? 126 LYS A CD   3  
ATOM 4251  C CE   . LYS A 1 29  ? -3.914  1.977   -10.361 1.00 0.00 ? 126 LYS A CE   3  
ATOM 4252  N NZ   . LYS A 1 29  ? -3.115  3.054   -11.001 1.00 0.00 ? 126 LYS A NZ   3  
ATOM 4253  H H    . LYS A 1 29  ? -1.134  1.291   -6.170  1.00 0.00 ? 126 LYS A H    3  
ATOM 4254  H HA   . LYS A 1 29  ? 0.438   -0.817  -7.463  1.00 0.00 ? 126 LYS A HA   3  
ATOM 4255  H HB2  . LYS A 1 29  ? -0.636  -0.378  -9.609  1.00 0.00 ? 126 LYS A HB2  3  
ATOM 4256  H HB3  . LYS A 1 29  ? -1.789  -0.944  -8.412  1.00 0.00 ? 126 LYS A HB3  3  
ATOM 4257  H HG2  . LYS A 1 29  ? -2.522  1.370   -8.057  1.00 0.00 ? 126 LYS A HG2  3  
ATOM 4258  H HG3  . LYS A 1 29  ? -1.404  1.894   -9.317  1.00 0.00 ? 126 LYS A HG3  3  
ATOM 4259  H HD2  . LYS A 1 29  ? -2.563  0.434   -10.924 1.00 0.00 ? 126 LYS A HD2  3  
ATOM 4260  H HD3  . LYS A 1 29  ? -3.706  -0.022  -9.660  1.00 0.00 ? 126 LYS A HD3  3  
ATOM 4261  H HE2  . LYS A 1 29  ? -4.701  1.671   -11.035 1.00 0.00 ? 126 LYS A HE2  3  
ATOM 4262  H HE3  . LYS A 1 29  ? -4.352  2.355   -9.449  1.00 0.00 ? 126 LYS A HE3  3  
ATOM 4263  H HZ1  . LYS A 1 29  ? -2.685  2.707   -11.882 1.00 0.00 ? 126 LYS A HZ1  3  
ATOM 4264  H HZ2  . LYS A 1 29  ? -2.361  3.372   -10.362 1.00 0.00 ? 126 LYS A HZ2  3  
ATOM 4265  H HZ3  . LYS A 1 29  ? -3.725  3.867   -11.227 1.00 0.00 ? 126 LYS A HZ3  3  
ATOM 4266  N N    . TRP A 1 30  ? 1.982   0.760   -8.552  1.00 0.00 ? 127 TRP A N    3  
ATOM 4267  C CA   . TRP A 1 30  ? 3.074   1.645   -8.922  1.00 0.00 ? 127 TRP A CA   3  
ATOM 4268  C C    . TRP A 1 30  ? 3.464   1.390   -10.372 1.00 0.00 ? 127 TRP A C    3  
ATOM 4269  O O    . TRP A 1 30  ? 3.222   0.302   -10.900 1.00 0.00 ? 127 TRP A O    3  
ATOM 4270  C CB   . TRP A 1 30  ? 4.273   1.390   -8.002  1.00 0.00 ? 127 TRP A CB   3  
ATOM 4271  C CG   . TRP A 1 30  ? 4.583   -0.067  -7.865  1.00 0.00 ? 127 TRP A CG   3  
ATOM 4272  C CD1  . TRP A 1 30  ? 5.392   -0.813  -8.672  1.00 0.00 ? 127 TRP A CD1  3  
ATOM 4273  C CD2  . TRP A 1 30  ? 4.059   -0.964  -6.878  1.00 0.00 ? 127 TRP A CD2  3  
ATOM 4274  N NE1  . TRP A 1 30  ? 5.390   -2.121  -8.257  1.00 0.00 ? 127 TRP A NE1  3  
ATOM 4275  C CE2  . TRP A 1 30  ? 4.585   -2.236  -7.157  1.00 0.00 ? 127 TRP A CE2  3  
ATOM 4276  C CE3  . TRP A 1 30  ? 3.194   -0.818  -5.784  1.00 0.00 ? 127 TRP A CE3  3  
ATOM 4277  C CZ2  . TRP A 1 30  ? 4.273   -3.352  -6.394  1.00 0.00 ? 127 TRP A CZ2  3  
ATOM 4278  C CZ3  . TRP A 1 30  ? 2.889   -1.930  -5.028  1.00 0.00 ? 127 TRP A CZ3  3  
ATOM 4279  C CH2  . TRP A 1 30  ? 3.426   -3.183  -5.337  1.00 0.00 ? 127 TRP A CH2  3  
ATOM 4280  H H    . TRP A 1 30  ? 2.071   -0.201  -8.740  1.00 0.00 ? 127 TRP A H    3  
ATOM 4281  H HA   . TRP A 1 30  ? 2.744   2.665   -8.810  1.00 0.00 ? 127 TRP A HA   3  
ATOM 4282  H HB2  . TRP A 1 30  ? 5.145   1.885   -8.404  1.00 0.00 ? 127 TRP A HB2  3  
ATOM 4283  H HB3  . TRP A 1 30  ? 4.059   1.781   -7.019  1.00 0.00 ? 127 TRP A HB3  3  
ATOM 4284  H HD1  . TRP A 1 30  ? 5.938   -0.421  -9.517  1.00 0.00 ? 127 TRP A HD1  3  
ATOM 4285  H HE1  . TRP A 1 30  ? 5.886   -2.853  -8.677  1.00 0.00 ? 127 TRP A HE1  3  
ATOM 4286  H HE3  . TRP A 1 30  ? 2.773   0.141   -5.522  1.00 0.00 ? 127 TRP A HE3  3  
ATOM 4287  H HZ2  . TRP A 1 30  ? 4.676   -4.325  -6.624  1.00 0.00 ? 127 TRP A HZ2  3  
ATOM 4288  H HZ3  . TRP A 1 30  ? 2.221   -1.840  -4.183  1.00 0.00 ? 127 TRP A HZ3  3  
ATOM 4289  H HH2  . TRP A 1 30  ? 3.158   -4.024  -4.720  1.00 0.00 ? 127 TRP A HH2  3  
ATOM 4290  N N    . SER A 1 31  ? 4.050   2.384   -11.013 1.00 0.00 ? 128 SER A N    3  
ATOM 4291  C CA   . SER A 1 31  ? 4.500   2.234   -12.382 1.00 0.00 ? 128 SER A CA   3  
ATOM 4292  C C    . SER A 1 31  ? 5.877   1.575   -12.396 1.00 0.00 ? 128 SER A C    3  
ATOM 4293  O O    . SER A 1 31  ? 6.776   1.988   -11.656 1.00 0.00 ? 128 SER A O    3  
ATOM 4294  C CB   . SER A 1 31  ? 4.543   3.598   -13.076 1.00 0.00 ? 128 SER A CB   3  
ATOM 4295  O OG   . SER A 1 31  ? 4.808   3.467   -14.464 1.00 0.00 ? 128 SER A OG   3  
ATOM 4296  H H    . SER A 1 31  ? 4.195   3.241   -10.552 1.00 0.00 ? 128 SER A H    3  
ATOM 4297  H HA   . SER A 1 31  ? 3.797   1.596   -12.896 1.00 0.00 ? 128 SER A HA   3  
ATOM 4298  H HB2  . SER A 1 31  ? 3.591   4.090   -12.952 1.00 0.00 ? 128 SER A HB2  3  
ATOM 4299  H HB3  . SER A 1 31  ? 5.320   4.202   -12.629 1.00 0.00 ? 128 SER A HB3  3  
ATOM 4300  H HG   . SER A 1 31  ? 5.462   4.126   -14.729 1.00 0.00 ? 128 SER A HG   3  
ATOM 4301  N N    . PRO A 1 32  ? 6.045   0.523   -13.219 1.00 0.00 ? 129 PRO A N    3  
ATOM 4302  C CA   . PRO A 1 32  ? 7.305   -0.221  -13.319 1.00 0.00 ? 129 PRO A CA   3  
ATOM 4303  C C    . PRO A 1 32  ? 8.492   0.682   -13.635 1.00 0.00 ? 129 PRO A C    3  
ATOM 4304  O O    . PRO A 1 32  ? 8.378   1.608   -14.439 1.00 0.00 ? 129 PRO A O    3  
ATOM 4305  C CB   . PRO A 1 32  ? 7.062   -1.187  -14.482 1.00 0.00 ? 129 PRO A CB   3  
ATOM 4306  C CG   . PRO A 1 32  ? 5.584   -1.330  -14.565 1.00 0.00 ? 129 PRO A CG   3  
ATOM 4307  C CD   . PRO A 1 32  ? 5.012   -0.016  -14.122 1.00 0.00 ? 129 PRO A CD   3  
ATOM 4308  H HA   . PRO A 1 32  ? 7.508   -0.781  -12.418 1.00 0.00 ? 129 PRO A HA   3  
ATOM 4309  H HB2  . PRO A 1 32  ? 7.470   -0.768  -15.391 1.00 0.00 ? 129 PRO A HB2  3  
ATOM 4310  H HB3  . PRO A 1 32  ? 7.539   -2.133  -14.272 1.00 0.00 ? 129 PRO A HB3  3  
ATOM 4311  H HG2  . PRO A 1 32  ? 5.293   -1.540  -15.583 1.00 0.00 ? 129 PRO A HG2  3  
ATOM 4312  H HG3  . PRO A 1 32  ? 5.255   -2.122  -13.909 1.00 0.00 ? 129 PRO A HG3  3  
ATOM 4313  H HD2  . PRO A 1 32  ? 4.862   0.636   -14.971 1.00 0.00 ? 129 PRO A HD2  3  
ATOM 4314  H HD3  . PRO A 1 32  ? 4.083   -0.172  -13.595 1.00 0.00 ? 129 PRO A HD3  3  
ATOM 4315  N N    . PRO A 1 33  ? 9.643   0.428   -12.985 1.00 0.00 ? 130 PRO A N    3  
ATOM 4316  C CA   . PRO A 1 33  ? 10.884  1.166   -13.240 1.00 0.00 ? 130 PRO A CA   3  
ATOM 4317  C C    . PRO A 1 33  ? 11.206  1.241   -14.731 1.00 0.00 ? 130 PRO A C    3  
ATOM 4318  O O    . PRO A 1 33  ? 11.179  0.223   -15.424 1.00 0.00 ? 130 PRO A O    3  
ATOM 4319  C CB   . PRO A 1 33  ? 11.939  0.349   -12.493 1.00 0.00 ? 130 PRO A CB   3  
ATOM 4320  C CG   . PRO A 1 33  ? 11.190  -0.325  -11.399 1.00 0.00 ? 130 PRO A CG   3  
ATOM 4321  C CD   . PRO A 1 33  ? 9.817   -0.599  -11.944 1.00 0.00 ? 130 PRO A CD   3  
ATOM 4322  H HA   . PRO A 1 33  ? 10.839  2.165   -12.831 1.00 0.00 ? 130 PRO A HA   3  
ATOM 4323  H HB2  . PRO A 1 33  ? 12.387  -0.367  -13.166 1.00 0.00 ? 130 PRO A HB2  3  
ATOM 4324  H HB3  . PRO A 1 33  ? 12.699  1.007   -12.099 1.00 0.00 ? 130 PRO A HB3  3  
ATOM 4325  H HG2  . PRO A 1 33  ? 11.681  -1.251  -11.135 1.00 0.00 ? 130 PRO A HG2  3  
ATOM 4326  H HG3  . PRO A 1 33  ? 11.130  0.326   -10.540 1.00 0.00 ? 130 PRO A HG3  3  
ATOM 4327  H HD2  . PRO A 1 33  ? 9.771   -1.589  -12.369 1.00 0.00 ? 130 PRO A HD2  3  
ATOM 4328  H HD3  . PRO A 1 33  ? 9.075   -0.487  -11.166 1.00 0.00 ? 130 PRO A HD3  3  
ATOM 4329  N N    . THR A 1 34  ? 11.483  2.443   -15.217 1.00 0.00 ? 131 THR A N    3  
ATOM 4330  C CA   . THR A 1 34  ? 11.543  2.708   -16.650 1.00 0.00 ? 131 THR A CA   3  
ATOM 4331  C C    . THR A 1 34  ? 12.526  1.810   -17.405 1.00 0.00 ? 131 THR A C    3  
ATOM 4332  O O    . THR A 1 34  ? 12.110  0.965   -18.205 1.00 0.00 ? 131 THR A O    3  
ATOM 4333  C CB   . THR A 1 34  ? 11.881  4.185   -16.914 1.00 0.00 ? 131 THR A CB   3  
ATOM 4334  O OG1  . THR A 1 34  ? 12.551  4.748   -15.774 1.00 0.00 ? 131 THR A OG1  3  
ATOM 4335  C CG2  . THR A 1 34  ? 10.622  4.982   -17.214 1.00 0.00 ? 131 THR A CG2  3  
ATOM 4336  H H    . THR A 1 34  ? 11.654  3.179   -14.595 1.00 0.00 ? 131 THR A H    3  
ATOM 4337  H HA   . THR A 1 34  ? 10.555  2.529   -17.047 1.00 0.00 ? 131 THR A HA   3  
ATOM 4338  H HB   . THR A 1 34  ? 12.537  4.240   -17.772 1.00 0.00 ? 131 THR A HB   3  
ATOM 4339  H HG1  . THR A 1 34  ? 13.364  4.242   -15.588 1.00 0.00 ? 131 THR A HG1  3  
ATOM 4340  H HG21 . THR A 1 34  ? 10.885  6.012   -17.402 1.00 0.00 ? 131 THR A HG21 3  
ATOM 4341  H HG22 . THR A 1 34  ? 9.953   4.930   -16.368 1.00 0.00 ? 131 THR A HG22 3  
ATOM 4342  H HG23 . THR A 1 34  ? 10.134  4.570   -18.084 1.00 0.00 ? 131 THR A HG23 3  
ATOM 4343  N N    . LEU A 1 35  ? 13.816  1.984   -17.152 1.00 0.00 ? 132 LEU A N    3  
ATOM 4344  C CA   . LEU A 1 35  ? 14.837  1.289   -17.919 1.00 0.00 ? 132 LEU A CA   3  
ATOM 4345  C C    . LEU A 1 35  ? 15.405  0.101   -17.165 1.00 0.00 ? 132 LEU A C    3  
ATOM 4346  O O    . LEU A 1 35  ? 16.478  0.173   -16.566 1.00 0.00 ? 132 LEU A O    3  
ATOM 4347  C CB   . LEU A 1 35  ? 15.974  2.228   -18.285 1.00 0.00 ? 132 LEU A CB   3  
ATOM 4348  C CG   . LEU A 1 35  ? 15.590  3.419   -19.163 1.00 0.00 ? 132 LEU A CG   3  
ATOM 4349  C CD1  . LEU A 1 35  ? 16.797  4.311   -19.410 1.00 0.00 ? 132 LEU A CD1  3  
ATOM 4350  C CD2  . LEU A 1 35  ? 15.008  2.940   -20.481 1.00 0.00 ? 132 LEU A CD2  3  
ATOM 4351  H H    . LEU A 1 35  ? 14.091  2.587   -16.420 1.00 0.00 ? 132 LEU A H    3  
ATOM 4352  H HA   . LEU A 1 35  ? 14.378  0.931   -18.829 1.00 0.00 ? 132 LEU A HA   3  
ATOM 4353  H HB2  . LEU A 1 35  ? 16.402  2.602   -17.369 1.00 0.00 ? 132 LEU A HB2  3  
ATOM 4354  H HB3  . LEU A 1 35  ? 16.720  1.650   -18.803 1.00 0.00 ? 132 LEU A HB3  3  
ATOM 4355  H HG   . LEU A 1 35  ? 14.838  4.005   -18.656 1.00 0.00 ? 132 LEU A HG   3  
ATOM 4356  H HD11 . LEU A 1 35  ? 17.572  3.741   -19.903 1.00 0.00 ? 132 LEU A HD11 3  
ATOM 4357  H HD12 . LEU A 1 35  ? 17.168  4.683   -18.468 1.00 0.00 ? 132 LEU A HD12 3  
ATOM 4358  H HD13 . LEU A 1 35  ? 16.508  5.141   -20.037 1.00 0.00 ? 132 LEU A HD13 3  
ATOM 4359  H HD21 . LEU A 1 35  ? 14.102  2.385   -20.294 1.00 0.00 ? 132 LEU A HD21 3  
ATOM 4360  H HD22 . LEU A 1 35  ? 15.724  2.305   -20.982 1.00 0.00 ? 132 LEU A HD22 3  
ATOM 4361  H HD23 . LEU A 1 35  ? 14.787  3.792   -21.104 1.00 0.00 ? 132 LEU A HD23 3  
ATOM 4362  N N    . ILE A 1 36  ? 14.680  -0.988  -17.203 1.00 0.00 ? 133 ILE A N    3  
ATOM 4363  C CA   . ILE A 1 36  ? 15.169  -2.242  -16.660 1.00 0.00 ? 133 ILE A CA   3  
ATOM 4364  C C    . ILE A 1 36  ? 15.744  -3.073  -17.791 1.00 0.00 ? 133 ILE A C    3  
ATOM 4365  O O    . ILE A 1 36  ? 16.920  -3.433  -17.776 1.00 0.00 ? 133 ILE A O    3  
ATOM 4366  C CB   . ILE A 1 36  ? 14.062  -3.055  -15.966 1.00 0.00 ? 133 ILE A CB   3  
ATOM 4367  C CG1  . ILE A 1 36  ? 13.291  -2.190  -14.971 1.00 0.00 ? 133 ILE A CG1  3  
ATOM 4368  C CG2  . ILE A 1 36  ? 14.674  -4.257  -15.262 1.00 0.00 ? 133 ILE A CG2  3  
ATOM 4369  C CD1  . ILE A 1 36  ? 12.050  -2.863  -14.428 1.00 0.00 ? 133 ILE A CD1  3  
ATOM 4370  H H    . ILE A 1 36  ? 13.801  -0.951  -17.621 1.00 0.00 ? 133 ILE A H    3  
ATOM 4371  H HA   . ILE A 1 36  ? 15.948  -2.025  -15.942 1.00 0.00 ? 133 ILE A HA   3  
ATOM 4372  H HB   . ILE A 1 36  ? 13.384  -3.418  -16.723 1.00 0.00 ? 133 ILE A HB   3  
ATOM 4373  H HG12 . ILE A 1 36  ? 13.933  -1.955  -14.135 1.00 0.00 ? 133 ILE A HG12 3  
ATOM 4374  H HG13 . ILE A 1 36  ? 12.988  -1.274  -15.457 1.00 0.00 ? 133 ILE A HG13 3  
ATOM 4375  H HG21 . ILE A 1 36  ? 13.890  -4.855  -14.821 1.00 0.00 ? 133 ILE A HG21 3  
ATOM 4376  H HG22 . ILE A 1 36  ? 15.346  -3.917  -14.490 1.00 0.00 ? 133 ILE A HG22 3  
ATOM 4377  H HG23 . ILE A 1 36  ? 15.221  -4.853  -15.980 1.00 0.00 ? 133 ILE A HG23 3  
ATOM 4378  H HD11 . ILE A 1 36  ? 11.369  -3.071  -15.240 1.00 0.00 ? 133 ILE A HD11 3  
ATOM 4379  H HD12 . ILE A 1 36  ? 11.569  -2.213  -13.713 1.00 0.00 ? 133 ILE A HD12 3  
ATOM 4380  H HD13 . ILE A 1 36  ? 12.325  -3.789  -13.944 1.00 0.00 ? 133 ILE A HD13 3  
ATOM 4381  N N    . ASP A 1 37  ? 14.889  -3.350  -18.774 1.00 0.00 ? 134 ASP A N    3  
ATOM 4382  C CA   . ASP A 1 37  ? 15.277  -4.066  -19.985 1.00 0.00 ? 134 ASP A CA   3  
ATOM 4383  C C    . ASP A 1 37  ? 15.879  -5.424  -19.648 1.00 0.00 ? 134 ASP A C    3  
ATOM 4384  O O    . ASP A 1 37  ? 17.098  -5.605  -19.658 1.00 0.00 ? 134 ASP A O    3  
ATOM 4385  C CB   . ASP A 1 37  ? 16.256  -3.230  -20.810 1.00 0.00 ? 134 ASP A CB   3  
ATOM 4386  C CG   . ASP A 1 37  ? 16.453  -3.783  -22.207 1.00 0.00 ? 134 ASP A CG   3  
ATOM 4387  O OD1  . ASP A 1 37  ? 15.509  -3.696  -23.027 1.00 0.00 ? 134 ASP A OD1  3  
ATOM 4388  O OD2  . ASP A 1 37  ? 17.545  -4.309  -22.494 1.00 0.00 ? 134 ASP A OD2  3  
ATOM 4389  H H    . ASP A 1 37  ? 13.954  -3.069  -18.675 1.00 0.00 ? 134 ASP A H    3  
ATOM 4390  H HA   . ASP A 1 37  ? 14.384  -4.225  -20.568 1.00 0.00 ? 134 ASP A HA   3  
ATOM 4391  H HB2  . ASP A 1 37  ? 15.879  -2.223  -20.891 1.00 0.00 ? 134 ASP A HB2  3  
ATOM 4392  H HB3  . ASP A 1 37  ? 17.212  -3.213  -20.309 1.00 0.00 ? 134 ASP A HB3  3  
ATOM 4393  N N    . LEU A 1 38  ? 15.009  -6.380  -19.361 1.00 0.00 ? 135 LEU A N    3  
ATOM 4394  C CA   . LEU A 1 38  ? 15.431  -7.705  -18.926 1.00 0.00 ? 135 LEU A CA   3  
ATOM 4395  C C    . LEU A 1 38  ? 15.742  -8.590  -20.132 1.00 0.00 ? 135 LEU A C    3  
ATOM 4396  O O    . LEU A 1 38  ? 15.232  -9.699  -20.248 1.00 0.00 ? 135 LEU A O    3  
ATOM 4397  C CB   . LEU A 1 38  ? 14.345  -8.371  -18.064 1.00 0.00 ? 135 LEU A CB   3  
ATOM 4398  C CG   . LEU A 1 38  ? 13.866  -7.576  -16.839 1.00 0.00 ? 135 LEU A CG   3  
ATOM 4399  C CD1  . LEU A 1 38  ? 12.831  -6.532  -17.233 1.00 0.00 ? 135 LEU A CD1  3  
ATOM 4400  C CD2  . LEU A 1 38  ? 13.293  -8.511  -15.788 1.00 0.00 ? 135 LEU A CD2  3  
ATOM 4401  H H    . LEU A 1 38  ? 14.051  -6.191  -19.451 1.00 0.00 ? 135 LEU A H    3  
ATOM 4402  H HA   . LEU A 1 38  ? 16.328  -7.592  -18.335 1.00 0.00 ? 135 LEU A HA   3  
ATOM 4403  H HB2  . LEU A 1 38  ? 13.489  -8.561  -18.695 1.00 0.00 ? 135 LEU A HB2  3  
ATOM 4404  H HB3  . LEU A 1 38  ? 14.727  -9.320  -17.718 1.00 0.00 ? 135 LEU A HB3  3  
ATOM 4405  H HG   . LEU A 1 38  ? 14.709  -7.061  -16.404 1.00 0.00 ? 135 LEU A HG   3  
ATOM 4406  H HD11 . LEU A 1 38  ? 12.431  -6.069  -16.344 1.00 0.00 ? 135 LEU A HD11 3  
ATOM 4407  H HD12 . LEU A 1 38  ? 12.034  -7.005  -17.785 1.00 0.00 ? 135 LEU A HD12 3  
ATOM 4408  H HD13 . LEU A 1 38  ? 13.297  -5.778  -17.850 1.00 0.00 ? 135 LEU A HD13 3  
ATOM 4409  H HD21 . LEU A 1 38  ? 12.973  -7.935  -14.931 1.00 0.00 ? 135 LEU A HD21 3  
ATOM 4410  H HD22 . LEU A 1 38  ? 14.051  -9.219  -15.484 1.00 0.00 ? 135 LEU A HD22 3  
ATOM 4411  H HD23 . LEU A 1 38  ? 12.450  -9.042  -16.201 1.00 0.00 ? 135 LEU A HD23 3  
ATOM 4412  N N    . LYS A 1 39  ? 16.571  -8.081  -21.032 1.00 0.00 ? 136 LYS A N    3  
ATOM 4413  C CA   . LYS A 1 39  ? 16.921  -8.805  -22.249 1.00 0.00 ? 136 LYS A CA   3  
ATOM 4414  C C    . LYS A 1 39  ? 18.291  -9.448  -22.097 1.00 0.00 ? 136 LYS A C    3  
ATOM 4415  O O    . LYS A 1 39  ? 18.535  -10.551 -22.584 1.00 0.00 ? 136 LYS A O    3  
ATOM 4416  C CB   . LYS A 1 39  ? 16.931  -7.852  -23.446 1.00 0.00 ? 136 LYS A CB   3  
ATOM 4417  C CG   . LYS A 1 39  ? 15.776  -6.874  -23.465 1.00 0.00 ? 136 LYS A CG   3  
ATOM 4418  C CD   . LYS A 1 39  ? 14.529  -7.470  -24.082 1.00 0.00 ? 136 LYS A CD   3  
ATOM 4419  C CE   . LYS A 1 39  ? 13.401  -6.465  -24.069 1.00 0.00 ? 136 LYS A CE   3  
ATOM 4420  N NZ   . LYS A 1 39  ? 13.769  -5.203  -24.766 1.00 0.00 ? 136 LYS A NZ   3  
ATOM 4421  H H    . LYS A 1 39  ? 16.960  -7.193  -20.872 1.00 0.00 ? 136 LYS A H    3  
ATOM 4422  H HA   . LYS A 1 39  ? 16.188  -9.579  -22.409 1.00 0.00 ? 136 LYS A HA   3  
ATOM 4423  H HB2  . LYS A 1 39  ? 17.848  -7.287  -23.438 1.00 0.00 ? 136 LYS A HB2  3  
ATOM 4424  H HB3  . LYS A 1 39  ? 16.883  -8.435  -24.353 1.00 0.00 ? 136 LYS A HB3  3  
ATOM 4425  H HG2  . LYS A 1 39  ? 15.554  -6.581  -22.450 1.00 0.00 ? 136 LYS A HG2  3  
ATOM 4426  H HG3  . LYS A 1 39  ? 16.067  -6.004  -24.035 1.00 0.00 ? 136 LYS A HG3  3  
ATOM 4427  H HD2  . LYS A 1 39  ? 14.738  -7.752  -25.103 1.00 0.00 ? 136 LYS A HD2  3  
ATOM 4428  H HD3  . LYS A 1 39  ? 14.230  -8.340  -23.517 1.00 0.00 ? 136 LYS A HD3  3  
ATOM 4429  H HE2  . LYS A 1 39  ? 12.544  -6.901  -24.556 1.00 0.00 ? 136 LYS A HE2  3  
ATOM 4430  H HE3  . LYS A 1 39  ? 13.158  -6.240  -23.043 1.00 0.00 ? 136 LYS A HE3  3  
ATOM 4431  H HZ1  . LYS A 1 39  ? 12.952  -4.560  -24.801 1.00 0.00 ? 136 LYS A HZ1  3  
ATOM 4432  H HZ2  . LYS A 1 39  ? 14.076  -5.407  -25.741 1.00 0.00 ? 136 LYS A HZ2  3  
ATOM 4433  H HZ3  . LYS A 1 39  ? 14.549  -4.725  -24.262 1.00 0.00 ? 136 LYS A HZ3  3  
ATOM 4434  N N    . THR A 1 40  ? 19.189  -8.744  -21.427 1.00 0.00 ? 137 THR A N    3  
ATOM 4435  C CA   . THR A 1 40  ? 20.506  -9.276  -21.137 1.00 0.00 ? 137 THR A CA   3  
ATOM 4436  C C    . THR A 1 40  ? 20.442  -10.178 -19.913 1.00 0.00 ? 137 THR A C    3  
ATOM 4437  O O    . THR A 1 40  ? 20.849  -11.341 -19.953 1.00 0.00 ? 137 THR A O    3  
ATOM 4438  C CB   . THR A 1 40  ? 21.524  -8.143  -20.906 1.00 0.00 ? 137 THR A CB   3  
ATOM 4439  O OG1  . THR A 1 40  ? 20.980  -7.177  -19.996 1.00 0.00 ? 137 THR A OG1  3  
ATOM 4440  C CG2  . THR A 1 40  ? 21.888  -7.466  -22.219 1.00 0.00 ? 137 THR A CG2  3  
ATOM 4441  H H    . THR A 1 40  ? 18.960  -7.844  -21.114 1.00 0.00 ? 137 THR A H    3  
ATOM 4442  H HA   . THR A 1 40  ? 20.828  -9.858  -21.989 1.00 0.00 ? 137 THR A HA   3  
ATOM 4443  H HB   . THR A 1 40  ? 22.419  -8.566  -20.475 1.00 0.00 ? 137 THR A HB   3  
ATOM 4444  H HG1  . THR A 1 40  ? 20.973  -6.307  -20.416 1.00 0.00 ? 137 THR A HG1  3  
ATOM 4445  H HG21 . THR A 1 40  ? 20.999  -7.051  -22.668 1.00 0.00 ? 137 THR A HG21 3  
ATOM 4446  H HG22 . THR A 1 40  ? 22.325  -8.192  -22.888 1.00 0.00 ? 137 THR A HG22 3  
ATOM 4447  H HG23 . THR A 1 40  ? 22.600  -6.676  -22.031 1.00 0.00 ? 137 THR A HG23 3  
ATOM 4448  N N    . GLY A 1 41  ? 19.907  -9.631  -18.833 1.00 0.00 ? 138 GLY A N    3  
ATOM 4449  C CA   . GLY A 1 41  ? 19.713  -10.398 -17.627 1.00 0.00 ? 138 GLY A CA   3  
ATOM 4450  C C    . GLY A 1 41  ? 18.272  -10.816 -17.461 1.00 0.00 ? 138 GLY A C    3  
ATOM 4451  O O    . GLY A 1 41  ? 17.414  -9.995  -17.136 1.00 0.00 ? 138 GLY A O    3  
ATOM 4452  H H    . GLY A 1 41  ? 19.645  -8.685  -18.855 1.00 0.00 ? 138 GLY A H    3  
ATOM 4453  H HA2  . GLY A 1 41  ? 20.335  -11.279 -17.666 1.00 0.00 ? 138 GLY A HA2  3  
ATOM 4454  H HA3  . GLY A 1 41  ? 20.003  -9.798  -16.778 1.00 0.00 ? 138 GLY A HA3  3  
ATOM 4455  N N    . TRP A 1 42  ? 17.996  -12.087 -17.694 1.00 0.00 ? 139 TRP A N    3  
ATOM 4456  C CA   . TRP A 1 42  ? 16.642  -12.601 -17.571 1.00 0.00 ? 139 TRP A CA   3  
ATOM 4457  C C    . TRP A 1 42  ? 16.340  -12.974 -16.126 1.00 0.00 ? 139 TRP A C    3  
ATOM 4458  O O    . TRP A 1 42  ? 16.218  -14.151 -15.783 1.00 0.00 ? 139 TRP A O    3  
ATOM 4459  C CB   . TRP A 1 42  ? 16.433  -13.802 -18.495 1.00 0.00 ? 139 TRP A CB   3  
ATOM 4460  C CG   . TRP A 1 42  ? 16.454  -13.437 -19.947 1.00 0.00 ? 139 TRP A CG   3  
ATOM 4461  C CD1  . TRP A 1 42  ? 17.511  -13.532 -20.805 1.00 0.00 ? 139 TRP A CD1  3  
ATOM 4462  C CD2  . TRP A 1 42  ? 15.364  -12.908 -20.711 1.00 0.00 ? 139 TRP A CD2  3  
ATOM 4463  N NE1  . TRP A 1 42  ? 17.143  -13.098 -22.056 1.00 0.00 ? 139 TRP A NE1  3  
ATOM 4464  C CE2  . TRP A 1 42  ? 15.831  -12.707 -22.023 1.00 0.00 ? 139 TRP A CE2  3  
ATOM 4465  C CE3  . TRP A 1 42  ? 14.037  -12.584 -20.413 1.00 0.00 ? 139 TRP A CE3  3  
ATOM 4466  C CZ2  . TRP A 1 42  ? 15.019  -12.198 -23.033 1.00 0.00 ? 139 TRP A CZ2  3  
ATOM 4467  C CZ3  . TRP A 1 42  ? 13.232  -12.078 -21.416 1.00 0.00 ? 139 TRP A CZ3  3  
ATOM 4468  C CH2  . TRP A 1 42  ? 13.725  -11.889 -22.713 1.00 0.00 ? 139 TRP A CH2  3  
ATOM 4469  H H    . TRP A 1 42  ? 18.721  -12.698 -17.950 1.00 0.00 ? 139 TRP A H    3  
ATOM 4470  H HA   . TRP A 1 42  ? 15.967  -11.812 -17.870 1.00 0.00 ? 139 TRP A HA   3  
ATOM 4471  H HB2  . TRP A 1 42  ? 17.216  -14.524 -18.320 1.00 0.00 ? 139 TRP A HB2  3  
ATOM 4472  H HB3  . TRP A 1 42  ? 15.477  -14.255 -18.276 1.00 0.00 ? 139 TRP A HB3  3  
ATOM 4473  H HD1  . TRP A 1 42  ? 18.487  -13.901 -20.527 1.00 0.00 ? 139 TRP A HD1  3  
ATOM 4474  H HE1  . TRP A 1 42  ? 17.726  -13.069 -22.842 1.00 0.00 ? 139 TRP A HE1  3  
ATOM 4475  H HE3  . TRP A 1 42  ? 13.638  -12.722 -19.418 1.00 0.00 ? 139 TRP A HE3  3  
ATOM 4476  H HZ2  . TRP A 1 42  ? 15.385  -12.046 -24.038 1.00 0.00 ? 139 TRP A HZ2  3  
ATOM 4477  H HZ3  . TRP A 1 42  ? 12.204  -11.821 -21.204 1.00 0.00 ? 139 TRP A HZ3  3  
ATOM 4478  H HH2  . TRP A 1 42  ? 13.062  -11.491 -23.465 1.00 0.00 ? 139 TRP A HH2  3  
ATOM 4479  N N    . PHE A 1 43  ? 16.239  -11.959 -15.285 1.00 0.00 ? 140 PHE A N    3  
ATOM 4480  C CA   . PHE A 1 43  ? 15.897  -12.151 -13.886 1.00 0.00 ? 140 PHE A CA   3  
ATOM 4481  C C    . PHE A 1 43  ? 14.441  -11.763 -13.664 1.00 0.00 ? 140 PHE A C    3  
ATOM 4482  O O    . PHE A 1 43  ? 13.757  -11.350 -14.599 1.00 0.00 ? 140 PHE A O    3  
ATOM 4483  C CB   . PHE A 1 43  ? 16.822  -11.316 -12.986 1.00 0.00 ? 140 PHE A CB   3  
ATOM 4484  C CG   . PHE A 1 43  ? 16.661  -9.825  -13.138 1.00 0.00 ? 140 PHE A CG   3  
ATOM 4485  C CD1  . PHE A 1 43  ? 17.311  -9.141  -14.153 1.00 0.00 ? 140 PHE A CD1  3  
ATOM 4486  C CD2  . PHE A 1 43  ? 15.865  -9.108  -12.258 1.00 0.00 ? 140 PHE A CD2  3  
ATOM 4487  C CE1  . PHE A 1 43  ? 17.167  -7.774  -14.289 1.00 0.00 ? 140 PHE A CE1  3  
ATOM 4488  C CE2  . PHE A 1 43  ? 15.718  -7.741  -12.389 1.00 0.00 ? 140 PHE A CE2  3  
ATOM 4489  C CZ   . PHE A 1 43  ? 16.369  -7.073  -13.406 1.00 0.00 ? 140 PHE A CZ   3  
ATOM 4490  H H    . PHE A 1 43  ? 16.396  -11.049 -15.619 1.00 0.00 ? 140 PHE A H    3  
ATOM 4491  H HA   . PHE A 1 43  ? 16.023  -13.197 -13.653 1.00 0.00 ? 140 PHE A HA   3  
ATOM 4492  H HB2  . PHE A 1 43  ? 16.623  -11.563 -11.955 1.00 0.00 ? 140 PHE A HB2  3  
ATOM 4493  H HB3  . PHE A 1 43  ? 17.849  -11.562 -13.215 1.00 0.00 ? 140 PHE A HB3  3  
ATOM 4494  H HD1  . PHE A 1 43  ? 17.933  -9.688  -14.846 1.00 0.00 ? 140 PHE A HD1  3  
ATOM 4495  H HD2  . PHE A 1 43  ? 15.355  -9.629  -11.461 1.00 0.00 ? 140 PHE A HD2  3  
ATOM 4496  H HE1  . PHE A 1 43  ? 17.678  -7.254  -15.085 1.00 0.00 ? 140 PHE A HE1  3  
ATOM 4497  H HE2  . PHE A 1 43  ? 15.094  -7.195  -11.697 1.00 0.00 ? 140 PHE A HE2  3  
ATOM 4498  H HZ   . PHE A 1 43  ? 16.255  -6.004  -13.511 1.00 0.00 ? 140 PHE A HZ   3  
ATOM 4499  N N    . THR A 1 44  ? 13.961  -11.900 -12.440 1.00 0.00 ? 141 THR A N    3  
ATOM 4500  C CA   . THR A 1 44  ? 12.609  -11.479 -12.118 1.00 0.00 ? 141 THR A CA   3  
ATOM 4501  C C    . THR A 1 44  ? 12.648  -10.375 -11.073 1.00 0.00 ? 141 THR A C    3  
ATOM 4502  O O    . THR A 1 44  ? 13.311  -10.511 -10.046 1.00 0.00 ? 141 THR A O    3  
ATOM 4503  C CB   . THR A 1 44  ? 11.758  -12.644 -11.591 1.00 0.00 ? 141 THR A CB   3  
ATOM 4504  O OG1  . THR A 1 44  ? 12.034  -13.832 -12.348 1.00 0.00 ? 141 THR A OG1  3  
ATOM 4505  C CG2  . THR A 1 44  ? 10.280  -12.314 -11.695 1.00 0.00 ? 141 THR A CG2  3  
ATOM 4506  H H    . THR A 1 44  ? 14.530  -12.279 -11.734 1.00 0.00 ? 141 THR A H    3  
ATOM 4507  H HA   . THR A 1 44  ? 12.151  -11.097 -13.019 1.00 0.00 ? 141 THR A HA   3  
ATOM 4508  H HB   . THR A 1 44  ? 12.000  -12.810 -10.555 1.00 0.00 ? 141 THR A HB   3  
ATOM 4509  H HG1  . THR A 1 44  ? 12.821  -13.690 -12.894 1.00 0.00 ? 141 THR A HG1  3  
ATOM 4510  H HG21 . THR A 1 44  ? 9.697   -13.138 -11.311 1.00 0.00 ? 141 THR A HG21 3  
ATOM 4511  H HG22 . THR A 1 44  ? 10.022  -12.141 -12.729 1.00 0.00 ? 141 THR A HG22 3  
ATOM 4512  H HG23 . THR A 1 44  ? 10.069  -11.425 -11.119 1.00 0.00 ? 141 THR A HG23 3  
ATOM 4513  N N    . LEU A 1 45  ? 11.952  -9.285  -11.338 1.00 0.00 ? 142 LEU A N    3  
ATOM 4514  C CA   . LEU A 1 45  ? 11.957  -8.148  -10.434 1.00 0.00 ? 142 LEU A CA   3  
ATOM 4515  C C    . LEU A 1 45  ? 10.814  -8.257  -9.436  1.00 0.00 ? 142 LEU A C    3  
ATOM 4516  O O    . LEU A 1 45  ? 9.642   -8.249  -9.812  1.00 0.00 ? 142 LEU A O    3  
ATOM 4517  C CB   . LEU A 1 45  ? 11.860  -6.835  -11.214 1.00 0.00 ? 142 LEU A CB   3  
ATOM 4518  C CG   . LEU A 1 45  ? 11.952  -5.572  -10.362 1.00 0.00 ? 142 LEU A CG   3  
ATOM 4519  C CD1  . LEU A 1 45  ? 13.244  -5.568  -9.570  1.00 0.00 ? 142 LEU A CD1  3  
ATOM 4520  C CD2  . LEU A 1 45  ? 11.864  -4.333  -11.233 1.00 0.00 ? 142 LEU A CD2  3  
ATOM 4521  H H    . LEU A 1 45  ? 11.408  -9.250  -12.150 1.00 0.00 ? 142 LEU A H    3  
ATOM 4522  H HA   . LEU A 1 45  ? 12.891  -8.165  -9.892  1.00 0.00 ? 142 LEU A HA   3  
ATOM 4523  H HB2  . LEU A 1 45  ? 12.660  -6.812  -11.938 1.00 0.00 ? 142 LEU A HB2  3  
ATOM 4524  H HB3  . LEU A 1 45  ? 10.918  -6.819  -11.739 1.00 0.00 ? 142 LEU A HB3  3  
ATOM 4525  H HG   . LEU A 1 45  ? 11.129  -5.553  -9.662  1.00 0.00 ? 142 LEU A HG   3  
ATOM 4526  H HD11 . LEU A 1 45  ? 13.405  -4.587  -9.157  1.00 0.00 ? 142 LEU A HD11 3  
ATOM 4527  H HD12 . LEU A 1 45  ? 14.067  -5.824  -10.221 1.00 0.00 ? 142 LEU A HD12 3  
ATOM 4528  H HD13 . LEU A 1 45  ? 13.180  -6.291  -8.770  1.00 0.00 ? 142 LEU A HD13 3  
ATOM 4529  H HD21 . LEU A 1 45  ? 12.719  -4.296  -11.892 1.00 0.00 ? 142 LEU A HD21 3  
ATOM 4530  H HD22 . LEU A 1 45  ? 11.855  -3.452  -10.608 1.00 0.00 ? 142 LEU A HD22 3  
ATOM 4531  H HD23 . LEU A 1 45  ? 10.959  -4.368  -11.821 1.00 0.00 ? 142 LEU A HD23 3  
ATOM 4532  N N    . LEU A 1 46  ? 11.171  -8.375  -8.168  1.00 0.00 ? 143 LEU A N    3  
ATOM 4533  C CA   . LEU A 1 46  ? 10.192  -8.506  -7.104  1.00 0.00 ? 143 LEU A CA   3  
ATOM 4534  C C    . LEU A 1 46  ? 10.091  -7.216  -6.311  1.00 0.00 ? 143 LEU A C    3  
ATOM 4535  O O    . LEU A 1 46  ? 11.086  -6.512  -6.113  1.00 0.00 ? 143 LEU A O    3  
ATOM 4536  C CB   . LEU A 1 46  ? 10.556  -9.674  -6.182  1.00 0.00 ? 143 LEU A CB   3  
ATOM 4537  C CG   . LEU A 1 46  ? 9.954   -11.030 -6.571  1.00 0.00 ? 143 LEU A CG   3  
ATOM 4538  C CD1  . LEU A 1 46  ? 10.153  -11.314 -8.048  1.00 0.00 ? 143 LEU A CD1  3  
ATOM 4539  C CD2  . LEU A 1 46  ? 10.569  -12.140 -5.737  1.00 0.00 ? 143 LEU A CD2  3  
ATOM 4540  H H    . LEU A 1 46  ? 12.123  -8.368  -7.937  1.00 0.00 ? 143 LEU A H    3  
ATOM 4541  H HA   . LEU A 1 46  ? 9.234   -8.705  -7.561  1.00 0.00 ? 143 LEU A HA   3  
ATOM 4542  H HB2  . LEU A 1 46  ? 11.631  -9.771  -6.170  1.00 0.00 ? 143 LEU A HB2  3  
ATOM 4543  H HB3  . LEU A 1 46  ? 10.222  -9.431  -5.184  1.00 0.00 ? 143 LEU A HB3  3  
ATOM 4544  H HG   . LEU A 1 46  ? 8.892   -11.015 -6.375  1.00 0.00 ? 143 LEU A HG   3  
ATOM 4545  H HD11 . LEU A 1 46  ? 11.209  -11.351 -8.268  1.00 0.00 ? 143 LEU A HD11 3  
ATOM 4546  H HD12 . LEU A 1 46  ? 9.691   -10.525 -8.625  1.00 0.00 ? 143 LEU A HD12 3  
ATOM 4547  H HD13 . LEU A 1 46  ? 9.697   -12.259 -8.299  1.00 0.00 ? 143 LEU A HD13 3  
ATOM 4548  H HD21 . LEU A 1 46  ? 11.638  -12.152 -5.884  1.00 0.00 ? 143 LEU A HD21 3  
ATOM 4549  H HD22 . LEU A 1 46  ? 10.154  -13.090 -6.040  1.00 0.00 ? 143 LEU A HD22 3  
ATOM 4550  H HD23 . LEU A 1 46  ? 10.351  -11.968 -4.695  1.00 0.00 ? 143 LEU A HD23 3  
ATOM 4551  N N    . TYR A 1 47  ? 8.887   -6.911  -5.866  1.00 0.00 ? 144 TYR A N    3  
ATOM 4552  C CA   . TYR A 1 47  ? 8.625   -5.666  -5.159  1.00 0.00 ? 144 TYR A CA   3  
ATOM 4553  C C    . TYR A 1 47  ? 8.248   -5.928  -3.704  1.00 0.00 ? 144 TYR A C    3  
ATOM 4554  O O    . TYR A 1 47  ? 7.910   -7.056  -3.331  1.00 0.00 ? 144 TYR A O    3  
ATOM 4555  C CB   . TYR A 1 47  ? 7.501   -4.889  -5.843  1.00 0.00 ? 144 TYR A CB   3  
ATOM 4556  C CG   . TYR A 1 47  ? 7.780   -4.550  -7.288  1.00 0.00 ? 144 TYR A CG   3  
ATOM 4557  C CD1  . TYR A 1 47  ? 8.461   -3.390  -7.631  1.00 0.00 ? 144 TYR A CD1  3  
ATOM 4558  C CD2  . TYR A 1 47  ? 7.355   -5.388  -8.310  1.00 0.00 ? 144 TYR A CD2  3  
ATOM 4559  C CE1  . TYR A 1 47  ? 8.710   -3.076  -8.952  1.00 0.00 ? 144 TYR A CE1  3  
ATOM 4560  C CE2  . TYR A 1 47  ? 7.599   -5.080  -9.632  1.00 0.00 ? 144 TYR A CE2  3  
ATOM 4561  C CZ   . TYR A 1 47  ? 8.276   -3.924  -9.947  1.00 0.00 ? 144 TYR A CZ   3  
ATOM 4562  O OH   . TYR A 1 47  ? 8.516   -3.610  -11.265 1.00 0.00 ? 144 TYR A OH   3  
ATOM 4563  H H    . TYR A 1 47  ? 8.152   -7.549  -6.012  1.00 0.00 ? 144 TYR A H    3  
ATOM 4564  H HA   . TYR A 1 47  ? 9.531   -5.072  -5.186  1.00 0.00 ? 144 TYR A HA   3  
ATOM 4565  H HB2  . TYR A 1 47  ? 6.597   -5.479  -5.811  1.00 0.00 ? 144 TYR A HB2  3  
ATOM 4566  H HB3  . TYR A 1 47  ? 7.337   -3.964  -5.310  1.00 0.00 ? 144 TYR A HB3  3  
ATOM 4567  H HD1  . TYR A 1 47  ? 8.799   -2.728  -6.847  1.00 0.00 ? 144 TYR A HD1  3  
ATOM 4568  H HD2  . TYR A 1 47  ? 6.824   -6.294  -8.059  1.00 0.00 ? 144 TYR A HD2  3  
ATOM 4569  H HE1  . TYR A 1 47  ? 9.242   -2.169  -9.201  1.00 0.00 ? 144 TYR A HE1  3  
ATOM 4570  H HE2  . TYR A 1 47  ? 7.260   -5.745  -10.414 1.00 0.00 ? 144 TYR A HE2  3  
ATOM 4571  H HH   . TYR A 1 47  ? 9.449   -3.421  -11.384 1.00 0.00 ? 144 TYR A HH   3  
ATOM 4572  N N    . GLU A 1 48  ? 8.284   -4.877  -2.898  1.00 0.00 ? 145 GLU A N    3  
ATOM 4573  C CA   . GLU A 1 48  ? 7.984   -4.977  -1.477  1.00 0.00 ? 145 GLU A CA   3  
ATOM 4574  C C    . GLU A 1 48  ? 7.481   -3.628  -0.965  1.00 0.00 ? 145 GLU A C    3  
ATOM 4575  O O    . GLU A 1 48  ? 7.998   -2.581  -1.360  1.00 0.00 ? 145 GLU A O    3  
ATOM 4576  C CB   . GLU A 1 48  ? 9.242   -5.418  -0.736  1.00 0.00 ? 145 GLU A CB   3  
ATOM 4577  C CG   . GLU A 1 48  ? 9.063   -5.662  0.750   1.00 0.00 ? 145 GLU A CG   3  
ATOM 4578  C CD   . GLU A 1 48  ? 10.328  -6.202  1.379   1.00 0.00 ? 145 GLU A CD   3  
ATOM 4579  O OE1  . GLU A 1 48  ? 11.368  -5.517  1.310   1.00 0.00 ? 145 GLU A OE1  3  
ATOM 4580  O OE2  . GLU A 1 48  ? 10.299  -7.330  1.917   1.00 0.00 ? 145 GLU A OE2  3  
ATOM 4581  H H    . GLU A 1 48  ? 8.518   -3.999  -3.269  1.00 0.00 ? 145 GLU A H    3  
ATOM 4582  H HA   . GLU A 1 48  ? 7.209   -5.719  -1.346  1.00 0.00 ? 145 GLU A HA   3  
ATOM 4583  H HB2  . GLU A 1 48  ? 9.599   -6.333  -1.181  1.00 0.00 ? 145 GLU A HB2  3  
ATOM 4584  H HB3  . GLU A 1 48  ? 9.997   -4.656  -0.861  1.00 0.00 ? 145 GLU A HB3  3  
ATOM 4585  H HG2  . GLU A 1 48  ? 8.804   -4.731  1.231   1.00 0.00 ? 145 GLU A HG2  3  
ATOM 4586  H HG3  . GLU A 1 48  ? 8.268   -6.378  0.895   1.00 0.00 ? 145 GLU A HG3  3  
ATOM 4587  N N    . ILE A 1 49  ? 6.466   -3.656  -0.106  1.00 0.00 ? 146 ILE A N    3  
ATOM 4588  C CA   . ILE A 1 49  ? 5.794   -2.435  0.327   1.00 0.00 ? 146 ILE A CA   3  
ATOM 4589  C C    . ILE A 1 49  ? 5.858   -2.285  1.846   1.00 0.00 ? 146 ILE A C    3  
ATOM 4590  O O    . ILE A 1 49  ? 5.546   -3.216  2.590   1.00 0.00 ? 146 ILE A O    3  
ATOM 4591  C CB   . ILE A 1 49  ? 4.304   -2.402  -0.124  1.00 0.00 ? 146 ILE A CB   3  
ATOM 4592  C CG1  . ILE A 1 49  ? 4.180   -2.566  -1.641  1.00 0.00 ? 146 ILE A CG1  3  
ATOM 4593  C CG2  . ILE A 1 49  ? 3.626   -1.107  0.300   1.00 0.00 ? 146 ILE A CG2  3  
ATOM 4594  C CD1  . ILE A 1 49  ? 4.280   -3.997  -2.112  1.00 0.00 ? 146 ILE A CD1  3  
ATOM 4595  H H    . ILE A 1 49  ? 6.164   -4.521  0.255   1.00 0.00 ? 146 ILE A H    3  
ATOM 4596  H HA   . ILE A 1 49  ? 6.304   -1.598  -0.127  1.00 0.00 ? 146 ILE A HA   3  
ATOM 4597  H HB   . ILE A 1 49  ? 3.791   -3.220  0.358   1.00 0.00 ? 146 ILE A HB   3  
ATOM 4598  H HG12 . ILE A 1 49  ? 3.223   -2.181  -1.960  1.00 0.00 ? 146 ILE A HG12 3  
ATOM 4599  H HG13 . ILE A 1 49  ? 4.967   -2.002  -2.123  1.00 0.00 ? 146 ILE A HG13 3  
ATOM 4600  H HG21 . ILE A 1 49  ? 3.692   -1.000  1.373   1.00 0.00 ? 146 ILE A HG21 3  
ATOM 4601  H HG22 . ILE A 1 49  ? 2.587   -1.135  0.004   1.00 0.00 ? 146 ILE A HG22 3  
ATOM 4602  H HG23 . ILE A 1 49  ? 4.113   -0.271  -0.180  1.00 0.00 ? 146 ILE A HG23 3  
ATOM 4603  H HD11 . ILE A 1 49  ? 4.306   -4.019  -3.190  1.00 0.00 ? 146 ILE A HD11 3  
ATOM 4604  H HD12 . ILE A 1 49  ? 3.423   -4.553  -1.759  1.00 0.00 ? 146 ILE A HD12 3  
ATOM 4605  H HD13 . ILE A 1 49  ? 5.183   -4.441  -1.719  1.00 0.00 ? 146 ILE A HD13 3  
ATOM 4606  N N    . ARG A 1 50  ? 6.273   -1.110  2.290   1.00 0.00 ? 147 ARG A N    3  
ATOM 4607  C CA   . ARG A 1 50  ? 6.315   -0.784  3.706   1.00 0.00 ? 147 ARG A CA   3  
ATOM 4608  C C    . ARG A 1 50  ? 5.215   0.210   4.019   1.00 0.00 ? 147 ARG A C    3  
ATOM 4609  O O    . ARG A 1 50  ? 5.168   1.293   3.436   1.00 0.00 ? 147 ARG A O    3  
ATOM 4610  C CB   . ARG A 1 50  ? 7.675   -0.186  4.082   1.00 0.00 ? 147 ARG A CB   3  
ATOM 4611  C CG   . ARG A 1 50  ? 7.836   0.086   5.567   1.00 0.00 ? 147 ARG A CG   3  
ATOM 4612  C CD   . ARG A 1 50  ? 9.187   0.710   5.893   1.00 0.00 ? 147 ARG A CD   3  
ATOM 4613  N NE   . ARG A 1 50  ? 9.242   2.138   5.566   1.00 0.00 ? 147 ARG A NE   3  
ATOM 4614  C CZ   . ARG A 1 50  ? 10.065  3.008   6.164   1.00 0.00 ? 147 ARG A CZ   3  
ATOM 4615  N NH1  . ARG A 1 50  ? 10.928  2.587   7.079   1.00 0.00 ? 147 ARG A NH1  3  
ATOM 4616  N NH2  . ARG A 1 50  ? 10.026  4.296   5.834   1.00 0.00 ? 147 ARG A NH2  3  
ATOM 4617  H H    . ARG A 1 50  ? 6.543   -0.427  1.636   1.00 0.00 ? 147 ARG A H    3  
ATOM 4618  H HA   . ARG A 1 50  ? 6.145   -1.689  4.273   1.00 0.00 ? 147 ARG A HA   3  
ATOM 4619  H HB2  . ARG A 1 50  ? 8.454   -0.872  3.778   1.00 0.00 ? 147 ARG A HB2  3  
ATOM 4620  H HB3  . ARG A 1 50  ? 7.803   0.745   3.551   1.00 0.00 ? 147 ARG A HB3  3  
ATOM 4621  H HG2  . ARG A 1 50  ? 7.057   0.763   5.881   1.00 0.00 ? 147 ARG A HG2  3  
ATOM 4622  H HG3  . ARG A 1 50  ? 7.741   -0.846  6.104   1.00 0.00 ? 147 ARG A HG3  3  
ATOM 4623  H HD2  . ARG A 1 50  ? 9.376   0.589   6.949   1.00 0.00 ? 147 ARG A HD2  3  
ATOM 4624  H HD3  . ARG A 1 50  ? 9.951   0.193   5.331   1.00 0.00 ? 147 ARG A HD3  3  
ATOM 4625  H HE   . ARG A 1 50  ? 8.628   2.470   4.870   1.00 0.00 ? 147 ARG A HE   3  
ATOM 4626  H HH11 . ARG A 1 50  ? 10.967  1.615   7.326   1.00 0.00 ? 147 ARG A HH11 3  
ATOM 4627  H HH12 . ARG A 1 50  ? 11.548  3.237   7.526   1.00 0.00 ? 147 ARG A HH12 3  
ATOM 4628  H HH21 . ARG A 1 50  ? 9.376   4.621   5.132   1.00 0.00 ? 147 ARG A HH21 3  
ATOM 4629  H HH22 . ARG A 1 50  ? 10.643  4.952   6.276   1.00 0.00 ? 147 ARG A HH22 3  
ATOM 4630  N N    . LEU A 1 51  ? 4.327   -0.160  4.920   1.00 0.00 ? 148 LEU A N    3  
ATOM 4631  C CA   . LEU A 1 51  ? 3.217   0.701   5.270   1.00 0.00 ? 148 LEU A CA   3  
ATOM 4632  C C    . LEU A 1 51  ? 2.833   0.544   6.729   1.00 0.00 ? 148 LEU A C    3  
ATOM 4633  O O    . LEU A 1 51  ? 3.267   -0.391  7.399   1.00 0.00 ? 148 LEU A O    3  
ATOM 4634  C CB   . LEU A 1 51  ? 2.015   0.433   4.353   1.00 0.00 ? 148 LEU A CB   3  
ATOM 4635  C CG   . LEU A 1 51  ? 1.678   -1.036  4.076   1.00 0.00 ? 148 LEU A CG   3  
ATOM 4636  C CD1  . LEU A 1 51  ? 1.093   -1.718  5.303   1.00 0.00 ? 148 LEU A CD1  3  
ATOM 4637  C CD2  . LEU A 1 51  ? 0.719   -1.128  2.905   1.00 0.00 ? 148 LEU A CD2  3  
ATOM 4638  H H    . LEU A 1 51  ? 4.422   -1.030  5.369   1.00 0.00 ? 148 LEU A H    3  
ATOM 4639  H HA   . LEU A 1 51  ? 3.541   1.718   5.114   1.00 0.00 ? 148 LEU A HA   3  
ATOM 4640  H HB2  . LEU A 1 51  ? 1.147   0.897   4.797   1.00 0.00 ? 148 LEU A HB2  3  
ATOM 4641  H HB3  . LEU A 1 51  ? 2.208   0.914   3.406   1.00 0.00 ? 148 LEU A HB3  3  
ATOM 4642  H HG   . LEU A 1 51  ? 2.582   -1.558  3.805   1.00 0.00 ? 148 LEU A HG   3  
ATOM 4643  H HD11 . LEU A 1 51  ? 1.818   -1.699  6.103   1.00 0.00 ? 148 LEU A HD11 3  
ATOM 4644  H HD12 . LEU A 1 51  ? 0.851   -2.743  5.063   1.00 0.00 ? 148 LEU A HD12 3  
ATOM 4645  H HD13 . LEU A 1 51  ? 0.200   -1.198  5.612   1.00 0.00 ? 148 LEU A HD13 3  
ATOM 4646  H HD21 . LEU A 1 51  ? -0.179  -0.569  3.132   1.00 0.00 ? 148 LEU A HD21 3  
ATOM 4647  H HD22 . LEU A 1 51  ? 0.466   -2.162  2.730   1.00 0.00 ? 148 LEU A HD22 3  
ATOM 4648  H HD23 . LEU A 1 51  ? 1.187   -0.716  2.024   1.00 0.00 ? 148 LEU A HD23 3  
ATOM 4649  N N    . LYS A 1 52  ? 2.036   1.480   7.213   1.00 0.00 ? 149 LYS A N    3  
ATOM 4650  C CA   . LYS A 1 52  ? 1.526   1.438   8.574   1.00 0.00 ? 149 LYS A CA   3  
ATOM 4651  C C    . LYS A 1 52  ? 0.497   2.542   8.772   1.00 0.00 ? 149 LYS A C    3  
ATOM 4652  O O    . LYS A 1 52  ? 0.561   3.583   8.112   1.00 0.00 ? 149 LYS A O    3  
ATOM 4653  C CB   . LYS A 1 52  ? 2.664   1.606   9.593   1.00 0.00 ? 149 LYS A CB   3  
ATOM 4654  C CG   . LYS A 1 52  ? 3.230   3.016   9.667   1.00 0.00 ? 149 LYS A CG   3  
ATOM 4655  C CD   . LYS A 1 52  ? 4.286   3.131   10.750  1.00 0.00 ? 149 LYS A CD   3  
ATOM 4656  C CE   . LYS A 1 52  ? 4.773   4.558   10.915  1.00 0.00 ? 149 LYS A CE   3  
ATOM 4657  N NZ   . LYS A 1 52  ? 3.692   5.468   11.379  1.00 0.00 ? 149 LYS A NZ   3  
ATOM 4658  H H    . LYS A 1 52  ? 1.782   2.232   6.633   1.00 0.00 ? 149 LYS A H    3  
ATOM 4659  H HA   . LYS A 1 52  ? 1.051   0.482   8.726   1.00 0.00 ? 149 LYS A HA   3  
ATOM 4660  H HB2  . LYS A 1 52  ? 2.295   1.340   10.572  1.00 0.00 ? 149 LYS A HB2  3  
ATOM 4661  H HB3  . LYS A 1 52  ? 3.468   0.934   9.329   1.00 0.00 ? 149 LYS A HB3  3  
ATOM 4662  H HG2  . LYS A 1 52  ? 3.677   3.265   8.716   1.00 0.00 ? 149 LYS A HG2  3  
ATOM 4663  H HG3  . LYS A 1 52  ? 2.428   3.707   9.883   1.00 0.00 ? 149 LYS A HG3  3  
ATOM 4664  H HD2  . LYS A 1 52  ? 3.865   2.796   11.686  1.00 0.00 ? 149 LYS A HD2  3  
ATOM 4665  H HD3  . LYS A 1 52  ? 5.127   2.503   10.488  1.00 0.00 ? 149 LYS A HD3  3  
ATOM 4666  H HE2  . LYS A 1 52  ? 5.575   4.570   11.638  1.00 0.00 ? 149 LYS A HE2  3  
ATOM 4667  H HE3  . LYS A 1 52  ? 5.144   4.910   9.963   1.00 0.00 ? 149 LYS A HE3  3  
ATOM 4668  H HZ1  . LYS A 1 52  ? 4.067   6.430   11.508  1.00 0.00 ? 149 LYS A HZ1  3  
ATOM 4669  H HZ2  . LYS A 1 52  ? 3.310   5.133   12.291  1.00 0.00 ? 149 LYS A HZ2  3  
ATOM 4670  H HZ3  . LYS A 1 52  ? 2.924   5.499   10.684  1.00 0.00 ? 149 LYS A HZ3  3  
ATOM 4671  N N    . PRO A 1 53  ? -0.485  2.317   9.653   1.00 0.00 ? 150 PRO A N    3  
ATOM 4672  C CA   . PRO A 1 53  ? -1.433  3.355   10.048  1.00 0.00 ? 150 PRO A CA   3  
ATOM 4673  C C    . PRO A 1 53  ? -0.763  4.407   10.927  1.00 0.00 ? 150 PRO A C    3  
ATOM 4674  O O    . PRO A 1 53  ? 0.313   4.181   11.484  1.00 0.00 ? 150 PRO A O    3  
ATOM 4675  C CB   . PRO A 1 53  ? -2.501  2.590   10.836  1.00 0.00 ? 150 PRO A CB   3  
ATOM 4676  C CG   . PRO A 1 53  ? -1.808  1.373   11.340  1.00 0.00 ? 150 PRO A CG   3  
ATOM 4677  C CD   . PRO A 1 53  ? -0.762  1.029   10.317  1.00 0.00 ? 150 PRO A CD   3  
ATOM 4678  H HA   . PRO A 1 53  ? -1.879  3.832   9.191   1.00 0.00 ? 150 PRO A HA   3  
ATOM 4679  H HB2  . PRO A 1 53  ? -2.860  3.206   11.648  1.00 0.00 ? 150 PRO A HB2  3  
ATOM 4680  H HB3  . PRO A 1 53  ? -3.320  2.335   10.181  1.00 0.00 ? 150 PRO A HB3  3  
ATOM 4681  H HG2  . PRO A 1 53  ? -1.344  1.586   12.291  1.00 0.00 ? 150 PRO A HG2  3  
ATOM 4682  H HG3  . PRO A 1 53  ? -2.515  0.564   11.440  1.00 0.00 ? 150 PRO A HG3  3  
ATOM 4683  H HD2  . PRO A 1 53  ? 0.125   0.647   10.800  1.00 0.00 ? 150 PRO A HD2  3  
ATOM 4684  H HD3  . PRO A 1 53  ? -1.148  0.308   9.612   1.00 0.00 ? 150 PRO A HD3  3  
ATOM 4685  N N    . GLU A 1 54  ? -1.409  5.557   11.042  1.00 0.00 ? 151 GLU A N    3  
ATOM 4686  C CA   . GLU A 1 54  ? -0.871  6.685   11.794  1.00 0.00 ? 151 GLU A CA   3  
ATOM 4687  C C    . GLU A 1 54  ? -0.810  6.384   13.289  1.00 0.00 ? 151 GLU A C    3  
ATOM 4688  O O    . GLU A 1 54  ? -0.160  7.097   14.048  1.00 0.00 ? 151 GLU A O    3  
ATOM 4689  C CB   . GLU A 1 54  ? -1.733  7.925   11.551  1.00 0.00 ? 151 GLU A CB   3  
ATOM 4690  C CG   . GLU A 1 54  ? -3.155  7.776   12.070  1.00 0.00 ? 151 GLU A CG   3  
ATOM 4691  C CD   . GLU A 1 54  ? -4.024  8.976   11.769  1.00 0.00 ? 151 GLU A CD   3  
ATOM 4692  O OE1  . GLU A 1 54  ? -3.733  10.074  12.287  1.00 0.00 ? 151 GLU A OE1  3  
ATOM 4693  O OE2  . GLU A 1 54  ? -5.019  8.816   11.030  1.00 0.00 ? 151 GLU A OE2  3  
ATOM 4694  H H    . GLU A 1 54  ? -2.272  5.662   10.585  1.00 0.00 ? 151 GLU A H    3  
ATOM 4695  H HA   . GLU A 1 54  ? 0.131   6.873   11.437  1.00 0.00 ? 151 GLU A HA   3  
ATOM 4696  H HB2  . GLU A 1 54  ? -1.277  8.770   12.047  1.00 0.00 ? 151 GLU A HB2  3  
ATOM 4697  H HB3  . GLU A 1 54  ? -1.776  8.120   10.490  1.00 0.00 ? 151 GLU A HB3  3  
ATOM 4698  H HG2  . GLU A 1 54  ? -3.602  6.906   11.612  1.00 0.00 ? 151 GLU A HG2  3  
ATOM 4699  H HG3  . GLU A 1 54  ? -3.119  7.636   13.141  1.00 0.00 ? 151 GLU A HG3  3  
ATOM 4700  N N    . LYS A 1 55  ? -1.500  5.331   13.706  1.00 0.00 ? 152 LYS A N    3  
ATOM 4701  C CA   . LYS A 1 55  ? -1.513  4.932   15.104  1.00 0.00 ? 152 LYS A CA   3  
ATOM 4702  C C    . LYS A 1 55  ? -0.441  3.879   15.357  1.00 0.00 ? 152 LYS A C    3  
ATOM 4703  O O    . LYS A 1 55  ? -0.298  3.366   16.467  1.00 0.00 ? 152 LYS A O    3  
ATOM 4704  C CB   . LYS A 1 55  ? -2.895  4.397   15.481  1.00 0.00 ? 152 LYS A CB   3  
ATOM 4705  C CG   . LYS A 1 55  ? -4.016  5.394   15.232  1.00 0.00 ? 152 LYS A CG   3  
ATOM 4706  C CD   . LYS A 1 55  ? -3.871  6.634   16.098  1.00 0.00 ? 152 LYS A CD   3  
ATOM 4707  C CE   . LYS A 1 55  ? -5.015  7.610   15.870  1.00 0.00 ? 152 LYS A CE   3  
ATOM 4708  N NZ   . LYS A 1 55  ? -4.914  8.797   16.756  1.00 0.00 ? 152 LYS A NZ   3  
ATOM 4709  H H    . LYS A 1 55  ? -2.015  4.812   13.055  1.00 0.00 ? 152 LYS A H    3  
ATOM 4710  H HA   . LYS A 1 55  ? -1.296  5.804   15.701  1.00 0.00 ? 152 LYS A HA   3  
ATOM 4711  H HB2  . LYS A 1 55  ? -3.096  3.508   14.901  1.00 0.00 ? 152 LYS A HB2  3  
ATOM 4712  H HB3  . LYS A 1 55  ? -2.896  4.139   16.530  1.00 0.00 ? 152 LYS A HB3  3  
ATOM 4713  H HG2  . LYS A 1 55  ? -3.994  5.692   14.194  1.00 0.00 ? 152 LYS A HG2  3  
ATOM 4714  H HG3  . LYS A 1 55  ? -4.961  4.923   15.452  1.00 0.00 ? 152 LYS A HG3  3  
ATOM 4715  H HD2  . LYS A 1 55  ? -3.866  6.338   17.137  1.00 0.00 ? 152 LYS A HD2  3  
ATOM 4716  H HD3  . LYS A 1 55  ? -2.939  7.124   15.857  1.00 0.00 ? 152 LYS A HD3  3  
ATOM 4717  H HE2  . LYS A 1 55  ? -4.993  7.936   14.840  1.00 0.00 ? 152 LYS A HE2  3  
ATOM 4718  H HE3  . LYS A 1 55  ? -5.948  7.103   16.065  1.00 0.00 ? 152 LYS A HE3  3  
ATOM 4719  H HZ1  . LYS A 1 55  ? -4.026  9.306   16.574  1.00 0.00 ? 152 LYS A HZ1  3  
ATOM 4720  H HZ2  . LYS A 1 55  ? -4.932  8.503   17.754  1.00 0.00 ? 152 LYS A HZ2  3  
ATOM 4721  H HZ3  . LYS A 1 55  ? -5.709  9.444   16.583  1.00 0.00 ? 152 LYS A HZ3  3  
ATOM 4722  N N    . ALA A 1 56  ? 0.319   3.577   14.316  1.00 0.00 ? 153 ALA A N    3  
ATOM 4723  C CA   . ALA A 1 56  ? 1.398   2.610   14.403  1.00 0.00 ? 153 ALA A CA   3  
ATOM 4724  C C    . ALA A 1 56  ? 2.740   3.323   14.480  1.00 0.00 ? 153 ALA A C    3  
ATOM 4725  O O    . ALA A 1 56  ? 3.021   4.223   13.686  1.00 0.00 ? 153 ALA A O    3  
ATOM 4726  C CB   . ALA A 1 56  ? 1.364   1.687   13.198  1.00 0.00 ? 153 ALA A CB   3  
ATOM 4727  H H    . ALA A 1 56  ? 0.153   4.025   13.458  1.00 0.00 ? 153 ALA A H    3  
ATOM 4728  H HA   . ALA A 1 56  ? 1.255   2.019   15.294  1.00 0.00 ? 153 ALA A HA   3  
ATOM 4729  H HB1  . ALA A 1 56  ? 1.368   2.282   12.292  1.00 0.00 ? 153 ALA A HB1  3  
ATOM 4730  H HB2  . ALA A 1 56  ? 0.467   1.089   13.228  1.00 0.00 ? 153 ALA A HB2  3  
ATOM 4731  H HB3  . ALA A 1 56  ? 2.231   1.043   13.210  1.00 0.00 ? 153 ALA A HB3  3  
ATOM 4732  N N    . ALA A 1 57  ? 3.558   2.925   15.438  1.00 0.00 ? 154 ALA A N    3  
ATOM 4733  C CA   . ALA A 1 57  ? 4.878   3.513   15.607  1.00 0.00 ? 154 ALA A CA   3  
ATOM 4734  C C    . ALA A 1 57  ? 5.899   2.772   14.757  1.00 0.00 ? 154 ALA A C    3  
ATOM 4735  O O    . ALA A 1 57  ? 6.824   3.370   14.202  1.00 0.00 ? 154 ALA A O    3  
ATOM 4736  C CB   . ALA A 1 57  ? 5.287   3.481   17.069  1.00 0.00 ? 154 ALA A CB   3  
ATOM 4737  H H    . ALA A 1 57  ? 3.271   2.211   16.049  1.00 0.00 ? 154 ALA A H    3  
ATOM 4738  H HA   . ALA A 1 57  ? 4.831   4.544   15.287  1.00 0.00 ? 154 ALA A HA   3  
ATOM 4739  H HB1  . ALA A 1 57  ? 4.563   4.024   17.658  1.00 0.00 ? 154 ALA A HB1  3  
ATOM 4740  H HB2  . ALA A 1 57  ? 6.258   3.938   17.181  1.00 0.00 ? 154 ALA A HB2  3  
ATOM 4741  H HB3  . ALA A 1 57  ? 5.330   2.455   17.406  1.00 0.00 ? 154 ALA A HB3  3  
ATOM 4742  N N    . GLU A 1 58  ? 5.708   1.467   14.653  1.00 0.00 ? 155 GLU A N    3  
ATOM 4743  C CA   . GLU A 1 58  ? 6.600   0.617   13.886  1.00 0.00 ? 155 GLU A CA   3  
ATOM 4744  C C    . GLU A 1 58  ? 6.048   0.400   12.483  1.00 0.00 ? 155 GLU A C    3  
ATOM 4745  O O    . GLU A 1 58  ? 4.835   0.421   12.271  1.00 0.00 ? 155 GLU A O    3  
ATOM 4746  C CB   . GLU A 1 58  ? 6.781   -0.727  14.591  1.00 0.00 ? 155 GLU A CB   3  
ATOM 4747  C CG   . GLU A 1 58  ? 5.469   -1.385  14.975  1.00 0.00 ? 155 GLU A CG   3  
ATOM 4748  C CD   . GLU A 1 58  ? 5.644   -2.808  15.452  1.00 0.00 ? 155 GLU A CD   3  
ATOM 4749  O OE1  . GLU A 1 58  ? 5.703   -3.718  14.602  1.00 0.00 ? 155 GLU A OE1  3  
ATOM 4750  O OE2  . GLU A 1 58  ? 5.725   -3.027  16.679  1.00 0.00 ? 155 GLU A OE2  3  
ATOM 4751  H H    . GLU A 1 58  ? 4.933   1.062   15.096  1.00 0.00 ? 155 GLU A H    3  
ATOM 4752  H HA   . GLU A 1 58  ? 7.557   1.113   13.816  1.00 0.00 ? 155 GLU A HA   3  
ATOM 4753  H HB2  . GLU A 1 58  ? 7.316   -1.396  13.932  1.00 0.00 ? 155 GLU A HB2  3  
ATOM 4754  H HB3  . GLU A 1 58  ? 7.362   -0.577  15.489  1.00 0.00 ? 155 GLU A HB3  3  
ATOM 4755  H HG2  . GLU A 1 58  ? 5.015   -0.810  15.769  1.00 0.00 ? 155 GLU A HG2  3  
ATOM 4756  H HG3  . GLU A 1 58  ? 4.816   -1.387  14.115  1.00 0.00 ? 155 GLU A HG3  3  
ATOM 4757  N N    . TRP A 1 59  ? 6.944   0.200   11.532  1.00 0.00 ? 156 TRP A N    3  
ATOM 4758  C CA   . TRP A 1 59  ? 6.560   -0.012  10.146  1.00 0.00 ? 156 TRP A CA   3  
ATOM 4759  C C    . TRP A 1 59  ? 6.252   -1.475  9.878   1.00 0.00 ? 156 TRP A C    3  
ATOM 4760  O O    . TRP A 1 59  ? 6.842   -2.367  10.489  1.00 0.00 ? 156 TRP A O    3  
ATOM 4761  C CB   . TRP A 1 59  ? 7.667   0.464   9.210   1.00 0.00 ? 156 TRP A CB   3  
ATOM 4762  C CG   . TRP A 1 59  ? 7.719   1.951   9.065   1.00 0.00 ? 156 TRP A CG   3  
ATOM 4763  C CD1  . TRP A 1 59  ? 8.526   2.821   9.738   1.00 0.00 ? 156 TRP A CD1  3  
ATOM 4764  C CD2  . TRP A 1 59  ? 6.917   2.742   8.185   1.00 0.00 ? 156 TRP A CD2  3  
ATOM 4765  N NE1  . TRP A 1 59  ? 8.278   4.107   9.322   1.00 0.00 ? 156 TRP A NE1  3  
ATOM 4766  C CE2  . TRP A 1 59  ? 7.294   4.084   8.370   1.00 0.00 ? 156 TRP A CE2  3  
ATOM 4767  C CE3  . TRP A 1 59  ? 5.917   2.443   7.256   1.00 0.00 ? 156 TRP A CE3  3  
ATOM 4768  C CZ2  . TRP A 1 59  ? 6.704   5.125   7.659   1.00 0.00 ? 156 TRP A CZ2  3  
ATOM 4769  C CZ3  . TRP A 1 59  ? 5.335   3.478   6.552   1.00 0.00 ? 156 TRP A CZ3  3  
ATOM 4770  C CH2  . TRP A 1 59  ? 5.730   4.803   6.756   1.00 0.00 ? 156 TRP A CH2  3  
ATOM 4771  H H    . TRP A 1 59  ? 7.895   0.182   11.771  1.00 0.00 ? 156 TRP A H    3  
ATOM 4772  H HA   . TRP A 1 59  ? 5.671   0.569   9.958   1.00 0.00 ? 156 TRP A HA   3  
ATOM 4773  H HB2  . TRP A 1 59  ? 8.621   0.133   9.593   1.00 0.00 ? 156 TRP A HB2  3  
ATOM 4774  H HB3  . TRP A 1 59  ? 7.509   0.037   8.231   1.00 0.00 ? 156 TRP A HB3  3  
ATOM 4775  H HD1  . TRP A 1 59  ? 9.251   2.528   10.483  1.00 0.00 ? 156 TRP A HD1  3  
ATOM 4776  H HE1  . TRP A 1 59  ? 8.736   4.912   9.655   1.00 0.00 ? 156 TRP A HE1  3  
ATOM 4777  H HE3  . TRP A 1 59  ? 5.597   1.422   7.086   1.00 0.00 ? 156 TRP A HE3  3  
ATOM 4778  H HZ2  . TRP A 1 59  ? 6.994   6.153   7.803   1.00 0.00 ? 156 TRP A HZ2  3  
ATOM 4779  H HZ3  . TRP A 1 59  ? 4.560   3.268   5.828   1.00 0.00 ? 156 TRP A HZ3  3  
ATOM 4780  H HH2  . TRP A 1 59  ? 5.246   5.579   6.183   1.00 0.00 ? 156 TRP A HH2  3  
ATOM 4781  N N    . GLU A 1 60  ? 5.325   -1.714  8.965   1.00 0.00 ? 157 GLU A N    3  
ATOM 4782  C CA   . GLU A 1 60  ? 4.936   -3.063  8.605   1.00 0.00 ? 157 GLU A CA   3  
ATOM 4783  C C    . GLU A 1 60  ? 5.293   -3.336  7.148   1.00 0.00 ? 157 GLU A C    3  
ATOM 4784  O O    . GLU A 1 60  ? 4.815   -2.653  6.239   1.00 0.00 ? 157 GLU A O    3  
ATOM 4785  C CB   . GLU A 1 60  ? 3.436   -3.236  8.829   1.00 0.00 ? 157 GLU A CB   3  
ATOM 4786  C CG   . GLU A 1 60  ? 2.969   -4.680  8.796   1.00 0.00 ? 157 GLU A CG   3  
ATOM 4787  C CD   . GLU A 1 60  ? 1.514   -4.821  9.184   1.00 0.00 ? 157 GLU A CD   3  
ATOM 4788  O OE1  . GLU A 1 60  ? 1.198   -4.678  10.383  1.00 0.00 ? 157 GLU A OE1  3  
ATOM 4789  O OE2  . GLU A 1 60  ? 0.678   -5.067  8.287   1.00 0.00 ? 157 GLU A OE2  3  
ATOM 4790  H H    . GLU A 1 60  ? 4.883   -0.959  8.519   1.00 0.00 ? 157 GLU A H    3  
ATOM 4791  H HA   . GLU A 1 60  ? 5.474   -3.752  9.238   1.00 0.00 ? 157 GLU A HA   3  
ATOM 4792  H HB2  . GLU A 1 60  ? 3.177   -2.816  9.789   1.00 0.00 ? 157 GLU A HB2  3  
ATOM 4793  H HB3  . GLU A 1 60  ? 2.910   -2.693  8.056   1.00 0.00 ? 157 GLU A HB3  3  
ATOM 4794  H HG2  . GLU A 1 60  ? 3.100   -5.066  7.796   1.00 0.00 ? 157 GLU A HG2  3  
ATOM 4795  H HG3  . GLU A 1 60  ? 3.569   -5.256  9.486   1.00 0.00 ? 157 GLU A HG3  3  
ATOM 4796  N N    . ILE A 1 61  ? 6.144   -4.321  6.930   1.00 0.00 ? 158 ILE A N    3  
ATOM 4797  C CA   . ILE A 1 61  ? 6.603   -4.642  5.590   1.00 0.00 ? 158 ILE A CA   3  
ATOM 4798  C C    . ILE A 1 61  ? 5.825   -5.823  5.018   1.00 0.00 ? 158 ILE A C    3  
ATOM 4799  O O    . ILE A 1 61  ? 5.644   -6.845  5.679   1.00 0.00 ? 158 ILE A O    3  
ATOM 4800  C CB   . ILE A 1 61  ? 8.123   -4.952  5.558   1.00 0.00 ? 158 ILE A CB   3  
ATOM 4801  C CG1  . ILE A 1 61  ? 8.955   -3.665  5.615   1.00 0.00 ? 158 ILE A CG1  3  
ATOM 4802  C CG2  . ILE A 1 61  ? 8.490   -5.748  4.317   1.00 0.00 ? 158 ILE A CG2  3  
ATOM 4803  C CD1  . ILE A 1 61  ? 8.934   -2.962  6.952   1.00 0.00 ? 158 ILE A CD1  3  
ATOM 4804  H H    . ILE A 1 61  ? 6.464   -4.857  7.689   1.00 0.00 ? 158 ILE A H    3  
ATOM 4805  H HA   . ILE A 1 61  ? 6.424   -3.777  4.968   1.00 0.00 ? 158 ILE A HA   3  
ATOM 4806  H HB   . ILE A 1 61  ? 8.357   -5.557  6.422   1.00 0.00 ? 158 ILE A HB   3  
ATOM 4807  H HG12 . ILE A 1 61  ? 9.983   -3.903  5.387   1.00 0.00 ? 158 ILE A HG12 3  
ATOM 4808  H HG13 . ILE A 1 61  ? 8.582   -2.975  4.872   1.00 0.00 ? 158 ILE A HG13 3  
ATOM 4809  H HG21 . ILE A 1 61  ? 8.197   -5.196  3.437   1.00 0.00 ? 158 ILE A HG21 3  
ATOM 4810  H HG22 . ILE A 1 61  ? 7.976   -6.698  4.334   1.00 0.00 ? 158 ILE A HG22 3  
ATOM 4811  H HG23 . ILE A 1 61  ? 9.556   -5.915  4.300   1.00 0.00 ? 158 ILE A HG23 3  
ATOM 4812  H HD11 . ILE A 1 61  ? 7.919   -2.692  7.202   1.00 0.00 ? 158 ILE A HD11 3  
ATOM 4813  H HD12 . ILE A 1 61  ? 9.539   -2.069  6.894   1.00 0.00 ? 158 ILE A HD12 3  
ATOM 4814  H HD13 . ILE A 1 61  ? 9.331   -3.619  7.711   1.00 0.00 ? 158 ILE A HD13 3  
ATOM 4815  N N    . HIS A 1 62  ? 5.351   -5.663  3.792   1.00 0.00 ? 159 HIS A N    3  
ATOM 4816  C CA   . HIS A 1 62  ? 4.683   -6.739  3.079   1.00 0.00 ? 159 HIS A CA   3  
ATOM 4817  C C    . HIS A 1 62  ? 5.352   -6.964  1.734   1.00 0.00 ? 159 HIS A C    3  
ATOM 4818  O O    . HIS A 1 62  ? 5.511   -6.030  0.947   1.00 0.00 ? 159 HIS A O    3  
ATOM 4819  C CB   . HIS A 1 62  ? 3.204   -6.418  2.866   1.00 0.00 ? 159 HIS A CB   3  
ATOM 4820  C CG   . HIS A 1 62  ? 2.374   -6.500  4.107   1.00 0.00 ? 159 HIS A CG   3  
ATOM 4821  N ND1  . HIS A 1 62  ? 1.638   -7.614  4.443   1.00 0.00 ? 159 HIS A ND1  3  
ATOM 4822  C CD2  . HIS A 1 62  ? 2.147   -5.591  5.083   1.00 0.00 ? 159 HIS A CD2  3  
ATOM 4823  C CE1  . HIS A 1 62  ? 0.991   -7.387  5.570   1.00 0.00 ? 159 HIS A CE1  3  
ATOM 4824  N NE2  . HIS A 1 62  ? 1.282   -6.167  5.978   1.00 0.00 ? 159 HIS A NE2  3  
ATOM 4825  H H    . HIS A 1 62  ? 5.460   -4.789  3.346   1.00 0.00 ? 159 HIS A H    3  
ATOM 4826  H HA   . HIS A 1 62  ? 4.769   -7.638  3.670   1.00 0.00 ? 159 HIS A HA   3  
ATOM 4827  H HB2  . HIS A 1 62  ? 3.117   -5.414  2.477   1.00 0.00 ? 159 HIS A HB2  3  
ATOM 4828  H HB3  . HIS A 1 62  ? 2.796   -7.112  2.146   1.00 0.00 ? 159 HIS A HB3  3  
ATOM 4829  H HD1  . HIS A 1 62  ? 1.609   -8.458  3.937   1.00 0.00 ? 159 HIS A HD1  3  
ATOM 4830  H HD2  . HIS A 1 62  ? 2.574   -4.599  5.148   1.00 0.00 ? 159 HIS A HD2  3  
ATOM 4831  H HE1  . HIS A 1 62  ? 0.335   -8.082  6.072   1.00 0.00 ? 159 HIS A HE1  3  
ATOM 4832  H HE2  . HIS A 1 62  ? 1.014   -5.779  6.852   1.00 0.00 ? 159 HIS A HE2  3  
ATOM 4833  N N    . PHE A 1 63  ? 5.745   -8.197  1.473   1.00 0.00 ? 160 PHE A N    3  
ATOM 4834  C CA   . PHE A 1 63  ? 6.401   -8.540  0.225   1.00 0.00 ? 160 PHE A CA   3  
ATOM 4835  C C    . PHE A 1 63  ? 5.356   -8.781  -0.857  1.00 0.00 ? 160 PHE A C    3  
ATOM 4836  O O    . PHE A 1 63  ? 4.451   -9.595  -0.683  1.00 0.00 ? 160 PHE A O    3  
ATOM 4837  C CB   . PHE A 1 63  ? 7.265   -9.783  0.418   1.00 0.00 ? 160 PHE A CB   3  
ATOM 4838  C CG   . PHE A 1 63  ? 8.265   -9.988  -0.676  1.00 0.00 ? 160 PHE A CG   3  
ATOM 4839  C CD1  . PHE A 1 63  ? 9.332   -9.120  -0.812  1.00 0.00 ? 160 PHE A CD1  3  
ATOM 4840  C CD2  . PHE A 1 63  ? 8.143   -11.041 -1.564  1.00 0.00 ? 160 PHE A CD2  3  
ATOM 4841  C CE1  . PHE A 1 63  ? 10.262  -9.296  -1.813  1.00 0.00 ? 160 PHE A CE1  3  
ATOM 4842  C CE2  . PHE A 1 63  ? 9.071   -11.224 -2.568  1.00 0.00 ? 160 PHE A CE2  3  
ATOM 4843  C CZ   . PHE A 1 63  ? 10.132  -10.349 -2.693  1.00 0.00 ? 160 PHE A CZ   3  
ATOM 4844  H H    . PHE A 1 63  ? 5.579   -8.903  2.135   1.00 0.00 ? 160 PHE A H    3  
ATOM 4845  H HA   . PHE A 1 63  ? 7.031   -7.711  -0.069  1.00 0.00 ? 160 PHE A HA   3  
ATOM 4846  H HB2  . PHE A 1 63  ? 7.803   -9.698  1.350   1.00 0.00 ? 160 PHE A HB2  3  
ATOM 4847  H HB3  . PHE A 1 63  ? 6.627   -10.654 0.456   1.00 0.00 ? 160 PHE A HB3  3  
ATOM 4848  H HD1  . PHE A 1 63  ? 9.434   -8.296  -0.122  1.00 0.00 ? 160 PHE A HD1  3  
ATOM 4849  H HD2  . PHE A 1 63  ? 7.312   -11.724 -1.467  1.00 0.00 ? 160 PHE A HD2  3  
ATOM 4850  H HE1  . PHE A 1 63  ? 11.088  -8.609  -1.907  1.00 0.00 ? 160 PHE A HE1  3  
ATOM 4851  H HE2  . PHE A 1 63  ? 8.966   -12.049 -3.255  1.00 0.00 ? 160 PHE A HE2  3  
ATOM 4852  H HZ   . PHE A 1 63  ? 10.862  -10.490 -3.477  1.00 0.00 ? 160 PHE A HZ   3  
ATOM 4853  N N    . ALA A 1 64  ? 5.473   -8.064  -1.966  1.00 0.00 ? 161 ALA A N    3  
ATOM 4854  C CA   . ALA A 1 64  ? 4.490   -8.158  -3.036  1.00 0.00 ? 161 ALA A CA   3  
ATOM 4855  C C    . ALA A 1 64  ? 4.761   -9.353  -3.929  1.00 0.00 ? 161 ALA A C    3  
ATOM 4856  O O    . ALA A 1 64  ? 3.835   -10.006 -4.409  1.00 0.00 ? 161 ALA A O    3  
ATOM 4857  C CB   . ALA A 1 64  ? 4.474   -6.888  -3.868  1.00 0.00 ? 161 ALA A CB   3  
ATOM 4858  H H    . ALA A 1 64  ? 6.242   -7.462  -2.072  1.00 0.00 ? 161 ALA A H    3  
ATOM 4859  H HA   . ALA A 1 64  ? 3.516   -8.275  -2.584  1.00 0.00 ? 161 ALA A HA   3  
ATOM 4860  H HB1  . ALA A 1 64  ? 5.440   -6.749  -4.330  1.00 0.00 ? 161 ALA A HB1  3  
ATOM 4861  H HB2  . ALA A 1 64  ? 4.254   -6.046  -3.233  1.00 0.00 ? 161 ALA A HB2  3  
ATOM 4862  H HB3  . ALA A 1 64  ? 3.716   -6.969  -4.636  1.00 0.00 ? 161 ALA A HB3  3  
ATOM 4863  N N    . GLY A 1 65  ? 6.034   -9.632  -4.144  1.00 0.00 ? 162 GLY A N    3  
ATOM 4864  C CA   . GLY A 1 65  ? 6.408   -10.692 -5.046  1.00 0.00 ? 162 GLY A CA   3  
ATOM 4865  C C    . GLY A 1 65  ? 6.529   -10.180 -6.460  1.00 0.00 ? 162 GLY A C    3  
ATOM 4866  O O    . GLY A 1 65  ? 7.062   -9.092  -6.686  1.00 0.00 ? 162 GLY A O    3  
ATOM 4867  H H    . GLY A 1 65  ? 6.726   -9.106  -3.694  1.00 0.00 ? 162 GLY A H    3  
ATOM 4868  H HA2  . GLY A 1 65  ? 7.357   -11.103 -4.733  1.00 0.00 ? 162 GLY A HA2  3  
ATOM 4869  H HA3  . GLY A 1 65  ? 5.657   -11.466 -5.015  1.00 0.00 ? 162 GLY A HA3  3  
ATOM 4870  N N    . GLN A 1 66  ? 6.011   -10.939 -7.410  1.00 0.00 ? 163 GLN A N    3  
ATOM 4871  C CA   . GLN A 1 66  ? 6.093   -10.561 -8.810  1.00 0.00 ? 163 GLN A CA   3  
ATOM 4872  C C    . GLN A 1 66  ? 4.778   -9.935  -9.269  1.00 0.00 ? 163 GLN A C    3  
ATOM 4873  O O    . GLN A 1 66  ? 4.005   -10.548 -10.011 1.00 0.00 ? 163 GLN A O    3  
ATOM 4874  C CB   . GLN A 1 66  ? 6.429   -11.779 -9.673  1.00 0.00 ? 163 GLN A CB   3  
ATOM 4875  C CG   . GLN A 1 66  ? 6.828   -11.423 -11.095 1.00 0.00 ? 163 GLN A CG   3  
ATOM 4876  C CD   . GLN A 1 66  ? 6.842   -12.623 -12.017 1.00 0.00 ? 163 GLN A CD   3  
ATOM 4877  O OE1  . GLN A 1 66  ? 7.114   -13.750 -11.596 1.00 0.00 ? 163 GLN A OE1  3  
ATOM 4878  N NE2  . GLN A 1 66  ? 6.536   -12.389 -13.281 1.00 0.00 ? 163 GLN A NE2  3  
ATOM 4879  H H    . GLN A 1 66  ? 5.551   -11.768 -7.163  1.00 0.00 ? 163 GLN A H    3  
ATOM 4880  H HA   . GLN A 1 66  ? 6.881   -9.829  -8.909  1.00 0.00 ? 163 GLN A HA   3  
ATOM 4881  H HB2  . GLN A 1 66  ? 7.246   -12.319 -9.216  1.00 0.00 ? 163 GLN A HB2  3  
ATOM 4882  H HB3  . GLN A 1 66  ? 5.563   -12.424 -9.717  1.00 0.00 ? 163 GLN A HB3  3  
ATOM 4883  H HG2  . GLN A 1 66  ? 6.130   -10.697 -11.482 1.00 0.00 ? 163 GLN A HG2  3  
ATOM 4884  H HG3  . GLN A 1 66  ? 7.822   -10.993 -11.076 1.00 0.00 ? 163 GLN A HG3  3  
ATOM 4885  H HE21 . GLN A 1 66  ? 6.319   -11.466 -13.543 1.00 0.00 ? 163 GLN A HE21 3  
ATOM 4886  H HE22 . GLN A 1 66  ? 6.546   -13.142 -13.908 1.00 0.00 ? 163 GLN A HE22 3  
ATOM 4887  N N    . GLN A 1 67  ? 4.512   -8.729  -8.791  1.00 0.00 ? 164 GLN A N    3  
ATOM 4888  C CA   . GLN A 1 67  ? 3.335   -7.972  -9.204  1.00 0.00 ? 164 GLN A CA   3  
ATOM 4889  C C    . GLN A 1 67  ? 3.537   -6.495  -8.896  1.00 0.00 ? 164 GLN A C    3  
ATOM 4890  O O    . GLN A 1 67  ? 4.203   -6.148  -7.921  1.00 0.00 ? 164 GLN A O    3  
ATOM 4891  C CB   . GLN A 1 67  ? 2.067   -8.499  -8.511  1.00 0.00 ? 164 GLN A CB   3  
ATOM 4892  C CG   . GLN A 1 67  ? 2.125   -8.473  -6.992  1.00 0.00 ? 164 GLN A CG   3  
ATOM 4893  C CD   . GLN A 1 67  ? 0.884   -9.066  -6.350  1.00 0.00 ? 164 GLN A CD   3  
ATOM 4894  O OE1  . GLN A 1 67  ? -0.214  -9.006  -6.907  1.00 0.00 ? 164 GLN A OE1  3  
ATOM 4895  N NE2  . GLN A 1 67  ? 1.048   -9.647  -5.172  1.00 0.00 ? 164 GLN A NE2  3  
ATOM 4896  H H    . GLN A 1 67  ? 5.128   -8.333  -8.137  1.00 0.00 ? 164 GLN A H    3  
ATOM 4897  H HA   . GLN A 1 67  ? 3.227   -8.090  -10.273 1.00 0.00 ? 164 GLN A HA   3  
ATOM 4898  H HB2  . GLN A 1 67  ? 1.225   -7.894  -8.823  1.00 0.00 ? 164 GLN A HB2  3  
ATOM 4899  H HB3  . GLN A 1 67  ? 1.898   -9.518  -8.825  1.00 0.00 ? 164 GLN A HB3  3  
ATOM 4900  H HG2  . GLN A 1 67  ? 2.985   -9.042  -6.668  1.00 0.00 ? 164 GLN A HG2  3  
ATOM 4901  H HG3  . GLN A 1 67  ? 2.229   -7.449  -6.664  1.00 0.00 ? 164 GLN A HG3  3  
ATOM 4902  H HE21 . GLN A 1 67  ? 1.952   -9.664  -4.786  1.00 0.00 ? 164 GLN A HE21 3  
ATOM 4903  H HE22 . GLN A 1 67  ? 0.262   -10.040 -4.734  1.00 0.00 ? 164 GLN A HE22 3  
ATOM 4904  N N    . THR A 1 68  ? 2.974   -5.629  -9.729  1.00 0.00 ? 165 THR A N    3  
ATOM 4905  C CA   . THR A 1 68  ? 3.126   -4.195  -9.543  1.00 0.00 ? 165 THR A CA   3  
ATOM 4906  C C    . THR A 1 68  ? 1.869   -3.585  -8.930  1.00 0.00 ? 165 THR A C    3  
ATOM 4907  O O    . THR A 1 68  ? 1.688   -2.365  -8.918  1.00 0.00 ? 165 THR A O    3  
ATOM 4908  C CB   . THR A 1 68  ? 3.467   -3.479  -10.867 1.00 0.00 ? 165 THR A CB   3  
ATOM 4909  O OG1  . THR A 1 68  ? 2.555   -3.872  -11.902 1.00 0.00 ? 165 THR A OG1  3  
ATOM 4910  C CG2  . THR A 1 68  ? 4.889   -3.789  -11.303 1.00 0.00 ? 165 THR A CG2  3  
ATOM 4911  H H    . THR A 1 68  ? 2.433   -5.962  -10.477 1.00 0.00 ? 165 THR A H    3  
ATOM 4912  H HA   . THR A 1 68  ? 3.949   -4.041  -8.859  1.00 0.00 ? 165 THR A HA   3  
ATOM 4913  H HB   . THR A 1 68  ? 3.383   -2.415  -10.703 1.00 0.00 ? 165 THR A HB   3  
ATOM 4914  H HG1  . THR A 1 68  ? 3.025   -3.890  -12.750 1.00 0.00 ? 165 THR A HG1  3  
ATOM 4915  H HG21 . THR A 1 68  ? 5.099   -3.279  -12.232 1.00 0.00 ? 165 THR A HG21 3  
ATOM 4916  H HG22 . THR A 1 68  ? 4.999   -4.854  -11.444 1.00 0.00 ? 165 THR A HG22 3  
ATOM 4917  H HG23 . THR A 1 68  ? 5.581   -3.453  -10.545 1.00 0.00 ? 165 THR A HG23 3  
ATOM 4918  N N    . GLU A 1 69  ? 1.007   -4.451  -8.424  1.00 0.00 ? 166 GLU A N    3  
ATOM 4919  C CA   . GLU A 1 69  ? -0.196  -4.033  -7.728  1.00 0.00 ? 166 GLU A CA   3  
ATOM 4920  C C    . GLU A 1 69  ? -0.435  -4.932  -6.519  1.00 0.00 ? 166 GLU A C    3  
ATOM 4921  O O    . GLU A 1 69  ? -0.717  -6.123  -6.657  1.00 0.00 ? 166 GLU A O    3  
ATOM 4922  C CB   . GLU A 1 69  ? -1.417  -4.043  -8.662  1.00 0.00 ? 166 GLU A CB   3  
ATOM 4923  C CG   . GLU A 1 69  ? -1.682  -5.375  -9.358  1.00 0.00 ? 166 GLU A CG   3  
ATOM 4924  C CD   . GLU A 1 69  ? -0.776  -5.611  -10.549 1.00 0.00 ? 166 GLU A CD   3  
ATOM 4925  O OE1  . GLU A 1 69  ? -1.064  -5.064  -11.634 1.00 0.00 ? 166 GLU A OE1  3  
ATOM 4926  O OE2  . GLU A 1 69  ? 0.222   -6.348  -10.413 1.00 0.00 ? 166 GLU A OE2  3  
ATOM 4927  H H    . GLU A 1 69  ? 1.185   -5.410  -8.529  1.00 0.00 ? 166 GLU A H    3  
ATOM 4928  H HA   . GLU A 1 69  ? -0.034  -3.023  -7.377  1.00 0.00 ? 166 GLU A HA   3  
ATOM 4929  H HB2  . GLU A 1 69  ? -2.291  -3.789  -8.083  1.00 0.00 ? 166 GLU A HB2  3  
ATOM 4930  H HB3  . GLU A 1 69  ? -1.274  -3.289  -9.421  1.00 0.00 ? 166 GLU A HB3  3  
ATOM 4931  H HG2  . GLU A 1 69  ? -1.523  -6.174  -8.648  1.00 0.00 ? 166 GLU A HG2  3  
ATOM 4932  H HG3  . GLU A 1 69  ? -2.708  -5.393  -9.695  1.00 0.00 ? 166 GLU A HG3  3  
ATOM 4933  N N    . PHE A 1 70  ? -0.324  -4.359  -5.337  1.00 0.00 ? 167 PHE A N    3  
ATOM 4934  C CA   . PHE A 1 70  ? -0.399  -5.126  -4.109  1.00 0.00 ? 167 PHE A CA   3  
ATOM 4935  C C    . PHE A 1 70  ? -1.699  -4.833  -3.376  1.00 0.00 ? 167 PHE A C    3  
ATOM 4936  O O    . PHE A 1 70  ? -2.272  -3.752  -3.514  1.00 0.00 ? 167 PHE A O    3  
ATOM 4937  C CB   . PHE A 1 70  ? 0.805   -4.808  -3.223  1.00 0.00 ? 167 PHE A CB   3  
ATOM 4938  C CG   . PHE A 1 70  ? 0.986   -5.762  -2.083  1.00 0.00 ? 167 PHE A CG   3  
ATOM 4939  C CD1  . PHE A 1 70  ? 1.164   -7.115  -2.319  1.00 0.00 ? 167 PHE A CD1  3  
ATOM 4940  C CD2  . PHE A 1 70  ? 0.988   -5.306  -0.778  1.00 0.00 ? 167 PHE A CD2  3  
ATOM 4941  C CE1  . PHE A 1 70  ? 1.338   -7.996  -1.272  1.00 0.00 ? 167 PHE A CE1  3  
ATOM 4942  C CE2  . PHE A 1 70  ? 1.162   -6.182  0.271   1.00 0.00 ? 167 PHE A CE2  3  
ATOM 4943  C CZ   . PHE A 1 70  ? 1.338   -7.529  0.025   1.00 0.00 ? 167 PHE A CZ   3  
ATOM 4944  H H    . PHE A 1 70  ? -0.208  -3.383  -5.286  1.00 0.00 ? 167 PHE A H    3  
ATOM 4945  H HA   . PHE A 1 70  ? -0.374  -6.174  -4.371  1.00 0.00 ? 167 PHE A HA   3  
ATOM 4946  H HB2  . PHE A 1 70  ? 1.699   -4.837  -3.821  1.00 0.00 ? 167 PHE A HB2  3  
ATOM 4947  H HB3  . PHE A 1 70  ? 0.685   -3.815  -2.810  1.00 0.00 ? 167 PHE A HB3  3  
ATOM 4948  H HD1  . PHE A 1 70  ? 1.164   -7.479  -3.336  1.00 0.00 ? 167 PHE A HD1  3  
ATOM 4949  H HD2  . PHE A 1 70  ? 0.851   -4.253  -0.584  1.00 0.00 ? 167 PHE A HD2  3  
ATOM 4950  H HE1  . PHE A 1 70  ? 1.474   -9.047  -1.470  1.00 0.00 ? 167 PHE A HE1  3  
ATOM 4951  H HE2  . PHE A 1 70  ? 1.162   -5.810  1.288   1.00 0.00 ? 167 PHE A HE2  3  
ATOM 4952  H HZ   . PHE A 1 70  ? 1.474   -8.216  0.847   1.00 0.00 ? 167 PHE A HZ   3  
ATOM 4953  N N    . LYS A 1 71  ? -2.164  -5.809  -2.610  1.00 0.00 ? 168 LYS A N    3  
ATOM 4954  C CA   . LYS A 1 71  ? -3.435  -5.700  -1.913  1.00 0.00 ? 168 LYS A CA   3  
ATOM 4955  C C    . LYS A 1 71  ? -3.235  -5.902  -0.414  1.00 0.00 ? 168 LYS A C    3  
ATOM 4956  O O    . LYS A 1 71  ? -2.603  -6.869  0.011   1.00 0.00 ? 168 LYS A O    3  
ATOM 4957  C CB   . LYS A 1 71  ? -4.440  -6.741  -2.439  1.00 0.00 ? 168 LYS A CB   3  
ATOM 4958  C CG   . LYS A 1 71  ? -4.758  -6.642  -3.932  1.00 0.00 ? 168 LYS A CG   3  
ATOM 4959  C CD   . LYS A 1 71  ? -3.632  -7.190  -4.800  1.00 0.00 ? 168 LYS A CD   3  
ATOM 4960  C CE   . LYS A 1 71  ? -4.013  -7.219  -6.271  1.00 0.00 ? 168 LYS A CE   3  
ATOM 4961  N NZ   . LYS A 1 71  ? -2.924  -7.783  -7.114  1.00 0.00 ? 168 LYS A NZ   3  
ATOM 4962  H H    . LYS A 1 71  ? -1.632  -6.624  -2.503  1.00 0.00 ? 168 LYS A H    3  
ATOM 4963  H HA   . LYS A 1 71  ? -3.828  -4.709  -2.086  1.00 0.00 ? 168 LYS A HA   3  
ATOM 4964  H HB2  . LYS A 1 71  ? -4.045  -7.726  -2.249  1.00 0.00 ? 168 LYS A HB2  3  
ATOM 4965  H HB3  . LYS A 1 71  ? -5.365  -6.628  -1.892  1.00 0.00 ? 168 LYS A HB3  3  
ATOM 4966  H HG2  . LYS A 1 71  ? -5.656  -7.204  -4.136  1.00 0.00 ? 168 LYS A HG2  3  
ATOM 4967  H HG3  . LYS A 1 71  ? -4.920  -5.604  -4.186  1.00 0.00 ? 168 LYS A HG3  3  
ATOM 4968  H HD2  . LYS A 1 71  ? -2.763  -6.560  -4.681  1.00 0.00 ? 168 LYS A HD2  3  
ATOM 4969  H HD3  . LYS A 1 71  ? -3.398  -8.194  -4.476  1.00 0.00 ? 168 LYS A HD3  3  
ATOM 4970  H HE2  . LYS A 1 71  ? -4.898  -7.825  -6.389  1.00 0.00 ? 168 LYS A HE2  3  
ATOM 4971  H HE3  . LYS A 1 71  ? -4.222  -6.210  -6.594  1.00 0.00 ? 168 LYS A HE3  3  
ATOM 4972  H HZ1  . LYS A 1 71  ? -3.216  -7.803  -8.113  1.00 0.00 ? 168 LYS A HZ1  3  
ATOM 4973  H HZ2  . LYS A 1 71  ? -2.704  -8.754  -6.814  1.00 0.00 ? 168 LYS A HZ2  3  
ATOM 4974  H HZ3  . LYS A 1 71  ? -2.061  -7.205  -7.028  1.00 0.00 ? 168 LYS A HZ3  3  
ATOM 4975  N N    . ILE A 1 72  ? -3.755  -4.982  0.381   1.00 0.00 ? 169 ILE A N    3  
ATOM 4976  C CA   . ILE A 1 72  ? -3.706  -5.111  1.833   1.00 0.00 ? 169 ILE A CA   3  
ATOM 4977  C C    . ILE A 1 72  ? -5.098  -5.416  2.367   1.00 0.00 ? 169 ILE A C    3  
ATOM 4978  O O    . ILE A 1 72  ? -6.074  -4.829  1.910   1.00 0.00 ? 169 ILE A O    3  
ATOM 4979  C CB   . ILE A 1 72  ? -3.182  -3.820  2.507   1.00 0.00 ? 169 ILE A CB   3  
ATOM 4980  C CG1  . ILE A 1 72  ? -1.832  -3.415  1.918   1.00 0.00 ? 169 ILE A CG1  3  
ATOM 4981  C CG2  . ILE A 1 72  ? -3.055  -4.010  4.014   1.00 0.00 ? 169 ILE A CG2  3  
ATOM 4982  C CD1  . ILE A 1 72  ? -0.714  -4.381  2.237   1.00 0.00 ? 169 ILE A CD1  3  
ATOM 4983  H H    . ILE A 1 72  ? -4.186  -4.194  -0.017  1.00 0.00 ? 169 ILE A H    3  
ATOM 4984  H HA   . ILE A 1 72  ? -3.043  -5.926  2.081   1.00 0.00 ? 169 ILE A HA   3  
ATOM 4985  H HB   . ILE A 1 72  ? -3.896  -3.032  2.329   1.00 0.00 ? 169 ILE A HB   3  
ATOM 4986  H HG12 . ILE A 1 72  ? -1.919  -3.357  0.843   1.00 0.00 ? 169 ILE A HG12 3  
ATOM 4987  H HG13 . ILE A 1 72  ? -1.555  -2.445  2.305   1.00 0.00 ? 169 ILE A HG13 3  
ATOM 4988  H HG21 . ILE A 1 72  ? -2.323  -4.779  4.217   1.00 0.00 ? 169 ILE A HG21 3  
ATOM 4989  H HG22 . ILE A 1 72  ? -4.011  -4.308  4.422   1.00 0.00 ? 169 ILE A HG22 3  
ATOM 4990  H HG23 . ILE A 1 72  ? -2.741  -3.084  4.470   1.00 0.00 ? 169 ILE A HG23 3  
ATOM 4991  H HD11 . ILE A 1 72  ? 0.201   -4.039  1.774   1.00 0.00 ? 169 ILE A HD11 3  
ATOM 4992  H HD12 . ILE A 1 72  ? -0.965  -5.360  1.857   1.00 0.00 ? 169 ILE A HD12 3  
ATOM 4993  H HD13 . ILE A 1 72  ? -0.577  -4.433  3.307   1.00 0.00 ? 169 ILE A HD13 3  
ATOM 4994  N N    . LEU A 1 73  ? -5.189  -6.337  3.317   1.00 0.00 ? 170 LEU A N    3  
ATOM 4995  C CA   . LEU A 1 73  ? -6.472  -6.698  3.907   1.00 0.00 ? 170 LEU A CA   3  
ATOM 4996  C C    . LEU A 1 73  ? -6.599  -6.116  5.313   1.00 0.00 ? 170 LEU A C    3  
ATOM 4997  O O    . LEU A 1 73  ? -7.705  -5.909  5.817   1.00 0.00 ? 170 LEU A O    3  
ATOM 4998  C CB   . LEU A 1 73  ? -6.644  -8.227  3.964   1.00 0.00 ? 170 LEU A CB   3  
ATOM 4999  C CG   . LEU A 1 73  ? -6.800  -8.954  2.616   1.00 0.00 ? 170 LEU A CG   3  
ATOM 5000  C CD1  . LEU A 1 73  ? -7.884  -8.305  1.770   1.00 0.00 ? 170 LEU A CD1  3  
ATOM 5001  C CD2  . LEU A 1 73  ? -5.479  -9.005  1.857   1.00 0.00 ? 170 LEU A CD2  3  
ATOM 5002  H H    . LEU A 1 73  ? -4.373  -6.789  3.626   1.00 0.00 ? 170 LEU A H    3  
ATOM 5003  H HA   . LEU A 1 73  ? -7.252  -6.280  3.287   1.00 0.00 ? 170 LEU A HA   3  
ATOM 5004  H HB2  . LEU A 1 73  ? -5.781  -8.639  4.466   1.00 0.00 ? 170 LEU A HB2  3  
ATOM 5005  H HB3  . LEU A 1 73  ? -7.517  -8.441  4.563   1.00 0.00 ? 170 LEU A HB3  3  
ATOM 5006  H HG   . LEU A 1 73  ? -7.108  -9.970  2.808   1.00 0.00 ? 170 LEU A HG   3  
ATOM 5007  H HD11 . LEU A 1 73  ? -7.617  -7.279  1.569   1.00 0.00 ? 170 LEU A HD11 3  
ATOM 5008  H HD12 . LEU A 1 73  ? -8.822  -8.336  2.302   1.00 0.00 ? 170 LEU A HD12 3  
ATOM 5009  H HD13 . LEU A 1 73  ? -7.981  -8.840  0.836   1.00 0.00 ? 170 LEU A HD13 3  
ATOM 5010  H HD21 . LEU A 1 73  ? -4.748  -9.541  2.444   1.00 0.00 ? 170 LEU A HD21 3  
ATOM 5011  H HD22 . LEU A 1 73  ? -5.129  -8.001  1.675   1.00 0.00 ? 170 LEU A HD22 3  
ATOM 5012  H HD23 . LEU A 1 73  ? -5.626  -9.512  0.914   1.00 0.00 ? 170 LEU A HD23 3  
ATOM 5013  N N    . SER A 1 74  ? -5.461  -5.837  5.932   1.00 0.00 ? 171 SER A N    3  
ATOM 5014  C CA   . SER A 1 74  ? -5.427  -5.362  7.309   1.00 0.00 ? 171 SER A CA   3  
ATOM 5015  C C    . SER A 1 74  ? -5.562  -3.840  7.388   1.00 0.00 ? 171 SER A C    3  
ATOM 5016  O O    . SER A 1 74  ? -4.619  -3.146  7.768   1.00 0.00 ? 171 SER A O    3  
ATOM 5017  C CB   . SER A 1 74  ? -4.117  -5.798  7.963   1.00 0.00 ? 171 SER A CB   3  
ATOM 5018  O OG   . SER A 1 74  ? -3.853  -7.168  7.709   1.00 0.00 ? 171 SER A OG   3  
ATOM 5019  H H    . SER A 1 74  ? -4.616  -5.962  5.453   1.00 0.00 ? 171 SER A H    3  
ATOM 5020  H HA   . SER A 1 74  ? -6.252  -5.815  7.839   1.00 0.00 ? 171 SER A HA   3  
ATOM 5021  H HB2  . SER A 1 74  ? -3.305  -5.208  7.565   1.00 0.00 ? 171 SER A HB2  3  
ATOM 5022  H HB3  . SER A 1 74  ? -4.182  -5.648  9.031   1.00 0.00 ? 171 SER A HB3  3  
ATOM 5023  H HG   . SER A 1 74  ? -4.648  -7.686  7.897   1.00 0.00 ? 171 SER A HG   3  
ATOM 5024  N N    . LEU A 1 75  ? -6.729  -3.318  7.029   1.00 0.00 ? 172 LEU A N    3  
ATOM 5025  C CA   . LEU A 1 75  ? -6.967  -1.881  7.115   1.00 0.00 ? 172 LEU A CA   3  
ATOM 5026  C C    . LEU A 1 75  ? -7.879  -1.552  8.285   1.00 0.00 ? 172 LEU A C    3  
ATOM 5027  O O    . LEU A 1 75  ? -8.833  -2.277  8.568   1.00 0.00 ? 172 LEU A O    3  
ATOM 5028  C CB   . LEU A 1 75  ? -7.592  -1.319  5.830   1.00 0.00 ? 172 LEU A CB   3  
ATOM 5029  C CG   . LEU A 1 75  ? -6.712  -1.335  4.577   1.00 0.00 ? 172 LEU A CG   3  
ATOM 5030  C CD1  . LEU A 1 75  ? -5.340  -0.745  4.864   1.00 0.00 ? 172 LEU A CD1  3  
ATOM 5031  C CD2  . LEU A 1 75  ? -6.593  -2.739  4.019   1.00 0.00 ? 172 LEU A CD2  3  
ATOM 5032  H H    . LEU A 1 75  ? -7.442  -3.908  6.700   1.00 0.00 ? 172 LEU A H    3  
ATOM 5033  H HA   . LEU A 1 75  ? -6.014  -1.401  7.277   1.00 0.00 ? 172 LEU A HA   3  
ATOM 5034  H HB2  . LEU A 1 75  ? -8.486  -1.887  5.617   1.00 0.00 ? 172 LEU A HB2  3  
ATOM 5035  H HB3  . LEU A 1 75  ? -7.879  -0.297  6.022   1.00 0.00 ? 172 LEU A HB3  3  
ATOM 5036  H HG   . LEU A 1 75  ? -7.179  -0.721  3.822   1.00 0.00 ? 172 LEU A HG   3  
ATOM 5037  H HD11 . LEU A 1 75  ? -5.453  0.265   5.229   1.00 0.00 ? 172 LEU A HD11 3  
ATOM 5038  H HD12 . LEU A 1 75  ? -4.756  -0.737  3.957   1.00 0.00 ? 172 LEU A HD12 3  
ATOM 5039  H HD13 . LEU A 1 75  ? -4.840  -1.344  5.609   1.00 0.00 ? 172 LEU A HD13 3  
ATOM 5040  H HD21 . LEU A 1 75  ? -7.573  -3.105  3.751   1.00 0.00 ? 172 LEU A HD21 3  
ATOM 5041  H HD22 . LEU A 1 75  ? -6.157  -3.388  4.764   1.00 0.00 ? 172 LEU A HD22 3  
ATOM 5042  H HD23 . LEU A 1 75  ? -5.962  -2.724  3.142   1.00 0.00 ? 172 LEU A HD23 3  
ATOM 5043  N N    . HIS A 1 76  ? -7.566  -0.463  8.964   1.00 0.00 ? 173 HIS A N    3  
ATOM 5044  C CA   . HIS A 1 76  ? -8.415  0.055   10.022  1.00 0.00 ? 173 HIS A CA   3  
ATOM 5045  C C    . HIS A 1 76  ? -9.179  1.271   9.511   1.00 0.00 ? 173 HIS A C    3  
ATOM 5046  O O    . HIS A 1 76  ? -8.576  2.286   9.159   1.00 0.00 ? 173 HIS A O    3  
ATOM 5047  C CB   . HIS A 1 76  ? -7.587  0.435   11.253  1.00 0.00 ? 173 HIS A CB   3  
ATOM 5048  C CG   . HIS A 1 76  ? -6.968  -0.730  11.970  1.00 0.00 ? 173 HIS A CG   3  
ATOM 5049  N ND1  . HIS A 1 76  ? -7.326  -1.104  13.247  1.00 0.00 ? 173 HIS A ND1  3  
ATOM 5050  C CD2  . HIS A 1 76  ? -5.994  -1.592  11.592  1.00 0.00 ? 173 HIS A CD2  3  
ATOM 5051  C CE1  . HIS A 1 76  ? -6.601  -2.142  13.621  1.00 0.00 ? 173 HIS A CE1  3  
ATOM 5052  N NE2  . HIS A 1 76  ? -5.784  -2.459  12.635  1.00 0.00 ? 173 HIS A NE2  3  
ATOM 5053  H H    . HIS A 1 76  ? -6.732  0.013   8.743   1.00 0.00 ? 173 HIS A H    3  
ATOM 5054  H HA   . HIS A 1 76  ? -9.119  -0.716  10.293  1.00 0.00 ? 173 HIS A HA   3  
ATOM 5055  H HB2  . HIS A 1 76  ? -6.788  1.094   10.947  1.00 0.00 ? 173 HIS A HB2  3  
ATOM 5056  H HB3  . HIS A 1 76  ? -8.223  0.955   11.954  1.00 0.00 ? 173 HIS A HB3  3  
ATOM 5057  H HD1  . HIS A 1 76  ? -8.008  -0.667  13.805  1.00 0.00 ? 173 HIS A HD1  3  
ATOM 5058  H HD2  . HIS A 1 76  ? -5.476  -1.596  10.642  1.00 0.00 ? 173 HIS A HD2  3  
ATOM 5059  H HE1  . HIS A 1 76  ? -6.666  -2.647  14.573  1.00 0.00 ? 173 HIS A HE1  3  
ATOM 5060  H HE2  . HIS A 1 76  ? -5.002  -3.049  12.728  1.00 0.00 ? 173 HIS A HE2  3  
ATOM 5061  N N    . PRO A 1 77  ? -10.514 1.173   9.440   1.00 0.00 ? 174 PRO A N    3  
ATOM 5062  C CA   . PRO A 1 77  ? -11.364 2.248   8.913   1.00 0.00 ? 174 PRO A CA   3  
ATOM 5063  C C    . PRO A 1 77  ? -11.213 3.558   9.686   1.00 0.00 ? 174 PRO A C    3  
ATOM 5064  O O    . PRO A 1 77  ? -11.358 3.588   10.909  1.00 0.00 ? 174 PRO A O    3  
ATOM 5065  C CB   . PRO A 1 77  ? -12.786 1.699   9.075   1.00 0.00 ? 174 PRO A CB   3  
ATOM 5066  C CG   . PRO A 1 77  ? -12.628 0.224   9.203   1.00 0.00 ? 174 PRO A CG   3  
ATOM 5067  C CD   . PRO A 1 77  ? -11.302 0.005   9.865   1.00 0.00 ? 174 PRO A CD   3  
ATOM 5068  H HA   . PRO A 1 77  ? -11.165 2.427   7.867   1.00 0.00 ? 174 PRO A HA   3  
ATOM 5069  H HB2  . PRO A 1 77  ? -13.237 2.125   9.961   1.00 0.00 ? 174 PRO A HB2  3  
ATOM 5070  H HB3  . PRO A 1 77  ? -13.375 1.959   8.208   1.00 0.00 ? 174 PRO A HB3  3  
ATOM 5071  H HG2  . PRO A 1 77  ? -13.422 -0.181  9.811   1.00 0.00 ? 174 PRO A HG2  3  
ATOM 5072  H HG3  . PRO A 1 77  ? -12.636 -0.233  8.224   1.00 0.00 ? 174 PRO A HG3  3  
ATOM 5073  H HD2  . PRO A 1 77  ? -11.414 -0.016  10.939  1.00 0.00 ? 174 PRO A HD2  3  
ATOM 5074  H HD3  . PRO A 1 77  ? -10.854 -0.911  9.512   1.00 0.00 ? 174 PRO A HD3  3  
ATOM 5075  N N    . GLY A 1 78  ? -10.917 4.634   8.966   1.00 0.00 ? 175 GLY A N    3  
ATOM 5076  C CA   . GLY A 1 78  ? -10.801 5.941   9.586   1.00 0.00 ? 175 GLY A CA   3  
ATOM 5077  C C    . GLY A 1 78  ? -9.402  6.231   10.082  1.00 0.00 ? 175 GLY A C    3  
ATOM 5078  O O    . GLY A 1 78  ? -9.218  6.973   11.050  1.00 0.00 ? 175 GLY A O    3  
ATOM 5079  H H    . GLY A 1 78  ? -10.773 4.541   7.997   1.00 0.00 ? 175 GLY A H    3  
ATOM 5080  H HA2  . GLY A 1 78  ? -11.071 6.695   8.861   1.00 0.00 ? 175 GLY A HA2  3  
ATOM 5081  H HA3  . GLY A 1 78  ? -11.485 5.995   10.419  1.00 0.00 ? 175 GLY A HA3  3  
ATOM 5082  N N    . GLN A 1 79  ? -8.411  5.652   9.422   1.00 0.00 ? 176 GLN A N    3  
ATOM 5083  C CA   . GLN A 1 79  ? -7.023  5.873   9.792   1.00 0.00 ? 176 GLN A CA   3  
ATOM 5084  C C    . GLN A 1 79  ? -6.177  6.157   8.562   1.00 0.00 ? 176 GLN A C    3  
ATOM 5085  O O    . GLN A 1 79  ? -6.436  5.634   7.477   1.00 0.00 ? 176 GLN A O    3  
ATOM 5086  C CB   . GLN A 1 79  ? -6.468  4.673   10.557  1.00 0.00 ? 176 GLN A CB   3  
ATOM 5087  C CG   . GLN A 1 79  ? -7.106  4.504   11.923  1.00 0.00 ? 176 GLN A CG   3  
ATOM 5088  C CD   . GLN A 1 79  ? -6.530  3.357   12.717  1.00 0.00 ? 176 GLN A CD   3  
ATOM 5089  O OE1  . GLN A 1 79  ? -5.355  3.013   12.590  1.00 0.00 ? 176 GLN A OE1  3  
ATOM 5090  N NE2  . GLN A 1 79  ? -7.365  2.755   13.541  1.00 0.00 ? 176 GLN A NE2  3  
ATOM 5091  H H    . GLN A 1 79  ? -8.616  5.063   8.663   1.00 0.00 ? 176 GLN A H    3  
ATOM 5092  H HA   . GLN A 1 79  ? -6.996  6.734   10.440  1.00 0.00 ? 176 GLN A HA   3  
ATOM 5093  H HB2  . GLN A 1 79  ? -6.645  3.776   9.983   1.00 0.00 ? 176 GLN A HB2  3  
ATOM 5094  H HB3  . GLN A 1 79  ? -5.405  4.803   10.692  1.00 0.00 ? 176 GLN A HB3  3  
ATOM 5095  H HG2  . GLN A 1 79  ? -6.960  5.413   12.485  1.00 0.00 ? 176 GLN A HG2  3  
ATOM 5096  H HG3  . GLN A 1 79  ? -8.164  4.334   11.789  1.00 0.00 ? 176 GLN A HG3  3  
ATOM 5097  H HE21 . GLN A 1 79  ? -8.289  3.089   13.582  1.00 0.00 ? 176 GLN A HE21 3  
ATOM 5098  H HE22 . GLN A 1 79  ? -7.037  2.001   14.075  1.00 0.00 ? 176 GLN A HE22 3  
ATOM 5099  N N    . LYS A 1 80  ? -5.185  7.015   8.736   1.00 0.00 ? 177 LYS A N    3  
ATOM 5100  C CA   . LYS A 1 80  ? -4.261  7.354   7.675   1.00 0.00 ? 177 LYS A CA   3  
ATOM 5101  C C    . LYS A 1 80  ? -3.166  6.303   7.568   1.00 0.00 ? 177 LYS A C    3  
ATOM 5102  O O    . LYS A 1 80  ? -2.576  5.914   8.574   1.00 0.00 ? 177 LYS A O    3  
ATOM 5103  C CB   . LYS A 1 80  ? -3.647  8.712   7.975   1.00 0.00 ? 177 LYS A CB   3  
ATOM 5104  C CG   . LYS A 1 80  ? -2.585  9.140   6.988   1.00 0.00 ? 177 LYS A CG   3  
ATOM 5105  C CD   . LYS A 1 80  ? -1.707  10.214  7.592   1.00 0.00 ? 177 LYS A CD   3  
ATOM 5106  C CE   . LYS A 1 80  ? -2.501  11.457  7.966   1.00 0.00 ? 177 LYS A CE   3  
ATOM 5107  N NZ   . LYS A 1 80  ? -3.206  12.057  6.803   1.00 0.00 ? 177 LYS A NZ   3  
ATOM 5108  H H    . LYS A 1 80  ? -5.068  7.444   9.615   1.00 0.00 ? 177 LYS A H    3  
ATOM 5109  H HA   . LYS A 1 80  ? -4.804  7.405   6.746   1.00 0.00 ? 177 LYS A HA   3  
ATOM 5110  H HB2  . LYS A 1 80  ? -4.431  9.455   7.970   1.00 0.00 ? 177 LYS A HB2  3  
ATOM 5111  H HB3  . LYS A 1 80  ? -3.202  8.680   8.959   1.00 0.00 ? 177 LYS A HB3  3  
ATOM 5112  H HG2  . LYS A 1 80  ? -1.974  8.287   6.733   1.00 0.00 ? 177 LYS A HG2  3  
ATOM 5113  H HG3  . LYS A 1 80  ? -3.061  9.528   6.101   1.00 0.00 ? 177 LYS A HG3  3  
ATOM 5114  H HD2  . LYS A 1 80  ? -1.253  9.815   8.485   1.00 0.00 ? 177 LYS A HD2  3  
ATOM 5115  H HD3  . LYS A 1 80  ? -0.942  10.480  6.883   1.00 0.00 ? 177 LYS A HD3  3  
ATOM 5116  H HE2  . LYS A 1 80  ? -3.230  11.187  8.712   1.00 0.00 ? 177 LYS A HE2  3  
ATOM 5117  H HE3  . LYS A 1 80  ? -1.822  12.188  8.379   1.00 0.00 ? 177 LYS A HE3  3  
ATOM 5118  H HZ1  . LYS A 1 80  ? -3.846  11.361  6.374   1.00 0.00 ? 177 LYS A HZ1  3  
ATOM 5119  H HZ2  . LYS A 1 80  ? -2.520  12.369  6.088   1.00 0.00 ? 177 LYS A HZ2  3  
ATOM 5120  H HZ3  . LYS A 1 80  ? -3.765  12.879  7.108   1.00 0.00 ? 177 LYS A HZ3  3  
ATOM 5121  N N    . TYR A 1 81  ? -2.901  5.842   6.357   1.00 0.00 ? 178 TYR A N    3  
ATOM 5122  C CA   . TYR A 1 81  ? -1.836  4.881   6.126   1.00 0.00 ? 178 TYR A CA   3  
ATOM 5123  C C    . TYR A 1 81  ? -0.739  5.496   5.274   1.00 0.00 ? 178 TYR A C    3  
ATOM 5124  O O    . TYR A 1 81  ? -1.014  6.209   4.307   1.00 0.00 ? 178 TYR A O    3  
ATOM 5125  C CB   . TYR A 1 81  ? -2.372  3.614   5.449   1.00 0.00 ? 178 TYR A CB   3  
ATOM 5126  C CG   . TYR A 1 81  ? -3.024  2.639   6.402   1.00 0.00 ? 178 TYR A CG   3  
ATOM 5127  C CD1  . TYR A 1 81  ? -4.181  2.971   7.095   1.00 0.00 ? 178 TYR A CD1  3  
ATOM 5128  C CD2  . TYR A 1 81  ? -2.479  1.379   6.604   1.00 0.00 ? 178 TYR A CD2  3  
ATOM 5129  C CE1  . TYR A 1 81  ? -4.776  2.076   7.963   1.00 0.00 ? 178 TYR A CE1  3  
ATOM 5130  C CE2  . TYR A 1 81  ? -3.068  0.478   7.468   1.00 0.00 ? 178 TYR A CE2  3  
ATOM 5131  C CZ   . TYR A 1 81  ? -4.213  0.831   8.145   1.00 0.00 ? 178 TYR A CZ   3  
ATOM 5132  O OH   . TYR A 1 81  ? -4.799  -0.064  9.008   1.00 0.00 ? 178 TYR A OH   3  
ATOM 5133  H H    . TYR A 1 81  ? -3.430  6.165   5.592   1.00 0.00 ? 178 TYR A H    3  
ATOM 5134  H HA   . TYR A 1 81  ? -1.420  4.615   7.086   1.00 0.00 ? 178 TYR A HA   3  
ATOM 5135  H HB2  . TYR A 1 81  ? -3.106  3.893   4.709   1.00 0.00 ? 178 TYR A HB2  3  
ATOM 5136  H HB3  . TYR A 1 81  ? -1.553  3.102   4.959   1.00 0.00 ? 178 TYR A HB3  3  
ATOM 5137  H HD1  . TYR A 1 81  ? -4.617  3.949   6.950   1.00 0.00 ? 178 TYR A HD1  3  
ATOM 5138  H HD2  . TYR A 1 81  ? -1.580  1.104   6.072   1.00 0.00 ? 178 TYR A HD2  3  
ATOM 5139  H HE1  . TYR A 1 81  ? -5.675  2.353   8.492   1.00 0.00 ? 178 TYR A HE1  3  
ATOM 5140  H HE2  . TYR A 1 81  ? -2.628  -0.497  7.610   1.00 0.00 ? 178 TYR A HE2  3  
ATOM 5141  H HH   . TYR A 1 81  ? -4.108  -0.544  9.483   1.00 0.00 ? 178 TYR A HH   3  
ATOM 5142  N N    . LEU A 1 82  ? 0.501   5.245   5.660   1.00 0.00 ? 179 LEU A N    3  
ATOM 5143  C CA   . LEU A 1 82  ? 1.644   5.668   4.867   1.00 0.00 ? 179 LEU A CA   3  
ATOM 5144  C C    . LEU A 1 82  ? 2.169   4.475   4.098   1.00 0.00 ? 179 LEU A C    3  
ATOM 5145  O O    . LEU A 1 82  ? 2.403   3.424   4.685   1.00 0.00 ? 179 LEU A O    3  
ATOM 5146  C CB   . LEU A 1 82  ? 2.770   6.235   5.743   1.00 0.00 ? 179 LEU A CB   3  
ATOM 5147  C CG   . LEU A 1 82  ? 2.421   7.448   6.608   1.00 0.00 ? 179 LEU A CG   3  
ATOM 5148  C CD1  . LEU A 1 82  ? 1.567   8.434   5.836   1.00 0.00 ? 179 LEU A CD1  3  
ATOM 5149  C CD2  . LEU A 1 82  ? 1.740   7.021   7.901   1.00 0.00 ? 179 LEU A CD2  3  
ATOM 5150  H H    . LEU A 1 82  ? 0.652   4.754   6.497   1.00 0.00 ? 179 LEU A H    3  
ATOM 5151  H HA   . LEU A 1 82  ? 1.311   6.423   4.168   1.00 0.00 ? 179 LEU A HA   3  
ATOM 5152  H HB2  . LEU A 1 82  ? 3.111   5.447   6.398   1.00 0.00 ? 179 LEU A HB2  3  
ATOM 5153  H HB3  . LEU A 1 82  ? 3.589   6.511   5.094   1.00 0.00 ? 179 LEU A HB3  3  
ATOM 5154  H HG   . LEU A 1 82  ? 3.338   7.953   6.871   1.00 0.00 ? 179 LEU A HG   3  
ATOM 5155  H HD11 . LEU A 1 82  ? 1.355   9.291   6.457   1.00 0.00 ? 179 LEU A HD11 3  
ATOM 5156  H HD12 . LEU A 1 82  ? 0.640   7.960   5.549   1.00 0.00 ? 179 LEU A HD12 3  
ATOM 5157  H HD13 . LEU A 1 82  ? 2.097   8.753   4.950   1.00 0.00 ? 179 LEU A HD13 3  
ATOM 5158  H HD21 . LEU A 1 82  ? 2.410   6.394   8.469   1.00 0.00 ? 179 LEU A HD21 3  
ATOM 5159  H HD22 . LEU A 1 82  ? 0.840   6.470   7.669   1.00 0.00 ? 179 LEU A HD22 3  
ATOM 5160  H HD23 . LEU A 1 82  ? 1.486   7.897   8.481   1.00 0.00 ? 179 LEU A HD23 3  
ATOM 5161  N N    . VAL A 1 83  ? 2.352   4.631   2.800   1.00 0.00 ? 180 VAL A N    3  
ATOM 5162  C CA   . VAL A 1 83  ? 2.775   3.516   1.963   1.00 0.00 ? 180 VAL A CA   3  
ATOM 5163  C C    . VAL A 1 83  ? 4.033   3.851   1.175   1.00 0.00 ? 180 VAL A C    3  
ATOM 5164  O O    . VAL A 1 83  ? 4.216   4.982   0.713   1.00 0.00 ? 180 VAL A O    3  
ATOM 5165  C CB   . VAL A 1 83  ? 1.665   3.067   0.984   1.00 0.00 ? 180 VAL A CB   3  
ATOM 5166  C CG1  . VAL A 1 83  ? 0.445   2.567   1.740   1.00 0.00 ? 180 VAL A CG1  3  
ATOM 5167  C CG2  . VAL A 1 83  ? 1.280   4.194   0.043   1.00 0.00 ? 180 VAL A CG2  3  
ATOM 5168  H H    . VAL A 1 83  ? 2.211   5.518   2.397   1.00 0.00 ? 180 VAL A H    3  
ATOM 5169  H HA   . VAL A 1 83  ? 2.995   2.686   2.618   1.00 0.00 ? 180 VAL A HA   3  
ATOM 5170  H HB   . VAL A 1 83  ? 2.049   2.250   0.390   1.00 0.00 ? 180 VAL A HB   3  
ATOM 5171  H HG11 . VAL A 1 83  ? 0.717   1.705   2.330   1.00 0.00 ? 180 VAL A HG11 3  
ATOM 5172  H HG12 . VAL A 1 83  ? -0.328  2.292   1.037   1.00 0.00 ? 180 VAL A HG12 3  
ATOM 5173  H HG13 . VAL A 1 83  ? 0.080   3.347   2.392   1.00 0.00 ? 180 VAL A HG13 3  
ATOM 5174  H HG21 . VAL A 1 83  ? 0.508   3.852   -0.630  1.00 0.00 ? 180 VAL A HG21 3  
ATOM 5175  H HG22 . VAL A 1 83  ? 2.145   4.497   -0.528  1.00 0.00 ? 180 VAL A HG22 3  
ATOM 5176  H HG23 . VAL A 1 83  ? 0.913   5.033   0.615   1.00 0.00 ? 180 VAL A HG23 3  
ATOM 5177  N N    . GLN A 1 84  ? 4.903   2.860   1.051   1.00 0.00 ? 181 GLN A N    3  
ATOM 5178  C CA   . GLN A 1 84  ? 6.140   2.986   0.291   1.00 0.00 ? 181 GLN A CA   3  
ATOM 5179  C C    . GLN A 1 84  ? 6.461   1.671   -0.399  1.00 0.00 ? 181 GLN A C    3  
ATOM 5180  O O    . GLN A 1 84  ? 6.380   0.613   0.217   1.00 0.00 ? 181 GLN A O    3  
ATOM 5181  C CB   . GLN A 1 84  ? 7.298   3.361   1.214   1.00 0.00 ? 181 GLN A CB   3  
ATOM 5182  C CG   . GLN A 1 84  ? 7.203   4.761   1.783   1.00 0.00 ? 181 GLN A CG   3  
ATOM 5183  C CD   . GLN A 1 84  ? 8.203   5.002   2.887   1.00 0.00 ? 181 GLN A CD   3  
ATOM 5184  O OE1  . GLN A 1 84  ? 8.545   4.090   3.631   1.00 0.00 ? 181 GLN A OE1  3  
ATOM 5185  N NE2  . GLN A 1 84  ? 8.690   6.227   2.992   1.00 0.00 ? 181 GLN A NE2  3  
ATOM 5186  H H    . GLN A 1 84  ? 4.712   2.006   1.499   1.00 0.00 ? 181 GLN A H    3  
ATOM 5187  H HA   . GLN A 1 84  ? 6.008   3.758   -0.452  1.00 0.00 ? 181 GLN A HA   3  
ATOM 5188  H HB2  . GLN A 1 84  ? 7.325   2.662   2.038   1.00 0.00 ? 181 GLN A HB2  3  
ATOM 5189  H HB3  . GLN A 1 84  ? 8.222   3.284   0.659   1.00 0.00 ? 181 GLN A HB3  3  
ATOM 5190  H HG2  . GLN A 1 84  ? 7.382   5.472   0.991   1.00 0.00 ? 181 GLN A HG2  3  
ATOM 5191  H HG3  . GLN A 1 84  ? 6.208   4.907   2.180   1.00 0.00 ? 181 GLN A HG3  3  
ATOM 5192  H HE21 . GLN A 1 84  ? 8.380   6.905   2.354   1.00 0.00 ? 181 GLN A HE21 3  
ATOM 5193  H HE22 . GLN A 1 84  ? 9.333   6.413   3.710   1.00 0.00 ? 181 GLN A HE22 3  
ATOM 5194  N N    . VAL A 1 85  ? 6.822   1.735   -1.667  1.00 0.00 ? 182 VAL A N    3  
ATOM 5195  C CA   . VAL A 1 85  ? 7.195   0.541   -2.407  1.00 0.00 ? 182 VAL A CA   3  
ATOM 5196  C C    . VAL A 1 85  ? 8.646   0.637   -2.866  1.00 0.00 ? 182 VAL A C    3  
ATOM 5197  O O    . VAL A 1 85  ? 9.087   1.687   -3.329  1.00 0.00 ? 182 VAL A O    3  
ATOM 5198  C CB   . VAL A 1 85  ? 6.262   0.311   -3.623  1.00 0.00 ? 182 VAL A CB   3  
ATOM 5199  C CG1  . VAL A 1 85  ? 6.232   1.530   -4.536  1.00 0.00 ? 182 VAL A CG1  3  
ATOM 5200  C CG2  . VAL A 1 85  ? 6.683   -0.929  -4.398  1.00 0.00 ? 182 VAL A CG2  3  
ATOM 5201  H H    . VAL A 1 85  ? 6.847   2.604   -2.117  1.00 0.00 ? 182 VAL A H    3  
ATOM 5202  H HA   . VAL A 1 85  ? 7.097   -0.304  -1.742  1.00 0.00 ? 182 VAL A HA   3  
ATOM 5203  H HB   . VAL A 1 85  ? 5.261   0.149   -3.251  1.00 0.00 ? 182 VAL A HB   3  
ATOM 5204  H HG11 . VAL A 1 85  ? 5.563   1.346   -5.366  1.00 0.00 ? 182 VAL A HG11 3  
ATOM 5205  H HG12 . VAL A 1 85  ? 7.226   1.723   -4.913  1.00 0.00 ? 182 VAL A HG12 3  
ATOM 5206  H HG13 . VAL A 1 85  ? 5.887   2.390   -3.980  1.00 0.00 ? 182 VAL A HG13 3  
ATOM 5207  H HG21 . VAL A 1 85  ? 6.648   -1.791  -3.748  1.00 0.00 ? 182 VAL A HG21 3  
ATOM 5208  H HG22 . VAL A 1 85  ? 7.689   -0.799  -4.768  1.00 0.00 ? 182 VAL A HG22 3  
ATOM 5209  H HG23 . VAL A 1 85  ? 6.010   -1.080  -5.231  1.00 0.00 ? 182 VAL A HG23 3  
ATOM 5210  N N    . ARG A 1 86  ? 9.395   -0.446  -2.709  1.00 0.00 ? 183 ARG A N    3  
ATOM 5211  C CA   . ARG A 1 86  ? 10.784  -0.468  -3.141  1.00 0.00 ? 183 ARG A CA   3  
ATOM 5212  C C    . ARG A 1 86  ? 10.986  -1.486  -4.252  1.00 0.00 ? 183 ARG A C    3  
ATOM 5213  O O    . ARG A 1 86  ? 10.224  -2.448  -4.374  1.00 0.00 ? 183 ARG A O    3  
ATOM 5214  C CB   . ARG A 1 86  ? 11.726  -0.749  -1.956  1.00 0.00 ? 183 ARG A CB   3  
ATOM 5215  C CG   . ARG A 1 86  ? 11.540  -2.106  -1.283  1.00 0.00 ? 183 ARG A CG   3  
ATOM 5216  C CD   . ARG A 1 86  ? 12.292  -3.216  -2.003  1.00 0.00 ? 183 ARG A CD   3  
ATOM 5217  N NE   . ARG A 1 86  ? 12.213  -4.486  -1.283  1.00 0.00 ? 183 ARG A NE   3  
ATOM 5218  C CZ   . ARG A 1 86  ? 12.471  -5.676  -1.824  1.00 0.00 ? 183 ARG A CZ   3  
ATOM 5219  N NH1  . ARG A 1 86  ? 12.784  -5.783  -3.110  1.00 0.00 ? 183 ARG A NH1  3  
ATOM 5220  N NH2  . ARG A 1 86  ? 12.400  -6.764  -1.071  1.00 0.00 ? 183 ARG A NH2  3  
ATOM 5221  H H    . ARG A 1 86  ? 9.003   -1.249  -2.297  1.00 0.00 ? 183 ARG A H    3  
ATOM 5222  H HA   . ARG A 1 86  ? 11.011  0.510   -3.536  1.00 0.00 ? 183 ARG A HA   3  
ATOM 5223  H HB2  . ARG A 1 86  ? 12.746  -0.692  -2.308  1.00 0.00 ? 183 ARG A HB2  3  
ATOM 5224  H HB3  . ARG A 1 86  ? 11.576  0.018   -1.209  1.00 0.00 ? 183 ARG A HB3  3  
ATOM 5225  H HG2  . ARG A 1 86  ? 11.902  -2.044  -0.269  1.00 0.00 ? 183 ARG A HG2  3  
ATOM 5226  H HG3  . ARG A 1 86  ? 10.487  -2.345  -1.275  1.00 0.00 ? 183 ARG A HG3  3  
ATOM 5227  H HD2  . ARG A 1 86  ? 11.866  -3.344  -2.985  1.00 0.00 ? 183 ARG A HD2  3  
ATOM 5228  H HD3  . ARG A 1 86  ? 13.329  -2.929  -2.096  1.00 0.00 ? 183 ARG A HD3  3  
ATOM 5229  H HE   . ARG A 1 86  ? 11.960  -4.449  -0.326  1.00 0.00 ? 183 ARG A HE   3  
ATOM 5230  H HH11 . ARG A 1 86  ? 12.828  -4.968  -3.687  1.00 0.00 ? 183 ARG A HH11 3  
ATOM 5231  H HH12 . ARG A 1 86  ? 12.978  -6.687  -3.506  1.00 0.00 ? 183 ARG A HH12 3  
ATOM 5232  H HH21 . ARG A 1 86  ? 12.150  -6.687  -0.097  1.00 0.00 ? 183 ARG A HH21 3  
ATOM 5233  H HH22 . ARG A 1 86  ? 12.597  -7.664  -1.466  1.00 0.00 ? 183 ARG A HH22 3  
ATOM 5234  N N    . CYS A 1 87  ? 12.015  -1.273  -5.051  1.00 0.00 ? 184 CYS A N    3  
ATOM 5235  C CA   . CYS A 1 87  ? 12.329  -2.163  -6.152  1.00 0.00 ? 184 CYS A CA   3  
ATOM 5236  C C    . CYS A 1 87  ? 13.829  -2.414  -6.200  1.00 0.00 ? 184 CYS A C    3  
ATOM 5237  O O    . CYS A 1 87  ? 14.585  -1.841  -5.413  1.00 0.00 ? 184 CYS A O    3  
ATOM 5238  C CB   . CYS A 1 87  ? 11.855  -1.553  -7.475  1.00 0.00 ? 184 CYS A CB   3  
ATOM 5239  S SG   . CYS A 1 87  ? 12.584  0.058   -7.848  1.00 0.00 ? 184 CYS A SG   3  
ATOM 5240  H H    . CYS A 1 87  ? 12.593  -0.490  -4.892  1.00 0.00 ? 184 CYS A H    3  
ATOM 5241  H HA   . CYS A 1 87  ? 11.818  -3.099  -5.986  1.00 0.00 ? 184 CYS A HA   3  
ATOM 5242  H HB2  . CYS A 1 87  ? 12.109  -2.223  -8.283  1.00 0.00 ? 184 CYS A HB2  3  
ATOM 5243  H HB3  . CYS A 1 87  ? 10.782  -1.429  -7.441  1.00 0.00 ? 184 CYS A HB3  3  
ATOM 5244  H HG   . CYS A 1 87  ? 12.580  0.222   -9.163  1.00 0.00 ? 184 CYS A HG   3  
ATOM 5245  N N    . LYS A 1 88  ? 14.253  -3.289  -7.099  1.00 0.00 ? 185 LYS A N    3  
ATOM 5246  C CA   . LYS A 1 88  ? 15.675  -3.516  -7.319  1.00 0.00 ? 185 LYS A CA   3  
ATOM 5247  C C    . LYS A 1 88  ? 16.025  -3.306  -8.793  1.00 0.00 ? 185 LYS A C    3  
ATOM 5248  O O    . LYS A 1 88  ? 16.075  -4.264  -9.568  1.00 0.00 ? 185 LYS A O    3  
ATOM 5249  C CB   . LYS A 1 88  ? 16.073  -4.932  -6.889  1.00 0.00 ? 185 LYS A CB   3  
ATOM 5250  C CG   . LYS A 1 88  ? 15.621  -5.304  -5.483  1.00 0.00 ? 185 LYS A CG   3  
ATOM 5251  C CD   . LYS A 1 88  ? 16.331  -6.550  -4.970  1.00 0.00 ? 185 LYS A CD   3  
ATOM 5252  C CE   . LYS A 1 88  ? 16.222  -7.714  -5.940  1.00 0.00 ? 185 LYS A CE   3  
ATOM 5253  N NZ   . LYS A 1 88  ? 16.988  -8.899  -5.471  1.00 0.00 ? 185 LYS A NZ   3  
ATOM 5254  H H    . LYS A 1 88  ? 13.597  -3.802  -7.618  1.00 0.00 ? 185 LYS A H    3  
ATOM 5255  H HA   . LYS A 1 88  ? 16.222  -2.799  -6.726  1.00 0.00 ? 185 LYS A HA   3  
ATOM 5256  H HB2  . LYS A 1 88  ? 15.640  -5.639  -7.579  1.00 0.00 ? 185 LYS A HB2  3  
ATOM 5257  H HB3  . LYS A 1 88  ? 17.149  -5.017  -6.932  1.00 0.00 ? 185 LYS A HB3  3  
ATOM 5258  H HG2  . LYS A 1 88  ? 15.836  -4.481  -4.817  1.00 0.00 ? 185 LYS A HG2  3  
ATOM 5259  H HG3  . LYS A 1 88  ? 14.557  -5.487  -5.497  1.00 0.00 ? 185 LYS A HG3  3  
ATOM 5260  H HD2  . LYS A 1 88  ? 17.374  -6.321  -4.818  1.00 0.00 ? 185 LYS A HD2  3  
ATOM 5261  H HD3  . LYS A 1 88  ? 15.886  -6.839  -4.028  1.00 0.00 ? 185 LYS A HD3  3  
ATOM 5262  H HE2  . LYS A 1 88  ? 15.183  -7.985  -6.040  1.00 0.00 ? 185 LYS A HE2  3  
ATOM 5263  H HE3  . LYS A 1 88  ? 16.608  -7.402  -6.899  1.00 0.00 ? 185 LYS A HE3  3  
ATOM 5264  H HZ1  . LYS A 1 88  ? 16.865  -9.692  -6.132  1.00 0.00 ? 185 LYS A HZ1  3  
ATOM 5265  H HZ2  . LYS A 1 88  ? 16.658  -9.193  -4.531  1.00 0.00 ? 185 LYS A HZ2  3  
ATOM 5266  H HZ3  . LYS A 1 88  ? 18.002  -8.671  -5.413  1.00 0.00 ? 185 LYS A HZ3  3  
ATOM 5267  N N    . PRO A 1 89  ? 16.261  -2.046  -9.201  1.00 0.00 ? 186 PRO A N    3  
ATOM 5268  C CA   . PRO A 1 89  ? 16.624  -1.705  -10.585 1.00 0.00 ? 186 PRO A CA   3  
ATOM 5269  C C    . PRO A 1 89  ? 17.867  -2.448  -11.063 1.00 0.00 ? 186 PRO A C    3  
ATOM 5270  O O    . PRO A 1 89  ? 18.786  -2.721  -10.288 1.00 0.00 ? 186 PRO A O    3  
ATOM 5271  C CB   . PRO A 1 89  ? 16.906  -0.202  -10.521 1.00 0.00 ? 186 PRO A CB   3  
ATOM 5272  C CG   . PRO A 1 89  ? 16.132  0.274   -9.345  1.00 0.00 ? 186 PRO A CG   3  
ATOM 5273  C CD   . PRO A 1 89  ? 16.182  -0.847  -8.349  1.00 0.00 ? 186 PRO A CD   3  
ATOM 5274  H HA   . PRO A 1 89  ? 15.808  -1.894  -11.267 1.00 0.00 ? 186 PRO A HA   3  
ATOM 5275  H HB2  . PRO A 1 89  ? 17.966  -0.036  -10.390 1.00 0.00 ? 186 PRO A HB2  3  
ATOM 5276  H HB3  . PRO A 1 89  ? 16.572  0.270   -11.431 1.00 0.00 ? 186 PRO A HB3  3  
ATOM 5277  H HG2  . PRO A 1 89  ? 16.591  1.164   -8.938  1.00 0.00 ? 186 PRO A HG2  3  
ATOM 5278  H HG3  . PRO A 1 89  ? 15.113  0.473   -9.635  1.00 0.00 ? 186 PRO A HG3  3  
ATOM 5279  H HD2  . PRO A 1 89  ? 17.058  -0.757  -7.723  1.00 0.00 ? 186 PRO A HD2  3  
ATOM 5280  H HD3  . PRO A 1 89  ? 15.285  -0.858  -7.747  1.00 0.00 ? 186 PRO A HD3  3  
ATOM 5281  N N    . ASP A 1 90  ? 17.887  -2.759  -12.352 1.00 0.00 ? 187 ASP A N    3  
ATOM 5282  C CA   . ASP A 1 90  ? 18.997  -3.495  -12.952 1.00 0.00 ? 187 ASP A CA   3  
ATOM 5283  C C    . ASP A 1 90  ? 20.237  -2.617  -13.026 1.00 0.00 ? 187 ASP A C    3  
ATOM 5284  O O    . ASP A 1 90  ? 21.366  -3.102  -12.964 1.00 0.00 ? 187 ASP A O    3  
ATOM 5285  C CB   . ASP A 1 90  ? 18.622  -3.992  -14.349 1.00 0.00 ? 187 ASP A CB   3  
ATOM 5286  C CG   . ASP A 1 90  ? 19.781  -4.678  -15.048 1.00 0.00 ? 187 ASP A CG   3  
ATOM 5287  O OD1  . ASP A 1 90  ? 20.176  -5.781  -14.614 1.00 0.00 ? 187 ASP A OD1  3  
ATOM 5288  O OD2  . ASP A 1 90  ? 20.311  -4.109  -16.024 1.00 0.00 ? 187 ASP A OD2  3  
ATOM 5289  H H    . ASP A 1 90  ? 17.137  -2.480  -12.918 1.00 0.00 ? 187 ASP A H    3  
ATOM 5290  H HA   . ASP A 1 90  ? 19.210  -4.344  -12.320 1.00 0.00 ? 187 ASP A HA   3  
ATOM 5291  H HB2  . ASP A 1 90  ? 17.807  -4.696  -14.269 1.00 0.00 ? 187 ASP A HB2  3  
ATOM 5292  H HB3  . ASP A 1 90  ? 18.309  -3.152  -14.951 1.00 0.00 ? 187 ASP A HB3  3  
ATOM 5293  N N    . HIS A 1 91  ? 20.017  -1.316  -13.145 1.00 0.00 ? 188 HIS A N    3  
ATOM 5294  C CA   . HIS A 1 91  ? 21.111  -0.354  -13.173 1.00 0.00 ? 188 HIS A CA   3  
ATOM 5295  C C    . HIS A 1 91  ? 21.403  0.163   -11.770 1.00 0.00 ? 188 HIS A C    3  
ATOM 5296  O O    . HIS A 1 91  ? 21.930  1.260   -11.596 1.00 0.00 ? 188 HIS A O    3  
ATOM 5297  C CB   . HIS A 1 91  ? 20.788  0.812   -14.114 1.00 0.00 ? 188 HIS A CB   3  
ATOM 5298  C CG   . HIS A 1 91  ? 20.820  0.442   -15.565 1.00 0.00 ? 188 HIS A CG   3  
ATOM 5299  N ND1  . HIS A 1 91  ? 21.924  0.638   -16.364 1.00 0.00 ? 188 HIS A ND1  3  
ATOM 5300  C CD2  . HIS A 1 91  ? 19.879  -0.119  -16.361 1.00 0.00 ? 188 HIS A CD2  3  
ATOM 5301  C CE1  . HIS A 1 91  ? 21.660  0.218   -17.586 1.00 0.00 ? 188 HIS A CE1  3  
ATOM 5302  N NE2  . HIS A 1 91  ? 20.427  -0.245  -17.612 1.00 0.00 ? 188 HIS A NE2  3  
ATOM 5303  H H    . HIS A 1 91  ? 19.092  -0.991  -13.217 1.00 0.00 ? 188 HIS A H    3  
ATOM 5304  H HA   . HIS A 1 91  ? 21.988  -0.866  -13.540 1.00 0.00 ? 188 HIS A HA   3  
ATOM 5305  H HB2  . HIS A 1 91  ? 19.800  1.185   -13.889 1.00 0.00 ? 188 HIS A HB2  3  
ATOM 5306  H HB3  . HIS A 1 91  ? 21.508  1.602   -13.956 1.00 0.00 ? 188 HIS A HB3  3  
ATOM 5307  H HD1  . HIS A 1 91  ? 22.780  1.025   -16.077 1.00 0.00 ? 188 HIS A HD1  3  
ATOM 5308  H HD2  . HIS A 1 91  ? 18.882  -0.411  -16.066 1.00 0.00 ? 188 HIS A HD2  3  
ATOM 5309  H HE1  . HIS A 1 91  ? 22.341  0.249   -18.423 1.00 0.00 ? 188 HIS A HE1  3  
ATOM 5310  H HE2  . HIS A 1 91  ? 19.923  -0.443  -18.431 1.00 0.00 ? 188 HIS A HE2  3  
ATOM 5311  N N    . GLY A 1 92  ? 21.038  -0.630  -10.774 1.00 0.00 ? 189 GLY A N    3  
ATOM 5312  C CA   . GLY A 1 92  ? 21.288  -0.269  -9.396  1.00 0.00 ? 189 GLY A CA   3  
ATOM 5313  C C    . GLY A 1 92  ? 21.004  -1.423  -8.461  1.00 0.00 ? 189 GLY A C    3  
ATOM 5314  O O    . GLY A 1 92  ? 21.423  -2.551  -8.717  1.00 0.00 ? 189 GLY A O    3  
ATOM 5315  H H    . GLY A 1 92  ? 20.592  -1.481  -10.978 1.00 0.00 ? 189 GLY A H    3  
ATOM 5316  H HA2  . GLY A 1 92  ? 22.322  0.025   -9.290  1.00 0.00 ? 189 GLY A HA2  3  
ATOM 5317  H HA3  . GLY A 1 92  ? 20.654  0.563   -9.128  1.00 0.00 ? 189 GLY A HA3  3  
ATOM 5318  N N    . TYR A 1 93  ? 20.284  -1.143  -7.387  1.00 0.00 ? 190 TYR A N    3  
ATOM 5319  C CA   . TYR A 1 93  ? 19.883  -2.165  -6.430  1.00 0.00 ? 190 TYR A CA   3  
ATOM 5320  C C    . TYR A 1 93  ? 18.749  -1.620  -5.571  1.00 0.00 ? 190 TYR A C    3  
ATOM 5321  O O    . TYR A 1 93  ? 18.139  -0.620  -5.949  1.00 0.00 ? 190 TYR A O    3  
ATOM 5322  C CB   . TYR A 1 93  ? 21.074  -2.614  -5.557  1.00 0.00 ? 190 TYR A CB   3  
ATOM 5323  C CG   . TYR A 1 93  ? 21.616  -1.565  -4.606  1.00 0.00 ? 190 TYR A CG   3  
ATOM 5324  C CD1  . TYR A 1 93  ? 22.447  -0.549  -5.056  1.00 0.00 ? 190 TYR A CD1  3  
ATOM 5325  C CD2  . TYR A 1 93  ? 21.309  -1.604  -3.252  1.00 0.00 ? 190 TYR A CD2  3  
ATOM 5326  C CE1  . TYR A 1 93  ? 22.952  0.398   -4.187  1.00 0.00 ? 190 TYR A CE1  3  
ATOM 5327  C CE2  . TYR A 1 93  ? 21.807  -0.659  -2.377  1.00 0.00 ? 190 TYR A CE2  3  
ATOM 5328  C CZ   . TYR A 1 93  ? 22.628  0.339   -2.849  1.00 0.00 ? 190 TYR A CZ   3  
ATOM 5329  O OH   . TYR A 1 93  ? 23.124  1.288   -1.982  1.00 0.00 ? 190 TYR A OH   3  
ATOM 5330  H H    . TYR A 1 93  ? 19.994  -0.219  -7.237  1.00 0.00 ? 190 TYR A H    3  
ATOM 5331  H HA   . TYR A 1 93  ? 19.514  -3.012  -6.988  1.00 0.00 ? 190 TYR A HA   3  
ATOM 5332  H HB2  . TYR A 1 93  ? 20.769  -3.460  -4.962  1.00 0.00 ? 190 TYR A HB2  3  
ATOM 5333  H HB3  . TYR A 1 93  ? 21.883  -2.920  -6.206  1.00 0.00 ? 190 TYR A HB3  3  
ATOM 5334  H HD1  . TYR A 1 93  ? 22.697  -0.504  -6.106  1.00 0.00 ? 190 TYR A HD1  3  
ATOM 5335  H HD2  . TYR A 1 93  ? 20.667  -2.389  -2.885  1.00 0.00 ? 190 TYR A HD2  3  
ATOM 5336  H HE1  . TYR A 1 93  ? 23.597  1.180   -4.559  1.00 0.00 ? 190 TYR A HE1  3  
ATOM 5337  H HE2  . TYR A 1 93  ? 21.552  -0.707  -1.328  1.00 0.00 ? 190 TYR A HE2  3  
ATOM 5338  H HH   . TYR A 1 93  ? 23.189  2.135   -2.443  1.00 0.00 ? 190 TYR A HH   3  
ATOM 5339  N N    . TRP A 1 94  ? 18.471  -2.293  -4.450  1.00 0.00 ? 191 TRP A N    3  
ATOM 5340  C CA   . TRP A 1 94  ? 17.475  -1.845  -3.463  1.00 0.00 ? 191 TRP A CA   3  
ATOM 5341  C C    . TRP A 1 94  ? 17.337  -0.328  -3.413  1.00 0.00 ? 191 TRP A C    3  
ATOM 5342  O O    . TRP A 1 94  ? 18.326  0.396   -3.279  1.00 0.00 ? 191 TRP A O    3  
ATOM 5343  C CB   . TRP A 1 94  ? 17.866  -2.338  -2.075  1.00 0.00 ? 191 TRP A CB   3  
ATOM 5344  C CG   . TRP A 1 94  ? 17.460  -3.744  -1.791  1.00 0.00 ? 191 TRP A CG   3  
ATOM 5345  C CD1  . TRP A 1 94  ? 17.951  -4.883  -2.357  1.00 0.00 ? 191 TRP A CD1  3  
ATOM 5346  C CD2  . TRP A 1 94  ? 16.483  -4.153  -0.839  1.00 0.00 ? 191 TRP A CD2  3  
ATOM 5347  N NE1  . TRP A 1 94  ? 17.324  -5.980  -1.815  1.00 0.00 ? 191 TRP A NE1  3  
ATOM 5348  C CE2  . TRP A 1 94  ? 16.420  -5.555  -0.877  1.00 0.00 ? 191 TRP A CE2  3  
ATOM 5349  C CE3  . TRP A 1 94  ? 15.653  -3.459  0.042   1.00 0.00 ? 191 TRP A CE3  3  
ATOM 5350  C CZ2  . TRP A 1 94  ? 15.560  -6.282  -0.063  1.00 0.00 ? 191 TRP A CZ2  3  
ATOM 5351  C CZ3  . TRP A 1 94  ? 14.797  -4.179  0.850   1.00 0.00 ? 191 TRP A CZ3  3  
ATOM 5352  C CH2  . TRP A 1 94  ? 14.756  -5.578  0.794   1.00 0.00 ? 191 TRP A CH2  3  
ATOM 5353  H H    . TRP A 1 94  ? 18.944  -3.137  -4.285  1.00 0.00 ? 191 TRP A H    3  
ATOM 5354  H HA   . TRP A 1 94  ? 16.523  -2.275  -3.731  1.00 0.00 ? 191 TRP A HA   3  
ATOM 5355  H HB2  . TRP A 1 94  ? 18.938  -2.277  -1.969  1.00 0.00 ? 191 TRP A HB2  3  
ATOM 5356  H HB3  . TRP A 1 94  ? 17.404  -1.702  -1.335  1.00 0.00 ? 191 TRP A HB3  3  
ATOM 5357  H HD1  . TRP A 1 94  ? 18.712  -4.904  -3.123  1.00 0.00 ? 191 TRP A HD1  3  
ATOM 5358  H HE1  . TRP A 1 94  ? 17.501  -6.917  -2.058  1.00 0.00 ? 191 TRP A HE1  3  
ATOM 5359  H HE3  . TRP A 1 94  ? 15.673  -2.377  0.091   1.00 0.00 ? 191 TRP A HE3  3  
ATOM 5360  H HZ2  . TRP A 1 94  ? 15.516  -7.361  -0.093  1.00 0.00 ? 191 TRP A HZ2  3  
ATOM 5361  H HZ3  . TRP A 1 94  ? 14.147  -3.662  1.540   1.00 0.00 ? 191 TRP A HZ3  3  
ATOM 5362  H HH2  . TRP A 1 94  ? 14.071  -6.100  1.444   1.00 0.00 ? 191 TRP A HH2  3  
ATOM 5363  N N    . SER A 1 95  ? 16.105  0.149   -3.500  1.00 0.00 ? 192 SER A N    3  
ATOM 5364  C CA   . SER A 1 95  ? 15.849  1.573   -3.527  1.00 0.00 ? 192 SER A CA   3  
ATOM 5365  C C    . SER A 1 95  ? 15.458  2.094   -2.153  1.00 0.00 ? 192 SER A C    3  
ATOM 5366  O O    . SER A 1 95  ? 15.256  3.298   -1.969  1.00 0.00 ? 192 SER A O    3  
ATOM 5367  C CB   . SER A 1 95  ? 14.759  1.888   -4.552  1.00 0.00 ? 192 SER A CB   3  
ATOM 5368  O OG   . SER A 1 95  ? 13.601  1.100   -4.318  1.00 0.00 ? 192 SER A OG   3  
ATOM 5369  H H    . SER A 1 95  ? 15.350  -0.471  -3.562  1.00 0.00 ? 192 SER A H    3  
ATOM 5370  H HA   . SER A 1 95  ? 16.760  2.056   -3.821  1.00 0.00 ? 192 SER A HA   3  
ATOM 5371  H HB2  . SER A 1 95  ? 14.489  2.931   -4.481  1.00 0.00 ? 192 SER A HB2  3  
ATOM 5372  H HB3  . SER A 1 95  ? 15.129  1.678   -5.545  1.00 0.00 ? 192 SER A HB3  3  
ATOM 5373  H HG   . SER A 1 95  ? 12.874  1.679   -4.053  1.00 0.00 ? 192 SER A HG   3  
ATOM 5374  N N    . ALA A 1 96  ? 15.366  1.174   -1.193  1.00 0.00 ? 193 ALA A N    3  
ATOM 5375  C CA   . ALA A 1 96  ? 14.996  1.507   0.177   1.00 0.00 ? 193 ALA A CA   3  
ATOM 5376  C C    . ALA A 1 96  ? 13.631  2.188   0.219   1.00 0.00 ? 193 ALA A C    3  
ATOM 5377  O O    . ALA A 1 96  ? 12.822  2.034   -0.696  1.00 0.00 ? 193 ALA A O    3  
ATOM 5378  C CB   . ALA A 1 96  ? 16.071  2.384   0.803   1.00 0.00 ? 193 ALA A CB   3  
ATOM 5379  H H    . ALA A 1 96  ? 15.556  0.246   -1.418  1.00 0.00 ? 193 ALA A H    3  
ATOM 5380  H HA   . ALA A 1 96  ? 14.941  0.589   0.743   1.00 0.00 ? 193 ALA A HA   3  
ATOM 5381  H HB1  . ALA A 1 96  ? 16.123  3.321   0.269   1.00 0.00 ? 193 ALA A HB1  3  
ATOM 5382  H HB2  . ALA A 1 96  ? 17.024  1.880   0.739   1.00 0.00 ? 193 ALA A HB2  3  
ATOM 5383  H HB3  . ALA A 1 96  ? 15.829  2.569   1.838   1.00 0.00 ? 193 ALA A HB3  3  
ATOM 5384  N N    . TRP A 1 97  ? 13.374  2.931   1.280   1.00 0.00 ? 194 TRP A N    3  
ATOM 5385  C CA   . TRP A 1 97  ? 12.080  3.567   1.462   1.00 0.00 ? 194 TRP A CA   3  
ATOM 5386  C C    . TRP A 1 97  ? 12.228  5.084   1.488   1.00 0.00 ? 194 TRP A C    3  
ATOM 5387  O O    . TRP A 1 97  ? 12.727  5.647   2.463   1.00 0.00 ? 194 TRP A O    3  
ATOM 5388  C CB   . TRP A 1 97  ? 11.442  3.097   2.766   1.00 0.00 ? 194 TRP A CB   3  
ATOM 5389  C CG   . TRP A 1 97  ? 11.545  1.620   2.999   1.00 0.00 ? 194 TRP A CG   3  
ATOM 5390  C CD1  . TRP A 1 97  ? 12.395  0.995   3.860   1.00 0.00 ? 194 TRP A CD1  3  
ATOM 5391  C CD2  . TRP A 1 97  ? 10.780  0.586   2.368   1.00 0.00 ? 194 TRP A CD2  3  
ATOM 5392  N NE1  . TRP A 1 97  ? 12.195  -0.361  3.824   1.00 0.00 ? 194 TRP A NE1  3  
ATOM 5393  C CE2  . TRP A 1 97  ? 11.211  -0.639  2.914   1.00 0.00 ? 194 TRP A CE2  3  
ATOM 5394  C CE3  . TRP A 1 97  ? 9.772   0.574   1.403   1.00 0.00 ? 194 TRP A CE3  3  
ATOM 5395  C CZ2  . TRP A 1 97  ? 10.668  -1.860  2.530   1.00 0.00 ? 194 TRP A CZ2  3  
ATOM 5396  C CZ3  . TRP A 1 97  ? 9.234   -0.640  1.019   1.00 0.00 ? 194 TRP A CZ3  3  
ATOM 5397  C CH2  . TRP A 1 97  ? 9.681   -1.841  1.583   1.00 0.00 ? 194 TRP A CH2  3  
ATOM 5398  H H    . TRP A 1 97  ? 14.069  3.054   1.958   1.00 0.00 ? 194 TRP A H    3  
ATOM 5399  H HA   . TRP A 1 97  ? 11.448  3.285   0.636   1.00 0.00 ? 194 TRP A HA   3  
ATOM 5400  H HB2  . TRP A 1 97  ? 11.925  3.596   3.593   1.00 0.00 ? 194 TRP A HB2  3  
ATOM 5401  H HB3  . TRP A 1 97  ? 10.394  3.361   2.759   1.00 0.00 ? 194 TRP A HB3  3  
ATOM 5402  H HD1  . TRP A 1 97  ? 13.111  1.508   4.480   1.00 0.00 ? 194 TRP A HD1  3  
ATOM 5403  H HE1  . TRP A 1 97  ? 12.681  -1.025  4.361   1.00 0.00 ? 194 TRP A HE1  3  
ATOM 5404  H HE3  . TRP A 1 97  ? 9.414   1.489   0.956   1.00 0.00 ? 194 TRP A HE3  3  
ATOM 5405  H HZ2  . TRP A 1 97  ? 10.997  -2.794  2.961   1.00 0.00 ? 194 TRP A HZ2  3  
ATOM 5406  H HZ3  . TRP A 1 97  ? 8.454   -0.670  0.273   1.00 0.00 ? 194 TRP A HZ3  3  
ATOM 5407  H HH2  . TRP A 1 97  ? 9.233   -2.765  1.251   1.00 0.00 ? 194 TRP A HH2  3  
ATOM 5408  N N    . SER A 1 98  ? 11.817  5.745   0.417   1.00 0.00 ? 195 SER A N    3  
ATOM 5409  C CA   . SER A 1 98  ? 11.895  7.197   0.352   1.00 0.00 ? 195 SER A CA   3  
ATOM 5410  C C    . SER A 1 98  ? 10.502  7.847   0.256   1.00 0.00 ? 195 SER A C    3  
ATOM 5411  O O    . SER A 1 98  ? 10.133  8.615   1.143   1.00 0.00 ? 195 SER A O    3  
ATOM 5412  C CB   . SER A 1 98  ? 12.803  7.640   -0.807  1.00 0.00 ? 195 SER A CB   3  
ATOM 5413  O OG   . SER A 1 98  ? 12.937  9.050   -0.856  1.00 0.00 ? 195 SER A OG   3  
ATOM 5414  H H    . SER A 1 98  ? 11.472  5.246   -0.352  1.00 0.00 ? 195 SER A H    3  
ATOM 5415  H HA   . SER A 1 98  ? 12.348  7.526   1.276   1.00 0.00 ? 195 SER A HA   3  
ATOM 5416  H HB2  . SER A 1 98  ? 13.783  7.206   -0.677  1.00 0.00 ? 195 SER A HB2  3  
ATOM 5417  H HB3  . SER A 1 98  ? 12.386  7.298   -1.740  1.00 0.00 ? 195 SER A HB3  3  
ATOM 5418  H HG   . SER A 1 98  ? 13.138  9.384   0.029   1.00 0.00 ? 195 SER A HG   3  
ATOM 5419  N N    . PRO A 1 99  ? 9.687   7.546   -0.786  1.00 0.00 ? 196 PRO A N    3  
ATOM 5420  C CA   . PRO A 1 99  ? 8.413   8.248   -1.003  1.00 0.00 ? 196 PRO A CA   3  
ATOM 5421  C C    . PRO A 1 99  ? 7.299   7.789   -0.062  1.00 0.00 ? 196 PRO A C    3  
ATOM 5422  O O    . PRO A 1 99  ? 6.517   6.895   -0.397  1.00 0.00 ? 196 PRO A O    3  
ATOM 5423  C CB   . PRO A 1 99  ? 8.069   7.893   -2.448  1.00 0.00 ? 196 PRO A CB   3  
ATOM 5424  C CG   . PRO A 1 99  ? 8.656   6.540   -2.645  1.00 0.00 ? 196 PRO A CG   3  
ATOM 5425  C CD   . PRO A 1 99  ? 9.914   6.507   -1.818  1.00 0.00 ? 196 PRO A CD   3  
ATOM 5426  H HA   . PRO A 1 99  ? 8.535   9.317   -0.915  1.00 0.00 ? 196 PRO A HA   3  
ATOM 5427  H HB2  . PRO A 1 99  ? 6.996   7.883   -2.575  1.00 0.00 ? 196 PRO A HB2  3  
ATOM 5428  H HB3  . PRO A 1 99  ? 8.510   8.617   -3.117  1.00 0.00 ? 196 PRO A HB3  3  
ATOM 5429  H HG2  . PRO A 1 99  ? 7.963   5.786   -2.304  1.00 0.00 ? 196 PRO A HG2  3  
ATOM 5430  H HG3  . PRO A 1 99  ? 8.890   6.391   -3.689  1.00 0.00 ? 196 PRO A HG3  3  
ATOM 5431  H HD2  . PRO A 1 99  ? 10.039  5.536   -1.364  1.00 0.00 ? 196 PRO A HD2  3  
ATOM 5432  H HD3  . PRO A 1 99  ? 10.767  6.752   -2.429  1.00 0.00 ? 196 PRO A HD3  3  
ATOM 5433  N N    . ALA A 1 100 ? 7.221   8.402   1.113   1.00 0.00 ? 197 ALA A N    3  
ATOM 5434  C CA   . ALA A 1 100 ? 6.162   8.083   2.062   1.00 0.00 ? 197 ALA A CA   3  
ATOM 5435  C C    . ALA A 1 100 ? 4.853   8.710   1.608   1.00 0.00 ? 197 ALA A C    3  
ATOM 5436  O O    . ALA A 1 100 ? 4.636   9.913   1.763   1.00 0.00 ? 197 ALA A O    3  
ATOM 5437  C CB   . ALA A 1 100 ? 6.529   8.539   3.467   1.00 0.00 ? 197 ALA A CB   3  
ATOM 5438  H H    . ALA A 1 100 ? 7.881   9.096   1.339   1.00 0.00 ? 197 ALA A H    3  
ATOM 5439  H HA   . ALA A 1 100 ? 6.044   7.009   2.076   1.00 0.00 ? 197 ALA A HA   3  
ATOM 5440  H HB1  . ALA A 1 100 ? 5.715   8.311   4.139   1.00 0.00 ? 197 ALA A HB1  3  
ATOM 5441  H HB2  . ALA A 1 100 ? 6.710   9.604   3.467   1.00 0.00 ? 197 ALA A HB2  3  
ATOM 5442  H HB3  . ALA A 1 100 ? 7.421   8.018   3.794   1.00 0.00 ? 197 ALA A HB3  3  
ATOM 5443  N N    . THR A 1 101 ? 3.996   7.890   1.026   1.00 0.00 ? 198 THR A N    3  
ATOM 5444  C CA   . THR A 1 101 ? 2.753   8.365   0.453   1.00 0.00 ? 198 THR A CA   3  
ATOM 5445  C C    . THR A 1 101 ? 1.625   8.316   1.481   1.00 0.00 ? 198 THR A C    3  
ATOM 5446  O O    . THR A 1 101 ? 1.435   7.306   2.159   1.00 0.00 ? 198 THR A O    3  
ATOM 5447  C CB   . THR A 1 101 ? 2.375   7.523   -0.777  1.00 0.00 ? 198 THR A CB   3  
ATOM 5448  O OG1  . THR A 1 101 ? 3.512   7.416   -1.648  1.00 0.00 ? 198 THR A OG1  3  
ATOM 5449  C CG2  . THR A 1 101 ? 1.207   8.143   -1.531  1.00 0.00 ? 198 THR A CG2  3  
ATOM 5450  H H    . THR A 1 101 ? 4.207   6.930   0.982   1.00 0.00 ? 198 THR A H    3  
ATOM 5451  H HA   . THR A 1 101 ? 2.898   9.387   0.136   1.00 0.00 ? 198 THR A HA   3  
ATOM 5452  H HB   . THR A 1 101 ? 2.090   6.536   -0.445  1.00 0.00 ? 198 THR A HB   3  
ATOM 5453  H HG1  . THR A 1 101 ? 4.212   6.922   -1.200  1.00 0.00 ? 198 THR A HG1  3  
ATOM 5454  H HG21 . THR A 1 101 ? 1.487   9.123   -1.889  1.00 0.00 ? 198 THR A HG21 3  
ATOM 5455  H HG22 . THR A 1 101 ? 0.357   8.230   -0.869  1.00 0.00 ? 198 THR A HG22 3  
ATOM 5456  H HG23 . THR A 1 101 ? 0.946   7.514   -2.370  1.00 0.00 ? 198 THR A HG23 3  
ATOM 5457  N N    . PHE A 1 102 ? 0.899   9.418   1.592   1.00 0.00 ? 199 PHE A N    3  
ATOM 5458  C CA   . PHE A 1 102 ? -0.202  9.534   2.538   1.00 0.00 ? 199 PHE A CA   3  
ATOM 5459  C C    . PHE A 1 102 ? -1.522  9.184   1.864   1.00 0.00 ? 199 PHE A C    3  
ATOM 5460  O O    . PHE A 1 102 ? -1.801  9.653   0.757   1.00 0.00 ? 199 PHE A O    3  
ATOM 5461  C CB   . PHE A 1 102 ? -0.272  10.965  3.089   1.00 0.00 ? 199 PHE A CB   3  
ATOM 5462  C CG   . PHE A 1 102 ? 0.865   11.340  4.003   1.00 0.00 ? 199 PHE A CG   3  
ATOM 5463  C CD1  . PHE A 1 102 ? 2.182   11.287  3.571   1.00 0.00 ? 199 PHE A CD1  3  
ATOM 5464  C CD2  . PHE A 1 102 ? 0.612   11.742  5.302   1.00 0.00 ? 199 PHE A CD2  3  
ATOM 5465  C CE1  . PHE A 1 102 ? 3.220   11.626  4.417   1.00 0.00 ? 199 PHE A CE1  3  
ATOM 5466  C CE2  . PHE A 1 102 ? 1.645   12.083  6.154   1.00 0.00 ? 199 PHE A CE2  3  
ATOM 5467  C CZ   . PHE A 1 102 ? 2.951   12.025  5.710   1.00 0.00 ? 199 PHE A CZ   3  
ATOM 5468  H H    . PHE A 1 102 ? 1.106   10.182  1.012   1.00 0.00 ? 199 PHE A H    3  
ATOM 5469  H HA   . PHE A 1 102 ? -0.025  8.847   3.352   1.00 0.00 ? 199 PHE A HA   3  
ATOM 5470  H HB2  . PHE A 1 102 ? -0.269  11.658  2.261   1.00 0.00 ? 199 PHE A HB2  3  
ATOM 5471  H HB3  . PHE A 1 102 ? -1.194  11.082  3.641   1.00 0.00 ? 199 PHE A HB3  3  
ATOM 5472  H HD1  . PHE A 1 102 ? 2.394   10.973  2.559   1.00 0.00 ? 199 PHE A HD1  3  
ATOM 5473  H HD2  . PHE A 1 102 ? -0.408  11.789  5.650   1.00 0.00 ? 199 PHE A HD2  3  
ATOM 5474  H HE1  . PHE A 1 102 ? 4.240   11.580  4.068   1.00 0.00 ? 199 PHE A HE1  3  
ATOM 5475  H HE2  . PHE A 1 102 ? 1.432   12.395  7.166   1.00 0.00 ? 199 PHE A HE2  3  
ATOM 5476  H HZ   . PHE A 1 102 ? 3.760   12.292  6.373   1.00 0.00 ? 199 PHE A HZ   3  
ATOM 5477  N N    . ILE A 1 103 ? -2.326  8.346   2.507   1.00 0.00 ? 200 ILE A N    3  
ATOM 5478  C CA   . ILE A 1 103 ? -3.648  8.045   2.000   1.00 0.00 ? 200 ILE A CA   3  
ATOM 5479  C C    . ILE A 1 103 ? -4.634  7.779   3.141   1.00 0.00 ? 200 ILE A C    3  
ATOM 5480  O O    . ILE A 1 103 ? -4.255  7.321   4.226   1.00 0.00 ? 200 ILE A O    3  
ATOM 5481  C CB   . ILE A 1 103 ? -3.631  6.833   1.050   1.00 0.00 ? 200 ILE A CB   3  
ATOM 5482  C CG1  . ILE A 1 103 ? -5.023  6.681   0.421   1.00 0.00 ? 200 ILE A CG1  3  
ATOM 5483  C CG2  . ILE A 1 103 ? -3.187  5.572   1.793   1.00 0.00 ? 200 ILE A CG2  3  
ATOM 5484  C CD1  . ILE A 1 103 ? -5.523  5.273   0.326   1.00 0.00 ? 200 ILE A CD1  3  
ATOM 5485  H H    . ILE A 1 103 ? -2.017  7.903   3.324   1.00 0.00 ? 200 ILE A H    3  
ATOM 5486  H HA   . ILE A 1 103 ? -3.990  8.902   1.440   1.00 0.00 ? 200 ILE A HA   3  
ATOM 5487  H HB   . ILE A 1 103 ? -2.913  7.029   0.268   1.00 0.00 ? 200 ILE A HB   3  
ATOM 5488  H HG12 . ILE A 1 103 ? -5.735  7.223   1.018   1.00 0.00 ? 200 ILE A HG12 3  
ATOM 5489  H HG13 . ILE A 1 103 ? -5.008  7.096   -0.576  1.00 0.00 ? 200 ILE A HG13 3  
ATOM 5490  H HG21 . ILE A 1 103 ? -3.868  5.376   2.608   1.00 0.00 ? 200 ILE A HG21 3  
ATOM 5491  H HG22 . ILE A 1 103 ? -2.188  5.716   2.186   1.00 0.00 ? 200 ILE A HG22 3  
ATOM 5492  H HG23 . ILE A 1 103 ? -3.188  4.733   1.113   1.00 0.00 ? 200 ILE A HG23 3  
ATOM 5493  H HD11 . ILE A 1 103 ? -6.594  5.294   0.179   1.00 0.00 ? 200 ILE A HD11 3  
ATOM 5494  H HD12 . ILE A 1 103 ? -5.300  4.762   1.250   1.00 0.00 ? 200 ILE A HD12 3  
ATOM 5495  H HD13 . ILE A 1 103 ? -5.044  4.773   -0.504  1.00 0.00 ? 200 ILE A HD13 3  
ATOM 5496  N N    . GLN A 1 104 ? -5.894  8.097   2.886   1.00 0.00 ? 201 GLN A N    3  
ATOM 5497  C CA   . GLN A 1 104 ? -6.973  7.854   3.823   1.00 0.00 ? 201 GLN A CA   3  
ATOM 5498  C C    . GLN A 1 104 ? -7.643  6.510   3.610   1.00 0.00 ? 201 GLN A C    3  
ATOM 5499  O O    . GLN A 1 104 ? -7.935  6.114   2.480   1.00 0.00 ? 201 GLN A O    3  
ATOM 5500  C CB   . GLN A 1 104 ? -8.021  8.933   3.656   1.00 0.00 ? 201 GLN A CB   3  
ATOM 5501  C CG   . GLN A 1 104 ? -7.779  10.151  4.522   1.00 0.00 ? 201 GLN A CG   3  
ATOM 5502  C CD   . GLN A 1 104 ? -8.105  9.892   5.980   1.00 0.00 ? 201 GLN A CD   3  
ATOM 5503  O OE1  . GLN A 1 104 ? -9.222  10.136  6.431   1.00 0.00 ? 201 GLN A OE1  3  
ATOM 5504  N NE2  . GLN A 1 104 ? -7.138  9.384   6.724   1.00 0.00 ? 201 GLN A NE2  3  
ATOM 5505  H H    . GLN A 1 104 ? -6.108  8.531   2.033   1.00 0.00 ? 201 GLN A H    3  
ATOM 5506  H HA   . GLN A 1 104 ? -6.574  7.904   4.824   1.00 0.00 ? 201 GLN A HA   3  
ATOM 5507  H HB2  . GLN A 1 104 ? -8.024  9.237   2.619   1.00 0.00 ? 201 GLN A HB2  3  
ATOM 5508  H HB3  . GLN A 1 104 ? -8.985  8.518   3.902   1.00 0.00 ? 201 GLN A HB3  3  
ATOM 5509  H HG2  . GLN A 1 104 ? -6.739  10.428  4.444   1.00 0.00 ? 201 GLN A HG2  3  
ATOM 5510  H HG3  . GLN A 1 104 ? -8.397  10.961  4.167   1.00 0.00 ? 201 GLN A HG3  3  
ATOM 5511  H HE21 . GLN A 1 104 ? -6.274  9.203   6.300   1.00 0.00 ? 201 GLN A HE21 3  
ATOM 5512  H HE22 . GLN A 1 104 ? -7.330  9.204   7.674   1.00 0.00 ? 201 GLN A HE22 3  
ATOM 5513  N N    . ILE A 1 105 ? -7.891  5.821   4.708   1.00 0.00 ? 202 ILE A N    3  
ATOM 5514  C CA   . ILE A 1 105 ? -8.787  4.681   4.709   1.00 0.00 ? 202 ILE A CA   3  
ATOM 5515  C C    . ILE A 1 105 ? -10.134 5.125   5.269   1.00 0.00 ? 202 ILE A C    3  
ATOM 5516  O O    . ILE A 1 105 ? -10.223 5.507   6.435   1.00 0.00 ? 202 ILE A O    3  
ATOM 5517  C CB   . ILE A 1 105 ? -8.243  3.515   5.562   1.00 0.00 ? 202 ILE A CB   3  
ATOM 5518  C CG1  . ILE A 1 105 ? -6.846  3.110   5.087   1.00 0.00 ? 202 ILE A CG1  3  
ATOM 5519  C CG2  . ILE A 1 105 ? -9.190  2.322   5.508   1.00 0.00 ? 202 ILE A CG2  3  
ATOM 5520  C CD1  . ILE A 1 105 ? -6.788  2.699   3.634   1.00 0.00 ? 202 ILE A CD1  3  
ATOM 5521  H H    . ILE A 1 105 ? -7.453  6.084   5.543   1.00 0.00 ? 202 ILE A H    3  
ATOM 5522  H HA   . ILE A 1 105 ? -8.912  4.343   3.691   1.00 0.00 ? 202 ILE A HA   3  
ATOM 5523  H HB   . ILE A 1 105 ? -8.183  3.848   6.588   1.00 0.00 ? 202 ILE A HB   3  
ATOM 5524  H HG12 . ILE A 1 105 ? -6.174  3.945   5.221   1.00 0.00 ? 202 ILE A HG12 3  
ATOM 5525  H HG13 . ILE A 1 105 ? -6.499  2.277   5.682   1.00 0.00 ? 202 ILE A HG13 3  
ATOM 5526  H HG21 . ILE A 1 105 ? -8.827  1.543   6.160   1.00 0.00 ? 202 ILE A HG21 3  
ATOM 5527  H HG22 . ILE A 1 105 ? -9.242  1.948   4.494   1.00 0.00 ? 202 ILE A HG22 3  
ATOM 5528  H HG23 . ILE A 1 105 ? -10.174 2.630   5.828   1.00 0.00 ? 202 ILE A HG23 3  
ATOM 5529  H HD11 . ILE A 1 105 ? -7.483  1.891   3.461   1.00 0.00 ? 202 ILE A HD11 3  
ATOM 5530  H HD12 . ILE A 1 105 ? -5.788  2.373   3.393   1.00 0.00 ? 202 ILE A HD12 3  
ATOM 5531  H HD13 . ILE A 1 105 ? -7.052  3.543   3.011   1.00 0.00 ? 202 ILE A HD13 3  
ATOM 5532  N N    . PRO A 1 106 ? -11.192 5.104   4.444   1.00 0.00 ? 203 PRO A N    3  
ATOM 5533  C CA   . PRO A 1 106 ? -12.522 5.588   4.839   1.00 0.00 ? 203 PRO A CA   3  
ATOM 5534  C C    . PRO A 1 106 ? -13.077 4.849   6.054   1.00 0.00 ? 203 PRO A C    3  
ATOM 5535  O O    . PRO A 1 106 ? -12.785 3.673   6.271   1.00 0.00 ? 203 PRO A O    3  
ATOM 5536  C CB   . PRO A 1 106 ? -13.393 5.309   3.604   1.00 0.00 ? 203 PRO A CB   3  
ATOM 5537  C CG   . PRO A 1 106 ? -12.634 4.303   2.811   1.00 0.00 ? 203 PRO A CG   3  
ATOM 5538  C CD   . PRO A 1 106 ? -11.185 4.593   3.064   1.00 0.00 ? 203 PRO A CD   3  
ATOM 5539  H HA   . PRO A 1 106 ? -12.511 6.648   5.041   1.00 0.00 ? 203 PRO A HA   3  
ATOM 5540  H HB2  . PRO A 1 106 ? -14.352 4.924   3.918   1.00 0.00 ? 203 PRO A HB2  3  
ATOM 5541  H HB3  . PRO A 1 106 ? -13.533 6.224   3.048   1.00 0.00 ? 203 PRO A HB3  3  
ATOM 5542  H HG2  . PRO A 1 106 ? -12.880 3.306   3.147   1.00 0.00 ? 203 PRO A HG2  3  
ATOM 5543  H HG3  . PRO A 1 106 ? -12.860 4.414   1.761   1.00 0.00 ? 203 PRO A HG3  3  
ATOM 5544  H HD2  . PRO A 1 106 ? -10.600 3.689   2.988   1.00 0.00 ? 203 PRO A HD2  3  
ATOM 5545  H HD3  . PRO A 1 106 ? -10.821 5.343   2.377   1.00 0.00 ? 203 PRO A HD3  3  
ATOM 5546  N N    . SER A 1 107 ? -13.875 5.556   6.847   1.00 0.00 ? 204 SER A N    3  
ATOM 5547  C CA   . SER A 1 107 ? -14.499 4.977   8.029   1.00 0.00 ? 204 SER A CA   3  
ATOM 5548  C C    . SER A 1 107 ? -15.565 3.969   7.611   1.00 0.00 ? 204 SER A C    3  
ATOM 5549  O O    . SER A 1 107 ? -15.904 3.051   8.358   1.00 0.00 ? 204 SER A O    3  
ATOM 5550  C CB   . SER A 1 107 ? -15.123 6.077   8.888   1.00 0.00 ? 204 SER A CB   3  
ATOM 5551  O OG   . SER A 1 107 ? -14.182 7.102   9.178   1.00 0.00 ? 204 SER A OG   3  
ATOM 5552  H H    . SER A 1 107 ? -14.056 6.496   6.625   1.00 0.00 ? 204 SER A H    3  
ATOM 5553  H HA   . SER A 1 107 ? -13.734 4.468   8.598   1.00 0.00 ? 204 SER A HA   3  
ATOM 5554  H HB2  . SER A 1 107 ? -15.956 6.512   8.358   1.00 0.00 ? 204 SER A HB2  3  
ATOM 5555  H HB3  . SER A 1 107 ? -15.471 5.652   9.817   1.00 0.00 ? 204 SER A HB3  3  
ATOM 5556  H HG   . SER A 1 107 ? -13.486 7.099   8.506   1.00 0.00 ? 204 SER A HG   3  
ATOM 5557  N N    . ASP A 1 108 ? -16.075 4.149   6.398   1.00 0.00 ? 205 ASP A N    3  
ATOM 5558  C CA   . ASP A 1 108 ? -17.059 3.240   5.821   1.00 0.00 ? 205 ASP A CA   3  
ATOM 5559  C C    . ASP A 1 108 ? -16.362 2.158   5.008   1.00 0.00 ? 205 ASP A C    3  
ATOM 5560  O O    . ASP A 1 108 ? -16.888 1.691   3.999   1.00 0.00 ? 205 ASP A O    3  
ATOM 5561  C CB   . ASP A 1 108 ? -18.038 4.004   4.927   1.00 0.00 ? 205 ASP A CB   3  
ATOM 5562  C CG   . ASP A 1 108 ? -18.915 4.963   5.701   1.00 0.00 ? 205 ASP A CG   3  
ATOM 5563  O OD1  . ASP A 1 108 ? -18.497 6.122   5.914   1.00 0.00 ? 205 ASP A OD1  3  
ATOM 5564  O OD2  . ASP A 1 108 ? -20.031 4.565   6.099   1.00 0.00 ? 205 ASP A OD2  3  
ATOM 5565  H H    . ASP A 1 108 ? -15.782 4.927   5.874   1.00 0.00 ? 205 ASP A H    3  
ATOM 5566  H HA   . ASP A 1 108 ? -17.603 2.777   6.631   1.00 0.00 ? 205 ASP A HA   3  
ATOM 5567  H HB2  . ASP A 1 108 ? -17.482 4.569   4.195   1.00 0.00 ? 205 ASP A HB2  3  
ATOM 5568  H HB3  . ASP A 1 108 ? -18.675 3.296   4.419   1.00 0.00 ? 205 ASP A HB3  3  
ATOM 5569  N N    . PHE A 1 109 ? -15.171 1.778   5.457   1.00 0.00 ? 206 PHE A N    3  
ATOM 5570  C CA   . PHE A 1 109 ? -14.353 0.775   4.775   1.00 0.00 ? 206 PHE A CA   3  
ATOM 5571  C C    . PHE A 1 109 ? -15.019 -0.597  4.814   1.00 0.00 ? 206 PHE A C    3  
ATOM 5572  O O    . PHE A 1 109 ? -14.874 -1.396  3.891   1.00 0.00 ? 206 PHE A O    3  
ATOM 5573  C CB   . PHE A 1 109 ? -12.968 0.708   5.429   1.00 0.00 ? 206 PHE A CB   3  
ATOM 5574  C CG   . PHE A 1 109 ? -12.055 -0.336  4.847   1.00 0.00 ? 206 PHE A CG   3  
ATOM 5575  C CD1  . PHE A 1 109 ? -11.331 -0.076  3.696   1.00 0.00 ? 206 PHE A CD1  3  
ATOM 5576  C CD2  . PHE A 1 109 ? -11.915 -1.574  5.457   1.00 0.00 ? 206 PHE A CD2  3  
ATOM 5577  C CE1  . PHE A 1 109 ? -10.487 -1.030  3.162   1.00 0.00 ? 206 PHE A CE1  3  
ATOM 5578  C CE2  . PHE A 1 109 ? -11.073 -2.531  4.926   1.00 0.00 ? 206 PHE A CE2  3  
ATOM 5579  C CZ   . PHE A 1 109 ? -10.359 -2.259  3.776   1.00 0.00 ? 206 PHE A CZ   3  
ATOM 5580  H H    . PHE A 1 109 ? -14.825 2.188   6.277   1.00 0.00 ? 206 PHE A H    3  
ATOM 5581  H HA   . PHE A 1 109 ? -14.242 1.079   3.745   1.00 0.00 ? 206 PHE A HA   3  
ATOM 5582  H HB2  . PHE A 1 109 ? -12.484 1.665   5.320   1.00 0.00 ? 206 PHE A HB2  3  
ATOM 5583  H HB3  . PHE A 1 109 ? -13.090 0.493   6.479   1.00 0.00 ? 206 PHE A HB3  3  
ATOM 5584  H HD1  . PHE A 1 109 ? -11.431 0.884   3.213   1.00 0.00 ? 206 PHE A HD1  3  
ATOM 5585  H HD2  . PHE A 1 109 ? -12.474 -1.788  6.356   1.00 0.00 ? 206 PHE A HD2  3  
ATOM 5586  H HE1  . PHE A 1 109 ? -9.928  -0.813  2.265   1.00 0.00 ? 206 PHE A HE1  3  
ATOM 5587  H HE2  . PHE A 1 109 ? -10.974 -3.492  5.409   1.00 0.00 ? 206 PHE A HE2  3  
ATOM 5588  H HZ   . PHE A 1 109 ? -9.700  -3.005  3.359   1.00 0.00 ? 206 PHE A HZ   3  
ATOM 5589  N N    . THR A 1 110 ? -15.745 -0.865  5.885   1.00 0.00 ? 207 THR A N    3  
ATOM 5590  C CA   . THR A 1 110 ? -16.403 -2.146  6.042   1.00 0.00 ? 207 THR A CA   3  
ATOM 5591  C C    . THR A 1 110 ? -17.882 -2.037  5.693   1.00 0.00 ? 207 THR A C    3  
ATOM 5592  O O    . THR A 1 110 ? -18.532 -1.028  5.979   1.00 0.00 ? 207 THR A O    3  
ATOM 5593  C CB   . THR A 1 110 ? -16.236 -2.699  7.475   1.00 0.00 ? 207 THR A CB   3  
ATOM 5594  O OG1  . THR A 1 110 ? -16.903 -3.961  7.607   1.00 0.00 ? 207 THR A OG1  3  
ATOM 5595  C CG2  . THR A 1 110 ? -16.774 -1.722  8.513   1.00 0.00 ? 207 THR A CG2  3  
ATOM 5596  H H    . THR A 1 110 ? -15.855 -0.181  6.575   1.00 0.00 ? 207 THR A H    3  
ATOM 5597  H HA   . THR A 1 110 ? -15.937 -2.839  5.357   1.00 0.00 ? 207 THR A HA   3  
ATOM 5598  H HB   . THR A 1 110 ? -15.184 -2.846  7.657   1.00 0.00 ? 207 THR A HB   3  
ATOM 5599  H HG1  . THR A 1 110 ? -16.597 -4.556  6.908   1.00 0.00 ? 207 THR A HG1  3  
ATOM 5600  H HG21 . THR A 1 110 ? -17.820 -1.534  8.321   1.00 0.00 ? 207 THR A HG21 3  
ATOM 5601  H HG22 . THR A 1 110 ? -16.225 -0.794  8.453   1.00 0.00 ? 207 THR A HG22 3  
ATOM 5602  H HG23 . THR A 1 110 ? -16.659 -2.145  9.499   1.00 0.00 ? 207 THR A HG23 3  
ATOM 5603  N N    . MET A 1 111 ? -18.396 -3.070  5.051   1.00 0.00 ? 208 MET A N    3  
ATOM 5604  C CA   . MET A 1 111 ? -19.796 -3.119  4.666   1.00 0.00 ? 208 MET A CA   3  
ATOM 5605  C C    . MET A 1 111 ? -20.501 -4.227  5.433   1.00 0.00 ? 208 MET A C    3  
ATOM 5606  O O    . MET A 1 111 ? -21.298 -3.959  6.331   1.00 0.00 ? 208 MET A O    3  
ATOM 5607  C CB   . MET A 1 111 ? -19.953 -3.345  3.153   1.00 0.00 ? 208 MET A CB   3  
ATOM 5608  C CG   . MET A 1 111 ? -19.331 -2.255  2.287   1.00 0.00 ? 208 MET A CG   3  
ATOM 5609  S SD   . MET A 1 111 ? -17.536 -2.391  2.146   1.00 0.00 ? 208 MET A SD   3  
ATOM 5610  C CE   . MET A 1 111 ? -17.377 -3.931  1.243   1.00 0.00 ? 208 MET A CE   3  
ATOM 5611  H H    . MET A 1 111 ? -17.816 -3.831  4.842   1.00 0.00 ? 208 MET A H    3  
ATOM 5612  H HA   . MET A 1 111 ? -20.244 -2.174  4.931   1.00 0.00 ? 208 MET A HA   3  
ATOM 5613  H HB2  . MET A 1 111 ? -19.489 -4.284  2.894   1.00 0.00 ? 208 MET A HB2  3  
ATOM 5614  H HB3  . MET A 1 111 ? -21.006 -3.400  2.919   1.00 0.00 ? 208 MET A HB3  3  
ATOM 5615  H HG2  . MET A 1 111 ? -19.757 -2.315  1.297   1.00 0.00 ? 208 MET A HG2  3  
ATOM 5616  H HG3  . MET A 1 111 ? -19.569 -1.294  2.721   1.00 0.00 ? 208 MET A HG3  3  
ATOM 5617  H HE1  . MET A 1 111 ? -17.894 -3.850  0.300   1.00 0.00 ? 208 MET A HE1  3  
ATOM 5618  H HE2  . MET A 1 111 ? -17.807 -4.735  1.821   1.00 0.00 ? 208 MET A HE2  3  
ATOM 5619  H HE3  . MET A 1 111 ? -16.332 -4.136  1.064   1.00 0.00 ? 208 MET A HE3  3  
ATOM 5620  N N    . ASN A 1 112 ? -20.182 -5.469  5.075   1.00 0.00 ? 209 ASN A N    3  
ATOM 5621  C CA   . ASN A 1 112 ? -20.731 -6.652  5.737   1.00 0.00 ? 209 ASN A CA   3  
ATOM 5622  C C    . ASN A 1 112 ? -22.258 -6.605  5.755   1.00 0.00 ? 209 ASN A C    3  
ATOM 5623  O O    . ASN A 1 112 ? -22.879 -6.435  6.806   1.00 0.00 ? 209 ASN A O    3  
ATOM 5624  C CB   . ASN A 1 112 ? -20.174 -6.781  7.161   1.00 0.00 ? 209 ASN A CB   3  
ATOM 5625  C CG   . ASN A 1 112 ? -20.469 -8.132  7.792   1.00 0.00 ? 209 ASN A CG   3  
ATOM 5626  O OD1  . ASN A 1 112 ? -19.706 -9.086  7.626   1.00 0.00 ? 209 ASN A OD1  3  
ATOM 5627  N ND2  . ASN A 1 112 ? -21.561 -8.221  8.535   1.00 0.00 ? 209 ASN A ND2  3  
ATOM 5628  H H    . ASN A 1 112 ? -19.555 -5.597  4.332   1.00 0.00 ? 209 ASN A H    3  
ATOM 5629  H HA   . ASN A 1 112 ? -20.423 -7.515  5.164   1.00 0.00 ? 209 ASN A HA   3  
ATOM 5630  H HB2  . ASN A 1 112 ? -19.104 -6.645  7.136   1.00 0.00 ? 209 ASN A HB2  3  
ATOM 5631  H HB3  . ASN A 1 112 ? -20.614 -6.012  7.780   1.00 0.00 ? 209 ASN A HB3  3  
ATOM 5632  H HD21 . ASN A 1 112 ? -22.120 -7.419  8.637   1.00 0.00 ? 209 ASN A HD21 3  
ATOM 5633  H HD22 . ASN A 1 112 ? -21.769 -9.083  8.954   1.00 0.00 ? 209 ASN A HD22 3  
ATOM 5634  N N    . ASP A 1 113 ? -22.857 -6.719  4.581   1.00 0.00 ? 210 ASP A N    3  
ATOM 5635  C CA   . ASP A 1 113 ? -24.308 -6.731  4.465   1.00 0.00 ? 210 ASP A CA   3  
ATOM 5636  C C    . ASP A 1 113 ? -24.794 -8.157  4.275   1.00 0.00 ? 210 ASP A C    3  
ATOM 5637  O O    . ASP A 1 113 ? -25.209 -8.780  5.273   1.00 0.00 ? 210 ASP A O    3  
ATOM 5638  C CB   . ASP A 1 113 ? -24.778 -5.850  3.302   1.00 0.00 ? 210 ASP A CB   3  
ATOM 5639  C CG   . ASP A 1 113 ? -24.444 -4.386  3.505   1.00 0.00 ? 210 ASP A CG   3  
ATOM 5640  O OD1  . ASP A 1 113 ? -25.224 -3.681  4.182   1.00 0.00 ? 210 ASP A OD1  3  
ATOM 5641  O OD2  . ASP A 1 113 ? -23.402 -3.926  2.990   1.00 0.00 ? 210 ASP A OD2  3  
ATOM 5642  O OXT  . ASP A 1 113 ? -24.717 -8.669  3.138   1.00 0.00 ? 210 ASP A OXT  3  
ATOM 5643  H H    . ASP A 1 113 ? -22.311 -6.801  3.770   1.00 0.00 ? 210 ASP A H    3  
ATOM 5644  H HA   . ASP A 1 113 ? -24.717 -6.346  5.388   1.00 0.00 ? 210 ASP A HA   3  
ATOM 5645  H HB2  . ASP A 1 113 ? -24.303 -6.185  2.393   1.00 0.00 ? 210 ASP A HB2  3  
ATOM 5646  H HB3  . ASP A 1 113 ? -25.849 -5.945  3.198   1.00 0.00 ? 210 ASP A HB3  3  
ATOM 5647  N N    . MET A 1 1   ? 27.406  9.509   -6.994  1.00 0.00 ? 98  MET A N    4  
ATOM 5648  C CA   . MET A 1 1   ? 27.338  9.193   -5.546  1.00 0.00 ? 98  MET A CA   4  
ATOM 5649  C C    . MET A 1 1   ? 27.089  7.705   -5.324  1.00 0.00 ? 98  MET A C    4  
ATOM 5650  O O    . MET A 1 1   ? 27.688  7.088   -4.443  1.00 0.00 ? 98  MET A O    4  
ATOM 5651  C CB   . MET A 1 1   ? 26.229  10.002  -4.863  1.00 0.00 ? 98  MET A CB   4  
ATOM 5652  C CG   . MET A 1 1   ? 26.456  11.505  -4.882  1.00 0.00 ? 98  MET A CG   4  
ATOM 5653  S SD   . MET A 1 1   ? 27.983  11.995  -4.058  1.00 0.00 ? 98  MET A SD   4  
ATOM 5654  C CE   . MET A 1 1   ? 27.653  11.476  -2.374  1.00 0.00 ? 98  MET A CE   4  
ATOM 5655  H H1   . MET A 1 1   ? 26.490  9.327   -7.447  1.00 0.00 ? 98  MET A H1   4  
ATOM 5656  H H2   . MET A 1 1   ? 28.126  8.916   -7.454  1.00 0.00 ? 98  MET A H2   4  
ATOM 5657  H H3   . MET A 1 1   ? 27.659  10.507  -7.134  1.00 0.00 ? 98  MET A H3   4  
ATOM 5658  H HA   . MET A 1 1   ? 28.287  9.453   -5.101  1.00 0.00 ? 98  MET A HA   4  
ATOM 5659  H HB2  . MET A 1 1   ? 25.294  9.797   -5.359  1.00 0.00 ? 98  MET A HB2  4  
ATOM 5660  H HB3  . MET A 1 1   ? 26.155  9.686   -3.833  1.00 0.00 ? 98  MET A HB3  4  
ATOM 5661  H HG2  . MET A 1 1   ? 26.495  11.836  -5.908  1.00 0.00 ? 98  MET A HG2  4  
ATOM 5662  H HG3  . MET A 1 1   ? 25.625  11.985  -4.385  1.00 0.00 ? 98  MET A HG3  4  
ATOM 5663  H HE1  . MET A 1 1   ? 28.490  11.739  -1.747  1.00 0.00 ? 98  MET A HE1  4  
ATOM 5664  H HE2  . MET A 1 1   ? 27.505  10.407  -2.348  1.00 0.00 ? 98  MET A HE2  4  
ATOM 5665  H HE3  . MET A 1 1   ? 26.763  11.971  -2.013  1.00 0.00 ? 98  MET A HE3  4  
ATOM 5666  N N    . TYR A 1 2   ? 26.201  7.129   -6.124  1.00 0.00 ? 99  TYR A N    4  
ATOM 5667  C CA   . TYR A 1 2   ? 25.855  5.726   -5.990  1.00 0.00 ? 99  TYR A CA   4  
ATOM 5668  C C    . TYR A 1 2   ? 25.814  5.050   -7.359  1.00 0.00 ? 99  TYR A C    4  
ATOM 5669  O O    . TYR A 1 2   ? 25.726  5.728   -8.382  1.00 0.00 ? 99  TYR A O    4  
ATOM 5670  C CB   . TYR A 1 2   ? 24.506  5.578   -5.258  1.00 0.00 ? 99  TYR A CB   4  
ATOM 5671  C CG   . TYR A 1 2   ? 23.975  4.162   -5.211  1.00 0.00 ? 99  TYR A CG   4  
ATOM 5672  C CD1  . TYR A 1 2   ? 24.463  3.226   -4.309  1.00 0.00 ? 99  TYR A CD1  4  
ATOM 5673  C CD2  . TYR A 1 2   ? 22.995  3.763   -6.098  1.00 0.00 ? 99  TYR A CD2  4  
ATOM 5674  C CE1  . TYR A 1 2   ? 23.979  1.928   -4.304  1.00 0.00 ? 99  TYR A CE1  4  
ATOM 5675  C CE2  . TYR A 1 2   ? 22.505  2.479   -6.103  1.00 0.00 ? 99  TYR A CE2  4  
ATOM 5676  C CZ   . TYR A 1 2   ? 23.000  1.561   -5.207  1.00 0.00 ? 99  TYR A CZ   4  
ATOM 5677  O OH   . TYR A 1 2   ? 22.517  0.276   -5.216  1.00 0.00 ? 99  TYR A OH   4  
ATOM 5678  H H    . TYR A 1 2   ? 25.770  7.658   -6.827  1.00 0.00 ? 99  TYR A H    4  
ATOM 5679  H HA   . TYR A 1 2   ? 26.626  5.249   -5.400  1.00 0.00 ? 99  TYR A HA   4  
ATOM 5680  H HB2  . TYR A 1 2   ? 24.616  5.923   -4.243  1.00 0.00 ? 99  TYR A HB2  4  
ATOM 5681  H HB3  . TYR A 1 2   ? 23.769  6.187   -5.762  1.00 0.00 ? 99  TYR A HB3  4  
ATOM 5682  H HD1  . TYR A 1 2   ? 25.229  3.519   -3.607  1.00 0.00 ? 99  TYR A HD1  4  
ATOM 5683  H HD2  . TYR A 1 2   ? 22.607  4.484   -6.802  1.00 0.00 ? 99  TYR A HD2  4  
ATOM 5684  H HE1  . TYR A 1 2   ? 24.366  1.210   -3.596  1.00 0.00 ? 99  TYR A HE1  4  
ATOM 5685  H HE2  . TYR A 1 2   ? 21.744  2.199   -6.820  1.00 0.00 ? 99  TYR A HE2  4  
ATOM 5686  H HH   . TYR A 1 2   ? 22.222  0.053   -6.104  1.00 0.00 ? 99  TYR A HH   4  
ATOM 5687  N N    . ILE A 1 3   ? 25.898  3.728   -7.361  1.00 0.00 ? 100 ILE A N    4  
ATOM 5688  C CA   . ILE A 1 3   ? 25.919  2.923   -8.579  1.00 0.00 ? 100 ILE A CA   4  
ATOM 5689  C C    . ILE A 1 3   ? 24.799  3.306   -9.552  1.00 0.00 ? 100 ILE A C    4  
ATOM 5690  O O    . ILE A 1 3   ? 25.034  3.526   -10.745 1.00 0.00 ? 100 ILE A O    4  
ATOM 5691  C CB   . ILE A 1 3   ? 25.816  1.415   -8.220  1.00 0.00 ? 100 ILE A CB   4  
ATOM 5692  C CG1  . ILE A 1 3   ? 27.072  0.946   -7.472  1.00 0.00 ? 100 ILE A CG1  4  
ATOM 5693  C CG2  . ILE A 1 3   ? 25.594  0.552   -9.452  1.00 0.00 ? 100 ILE A CG2  4  
ATOM 5694  C CD1  . ILE A 1 3   ? 26.990  1.070   -5.965  1.00 0.00 ? 100 ILE A CD1  4  
ATOM 5695  H H    . ILE A 1 3   ? 25.948  3.269   -6.500  1.00 0.00 ? 100 ILE A H    4  
ATOM 5696  H HA   . ILE A 1 3   ? 26.857  3.087   -9.062  1.00 0.00 ? 100 ILE A HA   4  
ATOM 5697  H HB   . ILE A 1 3   ? 24.963  1.290   -7.572  1.00 0.00 ? 100 ILE A HB   4  
ATOM 5698  H HG12 . ILE A 1 3   ? 27.256  -0.090  -7.707  1.00 0.00 ? 100 ILE A HG12 4  
ATOM 5699  H HG13 . ILE A 1 3   ? 27.913  1.538   -7.803  1.00 0.00 ? 100 ILE A HG13 4  
ATOM 5700  H HG21 . ILE A 1 3   ? 24.817  0.988   -10.060 1.00 0.00 ? 100 ILE A HG21 4  
ATOM 5701  H HG22 . ILE A 1 3   ? 25.292  -0.439  -9.141  1.00 0.00 ? 100 ILE A HG22 4  
ATOM 5702  H HG23 . ILE A 1 3   ? 26.510  0.491   -10.021 1.00 0.00 ? 100 ILE A HG23 4  
ATOM 5703  H HD11 . ILE A 1 3   ? 27.836  0.567   -5.520  1.00 0.00 ? 100 ILE A HD11 4  
ATOM 5704  H HD12 . ILE A 1 3   ? 26.077  0.613   -5.615  1.00 0.00 ? 100 ILE A HD12 4  
ATOM 5705  H HD13 . ILE A 1 3   ? 27.006  2.111   -5.683  1.00 0.00 ? 100 ILE A HD13 4  
ATOM 5706  N N    . VAL A 1 4   ? 23.597  3.407   -9.024  1.00 0.00 ? 101 VAL A N    4  
ATOM 5707  C CA   . VAL A 1 4   ? 22.410  3.680   -9.828  1.00 0.00 ? 101 VAL A CA   4  
ATOM 5708  C C    . VAL A 1 4   ? 21.672  4.914   -9.319  1.00 0.00 ? 101 VAL A C    4  
ATOM 5709  O O    . VAL A 1 4   ? 21.511  5.097   -8.116  1.00 0.00 ? 101 VAL A O    4  
ATOM 5710  C CB   . VAL A 1 4   ? 21.442  2.477   -9.817  1.00 0.00 ? 101 VAL A CB   4  
ATOM 5711  C CG1  . VAL A 1 4   ? 20.203  2.760   -10.653 1.00 0.00 ? 101 VAL A CG1  4  
ATOM 5712  C CG2  . VAL A 1 4   ? 22.144  1.228   -10.314 1.00 0.00 ? 101 VAL A CG2  4  
ATOM 5713  H H    . VAL A 1 4   ? 23.509  3.313   -8.060  1.00 0.00 ? 101 VAL A H    4  
ATOM 5714  H HA   . VAL A 1 4   ? 22.725  3.849   -10.837 1.00 0.00 ? 101 VAL A HA   4  
ATOM 5715  H HB   . VAL A 1 4   ? 21.127  2.303   -8.798  1.00 0.00 ? 101 VAL A HB   4  
ATOM 5716  H HG11 . VAL A 1 4   ? 20.496  2.950   -11.675 1.00 0.00 ? 101 VAL A HG11 4  
ATOM 5717  H HG12 . VAL A 1 4   ? 19.693  3.626   -10.258 1.00 0.00 ? 101 VAL A HG12 4  
ATOM 5718  H HG13 . VAL A 1 4   ? 19.542  1.907   -10.620 1.00 0.00 ? 101 VAL A HG13 4  
ATOM 5719  H HG21 . VAL A 1 4   ? 22.951  0.982   -9.643  1.00 0.00 ? 101 VAL A HG21 4  
ATOM 5720  H HG22 . VAL A 1 4   ? 22.541  1.409   -11.302 1.00 0.00 ? 101 VAL A HG22 4  
ATOM 5721  H HG23 . VAL A 1 4   ? 21.442  0.410   -10.353 1.00 0.00 ? 101 VAL A HG23 4  
ATOM 5722  N N    . GLN A 1 5   ? 21.230  5.761   -10.238 1.00 0.00 ? 102 GLN A N    4  
ATOM 5723  C CA   . GLN A 1 5   ? 20.420  6.915   -9.874  1.00 0.00 ? 102 GLN A CA   4  
ATOM 5724  C C    . GLN A 1 5   ? 19.109  6.452   -9.253  1.00 0.00 ? 102 GLN A C    4  
ATOM 5725  O O    . GLN A 1 5   ? 18.476  5.522   -9.754  1.00 0.00 ? 102 GLN A O    4  
ATOM 5726  C CB   . GLN A 1 5   ? 20.140  7.789   -11.097 1.00 0.00 ? 102 GLN A CB   4  
ATOM 5727  C CG   . GLN A 1 5   ? 21.383  8.443   -11.675 1.00 0.00 ? 102 GLN A CG   4  
ATOM 5728  C CD   . GLN A 1 5   ? 22.126  9.277   -10.650 1.00 0.00 ? 102 GLN A CD   4  
ATOM 5729  O OE1  . GLN A 1 5   ? 23.030  8.792   -9.968  1.00 0.00 ? 102 GLN A OE1  4  
ATOM 5730  N NE2  . GLN A 1 5   ? 21.739  10.532  -10.522 1.00 0.00 ? 102 GLN A NE2  4  
ATOM 5731  H H    . GLN A 1 5   ? 21.444  5.602   -11.183 1.00 0.00 ? 102 GLN A H    4  
ATOM 5732  H HA   . GLN A 1 5   ? 20.970  7.490   -9.145  1.00 0.00 ? 102 GLN A HA   4  
ATOM 5733  H HB2  . GLN A 1 5   ? 19.688  7.180   -11.866 1.00 0.00 ? 102 GLN A HB2  4  
ATOM 5734  H HB3  . GLN A 1 5   ? 19.448  8.568   -10.815 1.00 0.00 ? 102 GLN A HB3  4  
ATOM 5735  H HG2  . GLN A 1 5   ? 22.045  7.672   -12.039 1.00 0.00 ? 102 GLN A HG2  4  
ATOM 5736  H HG3  . GLN A 1 5   ? 21.089  9.083   -12.494 1.00 0.00 ? 102 GLN A HG3  4  
ATOM 5737  H HE21 . GLN A 1 5   ? 21.001  10.848  -11.087 1.00 0.00 ? 102 GLN A HE21 4  
ATOM 5738  H HE22 . GLN A 1 5   ? 22.205  11.099  -9.873  1.00 0.00 ? 102 GLN A HE22 4  
ATOM 5739  N N    . PRO A 1 6   ? 18.690  7.085   -8.149  1.00 0.00 ? 103 PRO A N    4  
ATOM 5740  C CA   . PRO A 1 6   ? 17.483  6.689   -7.425  1.00 0.00 ? 103 PRO A CA   4  
ATOM 5741  C C    . PRO A 1 6   ? 16.223  6.935   -8.240  1.00 0.00 ? 103 PRO A C    4  
ATOM 5742  O O    . PRO A 1 6   ? 15.719  8.058   -8.317  1.00 0.00 ? 103 PRO A O    4  
ATOM 5743  C CB   . PRO A 1 6   ? 17.502  7.580   -6.185  1.00 0.00 ? 103 PRO A CB   4  
ATOM 5744  C CG   . PRO A 1 6   ? 18.282  8.773   -6.604  1.00 0.00 ? 103 PRO A CG   4  
ATOM 5745  C CD   . PRO A 1 6   ? 19.345  8.249   -7.526  1.00 0.00 ? 103 PRO A CD   4  
ATOM 5746  H HA   . PRO A 1 6   ? 17.521  5.651   -7.129  1.00 0.00 ? 103 PRO A HA   4  
ATOM 5747  H HB2  . PRO A 1 6   ? 16.490  7.839   -5.911  1.00 0.00 ? 103 PRO A HB2  4  
ATOM 5748  H HB3  . PRO A 1 6   ? 17.981  7.059   -5.370  1.00 0.00 ? 103 PRO A HB3  4  
ATOM 5749  H HG2  . PRO A 1 6   ? 17.637  9.464   -7.130  1.00 0.00 ? 103 PRO A HG2  4  
ATOM 5750  H HG3  . PRO A 1 6   ? 18.728  9.248   -5.744  1.00 0.00 ? 103 PRO A HG3  4  
ATOM 5751  H HD2  . PRO A 1 6   ? 19.606  8.991   -8.267  1.00 0.00 ? 103 PRO A HD2  4  
ATOM 5752  H HD3  . PRO A 1 6   ? 20.218  7.945   -6.967  1.00 0.00 ? 103 PRO A HD3  4  
ATOM 5753  N N    . ASP A 1 7   ? 15.727  5.882   -8.856  1.00 0.00 ? 104 ASP A N    4  
ATOM 5754  C CA   . ASP A 1 7   ? 14.530  5.976   -9.668  1.00 0.00 ? 104 ASP A CA   4  
ATOM 5755  C C    . ASP A 1 7   ? 13.446  5.062   -9.105  1.00 0.00 ? 104 ASP A C    4  
ATOM 5756  O O    . ASP A 1 7   ? 13.385  3.878   -9.436  1.00 0.00 ? 104 ASP A O    4  
ATOM 5757  C CB   . ASP A 1 7   ? 14.843  5.604   -11.121 1.00 0.00 ? 104 ASP A CB   4  
ATOM 5758  C CG   . ASP A 1 7   ? 13.655  5.797   -12.045 1.00 0.00 ? 104 ASP A CG   4  
ATOM 5759  O OD1  . ASP A 1 7   ? 13.356  6.959   -12.405 1.00 0.00 ? 104 ASP A OD1  4  
ATOM 5760  O OD2  . ASP A 1 7   ? 13.031  4.791   -12.440 1.00 0.00 ? 104 ASP A OD2  4  
ATOM 5761  H H    . ASP A 1 7   ? 16.179  5.020   -8.763  1.00 0.00 ? 104 ASP A H    4  
ATOM 5762  H HA   . ASP A 1 7   ? 14.187  6.999   -9.629  1.00 0.00 ? 104 ASP A HA   4  
ATOM 5763  H HB2  . ASP A 1 7   ? 15.653  6.223   -11.477 1.00 0.00 ? 104 ASP A HB2  4  
ATOM 5764  H HB3  . ASP A 1 7   ? 15.142  4.568   -11.162 1.00 0.00 ? 104 ASP A HB3  4  
ATOM 5765  N N    . PRO A 1 8   ? 12.604  5.595   -8.209  1.00 0.00 ? 105 PRO A N    4  
ATOM 5766  C CA   . PRO A 1 8   ? 11.517  4.837   -7.593  1.00 0.00 ? 105 PRO A CA   4  
ATOM 5767  C C    . PRO A 1 8   ? 10.360  4.625   -8.563  1.00 0.00 ? 105 PRO A C    4  
ATOM 5768  O O    . PRO A 1 8   ? 10.087  5.486   -9.400  1.00 0.00 ? 105 PRO A O    4  
ATOM 5769  C CB   . PRO A 1 8   ? 11.067  5.723   -6.417  1.00 0.00 ? 105 PRO A CB   4  
ATOM 5770  C CG   . PRO A 1 8   ? 12.061  6.839   -6.340  1.00 0.00 ? 105 PRO A CG   4  
ATOM 5771  C CD   . PRO A 1 8   ? 12.639  6.974   -7.717  1.00 0.00 ? 105 PRO A CD   4  
ATOM 5772  H HA   . PRO A 1 8   ? 11.860  3.883   -7.223  1.00 0.00 ? 105 PRO A HA   4  
ATOM 5773  H HB2  . PRO A 1 8   ? 10.074  6.099   -6.610  1.00 0.00 ? 105 PRO A HB2  4  
ATOM 5774  H HB3  . PRO A 1 8   ? 11.064  5.139   -5.508  1.00 0.00 ? 105 PRO A HB3  4  
ATOM 5775  H HG2  . PRO A 1 8   ? 11.565  7.753   -6.051  1.00 0.00 ? 105 PRO A HG2  4  
ATOM 5776  H HG3  . PRO A 1 8   ? 12.837  6.591   -5.632  1.00 0.00 ? 105 PRO A HG3  4  
ATOM 5777  H HD2  . PRO A 1 8   ? 12.023  7.621   -8.327  1.00 0.00 ? 105 PRO A HD2  4  
ATOM 5778  H HD3  . PRO A 1 8   ? 13.652  7.343   -7.670  1.00 0.00 ? 105 PRO A HD3  4  
ATOM 5779  N N    . PRO A 1 9   ? 9.679   3.466   -8.471  1.00 0.00 ? 106 PRO A N    4  
ATOM 5780  C CA   . PRO A 1 9   ? 8.513   3.151   -9.300  1.00 0.00 ? 106 PRO A CA   4  
ATOM 5781  C C    . PRO A 1 9   ? 7.494   4.281   -9.290  1.00 0.00 ? 106 PRO A C    4  
ATOM 5782  O O    . PRO A 1 9   ? 6.877   4.575   -8.264  1.00 0.00 ? 106 PRO A O    4  
ATOM 5783  C CB   . PRO A 1 9   ? 7.926   1.883   -8.662  1.00 0.00 ? 106 PRO A CB   4  
ATOM 5784  C CG   . PRO A 1 9   ? 8.661   1.702   -7.375  1.00 0.00 ? 106 PRO A CG   4  
ATOM 5785  C CD   . PRO A 1 9   ? 9.991   2.370   -7.553  1.00 0.00 ? 106 PRO A CD   4  
ATOM 5786  H HA   . PRO A 1 9   ? 8.802   2.943   -10.320 1.00 0.00 ? 106 PRO A HA   4  
ATOM 5787  H HB2  . PRO A 1 9   ? 6.868   2.021   -8.494  1.00 0.00 ? 106 PRO A HB2  4  
ATOM 5788  H HB3  . PRO A 1 9   ? 8.080   1.043   -9.322  1.00 0.00 ? 106 PRO A HB3  4  
ATOM 5789  H HG2  . PRO A 1 9   ? 8.113   2.172   -6.573  1.00 0.00 ? 106 PRO A HG2  4  
ATOM 5790  H HG3  . PRO A 1 9   ? 8.794   0.649   -7.172  1.00 0.00 ? 106 PRO A HG3  4  
ATOM 5791  H HD2  . PRO A 1 9   ? 10.354  2.749   -6.608  1.00 0.00 ? 106 PRO A HD2  4  
ATOM 5792  H HD3  . PRO A 1 9   ? 10.705  1.689   -7.990  1.00 0.00 ? 106 PRO A HD3  4  
ATOM 5793  N N    . LEU A 1 10  ? 7.345   4.915   -10.438 1.00 0.00 ? 107 LEU A N    4  
ATOM 5794  C CA   . LEU A 1 10  ? 6.517   6.100   -10.568 1.00 0.00 ? 107 LEU A CA   4  
ATOM 5795  C C    . LEU A 1 10  ? 5.038   5.752   -10.510 1.00 0.00 ? 107 LEU A C    4  
ATOM 5796  O O    . LEU A 1 10  ? 4.650   4.593   -10.681 1.00 0.00 ? 107 LEU A O    4  
ATOM 5797  C CB   . LEU A 1 10  ? 6.826   6.842   -11.880 1.00 0.00 ? 107 LEU A CB   4  
ATOM 5798  C CG   . LEU A 1 10  ? 6.325   6.179   -13.175 1.00 0.00 ? 107 LEU A CG   4  
ATOM 5799  C CD1  . LEU A 1 10  ? 6.434   7.148   -14.339 1.00 0.00 ? 107 LEU A CD1  4  
ATOM 5800  C CD2  . LEU A 1 10  ? 7.102   4.910   -13.490 1.00 0.00 ? 107 LEU A CD2  4  
ATOM 5801  H H    . LEU A 1 10  ? 7.802   4.569   -11.226 1.00 0.00 ? 107 LEU A H    4  
ATOM 5802  H HA   . LEU A 1 10  ? 6.749   6.751   -9.740  1.00 0.00 ? 107 LEU A HA   4  
ATOM 5803  H HB2  . LEU A 1 10  ? 6.386   7.826   -11.817 1.00 0.00 ? 107 LEU A HB2  4  
ATOM 5804  H HB3  . LEU A 1 10  ? 7.897   6.956   -11.956 1.00 0.00 ? 107 LEU A HB3  4  
ATOM 5805  H HG   . LEU A 1 10  ? 5.283   5.915   -13.057 1.00 0.00 ? 107 LEU A HG   4  
ATOM 5806  H HD11 . LEU A 1 10  ? 6.092   6.667   -15.242 1.00 0.00 ? 107 LEU A HD11 4  
ATOM 5807  H HD12 . LEU A 1 10  ? 7.463   7.451   -14.459 1.00 0.00 ? 107 LEU A HD12 4  
ATOM 5808  H HD13 . LEU A 1 10  ? 5.824   8.017   -14.142 1.00 0.00 ? 107 LEU A HD13 4  
ATOM 5809  H HD21 . LEU A 1 10  ? 6.878   4.155   -12.752 1.00 0.00 ? 107 LEU A HD21 4  
ATOM 5810  H HD22 . LEU A 1 10  ? 8.160   5.122   -13.481 1.00 0.00 ? 107 LEU A HD22 4  
ATOM 5811  H HD23 . LEU A 1 10  ? 6.817   4.549   -14.468 1.00 0.00 ? 107 LEU A HD23 4  
ATOM 5812  N N    . GLU A 1 11  ? 4.229   6.774   -10.268 1.00 0.00 ? 108 GLU A N    4  
ATOM 5813  C CA   . GLU A 1 11  ? 2.777   6.644   -10.233 1.00 0.00 ? 108 GLU A CA   4  
ATOM 5814  C C    . GLU A 1 11  ? 2.333   5.670   -9.151  1.00 0.00 ? 108 GLU A C    4  
ATOM 5815  O O    . GLU A 1 11  ? 1.607   4.714   -9.423  1.00 0.00 ? 108 GLU A O    4  
ATOM 5816  C CB   . GLU A 1 11  ? 2.227   6.217   -11.598 1.00 0.00 ? 108 GLU A CB   4  
ATOM 5817  C CG   . GLU A 1 11  ? 2.500   7.226   -12.699 1.00 0.00 ? 108 GLU A CG   4  
ATOM 5818  C CD   . GLU A 1 11  ? 2.077   8.626   -12.310 1.00 0.00 ? 108 GLU A CD   4  
ATOM 5819  O OE1  . GLU A 1 11  ? 0.859   8.898   -12.272 1.00 0.00 ? 108 GLU A OE1  4  
ATOM 5820  O OE2  . GLU A 1 11  ? 2.963   9.460   -12.028 1.00 0.00 ? 108 GLU A OE2  4  
ATOM 5821  H H    . GLU A 1 11  ? 4.625   7.653   -10.094 1.00 0.00 ? 108 GLU A H    4  
ATOM 5822  H HA   . GLU A 1 11  ? 2.377   7.616   -9.993  1.00 0.00 ? 108 GLU A HA   4  
ATOM 5823  H HB2  . GLU A 1 11  ? 2.679   5.277   -11.879 1.00 0.00 ? 108 GLU A HB2  4  
ATOM 5824  H HB3  . GLU A 1 11  ? 1.159   6.084   -11.517 1.00 0.00 ? 108 GLU A HB3  4  
ATOM 5825  H HG2  . GLU A 1 11  ? 3.558   7.232   -12.912 1.00 0.00 ? 108 GLU A HG2  4  
ATOM 5826  H HG3  . GLU A 1 11  ? 1.955   6.933   -13.584 1.00 0.00 ? 108 GLU A HG3  4  
ATOM 5827  N N    . LEU A 1 12  ? 2.774   5.919   -7.926  1.00 0.00 ? 109 LEU A N    4  
ATOM 5828  C CA   . LEU A 1 12  ? 2.333   5.125   -6.793  1.00 0.00 ? 109 LEU A CA   4  
ATOM 5829  C C    . LEU A 1 12  ? 0.914   5.544   -6.428  1.00 0.00 ? 109 LEU A C    4  
ATOM 5830  O O    . LEU A 1 12  ? 0.701   6.510   -5.690  1.00 0.00 ? 109 LEU A O    4  
ATOM 5831  C CB   . LEU A 1 12  ? 3.301   5.300   -5.607  1.00 0.00 ? 109 LEU A CB   4  
ATOM 5832  C CG   . LEU A 1 12  ? 3.135   4.318   -4.432  1.00 0.00 ? 109 LEU A CG   4  
ATOM 5833  C CD1  . LEU A 1 12  ? 2.188   4.861   -3.374  1.00 0.00 ? 109 LEU A CD1  4  
ATOM 5834  C CD2  . LEU A 1 12  ? 2.640   2.968   -4.923  1.00 0.00 ? 109 LEU A CD2  4  
ATOM 5835  H H    . LEU A 1 12  ? 3.408   6.655   -7.782  1.00 0.00 ? 109 LEU A H    4  
ATOM 5836  H HA   . LEU A 1 12  ? 2.325   4.089   -7.097  1.00 0.00 ? 109 LEU A HA   4  
ATOM 5837  H HB2  . LEU A 1 12  ? 4.308   5.203   -5.984  1.00 0.00 ? 109 LEU A HB2  4  
ATOM 5838  H HB3  . LEU A 1 12  ? 3.181   6.303   -5.224  1.00 0.00 ? 109 LEU A HB3  4  
ATOM 5839  H HG   . LEU A 1 12  ? 4.096   4.167   -3.964  1.00 0.00 ? 109 LEU A HG   4  
ATOM 5840  H HD11 . LEU A 1 12  ? 2.145   4.172   -2.540  1.00 0.00 ? 109 LEU A HD11 4  
ATOM 5841  H HD12 . LEU A 1 12  ? 1.200   4.975   -3.797  1.00 0.00 ? 109 LEU A HD12 4  
ATOM 5842  H HD13 . LEU A 1 12  ? 2.545   5.820   -3.030  1.00 0.00 ? 109 LEU A HD13 4  
ATOM 5843  H HD21 . LEU A 1 12  ? 2.562   2.287   -4.087  1.00 0.00 ? 109 LEU A HD21 4  
ATOM 5844  H HD22 . LEU A 1 12  ? 3.339   2.571   -5.643  1.00 0.00 ? 109 LEU A HD22 4  
ATOM 5845  H HD23 . LEU A 1 12  ? 1.672   3.084   -5.385  1.00 0.00 ? 109 LEU A HD23 4  
ATOM 5846  N N    . ALA A 1 13  ? -0.049  4.824   -6.976  1.00 0.00 ? 110 ALA A N    4  
ATOM 5847  C CA   . ALA A 1 13  ? -1.450  5.139   -6.782  1.00 0.00 ? 110 ALA A CA   4  
ATOM 5848  C C    . ALA A 1 13  ? -2.035  4.286   -5.674  1.00 0.00 ? 110 ALA A C    4  
ATOM 5849  O O    . ALA A 1 13  ? -1.837  3.070   -5.645  1.00 0.00 ? 110 ALA A O    4  
ATOM 5850  C CB   . ALA A 1 13  ? -2.220  4.929   -8.076  1.00 0.00 ? 110 ALA A CB   4  
ATOM 5851  H H    . ALA A 1 13  ? 0.194   4.044   -7.529  1.00 0.00 ? 110 ALA A H    4  
ATOM 5852  H HA   . ALA A 1 13  ? -1.526  6.180   -6.506  1.00 0.00 ? 110 ALA A HA   4  
ATOM 5853  H HB1  . ALA A 1 13  ? -1.797  5.550   -8.852  1.00 0.00 ? 110 ALA A HB1  4  
ATOM 5854  H HB2  . ALA A 1 13  ? -3.255  5.195   -7.927  1.00 0.00 ? 110 ALA A HB2  4  
ATOM 5855  H HB3  . ALA A 1 13  ? -2.154  3.892   -8.370  1.00 0.00 ? 110 ALA A HB3  4  
ATOM 5856  N N    . VAL A 1 14  ? -2.736  4.924   -4.752  1.00 0.00 ? 111 VAL A N    4  
ATOM 5857  C CA   . VAL A 1 14  ? -3.347  4.212   -3.650  1.00 0.00 ? 111 VAL A CA   4  
ATOM 5858  C C    . VAL A 1 14  ? -4.849  4.428   -3.669  1.00 0.00 ? 111 VAL A C    4  
ATOM 5859  O O    . VAL A 1 14  ? -5.332  5.546   -3.479  1.00 0.00 ? 111 VAL A O    4  
ATOM 5860  C CB   . VAL A 1 14  ? -2.800  4.678   -2.292  1.00 0.00 ? 111 VAL A CB   4  
ATOM 5861  C CG1  . VAL A 1 14  ? -3.058  3.627   -1.225  1.00 0.00 ? 111 VAL A CG1  4  
ATOM 5862  C CG2  . VAL A 1 14  ? -1.321  5.009   -2.390  1.00 0.00 ? 111 VAL A CG2  4  
ATOM 5863  H H    . VAL A 1 14  ? -2.852  5.896   -4.817  1.00 0.00 ? 111 VAL A H    4  
ATOM 5864  H HA   . VAL A 1 14  ? -3.136  3.158   -3.766  1.00 0.00 ? 111 VAL A HA   4  
ATOM 5865  H HB   . VAL A 1 14  ? -3.330  5.573   -2.011  1.00 0.00 ? 111 VAL A HB   4  
ATOM 5866  H HG11 . VAL A 1 14  ? -2.623  2.687   -1.531  1.00 0.00 ? 111 VAL A HG11 4  
ATOM 5867  H HG12 . VAL A 1 14  ? -4.121  3.507   -1.089  1.00 0.00 ? 111 VAL A HG12 4  
ATOM 5868  H HG13 . VAL A 1 14  ? -2.610  3.943   -0.295  1.00 0.00 ? 111 VAL A HG13 4  
ATOM 5869  H HG21 . VAL A 1 14  ? -1.167  5.735   -3.174  1.00 0.00 ? 111 VAL A HG21 4  
ATOM 5870  H HG22 . VAL A 1 14  ? -0.766  4.110   -2.619  1.00 0.00 ? 111 VAL A HG22 4  
ATOM 5871  H HG23 . VAL A 1 14  ? -0.980  5.416   -1.450  1.00 0.00 ? 111 VAL A HG23 4  
ATOM 5872  N N    . GLU A 1 15  ? -5.577  3.360   -3.905  1.00 0.00 ? 112 GLU A N    4  
ATOM 5873  C CA   . GLU A 1 15  ? -7.021  3.429   -3.998  1.00 0.00 ? 112 GLU A CA   4  
ATOM 5874  C C    . GLU A 1 15  ? -7.659  2.379   -3.105  1.00 0.00 ? 112 GLU A C    4  
ATOM 5875  O O    . GLU A 1 15  ? -7.165  1.261   -3.008  1.00 0.00 ? 112 GLU A O    4  
ATOM 5876  C CB   . GLU A 1 15  ? -7.465  3.224   -5.447  1.00 0.00 ? 112 GLU A CB   4  
ATOM 5877  C CG   . GLU A 1 15  ? -8.959  3.396   -5.651  1.00 0.00 ? 112 GLU A CG   4  
ATOM 5878  C CD   . GLU A 1 15  ? -9.429  4.791   -5.289  1.00 0.00 ? 112 GLU A CD   4  
ATOM 5879  O OE1  . GLU A 1 15  ? -9.634  5.065   -4.086  1.00 0.00 ? 112 GLU A OE1  4  
ATOM 5880  O OE2  . GLU A 1 15  ? -9.575  5.628   -6.204  1.00 0.00 ? 112 GLU A OE2  4  
ATOM 5881  H H    . GLU A 1 15  ? -5.129  2.494   -4.022  1.00 0.00 ? 112 GLU A H    4  
ATOM 5882  H HA   . GLU A 1 15  ? -7.332  4.407   -3.667  1.00 0.00 ? 112 GLU A HA   4  
ATOM 5883  H HB2  . GLU A 1 15  ? -6.953  3.939   -6.074  1.00 0.00 ? 112 GLU A HB2  4  
ATOM 5884  H HB3  . GLU A 1 15  ? -7.193  2.226   -5.757  1.00 0.00 ? 112 GLU A HB3  4  
ATOM 5885  H HG2  . GLU A 1 15  ? -9.194  3.208   -6.687  1.00 0.00 ? 112 GLU A HG2  4  
ATOM 5886  H HG3  . GLU A 1 15  ? -9.478  2.681   -5.028  1.00 0.00 ? 112 GLU A HG3  4  
ATOM 5887  N N    . VAL A 1 16  ? -8.745  2.738   -2.447  1.00 0.00 ? 113 VAL A N    4  
ATOM 5888  C CA   . VAL A 1 16  ? -9.471  1.784   -1.636  1.00 0.00 ? 113 VAL A CA   4  
ATOM 5889  C C    . VAL A 1 16  ? -10.483 1.047   -2.507  1.00 0.00 ? 113 VAL A C    4  
ATOM 5890  O O    . VAL A 1 16  ? -11.394 1.646   -3.079  1.00 0.00 ? 113 VAL A O    4  
ATOM 5891  C CB   . VAL A 1 16  ? -10.154 2.451   -0.416  1.00 0.00 ? 113 VAL A CB   4  
ATOM 5892  C CG1  . VAL A 1 16  ? -11.058 3.600   -0.838  1.00 0.00 ? 113 VAL A CG1  4  
ATOM 5893  C CG2  . VAL A 1 16  ? -10.926 1.423   0.399   1.00 0.00 ? 113 VAL A CG2  4  
ATOM 5894  H H    . VAL A 1 16  ? -9.081  3.658   -2.533  1.00 0.00 ? 113 VAL A H    4  
ATOM 5895  H HA   . VAL A 1 16  ? -8.754  1.062   -1.267  1.00 0.00 ? 113 VAL A HA   4  
ATOM 5896  H HB   . VAL A 1 16  ? -9.378  2.859   0.216   1.00 0.00 ? 113 VAL A HB   4  
ATOM 5897  H HG11 . VAL A 1 16  ? -11.824 3.228   -1.501  1.00 0.00 ? 113 VAL A HG11 4  
ATOM 5898  H HG12 . VAL A 1 16  ? -10.472 4.349   -1.347  1.00 0.00 ? 113 VAL A HG12 4  
ATOM 5899  H HG13 . VAL A 1 16  ? -11.518 4.036   0.037   1.00 0.00 ? 113 VAL A HG13 4  
ATOM 5900  H HG21 . VAL A 1 16  ? -11.668 0.951   -0.228  1.00 0.00 ? 113 VAL A HG21 4  
ATOM 5901  H HG22 . VAL A 1 16  ? -11.414 1.913   1.227   1.00 0.00 ? 113 VAL A HG22 4  
ATOM 5902  H HG23 . VAL A 1 16  ? -10.243 0.675   0.775   1.00 0.00 ? 113 VAL A HG23 4  
ATOM 5903  N N    . LYS A 1 17  ? -10.280 -0.250  -2.648  1.00 0.00 ? 114 LYS A N    4  
ATOM 5904  C CA   . LYS A 1 17  ? -11.089 -1.055  -3.528  1.00 0.00 ? 114 LYS A CA   4  
ATOM 5905  C C    . LYS A 1 17  ? -12.117 -1.846  -2.729  1.00 0.00 ? 114 LYS A C    4  
ATOM 5906  O O    . LYS A 1 17  ? -11.758 -2.723  -1.942  1.00 0.00 ? 114 LYS A O    4  
ATOM 5907  C CB   . LYS A 1 17  ? -10.178 -2.002  -4.310  1.00 0.00 ? 114 LYS A CB   4  
ATOM 5908  C CG   . LYS A 1 17  ? -10.693 -2.332  -5.692  1.00 0.00 ? 114 LYS A CG   4  
ATOM 5909  C CD   . LYS A 1 17  ? -10.737 -1.092  -6.569  1.00 0.00 ? 114 LYS A CD   4  
ATOM 5910  C CE   . LYS A 1 17  ? -12.072 -0.953  -7.272  1.00 0.00 ? 114 LYS A CE   4  
ATOM 5911  N NZ   . LYS A 1 17  ? -12.332 -2.067  -8.223  1.00 0.00 ? 114 LYS A NZ   4  
ATOM 5912  H H    . LYS A 1 17  ? -9.558  -0.684  -2.148  1.00 0.00 ? 114 LYS A H    4  
ATOM 5913  H HA   . LYS A 1 17  ? -11.600 -0.400  -4.216  1.00 0.00 ? 114 LYS A HA   4  
ATOM 5914  H HB2  . LYS A 1 17  ? -9.205  -1.545  -4.411  1.00 0.00 ? 114 LYS A HB2  4  
ATOM 5915  H HB3  . LYS A 1 17  ? -10.078 -2.924  -3.757  1.00 0.00 ? 114 LYS A HB3  4  
ATOM 5916  H HG2  . LYS A 1 17  ? -10.034 -3.056  -6.144  1.00 0.00 ? 114 LYS A HG2  4  
ATOM 5917  H HG3  . LYS A 1 17  ? -11.687 -2.740  -5.607  1.00 0.00 ? 114 LYS A HG3  4  
ATOM 5918  H HD2  . LYS A 1 17  ? -10.572 -0.220  -5.954  1.00 0.00 ? 114 LYS A HD2  4  
ATOM 5919  H HD3  . LYS A 1 17  ? -9.955  -1.163  -7.311  1.00 0.00 ? 114 LYS A HD3  4  
ATOM 5920  H HE2  . LYS A 1 17  ? -12.852 -0.940  -6.526  1.00 0.00 ? 114 LYS A HE2  4  
ATOM 5921  H HE3  . LYS A 1 17  ? -12.079 -0.020  -7.813  1.00 0.00 ? 114 LYS A HE3  4  
ATOM 5922  H HZ1  . LYS A 1 17  ? -12.380 -2.971  -7.716  1.00 0.00 ? 114 LYS A HZ1  4  
ATOM 5923  H HZ2  . LYS A 1 17  ? -11.573 -2.117  -8.932  1.00 0.00 ? 114 LYS A HZ2  4  
ATOM 5924  H HZ3  . LYS A 1 17  ? -13.236 -1.912  -8.714  1.00 0.00 ? 114 LYS A HZ3  4  
ATOM 5925  N N    . GLN A 1 18  ? -13.387 -1.515  -2.918  1.00 0.00 ? 115 GLN A N    4  
ATOM 5926  C CA   . GLN A 1 18  ? -14.469 -2.206  -2.231  1.00 0.00 ? 115 GLN A CA   4  
ATOM 5927  C C    . GLN A 1 18  ? -15.200 -3.139  -3.196  1.00 0.00 ? 115 GLN A C    4  
ATOM 5928  O O    . GLN A 1 18  ? -16.031 -2.696  -3.993  1.00 0.00 ? 115 GLN A O    4  
ATOM 5929  C CB   . GLN A 1 18  ? -15.465 -1.207  -1.625  1.00 0.00 ? 115 GLN A CB   4  
ATOM 5930  C CG   . GLN A 1 18  ? -14.829 -0.169  -0.707  1.00 0.00 ? 115 GLN A CG   4  
ATOM 5931  C CD   . GLN A 1 18  ? -14.466 1.117   -1.432  1.00 0.00 ? 115 GLN A CD   4  
ATOM 5932  O OE1  . GLN A 1 18  ? -14.167 1.114   -2.624  1.00 0.00 ? 115 GLN A OE1  4  
ATOM 5933  N NE2  . GLN A 1 18  ? -14.503 2.230   -0.720  1.00 0.00 ? 115 GLN A NE2  4  
ATOM 5934  H H    . GLN A 1 18  ? -13.605 -0.778  -3.529  1.00 0.00 ? 115 GLN A H    4  
ATOM 5935  H HA   . GLN A 1 18  ? -14.036 -2.795  -1.438  1.00 0.00 ? 115 GLN A HA   4  
ATOM 5936  H HB2  . GLN A 1 18  ? -15.963 -0.686  -2.428  1.00 0.00 ? 115 GLN A HB2  4  
ATOM 5937  H HB3  . GLN A 1 18  ? -16.200 -1.756  -1.055  1.00 0.00 ? 115 GLN A HB3  4  
ATOM 5938  H HG2  . GLN A 1 18  ? -15.523 0.066   0.085   1.00 0.00 ? 115 GLN A HG2  4  
ATOM 5939  H HG3  . GLN A 1 18  ? -13.928 -0.591  -0.282  1.00 0.00 ? 115 GLN A HG3  4  
ATOM 5940  H HE21 . GLN A 1 18  ? -14.761 2.170   0.224   1.00 0.00 ? 115 GLN A HE21 4  
ATOM 5941  H HE22 . GLN A 1 18  ? -14.268 3.072   -1.166  1.00 0.00 ? 115 GLN A HE22 4  
ATOM 5942  N N    . PRO A 1 19  ? -14.870 -4.437  -3.164  1.00 0.00 ? 116 PRO A N    4  
ATOM 5943  C CA   . PRO A 1 19  ? -15.516 -5.449  -3.995  1.00 0.00 ? 116 PRO A CA   4  
ATOM 5944  C C    . PRO A 1 19  ? -16.848 -5.903  -3.413  1.00 0.00 ? 116 PRO A C    4  
ATOM 5945  O O    . PRO A 1 19  ? -17.017 -5.985  -2.202  1.00 0.00 ? 116 PRO A O    4  
ATOM 5946  C CB   . PRO A 1 19  ? -14.518 -6.614  -3.996  1.00 0.00 ? 116 PRO A CB   4  
ATOM 5947  C CG   . PRO A 1 19  ? -13.344 -6.155  -3.193  1.00 0.00 ? 116 PRO A CG   4  
ATOM 5948  C CD   . PRO A 1 19  ? -13.829 -5.031  -2.332  1.00 0.00 ? 116 PRO A CD   4  
ATOM 5949  H HA   . PRO A 1 19  ? -15.665 -5.097  -5.003  1.00 0.00 ? 116 PRO A HA   4  
ATOM 5950  H HB2  . PRO A 1 19  ? -14.982 -7.481  -3.551  1.00 0.00 ? 116 PRO A HB2  4  
ATOM 5951  H HB3  . PRO A 1 19  ? -14.233 -6.840  -5.012  1.00 0.00 ? 116 PRO A HB3  4  
ATOM 5952  H HG2  . PRO A 1 19  ? -12.979 -6.965  -2.580  1.00 0.00 ? 116 PRO A HG2  4  
ATOM 5953  H HG3  . PRO A 1 19  ? -12.564 -5.808  -3.855  1.00 0.00 ? 116 PRO A HG3  4  
ATOM 5954  H HD2  . PRO A 1 19  ? -14.236 -5.407  -1.405  1.00 0.00 ? 116 PRO A HD2  4  
ATOM 5955  H HD3  . PRO A 1 19  ? -13.033 -4.327  -2.146  1.00 0.00 ? 116 PRO A HD3  4  
ATOM 5956  N N    . GLU A 1 20  ? -17.787 -6.217  -4.291  1.00 0.00 ? 117 GLU A N    4  
ATOM 5957  C CA   . GLU A 1 20  ? -19.131 -6.588  -3.871  1.00 0.00 ? 117 GLU A CA   4  
ATOM 5958  C C    . GLU A 1 20  ? -19.176 -8.001  -3.295  1.00 0.00 ? 117 GLU A C    4  
ATOM 5959  O O    . GLU A 1 20  ? -20.070 -8.331  -2.515  1.00 0.00 ? 117 GLU A O    4  
ATOM 5960  C CB   . GLU A 1 20  ? -20.093 -6.478  -5.053  1.00 0.00 ? 117 GLU A CB   4  
ATOM 5961  C CG   . GLU A 1 20  ? -19.699 -7.342  -6.241  1.00 0.00 ? 117 GLU A CG   4  
ATOM 5962  C CD   . GLU A 1 20  ? -20.656 -7.201  -7.402  1.00 0.00 ? 117 GLU A CD   4  
ATOM 5963  O OE1  . GLU A 1 20  ? -21.760 -7.778  -7.338  1.00 0.00 ? 117 GLU A OE1  4  
ATOM 5964  O OE2  . GLU A 1 20  ? -20.309 -6.506  -8.383  1.00 0.00 ? 117 GLU A OE2  4  
ATOM 5965  H H    . GLU A 1 20  ? -17.573 -6.193  -5.248  1.00 0.00 ? 117 GLU A H    4  
ATOM 5966  H HA   . GLU A 1 20  ? -19.439 -5.893  -3.106  1.00 0.00 ? 117 GLU A HA   4  
ATOM 5967  H HB2  . GLU A 1 20  ? -21.076 -6.779  -4.726  1.00 0.00 ? 117 GLU A HB2  4  
ATOM 5968  H HB3  . GLU A 1 20  ? -20.129 -5.451  -5.378  1.00 0.00 ? 117 GLU A HB3  4  
ATOM 5969  H HG2  . GLU A 1 20  ? -18.714 -7.052  -6.570  1.00 0.00 ? 117 GLU A HG2  4  
ATOM 5970  H HG3  . GLU A 1 20  ? -19.684 -8.376  -5.929  1.00 0.00 ? 117 GLU A HG3  4  
ATOM 5971  N N    . ASP A 1 21  ? -18.219 -8.836  -3.681  1.00 0.00 ? 118 ASP A N    4  
ATOM 5972  C CA   . ASP A 1 21  ? -18.207 -10.225 -3.232  1.00 0.00 ? 118 ASP A CA   4  
ATOM 5973  C C    . ASP A 1 21  ? -16.956 -10.535 -2.418  1.00 0.00 ? 118 ASP A C    4  
ATOM 5974  O O    . ASP A 1 21  ? -16.748 -11.670 -1.991  1.00 0.00 ? 118 ASP A O    4  
ATOM 5975  C CB   . ASP A 1 21  ? -18.306 -11.184 -4.425  1.00 0.00 ? 118 ASP A CB   4  
ATOM 5976  C CG   . ASP A 1 21  ? -17.029 -11.266 -5.241  1.00 0.00 ? 118 ASP A CG   4  
ATOM 5977  O OD1  . ASP A 1 21  ? -16.647 -10.255 -5.866  1.00 0.00 ? 118 ASP A OD1  4  
ATOM 5978  O OD2  . ASP A 1 21  ? -16.409 -12.350 -5.273  1.00 0.00 ? 118 ASP A OD2  4  
ATOM 5979  H H    . ASP A 1 21  ? -17.516 -8.517  -4.285  1.00 0.00 ? 118 ASP A H    4  
ATOM 5980  H HA   . ASP A 1 21  ? -19.070 -10.371 -2.600  1.00 0.00 ? 118 ASP A HA   4  
ATOM 5981  H HB2  . ASP A 1 21  ? -18.537 -12.173 -4.061  1.00 0.00 ? 118 ASP A HB2  4  
ATOM 5982  H HB3  . ASP A 1 21  ? -19.103 -10.852 -5.075  1.00 0.00 ? 118 ASP A HB3  4  
ATOM 5983  N N    . ARG A 1 22  ? -16.133 -9.522  -2.189  1.00 0.00 ? 119 ARG A N    4  
ATOM 5984  C CA   . ARG A 1 22  ? -14.897 -9.693  -1.432  1.00 0.00 ? 119 ARG A CA   4  
ATOM 5985  C C    . ARG A 1 22  ? -14.710 -8.523  -0.474  1.00 0.00 ? 119 ARG A C    4  
ATOM 5986  O O    . ARG A 1 22  ? -15.204 -7.429  -0.727  1.00 0.00 ? 119 ARG A O    4  
ATOM 5987  C CB   . ARG A 1 22  ? -13.699 -9.792  -2.380  1.00 0.00 ? 119 ARG A CB   4  
ATOM 5988  C CG   . ARG A 1 22  ? -13.782 -10.961 -3.349  1.00 0.00 ? 119 ARG A CG   4  
ATOM 5989  C CD   . ARG A 1 22  ? -12.604 -10.979 -4.304  1.00 0.00 ? 119 ARG A CD   4  
ATOM 5990  N NE   . ARG A 1 22  ? -12.719 -12.054 -5.290  1.00 0.00 ? 119 ARG A NE   4  
ATOM 5991  C CZ   . ARG A 1 22  ? -11.694 -12.533 -5.994  1.00 0.00 ? 119 ARG A CZ   4  
ATOM 5992  N NH1  . ARG A 1 22  ? -10.470 -12.053 -5.806  1.00 0.00 ? 119 ARG A NH1  4  
ATOM 5993  N NH2  . ARG A 1 22  ? -11.893 -13.500 -6.882  1.00 0.00 ? 119 ARG A NH2  4  
ATOM 5994  H H    . ARG A 1 22  ? -16.365 -8.630  -2.521  1.00 0.00 ? 119 ARG A H    4  
ATOM 5995  H HA   . ARG A 1 22  ? -14.977 -10.607 -0.861  1.00 0.00 ? 119 ARG A HA   4  
ATOM 5996  H HB2  . ARG A 1 22  ? -13.634 -8.882  -2.957  1.00 0.00 ? 119 ARG A HB2  4  
ATOM 5997  H HB3  . ARG A 1 22  ? -12.798 -9.901  -1.794  1.00 0.00 ? 119 ARG A HB3  4  
ATOM 5998  H HG2  . ARG A 1 22  ? -13.788 -11.883 -2.786  1.00 0.00 ? 119 ARG A HG2  4  
ATOM 5999  H HG3  . ARG A 1 22  ? -14.696 -10.878 -3.919  1.00 0.00 ? 119 ARG A HG3  4  
ATOM 6000  H HD2  . ARG A 1 22  ? -12.564 -10.032 -4.820  1.00 0.00 ? 119 ARG A HD2  4  
ATOM 6001  H HD3  . ARG A 1 22  ? -11.698 -11.119 -3.735  1.00 0.00 ? 119 ARG A HD3  4  
ATOM 6002  H HE   . ARG A 1 22  ? -13.615 -12.431 -5.441  1.00 0.00 ? 119 ARG A HE   4  
ATOM 6003  H HH11 . ARG A 1 22  ? -10.310 -11.327 -5.133  1.00 0.00 ? 119 ARG A HH11 4  
ATOM 6004  H HH12 . ARG A 1 22  ? -9.697  -12.413 -6.338  1.00 0.00 ? 119 ARG A HH12 4  
ATOM 6005  H HH21 . ARG A 1 22  ? -12.816 -13.871 -7.025  1.00 0.00 ? 119 ARG A HH21 4  
ATOM 6006  H HH22 . ARG A 1 22  ? -11.125 -13.863 -7.415  1.00 0.00 ? 119 ARG A HH22 4  
ATOM 6007  N N    . LYS A 1 23  ? -14.027 -8.769  0.634   1.00 0.00 ? 120 LYS A N    4  
ATOM 6008  C CA   . LYS A 1 23  ? -13.755 -7.734  1.620   1.00 0.00 ? 120 LYS A CA   4  
ATOM 6009  C C    . LYS A 1 23  ? -12.884 -6.630  1.035   1.00 0.00 ? 120 LYS A C    4  
ATOM 6010  O O    . LYS A 1 23  ? -11.943 -6.900  0.288   1.00 0.00 ? 120 LYS A O    4  
ATOM 6011  C CB   . LYS A 1 23  ? -13.078 -8.337  2.855   1.00 0.00 ? 120 LYS A CB   4  
ATOM 6012  C CG   . LYS A 1 23  ? -14.036 -9.077  3.774   1.00 0.00 ? 120 LYS A CG   4  
ATOM 6013  C CD   . LYS A 1 23  ? -14.606 -10.324 3.125   1.00 0.00 ? 120 LYS A CD   4  
ATOM 6014  C CE   . LYS A 1 23  ? -15.673 -10.960 3.994   1.00 0.00 ? 120 LYS A CE   4  
ATOM 6015  N NZ   . LYS A 1 23  ? -16.165 -12.244 3.430   1.00 0.00 ? 120 LYS A NZ   4  
ATOM 6016  H H    . LYS A 1 23  ? -13.705 -9.678  0.806   1.00 0.00 ? 120 LYS A H    4  
ATOM 6017  H HA   . LYS A 1 23  ? -14.702 -7.309  1.916   1.00 0.00 ? 120 LYS A HA   4  
ATOM 6018  H HB2  . LYS A 1 23  ? -12.316 -9.032  2.531   1.00 0.00 ? 120 LYS A HB2  4  
ATOM 6019  H HB3  . LYS A 1 23  ? -12.612 -7.544  3.419   1.00 0.00 ? 120 LYS A HB3  4  
ATOM 6020  H HG2  . LYS A 1 23  ? -13.510 -9.361  4.670   1.00 0.00 ? 120 LYS A HG2  4  
ATOM 6021  H HG3  . LYS A 1 23  ? -14.848 -8.415  4.026   1.00 0.00 ? 120 LYS A HG3  4  
ATOM 6022  H HD2  . LYS A 1 23  ? -15.042 -10.053 2.176   1.00 0.00 ? 120 LYS A HD2  4  
ATOM 6023  H HD3  . LYS A 1 23  ? -13.807 -11.034 2.969   1.00 0.00 ? 120 LYS A HD3  4  
ATOM 6024  H HE2  . LYS A 1 23  ? -15.259 -11.144 4.974   1.00 0.00 ? 120 LYS A HE2  4  
ATOM 6025  H HE3  . LYS A 1 23  ? -16.502 -10.274 4.079   1.00 0.00 ? 120 LYS A HE3  4  
ATOM 6026  H HZ1  . LYS A 1 23  ? -15.382 -12.922 3.345   1.00 0.00 ? 120 LYS A HZ1  4  
ATOM 6027  H HZ2  . LYS A 1 23  ? -16.577 -12.087 2.488   1.00 0.00 ? 120 LYS A HZ2  4  
ATOM 6028  H HZ3  . LYS A 1 23  ? -16.895 -12.651 4.048   1.00 0.00 ? 120 LYS A HZ3  4  
ATOM 6029  N N    . PRO A 1 24  ? -13.210 -5.371  1.373   1.00 0.00 ? 121 PRO A N    4  
ATOM 6030  C CA   . PRO A 1 24  ? -12.494 -4.189  0.879   1.00 0.00 ? 121 PRO A CA   4  
ATOM 6031  C C    . PRO A 1 24  ? -11.013 -4.199  1.248   1.00 0.00 ? 121 PRO A C    4  
ATOM 6032  O O    . PRO A 1 24  ? -10.625 -4.662  2.323   1.00 0.00 ? 121 PRO A O    4  
ATOM 6033  C CB   . PRO A 1 24  ? -13.207 -3.016  1.563   1.00 0.00 ? 121 PRO A CB   4  
ATOM 6034  C CG   . PRO A 1 24  ? -13.936 -3.622  2.713   1.00 0.00 ? 121 PRO A CG   4  
ATOM 6035  C CD   . PRO A 1 24  ? -14.314 -5.002  2.272   1.00 0.00 ? 121 PRO A CD   4  
ATOM 6036  H HA   . PRO A 1 24  ? -12.589 -4.092  -0.192  1.00 0.00 ? 121 PRO A HA   4  
ATOM 6037  H HB2  . PRO A 1 24  ? -12.477 -2.292  1.896   1.00 0.00 ? 121 PRO A HB2  4  
ATOM 6038  H HB3  . PRO A 1 24  ? -13.890 -2.551  0.867   1.00 0.00 ? 121 PRO A HB3  4  
ATOM 6039  H HG2  . PRO A 1 24  ? -13.288 -3.667  3.576   1.00 0.00 ? 121 PRO A HG2  4  
ATOM 6040  H HG3  . PRO A 1 24  ? -14.821 -3.043  2.936   1.00 0.00 ? 121 PRO A HG3  4  
ATOM 6041  H HD2  . PRO A 1 24  ? -14.362 -5.673  3.119   1.00 0.00 ? 121 PRO A HD2  4  
ATOM 6042  H HD3  . PRO A 1 24  ? -15.255 -4.989  1.743   1.00 0.00 ? 121 PRO A HD3  4  
ATOM 6043  N N    . TYR A 1 25  ? -10.196 -3.674  0.349   1.00 0.00 ? 122 TYR A N    4  
ATOM 6044  C CA   . TYR A 1 25  ? -8.751  -3.683  0.519   1.00 0.00 ? 122 TYR A CA   4  
ATOM 6045  C C    . TYR A 1 25  ? -8.135  -2.466  -0.150  1.00 0.00 ? 122 TYR A C    4  
ATOM 6046  O O    . TYR A 1 25  ? -8.718  -1.893  -1.071  1.00 0.00 ? 122 TYR A O    4  
ATOM 6047  C CB   . TYR A 1 25  ? -8.151  -4.970  -0.075  1.00 0.00 ? 122 TYR A CB   4  
ATOM 6048  C CG   . TYR A 1 25  ? -8.570  -5.251  -1.506  1.00 0.00 ? 122 TYR A CG   4  
ATOM 6049  C CD1  . TYR A 1 25  ? -7.848  -4.755  -2.584  1.00 0.00 ? 122 TYR A CD1  4  
ATOM 6050  C CD2  . TYR A 1 25  ? -9.699  -6.014  -1.774  1.00 0.00 ? 122 TYR A CD2  4  
ATOM 6051  C CE1  . TYR A 1 25  ? -8.243  -5.007  -3.884  1.00 0.00 ? 122 TYR A CE1  4  
ATOM 6052  C CE2  . TYR A 1 25  ? -10.094 -6.272  -3.070  1.00 0.00 ? 122 TYR A CE2  4  
ATOM 6053  C CZ   . TYR A 1 25  ? -9.365  -5.766  -4.120  1.00 0.00 ? 122 TYR A CZ   4  
ATOM 6054  O OH   . TYR A 1 25  ? -9.765  -6.015  -5.412  1.00 0.00 ? 122 TYR A OH   4  
ATOM 6055  H H    . TYR A 1 25  ? -10.580 -3.256  -0.457  1.00 0.00 ? 122 TYR A H    4  
ATOM 6056  H HA   . TYR A 1 25  ? -8.538  -3.649  1.577   1.00 0.00 ? 122 TYR A HA   4  
ATOM 6057  H HB2  . TYR A 1 25  ? -7.074  -4.895  -0.057  1.00 0.00 ? 122 TYR A HB2  4  
ATOM 6058  H HB3  . TYR A 1 25  ? -8.456  -5.809  0.530   1.00 0.00 ? 122 TYR A HB3  4  
ATOM 6059  H HD1  . TYR A 1 25  ? -6.963  -4.166  -2.398  1.00 0.00 ? 122 TYR A HD1  4  
ATOM 6060  H HD2  . TYR A 1 25  ? -10.271 -6.411  -0.950  1.00 0.00 ? 122 TYR A HD2  4  
ATOM 6061  H HE1  . TYR A 1 25  ? -7.670  -4.612  -4.708  1.00 0.00 ? 122 TYR A HE1  4  
ATOM 6062  H HE2  . TYR A 1 25  ? -10.973 -6.870  -3.256  1.00 0.00 ? 122 TYR A HE2  4  
ATOM 6063  H HH   . TYR A 1 25  ? -10.713 -5.854  -5.494  1.00 0.00 ? 122 TYR A HH   4  
ATOM 6064  N N    . LEU A 1 26  ? -6.968  -2.060  0.324   1.00 0.00 ? 123 LEU A N    4  
ATOM 6065  C CA   . LEU A 1 26  ? -6.233  -0.992  -0.328  1.00 0.00 ? 123 LEU A CA   4  
ATOM 6066  C C    . LEU A 1 26  ? -5.490  -1.535  -1.524  1.00 0.00 ? 123 LEU A C    4  
ATOM 6067  O O    . LEU A 1 26  ? -4.754  -2.516  -1.419  1.00 0.00 ? 123 LEU A O    4  
ATOM 6068  C CB   . LEU A 1 26  ? -5.249  -0.306  0.619   1.00 0.00 ? 123 LEU A CB   4  
ATOM 6069  C CG   . LEU A 1 26  ? -5.780  0.953   1.301   1.00 0.00 ? 123 LEU A CG   4  
ATOM 6070  C CD1  . LEU A 1 26  ? -4.735  1.530   2.241   1.00 0.00 ? 123 LEU A CD1  4  
ATOM 6071  C CD2  . LEU A 1 26  ? -6.192  1.992   0.270   1.00 0.00 ? 123 LEU A CD2  4  
ATOM 6072  H H    . LEU A 1 26  ? -6.593  -2.492  1.122   1.00 0.00 ? 123 LEU A H    4  
ATOM 6073  H HA   . LEU A 1 26  ? -6.951  -0.266  -0.673  1.00 0.00 ? 123 LEU A HA   4  
ATOM 6074  H HB2  . LEU A 1 26  ? -4.967  -1.014  1.385   1.00 0.00 ? 123 LEU A HB2  4  
ATOM 6075  H HB3  . LEU A 1 26  ? -4.367  -0.039  0.056   1.00 0.00 ? 123 LEU A HB3  4  
ATOM 6076  H HG   . LEU A 1 26  ? -6.652  0.695   1.878   1.00 0.00 ? 123 LEU A HG   4  
ATOM 6077  H HD11 . LEU A 1 26  ? -5.120  2.430   2.697   1.00 0.00 ? 123 LEU A HD11 4  
ATOM 6078  H HD12 . LEU A 1 26  ? -3.840  1.762   1.685   1.00 0.00 ? 123 LEU A HD12 4  
ATOM 6079  H HD13 . LEU A 1 26  ? -4.504  0.808   3.009   1.00 0.00 ? 123 LEU A HD13 4  
ATOM 6080  H HD21 . LEU A 1 26  ? -5.373  2.171   -0.408  1.00 0.00 ? 123 LEU A HD21 4  
ATOM 6081  H HD22 . LEU A 1 26  ? -6.452  2.911   0.772   1.00 0.00 ? 123 LEU A HD22 4  
ATOM 6082  H HD23 . LEU A 1 26  ? -7.046  1.633   -0.283  1.00 0.00 ? 123 LEU A HD23 4  
ATOM 6083  N N    . TRP A 1 27  ? -5.700  -0.899  -2.652  1.00 0.00 ? 124 TRP A N    4  
ATOM 6084  C CA   . TRP A 1 27  ? -5.059  -1.299  -3.883  1.00 0.00 ? 124 TRP A CA   4  
ATOM 6085  C C    . TRP A 1 27  ? -3.891  -0.372  -4.180  1.00 0.00 ? 124 TRP A C    4  
ATOM 6086  O O    . TRP A 1 27  ? -4.078  0.766   -4.616  1.00 0.00 ? 124 TRP A O    4  
ATOM 6087  C CB   . TRP A 1 27  ? -6.067  -1.290  -5.038  1.00 0.00 ? 124 TRP A CB   4  
ATOM 6088  C CG   . TRP A 1 27  ? -5.526  -1.876  -6.308  1.00 0.00 ? 124 TRP A CG   4  
ATOM 6089  C CD1  . TRP A 1 27  ? -4.521  -2.795  -6.423  1.00 0.00 ? 124 TRP A CD1  4  
ATOM 6090  C CD2  . TRP A 1 27  ? -5.964  -1.593  -7.643  1.00 0.00 ? 124 TRP A CD2  4  
ATOM 6091  N NE1  . TRP A 1 27  ? -4.311  -3.099  -7.745  1.00 0.00 ? 124 TRP A NE1  4  
ATOM 6092  C CE2  . TRP A 1 27  ? -5.178  -2.371  -8.513  1.00 0.00 ? 124 TRP A CE2  4  
ATOM 6093  C CE3  . TRP A 1 27  ? -6.942  -0.757  -8.191  1.00 0.00 ? 124 TRP A CE3  4  
ATOM 6094  C CZ2  . TRP A 1 27  ? -5.337  -2.341  -9.894  1.00 0.00 ? 124 TRP A CZ2  4  
ATOM 6095  C CZ3  . TRP A 1 27  ? -7.096  -0.726  -9.566  1.00 0.00 ? 124 TRP A CZ3  4  
ATOM 6096  C CH2  . TRP A 1 27  ? -6.297  -1.513  -10.402 1.00 0.00 ? 124 TRP A CH2  4  
ATOM 6097  H H    . TRP A 1 27  ? -6.304  -0.120  -2.654  1.00 0.00 ? 124 TRP A H    4  
ATOM 6098  H HA   . TRP A 1 27  ? -4.683  -2.302  -3.750  1.00 0.00 ? 124 TRP A HA   4  
ATOM 6099  H HB2  . TRP A 1 27  ? -6.937  -1.863  -4.752  1.00 0.00 ? 124 TRP A HB2  4  
ATOM 6100  H HB3  . TRP A 1 27  ? -6.366  -0.270  -5.240  1.00 0.00 ? 124 TRP A HB3  4  
ATOM 6101  H HD1  . TRP A 1 27  ? -3.983  -3.219  -5.586  1.00 0.00 ? 124 TRP A HD1  4  
ATOM 6102  H HE1  . TRP A 1 27  ? -3.642  -3.734  -8.092  1.00 0.00 ? 124 TRP A HE1  4  
ATOM 6103  H HE3  . TRP A 1 27  ? -7.573  -0.145  -7.560  1.00 0.00 ? 124 TRP A HE3  4  
ATOM 6104  H HZ2  . TRP A 1 27  ? -4.729  -2.943  -10.553 1.00 0.00 ? 124 TRP A HZ2  4  
ATOM 6105  H HZ3  . TRP A 1 27  ? -7.839  -0.085  -10.011 1.00 0.00 ? 124 TRP A HZ3  4  
ATOM 6106  H HH2  . TRP A 1 27  ? -6.454  -1.456  -11.469 1.00 0.00 ? 124 TRP A HH2  4  
ATOM 6107  N N    . ILE A 1 28  ? -2.692  -0.854  -3.904  1.00 0.00 ? 125 ILE A N    4  
ATOM 6108  C CA   . ILE A 1 28  ? -1.484  -0.100  -4.176  1.00 0.00 ? 125 ILE A CA   4  
ATOM 6109  C C    . ILE A 1 28  ? -0.955  -0.493  -5.546  1.00 0.00 ? 125 ILE A C    4  
ATOM 6110  O O    . ILE A 1 28  ? -0.563  -1.642  -5.762  1.00 0.00 ? 125 ILE A O    4  
ATOM 6111  C CB   . ILE A 1 28  ? -0.382  -0.344  -3.113  1.00 0.00 ? 125 ILE A CB   4  
ATOM 6112  C CG1  . ILE A 1 28  ? -0.912  -0.124  -1.693  1.00 0.00 ? 125 ILE A CG1  4  
ATOM 6113  C CG2  . ILE A 1 28  ? 0.805   0.568   -3.360  1.00 0.00 ? 125 ILE A CG2  4  
ATOM 6114  C CD1  . ILE A 1 28  ? -1.550  -1.352  -1.085  1.00 0.00 ? 125 ILE A CD1  4  
ATOM 6115  H H    . ILE A 1 28  ? -2.616  -1.754  -3.515  1.00 0.00 ? 125 ILE A H    4  
ATOM 6116  H HA   . ILE A 1 28  ? -1.734  0.951   -4.180  1.00 0.00 ? 125 ILE A HA   4  
ATOM 6117  H HB   . ILE A 1 28  ? -0.044  -1.365  -3.208  1.00 0.00 ? 125 ILE A HB   4  
ATOM 6118  H HG12 . ILE A 1 28  ? -0.094  0.173   -1.053  1.00 0.00 ? 125 ILE A HG12 4  
ATOM 6119  H HG13 . ILE A 1 28  ? -1.652  0.662   -1.710  1.00 0.00 ? 125 ILE A HG13 4  
ATOM 6120  H HG21 . ILE A 1 28  ? 0.495   1.597   -3.258  1.00 0.00 ? 125 ILE A HG21 4  
ATOM 6121  H HG22 . ILE A 1 28  ? 1.181   0.404   -4.358  1.00 0.00 ? 125 ILE A HG22 4  
ATOM 6122  H HG23 . ILE A 1 28  ? 1.582   0.352   -2.642  1.00 0.00 ? 125 ILE A HG23 4  
ATOM 6123  H HD11 . ILE A 1 28  ? -1.865  -1.132  -0.078  1.00 0.00 ? 125 ILE A HD11 4  
ATOM 6124  H HD12 . ILE A 1 28  ? -0.832  -2.160  -1.071  1.00 0.00 ? 125 ILE A HD12 4  
ATOM 6125  H HD13 . ILE A 1 28  ? -2.406  -1.643  -1.676  1.00 0.00 ? 125 ILE A HD13 4  
ATOM 6126  N N    . LYS A 1 29  ? -0.970  0.447   -6.473  1.00 0.00 ? 126 LYS A N    4  
ATOM 6127  C CA   . LYS A 1 29  ? -0.581  0.164   -7.842  1.00 0.00 ? 126 LYS A CA   4  
ATOM 6128  C C    . LYS A 1 29  ? 0.474   1.155   -8.314  1.00 0.00 ? 126 LYS A C    4  
ATOM 6129  O O    . LYS A 1 29  ? 0.285   2.369   -8.222  1.00 0.00 ? 126 LYS A O    4  
ATOM 6130  C CB   . LYS A 1 29  ? -1.813  0.221   -8.745  1.00 0.00 ? 126 LYS A CB   4  
ATOM 6131  C CG   . LYS A 1 29  ? -1.580  -0.289  -10.157 1.00 0.00 ? 126 LYS A CG   4  
ATOM 6132  C CD   . LYS A 1 29  ? -2.869  -0.260  -10.959 1.00 0.00 ? 126 LYS A CD   4  
ATOM 6133  C CE   . LYS A 1 29  ? -2.703  -0.870  -12.341 1.00 0.00 ? 126 LYS A CE   4  
ATOM 6134  N NZ   . LYS A 1 29  ? -1.718  -0.128  -13.175 1.00 0.00 ? 126 LYS A NZ   4  
ATOM 6135  H H    . LYS A 1 29  ? -1.250  1.360   -6.230  1.00 0.00 ? 126 LYS A H    4  
ATOM 6136  H HA   . LYS A 1 29  ? -0.165  -0.831  -7.872  1.00 0.00 ? 126 LYS A HA   4  
ATOM 6137  H HB2  . LYS A 1 29  ? -2.596  -0.375  -8.299  1.00 0.00 ? 126 LYS A HB2  4  
ATOM 6138  H HB3  . LYS A 1 29  ? -2.148  1.246   -8.809  1.00 0.00 ? 126 LYS A HB3  4  
ATOM 6139  H HG2  . LYS A 1 29  ? -0.846  0.337   -10.642 1.00 0.00 ? 126 LYS A HG2  4  
ATOM 6140  H HG3  . LYS A 1 29  ? -1.218  -1.306  -10.109 1.00 0.00 ? 126 LYS A HG3  4  
ATOM 6141  H HD2  . LYS A 1 29  ? -3.623  -0.816  -10.423 1.00 0.00 ? 126 LYS A HD2  4  
ATOM 6142  H HD3  . LYS A 1 29  ? -3.189  0.766   -11.065 1.00 0.00 ? 126 LYS A HD3  4  
ATOM 6143  H HE2  . LYS A 1 29  ? -2.370  -1.891  -12.232 1.00 0.00 ? 126 LYS A HE2  4  
ATOM 6144  H HE3  . LYS A 1 29  ? -3.664  -0.858  -12.836 1.00 0.00 ? 126 LYS A HE3  4  
ATOM 6145  H HZ1  . LYS A 1 29  ? -1.662  -0.550  -14.124 1.00 0.00 ? 126 LYS A HZ1  4  
ATOM 6146  H HZ2  . LYS A 1 29  ? -0.774  -0.168  -12.736 1.00 0.00 ? 126 LYS A HZ2  4  
ATOM 6147  H HZ3  . LYS A 1 29  ? -2.002  0.867   -13.266 1.00 0.00 ? 126 LYS A HZ3  4  
ATOM 6148  N N    . TRP A 1 30  ? 1.582   0.633   -8.809  1.00 0.00 ? 127 TRP A N    4  
ATOM 6149  C CA   . TRP A 1 30  ? 2.684   1.463   -9.268  1.00 0.00 ? 127 TRP A CA   4  
ATOM 6150  C C    . TRP A 1 30  ? 3.058   1.102   -10.698 1.00 0.00 ? 127 TRP A C    4  
ATOM 6151  O O    . TRP A 1 30  ? 2.741   0.008   -11.175 1.00 0.00 ? 127 TRP A O    4  
ATOM 6152  C CB   . TRP A 1 30  ? 3.896   1.298   -8.344  1.00 0.00 ? 127 TRP A CB   4  
ATOM 6153  C CG   . TRP A 1 30  ? 4.291   -0.131  -8.120  1.00 0.00 ? 127 TRP A CG   4  
ATOM 6154  C CD1  . TRP A 1 30  ? 5.179   -0.863  -8.852  1.00 0.00 ? 127 TRP A CD1  4  
ATOM 6155  C CD2  . TRP A 1 30  ? 3.806   -1.002  -7.090  1.00 0.00 ? 127 TRP A CD2  4  
ATOM 6156  N NE1  . TRP A 1 30  ? 5.270   -2.135  -8.346  1.00 0.00 ? 127 TRP A NE1  4  
ATOM 6157  C CE2  . TRP A 1 30  ? 4.438   -2.244  -7.264  1.00 0.00 ? 127 TRP A CE2  4  
ATOM 6158  C CE3  . TRP A 1 30  ? 2.897   -0.850  -6.039  1.00 0.00 ? 127 TRP A CE3  4  
ATOM 6159  C CZ2  . TRP A 1 30  ? 4.190   -3.329  -6.429  1.00 0.00 ? 127 TRP A CZ2  4  
ATOM 6160  C CZ3  . TRP A 1 30  ? 2.652   -1.927  -5.210  1.00 0.00 ? 127 TRP A CZ3  4  
ATOM 6161  C CH2  . TRP A 1 30  ? 3.295   -3.152  -5.409  1.00 0.00 ? 127 TRP A CH2  4  
ATOM 6162  H H    . TRP A 1 30  ? 1.663   -0.343  -8.877  1.00 0.00 ? 127 TRP A H    4  
ATOM 6163  H HA   . TRP A 1 30  ? 2.359   2.492   -9.240  1.00 0.00 ? 127 TRP A HA   4  
ATOM 6164  H HB2  . TRP A 1 30  ? 4.742   1.812   -8.775  1.00 0.00 ? 127 TRP A HB2  4  
ATOM 6165  H HB3  . TRP A 1 30  ? 3.669   1.736   -7.384  1.00 0.00 ? 127 TRP A HB3  4  
ATOM 6166  H HD1  . TRP A 1 30  ? 5.720   -0.484  -9.707  1.00 0.00 ? 127 TRP A HD1  4  
ATOM 6167  H HE1  . TRP A 1 30  ? 5.840   -2.849  -8.699  1.00 0.00 ? 127 TRP A HE1  4  
ATOM 6168  H HE3  . TRP A 1 30  ? 2.392   0.088   -5.866  1.00 0.00 ? 127 TRP A HE3  4  
ATOM 6169  H HZ2  . TRP A 1 30  ? 4.676   -4.281  -6.572  1.00 0.00 ? 127 TRP A HZ2  4  
ATOM 6170  H HZ3  . TRP A 1 30  ? 1.951   -1.828  -4.394  1.00 0.00 ? 127 TRP A HZ3  4  
ATOM 6171  H HH2  . TRP A 1 30  ? 3.068   -3.966  -4.738  1.00 0.00 ? 127 TRP A HH2  4  
ATOM 6172  N N    . SER A 1 31  ? 3.717   2.021   -11.378 1.00 0.00 ? 128 SER A N    4  
ATOM 6173  C CA   . SER A 1 31  ? 4.148   1.795   -12.743 1.00 0.00 ? 128 SER A CA   4  
ATOM 6174  C C    . SER A 1 31  ? 5.624   1.405   -12.772 1.00 0.00 ? 128 SER A C    4  
ATOM 6175  O O    . SER A 1 31  ? 6.455   2.042   -12.120 1.00 0.00 ? 128 SER A O    4  
ATOM 6176  C CB   . SER A 1 31  ? 3.917   3.054   -13.577 1.00 0.00 ? 128 SER A CB   4  
ATOM 6177  O OG   . SER A 1 31  ? 2.557   3.455   -13.531 1.00 0.00 ? 128 SER A OG   4  
ATOM 6178  H H    . SER A 1 31  ? 3.929   2.882   -10.948 1.00 0.00 ? 128 SER A H    4  
ATOM 6179  H HA   . SER A 1 31  ? 3.561   0.988   -13.150 1.00 0.00 ? 128 SER A HA   4  
ATOM 6180  H HB2  . SER A 1 31  ? 4.529   3.857   -13.192 1.00 0.00 ? 128 SER A HB2  4  
ATOM 6181  H HB3  . SER A 1 31  ? 4.188   2.858   -14.603 1.00 0.00 ? 128 SER A HB3  4  
ATOM 6182  H HG   . SER A 1 31  ? 2.494   4.386   -13.772 1.00 0.00 ? 128 SER A HG   4  
ATOM 6183  N N    . PRO A 1 32  ? 5.962   0.333   -13.504 1.00 0.00 ? 129 PRO A N    4  
ATOM 6184  C CA   . PRO A 1 32  ? 7.351   -0.102  -13.675 1.00 0.00 ? 129 PRO A CA   4  
ATOM 6185  C C    . PRO A 1 32  ? 8.192   0.958   -14.379 1.00 0.00 ? 129 PRO A C    4  
ATOM 6186  O O    . PRO A 1 32  ? 7.709   1.632   -15.292 1.00 0.00 ? 129 PRO A O    4  
ATOM 6187  C CB   . PRO A 1 32  ? 7.236   -1.357  -14.546 1.00 0.00 ? 129 PRO A CB   4  
ATOM 6188  C CG   . PRO A 1 32  ? 5.823   -1.799  -14.412 1.00 0.00 ? 129 PRO A CG   4  
ATOM 6189  C CD   . PRO A 1 32  ? 5.021   -0.549  -14.211 1.00 0.00 ? 129 PRO A CD   4  
ATOM 6190  H HA   . PRO A 1 32  ? 7.806   -0.354  -12.727 1.00 0.00 ? 129 PRO A HA   4  
ATOM 6191  H HB2  . PRO A 1 32  ? 7.477   -1.109  -15.570 1.00 0.00 ? 129 PRO A HB2  4  
ATOM 6192  H HB3  . PRO A 1 32  ? 7.918   -2.111  -14.184 1.00 0.00 ? 129 PRO A HB3  4  
ATOM 6193  H HG2  . PRO A 1 32  ? 5.510   -2.307  -15.312 1.00 0.00 ? 129 PRO A HG2  4  
ATOM 6194  H HG3  . PRO A 1 32  ? 5.723   -2.449  -13.559 1.00 0.00 ? 129 PRO A HG3  4  
ATOM 6195  H HD2  . PRO A 1 32  ? 4.732   -0.125  -15.163 1.00 0.00 ? 129 PRO A HD2  4  
ATOM 6196  H HD3  . PRO A 1 32  ? 4.152   -0.753  -13.605 1.00 0.00 ? 129 PRO A HD3  4  
ATOM 6197  N N    . PRO A 1 33  ? 9.458   1.122   -13.957 1.00 0.00 ? 130 PRO A N    4  
ATOM 6198  C CA   . PRO A 1 33  ? 10.363  2.133   -14.518 1.00 0.00 ? 130 PRO A CA   4  
ATOM 6199  C C    . PRO A 1 33  ? 10.699  1.891   -15.992 1.00 0.00 ? 130 PRO A C    4  
ATOM 6200  O O    . PRO A 1 33  ? 11.699  1.250   -16.318 1.00 0.00 ? 130 PRO A O    4  
ATOM 6201  C CB   . PRO A 1 33  ? 11.622  2.016   -13.651 1.00 0.00 ? 130 PRO A CB   4  
ATOM 6202  C CG   . PRO A 1 33  ? 11.558  0.658   -13.046 1.00 0.00 ? 130 PRO A CG   4  
ATOM 6203  C CD   . PRO A 1 33  ? 10.099  0.341   -12.887 1.00 0.00 ? 130 PRO A CD   4  
ATOM 6204  H HA   . PRO A 1 33  ? 9.948   3.124   -14.411 1.00 0.00 ? 130 PRO A HA   4  
ATOM 6205  H HB2  . PRO A 1 33  ? 12.497  2.129   -14.271 1.00 0.00 ? 130 PRO A HB2  4  
ATOM 6206  H HB3  . PRO A 1 33  ? 11.612  2.785   -12.893 1.00 0.00 ? 130 PRO A HB3  4  
ATOM 6207  H HG2  . PRO A 1 33  ? 12.029  -0.058  -13.703 1.00 0.00 ? 130 PRO A HG2  4  
ATOM 6208  H HG3  . PRO A 1 33  ? 12.049  0.661   -12.084 1.00 0.00 ? 130 PRO A HG3  4  
ATOM 6209  H HD2  . PRO A 1 33  ? 9.926   -0.716  -13.023 1.00 0.00 ? 130 PRO A HD2  4  
ATOM 6210  H HD3  . PRO A 1 33  ? 9.749   0.658   -11.915 1.00 0.00 ? 130 PRO A HD3  4  
ATOM 6211  N N    . THR A 1 34  ? 9.841   2.414   -16.864 1.00 0.00 ? 131 THR A N    4  
ATOM 6212  C CA   . THR A 1 34  ? 10.019  2.355   -18.313 1.00 0.00 ? 131 THR A CA   4  
ATOM 6213  C C    . THR A 1 34  ? 10.160  0.911   -18.824 1.00 0.00 ? 131 THR A C    4  
ATOM 6214  O O    . THR A 1 34  ? 9.157   0.230   -19.044 1.00 0.00 ? 131 THR A O    4  
ATOM 6215  C CB   . THR A 1 34  ? 11.218  3.219   -18.764 1.00 0.00 ? 131 THR A CB   4  
ATOM 6216  O OG1  . THR A 1 34  ? 11.152  4.502   -18.125 1.00 0.00 ? 131 THR A OG1  4  
ATOM 6217  C CG2  . THR A 1 34  ? 11.217  3.414   -20.273 1.00 0.00 ? 131 THR A CG2  4  
ATOM 6218  H H    . THR A 1 34  ? 9.044   2.865   -16.513 1.00 0.00 ? 131 THR A H    4  
ATOM 6219  H HA   . THR A 1 34  ? 9.129   2.779   -18.755 1.00 0.00 ? 131 THR A HA   4  
ATOM 6220  H HB   . THR A 1 34  ? 12.133  2.727   -18.475 1.00 0.00 ? 131 THR A HB   4  
ATOM 6221  H HG1  . THR A 1 34  ? 10.603  4.431   -17.330 1.00 0.00 ? 131 THR A HG1  4  
ATOM 6222  H HG21 . THR A 1 34  ? 10.320  3.937   -20.568 1.00 0.00 ? 131 THR A HG21 4  
ATOM 6223  H HG22 . THR A 1 34  ? 11.251  2.453   -20.759 1.00 0.00 ? 131 THR A HG22 4  
ATOM 6224  H HG23 . THR A 1 34  ? 12.082  3.993   -20.561 1.00 0.00 ? 131 THR A HG23 4  
ATOM 6225  N N    . LEU A 1 35  ? 11.393  0.438   -18.987 1.00 0.00 ? 132 LEU A N    4  
ATOM 6226  C CA   . LEU A 1 35  ? 11.631  -0.891  -19.537 1.00 0.00 ? 132 LEU A CA   4  
ATOM 6227  C C    . LEU A 1 35  ? 12.324  -1.786  -18.525 1.00 0.00 ? 132 LEU A C    4  
ATOM 6228  O O    . LEU A 1 35  ? 12.438  -2.995  -18.742 1.00 0.00 ? 132 LEU A O    4  
ATOM 6229  C CB   . LEU A 1 35  ? 12.476  -0.806  -20.811 1.00 0.00 ? 132 LEU A CB   4  
ATOM 6230  C CG   . LEU A 1 35  ? 11.794  -0.146  -22.012 1.00 0.00 ? 132 LEU A CG   4  
ATOM 6231  C CD1  . LEU A 1 35  ? 12.772  -0.010  -23.169 1.00 0.00 ? 132 LEU A CD1  4  
ATOM 6232  C CD2  . LEU A 1 35  ? 10.571  -0.943  -22.441 1.00 0.00 ? 132 LEU A CD2  4  
ATOM 6233  H H    . LEU A 1 35  ? 12.160  0.988   -18.719 1.00 0.00 ? 132 LEU A H    4  
ATOM 6234  H HA   . LEU A 1 35  ? 10.674  -1.323  -19.780 1.00 0.00 ? 132 LEU A HA   4  
ATOM 6235  H HB2  . LEU A 1 35  ? 13.373  -0.250  -20.583 1.00 0.00 ? 132 LEU A HB2  4  
ATOM 6236  H HB3  . LEU A 1 35  ? 12.758  -1.809  -21.095 1.00 0.00 ? 132 LEU A HB3  4  
ATOM 6237  H HG   . LEU A 1 35  ? 11.467  0.844   -21.734 1.00 0.00 ? 132 LEU A HG   4  
ATOM 6238  H HD11 . LEU A 1 35  ? 13.615  0.589   -22.859 1.00 0.00 ? 132 LEU A HD11 4  
ATOM 6239  H HD12 . LEU A 1 35  ? 12.278  0.467   -24.004 1.00 0.00 ? 132 LEU A HD12 4  
ATOM 6240  H HD13 . LEU A 1 35  ? 13.115  -0.990  -23.466 1.00 0.00 ? 132 LEU A HD13 4  
ATOM 6241  H HD21 . LEU A 1 35  ? 10.139  -0.492  -23.322 1.00 0.00 ? 132 LEU A HD21 4  
ATOM 6242  H HD22 . LEU A 1 35  ? 9.844   -0.945  -21.643 1.00 0.00 ? 132 LEU A HD22 4  
ATOM 6243  H HD23 . LEU A 1 35  ? 10.864  -1.959  -22.664 1.00 0.00 ? 132 LEU A HD23 4  
ATOM 6244  N N    . ILE A 1 36  ? 12.762  -1.190  -17.416 1.00 0.00 ? 133 ILE A N    4  
ATOM 6245  C CA   . ILE A 1 36  ? 13.494  -1.907  -16.372 1.00 0.00 ? 133 ILE A CA   4  
ATOM 6246  C C    . ILE A 1 36  ? 14.871  -2.335  -16.892 1.00 0.00 ? 133 ILE A C    4  
ATOM 6247  O O    . ILE A 1 36  ? 15.883  -1.708  -16.579 1.00 0.00 ? 133 ILE A O    4  
ATOM 6248  C CB   . ILE A 1 36  ? 12.716  -3.151  -15.843 1.00 0.00 ? 133 ILE A CB   4  
ATOM 6249  C CG1  . ILE A 1 36  ? 11.434  -2.741  -15.103 1.00 0.00 ? 133 ILE A CG1  4  
ATOM 6250  C CG2  . ILE A 1 36  ? 13.589  -3.989  -14.926 1.00 0.00 ? 133 ILE A CG2  4  
ATOM 6251  C CD1  . ILE A 1 36  ? 10.288  -2.344  -16.008 1.00 0.00 ? 133 ILE A CD1  4  
ATOM 6252  H H    . ILE A 1 36  ? 12.590  -0.229  -17.298 1.00 0.00 ? 133 ILE A H    4  
ATOM 6253  H HA   . ILE A 1 36  ? 13.637  -1.222  -15.547 1.00 0.00 ? 133 ILE A HA   4  
ATOM 6254  H HB   . ILE A 1 36  ? 12.448  -3.760  -16.693 1.00 0.00 ? 133 ILE A HB   4  
ATOM 6255  H HG12 . ILE A 1 36  ? 11.100  -3.568  -14.496 1.00 0.00 ? 133 ILE A HG12 4  
ATOM 6256  H HG13 . ILE A 1 36  ? 11.654  -1.901  -14.461 1.00 0.00 ? 133 ILE A HG13 4  
ATOM 6257  H HG21 . ILE A 1 36  ? 13.831  -3.420  -14.041 1.00 0.00 ? 133 ILE A HG21 4  
ATOM 6258  H HG22 . ILE A 1 36  ? 14.500  -4.257  -15.442 1.00 0.00 ? 133 ILE A HG22 4  
ATOM 6259  H HG23 . ILE A 1 36  ? 13.059  -4.887  -14.644 1.00 0.00 ? 133 ILE A HG23 4  
ATOM 6260  H HD11 . ILE A 1 36  ? 9.444   -2.042  -15.408 1.00 0.00 ? 133 ILE A HD11 4  
ATOM 6261  H HD12 . ILE A 1 36  ? 10.008  -3.183  -16.625 1.00 0.00 ? 133 ILE A HD12 4  
ATOM 6262  H HD13 . ILE A 1 36  ? 10.595  -1.521  -16.636 1.00 0.00 ? 133 ILE A HD13 4  
ATOM 6263  N N    . ASP A 1 37  ? 14.873  -3.387  -17.705 1.00 0.00 ? 134 ASP A N    4  
ATOM 6264  C CA   . ASP A 1 37  ? 16.077  -3.937  -18.327 1.00 0.00 ? 134 ASP A CA   4  
ATOM 6265  C C    . ASP A 1 37  ? 17.234  -4.084  -17.337 1.00 0.00 ? 134 ASP A C    4  
ATOM 6266  O O    . ASP A 1 37  ? 18.283  -3.454  -17.477 1.00 0.00 ? 134 ASP A O    4  
ATOM 6267  C CB   . ASP A 1 37  ? 16.507  -3.092  -19.529 1.00 0.00 ? 134 ASP A CB   4  
ATOM 6268  C CG   . ASP A 1 37  ? 17.472  -3.835  -20.436 1.00 0.00 ? 134 ASP A CG   4  
ATOM 6269  O OD1  . ASP A 1 37  ? 17.024  -4.746  -21.164 1.00 0.00 ? 134 ASP A OD1  4  
ATOM 6270  O OD2  . ASP A 1 37  ? 18.681  -3.514  -20.429 1.00 0.00 ? 134 ASP A OD2  4  
ATOM 6271  H H    . ASP A 1 37  ? 14.011  -3.808  -17.914 1.00 0.00 ? 134 ASP A H    4  
ATOM 6272  H HA   . ASP A 1 37  ? 15.822  -4.923  -18.683 1.00 0.00 ? 134 ASP A HA   4  
ATOM 6273  H HB2  . ASP A 1 37  ? 15.633  -2.826  -20.105 1.00 0.00 ? 134 ASP A HB2  4  
ATOM 6274  H HB3  . ASP A 1 37  ? 16.990  -2.193  -19.178 1.00 0.00 ? 134 ASP A HB3  4  
ATOM 6275  N N    . LEU A 1 38  ? 17.025  -4.906  -16.325 1.00 0.00 ? 135 LEU A N    4  
ATOM 6276  C CA   . LEU A 1 38  ? 18.106  -5.320  -15.447 1.00 0.00 ? 135 LEU A CA   4  
ATOM 6277  C C    . LEU A 1 38  ? 18.897  -6.411  -16.144 1.00 0.00 ? 135 LEU A C    4  
ATOM 6278  O O    . LEU A 1 38  ? 20.130  -6.413  -16.146 1.00 0.00 ? 135 LEU A O    4  
ATOM 6279  C CB   . LEU A 1 38  ? 17.562  -5.833  -14.111 1.00 0.00 ? 135 LEU A CB   4  
ATOM 6280  C CG   . LEU A 1 38  ? 17.526  -4.807  -12.978 1.00 0.00 ? 135 LEU A CG   4  
ATOM 6281  C CD1  . LEU A 1 38  ? 16.700  -3.591  -13.364 1.00 0.00 ? 135 LEU A CD1  4  
ATOM 6282  C CD2  . LEU A 1 38  ? 16.979  -5.442  -11.711 1.00 0.00 ? 135 LEU A CD2  4  
ATOM 6283  H H    . LEU A 1 38  ? 16.121  -5.252  -16.169 1.00 0.00 ? 135 LEU A H    4  
ATOM 6284  H HA   . LEU A 1 38  ? 18.748  -4.470  -15.274 1.00 0.00 ? 135 LEU A HA   4  
ATOM 6285  H HB2  . LEU A 1 38  ? 16.557  -6.194  -14.272 1.00 0.00 ? 135 LEU A HB2  4  
ATOM 6286  H HB3  . LEU A 1 38  ? 18.176  -6.663  -13.793 1.00 0.00 ? 135 LEU A HB3  4  
ATOM 6287  H HG   . LEU A 1 38  ? 18.531  -4.476  -12.776 1.00 0.00 ? 135 LEU A HG   4  
ATOM 6288  H HD11 . LEU A 1 38  ? 17.109  -3.147  -14.260 1.00 0.00 ? 135 LEU A HD11 4  
ATOM 6289  H HD12 . LEU A 1 38  ? 16.725  -2.869  -12.561 1.00 0.00 ? 135 LEU A HD12 4  
ATOM 6290  H HD13 . LEU A 1 38  ? 15.681  -3.892  -13.546 1.00 0.00 ? 135 LEU A HD13 4  
ATOM 6291  H HD21 . LEU A 1 38  ? 17.658  -6.208  -11.370 1.00 0.00 ? 135 LEU A HD21 4  
ATOM 6292  H HD22 . LEU A 1 38  ? 16.013  -5.880  -11.915 1.00 0.00 ? 135 LEU A HD22 4  
ATOM 6293  H HD23 . LEU A 1 38  ? 16.876  -4.687  -10.947 1.00 0.00 ? 135 LEU A HD23 4  
ATOM 6294  N N    . LYS A 1 39  ? 18.163  -7.323  -16.751 1.00 0.00 ? 136 LYS A N    4  
ATOM 6295  C CA   . LYS A 1 39  ? 18.737  -8.376  -17.560 1.00 0.00 ? 136 LYS A CA   4  
ATOM 6296  C C    . LYS A 1 39  ? 17.734  -8.776  -18.614 1.00 0.00 ? 136 LYS A C    4  
ATOM 6297  O O    . LYS A 1 39  ? 16.676  -9.329  -18.309 1.00 0.00 ? 136 LYS A O    4  
ATOM 6298  C CB   . LYS A 1 39  ? 19.126  -9.576  -16.706 1.00 0.00 ? 136 LYS A CB   4  
ATOM 6299  C CG   . LYS A 1 39  ? 20.025  -10.542 -17.439 1.00 0.00 ? 136 LYS A CG   4  
ATOM 6300  C CD   . LYS A 1 39  ? 20.294  -11.781 -16.620 1.00 0.00 ? 136 LYS A CD   4  
ATOM 6301  C CE   . LYS A 1 39  ? 21.217  -12.718 -17.367 1.00 0.00 ? 136 LYS A CE   4  
ATOM 6302  N NZ   . LYS A 1 39  ? 22.604  -12.188 -17.450 1.00 0.00 ? 136 LYS A NZ   4  
ATOM 6303  H H    . LYS A 1 39  ? 17.186  -7.283  -16.657 1.00 0.00 ? 136 LYS A H    4  
ATOM 6304  H HA   . LYS A 1 39  ? 19.613  -7.993  -18.061 1.00 0.00 ? 136 LYS A HA   4  
ATOM 6305  H HB2  . LYS A 1 39  ? 19.644  -9.228  -15.824 1.00 0.00 ? 136 LYS A HB2  4  
ATOM 6306  H HB3  . LYS A 1 39  ? 18.232  -10.102 -16.408 1.00 0.00 ? 136 LYS A HB3  4  
ATOM 6307  H HG2  . LYS A 1 39  ? 19.548  -10.831 -18.363 1.00 0.00 ? 136 LYS A HG2  4  
ATOM 6308  H HG3  . LYS A 1 39  ? 20.962  -10.052 -17.655 1.00 0.00 ? 136 LYS A HG3  4  
ATOM 6309  H HD2  . LYS A 1 39  ? 20.757  -11.496 -15.687 1.00 0.00 ? 136 LYS A HD2  4  
ATOM 6310  H HD3  . LYS A 1 39  ? 19.360  -12.286 -16.426 1.00 0.00 ? 136 LYS A HD3  4  
ATOM 6311  H HE2  . LYS A 1 39  ? 21.230  -13.671 -16.867 1.00 0.00 ? 136 LYS A HE2  4  
ATOM 6312  H HE3  . LYS A 1 39  ? 20.830  -12.838 -18.368 1.00 0.00 ? 136 LYS A HE3  4  
ATOM 6313  H HZ1  . LYS A 1 39  ? 22.621  -11.314 -18.011 1.00 0.00 ? 136 LYS A HZ1  4  
ATOM 6314  H HZ2  . LYS A 1 39  ? 23.226  -12.887 -17.904 1.00 0.00 ? 136 LYS A HZ2  4  
ATOM 6315  H HZ3  . LYS A 1 39  ? 22.970  -11.984 -16.497 1.00 0.00 ? 136 LYS A HZ3  4  
ATOM 6316  N N    . THR A 1 40  ? 18.068  -8.456  -19.846 1.00 0.00 ? 137 THR A N    4  
ATOM 6317  C CA   . THR A 1 40  ? 17.181  -8.660  -20.964 1.00 0.00 ? 137 THR A CA   4  
ATOM 6318  C C    . THR A 1 40  ? 16.850  -10.141 -21.144 1.00 0.00 ? 137 THR A C    4  
ATOM 6319  O O    . THR A 1 40  ? 17.702  -10.941 -21.537 1.00 0.00 ? 137 THR A O    4  
ATOM 6320  C CB   . THR A 1 40  ? 17.814  -8.105  -22.245 1.00 0.00 ? 137 THR A CB   4  
ATOM 6321  O OG1  . THR A 1 40  ? 18.483  -6.866  -21.955 1.00 0.00 ? 137 THR A OG1  4  
ATOM 6322  C CG2  . THR A 1 40  ? 16.752  -7.864  -23.290 1.00 0.00 ? 137 THR A CG2  4  
ATOM 6323  H H    . THR A 1 40  ? 18.955  -8.067  -20.015 1.00 0.00 ? 137 THR A H    4  
ATOM 6324  H HA   . THR A 1 40  ? 16.268  -8.116  -20.773 1.00 0.00 ? 137 THR A HA   4  
ATOM 6325  H HB   . THR A 1 40  ? 18.528  -8.820  -22.626 1.00 0.00 ? 137 THR A HB   4  
ATOM 6326  H HG1  . THR A 1 40  ? 17.843  -6.226  -21.601 1.00 0.00 ? 137 THR A HG1  4  
ATOM 6327  H HG21 . THR A 1 40  ? 16.258  -8.795  -23.519 1.00 0.00 ? 137 THR A HG21 4  
ATOM 6328  H HG22 . THR A 1 40  ? 17.208  -7.465  -24.181 1.00 0.00 ? 137 THR A HG22 4  
ATOM 6329  H HG23 . THR A 1 40  ? 16.033  -7.159  -22.903 1.00 0.00 ? 137 THR A HG23 4  
ATOM 6330  N N    . GLY A 1 41  ? 15.615  -10.493 -20.827 1.00 0.00 ? 138 GLY A N    4  
ATOM 6331  C CA   . GLY A 1 41  ? 15.177  -11.867 -20.928 1.00 0.00 ? 138 GLY A CA   4  
ATOM 6332  C C    . GLY A 1 41  ? 13.877  -12.083 -20.187 1.00 0.00 ? 138 GLY A C    4  
ATOM 6333  O O    . GLY A 1 41  ? 12.816  -11.671 -20.655 1.00 0.00 ? 138 GLY A O    4  
ATOM 6334  H H    . GLY A 1 41  ? 14.987  -9.807  -20.510 1.00 0.00 ? 138 GLY A H    4  
ATOM 6335  H HA2  . GLY A 1 41  ? 15.038  -12.118 -21.970 1.00 0.00 ? 138 GLY A HA2  4  
ATOM 6336  H HA3  . GLY A 1 41  ? 15.933  -12.511 -20.506 1.00 0.00 ? 138 GLY A HA3  4  
ATOM 6337  N N    . TRP A 1 42  ? 13.955  -12.721 -19.032 1.00 0.00 ? 139 TRP A N    4  
ATOM 6338  C CA   . TRP A 1 42  ? 12.779  -12.943 -18.205 1.00 0.00 ? 139 TRP A CA   4  
ATOM 6339  C C    . TRP A 1 42  ? 13.031  -12.466 -16.781 1.00 0.00 ? 139 TRP A C    4  
ATOM 6340  O O    . TRP A 1 42  ? 12.215  -12.692 -15.885 1.00 0.00 ? 139 TRP A O    4  
ATOM 6341  C CB   . TRP A 1 42  ? 12.386  -14.422 -18.201 1.00 0.00 ? 139 TRP A CB   4  
ATOM 6342  C CG   . TRP A 1 42  ? 11.950  -14.930 -19.541 1.00 0.00 ? 139 TRP A CG   4  
ATOM 6343  C CD1  . TRP A 1 42  ? 12.716  -15.587 -20.458 1.00 0.00 ? 139 TRP A CD1  4  
ATOM 6344  C CD2  . TRP A 1 42  ? 10.645  -14.817 -20.117 1.00 0.00 ? 139 TRP A CD2  4  
ATOM 6345  N NE1  . TRP A 1 42  ? 11.965  -15.898 -21.564 1.00 0.00 ? 139 TRP A NE1  4  
ATOM 6346  C CE2  . TRP A 1 42  ? 10.691  -15.432 -21.380 1.00 0.00 ? 139 TRP A CE2  4  
ATOM 6347  C CE3  . TRP A 1 42  ? 9.441   -14.256 -19.685 1.00 0.00 ? 139 TRP A CE3  4  
ATOM 6348  C CZ2  . TRP A 1 42  ? 9.579   -15.502 -22.214 1.00 0.00 ? 139 TRP A CZ2  4  
ATOM 6349  C CZ3  . TRP A 1 42  ? 8.339   -14.325 -20.514 1.00 0.00 ? 139 TRP A CZ3  4  
ATOM 6350  C CH2  . TRP A 1 42  ? 8.415   -14.944 -21.766 1.00 0.00 ? 139 TRP A CH2  4  
ATOM 6351  H H    . TRP A 1 42  ? 14.826  -13.055 -18.724 1.00 0.00 ? 139 TRP A H    4  
ATOM 6352  H HA   . TRP A 1 42  ? 11.969  -12.368 -18.626 1.00 0.00 ? 139 TRP A HA   4  
ATOM 6353  H HB2  . TRP A 1 42  ? 13.231  -15.012 -17.882 1.00 0.00 ? 139 TRP A HB2  4  
ATOM 6354  H HB3  . TRP A 1 42  ? 11.570  -14.568 -17.507 1.00 0.00 ? 139 TRP A HB3  4  
ATOM 6355  H HD1  . TRP A 1 42  ? 13.757  -15.825 -20.316 1.00 0.00 ? 139 TRP A HD1  4  
ATOM 6356  H HE1  . TRP A 1 42  ? 12.290  -16.376 -22.362 1.00 0.00 ? 139 TRP A HE1  4  
ATOM 6357  H HE3  . TRP A 1 42  ? 9.365   -13.774 -18.722 1.00 0.00 ? 139 TRP A HE3  4  
ATOM 6358  H HZ2  . TRP A 1 42  ? 9.620   -15.977 -23.181 1.00 0.00 ? 139 TRP A HZ2  4  
ATOM 6359  H HZ3  . TRP A 1 42  ? 7.399   -13.895 -20.197 1.00 0.00 ? 139 TRP A HZ3  4  
ATOM 6360  H HH2  . TRP A 1 42  ? 7.528   -14.975 -22.381 1.00 0.00 ? 139 TRP A HH2  4  
ATOM 6361  N N    . PHE A 1 43  ? 14.164  -11.803 -16.578 1.00 0.00 ? 140 PHE A N    4  
ATOM 6362  C CA   . PHE A 1 43  ? 14.526  -11.298 -15.263 1.00 0.00 ? 140 PHE A CA   4  
ATOM 6363  C C    . PHE A 1 43  ? 13.675  -10.083 -14.919 1.00 0.00 ? 140 PHE A C    4  
ATOM 6364  O O    . PHE A 1 43  ? 13.948  -8.971  -15.368 1.00 0.00 ? 140 PHE A O    4  
ATOM 6365  C CB   . PHE A 1 43  ? 16.013  -10.933 -15.214 1.00 0.00 ? 140 PHE A CB   4  
ATOM 6366  C CG   . PHE A 1 43  ? 16.512  -10.618 -13.831 1.00 0.00 ? 140 PHE A CG   4  
ATOM 6367  C CD1  . PHE A 1 43  ? 16.971  -11.630 -13.005 1.00 0.00 ? 140 PHE A CD1  4  
ATOM 6368  C CD2  . PHE A 1 43  ? 16.518  -9.315  -13.355 1.00 0.00 ? 140 PHE A CD2  4  
ATOM 6369  C CE1  . PHE A 1 43  ? 17.427  -11.351 -11.730 1.00 0.00 ? 140 PHE A CE1  4  
ATOM 6370  C CE2  . PHE A 1 43  ? 16.970  -9.033  -12.081 1.00 0.00 ? 140 PHE A CE2  4  
ATOM 6371  C CZ   . PHE A 1 43  ? 17.426  -10.050 -11.268 1.00 0.00 ? 140 PHE A CZ   4  
ATOM 6372  H H    . PHE A 1 43  ? 14.767  -11.645 -17.334 1.00 0.00 ? 140 PHE A H    4  
ATOM 6373  H HA   . PHE A 1 43  ? 14.329  -12.078 -14.542 1.00 0.00 ? 140 PHE A HA   4  
ATOM 6374  H HB2  . PHE A 1 43  ? 16.593  -11.760 -15.596 1.00 0.00 ? 140 PHE A HB2  4  
ATOM 6375  H HB3  . PHE A 1 43  ? 16.183  -10.065 -15.835 1.00 0.00 ? 140 PHE A HB3  4  
ATOM 6376  H HD1  . PHE A 1 43  ? 16.972  -12.648 -13.365 1.00 0.00 ? 140 PHE A HD1  4  
ATOM 6377  H HD2  . PHE A 1 43  ? 16.161  -8.514  -13.988 1.00 0.00 ? 140 PHE A HD2  4  
ATOM 6378  H HE1  . PHE A 1 43  ? 17.782  -12.150 -11.096 1.00 0.00 ? 140 PHE A HE1  4  
ATOM 6379  H HE2  . PHE A 1 43  ? 16.971  -8.016  -11.723 1.00 0.00 ? 140 PHE A HE2  4  
ATOM 6380  H HZ   . PHE A 1 43  ? 17.780  -9.829  -10.273 1.00 0.00 ? 140 PHE A HZ   4  
ATOM 6381  N N    . THR A 1 44  ? 12.640  -10.307 -14.130 1.00 0.00 ? 141 THR A N    4  
ATOM 6382  C CA   . THR A 1 44  ? 11.724  -9.247  -13.757 1.00 0.00 ? 141 THR A CA   4  
ATOM 6383  C C    . THR A 1 44  ? 12.210  -8.502  -12.518 1.00 0.00 ? 141 THR A C    4  
ATOM 6384  O O    . THR A 1 44  ? 12.847  -9.086  -11.640 1.00 0.00 ? 141 THR A O    4  
ATOM 6385  C CB   . THR A 1 44  ? 10.317  -9.815  -13.503 1.00 0.00 ? 141 THR A CB   4  
ATOM 6386  O OG1  . THR A 1 44  ? 10.405  -10.990 -12.682 1.00 0.00 ? 141 THR A OG1  4  
ATOM 6387  C CG2  . THR A 1 44  ? 9.629   -10.155 -14.816 1.00 0.00 ? 141 THR A CG2  4  
ATOM 6388  H H    . THR A 1 44  ? 12.487  -11.213 -13.789 1.00 0.00 ? 141 THR A H    4  
ATOM 6389  H HA   . THR A 1 44  ? 11.666  -8.553  -14.582 1.00 0.00 ? 141 THR A HA   4  
ATOM 6390  H HB   . THR A 1 44  ? 9.731   -9.068  -12.987 1.00 0.00 ? 141 THR A HB   4  
ATOM 6391  H HG1  . THR A 1 44  ? 11.252  -10.990 -12.216 1.00 0.00 ? 141 THR A HG1  4  
ATOM 6392  H HG21 . THR A 1 44  ? 10.202  -10.908 -15.337 1.00 0.00 ? 141 THR A HG21 4  
ATOM 6393  H HG22 . THR A 1 44  ? 9.559   -9.267  -15.426 1.00 0.00 ? 141 THR A HG22 4  
ATOM 6394  H HG23 . THR A 1 44  ? 8.637   -10.533 -14.615 1.00 0.00 ? 141 THR A HG23 4  
ATOM 6395  N N    . LEU A 1 45  ? 11.913  -7.214  -12.465 1.00 0.00 ? 142 LEU A N    4  
ATOM 6396  C CA   . LEU A 1 45  ? 12.303  -6.376  -11.340 1.00 0.00 ? 142 LEU A CA   4  
ATOM 6397  C C    . LEU A 1 45  ? 11.339  -6.576  -10.178 1.00 0.00 ? 142 LEU A C    4  
ATOM 6398  O O    . LEU A 1 45  ? 10.121  -6.571  -10.367 1.00 0.00 ? 142 LEU A O    4  
ATOM 6399  C CB   . LEU A 1 45  ? 12.321  -4.909  -11.779 1.00 0.00 ? 142 LEU A CB   4  
ATOM 6400  C CG   . LEU A 1 45  ? 12.684  -3.885  -10.710 1.00 0.00 ? 142 LEU A CG   4  
ATOM 6401  C CD1  . LEU A 1 45  ? 14.056  -4.176  -10.134 1.00 0.00 ? 142 LEU A CD1  4  
ATOM 6402  C CD2  . LEU A 1 45  ? 12.643  -2.487  -11.304 1.00 0.00 ? 142 LEU A CD2  4  
ATOM 6403  H H    . LEU A 1 45  ? 11.407  -6.812  -13.205 1.00 0.00 ? 142 LEU A H    4  
ATOM 6404  H HA   . LEU A 1 45  ? 13.295  -6.668  -11.030 1.00 0.00 ? 142 LEU A HA   4  
ATOM 6405  H HB2  . LEU A 1 45  ? 13.034  -4.810  -12.580 1.00 0.00 ? 142 LEU A HB2  4  
ATOM 6406  H HB3  . LEU A 1 45  ? 11.343  -4.660  -12.158 1.00 0.00 ? 142 LEU A HB3  4  
ATOM 6407  H HG   . LEU A 1 45  ? 11.963  -3.933  -9.909  1.00 0.00 ? 142 LEU A HG   4  
ATOM 6408  H HD11 . LEU A 1 45  ? 14.789  -4.168  -10.927 1.00 0.00 ? 142 LEU A HD11 4  
ATOM 6409  H HD12 . LEU A 1 45  ? 14.048  -5.147  -9.660  1.00 0.00 ? 142 LEU A HD12 4  
ATOM 6410  H HD13 . LEU A 1 45  ? 14.307  -3.422  -9.403  1.00 0.00 ? 142 LEU A HD13 4  
ATOM 6411  H HD21 . LEU A 1 45  ? 13.353  -2.418  -12.115 1.00 0.00 ? 142 LEU A HD21 4  
ATOM 6412  H HD22 . LEU A 1 45  ? 12.896  -1.765  -10.542 1.00 0.00 ? 142 LEU A HD22 4  
ATOM 6413  H HD23 . LEU A 1 45  ? 11.650  -2.283  -11.676 1.00 0.00 ? 142 LEU A HD23 4  
ATOM 6414  N N    . LEU A 1 46  ? 11.881  -6.766  -8.986  1.00 0.00 ? 143 LEU A N    4  
ATOM 6415  C CA   . LEU A 1 46  ? 11.057  -7.020  -7.815  1.00 0.00 ? 143 LEU A CA   4  
ATOM 6416  C C    . LEU A 1 46  ? 10.756  -5.731  -7.066  1.00 0.00 ? 143 LEU A C    4  
ATOM 6417  O O    . LEU A 1 46  ? 11.526  -4.770  -7.120  1.00 0.00 ? 143 LEU A O    4  
ATOM 6418  C CB   . LEU A 1 46  ? 11.728  -8.026  -6.873  1.00 0.00 ? 143 LEU A CB   4  
ATOM 6419  C CG   . LEU A 1 46  ? 11.875  -9.454  -7.414  1.00 0.00 ? 143 LEU A CG   4  
ATOM 6420  C CD1  . LEU A 1 46  ? 10.608  -9.887  -8.138  1.00 0.00 ? 143 LEU A CD1  4  
ATOM 6421  C CD2  . LEU A 1 46  ? 13.088  -9.573  -8.327  1.00 0.00 ? 143 LEU A CD2  4  
ATOM 6422  H H    . LEU A 1 46  ? 12.857  -6.735  -8.890  1.00 0.00 ? 143 LEU A H    4  
ATOM 6423  H HA   . LEU A 1 46  ? 10.124  -7.438  -8.160  1.00 0.00 ? 143 LEU A HA   4  
ATOM 6424  H HB2  . LEU A 1 46  ? 12.714  -7.654  -6.630  1.00 0.00 ? 143 LEU A HB2  4  
ATOM 6425  H HB3  . LEU A 1 46  ? 11.148  -8.070  -5.963  1.00 0.00 ? 143 LEU A HB3  4  
ATOM 6426  H HG   . LEU A 1 46  ? 12.019  -10.128 -6.581  1.00 0.00 ? 143 LEU A HG   4  
ATOM 6427  H HD11 . LEU A 1 46  ? 10.425  -9.228  -8.973  1.00 0.00 ? 143 LEU A HD11 4  
ATOM 6428  H HD12 . LEU A 1 46  ? 9.768   -9.845  -7.455  1.00 0.00 ? 143 LEU A HD12 4  
ATOM 6429  H HD13 . LEU A 1 46  ? 10.727  -10.899 -8.497  1.00 0.00 ? 143 LEU A HD13 4  
ATOM 6430  H HD21 . LEU A 1 46  ? 12.969  -8.911  -9.171  1.00 0.00 ? 143 LEU A HD21 4  
ATOM 6431  H HD22 . LEU A 1 46  ? 13.175  -10.590 -8.677  1.00 0.00 ? 143 LEU A HD22 4  
ATOM 6432  H HD23 . LEU A 1 46  ? 13.978  -9.303  -7.779  1.00 0.00 ? 143 LEU A HD23 4  
ATOM 6433  N N    . TYR A 1 47  ? 9.626   -5.722  -6.371  1.00 0.00 ? 144 TYR A N    4  
ATOM 6434  C CA   . TYR A 1 47  ? 9.185   -4.555  -5.623  1.00 0.00 ? 144 TYR A CA   4  
ATOM 6435  C C    . TYR A 1 47  ? 8.822   -4.955  -4.200  1.00 0.00 ? 144 TYR A C    4  
ATOM 6436  O O    . TYR A 1 47  ? 8.384   -6.084  -3.955  1.00 0.00 ? 144 TYR A O    4  
ATOM 6437  C CB   . TYR A 1 47  ? 7.967   -3.914  -6.296  1.00 0.00 ? 144 TYR A CB   4  
ATOM 6438  C CG   . TYR A 1 47  ? 8.181   -3.563  -7.751  1.00 0.00 ? 144 TYR A CG   4  
ATOM 6439  C CD1  . TYR A 1 47  ? 8.680   -2.322  -8.120  1.00 0.00 ? 144 TYR A CD1  4  
ATOM 6440  C CD2  . TYR A 1 47  ? 7.887   -4.475  -8.756  1.00 0.00 ? 144 TYR A CD2  4  
ATOM 6441  C CE1  . TYR A 1 47  ? 8.883   -2.001  -9.449  1.00 0.00 ? 144 TYR A CE1  4  
ATOM 6442  C CE2  . TYR A 1 47  ? 8.086   -4.162  -10.085 1.00 0.00 ? 144 TYR A CE2  4  
ATOM 6443  C CZ   . TYR A 1 47  ? 8.583   -2.925  -10.427 1.00 0.00 ? 144 TYR A CZ   4  
ATOM 6444  O OH   . TYR A 1 47  ? 8.789   -2.613  -11.751 1.00 0.00 ? 144 TYR A OH   4  
ATOM 6445  H H    . TYR A 1 47  ? 9.074   -6.530  -6.353  1.00 0.00 ? 144 TYR A H    4  
ATOM 6446  H HA   . TYR A 1 47  ? 9.996   -3.844  -5.597  1.00 0.00 ? 144 TYR A HA   4  
ATOM 6447  H HB2  . TYR A 1 47  ? 7.133   -4.598  -6.242  1.00 0.00 ? 144 TYR A HB2  4  
ATOM 6448  H HB3  . TYR A 1 47  ? 7.713   -3.005  -5.770  1.00 0.00 ? 144 TYR A HB3  4  
ATOM 6449  H HD1  . TYR A 1 47  ? 8.913   -1.600  -7.352  1.00 0.00 ? 144 TYR A HD1  4  
ATOM 6450  H HD2  . TYR A 1 47  ? 7.495   -5.445  -8.485  1.00 0.00 ? 144 TYR A HD2  4  
ATOM 6451  H HE1  . TYR A 1 47  ? 9.272   -1.030  -9.717  1.00 0.00 ? 144 TYR A HE1  4  
ATOM 6452  H HE2  . TYR A 1 47  ? 7.851   -4.885  -10.850 1.00 0.00 ? 144 TYR A HE2  4  
ATOM 6453  H HH   . TYR A 1 47  ? 9.662   -2.225  -11.854 1.00 0.00 ? 144 TYR A HH   4  
ATOM 6454  N N    . GLU A 1 48  ? 9.002   -4.034  -3.271  1.00 0.00 ? 145 GLU A N    4  
ATOM 6455  C CA   . GLU A 1 48  ? 8.639   -4.265  -1.884  1.00 0.00 ? 145 GLU A CA   4  
ATOM 6456  C C    . GLU A 1 48  ? 7.770   -3.112  -1.396  1.00 0.00 ? 145 GLU A C    4  
ATOM 6457  O O    . GLU A 1 48  ? 8.016   -1.956  -1.748  1.00 0.00 ? 145 GLU A O    4  
ATOM 6458  C CB   . GLU A 1 48  ? 9.902   -4.410  -1.029  1.00 0.00 ? 145 GLU A CB   4  
ATOM 6459  C CG   . GLU A 1 48  ? 9.648   -4.923  0.380   1.00 0.00 ? 145 GLU A CG   4  
ATOM 6460  C CD   . GLU A 1 48  ? 10.931  -5.265  1.112   1.00 0.00 ? 145 GLU A CD   4  
ATOM 6461  O OE1  . GLU A 1 48  ? 11.394  -6.421  1.002   1.00 0.00 ? 145 GLU A OE1  4  
ATOM 6462  O OE2  . GLU A 1 48  ? 11.487  -4.387  1.806   1.00 0.00 ? 145 GLU A OE2  4  
ATOM 6463  H H    . GLU A 1 48  ? 9.391   -3.168  -3.523  1.00 0.00 ? 145 GLU A H    4  
ATOM 6464  H HA   . GLU A 1 48  ? 8.066   -5.181  -1.836  1.00 0.00 ? 145 GLU A HA   4  
ATOM 6465  H HB2  . GLU A 1 48  ? 10.574  -5.099  -1.519  1.00 0.00 ? 145 GLU A HB2  4  
ATOM 6466  H HB3  . GLU A 1 48  ? 10.384  -3.446  -0.955  1.00 0.00 ? 145 GLU A HB3  4  
ATOM 6467  H HG2  . GLU A 1 48  ? 9.123   -4.161  0.938   1.00 0.00 ? 145 GLU A HG2  4  
ATOM 6468  H HG3  . GLU A 1 48  ? 9.035   -5.811  0.320   1.00 0.00 ? 145 GLU A HG3  4  
ATOM 6469  N N    . ILE A 1 49  ? 6.741   -3.427  -0.618  1.00 0.00 ? 146 ILE A N    4  
ATOM 6470  C CA   . ILE A 1 49  ? 5.796   -2.419  -0.154  1.00 0.00 ? 146 ILE A CA   4  
ATOM 6471  C C    . ILE A 1 49  ? 5.901   -2.246  1.357   1.00 0.00 ? 146 ILE A C    4  
ATOM 6472  O O    . ILE A 1 49  ? 5.766   -3.210  2.115   1.00 0.00 ? 146 ILE A O    4  
ATOM 6473  C CB   . ILE A 1 49  ? 4.326   -2.776  -0.509  1.00 0.00 ? 146 ILE A CB   4  
ATOM 6474  C CG1  . ILE A 1 49  ? 4.178   -3.157  -1.986  1.00 0.00 ? 146 ILE A CG1  4  
ATOM 6475  C CG2  . ILE A 1 49  ? 3.395   -1.614  -0.186  1.00 0.00 ? 146 ILE A CG2  4  
ATOM 6476  C CD1  . ILE A 1 49  ? 4.368   -4.634  -2.261  1.00 0.00 ? 146 ILE A CD1  4  
ATOM 6477  H H    . ILE A 1 49  ? 6.620   -4.362  -0.337  1.00 0.00 ? 146 ILE A H    4  
ATOM 6478  H HA   . ILE A 1 49  ? 6.044   -1.482  -0.632  1.00 0.00 ? 146 ILE A HA   4  
ATOM 6479  H HB   . ILE A 1 49  ? 4.030   -3.617  0.100   1.00 0.00 ? 146 ILE A HB   4  
ATOM 6480  H HG12 . ILE A 1 49  ? 3.189   -2.884  -2.324  1.00 0.00 ? 146 ILE A HG12 4  
ATOM 6481  H HG13 . ILE A 1 49  ? 4.912   -2.614  -2.565  1.00 0.00 ? 146 ILE A HG13 4  
ATOM 6482  H HG21 . ILE A 1 49  ? 3.493   -1.351  0.856   1.00 0.00 ? 146 ILE A HG21 4  
ATOM 6483  H HG22 . ILE A 1 49  ? 2.375   -1.905  -0.390  1.00 0.00 ? 146 ILE A HG22 4  
ATOM 6484  H HG23 . ILE A 1 49  ? 3.655   -0.763  -0.800  1.00 0.00 ? 146 ILE A HG23 4  
ATOM 6485  H HD11 . ILE A 1 49  ? 5.369   -4.927  -1.982  1.00 0.00 ? 146 ILE A HD11 4  
ATOM 6486  H HD12 . ILE A 1 49  ? 4.216   -4.825  -3.312  1.00 0.00 ? 146 ILE A HD12 4  
ATOM 6487  H HD13 . ILE A 1 49  ? 3.652   -5.202  -1.686  1.00 0.00 ? 146 ILE A HD13 4  
ATOM 6488  N N    . ARG A 1 50  ? 6.140   -1.018  1.788   1.00 0.00 ? 147 ARG A N    4  
ATOM 6489  C CA   . ARG A 1 50  ? 6.222   -0.706  3.206   1.00 0.00 ? 147 ARG A CA   4  
ATOM 6490  C C    . ARG A 1 50  ? 5.065   0.200   3.595   1.00 0.00 ? 147 ARG A C    4  
ATOM 6491  O O    . ARG A 1 50  ? 4.922   1.295   3.054   1.00 0.00 ? 147 ARG A O    4  
ATOM 6492  C CB   . ARG A 1 50  ? 7.556   -0.022  3.531   1.00 0.00 ? 147 ARG A CB   4  
ATOM 6493  C CG   . ARG A 1 50  ? 7.826   0.100   5.021   1.00 0.00 ? 147 ARG A CG   4  
ATOM 6494  C CD   . ARG A 1 50  ? 9.160   0.778   5.311   1.00 0.00 ? 147 ARG A CD   4  
ATOM 6495  N NE   . ARG A 1 50  ? 9.130   2.215   5.036   1.00 0.00 ? 147 ARG A NE   4  
ATOM 6496  C CZ   . ARG A 1 50  ? 9.734   3.133   5.795   1.00 0.00 ? 147 ARG A CZ   4  
ATOM 6497  N NH1  . ARG A 1 50  ? 10.467  2.765   6.838   1.00 0.00 ? 147 ARG A NH1  4  
ATOM 6498  N NH2  . ARG A 1 50  ? 9.617   4.421   5.499   1.00 0.00 ? 147 ARG A NH2  4  
ATOM 6499  H H    . ARG A 1 50  ? 6.249   -0.294  1.131   1.00 0.00 ? 147 ARG A H    4  
ATOM 6500  H HA   . ARG A 1 50  ? 6.150   -1.630  3.760   1.00 0.00 ? 147 ARG A HA   4  
ATOM 6501  H HB2  . ARG A 1 50  ? 8.357   -0.593  3.087   1.00 0.00 ? 147 ARG A HB2  4  
ATOM 6502  H HB3  . ARG A 1 50  ? 7.552   0.970   3.105   1.00 0.00 ? 147 ARG A HB3  4  
ATOM 6503  H HG2  . ARG A 1 50  ? 7.038   0.683   5.470   1.00 0.00 ? 147 ARG A HG2  4  
ATOM 6504  H HG3  . ARG A 1 50  ? 7.835   -0.889  5.455   1.00 0.00 ? 147 ARG A HG3  4  
ATOM 6505  H HD2  . ARG A 1 50  ? 9.403   0.629   6.351   1.00 0.00 ? 147 ARG A HD2  4  
ATOM 6506  H HD3  . ARG A 1 50  ? 9.921   0.319   4.696   1.00 0.00 ? 147 ARG A HD3  4  
ATOM 6507  H HE   . ARG A 1 50  ? 8.622   2.516   4.246   1.00 0.00 ? 147 ARG A HE   4  
ATOM 6508  H HH11 . ARG A 1 50  ? 10.578  1.795   7.064   1.00 0.00 ? 147 ARG A HH11 4  
ATOM 6509  H HH12 . ARG A 1 50  ? 10.907  3.462   7.414   1.00 0.00 ? 147 ARG A HH12 4  
ATOM 6510  H HH21 . ARG A 1 50  ? 9.079   4.709   4.699   1.00 0.00 ? 147 ARG A HH21 4  
ATOM 6511  H HH22 . ARG A 1 50  ? 10.057  5.114   6.076   1.00 0.00 ? 147 ARG A HH22 4  
ATOM 6512  N N    . LEU A 1 51  ? 4.236   -0.253  4.521   1.00 0.00 ? 148 LEU A N    4  
ATOM 6513  C CA   . LEU A 1 51  ? 3.073   0.517   4.933   1.00 0.00 ? 148 LEU A CA   4  
ATOM 6514  C C    . LEU A 1 51  ? 2.821   0.358   6.426   1.00 0.00 ? 148 LEU A C    4  
ATOM 6515  O O    . LEU A 1 51  ? 3.318   -0.579  7.047   1.00 0.00 ? 148 LEU A O    4  
ATOM 6516  C CB   . LEU A 1 51  ? 1.821   0.143   4.093   1.00 0.00 ? 148 LEU A CB   4  
ATOM 6517  C CG   . LEU A 1 51  ? 1.153   -1.238  4.313   1.00 0.00 ? 148 LEU A CG   4  
ATOM 6518  C CD1  . LEU A 1 51  ? 2.163   -2.375  4.334   1.00 0.00 ? 148 LEU A CD1  4  
ATOM 6519  C CD2  . LEU A 1 51  ? 0.291   -1.248  5.570   1.00 0.00 ? 148 LEU A CD2  4  
ATOM 6520  H H    . LEU A 1 51  ? 4.414   -1.123  4.946   1.00 0.00 ? 148 LEU A H    4  
ATOM 6521  H HA   . LEU A 1 51  ? 3.306   1.557   4.747   1.00 0.00 ? 148 LEU A HA   4  
ATOM 6522  H HB2  . LEU A 1 51  ? 1.071   0.894   4.280   1.00 0.00 ? 148 LEU A HB2  4  
ATOM 6523  H HB3  . LEU A 1 51  ? 2.101   0.209   3.051   1.00 0.00 ? 148 LEU A HB3  4  
ATOM 6524  H HG   . LEU A 1 51  ? 0.495   -1.423  3.477   1.00 0.00 ? 148 LEU A HG   4  
ATOM 6525  H HD11 . LEU A 1 51  ? 1.649   -3.311  4.498   1.00 0.00 ? 148 LEU A HD11 4  
ATOM 6526  H HD12 . LEU A 1 51  ? 2.875   -2.211  5.129   1.00 0.00 ? 148 LEU A HD12 4  
ATOM 6527  H HD13 . LEU A 1 51  ? 2.684   -2.413  3.389   1.00 0.00 ? 148 LEU A HD13 4  
ATOM 6528  H HD21 . LEU A 1 51  ? -0.489  -0.507  5.477   1.00 0.00 ? 148 LEU A HD21 4  
ATOM 6529  H HD22 . LEU A 1 51  ? 0.905   -1.018  6.429   1.00 0.00 ? 148 LEU A HD22 4  
ATOM 6530  H HD23 . LEU A 1 51  ? -0.151  -2.225  5.695   1.00 0.00 ? 148 LEU A HD23 4  
ATOM 6531  N N    . LYS A 1 52  ? 2.073   1.291   7.002   1.00 0.00 ? 149 LYS A N    4  
ATOM 6532  C CA   . LYS A 1 52  ? 1.708   1.215   8.410   1.00 0.00 ? 149 LYS A CA   4  
ATOM 6533  C C    . LYS A 1 52  ? 0.573   2.187   8.714   1.00 0.00 ? 149 LYS A C    4  
ATOM 6534  O O    . LYS A 1 52  ? 0.451   3.232   8.070   1.00 0.00 ? 149 LYS A O    4  
ATOM 6535  C CB   . LYS A 1 52  ? 2.914   1.536   9.306   1.00 0.00 ? 149 LYS A CB   4  
ATOM 6536  C CG   . LYS A 1 52  ? 3.250   3.017   9.386   1.00 0.00 ? 149 LYS A CG   4  
ATOM 6537  C CD   . LYS A 1 52  ? 4.378   3.283   10.368  1.00 0.00 ? 149 LYS A CD   4  
ATOM 6538  C CE   . LYS A 1 52  ? 4.617   4.774   10.550  1.00 0.00 ? 149 LYS A CE   4  
ATOM 6539  N NZ   . LYS A 1 52  ? 3.469   5.449   11.217  1.00 0.00 ? 149 LYS A NZ   4  
ATOM 6540  H H    . LYS A 1 52  ? 1.757   2.051   6.463   1.00 0.00 ? 149 LYS A H    4  
ATOM 6541  H HA   . LYS A 1 52  ? 1.373   0.209   8.614   1.00 0.00 ? 149 LYS A HA   4  
ATOM 6542  H HB2  . LYS A 1 52  ? 2.708   1.183   10.306  1.00 0.00 ? 149 LYS A HB2  4  
ATOM 6543  H HB3  . LYS A 1 52  ? 3.778   1.015   8.923   1.00 0.00 ? 149 LYS A HB3  4  
ATOM 6544  H HG2  . LYS A 1 52  ? 3.552   3.361   8.409   1.00 0.00 ? 149 LYS A HG2  4  
ATOM 6545  H HG3  . LYS A 1 52  ? 2.371   3.558   9.705   1.00 0.00 ? 149 LYS A HG3  4  
ATOM 6546  H HD2  . LYS A 1 52  ? 4.120   2.852   11.325  1.00 0.00 ? 149 LYS A HD2  4  
ATOM 6547  H HD3  . LYS A 1 52  ? 5.283   2.825   9.997   1.00 0.00 ? 149 LYS A HD3  4  
ATOM 6548  H HE2  . LYS A 1 52  ? 5.504   4.912   11.151  1.00 0.00 ? 149 LYS A HE2  4  
ATOM 6549  H HE3  . LYS A 1 52  ? 4.771   5.219   9.577   1.00 0.00 ? 149 LYS A HE3  4  
ATOM 6550  H HZ1  . LYS A 1 52  ? 3.662   6.468   11.320  1.00 0.00 ? 149 LYS A HZ1  4  
ATOM 6551  H HZ2  . LYS A 1 52  ? 3.315   5.044   12.166  1.00 0.00 ? 149 LYS A HZ2  4  
ATOM 6552  H HZ3  . LYS A 1 52  ? 2.605   5.330   10.657  1.00 0.00 ? 149 LYS A HZ3  4  
ATOM 6553  N N    . PRO A 1 53  ? -0.290  1.838   9.680   1.00 0.00 ? 150 PRO A N    4  
ATOM 6554  C CA   . PRO A 1 53  ? -1.325  2.746   10.178  1.00 0.00 ? 150 PRO A CA   4  
ATOM 6555  C C    . PRO A 1 53  ? -0.741  3.851   11.054  1.00 0.00 ? 150 PRO A C    4  
ATOM 6556  O O    . PRO A 1 53  ? 0.427   3.805   11.445  1.00 0.00 ? 150 PRO A O    4  
ATOM 6557  C CB   . PRO A 1 53  ? -2.226  1.835   11.014  1.00 0.00 ? 150 PRO A CB   4  
ATOM 6558  C CG   . PRO A 1 53  ? -1.341  0.721   11.451  1.00 0.00 ? 150 PRO A CG   4  
ATOM 6559  C CD   . PRO A 1 53  ? -0.348  0.519   10.340  1.00 0.00 ? 150 PRO A CD   4  
ATOM 6560  H HA   . PRO A 1 53  ? -1.892  3.185   9.371   1.00 0.00 ? 150 PRO A HA   4  
ATOM 6561  H HB2  . PRO A 1 53  ? -2.612  2.387   11.858  1.00 0.00 ? 150 PRO A HB2  4  
ATOM 6562  H HB3  . PRO A 1 53  ? -3.043  1.476   10.406  1.00 0.00 ? 150 PRO A HB3  4  
ATOM 6563  H HG2  . PRO A 1 53  ? -0.834  0.994   12.363  1.00 0.00 ? 150 PRO A HG2  4  
ATOM 6564  H HG3  . PRO A 1 53  ? -1.925  -0.174  11.599  1.00 0.00 ? 150 PRO A HG3  4  
ATOM 6565  H HD2  . PRO A 1 53  ? 0.618   0.247   10.742  1.00 0.00 ? 150 PRO A HD2  4  
ATOM 6566  H HD3  . PRO A 1 53  ? -0.698  -0.238  9.655   1.00 0.00 ? 150 PRO A HD3  4  
ATOM 6567  N N    . GLU A 1 54  ? -1.573  4.835   11.363  1.00 0.00 ? 151 GLU A N    4  
ATOM 6568  C CA   . GLU A 1 54  ? -1.174  5.970   12.188  1.00 0.00 ? 151 GLU A CA   4  
ATOM 6569  C C    . GLU A 1 54  ? -0.925  5.555   13.634  1.00 0.00 ? 151 GLU A C    4  
ATOM 6570  O O    . GLU A 1 54  ? -0.393  6.328   14.427  1.00 0.00 ? 151 GLU A O    4  
ATOM 6571  C CB   . GLU A 1 54  ? -2.261  7.045   12.150  1.00 0.00 ? 151 GLU A CB   4  
ATOM 6572  C CG   . GLU A 1 54  ? -3.639  6.507   12.502  1.00 0.00 ? 151 GLU A CG   4  
ATOM 6573  C CD   . GLU A 1 54  ? -4.656  7.597   12.746  1.00 0.00 ? 151 GLU A CD   4  
ATOM 6574  O OE1  . GLU A 1 54  ? -5.241  8.106   11.770  1.00 0.00 ? 151 GLU A OE1  4  
ATOM 6575  O OE2  . GLU A 1 54  ? -4.881  7.946   13.921  1.00 0.00 ? 151 GLU A OE2  4  
ATOM 6576  H H    . GLU A 1 54  ? -2.486  4.813   11.002  1.00 0.00 ? 151 GLU A H    4  
ATOM 6577  H HA   . GLU A 1 54  ? -0.261  6.373   11.778  1.00 0.00 ? 151 GLU A HA   4  
ATOM 6578  H HB2  . GLU A 1 54  ? -2.008  7.824   12.854  1.00 0.00 ? 151 GLU A HB2  4  
ATOM 6579  H HB3  . GLU A 1 54  ? -2.305  7.465   11.157  1.00 0.00 ? 151 GLU A HB3  4  
ATOM 6580  H HG2  . GLU A 1 54  ? -3.988  5.889   11.688  1.00 0.00 ? 151 GLU A HG2  4  
ATOM 6581  H HG3  . GLU A 1 54  ? -3.557  5.905   13.395  1.00 0.00 ? 151 GLU A HG3  4  
ATOM 6582  N N    . LYS A 1 55  ? -1.323  4.339   13.975  1.00 0.00 ? 152 LYS A N    4  
ATOM 6583  C CA   . LYS A 1 55  ? -1.136  3.829   15.327  1.00 0.00 ? 152 LYS A CA   4  
ATOM 6584  C C    . LYS A 1 55  ? 0.165   3.044   15.412  1.00 0.00 ? 152 LYS A C    4  
ATOM 6585  O O    . LYS A 1 55  ? 0.542   2.544   16.472  1.00 0.00 ? 152 LYS A O    4  
ATOM 6586  C CB   . LYS A 1 55  ? -2.300  2.921   15.723  1.00 0.00 ? 152 LYS A CB   4  
ATOM 6587  C CG   . LYS A 1 55  ? -3.671  3.474   15.371  1.00 0.00 ? 152 LYS A CG   4  
ATOM 6588  C CD   . LYS A 1 55  ? -3.931  4.830   16.007  1.00 0.00 ? 152 LYS A CD   4  
ATOM 6589  C CE   . LYS A 1 55  ? -5.358  5.289   15.754  1.00 0.00 ? 152 LYS A CE   4  
ATOM 6590  N NZ   . LYS A 1 55  ? -5.585  6.693   16.187  1.00 0.00 ? 152 LYS A NZ   4  
ATOM 6591  H H    . LYS A 1 55  ? -1.752  3.771   13.305  1.00 0.00 ? 152 LYS A H    4  
ATOM 6592  H HA   . LYS A 1 55  ? -1.093  4.668   16.002  1.00 0.00 ? 152 LYS A HA   4  
ATOM 6593  H HB2  . LYS A 1 55  ? -2.182  1.970   15.224  1.00 0.00 ? 152 LYS A HB2  4  
ATOM 6594  H HB3  . LYS A 1 55  ? -2.264  2.761   16.790  1.00 0.00 ? 152 LYS A HB3  4  
ATOM 6595  H HG2  . LYS A 1 55  ? -3.733  3.578   14.298  1.00 0.00 ? 152 LYS A HG2  4  
ATOM 6596  H HG3  . LYS A 1 55  ? -4.422  2.777   15.709  1.00 0.00 ? 152 LYS A HG3  4  
ATOM 6597  H HD2  . LYS A 1 55  ? -3.773  4.753   17.072  1.00 0.00 ? 152 LYS A HD2  4  
ATOM 6598  H HD3  . LYS A 1 55  ? -3.247  5.553   15.588  1.00 0.00 ? 152 LYS A HD3  4  
ATOM 6599  H HE2  . LYS A 1 55  ? -5.563  5.213   14.696  1.00 0.00 ? 152 LYS A HE2  4  
ATOM 6600  H HE3  . LYS A 1 55  ? -6.031  4.641   16.295  1.00 0.00 ? 152 LYS A HE3  4  
ATOM 6601  H HZ1  . LYS A 1 55  ? -5.115  7.353   15.529  1.00 0.00 ? 152 LYS A HZ1  4  
ATOM 6602  H HZ2  . LYS A 1 55  ? -5.208  6.841   17.144  1.00 0.00 ? 152 LYS A HZ2  4  
ATOM 6603  H HZ3  . LYS A 1 55  ? -6.604  6.900   16.197  1.00 0.00 ? 152 LYS A HZ3  4  
ATOM 6604  N N    . ALA A 1 56  ? 0.844   2.943   14.283  1.00 0.00 ? 153 ALA A N    4  
ATOM 6605  C CA   . ALA A 1 56  ? 2.025   2.110   14.173  1.00 0.00 ? 153 ALA A CA   4  
ATOM 6606  C C    . ALA A 1 56  ? 3.302   2.927   14.272  1.00 0.00 ? 153 ALA A C    4  
ATOM 6607  O O    . ALA A 1 56  ? 3.524   3.849   13.488  1.00 0.00 ? 153 ALA A O    4  
ATOM 6608  C CB   . ALA A 1 56  ? 1.998   1.358   12.859  1.00 0.00 ? 153 ALA A CB   4  
ATOM 6609  H H    . ALA A 1 56  ? 0.547   3.452   13.499  1.00 0.00 ? 153 ALA A H    4  
ATOM 6610  H HA   . ALA A 1 56  ? 2.004   1.389   14.975  1.00 0.00 ? 153 ALA A HA   4  
ATOM 6611  H HB1  . ALA A 1 56  ? 1.152   0.689   12.845  1.00 0.00 ? 153 ALA A HB1  4  
ATOM 6612  H HB2  . ALA A 1 56  ? 2.909   0.789   12.749  1.00 0.00 ? 153 ALA A HB2  4  
ATOM 6613  H HB3  . ALA A 1 56  ? 1.911   2.065   12.044  1.00 0.00 ? 153 ALA A HB3  4  
ATOM 6614  N N    . ALA A 1 57  ? 4.137   2.577   15.234  1.00 0.00 ? 154 ALA A N    4  
ATOM 6615  C CA   . ALA A 1 57  ? 5.453   3.179   15.366  1.00 0.00 ? 154 ALA A CA   4  
ATOM 6616  C C    . ALA A 1 57  ? 6.433   2.456   14.458  1.00 0.00 ? 154 ALA A C    4  
ATOM 6617  O O    . ALA A 1 57  ? 7.416   3.029   13.983  1.00 0.00 ? 154 ALA A O    4  
ATOM 6618  C CB   . ALA A 1 57  ? 5.922   3.103   16.809  1.00 0.00 ? 154 ALA A CB   4  
ATOM 6619  H H    . ALA A 1 57  ? 3.863   1.885   15.873  1.00 0.00 ? 154 ALA A H    4  
ATOM 6620  H HA   . ALA A 1 57  ? 5.387   4.218   15.076  1.00 0.00 ? 154 ALA A HA   4  
ATOM 6621  H HB1  . ALA A 1 57  ? 5.194   3.574   17.450  1.00 0.00 ? 154 ALA A HB1  4  
ATOM 6622  H HB2  . ALA A 1 57  ? 6.871   3.611   16.905  1.00 0.00 ? 154 ALA A HB2  4  
ATOM 6623  H HB3  . ALA A 1 57  ? 6.039   2.066   17.092  1.00 0.00 ? 154 ALA A HB3  4  
ATOM 6624  N N    . GLU A 1 58  ? 6.143   1.188   14.223  1.00 0.00 ? 155 GLU A N    4  
ATOM 6625  C CA   . GLU A 1 58  ? 6.974   0.338   13.393  1.00 0.00 ? 155 GLU A CA   4  
ATOM 6626  C C    . GLU A 1 58  ? 6.293   0.083   12.055  1.00 0.00 ? 155 GLU A C    4  
ATOM 6627  O O    . GLU A 1 58  ? 5.066   -0.000  11.977  1.00 0.00 ? 155 GLU A O    4  
ATOM 6628  C CB   . GLU A 1 58  ? 7.234   -0.982  14.115  1.00 0.00 ? 155 GLU A CB   4  
ATOM 6629  C CG   . GLU A 1 58  ? 7.908   -0.812  15.465  1.00 0.00 ? 155 GLU A CG   4  
ATOM 6630  C CD   . GLU A 1 58  ? 8.137   -2.129  16.167  1.00 0.00 ? 155 GLU A CD   4  
ATOM 6631  O OE1  . GLU A 1 58  ? 7.172   -2.679  16.738  1.00 0.00 ? 155 GLU A OE1  4  
ATOM 6632  O OE2  . GLU A 1 58  ? 9.282   -2.625  16.152  1.00 0.00 ? 155 GLU A OE2  4  
ATOM 6633  H H    . GLU A 1 58  ? 5.330   0.807   14.620  1.00 0.00 ? 155 GLU A H    4  
ATOM 6634  H HA   . GLU A 1 58  ? 7.913   0.845   13.225  1.00 0.00 ? 155 GLU A HA   4  
ATOM 6635  H HB2  . GLU A 1 58  ? 6.291   -1.482  14.272  1.00 0.00 ? 155 GLU A HB2  4  
ATOM 6636  H HB3  . GLU A 1 58  ? 7.866   -1.601  13.497  1.00 0.00 ? 155 GLU A HB3  4  
ATOM 6637  H HG2  . GLU A 1 58  ? 8.862   -0.330  15.319  1.00 0.00 ? 155 GLU A HG2  4  
ATOM 6638  H HG3  . GLU A 1 58  ? 7.283   -0.190  16.090  1.00 0.00 ? 155 GLU A HG3  4  
ATOM 6639  N N    . TRP A 1 59  ? 7.090   -0.038  11.009  1.00 0.00 ? 156 TRP A N    4  
ATOM 6640  C CA   . TRP A 1 59  ? 6.566   -0.221  9.665   1.00 0.00 ? 156 TRP A CA   4  
ATOM 6641  C C    . TRP A 1 59  ? 6.313   -1.690  9.358   1.00 0.00 ? 156 TRP A C    4  
ATOM 6642  O O    . TRP A 1 59  ? 6.926   -2.578  9.951   1.00 0.00 ? 156 TRP A O    4  
ATOM 6643  C CB   . TRP A 1 59  ? 7.535   0.358   8.639   1.00 0.00 ? 156 TRP A CB   4  
ATOM 6644  C CG   . TRP A 1 59  ? 7.527   1.853   8.574   1.00 0.00 ? 156 TRP A CG   4  
ATOM 6645  C CD1  . TRP A 1 59  ? 8.277   2.718   9.318   1.00 0.00 ? 156 TRP A CD1  4  
ATOM 6646  C CD2  . TRP A 1 59  ? 6.732   2.661   7.701   1.00 0.00 ? 156 TRP A CD2  4  
ATOM 6647  N NE1  . TRP A 1 59  ? 8.000   4.014   8.954   1.00 0.00 ? 156 TRP A NE1  4  
ATOM 6648  C CE2  . TRP A 1 59  ? 7.054   4.005   7.963   1.00 0.00 ? 156 TRP A CE2  4  
ATOM 6649  C CE3  . TRP A 1 59  ? 5.782   2.374   6.720   1.00 0.00 ? 156 TRP A CE3  4  
ATOM 6650  C CZ2  . TRP A 1 59  ? 6.458   5.059   7.276   1.00 0.00 ? 156 TRP A CZ2  4  
ATOM 6651  C CZ3  . TRP A 1 59  ? 5.192   3.419   6.040   1.00 0.00 ? 156 TRP A CZ3  4  
ATOM 6652  C CH2  . TRP A 1 59  ? 5.533   4.747   6.320   1.00 0.00 ? 156 TRP A CH2  4  
ATOM 6653  H H    . TRP A 1 59  ? 8.062   -0.013  11.142  1.00 0.00 ? 156 TRP A H    4  
ATOM 6654  H HA   . TRP A 1 59  ? 5.631   0.313   9.601   1.00 0.00 ? 156 TRP A HA   4  
ATOM 6655  H HB2  . TRP A 1 59  ? 8.537   0.041   8.885   1.00 0.00 ? 156 TRP A HB2  4  
ATOM 6656  H HB3  . TRP A 1 59  ? 7.276   -0.019  7.660   1.00 0.00 ? 156 TRP A HB3  4  
ATOM 6657  H HD1  . TRP A 1 59  ? 8.982   2.414   10.077  1.00 0.00 ? 156 TRP A HD1  4  
ATOM 6658  H HE1  . TRP A 1 59  ? 8.417   4.817   9.338   1.00 0.00 ? 156 TRP A HE1  4  
ATOM 6659  H HE3  . TRP A 1 59  ? 5.504   1.355   6.496   1.00 0.00 ? 156 TRP A HE3  4  
ATOM 6660  H HZ2  . TRP A 1 59  ? 6.708   6.090   7.479   1.00 0.00 ? 156 TRP A HZ2  4  
ATOM 6661  H HZ3  . TRP A 1 59  ? 4.455   3.217   5.278   1.00 0.00 ? 156 TRP A HZ3  4  
ATOM 6662  H HH2  . TRP A 1 59  ? 5.046   5.531   5.764   1.00 0.00 ? 156 TRP A HH2  4  
ATOM 6663  N N    . GLU A 1 60  ? 5.401   -1.930  8.426   1.00 0.00 ? 157 GLU A N    4  
ATOM 6664  C CA   . GLU A 1 60  ? 5.078   -3.275  7.984   1.00 0.00 ? 157 GLU A CA   4  
ATOM 6665  C C    . GLU A 1 60  ? 5.549   -3.472  6.545   1.00 0.00 ? 157 GLU A C    4  
ATOM 6666  O O    . GLU A 1 60  ? 5.226   -2.675  5.662   1.00 0.00 ? 157 GLU A O    4  
ATOM 6667  C CB   . GLU A 1 60  ? 3.569   -3.503  8.085   1.00 0.00 ? 157 GLU A CB   4  
ATOM 6668  C CG   . GLU A 1 60  ? 3.134   -4.910  7.719   1.00 0.00 ? 157 GLU A CG   4  
ATOM 6669  C CD   . GLU A 1 60  ? 3.735   -5.958  8.628   1.00 0.00 ? 157 GLU A CD   4  
ATOM 6670  O OE1  . GLU A 1 60  ? 3.136   -6.240  9.685   1.00 0.00 ? 157 GLU A OE1  4  
ATOM 6671  O OE2  . GLU A 1 60  ? 4.804   -6.504  8.285   1.00 0.00 ? 157 GLU A OE2  4  
ATOM 6672  H H    . GLU A 1 60  ? 4.925   -1.174  8.019   1.00 0.00 ? 157 GLU A H    4  
ATOM 6673  H HA   . GLU A 1 60  ? 5.592   -3.976  8.626   1.00 0.00 ? 157 GLU A HA   4  
ATOM 6674  H HB2  . GLU A 1 60  ? 3.255   -3.306  9.098   1.00 0.00 ? 157 GLU A HB2  4  
ATOM 6675  H HB3  . GLU A 1 60  ? 3.069   -2.811  7.423   1.00 0.00 ? 157 GLU A HB3  4  
ATOM 6676  H HG2  . GLU A 1 60  ? 2.058   -4.970  7.788   1.00 0.00 ? 157 GLU A HG2  4  
ATOM 6677  H HG3  . GLU A 1 60  ? 3.440   -5.116  6.703   1.00 0.00 ? 157 GLU A HG3  4  
ATOM 6678  N N    . ILE A 1 61  ? 6.316   -4.527  6.312   1.00 0.00 ? 158 ILE A N    4  
ATOM 6679  C CA   . ILE A 1 61  ? 6.885   -4.782  4.994   1.00 0.00 ? 158 ILE A CA   4  
ATOM 6680  C C    . ILE A 1 61  ? 6.230   -5.994  4.334   1.00 0.00 ? 158 ILE A C    4  
ATOM 6681  O O    . ILE A 1 61  ? 6.152   -7.074  4.920   1.00 0.00 ? 158 ILE A O    4  
ATOM 6682  C CB   . ILE A 1 61  ? 8.424   -4.990  5.061   1.00 0.00 ? 158 ILE A CB   4  
ATOM 6683  C CG1  . ILE A 1 61  ? 9.163   -3.645  5.141   1.00 0.00 ? 158 ILE A CG1  4  
ATOM 6684  C CG2  . ILE A 1 61  ? 8.926   -5.790  3.866   1.00 0.00 ? 158 ILE A CG2  4  
ATOM 6685  C CD1  . ILE A 1 61  ? 8.996   -2.918  6.458   1.00 0.00 ? 158 ILE A CD1  4  
ATOM 6686  H H    . ILE A 1 61  ? 6.498   -5.158  7.042   1.00 0.00 ? 158 ILE A H    4  
ATOM 6687  H HA   . ILE A 1 61  ? 6.692   -3.912  4.382   1.00 0.00 ? 158 ILE A HA   4  
ATOM 6688  H HB   . ILE A 1 61  ? 8.642   -5.558  5.951   1.00 0.00 ? 158 ILE A HB   4  
ATOM 6689  H HG12 . ILE A 1 61  ? 10.218  -3.815  4.993   1.00 0.00 ? 158 ILE A HG12 4  
ATOM 6690  H HG13 . ILE A 1 61  ? 8.798   -2.996  4.356   1.00 0.00 ? 158 ILE A HG13 4  
ATOM 6691  H HG21 . ILE A 1 61  ? 8.715   -5.249  2.955   1.00 0.00 ? 158 ILE A HG21 4  
ATOM 6692  H HG22 . ILE A 1 61  ? 8.426   -6.748  3.839   1.00 0.00 ? 158 ILE A HG22 4  
ATOM 6693  H HG23 . ILE A 1 61  ? 9.991   -5.944  3.956   1.00 0.00 ? 158 ILE A HG23 4  
ATOM 6694  H HD11 . ILE A 1 61  ? 7.949   -2.718  6.628   1.00 0.00 ? 158 ILE A HD11 4  
ATOM 6695  H HD12 . ILE A 1 61  ? 9.538   -1.983  6.423   1.00 0.00 ? 158 ILE A HD12 4  
ATOM 6696  H HD13 . ILE A 1 61  ? 9.382   -3.529  7.259   1.00 0.00 ? 158 ILE A HD13 4  
ATOM 6697  N N    . HIS A 1 62  ? 5.746   -5.796  3.114   1.00 0.00 ? 159 HIS A N    4  
ATOM 6698  C CA   . HIS A 1 62  ? 5.195   -6.879  2.308   1.00 0.00 ? 159 HIS A CA   4  
ATOM 6699  C C    . HIS A 1 62  ? 5.911   -6.915  0.964   1.00 0.00 ? 159 HIS A C    4  
ATOM 6700  O O    . HIS A 1 62  ? 6.162   -5.871  0.369   1.00 0.00 ? 159 HIS A O    4  
ATOM 6701  C CB   . HIS A 1 62  ? 3.691   -6.692  2.076   1.00 0.00 ? 159 HIS A CB   4  
ATOM 6702  C CG   . HIS A 1 62  ? 2.840   -6.783  3.310   1.00 0.00 ? 159 HIS A CG   4  
ATOM 6703  N ND1  . HIS A 1 62  ? 2.033   -7.865  3.590   1.00 0.00 ? 159 HIS A ND1  4  
ATOM 6704  C CD2  . HIS A 1 62  ? 2.631   -5.896  4.312   1.00 0.00 ? 159 HIS A CD2  4  
ATOM 6705  C CE1  . HIS A 1 62  ? 1.363   -7.638  4.704   1.00 0.00 ? 159 HIS A CE1  4  
ATOM 6706  N NE2  . HIS A 1 62  ? 1.708   -6.452  5.161   1.00 0.00 ? 159 HIS A NE2  4  
ATOM 6707  H H    . HIS A 1 62  ? 5.773   -4.886  2.734   1.00 0.00 ? 159 HIS A H    4  
ATOM 6708  H HA   . HIS A 1 62  ? 5.367   -7.810  2.830   1.00 0.00 ? 159 HIS A HA   4  
ATOM 6709  H HB2  . HIS A 1 62  ? 3.524   -5.720  1.639   1.00 0.00 ? 159 HIS A HB2  4  
ATOM 6710  H HB3  . HIS A 1 62  ? 3.348   -7.449  1.384   1.00 0.00 ? 159 HIS A HB3  4  
ATOM 6711  H HD1  . HIS A 1 62  ? 1.971   -8.691  3.058   1.00 0.00 ? 159 HIS A HD1  4  
ATOM 6712  H HD2  . HIS A 1 62  ? 3.105   -4.931  4.422   1.00 0.00 ? 159 HIS A HD2  4  
ATOM 6713  H HE1  . HIS A 1 62  ? 0.640   -8.301  5.154   1.00 0.00 ? 159 HIS A HE1  4  
ATOM 6714  H HE2  . HIS A 1 62  ? 1.409   -6.069  6.018   1.00 0.00 ? 159 HIS A HE2  4  
ATOM 6715  N N    . PHE A 1 63  ? 6.239   -8.103  0.484   1.00 0.00 ? 160 PHE A N    4  
ATOM 6716  C CA   . PHE A 1 63  ? 6.952   -8.232  -0.779  1.00 0.00 ? 160 PHE A CA   4  
ATOM 6717  C C    . PHE A 1 63  ? 5.964   -8.504  -1.912  1.00 0.00 ? 160 PHE A C    4  
ATOM 6718  O O    . PHE A 1 63  ? 5.018   -9.280  -1.753  1.00 0.00 ? 160 PHE A O    4  
ATOM 6719  C CB   . PHE A 1 63  ? 7.985   -9.358  -0.687  1.00 0.00 ? 160 PHE A CB   4  
ATOM 6720  C CG   . PHE A 1 63  ? 9.114   -9.204  -1.663  1.00 0.00 ? 160 PHE A CG   4  
ATOM 6721  C CD1  . PHE A 1 63  ? 10.066  -8.217  -1.473  1.00 0.00 ? 160 PHE A CD1  4  
ATOM 6722  C CD2  . PHE A 1 63  ? 9.223   -10.032 -2.767  1.00 0.00 ? 160 PHE A CD2  4  
ATOM 6723  C CE1  . PHE A 1 63  ? 11.106  -8.058  -2.363  1.00 0.00 ? 160 PHE A CE1  4  
ATOM 6724  C CE2  . PHE A 1 63  ? 10.262  -9.878  -3.663  1.00 0.00 ? 160 PHE A CE2  4  
ATOM 6725  C CZ   . PHE A 1 63  ? 11.206  -8.889  -3.460  1.00 0.00 ? 160 PHE A CZ   4  
ATOM 6726  H H    . PHE A 1 63  ? 5.995   -8.909  0.986   1.00 0.00 ? 160 PHE A H    4  
ATOM 6727  H HA   . PHE A 1 63  ? 7.463   -7.300  -0.974  1.00 0.00 ? 160 PHE A HA   4  
ATOM 6728  H HB2  . PHE A 1 63  ? 8.404   -9.373  0.308   1.00 0.00 ? 160 PHE A HB2  4  
ATOM 6729  H HB3  . PHE A 1 63  ? 7.499   -10.302 -0.884  1.00 0.00 ? 160 PHE A HB3  4  
ATOM 6730  H HD1  . PHE A 1 63  ? 9.990   -7.567  -0.614  1.00 0.00 ? 160 PHE A HD1  4  
ATOM 6731  H HD2  . PHE A 1 63  ? 8.486   -10.804 -2.927  1.00 0.00 ? 160 PHE A HD2  4  
ATOM 6732  H HE1  . PHE A 1 63  ? 11.839  -7.283  -2.201  1.00 0.00 ? 160 PHE A HE1  4  
ATOM 6733  H HE2  . PHE A 1 63  ? 10.338  -10.529 -4.520  1.00 0.00 ? 160 PHE A HE2  4  
ATOM 6734  H HZ   . PHE A 1 63  ? 12.019  -8.767  -4.159  1.00 0.00 ? 160 PHE A HZ   4  
ATOM 6735  N N    . ALA A 1 64  ? 6.182   -7.852  -3.053  1.00 0.00 ? 161 ALA A N    4  
ATOM 6736  C CA   . ALA A 1 64  ? 5.278   -7.973  -4.195  1.00 0.00 ? 161 ALA A CA   4  
ATOM 6737  C C    . ALA A 1 64  ? 5.492   -9.283  -4.940  1.00 0.00 ? 161 ALA A C    4  
ATOM 6738  O O    . ALA A 1 64  ? 4.609   -9.752  -5.654  1.00 0.00 ? 161 ALA A O    4  
ATOM 6739  C CB   . ALA A 1 64  ? 5.456   -6.800  -5.145  1.00 0.00 ? 161 ALA A CB   4  
ATOM 6740  H H    . ALA A 1 64  ? 6.971   -7.269  -3.130  1.00 0.00 ? 161 ALA A H    4  
ATOM 6741  H HA   . ALA A 1 64  ? 4.264   -7.949  -3.819  1.00 0.00 ? 161 ALA A HA   4  
ATOM 6742  H HB1  . ALA A 1 64  ? 6.447   -6.832  -5.573  1.00 0.00 ? 161 ALA A HB1  4  
ATOM 6743  H HB2  . ALA A 1 64  ? 5.329   -5.875  -4.602  1.00 0.00 ? 161 ALA A HB2  4  
ATOM 6744  H HB3  . ALA A 1 64  ? 4.720   -6.859  -5.933  1.00 0.00 ? 161 ALA A HB3  4  
ATOM 6745  N N    . GLY A 1 65  ? 6.679   -9.855  -4.794  1.00 0.00 ? 162 GLY A N    4  
ATOM 6746  C CA   . GLY A 1 65  ? 6.969   -11.137 -5.409  1.00 0.00 ? 162 GLY A CA   4  
ATOM 6747  C C    . GLY A 1 65  ? 7.402   -11.015 -6.855  1.00 0.00 ? 162 GLY A C    4  
ATOM 6748  O O    . GLY A 1 65  ? 8.379   -11.641 -7.260  1.00 0.00 ? 162 GLY A O    4  
ATOM 6749  H H    . GLY A 1 65  ? 7.368   -9.402  -4.266  1.00 0.00 ? 162 GLY A H    4  
ATOM 6750  H HA2  . GLY A 1 65  ? 7.761   -11.618 -4.853  1.00 0.00 ? 162 GLY A HA2  4  
ATOM 6751  H HA3  . GLY A 1 65  ? 6.085   -11.753 -5.361  1.00 0.00 ? 162 GLY A HA3  4  
ATOM 6752  N N    . GLN A 1 66  ? 6.674   -10.211 -7.623  1.00 0.00 ? 163 GLN A N    4  
ATOM 6753  C CA   . GLN A 1 66  ? 6.972   -9.993  -9.039  1.00 0.00 ? 163 GLN A CA   4  
ATOM 6754  C C    . GLN A 1 66  ? 5.967   -9.014  -9.636  1.00 0.00 ? 163 GLN A C    4  
ATOM 6755  O O    . GLN A 1 66  ? 6.297   -8.223  -10.521 1.00 0.00 ? 163 GLN A O    4  
ATOM 6756  C CB   . GLN A 1 66  ? 6.923   -11.314 -9.816  1.00 0.00 ? 163 GLN A CB   4  
ATOM 6757  C CG   . GLN A 1 66  ? 7.310   -11.176 -11.280 1.00 0.00 ? 163 GLN A CG   4  
ATOM 6758  C CD   . GLN A 1 66  ? 7.226   -12.488 -12.036 1.00 0.00 ? 163 GLN A CD   4  
ATOM 6759  O OE1  . GLN A 1 66  ? 6.406   -13.353 -11.723 1.00 0.00 ? 163 GLN A OE1  4  
ATOM 6760  N NE2  . GLN A 1 66  ? 8.083   -12.651 -13.029 1.00 0.00 ? 163 GLN A NE2  4  
ATOM 6761  H H    . GLN A 1 66  ? 5.907   -9.749  -7.223  1.00 0.00 ? 163 GLN A H    4  
ATOM 6762  H HA   . GLN A 1 66  ? 7.962   -9.571  -9.113  1.00 0.00 ? 163 GLN A HA   4  
ATOM 6763  H HB2  . GLN A 1 66  ? 7.600   -12.015 -9.353  1.00 0.00 ? 163 GLN A HB2  4  
ATOM 6764  H HB3  . GLN A 1 66  ? 5.920   -11.710 -9.768  1.00 0.00 ? 163 GLN A HB3  4  
ATOM 6765  H HG2  . GLN A 1 66  ? 6.646   -10.466 -11.750 1.00 0.00 ? 163 GLN A HG2  4  
ATOM 6766  H HG3  . GLN A 1 66  ? 8.324   -10.809 -11.338 1.00 0.00 ? 163 GLN A HG3  4  
ATOM 6767  H HE21 . GLN A 1 66  ? 8.719   -11.923 -13.218 1.00 0.00 ? 163 GLN A HE21 4  
ATOM 6768  H HE22 . GLN A 1 66  ? 8.048   -13.486 -13.542 1.00 0.00 ? 163 GLN A HE22 4  
ATOM 6769  N N    . GLN A 1 67  ? 4.743   -9.078  -9.131  1.00 0.00 ? 164 GLN A N    4  
ATOM 6770  C CA   . GLN A 1 67  ? 3.650   -8.250  -9.626  1.00 0.00 ? 164 GLN A CA   4  
ATOM 6771  C C    . GLN A 1 67  ? 3.820   -6.798  -9.206  1.00 0.00 ? 164 GLN A C    4  
ATOM 6772  O O    . GLN A 1 67  ? 4.547   -6.492  -8.261  1.00 0.00 ? 164 GLN A O    4  
ATOM 6773  C CB   . GLN A 1 67  ? 2.305   -8.792  -9.135  1.00 0.00 ? 164 GLN A CB   4  
ATOM 6774  C CG   . GLN A 1 67  ? 2.218   -8.958  -7.627  1.00 0.00 ? 164 GLN A CG   4  
ATOM 6775  C CD   . GLN A 1 67  ? 0.899   -9.562  -7.188  1.00 0.00 ? 164 GLN A CD   4  
ATOM 6776  O OE1  . GLN A 1 67  ? -0.136  -9.356  -7.824  1.00 0.00 ? 164 GLN A OE1  4  
ATOM 6777  N NE2  . GLN A 1 67  ? 0.929   -10.323 -6.107  1.00 0.00 ? 164 GLN A NE2  4  
ATOM 6778  H H    . GLN A 1 67  ? 4.572   -9.698  -8.401  1.00 0.00 ? 164 GLN A H    4  
ATOM 6779  H HA   . GLN A 1 67  ? 3.667   -8.295  -10.703 1.00 0.00 ? 164 GLN A HA   4  
ATOM 6780  H HB2  . GLN A 1 67  ? 1.525   -8.112  -9.442  1.00 0.00 ? 164 GLN A HB2  4  
ATOM 6781  H HB3  . GLN A 1 67  ? 2.131   -9.754  -9.593  1.00 0.00 ? 164 GLN A HB3  4  
ATOM 6782  H HG2  . GLN A 1 67  ? 3.019   -9.606  -7.302  1.00 0.00 ? 164 GLN A HG2  4  
ATOM 6783  H HG3  . GLN A 1 67  ? 2.327   -7.990  -7.164  1.00 0.00 ? 164 GLN A HG3  4  
ATOM 6784  H HE21 . GLN A 1 67  ? 1.792   -10.455 -5.656  1.00 0.00 ? 164 GLN A HE21 4  
ATOM 6785  H HE22 . GLN A 1 67  ? 0.091   -10.732 -5.805  1.00 0.00 ? 164 GLN A HE22 4  
ATOM 6786  N N    . THR A 1 68  ? 3.144   -5.909  -9.915  1.00 0.00 ? 165 THR A N    4  
ATOM 6787  C CA   . THR A 1 68  ? 3.299   -4.486  -9.697  1.00 0.00 ? 165 THR A CA   4  
ATOM 6788  C C    . THR A 1 68  ? 2.051   -3.881  -9.065  1.00 0.00 ? 165 THR A C    4  
ATOM 6789  O O    . THR A 1 68  ? 1.723   -2.712  -9.286  1.00 0.00 ? 165 THR A O    4  
ATOM 6790  C CB   . THR A 1 68  ? 3.623   -3.778  -11.021 1.00 0.00 ? 165 THR A CB   4  
ATOM 6791  O OG1  . THR A 1 68  ? 2.569   -3.994  -11.971 1.00 0.00 ? 165 THR A OG1  4  
ATOM 6792  C CG2  . THR A 1 68  ? 4.930   -4.309  -11.586 1.00 0.00 ? 165 THR A CG2  4  
ATOM 6793  H H    . THR A 1 68  ? 2.526   -6.219  -10.611 1.00 0.00 ? 165 THR A H    4  
ATOM 6794  H HA   . THR A 1 68  ? 4.133   -4.343  -9.026  1.00 0.00 ? 165 THR A HA   4  
ATOM 6795  H HB   . THR A 1 68  ? 3.729   -2.720  -10.833 1.00 0.00 ? 165 THR A HB   4  
ATOM 6796  H HG1  . THR A 1 68  ? 1.727   -3.707  -11.589 1.00 0.00 ? 165 THR A HG1  4  
ATOM 6797  H HG21 . THR A 1 68  ? 5.752   -3.951  -10.986 1.00 0.00 ? 165 THR A HG21 4  
ATOM 6798  H HG22 . THR A 1 68  ? 5.050   -3.966  -12.602 1.00 0.00 ? 165 THR A HG22 4  
ATOM 6799  H HG23 . THR A 1 68  ? 4.916   -5.391  -11.568 1.00 0.00 ? 165 THR A HG23 4  
ATOM 6800  N N    . GLU A 1 69  ? 1.359   -4.689  -8.279  1.00 0.00 ? 166 GLU A N    4  
ATOM 6801  C CA   . GLU A 1 69  ? 0.209   -4.223  -7.526  1.00 0.00 ? 166 GLU A CA   4  
ATOM 6802  C C    . GLU A 1 69  ? 0.029   -5.080  -6.281  1.00 0.00 ? 166 GLU A C    4  
ATOM 6803  O O    . GLU A 1 69  ? 0.233   -6.294  -6.321  1.00 0.00 ? 166 GLU A O    4  
ATOM 6804  C CB   . GLU A 1 69  ? -1.057  -4.257  -8.384  1.00 0.00 ? 166 GLU A CB   4  
ATOM 6805  C CG   . GLU A 1 69  ? -1.442  -5.646  -8.864  1.00 0.00 ? 166 GLU A CG   4  
ATOM 6806  C CD   . GLU A 1 69  ? -2.683  -5.635  -9.727  1.00 0.00 ? 166 GLU A CD   4  
ATOM 6807  O OE1  . GLU A 1 69  ? -3.792  -5.480  -9.175  1.00 0.00 ? 166 GLU A OE1  4  
ATOM 6808  O OE2  . GLU A 1 69  ? -2.554  -5.775  -10.960 1.00 0.00 ? 166 GLU A OE2  4  
ATOM 6809  H H    . GLU A 1 69  ? 1.632   -5.629  -8.202  1.00 0.00 ? 166 GLU A H    4  
ATOM 6810  H HA   . GLU A 1 69  ? 0.403   -3.204  -7.221  1.00 0.00 ? 166 GLU A HA   4  
ATOM 6811  H HB2  . GLU A 1 69  ? -1.877  -3.861  -7.807  1.00 0.00 ? 166 GLU A HB2  4  
ATOM 6812  H HB3  . GLU A 1 69  ? -0.905  -3.630  -9.251  1.00 0.00 ? 166 GLU A HB3  4  
ATOM 6813  H HG2  . GLU A 1 69  ? -0.624  -6.053  -9.440  1.00 0.00 ? 166 GLU A HG2  4  
ATOM 6814  H HG3  . GLU A 1 69  ? -1.623  -6.274  -8.003  1.00 0.00 ? 166 GLU A HG3  4  
ATOM 6815  N N    . PHE A 1 70  ? -0.329  -4.452  -5.174  1.00 0.00 ? 167 PHE A N    4  
ATOM 6816  C CA   . PHE A 1 70  ? -0.525  -5.178  -3.934  1.00 0.00 ? 167 PHE A CA   4  
ATOM 6817  C C    . PHE A 1 70  ? -1.798  -4.713  -3.233  1.00 0.00 ? 167 PHE A C    4  
ATOM 6818  O O    . PHE A 1 70  ? -2.243  -3.582  -3.428  1.00 0.00 ? 167 PHE A O    4  
ATOM 6819  C CB   . PHE A 1 70  ? 0.689   -4.999  -3.020  1.00 0.00 ? 167 PHE A CB   4  
ATOM 6820  C CG   . PHE A 1 70  ? 0.718   -5.976  -1.885  1.00 0.00 ? 167 PHE A CG   4  
ATOM 6821  C CD1  . PHE A 1 70  ? 0.784   -7.336  -2.136  1.00 0.00 ? 167 PHE A CD1  4  
ATOM 6822  C CD2  . PHE A 1 70  ? 0.663   -5.542  -0.574  1.00 0.00 ? 167 PHE A CD2  4  
ATOM 6823  C CE1  . PHE A 1 70  ? 0.798   -8.245  -1.098  1.00 0.00 ? 167 PHE A CE1  4  
ATOM 6824  C CE2  . PHE A 1 70  ? 0.674   -6.447  0.468   1.00 0.00 ? 167 PHE A CE2  4  
ATOM 6825  C CZ   . PHE A 1 70  ? 0.742   -7.799  0.206   1.00 0.00 ? 167 PHE A CZ   4  
ATOM 6826  H H    . PHE A 1 70  ? -0.457  -3.475  -5.191  1.00 0.00 ? 167 PHE A H    4  
ATOM 6827  H HA   . PHE A 1 70  ? -0.626  -6.223  -4.176  1.00 0.00 ? 167 PHE A HA   4  
ATOM 6828  H HB2  . PHE A 1 70  ? 1.590   -5.132  -3.600  1.00 0.00 ? 167 PHE A HB2  4  
ATOM 6829  H HB3  . PHE A 1 70  ? 0.676   -4.003  -2.605  1.00 0.00 ? 167 PHE A HB3  4  
ATOM 6830  H HD1  . PHE A 1 70  ? 0.829   -7.685  -3.156  1.00 0.00 ? 167 PHE A HD1  4  
ATOM 6831  H HD2  . PHE A 1 70  ? 0.610   -4.483  -0.366  1.00 0.00 ? 167 PHE A HD2  4  
ATOM 6832  H HE1  . PHE A 1 70  ? 0.850   -9.302  -1.306  1.00 0.00 ? 167 PHE A HE1  4  
ATOM 6833  H HE2  . PHE A 1 70  ? 0.632   -6.096  1.488   1.00 0.00 ? 167 PHE A HE2  4  
ATOM 6834  H HZ   . PHE A 1 70  ? 0.750   -8.507  1.021   1.00 0.00 ? 167 PHE A HZ   4  
ATOM 6835  N N    . LYS A 1 71  ? -2.390  -5.596  -2.438  1.00 0.00 ? 168 LYS A N    4  
ATOM 6836  C CA   . LYS A 1 71  ? -3.608  -5.270  -1.702  1.00 0.00 ? 168 LYS A CA   4  
ATOM 6837  C C    . LYS A 1 71  ? -3.348  -5.387  -0.201  1.00 0.00 ? 168 LYS A C    4  
ATOM 6838  O O    . LYS A 1 71  ? -2.643  -6.294  0.240   1.00 0.00 ? 168 LYS A O    4  
ATOM 6839  C CB   . LYS A 1 71  ? -4.755  -6.222  -2.075  1.00 0.00 ? 168 LYS A CB   4  
ATOM 6840  C CG   . LYS A 1 71  ? -4.679  -6.823  -3.475  1.00 0.00 ? 168 LYS A CG   4  
ATOM 6841  C CD   . LYS A 1 71  ? -4.952  -5.823  -4.585  1.00 0.00 ? 168 LYS A CD   4  
ATOM 6842  C CE   . LYS A 1 71  ? -4.757  -6.476  -5.948  1.00 0.00 ? 168 LYS A CE   4  
ATOM 6843  N NZ   . LYS A 1 71  ? -5.378  -5.698  -7.051  1.00 0.00 ? 168 LYS A NZ   4  
ATOM 6844  H H    . LYS A 1 71  ? -1.995  -6.487  -2.333  1.00 0.00 ? 168 LYS A H    4  
ATOM 6845  H HA   . LYS A 1 71  ? -3.888  -4.256  -1.940  1.00 0.00 ? 168 LYS A HA   4  
ATOM 6846  H HB2  . LYS A 1 71  ? -4.767  -7.036  -1.366  1.00 0.00 ? 168 LYS A HB2  4  
ATOM 6847  H HB3  . LYS A 1 71  ? -5.686  -5.681  -1.992  1.00 0.00 ? 168 LYS A HB3  4  
ATOM 6848  H HG2  . LYS A 1 71  ? -3.695  -7.232  -3.621  1.00 0.00 ? 168 LYS A HG2  4  
ATOM 6849  H HG3  . LYS A 1 71  ? -5.411  -7.611  -3.540  1.00 0.00 ? 168 LYS A HG3  4  
ATOM 6850  H HD2  . LYS A 1 71  ? -5.968  -5.473  -4.500  1.00 0.00 ? 168 LYS A HD2  4  
ATOM 6851  H HD3  . LYS A 1 71  ? -4.268  -4.993  -4.489  1.00 0.00 ? 168 LYS A HD3  4  
ATOM 6852  H HE2  . LYS A 1 71  ? -3.700  -6.563  -6.140  1.00 0.00 ? 168 LYS A HE2  4  
ATOM 6853  H HE3  . LYS A 1 71  ? -5.197  -7.463  -5.924  1.00 0.00 ? 168 LYS A HE3  4  
ATOM 6854  H HZ1  . LYS A 1 71  ? -5.221  -4.682  -6.908  1.00 0.00 ? 168 LYS A HZ1  4  
ATOM 6855  H HZ2  . LYS A 1 71  ? -6.404  -5.875  -7.086  1.00 0.00 ? 168 LYS A HZ2  4  
ATOM 6856  H HZ3  . LYS A 1 71  ? -4.957  -5.972  -7.967  1.00 0.00 ? 168 LYS A HZ3  4  
ATOM 6857  N N    . ILE A 1 72  ? -3.910  -4.476  0.582   1.00 0.00 ? 169 ILE A N    4  
ATOM 6858  C CA   . ILE A 1 72  ? -3.790  -4.550  2.036   1.00 0.00 ? 169 ILE A CA   4  
ATOM 6859  C C    . ILE A 1 72  ? -5.153  -4.788  2.674   1.00 0.00 ? 169 ILE A C    4  
ATOM 6860  O O    . ILE A 1 72  ? -6.092  -4.025  2.452   1.00 0.00 ? 169 ILE A O    4  
ATOM 6861  C CB   . ILE A 1 72  ? -3.173  -3.268  2.645   1.00 0.00 ? 169 ILE A CB   4  
ATOM 6862  C CG1  . ILE A 1 72  ? -1.817  -2.955  2.010   1.00 0.00 ? 169 ILE A CG1  4  
ATOM 6863  C CG2  . ILE A 1 72  ? -3.018  -3.417  4.154   1.00 0.00 ? 169 ILE A CG2  4  
ATOM 6864  C CD1  . ILE A 1 72  ? -0.740  -3.971  2.328   1.00 0.00 ? 169 ILE A CD1  4  
ATOM 6865  H H    . ILE A 1 72  ? -4.414  -3.736  0.176   1.00 0.00 ? 169 ILE A H    4  
ATOM 6866  H HA   . ILE A 1 72  ? -3.147  -5.384  2.274   1.00 0.00 ? 169 ILE A HA   4  
ATOM 6867  H HB   . ILE A 1 72  ? -3.849  -2.448  2.457   1.00 0.00 ? 169 ILE A HB   4  
ATOM 6868  H HG12 . ILE A 1 72  ? -1.930  -2.923  0.937   1.00 0.00 ? 169 ILE A HG12 4  
ATOM 6869  H HG13 . ILE A 1 72  ? -1.479  -1.991  2.360   1.00 0.00 ? 169 ILE A HG13 4  
ATOM 6870  H HG21 . ILE A 1 72  ? -3.983  -3.614  4.597   1.00 0.00 ? 169 ILE A HG21 4  
ATOM 6871  H HG22 . ILE A 1 72  ? -2.612  -2.506  4.567   1.00 0.00 ? 169 ILE A HG22 4  
ATOM 6872  H HG23 . ILE A 1 72  ? -2.348  -4.240  4.368   1.00 0.00 ? 169 ILE A HG23 4  
ATOM 6873  H HD11 . ILE A 1 72  ? -0.592  -4.016  3.397   1.00 0.00 ? 169 ILE A HD11 4  
ATOM 6874  H HD12 . ILE A 1 72  ? 0.183   -3.678  1.849   1.00 0.00 ? 169 ILE A HD12 4  
ATOM 6875  H HD13 . ILE A 1 72  ? -1.043  -4.941  1.965   1.00 0.00 ? 169 ILE A HD13 4  
ATOM 6876  N N    . LEU A 1 73  ? -5.254  -5.856  3.459   1.00 0.00 ? 170 LEU A N    4  
ATOM 6877  C CA   . LEU A 1 73  ? -6.487  -6.177  4.174   1.00 0.00 ? 170 LEU A CA   4  
ATOM 6878  C C    . LEU A 1 73  ? -6.434  -5.637  5.599   1.00 0.00 ? 170 LEU A C    4  
ATOM 6879  O O    . LEU A 1 73  ? -7.461  -5.518  6.270   1.00 0.00 ? 170 LEU A O    4  
ATOM 6880  C CB   . LEU A 1 73  ? -6.724  -7.697  4.208   1.00 0.00 ? 170 LEU A CB   4  
ATOM 6881  C CG   . LEU A 1 73  ? -7.183  -8.348  2.893   1.00 0.00 ? 170 LEU A CG   4  
ATOM 6882  C CD1  . LEU A 1 73  ? -8.442  -7.675  2.375   1.00 0.00 ? 170 LEU A CD1  4  
ATOM 6883  C CD2  . LEU A 1 73  ? -6.082  -8.314  1.840   1.00 0.00 ? 170 LEU A CD2  4  
ATOM 6884  H H    . LEU A 1 73  ? -4.482  -6.452  3.551   1.00 0.00 ? 170 LEU A H    4  
ATOM 6885  H HA   . LEU A 1 73  ? -7.305  -5.704  3.654   1.00 0.00 ? 170 LEU A HA   4  
ATOM 6886  H HB2  . LEU A 1 73  ? -5.802  -8.171  4.511   1.00 0.00 ? 170 LEU A HB2  4  
ATOM 6887  H HB3  . LEU A 1 73  ? -7.472  -7.900  4.961   1.00 0.00 ? 170 LEU A HB3  4  
ATOM 6888  H HG   . LEU A 1 73  ? -7.424  -9.383  3.086   1.00 0.00 ? 170 LEU A HG   4  
ATOM 6889  H HD11 . LEU A 1 73  ? -9.241  -7.811  3.088   1.00 0.00 ? 170 LEU A HD11 4  
ATOM 6890  H HD12 . LEU A 1 73  ? -8.723  -8.114  1.430   1.00 0.00 ? 170 LEU A HD12 4  
ATOM 6891  H HD13 . LEU A 1 73  ? -8.256  -6.622  2.242   1.00 0.00 ? 170 LEU A HD13 4  
ATOM 6892  H HD21 . LEU A 1 73  ? -5.226  -8.869  2.198   1.00 0.00 ? 170 LEU A HD21 4  
ATOM 6893  H HD22 . LEU A 1 73  ? -5.793  -7.291  1.653   1.00 0.00 ? 170 LEU A HD22 4  
ATOM 6894  H HD23 . LEU A 1 73  ? -6.444  -8.760  0.926   1.00 0.00 ? 170 LEU A HD23 4  
ATOM 6895  N N    . SER A 1 74  ? -5.231  -5.310  6.046   1.00 0.00 ? 171 SER A N    4  
ATOM 6896  C CA   . SER A 1 74  ? -5.008  -4.821  7.399   1.00 0.00 ? 171 SER A CA   4  
ATOM 6897  C C    . SER A 1 74  ? -5.343  -3.333  7.498   1.00 0.00 ? 171 SER A C    4  
ATOM 6898  O O    . SER A 1 74  ? -4.447  -2.498  7.623   1.00 0.00 ? 171 SER A O    4  
ATOM 6899  C CB   . SER A 1 74  ? -3.544  -5.050  7.777   1.00 0.00 ? 171 SER A CB   4  
ATOM 6900  O OG   . SER A 1 74  ? -3.106  -6.339  7.370   1.00 0.00 ? 171 SER A OG   4  
ATOM 6901  H H    . SER A 1 74  ? -4.464  -5.400  5.448   1.00 0.00 ? 171 SER A H    4  
ATOM 6902  H HA   . SER A 1 74  ? -5.644  -5.377  8.072   1.00 0.00 ? 171 SER A HA   4  
ATOM 6903  H HB2  . SER A 1 74  ? -2.930  -4.306  7.293   1.00 0.00 ? 171 SER A HB2  4  
ATOM 6904  H HB3  . SER A 1 74  ? -3.434  -4.967  8.847   1.00 0.00 ? 171 SER A HB3  4  
ATOM 6905  H HG   . SER A 1 74  ? -3.808  -6.981  7.535   1.00 0.00 ? 171 SER A HG   4  
ATOM 6906  N N    . LEU A 1 75  ? -6.627  -3.001  7.433   1.00 0.00 ? 172 LEU A N    4  
ATOM 6907  C CA   . LEU A 1 75  ? -7.051  -1.606  7.426   1.00 0.00 ? 172 LEU A CA   4  
ATOM 6908  C C    . LEU A 1 75  ? -8.135  -1.351  8.465   1.00 0.00 ? 172 LEU A C    4  
ATOM 6909  O O    . LEU A 1 75  ? -9.062  -2.146  8.622   1.00 0.00 ? 172 LEU A O    4  
ATOM 6910  C CB   . LEU A 1 75  ? -7.575  -1.217  6.046   1.00 0.00 ? 172 LEU A CB   4  
ATOM 6911  C CG   . LEU A 1 75  ? -6.625  -1.491  4.882   1.00 0.00 ? 172 LEU A CG   4  
ATOM 6912  C CD1  . LEU A 1 75  ? -7.305  -1.170  3.567   1.00 0.00 ? 172 LEU A CD1  4  
ATOM 6913  C CD2  . LEU A 1 75  ? -5.344  -0.686  5.026   1.00 0.00 ? 172 LEU A CD2  4  
ATOM 6914  H H    . LEU A 1 75  ? -7.306  -3.711  7.389   1.00 0.00 ? 172 LEU A H    4  
ATOM 6915  H HA   . LEU A 1 75  ? -6.192  -0.996  7.661   1.00 0.00 ? 172 LEU A HA   4  
ATOM 6916  H HB2  . LEU A 1 75  ? -8.495  -1.757  5.868   1.00 0.00 ? 172 LEU A HB2  4  
ATOM 6917  H HB3  . LEU A 1 75  ? -7.798  -0.160  6.056   1.00 0.00 ? 172 LEU A HB3  4  
ATOM 6918  H HG   . LEU A 1 75  ? -6.365  -2.541  4.876   1.00 0.00 ? 172 LEU A HG   4  
ATOM 6919  H HD11 . LEU A 1 75  ? -7.618  -0.137  3.566   1.00 0.00 ? 172 LEU A HD11 4  
ATOM 6920  H HD12 . LEU A 1 75  ? -8.168  -1.807  3.443   1.00 0.00 ? 172 LEU A HD12 4  
ATOM 6921  H HD13 . LEU A 1 75  ? -6.615  -1.339  2.753   1.00 0.00 ? 172 LEU A HD13 4  
ATOM 6922  H HD21 . LEU A 1 75  ? -5.579  0.368   5.034   1.00 0.00 ? 172 LEU A HD21 4  
ATOM 6923  H HD22 . LEU A 1 75  ? -4.686  -0.902  4.197   1.00 0.00 ? 172 LEU A HD22 4  
ATOM 6924  H HD23 . LEU A 1 75  ? -4.854  -0.951  5.951   1.00 0.00 ? 172 LEU A HD23 4  
ATOM 6925  N N    . HIS A 1 76  ? -8.010  -0.238  9.172   1.00 0.00 ? 173 HIS A N    4  
ATOM 6926  C CA   . HIS A 1 76  ? -9.005  0.169   10.154  1.00 0.00 ? 173 HIS A CA   4  
ATOM 6927  C C    . HIS A 1 76  ? -9.736  1.421   9.678   1.00 0.00 ? 173 HIS A C    4  
ATOM 6928  O O    . HIS A 1 76  ? -9.104  2.431   9.362   1.00 0.00 ? 173 HIS A O    4  
ATOM 6929  C CB   . HIS A 1 76  ? -8.350  0.441   11.508  1.00 0.00 ? 173 HIS A CB   4  
ATOM 6930  C CG   . HIS A 1 76  ? -7.769  -0.772  12.165  1.00 0.00 ? 173 HIS A CG   4  
ATOM 6931  N ND1  . HIS A 1 76  ? -8.404  -1.454  13.176  1.00 0.00 ? 173 HIS A ND1  4  
ATOM 6932  C CD2  . HIS A 1 76  ? -6.595  -1.413  11.963  1.00 0.00 ? 173 HIS A CD2  4  
ATOM 6933  C CE1  . HIS A 1 76  ? -7.646  -2.459  13.569  1.00 0.00 ? 173 HIS A CE1  4  
ATOM 6934  N NE2  . HIS A 1 76  ? -6.544  -2.456  12.849  1.00 0.00 ? 173 HIS A NE2  4  
ATOM 6935  H H    . HIS A 1 76  ? -7.218  0.327   9.032   1.00 0.00 ? 173 HIS A H    4  
ATOM 6936  H HA   . HIS A 1 76  ? -9.715  -0.634  10.261  1.00 0.00 ? 173 HIS A HA   4  
ATOM 6937  H HB2  . HIS A 1 76  ? -7.552  1.156   11.373  1.00 0.00 ? 173 HIS A HB2  4  
ATOM 6938  H HB3  . HIS A 1 76  ? -9.088  0.859   12.177  1.00 0.00 ? 173 HIS A HB3  4  
ATOM 6939  H HD1  . HIS A 1 76  ? -9.286  -1.235  13.551  1.00 0.00 ? 173 HIS A HD1  4  
ATOM 6940  H HD2  . HIS A 1 76  ? -5.837  -1.148  11.239  1.00 0.00 ? 173 HIS A HD2  4  
ATOM 6941  H HE1  . HIS A 1 76  ? -7.887  -3.162  14.351  1.00 0.00 ? 173 HIS A HE1  4  
ATOM 6942  H HE2  . HIS A 1 76  ? -5.748  -2.997  13.043  1.00 0.00 ? 173 HIS A HE2  4  
ATOM 6943  N N    . PRO A 1 77  ? -11.076 1.371   9.614   1.00 0.00 ? 174 PRO A N    4  
ATOM 6944  C CA   . PRO A 1 77  ? -11.892 2.506   9.169   1.00 0.00 ? 174 PRO A CA   4  
ATOM 6945  C C    . PRO A 1 77  ? -11.717 3.735   10.059  1.00 0.00 ? 174 PRO A C    4  
ATOM 6946  O O    . PRO A 1 77  ? -11.940 3.674   11.271  1.00 0.00 ? 174 PRO A O    4  
ATOM 6947  C CB   . PRO A 1 77  ? -13.332 1.985   9.262   1.00 0.00 ? 174 PRO A CB   4  
ATOM 6948  C CG   . PRO A 1 77  ? -13.211 0.500   9.294   1.00 0.00 ? 174 PRO A CG   4  
ATOM 6949  C CD   . PRO A 1 77  ? -11.904 0.205   9.967   1.00 0.00 ? 174 PRO A CD   4  
ATOM 6950  H HA   . PRO A 1 77  ? -11.670 2.774   8.146   1.00 0.00 ? 174 PRO A HA   4  
ATOM 6951  H HB2  . PRO A 1 77  ? -13.795 2.363   10.161  1.00 0.00 ? 174 PRO A HB2  4  
ATOM 6952  H HB3  . PRO A 1 77  ? -13.893 2.316   8.399   1.00 0.00 ? 174 PRO A HB3  4  
ATOM 6953  H HG2  . PRO A 1 77  ? -14.028 0.077   9.861   1.00 0.00 ? 174 PRO A HG2  4  
ATOM 6954  H HG3  . PRO A 1 77  ? -13.210 0.109   8.288   1.00 0.00 ? 174 PRO A HG3  4  
ATOM 6955  H HD2  . PRO A 1 77  ? -12.035 0.132   11.036  1.00 0.00 ? 174 PRO A HD2  4  
ATOM 6956  H HD3  . PRO A 1 77  ? -11.477 -0.705  9.573   1.00 0.00 ? 174 PRO A HD3  4  
ATOM 6957  N N    . GLY A 1 78  ? -11.311 4.843   9.455   1.00 0.00 ? 175 GLY A N    4  
ATOM 6958  C CA   . GLY A 1 78  ? -11.159 6.078   10.199  1.00 0.00 ? 175 GLY A CA   4  
ATOM 6959  C C    . GLY A 1 78  ? -9.739  6.307   10.669  1.00 0.00 ? 175 GLY A C    4  
ATOM 6960  O O    . GLY A 1 78  ? -9.506  7.046   11.629  1.00 0.00 ? 175 GLY A O    4  
ATOM 6961  H H    . GLY A 1 78  ? -11.113 4.825   8.492   1.00 0.00 ? 175 GLY A H    4  
ATOM 6962  H HA2  . GLY A 1 78  ? -11.452 6.903   9.568   1.00 0.00 ? 175 GLY A HA2  4  
ATOM 6963  H HA3  . GLY A 1 78  ? -11.810 6.047   11.059  1.00 0.00 ? 175 GLY A HA3  4  
ATOM 6964  N N    . GLN A 1 79  ? -8.783  5.673   10.006  1.00 0.00 ? 176 GLN A N    4  
ATOM 6965  C CA   . GLN A 1 79  ? -7.384  5.824   10.367  1.00 0.00 ? 176 GLN A CA   4  
ATOM 6966  C C    . GLN A 1 79  ? -6.535  6.124   9.138   1.00 0.00 ? 176 GLN A C    4  
ATOM 6967  O O    . GLN A 1 79  ? -6.859  5.702   8.025   1.00 0.00 ? 176 GLN A O    4  
ATOM 6968  C CB   . GLN A 1 79  ? -6.888  4.572   11.089  1.00 0.00 ? 176 GLN A CB   4  
ATOM 6969  C CG   . GLN A 1 79  ? -7.515  4.411   12.462  1.00 0.00 ? 176 GLN A CG   4  
ATOM 6970  C CD   . GLN A 1 79  ? -7.135  3.123   13.156  1.00 0.00 ? 176 GLN A CD   4  
ATOM 6971  O OE1  . GLN A 1 79  ? -6.047  2.584   12.956  1.00 0.00 ? 176 GLN A OE1  4  
ATOM 6972  N NE2  . GLN A 1 79  ? -8.040  2.623   13.981  1.00 0.00 ? 176 GLN A NE2  4  
ATOM 6973  H H    . GLN A 1 79  ? -9.022  5.088   9.259   1.00 0.00 ? 176 GLN A H    4  
ATOM 6974  H HA   . GLN A 1 79  ? -7.313  6.661   11.045  1.00 0.00 ? 176 GLN A HA   4  
ATOM 6975  H HB2  . GLN A 1 79  ? -7.131  3.703   10.495  1.00 0.00 ? 176 GLN A HB2  4  
ATOM 6976  H HB3  . GLN A 1 79  ? -5.816  4.634   11.207  1.00 0.00 ? 176 GLN A HB3  4  
ATOM 6977  H HG2  . GLN A 1 79  ? -7.200  5.236   13.081  1.00 0.00 ? 176 GLN A HG2  4  
ATOM 6978  H HG3  . GLN A 1 79  ? -8.589  4.439   12.353  1.00 0.00 ? 176 GLN A HG3  4  
ATOM 6979  H HE21 . GLN A 1 79  ? -8.886  3.114   14.087  1.00 0.00 ? 176 GLN A HE21 4  
ATOM 6980  H HE22 . GLN A 1 79  ? -7.835  1.786   14.451  1.00 0.00 ? 176 GLN A HE22 4  
ATOM 6981  N N    . LYS A 1 80  ? -5.469  6.881   9.350   1.00 0.00 ? 177 LYS A N    4  
ATOM 6982  C CA   . LYS A 1 80  ? -4.568  7.278   8.282   1.00 0.00 ? 177 LYS A CA   4  
ATOM 6983  C C    . LYS A 1 80  ? -3.450  6.250   8.129   1.00 0.00 ? 177 LYS A C    4  
ATOM 6984  O O    . LYS A 1 80  ? -2.869  5.805   9.117   1.00 0.00 ? 177 LYS A O    4  
ATOM 6985  C CB   . LYS A 1 80  ? -3.982  8.655   8.607   1.00 0.00 ? 177 LYS A CB   4  
ATOM 6986  C CG   . LYS A 1 80  ? -3.327  9.362   7.435   1.00 0.00 ? 177 LYS A CG   4  
ATOM 6987  C CD   . LYS A 1 80  ? -2.687  10.664  7.889   1.00 0.00 ? 177 LYS A CD   4  
ATOM 6988  C CE   . LYS A 1 80  ? -2.230  11.515  6.716   1.00 0.00 ? 177 LYS A CE   4  
ATOM 6989  N NZ   . LYS A 1 80  ? -3.372  12.018  5.905   1.00 0.00 ? 177 LYS A NZ   4  
ATOM 6990  H H    . LYS A 1 80  ? -5.282  7.196   10.267  1.00 0.00 ? 177 LYS A H    4  
ATOM 6991  H HA   . LYS A 1 80  ? -5.132  7.333   7.364   1.00 0.00 ? 177 LYS A HA   4  
ATOM 6992  H HB2  . LYS A 1 80  ? -4.774  9.289   8.976   1.00 0.00 ? 177 LYS A HB2  4  
ATOM 6993  H HB3  . LYS A 1 80  ? -3.242  8.539   9.384   1.00 0.00 ? 177 LYS A HB3  4  
ATOM 6994  H HG2  . LYS A 1 80  ? -2.566  8.721   7.015   1.00 0.00 ? 177 LYS A HG2  4  
ATOM 6995  H HG3  . LYS A 1 80  ? -4.076  9.578   6.688   1.00 0.00 ? 177 LYS A HG3  4  
ATOM 6996  H HD2  . LYS A 1 80  ? -3.409  11.224  8.465   1.00 0.00 ? 177 LYS A HD2  4  
ATOM 6997  H HD3  . LYS A 1 80  ? -1.834  10.434  8.509   1.00 0.00 ? 177 LYS A HD3  4  
ATOM 6998  H HE2  . LYS A 1 80  ? -1.674  12.358  7.094   1.00 0.00 ? 177 LYS A HE2  4  
ATOM 6999  H HE3  . LYS A 1 80  ? -1.590  10.918  6.087   1.00 0.00 ? 177 LYS A HE3  4  
ATOM 7000  H HZ1  . LYS A 1 80  ? -3.875  11.225  5.462   1.00 0.00 ? 177 LYS A HZ1  4  
ATOM 7001  H HZ2  . LYS A 1 80  ? -3.026  12.653  5.155   1.00 0.00 ? 177 LYS A HZ2  4  
ATOM 7002  H HZ3  . LYS A 1 80  ? -4.037  12.545  6.506   1.00 0.00 ? 177 LYS A HZ3  4  
ATOM 7003  N N    . TYR A 1 81  ? -3.166  5.865   6.896   1.00 0.00 ? 178 TYR A N    4  
ATOM 7004  C CA   . TYR A 1 81  ? -2.111  4.904   6.615   1.00 0.00 ? 178 TYR A CA   4  
ATOM 7005  C C    . TYR A 1 81  ? -1.048  5.521   5.716   1.00 0.00 ? 178 TYR A C    4  
ATOM 7006  O O    . TYR A 1 81  ? -1.335  6.407   4.909   1.00 0.00 ? 178 TYR A O    4  
ATOM 7007  C CB   . TYR A 1 81  ? -2.684  3.650   5.946   1.00 0.00 ? 178 TYR A CB   4  
ATOM 7008  C CG   . TYR A 1 81  ? -3.353  2.683   6.898   1.00 0.00 ? 178 TYR A CG   4  
ATOM 7009  C CD1  . TYR A 1 81  ? -4.479  3.048   7.625   1.00 0.00 ? 178 TYR A CD1  4  
ATOM 7010  C CD2  . TYR A 1 81  ? -2.860  1.394   7.056   1.00 0.00 ? 178 TYR A CD2  4  
ATOM 7011  C CE1  . TYR A 1 81  ? -5.092  2.158   8.485   1.00 0.00 ? 178 TYR A CE1  4  
ATOM 7012  C CE2  . TYR A 1 81  ? -3.468  0.499   7.915   1.00 0.00 ? 178 TYR A CE2  4  
ATOM 7013  C CZ   . TYR A 1 81  ? -4.582  0.886   8.626   1.00 0.00 ? 178 TYR A CZ   4  
ATOM 7014  O OH   . TYR A 1 81  ? -5.192  -0.003  9.478   1.00 0.00 ? 178 TYR A OH   4  
ATOM 7015  H H    . TYR A 1 81  ? -3.679  6.242   6.144   1.00 0.00 ? 178 TYR A H    4  
ATOM 7016  H HA   . TYR A 1 81  ? -1.655  4.626   7.553   1.00 0.00 ? 178 TYR A HA   4  
ATOM 7017  H HB2  . TYR A 1 81  ? -3.417  3.947   5.214   1.00 0.00 ? 178 TYR A HB2  4  
ATOM 7018  H HB3  . TYR A 1 81  ? -1.883  3.121   5.448   1.00 0.00 ? 178 TYR A HB3  4  
ATOM 7019  H HD1  . TYR A 1 81  ? -4.875  4.046   7.513   1.00 0.00 ? 178 TYR A HD1  4  
ATOM 7020  H HD2  . TYR A 1 81  ? -1.985  1.094   6.499   1.00 0.00 ? 178 TYR A HD2  4  
ATOM 7021  H HE1  . TYR A 1 81  ? -5.969  2.460   9.041   1.00 0.00 ? 178 TYR A HE1  4  
ATOM 7022  H HE2  . TYR A 1 81  ? -3.070  -0.498  8.024   1.00 0.00 ? 178 TYR A HE2  4  
ATOM 7023  H HH   . TYR A 1 81  ? -4.522  -0.580  9.871   1.00 0.00 ? 178 TYR A HH   4  
ATOM 7024  N N    . LEU A 1 82  ? 0.178   5.062   5.879   1.00 0.00 ? 179 LEU A N    4  
ATOM 7025  C CA   . LEU A 1 82  ? 1.278   5.488   5.029   1.00 0.00 ? 179 LEU A CA   4  
ATOM 7026  C C    . LEU A 1 82  ? 1.735   4.314   4.182   1.00 0.00 ? 179 LEU A C    4  
ATOM 7027  O O    . LEU A 1 82  ? 1.859   3.202   4.691   1.00 0.00 ? 179 LEU A O    4  
ATOM 7028  C CB   . LEU A 1 82  ? 2.457   6.006   5.859   1.00 0.00 ? 179 LEU A CB   4  
ATOM 7029  C CG   . LEU A 1 82  ? 2.251   7.338   6.594   1.00 0.00 ? 179 LEU A CG   4  
ATOM 7030  C CD1  . LEU A 1 82  ? 1.244   7.203   7.729   1.00 0.00 ? 179 LEU A CD1  4  
ATOM 7031  C CD2  . LEU A 1 82  ? 3.579   7.849   7.126   1.00 0.00 ? 179 LEU A CD2  4  
ATOM 7032  H H    . LEU A 1 82  ? 0.353   4.406   6.591   1.00 0.00 ? 179 LEU A H    4  
ATOM 7033  H HA   . LEU A 1 82  ? 0.920   6.275   4.382   1.00 0.00 ? 179 LEU A HA   4  
ATOM 7034  H HB2  . LEU A 1 82  ? 2.706   5.254   6.593   1.00 0.00 ? 179 LEU A HB2  4  
ATOM 7035  H HB3  . LEU A 1 82  ? 3.301   6.122   5.196   1.00 0.00 ? 179 LEU A HB3  4  
ATOM 7036  H HG   . LEU A 1 82  ? 1.871   8.068   5.897   1.00 0.00 ? 179 LEU A HG   4  
ATOM 7037  H HD11 . LEU A 1 82  ? 0.289   6.893   7.330   1.00 0.00 ? 179 LEU A HD11 4  
ATOM 7038  H HD12 . LEU A 1 82  ? 1.133   8.156   8.227   1.00 0.00 ? 179 LEU A HD12 4  
ATOM 7039  H HD13 . LEU A 1 82  ? 1.595   6.466   8.436   1.00 0.00 ? 179 LEU A HD13 4  
ATOM 7040  H HD21 . LEU A 1 82  ? 3.421   8.772   7.662   1.00 0.00 ? 179 LEU A HD21 4  
ATOM 7041  H HD22 . LEU A 1 82  ? 4.255   8.022   6.300   1.00 0.00 ? 179 LEU A HD22 4  
ATOM 7042  H HD23 . LEU A 1 82  ? 4.007   7.114   7.793   1.00 0.00 ? 179 LEU A HD23 4  
ATOM 7043  N N    . VAL A 1 83  ? 1.978   4.553   2.900   1.00 0.00 ? 180 VAL A N    4  
ATOM 7044  C CA   . VAL A 1 83  ? 2.372   3.484   1.987   1.00 0.00 ? 180 VAL A CA   4  
ATOM 7045  C C    . VAL A 1 83  ? 3.575   3.890   1.142   1.00 0.00 ? 180 VAL A C    4  
ATOM 7046  O O    . VAL A 1 83  ? 3.756   5.066   0.816   1.00 0.00 ? 180 VAL A O    4  
ATOM 7047  C CB   . VAL A 1 83  ? 1.213   3.063   1.053   1.00 0.00 ? 180 VAL A CB   4  
ATOM 7048  C CG1  . VAL A 1 83  ? 0.077   2.427   1.839   1.00 0.00 ? 180 VAL A CG1  4  
ATOM 7049  C CG2  . VAL A 1 83  ? 0.704   4.250   0.258   1.00 0.00 ? 180 VAL A CG2  4  
ATOM 7050  H H    . VAL A 1 83  ? 1.900   5.474   2.559   1.00 0.00 ? 180 VAL A H    4  
ATOM 7051  H HA   . VAL A 1 83  ? 2.646   2.628   2.583   1.00 0.00 ? 180 VAL A HA   4  
ATOM 7052  H HB   . VAL A 1 83  ? 1.591   2.329   0.356   1.00 0.00 ? 180 VAL A HB   4  
ATOM 7053  H HG11 . VAL A 1 83  ? -0.290  3.129   2.572   1.00 0.00 ? 180 VAL A HG11 4  
ATOM 7054  H HG12 . VAL A 1 83  ? 0.436   1.539   2.337   1.00 0.00 ? 180 VAL A HG12 4  
ATOM 7055  H HG13 . VAL A 1 83  ? -0.723  2.160   1.164   1.00 0.00 ? 180 VAL A HG13 4  
ATOM 7056  H HG21 . VAL A 1 83  ? 1.490   4.617   -0.383  1.00 0.00 ? 180 VAL A HG21 4  
ATOM 7057  H HG22 . VAL A 1 83  ? 0.396   5.032   0.937   1.00 0.00 ? 180 VAL A HG22 4  
ATOM 7058  H HG23 . VAL A 1 83  ? -0.138  3.943   -0.344  1.00 0.00 ? 180 VAL A HG23 4  
ATOM 7059  N N    . GLN A 1 84  ? 4.394   2.902   0.805   1.00 0.00 ? 181 GLN A N    4  
ATOM 7060  C CA   . GLN A 1 84  ? 5.602   3.108   0.016   1.00 0.00 ? 181 GLN A CA   4  
ATOM 7061  C C    . GLN A 1 84  ? 5.917   1.867   -0.804  1.00 0.00 ? 181 GLN A C    4  
ATOM 7062  O O    . GLN A 1 84  ? 5.701   0.746   -0.349  1.00 0.00 ? 181 GLN A O    4  
ATOM 7063  C CB   . GLN A 1 84  ? 6.803   3.394   0.921   1.00 0.00 ? 181 GLN A CB   4  
ATOM 7064  C CG   . GLN A 1 84  ? 6.833   4.786   1.517   1.00 0.00 ? 181 GLN A CG   4  
ATOM 7065  C CD   . GLN A 1 84  ? 8.032   4.988   2.416   1.00 0.00 ? 181 GLN A CD   4  
ATOM 7066  O OE1  . GLN A 1 84  ? 8.493   4.051   3.056   1.00 0.00 ? 181 GLN A OE1  4  
ATOM 7067  N NE2  . GLN A 1 84  ? 8.556   6.203   2.454   1.00 0.00 ? 181 GLN A NE2  4  
ATOM 7068  H H    . GLN A 1 84  ? 4.176   1.992   1.096   1.00 0.00 ? 181 GLN A H    4  
ATOM 7069  H HA   . GLN A 1 84  ? 5.443   3.945   -0.645  1.00 0.00 ? 181 GLN A HA   4  
ATOM 7070  H HB2  . GLN A 1 84  ? 6.798   2.685   1.734   1.00 0.00 ? 181 GLN A HB2  4  
ATOM 7071  H HB3  . GLN A 1 84  ? 7.707   3.256   0.346   1.00 0.00 ? 181 GLN A HB3  4  
ATOM 7072  H HG2  . GLN A 1 84  ? 6.875   5.508   0.714   1.00 0.00 ? 181 GLN A HG2  4  
ATOM 7073  H HG3  . GLN A 1 84  ? 5.934   4.940   2.096   1.00 0.00 ? 181 GLN A HG3  4  
ATOM 7074  H HE21 . GLN A 1 84  ? 8.146   6.902   1.903   1.00 0.00 ? 181 GLN A HE21 4  
ATOM 7075  H HE22 . GLN A 1 84  ? 9.337   6.355   3.034   1.00 0.00 ? 181 GLN A HE22 4  
ATOM 7076  N N    . VAL A 1 85  ? 6.433   2.071   -2.002  1.00 0.00 ? 182 VAL A N    4  
ATOM 7077  C CA   . VAL A 1 85  ? 6.942   0.977   -2.808  1.00 0.00 ? 182 VAL A CA   4  
ATOM 7078  C C    . VAL A 1 85  ? 8.233   1.404   -3.482  1.00 0.00 ? 182 VAL A C    4  
ATOM 7079  O O    . VAL A 1 85  ? 8.403   2.576   -3.830  1.00 0.00 ? 182 VAL A O    4  
ATOM 7080  C CB   . VAL A 1 85  ? 5.937   0.509   -3.888  1.00 0.00 ? 182 VAL A CB   4  
ATOM 7081  C CG1  . VAL A 1 85  ? 5.709   1.594   -4.933  1.00 0.00 ? 182 VAL A CG1  4  
ATOM 7082  C CG2  . VAL A 1 85  ? 6.418   -0.777  -4.550  1.00 0.00 ? 182 VAL A CG2  4  
ATOM 7083  H H    . VAL A 1 85  ? 6.475   2.983   -2.358  1.00 0.00 ? 182 VAL A H    4  
ATOM 7084  H HA   . VAL A 1 85  ? 7.149   0.144   -2.149  1.00 0.00 ? 182 VAL A HA   4  
ATOM 7085  H HB   . VAL A 1 85  ? 4.992   0.306   -3.404  1.00 0.00 ? 182 VAL A HB   4  
ATOM 7086  H HG11 . VAL A 1 85  ? 5.281   2.465   -4.462  1.00 0.00 ? 182 VAL A HG11 4  
ATOM 7087  H HG12 . VAL A 1 85  ? 5.035   1.229   -5.695  1.00 0.00 ? 182 VAL A HG12 4  
ATOM 7088  H HG13 . VAL A 1 85  ? 6.652   1.859   -5.386  1.00 0.00 ? 182 VAL A HG13 4  
ATOM 7089  H HG21 . VAL A 1 85  ? 5.689   -1.101  -5.278  1.00 0.00 ? 182 VAL A HG21 4  
ATOM 7090  H HG22 . VAL A 1 85  ? 6.542   -1.544  -3.800  1.00 0.00 ? 182 VAL A HG22 4  
ATOM 7091  H HG23 . VAL A 1 85  ? 7.364   -0.599  -5.044  1.00 0.00 ? 182 VAL A HG23 4  
ATOM 7092  N N    . ARG A 1 86  ? 9.154   0.475   -3.630  1.00 0.00 ? 183 ARG A N    4  
ATOM 7093  C CA   . ARG A 1 86  ? 10.337  0.724   -4.422  1.00 0.00 ? 183 ARG A CA   4  
ATOM 7094  C C    . ARG A 1 86  ? 10.908  -0.582  -4.933  1.00 0.00 ? 183 ARG A C    4  
ATOM 7095  O O    . ARG A 1 86  ? 10.594  -1.660  -4.423  1.00 0.00 ? 183 ARG A O    4  
ATOM 7096  C CB   . ARG A 1 86  ? 11.402  1.494   -3.636  1.00 0.00 ? 183 ARG A CB   4  
ATOM 7097  C CG   . ARG A 1 86  ? 12.122  0.675   -2.581  1.00 0.00 ? 183 ARG A CG   4  
ATOM 7098  C CD   . ARG A 1 86  ? 13.504  1.247   -2.310  1.00 0.00 ? 183 ARG A CD   4  
ATOM 7099  N NE   . ARG A 1 86  ? 14.317  1.273   -3.526  1.00 0.00 ? 183 ARG A NE   4  
ATOM 7100  C CZ   . ARG A 1 86  ? 15.276  2.165   -3.770  1.00 0.00 ? 183 ARG A CZ   4  
ATOM 7101  N NH1  . ARG A 1 86  ? 15.611  3.059   -2.848  1.00 0.00 ? 183 ARG A NH1  4  
ATOM 7102  N NH2  . ARG A 1 86  ? 15.910  2.154   -4.936  1.00 0.00 ? 183 ARG A NH2  4  
ATOM 7103  H H    . ARG A 1 86  ? 9.035   -0.400  -3.197  1.00 0.00 ? 183 ARG A H    4  
ATOM 7104  H HA   . ARG A 1 86  ? 10.036  1.318   -5.271  1.00 0.00 ? 183 ARG A HA   4  
ATOM 7105  H HB2  . ARG A 1 86  ? 12.141  1.867   -4.330  1.00 0.00 ? 183 ARG A HB2  4  
ATOM 7106  H HB3  . ARG A 1 86  ? 10.930  2.333   -3.146  1.00 0.00 ? 183 ARG A HB3  4  
ATOM 7107  H HG2  . ARG A 1 86  ? 11.546  0.690   -1.666  1.00 0.00 ? 183 ARG A HG2  4  
ATOM 7108  H HG3  . ARG A 1 86  ? 12.223  -0.341  -2.932  1.00 0.00 ? 183 ARG A HG3  4  
ATOM 7109  H HD2  . ARG A 1 86  ? 13.398  2.254   -1.935  1.00 0.00 ? 183 ARG A HD2  4  
ATOM 7110  H HD3  . ARG A 1 86  ? 13.997  0.635   -1.569  1.00 0.00 ? 183 ARG A HD3  4  
ATOM 7111  H HE   . ARG A 1 86  ? 14.122  0.592   -4.215  1.00 0.00 ? 183 ARG A HE   4  
ATOM 7112  H HH11 . ARG A 1 86  ? 15.152  3.069   -1.953  1.00 0.00 ? 183 ARG A HH11 4  
ATOM 7113  H HH12 . ARG A 1 86  ? 16.326  3.741   -3.044  1.00 0.00 ? 183 ARG A HH12 4  
ATOM 7114  H HH21 . ARG A 1 86  ? 15.668  1.476   -5.638  1.00 0.00 ? 183 ARG A HH21 4  
ATOM 7115  H HH22 . ARG A 1 86  ? 16.635  2.826   -5.123  1.00 0.00 ? 183 ARG A HH22 4  
ATOM 7116  N N    . CYS A 1 87  ? 11.728  -0.469  -5.954  1.00 0.00 ? 184 CYS A N    4  
ATOM 7117  C CA   . CYS A 1 87  ? 12.393  -1.608  -6.544  1.00 0.00 ? 184 CYS A CA   4  
ATOM 7118  C C    . CYS A 1 87  ? 13.896  -1.454  -6.365  1.00 0.00 ? 184 CYS A C    4  
ATOM 7119  O O    . CYS A 1 87  ? 14.339  -0.514  -5.697  1.00 0.00 ? 184 CYS A O    4  
ATOM 7120  C CB   . CYS A 1 87  ? 12.013  -1.691  -8.014  1.00 0.00 ? 184 CYS A CB   4  
ATOM 7121  S SG   . CYS A 1 87  ? 12.146  -0.114  -8.893  1.00 0.00 ? 184 CYS A SG   4  
ATOM 7122  H H    . CYS A 1 87  ? 11.899  0.418   -6.332  1.00 0.00 ? 184 CYS A H    4  
ATOM 7123  H HA   . CYS A 1 87  ? 12.061  -2.499  -6.034  1.00 0.00 ? 184 CYS A HA   4  
ATOM 7124  H HB2  . CYS A 1 87  ? 12.656  -2.401  -8.508  1.00 0.00 ? 184 CYS A HB2  4  
ATOM 7125  H HB3  . CYS A 1 87  ? 10.985  -2.022  -8.090  1.00 0.00 ? 184 CYS A HB3  4  
ATOM 7126  H HG   . CYS A 1 87  ? 13.413  0.050   -9.252  1.00 0.00 ? 184 CYS A HG   4  
ATOM 7127  N N    . LYS A 1 88  ? 14.684  -2.351  -6.943  1.00 0.00 ? 185 LYS A N    4  
ATOM 7128  C CA   . LYS A 1 88  ? 16.127  -2.275  -6.766  1.00 0.00 ? 185 LYS A CA   4  
ATOM 7129  C C    . LYS A 1 88  ? 16.875  -3.008  -7.870  1.00 0.00 ? 185 LYS A C    4  
ATOM 7130  O O    . LYS A 1 88  ? 16.515  -4.121  -8.256  1.00 0.00 ? 185 LYS A O    4  
ATOM 7131  C CB   . LYS A 1 88  ? 16.530  -2.796  -5.374  1.00 0.00 ? 185 LYS A CB   4  
ATOM 7132  C CG   . LYS A 1 88  ? 16.158  -4.241  -5.078  1.00 0.00 ? 185 LYS A CG   4  
ATOM 7133  C CD   . LYS A 1 88  ? 17.283  -5.203  -5.431  1.00 0.00 ? 185 LYS A CD   4  
ATOM 7134  C CE   . LYS A 1 88  ? 17.025  -6.581  -4.850  1.00 0.00 ? 185 LYS A CE   4  
ATOM 7135  N NZ   . LYS A 1 88  ? 18.062  -7.565  -5.255  1.00 0.00 ? 185 LYS A NZ   4  
ATOM 7136  H H    . LYS A 1 88  ? 14.296  -3.059  -7.511  1.00 0.00 ? 185 LYS A H    4  
ATOM 7137  H HA   . LYS A 1 88  ? 16.395  -1.231  -6.823  1.00 0.00 ? 185 LYS A HA   4  
ATOM 7138  H HB2  . LYS A 1 88  ? 17.600  -2.705  -5.271  1.00 0.00 ? 185 LYS A HB2  4  
ATOM 7139  H HB3  . LYS A 1 88  ? 16.055  -2.173  -4.632  1.00 0.00 ? 185 LYS A HB3  4  
ATOM 7140  H HG2  . LYS A 1 88  ? 15.936  -4.336  -4.025  1.00 0.00 ? 185 LYS A HG2  4  
ATOM 7141  H HG3  . LYS A 1 88  ? 15.282  -4.500  -5.655  1.00 0.00 ? 185 LYS A HG3  4  
ATOM 7142  H HD2  . LYS A 1 88  ? 17.352  -5.283  -6.506  1.00 0.00 ? 185 LYS A HD2  4  
ATOM 7143  H HD3  . LYS A 1 88  ? 18.211  -4.820  -5.035  1.00 0.00 ? 185 LYS A HD3  4  
ATOM 7144  H HE2  . LYS A 1 88  ? 17.024  -6.502  -3.772  1.00 0.00 ? 185 LYS A HE2  4  
ATOM 7145  H HE3  . LYS A 1 88  ? 16.059  -6.925  -5.187  1.00 0.00 ? 185 LYS A HE3  4  
ATOM 7146  H HZ1  . LYS A 1 88  ? 18.159  -7.580  -6.289  1.00 0.00 ? 185 LYS A HZ1  4  
ATOM 7147  H HZ2  . LYS A 1 88  ? 17.799  -8.516  -4.930  1.00 0.00 ? 185 LYS A HZ2  4  
ATOM 7148  H HZ3  . LYS A 1 88  ? 18.980  -7.314  -4.838  1.00 0.00 ? 185 LYS A HZ3  4  
ATOM 7149  N N    . PRO A 1 89  ? 17.925  -2.365  -8.401  1.00 0.00 ? 186 PRO A N    4  
ATOM 7150  C CA   . PRO A 1 89  ? 18.775  -2.950  -9.438  1.00 0.00 ? 186 PRO A CA   4  
ATOM 7151  C C    . PRO A 1 89  ? 19.602  -4.107  -8.893  1.00 0.00 ? 186 PRO A C    4  
ATOM 7152  O O    . PRO A 1 89  ? 20.096  -4.057  -7.766  1.00 0.00 ? 186 PRO A O    4  
ATOM 7153  C CB   . PRO A 1 89  ? 19.684  -1.787  -9.846  1.00 0.00 ? 186 PRO A CB   4  
ATOM 7154  C CG   . PRO A 1 89  ? 19.729  -0.909  -8.649  1.00 0.00 ? 186 PRO A CG   4  
ATOM 7155  C CD   . PRO A 1 89  ? 18.370  -1.010  -8.022  1.00 0.00 ? 186 PRO A CD   4  
ATOM 7156  H HA   . PRO A 1 89  ? 18.198  -3.282  -10.287 1.00 0.00 ? 186 PRO A HA   4  
ATOM 7157  H HB2  . PRO A 1 89  ? 20.665  -2.163  -10.099 1.00 0.00 ? 186 PRO A HB2  4  
ATOM 7158  H HB3  . PRO A 1 89  ? 19.257  -1.275  -10.697 1.00 0.00 ? 186 PRO A HB3  4  
ATOM 7159  H HG2  . PRO A 1 89  ? 20.486  -1.263  -7.964  1.00 0.00 ? 186 PRO A HG2  4  
ATOM 7160  H HG3  . PRO A 1 89  ? 19.932  0.110   -8.944  1.00 0.00 ? 186 PRO A HG3  4  
ATOM 7161  H HD2  . PRO A 1 89  ? 18.440  -0.912  -6.949  1.00 0.00 ? 186 PRO A HD2  4  
ATOM 7162  H HD3  . PRO A 1 89  ? 17.709  -0.260  -8.430  1.00 0.00 ? 186 PRO A HD3  4  
ATOM 7163  N N    . ASP A 1 90  ? 19.750  -5.144  -9.704  1.00 0.00 ? 187 ASP A N    4  
ATOM 7164  C CA   . ASP A 1 90  ? 20.452  -6.352  -9.290  1.00 0.00 ? 187 ASP A CA   4  
ATOM 7165  C C    . ASP A 1 90  ? 21.949  -6.094  -9.195  1.00 0.00 ? 187 ASP A C    4  
ATOM 7166  O O    . ASP A 1 90  ? 22.662  -6.762  -8.448  1.00 0.00 ? 187 ASP A O    4  
ATOM 7167  C CB   . ASP A 1 90  ? 20.178  -7.490  -10.272 1.00 0.00 ? 187 ASP A CB   4  
ATOM 7168  C CG   . ASP A 1 90  ? 20.768  -8.805  -9.809  1.00 0.00 ? 187 ASP A CG   4  
ATOM 7169  O OD1  . ASP A 1 90  ? 20.139  -9.475  -8.960  1.00 0.00 ? 187 ASP A OD1  4  
ATOM 7170  O OD2  . ASP A 1 90  ? 21.858  -9.180  -10.293 1.00 0.00 ? 187 ASP A OD2  4  
ATOM 7171  H H    . ASP A 1 90  ? 19.384  -5.092  -10.611 1.00 0.00 ? 187 ASP A H    4  
ATOM 7172  H HA   . ASP A 1 90  ? 20.084  -6.632  -8.314  1.00 0.00 ? 187 ASP A HA   4  
ATOM 7173  H HB2  . ASP A 1 90  ? 19.112  -7.613  -10.384 1.00 0.00 ? 187 ASP A HB2  4  
ATOM 7174  H HB3  . ASP A 1 90  ? 20.610  -7.241  -11.229 1.00 0.00 ? 187 ASP A HB3  4  
ATOM 7175  N N    . HIS A 1 91  ? 22.413  -5.100  -9.941  1.00 0.00 ? 188 HIS A N    4  
ATOM 7176  C CA   . HIS A 1 91  ? 23.824  -4.724  -9.935  1.00 0.00 ? 188 HIS A CA   4  
ATOM 7177  C C    . HIS A 1 91  ? 24.122  -3.780  -8.776  1.00 0.00 ? 188 HIS A C    4  
ATOM 7178  O O    . HIS A 1 91  ? 25.199  -3.187  -8.703  1.00 0.00 ? 188 HIS A O    4  
ATOM 7179  C CB   . HIS A 1 91  ? 24.213  -4.055  -11.256 1.00 0.00 ? 188 HIS A CB   4  
ATOM 7180  C CG   . HIS A 1 91  ? 24.024  -4.924  -12.461 1.00 0.00 ? 188 HIS A CG   4  
ATOM 7181  N ND1  . HIS A 1 91  ? 23.535  -4.452  -13.658 1.00 0.00 ? 188 HIS A ND1  4  
ATOM 7182  C CD2  . HIS A 1 91  ? 24.275  -6.240  -12.653 1.00 0.00 ? 188 HIS A CD2  4  
ATOM 7183  C CE1  . HIS A 1 91  ? 23.492  -5.439  -14.531 1.00 0.00 ? 188 HIS A CE1  4  
ATOM 7184  N NE2  . HIS A 1 91  ? 23.936  -6.535  -13.949 1.00 0.00 ? 188 HIS A NE2  4  
ATOM 7185  H H    . HIS A 1 91  ? 21.789  -4.603  -10.513 1.00 0.00 ? 188 HIS A H    4  
ATOM 7186  H HA   . HIS A 1 91  ? 24.407  -5.625  -9.811  1.00 0.00 ? 188 HIS A HA   4  
ATOM 7187  H HB2  . HIS A 1 91  ? 23.611  -3.170  -11.390 1.00 0.00 ? 188 HIS A HB2  4  
ATOM 7188  H HB3  . HIS A 1 91  ? 25.255  -3.770  -11.213 1.00 0.00 ? 188 HIS A HB3  4  
ATOM 7189  H HD1  . HIS A 1 91  ? 23.263  -3.526  -13.846 1.00 0.00 ? 188 HIS A HD1  4  
ATOM 7190  H HD2  . HIS A 1 91  ? 24.663  -6.932  -11.920 1.00 0.00 ? 188 HIS A HD2  4  
ATOM 7191  H HE1  . HIS A 1 91  ? 23.149  -5.362  -15.551 1.00 0.00 ? 188 HIS A HE1  4  
ATOM 7192  H HE2  . HIS A 1 91  ? 24.202  -7.351  -14.428 1.00 0.00 ? 188 HIS A HE2  4  
ATOM 7193  N N    . GLY A 1 92  ? 23.157  -3.636  -7.883  1.00 0.00 ? 189 GLY A N    4  
ATOM 7194  C CA   . GLY A 1 92  ? 23.329  -2.787  -6.728  1.00 0.00 ? 189 GLY A CA   4  
ATOM 7195  C C    . GLY A 1 92  ? 22.500  -3.265  -5.563  1.00 0.00 ? 189 GLY A C    4  
ATOM 7196  O O    . GLY A 1 92  ? 22.110  -4.430  -5.516  1.00 0.00 ? 189 GLY A O    4  
ATOM 7197  H H    . GLY A 1 92  ? 22.316  -4.127  -8.002  1.00 0.00 ? 189 GLY A H    4  
ATOM 7198  H HA2  . GLY A 1 92  ? 24.371  -2.785  -6.443  1.00 0.00 ? 189 GLY A HA2  4  
ATOM 7199  H HA3  . GLY A 1 92  ? 23.030  -1.783  -6.979  1.00 0.00 ? 189 GLY A HA3  4  
ATOM 7200  N N    . TYR A 1 93  ? 22.217  -2.372  -4.629  1.00 0.00 ? 190 TYR A N    4  
ATOM 7201  C CA   . TYR A 1 93  ? 21.467  -2.740  -3.436  1.00 0.00 ? 190 TYR A CA   4  
ATOM 7202  C C    . TYR A 1 93  ? 20.445  -1.665  -3.074  1.00 0.00 ? 190 TYR A C    4  
ATOM 7203  O O    . TYR A 1 93  ? 20.199  -0.739  -3.845  1.00 0.00 ? 190 TYR A O    4  
ATOM 7204  C CB   . TYR A 1 93  ? 22.415  -2.970  -2.253  1.00 0.00 ? 190 TYR A CB   4  
ATOM 7205  C CG   . TYR A 1 93  ? 23.497  -3.991  -2.524  1.00 0.00 ? 190 TYR A CG   4  
ATOM 7206  C CD1  . TYR A 1 93  ? 23.213  -5.350  -2.526  1.00 0.00 ? 190 TYR A CD1  4  
ATOM 7207  C CD2  . TYR A 1 93  ? 24.801  -3.592  -2.787  1.00 0.00 ? 190 TYR A CD2  4  
ATOM 7208  C CE1  . TYR A 1 93  ? 24.200  -6.283  -2.781  1.00 0.00 ? 190 TYR A CE1  4  
ATOM 7209  C CE2  . TYR A 1 93  ? 25.792  -4.519  -3.044  1.00 0.00 ? 190 TYR A CE2  4  
ATOM 7210  C CZ   . TYR A 1 93  ? 25.487  -5.862  -3.039  1.00 0.00 ? 190 TYR A CZ   4  
ATOM 7211  O OH   . TYR A 1 93  ? 26.473  -6.790  -3.294  1.00 0.00 ? 190 TYR A OH   4  
ATOM 7212  H H    . TYR A 1 93  ? 22.510  -1.438  -4.749  1.00 0.00 ? 190 TYR A H    4  
ATOM 7213  H HA   . TYR A 1 93  ? 20.944  -3.660  -3.647  1.00 0.00 ? 190 TYR A HA   4  
ATOM 7214  H HB2  . TYR A 1 93  ? 22.897  -2.036  -2.002  1.00 0.00 ? 190 TYR A HB2  4  
ATOM 7215  H HB3  . TYR A 1 93  ? 21.841  -3.311  -1.403  1.00 0.00 ? 190 TYR A HB3  4  
ATOM 7216  H HD1  . TYR A 1 93  ? 22.205  -5.677  -2.324  1.00 0.00 ? 190 TYR A HD1  4  
ATOM 7217  H HD2  . TYR A 1 93  ? 25.038  -2.539  -2.789  1.00 0.00 ? 190 TYR A HD2  4  
ATOM 7218  H HE1  . TYR A 1 93  ? 23.961  -7.335  -2.778  1.00 0.00 ? 190 TYR A HE1  4  
ATOM 7219  H HE2  . TYR A 1 93  ? 26.800  -4.188  -3.245  1.00 0.00 ? 190 TYR A HE2  4  
ATOM 7220  H HH   . TYR A 1 93  ? 26.206  -7.346  -4.039  1.00 0.00 ? 190 TYR A HH   4  
ATOM 7221  N N    . TRP A 1 94  ? 19.836  -1.821  -1.908  1.00 0.00 ? 191 TRP A N    4  
ATOM 7222  C CA   . TRP A 1 94  ? 18.895  -0.839  -1.381  1.00 0.00 ? 191 TRP A CA   4  
ATOM 7223  C C    . TRP A 1 94  ? 19.579  0.450   -0.943  1.00 0.00 ? 191 TRP A C    4  
ATOM 7224  O O    . TRP A 1 94  ? 20.777  0.478   -0.654  1.00 0.00 ? 191 TRP A O    4  
ATOM 7225  C CB   . TRP A 1 94  ? 18.125  -1.434  -0.206  1.00 0.00 ? 191 TRP A CB   4  
ATOM 7226  C CG   . TRP A 1 94  ? 16.977  -2.293  -0.623  1.00 0.00 ? 191 TRP A CG   4  
ATOM 7227  C CD1  . TRP A 1 94  ? 17.035  -3.497  -1.263  1.00 0.00 ? 191 TRP A CD1  4  
ATOM 7228  C CD2  . TRP A 1 94  ? 15.591  -2.008  -0.424  1.00 0.00 ? 191 TRP A CD2  4  
ATOM 7229  N NE1  . TRP A 1 94  ? 15.766  -3.974  -1.479  1.00 0.00 ? 191 TRP A NE1  4  
ATOM 7230  C CE2  . TRP A 1 94  ? 14.863  -3.080  -0.972  1.00 0.00 ? 191 TRP A CE2  4  
ATOM 7231  C CE3  . TRP A 1 94  ? 14.896  -0.950  0.167   1.00 0.00 ? 191 TRP A CE3  4  
ATOM 7232  C CZ2  . TRP A 1 94  ? 13.474  -3.122  -0.950  1.00 0.00 ? 191 TRP A CZ2  4  
ATOM 7233  C CZ3  . TRP A 1 94  ? 13.518  -0.995  0.189   1.00 0.00 ? 191 TRP A CZ3  4  
ATOM 7234  C CH2  . TRP A 1 94  ? 12.819  -2.074  -0.366  1.00 0.00 ? 191 TRP A CH2  4  
ATOM 7235  H H    . TRP A 1 94  ? 20.007  -2.635  -1.393  1.00 0.00 ? 191 TRP A H    4  
ATOM 7236  H HA   . TRP A 1 94  ? 18.199  -0.599  -2.160  1.00 0.00 ? 191 TRP A HA   4  
ATOM 7237  H HB2  . TRP A 1 94  ? 18.796  -2.038  0.386   1.00 0.00 ? 191 TRP A HB2  4  
ATOM 7238  H HB3  . TRP A 1 94  ? 17.738  -0.631  0.404   1.00 0.00 ? 191 TRP A HB3  4  
ATOM 7239  H HD1  . TRP A 1 94  ? 17.951  -3.988  -1.555  1.00 0.00 ? 191 TRP A HD1  4  
ATOM 7240  H HE1  . TRP A 1 94  ? 15.544  -4.822  -1.924  1.00 0.00 ? 191 TRP A HE1  4  
ATOM 7241  H HE3  . TRP A 1 94  ? 15.418  -0.107  0.602   1.00 0.00 ? 191 TRP A HE3  4  
ATOM 7242  H HZ2  . TRP A 1 94  ? 12.920  -3.946  -1.373  1.00 0.00 ? 191 TRP A HZ2  4  
ATOM 7243  H HZ3  . TRP A 1 94  ? 12.960  -0.187  0.642   1.00 0.00 ? 191 TRP A HZ3  4  
ATOM 7244  H HH2  . TRP A 1 94  ? 11.741  -2.064  -0.326  1.00 0.00 ? 191 TRP A HH2  4  
ATOM 7245  N N    . SER A 1 95  ? 18.790  1.512   -0.901  1.00 0.00 ? 192 SER A N    4  
ATOM 7246  C CA   . SER A 1 95  ? 19.241  2.804   -0.423  1.00 0.00 ? 192 SER A CA   4  
ATOM 7247  C C    . SER A 1 95  ? 18.098  3.457   0.352   1.00 0.00 ? 192 SER A C    4  
ATOM 7248  O O    . SER A 1 95  ? 17.833  4.656   0.218   1.00 0.00 ? 192 SER A O    4  
ATOM 7249  C CB   . SER A 1 95  ? 19.688  3.684   -1.602  1.00 0.00 ? 192 SER A CB   4  
ATOM 7250  O OG   . SER A 1 95  ? 20.342  4.863   -1.159  1.00 0.00 ? 192 SER A OG   4  
ATOM 7251  H H    . SER A 1 95  ? 17.863  1.423   -1.203  1.00 0.00 ? 192 SER A H    4  
ATOM 7252  H HA   . SER A 1 95  ? 20.076  2.645   0.244   1.00 0.00 ? 192 SER A HA   4  
ATOM 7253  H HB2  . SER A 1 95  ? 20.369  3.125   -2.225  1.00 0.00 ? 192 SER A HB2  4  
ATOM 7254  H HB3  . SER A 1 95  ? 18.822  3.964   -2.182  1.00 0.00 ? 192 SER A HB3  4  
ATOM 7255  H HG   . SER A 1 95  ? 20.128  5.591   -1.758  1.00 0.00 ? 192 SER A HG   4  
ATOM 7256  N N    . ALA A 1 96  ? 17.411  2.626   1.146   1.00 0.00 ? 193 ALA A N    4  
ATOM 7257  C CA   . ALA A 1 96  ? 16.263  3.046   1.952   1.00 0.00 ? 193 ALA A CA   4  
ATOM 7258  C C    . ALA A 1 96  ? 15.063  3.427   1.082   1.00 0.00 ? 193 ALA A C    4  
ATOM 7259  O O    . ALA A 1 96  ? 15.065  3.215   -0.134  1.00 0.00 ? 193 ALA A O    4  
ATOM 7260  C CB   . ALA A 1 96  ? 16.642  4.189   2.885   1.00 0.00 ? 193 ALA A CB   4  
ATOM 7261  H H    . ALA A 1 96  ? 17.695  1.690   1.196   1.00 0.00 ? 193 ALA A H    4  
ATOM 7262  H HA   . ALA A 1 96  ? 15.978  2.205   2.567   1.00 0.00 ? 193 ALA A HA   4  
ATOM 7263  H HB1  . ALA A 1 96  ? 17.488  3.894   3.488   1.00 0.00 ? 193 ALA A HB1  4  
ATOM 7264  H HB2  . ALA A 1 96  ? 15.806  4.421   3.524   1.00 0.00 ? 193 ALA A HB2  4  
ATOM 7265  H HB3  . ALA A 1 96  ? 16.902  5.058   2.300   1.00 0.00 ? 193 ALA A HB3  4  
ATOM 7266  N N    . TRP A 1 97  ? 14.034  3.970   1.718   1.00 0.00 ? 194 TRP A N    4  
ATOM 7267  C CA   . TRP A 1 97  ? 12.812  4.359   1.026   1.00 0.00 ? 194 TRP A CA   4  
ATOM 7268  C C    . TRP A 1 97  ? 12.811  5.864   0.774   1.00 0.00 ? 194 TRP A C    4  
ATOM 7269  O O    . TRP A 1 97  ? 13.750  6.566   1.164   1.00 0.00 ? 194 TRP A O    4  
ATOM 7270  C CB   . TRP A 1 97  ? 11.588  3.971   1.859   1.00 0.00 ? 194 TRP A CB   4  
ATOM 7271  C CG   . TRP A 1 97  ? 11.530  2.515   2.217   1.00 0.00 ? 194 TRP A CG   4  
ATOM 7272  C CD1  . TRP A 1 97  ? 12.186  1.898   3.244   1.00 0.00 ? 194 TRP A CD1  4  
ATOM 7273  C CD2  . TRP A 1 97  ? 10.765  1.499   1.562   1.00 0.00 ? 194 TRP A CD2  4  
ATOM 7274  N NE1  . TRP A 1 97  ? 11.878  0.561   3.262   1.00 0.00 ? 194 TRP A NE1  4  
ATOM 7275  C CE2  . TRP A 1 97  ? 11.007  0.291   2.242   1.00 0.00 ? 194 TRP A CE2  4  
ATOM 7276  C CE3  . TRP A 1 97  ? 9.899   1.491   0.466   1.00 0.00 ? 194 TRP A CE3  4  
ATOM 7277  C CZ2  . TRP A 1 97  ? 10.413  -0.909  1.864   1.00 0.00 ? 194 TRP A CZ2  4  
ATOM 7278  C CZ3  . TRP A 1 97  ? 9.312   0.298   0.093   1.00 0.00 ? 194 TRP A CZ3  4  
ATOM 7279  C CH2  . TRP A 1 97  ? 9.570   -0.887  0.790   1.00 0.00 ? 194 TRP A CH2  4  
ATOM 7280  H H    . TRP A 1 97  ? 14.098  4.123   2.686   1.00 0.00 ? 194 TRP A H    4  
ATOM 7281  H HA   . TRP A 1 97  ? 12.781  3.840   0.080   1.00 0.00 ? 194 TRP A HA   4  
ATOM 7282  H HB2  . TRP A 1 97  ? 11.596  4.535   2.779   1.00 0.00 ? 194 TRP A HB2  4  
ATOM 7283  H HB3  . TRP A 1 97  ? 10.694  4.214   1.304   1.00 0.00 ? 194 TRP A HB3  4  
ATOM 7284  H HD1  . TRP A 1 97  ? 12.851  2.400   3.930   1.00 0.00 ? 194 TRP A HD1  4  
ATOM 7285  H HE1  . TRP A 1 97  ? 12.226  -0.095  3.906   1.00 0.00 ? 194 TRP A HE1  4  
ATOM 7286  H HE3  . TRP A 1 97  ? 9.687   2.395   -0.085  1.00 0.00 ? 194 TRP A HE3  4  
ATOM 7287  H HZ2  . TRP A 1 97  ? 10.599  -1.832  2.394   1.00 0.00 ? 194 TRP A HZ2  4  
ATOM 7288  H HZ3  . TRP A 1 97  ? 8.639   0.271   -0.750  1.00 0.00 ? 194 TRP A HZ3  4  
ATOM 7289  H HH2  . TRP A 1 97  ? 9.089   -1.796  0.461   1.00 0.00 ? 194 TRP A HH2  4  
ATOM 7290  N N    . SER A 1 98  ? 11.765  6.359   0.118   1.00 0.00 ? 195 SER A N    4  
ATOM 7291  C CA   . SER A 1 98  ? 11.672  7.777   -0.211  1.00 0.00 ? 195 SER A CA   4  
ATOM 7292  C C    . SER A 1 98  ? 10.214  8.240   -0.415  1.00 0.00 ? 195 SER A C    4  
ATOM 7293  O O    . SER A 1 98  ? 9.782   9.188   0.238   1.00 0.00 ? 195 SER A O    4  
ATOM 7294  C CB   . SER A 1 98  ? 12.516  8.106   -1.454  1.00 0.00 ? 195 SER A CB   4  
ATOM 7295  O OG   . SER A 1 98  ? 13.881  7.768   -1.253  1.00 0.00 ? 195 SER A OG   4  
ATOM 7296  H H    . SER A 1 98  ? 11.037  5.761   -0.139  1.00 0.00 ? 195 SER A H    4  
ATOM 7297  H HA   . SER A 1 98  ? 12.079  8.322   0.627   1.00 0.00 ? 195 SER A HA   4  
ATOM 7298  H HB2  . SER A 1 98  ? 12.142  7.552   -2.300  1.00 0.00 ? 195 SER A HB2  4  
ATOM 7299  H HB3  . SER A 1 98  ? 12.447  9.164   -1.661  1.00 0.00 ? 195 SER A HB3  4  
ATOM 7300  H HG   . SER A 1 98  ? 14.001  7.474   -0.339  1.00 0.00 ? 195 SER A HG   4  
ATOM 7301  N N    . PRO A 1 99  ? 9.419   7.587   -1.298  1.00 0.00 ? 196 PRO A N    4  
ATOM 7302  C CA   . PRO A 1 99  ? 8.080   8.069   -1.645  1.00 0.00 ? 196 PRO A CA   4  
ATOM 7303  C C    . PRO A 1 99  ? 7.013   7.648   -0.637  1.00 0.00 ? 196 PRO A C    4  
ATOM 7304  O O    . PRO A 1 99  ? 6.286   6.678   -0.855  1.00 0.00 ? 196 PRO A O    4  
ATOM 7305  C CB   . PRO A 1 99  ? 7.801   7.423   -3.015  1.00 0.00 ? 196 PRO A CB   4  
ATOM 7306  C CG   . PRO A 1 99  ? 8.970   6.532   -3.312  1.00 0.00 ? 196 PRO A CG   4  
ATOM 7307  C CD   . PRO A 1 99  ? 9.717   6.347   -2.021  1.00 0.00 ? 196 PRO A CD   4  
ATOM 7308  H HA   . PRO A 1 99  ? 8.066   9.143   -1.746  1.00 0.00 ? 196 PRO A HA   4  
ATOM 7309  H HB2  . PRO A 1 99  ? 6.884   6.855   -2.961  1.00 0.00 ? 196 PRO A HB2  4  
ATOM 7310  H HB3  . PRO A 1 99  ? 7.701   8.197   -3.761  1.00 0.00 ? 196 PRO A HB3  4  
ATOM 7311  H HG2  . PRO A 1 99  ? 8.618   5.578   -3.676  1.00 0.00 ? 196 PRO A HG2  4  
ATOM 7312  H HG3  . PRO A 1 99  ? 9.607   7.000   -4.048  1.00 0.00 ? 196 PRO A HG3  4  
ATOM 7313  H HD2  . PRO A 1 99  ? 9.342   5.486   -1.486  1.00 0.00 ? 196 PRO A HD2  4  
ATOM 7314  H HD3  . PRO A 1 99  ? 10.775  6.248   -2.202  1.00 0.00 ? 196 PRO A HD3  4  
ATOM 7315  N N    . ALA A 1 100 ? 6.917   8.380   0.468   1.00 0.00 ? 197 ALA A N    4  
ATOM 7316  C CA   . ALA A 1 100 ? 5.913   8.093   1.485   1.00 0.00 ? 197 ALA A CA   4  
ATOM 7317  C C    . ALA A 1 100 ? 4.578   8.715   1.111   1.00 0.00 ? 197 ALA A C    4  
ATOM 7318  O O    . ALA A 1 100 ? 4.384   9.924   1.231   1.00 0.00 ? 197 ALA A O    4  
ATOM 7319  C CB   . ALA A 1 100 ? 6.362   8.583   2.854   1.00 0.00 ? 197 ALA A CB   4  
ATOM 7320  H H    . ALA A 1 100 ? 7.526   9.140   0.593   1.00 0.00 ? 197 ALA A H    4  
ATOM 7321  H HA   . ALA A 1 100 ? 5.791   7.021   1.537   1.00 0.00 ? 197 ALA A HA   4  
ATOM 7322  H HB1  . ALA A 1 100 ? 5.593   8.366   3.581   1.00 0.00 ? 197 ALA A HB1  4  
ATOM 7323  H HB2  . ALA A 1 100 ? 6.535   9.648   2.818   1.00 0.00 ? 197 ALA A HB2  4  
ATOM 7324  H HB3  . ALA A 1 100 ? 7.276   8.076   3.138   1.00 0.00 ? 197 ALA A HB3  4  
ATOM 7325  N N    . THR A 1 101 ? 3.664   7.884   0.649   1.00 0.00 ? 198 THR A N    4  
ATOM 7326  C CA   . THR A 1 101 ? 2.348   8.342   0.252   1.00 0.00 ? 198 THR A CA   4  
ATOM 7327  C C    . THR A 1 101 ? 1.352   8.138   1.390   1.00 0.00 ? 198 THR A C    4  
ATOM 7328  O O    . THR A 1 101 ? 1.374   7.112   2.069   1.00 0.00 ? 198 THR A O    4  
ATOM 7329  C CB   . THR A 1 101 ? 1.875   7.596   -1.006  1.00 0.00 ? 198 THR A CB   4  
ATOM 7330  O OG1  . THR A 1 101 ? 2.850   7.748   -2.047  1.00 0.00 ? 198 THR A OG1  4  
ATOM 7331  C CG2  . THR A 1 101 ? 0.530   8.120   -1.487  1.00 0.00 ? 198 THR A CG2  4  
ATOM 7332  H H    . THR A 1 101 ? 3.876   6.923   0.586   1.00 0.00 ? 198 THR A H    4  
ATOM 7333  H HA   . THR A 1 101 ? 2.413   9.395   0.024   1.00 0.00 ? 198 THR A HA   4  
ATOM 7334  H HB   . THR A 1 101 ? 1.774   6.548   -0.769  1.00 0.00 ? 198 THR A HB   4  
ATOM 7335  H HG1  . THR A 1 101 ? 3.725   7.855   -1.652  1.00 0.00 ? 198 THR A HG1  4  
ATOM 7336  H HG21 . THR A 1 101 ? -0.208  7.983   -0.711  1.00 0.00 ? 198 THR A HG21 4  
ATOM 7337  H HG22 . THR A 1 101 ? 0.227   7.576   -2.370  1.00 0.00 ? 198 THR A HG22 4  
ATOM 7338  H HG23 . THR A 1 101 ? 0.615   9.170   -1.722  1.00 0.00 ? 198 THR A HG23 4  
ATOM 7339  N N    . PHE A 1 102 ? 0.496   9.123   1.604   1.00 0.00 ? 199 PHE A N    4  
ATOM 7340  C CA   . PHE A 1 102 ? -0.474  9.069   2.683   1.00 0.00 ? 199 PHE A CA   4  
ATOM 7341  C C    . PHE A 1 102 ? -1.857  8.722   2.141   1.00 0.00 ? 199 PHE A C    4  
ATOM 7342  O O    . PHE A 1 102 ? -2.322  9.318   1.169   1.00 0.00 ? 199 PHE A O    4  
ATOM 7343  C CB   . PHE A 1 102 ? -0.519  10.411  3.416   1.00 0.00 ? 199 PHE A CB   4  
ATOM 7344  C CG   . PHE A 1 102 ? 0.785   10.801  4.060   1.00 0.00 ? 199 PHE A CG   4  
ATOM 7345  C CD1  . PHE A 1 102 ? 1.783   11.422  3.323   1.00 0.00 ? 199 PHE A CD1  4  
ATOM 7346  C CD2  . PHE A 1 102 ? 1.011   10.552  5.403   1.00 0.00 ? 199 PHE A CD2  4  
ATOM 7347  C CE1  . PHE A 1 102 ? 2.976   11.786  3.914   1.00 0.00 ? 199 PHE A CE1  4  
ATOM 7348  C CE2  . PHE A 1 102 ? 2.203   10.913  5.999   1.00 0.00 ? 199 PHE A CE2  4  
ATOM 7349  C CZ   . PHE A 1 102 ? 3.187   11.529  5.254   1.00 0.00 ? 199 PHE A CZ   4  
ATOM 7350  H H    . PHE A 1 102 ? 0.509   9.907   1.014   1.00 0.00 ? 199 PHE A H    4  
ATOM 7351  H HA   . PHE A 1 102 ? -0.165  8.300   3.372   1.00 0.00 ? 199 PHE A HA   4  
ATOM 7352  H HB2  . PHE A 1 102 ? -0.783  11.186  2.713   1.00 0.00 ? 199 PHE A HB2  4  
ATOM 7353  H HB3  . PHE A 1 102 ? -1.271  10.364  4.189   1.00 0.00 ? 199 PHE A HB3  4  
ATOM 7354  H HD1  . PHE A 1 102 ? 1.620   11.621  2.274   1.00 0.00 ? 199 PHE A HD1  4  
ATOM 7355  H HD2  . PHE A 1 102 ? 0.245   10.067  5.988   1.00 0.00 ? 199 PHE A HD2  4  
ATOM 7356  H HE1  . PHE A 1 102 ? 3.745   12.269  3.329   1.00 0.00 ? 199 PHE A HE1  4  
ATOM 7357  H HE2  . PHE A 1 102 ? 2.366   10.711  7.048   1.00 0.00 ? 199 PHE A HE2  4  
ATOM 7358  H HZ   . PHE A 1 102 ? 4.119   11.813  5.719   1.00 0.00 ? 199 PHE A HZ   4  
ATOM 7359  N N    . ILE A 1 103 ? -2.500  7.752   2.767   1.00 0.00 ? 200 ILE A N    4  
ATOM 7360  C CA   . ILE A 1 103 ? -3.830  7.328   2.362   1.00 0.00 ? 200 ILE A CA   4  
ATOM 7361  C C    . ILE A 1 103 ? -4.720  7.139   3.589   1.00 0.00 ? 200 ILE A C    4  
ATOM 7362  O O    . ILE A 1 103 ? -4.287  6.607   4.608   1.00 0.00 ? 200 ILE A O    4  
ATOM 7363  C CB   . ILE A 1 103 ? -3.770  6.016   1.538   1.00 0.00 ? 200 ILE A CB   4  
ATOM 7364  C CG1  . ILE A 1 103 ? -5.172  5.568   1.111   1.00 0.00 ? 200 ILE A CG1  4  
ATOM 7365  C CG2  . ILE A 1 103 ? -3.075  4.911   2.322   1.00 0.00 ? 200 ILE A CG2  4  
ATOM 7366  C CD1  . ILE A 1 103 ? -5.857  6.532   0.168   1.00 0.00 ? 200 ILE A CD1  4  
ATOM 7367  H H    . ILE A 1 103 ? -2.070  7.304   3.531   1.00 0.00 ? 200 ILE A H    4  
ATOM 7368  H HA   . ILE A 1 103 ? -4.251  8.102   1.739   1.00 0.00 ? 200 ILE A HA   4  
ATOM 7369  H HB   . ILE A 1 103 ? -3.182  6.209   0.651   1.00 0.00 ? 200 ILE A HB   4  
ATOM 7370  H HG12 . ILE A 1 103 ? -5.101  4.614   0.614   1.00 0.00 ? 200 ILE A HG12 4  
ATOM 7371  H HG13 . ILE A 1 103 ? -5.792  5.466   1.991   1.00 0.00 ? 200 ILE A HG13 4  
ATOM 7372  H HG21 . ILE A 1 103 ? -2.060  5.209   2.540   1.00 0.00 ? 200 ILE A HG21 4  
ATOM 7373  H HG22 . ILE A 1 103 ? -3.067  4.005   1.736   1.00 0.00 ? 200 ILE A HG22 4  
ATOM 7374  H HG23 . ILE A 1 103 ? -3.606  4.738   3.245   1.00 0.00 ? 200 ILE A HG23 4  
ATOM 7375  H HD11 . ILE A 1 103 ? -5.983  7.486   0.660   1.00 0.00 ? 200 ILE A HD11 4  
ATOM 7376  H HD12 . ILE A 1 103 ? -6.824  6.139   -0.106  1.00 0.00 ? 200 ILE A HD12 4  
ATOM 7377  H HD13 . ILE A 1 103 ? -5.253  6.659   -0.720  1.00 0.00 ? 200 ILE A HD13 4  
ATOM 7378  N N    . GLN A 1 104 ? -5.952  7.604   3.505   1.00 0.00 ? 201 GLN A N    4  
ATOM 7379  C CA   . GLN A 1 104 ? -6.888  7.465   4.605   1.00 0.00 ? 201 GLN A CA   4  
ATOM 7380  C C    . GLN A 1 104 ? -7.880  6.349   4.354   1.00 0.00 ? 201 GLN A C    4  
ATOM 7381  O O    . GLN A 1 104 ? -8.266  6.089   3.212   1.00 0.00 ? 201 GLN A O    4  
ATOM 7382  C CB   . GLN A 1 104 ? -7.646  8.761   4.841   1.00 0.00 ? 201 GLN A CB   4  
ATOM 7383  C CG   . GLN A 1 104 ? -6.869  9.786   5.638   1.00 0.00 ? 201 GLN A CG   4  
ATOM 7384  C CD   . GLN A 1 104 ? -7.773  10.856  6.198   1.00 0.00 ? 201 GLN A CD   4  
ATOM 7385  O OE1  . GLN A 1 104 ? -7.986  11.899  5.581   1.00 0.00 ? 201 GLN A OE1  4  
ATOM 7386  N NE2  . GLN A 1 104 ? -8.337  10.583  7.362   1.00 0.00 ? 201 GLN A NE2  4  
ATOM 7387  H H    . GLN A 1 104 ? -6.242  8.050   2.681   1.00 0.00 ? 201 GLN A H    4  
ATOM 7388  H HA   . GLN A 1 104 ? -6.320  7.228   5.492   1.00 0.00 ? 201 GLN A HA   4  
ATOM 7389  H HB2  . GLN A 1 104 ? -7.893  9.194   3.883   1.00 0.00 ? 201 GLN A HB2  4  
ATOM 7390  H HB3  . GLN A 1 104 ? -8.559  8.540   5.373   1.00 0.00 ? 201 GLN A HB3  4  
ATOM 7391  H HG2  . GLN A 1 104 ? -6.369  9.289   6.455   1.00 0.00 ? 201 GLN A HG2  4  
ATOM 7392  H HG3  . GLN A 1 104 ? -6.138  10.249  4.994   1.00 0.00 ? 201 GLN A HG3  4  
ATOM 7393  H HE21 . GLN A 1 104 ? -8.137  9.716   7.782   1.00 0.00 ? 201 GLN A HE21 4  
ATOM 7394  H HE22 . GLN A 1 104 ? -8.930  11.255  7.760   1.00 0.00 ? 201 GLN A HE22 4  
ATOM 7395  N N    . ILE A 1 105 ? -8.290  5.694   5.426   1.00 0.00 ? 202 ILE A N    4  
ATOM 7396  C CA   . ILE A 1 105 ? -9.304  4.662   5.341   1.00 0.00 ? 202 ILE A CA   4  
ATOM 7397  C C    . ILE A 1 105 ? -10.666 5.249   5.680   1.00 0.00 ? 202 ILE A C    4  
ATOM 7398  O O    . ILE A 1 105 ? -10.879 5.742   6.793   1.00 0.00 ? 202 ILE A O    4  
ATOM 7399  C CB   . ILE A 1 105 ? -9.000  3.484   6.289   1.00 0.00 ? 202 ILE A CB   4  
ATOM 7400  C CG1  . ILE A 1 105 ? -7.566  2.992   6.082   1.00 0.00 ? 202 ILE A CG1  4  
ATOM 7401  C CG2  . ILE A 1 105 ? -9.985  2.347   6.060   1.00 0.00 ? 202 ILE A CG2  4  
ATOM 7402  C CD1  . ILE A 1 105 ? -7.212  2.757   4.632   1.00 0.00 ? 202 ILE A CD1  4  
ATOM 7403  H H    . ILE A 1 105 ? -7.895  5.906   6.300   1.00 0.00 ? 202 ILE A H    4  
ATOM 7404  H HA   . ILE A 1 105 ? -9.320  4.293   4.326   1.00 0.00 ? 202 ILE A HA   4  
ATOM 7405  H HB   . ILE A 1 105 ? -9.113  3.828   7.305   1.00 0.00 ? 202 ILE A HB   4  
ATOM 7406  H HG12 . ILE A 1 105 ? -6.881  3.728   6.474   1.00 0.00 ? 202 ILE A HG12 4  
ATOM 7407  H HG13 . ILE A 1 105 ? -7.431  2.062   6.613   1.00 0.00 ? 202 ILE A HG13 4  
ATOM 7408  H HG21 . ILE A 1 105 ? -9.879  1.974   5.052   1.00 0.00 ? 202 ILE A HG21 4  
ATOM 7409  H HG22 . ILE A 1 105 ? -10.993 2.711   6.204   1.00 0.00 ? 202 ILE A HG22 4  
ATOM 7410  H HG23 . ILE A 1 105 ? -9.786  1.550   6.763   1.00 0.00 ? 202 ILE A HG23 4  
ATOM 7411  H HD11 . ILE A 1 105 ? -6.209  2.366   4.564   1.00 0.00 ? 202 ILE A HD11 4  
ATOM 7412  H HD12 . ILE A 1 105 ? -7.272  3.694   4.095   1.00 0.00 ? 202 ILE A HD12 4  
ATOM 7413  H HD13 . ILE A 1 105 ? -7.907  2.050   4.202   1.00 0.00 ? 202 ILE A HD13 4  
ATOM 7414  N N    . PRO A 1 106 ? -11.600 5.212   4.720   1.00 0.00 ? 203 PRO A N    4  
ATOM 7415  C CA   . PRO A 1 106 ? -12.935 5.792   4.884   1.00 0.00 ? 203 PRO A CA   4  
ATOM 7416  C C    . PRO A 1 106 ? -13.720 5.117   6.001   1.00 0.00 ? 203 PRO A C    4  
ATOM 7417  O O    . PRO A 1 106 ? -13.491 3.953   6.329   1.00 0.00 ? 203 PRO A O    4  
ATOM 7418  C CB   . PRO A 1 106 ? -13.610 5.537   3.531   1.00 0.00 ? 203 PRO A CB   4  
ATOM 7419  C CG   . PRO A 1 106 ? -12.840 4.422   2.916   1.00 0.00 ? 203 PRO A CG   4  
ATOM 7420  C CD   . PRO A 1 106 ? -11.430 4.586   3.396   1.00 0.00 ? 203 PRO A CD   4  
ATOM 7421  H HA   . PRO A 1 106 ? -12.885 6.854   5.072   1.00 0.00 ? 203 PRO A HA   4  
ATOM 7422  H HB2  . PRO A 1 106 ? -14.643 5.264   3.687   1.00 0.00 ? 203 PRO A HB2  4  
ATOM 7423  H HB3  . PRO A 1 106 ? -13.559 6.431   2.926   1.00 0.00 ? 203 PRO A HB3  4  
ATOM 7424  H HG2  . PRO A 1 106 ? -13.241 3.474   3.242   1.00 0.00 ? 203 PRO A HG2  4  
ATOM 7425  H HG3  . PRO A 1 106 ? -12.880 4.497   1.839   1.00 0.00 ? 203 PRO A HG3  4  
ATOM 7426  H HD2  . PRO A 1 106 ? -10.948 3.624   3.481   1.00 0.00 ? 203 PRO A HD2  4  
ATOM 7427  H HD3  . PRO A 1 106 ? -10.875 5.233   2.733   1.00 0.00 ? 203 PRO A HD3  4  
ATOM 7428  N N    . SER A 1 107 ? -14.645 5.864   6.586   1.00 0.00 ? 204 SER A N    4  
ATOM 7429  C CA   . SER A 1 107 ? -15.494 5.346   7.643   1.00 0.00 ? 204 SER A CA   4  
ATOM 7430  C C    . SER A 1 107 ? -16.486 4.346   7.067   1.00 0.00 ? 204 SER A C    4  
ATOM 7431  O O    . SER A 1 107 ? -16.986 3.471   7.768   1.00 0.00 ? 204 SER A O    4  
ATOM 7432  C CB   . SER A 1 107 ? -16.228 6.497   8.331   1.00 0.00 ? 204 SER A CB   4  
ATOM 7433  O OG   . SER A 1 107 ? -15.304 7.463   8.813   1.00 0.00 ? 204 SER A OG   4  
ATOM 7434  H H    . SER A 1 107 ? -14.764 6.794   6.293   1.00 0.00 ? 204 SER A H    4  
ATOM 7435  H HA   . SER A 1 107 ? -14.865 4.844   8.363   1.00 0.00 ? 204 SER A HA   4  
ATOM 7436  H HB2  . SER A 1 107 ? -16.891 6.973   7.624   1.00 0.00 ? 204 SER A HB2  4  
ATOM 7437  H HB3  . SER A 1 107 ? -16.800 6.114   9.162   1.00 0.00 ? 204 SER A HB3  4  
ATOM 7438  H HG   . SER A 1 107 ? -14.455 7.348   8.365   1.00 0.00 ? 204 SER A HG   4  
ATOM 7439  N N    . ASP A 1 108 ? -16.741 4.471   5.770   1.00 0.00 ? 205 ASP A N    4  
ATOM 7440  C CA   . ASP A 1 108 ? -17.617 3.546   5.063   1.00 0.00 ? 205 ASP A CA   4  
ATOM 7441  C C    . ASP A 1 108 ? -16.787 2.442   4.425   1.00 0.00 ? 205 ASP A C    4  
ATOM 7442  O O    . ASP A 1 108 ? -17.096 1.968   3.333   1.00 0.00 ? 205 ASP A O    4  
ATOM 7443  C CB   . ASP A 1 108 ? -18.415 4.274   3.976   1.00 0.00 ? 205 ASP A CB   4  
ATOM 7444  C CG   . ASP A 1 108 ? -19.165 5.477   4.501   1.00 0.00 ? 205 ASP A CG   4  
ATOM 7445  O OD1  . ASP A 1 108 ? -20.234 5.299   5.115   1.00 0.00 ? 205 ASP A OD1  4  
ATOM 7446  O OD2  . ASP A 1 108 ? -18.689 6.613   4.294   1.00 0.00 ? 205 ASP A OD2  4  
ATOM 7447  H H    . ASP A 1 108 ? -16.328 5.210   5.275   1.00 0.00 ? 205 ASP A H    4  
ATOM 7448  H HA   . ASP A 1 108 ? -18.298 3.111   5.779   1.00 0.00 ? 205 ASP A HA   4  
ATOM 7449  H HB2  . ASP A 1 108 ? -17.737 4.610   3.207   1.00 0.00 ? 205 ASP A HB2  4  
ATOM 7450  H HB3  . ASP A 1 108 ? -19.129 3.588   3.545   1.00 0.00 ? 205 ASP A HB3  4  
ATOM 7451  N N    . PHE A 1 109 ? -15.714 2.056   5.101   1.00 0.00 ? 206 PHE A N    4  
ATOM 7452  C CA   . PHE A 1 109 ? -14.807 1.041   4.587   1.00 0.00 ? 206 PHE A CA   4  
ATOM 7453  C C    . PHE A 1 109 ? -15.469 -0.329  4.592   1.00 0.00 ? 206 PHE A C    4  
ATOM 7454  O O    . PHE A 1 109 ? -15.475 -1.024  3.581   1.00 0.00 ? 206 PHE A O    4  
ATOM 7455  C CB   . PHE A 1 109 ? -13.524 1.007   5.418   1.00 0.00 ? 206 PHE A CB   4  
ATOM 7456  C CG   . PHE A 1 109 ? -12.537 -0.041  4.979   1.00 0.00 ? 206 PHE A CG   4  
ATOM 7457  C CD1  . PHE A 1 109 ? -11.744 0.161   3.860   1.00 0.00 ? 206 PHE A CD1  4  
ATOM 7458  C CD2  . PHE A 1 109 ? -12.409 -1.230  5.681   1.00 0.00 ? 206 PHE A CD2  4  
ATOM 7459  C CE1  . PHE A 1 109 ? -10.841 -0.801  3.453   1.00 0.00 ? 206 PHE A CE1  4  
ATOM 7460  C CE2  . PHE A 1 109 ? -11.507 -2.194  5.278   1.00 0.00 ? 206 PHE A CE2  4  
ATOM 7461  C CZ   . PHE A 1 109 ? -10.723 -1.979  4.162   1.00 0.00 ? 206 PHE A CZ   4  
ATOM 7462  H H    . PHE A 1 109 ? -15.526 2.469   5.971   1.00 0.00 ? 206 PHE A H    4  
ATOM 7463  H HA   . PHE A 1 109 ? -14.560 1.304   3.569   1.00 0.00 ? 206 PHE A HA   4  
ATOM 7464  H HB2  . PHE A 1 109 ? -13.036 1.968   5.350   1.00 0.00 ? 206 PHE A HB2  4  
ATOM 7465  H HB3  . PHE A 1 109 ? -13.778 0.813   6.449   1.00 0.00 ? 206 PHE A HB3  4  
ATOM 7466  H HD1  . PHE A 1 109 ? -11.833 1.084   3.307   1.00 0.00 ? 206 PHE A HD1  4  
ATOM 7467  H HD2  . PHE A 1 109 ? -13.023 -1.398  6.554   1.00 0.00 ? 206 PHE A HD2  4  
ATOM 7468  H HE1  . PHE A 1 109 ? -10.227 -0.632  2.581   1.00 0.00 ? 206 PHE A HE1  4  
ATOM 7469  H HE2  . PHE A 1 109 ? -11.415 -3.115  5.834   1.00 0.00 ? 206 PHE A HE2  4  
ATOM 7470  H HZ   . PHE A 1 109 ? -10.017 -2.732  3.845   1.00 0.00 ? 206 PHE A HZ   4  
ATOM 7471  N N    . THR A 1 110 ? -16.030 -0.703  5.732   1.00 0.00 ? 207 THR A N    4  
ATOM 7472  C CA   . THR A 1 110 ? -16.635 -2.015  5.885   1.00 0.00 ? 207 THR A CA   4  
ATOM 7473  C C    . THR A 1 110 ? -17.855 -2.165  4.984   1.00 0.00 ? 207 THR A C    4  
ATOM 7474  O O    . THR A 1 110 ? -18.599 -1.209  4.745   1.00 0.00 ? 207 THR A O    4  
ATOM 7475  C CB   . THR A 1 110 ? -17.031 -2.294  7.354   1.00 0.00 ? 207 THR A CB   4  
ATOM 7476  O OG1  . THR A 1 110 ? -17.669 -3.572  7.463   1.00 0.00 ? 207 THR A OG1  4  
ATOM 7477  C CG2  . THR A 1 110 ? -17.957 -1.213  7.896   1.00 0.00 ? 207 THR A CG2  4  
ATOM 7478  H H    . THR A 1 110 ? -16.048 -0.078  6.484   1.00 0.00 ? 207 THR A H    4  
ATOM 7479  H HA   . THR A 1 110 ? -15.898 -2.749  5.591   1.00 0.00 ? 207 THR A HA   4  
ATOM 7480  H HB   . THR A 1 110 ? -16.131 -2.304  7.950   1.00 0.00 ? 207 THR A HB   4  
ATOM 7481  H HG1  . THR A 1 110 ? -17.548 -3.916  8.358   1.00 0.00 ? 207 THR A HG1  4  
ATOM 7482  H HG21 . THR A 1 110 ? -17.458 -0.256  7.854   1.00 0.00 ? 207 THR A HG21 4  
ATOM 7483  H HG22 . THR A 1 110 ? -18.216 -1.439  8.920   1.00 0.00 ? 207 THR A HG22 4  
ATOM 7484  H HG23 . THR A 1 110 ? -18.855 -1.175  7.297   1.00 0.00 ? 207 THR A HG23 4  
ATOM 7485  N N    . MET A 1 111 ? -18.038 -3.365  4.463   1.00 0.00 ? 208 MET A N    4  
ATOM 7486  C CA   . MET A 1 111 ? -19.184 -3.669  3.624   1.00 0.00 ? 208 MET A CA   4  
ATOM 7487  C C    . MET A 1 111 ? -20.058 -4.707  4.308   1.00 0.00 ? 208 MET A C    4  
ATOM 7488  O O    . MET A 1 111 ? -21.003 -5.237  3.722   1.00 0.00 ? 208 MET A O    4  
ATOM 7489  C CB   . MET A 1 111 ? -18.736 -4.174  2.252   1.00 0.00 ? 208 MET A CB   4  
ATOM 7490  C CG   . MET A 1 111 ? -17.897 -3.166  1.481   1.00 0.00 ? 208 MET A CG   4  
ATOM 7491  S SD   . MET A 1 111 ? -17.498 -3.722  -0.184  1.00 0.00 ? 208 MET A SD   4  
ATOM 7492  C CE   . MET A 1 111 ? -19.123 -3.730  -0.938  1.00 0.00 ? 208 MET A CE   4  
ATOM 7493  H H    . MET A 1 111 ? -17.383 -4.074  4.657   1.00 0.00 ? 208 MET A H    4  
ATOM 7494  H HA   . MET A 1 111 ? -19.755 -2.761  3.498   1.00 0.00 ? 208 MET A HA   4  
ATOM 7495  H HB2  . MET A 1 111 ? -18.149 -5.071  2.386   1.00 0.00 ? 208 MET A HB2  4  
ATOM 7496  H HB3  . MET A 1 111 ? -19.609 -4.409  1.664   1.00 0.00 ? 208 MET A HB3  4  
ATOM 7497  H HG2  . MET A 1 111 ? -18.447 -2.241  1.412   1.00 0.00 ? 208 MET A HG2  4  
ATOM 7498  H HG3  . MET A 1 111 ? -16.977 -2.997  2.020   1.00 0.00 ? 208 MET A HG3  4  
ATOM 7499  H HE1  . MET A 1 111 ? -19.556 -2.742  -0.871  1.00 0.00 ? 208 MET A HE1  4  
ATOM 7500  H HE2  . MET A 1 111 ? -19.756 -4.436  -0.422  1.00 0.00 ? 208 MET A HE2  4  
ATOM 7501  H HE3  . MET A 1 111 ? -19.037 -4.014  -1.976  1.00 0.00 ? 208 MET A HE3  4  
ATOM 7502  N N    . ASN A 1 112 ? -19.733 -4.988  5.559   1.00 0.00 ? 209 ASN A N    4  
ATOM 7503  C CA   . ASN A 1 112 ? -20.498 -5.927  6.361   1.00 0.00 ? 209 ASN A CA   4  
ATOM 7504  C C    . ASN A 1 112 ? -20.724 -5.350  7.749   1.00 0.00 ? 209 ASN A C    4  
ATOM 7505  O O    . ASN A 1 112 ? -19.950 -5.604  8.675   1.00 0.00 ? 209 ASN A O    4  
ATOM 7506  C CB   . ASN A 1 112 ? -19.772 -7.270  6.462   1.00 0.00 ? 209 ASN A CB   4  
ATOM 7507  C CG   . ASN A 1 112 ? -20.565 -8.295  7.250   1.00 0.00 ? 209 ASN A CG   4  
ATOM 7508  O OD1  . ASN A 1 112 ? -21.798 -8.295  7.234   1.00 0.00 ? 209 ASN A OD1  4  
ATOM 7509  N ND2  . ASN A 1 112 ? -19.864 -9.173  7.947   1.00 0.00 ? 209 ASN A ND2  4  
ATOM 7510  H H    . ASN A 1 112 ? -18.955 -4.542  5.962   1.00 0.00 ? 209 ASN A H    4  
ATOM 7511  H HA   . ASN A 1 112 ? -21.454 -6.075  5.881   1.00 0.00 ? 209 ASN A HA   4  
ATOM 7512  H HB2  . ASN A 1 112 ? -19.604 -7.659  5.469   1.00 0.00 ? 209 ASN A HB2  4  
ATOM 7513  H HB3  . ASN A 1 112 ? -18.821 -7.122  6.953   1.00 0.00 ? 209 ASN A HB3  4  
ATOM 7514  H HD21 . ASN A 1 112 ? -18.884 -9.116  7.915   1.00 0.00 ? 209 ASN A HD21 4  
ATOM 7515  H HD22 . ASN A 1 112 ? -20.352 -9.844  8.471   1.00 0.00 ? 209 ASN A HD22 4  
ATOM 7516  N N    . ASP A 1 113 ? -21.777 -4.563  7.883   1.00 0.00 ? 210 ASP A N    4  
ATOM 7517  C CA   . ASP A 1 113 ? -22.080 -3.899  9.139   1.00 0.00 ? 210 ASP A CA   4  
ATOM 7518  C C    . ASP A 1 113 ? -23.582 -3.816  9.345   1.00 0.00 ? 210 ASP A C    4  
ATOM 7519  O O    . ASP A 1 113 ? -24.243 -3.065  8.599   1.00 0.00 ? 210 ASP A O    4  
ATOM 7520  C CB   . ASP A 1 113 ? -21.469 -2.498  9.159   1.00 0.00 ? 210 ASP A CB   4  
ATOM 7521  C CG   . ASP A 1 113 ? -21.765 -1.759  10.445  1.00 0.00 ? 210 ASP A CG   4  
ATOM 7522  O OD1  . ASP A 1 113 ? -21.293 -2.205  11.510  1.00 0.00 ? 210 ASP A OD1  4  
ATOM 7523  O OD2  . ASP A 1 113 ? -22.466 -0.723  10.397  1.00 0.00 ? 210 ASP A OD2  4  
ATOM 7524  O OXT  . ASP A 1 113 ? -24.103 -4.511  10.241  1.00 0.00 ? 210 ASP A OXT  4  
ATOM 7525  H H    . ASP A 1 113 ? -22.375 -4.427  7.116   1.00 0.00 ? 210 ASP A H    4  
ATOM 7526  H HA   . ASP A 1 113 ? -21.649 -4.484  9.937   1.00 0.00 ? 210 ASP A HA   4  
ATOM 7527  H HB2  . ASP A 1 113 ? -20.398 -2.578  9.049   1.00 0.00 ? 210 ASP A HB2  4  
ATOM 7528  H HB3  . ASP A 1 113 ? -21.871 -1.926  8.336   1.00 0.00 ? 210 ASP A HB3  4  
ATOM 7529  N N    . MET A 1 1   ? 32.172  1.867   -13.213 1.00 0.00 ? 98  MET A N    5  
ATOM 7530  C CA   . MET A 1 1   ? 32.618  2.826   -12.174 1.00 0.00 ? 98  MET A CA   5  
ATOM 7531  C C    . MET A 1 1   ? 31.420  3.437   -11.468 1.00 0.00 ? 98  MET A C    5  
ATOM 7532  O O    . MET A 1 1   ? 30.533  3.999   -12.116 1.00 0.00 ? 98  MET A O    5  
ATOM 7533  C CB   . MET A 1 1   ? 33.478  3.934   -12.785 1.00 0.00 ? 98  MET A CB   5  
ATOM 7534  C CG   . MET A 1 1   ? 34.848  3.466   -13.244 1.00 0.00 ? 98  MET A CG   5  
ATOM 7535  S SD   . MET A 1 1   ? 35.822  2.751   -11.904 1.00 0.00 ? 98  MET A SD   5  
ATOM 7536  C CE   . MET A 1 1   ? 37.343  2.365   -12.768 1.00 0.00 ? 98  MET A CE   5  
ATOM 7537  H H1   . MET A 1 1   ? 31.624  1.099   -12.775 1.00 0.00 ? 98  MET A H1   5  
ATOM 7538  H H2   . MET A 1 1   ? 32.993  1.452   -13.698 1.00 0.00 ? 98  MET A H2   5  
ATOM 7539  H H3   . MET A 1 1   ? 31.573  2.348   -13.914 1.00 0.00 ? 98  MET A H3   5  
ATOM 7540  H HA   . MET A 1 1   ? 33.206  2.283   -11.448 1.00 0.00 ? 98  MET A HA   5  
ATOM 7541  H HB2  . MET A 1 1   ? 32.959  4.349   -13.636 1.00 0.00 ? 98  MET A HB2  5  
ATOM 7542  H HB3  . MET A 1 1   ? 33.617  4.711   -12.048 1.00 0.00 ? 98  MET A HB3  5  
ATOM 7543  H HG2  . MET A 1 1   ? 34.719  2.722   -14.013 1.00 0.00 ? 98  MET A HG2  5  
ATOM 7544  H HG3  . MET A 1 1   ? 35.383  4.310   -13.649 1.00 0.00 ? 98  MET A HG3  5  
ATOM 7545  H HE1  . MET A 1 1   ? 38.052  1.937   -12.074 1.00 0.00 ? 98  MET A HE1  5  
ATOM 7546  H HE2  . MET A 1 1   ? 37.756  3.269   -13.191 1.00 0.00 ? 98  MET A HE2  5  
ATOM 7547  H HE3  . MET A 1 1   ? 37.140  1.657   -13.558 1.00 0.00 ? 98  MET A HE3  5  
ATOM 7548  N N    . TYR A 1 2   ? 31.411  3.314   -10.143 1.00 0.00 ? 99  TYR A N    5  
ATOM 7549  C CA   . TYR A 1 2   ? 30.326  3.802   -9.296  1.00 0.00 ? 99  TYR A CA   5  
ATOM 7550  C C    . TYR A 1 2   ? 29.046  2.993   -9.497  1.00 0.00 ? 99  TYR A C    5  
ATOM 7551  O O    . TYR A 1 2   ? 28.582  2.789   -10.621 1.00 0.00 ? 99  TYR A O    5  
ATOM 7552  C CB   . TYR A 1 2   ? 30.058  5.300   -9.517  1.00 0.00 ? 99  TYR A CB   5  
ATOM 7553  C CG   . TYR A 1 2   ? 28.764  5.774   -8.887  1.00 0.00 ? 99  TYR A CG   5  
ATOM 7554  C CD1  . TYR A 1 2   ? 28.490  5.535   -7.545  1.00 0.00 ? 99  TYR A CD1  5  
ATOM 7555  C CD2  . TYR A 1 2   ? 27.804  6.433   -9.643  1.00 0.00 ? 99  TYR A CD2  5  
ATOM 7556  C CE1  . TYR A 1 2   ? 27.299  5.940   -6.976  1.00 0.00 ? 99  TYR A CE1  5  
ATOM 7557  C CE2  . TYR A 1 2   ? 26.610  6.841   -9.081  1.00 0.00 ? 99  TYR A CE2  5  
ATOM 7558  C CZ   . TYR A 1 2   ? 26.363  6.593   -7.749  1.00 0.00 ? 99  TYR A CZ   5  
ATOM 7559  O OH   . TYR A 1 2   ? 25.171  6.993   -7.187  1.00 0.00 ? 99  TYR A OH   5  
ATOM 7560  H H    . TYR A 1 2   ? 32.174  2.873   -9.712  1.00 0.00 ? 99  TYR A H    5  
ATOM 7561  H HA   . TYR A 1 2   ? 30.645  3.665   -8.275  1.00 0.00 ? 99  TYR A HA   5  
ATOM 7562  H HB2  . TYR A 1 2   ? 30.866  5.872   -9.088  1.00 0.00 ? 99  TYR A HB2  5  
ATOM 7563  H HB3  . TYR A 1 2   ? 30.005  5.496   -10.577 1.00 0.00 ? 99  TYR A HB3  5  
ATOM 7564  H HD1  . TYR A 1 2   ? 29.225  5.024   -6.943  1.00 0.00 ? 99  TYR A HD1  5  
ATOM 7565  H HD2  . TYR A 1 2   ? 27.999  6.628   -10.688 1.00 0.00 ? 99  TYR A HD2  5  
ATOM 7566  H HE1  . TYR A 1 2   ? 27.101  5.736   -5.935  1.00 0.00 ? 99  TYR A HE1  5  
ATOM 7567  H HE2  . TYR A 1 2   ? 25.874  7.350   -9.687  1.00 0.00 ? 99  TYR A HE2  5  
ATOM 7568  H HH   . TYR A 1 2   ? 24.470  6.948   -7.858  1.00 0.00 ? 99  TYR A HH   5  
ATOM 7569  N N    . ILE A 1 3   ? 28.494  2.519   -8.391  1.00 0.00 ? 100 ILE A N    5  
ATOM 7570  C CA   . ILE A 1 3   ? 27.211  1.841   -8.401  1.00 0.00 ? 100 ILE A CA   5  
ATOM 7571  C C    . ILE A 1 3   ? 26.096  2.850   -8.663  1.00 0.00 ? 100 ILE A C    5  
ATOM 7572  O O    . ILE A 1 3   ? 25.582  3.480   -7.734  1.00 0.00 ? 100 ILE A O    5  
ATOM 7573  C CB   . ILE A 1 3   ? 26.945  1.127   -7.057  1.00 0.00 ? 100 ILE A CB   5  
ATOM 7574  C CG1  . ILE A 1 3   ? 28.075  0.142   -6.715  1.00 0.00 ? 100 ILE A CG1  5  
ATOM 7575  C CG2  . ILE A 1 3   ? 25.602  0.420   -7.091  1.00 0.00 ? 100 ILE A CG2  5  
ATOM 7576  C CD1  . ILE A 1 3   ? 28.267  -0.976  -7.721  1.00 0.00 ? 100 ILE A CD1  5  
ATOM 7577  H H    . ILE A 1 3   ? 28.968  2.630   -7.538  1.00 0.00 ? 100 ILE A H    5  
ATOM 7578  H HA   . ILE A 1 3   ? 27.215  1.109   -9.193  1.00 0.00 ? 100 ILE A HA   5  
ATOM 7579  H HB   . ILE A 1 3   ? 26.898  1.882   -6.287  1.00 0.00 ? 100 ILE A HB   5  
ATOM 7580  H HG12 . ILE A 1 3   ? 29.005  0.685   -6.652  1.00 0.00 ? 100 ILE A HG12 5  
ATOM 7581  H HG13 . ILE A 1 3   ? 27.865  -0.309  -5.756  1.00 0.00 ? 100 ILE A HG13 5  
ATOM 7582  H HG21 . ILE A 1 3   ? 24.823  1.151   -7.252  1.00 0.00 ? 100 ILE A HG21 5  
ATOM 7583  H HG22 . ILE A 1 3   ? 25.437  -0.083  -6.151  1.00 0.00 ? 100 ILE A HG22 5  
ATOM 7584  H HG23 . ILE A 1 3   ? 25.592  -0.300  -7.894  1.00 0.00 ? 100 ILE A HG23 5  
ATOM 7585  H HD11 . ILE A 1 3   ? 27.316  -1.446  -7.927  1.00 0.00 ? 100 ILE A HD11 5  
ATOM 7586  H HD12 . ILE A 1 3   ? 28.949  -1.708  -7.315  1.00 0.00 ? 100 ILE A HD12 5  
ATOM 7587  H HD13 . ILE A 1 3   ? 28.680  -0.576  -8.635  1.00 0.00 ? 100 ILE A HD13 5  
ATOM 7588  N N    . VAL A 1 4   ? 25.740  3.016   -9.927  1.00 0.00 ? 101 VAL A N    5  
ATOM 7589  C CA   . VAL A 1 4   ? 24.748  4.010   -10.314 1.00 0.00 ? 101 VAL A CA   5  
ATOM 7590  C C    . VAL A 1 4   ? 23.363  3.643   -9.788  1.00 0.00 ? 101 VAL A C    5  
ATOM 7591  O O    . VAL A 1 4   ? 23.011  2.465   -9.668  1.00 0.00 ? 101 VAL A O    5  
ATOM 7592  C CB   . VAL A 1 4   ? 24.694  4.211   -11.846 1.00 0.00 ? 101 VAL A CB   5  
ATOM 7593  C CG1  . VAL A 1 4   ? 26.013  4.771   -12.357 1.00 0.00 ? 101 VAL A CG1  5  
ATOM 7594  C CG2  . VAL A 1 4   ? 24.354  2.913   -12.560 1.00 0.00 ? 101 VAL A CG2  5  
ATOM 7595  H H    . VAL A 1 4   ? 26.147  2.450   -10.618 1.00 0.00 ? 101 VAL A H    5  
ATOM 7596  H HA   . VAL A 1 4   ? 25.044  4.949   -9.867  1.00 0.00 ? 101 VAL A HA   5  
ATOM 7597  H HB   . VAL A 1 4   ? 23.919  4.930   -12.064 1.00 0.00 ? 101 VAL A HB   5  
ATOM 7598  H HG11 . VAL A 1 4   ? 26.811  4.079   -12.132 1.00 0.00 ? 101 VAL A HG11 5  
ATOM 7599  H HG12 . VAL A 1 4   ? 26.211  5.718   -11.878 1.00 0.00 ? 101 VAL A HG12 5  
ATOM 7600  H HG13 . VAL A 1 4   ? 25.951  4.915   -13.426 1.00 0.00 ? 101 VAL A HG13 5  
ATOM 7601  H HG21 . VAL A 1 4   ? 24.311  3.090   -13.625 1.00 0.00 ? 101 VAL A HG21 5  
ATOM 7602  H HG22 . VAL A 1 4   ? 23.397  2.555   -12.215 1.00 0.00 ? 101 VAL A HG22 5  
ATOM 7603  H HG23 . VAL A 1 4   ? 25.115  2.176   -12.348 1.00 0.00 ? 101 VAL A HG23 5  
ATOM 7604  N N    . GLN A 1 5   ? 22.593  4.666   -9.454  1.00 0.00 ? 102 GLN A N    5  
ATOM 7605  C CA   . GLN A 1 5   ? 21.276  4.484   -8.869  1.00 0.00 ? 102 GLN A CA   5  
ATOM 7606  C C    . GLN A 1 5   ? 20.232  4.239   -9.952  1.00 0.00 ? 102 GLN A C    5  
ATOM 7607  O O    . GLN A 1 5   ? 20.270  4.858   -11.019 1.00 0.00 ? 102 GLN A O    5  
ATOM 7608  C CB   . GLN A 1 5   ? 20.884  5.705   -8.018  1.00 0.00 ? 102 GLN A CB   5  
ATOM 7609  C CG   . GLN A 1 5   ? 20.785  7.019   -8.788  1.00 0.00 ? 102 GLN A CG   5  
ATOM 7610  C CD   . GLN A 1 5   ? 22.106  7.767   -8.890  1.00 0.00 ? 102 GLN A CD   5  
ATOM 7611  O OE1  . GLN A 1 5   ? 23.182  7.172   -8.893  1.00 0.00 ? 102 GLN A OE1  5  
ATOM 7612  N NE2  . GLN A 1 5   ? 22.032  9.085   -8.967  1.00 0.00 ? 102 GLN A NE2  5  
ATOM 7613  H H    . GLN A 1 5   ? 22.918  5.580   -9.612  1.00 0.00 ? 102 GLN A H    5  
ATOM 7614  H HA   . GLN A 1 5   ? 21.319  3.615   -8.230  1.00 0.00 ? 102 GLN A HA   5  
ATOM 7615  H HB2  . GLN A 1 5   ? 19.924  5.513   -7.562  1.00 0.00 ? 102 GLN A HB2  5  
ATOM 7616  H HB3  . GLN A 1 5   ? 21.619  5.829   -7.237  1.00 0.00 ? 102 GLN A HB3  5  
ATOM 7617  H HG2  . GLN A 1 5   ? 20.438  6.806   -9.788  1.00 0.00 ? 102 GLN A HG2  5  
ATOM 7618  H HG3  . GLN A 1 5   ? 20.066  7.656   -8.292  1.00 0.00 ? 102 GLN A HG3  5  
ATOM 7619  H HE21 . GLN A 1 5   ? 21.142  9.500   -8.955  1.00 0.00 ? 102 GLN A HE21 5  
ATOM 7620  H HE22 . GLN A 1 5   ? 22.866  9.594   -9.041  1.00 0.00 ? 102 GLN A HE22 5  
ATOM 7621  N N    . PRO A 1 6   ? 19.301  3.309   -9.694  1.00 0.00 ? 103 PRO A N    5  
ATOM 7622  C CA   . PRO A 1 6   ? 18.206  3.001   -10.615 1.00 0.00 ? 103 PRO A CA   5  
ATOM 7623  C C    . PRO A 1 6   ? 17.088  4.034   -10.529 1.00 0.00 ? 103 PRO A C    5  
ATOM 7624  O O    . PRO A 1 6   ? 17.203  5.032   -9.815  1.00 0.00 ? 103 PRO A O    5  
ATOM 7625  C CB   . PRO A 1 6   ? 17.715  1.642   -10.116 1.00 0.00 ? 103 PRO A CB   5  
ATOM 7626  C CG   . PRO A 1 6   ? 17.987  1.666   -8.654  1.00 0.00 ? 103 PRO A CG   5  
ATOM 7627  C CD   . PRO A 1 6   ? 19.246  2.474   -8.476  1.00 0.00 ? 103 PRO A CD   5  
ATOM 7628  H HA   . PRO A 1 6   ? 18.549  2.918   -11.635 1.00 0.00 ? 103 PRO A HA   5  
ATOM 7629  H HB2  . PRO A 1 6   ? 16.660  1.538   -10.323 1.00 0.00 ? 103 PRO A HB2  5  
ATOM 7630  H HB3  . PRO A 1 6   ? 18.265  0.853   -10.607 1.00 0.00 ? 103 PRO A HB3  5  
ATOM 7631  H HG2  . PRO A 1 6   ? 17.164  2.138   -8.136  1.00 0.00 ? 103 PRO A HG2  5  
ATOM 7632  H HG3  . PRO A 1 6   ? 18.132  0.660   -8.289  1.00 0.00 ? 103 PRO A HG3  5  
ATOM 7633  H HD2  . PRO A 1 6   ? 19.177  3.089   -7.591  1.00 0.00 ? 103 PRO A HD2  5  
ATOM 7634  H HD3  . PRO A 1 6   ? 20.105  1.823   -8.418  1.00 0.00 ? 103 PRO A HD3  5  
ATOM 7635  N N    . ASP A 1 7   ? 16.003  3.784   -11.246 1.00 0.00 ? 104 ASP A N    5  
ATOM 7636  C CA   . ASP A 1 7   ? 14.872  4.698   -11.264 1.00 0.00 ? 104 ASP A CA   5  
ATOM 7637  C C    . ASP A 1 7   ? 13.733  4.127   -10.427 1.00 0.00 ? 104 ASP A C    5  
ATOM 7638  O O    . ASP A 1 7   ? 13.086  3.163   -10.826 1.00 0.00 ? 104 ASP A O    5  
ATOM 7639  C CB   . ASP A 1 7   ? 14.405  4.951   -12.699 1.00 0.00 ? 104 ASP A CB   5  
ATOM 7640  C CG   . ASP A 1 7   ? 13.341  6.025   -12.777 1.00 0.00 ? 104 ASP A CG   5  
ATOM 7641  O OD1  . ASP A 1 7   ? 13.639  7.188   -12.426 1.00 0.00 ? 104 ASP A OD1  5  
ATOM 7642  O OD2  . ASP A 1 7   ? 12.210  5.726   -13.209 1.00 0.00 ? 104 ASP A OD2  5  
ATOM 7643  H H    . ASP A 1 7   ? 15.952  2.956   -11.759 1.00 0.00 ? 104 ASP A H    5  
ATOM 7644  H HA   . ASP A 1 7   ? 15.193  5.631   -10.828 1.00 0.00 ? 104 ASP A HA   5  
ATOM 7645  H HB2  . ASP A 1 7   ? 15.250  5.263   -13.296 1.00 0.00 ? 104 ASP A HB2  5  
ATOM 7646  H HB3  . ASP A 1 7   ? 14.000  4.037   -13.108 1.00 0.00 ? 104 ASP A HB3  5  
ATOM 7647  N N    . PRO A 1 8   ? 13.498  4.703   -9.241  1.00 0.00 ? 105 PRO A N    5  
ATOM 7648  C CA   . PRO A 1 8   ? 12.486  4.213   -8.294  1.00 0.00 ? 105 PRO A CA   5  
ATOM 7649  C C    . PRO A 1 8   ? 11.061  4.326   -8.839  1.00 0.00 ? 105 PRO A C    5  
ATOM 7650  O O    . PRO A 1 8   ? 10.746  5.254   -9.593  1.00 0.00 ? 105 PRO A O    5  
ATOM 7651  C CB   . PRO A 1 8   ? 12.665  5.127   -7.073  1.00 0.00 ? 105 PRO A CB   5  
ATOM 7652  C CG   . PRO A 1 8   ? 14.018  5.725   -7.239  1.00 0.00 ? 105 PRO A CG   5  
ATOM 7653  C CD   . PRO A 1 8   ? 14.205  5.878   -8.714  1.00 0.00 ? 105 PRO A CD   5  
ATOM 7654  H HA   . PRO A 1 8   ? 12.681  3.190   -8.011  1.00 0.00 ? 105 PRO A HA   5  
ATOM 7655  H HB2  . PRO A 1 8   ? 11.896  5.885   -7.071  1.00 0.00 ? 105 PRO A HB2  5  
ATOM 7656  H HB3  . PRO A 1 8   ? 12.602  4.541   -6.168  1.00 0.00 ? 105 PRO A HB3  5  
ATOM 7657  H HG2  . PRO A 1 8   ? 14.062  6.686   -6.750  1.00 0.00 ? 105 PRO A HG2  5  
ATOM 7658  H HG3  . PRO A 1 8   ? 14.767  5.060   -6.836  1.00 0.00 ? 105 PRO A HG3  5  
ATOM 7659  H HD2  . PRO A 1 8   ? 13.754  6.796   -9.063  1.00 0.00 ? 105 PRO A HD2  5  
ATOM 7660  H HD3  . PRO A 1 8   ? 15.253  5.845   -8.967  1.00 0.00 ? 105 PRO A HD3  5  
ATOM 7661  N N    . PRO A 1 9   ? 10.179  3.385   -8.445  1.00 0.00 ? 106 PRO A N    5  
ATOM 7662  C CA   . PRO A 1 9   ? 8.779   3.366   -8.884  1.00 0.00 ? 106 PRO A CA   5  
ATOM 7663  C C    . PRO A 1 9   ? 8.054   4.652   -8.508  1.00 0.00 ? 106 PRO A C    5  
ATOM 7664  O O    . PRO A 1 9   ? 8.140   5.117   -7.369  1.00 0.00 ? 106 PRO A O    5  
ATOM 7665  C CB   . PRO A 1 9   ? 8.174   2.168   -8.141  1.00 0.00 ? 106 PRO A CB   5  
ATOM 7666  C CG   . PRO A 1 9   ? 9.335   1.326   -7.747  1.00 0.00 ? 106 PRO A CG   5  
ATOM 7667  C CD   . PRO A 1 9   ? 10.478  2.274   -7.528  1.00 0.00 ? 106 PRO A CD   5  
ATOM 7668  H HA   . PRO A 1 9   ? 8.703   3.210   -9.951  1.00 0.00 ? 106 PRO A HA   5  
ATOM 7669  H HB2  . PRO A 1 9   ? 7.628   2.516   -7.278  1.00 0.00 ? 106 PRO A HB2  5  
ATOM 7670  H HB3  . PRO A 1 9   ? 7.510   1.633   -8.802  1.00 0.00 ? 106 PRO A HB3  5  
ATOM 7671  H HG2  . PRO A 1 9   ? 9.109   0.793   -6.835  1.00 0.00 ? 106 PRO A HG2  5  
ATOM 7672  H HG3  . PRO A 1 9   ? 9.571   0.632   -8.540  1.00 0.00 ? 106 PRO A HG3  5  
ATOM 7673  H HD2  . PRO A 1 9   ? 10.494  2.614   -6.503  1.00 0.00 ? 106 PRO A HD2  5  
ATOM 7674  H HD3  . PRO A 1 9   ? 11.412  1.799   -7.785  1.00 0.00 ? 106 PRO A HD3  5  
ATOM 7675  N N    . LEU A 1 10  ? 7.334   5.212   -9.464  1.00 0.00 ? 107 LEU A N    5  
ATOM 7676  C CA   . LEU A 1 10  ? 6.715   6.518   -9.295  1.00 0.00 ? 107 LEU A CA   5  
ATOM 7677  C C    . LEU A 1 10  ? 5.212   6.423   -9.499  1.00 0.00 ? 107 LEU A C    5  
ATOM 7678  O O    . LEU A 1 10  ? 4.687   5.338   -9.757  1.00 0.00 ? 107 LEU A O    5  
ATOM 7679  C CB   . LEU A 1 10  ? 7.313   7.540   -10.274 1.00 0.00 ? 107 LEU A CB   5  
ATOM 7680  C CG   . LEU A 1 10  ? 7.117   7.238   -11.768 1.00 0.00 ? 107 LEU A CG   5  
ATOM 7681  C CD1  . LEU A 1 10  ? 7.215   8.520   -12.578 1.00 0.00 ? 107 LEU A CD1  5  
ATOM 7682  C CD2  . LEU A 1 10  ? 8.153   6.239   -12.267 1.00 0.00 ? 107 LEU A CD2  5  
ATOM 7683  H H    . LEU A 1 10  ? 7.188   4.719   -10.300 1.00 0.00 ? 107 LEU A H    5  
ATOM 7684  H HA   . LEU A 1 10  ? 6.907   6.846   -8.284  1.00 0.00 ? 107 LEU A HA   5  
ATOM 7685  H HB2  . LEU A 1 10  ? 6.869   8.502   -10.066 1.00 0.00 ? 107 LEU A HB2  5  
ATOM 7686  H HB3  . LEU A 1 10  ? 8.372   7.606   -10.083 1.00 0.00 ? 107 LEU A HB3  5  
ATOM 7687  H HG   . LEU A 1 10  ? 6.134   6.815   -11.923 1.00 0.00 ? 107 LEU A HG   5  
ATOM 7688  H HD11 . LEU A 1 10  ? 7.087   8.293   -13.627 1.00 0.00 ? 107 LEU A HD11 5  
ATOM 7689  H HD12 . LEU A 1 10  ? 8.184   8.970   -12.423 1.00 0.00 ? 107 LEU A HD12 5  
ATOM 7690  H HD13 . LEU A 1 10  ? 6.444   9.206   -12.263 1.00 0.00 ? 107 LEU A HD13 5  
ATOM 7691  H HD21 . LEU A 1 10  ? 9.139   6.671   -12.180 1.00 0.00 ? 107 LEU A HD21 5  
ATOM 7692  H HD22 . LEU A 1 10  ? 7.955   6.002   -13.302 1.00 0.00 ? 107 LEU A HD22 5  
ATOM 7693  H HD23 . LEU A 1 10  ? 8.104   5.338   -11.677 1.00 0.00 ? 107 LEU A HD23 5  
ATOM 7694  N N    . GLU A 1 11  ? 4.531   7.561   -9.381  1.00 0.00 ? 108 GLU A N    5  
ATOM 7695  C CA   . GLU A 1 11  ? 3.082   7.629   -9.561  1.00 0.00 ? 108 GLU A CA   5  
ATOM 7696  C C    . GLU A 1 11  ? 2.377   6.638   -8.642  1.00 0.00 ? 108 GLU A C    5  
ATOM 7697  O O    . GLU A 1 11  ? 1.424   5.970   -9.046  1.00 0.00 ? 108 GLU A O    5  
ATOM 7698  C CB   . GLU A 1 11  ? 2.711   7.348   -11.020 1.00 0.00 ? 108 GLU A CB   5  
ATOM 7699  C CG   . GLU A 1 11  ? 3.248   8.377   -12.001 1.00 0.00 ? 108 GLU A CG   5  
ATOM 7700  C CD   . GLU A 1 11  ? 2.645   9.748   -11.791 1.00 0.00 ? 108 GLU A CD   5  
ATOM 7701  O OE1  . GLU A 1 11  ? 1.461   9.937   -12.140 1.00 0.00 ? 108 GLU A OE1  5  
ATOM 7702  O OE2  . GLU A 1 11  ? 3.353   10.642  -11.282 1.00 0.00 ? 108 GLU A OE2  5  
ATOM 7703  H H    . GLU A 1 11  ? 5.019   8.384   -9.165  1.00 0.00 ? 108 GLU A H    5  
ATOM 7704  H HA   . GLU A 1 11  ? 2.763   8.629   -9.305  1.00 0.00 ? 108 GLU A HA   5  
ATOM 7705  H HB2  . GLU A 1 11  ? 3.101   6.380   -11.297 1.00 0.00 ? 108 GLU A HB2  5  
ATOM 7706  H HB3  . GLU A 1 11  ? 1.635   7.328   -11.106 1.00 0.00 ? 108 GLU A HB3  5  
ATOM 7707  H HG2  . GLU A 1 11  ? 4.318   8.450   -11.878 1.00 0.00 ? 108 GLU A HG2  5  
ATOM 7708  H HG3  . GLU A 1 11  ? 3.024   8.052   -13.006 1.00 0.00 ? 108 GLU A HG3  5  
ATOM 7709  N N    . LEU A 1 12  ? 2.861   6.547   -7.409  1.00 0.00 ? 109 LEU A N    5  
ATOM 7710  C CA   . LEU A 1 12  ? 2.327   5.604   -6.439  1.00 0.00 ? 109 LEU A CA   5  
ATOM 7711  C C    . LEU A 1 12  ? 0.878   5.962   -6.113  1.00 0.00 ? 109 LEU A C    5  
ATOM 7712  O O    . LEU A 1 12  ? 0.611   6.916   -5.382  1.00 0.00 ? 109 LEU A O    5  
ATOM 7713  C CB   . LEU A 1 12  ? 3.190   5.622   -5.170  1.00 0.00 ? 109 LEU A CB   5  
ATOM 7714  C CG   . LEU A 1 12  ? 3.262   4.303   -4.387  1.00 0.00 ? 109 LEU A CG   5  
ATOM 7715  C CD1  . LEU A 1 12  ? 4.164   4.454   -3.174  1.00 0.00 ? 109 LEU A CD1  5  
ATOM 7716  C CD2  . LEU A 1 12  ? 1.880   3.841   -3.963  1.00 0.00 ? 109 LEU A CD2  5  
ATOM 7717  H H    . LEU A 1 12  ? 3.599   7.136   -7.143  1.00 0.00 ? 109 LEU A H    5  
ATOM 7718  H HA   . LEU A 1 12  ? 2.356   4.617   -6.877  1.00 0.00 ? 109 LEU A HA   5  
ATOM 7719  H HB2  . LEU A 1 12  ? 4.195   5.899   -5.454  1.00 0.00 ? 109 LEU A HB2  5  
ATOM 7720  H HB3  . LEU A 1 12  ? 2.801   6.383   -4.510  1.00 0.00 ? 109 LEU A HB3  5  
ATOM 7721  H HG   . LEU A 1 12  ? 3.690   3.542   -5.024  1.00 0.00 ? 109 LEU A HG   5  
ATOM 7722  H HD11 . LEU A 1 12  ? 4.212   3.515   -2.641  1.00 0.00 ? 109 LEU A HD11 5  
ATOM 7723  H HD12 . LEU A 1 12  ? 3.766   5.216   -2.521  1.00 0.00 ? 109 LEU A HD12 5  
ATOM 7724  H HD13 . LEU A 1 12  ? 5.156   4.736   -3.495  1.00 0.00 ? 109 LEU A HD13 5  
ATOM 7725  H HD21 . LEU A 1 12  ? 1.277   3.660   -4.842  1.00 0.00 ? 109 LEU A HD21 5  
ATOM 7726  H HD22 . LEU A 1 12  ? 1.414   4.603   -3.357  1.00 0.00 ? 109 LEU A HD22 5  
ATOM 7727  H HD23 . LEU A 1 12  ? 1.966   2.929   -3.391  1.00 0.00 ? 109 LEU A HD23 5  
ATOM 7728  N N    . ALA A 1 13  ? -0.050  5.198   -6.666  1.00 0.00 ? 110 ALA A N    5  
ATOM 7729  C CA   . ALA A 1 13  ? -1.465  5.457   -6.475  1.00 0.00 ? 110 ALA A CA   5  
ATOM 7730  C C    . ALA A 1 13  ? -2.093  4.388   -5.597  1.00 0.00 ? 110 ALA A C    5  
ATOM 7731  O O    . ALA A 1 13  ? -1.881  3.194   -5.802  1.00 0.00 ? 110 ALA A O    5  
ATOM 7732  C CB   . ALA A 1 13  ? -2.175  5.526   -7.818  1.00 0.00 ? 110 ALA A CB   5  
ATOM 7733  H H    . ALA A 1 13  ? 0.222   4.427   -7.214  1.00 0.00 ? 110 ALA A H    5  
ATOM 7734  H HA   . ALA A 1 13  ? -1.567  6.416   -5.989  1.00 0.00 ? 110 ALA A HA   5  
ATOM 7735  H HB1  . ALA A 1 13  ? -1.713  6.286   -8.431  1.00 0.00 ? 110 ALA A HB1  5  
ATOM 7736  H HB2  . ALA A 1 13  ? -3.215  5.771   -7.665  1.00 0.00 ? 110 ALA A HB2  5  
ATOM 7737  H HB3  . ALA A 1 13  ? -2.099  4.569   -8.314  1.00 0.00 ? 110 ALA A HB3  5  
ATOM 7738  N N    . VAL A 1 14  ? -2.859  4.821   -4.612  1.00 0.00 ? 111 VAL A N    5  
ATOM 7739  C CA   . VAL A 1 14  ? -3.521  3.896   -3.713  1.00 0.00 ? 111 VAL A CA   5  
ATOM 7740  C C    . VAL A 1 14  ? -5.030  3.993   -3.891  1.00 0.00 ? 111 VAL A C    5  
ATOM 7741  O O    . VAL A 1 14  ? -5.601  5.082   -3.809  1.00 0.00 ? 111 VAL A O    5  
ATOM 7742  C CB   . VAL A 1 14  ? -3.164  4.179   -2.242  1.00 0.00 ? 111 VAL A CB   5  
ATOM 7743  C CG1  . VAL A 1 14  ? -3.569  3.008   -1.368  1.00 0.00 ? 111 VAL A CG1  5  
ATOM 7744  C CG2  . VAL A 1 14  ? -1.682  4.479   -2.091  1.00 0.00 ? 111 VAL A CG2  5  
ATOM 7745  H H    . VAL A 1 14  ? -2.986  5.784   -4.491  1.00 0.00 ? 111 VAL A H    5  
ATOM 7746  H HA   . VAL A 1 14  ? -3.198  2.894   -3.959  1.00 0.00 ? 111 VAL A HA   5  
ATOM 7747  H HB   . VAL A 1 14  ? -3.721  5.047   -1.922  1.00 0.00 ? 111 VAL A HB   5  
ATOM 7748  H HG11 . VAL A 1 14  ? -4.631  2.844   -1.458  1.00 0.00 ? 111 VAL A HG11 5  
ATOM 7749  H HG12 . VAL A 1 14  ? -3.323  3.225   -0.339  1.00 0.00 ? 111 VAL A HG12 5  
ATOM 7750  H HG13 . VAL A 1 14  ? -3.040  2.123   -1.686  1.00 0.00 ? 111 VAL A HG13 5  
ATOM 7751  H HG21 . VAL A 1 14  ? -1.422  5.329   -2.703  1.00 0.00 ? 111 VAL A HG21 5  
ATOM 7752  H HG22 . VAL A 1 14  ? -1.108  3.620   -2.405  1.00 0.00 ? 111 VAL A HG22 5  
ATOM 7753  H HG23 . VAL A 1 14  ? -1.464  4.701   -1.055  1.00 0.00 ? 111 VAL A HG23 5  
ATOM 7754  N N    . GLU A 1 15  ? -5.666  2.861   -4.138  1.00 0.00 ? 112 GLU A N    5  
ATOM 7755  C CA   . GLU A 1 15  ? -7.095  2.833   -4.404  1.00 0.00 ? 112 GLU A CA   5  
ATOM 7756  C C    . GLU A 1 15  ? -7.794  1.852   -3.474  1.00 0.00 ? 112 GLU A C    5  
ATOM 7757  O O    . GLU A 1 15  ? -7.341  0.723   -3.289  1.00 0.00 ? 112 GLU A O    5  
ATOM 7758  C CB   . GLU A 1 15  ? -7.339  2.462   -5.871  1.00 0.00 ? 112 GLU A CB   5  
ATOM 7759  C CG   . GLU A 1 15  ? -8.799  2.507   -6.299  1.00 0.00 ? 112 GLU A CG   5  
ATOM 7760  C CD   . GLU A 1 15  ? -8.944  2.561   -7.806  1.00 0.00 ? 112 GLU A CD   5  
ATOM 7761  O OE1  . GLU A 1 15  ? -8.398  3.499   -8.423  1.00 0.00 ? 112 GLU A OE1  5  
ATOM 7762  O OE2  . GLU A 1 15  ? -9.593  1.666   -8.387  1.00 0.00 ? 112 GLU A OE2  5  
ATOM 7763  H H    . GLU A 1 15  ? -5.162  2.013   -4.138  1.00 0.00 ? 112 GLU A H    5  
ATOM 7764  H HA   . GLU A 1 15  ? -7.483  3.823   -4.220  1.00 0.00 ? 112 GLU A HA   5  
ATOM 7765  H HB2  . GLU A 1 15  ? -6.785  3.145   -6.498  1.00 0.00 ? 112 GLU A HB2  5  
ATOM 7766  H HB3  . GLU A 1 15  ? -6.971  1.460   -6.039  1.00 0.00 ? 112 GLU A HB3  5  
ATOM 7767  H HG2  . GLU A 1 15  ? -9.300  1.620   -5.934  1.00 0.00 ? 112 GLU A HG2  5  
ATOM 7768  H HG3  . GLU A 1 15  ? -9.262  3.385   -5.873  1.00 0.00 ? 112 GLU A HG3  5  
ATOM 7769  N N    . VAL A 1 16  ? -8.889  2.292   -2.875  1.00 0.00 ? 113 VAL A N    5  
ATOM 7770  C CA   . VAL A 1 16  ? -9.651  1.446   -1.974  1.00 0.00 ? 113 VAL A CA   5  
ATOM 7771  C C    . VAL A 1 16  ? -10.670 0.625   -2.758  1.00 0.00 ? 113 VAL A C    5  
ATOM 7772  O O    . VAL A 1 16  ? -11.453 1.163   -3.541  1.00 0.00 ? 113 VAL A O    5  
ATOM 7773  C CB   . VAL A 1 16  ? -10.354 2.274   -0.868  1.00 0.00 ? 113 VAL A CB   5  
ATOM 7774  C CG1  . VAL A 1 16  ? -11.241 3.358   -1.463  1.00 0.00 ? 113 VAL A CG1  5  
ATOM 7775  C CG2  . VAL A 1 16  ? -11.155 1.371   0.061   1.00 0.00 ? 113 VAL A CG2  5  
ATOM 7776  H H    . VAL A 1 16  ? -9.200  3.205   -3.057  1.00 0.00 ? 113 VAL A H    5  
ATOM 7777  H HA   . VAL A 1 16  ? -8.958  0.769   -1.498  1.00 0.00 ? 113 VAL A HA   5  
ATOM 7778  H HB   . VAL A 1 16  ? -9.589  2.761   -0.279  1.00 0.00 ? 113 VAL A HB   5  
ATOM 7779  H HG11 . VAL A 1 16  ? -10.640 4.028   -2.059  1.00 0.00 ? 113 VAL A HG11 5  
ATOM 7780  H HG12 . VAL A 1 16  ? -11.716 3.912   -0.668  1.00 0.00 ? 113 VAL A HG12 5  
ATOM 7781  H HG13 . VAL A 1 16  ? -11.997 2.903   -2.086  1.00 0.00 ? 113 VAL A HG13 5  
ATOM 7782  H HG21 . VAL A 1 16  ? -11.910 0.850   -0.508  1.00 0.00 ? 113 VAL A HG21 5  
ATOM 7783  H HG22 . VAL A 1 16  ? -11.629 1.970   0.825   1.00 0.00 ? 113 VAL A HG22 5  
ATOM 7784  H HG23 . VAL A 1 16  ? -10.495 0.653   0.524   1.00 0.00 ? 113 VAL A HG23 5  
ATOM 7785  N N    . LYS A 1 17  ? -10.637 -0.683  -2.570  1.00 0.00 ? 114 LYS A N    5  
ATOM 7786  C CA   . LYS A 1 17  ? -11.536 -1.575  -3.279  1.00 0.00 ? 114 LYS A CA   5  
ATOM 7787  C C    . LYS A 1 17  ? -12.612 -2.105  -2.356  1.00 0.00 ? 114 LYS A C    5  
ATOM 7788  O O    . LYS A 1 17  ? -12.323 -2.644  -1.289  1.00 0.00 ? 114 LYS A O    5  
ATOM 7789  C CB   . LYS A 1 17  ? -10.763 -2.733  -3.907  1.00 0.00 ? 114 LYS A CB   5  
ATOM 7790  C CG   . LYS A 1 17  ? -9.998  -2.326  -5.149  1.00 0.00 ? 114 LYS A CG   5  
ATOM 7791  C CD   . LYS A 1 17  ? -10.951 -1.929  -6.259  1.00 0.00 ? 114 LYS A CD   5  
ATOM 7792  C CE   . LYS A 1 17  ? -10.260 -1.089  -7.303  1.00 0.00 ? 114 LYS A CE   5  
ATOM 7793  N NZ   . LYS A 1 17  ? -11.192 -0.659  -8.376  1.00 0.00 ? 114 LYS A NZ   5  
ATOM 7794  H H    . LYS A 1 17  ? -9.996  -1.062  -1.927  1.00 0.00 ? 114 LYS A H    5  
ATOM 7795  H HA   . LYS A 1 17  ? -12.006 -1.004  -4.063  1.00 0.00 ? 114 LYS A HA   5  
ATOM 7796  H HB2  . LYS A 1 17  ? -10.059 -3.118  -3.183  1.00 0.00 ? 114 LYS A HB2  5  
ATOM 7797  H HB3  . LYS A 1 17  ? -11.457 -3.514  -4.175  1.00 0.00 ? 114 LYS A HB3  5  
ATOM 7798  H HG2  . LYS A 1 17  ? -9.360  -1.487  -4.912  1.00 0.00 ? 114 LYS A HG2  5  
ATOM 7799  H HG3  . LYS A 1 17  ? -9.395  -3.158  -5.482  1.00 0.00 ? 114 LYS A HG3  5  
ATOM 7800  H HD2  . LYS A 1 17  ? -11.338 -2.819  -6.727  1.00 0.00 ? 114 LYS A HD2  5  
ATOM 7801  H HD3  . LYS A 1 17  ? -11.763 -1.359  -5.838  1.00 0.00 ? 114 LYS A HD3  5  
ATOM 7802  H HE2  . LYS A 1 17  ? -9.861  -0.214  -6.817  1.00 0.00 ? 114 LYS A HE2  5  
ATOM 7803  H HE3  . LYS A 1 17  ? -9.457  -1.662  -7.737  1.00 0.00 ? 114 LYS A HE3  5  
ATOM 7804  H HZ1  . LYS A 1 17  ? -12.014 -0.177  -7.961  1.00 0.00 ? 114 LYS A HZ1  5  
ATOM 7805  H HZ2  . LYS A 1 17  ? -11.525 -1.482  -8.917  1.00 0.00 ? 114 LYS A HZ2  5  
ATOM 7806  H HZ3  . LYS A 1 17  ? -10.711 -0.001  -9.022  1.00 0.00 ? 114 LYS A HZ3  5  
ATOM 7807  N N    . GLN A 1 18  ? -13.855 -1.948  -2.776  1.00 0.00 ? 115 GLN A N    5  
ATOM 7808  C CA   . GLN A 1 18  ? -14.990 -2.365  -1.965  1.00 0.00 ? 115 GLN A CA   5  
ATOM 7809  C C    . GLN A 1 18  ? -15.995 -3.160  -2.792  1.00 0.00 ? 115 GLN A C    5  
ATOM 7810  O O    . GLN A 1 18  ? -16.957 -2.601  -3.325  1.00 0.00 ? 115 GLN A O    5  
ATOM 7811  C CB   . GLN A 1 18  ? -15.676 -1.153  -1.335  1.00 0.00 ? 115 GLN A CB   5  
ATOM 7812  C CG   . GLN A 1 18  ? -14.775 -0.356  -0.408  1.00 0.00 ? 115 GLN A CG   5  
ATOM 7813  C CD   . GLN A 1 18  ? -15.510 0.768   0.284   1.00 0.00 ? 115 GLN A CD   5  
ATOM 7814  O OE1  . GLN A 1 18  ? -15.570 1.892   -0.215  1.00 0.00 ? 115 GLN A OE1  5  
ATOM 7815  N NE2  . GLN A 1 18  ? -16.083 0.474   1.437   1.00 0.00 ? 115 GLN A NE2  5  
ATOM 7816  H H    . GLN A 1 18  ? -14.012 -1.556  -3.664  1.00 0.00 ? 115 GLN A H    5  
ATOM 7817  H HA   . GLN A 1 18  ? -14.613 -3.001  -1.177  1.00 0.00 ? 115 GLN A HA   5  
ATOM 7818  H HB2  . GLN A 1 18  ? -16.015 -0.497  -2.122  1.00 0.00 ? 115 GLN A HB2  5  
ATOM 7819  H HB3  . GLN A 1 18  ? -16.531 -1.492  -0.769  1.00 0.00 ? 115 GLN A HB3  5  
ATOM 7820  H HG2  . GLN A 1 18  ? -14.375 -1.019  0.345   1.00 0.00 ? 115 GLN A HG2  5  
ATOM 7821  H HG3  . GLN A 1 18  ? -13.964 0.062   -0.984  1.00 0.00 ? 115 GLN A HG3  5  
ATOM 7822  H HE21 . GLN A 1 18  ? -15.997 -0.444  1.777   1.00 0.00 ? 115 GLN A HE21 5  
ATOM 7823  H HE22 . GLN A 1 18  ? -16.569 1.187   1.913   1.00 0.00 ? 115 GLN A HE22 5  
ATOM 7824  N N    . PRO A 1 19  ? -15.769 -4.472  -2.927  1.00 0.00 ? 116 PRO A N    5  
ATOM 7825  C CA   . PRO A 1 19  ? -16.687 -5.371  -3.630  1.00 0.00 ? 116 PRO A CA   5  
ATOM 7826  C C    . PRO A 1 19  ? -17.966 -5.603  -2.829  1.00 0.00 ? 116 PRO A C    5  
ATOM 7827  O O    . PRO A 1 19  ? -18.050 -5.233  -1.661  1.00 0.00 ? 116 PRO A O    5  
ATOM 7828  C CB   . PRO A 1 19  ? -15.888 -6.679  -3.762  1.00 0.00 ? 116 PRO A CB   5  
ATOM 7829  C CG   . PRO A 1 19  ? -14.486 -6.334  -3.377  1.00 0.00 ? 116 PRO A CG   5  
ATOM 7830  C CD   . PRO A 1 19  ? -14.599 -5.192  -2.416  1.00 0.00 ? 116 PRO A CD   5  
ATOM 7831  H HA   . PRO A 1 19  ? -16.938 -4.993  -4.610  1.00 0.00 ? 116 PRO A HA   5  
ATOM 7832  H HB2  . PRO A 1 19  ? -16.306 -7.423  -3.098  1.00 0.00 ? 116 PRO A HB2  5  
ATOM 7833  H HB3  . PRO A 1 19  ? -15.939 -7.033  -4.780  1.00 0.00 ? 116 PRO A HB3  5  
ATOM 7834  H HG2  . PRO A 1 19  ? -14.015 -7.180  -2.900  1.00 0.00 ? 116 PRO A HG2  5  
ATOM 7835  H HG3  . PRO A 1 19  ? -13.927 -6.036  -4.252  1.00 0.00 ? 116 PRO A HG3  5  
ATOM 7836  H HD2  . PRO A 1 19  ? -14.770 -5.553  -1.413  1.00 0.00 ? 116 PRO A HD2  5  
ATOM 7837  H HD3  . PRO A 1 19  ? -13.715 -4.572  -2.455  1.00 0.00 ? 116 PRO A HD3  5  
ATOM 7838  N N    . GLU A 1 20  ? -18.962 -6.208  -3.461  1.00 0.00 ? 117 GLU A N    5  
ATOM 7839  C CA   . GLU A 1 20  ? -20.245 -6.438  -2.808  1.00 0.00 ? 117 GLU A CA   5  
ATOM 7840  C C    . GLU A 1 20  ? -20.382 -7.882  -2.349  1.00 0.00 ? 117 GLU A C    5  
ATOM 7841  O O    . GLU A 1 20  ? -21.360 -8.247  -1.694  1.00 0.00 ? 117 GLU A O    5  
ATOM 7842  C CB   . GLU A 1 20  ? -21.410 -6.086  -3.739  1.00 0.00 ? 117 GLU A CB   5  
ATOM 7843  C CG   . GLU A 1 20  ? -21.479 -6.919  -5.014  1.00 0.00 ? 117 GLU A CG   5  
ATOM 7844  C CD   . GLU A 1 20  ? -20.451 -6.512  -6.047  1.00 0.00 ? 117 GLU A CD   5  
ATOM 7845  O OE1  . GLU A 1 20  ? -19.325 -7.055  -6.025  1.00 0.00 ? 117 GLU A OE1  5  
ATOM 7846  O OE2  . GLU A 1 20  ? -20.759 -5.647  -6.886  1.00 0.00 ? 117 GLU A OE2  5  
ATOM 7847  H H    . GLU A 1 20  ? -18.837 -6.502  -4.393  1.00 0.00 ? 117 GLU A H    5  
ATOM 7848  H HA   . GLU A 1 20  ? -20.289 -5.796  -1.941  1.00 0.00 ? 117 GLU A HA   5  
ATOM 7849  H HB2  . GLU A 1 20  ? -22.334 -6.229  -3.200  1.00 0.00 ? 117 GLU A HB2  5  
ATOM 7850  H HB3  . GLU A 1 20  ? -21.327 -5.047  -4.020  1.00 0.00 ? 117 GLU A HB3  5  
ATOM 7851  H HG2  . GLU A 1 20  ? -21.316 -7.955  -4.760  1.00 0.00 ? 117 GLU A HG2  5  
ATOM 7852  H HG3  . GLU A 1 20  ? -22.463 -6.808  -5.447  1.00 0.00 ? 117 GLU A HG3  5  
ATOM 7853  N N    . ASP A 1 21  ? -19.418 -8.710  -2.711  1.00 0.00 ? 118 ASP A N    5  
ATOM 7854  C CA   . ASP A 1 21  ? -19.454 -10.120 -2.341  1.00 0.00 ? 118 ASP A CA   5  
ATOM 7855  C C    . ASP A 1 21  ? -18.103 -10.562 -1.783  1.00 0.00 ? 118 ASP A C    5  
ATOM 7856  O O    . ASP A 1 21  ? -17.904 -11.723 -1.425  1.00 0.00 ? 118 ASP A O    5  
ATOM 7857  C CB   . ASP A 1 21  ? -19.843 -10.965 -3.559  1.00 0.00 ? 118 ASP A CB   5  
ATOM 7858  C CG   . ASP A 1 21  ? -19.978 -12.439 -3.235  1.00 0.00 ? 118 ASP A CG   5  
ATOM 7859  O OD1  . ASP A 1 21  ? -20.889 -12.802 -2.461  1.00 0.00 ? 118 ASP A OD1  5  
ATOM 7860  O OD2  . ASP A 1 21  ? -19.171 -13.242 -3.747  1.00 0.00 ? 118 ASP A OD2  5  
ATOM 7861  H H    . ASP A 1 21  ? -18.673 -8.371  -3.248  1.00 0.00 ? 118 ASP A H    5  
ATOM 7862  H HA   . ASP A 1 21  ? -20.204 -10.241 -1.574  1.00 0.00 ? 118 ASP A HA   5  
ATOM 7863  H HB2  . ASP A 1 21  ? -20.790 -10.613 -3.941  1.00 0.00 ? 118 ASP A HB2  5  
ATOM 7864  H HB3  . ASP A 1 21  ? -19.089 -10.851 -4.323  1.00 0.00 ? 118 ASP A HB3  5  
ATOM 7865  N N    . ARG A 1 22  ? -17.184 -9.615  -1.682  1.00 0.00 ? 119 ARG A N    5  
ATOM 7866  C CA   . ARG A 1 22  ? -15.832 -9.905  -1.230  1.00 0.00 ? 119 ARG A CA   5  
ATOM 7867  C C    . ARG A 1 22  ? -15.381 -8.830  -0.252  1.00 0.00 ? 119 ARG A C    5  
ATOM 7868  O O    . ARG A 1 22  ? -15.815 -7.682  -0.346  1.00 0.00 ? 119 ARG A O    5  
ATOM 7869  C CB   . ARG A 1 22  ? -14.878 -9.963  -2.427  1.00 0.00 ? 119 ARG A CB   5  
ATOM 7870  C CG   . ARG A 1 22  ? -15.320 -10.930 -3.512  1.00 0.00 ? 119 ARG A CG   5  
ATOM 7871  C CD   . ARG A 1 22  ? -14.446 -10.822 -4.749  1.00 0.00 ? 119 ARG A CD   5  
ATOM 7872  N NE   . ARG A 1 22  ? -15.027 -11.532 -5.888  1.00 0.00 ? 119 ARG A NE   5  
ATOM 7873  C CZ   . ARG A 1 22  ? -14.623 -11.373 -7.149  1.00 0.00 ? 119 ARG A CZ   5  
ATOM 7874  N NH1  . ARG A 1 22  ? -13.603 -10.572 -7.426  1.00 0.00 ? 119 ARG A NH1  5  
ATOM 7875  N NH2  . ARG A 1 22  ? -15.237 -12.021 -8.131  1.00 0.00 ? 119 ARG A NH2  5  
ATOM 7876  H H    . ARG A 1 22  ? -17.425 -8.690  -1.889  1.00 0.00 ? 119 ARG A H    5  
ATOM 7877  H HA   . ARG A 1 22  ? -15.838 -10.861 -0.728  1.00 0.00 ? 119 ARG A HA   5  
ATOM 7878  H HB2  . ARG A 1 22  ? -14.804 -8.979  -2.862  1.00 0.00 ? 119 ARG A HB2  5  
ATOM 7879  H HB3  . ARG A 1 22  ? -13.901 -10.267 -2.080  1.00 0.00 ? 119 ARG A HB3  5  
ATOM 7880  H HG2  . ARG A 1 22  ? -15.259 -11.938 -3.130  1.00 0.00 ? 119 ARG A HG2  5  
ATOM 7881  H HG3  . ARG A 1 22  ? -16.342 -10.708 -3.784  1.00 0.00 ? 119 ARG A HG3  5  
ATOM 7882  H HD2  . ARG A 1 22  ? -14.334 -9.779  -5.005  1.00 0.00 ? 119 ARG A HD2  5  
ATOM 7883  H HD3  . ARG A 1 22  ? -13.476 -11.245 -4.529  1.00 0.00 ? 119 ARG A HD3  5  
ATOM 7884  H HE   . ARG A 1 22  ? -15.773 -12.148 -5.703  1.00 0.00 ? 119 ARG A HE   5  
ATOM 7885  H HH11 . ARG A 1 22  ? -13.133 -10.081 -6.688  1.00 0.00 ? 119 ARG A HH11 5  
ATOM 7886  H HH12 . ARG A 1 22  ? -13.297 -10.454 -8.376  1.00 0.00 ? 119 ARG A HH12 5  
ATOM 7887  H HH21 . ARG A 1 22  ? -16.009 -12.631 -7.931  1.00 0.00 ? 119 ARG A HH21 5  
ATOM 7888  H HH22 . ARG A 1 22  ? -14.939 -11.898 -9.083  1.00 0.00 ? 119 ARG A HH22 5  
ATOM 7889  N N    . LYS A 1 23  ? -14.531 -9.218  0.693   1.00 0.00 ? 120 LYS A N    5  
ATOM 7890  C CA   . LYS A 1 23  ? -14.009 -8.300  1.701   1.00 0.00 ? 120 LYS A CA   5  
ATOM 7891  C C    . LYS A 1 23  ? -13.307 -7.111  1.056   1.00 0.00 ? 120 LYS A C    5  
ATOM 7892  O O    . LYS A 1 23  ? -12.467 -7.286  0.171   1.00 0.00 ? 120 LYS A O    5  
ATOM 7893  C CB   . LYS A 1 23  ? -13.019 -9.027  2.619   1.00 0.00 ? 120 LYS A CB   5  
ATOM 7894  C CG   . LYS A 1 23  ? -13.636 -10.156 3.427   1.00 0.00 ? 120 LYS A CG   5  
ATOM 7895  C CD   . LYS A 1 23  ? -14.685 -9.639  4.399   1.00 0.00 ? 120 LYS A CD   5  
ATOM 7896  C CE   . LYS A 1 23  ? -15.278 -10.768 5.224   1.00 0.00 ? 120 LYS A CE   5  
ATOM 7897  N NZ   . LYS A 1 23  ? -14.263 -11.407 6.104   1.00 0.00 ? 120 LYS A NZ   5  
ATOM 7898  H H    . LYS A 1 23  ? -14.247 -10.156 0.717   1.00 0.00 ? 120 LYS A H    5  
ATOM 7899  H HA   . LYS A 1 23  ? -14.840 -7.945  2.288   1.00 0.00 ? 120 LYS A HA   5  
ATOM 7900  H HB2  . LYS A 1 23  ? -12.226 -9.441  2.015   1.00 0.00 ? 120 LYS A HB2  5  
ATOM 7901  H HB3  . LYS A 1 23  ? -12.597 -8.310  3.308   1.00 0.00 ? 120 LYS A HB3  5  
ATOM 7902  H HG2  . LYS A 1 23  ? -14.104 -10.855 2.751   1.00 0.00 ? 120 LYS A HG2  5  
ATOM 7903  H HG3  . LYS A 1 23  ? -12.857 -10.655 3.983   1.00 0.00 ? 120 LYS A HG3  5  
ATOM 7904  H HD2  . LYS A 1 23  ? -14.224 -8.924  5.064   1.00 0.00 ? 120 LYS A HD2  5  
ATOM 7905  H HD3  . LYS A 1 23  ? -15.474 -9.159  3.842   1.00 0.00 ? 120 LYS A HD3  5  
ATOM 7906  H HE2  . LYS A 1 23  ? -16.075 -10.370 5.835   1.00 0.00 ? 120 LYS A HE2  5  
ATOM 7907  H HE3  . LYS A 1 23  ? -15.678 -11.510 4.550   1.00 0.00 ? 120 LYS A HE3  5  
ATOM 7908  H HZ1  . LYS A 1 23  ? -13.500 -11.819 5.531   1.00 0.00 ? 120 LYS A HZ1  5  
ATOM 7909  H HZ2  . LYS A 1 23  ? -14.704 -12.162 6.666   1.00 0.00 ? 120 LYS A HZ2  5  
ATOM 7910  H HZ3  . LYS A 1 23  ? -13.855 -10.703 6.752   1.00 0.00 ? 120 LYS A HZ3  5  
ATOM 7911  N N    . PRO A 1 24  ? -13.650 -5.889  1.492   1.00 0.00 ? 121 PRO A N    5  
ATOM 7912  C CA   . PRO A 1 24  ? -13.000 -4.669  1.010   1.00 0.00 ? 121 PRO A CA   5  
ATOM 7913  C C    . PRO A 1 24  ? -11.515 -4.658  1.354   1.00 0.00 ? 121 PRO A C    5  
ATOM 7914  O O    . PRO A 1 24  ? -11.119 -5.020  2.466   1.00 0.00 ? 121 PRO A O    5  
ATOM 7915  C CB   . PRO A 1 24  ? -13.738 -3.542  1.743   1.00 0.00 ? 121 PRO A CB   5  
ATOM 7916  C CG   . PRO A 1 24  ? -14.377 -4.196  2.919   1.00 0.00 ? 121 PRO A CG   5  
ATOM 7917  C CD   . PRO A 1 24  ? -14.697 -5.598  2.487   1.00 0.00 ? 121 PRO A CD   5  
ATOM 7918  H HA   . PRO A 1 24  ? -13.121 -4.552  -0.058  1.00 0.00 ? 121 PRO A HA   5  
ATOM 7919  H HB2  . PRO A 1 24  ? -13.030 -2.785  2.050   1.00 0.00 ? 121 PRO A HB2  5  
ATOM 7920  H HB3  . PRO A 1 24  ? -14.477 -3.106  1.087   1.00 0.00 ? 121 PRO A HB3  5  
ATOM 7921  H HG2  . PRO A 1 24  ? -13.690 -4.207  3.752   1.00 0.00 ? 121 PRO A HG2  5  
ATOM 7922  H HG3  . PRO A 1 24  ? -15.282 -3.670  3.186   1.00 0.00 ? 121 PRO A HG3  5  
ATOM 7923  H HD2  . PRO A 1 24  ? -14.629 -6.274  3.328   1.00 0.00 ? 121 PRO A HD2  5  
ATOM 7924  H HD3  . PRO A 1 24  ? -15.679 -5.644  2.040   1.00 0.00 ? 121 PRO A HD3  5  
ATOM 7925  N N    . TYR A 1 25  ? -10.698 -4.245  0.401   1.00 0.00 ? 122 TYR A N    5  
ATOM 7926  C CA   . TYR A 1 25  ? -9.257  -4.277  0.569   1.00 0.00 ? 122 TYR A CA   5  
ATOM 7927  C C    . TYR A 1 25  ? -8.623  -3.038  -0.042  1.00 0.00 ? 122 TYR A C    5  
ATOM 7928  O O    . TYR A 1 25  ? -9.252  -2.328  -0.828  1.00 0.00 ? 122 TYR A O    5  
ATOM 7929  C CB   . TYR A 1 25  ? -8.672  -5.546  -0.069  1.00 0.00 ? 122 TYR A CB   5  
ATOM 7930  C CG   . TYR A 1 25  ? -8.854  -5.641  -1.571  1.00 0.00 ? 122 TYR A CG   5  
ATOM 7931  C CD1  . TYR A 1 25  ? -10.013 -6.175  -2.120  1.00 0.00 ? 122 TYR A CD1  5  
ATOM 7932  C CD2  . TYR A 1 25  ? -7.857  -5.208  -2.438  1.00 0.00 ? 122 TYR A CD2  5  
ATOM 7933  C CE1  . TYR A 1 25  ? -10.176 -6.270  -3.489  1.00 0.00 ? 122 TYR A CE1  5  
ATOM 7934  C CE2  . TYR A 1 25  ? -8.012  -5.300  -3.808  1.00 0.00 ? 122 TYR A CE2  5  
ATOM 7935  C CZ   . TYR A 1 25  ? -9.171  -5.832  -4.329  1.00 0.00 ? 122 TYR A CZ   5  
ATOM 7936  O OH   . TYR A 1 25  ? -9.327  -5.923  -5.695  1.00 0.00 ? 122 TYR A OH   5  
ATOM 7937  H H    . TYR A 1 25  ? -11.076 -3.889  -0.434  1.00 0.00 ? 122 TYR A H    5  
ATOM 7938  H HA   . TYR A 1 25  ? -9.048  -4.288  1.628   1.00 0.00 ? 122 TYR A HA   5  
ATOM 7939  H HB2  . TYR A 1 25  ? -7.614  -5.583  0.136   1.00 0.00 ? 122 TYR A HB2  5  
ATOM 7940  H HB3  . TYR A 1 25  ? -9.147  -6.408  0.377   1.00 0.00 ? 122 TYR A HB3  5  
ATOM 7941  H HD1  . TYR A 1 25  ? -10.798 -6.517  -1.461  1.00 0.00 ? 122 TYR A HD1  5  
ATOM 7942  H HD2  . TYR A 1 25  ? -6.949  -4.790  -2.026  1.00 0.00 ? 122 TYR A HD2  5  
ATOM 7943  H HE1  . TYR A 1 25  ? -11.085 -6.686  -3.897  1.00 0.00 ? 122 TYR A HE1  5  
ATOM 7944  H HE2  . TYR A 1 25  ? -7.224  -4.958  -4.463  1.00 0.00 ? 122 TYR A HE2  5  
ATOM 7945  H HH   . TYR A 1 25  ? -8.502  -6.227  -6.091  1.00 0.00 ? 122 TYR A HH   5  
ATOM 7946  N N    . LEU A 1 26  ? -7.380  -2.778  0.322   1.00 0.00 ? 123 LEU A N    5  
ATOM 7947  C CA   . LEU A 1 26  ? -6.663  -1.634  -0.206  1.00 0.00 ? 123 LEU A CA   5  
ATOM 7948  C C    . LEU A 1 26  ? -5.731  -2.083  -1.318  1.00 0.00 ? 123 LEU A C    5  
ATOM 7949  O O    . LEU A 1 26  ? -4.907  -2.979  -1.126  1.00 0.00 ? 123 LEU A O    5  
ATOM 7950  C CB   . LEU A 1 26  ? -5.869  -0.939  0.900   1.00 0.00 ? 123 LEU A CB   5  
ATOM 7951  C CG   . LEU A 1 26  ? -5.275  0.417   0.521   1.00 0.00 ? 123 LEU A CG   5  
ATOM 7952  C CD1  . LEU A 1 26  ? -6.380  1.421   0.228   1.00 0.00 ? 123 LEU A CD1  5  
ATOM 7953  C CD2  . LEU A 1 26  ? -4.364  0.925   1.629   1.00 0.00 ? 123 LEU A CD2  5  
ATOM 7954  H H    . LEU A 1 26  ? -6.928  -3.383  0.953   1.00 0.00 ? 123 LEU A H    5  
ATOM 7955  H HA   . LEU A 1 26  ? -7.387  -0.944  -0.611  1.00 0.00 ? 123 LEU A HA   5  
ATOM 7956  H HB2  . LEU A 1 26  ? -6.522  -0.798  1.749   1.00 0.00 ? 123 LEU A HB2  5  
ATOM 7957  H HB3  . LEU A 1 26  ? -5.060  -1.589  1.194   1.00 0.00 ? 123 LEU A HB3  5  
ATOM 7958  H HG   . LEU A 1 26  ? -4.682  0.304   -0.375  1.00 0.00 ? 123 LEU A HG   5  
ATOM 7959  H HD11 . LEU A 1 26  ? -6.949  1.093   -0.629  1.00 0.00 ? 123 LEU A HD11 5  
ATOM 7960  H HD12 . LEU A 1 26  ? -5.946  2.387   0.023   1.00 0.00 ? 123 LEU A HD12 5  
ATOM 7961  H HD13 . LEU A 1 26  ? -7.034  1.497   1.084   1.00 0.00 ? 123 LEU A HD13 5  
ATOM 7962  H HD21 . LEU A 1 26  ? -4.932  1.031   2.541   1.00 0.00 ? 123 LEU A HD21 5  
ATOM 7963  H HD22 . LEU A 1 26  ? -3.955  1.882   1.347   1.00 0.00 ? 123 LEU A HD22 5  
ATOM 7964  H HD23 . LEU A 1 26  ? -3.559  0.221   1.786   1.00 0.00 ? 123 LEU A HD23 5  
ATOM 7965  N N    . TRP A 1 27  ? -5.876  -1.469  -2.476  1.00 0.00 ? 124 TRP A N    5  
ATOM 7966  C CA   . TRP A 1 27  ? -5.095  -1.837  -3.640  1.00 0.00 ? 124 TRP A CA   5  
ATOM 7967  C C    . TRP A 1 27  ? -4.050  -0.768  -3.939  1.00 0.00 ? 124 TRP A C    5  
ATOM 7968  O O    . TRP A 1 27  ? -4.385  0.381   -4.236  1.00 0.00 ? 124 TRP A O    5  
ATOM 7969  C CB   . TRP A 1 27  ? -6.033  -2.039  -4.835  1.00 0.00 ? 124 TRP A CB   5  
ATOM 7970  C CG   . TRP A 1 27  ? -5.338  -2.360  -6.121  1.00 0.00 ? 124 TRP A CG   5  
ATOM 7971  C CD1  . TRP A 1 27  ? -4.309  -3.238  -6.313  1.00 0.00 ? 124 TRP A CD1  5  
ATOM 7972  C CD2  . TRP A 1 27  ? -5.643  -1.813  -7.405  1.00 0.00 ? 124 TRP A CD2  5  
ATOM 7973  N NE1  . TRP A 1 27  ? -3.950  -3.256  -7.640  1.00 0.00 ? 124 TRP A NE1  5  
ATOM 7974  C CE2  . TRP A 1 27  ? -4.756  -2.392  -8.328  1.00 0.00 ? 124 TRP A CE2  5  
ATOM 7975  C CE3  . TRP A 1 27  ? -6.581  -0.883  -7.864  1.00 0.00 ? 124 TRP A CE3  5  
ATOM 7976  C CZ2  . TRP A 1 27  ? -4.779  -2.075  -9.682  1.00 0.00 ? 124 TRP A CZ2  5  
ATOM 7977  C CZ3  . TRP A 1 27  ? -6.604  -0.570  -9.207  1.00 0.00 ? 124 TRP A CZ3  5  
ATOM 7978  C CH2  . TRP A 1 27  ? -5.708  -1.164  -10.102 1.00 0.00 ? 124 TRP A CH2  5  
ATOM 7979  H H    . TRP A 1 27  ? -6.525  -0.735  -2.554  1.00 0.00 ? 124 TRP A H    5  
ATOM 7980  H HA   . TRP A 1 27  ? -4.591  -2.768  -3.426  1.00 0.00 ? 124 TRP A HA   5  
ATOM 7981  H HB2  . TRP A 1 27  ? -6.708  -2.851  -4.614  1.00 0.00 ? 124 TRP A HB2  5  
ATOM 7982  H HB3  . TRP A 1 27  ? -6.607  -1.135  -4.983  1.00 0.00 ? 124 TRP A HB3  5  
ATOM 7983  H HD1  . TRP A 1 27  ? -3.849  -3.820  -5.528  1.00 0.00 ? 124 TRP A HD1  5  
ATOM 7984  H HE1  . TRP A 1 27  ? -3.234  -3.799  -8.030  1.00 0.00 ? 124 TRP A HE1  5  
ATOM 7985  H HE3  . TRP A 1 27  ? -7.280  -0.416  -7.187  1.00 0.00 ? 124 TRP A HE3  5  
ATOM 7986  H HZ2  . TRP A 1 27  ? -4.096  -2.525  -10.386 1.00 0.00 ? 124 TRP A HZ2  5  
ATOM 7987  H HZ3  . TRP A 1 27  ? -7.322  0.146   -9.580  1.00 0.00 ? 124 TRP A HZ3  5  
ATOM 7988  H HH2  . TRP A 1 27  ? -5.761  -0.889  -11.143 1.00 0.00 ? 124 TRP A HH2  5  
ATOM 7989  N N    . ILE A 1 28  ? -2.786  -1.145  -3.831  1.00 0.00 ? 125 ILE A N    5  
ATOM 7990  C CA   . ILE A 1 28  ? -1.693  -0.225  -4.097  1.00 0.00 ? 125 ILE A CA   5  
ATOM 7991  C C    . ILE A 1 28  ? -1.126  -0.488  -5.485  1.00 0.00 ? 125 ILE A C    5  
ATOM 7992  O O    . ILE A 1 28  ? -0.702  -1.605  -5.789  1.00 0.00 ? 125 ILE A O    5  
ATOM 7993  C CB   . ILE A 1 28  ? -0.548  -0.346  -3.056  1.00 0.00 ? 125 ILE A CB   5  
ATOM 7994  C CG1  . ILE A 1 28  ? -1.074  -0.248  -1.621  1.00 0.00 ? 125 ILE A CG1  5  
ATOM 7995  C CG2  . ILE A 1 28  ? 0.493   0.732   -3.292  1.00 0.00 ? 125 ILE A CG2  5  
ATOM 7996  C CD1  . ILE A 1 28  ? -1.539  -1.568  -1.050  1.00 0.00 ? 125 ILE A CD1  5  
ATOM 7997  H H    . ILE A 1 28  ? -2.581  -2.072  -3.574  1.00 0.00 ? 125 ILE A H    5  
ATOM 7998  H HA   . ILE A 1 28  ? -2.085  0.781   -4.062  1.00 0.00 ? 125 ILE A HA   5  
ATOM 7999  H HB   . ILE A 1 28  ? -0.070  -1.306  -3.191  1.00 0.00 ? 125 ILE A HB   5  
ATOM 8000  H HG12 . ILE A 1 28  ? -0.288  0.128   -0.983  1.00 0.00 ? 125 ILE A HG12 5  
ATOM 8001  H HG13 . ILE A 1 28  ? -1.909  0.436   -1.596  1.00 0.00 ? 125 ILE A HG13 5  
ATOM 8002  H HG21 . ILE A 1 28  ? 0.048   1.703   -3.131  1.00 0.00 ? 125 ILE A HG21 5  
ATOM 8003  H HG22 . ILE A 1 28  ? 0.853   0.667   -4.306  1.00 0.00 ? 125 ILE A HG22 5  
ATOM 8004  H HG23 . ILE A 1 28  ? 1.316   0.594   -2.607  1.00 0.00 ? 125 ILE A HG23 5  
ATOM 8005  H HD11 . ILE A 1 28  ? -1.853  -1.427  -0.028  1.00 0.00 ? 125 ILE A HD11 5  
ATOM 8006  H HD12 . ILE A 1 28  ? -0.726  -2.280  -1.082  1.00 0.00 ? 125 ILE A HD12 5  
ATOM 8007  H HD13 . ILE A 1 28  ? -2.366  -1.941  -1.635  1.00 0.00 ? 125 ILE A HD13 5  
ATOM 8008  N N    . LYS A 1 29  ? -1.129  0.536   -6.326  1.00 0.00 ? 126 LYS A N    5  
ATOM 8009  C CA   . LYS A 1 29  ? -0.622  0.406   -7.680  1.00 0.00 ? 126 LYS A CA   5  
ATOM 8010  C C    . LYS A 1 29  ? 0.368   1.522   -7.990  1.00 0.00 ? 126 LYS A C    5  
ATOM 8011  O O    . LYS A 1 29  ? 0.035   2.705   -7.927  1.00 0.00 ? 126 LYS A O    5  
ATOM 8012  C CB   . LYS A 1 29  ? -1.777  0.423   -8.686  1.00 0.00 ? 126 LYS A CB   5  
ATOM 8013  C CG   . LYS A 1 29  ? -1.331  0.259   -10.132 1.00 0.00 ? 126 LYS A CG   5  
ATOM 8014  C CD   . LYS A 1 29  ? -2.513  0.221   -11.088 1.00 0.00 ? 126 LYS A CD   5  
ATOM 8015  C CE   . LYS A 1 29  ? -3.310  1.518   -11.060 1.00 0.00 ? 126 LYS A CE   5  
ATOM 8016  N NZ   . LYS A 1 29  ? -4.413  1.519   -12.058 1.00 0.00 ? 126 LYS A NZ   5  
ATOM 8017  H H    . LYS A 1 29  ? -1.475  1.407   -6.025  1.00 0.00 ? 126 LYS A H    5  
ATOM 8018  H HA   . LYS A 1 29  ? -0.109  -0.542  -7.751  1.00 0.00 ? 126 LYS A HA   5  
ATOM 8019  H HB2  . LYS A 1 29  ? -2.458  -0.382  -8.447  1.00 0.00 ? 126 LYS A HB2  5  
ATOM 8020  H HB3  . LYS A 1 29  ? -2.299  1.363   -8.596  1.00 0.00 ? 126 LYS A HB3  5  
ATOM 8021  H HG2  . LYS A 1 29  ? -0.695  1.090   -10.397 1.00 0.00 ? 126 LYS A HG2  5  
ATOM 8022  H HG3  . LYS A 1 29  ? -0.777  -0.663  -10.222 1.00 0.00 ? 126 LYS A HG3  5  
ATOM 8023  H HD2  . LYS A 1 29  ? -2.147  0.059   -12.091 1.00 0.00 ? 126 LYS A HD2  5  
ATOM 8024  H HD3  . LYS A 1 29  ? -3.163  -0.596  -10.804 1.00 0.00 ? 126 LYS A HD3  5  
ATOM 8025  H HE2  . LYS A 1 29  ? -3.732  1.646   -10.074 1.00 0.00 ? 126 LYS A HE2  5  
ATOM 8026  H HE3  . LYS A 1 29  ? -2.642  2.339   -11.273 1.00 0.00 ? 126 LYS A HE3  5  
ATOM 8027  H HZ1  . LYS A 1 29  ? -4.023  1.477   -13.021 1.00 0.00 ? 126 LYS A HZ1  5  
ATOM 8028  H HZ2  . LYS A 1 29  ? -4.980  2.384   -11.965 1.00 0.00 ? 126 LYS A HZ2  5  
ATOM 8029  H HZ3  . LYS A 1 29  ? -5.031  0.695   -11.916 1.00 0.00 ? 126 LYS A HZ3  5  
ATOM 8030  N N    . TRP A 1 30  ? 1.585   1.134   -8.315  1.00 0.00 ? 127 TRP A N    5  
ATOM 8031  C CA   . TRP A 1 30  ? 2.634   2.085   -8.641  1.00 0.00 ? 127 TRP A CA   5  
ATOM 8032  C C    . TRP A 1 30  ? 3.069   1.902   -10.089 1.00 0.00 ? 127 TRP A C    5  
ATOM 8033  O O    . TRP A 1 30  ? 2.821   0.857   -10.693 1.00 0.00 ? 127 TRP A O    5  
ATOM 8034  C CB   . TRP A 1 30  ? 3.830   1.897   -7.703  1.00 0.00 ? 127 TRP A CB   5  
ATOM 8035  C CG   . TRP A 1 30  ? 4.317   0.482   -7.636  1.00 0.00 ? 127 TRP A CG   5  
ATOM 8036  C CD1  . TRP A 1 30  ? 5.289   -0.092  -8.403  1.00 0.00 ? 127 TRP A CD1  5  
ATOM 8037  C CD2  . TRP A 1 30  ? 3.846   -0.539  -6.751  1.00 0.00 ? 127 TRP A CD2  5  
ATOM 8038  N NE1  . TRP A 1 30  ? 5.446   -1.409  -8.049  1.00 0.00 ? 127 TRP A NE1  5  
ATOM 8039  C CE2  . TRP A 1 30  ? 4.571   -1.705  -7.037  1.00 0.00 ? 127 TRP A CE2  5  
ATOM 8040  C CE3  . TRP A 1 30  ? 2.879   -0.577  -5.745  1.00 0.00 ? 127 TRP A CE3  5  
ATOM 8041  C CZ2  . TRP A 1 30  ? 4.360   -2.898  -6.356  1.00 0.00 ? 127 TRP A CZ2  5  
ATOM 8042  C CZ3  . TRP A 1 30  ? 2.669   -1.761  -5.067  1.00 0.00 ? 127 TRP A CZ3  5  
ATOM 8043  C CH2  . TRP A 1 30  ? 3.405   -2.909  -5.376  1.00 0.00 ? 127 TRP A CH2  5  
ATOM 8044  H H    . TRP A 1 30  ? 1.786   0.175   -8.348  1.00 0.00 ? 127 TRP A H    5  
ATOM 8045  H HA   . TRP A 1 30  ? 2.236   3.079   -8.509  1.00 0.00 ? 127 TRP A HA   5  
ATOM 8046  H HB2  . TRP A 1 30  ? 4.646   2.516   -8.044  1.00 0.00 ? 127 TRP A HB2  5  
ATOM 8047  H HB3  . TRP A 1 30  ? 3.546   2.201   -6.706  1.00 0.00 ? 127 TRP A HB3  5  
ATOM 8048  H HD1  . TRP A 1 30  ? 5.842   0.424   -9.173  1.00 0.00 ? 127 TRP A HD1  5  
ATOM 8049  H HE1  . TRP A 1 30  ? 6.084   -2.036  -8.454  1.00 0.00 ? 127 TRP A HE1  5  
ATOM 8050  H HE3  . TRP A 1 30  ? 2.305   0.300   -5.491  1.00 0.00 ? 127 TRP A HE3  5  
ATOM 8051  H HZ2  . TRP A 1 30  ? 4.918   -3.792  -6.588  1.00 0.00 ? 127 TRP A HZ2  5  
ATOM 8052  H HZ3  . TRP A 1 30  ? 1.923   -1.809  -4.287  1.00 0.00 ? 127 TRP A HZ3  5  
ATOM 8053  H HH2  . TRP A 1 30  ? 3.205   -3.813  -4.821  1.00 0.00 ? 127 TRP A HH2  5  
ATOM 8054  N N    . SER A 1 31  ? 3.710   2.916   -10.642 1.00 0.00 ? 128 SER A N    5  
ATOM 8055  C CA   . SER A 1 31  ? 4.224   2.838   -11.994 1.00 0.00 ? 128 SER A CA   5  
ATOM 8056  C C    . SER A 1 31  ? 5.693   2.432   -11.969 1.00 0.00 ? 128 SER A C    5  
ATOM 8057  O O    . SER A 1 31  ? 6.494   3.019   -11.234 1.00 0.00 ? 128 SER A O    5  
ATOM 8058  C CB   . SER A 1 31  ? 4.052   4.183   -12.698 1.00 0.00 ? 128 SER A CB   5  
ATOM 8059  O OG   . SER A 1 31  ? 2.682   4.551   -12.760 1.00 0.00 ? 128 SER A OG   5  
ATOM 8060  H H    . SER A 1 31  ? 3.854   3.740   -10.123 1.00 0.00 ? 128 SER A H    5  
ATOM 8061  H HA   . SER A 1 31  ? 3.659   2.085   -12.523 1.00 0.00 ? 128 SER A HA   5  
ATOM 8062  H HB2  . SER A 1 31  ? 4.593   4.944   -12.155 1.00 0.00 ? 128 SER A HB2  5  
ATOM 8063  H HB3  . SER A 1 31  ? 4.440   4.114   -13.704 1.00 0.00 ? 128 SER A HB3  5  
ATOM 8064  H HG   . SER A 1 31  ? 2.239   4.280   -11.943 1.00 0.00 ? 128 SER A HG   5  
ATOM 8065  N N    . PRO A 1 32  ? 6.059   1.409   -12.758 1.00 0.00 ? 129 PRO A N    5  
ATOM 8066  C CA   . PRO A 1 32  ? 7.432   0.899   -12.815 1.00 0.00 ? 129 PRO A CA   5  
ATOM 8067  C C    . PRO A 1 32  ? 8.404   1.938   -13.368 1.00 0.00 ? 129 PRO A C    5  
ATOM 8068  O O    . PRO A 1 32  ? 7.976   2.919   -13.981 1.00 0.00 ? 129 PRO A O    5  
ATOM 8069  C CB   . PRO A 1 32  ? 7.334   -0.309  -13.756 1.00 0.00 ? 129 PRO A CB   5  
ATOM 8070  C CG   . PRO A 1 32  ? 6.107   -0.071  -14.564 1.00 0.00 ? 129 PRO A CG   5  
ATOM 8071  C CD   . PRO A 1 32  ? 5.160   0.674   -13.667 1.00 0.00 ? 129 PRO A CD   5  
ATOM 8072  H HA   . PRO A 1 32  ? 7.771   0.576   -11.842 1.00 0.00 ? 129 PRO A HA   5  
ATOM 8073  H HB2  . PRO A 1 32  ? 8.215   -0.354  -14.380 1.00 0.00 ? 129 PRO A HB2  5  
ATOM 8074  H HB3  . PRO A 1 32  ? 7.253   -1.215  -13.174 1.00 0.00 ? 129 PRO A HB3  5  
ATOM 8075  H HG2  . PRO A 1 32  ? 6.349   0.526   -15.431 1.00 0.00 ? 129 PRO A HG2  5  
ATOM 8076  H HG3  . PRO A 1 32  ? 5.676   -1.013  -14.864 1.00 0.00 ? 129 PRO A HG3  5  
ATOM 8077  H HD2  . PRO A 1 32  ? 4.552   1.355   -14.244 1.00 0.00 ? 129 PRO A HD2  5  
ATOM 8078  H HD3  . PRO A 1 32  ? 4.538   -0.016  -13.117 1.00 0.00 ? 129 PRO A HD3  5  
ATOM 8079  N N    . PRO A 1 33  ? 9.718   1.736   -13.143 1.00 0.00 ? 130 PRO A N    5  
ATOM 8080  C CA   . PRO A 1 33  ? 10.775  2.644   -13.602 1.00 0.00 ? 130 PRO A CA   5  
ATOM 8081  C C    . PRO A 1 33  ? 10.519  3.227   -14.990 1.00 0.00 ? 130 PRO A C    5  
ATOM 8082  O O    . PRO A 1 33  ? 10.114  2.516   -15.915 1.00 0.00 ? 130 PRO A O    5  
ATOM 8083  C CB   . PRO A 1 33  ? 11.998  1.733   -13.636 1.00 0.00 ? 130 PRO A CB   5  
ATOM 8084  C CG   . PRO A 1 33  ? 11.777  0.774   -12.521 1.00 0.00 ? 130 PRO A CG   5  
ATOM 8085  C CD   . PRO A 1 33  ? 10.284  0.591   -12.401 1.00 0.00 ? 130 PRO A CD   5  
ATOM 8086  H HA   . PRO A 1 33  ? 10.943  3.443   -12.896 1.00 0.00 ? 130 PRO A HA   5  
ATOM 8087  H HB2  . PRO A 1 33  ? 12.046  1.228   -14.590 1.00 0.00 ? 130 PRO A HB2  5  
ATOM 8088  H HB3  . PRO A 1 33  ? 12.892  2.317   -13.483 1.00 0.00 ? 130 PRO A HB3  5  
ATOM 8089  H HG2  . PRO A 1 33  ? 12.250  -0.169  -12.751 1.00 0.00 ? 130 PRO A HG2  5  
ATOM 8090  H HG3  . PRO A 1 33  ? 12.178  1.180   -11.604 1.00 0.00 ? 130 PRO A HG3  5  
ATOM 8091  H HD2  . PRO A 1 33  ? 9.983   -0.344  -12.851 1.00 0.00 ? 130 PRO A HD2  5  
ATOM 8092  H HD3  . PRO A 1 33  ? 9.985   0.621   -11.363 1.00 0.00 ? 130 PRO A HD3  5  
ATOM 8093  N N    . THR A 1 34  ? 10.754  4.529   -15.117 1.00 0.00 ? 131 THR A N    5  
ATOM 8094  C CA   . THR A 1 34  ? 10.578  5.233   -16.379 1.00 0.00 ? 131 THR A CA   5  
ATOM 8095  C C    . THR A 1 34  ? 11.617  4.776   -17.389 1.00 0.00 ? 131 THR A C    5  
ATOM 8096  O O    . THR A 1 34  ? 11.384  4.785   -18.597 1.00 0.00 ? 131 THR A O    5  
ATOM 8097  C CB   . THR A 1 34  ? 10.704  6.756   -16.187 1.00 0.00 ? 131 THR A CB   5  
ATOM 8098  O OG1  . THR A 1 34  ? 11.895  7.062   -15.450 1.00 0.00 ? 131 THR A OG1  5  
ATOM 8099  C CG2  . THR A 1 34  ? 9.498   7.313   -15.454 1.00 0.00 ? 131 THR A CG2  5  
ATOM 8100  H H    . THR A 1 34  ? 11.070  5.035   -14.331 1.00 0.00 ? 131 THR A H    5  
ATOM 8101  H HA   . THR A 1 34  ? 9.591   5.012   -16.757 1.00 0.00 ? 131 THR A HA   5  
ATOM 8102  H HB   . THR A 1 34  ? 10.764  7.221   -17.158 1.00 0.00 ? 131 THR A HB   5  
ATOM 8103  H HG1  . THR A 1 34  ? 11.861  6.625   -14.581 1.00 0.00 ? 131 THR A HG1  5  
ATOM 8104  H HG21 . THR A 1 34  ? 9.423   6.846   -14.484 1.00 0.00 ? 131 THR A HG21 5  
ATOM 8105  H HG22 . THR A 1 34  ? 8.605   7.108   -16.022 1.00 0.00 ? 131 THR A HG22 5  
ATOM 8106  H HG23 . THR A 1 34  ? 9.612   8.380   -15.333 1.00 0.00 ? 131 THR A HG23 5  
ATOM 8107  N N    . LEU A 1 35  ? 12.768  4.389   -16.870 1.00 0.00 ? 132 LEU A N    5  
ATOM 8108  C CA   . LEU A 1 35  ? 13.854  3.893   -17.690 1.00 0.00 ? 132 LEU A CA   5  
ATOM 8109  C C    . LEU A 1 35  ? 13.868  2.373   -17.668 1.00 0.00 ? 132 LEU A C    5  
ATOM 8110  O O    . LEU A 1 35  ? 13.027  1.756   -17.009 1.00 0.00 ? 132 LEU A O    5  
ATOM 8111  C CB   . LEU A 1 35  ? 15.182  4.444   -17.185 1.00 0.00 ? 132 LEU A CB   5  
ATOM 8112  C CG   . LEU A 1 35  ? 15.272  5.967   -17.157 1.00 0.00 ? 132 LEU A CG   5  
ATOM 8113  C CD1  . LEU A 1 35  ? 16.654  6.398   -16.712 1.00 0.00 ? 132 LEU A CD1  5  
ATOM 8114  C CD2  . LEU A 1 35  ? 14.943  6.549   -18.523 1.00 0.00 ? 132 LEU A CD2  5  
ATOM 8115  H H    . LEU A 1 35  ? 12.885  4.440   -15.901 1.00 0.00 ? 132 LEU A H    5  
ATOM 8116  H HA   . LEU A 1 35  ? 13.696  4.233   -18.700 1.00 0.00 ? 132 LEU A HA   5  
ATOM 8117  H HB2  . LEU A 1 35  ? 15.345  4.074   -16.183 1.00 0.00 ? 132 LEU A HB2  5  
ATOM 8118  H HB3  . LEU A 1 35  ? 15.970  4.070   -17.823 1.00 0.00 ? 132 LEU A HB3  5  
ATOM 8119  H HG   . LEU A 1 35  ? 14.554  6.352   -16.446 1.00 0.00 ? 132 LEU A HG   5  
ATOM 8120  H HD11 . LEU A 1 35  ? 16.840  6.030   -15.717 1.00 0.00 ? 132 LEU A HD11 5  
ATOM 8121  H HD12 . LEU A 1 35  ? 16.713  7.475   -16.717 1.00 0.00 ? 132 LEU A HD12 5  
ATOM 8122  H HD13 . LEU A 1 35  ? 17.387  5.993   -17.392 1.00 0.00 ? 132 LEU A HD13 5  
ATOM 8123  H HD21 . LEU A 1 35  ? 15.041  7.623   -18.490 1.00 0.00 ? 132 LEU A HD21 5  
ATOM 8124  H HD22 . LEU A 1 35  ? 13.929  6.290   -18.791 1.00 0.00 ? 132 LEU A HD22 5  
ATOM 8125  H HD23 . LEU A 1 35  ? 15.623  6.147   -19.261 1.00 0.00 ? 132 LEU A HD23 5  
ATOM 8126  N N    . ILE A 1 36  ? 14.836  1.781   -18.367 1.00 0.00 ? 133 ILE A N    5  
ATOM 8127  C CA   . ILE A 1 36  ? 14.978  0.328   -18.465 1.00 0.00 ? 133 ILE A CA   5  
ATOM 8128  C C    . ILE A 1 36  ? 13.865  -0.296  -19.309 1.00 0.00 ? 133 ILE A C    5  
ATOM 8129  O O    . ILE A 1 36  ? 14.147  -1.028  -20.261 1.00 0.00 ? 133 ILE A O    5  
ATOM 8130  C CB   . ILE A 1 36  ? 15.000  -0.324  -17.069 1.00 0.00 ? 133 ILE A CB   5  
ATOM 8131  C CG1  . ILE A 1 36  ? 16.116  0.295   -16.230 1.00 0.00 ? 133 ILE A CG1  5  
ATOM 8132  C CG2  . ILE A 1 36  ? 15.191  -1.831  -17.187 1.00 0.00 ? 133 ILE A CG2  5  
ATOM 8133  C CD1  . ILE A 1 36  ? 15.875  0.195   -14.746 1.00 0.00 ? 133 ILE A CD1  5  
ATOM 8134  H H    . ILE A 1 36  ? 15.490  2.343   -18.822 1.00 0.00 ? 133 ILE A H    5  
ATOM 8135  H HA   . ILE A 1 36  ? 15.925  0.125   -18.944 1.00 0.00 ? 133 ILE A HA   5  
ATOM 8136  H HB   . ILE A 1 36  ? 14.050  -0.139  -16.591 1.00 0.00 ? 133 ILE A HB   5  
ATOM 8137  H HG12 . ILE A 1 36  ? 17.045  -0.208  -16.449 1.00 0.00 ? 133 ILE A HG12 5  
ATOM 8138  H HG13 . ILE A 1 36  ? 16.209  1.342   -16.482 1.00 0.00 ? 133 ILE A HG13 5  
ATOM 8139  H HG21 . ILE A 1 36  ? 14.370  -2.255  -17.747 1.00 0.00 ? 133 ILE A HG21 5  
ATOM 8140  H HG22 . ILE A 1 36  ? 15.216  -2.270  -16.200 1.00 0.00 ? 133 ILE A HG22 5  
ATOM 8141  H HG23 . ILE A 1 36  ? 16.119  -2.038  -17.696 1.00 0.00 ? 133 ILE A HG23 5  
ATOM 8142  H HD11 . ILE A 1 36  ? 15.784  -0.844  -14.465 1.00 0.00 ? 133 ILE A HD11 5  
ATOM 8143  H HD12 . ILE A 1 36  ? 14.962  0.717   -14.500 1.00 0.00 ? 133 ILE A HD12 5  
ATOM 8144  H HD13 . ILE A 1 36  ? 16.702  0.642   -14.218 1.00 0.00 ? 133 ILE A HD13 5  
ATOM 8145  N N    . ASP A 1 37  ? 12.614  0.004   -18.965 1.00 0.00 ? 134 ASP A N    5  
ATOM 8146  C CA   . ASP A 1 37  ? 11.455  -0.550  -19.660 1.00 0.00 ? 134 ASP A CA   5  
ATOM 8147  C C    . ASP A 1 37  ? 11.525  -2.070  -19.681 1.00 0.00 ? 134 ASP A C    5  
ATOM 8148  O O    . ASP A 1 37  ? 11.653  -2.691  -20.739 1.00 0.00 ? 134 ASP A O    5  
ATOM 8149  C CB   . ASP A 1 37  ? 11.342  0.007   -21.085 1.00 0.00 ? 134 ASP A CB   5  
ATOM 8150  C CG   . ASP A 1 37  ? 10.918  1.462   -21.113 1.00 0.00 ? 134 ASP A CG   5  
ATOM 8151  O OD1  . ASP A 1 37  ? 9.792   1.765   -20.664 1.00 0.00 ? 134 ASP A OD1  5  
ATOM 8152  O OD2  . ASP A 1 37  ? 11.689  2.308   -21.612 1.00 0.00 ? 134 ASP A OD2  5  
ATOM 8153  H H    . ASP A 1 37  ? 12.467  0.623   -18.214 1.00 0.00 ? 134 ASP A H    5  
ATOM 8154  H HA   . ASP A 1 37  ? 10.577  -0.258  -19.105 1.00 0.00 ? 134 ASP A HA   5  
ATOM 8155  H HB2  . ASP A 1 37  ? 12.300  -0.077  -21.575 1.00 0.00 ? 134 ASP A HB2  5  
ATOM 8156  H HB3  . ASP A 1 37  ? 10.612  -0.572  -21.632 1.00 0.00 ? 134 ASP A HB3  5  
ATOM 8157  N N    . LEU A 1 38  ? 11.437  -2.659  -18.497 1.00 0.00 ? 135 LEU A N    5  
ATOM 8158  C CA   . LEU A 1 38  ? 11.572  -4.103  -18.334 1.00 0.00 ? 135 LEU A CA   5  
ATOM 8159  C C    . LEU A 1 38  ? 10.270  -4.824  -18.669 1.00 0.00 ? 135 LEU A C    5  
ATOM 8160  O O    . LEU A 1 38  ? 9.742   -5.603  -17.873 1.00 0.00 ? 135 LEU A O    5  
ATOM 8161  C CB   . LEU A 1 38  ? 12.017  -4.443  -16.909 1.00 0.00 ? 135 LEU A CB   5  
ATOM 8162  C CG   . LEU A 1 38  ? 11.197  -3.776  -15.808 1.00 0.00 ? 135 LEU A CG   5  
ATOM 8163  C CD1  . LEU A 1 38  ? 10.889  -4.766  -14.698 1.00 0.00 ? 135 LEU A CD1  5  
ATOM 8164  C CD2  . LEU A 1 38  ? 11.936  -2.568  -15.248 1.00 0.00 ? 135 LEU A CD2  5  
ATOM 8165  H H    . LEU A 1 38  ? 11.263  -2.106  -17.704 1.00 0.00 ? 135 LEU A H    5  
ATOM 8166  H HA   . LEU A 1 38  ? 12.330  -4.435  -19.018 1.00 0.00 ? 135 LEU A HA   5  
ATOM 8167  H HB2  . LEU A 1 38  ? 11.953  -5.514  -16.780 1.00 0.00 ? 135 LEU A HB2  5  
ATOM 8168  H HB3  . LEU A 1 38  ? 13.047  -4.143  -16.793 1.00 0.00 ? 135 LEU A HB3  5  
ATOM 8169  H HG   . LEU A 1 38  ? 10.265  -3.436  -16.228 1.00 0.00 ? 135 LEU A HG   5  
ATOM 8170  H HD11 . LEU A 1 38  ? 10.344  -4.267  -13.911 1.00 0.00 ? 135 LEU A HD11 5  
ATOM 8171  H HD12 . LEU A 1 38  ? 11.813  -5.162  -14.301 1.00 0.00 ? 135 LEU A HD12 5  
ATOM 8172  H HD13 . LEU A 1 38  ? 10.292  -5.574  -15.092 1.00 0.00 ? 135 LEU A HD13 5  
ATOM 8173  H HD21 . LEU A 1 38  ? 11.325  -2.090  -14.497 1.00 0.00 ? 135 LEU A HD21 5  
ATOM 8174  H HD22 . LEU A 1 38  ? 12.139  -1.868  -16.046 1.00 0.00 ? 135 LEU A HD22 5  
ATOM 8175  H HD23 . LEU A 1 38  ? 12.867  -2.889  -14.806 1.00 0.00 ? 135 LEU A HD23 5  
ATOM 8176  N N    . LYS A 1 39  ? 9.763   -4.564  -19.861 1.00 0.00 ? 136 LYS A N    5  
ATOM 8177  C CA   . LYS A 1 39  ? 8.548   -5.205  -20.327 1.00 0.00 ? 136 LYS A CA   5  
ATOM 8178  C C    . LYS A 1 39  ? 8.859   -6.612  -20.819 1.00 0.00 ? 136 LYS A C    5  
ATOM 8179  O O    . LYS A 1 39  ? 7.980   -7.468  -20.909 1.00 0.00 ? 136 LYS A O    5  
ATOM 8180  C CB   . LYS A 1 39  ? 7.911   -4.385  -21.437 1.00 0.00 ? 136 LYS A CB   5  
ATOM 8181  C CG   . LYS A 1 39  ? 6.495   -4.811  -21.724 1.00 0.00 ? 136 LYS A CG   5  
ATOM 8182  C CD   . LYS A 1 39  ? 5.832   -3.898  -22.723 1.00 0.00 ? 136 LYS A CD   5  
ATOM 8183  C CE   . LYS A 1 39  ? 4.360   -4.221  -22.820 1.00 0.00 ? 136 LYS A CE   5  
ATOM 8184  N NZ   . LYS A 1 39  ? 3.635   -3.886  -21.564 1.00 0.00 ? 136 LYS A NZ   5  
ATOM 8185  H H    . LYS A 1 39  ? 10.222  -3.921  -20.444 1.00 0.00 ? 136 LYS A H    5  
ATOM 8186  H HA   . LYS A 1 39  ? 7.854   -5.269  -19.501 1.00 0.00 ? 136 LYS A HA   5  
ATOM 8187  H HB2  . LYS A 1 39  ? 7.905   -3.344  -21.150 1.00 0.00 ? 136 LYS A HB2  5  
ATOM 8188  H HB3  . LYS A 1 39  ? 8.491   -4.500  -22.339 1.00 0.00 ? 136 LYS A HB3  5  
ATOM 8189  H HG2  . LYS A 1 39  ? 6.506   -5.814  -22.122 1.00 0.00 ? 136 LYS A HG2  5  
ATOM 8190  H HG3  . LYS A 1 39  ? 5.931   -4.794  -20.804 1.00 0.00 ? 136 LYS A HG3  5  
ATOM 8191  H HD2  . LYS A 1 39  ? 5.954   -2.875  -22.402 1.00 0.00 ? 136 LYS A HD2  5  
ATOM 8192  H HD3  . LYS A 1 39  ? 6.292   -4.039  -23.689 1.00 0.00 ? 136 LYS A HD3  5  
ATOM 8193  H HE2  . LYS A 1 39  ? 3.932   -3.667  -23.638 1.00 0.00 ? 136 LYS A HE2  5  
ATOM 8194  H HE3  . LYS A 1 39  ? 4.263   -5.279  -23.004 1.00 0.00 ? 136 LYS A HE3  5  
ATOM 8195  H HZ1  . LYS A 1 39  ? 4.081   -4.360  -20.753 1.00 0.00 ? 136 LYS A HZ1  5  
ATOM 8196  H HZ2  . LYS A 1 39  ? 2.646   -4.195  -21.631 1.00 0.00 ? 136 LYS A HZ2  5  
ATOM 8197  H HZ3  . LYS A 1 39  ? 3.652   -2.860  -21.402 1.00 0.00 ? 136 LYS A HZ3  5  
ATOM 8198  N N    . THR A 1 40  ? 10.123  -6.836  -21.131 1.00 0.00 ? 137 THR A N    5  
ATOM 8199  C CA   . THR A 1 40  ? 10.590  -8.142  -21.557 1.00 0.00 ? 137 THR A CA   5  
ATOM 8200  C C    . THR A 1 40  ? 10.922  -9.021  -20.352 1.00 0.00 ? 137 THR A C    5  
ATOM 8201  O O    . THR A 1 40  ? 10.741  -8.607  -19.202 1.00 0.00 ? 137 THR A O    5  
ATOM 8202  C CB   . THR A 1 40  ? 11.834  -8.006  -22.451 1.00 0.00 ? 137 THR A CB   5  
ATOM 8203  O OG1  . THR A 1 40  ? 12.764  -7.093  -21.851 1.00 0.00 ? 137 THR A OG1  5  
ATOM 8204  C CG2  . THR A 1 40  ? 11.458  -7.515  -23.840 1.00 0.00 ? 137 THR A CG2  5  
ATOM 8205  H H    . THR A 1 40  ? 10.764  -6.101  -21.070 1.00 0.00 ? 137 THR A H    5  
ATOM 8206  H HA   . THR A 1 40  ? 9.806   -8.609  -22.132 1.00 0.00 ? 137 THR A HA   5  
ATOM 8207  H HB   . THR A 1 40  ? 12.302  -8.976  -22.541 1.00 0.00 ? 137 THR A HB   5  
ATOM 8208  H HG1  . THR A 1 40  ? 12.825  -6.298  -22.391 1.00 0.00 ? 137 THR A HG1  5  
ATOM 8209  H HG21 . THR A 1 40  ? 12.345  -7.452  -24.453 1.00 0.00 ? 137 THR A HG21 5  
ATOM 8210  H HG22 . THR A 1 40  ? 11.003  -6.539  -23.763 1.00 0.00 ? 137 THR A HG22 5  
ATOM 8211  H HG23 . THR A 1 40  ? 10.758  -8.204  -24.289 1.00 0.00 ? 137 THR A HG23 5  
ATOM 8212  N N    . GLY A 1 41  ? 11.393  -10.233 -20.616 1.00 0.00 ? 138 GLY A N    5  
ATOM 8213  C CA   . GLY A 1 41  ? 11.825  -11.107 -19.545 1.00 0.00 ? 138 GLY A CA   5  
ATOM 8214  C C    . GLY A 1 41  ? 13.285  -10.888 -19.203 1.00 0.00 ? 138 GLY A C    5  
ATOM 8215  O O    . GLY A 1 41  ? 13.844  -9.836  -19.527 1.00 0.00 ? 138 GLY A O    5  
ATOM 8216  H H    . GLY A 1 41  ? 11.449  -10.535 -21.547 1.00 0.00 ? 138 GLY A H    5  
ATOM 8217  H HA2  . GLY A 1 41  ? 11.225  -10.915 -18.669 1.00 0.00 ? 138 GLY A HA2  5  
ATOM 8218  H HA3  . GLY A 1 41  ? 11.686  -12.133 -19.851 1.00 0.00 ? 138 GLY A HA3  5  
ATOM 8219  N N    . TRP A 1 42  ? 13.896  -11.884 -18.559 1.00 0.00 ? 139 TRP A N    5  
ATOM 8220  C CA   . TRP A 1 42  ? 15.311  -11.845 -18.173 1.00 0.00 ? 139 TRP A CA   5  
ATOM 8221  C C    . TRP A 1 42  ? 15.558  -10.821 -17.061 1.00 0.00 ? 139 TRP A C    5  
ATOM 8222  O O    . TRP A 1 42  ? 15.911  -11.186 -15.938 1.00 0.00 ? 139 TRP A O    5  
ATOM 8223  C CB   . TRP A 1 42  ? 16.202  -11.550 -19.390 1.00 0.00 ? 139 TRP A CB   5  
ATOM 8224  C CG   . TRP A 1 42  ? 17.669  -11.645 -19.098 1.00 0.00 ? 139 TRP A CG   5  
ATOM 8225  C CD1  . TRP A 1 42  ? 18.408  -12.787 -19.006 1.00 0.00 ? 139 TRP A CD1  5  
ATOM 8226  C CD2  . TRP A 1 42  ? 18.574  -10.560 -18.864 1.00 0.00 ? 139 TRP A CD2  5  
ATOM 8227  N NE1  . TRP A 1 42  ? 19.717  -12.480 -18.727 1.00 0.00 ? 139 TRP A NE1  5  
ATOM 8228  C CE2  . TRP A 1 42  ? 19.845  -11.119 -18.632 1.00 0.00 ? 139 TRP A CE2  5  
ATOM 8229  C CE3  . TRP A 1 42  ? 18.434  -9.171  -18.825 1.00 0.00 ? 139 TRP A CE3  5  
ATOM 8230  C CZ2  . TRP A 1 42  ? 20.964  -10.337 -18.367 1.00 0.00 ? 139 TRP A CZ2  5  
ATOM 8231  C CZ3  . TRP A 1 42  ? 19.546  -8.396  -18.561 1.00 0.00 ? 139 TRP A CZ3  5  
ATOM 8232  C CH2  . TRP A 1 42  ? 20.798  -8.981  -18.336 1.00 0.00 ? 139 TRP A CH2  5  
ATOM 8233  H H    . TRP A 1 42  ? 13.376  -12.685 -18.337 1.00 0.00 ? 139 TRP A H    5  
ATOM 8234  H HA   . TRP A 1 42  ? 15.565  -12.823 -17.793 1.00 0.00 ? 139 TRP A HA   5  
ATOM 8235  H HB2  . TRP A 1 42  ? 15.973  -12.256 -20.174 1.00 0.00 ? 139 TRP A HB2  5  
ATOM 8236  H HB3  . TRP A 1 42  ? 15.996  -10.550 -19.742 1.00 0.00 ? 139 TRP A HB3  5  
ATOM 8237  H HD1  . TRP A 1 42  ? 18.009  -13.780 -19.135 1.00 0.00 ? 139 TRP A HD1  5  
ATOM 8238  H HE1  . TRP A 1 42  ? 20.444  -13.132 -18.608 1.00 0.00 ? 139 TRP A HE1  5  
ATOM 8239  H HE3  . TRP A 1 42  ? 17.476  -8.701  -18.995 1.00 0.00 ? 139 TRP A HE3  5  
ATOM 8240  H HZ2  . TRP A 1 42  ? 21.936  -10.773 -18.191 1.00 0.00 ? 139 TRP A HZ2  5  
ATOM 8241  H HZ3  . TRP A 1 42  ? 19.456  -7.321  -18.525 1.00 0.00 ? 139 TRP A HZ3  5  
ATOM 8242  H HH2  . TRP A 1 42  ? 21.641  -8.337  -18.132 1.00 0.00 ? 139 TRP A HH2  5  
ATOM 8243  N N    . PHE A 1 43  ? 15.365  -9.547  -17.375 1.00 0.00 ? 140 PHE A N    5  
ATOM 8244  C CA   . PHE A 1 43  ? 15.560  -8.477  -16.410 1.00 0.00 ? 140 PHE A CA   5  
ATOM 8245  C C    . PHE A 1 43  ? 14.447  -8.518  -15.370 1.00 0.00 ? 140 PHE A C    5  
ATOM 8246  O O    . PHE A 1 43  ? 13.332  -8.059  -15.621 1.00 0.00 ? 140 PHE A O    5  
ATOM 8247  C CB   . PHE A 1 43  ? 15.572  -7.118  -17.122 1.00 0.00 ? 140 PHE A CB   5  
ATOM 8248  C CG   . PHE A 1 43  ? 16.050  -5.978  -16.264 1.00 0.00 ? 140 PHE A CG   5  
ATOM 8249  C CD1  . PHE A 1 43  ? 15.202  -5.369  -15.351 1.00 0.00 ? 140 PHE A CD1  5  
ATOM 8250  C CD2  . PHE A 1 43  ? 17.349  -5.511  -16.378 1.00 0.00 ? 140 PHE A CD2  5  
ATOM 8251  C CE1  . PHE A 1 43  ? 15.642  -4.319  -14.568 1.00 0.00 ? 140 PHE A CE1  5  
ATOM 8252  C CE2  . PHE A 1 43  ? 17.795  -4.462  -15.598 1.00 0.00 ? 140 PHE A CE2  5  
ATOM 8253  C CZ   . PHE A 1 43  ? 16.941  -3.866  -14.692 1.00 0.00 ? 140 PHE A CZ   5  
ATOM 8254  H H    . PHE A 1 43  ? 15.066  -9.322  -18.284 1.00 0.00 ? 140 PHE A H    5  
ATOM 8255  H HA   . PHE A 1 43  ? 16.509  -8.633  -15.919 1.00 0.00 ? 140 PHE A HA   5  
ATOM 8256  H HB2  . PHE A 1 43  ? 16.221  -7.178  -17.982 1.00 0.00 ? 140 PHE A HB2  5  
ATOM 8257  H HB3  . PHE A 1 43  ? 14.569  -6.887  -17.453 1.00 0.00 ? 140 PHE A HB3  5  
ATOM 8258  H HD1  . PHE A 1 43  ? 14.186  -5.723  -15.253 1.00 0.00 ? 140 PHE A HD1  5  
ATOM 8259  H HD2  . PHE A 1 43  ? 18.019  -5.977  -17.086 1.00 0.00 ? 140 PHE A HD2  5  
ATOM 8260  H HE1  . PHE A 1 43  ? 14.972  -3.853  -13.861 1.00 0.00 ? 140 PHE A HE1  5  
ATOM 8261  H HE2  . PHE A 1 43  ? 18.811  -4.109  -15.695 1.00 0.00 ? 140 PHE A HE2  5  
ATOM 8262  H HZ   . PHE A 1 43  ? 17.289  -3.046  -14.081 1.00 0.00 ? 140 PHE A HZ   5  
ATOM 8263  N N    . THR A 1 44  ? 14.746  -9.082  -14.213 1.00 0.00 ? 141 THR A N    5  
ATOM 8264  C CA   . THR A 1 44  ? 13.755  -9.220  -13.163 1.00 0.00 ? 141 THR A CA   5  
ATOM 8265  C C    . THR A 1 44  ? 13.880  -8.073  -12.168 1.00 0.00 ? 141 THR A C    5  
ATOM 8266  O O    . THR A 1 44  ? 14.981  -7.741  -11.721 1.00 0.00 ? 141 THR A O    5  
ATOM 8267  C CB   . THR A 1 44  ? 13.921  -10.556 -12.422 1.00 0.00 ? 141 THR A CB   5  
ATOM 8268  O OG1  . THR A 1 44  ? 14.351  -11.571 -13.344 1.00 0.00 ? 141 THR A OG1  5  
ATOM 8269  C CG2  . THR A 1 44  ? 12.619  -10.986 -11.770 1.00 0.00 ? 141 THR A CG2  5  
ATOM 8270  H H    . THR A 1 44  ? 15.661  -9.403  -14.055 1.00 0.00 ? 141 THR A H    5  
ATOM 8271  H HA   . THR A 1 44  ? 12.774  -9.194  -13.615 1.00 0.00 ? 141 THR A HA   5  
ATOM 8272  H HB   . THR A 1 44  ? 14.662  -10.430 -11.653 1.00 0.00 ? 141 THR A HB   5  
ATOM 8273  H HG1  . THR A 1 44  ? 14.900  -11.167 -14.029 1.00 0.00 ? 141 THR A HG1  5  
ATOM 8274  H HG21 . THR A 1 44  ? 12.762  -11.933 -11.271 1.00 0.00 ? 141 THR A HG21 5  
ATOM 8275  H HG22 . THR A 1 44  ? 11.855  -11.091 -12.525 1.00 0.00 ? 141 THR A HG22 5  
ATOM 8276  H HG23 . THR A 1 44  ? 12.314  -10.241 -11.050 1.00 0.00 ? 141 THR A HG23 5  
ATOM 8277  N N    . LEU A 1 45  ? 12.757  -7.463  -11.838 1.00 0.00 ? 142 LEU A N    5  
ATOM 8278  C CA   . LEU A 1 45  ? 12.734  -6.369  -10.888 1.00 0.00 ? 142 LEU A CA   5  
ATOM 8279  C C    . LEU A 1 45  ? 11.694  -6.645  -9.818  1.00 0.00 ? 142 LEU A C    5  
ATOM 8280  O O    . LEU A 1 45  ? 10.505  -6.767  -10.113 1.00 0.00 ? 142 LEU A O    5  
ATOM 8281  C CB   . LEU A 1 45  ? 12.422  -5.059  -11.607 1.00 0.00 ? 142 LEU A CB   5  
ATOM 8282  C CG   . LEU A 1 45  ? 12.495  -3.799  -10.752 1.00 0.00 ? 142 LEU A CG   5  
ATOM 8283  C CD1  . LEU A 1 45  ? 13.917  -3.560  -10.282 1.00 0.00 ? 142 LEU A CD1  5  
ATOM 8284  C CD2  . LEU A 1 45  ? 11.992  -2.601  -11.536 1.00 0.00 ? 142 LEU A CD2  5  
ATOM 8285  H H    . LEU A 1 45  ? 11.915  -7.756  -12.246 1.00 0.00 ? 142 LEU A H    5  
ATOM 8286  H HA   . LEU A 1 45  ? 13.709  -6.302  -10.426 1.00 0.00 ? 142 LEU A HA   5  
ATOM 8287  H HB2  . LEU A 1 45  ? 13.121  -4.949  -12.421 1.00 0.00 ? 142 LEU A HB2  5  
ATOM 8288  H HB3  . LEU A 1 45  ? 11.427  -5.128  -12.016 1.00 0.00 ? 142 LEU A HB3  5  
ATOM 8289  H HG   . LEU A 1 45  ? 11.867  -3.922  -9.882  1.00 0.00 ? 142 LEU A HG   5  
ATOM 8290  H HD11 . LEU A 1 45  ? 13.961  -2.641  -9.716  1.00 0.00 ? 142 LEU A HD11 5  
ATOM 8291  H HD12 . LEU A 1 45  ? 14.571  -3.485  -11.139 1.00 0.00 ? 142 LEU A HD12 5  
ATOM 8292  H HD13 . LEU A 1 45  ? 14.235  -4.382  -9.658  1.00 0.00 ? 142 LEU A HD13 5  
ATOM 8293  H HD21 . LEU A 1 45  ? 12.603  -2.465  -12.416 1.00 0.00 ? 142 LEU A HD21 5  
ATOM 8294  H HD22 . LEU A 1 45  ? 12.050  -1.716  -10.918 1.00 0.00 ? 142 LEU A HD22 5  
ATOM 8295  H HD23 . LEU A 1 45  ? 10.967  -2.768  -11.831 1.00 0.00 ? 142 LEU A HD23 5  
ATOM 8296  N N    . LEU A 1 46  ? 12.144  -6.779  -8.583  1.00 0.00 ? 143 LEU A N    5  
ATOM 8297  C CA   . LEU A 1 46  ? 11.246  -7.063  -7.479  1.00 0.00 ? 143 LEU A CA   5  
ATOM 8298  C C    . LEU A 1 46  ? 10.926  -5.797  -6.702  1.00 0.00 ? 143 LEU A C    5  
ATOM 8299  O O    . LEU A 1 46  ? 11.781  -4.922  -6.531  1.00 0.00 ? 143 LEU A O    5  
ATOM 8300  C CB   . LEU A 1 46  ? 11.844  -8.128  -6.558  1.00 0.00 ? 143 LEU A CB   5  
ATOM 8301  C CG   . LEU A 1 46  ? 11.421  -9.570  -6.859  1.00 0.00 ? 143 LEU A CG   5  
ATOM 8302  C CD1  . LEU A 1 46  ? 11.594  -9.896  -8.332  1.00 0.00 ? 143 LEU A CD1  5  
ATOM 8303  C CD2  . LEU A 1 46  ? 12.222  -10.538 -6.007  1.00 0.00 ? 143 LEU A CD2  5  
ATOM 8304  H H    . LEU A 1 46  ? 13.103  -6.680  -8.409  1.00 0.00 ? 143 LEU A H    5  
ATOM 8305  H HA   . LEU A 1 46  ? 10.327  -7.444  -7.899  1.00 0.00 ? 143 LEU A HA   5  
ATOM 8306  H HB2  . LEU A 1 46  ? 12.919  -8.071  -6.630  1.00 0.00 ? 143 LEU A HB2  5  
ATOM 8307  H HB3  . LEU A 1 46  ? 11.555  -7.896  -5.546  1.00 0.00 ? 143 LEU A HB3  5  
ATOM 8308  H HG   . LEU A 1 46  ? 10.378  -9.692  -6.611  1.00 0.00 ? 143 LEU A HG   5  
ATOM 8309  H HD11 . LEU A 1 46  ? 10.973  -9.234  -8.918  1.00 0.00 ? 143 LEU A HD11 5  
ATOM 8310  H HD12 . LEU A 1 46  ? 11.299  -10.919 -8.511  1.00 0.00 ? 143 LEU A HD12 5  
ATOM 8311  H HD13 . LEU A 1 46  ? 12.628  -9.763  -8.612  1.00 0.00 ? 143 LEU A HD13 5  
ATOM 8312  H HD21 . LEU A 1 46  ? 12.044  -10.331 -4.962  1.00 0.00 ? 143 LEU A HD21 5  
ATOM 8313  H HD22 . LEU A 1 46  ? 13.275  -10.421 -6.222  1.00 0.00 ? 143 LEU A HD22 5  
ATOM 8314  H HD23 . LEU A 1 46  ? 11.918  -11.549 -6.231  1.00 0.00 ? 143 LEU A HD23 5  
ATOM 8315  N N    . TYR A 1 47  ? 9.688   -5.710  -6.247  1.00 0.00 ? 144 TYR A N    5  
ATOM 8316  C CA   . TYR A 1 47  ? 9.201   -4.532  -5.546  1.00 0.00 ? 144 TYR A CA   5  
ATOM 8317  C C    . TYR A 1 47  ? 8.851   -4.872  -4.101  1.00 0.00 ? 144 TYR A C    5  
ATOM 8318  O O    . TYR A 1 47  ? 8.194   -5.884  -3.830  1.00 0.00 ? 144 TYR A O    5  
ATOM 8319  C CB   . TYR A 1 47  ? 7.963   -3.971  -6.255  1.00 0.00 ? 144 TYR A CB   5  
ATOM 8320  C CG   . TYR A 1 47  ? 8.161   -3.709  -7.734  1.00 0.00 ? 144 TYR A CG   5  
ATOM 8321  C CD1  . TYR A 1 47  ? 7.985   -4.723  -8.669  1.00 0.00 ? 144 TYR A CD1  5  
ATOM 8322  C CD2  . TYR A 1 47  ? 8.515   -2.449  -8.197  1.00 0.00 ? 144 TYR A CD2  5  
ATOM 8323  C CE1  . TYR A 1 47  ? 8.157   -4.489  -10.019 1.00 0.00 ? 144 TYR A CE1  5  
ATOM 8324  C CE2  . TYR A 1 47  ? 8.689   -2.207  -9.547  1.00 0.00 ? 144 TYR A CE2  5  
ATOM 8325  C CZ   . TYR A 1 47  ? 8.509   -3.231  -10.453 1.00 0.00 ? 144 TYR A CZ   5  
ATOM 8326  O OH   . TYR A 1 47  ? 8.679   -2.992  -11.796 1.00 0.00 ? 144 TYR A OH   5  
ATOM 8327  H H    . TYR A 1 47  ? 9.075   -6.466  -6.394  1.00 0.00 ? 144 TYR A H    5  
ATOM 8328  H HA   . TYR A 1 47  ? 9.983   -3.788  -5.555  1.00 0.00 ? 144 TYR A HA   5  
ATOM 8329  H HB2  . TYR A 1 47  ? 7.150   -4.674  -6.152  1.00 0.00 ? 144 TYR A HB2  5  
ATOM 8330  H HB3  . TYR A 1 47  ? 7.685   -3.038  -5.788  1.00 0.00 ? 144 TYR A HB3  5  
ATOM 8331  H HD1  . TYR A 1 47  ? 7.709   -5.710  -8.326  1.00 0.00 ? 144 TYR A HD1  5  
ATOM 8332  H HD2  . TYR A 1 47  ? 8.656   -1.648  -7.486  1.00 0.00 ? 144 TYR A HD2  5  
ATOM 8333  H HE1  . TYR A 1 47  ? 8.014   -5.291  -10.728 1.00 0.00 ? 144 TYR A HE1  5  
ATOM 8334  H HE2  . TYR A 1 47  ? 8.965   -1.220  -9.887  1.00 0.00 ? 144 TYR A HE2  5  
ATOM 8335  H HH   . TYR A 1 47  ? 8.079   -3.556  -12.301 1.00 0.00 ? 144 TYR A HH   5  
ATOM 8336  N N    . GLU A 1 48  ? 9.298   -4.029  -3.179  1.00 0.00 ? 145 GLU A N    5  
ATOM 8337  C CA   . GLU A 1 48  ? 8.986   -4.198  -1.768  1.00 0.00 ? 145 GLU A CA   5  
ATOM 8338  C C    . GLU A 1 48  ? 8.166   -3.007  -1.281  1.00 0.00 ? 145 GLU A C    5  
ATOM 8339  O O    . GLU A 1 48  ? 8.437   -1.867  -1.665  1.00 0.00 ? 145 GLU A O    5  
ATOM 8340  C CB   . GLU A 1 48  ? 10.275  -4.337  -0.952  1.00 0.00 ? 145 GLU A CB   5  
ATOM 8341  C CG   . GLU A 1 48  ? 10.041  -4.703  0.505   1.00 0.00 ? 145 GLU A CG   5  
ATOM 8342  C CD   . GLU A 1 48  ? 11.328  -4.927  1.275   1.00 0.00 ? 145 GLU A CD   5  
ATOM 8343  O OE1  . GLU A 1 48  ? 11.885  -6.047  1.209   1.00 0.00 ? 145 GLU A OE1  5  
ATOM 8344  O OE2  . GLU A 1 48  ? 11.785  -3.995  1.962   1.00 0.00 ? 145 GLU A OE2  5  
ATOM 8345  H H    . GLU A 1 48  ? 9.851   -3.265  -3.456  1.00 0.00 ? 145 GLU A H    5  
ATOM 8346  H HA   . GLU A 1 48  ? 8.397   -5.097  -1.662  1.00 0.00 ? 145 GLU A HA   5  
ATOM 8347  H HB2  . GLU A 1 48  ? 10.889  -5.105  -1.400  1.00 0.00 ? 145 GLU A HB2  5  
ATOM 8348  H HB3  . GLU A 1 48  ? 10.810  -3.399  -0.983  1.00 0.00 ? 145 GLU A HB3  5  
ATOM 8349  H HG2  . GLU A 1 48  ? 9.493   -3.903  0.978   1.00 0.00 ? 145 GLU A HG2  5  
ATOM 8350  H HG3  . GLU A 1 48  ? 9.453   -5.609  0.544   1.00 0.00 ? 145 GLU A HG3  5  
ATOM 8351  N N    . ILE A 1 49  ? 7.160   -3.272  -0.454  1.00 0.00 ? 146 ILE A N    5  
ATOM 8352  C CA   . ILE A 1 49  ? 6.261   -2.226  0.015   1.00 0.00 ? 146 ILE A CA   5  
ATOM 8353  C C    . ILE A 1 49  ? 6.299   -2.119  1.535   1.00 0.00 ? 146 ILE A C    5  
ATOM 8354  O O    . ILE A 1 49  ? 5.979   -3.070  2.247   1.00 0.00 ? 146 ILE A O    5  
ATOM 8355  C CB   . ILE A 1 49  ? 4.791   -2.461  -0.421  1.00 0.00 ? 146 ILE A CB   5  
ATOM 8356  C CG1  . ILE A 1 49  ? 4.678   -2.678  -1.933  1.00 0.00 ? 146 ILE A CG1  5  
ATOM 8357  C CG2  . ILE A 1 49  ? 3.909   -1.293  0.001   1.00 0.00 ? 146 ILE A CG2  5  
ATOM 8358  C CD1  . ILE A 1 49  ? 4.826   -4.122  -2.360  1.00 0.00 ? 146 ILE A CD1  5  
ATOM 8359  H H    . ILE A 1 49  ? 7.029   -4.195  -0.137  1.00 0.00 ? 146 ILE A H    5  
ATOM 8360  H HA   . ILE A 1 49  ? 6.594   -1.289  -0.408  1.00 0.00 ? 146 ILE A HA   5  
ATOM 8361  H HB   . ILE A 1 49  ? 4.435   -3.342  0.088   1.00 0.00 ? 146 ILE A HB   5  
ATOM 8362  H HG12 . ILE A 1 49  ? 3.711   -2.333  -2.267  1.00 0.00 ? 146 ILE A HG12 5  
ATOM 8363  H HG13 . ILE A 1 49  ? 5.449   -2.105  -2.429  1.00 0.00 ? 146 ILE A HG13 5  
ATOM 8364  H HG21 . ILE A 1 49  ? 2.886   -1.494  -0.284  1.00 0.00 ? 146 ILE A HG21 5  
ATOM 8365  H HG22 . ILE A 1 49  ? 4.248   -0.392  -0.491  1.00 0.00 ? 146 ILE A HG22 5  
ATOM 8366  H HG23 . ILE A 1 49  ? 3.968   -1.163  1.071   1.00 0.00 ? 146 ILE A HG23 5  
ATOM 8367  H HD11 . ILE A 1 49  ? 5.775   -4.506  -2.018  1.00 0.00 ? 146 ILE A HD11 5  
ATOM 8368  H HD12 . ILE A 1 49  ? 4.778   -4.184  -3.438  1.00 0.00 ? 146 ILE A HD12 5  
ATOM 8369  H HD13 . ILE A 1 49  ? 4.023   -4.707  -1.932  1.00 0.00 ? 146 ILE A HD13 5  
ATOM 8370  N N    . ARG A 1 50  ? 6.684   -0.955  2.020   1.00 0.00 ? 147 ARG A N    5  
ATOM 8371  C CA   . ARG A 1 50  ? 6.699   -0.680  3.449   1.00 0.00 ? 147 ARG A CA   5  
ATOM 8372  C C    . ARG A 1 50  ? 5.515   0.203   3.801   1.00 0.00 ? 147 ARG A C    5  
ATOM 8373  O O    . ARG A 1 50  ? 5.374   1.299   3.256   1.00 0.00 ? 147 ARG A O    5  
ATOM 8374  C CB   . ARG A 1 50  ? 8.000   0.020   3.850   1.00 0.00 ? 147 ARG A CB   5  
ATOM 8375  C CG   . ARG A 1 50  ? 8.134   0.236   5.349   1.00 0.00 ? 147 ARG A CG   5  
ATOM 8376  C CD   . ARG A 1 50  ? 9.362   1.062   5.701   1.00 0.00 ? 147 ARG A CD   5  
ATOM 8377  N NE   . ARG A 1 50  ? 9.214   2.472   5.326   1.00 0.00 ? 147 ARG A NE   5  
ATOM 8378  C CZ   . ARG A 1 50  ? 9.764   3.484   6.007   1.00 0.00 ? 147 ARG A CZ   5  
ATOM 8379  N NH1  . ARG A 1 50  ? 10.544  3.240   7.052   1.00 0.00 ? 147 ARG A NH1  5  
ATOM 8380  N NH2  . ARG A 1 50  ? 9.548   4.740   5.635   1.00 0.00 ? 147 ARG A NH2  5  
ATOM 8381  H H    . ARG A 1 50  ? 6.948   -0.248  1.392   1.00 0.00 ? 147 ARG A H    5  
ATOM 8382  H HA   . ARG A 1 50  ? 6.611   -1.618  3.978   1.00 0.00 ? 147 ARG A HA   5  
ATOM 8383  H HB2  . ARG A 1 50  ? 8.835   -0.580  3.518   1.00 0.00 ? 147 ARG A HB2  5  
ATOM 8384  H HB3  . ARG A 1 50  ? 8.042   0.983   3.363   1.00 0.00 ? 147 ARG A HB3  5  
ATOM 8385  H HG2  . ARG A 1 50  ? 7.255   0.752   5.704   1.00 0.00 ? 147 ARG A HG2  5  
ATOM 8386  H HG3  . ARG A 1 50  ? 8.206   -0.726  5.835   1.00 0.00 ? 147 ARG A HG3  5  
ATOM 8387  H HD2  . ARG A 1 50  ? 9.527   0.999   6.767   1.00 0.00 ? 147 ARG A HD2  5  
ATOM 8388  H HD3  . ARG A 1 50  ? 10.216  0.650   5.183   1.00 0.00 ? 147 ARG A HD3  5  
ATOM 8389  H HE   . ARG A 1 50  ? 8.667   2.674   4.536   1.00 0.00 ? 147 ARG A HE   5  
ATOM 8390  H HH11 . ARG A 1 50  ? 10.729  2.296   7.336   1.00 0.00 ? 147 ARG A HH11 5  
ATOM 8391  H HH12 . ARG A 1 50  ? 10.951  4.002   7.568   1.00 0.00 ? 147 ARG A HH12 5  
ATOM 8392  H HH21 . ARG A 1 50  ? 8.968   4.951   4.838   1.00 0.00 ? 147 ARG A HH21 5  
ATOM 8393  H HH22 . ARG A 1 50  ? 9.959   5.496   6.156   1.00 0.00 ? 147 ARG A HH22 5  
ATOM 8394  N N    . LEU A 1 51  ? 4.665   -0.268  4.696   1.00 0.00 ? 148 LEU A N    5  
ATOM 8395  C CA   . LEU A 1 51  ? 3.468   0.467   5.054   1.00 0.00 ? 148 LEU A CA   5  
ATOM 8396  C C    . LEU A 1 51  ? 3.144   0.310   6.532   1.00 0.00 ? 148 LEU A C    5  
ATOM 8397  O O    . LEU A 1 51  ? 3.664   -0.585  7.197   1.00 0.00 ? 148 LEU A O    5  
ATOM 8398  C CB   . LEU A 1 51  ? 2.299   -0.012  4.196   1.00 0.00 ? 148 LEU A CB   5  
ATOM 8399  C CG   . LEU A 1 51  ? 1.967   -1.498  4.320   1.00 0.00 ? 148 LEU A CG   5  
ATOM 8400  C CD1  . LEU A 1 51  ? 0.844   -1.719  5.323   1.00 0.00 ? 148 LEU A CD1  5  
ATOM 8401  C CD2  . LEU A 1 51  ? 1.609   -2.069  2.963   1.00 0.00 ? 148 LEU A CD2  5  
ATOM 8402  H H    . LEU A 1 51  ? 4.841   -1.138  5.124   1.00 0.00 ? 148 LEU A H    5  
ATOM 8403  H HA   . LEU A 1 51  ? 3.647   1.511   4.847   1.00 0.00 ? 148 LEU A HA   5  
ATOM 8404  H HB2  . LEU A 1 51  ? 1.422   0.555   4.472   1.00 0.00 ? 148 LEU A HB2  5  
ATOM 8405  H HB3  . LEU A 1 51  ? 2.531   0.196   3.162   1.00 0.00 ? 148 LEU A HB3  5  
ATOM 8406  H HG   . LEU A 1 51  ? 2.840   -2.023  4.680   1.00 0.00 ? 148 LEU A HG   5  
ATOM 8407  H HD11 . LEU A 1 51  ? 0.567   -2.764  5.332   1.00 0.00 ? 148 LEU A HD11 5  
ATOM 8408  H HD12 . LEU A 1 51  ? -0.012  -1.119  5.047   1.00 0.00 ? 148 LEU A HD12 5  
ATOM 8409  H HD13 . LEU A 1 51  ? 1.183   -1.430  6.308   1.00 0.00 ? 148 LEU A HD13 5  
ATOM 8410  H HD21 . LEU A 1 51  ? 1.379   -3.120  3.067   1.00 0.00 ? 148 LEU A HD21 5  
ATOM 8411  H HD22 . LEU A 1 51  ? 2.446   -1.950  2.292   1.00 0.00 ? 148 LEU A HD22 5  
ATOM 8412  H HD23 . LEU A 1 51  ? 0.750   -1.548  2.567   1.00 0.00 ? 148 LEU A HD23 5  
ATOM 8413  N N    . LYS A 1 52  ? 2.302   1.202   7.036   1.00 0.00 ? 149 LYS A N    5  
ATOM 8414  C CA   . LYS A 1 52  ? 1.808   1.126   8.404   1.00 0.00 ? 149 LYS A CA   5  
ATOM 8415  C C    . LYS A 1 52  ? 0.710   2.162   8.604   1.00 0.00 ? 149 LYS A C    5  
ATOM 8416  O O    . LYS A 1 52  ? 0.701   3.199   7.935   1.00 0.00 ? 149 LYS A O    5  
ATOM 8417  C CB   . LYS A 1 52  ? 2.931   1.380   9.422   1.00 0.00 ? 149 LYS A CB   5  
ATOM 8418  C CG   . LYS A 1 52  ? 3.376   2.833   9.494   1.00 0.00 ? 149 LYS A CG   5  
ATOM 8419  C CD   . LYS A 1 52  ? 4.177   3.114   10.756  1.00 0.00 ? 149 LYS A CD   5  
ATOM 8420  C CE   . LYS A 1 52  ? 4.520   4.590   10.871  1.00 0.00 ? 149 LYS A CE   5  
ATOM 8421  N NZ   . LYS A 1 52  ? 5.116   4.925   12.190  1.00 0.00 ? 149 LYS A NZ   5  
ATOM 8422  H H    . LYS A 1 52  ? 2.003   1.944   6.466   1.00 0.00 ? 149 LYS A H    5  
ATOM 8423  H HA   . LYS A 1 52  ? 1.397   0.140   8.562   1.00 0.00 ? 149 LYS A HA   5  
ATOM 8424  H HB2  . LYS A 1 52  ? 2.588   1.083   10.402  1.00 0.00 ? 149 LYS A HB2  5  
ATOM 8425  H HB3  . LYS A 1 52  ? 3.786   0.777   9.152   1.00 0.00 ? 149 LYS A HB3  5  
ATOM 8426  H HG2  . LYS A 1 52  ? 3.992   3.052   8.634   1.00 0.00 ? 149 LYS A HG2  5  
ATOM 8427  H HG3  . LYS A 1 52  ? 2.502   3.467   9.484   1.00 0.00 ? 149 LYS A HG3  5  
ATOM 8428  H HD2  . LYS A 1 52  ? 3.594   2.822   11.615  1.00 0.00 ? 149 LYS A HD2  5  
ATOM 8429  H HD3  . LYS A 1 52  ? 5.093   2.542   10.726  1.00 0.00 ? 149 LYS A HD3  5  
ATOM 8430  H HE2  . LYS A 1 52  ? 5.228   4.842   10.095  1.00 0.00 ? 149 LYS A HE2  5  
ATOM 8431  H HE3  . LYS A 1 52  ? 3.618   5.168   10.735  1.00 0.00 ? 149 LYS A HE3  5  
ATOM 8432  H HZ1  . LYS A 1 52  ? 5.250   5.954   12.271  1.00 0.00 ? 149 LYS A HZ1  5  
ATOM 8433  H HZ2  . LYS A 1 52  ? 6.037   4.458   12.296  1.00 0.00 ? 149 LYS A HZ2  5  
ATOM 8434  H HZ3  . LYS A 1 52  ? 4.488   4.607   12.960  1.00 0.00 ? 149 LYS A HZ3  5  
ATOM 8435  N N    . PRO A 1 53  ? -0.248  1.887   9.499   1.00 0.00 ? 150 PRO A N    5  
ATOM 8436  C CA   . PRO A 1 53  ? -1.225  2.886   9.921   1.00 0.00 ? 150 PRO A CA   5  
ATOM 8437  C C    . PRO A 1 53  ? -0.576  3.938   10.818  1.00 0.00 ? 150 PRO A C    5  
ATOM 8438  O O    . PRO A 1 53  ? 0.452   3.686   11.444  1.00 0.00 ? 150 PRO A O    5  
ATOM 8439  C CB   . PRO A 1 53  ? -2.262  2.073   10.697  1.00 0.00 ? 150 PRO A CB   5  
ATOM 8440  C CG   . PRO A 1 53  ? -1.532  0.865   11.172  1.00 0.00 ? 150 PRO A CG   5  
ATOM 8441  C CD   . PRO A 1 53  ? -0.468  0.581   10.146  1.00 0.00 ? 150 PRO A CD   5  
ATOM 8442  H HA   . PRO A 1 53  ? -1.690  3.369   9.076   1.00 0.00 ? 150 PRO A HA   5  
ATOM 8443  H HB2  . PRO A 1 53  ? -2.634  2.660   11.524  1.00 0.00 ? 150 PRO A HB2  5  
ATOM 8444  H HB3  . PRO A 1 53  ? -3.079  1.808   10.042  1.00 0.00 ? 150 PRO A HB3  5  
ATOM 8445  H HG2  . PRO A 1 53  ? -1.081  1.067   12.130  1.00 0.00 ? 150 PRO A HG2  5  
ATOM 8446  H HG3  . PRO A 1 53  ? -2.213  0.031   11.246  1.00 0.00 ? 150 PRO A HG3  5  
ATOM 8447  H HD2  . PRO A 1 53  ? 0.434   0.232   10.627  1.00 0.00 ? 150 PRO A HD2  5  
ATOM 8448  H HD3  . PRO A 1 53  ? -0.820  -0.148  9.430   1.00 0.00 ? 150 PRO A HD3  5  
ATOM 8449  N N    . GLU A 1 54  ? -1.187  5.112   10.865  1.00 0.00 ? 151 GLU A N    5  
ATOM 8450  C CA   . GLU A 1 54  ? -0.647  6.257   11.595  1.00 0.00 ? 151 GLU A CA   5  
ATOM 8451  C C    . GLU A 1 54  ? -0.526  5.983   13.093  1.00 0.00 ? 151 GLU A C    5  
ATOM 8452  O O    . GLU A 1 54  ? 0.198   6.679   13.804  1.00 0.00 ? 151 GLU A O    5  
ATOM 8453  C CB   . GLU A 1 54  ? -1.543  7.476   11.369  1.00 0.00 ? 151 GLU A CB   5  
ATOM 8454  C CG   . GLU A 1 54  ? -2.950  7.296   11.922  1.00 0.00 ? 151 GLU A CG   5  
ATOM 8455  C CD   . GLU A 1 54  ? -3.861  8.467   11.625  1.00 0.00 ? 151 GLU A CD   5  
ATOM 8456  O OE1  . GLU A 1 54  ? -3.524  9.605   12.007  1.00 0.00 ? 151 GLU A OE1  5  
ATOM 8457  O OE2  . GLU A 1 54  ? -4.933  8.251   11.023  1.00 0.00 ? 151 GLU A OE2  5  
ATOM 8458  H H    . GLU A 1 54  ? -2.029  5.226   10.367  1.00 0.00 ? 151 GLU A H    5  
ATOM 8459  H HA   . GLU A 1 54  ? 0.336   6.465   11.202  1.00 0.00 ? 151 GLU A HA   5  
ATOM 8460  H HB2  . GLU A 1 54  ? -1.095  8.332   11.853  1.00 0.00 ? 151 GLU A HB2  5  
ATOM 8461  H HB3  . GLU A 1 54  ? -1.616  7.667   10.310  1.00 0.00 ? 151 GLU A HB3  5  
ATOM 8462  H HG2  . GLU A 1 54  ? -3.382  6.408   11.484  1.00 0.00 ? 151 GLU A HG2  5  
ATOM 8463  H HG3  . GLU A 1 54  ? -2.886  7.171   12.992  1.00 0.00 ? 151 GLU A HG3  5  
ATOM 8464  N N    . LYS A 1 55  ? -1.243  4.974   13.565  1.00 0.00 ? 152 LYS A N    5  
ATOM 8465  C CA   . LYS A 1 55  ? -1.227  4.620   14.976  1.00 0.00 ? 152 LYS A CA   5  
ATOM 8466  C C    . LYS A 1 55  ? -0.154  3.573   15.253  1.00 0.00 ? 152 LYS A C    5  
ATOM 8467  O O    . LYS A 1 55  ? 0.088   3.203   16.400  1.00 0.00 ? 152 LYS A O    5  
ATOM 8468  C CB   . LYS A 1 55  ? -2.602  4.099   15.399  1.00 0.00 ? 152 LYS A CB   5  
ATOM 8469  C CG   . LYS A 1 55  ? -3.737  5.070   15.108  1.00 0.00 ? 152 LYS A CG   5  
ATOM 8470  C CD   . LYS A 1 55  ? -3.564  6.378   15.866  1.00 0.00 ? 152 LYS A CD   5  
ATOM 8471  C CE   . LYS A 1 55  ? -4.639  7.390   15.502  1.00 0.00 ? 152 LYS A CE   5  
ATOM 8472  N NZ   . LYS A 1 55  ? -6.009  6.859   15.718  1.00 0.00 ? 152 LYS A NZ   5  
ATOM 8473  H H    . LYS A 1 55  ? -1.797  4.454   12.949  1.00 0.00 ? 152 LYS A H    5  
ATOM 8474  H HA   . LYS A 1 55  ? -0.998  5.513   15.539  1.00 0.00 ? 152 LYS A HA   5  
ATOM 8475  H HB2  . LYS A 1 55  ? -2.802  3.176   14.874  1.00 0.00 ? 152 LYS A HB2  5  
ATOM 8476  H HB3  . LYS A 1 55  ? -2.589  3.903   16.461  1.00 0.00 ? 152 LYS A HB3  5  
ATOM 8477  H HG2  . LYS A 1 55  ? -3.754  5.281   14.048  1.00 0.00 ? 152 LYS A HG2  5  
ATOM 8478  H HG3  . LYS A 1 55  ? -4.672  4.616   15.399  1.00 0.00 ? 152 LYS A HG3  5  
ATOM 8479  H HD2  . LYS A 1 55  ? -3.618  6.177   16.925  1.00 0.00 ? 152 LYS A HD2  5  
ATOM 8480  H HD3  . LYS A 1 55  ? -2.596  6.793   15.628  1.00 0.00 ? 152 LYS A HD3  5  
ATOM 8481  H HE2  . LYS A 1 55  ? -4.507  8.271   16.112  1.00 0.00 ? 152 LYS A HE2  5  
ATOM 8482  H HE3  . LYS A 1 55  ? -4.526  7.655   14.460  1.00 0.00 ? 152 LYS A HE3  5  
ATOM 8483  H HZ1  . LYS A 1 55  ? -6.084  6.428   16.662  1.00 0.00 ? 152 LYS A HZ1  5  
ATOM 8484  H HZ2  . LYS A 1 55  ? -6.232  6.137   15.003  1.00 0.00 ? 152 LYS A HZ2  5  
ATOM 8485  H HZ3  . LYS A 1 55  ? -6.706  7.627   15.647  1.00 0.00 ? 152 LYS A HZ3  5  
ATOM 8486  N N    . ALA A 1 56  ? 0.502   3.118   14.196  1.00 0.00 ? 153 ALA A N    5  
ATOM 8487  C CA   . ALA A 1 56  ? 1.515   2.082   14.310  1.00 0.00 ? 153 ALA A CA   5  
ATOM 8488  C C    . ALA A 1 56  ? 2.881   2.682   14.601  1.00 0.00 ? 153 ALA A C    5  
ATOM 8489  O O    . ALA A 1 56  ? 3.345   3.575   13.889  1.00 0.00 ? 153 ALA A O    5  
ATOM 8490  C CB   . ALA A 1 56  ? 1.567   1.261   13.034  1.00 0.00 ? 153 ALA A CB   5  
ATOM 8491  H H    . ALA A 1 56  ? 0.310   3.501   13.312  1.00 0.00 ? 153 ALA A H    5  
ATOM 8492  H HA   . ALA A 1 56  ? 1.236   1.426   15.122  1.00 0.00 ? 153 ALA A HA   5  
ATOM 8493  H HB1  . ALA A 1 56  ? 1.645   1.929   12.184  1.00 0.00 ? 153 ALA A HB1  5  
ATOM 8494  H HB2  . ALA A 1 56  ? 0.668   0.674   12.945  1.00 0.00 ? 153 ALA A HB2  5  
ATOM 8495  H HB3  . ALA A 1 56  ? 2.427   0.608   13.058  1.00 0.00 ? 153 ALA A HB3  5  
ATOM 8496  N N    . ALA A 1 57  ? 3.519   2.190   15.649  1.00 0.00 ? 154 ALA A N    5  
ATOM 8497  C CA   . ALA A 1 57  ? 4.862   2.620   16.005  1.00 0.00 ? 154 ALA A CA   5  
ATOM 8498  C C    . ALA A 1 57  ? 5.897   1.850   15.202  1.00 0.00 ? 154 ALA A C    5  
ATOM 8499  O O    . ALA A 1 57  ? 7.069   2.220   15.149  1.00 0.00 ? 154 ALA A O    5  
ATOM 8500  C CB   . ALA A 1 57  ? 5.102   2.410   17.487  1.00 0.00 ? 154 ALA A CB   5  
ATOM 8501  H H    . ALA A 1 57  ? 3.069   1.516   16.207  1.00 0.00 ? 154 ALA A H    5  
ATOM 8502  H HA   . ALA A 1 57  ? 4.951   3.674   15.788  1.00 0.00 ? 154 ALA A HA   5  
ATOM 8503  H HB1  . ALA A 1 57  ? 4.344   2.930   18.054  1.00 0.00 ? 154 ALA A HB1  5  
ATOM 8504  H HB2  . ALA A 1 57  ? 6.077   2.792   17.752  1.00 0.00 ? 154 ALA A HB2  5  
ATOM 8505  H HB3  . ALA A 1 57  ? 5.058   1.352   17.708  1.00 0.00 ? 154 ALA A HB3  5  
ATOM 8506  N N    . GLU A 1 58  ? 5.452   0.772   14.580  1.00 0.00 ? 155 GLU A N    5  
ATOM 8507  C CA   . GLU A 1 58  ? 6.334   -0.094  13.823  1.00 0.00 ? 155 GLU A CA   5  
ATOM 8508  C C    . GLU A 1 58  ? 5.902   -0.164  12.365  1.00 0.00 ? 155 GLU A C    5  
ATOM 8509  O O    . GLU A 1 58  ? 4.709   -0.237  12.063  1.00 0.00 ? 155 GLU A O    5  
ATOM 8510  C CB   . GLU A 1 58  ? 6.325   -1.495  14.428  1.00 0.00 ? 155 GLU A CB   5  
ATOM 8511  C CG   . GLU A 1 58  ? 6.864   -1.561  15.844  1.00 0.00 ? 155 GLU A CG   5  
ATOM 8512  C CD   . GLU A 1 58  ? 6.837   -2.966  16.396  1.00 0.00 ? 155 GLU A CD   5  
ATOM 8513  O OE1  . GLU A 1 58  ? 7.779   -3.735  16.117  1.00 0.00 ? 155 GLU A OE1  5  
ATOM 8514  O OE2  . GLU A 1 58  ? 5.869   -3.318  17.104  1.00 0.00 ? 155 GLU A OE2  5  
ATOM 8515  H H    . GLU A 1 58  ? 4.496   0.552   14.631  1.00 0.00 ? 155 GLU A H    5  
ATOM 8516  H HA   . GLU A 1 58  ? 7.333   0.309   13.878  1.00 0.00 ? 155 GLU A HA   5  
ATOM 8517  H HB2  . GLU A 1 58  ? 5.307   -1.855  14.443  1.00 0.00 ? 155 GLU A HB2  5  
ATOM 8518  H HB3  . GLU A 1 58  ? 6.920   -2.148  13.808  1.00 0.00 ? 155 GLU A HB3  5  
ATOM 8519  H HG2  . GLU A 1 58  ? 7.883   -1.205  15.846  1.00 0.00 ? 155 GLU A HG2  5  
ATOM 8520  H HG3  . GLU A 1 58  ? 6.259   -0.927  16.478  1.00 0.00 ? 155 GLU A HG3  5  
ATOM 8521  N N    . TRP A 1 59  ? 6.876   -0.139  11.469  1.00 0.00 ? 156 TRP A N    5  
ATOM 8522  C CA   . TRP A 1 59  ? 6.608   -0.263  10.046  1.00 0.00 ? 156 TRP A CA   5  
ATOM 8523  C C    . TRP A 1 59  ? 6.428   -1.725  9.667   1.00 0.00 ? 156 TRP A C    5  
ATOM 8524  O O    . TRP A 1 59  ? 7.028   -2.613  10.278  1.00 0.00 ? 156 TRP A O    5  
ATOM 8525  C CB   . TRP A 1 59  ? 7.743   0.351   9.226   1.00 0.00 ? 156 TRP A CB   5  
ATOM 8526  C CG   . TRP A 1 59  ? 7.682   1.844   9.141   1.00 0.00 ? 156 TRP A CG   5  
ATOM 8527  C CD1  . TRP A 1 59  ? 8.370   2.749   9.898   1.00 0.00 ? 156 TRP A CD1  5  
ATOM 8528  C CD2  . TRP A 1 59  ? 6.880   2.606   8.235   1.00 0.00 ? 156 TRP A CD2  5  
ATOM 8529  N NE1  . TRP A 1 59  ? 8.046   4.027   9.512   1.00 0.00 ? 156 TRP A NE1  5  
ATOM 8530  C CE2  . TRP A 1 59  ? 7.134   3.967   8.492   1.00 0.00 ? 156 TRP A CE2  5  
ATOM 8531  C CE3  . TRP A 1 59  ? 5.975   2.266   7.231   1.00 0.00 ? 156 TRP A CE3  5  
ATOM 8532  C CZ2  . TRP A 1 59  ? 6.510   4.986   7.773   1.00 0.00 ? 156 TRP A CZ2  5  
ATOM 8533  C CZ3  . TRP A 1 59  ? 5.358   3.277   6.523   1.00 0.00 ? 156 TRP A CZ3  5  
ATOM 8534  C CH2  . TRP A 1 59  ? 5.630   4.622   6.796   1.00 0.00 ? 156 TRP A CH2  5  
ATOM 8535  H H    . TRP A 1 59  ? 7.806   -0.048  11.774  1.00 0.00 ? 156 TRP A H    5  
ATOM 8536  H HA   . TRP A 1 59  ? 5.693   0.268   9.834   1.00 0.00 ? 156 TRP A HA   5  
ATOM 8537  H HB2  . TRP A 1 59  ? 8.688   0.081   9.674   1.00 0.00 ? 156 TRP A HB2  5  
ATOM 8538  H HB3  . TRP A 1 59  ? 7.702   -0.044  8.221   1.00 0.00 ? 156 TRP A HB3  5  
ATOM 8539  H HD1  . TRP A 1 59  ? 9.062   2.484   10.683  1.00 0.00 ? 156 TRP A HD1  5  
ATOM 8540  H HE1  . TRP A 1 59  ? 8.411   4.853   9.906   1.00 0.00 ? 156 TRP A HE1  5  
ATOM 8541  H HE3  . TRP A 1 59  ? 5.750   1.231   7.006   1.00 0.00 ? 156 TRP A HE3  5  
ATOM 8542  H HZ2  . TRP A 1 59  ? 6.706   6.032   7.967   1.00 0.00 ? 156 TRP A HZ2  5  
ATOM 8543  H HZ3  . TRP A 1 59  ? 4.655   3.034   5.742   1.00 0.00 ? 156 TRP A HZ3  5  
ATOM 8544  H HH2  . TRP A 1 59  ? 5.125   5.378   6.217   1.00 0.00 ? 156 TRP A HH2  5  
ATOM 8545  N N    . GLU A 1 60  ? 5.589   -1.974  8.677   1.00 0.00 ? 157 GLU A N    5  
ATOM 8546  C CA   . GLU A 1 60  ? 5.361   -3.325  8.203   1.00 0.00 ? 157 GLU A CA   5  
ATOM 8547  C C    . GLU A 1 60  ? 5.828   -3.464  6.759   1.00 0.00 ? 157 GLU A C    5  
ATOM 8548  O O    . GLU A 1 60  ? 5.317   -2.790  5.860   1.00 0.00 ? 157 GLU A O    5  
ATOM 8549  C CB   . GLU A 1 60  ? 3.880   -3.673  8.318   1.00 0.00 ? 157 GLU A CB   5  
ATOM 8550  C CG   . GLU A 1 60  ? 3.588   -5.156  8.166   1.00 0.00 ? 157 GLU A CG   5  
ATOM 8551  C CD   . GLU A 1 60  ? 4.394   -6.006  9.128   1.00 0.00 ? 157 GLU A CD   5  
ATOM 8552  O OE1  . GLU A 1 60  ? 4.215   -5.858  10.352  1.00 0.00 ? 157 GLU A OE1  5  
ATOM 8553  O OE2  . GLU A 1 60  ? 5.219   -6.818  8.663   1.00 0.00 ? 157 GLU A OE2  5  
ATOM 8554  H H    . GLU A 1 60  ? 5.096   -1.231  8.258   1.00 0.00 ? 157 GLU A H    5  
ATOM 8555  H HA   . GLU A 1 60  ? 5.933   -3.999  8.825   1.00 0.00 ? 157 GLU A HA   5  
ATOM 8556  H HB2  . GLU A 1 60  ? 3.520   -3.352  9.283   1.00 0.00 ? 157 GLU A HB2  5  
ATOM 8557  H HB3  . GLU A 1 60  ? 3.342   -3.141  7.546   1.00 0.00 ? 157 GLU A HB3  5  
ATOM 8558  H HG2  . GLU A 1 60  ? 2.538   -5.325  8.353   1.00 0.00 ? 157 GLU A HG2  5  
ATOM 8559  H HG3  . GLU A 1 60  ? 3.827   -5.457  7.156   1.00 0.00 ? 157 GLU A HG3  5  
ATOM 8560  N N    . ILE A 1 61  ? 6.807   -4.324  6.547   1.00 0.00 ? 158 ILE A N    5  
ATOM 8561  C CA   . ILE A 1 61  ? 7.349   -4.558  5.218   1.00 0.00 ? 158 ILE A CA   5  
ATOM 8562  C C    . ILE A 1 61  ? 6.639   -5.732  4.554   1.00 0.00 ? 158 ILE A C    5  
ATOM 8563  O O    . ILE A 1 61  ? 6.594   -6.835  5.094   1.00 0.00 ? 158 ILE A O    5  
ATOM 8564  C CB   . ILE A 1 61  ? 8.879   -4.819  5.256   1.00 0.00 ? 158 ILE A CB   5  
ATOM 8565  C CG1  . ILE A 1 61  ? 9.660   -3.504  5.385   1.00 0.00 ? 158 ILE A CG1  5  
ATOM 8566  C CG2  . ILE A 1 61  ? 9.332   -5.577  4.016   1.00 0.00 ? 158 ILE A CG2  5  
ATOM 8567  C CD1  . ILE A 1 61  ? 9.500   -2.807  6.719   1.00 0.00 ? 158 ILE A CD1  5  
ATOM 8568  H H    . ILE A 1 61  ? 7.175   -4.827  7.304   1.00 0.00 ? 158 ILE A H    5  
ATOM 8569  H HA   . ILE A 1 61  ? 7.172   -3.669  4.630   1.00 0.00 ? 158 ILE A HA   5  
ATOM 8570  H HB   . ILE A 1 61  ? 9.090   -5.436  6.116   1.00 0.00 ? 158 ILE A HB   5  
ATOM 8571  H HG12 . ILE A 1 61  ? 10.712  -3.708  5.248   1.00 0.00 ? 158 ILE A HG12 5  
ATOM 8572  H HG13 . ILE A 1 61  ? 9.330   -2.823  4.613   1.00 0.00 ? 158 ILE A HG13 5  
ATOM 8573  H HG21 . ILE A 1 61  ? 10.400  -5.738  4.062   1.00 0.00 ? 158 ILE A HG21 5  
ATOM 8574  H HG22 . ILE A 1 61  ? 9.091   -5.001  3.135   1.00 0.00 ? 158 ILE A HG22 5  
ATOM 8575  H HG23 . ILE A 1 61  ? 8.825   -6.529  3.972   1.00 0.00 ? 158 ILE A HG23 5  
ATOM 8576  H HD11 . ILE A 1 61  ? 10.045  -1.876  6.703   1.00 0.00 ? 158 ILE A HD11 5  
ATOM 8577  H HD12 . ILE A 1 61  ? 9.885   -3.437  7.504   1.00 0.00 ? 158 ILE A HD12 5  
ATOM 8578  H HD13 . ILE A 1 61  ? 8.452   -2.607  6.897   1.00 0.00 ? 158 ILE A HD13 5  
ATOM 8579  N N    . HIS A 1 62  ? 6.069   -5.478  3.390   1.00 0.00 ? 159 HIS A N    5  
ATOM 8580  C CA   . HIS A 1 62  ? 5.422   -6.513  2.602   1.00 0.00 ? 159 HIS A CA   5  
ATOM 8581  C C    . HIS A 1 62  ? 6.120   -6.639  1.258   1.00 0.00 ? 159 HIS A C    5  
ATOM 8582  O O    . HIS A 1 62  ? 6.746   -5.691  0.787   1.00 0.00 ? 159 HIS A O    5  
ATOM 8583  C CB   . HIS A 1 62  ? 3.943   -6.195  2.386   1.00 0.00 ? 159 HIS A CB   5  
ATOM 8584  C CG   . HIS A 1 62  ? 3.091   -6.341  3.610   1.00 0.00 ? 159 HIS A CG   5  
ATOM 8585  N ND1  . HIS A 1 62  ? 2.271   -7.426  3.831   1.00 0.00 ? 159 HIS A ND1  5  
ATOM 8586  C CD2  . HIS A 1 62  ? 2.905   -5.511  4.661   1.00 0.00 ? 159 HIS A CD2  5  
ATOM 8587  C CE1  . HIS A 1 62  ? 1.613   -7.255  4.962   1.00 0.00 ? 159 HIS A CE1  5  
ATOM 8588  N NE2  . HIS A 1 62  ? 1.979   -6.102  5.486   1.00 0.00 ? 159 HIS A NE2  5  
ATOM 8589  H H    . HIS A 1 62  ? 6.098   -4.557  3.035   1.00 0.00 ? 159 HIS A H    5  
ATOM 8590  H HA   . HIS A 1 62  ? 5.513   -7.447  3.136   1.00 0.00 ? 159 HIS A HA   5  
ATOM 8591  H HB2  . HIS A 1 62  ? 3.850   -5.176  2.042   1.00 0.00 ? 159 HIS A HB2  5  
ATOM 8592  H HB3  . HIS A 1 62  ? 3.550   -6.859  1.629   1.00 0.00 ? 159 HIS A HB3  5  
ATOM 8593  H HD1  . HIS A 1 62  ? 2.188   -8.216  3.249   1.00 0.00 ? 159 HIS A HD1  5  
ATOM 8594  H HD2  . HIS A 1 62  ? 3.401   -4.564  4.825   1.00 0.00 ? 159 HIS A HD2  5  
ATOM 8595  H HE1  . HIS A 1 62  ? 0.894   -7.940  5.385   1.00 0.00 ? 159 HIS A HE1  5  
ATOM 8596  H HE2  . HIS A 1 62  ? 1.522   -5.658  6.236   1.00 0.00 ? 159 HIS A HE2  5  
ATOM 8597  N N    . PHE A 1 63  ? 6.009   -7.797  0.637   1.00 0.00 ? 160 PHE A N    5  
ATOM 8598  C CA   . PHE A 1 63  ? 6.697   -8.042  -0.614  1.00 0.00 ? 160 PHE A CA   5  
ATOM 8599  C C    . PHE A 1 63  ? 5.704   -8.426  -1.703  1.00 0.00 ? 160 PHE A C    5  
ATOM 8600  O O    . PHE A 1 63  ? 4.861   -9.301  -1.502  1.00 0.00 ? 160 PHE A O    5  
ATOM 8601  C CB   . PHE A 1 63  ? 7.733   -9.146  -0.429  1.00 0.00 ? 160 PHE A CB   5  
ATOM 8602  C CG   . PHE A 1 63  ? 8.892   -9.015  -1.363  1.00 0.00 ? 160 PHE A CG   5  
ATOM 8603  C CD1  . PHE A 1 63  ? 9.880   -8.082  -1.111  1.00 0.00 ? 160 PHE A CD1  5  
ATOM 8604  C CD2  . PHE A 1 63  ? 8.991   -9.808  -2.490  1.00 0.00 ? 160 PHE A CD2  5  
ATOM 8605  C CE1  . PHE A 1 63  ? 10.950  -7.941  -1.965  1.00 0.00 ? 160 PHE A CE1  5  
ATOM 8606  C CE2  . PHE A 1 63  ? 10.061  -9.674  -3.349  1.00 0.00 ? 160 PHE A CE2  5  
ATOM 8607  C CZ   . PHE A 1 63  ? 11.043  -8.737  -3.086  1.00 0.00 ? 160 PHE A CZ   5  
ATOM 8608  H H    . PHE A 1 63  ? 5.446   -8.502  1.024   1.00 0.00 ? 160 PHE A H    5  
ATOM 8609  H HA   . PHE A 1 63  ? 7.203   -7.131  -0.904  1.00 0.00 ? 160 PHE A HA   5  
ATOM 8610  H HB2  . PHE A 1 63  ? 8.112   -9.113  0.582   1.00 0.00 ? 160 PHE A HB2  5  
ATOM 8611  H HB3  . PHE A 1 63  ? 7.267   -10.105 -0.605  1.00 0.00 ? 160 PHE A HB3  5  
ATOM 8612  H HD1  . PHE A 1 63  ? 9.810   -7.462  -0.231  1.00 0.00 ? 160 PHE A HD1  5  
ATOM 8613  H HD2  . PHE A 1 63  ? 8.222   -10.539 -2.695  1.00 0.00 ? 160 PHE A HD2  5  
ATOM 8614  H HE1  . PHE A 1 63  ? 11.714  -7.206  -1.756  1.00 0.00 ? 160 PHE A HE1  5  
ATOM 8615  H HE2  . PHE A 1 63  ? 10.130  -10.297 -4.227  1.00 0.00 ? 160 PHE A HE2  5  
ATOM 8616  H HZ   . PHE A 1 63  ? 11.881  -8.629  -3.756  1.00 0.00 ? 160 PHE A HZ   5  
ATOM 8617  N N    . ALA A 1 64  ? 5.796   -7.761  -2.846  1.00 0.00 ? 161 ALA A N    5  
ATOM 8618  C CA   . ALA A 1 64  ? 4.900   -8.042  -3.962  1.00 0.00 ? 161 ALA A CA   5  
ATOM 8619  C C    . ALA A 1 64  ? 5.561   -8.970  -4.970  1.00 0.00 ? 161 ALA A C    5  
ATOM 8620  O O    . ALA A 1 64  ? 4.905   -9.811  -5.579  1.00 0.00 ? 161 ALA A O    5  
ATOM 8621  C CB   . ALA A 1 64  ? 4.465   -6.752  -4.640  1.00 0.00 ? 161 ALA A CB   5  
ATOM 8622  H H    . ALA A 1 64  ? 6.482   -7.063  -2.943  1.00 0.00 ? 161 ALA A H    5  
ATOM 8623  H HA   . ALA A 1 64  ? 4.020   -8.527  -3.565  1.00 0.00 ? 161 ALA A HA   5  
ATOM 8624  H HB1  . ALA A 1 64  ? 3.988   -6.109  -3.917  1.00 0.00 ? 161 ALA A HB1  5  
ATOM 8625  H HB2  . ALA A 1 64  ? 3.769   -6.981  -5.434  1.00 0.00 ? 161 ALA A HB2  5  
ATOM 8626  H HB3  . ALA A 1 64  ? 5.329   -6.253  -5.052  1.00 0.00 ? 161 ALA A HB3  5  
ATOM 8627  N N    . GLY A 1 65  ? 6.865   -8.819  -5.139  1.00 0.00 ? 162 GLY A N    5  
ATOM 8628  C CA   . GLY A 1 65  ? 7.586   -9.643  -6.085  1.00 0.00 ? 162 GLY A CA   5  
ATOM 8629  C C    . GLY A 1 65  ? 7.823   -8.914  -7.385  1.00 0.00 ? 162 GLY A C    5  
ATOM 8630  O O    . GLY A 1 65  ? 8.092   -7.713  -7.383  1.00 0.00 ? 162 GLY A O    5  
ATOM 8631  H H    . GLY A 1 65  ? 7.341   -8.133  -4.628  1.00 0.00 ? 162 GLY A H    5  
ATOM 8632  H HA2  . GLY A 1 65  ? 8.536   -9.920  -5.655  1.00 0.00 ? 162 GLY A HA2  5  
ATOM 8633  H HA3  . GLY A 1 65  ? 7.012   -10.536 -6.282  1.00 0.00 ? 162 GLY A HA3  5  
ATOM 8634  N N    . GLN A 1 66  ? 7.705   -9.626  -8.495  1.00 0.00 ? 163 GLN A N    5  
ATOM 8635  C CA   . GLN A 1 66  ? 7.915   -9.040  -9.813  1.00 0.00 ? 163 GLN A CA   5  
ATOM 8636  C C    . GLN A 1 66  ? 6.583   -8.525  -10.374 1.00 0.00 ? 163 GLN A C    5  
ATOM 8637  O O    . GLN A 1 66  ? 6.175   -8.883  -11.480 1.00 0.00 ? 163 GLN A O    5  
ATOM 8638  C CB   . GLN A 1 66  ? 8.525   -10.086 -10.757 1.00 0.00 ? 163 GLN A CB   5  
ATOM 8639  C CG   . GLN A 1 66  ? 9.199   -9.501  -11.990 1.00 0.00 ? 163 GLN A CG   5  
ATOM 8640  C CD   . GLN A 1 66  ? 9.411   -10.534 -13.079 1.00 0.00 ? 163 GLN A CD   5  
ATOM 8641  O OE1  . GLN A 1 66  ? 9.614   -11.718 -12.801 1.00 0.00 ? 163 GLN A OE1  5  
ATOM 8642  N NE2  . GLN A 1 66  ? 9.362   -10.099 -14.325 1.00 0.00 ? 163 GLN A NE2  5  
ATOM 8643  H H    . GLN A 1 66  ? 7.470   -10.576 -8.428  1.00 0.00 ? 163 GLN A H    5  
ATOM 8644  H HA   . GLN A 1 66  ? 8.598   -8.210  -9.710  1.00 0.00 ? 163 GLN A HA   5  
ATOM 8645  H HB2  . GLN A 1 66  ? 9.261   -10.656 -10.211 1.00 0.00 ? 163 GLN A HB2  5  
ATOM 8646  H HB3  . GLN A 1 66  ? 7.741   -10.753 -11.086 1.00 0.00 ? 163 GLN A HB3  5  
ATOM 8647  H HG2  . GLN A 1 66  ? 8.586   -8.704  -12.382 1.00 0.00 ? 163 GLN A HG2  5  
ATOM 8648  H HG3  . GLN A 1 66  ? 10.169  -9.105  -11.701 1.00 0.00 ? 163 GLN A HG3  5  
ATOM 8649  H HE21 . GLN A 1 66  ? 9.193   -9.143  -14.477 1.00 0.00 ? 163 GLN A HE21 5  
ATOM 8650  H HE22 . GLN A 1 66  ? 9.497   -10.746 -15.050 1.00 0.00 ? 163 GLN A HE22 5  
ATOM 8651  N N    . GLN A 1 67  ? 5.900   -7.701  -9.590  1.00 0.00 ? 164 GLN A N    5  
ATOM 8652  C CA   . GLN A 1 67  ? 4.605   -7.154  -9.982  1.00 0.00 ? 164 GLN A CA   5  
ATOM 8653  C C    . GLN A 1 67  ? 4.398   -5.784  -9.354  1.00 0.00 ? 164 GLN A C    5  
ATOM 8654  O O    . GLN A 1 67  ? 4.910   -5.509  -8.269  1.00 0.00 ? 164 GLN A O    5  
ATOM 8655  C CB   . GLN A 1 67  ? 3.471   -8.105  -9.581  1.00 0.00 ? 164 GLN A CB   5  
ATOM 8656  C CG   . GLN A 1 67  ? 3.467   -8.474  -8.107  1.00 0.00 ? 164 GLN A CG   5  
ATOM 8657  C CD   . GLN A 1 67  ? 2.364   -9.452  -7.756  1.00 0.00 ? 164 GLN A CD   5  
ATOM 8658  O OE1  . GLN A 1 67  ? 1.255   -9.052  -7.404  1.00 0.00 ? 164 GLN A OE1  5  
ATOM 8659  N NE2  . GLN A 1 67  ? 2.660   -10.739 -7.844  1.00 0.00 ? 164 GLN A NE2  5  
ATOM 8660  H H    . GLN A 1 67  ? 6.283   -7.440  -8.724  1.00 0.00 ? 164 GLN A H    5  
ATOM 8661  H HA   . GLN A 1 67  ? 4.604   -7.043  -11.055 1.00 0.00 ? 164 GLN A HA   5  
ATOM 8662  H HB2  . GLN A 1 67  ? 2.527   -7.636  -9.813  1.00 0.00 ? 164 GLN A HB2  5  
ATOM 8663  H HB3  . GLN A 1 67  ? 3.561   -9.014  -10.156 1.00 0.00 ? 164 GLN A HB3  5  
ATOM 8664  H HG2  . GLN A 1 67  ? 4.417   -8.924  -7.858  1.00 0.00 ? 164 GLN A HG2  5  
ATOM 8665  H HG3  . GLN A 1 67  ? 3.331   -7.575  -7.524  1.00 0.00 ? 164 GLN A HG3  5  
ATOM 8666  H HE21 . GLN A 1 67  ? 3.567   -10.991 -8.124  1.00 0.00 ? 164 GLN A HE21 5  
ATOM 8667  H HE22 . GLN A 1 67  ? 1.956   -11.388 -7.634  1.00 0.00 ? 164 GLN A HE22 5  
ATOM 8668  N N    . THR A 1 68  ? 3.650   -4.932  -10.037 1.00 0.00 ? 165 THR A N    5  
ATOM 8669  C CA   . THR A 1 68  ? 3.472   -3.559  -9.598  1.00 0.00 ? 165 THR A CA   5  
ATOM 8670  C C    . THR A 1 68  ? 2.128   -3.351  -8.906  1.00 0.00 ? 165 THR A C    5  
ATOM 8671  O O    . THR A 1 68  ? 1.529   -2.279  -9.001  1.00 0.00 ? 165 THR A O    5  
ATOM 8672  C CB   . THR A 1 68  ? 3.588   -2.581  -10.779 1.00 0.00 ? 165 THR A CB   5  
ATOM 8673  O OG1  . THR A 1 68  ? 2.634   -2.926  -11.795 1.00 0.00 ? 165 THR A OG1  5  
ATOM 8674  C CG2  . THR A 1 68  ? 4.989   -2.602  -11.368 1.00 0.00 ? 165 THR A CG2  5  
ATOM 8675  H H    . THR A 1 68  ? 3.204   -5.233  -10.858 1.00 0.00 ? 165 THR A H    5  
ATOM 8676  H HA   . THR A 1 68  ? 4.262   -3.332  -8.896  1.00 0.00 ? 165 THR A HA   5  
ATOM 8677  H HB   . THR A 1 68  ? 3.380   -1.586  -10.416 1.00 0.00 ? 165 THR A HB   5  
ATOM 8678  H HG1  . THR A 1 68  ? 1.768   -3.058  -11.389 1.00 0.00 ? 165 THR A HG1  5  
ATOM 8679  H HG21 . THR A 1 68  ? 5.036   -1.927  -12.210 1.00 0.00 ? 165 THR A HG21 5  
ATOM 8680  H HG22 . THR A 1 68  ? 5.226   -3.603  -11.697 1.00 0.00 ? 165 THR A HG22 5  
ATOM 8681  H HG23 . THR A 1 68  ? 5.701   -2.292  -10.618 1.00 0.00 ? 165 THR A HG23 5  
ATOM 8682  N N    . GLU A 1 69  ? 1.659   -4.376  -8.212  1.00 0.00 ? 166 GLU A N    5  
ATOM 8683  C CA   . GLU A 1 69  ? 0.400   -4.290  -7.489  1.00 0.00 ? 166 GLU A CA   5  
ATOM 8684  C C    . GLU A 1 69  ? 0.445   -5.123  -6.215  1.00 0.00 ? 166 GLU A C    5  
ATOM 8685  O O    . GLU A 1 69  ? 0.911   -6.261  -6.225  1.00 0.00 ? 166 GLU A O    5  
ATOM 8686  C CB   . GLU A 1 69  ? -0.760  -4.750  -8.377  1.00 0.00 ? 166 GLU A CB   5  
ATOM 8687  C CG   . GLU A 1 69  ? -0.496  -6.066  -9.091  1.00 0.00 ? 166 GLU A CG   5  
ATOM 8688  C CD   . GLU A 1 69  ? -1.736  -6.631  -9.745  1.00 0.00 ? 166 GLU A CD   5  
ATOM 8689  O OE1  . GLU A 1 69  ? -2.183  -6.080  -10.772 1.00 0.00 ? 166 GLU A OE1  5  
ATOM 8690  O OE2  . GLU A 1 69  ? -2.268  -7.639  -9.236  1.00 0.00 ? 166 GLU A OE2  5  
ATOM 8691  H H    . GLU A 1 69  ? 2.173   -5.212  -8.183  1.00 0.00 ? 166 GLU A H    5  
ATOM 8692  H HA   . GLU A 1 69  ? 0.245   -3.256  -7.220  1.00 0.00 ? 166 GLU A HA   5  
ATOM 8693  H HB2  . GLU A 1 69  ? -1.641  -4.868  -7.765  1.00 0.00 ? 166 GLU A HB2  5  
ATOM 8694  H HB3  . GLU A 1 69  ? -0.950  -3.992  -9.123  1.00 0.00 ? 166 GLU A HB3  5  
ATOM 8695  H HG2  . GLU A 1 69  ? 0.251   -5.905  -9.853  1.00 0.00 ? 166 GLU A HG2  5  
ATOM 8696  H HG3  . GLU A 1 69  ? -0.127  -6.783  -8.372  1.00 0.00 ? 166 GLU A HG3  5  
ATOM 8697  N N    . PHE A 1 70  ? -0.019  -4.545  -5.118  1.00 0.00 ? 167 PHE A N    5  
ATOM 8698  C CA   . PHE A 1 70  ? -0.109  -5.265  -3.857  1.00 0.00 ? 167 PHE A CA   5  
ATOM 8699  C C    . PHE A 1 70  ? -1.440  -4.960  -3.172  1.00 0.00 ? 167 PHE A C    5  
ATOM 8700  O O    . PHE A 1 70  ? -1.995  -3.874  -3.345  1.00 0.00 ? 167 PHE A O    5  
ATOM 8701  C CB   . PHE A 1 70  ? 1.063   -4.889  -2.949  1.00 0.00 ? 167 PHE A CB   5  
ATOM 8702  C CG   . PHE A 1 70  ? 1.191   -5.776  -1.750  1.00 0.00 ? 167 PHE A CG   5  
ATOM 8703  C CD1  . PHE A 1 70  ? 1.502   -7.116  -1.898  1.00 0.00 ? 167 PHE A CD1  5  
ATOM 8704  C CD2  . PHE A 1 70  ? 0.989   -5.275  -0.478  1.00 0.00 ? 167 PHE A CD2  5  
ATOM 8705  C CE1  . PHE A 1 70  ? 1.612   -7.941  -0.797  1.00 0.00 ? 167 PHE A CE1  5  
ATOM 8706  C CE2  . PHE A 1 70  ? 1.096   -6.095  0.627   1.00 0.00 ? 167 PHE A CE2  5  
ATOM 8707  C CZ   . PHE A 1 70  ? 1.407   -7.431  0.466   1.00 0.00 ? 167 PHE A CZ   5  
ATOM 8708  H H    . PHE A 1 70  ? -0.298  -3.603  -5.152  1.00 0.00 ? 167 PHE A H    5  
ATOM 8709  H HA   . PHE A 1 70  ? -0.061  -6.323  -4.075  1.00 0.00 ? 167 PHE A HA   5  
ATOM 8710  H HB2  . PHE A 1 70  ? 1.982   -4.954  -3.511  1.00 0.00 ? 167 PHE A HB2  5  
ATOM 8711  H HB3  . PHE A 1 70  ? 0.929   -3.874  -2.602  1.00 0.00 ? 167 PHE A HB3  5  
ATOM 8712  H HD1  . PHE A 1 70  ? 1.664   -7.516  -2.888  1.00 0.00 ? 167 PHE A HD1  5  
ATOM 8713  H HD2  . PHE A 1 70  ? 0.743   -4.231  -0.350  1.00 0.00 ? 167 PHE A HD2  5  
ATOM 8714  H HE1  . PHE A 1 70  ? 1.855   -8.985  -0.926  1.00 0.00 ? 167 PHE A HE1  5  
ATOM 8715  H HE2  . PHE A 1 70  ? 0.938   -5.689  1.617   1.00 0.00 ? 167 PHE A HE2  5  
ATOM 8716  H HZ   . PHE A 1 70  ? 1.493   -8.073  1.330   1.00 0.00 ? 167 PHE A HZ   5  
ATOM 8717  N N    . LYS A 1 71  ? -1.958  -5.924  -2.414  1.00 0.00 ? 168 LYS A N    5  
ATOM 8718  C CA   . LYS A 1 71  ? -3.253  -5.770  -1.756  1.00 0.00 ? 168 LYS A CA   5  
ATOM 8719  C C    . LYS A 1 71  ? -3.116  -5.861  -0.238  1.00 0.00 ? 168 LYS A C    5  
ATOM 8720  O O    . LYS A 1 71  ? -2.346  -6.670  0.281   1.00 0.00 ? 168 LYS A O    5  
ATOM 8721  C CB   . LYS A 1 71  ? -4.245  -6.842  -2.235  1.00 0.00 ? 168 LYS A CB   5  
ATOM 8722  C CG   . LYS A 1 71  ? -4.705  -6.693  -3.681  1.00 0.00 ? 168 LYS A CG   5  
ATOM 8723  C CD   . LYS A 1 71  ? -3.624  -7.086  -4.677  1.00 0.00 ? 168 LYS A CD   5  
ATOM 8724  C CE   . LYS A 1 71  ? -4.134  -7.024  -6.107  1.00 0.00 ? 168 LYS A CE   5  
ATOM 8725  N NZ   . LYS A 1 71  ? -5.192  -8.037  -6.368  1.00 0.00 ? 168 LYS A NZ   5  
ATOM 8726  H H    . LYS A 1 71  ? -1.454  -6.757  -2.287  1.00 0.00 ? 168 LYS A H    5  
ATOM 8727  H HA   . LYS A 1 71  ? -3.641  -4.797  -2.012  1.00 0.00 ? 168 LYS A HA   5  
ATOM 8728  H HB2  . LYS A 1 71  ? -3.779  -7.811  -2.132  1.00 0.00 ? 168 LYS A HB2  5  
ATOM 8729  H HB3  . LYS A 1 71  ? -5.119  -6.810  -1.600  1.00 0.00 ? 168 LYS A HB3  5  
ATOM 8730  H HG2  . LYS A 1 71  ? -5.565  -7.324  -3.838  1.00 0.00 ? 168 LYS A HG2  5  
ATOM 8731  H HG3  . LYS A 1 71  ? -4.981  -5.664  -3.852  1.00 0.00 ? 168 LYS A HG3  5  
ATOM 8732  H HD2  . LYS A 1 71  ? -2.790  -6.409  -4.574  1.00 0.00 ? 168 LYS A HD2  5  
ATOM 8733  H HD3  . LYS A 1 71  ? -3.301  -8.094  -4.463  1.00 0.00 ? 168 LYS A HD3  5  
ATOM 8734  H HE2  . LYS A 1 71  ? -4.541  -6.039  -6.287  1.00 0.00 ? 168 LYS A HE2  5  
ATOM 8735  H HE3  . LYS A 1 71  ? -3.308  -7.197  -6.780  1.00 0.00 ? 168 LYS A HE3  5  
ATOM 8736  H HZ1  . LYS A 1 71  ? -5.532  -7.953  -7.349  1.00 0.00 ? 168 LYS A HZ1  5  
ATOM 8737  H HZ2  . LYS A 1 71  ? -5.995  -7.896  -5.725  1.00 0.00 ? 168 LYS A HZ2  5  
ATOM 8738  H HZ3  . LYS A 1 71  ? -4.817  -8.996  -6.227  1.00 0.00 ? 168 LYS A HZ3  5  
ATOM 8739  N N    . ILE A 1 72  ? -3.869  -5.025  0.466   1.00 0.00 ? 169 ILE A N    5  
ATOM 8740  C CA   . ILE A 1 72  ? -3.905  -5.053  1.926   1.00 0.00 ? 169 ILE A CA   5  
ATOM 8741  C C    . ILE A 1 72  ? -5.311  -5.390  2.403   1.00 0.00 ? 169 ILE A C    5  
ATOM 8742  O O    . ILE A 1 72  ? -6.288  -4.869  1.870   1.00 0.00 ? 169 ILE A O    5  
ATOM 8743  C CB   . ILE A 1 72  ? -3.487  -3.695  2.535   1.00 0.00 ? 169 ILE A CB   5  
ATOM 8744  C CG1  . ILE A 1 72  ? -2.148  -3.239  1.962   1.00 0.00 ? 169 ILE A CG1  5  
ATOM 8745  C CG2  . ILE A 1 72  ? -3.402  -3.787  4.053   1.00 0.00 ? 169 ILE A CG2  5  
ATOM 8746  C CD1  . ILE A 1 72  ? -1.000  -4.159  2.305   1.00 0.00 ? 169 ILE A CD1  5  
ATOM 8747  H H    . ILE A 1 72  ? -4.418  -4.362  -0.011  1.00 0.00 ? 169 ILE A H    5  
ATOM 8748  H HA   . ILE A 1 72  ? -3.219  -5.814  2.269   1.00 0.00 ? 169 ILE A HA   5  
ATOM 8749  H HB   . ILE A 1 72  ? -4.243  -2.968  2.287   1.00 0.00 ? 169 ILE A HB   5  
ATOM 8750  H HG12 . ILE A 1 72  ? -2.225  -3.192  0.886   1.00 0.00 ? 169 ILE A HG12 5  
ATOM 8751  H HG13 . ILE A 1 72  ? -1.914  -2.257  2.346   1.00 0.00 ? 169 ILE A HG13 5  
ATOM 8752  H HG21 . ILE A 1 72  ? -4.349  -4.122  4.448   1.00 0.00 ? 169 ILE A HG21 5  
ATOM 8753  H HG22 . ILE A 1 72  ? -3.165  -2.816  4.461   1.00 0.00 ? 169 ILE A HG22 5  
ATOM 8754  H HG23 . ILE A 1 72  ? -2.627  -4.490  4.326   1.00 0.00 ? 169 ILE A HG23 5  
ATOM 8755  H HD11 . ILE A 1 72  ? -0.097  -3.795  1.837   1.00 0.00 ? 169 ILE A HD11 5  
ATOM 8756  H HD12 . ILE A 1 72  ? -1.215  -5.153  1.943   1.00 0.00 ? 169 ILE A HD12 5  
ATOM 8757  H HD13 . ILE A 1 72  ? -0.867  -4.185  3.376   1.00 0.00 ? 169 ILE A HD13 5  
ATOM 8758  N N    . LEU A 1 73  ? -5.410  -6.265  3.393   1.00 0.00 ? 170 LEU A N    5  
ATOM 8759  C CA   . LEU A 1 73  ? -6.704  -6.643  3.953   1.00 0.00 ? 170 LEU A CA   5  
ATOM 8760  C C    . LEU A 1 73  ? -6.928  -5.961  5.301   1.00 0.00 ? 170 LEU A C    5  
ATOM 8761  O O    . LEU A 1 73  ? -8.068  -5.766  5.729   1.00 0.00 ? 170 LEU A O    5  
ATOM 8762  C CB   . LEU A 1 73  ? -6.811  -8.170  4.123   1.00 0.00 ? 170 LEU A CB   5  
ATOM 8763  C CG   . LEU A 1 73  ? -6.940  -8.999  2.834   1.00 0.00 ? 170 LEU A CG   5  
ATOM 8764  C CD1  . LEU A 1 73  ? -8.080  -8.484  1.971   1.00 0.00 ? 170 LEU A CD1  5  
ATOM 8765  C CD2  . LEU A 1 73  ? -5.636  -9.014  2.049   1.00 0.00 ? 170 LEU A CD2  5  
ATOM 8766  H H    . LEU A 1 73  ? -4.594  -6.671  3.757   1.00 0.00 ? 170 LEU A H    5  
ATOM 8767  H HA   . LEU A 1 73  ? -7.468  -6.312  3.268   1.00 0.00 ? 170 LEU A HA   5  
ATOM 8768  H HB2  . LEU A 1 73  ? -5.932  -8.508  4.649   1.00 0.00 ? 170 LEU A HB2  5  
ATOM 8769  H HB3  . LEU A 1 73  ? -7.674  -8.375  4.740   1.00 0.00 ? 170 LEU A HB3  5  
ATOM 8770  H HG   . LEU A 1 73  ? -7.174  -10.020 3.104   1.00 0.00 ? 170 LEU A HG   5  
ATOM 8771  H HD11 . LEU A 1 73  ? -9.002  -8.521  2.530   1.00 0.00 ? 170 LEU A HD11 5  
ATOM 8772  H HD12 . LEU A 1 73  ? -8.168  -9.099  1.087   1.00 0.00 ? 170 LEU A HD12 5  
ATOM 8773  H HD13 . LEU A 1 73  ? -7.876  -7.464  1.680   1.00 0.00 ? 170 LEU A HD13 5  
ATOM 8774  H HD21 . LEU A 1 73  ? -5.765  -9.596  1.149   1.00 0.00 ? 170 LEU A HD21 5  
ATOM 8775  H HD22 . LEU A 1 73  ? -4.857  -9.453  2.654   1.00 0.00 ? 170 LEU A HD22 5  
ATOM 8776  H HD23 . LEU A 1 73  ? -5.362  -8.002  1.788   1.00 0.00 ? 170 LEU A HD23 5  
ATOM 8777  N N    . SER A 1 74  ? -5.839  -5.588  5.958   1.00 0.00 ? 171 SER A N    5  
ATOM 8778  C CA   . SER A 1 74  ? -5.910  -4.985  7.283   1.00 0.00 ? 171 SER A CA   5  
ATOM 8779  C C    . SER A 1 74  ? -6.034  -3.462  7.210   1.00 0.00 ? 171 SER A C    5  
ATOM 8780  O O    . SER A 1 74  ? -5.046  -2.745  7.365   1.00 0.00 ? 171 SER A O    5  
ATOM 8781  C CB   . SER A 1 74  ? -4.667  -5.360  8.089   1.00 0.00 ? 171 SER A CB   5  
ATOM 8782  O OG   . SER A 1 74  ? -4.585  -6.761  8.284   1.00 0.00 ? 171 SER A OG   5  
ATOM 8783  H H    . SER A 1 74  ? -4.962  -5.724  5.544   1.00 0.00 ? 171 SER A H    5  
ATOM 8784  H HA   . SER A 1 74  ? -6.780  -5.381  7.779   1.00 0.00 ? 171 SER A HA   5  
ATOM 8785  H HB2  . SER A 1 74  ? -3.785  -5.030  7.559   1.00 0.00 ? 171 SER A HB2  5  
ATOM 8786  H HB3  . SER A 1 74  ? -4.709  -4.875  9.053   1.00 0.00 ? 171 SER A HB3  5  
ATOM 8787  H HG   . SER A 1 74  ? -4.323  -6.936  9.197   1.00 0.00 ? 171 SER A HG   5  
ATOM 8788  N N    . LEU A 1 75  ? -7.243  -2.973  6.968   1.00 0.00 ? 172 LEU A N    5  
ATOM 8789  C CA   . LEU A 1 75  ? -7.493  -1.539  6.961   1.00 0.00 ? 172 LEU A CA   5  
ATOM 8790  C C    . LEU A 1 75  ? -8.464  -1.157  8.069   1.00 0.00 ? 172 LEU A C    5  
ATOM 8791  O O    . LEU A 1 75  ? -9.505  -1.792  8.247   1.00 0.00 ? 172 LEU A O    5  
ATOM 8792  C CB   . LEU A 1 75  ? -8.060  -1.071  5.616   1.00 0.00 ? 172 LEU A CB   5  
ATOM 8793  C CG   . LEU A 1 75  ? -7.144  -1.234  4.399   1.00 0.00 ? 172 LEU A CG   5  
ATOM 8794  C CD1  . LEU A 1 75  ? -5.741  -0.727  4.697   1.00 0.00 ? 172 LEU A CD1  5  
ATOM 8795  C CD2  . LEU A 1 75  ? -7.111  -2.678  3.928   1.00 0.00 ? 172 LEU A CD2  5  
ATOM 8796  H H    . LEU A 1 75  ? -7.982  -3.585  6.776   1.00 0.00 ? 172 LEU A H    5  
ATOM 8797  H HA   . LEU A 1 75  ? -6.553  -1.038  7.138   1.00 0.00 ? 172 LEU A HA   5  
ATOM 8798  H HB2  . LEU A 1 75  ? -8.969  -1.620  5.427   1.00 0.00 ? 172 LEU A HB2  5  
ATOM 8799  H HB3  . LEU A 1 75  ? -8.311  -0.023  5.706   1.00 0.00 ? 172 LEU A HB3  5  
ATOM 8800  H HG   . LEU A 1 75  ? -7.541  -0.638  3.594   1.00 0.00 ? 172 LEU A HG   5  
ATOM 8801  H HD11 . LEU A 1 75  ? -5.128  -0.820  3.812   1.00 0.00 ? 172 LEU A HD11 5  
ATOM 8802  H HD12 . LEU A 1 75  ? -5.309  -1.311  5.496   1.00 0.00 ? 172 LEU A HD12 5  
ATOM 8803  H HD13 . LEU A 1 75  ? -5.789  0.310   4.994   1.00 0.00 ? 172 LEU A HD13 5  
ATOM 8804  H HD21 . LEU A 1 75  ? -6.458  -2.763  3.071   1.00 0.00 ? 172 LEU A HD21 5  
ATOM 8805  H HD22 . LEU A 1 75  ? -8.106  -2.991  3.656   1.00 0.00 ? 172 LEU A HD22 5  
ATOM 8806  H HD23 . LEU A 1 75  ? -6.741  -3.307  4.724   1.00 0.00 ? 172 LEU A HD23 5  
ATOM 8807  N N    . HIS A 1 76  ? -8.110  -0.127  8.817   1.00 0.00 ? 173 HIS A N    5  
ATOM 8808  C CA   . HIS A 1 76  ? -8.981  0.399   9.856   1.00 0.00 ? 173 HIS A CA   5  
ATOM 8809  C C    . HIS A 1 76  ? -9.702  1.642   9.341   1.00 0.00 ? 173 HIS A C    5  
ATOM 8810  O O    . HIS A 1 76  ? -9.060  2.628   8.977   1.00 0.00 ? 173 HIS A O    5  
ATOM 8811  C CB   . HIS A 1 76  ? -8.180  0.740   11.118  1.00 0.00 ? 173 HIS A CB   5  
ATOM 8812  C CG   . HIS A 1 76  ? -7.468  -0.432  11.726  1.00 0.00 ? 173 HIS A CG   5  
ATOM 8813  N ND1  . HIS A 1 76  ? -6.423  -0.297  12.614  1.00 0.00 ? 173 HIS A ND1  5  
ATOM 8814  C CD2  . HIS A 1 76  ? -7.656  -1.765  11.571  1.00 0.00 ? 173 HIS A CD2  5  
ATOM 8815  C CE1  . HIS A 1 76  ? -5.999  -1.493  12.977  1.00 0.00 ? 173 HIS A CE1  5  
ATOM 8816  N NE2  . HIS A 1 76  ? -6.730  -2.400  12.359  1.00 0.00 ? 173 HIS A NE2  5  
ATOM 8817  H H    . HIS A 1 76  ? -7.231  0.292   8.670   1.00 0.00 ? 173 HIS A H    5  
ATOM 8818  H HA   . HIS A 1 76  ? -9.711  -0.359  10.094  1.00 0.00 ? 173 HIS A HA   5  
ATOM 8819  H HB2  . HIS A 1 76  ? -7.438  1.484   10.871  1.00 0.00 ? 173 HIS A HB2  5  
ATOM 8820  H HB3  . HIS A 1 76  ? -8.851  1.144   11.862  1.00 0.00 ? 173 HIS A HB3  5  
ATOM 8821  H HD1  . HIS A 1 76  ? -6.050  0.554   12.938  1.00 0.00 ? 173 HIS A HD1  5  
ATOM 8822  H HD2  . HIS A 1 76  ? -8.394  -2.237  10.938  1.00 0.00 ? 173 HIS A HD2  5  
ATOM 8823  H HE1  . HIS A 1 76  ? -5.189  -1.695  13.663  1.00 0.00 ? 173 HIS A HE1  5  
ATOM 8824  H HE2  . HIS A 1 76  ? -6.726  -3.365  12.567  1.00 0.00 ? 173 HIS A HE2  5  
ATOM 8825  N N    . PRO A 1 77  ? -11.043 1.600   9.282   1.00 0.00 ? 174 PRO A N    5  
ATOM 8826  C CA   . PRO A 1 77  ? -11.854 2.712   8.767   1.00 0.00 ? 174 PRO A CA   5  
ATOM 8827  C C    . PRO A 1 77  ? -11.605 4.022   9.513   1.00 0.00 ? 174 PRO A C    5  
ATOM 8828  O O    . PRO A 1 77  ? -11.839 4.115   10.719  1.00 0.00 ? 174 PRO A O    5  
ATOM 8829  C CB   . PRO A 1 77  ? -13.298 2.248   8.990   1.00 0.00 ? 174 PRO A CB   5  
ATOM 8830  C CG   . PRO A 1 77  ? -13.218 0.764   9.101   1.00 0.00 ? 174 PRO A CG   5  
ATOM 8831  C CD   . PRO A 1 77  ? -11.876 0.460   9.705   1.00 0.00 ? 174 PRO A CD   5  
ATOM 8832  H HA   . PRO A 1 77  ? -11.686 2.867   7.712   1.00 0.00 ? 174 PRO A HA   5  
ATOM 8833  H HB2  . PRO A 1 77  ? -13.682 2.691   9.897   1.00 0.00 ? 174 PRO A HB2  5  
ATOM 8834  H HB3  . PRO A 1 77  ? -13.908 2.547   8.152   1.00 0.00 ? 174 PRO A HB3  5  
ATOM 8835  H HG2  . PRO A 1 77  ? -14.007 0.402   9.742   1.00 0.00 ? 174 PRO A HG2  5  
ATOM 8836  H HG3  . PRO A 1 77  ? -13.296 0.318   8.120   1.00 0.00 ? 174 PRO A HG3  5  
ATOM 8837  H HD2  . PRO A 1 77  ? -11.949 0.414   10.782  1.00 0.00 ? 174 PRO A HD2  5  
ATOM 8838  H HD3  . PRO A 1 77  ? -11.490 -0.468  9.312   1.00 0.00 ? 174 PRO A HD3  5  
ATOM 8839  N N    . GLY A 1 78  ? -11.128 5.026   8.791   1.00 0.00 ? 175 GLY A N    5  
ATOM 8840  C CA   . GLY A 1 78  ? -10.903 6.328   9.386   1.00 0.00 ? 175 GLY A CA   5  
ATOM 8841  C C    . GLY A 1 78  ? -9.464  6.545   9.806   1.00 0.00 ? 175 GLY A C    5  
ATOM 8842  O O    . GLY A 1 78  ? -9.137  7.561   10.418  1.00 0.00 ? 175 GLY A O    5  
ATOM 8843  H H    . GLY A 1 78  ? -10.929 4.886   7.839   1.00 0.00 ? 175 GLY A H    5  
ATOM 8844  H HA2  . GLY A 1 78  ? -11.172 7.090   8.668   1.00 0.00 ? 175 GLY A HA2  5  
ATOM 8845  H HA3  . GLY A 1 78  ? -11.536 6.427   10.253  1.00 0.00 ? 175 GLY A HA3  5  
ATOM 8846  N N    . GLN A 1 79  ? -8.599  5.596   9.479   1.00 0.00 ? 176 GLN A N    5  
ATOM 8847  C CA   . GLN A 1 79  ? -7.196  5.705   9.843   1.00 0.00 ? 176 GLN A CA   5  
ATOM 8848  C C    . GLN A 1 79  ? -6.338  5.968   8.608   1.00 0.00 ? 176 GLN A C    5  
ATOM 8849  O O    . GLN A 1 79  ? -6.697  5.591   7.489   1.00 0.00 ? 176 GLN A O    5  
ATOM 8850  C CB   . GLN A 1 79  ? -6.729  4.435   10.558  1.00 0.00 ? 176 GLN A CB   5  
ATOM 8851  C CG   . GLN A 1 79  ? -7.576  4.077   11.773  1.00 0.00 ? 176 GLN A CG   5  
ATOM 8852  C CD   . GLN A 1 79  ? -7.564  5.145   12.853  1.00 0.00 ? 176 GLN A CD   5  
ATOM 8853  O OE1  . GLN A 1 79  ? -6.574  5.855   13.045  1.00 0.00 ? 176 GLN A OE1  5  
ATOM 8854  N NE2  . GLN A 1 79  ? -8.673  5.270   13.566  1.00 0.00 ? 176 GLN A NE2  5  
ATOM 8855  H H    . GLN A 1 79  ? -8.909  4.809   8.984   1.00 0.00 ? 176 GLN A H    5  
ATOM 8856  H HA   . GLN A 1 79  ? -7.095  6.541   10.517  1.00 0.00 ? 176 GLN A HA   5  
ATOM 8857  H HB2  . GLN A 1 79  ? -6.768  3.609   9.863   1.00 0.00 ? 176 GLN A HB2  5  
ATOM 8858  H HB3  . GLN A 1 79  ? -5.709  4.572   10.884  1.00 0.00 ? 176 GLN A HB3  5  
ATOM 8859  H HG2  . GLN A 1 79  ? -8.595  3.929   11.451  1.00 0.00 ? 176 GLN A HG2  5  
ATOM 8860  H HG3  . GLN A 1 79  ? -7.199  3.157   12.196  1.00 0.00 ? 176 GLN A HG3  5  
ATOM 8861  H HE21 . GLN A 1 79  ? -9.426  4.675   13.360  1.00 0.00 ? 176 GLN A HE21 5  
ATOM 8862  H HE22 . GLN A 1 79  ? -8.698  5.951   14.272  1.00 0.00 ? 176 GLN A HE22 5  
ATOM 8863  N N    . LYS A 1 80  ? -5.222  6.645   8.823   1.00 0.00 ? 177 LYS A N    5  
ATOM 8864  C CA   . LYS A 1 80  ? -4.296  6.993   7.756   1.00 0.00 ? 177 LYS A CA   5  
ATOM 8865  C C    . LYS A 1 80  ? -3.208  5.932   7.641   1.00 0.00 ? 177 LYS A C    5  
ATOM 8866  O O    . LYS A 1 80  ? -2.689  5.463   8.652   1.00 0.00 ? 177 LYS A O    5  
ATOM 8867  C CB   . LYS A 1 80  ? -3.669  8.352   8.069   1.00 0.00 ? 177 LYS A CB   5  
ATOM 8868  C CG   . LYS A 1 80  ? -2.924  9.004   6.921   1.00 0.00 ? 177 LYS A CG   5  
ATOM 8869  C CD   . LYS A 1 80  ? -2.203  10.247  7.413   1.00 0.00 ? 177 LYS A CD   5  
ATOM 8870  C CE   . LYS A 1 80  ? -1.751  11.143  6.274   1.00 0.00 ? 177 LYS A CE   5  
ATOM 8871  N NZ   . LYS A 1 80  ? -2.899  11.771  5.565   1.00 0.00 ? 177 LYS A NZ   5  
ATOM 8872  H H    . LYS A 1 80  ? -5.012  6.935   9.742   1.00 0.00 ? 177 LYS A H    5  
ATOM 8873  H HA   . LYS A 1 80  ? -4.845  7.052   6.829   1.00 0.00 ? 177 LYS A HA   5  
ATOM 8874  H HB2  . LYS A 1 80  ? -4.451  9.025   8.378   1.00 0.00 ? 177 LYS A HB2  5  
ATOM 8875  H HB3  . LYS A 1 80  ? -2.977  8.229   8.888   1.00 0.00 ? 177 LYS A HB3  5  
ATOM 8876  H HG2  . LYS A 1 80  ? -2.201  8.306   6.522   1.00 0.00 ? 177 LYS A HG2  5  
ATOM 8877  H HG3  . LYS A 1 80  ? -3.628  9.284   6.152   1.00 0.00 ? 177 LYS A HG3  5  
ATOM 8878  H HD2  . LYS A 1 80  ? -2.871  10.805  8.049   1.00 0.00 ? 177 LYS A HD2  5  
ATOM 8879  H HD3  . LYS A 1 80  ? -1.337  9.944   7.984   1.00 0.00 ? 177 LYS A HD3  5  
ATOM 8880  H HE2  . LYS A 1 80  ? -1.119  11.921  6.674   1.00 0.00 ? 177 LYS A HE2  5  
ATOM 8881  H HE3  . LYS A 1 80  ? -1.187  10.550  5.572   1.00 0.00 ? 177 LYS A HE3  5  
ATOM 8882  H HZ1  . LYS A 1 80  ? -3.481  11.045  5.102   1.00 0.00 ? 177 LYS A HZ1  5  
ATOM 8883  H HZ2  . LYS A 1 80  ? -2.555  12.433  4.841   1.00 0.00 ? 177 LYS A HZ2  5  
ATOM 8884  H HZ3  . LYS A 1 80  ? -3.494  12.298  6.240   1.00 0.00 ? 177 LYS A HZ3  5  
ATOM 8885  N N    . TYR A 1 81  ? -2.879  5.544   6.420   1.00 0.00 ? 178 TYR A N    5  
ATOM 8886  C CA   . TYR A 1 81  ? -1.808  4.586   6.185   1.00 0.00 ? 178 TYR A CA   5  
ATOM 8887  C C    . TYR A 1 81  ? -0.733  5.205   5.303   1.00 0.00 ? 178 TYR A C    5  
ATOM 8888  O O    . TYR A 1 81  ? -1.034  5.940   4.360   1.00 0.00 ? 178 TYR A O    5  
ATOM 8889  C CB   . TYR A 1 81  ? -2.341  3.299   5.538   1.00 0.00 ? 178 TYR A CB   5  
ATOM 8890  C CG   . TYR A 1 81  ? -3.135  2.413   6.475   1.00 0.00 ? 178 TYR A CG   5  
ATOM 8891  C CD1  . TYR A 1 81  ? -4.353  2.828   6.998   1.00 0.00 ? 178 TYR A CD1  5  
ATOM 8892  C CD2  . TYR A 1 81  ? -2.665  1.155   6.831   1.00 0.00 ? 178 TYR A CD2  5  
ATOM 8893  C CE1  . TYR A 1 81  ? -5.077  2.019   7.850   1.00 0.00 ? 178 TYR A CE1  5  
ATOM 8894  C CE2  . TYR A 1 81  ? -3.385  0.339   7.682   1.00 0.00 ? 178 TYR A CE2  5  
ATOM 8895  C CZ   . TYR A 1 81  ? -4.589  0.776   8.190   1.00 0.00 ? 178 TYR A CZ   5  
ATOM 8896  O OH   . TYR A 1 81  ? -5.308  -0.033  9.040   1.00 0.00 ? 178 TYR A OH   5  
ATOM 8897  H H    . TYR A 1 81  ? -3.367  5.916   5.650   1.00 0.00 ? 178 TYR A H    5  
ATOM 8898  H HA   . TYR A 1 81  ? -1.371  4.343   7.142   1.00 0.00 ? 178 TYR A HA   5  
ATOM 8899  H HB2  . TYR A 1 81  ? -2.982  3.559   4.712   1.00 0.00 ? 178 TYR A HB2  5  
ATOM 8900  H HB3  . TYR A 1 81  ? -1.504  2.717   5.168   1.00 0.00 ? 178 TYR A HB3  5  
ATOM 8901  H HD1  . TYR A 1 81  ? -4.732  3.803   6.731   1.00 0.00 ? 178 TYR A HD1  5  
ATOM 8902  H HD2  . TYR A 1 81  ? -1.721  0.815   6.433   1.00 0.00 ? 178 TYR A HD2  5  
ATOM 8903  H HE1  . TYR A 1 81  ? -6.023  2.361   8.245   1.00 0.00 ? 178 TYR A HE1  5  
ATOM 8904  H HE2  . TYR A 1 81  ? -3.002  -0.635  7.948   1.00 0.00 ? 178 TYR A HE2  5  
ATOM 8905  H HH   . TYR A 1 81  ? -4.698  -0.533  9.592   1.00 0.00 ? 178 TYR A HH   5  
ATOM 8906  N N    . LEU A 1 82  ? 0.515   4.929   5.635   1.00 0.00 ? 179 LEU A N    5  
ATOM 8907  C CA   . LEU A 1 82  ? 1.643   5.392   4.841   1.00 0.00 ? 179 LEU A CA   5  
ATOM 8908  C C    . LEU A 1 82  ? 2.194   4.230   4.032   1.00 0.00 ? 179 LEU A C    5  
ATOM 8909  O O    . LEU A 1 82  ? 2.511   3.184   4.595   1.00 0.00 ? 179 LEU A O    5  
ATOM 8910  C CB   . LEU A 1 82  ? 2.759   5.958   5.732   1.00 0.00 ? 179 LEU A CB   5  
ATOM 8911  C CG   . LEU A 1 82  ? 2.466   7.276   6.463   1.00 0.00 ? 179 LEU A CG   5  
ATOM 8912  C CD1  . LEU A 1 82  ? 1.404   7.097   7.540   1.00 0.00 ? 179 LEU A CD1  5  
ATOM 8913  C CD2  . LEU A 1 82  ? 3.746   7.830   7.072   1.00 0.00 ? 179 LEU A CD2  5  
ATOM 8914  H H    . LEU A 1 82  ? 0.688   4.388   6.438   1.00 0.00 ? 179 LEU A H    5  
ATOM 8915  H HA   . LEU A 1 82  ? 1.293   6.161   4.167   1.00 0.00 ? 179 LEU A HA   5  
ATOM 8916  H HB2  . LEU A 1 82  ? 3.000   5.214   6.476   1.00 0.00 ? 179 LEU A HB2  5  
ATOM 8917  H HB3  . LEU A 1 82  ? 3.631   6.109   5.112   1.00 0.00 ? 179 LEU A HB3  5  
ATOM 8918  H HG   . LEU A 1 82  ? 2.100   7.998   5.752   1.00 0.00 ? 179 LEU A HG   5  
ATOM 8919  H HD11 . LEU A 1 82  ? 1.752   6.384   8.273   1.00 0.00 ? 179 LEU A HD11 5  
ATOM 8920  H HD12 . LEU A 1 82  ? 0.492   6.735   7.088   1.00 0.00 ? 179 LEU A HD12 5  
ATOM 8921  H HD13 . LEU A 1 82  ? 1.216   8.044   8.020   1.00 0.00 ? 179 LEU A HD13 5  
ATOM 8922  H HD21 . LEU A 1 82  ? 3.535   8.769   7.559   1.00 0.00 ? 179 LEU A HD21 5  
ATOM 8923  H HD22 . LEU A 1 82  ? 4.477   7.987   6.291   1.00 0.00 ? 179 LEU A HD22 5  
ATOM 8924  H HD23 . LEU A 1 82  ? 4.135   7.128   7.794   1.00 0.00 ? 179 LEU A HD23 5  
ATOM 8925  N N    . VAL A 1 83  ? 2.303   4.403   2.724   1.00 0.00 ? 180 VAL A N    5  
ATOM 8926  C CA   . VAL A 1 83  ? 2.775   3.333   1.856   1.00 0.00 ? 180 VAL A CA   5  
ATOM 8927  C C    . VAL A 1 83  ? 3.986   3.774   1.041   1.00 0.00 ? 180 VAL A C    5  
ATOM 8928  O O    . VAL A 1 83  ? 4.052   4.906   0.561   1.00 0.00 ? 180 VAL A O    5  
ATOM 8929  C CB   . VAL A 1 83  ? 1.669   2.825   0.901   1.00 0.00 ? 180 VAL A CB   5  
ATOM 8930  C CG1  . VAL A 1 83  ? 0.543   2.166   1.683   1.00 0.00 ? 180 VAL A CG1  5  
ATOM 8931  C CG2  . VAL A 1 83  ? 1.128   3.955   0.039   1.00 0.00 ? 180 VAL A CG2  5  
ATOM 8932  H H    . VAL A 1 83  ? 2.070   5.277   2.331   1.00 0.00 ? 180 VAL A H    5  
ATOM 8933  H HA   . VAL A 1 83  ? 3.071   2.508   2.490   1.00 0.00 ? 180 VAL A HA   5  
ATOM 8934  H HB   . VAL A 1 83  ? 2.103   2.082   0.247   1.00 0.00 ? 180 VAL A HB   5  
ATOM 8935  H HG11 . VAL A 1 83  ? 0.117   2.879   2.372   1.00 0.00 ? 180 VAL A HG11 5  
ATOM 8936  H HG12 . VAL A 1 83  ? 0.934   1.323   2.233   1.00 0.00 ? 180 VAL A HG12 5  
ATOM 8937  H HG13 . VAL A 1 83  ? -0.220  1.825   0.999   1.00 0.00 ? 180 VAL A HG13 5  
ATOM 8938  H HG21 . VAL A 1 83  ? 0.730   4.735   0.673   1.00 0.00 ? 180 VAL A HG21 5  
ATOM 8939  H HG22 . VAL A 1 83  ? 0.345   3.577   -0.602  1.00 0.00 ? 180 VAL A HG22 5  
ATOM 8940  H HG23 . VAL A 1 83  ? 1.926   4.356   -0.568  1.00 0.00 ? 180 VAL A HG23 5  
ATOM 8941  N N    . GLN A 1 84  ? 4.951   2.874   0.912   1.00 0.00 ? 181 GLN A N    5  
ATOM 8942  C CA   . GLN A 1 84  ? 6.166   3.139   0.153   1.00 0.00 ? 181 GLN A CA   5  
ATOM 8943  C C    . GLN A 1 84  ? 6.586   1.898   -0.610  1.00 0.00 ? 181 GLN A C    5  
ATOM 8944  O O    . GLN A 1 84  ? 6.596   0.804   -0.054  1.00 0.00 ? 181 GLN A O    5  
ATOM 8945  C CB   . GLN A 1 84  ? 7.303   3.557   1.084   1.00 0.00 ? 181 GLN A CB   5  
ATOM 8946  C CG   . GLN A 1 84  ? 7.059   4.868   1.799   1.00 0.00 ? 181 GLN A CG   5  
ATOM 8947  C CD   . GLN A 1 84  ? 7.200   4.752   3.300   1.00 0.00 ? 181 GLN A CD   5  
ATOM 8948  O OE1  . GLN A 1 84  ? 7.637   5.686   3.964   1.00 0.00 ? 181 GLN A OE1  5  
ATOM 8949  N NE2  . GLN A 1 84  ? 6.807   3.616   3.851   1.00 0.00 ? 181 GLN A NE2  5  
ATOM 8950  H H    . GLN A 1 84  ? 4.844   1.998   1.344   1.00 0.00 ? 181 GLN A H    5  
ATOM 8951  H HA   . GLN A 1 84  ? 5.963   3.936   -0.546  1.00 0.00 ? 181 GLN A HA   5  
ATOM 8952  H HB2  . GLN A 1 84  ? 7.445   2.787   1.826   1.00 0.00 ? 181 GLN A HB2  5  
ATOM 8953  H HB3  . GLN A 1 84  ? 8.209   3.653   0.503   1.00 0.00 ? 181 GLN A HB3  5  
ATOM 8954  H HG2  . GLN A 1 84  ? 7.766   5.600   1.442   1.00 0.00 ? 181 GLN A HG2  5  
ATOM 8955  H HG3  . GLN A 1 84  ? 6.055   5.196   1.575   1.00 0.00 ? 181 GLN A HG3  5  
ATOM 8956  H HE21 . GLN A 1 84  ? 6.446   2.912   3.265   1.00 0.00 ? 181 GLN A HE21 5  
ATOM 8957  H HE22 . GLN A 1 84  ? 6.866   3.532   4.825   1.00 0.00 ? 181 GLN A HE22 5  
ATOM 8958  N N    . VAL A 1 85  ? 6.939   2.068   -1.870  1.00 0.00 ? 182 VAL A N    5  
ATOM 8959  C CA   . VAL A 1 85  ? 7.412   0.959   -2.678  1.00 0.00 ? 182 VAL A CA   5  
ATOM 8960  C C    . VAL A 1 85  ? 8.724   1.327   -3.360  1.00 0.00 ? 182 VAL A C    5  
ATOM 8961  O O    . VAL A 1 85  ? 8.892   2.450   -3.835  1.00 0.00 ? 182 VAL A O    5  
ATOM 8962  C CB   . VAL A 1 85  ? 6.364   0.535   -3.736  1.00 0.00 ? 182 VAL A CB   5  
ATOM 8963  C CG1  . VAL A 1 85  ? 6.026   1.686   -4.673  1.00 0.00 ? 182 VAL A CG1  5  
ATOM 8964  C CG2  . VAL A 1 85  ? 6.850   -0.675  -4.521  1.00 0.00 ? 182 VAL A CG2  5  
ATOM 8965  H H    . VAL A 1 85  ? 6.887   2.961   -2.271  1.00 0.00 ? 182 VAL A H    5  
ATOM 8966  H HA   . VAL A 1 85  ? 7.587   0.120   -2.019  1.00 0.00 ? 182 VAL A HA   5  
ATOM 8967  H HB   . VAL A 1 85  ? 5.458   0.253   -3.216  1.00 0.00 ? 182 VAL A HB   5  
ATOM 8968  H HG11 . VAL A 1 85  ? 5.298   1.358   -5.402  1.00 0.00 ? 182 VAL A HG11 5  
ATOM 8969  H HG12 . VAL A 1 85  ? 6.922   2.011   -5.181  1.00 0.00 ? 182 VAL A HG12 5  
ATOM 8970  H HG13 . VAL A 1 85  ? 5.619   2.507   -4.102  1.00 0.00 ? 182 VAL A HG13 5  
ATOM 8971  H HG21 . VAL A 1 85  ? 6.107   -0.951  -5.254  1.00 0.00 ? 182 VAL A HG21 5  
ATOM 8972  H HG22 . VAL A 1 85  ? 7.014   -1.502  -3.845  1.00 0.00 ? 182 VAL A HG22 5  
ATOM 8973  H HG23 . VAL A 1 85  ? 7.776   -0.431  -5.021  1.00 0.00 ? 182 VAL A HG23 5  
ATOM 8974  N N    . ARG A 1 86  ? 9.664   0.398   -3.374  1.00 0.00 ? 183 ARG A N    5  
ATOM 8975  C CA   . ARG A 1 86  ? 10.929  0.621   -4.049  1.00 0.00 ? 183 ARG A CA   5  
ATOM 8976  C C    . ARG A 1 86  ? 11.399  -0.673  -4.700  1.00 0.00 ? 183 ARG A C    5  
ATOM 8977  O O    . ARG A 1 86  ? 11.093  -1.766  -4.218  1.00 0.00 ? 183 ARG A O    5  
ATOM 8978  C CB   . ARG A 1 86  ? 11.973  1.167   -3.070  1.00 0.00 ? 183 ARG A CB   5  
ATOM 8979  C CG   . ARG A 1 86  ? 13.086  1.945   -3.754  1.00 0.00 ? 183 ARG A CG   5  
ATOM 8980  C CD   . ARG A 1 86  ? 13.886  2.780   -2.765  1.00 0.00 ? 183 ARG A CD   5  
ATOM 8981  N NE   . ARG A 1 86  ? 14.788  3.713   -3.446  1.00 0.00 ? 183 ARG A NE   5  
ATOM 8982  C CZ   . ARG A 1 86  ? 15.091  4.930   -2.989  1.00 0.00 ? 183 ARG A CZ   5  
ATOM 8983  N NH1  . ARG A 1 86  ? 14.659  5.321   -1.796  1.00 0.00 ? 183 ARG A NH1  5  
ATOM 8984  N NH2  . ARG A 1 86  ? 15.854  5.741   -3.709  1.00 0.00 ? 183 ARG A NH2  5  
ATOM 8985  H H    . ARG A 1 86  ? 9.505   -0.461  -2.918  1.00 0.00 ? 183 ARG A H    5  
ATOM 8986  H HA   . ARG A 1 86  ? 10.760  1.353   -4.825  1.00 0.00 ? 183 ARG A HA   5  
ATOM 8987  H HB2  . ARG A 1 86  ? 11.482  1.821   -2.364  1.00 0.00 ? 183 ARG A HB2  5  
ATOM 8988  H HB3  . ARG A 1 86  ? 12.417  0.340   -2.534  1.00 0.00 ? 183 ARG A HB3  5  
ATOM 8989  H HG2  . ARG A 1 86  ? 13.752  1.248   -4.237  1.00 0.00 ? 183 ARG A HG2  5  
ATOM 8990  H HG3  . ARG A 1 86  ? 12.650  2.601   -4.495  1.00 0.00 ? 183 ARG A HG3  5  
ATOM 8991  H HD2  . ARG A 1 86  ? 13.200  3.343   -2.150  1.00 0.00 ? 183 ARG A HD2  5  
ATOM 8992  H HD3  . ARG A 1 86  ? 14.469  2.118   -2.142  1.00 0.00 ? 183 ARG A HD3  5  
ATOM 8993  H HE   . ARG A 1 86  ? 15.169  3.423   -4.308  1.00 0.00 ? 183 ARG A HE   5  
ATOM 8994  H HH11 . ARG A 1 86  ? 14.117  4.701   -1.230  1.00 0.00 ? 183 ARG A HH11 5  
ATOM 8995  H HH12 . ARG A 1 86  ? 14.867  6.249   -1.460  1.00 0.00 ? 183 ARG A HH12 5  
ATOM 8996  H HH21 . ARG A 1 86  ? 16.207  5.442   -4.602  1.00 0.00 ? 183 ARG A HH21 5  
ATOM 8997  H HH22 . ARG A 1 86  ? 16.082  6.658   -3.369  1.00 0.00 ? 183 ARG A HH22 5  
ATOM 8998  N N    . CYS A 1 87  ? 12.120  -0.547  -5.803  1.00 0.00 ? 184 CYS A N    5  
ATOM 8999  C CA   . CYS A 1 87  ? 12.526  -1.698  -6.592  1.00 0.00 ? 184 CYS A CA   5  
ATOM 9000  C C    . CYS A 1 87  ? 14.044  -1.808  -6.639  1.00 0.00 ? 184 CYS A C    5  
ATOM 9001  O O    . CYS A 1 87  ? 14.748  -0.820  -6.424  1.00 0.00 ? 184 CYS A O    5  
ATOM 9002  C CB   . CYS A 1 87  ? 11.966  -1.563  -8.006  1.00 0.00 ? 184 CYS A CB   5  
ATOM 9003  S SG   . CYS A 1 87  ? 12.556  -0.100  -8.892  1.00 0.00 ? 184 CYS A SG   5  
ATOM 9004  H H    . CYS A 1 87  ? 12.400  0.347   -6.091  1.00 0.00 ? 184 CYS A H    5  
ATOM 9005  H HA   . CYS A 1 87  ? 12.118  -2.585  -6.130  1.00 0.00 ? 184 CYS A HA   5  
ATOM 9006  H HB2  . CYS A 1 87  ? 12.246  -2.431  -8.581  1.00 0.00 ? 184 CYS A HB2  5  
ATOM 9007  H HB3  . CYS A 1 87  ? 10.886  -1.502  -7.954  1.00 0.00 ? 184 CYS A HB3  5  
ATOM 9008  H HG   . CYS A 1 87  ? 13.611  0.377   -8.243  1.00 0.00 ? 184 CYS A HG   5  
ATOM 9009  N N    . LYS A 1 88  ? 14.551  -2.999  -6.934  1.00 0.00 ? 185 LYS A N    5  
ATOM 9010  C CA   . LYS A 1 88  ? 15.991  -3.215  -6.980  1.00 0.00 ? 185 LYS A CA   5  
ATOM 9011  C C    . LYS A 1 88  ? 16.365  -4.230  -8.058  1.00 0.00 ? 185 LYS A C    5  
ATOM 9012  O O    . LYS A 1 88  ? 15.984  -5.401  -7.991  1.00 0.00 ? 185 LYS A O    5  
ATOM 9013  C CB   . LYS A 1 88  ? 16.524  -3.662  -5.614  1.00 0.00 ? 185 LYS A CB   5  
ATOM 9014  C CG   . LYS A 1 88  ? 15.826  -4.887  -5.040  1.00 0.00 ? 185 LYS A CG   5  
ATOM 9015  C CD   . LYS A 1 88  ? 16.419  -5.292  -3.699  1.00 0.00 ? 185 LYS A CD   5  
ATOM 9016  C CE   . LYS A 1 88  ? 17.896  -5.629  -3.821  1.00 0.00 ? 185 LYS A CE   5  
ATOM 9017  N NZ   . LYS A 1 88  ? 18.474  -6.064  -2.525  1.00 0.00 ? 185 LYS A NZ   5  
ATOM 9018  H H    . LYS A 1 88  ? 13.944  -3.745  -7.147  1.00 0.00 ? 185 LYS A H    5  
ATOM 9019  H HA   . LYS A 1 88  ? 16.448  -2.270  -7.234  1.00 0.00 ? 185 LYS A HA   5  
ATOM 9020  H HB2  . LYS A 1 88  ? 17.574  -3.889  -5.714  1.00 0.00 ? 185 LYS A HB2  5  
ATOM 9021  H HB3  . LYS A 1 88  ? 16.408  -2.848  -4.915  1.00 0.00 ? 185 LYS A HB3  5  
ATOM 9022  H HG2  . LYS A 1 88  ? 14.779  -4.662  -4.906  1.00 0.00 ? 185 LYS A HG2  5  
ATOM 9023  H HG3  . LYS A 1 88  ? 15.936  -5.707  -5.733  1.00 0.00 ? 185 LYS A HG3  5  
ATOM 9024  H HD2  . LYS A 1 88  ? 16.301  -4.474  -3.003  1.00 0.00 ? 185 LYS A HD2  5  
ATOM 9025  H HD3  . LYS A 1 88  ? 15.889  -6.158  -3.331  1.00 0.00 ? 185 LYS A HD3  5  
ATOM 9026  H HE2  . LYS A 1 88  ? 18.011  -6.425  -4.541  1.00 0.00 ? 185 LYS A HE2  5  
ATOM 9027  H HE3  . LYS A 1 88  ? 18.425  -4.754  -4.165  1.00 0.00 ? 185 LYS A HE3  5  
ATOM 9028  H HZ1  . LYS A 1 88  ? 18.026  -6.948  -2.210  1.00 0.00 ? 185 LYS A HZ1  5  
ATOM 9029  H HZ2  . LYS A 1 88  ? 18.318  -5.333  -1.801  1.00 0.00 ? 185 LYS A HZ2  5  
ATOM 9030  H HZ3  . LYS A 1 88  ? 19.496  -6.226  -2.623  1.00 0.00 ? 185 LYS A HZ3  5  
ATOM 9031  N N    . PRO A 1 89  ? 17.091  -3.776  -9.086  1.00 0.00 ? 186 PRO A N    5  
ATOM 9032  C CA   . PRO A 1 89  ? 17.583  -4.635  -10.153 1.00 0.00 ? 186 PRO A CA   5  
ATOM 9033  C C    . PRO A 1 89  ? 18.955  -5.206  -9.821  1.00 0.00 ? 186 PRO A C    5  
ATOM 9034  O O    . PRO A 1 89  ? 19.444  -5.053  -8.703  1.00 0.00 ? 186 PRO A O    5  
ATOM 9035  C CB   . PRO A 1 89  ? 17.678  -3.664  -11.324 1.00 0.00 ? 186 PRO A CB   5  
ATOM 9036  C CG   . PRO A 1 89  ? 18.050  -2.359  -10.700 1.00 0.00 ? 186 PRO A CG   5  
ATOM 9037  C CD   . PRO A 1 89  ? 17.484  -2.370  -9.300  1.00 0.00 ? 186 PRO A CD   5  
ATOM 9038  H HA   . PRO A 1 89  ? 16.893  -5.432  -10.384 1.00 0.00 ? 186 PRO A HA   5  
ATOM 9039  H HB2  . PRO A 1 89  ? 18.435  -4.004  -12.016 1.00 0.00 ? 186 PRO A HB2  5  
ATOM 9040  H HB3  . PRO A 1 89  ? 16.724  -3.603  -11.824 1.00 0.00 ? 186 PRO A HB3  5  
ATOM 9041  H HG2  . PRO A 1 89  ? 19.126  -2.266  -10.666 1.00 0.00 ? 186 PRO A HG2  5  
ATOM 9042  H HG3  . PRO A 1 89  ? 17.623  -1.548  -11.270 1.00 0.00 ? 186 PRO A HG3  5  
ATOM 9043  H HD2  . PRO A 1 89  ? 18.237  -2.068  -8.587  1.00 0.00 ? 186 PRO A HD2  5  
ATOM 9044  H HD3  . PRO A 1 89  ? 16.625  -1.717  -9.238  1.00 0.00 ? 186 PRO A HD3  5  
ATOM 9045  N N    . ASP A 1 90  ? 19.581  -5.850  -10.792 1.00 0.00 ? 187 ASP A N    5  
ATOM 9046  C CA   . ASP A 1 90  ? 20.924  -6.388  -10.605 1.00 0.00 ? 187 ASP A CA   5  
ATOM 9047  C C    . ASP A 1 90  ? 21.967  -5.336  -10.961 1.00 0.00 ? 187 ASP A C    5  
ATOM 9048  O O    . ASP A 1 90  ? 23.154  -5.631  -11.074 1.00 0.00 ? 187 ASP A O    5  
ATOM 9049  C CB   . ASP A 1 90  ? 21.135  -7.645  -11.452 1.00 0.00 ? 187 ASP A CB   5  
ATOM 9050  C CG   . ASP A 1 90  ? 20.239  -8.792  -11.030 1.00 0.00 ? 187 ASP A CG   5  
ATOM 9051  O OD1  . ASP A 1 90  ? 20.577  -9.491  -10.055 1.00 0.00 ? 187 ASP A OD1  5  
ATOM 9052  O OD2  . ASP A 1 90  ? 19.185  -9.001  -11.672 1.00 0.00 ? 187 ASP A OD2  5  
ATOM 9053  H H    . ASP A 1 90  ? 19.126  -5.980  -11.654 1.00 0.00 ? 187 ASP A H    5  
ATOM 9054  H HA   . ASP A 1 90  ? 21.033  -6.644  -9.561  1.00 0.00 ? 187 ASP A HA   5  
ATOM 9055  H HB2  . ASP A 1 90  ? 20.926  -7.414  -12.486 1.00 0.00 ? 187 ASP A HB2  5  
ATOM 9056  H HB3  . ASP A 1 90  ? 22.163  -7.963  -11.361 1.00 0.00 ? 187 ASP A HB3  5  
ATOM 9057  N N    . HIS A 1 91  ? 21.506  -4.106  -11.147 1.00 0.00 ? 188 HIS A N    5  
ATOM 9058  C CA   . HIS A 1 91  ? 22.385  -2.988  -11.471 1.00 0.00 ? 188 HIS A CA   5  
ATOM 9059  C C    . HIS A 1 91  ? 22.708  -2.168  -10.228 1.00 0.00 ? 188 HIS A C    5  
ATOM 9060  O O    . HIS A 1 91  ? 23.708  -1.453  -10.189 1.00 0.00 ? 188 HIS A O    5  
ATOM 9061  C CB   . HIS A 1 91  ? 21.734  -2.075  -12.513 1.00 0.00 ? 188 HIS A CB   5  
ATOM 9062  C CG   . HIS A 1 91  ? 21.848  -2.550  -13.927 1.00 0.00 ? 188 HIS A CG   5  
ATOM 9063  N ND1  . HIS A 1 91  ? 22.546  -1.859  -14.894 1.00 0.00 ? 188 HIS A ND1  5  
ATOM 9064  C CD2  . HIS A 1 91  ? 21.321  -3.630  -14.549 1.00 0.00 ? 188 HIS A CD2  5  
ATOM 9065  C CE1  . HIS A 1 91  ? 22.442  -2.490  -16.047 1.00 0.00 ? 188 HIS A CE1  5  
ATOM 9066  N NE2  . HIS A 1 91  ? 21.704  -3.568  -15.865 1.00 0.00 ? 188 HIS A NE2  5  
ATOM 9067  H H    . HIS A 1 91  ? 20.546  -3.945  -11.058 1.00 0.00 ? 188 HIS A H    5  
ATOM 9068  H HA   . HIS A 1 91  ? 23.301  -3.388  -11.877 1.00 0.00 ? 188 HIS A HA   5  
ATOM 9069  H HB2  . HIS A 1 91  ? 20.684  -1.983  -12.285 1.00 0.00 ? 188 HIS A HB2  5  
ATOM 9070  H HB3  . HIS A 1 91  ? 22.192  -1.100  -12.453 1.00 0.00 ? 188 HIS A HB3  5  
ATOM 9071  H HD1  . HIS A 1 91  ? 23.043  -1.019  -14.754 1.00 0.00 ? 188 HIS A HD1  5  
ATOM 9072  H HD2  . HIS A 1 91  ? 20.711  -4.397  -14.094 1.00 0.00 ? 188 HIS A HD2  5  
ATOM 9073  H HE1  . HIS A 1 91  ? 22.882  -2.175  -16.980 1.00 0.00 ? 188 HIS A HE1  5  
ATOM 9074  H HE2  . HIS A 1 91  ? 21.586  -4.286  -16.523 1.00 0.00 ? 188 HIS A HE2  5  
ATOM 9075  N N    . GLY A 1 92  ? 21.861  -2.275  -9.213  1.00 0.00 ? 189 GLY A N    5  
ATOM 9076  C CA   . GLY A 1 92  ? 22.029  -1.458  -8.031  1.00 0.00 ? 189 GLY A CA   5  
ATOM 9077  C C    . GLY A 1 92  ? 21.156  -1.917  -6.885  1.00 0.00 ? 189 GLY A C    5  
ATOM 9078  O O    . GLY A 1 92  ? 20.632  -3.029  -6.905  1.00 0.00 ? 189 GLY A O    5  
ATOM 9079  H H    . GLY A 1 92  ? 21.130  -2.923  -9.257  1.00 0.00 ? 189 GLY A H    5  
ATOM 9080  H HA2  . GLY A 1 92  ? 23.063  -1.499  -7.721  1.00 0.00 ? 189 GLY A HA2  5  
ATOM 9081  H HA3  . GLY A 1 92  ? 21.777  -0.437  -8.273  1.00 0.00 ? 189 GLY A HA3  5  
ATOM 9082  N N    . TYR A 1 93  ? 20.983  -1.050  -5.898  1.00 0.00 ? 190 TYR A N    5  
ATOM 9083  C CA   . TYR A 1 93  ? 20.241  -1.394  -4.694  1.00 0.00 ? 190 TYR A CA   5  
ATOM 9084  C C    . TYR A 1 93  ? 19.711  -0.135  -4.021  1.00 0.00 ? 190 TYR A C    5  
ATOM 9085  O O    . TYR A 1 93  ? 19.953  0.979   -4.490  1.00 0.00 ? 190 TYR A O    5  
ATOM 9086  C CB   . TYR A 1 93  ? 21.145  -2.164  -3.721  1.00 0.00 ? 190 TYR A CB   5  
ATOM 9087  C CG   . TYR A 1 93  ? 22.362  -1.382  -3.265  1.00 0.00 ? 190 TYR A CG   5  
ATOM 9088  C CD1  . TYR A 1 93  ? 23.522  -1.356  -4.030  1.00 0.00 ? 190 TYR A CD1  5  
ATOM 9089  C CD2  . TYR A 1 93  ? 22.348  -0.669  -2.072  1.00 0.00 ? 190 TYR A CD2  5  
ATOM 9090  C CE1  . TYR A 1 93  ? 24.631  -0.643  -3.618  1.00 0.00 ? 190 TYR A CE1  5  
ATOM 9091  C CE2  . TYR A 1 93  ? 23.453  0.046   -1.656  1.00 0.00 ? 190 TYR A CE2  5  
ATOM 9092  C CZ   . TYR A 1 93  ? 24.592  0.056   -2.434  1.00 0.00 ? 190 TYR A CZ   5  
ATOM 9093  O OH   . TYR A 1 93  ? 25.696  0.768   -2.024  1.00 0.00 ? 190 TYR A OH   5  
ATOM 9094  H H    . TYR A 1 93  ? 21.360  -0.145  -5.984  1.00 0.00 ? 190 TYR A H    5  
ATOM 9095  H HA   . TYR A 1 93  ? 19.410  -2.021  -4.979  1.00 0.00 ? 190 TYR A HA   5  
ATOM 9096  H HB2  . TYR A 1 93  ? 20.575  -2.424  -2.844  1.00 0.00 ? 190 TYR A HB2  5  
ATOM 9097  H HB3  . TYR A 1 93  ? 21.491  -3.067  -4.200  1.00 0.00 ? 190 TYR A HB3  5  
ATOM 9098  H HD1  . TYR A 1 93  ? 23.550  -1.904  -4.960  1.00 0.00 ? 190 TYR A HD1  5  
ATOM 9099  H HD2  . TYR A 1 93  ? 21.455  -0.678  -1.465  1.00 0.00 ? 190 TYR A HD2  5  
ATOM 9100  H HE1  . TYR A 1 93  ? 25.524  -0.636  -4.226  1.00 0.00 ? 190 TYR A HE1  5  
ATOM 9101  H HE2  . TYR A 1 93  ? 23.423  0.595   -0.726  1.00 0.00 ? 190 TYR A HE2  5  
ATOM 9102  H HH   . TYR A 1 93  ? 26.015  1.312   -2.756  1.00 0.00 ? 190 TYR A HH   5  
ATOM 9103  N N    . TRP A 1 94  ? 18.993  -0.316  -2.923  1.00 0.00 ? 191 TRP A N    5  
ATOM 9104  C CA   . TRP A 1 94  ? 18.498  0.801   -2.135  1.00 0.00 ? 191 TRP A CA   5  
ATOM 9105  C C    . TRP A 1 94  ? 18.633  0.497   -0.650  1.00 0.00 ? 191 TRP A C    5  
ATOM 9106  O O    . TRP A 1 94  ? 18.352  -0.615  -0.202  1.00 0.00 ? 191 TRP A O    5  
ATOM 9107  C CB   . TRP A 1 94  ? 17.041  1.131   -2.489  1.00 0.00 ? 191 TRP A CB   5  
ATOM 9108  C CG   . TRP A 1 94  ? 16.125  -0.055  -2.490  1.00 0.00 ? 191 TRP A CG   5  
ATOM 9109  C CD1  . TRP A 1 94  ? 15.905  -0.907  -3.530  1.00 0.00 ? 191 TRP A CD1  5  
ATOM 9110  C CD2  . TRP A 1 94  ? 15.297  -0.513  -1.414  1.00 0.00 ? 191 TRP A CD2  5  
ATOM 9111  N NE1  . TRP A 1 94  ? 15.000  -1.872  -3.167  1.00 0.00 ? 191 TRP A NE1  5  
ATOM 9112  C CE2  . TRP A 1 94  ? 14.613  -1.654  -1.875  1.00 0.00 ? 191 TRP A CE2  5  
ATOM 9113  C CE3  . TRP A 1 94  ? 15.069  -0.076  -0.104  1.00 0.00 ? 191 TRP A CE3  5  
ATOM 9114  C CZ2  . TRP A 1 94  ? 13.722  -2.361  -1.078  1.00 0.00 ? 191 TRP A CZ2  5  
ATOM 9115  C CZ3  . TRP A 1 94  ? 14.182  -0.781  0.685   1.00 0.00 ? 191 TRP A CZ3  5  
ATOM 9116  C CH2  . TRP A 1 94  ? 13.519  -1.913  0.195   1.00 0.00 ? 191 TRP A CH2  5  
ATOM 9117  H H    . TRP A 1 94  ? 18.795  -1.231  -2.626  1.00 0.00 ? 191 TRP A H    5  
ATOM 9118  H HA   . TRP A 1 94  ? 19.116  1.657   -2.365  1.00 0.00 ? 191 TRP A HA   5  
ATOM 9119  H HB2  . TRP A 1 94  ? 16.660  1.841   -1.770  1.00 0.00 ? 191 TRP A HB2  5  
ATOM 9120  H HB3  . TRP A 1 94  ? 17.012  1.576   -3.473  1.00 0.00 ? 191 TRP A HB3  5  
ATOM 9121  H HD1  . TRP A 1 94  ? 16.383  -0.824  -4.495  1.00 0.00 ? 191 TRP A HD1  5  
ATOM 9122  H HE1  . TRP A 1 94  ? 14.684  -2.600  -3.740  1.00 0.00 ? 191 TRP A HE1  5  
ATOM 9123  H HE3  . TRP A 1 94  ? 15.568  0.797   0.293   1.00 0.00 ? 191 TRP A HE3  5  
ATOM 9124  H HZ2  . TRP A 1 94  ? 13.202  -3.237  -1.440  1.00 0.00 ? 191 TRP A HZ2  5  
ATOM 9125  H HZ3  . TRP A 1 94  ? 13.990  -0.460  1.699   1.00 0.00 ? 191 TRP A HZ3  5  
ATOM 9126  H HH2  . TRP A 1 94  ? 12.832  -2.432  0.849   1.00 0.00 ? 191 TRP A HH2  5  
ATOM 9127  N N    . SER A 1 95  ? 19.077  1.482   0.107   1.00 0.00 ? 192 SER A N    5  
ATOM 9128  C CA   . SER A 1 95  ? 19.293  1.307   1.530   1.00 0.00 ? 192 SER A CA   5  
ATOM 9129  C C    . SER A 1 95  ? 18.321  2.153   2.344   1.00 0.00 ? 192 SER A C    5  
ATOM 9130  O O    . SER A 1 95  ? 18.419  2.218   3.572   1.00 0.00 ? 192 SER A O    5  
ATOM 9131  C CB   . SER A 1 95  ? 20.741  1.666   1.876   1.00 0.00 ? 192 SER A CB   5  
ATOM 9132  O OG   . SER A 1 95  ? 21.113  2.904   1.287   1.00 0.00 ? 192 SER A OG   5  
ATOM 9133  H H    . SER A 1 95  ? 19.270  2.355   -0.302  1.00 0.00 ? 192 SER A H    5  
ATOM 9134  H HA   . SER A 1 95  ? 19.126  0.267   1.765   1.00 0.00 ? 192 SER A HA   5  
ATOM 9135  H HB2  . SER A 1 95  ? 20.845  1.747   2.947   1.00 0.00 ? 192 SER A HB2  5  
ATOM 9136  H HB3  . SER A 1 95  ? 21.399  0.893   1.508   1.00 0.00 ? 192 SER A HB3  5  
ATOM 9137  H HG   . SER A 1 95  ? 21.022  3.609   1.941   1.00 0.00 ? 192 SER A HG   5  
ATOM 9138  N N    . ALA A 1 96  ? 17.373  2.789   1.664   1.00 0.00 ? 193 ALA A N    5  
ATOM 9139  C CA   . ALA A 1 96  ? 16.434  3.682   2.329   1.00 0.00 ? 193 ALA A CA   5  
ATOM 9140  C C    . ALA A 1 96  ? 15.139  3.826   1.537   1.00 0.00 ? 193 ALA A C    5  
ATOM 9141  O O    . ALA A 1 96  ? 15.055  3.430   0.373   1.00 0.00 ? 193 ALA A O    5  
ATOM 9142  C CB   . ALA A 1 96  ? 17.073  5.047   2.530   1.00 0.00 ? 193 ALA A CB   5  
ATOM 9143  H H    . ALA A 1 96  ? 17.302  2.652   0.695   1.00 0.00 ? 193 ALA A H    5  
ATOM 9144  H HA   . ALA A 1 96  ? 16.209  3.270   3.301   1.00 0.00 ? 193 ALA A HA   5  
ATOM 9145  H HB1  . ALA A 1 96  ? 16.392  5.687   3.069   1.00 0.00 ? 193 ALA A HB1  5  
ATOM 9146  H HB2  . ALA A 1 96  ? 17.294  5.484   1.567   1.00 0.00 ? 193 ALA A HB2  5  
ATOM 9147  H HB3  . ALA A 1 96  ? 17.987  4.936   3.093   1.00 0.00 ? 193 ALA A HB3  5  
ATOM 9148  N N    . TRP A 1 97  ? 14.133  4.396   2.185   1.00 0.00 ? 194 TRP A N    5  
ATOM 9149  C CA   . TRP A 1 97  ? 12.852  4.668   1.553   1.00 0.00 ? 194 TRP A CA   5  
ATOM 9150  C C    . TRP A 1 97  ? 12.717  6.162   1.307   1.00 0.00 ? 194 TRP A C    5  
ATOM 9151  O O    . TRP A 1 97  ? 13.241  6.971   2.077   1.00 0.00 ? 194 TRP A O    5  
ATOM 9152  C CB   . TRP A 1 97  ? 11.704  4.185   2.439   1.00 0.00 ? 194 TRP A CB   5  
ATOM 9153  C CG   . TRP A 1 97  ? 11.755  2.722   2.751   1.00 0.00 ? 194 TRP A CG   5  
ATOM 9154  C CD1  . TRP A 1 97  ? 12.392  2.131   3.803   1.00 0.00 ? 194 TRP A CD1  5  
ATOM 9155  C CD2  . TRP A 1 97  ? 11.144  1.665   2.005   1.00 0.00 ? 194 TRP A CD2  5  
ATOM 9156  N NE1  . TRP A 1 97  ? 12.211  0.772   3.761   1.00 0.00 ? 194 TRP A NE1  5  
ATOM 9157  C CE2  . TRP A 1 97  ? 11.449  0.460   2.665   1.00 0.00 ? 194 TRP A CE2  5  
ATOM 9158  C CE3  . TRP A 1 97  ? 10.369  1.618   0.844   1.00 0.00 ? 194 TRP A CE3  5  
ATOM 9159  C CZ2  . TRP A 1 97  ? 11.004  -0.775  2.205   1.00 0.00 ? 194 TRP A CZ2  5  
ATOM 9160  C CZ3  . TRP A 1 97  ? 9.928   0.391   0.387   1.00 0.00 ? 194 TRP A CZ3  5  
ATOM 9161  C CH2  . TRP A 1 97  ? 10.246  -0.791  1.067   1.00 0.00 ? 194 TRP A CH2  5  
ATOM 9162  H H    . TRP A 1 97  ? 14.259  4.649   3.126   1.00 0.00 ? 194 TRP A H    5  
ATOM 9163  H HA   . TRP A 1 97  ? 12.823  4.146   0.608   1.00 0.00 ? 194 TRP A HA   5  
ATOM 9164  H HB2  . TRP A 1 97  ? 11.730  4.723   3.374   1.00 0.00 ? 194 TRP A HB2  5  
ATOM 9165  H HB3  . TRP A 1 97  ? 10.766  4.388   1.940   1.00 0.00 ? 194 TRP A HB3  5  
ATOM 9166  H HD1  . TRP A 1 97  ? 12.952  2.668   4.555   1.00 0.00 ? 194 TRP A HD1  5  
ATOM 9167  H HE1  . TRP A 1 97  ? 12.569  0.127   4.411   1.00 0.00 ? 194 TRP A HE1  5  
ATOM 9168  H HE3  . TRP A 1 97  ? 10.114  2.518   0.306   1.00 0.00 ? 194 TRP A HE3  5  
ATOM 9169  H HZ2  . TRP A 1 97  ? 11.241  -1.693  2.719   1.00 0.00 ? 194 TRP A HZ2  5  
ATOM 9170  H HZ3  . TRP A 1 97  ? 9.327   0.336   -0.508  1.00 0.00 ? 194 TRP A HZ3  5  
ATOM 9171  H HH2  . TRP A 1 97  ? 9.879   -1.727  0.673   1.00 0.00 ? 194 TRP A HH2  5  
ATOM 9172  N N    . SER A 1 98  ? 12.020  6.529   0.244   1.00 0.00 ? 195 SER A N    5  
ATOM 9173  C CA   . SER A 1 98  ? 11.883  7.933   -0.115  1.00 0.00 ? 195 SER A CA   5  
ATOM 9174  C C    . SER A 1 98  ? 10.443  8.282   -0.534  1.00 0.00 ? 195 SER A C    5  
ATOM 9175  O O    . SER A 1 98  ? 9.832   9.154   0.083   1.00 0.00 ? 195 SER A O    5  
ATOM 9176  C CB   . SER A 1 98  ? 12.889  8.302   -1.211  1.00 0.00 ? 195 SER A CB   5  
ATOM 9177  O OG   . SER A 1 98  ? 14.212  7.958   -0.823  1.00 0.00 ? 195 SER A OG   5  
ATOM 9178  H H    . SER A 1 98  ? 11.584  5.851   -0.303  1.00 0.00 ? 195 SER A H    5  
ATOM 9179  H HA   . SER A 1 98  ? 12.119  8.507   0.768   1.00 0.00 ? 195 SER A HA   5  
ATOM 9180  H HB2  . SER A 1 98  ? 12.645  7.771   -2.117  1.00 0.00 ? 195 SER A HB2  5  
ATOM 9181  H HB3  . SER A 1 98  ? 12.846  9.365   -1.393  1.00 0.00 ? 195 SER A HB3  5  
ATOM 9182  H HG   . SER A 1 98  ? 14.631  8.723   -0.410  1.00 0.00 ? 195 SER A HG   5  
ATOM 9183  N N    . PRO A 1 99  ? 9.860   7.622   -1.566  1.00 0.00 ? 196 PRO A N    5  
ATOM 9184  C CA   . PRO A 1 99  ? 8.497   7.945   -2.017  1.00 0.00 ? 196 PRO A CA   5  
ATOM 9185  C C    . PRO A 1 99  ? 7.421   7.494   -1.028  1.00 0.00 ? 196 PRO A C    5  
ATOM 9186  O O    . PRO A 1 99  ? 6.829   6.421   -1.177  1.00 0.00 ? 196 PRO A O    5  
ATOM 9187  C CB   . PRO A 1 99  ? 8.365   7.177   -3.334  1.00 0.00 ? 196 PRO A CB   5  
ATOM 9188  C CG   . PRO A 1 99  ? 9.300   6.028   -3.195  1.00 0.00 ? 196 PRO A CG   5  
ATOM 9189  C CD   . PRO A 1 99  ? 10.456  6.538   -2.383  1.00 0.00 ? 196 PRO A CD   5  
ATOM 9190  H HA   . PRO A 1 99  ? 8.386   9.003   -2.204  1.00 0.00 ? 196 PRO A HA   5  
ATOM 9191  H HB2  . PRO A 1 99  ? 7.343   6.844   -3.459  1.00 0.00 ? 196 PRO A HB2  5  
ATOM 9192  H HB3  . PRO A 1 99  ? 8.643   7.816   -4.158  1.00 0.00 ? 196 PRO A HB3  5  
ATOM 9193  H HG2  . PRO A 1 99  ? 8.810   5.215   -2.680  1.00 0.00 ? 196 PRO A HG2  5  
ATOM 9194  H HG3  . PRO A 1 99  ? 9.638   5.707   -4.169  1.00 0.00 ? 196 PRO A HG3  5  
ATOM 9195  H HD2  . PRO A 1 99  ? 10.848  5.753   -1.755  1.00 0.00 ? 196 PRO A HD2  5  
ATOM 9196  H HD3  . PRO A 1 99  ? 11.226  6.925   -3.032  1.00 0.00 ? 196 PRO A HD3  5  
ATOM 9197  N N    . ALA A 1 100 ? 7.173   8.310   -0.012  1.00 0.00 ? 197 ALA A N    5  
ATOM 9198  C CA   . ALA A 1 100 ? 6.131   8.012   0.956   1.00 0.00 ? 197 ALA A CA   5  
ATOM 9199  C C    . ALA A 1 100 ? 4.795   8.571   0.495   1.00 0.00 ? 197 ALA A C    5  
ATOM 9200  O O    . ALA A 1 100 ? 4.624   9.786   0.359   1.00 0.00 ? 197 ALA A O    5  
ATOM 9201  C CB   . ALA A 1 100 ? 6.490   8.546   2.336   1.00 0.00 ? 197 ALA A CB   5  
ATOM 9202  H H    . ALA A 1 100 ? 7.707   9.127   0.089   1.00 0.00 ? 197 ALA A H    5  
ATOM 9203  H HA   . ALA A 1 100 ? 6.048   6.941   1.024   1.00 0.00 ? 197 ALA A HA   5  
ATOM 9204  H HB1  . ALA A 1 100 ? 7.417   8.098   2.667   1.00 0.00 ? 197 ALA A HB1  5  
ATOM 9205  H HB2  . ALA A 1 100 ? 5.702   8.295   3.033   1.00 0.00 ? 197 ALA A HB2  5  
ATOM 9206  H HB3  . ALA A 1 100 ? 6.603   9.618   2.290   1.00 0.00 ? 197 ALA A HB3  5  
ATOM 9207  N N    . THR A 1 101 ? 3.865   7.676   0.229   1.00 0.00 ? 198 THR A N    5  
ATOM 9208  C CA   . THR A 1 101 ? 2.535   8.060   -0.195  1.00 0.00 ? 198 THR A CA   5  
ATOM 9209  C C    . THR A 1 101 ? 1.540   7.827   0.933   1.00 0.00 ? 198 THR A C    5  
ATOM 9210  O O    . THR A 1 101 ? 1.613   6.823   1.640   1.00 0.00 ? 198 THR A O    5  
ATOM 9211  C CB   . THR A 1 101 ? 2.116   7.276   -1.453  1.00 0.00 ? 198 THR A CB   5  
ATOM 9212  O OG1  . THR A 1 101 ? 3.059   7.529   -2.502  1.00 0.00 ? 198 THR A OG1  5  
ATOM 9213  C CG2  . THR A 1 101 ? 0.721   7.670   -1.916  1.00 0.00 ? 198 THR A CG2  5  
ATOM 9214  H H    . THR A 1 101 ? 4.075   6.719   0.329   1.00 0.00 ? 198 THR A H    5  
ATOM 9215  H HA   . THR A 1 101 ? 2.551   9.111   -0.438  1.00 0.00 ? 198 THR A HA   5  
ATOM 9216  H HB   . THR A 1 101 ? 2.121   6.221   -1.220  1.00 0.00 ? 198 THR A HB   5  
ATOM 9217  H HG1  . THR A 1 101 ? 3.888   7.080   -2.301  1.00 0.00 ? 198 THR A HG1  5  
ATOM 9218  H HG21 . THR A 1 101 ? 0.701   8.727   -2.139  1.00 0.00 ? 198 THR A HG21 5  
ATOM 9219  H HG22 . THR A 1 101 ? 0.008   7.454   -1.134  1.00 0.00 ? 198 THR A HG22 5  
ATOM 9220  H HG23 . THR A 1 101 ? 0.465   7.109   -2.803  1.00 0.00 ? 198 THR A HG23 5  
ATOM 9221  N N    . PHE A 1 102 ? 0.631   8.767   1.113   1.00 0.00 ? 199 PHE A N    5  
ATOM 9222  C CA   . PHE A 1 102 ? -0.324  8.696   2.199   1.00 0.00 ? 199 PHE A CA   5  
ATOM 9223  C C    . PHE A 1 102 ? -1.705  8.339   1.667   1.00 0.00 ? 199 PHE A C    5  
ATOM 9224  O O    . PHE A 1 102 ? -2.109  8.808   0.601   1.00 0.00 ? 199 PHE A O    5  
ATOM 9225  C CB   . PHE A 1 102 ? -0.377  10.034  2.937   1.00 0.00 ? 199 PHE A CB   5  
ATOM 9226  C CG   . PHE A 1 102 ? 0.961   10.514  3.435   1.00 0.00 ? 199 PHE A CG   5  
ATOM 9227  C CD1  . PHE A 1 102 ? 1.787   11.275  2.619   1.00 0.00 ? 199 PHE A CD1  5  
ATOM 9228  C CD2  . PHE A 1 102 ? 1.389   10.210  4.715   1.00 0.00 ? 199 PHE A CD2  5  
ATOM 9229  C CE1  . PHE A 1 102 ? 3.012   11.720  3.073   1.00 0.00 ? 199 PHE A CE1  5  
ATOM 9230  C CE2  . PHE A 1 102 ? 2.616   10.655  5.174   1.00 0.00 ? 199 PHE A CE2  5  
ATOM 9231  C CZ   . PHE A 1 102 ? 3.427   11.410  4.351   1.00 0.00 ? 199 PHE A CZ   5  
ATOM 9232  H H    . PHE A 1 102 ? 0.591   9.525   0.489   1.00 0.00 ? 199 PHE A H    5  
ATOM 9233  H HA   . PHE A 1 102 ? 0.002   7.927   2.883   1.00 0.00 ? 199 PHE A HA   5  
ATOM 9234  H HB2  . PHE A 1 102 ? -0.769  10.786  2.272   1.00 0.00 ? 199 PHE A HB2  5  
ATOM 9235  H HB3  . PHE A 1 102 ? -1.034  9.939   3.788   1.00 0.00 ? 199 PHE A HB3  5  
ATOM 9236  H HD1  . PHE A 1 102 ? 1.466   11.517  1.619   1.00 0.00 ? 199 PHE A HD1  5  
ATOM 9237  H HD2  . PHE A 1 102 ? 0.757   9.619   5.360   1.00 0.00 ? 199 PHE A HD2  5  
ATOM 9238  H HE1  . PHE A 1 102 ? 3.646   12.311  2.428   1.00 0.00 ? 199 PHE A HE1  5  
ATOM 9239  H HE2  . PHE A 1 102 ? 2.939   10.410  6.175   1.00 0.00 ? 199 PHE A HE2  5  
ATOM 9240  H HZ   . PHE A 1 102 ? 4.385   11.756  4.709   1.00 0.00 ? 199 PHE A HZ   5  
ATOM 9241  N N    . ILE A 1 103 ? -2.414  7.492   2.398   1.00 0.00 ? 200 ILE A N    5  
ATOM 9242  C CA   . ILE A 1 103 ? -3.767  7.113   2.025   1.00 0.00 ? 200 ILE A CA   5  
ATOM 9243  C C    . ILE A 1 103 ? -4.681  7.112   3.251   1.00 0.00 ? 200 ILE A C    5  
ATOM 9244  O O    . ILE A 1 103 ? -4.314  6.618   4.320   1.00 0.00 ? 200 ILE A O    5  
ATOM 9245  C CB   . ILE A 1 103 ? -3.802  5.729   1.328   1.00 0.00 ? 200 ILE A CB   5  
ATOM 9246  C CG1  . ILE A 1 103 ? -5.238  5.333   0.959   1.00 0.00 ? 200 ILE A CG1  5  
ATOM 9247  C CG2  . ILE A 1 103 ? -3.163  4.662   2.207   1.00 0.00 ? 200 ILE A CG2  5  
ATOM 9248  C CD1  . ILE A 1 103 ? -5.887  6.259   -0.050  1.00 0.00 ? 200 ILE A CD1  5  
ATOM 9249  H H    . ILE A 1 103 ? -2.015  7.102   3.207   1.00 0.00 ? 200 ILE A H    5  
ATOM 9250  H HA   . ILE A 1 103 ? -4.130  7.851   1.325   1.00 0.00 ? 200 ILE A HA   5  
ATOM 9251  H HB   . ILE A 1 103 ? -3.216  5.799   0.423   1.00 0.00 ? 200 ILE A HB   5  
ATOM 9252  H HG12 . ILE A 1 103 ? -5.233  4.340   0.538   1.00 0.00 ? 200 ILE A HG12 5  
ATOM 9253  H HG13 . ILE A 1 103 ? -5.845  5.337   1.852   1.00 0.00 ? 200 ILE A HG13 5  
ATOM 9254  H HG21 . ILE A 1 103 ? -3.152  3.720   1.682   1.00 0.00 ? 200 ILE A HG21 5  
ATOM 9255  H HG22 . ILE A 1 103 ? -3.735  4.559   3.118   1.00 0.00 ? 200 ILE A HG22 5  
ATOM 9256  H HG23 . ILE A 1 103 ? -2.151  4.953   2.448   1.00 0.00 ? 200 ILE A HG23 5  
ATOM 9257  H HD11 . ILE A 1 103 ? -6.868  5.883   -0.303  1.00 0.00 ? 200 ILE A HD11 5  
ATOM 9258  H HD12 . ILE A 1 103 ? -5.279  6.304   -0.940  1.00 0.00 ? 200 ILE A HD12 5  
ATOM 9259  H HD13 . ILE A 1 103 ? -5.979  7.247   0.377   1.00 0.00 ? 200 ILE A HD13 5  
ATOM 9260  N N    . GLN A 1 104 ? -5.854  7.702   3.099   1.00 0.00 ? 201 GLN A N    5  
ATOM 9261  C CA   . GLN A 1 104 ? -6.843  7.731   4.161   1.00 0.00 ? 201 GLN A CA   5  
ATOM 9262  C C    . GLN A 1 104 ? -7.923  6.695   3.902   1.00 0.00 ? 201 GLN A C    5  
ATOM 9263  O O    . GLN A 1 104 ? -8.560  6.702   2.848   1.00 0.00 ? 201 GLN A O    5  
ATOM 9264  C CB   . GLN A 1 104 ? -7.466  9.124   4.260   1.00 0.00 ? 201 GLN A CB   5  
ATOM 9265  C CG   . GLN A 1 104 ? -6.487  10.193  4.711   1.00 0.00 ? 201 GLN A CG   5  
ATOM 9266  C CD   . GLN A 1 104 ? -6.376  10.312  6.221   1.00 0.00 ? 201 GLN A CD   5  
ATOM 9267  O OE1  . GLN A 1 104 ? -6.032  11.371  6.738   1.00 0.00 ? 201 GLN A OE1  5  
ATOM 9268  N NE2  . GLN A 1 104 ? -6.690  9.248   6.945   1.00 0.00 ? 201 GLN A NE2  5  
ATOM 9269  H H    . GLN A 1 104 ? -6.063  8.135   2.242   1.00 0.00 ? 201 GLN A H    5  
ATOM 9270  H HA   . GLN A 1 104 ? -6.345  7.498   5.089   1.00 0.00 ? 201 GLN A HA   5  
ATOM 9271  H HB2  . GLN A 1 104 ? -7.848  9.404   3.289   1.00 0.00 ? 201 GLN A HB2  5  
ATOM 9272  H HB3  . GLN A 1 104 ? -8.282  9.091   4.965   1.00 0.00 ? 201 GLN A HB3  5  
ATOM 9273  H HG2  . GLN A 1 104 ? -5.512  9.956   4.316   1.00 0.00 ? 201 GLN A HG2  5  
ATOM 9274  H HG3  . GLN A 1 104 ? -6.811  11.144  4.316   1.00 0.00 ? 201 GLN A HG3  5  
ATOM 9275  H HE21 . GLN A 1 104 ? -6.981  8.437   6.482   1.00 0.00 ? 201 GLN A HE21 5  
ATOM 9276  H HE22 . GLN A 1 104 ? -6.620  9.320   7.923   1.00 0.00 ? 201 GLN A HE22 5  
ATOM 9277  N N    . ILE A 1 105 ? -8.117  5.797   4.854   1.00 0.00 ? 202 ILE A N    5  
ATOM 9278  C CA   . ILE A 1 105 ? -9.153  4.786   4.738   1.00 0.00 ? 202 ILE A CA   5  
ATOM 9279  C C    . ILE A 1 105 ? -10.505 5.393   5.091   1.00 0.00 ? 202 ILE A C    5  
ATOM 9280  O O    . ILE A 1 105 ? -10.673 5.954   6.175   1.00 0.00 ? 202 ILE A O    5  
ATOM 9281  C CB   . ILE A 1 105 ? -8.863  3.578   5.657   1.00 0.00 ? 202 ILE A CB   5  
ATOM 9282  C CG1  . ILE A 1 105 ? -7.476  3.000   5.357   1.00 0.00 ? 202 ILE A CG1  5  
ATOM 9283  C CG2  . ILE A 1 105 ? -9.930  2.504   5.494   1.00 0.00 ? 202 ILE A CG2  5  
ATOM 9284  C CD1  . ILE A 1 105 ? -7.289  2.566   3.917   1.00 0.00 ? 202 ILE A CD1  5  
ATOM 9285  H H    . ILE A 1 105 ? -7.552  5.813   5.657   1.00 0.00 ? 202 ILE A H    5  
ATOM 9286  H HA   . ILE A 1 105 ? -9.174  4.444   3.714   1.00 0.00 ? 202 ILE A HA   5  
ATOM 9287  H HB   . ILE A 1 105 ? -8.887  3.919   6.681   1.00 0.00 ? 202 ILE A HB   5  
ATOM 9288  H HG12 . ILE A 1 105 ? -6.729  3.749   5.574   1.00 0.00 ? 202 ILE A HG12 5  
ATOM 9289  H HG13 . ILE A 1 105 ? -7.307  2.139   5.987   1.00 0.00 ? 202 ILE A HG13 5  
ATOM 9290  H HG21 . ILE A 1 105 ? -9.908  2.123   4.481   1.00 0.00 ? 202 ILE A HG21 5  
ATOM 9291  H HG22 . ILE A 1 105 ? -10.902 2.929   5.696   1.00 0.00 ? 202 ILE A HG22 5  
ATOM 9292  H HG23 . ILE A 1 105 ? -9.739  1.697   6.185   1.00 0.00 ? 202 ILE A HG23 5  
ATOM 9293  H HD11 . ILE A 1 105 ? -7.401  3.421   3.265   1.00 0.00 ? 202 ILE A HD11 5  
ATOM 9294  H HD12 . ILE A 1 105 ? -8.031  1.823   3.666   1.00 0.00 ? 202 ILE A HD12 5  
ATOM 9295  H HD13 . ILE A 1 105 ? -6.302  2.146   3.792   1.00 0.00 ? 202 ILE A HD13 5  
ATOM 9296  N N    . PRO A 1 106 ? -11.479 5.307   4.170   1.00 0.00 ? 203 PRO A N    5  
ATOM 9297  C CA   . PRO A 1 106 ? -12.809 5.897   4.359   1.00 0.00 ? 203 PRO A CA   5  
ATOM 9298  C C    . PRO A 1 106 ? -13.538 5.311   5.563   1.00 0.00 ? 203 PRO A C    5  
ATOM 9299  O O    . PRO A 1 106 ? -13.342 4.149   5.925   1.00 0.00 ? 203 PRO A O    5  
ATOM 9300  C CB   . PRO A 1 106 ? -13.553 5.539   3.065   1.00 0.00 ? 203 PRO A CB   5  
ATOM 9301  C CG   . PRO A 1 106 ? -12.791 4.405   2.474   1.00 0.00 ? 203 PRO A CG   5  
ATOM 9302  C CD   . PRO A 1 106 ? -11.362 4.623   2.871   1.00 0.00 ? 203 PRO A CD   5  
ATOM 9303  H HA   . PRO A 1 106 ? -12.753 6.970   4.461   1.00 0.00 ? 203 PRO A HA   5  
ATOM 9304  H HB2  . PRO A 1 106 ? -14.568 5.251   3.300   1.00 0.00 ? 203 PRO A HB2  5  
ATOM 9305  H HB3  . PRO A 1 106 ? -13.562 6.393   2.405   1.00 0.00 ? 203 PRO A HB3  5  
ATOM 9306  H HG2  . PRO A 1 106 ? -13.155 3.470   2.875   1.00 0.00 ? 203 PRO A HG2  5  
ATOM 9307  H HG3  . PRO A 1 106 ? -12.888 4.417   1.398   1.00 0.00 ? 203 PRO A HG3  5  
ATOM 9308  H HD2  . PRO A 1 106 ? -10.852 3.677   2.976   1.00 0.00 ? 203 PRO A HD2  5  
ATOM 9309  H HD3  . PRO A 1 106 ? -10.858 5.248   2.149   1.00 0.00 ? 203 PRO A HD3  5  
ATOM 9310  N N    . SER A 1 107 ? -14.382 6.131   6.179   1.00 0.00 ? 204 SER A N    5  
ATOM 9311  C CA   . SER A 1 107 ? -15.194 5.699   7.305   1.00 0.00 ? 204 SER A CA   5  
ATOM 9312  C C    . SER A 1 107 ? -16.203 4.652   6.847   1.00 0.00 ? 204 SER A C    5  
ATOM 9313  O O    . SER A 1 107 ? -16.633 3.799   7.622   1.00 0.00 ? 204 SER A O    5  
ATOM 9314  C CB   . SER A 1 107 ? -15.923 6.897   7.912   1.00 0.00 ? 204 SER A CB   5  
ATOM 9315  O OG   . SER A 1 107 ? -15.024 7.966   8.156   1.00 0.00 ? 204 SER A OG   5  
ATOM 9316  H H    . SER A 1 107 ? -14.460 7.060   5.866   1.00 0.00 ? 204 SER A H    5  
ATOM 9317  H HA   . SER A 1 107 ? -14.543 5.263   8.046   1.00 0.00 ? 204 SER A HA   5  
ATOM 9318  H HB2  . SER A 1 107 ? -16.688 7.236   7.228   1.00 0.00 ? 204 SER A HB2  5  
ATOM 9319  H HB3  . SER A 1 107 ? -16.378 6.604   8.847   1.00 0.00 ? 204 SER A HB3  5  
ATOM 9320  H HG   . SER A 1 107 ? -14.486 7.760   8.935   1.00 0.00 ? 204 SER A HG   5  
ATOM 9321  N N    . ASP A 1 108 ? -16.555 4.718   5.567   1.00 0.00 ? 205 ASP A N    5  
ATOM 9322  C CA   . ASP A 1 108 ? -17.495 3.778   4.973   1.00 0.00 ? 205 ASP A CA   5  
ATOM 9323  C C    . ASP A 1 108 ? -16.755 2.590   4.371   1.00 0.00 ? 205 ASP A C    5  
ATOM 9324  O O    . ASP A 1 108 ? -17.224 1.982   3.411   1.00 0.00 ? 205 ASP A O    5  
ATOM 9325  C CB   . ASP A 1 108 ? -18.325 4.460   3.881   1.00 0.00 ? 205 ASP A CB   5  
ATOM 9326  C CG   . ASP A 1 108 ? -19.143 5.627   4.393   1.00 0.00 ? 205 ASP A CG   5  
ATOM 9327  O OD1  . ASP A 1 108 ? -20.191 5.394   5.026   1.00 0.00 ? 205 ASP A OD1  5  
ATOM 9328  O OD2  . ASP A 1 108 ? -18.745 6.786   4.152   1.00 0.00 ? 205 ASP A OD2  5  
ATOM 9329  H H    . ASP A 1 108 ? -16.170 5.427   5.007   1.00 0.00 ? 205 ASP A H    5  
ATOM 9330  H HA   . ASP A 1 108 ? -18.154 3.425   5.752   1.00 0.00 ? 205 ASP A HA   5  
ATOM 9331  H HB2  . ASP A 1 108 ? -17.661 4.826   3.112   1.00 0.00 ? 205 ASP A HB2  5  
ATOM 9332  H HB3  . ASP A 1 108 ? -18.999 3.734   3.448   1.00 0.00 ? 205 ASP A HB3  5  
ATOM 9333  N N    . PHE A 1 109 ? -15.587 2.276   4.922   1.00 0.00 ? 206 PHE A N    5  
ATOM 9334  C CA   . PHE A 1 109 ? -14.792 1.149   4.446   1.00 0.00 ? 206 PHE A CA   5  
ATOM 9335  C C    . PHE A 1 109 ? -15.551 -0.158  4.642   1.00 0.00 ? 206 PHE A C    5  
ATOM 9336  O O    . PHE A 1 109 ? -15.630 -0.990  3.738   1.00 0.00 ? 206 PHE A O    5  
ATOM 9337  C CB   . PHE A 1 109 ? -13.452 1.091   5.180   1.00 0.00 ? 206 PHE A CB   5  
ATOM 9338  C CG   . PHE A 1 109 ? -12.543 -0.005  4.699   1.00 0.00 ? 206 PHE A CG   5  
ATOM 9339  C CD1  . PHE A 1 109 ? -11.788 0.163   3.552   1.00 0.00 ? 206 PHE A CD1  5  
ATOM 9340  C CD2  . PHE A 1 109 ? -12.448 -1.202  5.393   1.00 0.00 ? 206 PHE A CD2  5  
ATOM 9341  C CE1  . PHE A 1 109 ? -10.952 -0.840  3.104   1.00 0.00 ? 206 PHE A CE1  5  
ATOM 9342  C CE2  . PHE A 1 109 ? -11.614 -2.210  4.948   1.00 0.00 ? 206 PHE A CE2  5  
ATOM 9343  C CZ   . PHE A 1 109 ? -10.865 -2.029  3.803   1.00 0.00 ? 206 PHE A CZ   5  
ATOM 9344  H H    . PHE A 1 109 ? -15.247 2.823   5.662   1.00 0.00 ? 206 PHE A H    5  
ATOM 9345  H HA   . PHE A 1 109 ? -14.611 1.293   3.391   1.00 0.00 ? 206 PHE A HA   5  
ATOM 9346  H HB2  . PHE A 1 109 ? -12.935 2.030   5.045   1.00 0.00 ? 206 PHE A HB2  5  
ATOM 9347  H HB3  . PHE A 1 109 ? -13.634 0.936   6.232   1.00 0.00 ? 206 PHE A HB3  5  
ATOM 9348  H HD1  . PHE A 1 109 ? -11.854 1.092   3.005   1.00 0.00 ? 206 PHE A HD1  5  
ATOM 9349  H HD2  . PHE A 1 109 ? -13.034 -1.346  6.289   1.00 0.00 ? 206 PHE A HD2  5  
ATOM 9350  H HE1  . PHE A 1 109 ? -10.366 -0.695  2.210   1.00 0.00 ? 206 PHE A HE1  5  
ATOM 9351  H HE2  . PHE A 1 109 ? -11.547 -3.137  5.497   1.00 0.00 ? 206 PHE A HE2  5  
ATOM 9352  H HZ   . PHE A 1 109 ? -10.213 -2.814  3.451   1.00 0.00 ? 206 PHE A HZ   5  
ATOM 9353  N N    . THR A 1 110 ? -16.111 -0.333  5.825   1.00 0.00 ? 207 THR A N    5  
ATOM 9354  C CA   . THR A 1 110 ? -16.898 -1.510  6.118   1.00 0.00 ? 207 THR A CA   5  
ATOM 9355  C C    . THR A 1 110 ? -18.376 -1.202  5.939   1.00 0.00 ? 207 THR A C    5  
ATOM 9356  O O    . THR A 1 110 ? -18.945 -0.383  6.662   1.00 0.00 ? 207 THR A O    5  
ATOM 9357  C CB   . THR A 1 110 ? -16.657 -1.997  7.550   1.00 0.00 ? 207 THR A CB   5  
ATOM 9358  O OG1  . THR A 1 110 ? -15.269 -1.843  7.889   1.00 0.00 ? 207 THR A OG1  5  
ATOM 9359  C CG2  . THR A 1 110 ? -17.057 -3.457  7.702   1.00 0.00 ? 207 THR A CG2  5  
ATOM 9360  H H    . THR A 1 110 ? -15.993 0.348   6.519   1.00 0.00 ? 207 THR A H    5  
ATOM 9361  H HA   . THR A 1 110 ? -16.608 -2.293  5.432   1.00 0.00 ? 207 THR A HA   5  
ATOM 9362  H HB   . THR A 1 110 ? -17.260 -1.402  8.213   1.00 0.00 ? 207 THR A HB   5  
ATOM 9363  H HG1  . THR A 1 110 ? -14.738 -2.418  7.326   1.00 0.00 ? 207 THR A HG1  5  
ATOM 9364  H HG21 . THR A 1 110 ? -18.104 -3.571  7.459   1.00 0.00 ? 207 THR A HG21 5  
ATOM 9365  H HG22 . THR A 1 110 ? -16.888 -3.773  8.721   1.00 0.00 ? 207 THR A HG22 5  
ATOM 9366  H HG23 . THR A 1 110 ? -16.465 -4.063  7.034   1.00 0.00 ? 207 THR A HG23 5  
ATOM 9367  N N    . MET A 1 111 ? -18.984 -1.863  4.977   1.00 0.00 ? 208 MET A N    5  
ATOM 9368  C CA   . MET A 1 111 ? -20.386 -1.639  4.641   1.00 0.00 ? 208 MET A CA   5  
ATOM 9369  C C    . MET A 1 111 ? -21.067 -2.965  4.354   1.00 0.00 ? 208 MET A C    5  
ATOM 9370  O O    . MET A 1 111 ? -22.000 -3.365  5.048   1.00 0.00 ? 208 MET A O    5  
ATOM 9371  C CB   . MET A 1 111 ? -20.520 -0.718  3.421   1.00 0.00 ? 208 MET A CB   5  
ATOM 9372  C CG   . MET A 1 111 ? -20.122 0.726   3.682   1.00 0.00 ? 208 MET A CG   5  
ATOM 9373  S SD   . MET A 1 111 ? -21.189 1.540   4.888   1.00 0.00 ? 208 MET A SD   5  
ATOM 9374  C CE   . MET A 1 111 ? -22.760 1.523   4.025   1.00 0.00 ? 208 MET A CE   5  
ATOM 9375  H H    . MET A 1 111 ? -18.479 -2.545  4.491   1.00 0.00 ? 208 MET A H    5  
ATOM 9376  H HA   . MET A 1 111 ? -20.864 -1.175  5.491   1.00 0.00 ? 208 MET A HA   5  
ATOM 9377  H HB2  . MET A 1 111 ? -19.894 -1.101  2.628   1.00 0.00 ? 208 MET A HB2  5  
ATOM 9378  H HB3  . MET A 1 111 ? -21.549 -0.730  3.089   1.00 0.00 ? 208 MET A HB3  5  
ATOM 9379  H HG2  . MET A 1 111 ? -19.108 0.743   4.052   1.00 0.00 ? 208 MET A HG2  5  
ATOM 9380  H HG3  . MET A 1 111 ? -20.172 1.272   2.751   1.00 0.00 ? 208 MET A HG3  5  
ATOM 9381  H HE1  . MET A 1 111 ? -22.657 2.032   3.080   1.00 0.00 ? 208 MET A HE1  5  
ATOM 9382  H HE2  . MET A 1 111 ? -23.505 2.022   4.625   1.00 0.00 ? 208 MET A HE2  5  
ATOM 9383  H HE3  . MET A 1 111 ? -23.064 0.501   3.852   1.00 0.00 ? 208 MET A HE3  5  
ATOM 9384  N N    . ASN A 1 112 ? -20.581 -3.649  3.333   1.00 0.00 ? 209 ASN A N    5  
ATOM 9385  C CA   . ASN A 1 112 ? -21.133 -4.930  2.932   1.00 0.00 ? 209 ASN A CA   5  
ATOM 9386  C C    . ASN A 1 112 ? -20.026 -5.810  2.369   1.00 0.00 ? 209 ASN A C    5  
ATOM 9387  O O    . ASN A 1 112 ? -19.007 -5.304  1.893   1.00 0.00 ? 209 ASN A O    5  
ATOM 9388  C CB   . ASN A 1 112 ? -22.246 -4.740  1.893   1.00 0.00 ? 209 ASN A CB   5  
ATOM 9389  C CG   . ASN A 1 112 ? -21.740 -4.217  0.558   1.00 0.00 ? 209 ASN A CG   5  
ATOM 9390  O OD1  . ASN A 1 112 ? -21.413 -4.990  -0.341  1.00 0.00 ? 209 ASN A OD1  5  
ATOM 9391  N ND2  . ASN A 1 112 ? -21.690 -2.900  0.410   1.00 0.00 ? 209 ASN A ND2  5  
ATOM 9392  H H    . ASN A 1 112 ? -19.817 -3.288  2.835   1.00 0.00 ? 209 ASN A H    5  
ATOM 9393  H HA   . ASN A 1 112 ? -21.544 -5.406  3.810   1.00 0.00 ? 209 ASN A HA   5  
ATOM 9394  H HB2  . ASN A 1 112 ? -22.731 -5.688  1.720   1.00 0.00 ? 209 ASN A HB2  5  
ATOM 9395  H HB3  . ASN A 1 112 ? -22.970 -4.039  2.280   1.00 0.00 ? 209 ASN A HB3  5  
ATOM 9396  H HD21 . ASN A 1 112 ? -21.984 -2.336  1.159   1.00 0.00 ? 209 ASN A HD21 5  
ATOM 9397  H HD22 . ASN A 1 112 ? -21.363 -2.542  -0.442  1.00 0.00 ? 209 ASN A HD22 5  
ATOM 9398  N N    . ASP A 1 113 ? -20.216 -7.114  2.450   1.00 0.00 ? 210 ASP A N    5  
ATOM 9399  C CA   . ASP A 1 113 ? -19.243 -8.070  1.942   1.00 0.00 ? 210 ASP A CA   5  
ATOM 9400  C C    . ASP A 1 113 ? -19.938 -9.392  1.673   1.00 0.00 ? 210 ASP A C    5  
ATOM 9401  O O    . ASP A 1 113 ? -21.046 -9.594  2.219   1.00 0.00 ? 210 ASP A O    5  
ATOM 9402  C CB   . ASP A 1 113 ? -18.097 -8.279  2.939   1.00 0.00 ? 210 ASP A CB   5  
ATOM 9403  C CG   . ASP A 1 113 ? -18.485 -9.156  4.116   1.00 0.00 ? 210 ASP A CG   5  
ATOM 9404  O OD1  . ASP A 1 113 ? -18.992 -8.616  5.122   1.00 0.00 ? 210 ASP A OD1  5  
ATOM 9405  O OD2  . ASP A 1 113 ? -18.268 -10.387 4.047   1.00 0.00 ? 210 ASP A OD2  5  
ATOM 9406  O OXT  . ASP A 1 113 ? -19.385 -10.223 0.928   1.00 0.00 ? 210 ASP A OXT  5  
ATOM 9407  H H    . ASP A 1 113 ? -21.036 -7.454  2.861   1.00 0.00 ? 210 ASP A H    5  
ATOM 9408  H HA   . ASP A 1 113 ? -18.846 -7.684  1.014   1.00 0.00 ? 210 ASP A HA   5  
ATOM 9409  H HB2  . ASP A 1 113 ? -17.266 -8.741  2.430   1.00 0.00 ? 210 ASP A HB2  5  
ATOM 9410  H HB3  . ASP A 1 113 ? -17.787 -7.317  3.320   1.00 0.00 ? 210 ASP A HB3  5  
ATOM 9411  N N    . MET A 1 1   ? 30.586  7.631   -15.238 1.00 0.00 ? 98  MET A N    6  
ATOM 9412  C CA   . MET A 1 1   ? 29.345  8.109   -14.590 1.00 0.00 ? 98  MET A CA   6  
ATOM 9413  C C    . MET A 1 1   ? 28.930  7.156   -13.481 1.00 0.00 ? 98  MET A C    6  
ATOM 9414  O O    . MET A 1 1   ? 29.245  5.967   -13.522 1.00 0.00 ? 98  MET A O    6  
ATOM 9415  C CB   . MET A 1 1   ? 28.203  8.226   -15.607 1.00 0.00 ? 98  MET A CB   6  
ATOM 9416  C CG   . MET A 1 1   ? 27.751  6.888   -16.178 1.00 0.00 ? 98  MET A CG   6  
ATOM 9417  S SD   . MET A 1 1   ? 26.238  7.011   -17.157 1.00 0.00 ? 98  MET A SD   6  
ATOM 9418  C CE   . MET A 1 1   ? 25.055  7.512   -15.907 1.00 0.00 ? 98  MET A CE   6  
ATOM 9419  H H1   . MET A 1 1   ? 31.365  7.618   -14.548 1.00 0.00 ? 98  MET A H1   6  
ATOM 9420  H H2   . MET A 1 1   ? 30.846  8.257   -16.024 1.00 0.00 ? 98  MET A H2   6  
ATOM 9421  H H3   . MET A 1 1   ? 30.450  6.669   -15.604 1.00 0.00 ? 98  MET A H3   6  
ATOM 9422  H HA   . MET A 1 1   ? 29.539  9.081   -14.161 1.00 0.00 ? 98  MET A HA   6  
ATOM 9423  H HB2  . MET A 1 1   ? 27.356  8.690   -15.126 1.00 0.00 ? 98  MET A HB2  6  
ATOM 9424  H HB3  . MET A 1 1   ? 28.528  8.850   -16.425 1.00 0.00 ? 98  MET A HB3  6  
ATOM 9425  H HG2  . MET A 1 1   ? 28.537  6.499   -16.808 1.00 0.00 ? 98  MET A HG2  6  
ATOM 9426  H HG3  . MET A 1 1   ? 27.579  6.205   -15.360 1.00 0.00 ? 98  MET A HG3  6  
ATOM 9427  H HE1  . MET A 1 1   ? 25.344  8.468   -15.499 1.00 0.00 ? 98  MET A HE1  6  
ATOM 9428  H HE2  . MET A 1 1   ? 25.031  6.775   -15.117 1.00 0.00 ? 98  MET A HE2  6  
ATOM 9429  H HE3  . MET A 1 1   ? 24.075  7.594   -16.353 1.00 0.00 ? 98  MET A HE3  6  
ATOM 9430  N N    . TYR A 1 2   ? 28.225  7.679   -12.492 1.00 0.00 ? 99  TYR A N    6  
ATOM 9431  C CA   . TYR A 1 2   ? 27.690  6.855   -11.426 1.00 0.00 ? 99  TYR A CA   6  
ATOM 9432  C C    . TYR A 1 2   ? 26.224  6.555   -11.679 1.00 0.00 ? 99  TYR A C    6  
ATOM 9433  O O    . TYR A 1 2   ? 25.455  7.425   -12.096 1.00 0.00 ? 99  TYR A O    6  
ATOM 9434  C CB   . TYR A 1 2   ? 27.867  7.537   -10.062 1.00 0.00 ? 99  TYR A CB   6  
ATOM 9435  C CG   . TYR A 1 2   ? 27.064  6.884   -8.956  1.00 0.00 ? 99  TYR A CG   6  
ATOM 9436  C CD1  . TYR A 1 2   ? 27.267  5.554   -8.610  1.00 0.00 ? 99  TYR A CD1  6  
ATOM 9437  C CD2  . TYR A 1 2   ? 26.087  7.596   -8.273  1.00 0.00 ? 99  TYR A CD2  6  
ATOM 9438  C CE1  . TYR A 1 2   ? 26.523  4.954   -7.615  1.00 0.00 ? 99  TYR A CE1  6  
ATOM 9439  C CE2  . TYR A 1 2   ? 25.337  7.004   -7.275  1.00 0.00 ? 99  TYR A CE2  6  
ATOM 9440  C CZ   . TYR A 1 2   ? 25.559  5.682   -6.950  1.00 0.00 ? 99  TYR A CZ   6  
ATOM 9441  O OH   . TYR A 1 2   ? 24.819  5.088   -5.952  1.00 0.00 ? 99  TYR A OH   6  
ATOM 9442  H H    . TYR A 1 2   ? 28.055  8.646   -12.482 1.00 0.00 ? 99  TYR A H    6  
ATOM 9443  H HA   . TYR A 1 2   ? 28.233  5.920   -11.425 1.00 0.00 ? 99  TYR A HA   6  
ATOM 9444  H HB2  . TYR A 1 2   ? 28.909  7.503   -9.782  1.00 0.00 ? 99  TYR A HB2  6  
ATOM 9445  H HB3  . TYR A 1 2   ? 27.553  8.567   -10.139 1.00 0.00 ? 99  TYR A HB3  6  
ATOM 9446  H HD1  . TYR A 1 2   ? 28.023  4.988   -9.132  1.00 0.00 ? 99  TYR A HD1  6  
ATOM 9447  H HD2  . TYR A 1 2   ? 25.915  8.631   -8.531  1.00 0.00 ? 99  TYR A HD2  6  
ATOM 9448  H HE1  . TYR A 1 2   ? 26.689  3.915   -7.372  1.00 0.00 ? 99  TYR A HE1  6  
ATOM 9449  H HE2  . TYR A 1 2   ? 24.576  7.575   -6.759  1.00 0.00 ? 99  TYR A HE2  6  
ATOM 9450  H HH   . TYR A 1 2   ? 23.884  5.304   -6.074  1.00 0.00 ? 99  TYR A HH   6  
ATOM 9451  N N    . ILE A 1 3   ? 25.860  5.311   -11.443 1.00 0.00 ? 100 ILE A N    6  
ATOM 9452  C CA   . ILE A 1 3   ? 24.491  4.858   -11.569 1.00 0.00 ? 100 ILE A CA   6  
ATOM 9453  C C    . ILE A 1 3   ? 23.668  5.298   -10.365 1.00 0.00 ? 100 ILE A C    6  
ATOM 9454  O O    . ILE A 1 3   ? 23.856  4.802   -9.257  1.00 0.00 ? 100 ILE A O    6  
ATOM 9455  C CB   . ILE A 1 3   ? 24.453  3.333   -11.683 1.00 0.00 ? 100 ILE A CB   6  
ATOM 9456  C CG1  . ILE A 1 3   ? 25.165  2.894   -12.961 1.00 0.00 ? 100 ILE A CG1  6  
ATOM 9457  C CG2  . ILE A 1 3   ? 23.020  2.836   -11.656 1.00 0.00 ? 100 ILE A CG2  6  
ATOM 9458  C CD1  . ILE A 1 3   ? 25.472  1.420   -12.998 1.00 0.00 ? 100 ILE A CD1  6  
ATOM 9459  H H    . ILE A 1 3   ? 26.546  4.664   -11.170 1.00 0.00 ? 100 ILE A H    6  
ATOM 9460  H HA   . ILE A 1 3   ? 24.069  5.283   -12.469 1.00 0.00 ? 100 ILE A HA   6  
ATOM 9461  H HB   . ILE A 1 3   ? 24.971  2.918   -10.829 1.00 0.00 ? 100 ILE A HB   6  
ATOM 9462  H HG12 . ILE A 1 3   ? 24.541  3.126   -13.811 1.00 0.00 ? 100 ILE A HG12 6  
ATOM 9463  H HG13 . ILE A 1 3   ? 26.097  3.432   -13.046 1.00 0.00 ? 100 ILE A HG13 6  
ATOM 9464  H HG21 . ILE A 1 3   ? 22.559  3.136   -10.725 1.00 0.00 ? 100 ILE A HG21 6  
ATOM 9465  H HG22 . ILE A 1 3   ? 23.012  1.759   -11.729 1.00 0.00 ? 100 ILE A HG22 6  
ATOM 9466  H HG23 . ILE A 1 3   ? 22.473  3.261   -12.483 1.00 0.00 ? 100 ILE A HG23 6  
ATOM 9467  H HD11 . ILE A 1 3   ? 25.985  1.185   -13.917 1.00 0.00 ? 100 ILE A HD11 6  
ATOM 9468  H HD12 . ILE A 1 3   ? 24.552  0.860   -12.942 1.00 0.00 ? 100 ILE A HD12 6  
ATOM 9469  H HD13 . ILE A 1 3   ? 26.101  1.169   -12.158 1.00 0.00 ? 100 ILE A HD13 6  
ATOM 9470  N N    . VAL A 1 4   ? 22.749  6.215   -10.594 1.00 0.00 ? 101 VAL A N    6  
ATOM 9471  C CA   . VAL A 1 4   ? 21.985  6.812   -9.512  1.00 0.00 ? 101 VAL A CA   6  
ATOM 9472  C C    . VAL A 1 4   ? 20.573  6.242   -9.441  1.00 0.00 ? 101 VAL A C    6  
ATOM 9473  O O    . VAL A 1 4   ? 19.929  6.007   -10.467 1.00 0.00 ? 101 VAL A O    6  
ATOM 9474  C CB   . VAL A 1 4   ? 21.913  8.341   -9.666  1.00 0.00 ? 101 VAL A CB   6  
ATOM 9475  C CG1  . VAL A 1 4   ? 23.306  8.939   -9.669  1.00 0.00 ? 101 VAL A CG1  6  
ATOM 9476  C CG2  . VAL A 1 4   ? 21.164  8.719   -10.936 1.00 0.00 ? 101 VAL A CG2  6  
ATOM 9477  H H    . VAL A 1 4   ? 22.570  6.490   -11.515 1.00 0.00 ? 101 VAL A H    6  
ATOM 9478  H HA   . VAL A 1 4   ? 22.496  6.592   -8.586  1.00 0.00 ? 101 VAL A HA   6  
ATOM 9479  H HB   . VAL A 1 4   ? 21.379  8.742   -8.820  1.00 0.00 ? 101 VAL A HB   6  
ATOM 9480  H HG11 . VAL A 1 4   ? 23.797  8.708   -8.734  1.00 0.00 ? 101 VAL A HG11 6  
ATOM 9481  H HG12 . VAL A 1 4   ? 23.242  10.009  -9.787  1.00 0.00 ? 101 VAL A HG12 6  
ATOM 9482  H HG13 . VAL A 1 4   ? 23.875  8.517   -10.484 1.00 0.00 ? 101 VAL A HG13 6  
ATOM 9483  H HG21 . VAL A 1 4   ? 21.665  8.286   -11.790 1.00 0.00 ? 101 VAL A HG21 6  
ATOM 9484  H HG22 . VAL A 1 4   ? 21.140  9.792   -11.036 1.00 0.00 ? 101 VAL A HG22 6  
ATOM 9485  H HG23 . VAL A 1 4   ? 20.154  8.337   -10.884 1.00 0.00 ? 101 VAL A HG23 6  
ATOM 9486  N N    . GLN A 1 5   ? 20.108  6.006   -8.224  1.00 0.00 ? 102 GLN A N    6  
ATOM 9487  C CA   . GLN A 1 5   ? 18.772  5.470   -7.992  1.00 0.00 ? 102 GLN A CA   6  
ATOM 9488  C C    . GLN A 1 5   ? 17.893  6.521   -7.318  1.00 0.00 ? 102 GLN A C    6  
ATOM 9489  O O    . GLN A 1 5   ? 17.848  6.601   -6.091  1.00 0.00 ? 102 GLN A O    6  
ATOM 9490  C CB   . GLN A 1 5   ? 18.836  4.226   -7.095  1.00 0.00 ? 102 GLN A CB   6  
ATOM 9491  C CG   . GLN A 1 5   ? 19.306  2.941   -7.772  1.00 0.00 ? 102 GLN A CG   6  
ATOM 9492  C CD   . GLN A 1 5   ? 20.587  3.102   -8.559  1.00 0.00 ? 102 GLN A CD   6  
ATOM 9493  O OE1  . GLN A 1 5   ? 20.558  3.287   -9.774  1.00 0.00 ? 102 GLN A OE1  6  
ATOM 9494  N NE2  . GLN A 1 5   ? 21.716  3.063   -7.873  1.00 0.00 ? 102 GLN A NE2  6  
ATOM 9495  H H    . GLN A 1 5   ? 20.683  6.196   -7.451  1.00 0.00 ? 102 GLN A H    6  
ATOM 9496  H HA   . GLN A 1 5   ? 18.343  5.202   -8.945  1.00 0.00 ? 102 GLN A HA   6  
ATOM 9497  H HB2  . GLN A 1 5   ? 19.510  4.431   -6.277  1.00 0.00 ? 102 GLN A HB2  6  
ATOM 9498  H HB3  . GLN A 1 5   ? 17.850  4.049   -6.689  1.00 0.00 ? 102 GLN A HB3  6  
ATOM 9499  H HG2  . GLN A 1 5   ? 19.468  2.191   -7.011  1.00 0.00 ? 102 GLN A HG2  6  
ATOM 9500  H HG3  . GLN A 1 5   ? 18.529  2.603   -8.443  1.00 0.00 ? 102 GLN A HG3  6  
ATOM 9501  H HE21 . GLN A 1 5   ? 21.665  2.927   -6.901  1.00 0.00 ? 102 GLN A HE21 6  
ATOM 9502  H HE22 . GLN A 1 5   ? 22.559  3.191   -8.360  1.00 0.00 ? 102 GLN A HE22 6  
ATOM 9503  N N    . PRO A 1 6   ? 17.190  7.351   -8.101  1.00 0.00 ? 103 PRO A N    6  
ATOM 9504  C CA   . PRO A 1 6   ? 16.302  8.367   -7.546  1.00 0.00 ? 103 PRO A CA   6  
ATOM 9505  C C    . PRO A 1 6   ? 15.029  7.754   -6.959  1.00 0.00 ? 103 PRO A C    6  
ATOM 9506  O O    . PRO A 1 6   ? 14.937  7.536   -5.753  1.00 0.00 ? 103 PRO A O    6  
ATOM 9507  C CB   . PRO A 1 6   ? 15.991  9.272   -8.738  1.00 0.00 ? 103 PRO A CB   6  
ATOM 9508  C CG   . PRO A 1 6   ? 16.211  8.427   -9.949  1.00 0.00 ? 103 PRO A CG   6  
ATOM 9509  C CD   . PRO A 1 6   ? 17.215  7.369   -9.574  1.00 0.00 ? 103 PRO A CD   6  
ATOM 9510  H HA   . PRO A 1 6   ? 16.801  8.940   -6.778  1.00 0.00 ? 103 PRO A HA   6  
ATOM 9511  H HB2  . PRO A 1 6   ? 14.968  9.611   -8.676  1.00 0.00 ? 103 PRO A HB2  6  
ATOM 9512  H HB3  . PRO A 1 6   ? 16.657  10.122  -8.728  1.00 0.00 ? 103 PRO A HB3  6  
ATOM 9513  H HG2  . PRO A 1 6   ? 15.281  7.966   -10.246 1.00 0.00 ? 103 PRO A HG2  6  
ATOM 9514  H HG3  . PRO A 1 6   ? 16.595  9.037   -10.752 1.00 0.00 ? 103 PRO A HG3  6  
ATOM 9515  H HD2  . PRO A 1 6   ? 16.916  6.411   -9.973  1.00 0.00 ? 103 PRO A HD2  6  
ATOM 9516  H HD3  . PRO A 1 6   ? 18.196  7.638   -9.938  1.00 0.00 ? 103 PRO A HD3  6  
ATOM 9517  N N    . ASP A 1 7   ? 14.061  7.457   -7.813  1.00 0.00 ? 104 ASP A N    6  
ATOM 9518  C CA   . ASP A 1 7   ? 12.850  6.760   -7.395  1.00 0.00 ? 104 ASP A CA   6  
ATOM 9519  C C    . ASP A 1 7   ? 12.531  5.674   -8.409  1.00 0.00 ? 104 ASP A C    6  
ATOM 9520  O O    . ASP A 1 7   ? 11.810  5.916   -9.374  1.00 0.00 ? 104 ASP A O    6  
ATOM 9521  C CB   . ASP A 1 7   ? 11.654  7.719   -7.275  1.00 0.00 ? 104 ASP A CB   6  
ATOM 9522  C CG   . ASP A 1 7   ? 11.839  8.781   -6.210  1.00 0.00 ? 104 ASP A CG   6  
ATOM 9523  O OD1  . ASP A 1 7   ? 11.525  8.517   -5.029  1.00 0.00 ? 104 ASP A OD1  6  
ATOM 9524  O OD2  . ASP A 1 7   ? 12.287  9.897   -6.553  1.00 0.00 ? 104 ASP A OD2  6  
ATOM 9525  H H    . ASP A 1 7   ? 14.157  7.713   -8.755  1.00 0.00 ? 104 ASP A H    6  
ATOM 9526  H HA   . ASP A 1 7   ? 13.040  6.301   -6.435  1.00 0.00 ? 104 ASP A HA   6  
ATOM 9527  H HB2  . ASP A 1 7   ? 11.507  8.214   -8.222  1.00 0.00 ? 104 ASP A HB2  6  
ATOM 9528  H HB3  . ASP A 1 7   ? 10.770  7.147   -7.035  1.00 0.00 ? 104 ASP A HB3  6  
ATOM 9529  N N    . PRO A 1 8   ? 13.102  4.472   -8.222  1.00 0.00 ? 105 PRO A N    6  
ATOM 9530  C CA   . PRO A 1 8   ? 12.892  3.347   -9.140  1.00 0.00 ? 105 PRO A CA   6  
ATOM 9531  C C    . PRO A 1 8   ? 11.403  3.031   -9.386  1.00 0.00 ? 105 PRO A C    6  
ATOM 9532  O O    . PRO A 1 8   ? 11.006  2.833   -10.533 1.00 0.00 ? 105 PRO A O    6  
ATOM 9533  C CB   . PRO A 1 8   ? 13.621  2.177   -8.468  1.00 0.00 ? 105 PRO A CB   6  
ATOM 9534  C CG   . PRO A 1 8   ? 14.613  2.812   -7.553  1.00 0.00 ? 105 PRO A CG   6  
ATOM 9535  C CD   . PRO A 1 8   ? 14.008  4.119   -7.112  1.00 0.00 ? 105 PRO A CD   6  
ATOM 9536  H HA   . PRO A 1 8   ? 13.358  3.547   -10.096 1.00 0.00 ? 105 PRO A HA   6  
ATOM 9537  H HB2  . PRO A 1 8   ? 12.912  1.570   -7.927  1.00 0.00 ? 105 PRO A HB2  6  
ATOM 9538  H HB3  . PRO A 1 8   ? 14.111  1.577   -9.221  1.00 0.00 ? 105 PRO A HB3  6  
ATOM 9539  H HG2  . PRO A 1 8   ? 14.785  2.174   -6.699  1.00 0.00 ? 105 PRO A HG2  6  
ATOM 9540  H HG3  . PRO A 1 8   ? 15.539  2.989   -8.080  1.00 0.00 ? 105 PRO A HG3  6  
ATOM 9541  H HD2  . PRO A 1 8   ? 13.457  3.987   -6.193  1.00 0.00 ? 105 PRO A HD2  6  
ATOM 9542  H HD3  . PRO A 1 8   ? 14.776  4.868   -6.988  1.00 0.00 ? 105 PRO A HD3  6  
ATOM 9543  N N    . PRO A 1 9   ? 10.547  2.958   -8.341  1.00 0.00 ? 106 PRO A N    6  
ATOM 9544  C CA   . PRO A 1 9   ? 9.114   2.847   -8.525  1.00 0.00 ? 106 PRO A CA   6  
ATOM 9545  C C    . PRO A 1 9   ? 8.432   4.209   -8.424  1.00 0.00 ? 106 PRO A C    6  
ATOM 9546  O O    . PRO A 1 9   ? 8.266   4.758   -7.330  1.00 0.00 ? 106 PRO A O    6  
ATOM 9547  C CB   . PRO A 1 9   ? 8.692   1.939   -7.367  1.00 0.00 ? 106 PRO A CB   6  
ATOM 9548  C CG   . PRO A 1 9   ? 9.809   1.999   -6.359  1.00 0.00 ? 106 PRO A CG   6  
ATOM 9549  C CD   . PRO A 1 9   ? 10.862  2.932   -6.910  1.00 0.00 ? 106 PRO A CD   6  
ATOM 9550  H HA   . PRO A 1 9   ? 8.865   2.381   -9.467  1.00 0.00 ? 106 PRO A HA   6  
ATOM 9551  H HB2  . PRO A 1 9   ? 7.766   2.306   -6.949  1.00 0.00 ? 106 PRO A HB2  6  
ATOM 9552  H HB3  . PRO A 1 9   ? 8.548   0.934   -7.735  1.00 0.00 ? 106 PRO A HB3  6  
ATOM 9553  H HG2  . PRO A 1 9   ? 9.434   2.377   -5.421  1.00 0.00 ? 106 PRO A HG2  6  
ATOM 9554  H HG3  . PRO A 1 9   ? 10.225  1.011   -6.221  1.00 0.00 ? 106 PRO A HG3  6  
ATOM 9555  H HD2  . PRO A 1 9   ? 10.761  3.916   -6.474  1.00 0.00 ? 106 PRO A HD2  6  
ATOM 9556  H HD3  . PRO A 1 9   ? 11.850  2.538   -6.735  1.00 0.00 ? 106 PRO A HD3  6  
ATOM 9557  N N    . LEU A 1 10  ? 8.039   4.755   -9.563  1.00 0.00 ? 107 LEU A N    6  
ATOM 9558  C CA   . LEU A 1 10  ? 7.441   6.080   -9.592  1.00 0.00 ? 107 LEU A CA   6  
ATOM 9559  C C    . LEU A 1 10  ? 5.944   5.994   -9.474  1.00 0.00 ? 107 LEU A C    6  
ATOM 9560  O O    . LEU A 1 10  ? 5.375   4.901   -9.425  1.00 0.00 ? 107 LEU A O    6  
ATOM 9561  C CB   . LEU A 1 10  ? 7.707   6.810   -10.903 1.00 0.00 ? 107 LEU A CB   6  
ATOM 9562  C CG   . LEU A 1 10  ? 9.145   7.133   -11.249 1.00 0.00 ? 107 LEU A CG   6  
ATOM 9563  C CD1  . LEU A 1 10  ? 9.796   5.958   -11.957 1.00 0.00 ? 107 LEU A CD1  6  
ATOM 9564  C CD2  . LEU A 1 10  ? 9.161   8.378   -12.113 1.00 0.00 ? 107 LEU A CD2  6  
ATOM 9565  H H    . LEU A 1 10  ? 8.126   4.247   -10.397 1.00 0.00 ? 107 LEU A H    6  
ATOM 9566  H HA   . LEU A 1 10  ? 7.837   6.658   -8.771  1.00 0.00 ? 107 LEU A HA   6  
ATOM 9567  H HB2  . LEU A 1 10  ? 7.307   6.206   -11.702 1.00 0.00 ? 107 LEU A HB2  6  
ATOM 9568  H HB3  . LEU A 1 10  ? 7.155   7.739   -10.878 1.00 0.00 ? 107 LEU A HB3  6  
ATOM 9569  H HG   . LEU A 1 10  ? 9.698   7.338   -10.345 1.00 0.00 ? 107 LEU A HG   6  
ATOM 9570  H HD11 . LEU A 1 10  ? 10.801  6.222   -12.249 1.00 0.00 ? 107 LEU A HD11 6  
ATOM 9571  H HD12 . LEU A 1 10  ? 9.218   5.706   -12.834 1.00 0.00 ? 107 LEU A HD12 6  
ATOM 9572  H HD13 . LEU A 1 10  ? 9.823   5.109   -11.291 1.00 0.00 ? 107 LEU A HD13 6  
ATOM 9573  H HD21 . LEU A 1 10  ? 10.168  8.582   -12.443 1.00 0.00 ? 107 LEU A HD21 6  
ATOM 9574  H HD22 . LEU A 1 10  ? 8.787   9.213   -11.539 1.00 0.00 ? 107 LEU A HD22 6  
ATOM 9575  H HD23 . LEU A 1 10  ? 8.518   8.220   -12.969 1.00 0.00 ? 107 LEU A HD23 6  
ATOM 9576  N N    . GLU A 1 11  ? 5.329   7.171   -9.456  1.00 0.00 ? 108 GLU A N    6  
ATOM 9577  C CA   . GLU A 1 11  ? 3.902   7.309   -9.664  1.00 0.00 ? 108 GLU A CA   6  
ATOM 9578  C C    . GLU A 1 11  ? 3.108   6.362   -8.773  1.00 0.00 ? 108 GLU A C    6  
ATOM 9579  O O    . GLU A 1 11  ? 2.210   5.658   -9.236  1.00 0.00 ? 108 GLU A O    6  
ATOM 9580  C CB   . GLU A 1 11  ? 3.597   7.058   -11.138 1.00 0.00 ? 108 GLU A CB   6  
ATOM 9581  C CG   . GLU A 1 11  ? 4.017   8.194   -12.050 1.00 0.00 ? 108 GLU A CG   6  
ATOM 9582  C CD   . GLU A 1 11  ? 3.621   7.952   -13.488 1.00 0.00 ? 108 GLU A CD   6  
ATOM 9583  O OE1  . GLU A 1 11  ? 2.469   8.266   -13.855 1.00 0.00 ? 108 GLU A OE1  6  
ATOM 9584  O OE2  . GLU A 1 11  ? 4.457   7.438   -14.260 1.00 0.00 ? 108 GLU A OE2  6  
ATOM 9585  H H    . GLU A 1 11  ? 5.861   7.978   -9.292  1.00 0.00 ? 108 GLU A H    6  
ATOM 9586  H HA   . GLU A 1 11  ? 3.637   8.324   -9.424  1.00 0.00 ? 108 GLU A HA   6  
ATOM 9587  H HB2  . GLU A 1 11  ? 4.140   6.176   -11.450 1.00 0.00 ? 108 GLU A HB2  6  
ATOM 9588  H HB3  . GLU A 1 11  ? 2.539   6.889   -11.262 1.00 0.00 ? 108 GLU A HB3  6  
ATOM 9589  H HG2  . GLU A 1 11  ? 3.550   9.107   -11.712 1.00 0.00 ? 108 GLU A HG2  6  
ATOM 9590  H HG3  . GLU A 1 11  ? 5.093   8.299   -12.000 1.00 0.00 ? 108 GLU A HG3  6  
ATOM 9591  N N    . LEU A 1 12  ? 3.464   6.336   -7.497  1.00 0.00 ? 109 LEU A N    6  
ATOM 9592  C CA   . LEU A 1 12  ? 2.794   5.473   -6.540  1.00 0.00 ? 109 LEU A CA   6  
ATOM 9593  C C    . LEU A 1 12  ? 1.340   5.902   -6.383  1.00 0.00 ? 109 LEU A C    6  
ATOM 9594  O O    . LEU A 1 12  ? 1.050   6.997   -5.895  1.00 0.00 ? 109 LEU A O    6  
ATOM 9595  C CB   . LEU A 1 12  ? 3.518   5.500   -5.190  1.00 0.00 ? 109 LEU A CB   6  
ATOM 9596  C CG   . LEU A 1 12  ? 2.986   4.524   -4.137  1.00 0.00 ? 109 LEU A CG   6  
ATOM 9597  C CD1  . LEU A 1 12  ? 3.028   3.099   -4.662  1.00 0.00 ? 109 LEU A CD1  6  
ATOM 9598  C CD2  . LEU A 1 12  ? 3.794   4.633   -2.853  1.00 0.00 ? 109 LEU A CD2  6  
ATOM 9599  H H    . LEU A 1 12  ? 4.200   6.909   -7.193  1.00 0.00 ? 109 LEU A H    6  
ATOM 9600  H HA   . LEU A 1 12  ? 2.817   4.468   -6.933  1.00 0.00 ? 109 LEU A HA   6  
ATOM 9601  H HB2  . LEU A 1 12  ? 4.561   5.277   -5.363  1.00 0.00 ? 109 LEU A HB2  6  
ATOM 9602  H HB3  . LEU A 1 12  ? 3.446   6.500   -4.789  1.00 0.00 ? 109 LEU A HB3  6  
ATOM 9603  H HG   . LEU A 1 12  ? 1.958   4.769   -3.910  1.00 0.00 ? 109 LEU A HG   6  
ATOM 9604  H HD11 . LEU A 1 12  ? 2.372   3.011   -5.515  1.00 0.00 ? 109 LEU A HD11 6  
ATOM 9605  H HD12 . LEU A 1 12  ? 2.705   2.421   -3.886  1.00 0.00 ? 109 LEU A HD12 6  
ATOM 9606  H HD13 . LEU A 1 12  ? 4.037   2.855   -4.957  1.00 0.00 ? 109 LEU A HD13 6  
ATOM 9607  H HD21 . LEU A 1 12  ? 4.825   4.384   -3.055  1.00 0.00 ? 109 LEU A HD21 6  
ATOM 9608  H HD22 . LEU A 1 12  ? 3.396   3.951   -2.117  1.00 0.00 ? 109 LEU A HD22 6  
ATOM 9609  H HD23 . LEU A 1 12  ? 3.736   5.644   -2.477  1.00 0.00 ? 109 LEU A HD23 6  
ATOM 9610  N N    . ALA A 1 13  ? 0.439   5.046   -6.828  1.00 0.00 ? 110 ALA A N    6  
ATOM 9611  C CA   . ALA A 1 13  ? -0.979  5.336   -6.777  1.00 0.00 ? 110 ALA A CA   6  
ATOM 9612  C C    . ALA A 1 13  ? -1.679  4.386   -5.825  1.00 0.00 ? 110 ALA A C    6  
ATOM 9613  O O    . ALA A 1 13  ? -1.524  3.167   -5.922  1.00 0.00 ? 110 ALA A O    6  
ATOM 9614  C CB   . ALA A 1 13  ? -1.589  5.242   -8.166  1.00 0.00 ? 110 ALA A CB   6  
ATOM 9615  H H    . ALA A 1 13  ? 0.739   4.181   -7.193  1.00 0.00 ? 110 ALA A H    6  
ATOM 9616  H HA   . ALA A 1 13  ? -1.102  6.348   -6.419  1.00 0.00 ? 110 ALA A HA   6  
ATOM 9617  H HB1  . ALA A 1 13  ? -1.487  4.233   -8.537  1.00 0.00 ? 110 ALA A HB1  6  
ATOM 9618  H HB2  . ALA A 1 13  ? -1.082  5.925   -8.830  1.00 0.00 ? 110 ALA A HB2  6  
ATOM 9619  H HB3  . ALA A 1 13  ? -2.637  5.501   -8.114  1.00 0.00 ? 110 ALA A HB3  6  
ATOM 9620  N N    . VAL A 1 14  ? -2.437  4.948   -4.904  1.00 0.00 ? 111 VAL A N    6  
ATOM 9621  C CA   . VAL A 1 14  ? -3.149  4.157   -3.919  1.00 0.00 ? 111 VAL A CA   6  
ATOM 9622  C C    . VAL A 1 14  ? -4.648  4.337   -4.099  1.00 0.00 ? 111 VAL A C    6  
ATOM 9623  O O    . VAL A 1 14  ? -5.148  5.464   -4.131  1.00 0.00 ? 111 VAL A O    6  
ATOM 9624  C CB   . VAL A 1 14  ? -2.759  4.565   -2.485  1.00 0.00 ? 111 VAL A CB   6  
ATOM 9625  C CG1  . VAL A 1 14  ? -3.207  3.510   -1.489  1.00 0.00 ? 111 VAL A CG1  6  
ATOM 9626  C CG2  . VAL A 1 14  ? -1.263  4.815   -2.382  1.00 0.00 ? 111 VAL A CG2  6  
ATOM 9627  H H    . VAL A 1 14  ? -2.529  5.926   -4.890  1.00 0.00 ? 111 VAL A H    6  
ATOM 9628  H HA   . VAL A 1 14  ? -2.892  3.119   -4.068  1.00 0.00 ? 111 VAL A HA   6  
ATOM 9629  H HB   . VAL A 1 14  ? -3.271  5.484   -2.248  1.00 0.00 ? 111 VAL A HB   6  
ATOM 9630  H HG11 . VAL A 1 14  ? -2.889  3.794   -0.497  1.00 0.00 ? 111 VAL A HG11 6  
ATOM 9631  H HG12 . VAL A 1 14  ? -2.770  2.558   -1.749  1.00 0.00 ? 111 VAL A HG12 6  
ATOM 9632  H HG13 . VAL A 1 14  ? -4.283  3.431   -1.513  1.00 0.00 ? 111 VAL A HG13 6  
ATOM 9633  H HG21 . VAL A 1 14  ? -0.973  5.560   -3.108  1.00 0.00 ? 111 VAL A HG21 6  
ATOM 9634  H HG22 . VAL A 1 14  ? -0.729  3.896   -2.577  1.00 0.00 ? 111 VAL A HG22 6  
ATOM 9635  H HG23 . VAL A 1 14  ? -1.025  5.167   -1.389  1.00 0.00 ? 111 VAL A HG23 6  
ATOM 9636  N N    . GLU A 1 15  ? -5.359  3.234   -4.236  1.00 0.00 ? 112 GLU A N    6  
ATOM 9637  C CA   . GLU A 1 15  ? -6.795  3.281   -4.438  1.00 0.00 ? 112 GLU A CA   6  
ATOM 9638  C C    . GLU A 1 15  ? -7.481  2.157   -3.673  1.00 0.00 ? 112 GLU A C    6  
ATOM 9639  O O    . GLU A 1 15  ? -7.117  0.992   -3.803  1.00 0.00 ? 112 GLU A O    6  
ATOM 9640  C CB   . GLU A 1 15  ? -7.108  3.193   -5.934  1.00 0.00 ? 112 GLU A CB   6  
ATOM 9641  C CG   . GLU A 1 15  ? -8.591  3.180   -6.259  1.00 0.00 ? 112 GLU A CG   6  
ATOM 9642  C CD   . GLU A 1 15  ? -8.859  3.439   -7.727  1.00 0.00 ? 112 GLU A CD   6  
ATOM 9643  O OE1  . GLU A 1 15  ? -8.588  2.547   -8.555  1.00 0.00 ? 112 GLU A OE1  6  
ATOM 9644  O OE2  . GLU A 1 15  ? -9.332  4.545   -8.063  1.00 0.00 ? 112 GLU A OE2  6  
ATOM 9645  H H    . GLU A 1 15  ? -4.906  2.361   -4.206  1.00 0.00 ? 112 GLU A H    6  
ATOM 9646  H HA   . GLU A 1 15  ? -7.152  4.227   -4.060  1.00 0.00 ? 112 GLU A HA   6  
ATOM 9647  H HB2  . GLU A 1 15  ? -6.662  4.043   -6.431  1.00 0.00 ? 112 GLU A HB2  6  
ATOM 9648  H HB3  . GLU A 1 15  ? -6.668  2.289   -6.327  1.00 0.00 ? 112 GLU A HB3  6  
ATOM 9649  H HG2  . GLU A 1 15  ? -8.994  2.211   -6.000  1.00 0.00 ? 112 GLU A HG2  6  
ATOM 9650  H HG3  . GLU A 1 15  ? -9.083  3.942   -5.675  1.00 0.00 ? 112 GLU A HG3  6  
ATOM 9651  N N    . VAL A 1 16  ? -8.459  2.517   -2.857  1.00 0.00 ? 113 VAL A N    6  
ATOM 9652  C CA   . VAL A 1 16  ? -9.208  1.534   -2.092  1.00 0.00 ? 113 VAL A CA   6  
ATOM 9653  C C    . VAL A 1 16  ? -10.291 0.899   -2.961  1.00 0.00 ? 113 VAL A C    6  
ATOM 9654  O O    . VAL A 1 16  ? -10.999 1.591   -3.694  1.00 0.00 ? 113 VAL A O    6  
ATOM 9655  C CB   . VAL A 1 16  ? -9.832  2.159   -0.819  1.00 0.00 ? 113 VAL A CB   6  
ATOM 9656  C CG1  . VAL A 1 16  ? -10.766 3.310   -1.164  1.00 0.00 ? 113 VAL A CG1  6  
ATOM 9657  C CG2  . VAL A 1 16  ? -10.562 1.104   -0.003  1.00 0.00 ? 113 VAL A CG2  6  
ATOM 9658  H H    . VAL A 1 16  ? -8.690  3.464   -2.774  1.00 0.00 ? 113 VAL A H    6  
ATOM 9659  H HA   . VAL A 1 16  ? -8.516  0.762   -1.784  1.00 0.00 ? 113 VAL A HA   6  
ATOM 9660  H HB   . VAL A 1 16  ? -9.031  2.555   -0.212  1.00 0.00 ? 113 VAL A HB   6  
ATOM 9661  H HG11 . VAL A 1 16  ? -11.198 3.708   -0.259  1.00 0.00 ? 113 VAL A HG11 6  
ATOM 9662  H HG12 . VAL A 1 16  ? -11.553 2.950   -1.811  1.00 0.00 ? 113 VAL A HG12 6  
ATOM 9663  H HG13 . VAL A 1 16  ? -10.211 4.085   -1.671  1.00 0.00 ? 113 VAL A HG13 6  
ATOM 9664  H HG21 . VAL A 1 16  ? -11.353 0.674   -0.597  1.00 0.00 ? 113 VAL A HG21 6  
ATOM 9665  H HG22 . VAL A 1 16  ? -10.982 1.559   0.882   1.00 0.00 ? 113 VAL A HG22 6  
ATOM 9666  H HG23 . VAL A 1 16  ? -9.867  0.329   0.287   1.00 0.00 ? 113 VAL A HG23 6  
ATOM 9667  N N    . LYS A 1 17  ? -10.395 -0.420  -2.902  1.00 0.00 ? 114 LYS A N    6  
ATOM 9668  C CA   . LYS A 1 17  ? -11.376 -1.139  -3.696  1.00 0.00 ? 114 LYS A CA   6  
ATOM 9669  C C    . LYS A 1 17  ? -12.270 -2.000  -2.814  1.00 0.00 ? 114 LYS A C    6  
ATOM 9670  O O    . LYS A 1 17  ? -11.804 -2.907  -2.118  1.00 0.00 ? 114 LYS A O    6  
ATOM 9671  C CB   . LYS A 1 17  ? -10.682 -1.984  -4.769  1.00 0.00 ? 114 LYS A CB   6  
ATOM 9672  C CG   . LYS A 1 17  ? -10.148 -1.153  -5.929  1.00 0.00 ? 114 LYS A CG   6  
ATOM 9673  C CD   . LYS A 1 17  ? -11.288 -0.573  -6.754  1.00 0.00 ? 114 LYS A CD   6  
ATOM 9674  C CE   . LYS A 1 17  ? -10.840 0.589   -7.619  1.00 0.00 ? 114 LYS A CE   6  
ATOM 9675  N NZ   . LYS A 1 17  ? -9.826  0.193   -8.629  1.00 0.00 ? 114 LYS A NZ   6  
ATOM 9676  H H    . LYS A 1 17  ? -9.797  -0.926  -2.303  1.00 0.00 ? 114 LYS A H    6  
ATOM 9677  H HA   . LYS A 1 17  ? -11.993 -0.400  -4.185  1.00 0.00 ? 114 LYS A HA   6  
ATOM 9678  H HB2  . LYS A 1 17  ? -9.855  -2.513  -4.317  1.00 0.00 ? 114 LYS A HB2  6  
ATOM 9679  H HB3  . LYS A 1 17  ? -11.388 -2.701  -5.161  1.00 0.00 ? 114 LYS A HB3  6  
ATOM 9680  H HG2  . LYS A 1 17  ? -9.551  -0.344  -5.536  1.00 0.00 ? 114 LYS A HG2  6  
ATOM 9681  H HG3  . LYS A 1 17  ? -9.539  -1.781  -6.562  1.00 0.00 ? 114 LYS A HG3  6  
ATOM 9682  H HD2  . LYS A 1 17  ? -11.681 -1.346  -7.394  1.00 0.00 ? 114 LYS A HD2  6  
ATOM 9683  H HD3  . LYS A 1 17  ? -12.062 -0.231  -6.086  1.00 0.00 ? 114 LYS A HD3  6  
ATOM 9684  H HE2  . LYS A 1 17  ? -11.703 0.990   -8.130  1.00 0.00 ? 114 LYS A HE2  6  
ATOM 9685  H HE3  . LYS A 1 17  ? -10.421 1.351   -6.980  1.00 0.00 ? 114 LYS A HE3  6  
ATOM 9686  H HZ1  . LYS A 1 17  ? -9.130  -0.453  -8.209  1.00 0.00 ? 114 LYS A HZ1  6  
ATOM 9687  H HZ2  . LYS A 1 17  ? -9.329  1.043   -8.983  1.00 0.00 ? 114 LYS A HZ2  6  
ATOM 9688  H HZ3  . LYS A 1 17  ? -10.285 -0.283  -9.430  1.00 0.00 ? 114 LYS A HZ3  6  
ATOM 9689  N N    . GLN A 1 18  ? -13.553 -1.682  -2.836  1.00 0.00 ? 115 GLN A N    6  
ATOM 9690  C CA   . GLN A 1 18  ? -14.556 -2.413  -2.077  1.00 0.00 ? 115 GLN A CA   6  
ATOM 9691  C C    . GLN A 1 18  ? -15.424 -3.230  -3.034  1.00 0.00 ? 115 GLN A C    6  
ATOM 9692  O O    . GLN A 1 18  ? -16.320 -2.687  -3.683  1.00 0.00 ? 115 GLN A O    6  
ATOM 9693  C CB   . GLN A 1 18  ? -15.427 -1.431  -1.290  1.00 0.00 ? 115 GLN A CB   6  
ATOM 9694  C CG   . GLN A 1 18  ? -14.643 -0.531  -0.349  1.00 0.00 ? 115 GLN A CG   6  
ATOM 9695  C CD   . GLN A 1 18  ? -15.532 0.434   0.411   1.00 0.00 ? 115 GLN A CD   6  
ATOM 9696  O OE1  . GLN A 1 18  ? -15.767 1.561   -0.029  1.00 0.00 ? 115 GLN A OE1  6  
ATOM 9697  N NE2  . GLN A 1 18  ? -16.041 -0.003  1.550   1.00 0.00 ? 115 GLN A NE2  6  
ATOM 9698  H H    . GLN A 1 18  ? -13.842 -0.923  -3.387  1.00 0.00 ? 115 GLN A H    6  
ATOM 9699  H HA   . GLN A 1 18  ? -14.051 -3.077  -1.393  1.00 0.00 ? 115 GLN A HA   6  
ATOM 9700  H HB2  . GLN A 1 18  ? -15.964 -0.804  -1.988  1.00 0.00 ? 115 GLN A HB2  6  
ATOM 9701  H HB3  . GLN A 1 18  ? -16.140 -1.992  -0.706  1.00 0.00 ? 115 GLN A HB3  6  
ATOM 9702  H HG2  . GLN A 1 18  ? -14.116 -1.145  0.364   1.00 0.00 ? 115 GLN A HG2  6  
ATOM 9703  H HG3  . GLN A 1 18  ? -13.931 0.040   -0.927  1.00 0.00 ? 115 GLN A HG3  6  
ATOM 9704  H HE21 . GLN A 1 18  ? -15.822 -0.914  1.839   1.00 0.00 ? 115 GLN A HE21 6  
ATOM 9705  H HE22 . GLN A 1 18  ? -16.621 0.606   2.064   1.00 0.00 ? 115 GLN A HE22 6  
ATOM 9706  N N    . PRO A 1 19  ? -15.142 -4.539  -3.164  1.00 0.00 ? 116 PRO A N    6  
ATOM 9707  C CA   . PRO A 1 19  ? -15.874 -5.422  -4.079  1.00 0.00 ? 116 PRO A CA   6  
ATOM 9708  C C    . PRO A 1 19  ? -17.322 -5.650  -3.645  1.00 0.00 ? 116 PRO A C    6  
ATOM 9709  O O    . PRO A 1 19  ? -18.227 -4.955  -4.113  1.00 0.00 ? 116 PRO A O    6  
ATOM 9710  C CB   . PRO A 1 19  ? -15.073 -6.735  -4.052  1.00 0.00 ? 116 PRO A CB   6  
ATOM 9711  C CG   . PRO A 1 19  ? -13.779 -6.392  -3.390  1.00 0.00 ? 116 PRO A CG   6  
ATOM 9712  C CD   . PRO A 1 19  ? -14.082 -5.262  -2.452  1.00 0.00 ? 116 PRO A CD   6  
ATOM 9713  H HA   . PRO A 1 19  ? -15.871 -5.022  -5.083  1.00 0.00 ? 116 PRO A HA   6  
ATOM 9714  H HB2  . PRO A 1 19  ? -15.617 -7.481  -3.494  1.00 0.00 ? 116 PRO A HB2  6  
ATOM 9715  H HB3  . PRO A 1 19  ? -14.916 -7.082  -5.063  1.00 0.00 ? 116 PRO A HB3  6  
ATOM 9716  H HG2  . PRO A 1 19  ? -13.408 -7.245  -2.841  1.00 0.00 ? 116 PRO A HG2  6  
ATOM 9717  H HG3  . PRO A 1 19  ? -13.059 -6.081  -4.133  1.00 0.00 ? 116 PRO A HG3  6  
ATOM 9718  H HD2  . PRO A 1 19  ? -14.435 -5.638  -1.503  1.00 0.00 ? 116 PRO A HD2  6  
ATOM 9719  H HD3  . PRO A 1 19  ? -13.210 -4.639  -2.319  1.00 0.00 ? 116 PRO A HD3  6  
ATOM 9720  N N    . GLU A 1 20  ? -17.541 -6.605  -2.739  1.00 0.00 ? 117 GLU A N    6  
ATOM 9721  C CA   . GLU A 1 20  ? -18.880 -6.915  -2.261  1.00 0.00 ? 117 GLU A CA   6  
ATOM 9722  C C    . GLU A 1 20  ? -18.826 -7.959  -1.149  1.00 0.00 ? 117 GLU A C    6  
ATOM 9723  O O    . GLU A 1 20  ? -18.960 -7.630  0.028   1.00 0.00 ? 117 GLU A O    6  
ATOM 9724  C CB   . GLU A 1 20  ? -19.756 -7.415  -3.412  1.00 0.00 ? 117 GLU A CB   6  
ATOM 9725  C CG   . GLU A 1 20  ? -21.219 -7.522  -3.043  1.00 0.00 ? 117 GLU A CG   6  
ATOM 9726  C CD   . GLU A 1 20  ? -21.765 -6.217  -2.514  1.00 0.00 ? 117 GLU A CD   6  
ATOM 9727  O OE1  . GLU A 1 20  ? -21.926 -5.266  -3.308  1.00 0.00 ? 117 GLU A OE1  6  
ATOM 9728  O OE2  . GLU A 1 20  ? -22.020 -6.129  -1.296  1.00 0.00 ? 117 GLU A OE2  6  
ATOM 9729  H H    . GLU A 1 20  ? -16.785 -7.110  -2.381  1.00 0.00 ? 117 GLU A H    6  
ATOM 9730  H HA   . GLU A 1 20  ? -19.307 -6.007  -1.864  1.00 0.00 ? 117 GLU A HA   6  
ATOM 9731  H HB2  . GLU A 1 20  ? -19.664 -6.733  -4.244  1.00 0.00 ? 117 GLU A HB2  6  
ATOM 9732  H HB3  . GLU A 1 20  ? -19.412 -8.391  -3.718  1.00 0.00 ? 117 GLU A HB3  6  
ATOM 9733  H HG2  . GLU A 1 20  ? -21.781 -7.805  -3.919  1.00 0.00 ? 117 GLU A HG2  6  
ATOM 9734  H HG3  . GLU A 1 20  ? -21.327 -8.279  -2.282  1.00 0.00 ? 117 GLU A HG3  6  
ATOM 9735  N N    . ASP A 1 21  ? -18.634 -9.215  -1.527  1.00 0.00 ? 118 ASP A N    6  
ATOM 9736  C CA   . ASP A 1 21  ? -18.489 -10.293 -0.556  1.00 0.00 ? 118 ASP A CA   6  
ATOM 9737  C C    . ASP A 1 21  ? -17.032 -10.411 -0.148  1.00 0.00 ? 118 ASP A C    6  
ATOM 9738  O O    . ASP A 1 21  ? -16.712 -10.716 1.002   1.00 0.00 ? 118 ASP A O    6  
ATOM 9739  C CB   . ASP A 1 21  ? -18.986 -11.618 -1.135  1.00 0.00 ? 118 ASP A CB   6  
ATOM 9740  C CG   . ASP A 1 21  ? -18.809 -12.776 -0.172  1.00 0.00 ? 118 ASP A CG   6  
ATOM 9741  O OD1  . ASP A 1 21  ? -19.541 -12.834 0.839   1.00 0.00 ? 118 ASP A OD1  6  
ATOM 9742  O OD2  . ASP A 1 21  ? -17.937 -13.638 -0.421  1.00 0.00 ? 118 ASP A OD2  6  
ATOM 9743  H H    . ASP A 1 21  ? -18.588 -9.425  -2.486  1.00 0.00 ? 118 ASP A H    6  
ATOM 9744  H HA   . ASP A 1 21  ? -19.077 -10.040 0.314   1.00 0.00 ? 118 ASP A HA   6  
ATOM 9745  H HB2  . ASP A 1 21  ? -20.036 -11.529 -1.372  1.00 0.00 ? 118 ASP A HB2  6  
ATOM 9746  H HB3  . ASP A 1 21  ? -18.435 -11.837 -2.038  1.00 0.00 ? 118 ASP A HB3  6  
ATOM 9747  N N    . ARG A 1 22  ? -16.156 -10.156 -1.109  1.00 0.00 ? 119 ARG A N    6  
ATOM 9748  C CA   . ARG A 1 22  ? -14.726 -10.094 -0.849  1.00 0.00 ? 119 ARG A CA   6  
ATOM 9749  C C    . ARG A 1 22  ? -14.437 -8.890  0.035   1.00 0.00 ? 119 ARG A C    6  
ATOM 9750  O O    . ARG A 1 22  ? -14.975 -7.803  -0.197  1.00 0.00 ? 119 ARG A O    6  
ATOM 9751  C CB   . ARG A 1 22  ? -13.951 -9.959  -2.160  1.00 0.00 ? 119 ARG A CB   6  
ATOM 9752  C CG   . ARG A 1 22  ? -14.232 -11.058 -3.172  1.00 0.00 ? 119 ARG A CG   6  
ATOM 9753  C CD   . ARG A 1 22  ? -13.593 -10.734 -4.512  1.00 0.00 ? 119 ARG A CD   6  
ATOM 9754  N NE   . ARG A 1 22  ? -14.009 -11.656 -5.568  1.00 0.00 ? 119 ARG A NE   6  
ATOM 9755  C CZ   . ARG A 1 22  ? -13.811 -11.431 -6.868  1.00 0.00 ? 119 ARG A CZ   6  
ATOM 9756  N NH1  . ARG A 1 22  ? -13.178 -10.335 -7.266  1.00 0.00 ? 119 ARG A NH1  6  
ATOM 9757  N NH2  . ARG A 1 22  ? -14.233 -12.309 -7.768  1.00 0.00 ? 119 ARG A NH2  6  
ATOM 9758  H H    . ARG A 1 22  ? -16.483 -9.998  -2.021  1.00 0.00 ? 119 ARG A H    6  
ATOM 9759  H HA   . ARG A 1 22  ? -14.428 -10.997 -0.340  1.00 0.00 ? 119 ARG A HA   6  
ATOM 9760  H HB2  . ARG A 1 22  ? -14.205 -9.015  -2.615  1.00 0.00 ? 119 ARG A HB2  6  
ATOM 9761  H HB3  . ARG A 1 22  ? -12.893 -9.966  -1.938  1.00 0.00 ? 119 ARG A HB3  6  
ATOM 9762  H HG2  . ARG A 1 22  ? -13.825 -11.988 -2.802  1.00 0.00 ? 119 ARG A HG2  6  
ATOM 9763  H HG3  . ARG A 1 22  ? -15.298 -11.154 -3.301  1.00 0.00 ? 119 ARG A HG3  6  
ATOM 9764  H HD2  . ARG A 1 22  ? -13.874 -9.731  -4.796  1.00 0.00 ? 119 ARG A HD2  6  
ATOM 9765  H HD3  . ARG A 1 22  ? -12.519 -10.788 -4.405  1.00 0.00 ? 119 ARG A HD3  6  
ATOM 9766  H HE   . ARG A 1 22  ? -14.462 -12.485 -5.291  1.00 0.00 ? 119 ARG A HE   6  
ATOM 9767  H HH11 . ARG A 1 22  ? -12.844 -9.672  -6.592  1.00 0.00 ? 119 ARG A HH11 6  
ATOM 9768  H HH12 . ARG A 1 22  ? -13.025 -10.169 -8.244  1.00 0.00 ? 119 ARG A HH12 6  
ATOM 9769  H HH21 . ARG A 1 22  ? -14.702 -13.146 -7.475  1.00 0.00 ? 119 ARG A HH21 6  
ATOM 9770  H HH22 . ARG A 1 22  ? -14.086 -12.140 -8.746  1.00 0.00 ? 119 ARG A HH22 6  
ATOM 9771  N N    . LYS A 1 23  ? -13.614 -9.091  1.055   1.00 0.00 ? 120 LYS A N    6  
ATOM 9772  C CA   . LYS A 1 23  ? -13.260 -8.022  1.982   1.00 0.00 ? 120 LYS A CA   6  
ATOM 9773  C C    . LYS A 1 23  ? -12.619 -6.852  1.247   1.00 0.00 ? 120 LYS A C    6  
ATOM 9774  O O    . LYS A 1 23  ? -11.765 -7.047  0.381   1.00 0.00 ? 120 LYS A O    6  
ATOM 9775  C CB   . LYS A 1 23  ? -12.301 -8.542  3.053   1.00 0.00 ? 120 LYS A CB   6  
ATOM 9776  C CG   . LYS A 1 23  ? -12.903 -9.619  3.938   1.00 0.00 ? 120 LYS A CG   6  
ATOM 9777  C CD   . LYS A 1 23  ? -14.141 -9.119  4.665   1.00 0.00 ? 120 LYS A CD   6  
ATOM 9778  C CE   . LYS A 1 23  ? -14.692 -10.173 5.608   1.00 0.00 ? 120 LYS A CE   6  
ATOM 9779  N NZ   . LYS A 1 23  ? -13.757 -10.461 6.729   1.00 0.00 ? 120 LYS A NZ   6  
ATOM 9780  H H    . LYS A 1 23  ? -13.230 -9.986  1.190   1.00 0.00 ? 120 LYS A H    6  
ATOM 9781  H HA   . LYS A 1 23  ? -14.166 -7.683  2.455   1.00 0.00 ? 120 LYS A HA   6  
ATOM 9782  H HB2  . LYS A 1 23  ? -11.426 -8.952  2.570   1.00 0.00 ? 120 LYS A HB2  6  
ATOM 9783  H HB3  . LYS A 1 23  ? -12.002 -7.717  3.682   1.00 0.00 ? 120 LYS A HB3  6  
ATOM 9784  H HG2  . LYS A 1 23  ? -13.176 -10.464 3.326   1.00 0.00 ? 120 LYS A HG2  6  
ATOM 9785  H HG3  . LYS A 1 23  ? -12.168 -9.923  4.667   1.00 0.00 ? 120 LYS A HG3  6  
ATOM 9786  H HD2  . LYS A 1 23  ? -13.881 -8.240  5.235   1.00 0.00 ? 120 LYS A HD2  6  
ATOM 9787  H HD3  . LYS A 1 23  ? -14.898 -8.868  3.937   1.00 0.00 ? 120 LYS A HD3  6  
ATOM 9788  H HE2  . LYS A 1 23  ? -15.628 -9.822  6.012   1.00 0.00 ? 120 LYS A HE2  6  
ATOM 9789  H HE3  . LYS A 1 23  ? -14.859 -11.080 5.046   1.00 0.00 ? 120 LYS A HE3  6  
ATOM 9790  H HZ1  . LYS A 1 23  ? -12.832 -10.758 6.360   1.00 0.00 ? 120 LYS A HZ1  6  
ATOM 9791  H HZ2  . LYS A 1 23  ? -14.139 -11.222 7.327   1.00 0.00 ? 120 LYS A HZ2  6  
ATOM 9792  H HZ3  . LYS A 1 23  ? -13.627 -9.612  7.317   1.00 0.00 ? 120 LYS A HZ3  6  
ATOM 9793  N N    . PRO A 1 24  ? -13.041 -5.620  1.577   1.00 0.00 ? 121 PRO A N    6  
ATOM 9794  C CA   . PRO A 1 24  ? -12.485 -4.408  0.976   1.00 0.00 ? 121 PRO A CA   6  
ATOM 9795  C C    . PRO A 1 24  ? -10.999 -4.265  1.287   1.00 0.00 ? 121 PRO A C    6  
ATOM 9796  O O    . PRO A 1 24  ? -10.559 -4.555  2.402   1.00 0.00 ? 121 PRO A O    6  
ATOM 9797  C CB   . PRO A 1 24  ? -13.292 -3.276  1.620   1.00 0.00 ? 121 PRO A CB   6  
ATOM 9798  C CG   . PRO A 1 24  ? -13.857 -3.861  2.867   1.00 0.00 ? 121 PRO A CG   6  
ATOM 9799  C CD   . PRO A 1 24  ? -14.089 -5.314  2.567   1.00 0.00 ? 121 PRO A CD   6  
ATOM 9800  H HA   . PRO A 1 24  ? -12.628 -4.396  -0.094  1.00 0.00 ? 121 PRO A HA   6  
ATOM 9801  H HB2  . PRO A 1 24  ? -12.641 -2.441  1.834   1.00 0.00 ? 121 PRO A HB2  6  
ATOM 9802  H HB3  . PRO A 1 24  ? -14.075 -2.964  0.944   1.00 0.00 ? 121 PRO A HB3  6  
ATOM 9803  H HG2  . PRO A 1 24  ? -13.151 -3.753  3.677   1.00 0.00 ? 121 PRO A HG2  6  
ATOM 9804  H HG3  . PRO A 1 24  ? -14.790 -3.376  3.112   1.00 0.00 ? 121 PRO A HG3  6  
ATOM 9805  H HD2  . PRO A 1 24  ? -13.964 -5.909  3.460   1.00 0.00 ? 121 PRO A HD2  6  
ATOM 9806  H HD3  . PRO A 1 24  ? -15.072 -5.461  2.146   1.00 0.00 ? 121 PRO A HD3  6  
ATOM 9807  N N    . TYR A 1 25  ? -10.234 -3.819  0.304   1.00 0.00 ? 122 TYR A N    6  
ATOM 9808  C CA   . TYR A 1 25  ? -8.786  -3.785  0.427   1.00 0.00 ? 122 TYR A CA   6  
ATOM 9809  C C    . TYR A 1 25  ? -8.194  -2.569  -0.267  1.00 0.00 ? 122 TYR A C    6  
ATOM 9810  O O    . TYR A 1 25  ? -8.805  -1.991  -1.171  1.00 0.00 ? 122 TYR A O    6  
ATOM 9811  C CB   . TYR A 1 25  ? -8.184  -5.068  -0.164  1.00 0.00 ? 122 TYR A CB   6  
ATOM 9812  C CG   . TYR A 1 25  ? -8.630  -5.373  -1.581  1.00 0.00 ? 122 TYR A CG   6  
ATOM 9813  C CD1  . TYR A 1 25  ? -9.859  -5.971  -1.823  1.00 0.00 ? 122 TYR A CD1  6  
ATOM 9814  C CD2  . TYR A 1 25  ? -7.829  -5.065  -2.672  1.00 0.00 ? 122 TYR A CD2  6  
ATOM 9815  C CE1  . TYR A 1 25  ? -10.276 -6.255  -3.106  1.00 0.00 ? 122 TYR A CE1  6  
ATOM 9816  C CE2  . TYR A 1 25  ? -8.241  -5.348  -3.961  1.00 0.00 ? 122 TYR A CE2  6  
ATOM 9817  C CZ   . TYR A 1 25  ? -9.464  -5.941  -4.171  1.00 0.00 ? 122 TYR A CZ   6  
ATOM 9818  O OH   . TYR A 1 25  ? -9.877  -6.230  -5.452  1.00 0.00 ? 122 TYR A OH   6  
ATOM 9819  H H    . TYR A 1 25  ? -10.651 -3.503  -0.528  1.00 0.00 ? 122 TYR A H    6  
ATOM 9820  H HA   . TYR A 1 25  ? -8.543  -3.739  1.477   1.00 0.00 ? 122 TYR A HA   6  
ATOM 9821  H HB2  . TYR A 1 25  ? -7.107  -4.982  -0.170  1.00 0.00 ? 122 TYR A HB2  6  
ATOM 9822  H HB3  . TYR A 1 25  ? -8.466  -5.904  0.456   1.00 0.00 ? 122 TYR A HB3  6  
ATOM 9823  H HD1  . TYR A 1 25  ? -10.496 -6.216  -0.986  1.00 0.00 ? 122 TYR A HD1  6  
ATOM 9824  H HD2  . TYR A 1 25  ? -6.866  -4.604  -2.505  1.00 0.00 ? 122 TYR A HD2  6  
ATOM 9825  H HE1  . TYR A 1 25  ? -11.236 -6.721  -3.269  1.00 0.00 ? 122 TYR A HE1  6  
ATOM 9826  H HE2  . TYR A 1 25  ? -7.605  -5.101  -4.796  1.00 0.00 ? 122 TYR A HE2  6  
ATOM 9827  H HH   . TYR A 1 25  ? -9.140  -6.625  -5.941  1.00 0.00 ? 122 TYR A HH   6  
ATOM 9828  N N    . LEU A 1 26  ? -7.013  -2.173  0.182   1.00 0.00 ? 123 LEU A N    6  
ATOM 9829  C CA   . LEU A 1 26  ? -6.258  -1.128  -0.487  1.00 0.00 ? 123 LEU A CA   6  
ATOM 9830  C C    . LEU A 1 26  ? -5.484  -1.715  -1.643  1.00 0.00 ? 123 LEU A C    6  
ATOM 9831  O O    . LEU A 1 26  ? -4.795  -2.723  -1.492  1.00 0.00 ? 123 LEU A O    6  
ATOM 9832  C CB   . LEU A 1 26  ? -5.285  -0.428  0.462   1.00 0.00 ? 123 LEU A CB   6  
ATOM 9833  C CG   . LEU A 1 26  ? -5.760  0.912   1.020   1.00 0.00 ? 123 LEU A CG   6  
ATOM 9834  C CD1  . LEU A 1 26  ? -4.696  1.516   1.924   1.00 0.00 ? 123 LEU A CD1  6  
ATOM 9835  C CD2  . LEU A 1 26  ? -6.107  1.871   -0.107  1.00 0.00 ? 123 LEU A CD2  6  
ATOM 9836  H H    . LEU A 1 26  ? -6.639  -2.600  0.984   1.00 0.00 ? 123 LEU A H    6  
ATOM 9837  H HA   . LEU A 1 26  ? -6.961  -0.406  -0.870  1.00 0.00 ? 123 LEU A HA   6  
ATOM 9838  H HB2  . LEU A 1 26  ? -5.087  -1.088  1.291   1.00 0.00 ? 123 LEU A HB2  6  
ATOM 9839  H HB3  . LEU A 1 26  ? -4.360  -0.260  -0.069  1.00 0.00 ? 123 LEU A HB3  6  
ATOM 9840  H HG   . LEU A 1 26  ? -6.649  0.751   1.607   1.00 0.00 ? 123 LEU A HG   6  
ATOM 9841  H HD11 . LEU A 1 26  ? -4.529  0.865   2.769   1.00 0.00 ? 123 LEU A HD11 6  
ATOM 9842  H HD12 . LEU A 1 26  ? -5.025  2.482   2.272   1.00 0.00 ? 123 LEU A HD12 6  
ATOM 9843  H HD13 . LEU A 1 26  ? -3.775  1.628   1.370   1.00 0.00 ? 123 LEU A HD13 6  
ATOM 9844  H HD21 . LEU A 1 26  ? -5.282  1.924   -0.800  1.00 0.00 ? 123 LEU A HD21 6  
ATOM 9845  H HD22 . LEU A 1 26  ? -6.300  2.852   0.301   1.00 0.00 ? 123 LEU A HD22 6  
ATOM 9846  H HD23 . LEU A 1 26  ? -6.987  1.520   -0.621  1.00 0.00 ? 123 LEU A HD23 6  
ATOM 9847  N N    . TRP A 1 27  ? -5.609  -1.085  -2.786  1.00 0.00 ? 124 TRP A N    6  
ATOM 9848  C CA   . TRP A 1 27  ? -4.903  -1.509  -3.973  1.00 0.00 ? 124 TRP A CA   6  
ATOM 9849  C C    . TRP A 1 27  ? -3.789  -0.518  -4.290  1.00 0.00 ? 124 TRP A C    6  
ATOM 9850  O O    . TRP A 1 27  ? -4.043  0.607   -4.722  1.00 0.00 ? 124 TRP A O    6  
ATOM 9851  C CB   . TRP A 1 27  ? -5.885  -1.641  -5.138  1.00 0.00 ? 124 TRP A CB   6  
ATOM 9852  C CG   . TRP A 1 27  ? -5.239  -1.933  -6.452  1.00 0.00 ? 124 TRP A CG   6  
ATOM 9853  C CD1  . TRP A 1 27  ? -4.221  -2.809  -6.698  1.00 0.00 ? 124 TRP A CD1  6  
ATOM 9854  C CD2  . TRP A 1 27  ? -5.583  -1.349  -7.710  1.00 0.00 ? 124 TRP A CD2  6  
ATOM 9855  N NE1  . TRP A 1 27  ? -3.908  -2.797  -8.036  1.00 0.00 ? 124 TRP A NE1  6  
ATOM 9856  C CE2  . TRP A 1 27  ? -4.727  -1.906  -8.676  1.00 0.00 ? 124 TRP A CE2  6  
ATOM 9857  C CE3  . TRP A 1 27  ? -6.531  -0.404  -8.111  1.00 0.00 ? 124 TRP A CE3  6  
ATOM 9858  C CZ2  . TRP A 1 27  ? -4.792  -1.550  -10.019 1.00 0.00 ? 124 TRP A CZ2  6  
ATOM 9859  C CZ3  . TRP A 1 27  ? -6.595  -0.053  -9.446  1.00 0.00 ? 124 TRP A CZ3  6  
ATOM 9860  C CH2  . TRP A 1 27  ? -5.729  -0.624  -10.384 1.00 0.00 ? 124 TRP A CH2  6  
ATOM 9861  H H    . TRP A 1 27  ? -6.196  -0.297  -2.836  1.00 0.00 ? 124 TRP A H    6  
ATOM 9862  H HA   . TRP A 1 27  ? -4.463  -2.475  -3.771  1.00 0.00 ? 124 TRP A HA   6  
ATOM 9863  H HB2  . TRP A 1 27  ? -6.577  -2.442  -4.926  1.00 0.00 ? 124 TRP A HB2  6  
ATOM 9864  H HB3  . TRP A 1 27  ? -6.437  -0.716  -5.237  1.00 0.00 ? 124 TRP A HB3  6  
ATOM 9865  H HD1  . TRP A 1 27  ? -3.743  -3.419  -5.940  1.00 0.00 ? 124 TRP A HD1  6  
ATOM 9866  H HE1  . TRP A 1 27  ? -3.207  -3.335  -8.464  1.00 0.00 ? 124 TRP A HE1  6  
ATOM 9867  H HE3  . TRP A 1 27  ? -7.213  0.044   -7.400  1.00 0.00 ? 124 TRP A HE3  6  
ATOM 9868  H HZ2  . TRP A 1 27  ? -4.131  -1.977  -10.756 1.00 0.00 ? 124 TRP A HZ2  6  
ATOM 9869  H HZ3  . TRP A 1 27  ? -7.319  0.676   -9.776  1.00 0.00 ? 124 TRP A HZ3  6  
ATOM 9870  H HH2  . TRP A 1 27  ? -5.813  -0.319  -11.414 1.00 0.00 ? 124 TRP A HH2  6  
ATOM 9871  N N    . ILE A 1 28  ? -2.560  -0.937  -4.036  1.00 0.00 ? 125 ILE A N    6  
ATOM 9872  C CA   . ILE A 1 28  ? -1.402  -0.091  -4.266  1.00 0.00 ? 125 ILE A CA   6  
ATOM 9873  C C    . ILE A 1 28  ? -0.728  -0.485  -5.571  1.00 0.00 ? 125 ILE A C    6  
ATOM 9874  O O    . ILE A 1 28  ? -0.484  -1.667  -5.812  1.00 0.00 ? 125 ILE A O    6  
ATOM 9875  C CB   . ILE A 1 28  ? -0.359  -0.196  -3.122  1.00 0.00 ? 125 ILE A CB   6  
ATOM 9876  C CG1  . ILE A 1 28  ? -1.012  -0.030  -1.747  1.00 0.00 ? 125 ILE A CG1  6  
ATOM 9877  C CG2  . ILE A 1 28  ? 0.737   0.841   -3.302  1.00 0.00 ? 125 ILE A CG2  6  
ATOM 9878  C CD1  . ILE A 1 28  ? -1.505  -1.329  -1.149  1.00 0.00 ? 125 ILE A CD1  6  
ATOM 9879  H H    . ILE A 1 28  ? -2.425  -1.847  -3.691  1.00 0.00 ? 125 ILE A H    6  
ATOM 9880  H HA   . ILE A 1 28  ? -1.738  0.934   -4.334  1.00 0.00 ? 125 ILE A HA   6  
ATOM 9881  H HB   . ILE A 1 28  ? 0.097   -1.174  -3.177  1.00 0.00 ? 125 ILE A HB   6  
ATOM 9882  H HG12 . ILE A 1 28  ? -0.293  0.397   -1.063  1.00 0.00 ? 125 ILE A HG12 6  
ATOM 9883  H HG13 . ILE A 1 28  ? -1.856  0.637   -1.836  1.00 0.00 ? 125 ILE A HG13 6  
ATOM 9884  H HG21 . ILE A 1 28  ? 1.462   0.739   -2.508  1.00 0.00 ? 125 ILE A HG21 6  
ATOM 9885  H HG22 . ILE A 1 28  ? 0.305   1.830   -3.271  1.00 0.00 ? 125 ILE A HG22 6  
ATOM 9886  H HG23 . ILE A 1 28  ? 1.221   0.689   -4.254  1.00 0.00 ? 125 ILE A HG23 6  
ATOM 9887  H HD11 . ILE A 1 28  ? -0.685  -2.031  -1.091  1.00 0.00 ? 125 ILE A HD11 6  
ATOM 9888  H HD12 . ILE A 1 28  ? -2.285  -1.740  -1.773  1.00 0.00 ? 125 ILE A HD12 6  
ATOM 9889  H HD13 . ILE A 1 28  ? -1.894  -1.146  -0.158  1.00 0.00 ? 125 ILE A HD13 6  
ATOM 9890  N N    . LYS A 1 29  ? -0.442  0.496   -6.409  1.00 0.00 ? 126 LYS A N    6  
ATOM 9891  C CA   . LYS A 1 29  ? 0.267   0.245   -7.653  1.00 0.00 ? 126 LYS A CA   6  
ATOM 9892  C C    . LYS A 1 29  ? 1.298   1.334   -7.910  1.00 0.00 ? 126 LYS A C    6  
ATOM 9893  O O    . LYS A 1 29  ? 1.183   2.446   -7.401  1.00 0.00 ? 126 LYS A O    6  
ATOM 9894  C CB   . LYS A 1 29  ? -0.703  0.141   -8.828  1.00 0.00 ? 126 LYS A CB   6  
ATOM 9895  C CG   . LYS A 1 29  ? -1.661  1.306   -8.932  1.00 0.00 ? 126 LYS A CG   6  
ATOM 9896  C CD   . LYS A 1 29  ? -2.505  1.215   -10.187 1.00 0.00 ? 126 LYS A CD   6  
ATOM 9897  C CE   . LYS A 1 29  ? -3.592  2.271   -10.194 1.00 0.00 ? 126 LYS A CE   6  
ATOM 9898  N NZ   . LYS A 1 29  ? -4.337  2.301   -11.477 1.00 0.00 ? 126 LYS A NZ   6  
ATOM 9899  H H    . LYS A 1 29  ? -0.709  1.418   -6.187  1.00 0.00 ? 126 LYS A H    6  
ATOM 9900  H HA   . LYS A 1 29  ? 0.784   -0.694  -7.546  1.00 0.00 ? 126 LYS A HA   6  
ATOM 9901  H HB2  . LYS A 1 29  ? -0.134  0.089   -9.744  1.00 0.00 ? 126 LYS A HB2  6  
ATOM 9902  H HB3  . LYS A 1 29  ? -1.281  -0.766  -8.723  1.00 0.00 ? 126 LYS A HB3  6  
ATOM 9903  H HG2  . LYS A 1 29  ? -2.310  1.303   -8.069  1.00 0.00 ? 126 LYS A HG2  6  
ATOM 9904  H HG3  . LYS A 1 29  ? -1.092  2.223   -8.954  1.00 0.00 ? 126 LYS A HG3  6  
ATOM 9905  H HD2  . LYS A 1 29  ? -1.870  1.358   -11.049 1.00 0.00 ? 126 LYS A HD2  6  
ATOM 9906  H HD3  . LYS A 1 29  ? -2.962  0.236   -10.232 1.00 0.00 ? 126 LYS A HD3  6  
ATOM 9907  H HE2  . LYS A 1 29  ? -4.285  2.053   -9.395  1.00 0.00 ? 126 LYS A HE2  6  
ATOM 9908  H HE3  . LYS A 1 29  ? -3.140  3.237   -10.025 1.00 0.00 ? 126 LYS A HE3  6  
ATOM 9909  H HZ1  . LYS A 1 29  ? -5.125  2.979   -11.418 1.00 0.00 ? 126 LYS A HZ1  6  
ATOM 9910  H HZ2  . LYS A 1 29  ? -4.722  1.362   -11.694 1.00 0.00 ? 126 LYS A HZ2  6  
ATOM 9911  H HZ3  . LYS A 1 29  ? -3.706  2.591   -12.251 1.00 0.00 ? 126 LYS A HZ3  6  
ATOM 9912  N N    . TRP A 1 30  ? 2.298   0.999   -8.701  1.00 0.00 ? 127 TRP A N    6  
ATOM 9913  C CA   . TRP A 1 30  ? 3.420   1.888   -8.953  1.00 0.00 ? 127 TRP A CA   6  
ATOM 9914  C C    . TRP A 1 30  ? 3.878   1.748   -10.398 1.00 0.00 ? 127 TRP A C    6  
ATOM 9915  O O    . TRP A 1 30  ? 3.643   0.717   -11.031 1.00 0.00 ? 127 TRP A O    6  
ATOM 9916  C CB   . TRP A 1 30  ? 4.568   1.555   -7.990  1.00 0.00 ? 127 TRP A CB   6  
ATOM 9917  C CG   . TRP A 1 30  ? 4.812   0.081   -7.876  1.00 0.00 ? 127 TRP A CG   6  
ATOM 9918  C CD1  . TRP A 1 30  ? 5.640   -0.676  -8.651  1.00 0.00 ? 127 TRP A CD1  6  
ATOM 9919  C CD2  . TRP A 1 30  ? 4.199   -0.820  -6.940  1.00 0.00 ? 127 TRP A CD2  6  
ATOM 9920  N NE1  . TRP A 1 30  ? 5.573   -1.991  -8.265  1.00 0.00 ? 127 TRP A NE1  6  
ATOM 9921  C CE2  . TRP A 1 30  ? 4.699   -2.103  -7.216  1.00 0.00 ? 127 TRP A CE2  6  
ATOM 9922  C CE3  . TRP A 1 30  ? 3.277   -0.666  -5.898  1.00 0.00 ? 127 TRP A CE3  6  
ATOM 9923  C CZ2  . TRP A 1 30  ? 4.305   -3.224  -6.496  1.00 0.00 ? 127 TRP A CZ2  6  
ATOM 9924  C CZ3  . TRP A 1 30  ? 2.889   -1.780  -5.182  1.00 0.00 ? 127 TRP A CZ3  6  
ATOM 9925  C CH2  . TRP A 1 30  ? 3.400   -3.046  -5.485  1.00 0.00 ? 127 TRP A CH2  6  
ATOM 9926  H H    . TRP A 1 30  ? 2.284   0.122   -9.141  1.00 0.00 ? 127 TRP A H    6  
ATOM 9927  H HA   . TRP A 1 30  ? 3.094   2.902   -8.781  1.00 0.00 ? 127 TRP A HA   6  
ATOM 9928  H HB2  . TRP A 1 30  ? 5.476   2.020   -8.344  1.00 0.00 ? 127 TRP A HB2  6  
ATOM 9929  H HB3  . TRP A 1 30  ? 4.330   1.934   -7.007  1.00 0.00 ? 127 TRP A HB3  6  
ATOM 9930  H HD1  . TRP A 1 30  ? 6.248   -0.286  -9.453  1.00 0.00 ? 127 TRP A HD1  6  
ATOM 9931  H HE1  . TRP A 1 30  ? 6.072   -2.730  -8.670  1.00 0.00 ? 127 TRP A HE1  6  
ATOM 9932  H HE3  . TRP A 1 30  ? 2.873   0.303   -5.646  1.00 0.00 ? 127 TRP A HE3  6  
ATOM 9933  H HZ2  . TRP A 1 30  ? 4.687   -4.206  -6.724  1.00 0.00 ? 127 TRP A HZ2  6  
ATOM 9934  H HZ3  . TRP A 1 30  ? 2.174   -1.682  -4.378  1.00 0.00 ? 127 TRP A HZ3  6  
ATOM 9935  H HH2  . TRP A 1 30  ? 3.066   -3.890  -4.901  1.00 0.00 ? 127 TRP A HH2  6  
ATOM 9936  N N    . SER A 1 31  ? 4.524   2.777   -10.919 1.00 0.00 ? 128 SER A N    6  
ATOM 9937  C CA   . SER A 1 31  ? 4.971   2.771   -12.301 1.00 0.00 ? 128 SER A CA   6  
ATOM 9938  C C    . SER A 1 31  ? 6.495   2.780   -12.385 1.00 0.00 ? 128 SER A C    6  
ATOM 9939  O O    . SER A 1 31  ? 7.129   3.802   -12.126 1.00 0.00 ? 128 SER A O    6  
ATOM 9940  C CB   . SER A 1 31  ? 4.411   3.987   -13.032 1.00 0.00 ? 128 SER A CB   6  
ATOM 9941  O OG   . SER A 1 31  ? 3.008   4.088   -12.847 1.00 0.00 ? 128 SER A OG   6  
ATOM 9942  H H    . SER A 1 31  ? 4.715   3.564   -10.355 1.00 0.00 ? 128 SER A H    6  
ATOM 9943  H HA   . SER A 1 31  ? 4.595   1.875   -12.770 1.00 0.00 ? 128 SER A HA   6  
ATOM 9944  H HB2  . SER A 1 31  ? 4.883   4.880   -12.647 1.00 0.00 ? 128 SER A HB2  6  
ATOM 9945  H HB3  . SER A 1 31  ? 4.618   3.899   -14.087 1.00 0.00 ? 128 SER A HB3  6  
ATOM 9946  H HG   . SER A 1 31  ? 2.757   3.598   -12.055 1.00 0.00 ? 128 SER A HG   6  
ATOM 9947  N N    . PRO A 1 32  ? 7.105   1.638   -12.726 1.00 0.00 ? 129 PRO A N    6  
ATOM 9948  C CA   . PRO A 1 32  ? 8.547   1.558   -12.967 1.00 0.00 ? 129 PRO A CA   6  
ATOM 9949  C C    . PRO A 1 32  ? 8.930   2.290   -14.255 1.00 0.00 ? 129 PRO A C    6  
ATOM 9950  O O    . PRO A 1 32  ? 8.051   2.663   -15.038 1.00 0.00 ? 129 PRO A O    6  
ATOM 9951  C CB   . PRO A 1 32  ? 8.818   0.048   -13.099 1.00 0.00 ? 129 PRO A CB   6  
ATOM 9952  C CG   . PRO A 1 32  ? 7.569   -0.629  -12.638 1.00 0.00 ? 129 PRO A CG   6  
ATOM 9953  C CD   . PRO A 1 32  ? 6.451   0.337   -12.899 1.00 0.00 ? 129 PRO A CD   6  
ATOM 9954  H HA   . PRO A 1 32  ? 9.111   1.963   -12.138 1.00 0.00 ? 129 PRO A HA   6  
ATOM 9955  H HB2  . PRO A 1 32  ? 9.037   -0.189  -14.130 1.00 0.00 ? 129 PRO A HB2  6  
ATOM 9956  H HB3  . PRO A 1 32  ? 9.661   -0.221  -12.480 1.00 0.00 ? 129 PRO A HB3  6  
ATOM 9957  H HG2  . PRO A 1 32  ? 7.417   -1.538  -13.200 1.00 0.00 ? 129 PRO A HG2  6  
ATOM 9958  H HG3  . PRO A 1 32  ? 7.638   -0.846  -11.583 1.00 0.00 ? 129 PRO A HG3  6  
ATOM 9959  H HD2  . PRO A 1 32  ? 6.075   0.222   -13.905 1.00 0.00 ? 129 PRO A HD2  6  
ATOM 9960  H HD3  . PRO A 1 32  ? 5.659   0.204   -12.178 1.00 0.00 ? 129 PRO A HD3  6  
ATOM 9961  N N    . PRO A 1 33  ? 10.234  2.527   -14.490 1.00 0.00 ? 130 PRO A N    6  
ATOM 9962  C CA   . PRO A 1 33  ? 10.713  3.158   -15.728 1.00 0.00 ? 130 PRO A CA   6  
ATOM 9963  C C    . PRO A 1 33  ? 10.154  2.484   -16.986 1.00 0.00 ? 130 PRO A C    6  
ATOM 9964  O O    . PRO A 1 33  ? 9.793   1.302   -16.952 1.00 0.00 ? 130 PRO A O    6  
ATOM 9965  C CB   . PRO A 1 33  ? 12.229  2.979   -15.645 1.00 0.00 ? 130 PRO A CB   6  
ATOM 9966  C CG   . PRO A 1 33  ? 12.519  2.923   -14.187 1.00 0.00 ? 130 PRO A CG   6  
ATOM 9967  C CD   . PRO A 1 33  ? 11.341  2.227   -13.562 1.00 0.00 ? 130 PRO A CD   6  
ATOM 9968  H HA   . PRO A 1 33  ? 10.474  4.212   -15.752 1.00 0.00 ? 130 PRO A HA   6  
ATOM 9969  H HB2  . PRO A 1 33  ? 12.515  2.063   -16.142 1.00 0.00 ? 130 PRO A HB2  6  
ATOM 9970  H HB3  . PRO A 1 33  ? 12.721  3.818   -16.113 1.00 0.00 ? 130 PRO A HB3  6  
ATOM 9971  H HG2  . PRO A 1 33  ? 13.424  2.361   -14.012 1.00 0.00 ? 130 PRO A HG2  6  
ATOM 9972  H HG3  . PRO A 1 33  ? 12.614  3.923   -13.793 1.00 0.00 ? 130 PRO A HG3  6  
ATOM 9973  H HD2  . PRO A 1 33  ? 11.516  1.164   -13.503 1.00 0.00 ? 130 PRO A HD2  6  
ATOM 9974  H HD3  . PRO A 1 33  ? 11.140  2.632   -12.581 1.00 0.00 ? 130 PRO A HD3  6  
ATOM 9975  N N    . THR A 1 34  ? 10.072  3.247   -18.077 1.00 0.00 ? 131 THR A N    6  
ATOM 9976  C CA   . THR A 1 34  ? 9.467   2.785   -19.326 1.00 0.00 ? 131 THR A CA   6  
ATOM 9977  C C    . THR A 1 34  ? 9.953   1.388   -19.713 1.00 0.00 ? 131 THR A C    6  
ATOM 9978  O O    . THR A 1 34  ? 9.163   0.444   -19.774 1.00 0.00 ? 131 THR A O    6  
ATOM 9979  C CB   . THR A 1 34  ? 9.774   3.767   -20.471 1.00 0.00 ? 131 THR A CB   6  
ATOM 9980  O OG1  . THR A 1 34  ? 9.494   5.108   -20.042 1.00 0.00 ? 131 THR A OG1  6  
ATOM 9981  C CG2  . THR A 1 34  ? 8.945   3.446   -21.707 1.00 0.00 ? 131 THR A CG2  6  
ATOM 9982  H H    . THR A 1 34  ? 10.428  4.160   -18.040 1.00 0.00 ? 131 THR A H    6  
ATOM 9983  H HA   . THR A 1 34  ? 8.396   2.755   -19.185 1.00 0.00 ? 131 THR A HA   6  
ATOM 9984  H HB   . THR A 1 34  ? 10.821  3.689   -20.723 1.00 0.00 ? 131 THR A HB   6  
ATOM 9985  H HG1  . THR A 1 34  ? 8.575   5.167   -19.752 1.00 0.00 ? 131 THR A HG1  6  
ATOM 9986  H HG21 . THR A 1 34  ? 7.895   3.523   -21.466 1.00 0.00 ? 131 THR A HG21 6  
ATOM 9987  H HG22 . THR A 1 34  ? 9.167   2.441   -22.038 1.00 0.00 ? 131 THR A HG22 6  
ATOM 9988  H HG23 . THR A 1 34  ? 9.186   4.145   -22.494 1.00 0.00 ? 131 THR A HG23 6  
ATOM 9989  N N    . LEU A 1 35  ? 11.248  1.260   -19.961 1.00 0.00 ? 132 LEU A N    6  
ATOM 9990  C CA   . LEU A 1 35  ? 11.834  -0.032  -20.277 1.00 0.00 ? 132 LEU A CA   6  
ATOM 9991  C C    . LEU A 1 35  ? 13.261  -0.111  -19.745 1.00 0.00 ? 132 LEU A C    6  
ATOM 9992  O O    . LEU A 1 35  ? 14.092  0.757   -20.014 1.00 0.00 ? 132 LEU A O    6  
ATOM 9993  C CB   . LEU A 1 35  ? 11.764  -0.306  -21.791 1.00 0.00 ? 132 LEU A CB   6  
ATOM 9994  C CG   . LEU A 1 35  ? 12.373  0.762   -22.708 1.00 0.00 ? 132 LEU A CG   6  
ATOM 9995  C CD1  . LEU A 1 35  ? 13.834  0.460   -22.994 1.00 0.00 ? 132 LEU A CD1  6  
ATOM 9996  C CD2  . LEU A 1 35  ? 11.584  0.859   -24.003 1.00 0.00 ? 132 LEU A CD2  6  
ATOM 9997  H H    . LEU A 1 35  ? 11.826  2.053   -19.926 1.00 0.00 ? 132 LEU A H    6  
ATOM 9998  H HA   . LEU A 1 35  ? 11.247  -0.780  -19.768 1.00 0.00 ? 132 LEU A HA   6  
ATOM 9999  H HB2  . LEU A 1 35  ? 12.273  -1.239  -21.984 1.00 0.00 ? 132 LEU A HB2  6  
ATOM 10000 H HB3  . LEU A 1 35  ? 10.726  -0.426  -22.061 1.00 0.00 ? 132 LEU A HB3  6  
ATOM 10001 H HG   . LEU A 1 35  ? 12.323  1.720   -22.213 1.00 0.00 ? 132 LEU A HG   6  
ATOM 10002 H HD11 . LEU A 1 35  ? 13.908  -0.473  -23.532 1.00 0.00 ? 132 LEU A HD11 6  
ATOM 10003 H HD12 . LEU A 1 35  ? 14.371  0.381   -22.062 1.00 0.00 ? 132 LEU A HD12 6  
ATOM 10004 H HD13 . LEU A 1 35  ? 14.257  1.255   -23.589 1.00 0.00 ? 132 LEU A HD13 6  
ATOM 10005 H HD21 . LEU A 1 35  ? 10.565  1.145   -23.784 1.00 0.00 ? 132 LEU A HD21 6  
ATOM 10006 H HD22 . LEU A 1 35  ? 11.590  -0.099  -24.502 1.00 0.00 ? 132 LEU A HD22 6  
ATOM 10007 H HD23 . LEU A 1 35  ? 12.036  1.602   -24.645 1.00 0.00 ? 132 LEU A HD23 6  
ATOM 10008 N N    . ILE A 1 36  ? 13.523  -1.135  -18.950 1.00 0.00 ? 133 ILE A N    6  
ATOM 10009 C CA   . ILE A 1 36  ? 14.833  -1.322  -18.347 1.00 0.00 ? 133 ILE A CA   6  
ATOM 10010 C C    . ILE A 1 36  ? 15.520  -2.537  -18.949 1.00 0.00 ? 133 ILE A C    6  
ATOM 10011 O O    . ILE A 1 36  ? 16.668  -2.457  -19.383 1.00 0.00 ? 133 ILE A O    6  
ATOM 10012 C CB   . ILE A 1 36  ? 14.730  -1.528  -16.821 1.00 0.00 ? 133 ILE A CB   6  
ATOM 10013 C CG1  . ILE A 1 36  ? 13.902  -0.415  -16.175 1.00 0.00 ? 133 ILE A CG1  6  
ATOM 10014 C CG2  . ILE A 1 36  ? 16.122  -1.580  -16.205 1.00 0.00 ? 133 ILE A CG2  6  
ATOM 10015 C CD1  . ILE A 1 36  ? 13.666  -0.619  -14.693 1.00 0.00 ? 133 ILE A CD1  6  
ATOM 10016 H H    . ILE A 1 36  ? 12.815  -1.787  -18.764 1.00 0.00 ? 133 ILE A H    6  
ATOM 10017 H HA   . ILE A 1 36  ? 15.428  -0.441  -18.539 1.00 0.00 ? 133 ILE A HA   6  
ATOM 10018 H HB   . ILE A 1 36  ? 14.249  -2.476  -16.640 1.00 0.00 ? 133 ILE A HB   6  
ATOM 10019 H HG12 . ILE A 1 36  ? 14.415  0.527   -16.301 1.00 0.00 ? 133 ILE A HG12 6  
ATOM 10020 H HG13 . ILE A 1 36  ? 12.939  -0.363  -16.661 1.00 0.00 ? 133 ILE A HG13 6  
ATOM 10021 H HG21 . ILE A 1 36  ? 16.037  -1.700  -15.135 1.00 0.00 ? 133 ILE A HG21 6  
ATOM 10022 H HG22 . ILE A 1 36  ? 16.651  -0.665  -16.425 1.00 0.00 ? 133 ILE A HG22 6  
ATOM 10023 H HG23 . ILE A 1 36  ? 16.665  -2.418  -16.617 1.00 0.00 ? 133 ILE A HG23 6  
ATOM 10024 H HD11 . ILE A 1 36  ? 13.119  -1.538  -14.540 1.00 0.00 ? 133 ILE A HD11 6  
ATOM 10025 H HD12 . ILE A 1 36  ? 13.097  0.209   -14.302 1.00 0.00 ? 133 ILE A HD12 6  
ATOM 10026 H HD13 . ILE A 1 36  ? 14.616  -0.676  -14.182 1.00 0.00 ? 133 ILE A HD13 6  
ATOM 10027 N N    . ASP A 1 37  ? 14.796  -3.652  -18.978 1.00 0.00 ? 134 ASP A N    6  
ATOM 10028 C CA   . ASP A 1 37  ? 15.322  -4.923  -19.469 1.00 0.00 ? 134 ASP A CA   6  
ATOM 10029 C C    . ASP A 1 37  ? 16.546  -5.340  -18.666 1.00 0.00 ? 134 ASP A C    6  
ATOM 10030 O O    . ASP A 1 37  ? 17.690  -5.135  -19.082 1.00 0.00 ? 134 ASP A O    6  
ATOM 10031 C CB   . ASP A 1 37  ? 15.653  -4.846  -20.964 1.00 0.00 ? 134 ASP A CB   6  
ATOM 10032 C CG   . ASP A 1 37  ? 16.094  -6.179  -21.541 1.00 0.00 ? 134 ASP A CG   6  
ATOM 10033 O OD1  . ASP A 1 37  ? 15.229  -7.060  -21.743 1.00 0.00 ? 134 ASP A OD1  6  
ATOM 10034 O OD2  . ASP A 1 37  ? 17.301  -6.341  -21.823 1.00 0.00 ? 134 ASP A OD2  6  
ATOM 10035 H H    . ASP A 1 37  ? 13.870  -3.619  -18.659 1.00 0.00 ? 134 ASP A H    6  
ATOM 10036 H HA   . ASP A 1 37  ? 14.554  -5.667  -19.320 1.00 0.00 ? 134 ASP A HA   6  
ATOM 10037 H HB2  . ASP A 1 37  ? 14.779  -4.517  -21.501 1.00 0.00 ? 134 ASP A HB2  6  
ATOM 10038 H HB3  . ASP A 1 37  ? 16.449  -4.130  -21.111 1.00 0.00 ? 134 ASP A HB3  6  
ATOM 10039 N N    . LEU A 1 38  ? 16.290  -5.894  -17.490 1.00 0.00 ? 135 LEU A N    6  
ATOM 10040 C CA   . LEU A 1 38  ? 17.350  -6.392  -16.633 1.00 0.00 ? 135 LEU A CA   6  
ATOM 10041 C C    . LEU A 1 38  ? 17.939  -7.641  -17.266 1.00 0.00 ? 135 LEU A C    6  
ATOM 10042 O O    . LEU A 1 38  ? 19.096  -7.661  -17.688 1.00 0.00 ? 135 LEU A O    6  
ATOM 10043 C CB   . LEU A 1 38  ? 16.798  -6.708  -15.240 1.00 0.00 ? 135 LEU A CB   6  
ATOM 10044 C CG   . LEU A 1 38  ? 15.966  -5.595  -14.598 1.00 0.00 ? 135 LEU A CG   6  
ATOM 10045 C CD1  . LEU A 1 38  ? 15.402  -6.048  -13.264 1.00 0.00 ? 135 LEU A CD1  6  
ATOM 10046 C CD2  . LEU A 1 38  ? 16.805  -4.345  -14.418 1.00 0.00 ? 135 LEU A CD2  6  
ATOM 10047 H H    . LEU A 1 38  ? 15.359  -5.980  -17.197 1.00 0.00 ? 135 LEU A H    6  
ATOM 10048 H HA   . LEU A 1 38  ? 18.114  -5.634  -16.558 1.00 0.00 ? 135 LEU A HA   6  
ATOM 10049 H HB2  . LEU A 1 38  ? 16.181  -7.591  -15.312 1.00 0.00 ? 135 LEU A HB2  6  
ATOM 10050 H HB3  . LEU A 1 38  ? 17.629  -6.923  -14.587 1.00 0.00 ? 135 LEU A HB3  6  
ATOM 10051 H HG   . LEU A 1 38  ? 15.138  -5.353  -15.247 1.00 0.00 ? 135 LEU A HG   6  
ATOM 10052 H HD11 . LEU A 1 38  ? 16.211  -6.315  -12.601 1.00 0.00 ? 135 LEU A HD11 6  
ATOM 10053 H HD12 . LEU A 1 38  ? 14.762  -6.904  -13.416 1.00 0.00 ? 135 LEU A HD12 6  
ATOM 10054 H HD13 . LEU A 1 38  ? 14.830  -5.244  -12.826 1.00 0.00 ? 135 LEU A HD13 6  
ATOM 10055 H HD21 . LEU A 1 38  ? 17.143  -3.999  -15.383 1.00 0.00 ? 135 LEU A HD21 6  
ATOM 10056 H HD22 . LEU A 1 38  ? 17.658  -4.570  -13.798 1.00 0.00 ? 135 LEU A HD22 6  
ATOM 10057 H HD23 . LEU A 1 38  ? 16.210  -3.576  -13.948 1.00 0.00 ? 135 LEU A HD23 6  
ATOM 10058 N N    . LYS A 1 39  ? 17.112  -8.671  -17.342 1.00 0.00 ? 136 LYS A N    6  
ATOM 10059 C CA   . LYS A 1 39  ? 17.423  -9.875  -18.087 1.00 0.00 ? 136 LYS A CA   6  
ATOM 10060 C C    . LYS A 1 39  ? 16.156  -10.373 -18.736 1.00 0.00 ? 136 LYS A C    6  
ATOM 10061 O O    . LYS A 1 39  ? 15.181  -10.696 -18.058 1.00 0.00 ? 136 LYS A O    6  
ATOM 10062 C CB   . LYS A 1 39  ? 18.034  -10.963 -17.205 1.00 0.00 ? 136 LYS A CB   6  
ATOM 10063 C CG   . LYS A 1 39  ? 19.392  -10.607 -16.628 1.00 0.00 ? 136 LYS A CG   6  
ATOM 10064 C CD   . LYS A 1 39  ? 19.967  -11.771 -15.849 1.00 0.00 ? 136 LYS A CD   6  
ATOM 10065 C CE   . LYS A 1 39  ? 21.357  -11.463 -15.323 1.00 0.00 ? 136 LYS A CE   6  
ATOM 10066 N NZ   . LYS A 1 39  ? 21.968  -12.643 -14.659 1.00 0.00 ? 136 LYS A NZ   6  
ATOM 10067 H H    . LYS A 1 39  ? 16.244  -8.613  -16.888 1.00 0.00 ? 136 LYS A H    6  
ATOM 10068 H HA   . LYS A 1 39  ? 18.118  -9.612  -18.870 1.00 0.00 ? 136 LYS A HA   6  
ATOM 10069 H HB2  . LYS A 1 39  ? 17.366  -11.161 -16.385 1.00 0.00 ? 136 LYS A HB2  6  
ATOM 10070 H HB3  . LYS A 1 39  ? 18.142  -11.863 -17.791 1.00 0.00 ? 136 LYS A HB3  6  
ATOM 10071 H HG2  . LYS A 1 39  ? 20.063  -10.356 -17.438 1.00 0.00 ? 136 LYS A HG2  6  
ATOM 10072 H HG3  . LYS A 1 39  ? 19.284  -9.758  -15.969 1.00 0.00 ? 136 LYS A HG3  6  
ATOM 10073 H HD2  . LYS A 1 39  ? 19.317  -11.987 -15.016 1.00 0.00 ? 136 LYS A HD2  6  
ATOM 10074 H HD3  . LYS A 1 39  ? 20.019  -12.631 -16.498 1.00 0.00 ? 136 LYS A HD3  6  
ATOM 10075 H HE2  . LYS A 1 39  ? 21.982  -11.160 -16.149 1.00 0.00 ? 136 LYS A HE2  6  
ATOM 10076 H HE3  . LYS A 1 39  ? 21.286  -10.655 -14.610 1.00 0.00 ? 136 LYS A HE3  6  
ATOM 10077 H HZ1  . LYS A 1 39  ? 22.087  -13.417 -15.344 1.00 0.00 ? 136 LYS A HZ1  6  
ATOM 10078 H HZ2  . LYS A 1 39  ? 21.362  -12.974 -13.883 1.00 0.00 ? 136 LYS A HZ2  6  
ATOM 10079 H HZ3  . LYS A 1 39  ? 22.900  -12.395 -14.273 1.00 0.00 ? 136 LYS A HZ3  6  
ATOM 10080 N N    . THR A 1 40  ? 16.189  -10.420 -20.046 1.00 0.00 ? 137 THR A N    6  
ATOM 10081 C CA   . THR A 1 40  ? 14.997  -10.601 -20.847 1.00 0.00 ? 137 THR A CA   6  
ATOM 10082 C C    . THR A 1 40  ? 14.286  -11.924 -20.559 1.00 0.00 ? 137 THR A C    6  
ATOM 10083 O O    . THR A 1 40  ? 14.769  -12.998 -20.919 1.00 0.00 ? 137 THR A O    6  
ATOM 10084 C CB   . THR A 1 40  ? 15.354  -10.521 -22.333 1.00 0.00 ? 137 THR A CB   6  
ATOM 10085 O OG1  . THR A 1 40  ? 16.255  -9.426  -22.552 1.00 0.00 ? 137 THR A OG1  6  
ATOM 10086 C CG2  . THR A 1 40  ? 14.107  -10.317 -23.161 1.00 0.00 ? 137 THR A CG2  6  
ATOM 10087 H H    . THR A 1 40  ? 17.056  -10.335 -20.499 1.00 0.00 ? 137 THR A H    6  
ATOM 10088 H HA   . THR A 1 40  ? 14.323  -9.789  -20.622 1.00 0.00 ? 137 THR A HA   6  
ATOM 10089 H HB   . THR A 1 40  ? 15.828  -11.444 -22.633 1.00 0.00 ? 137 THR A HB   6  
ATOM 10090 H HG1  . THR A 1 40  ? 15.860  -8.606  -22.204 1.00 0.00 ? 137 THR A HG1  6  
ATOM 10091 H HG21 . THR A 1 40  ? 13.418  -11.127 -22.978 1.00 0.00 ? 137 THR A HG21 6  
ATOM 10092 H HG22 . THR A 1 40  ? 14.369  -10.294 -24.206 1.00 0.00 ? 137 THR A HG22 6  
ATOM 10093 H HG23 . THR A 1 40  ? 13.647  -9.381  -22.882 1.00 0.00 ? 137 THR A HG23 6  
ATOM 10094 N N    . GLY A 1 41  ? 13.144  -11.832 -19.890 1.00 0.00 ? 138 GLY A N    6  
ATOM 10095 C CA   . GLY A 1 41  ? 12.303  -12.995 -19.680 1.00 0.00 ? 138 GLY A CA   6  
ATOM 10096 C C    . GLY A 1 41  ? 12.670  -13.789 -18.443 1.00 0.00 ? 138 GLY A C    6  
ATOM 10097 O O    . GLY A 1 41  ? 11.839  -13.982 -17.558 1.00 0.00 ? 138 GLY A O    6  
ATOM 10098 H H    . GLY A 1 41  ? 12.869  -10.960 -19.529 1.00 0.00 ? 138 GLY A H    6  
ATOM 10099 H HA2  . GLY A 1 41  ? 11.279  -12.669 -19.587 1.00 0.00 ? 138 GLY A HA2  6  
ATOM 10100 H HA3  . GLY A 1 41  ? 12.383  -13.640 -20.543 1.00 0.00 ? 138 GLY A HA3  6  
ATOM 10101 N N    . TRP A 1 42  ? 13.920  -14.232 -18.366 1.00 0.00 ? 139 TRP A N    6  
ATOM 10102 C CA   . TRP A 1 42  ? 14.348  -15.120 -17.287 1.00 0.00 ? 139 TRP A CA   6  
ATOM 10103 C C    . TRP A 1 42  ? 14.664  -14.352 -16.002 1.00 0.00 ? 139 TRP A C    6  
ATOM 10104 O O    . TRP A 1 42  ? 15.223  -14.908 -15.056 1.00 0.00 ? 139 TRP A O    6  
ATOM 10105 C CB   . TRP A 1 42  ? 15.542  -15.979 -17.729 1.00 0.00 ? 139 TRP A CB   6  
ATOM 10106 C CG   . TRP A 1 42  ? 16.733  -15.201 -18.199 1.00 0.00 ? 139 TRP A CG   6  
ATOM 10107 C CD1  . TRP A 1 42  ? 17.648  -14.569 -17.418 1.00 0.00 ? 139 TRP A CD1  6  
ATOM 10108 C CD2  . TRP A 1 42  ? 17.149  -14.992 -19.556 1.00 0.00 ? 139 TRP A CD2  6  
ATOM 10109 N NE1  . TRP A 1 42  ? 18.606  -13.970 -18.201 1.00 0.00 ? 139 TRP A NE1  6  
ATOM 10110 C CE2  . TRP A 1 42  ? 18.321  -14.215 -19.517 1.00 0.00 ? 139 TRP A CE2  6  
ATOM 10111 C CE3  . TRP A 1 42  ? 16.643  -15.383 -20.798 1.00 0.00 ? 139 TRP A CE3  6  
ATOM 10112 C CZ2  . TRP A 1 42  ? 18.996  -13.823 -20.671 1.00 0.00 ? 139 TRP A CZ2  6  
ATOM 10113 C CZ3  . TRP A 1 42  ? 17.313  -14.994 -21.944 1.00 0.00 ? 139 TRP A CZ3  6  
ATOM 10114 C CH2  . TRP A 1 42  ? 18.478  -14.221 -21.873 1.00 0.00 ? 139 TRP A CH2  6  
ATOM 10115 H H    . TRP A 1 42  ? 14.569  -13.958 -19.050 1.00 0.00 ? 139 TRP A H    6  
ATOM 10116 H HA   . TRP A 1 42  ? 13.524  -15.779 -17.077 1.00 0.00 ? 139 TRP A HA   6  
ATOM 10117 H HB2  . TRP A 1 42  ? 15.859  -16.589 -16.896 1.00 0.00 ? 139 TRP A HB2  6  
ATOM 10118 H HB3  . TRP A 1 42  ? 15.227  -16.625 -18.536 1.00 0.00 ? 139 TRP A HB3  6  
ATOM 10119 H HD1  . TRP A 1 42  ? 17.604  -14.546 -16.341 1.00 0.00 ? 139 TRP A HD1  6  
ATOM 10120 H HE1  . TRP A 1 42  ? 19.370  -13.455 -17.870 1.00 0.00 ? 139 TRP A HE1  6  
ATOM 10121 H HE3  . TRP A 1 42  ? 15.747  -15.980 -20.873 1.00 0.00 ? 139 TRP A HE3  6  
ATOM 10122 H HZ2  . TRP A 1 42  ? 19.896  -13.225 -20.633 1.00 0.00 ? 139 TRP A HZ2  6  
ATOM 10123 H HZ3  . TRP A 1 42  ? 16.936  -15.288 -22.913 1.00 0.00 ? 139 TRP A HZ3  6  
ATOM 10124 H HH2  . TRP A 1 42  ? 18.967  -13.939 -22.794 1.00 0.00 ? 139 TRP A HH2  6  
ATOM 10125 N N    . PHE A 1 43  ? 14.297  -13.078 -15.965 1.00 0.00 ? 140 PHE A N    6  
ATOM 10126 C CA   . PHE A 1 43  ? 14.416  -12.283 -14.751 1.00 0.00 ? 140 PHE A CA   6  
ATOM 10127 C C    . PHE A 1 43  ? 13.384  -11.168 -14.761 1.00 0.00 ? 140 PHE A C    6  
ATOM 10128 O O    . PHE A 1 43  ? 13.131  -10.551 -15.795 1.00 0.00 ? 140 PHE A O    6  
ATOM 10129 C CB   . PHE A 1 43  ? 15.816  -11.686 -14.616 1.00 0.00 ? 140 PHE A CB   6  
ATOM 10130 C CG   . PHE A 1 43  ? 16.105  -11.114 -13.253 1.00 0.00 ? 140 PHE A CG   6  
ATOM 10131 C CD1  . PHE A 1 43  ? 16.504  -11.940 -12.213 1.00 0.00 ? 140 PHE A CD1  6  
ATOM 10132 C CD2  . PHE A 1 43  ? 15.979  -9.755  -13.010 1.00 0.00 ? 140 PHE A CD2  6  
ATOM 10133 C CE1  . PHE A 1 43  ? 16.771  -11.422 -10.960 1.00 0.00 ? 140 PHE A CE1  6  
ATOM 10134 C CE2  . PHE A 1 43  ? 16.245  -9.233  -11.758 1.00 0.00 ? 140 PHE A CE2  6  
ATOM 10135 C CZ   . PHE A 1 43  ? 16.641  -10.067 -10.733 1.00 0.00 ? 140 PHE A CZ   6  
ATOM 10136 H H    . PHE A 1 43  ? 13.936  -12.659 -16.775 1.00 0.00 ? 140 PHE A H    6  
ATOM 10137 H HA   . PHE A 1 43  ? 14.224  -12.932 -13.909 1.00 0.00 ? 140 PHE A HA   6  
ATOM 10138 H HB2  . PHE A 1 43  ? 16.551  -12.449 -14.821 1.00 0.00 ? 140 PHE A HB2  6  
ATOM 10139 H HB3  . PHE A 1 43  ? 15.921  -10.887 -15.335 1.00 0.00 ? 140 PHE A HB3  6  
ATOM 10140 H HD1  . PHE A 1 43  ? 16.606  -12.999 -12.389 1.00 0.00 ? 140 PHE A HD1  6  
ATOM 10141 H HD2  . PHE A 1 43  ? 15.669  -9.101  -13.810 1.00 0.00 ? 140 PHE A HD2  6  
ATOM 10142 H HE1  . PHE A 1 43  ? 17.080  -12.078 -10.160 1.00 0.00 ? 140 PHE A HE1  6  
ATOM 10143 H HE2  . PHE A 1 43  ? 16.143  -8.172  -11.582 1.00 0.00 ? 140 PHE A HE2  6  
ATOM 10144 H HZ   . PHE A 1 43  ? 16.849  -9.661  -9.753  1.00 0.00 ? 140 PHE A HZ   6  
ATOM 10145 N N    . THR A 1 44  ? 12.776  -10.932 -13.618 1.00 0.00 ? 141 THR A N    6  
ATOM 10146 C CA   . THR A 1 44  ? 11.827  -9.849  -13.462 1.00 0.00 ? 141 THR A CA   6  
ATOM 10147 C C    . THR A 1 44  ? 12.111  -9.124  -12.150 1.00 0.00 ? 141 THR A C    6  
ATOM 10148 O O    . THR A 1 44  ? 12.601  -9.736  -11.196 1.00 0.00 ? 141 THR A O    6  
ATOM 10149 C CB   . THR A 1 44  ? 10.384  -10.391 -13.475 1.00 0.00 ? 141 THR A CB   6  
ATOM 10150 O OG1  . THR A 1 44  ? 10.235  -11.333 -14.549 1.00 0.00 ? 141 THR A OG1  6  
ATOM 10151 C CG2  . THR A 1 44  ? 9.372   -9.269  -13.652 1.00 0.00 ? 141 THR A CG2  6  
ATOM 10152 H H    . THR A 1 44  ? 12.964  -11.509 -12.847 1.00 0.00 ? 141 THR A H    6  
ATOM 10153 H HA   . THR A 1 44  ? 11.952  -9.162  -14.287 1.00 0.00 ? 141 THR A HA   6  
ATOM 10154 H HB   . THR A 1 44  ? 10.191  -10.889 -12.535 1.00 0.00 ? 141 THR A HB   6  
ATOM 10155 H HG1  . THR A 1 44  ? 10.928  -11.176 -15.205 1.00 0.00 ? 141 THR A HG1  6  
ATOM 10156 H HG21 . THR A 1 44  ? 9.544   -8.776  -14.598 1.00 0.00 ? 141 THR A HG21 6  
ATOM 10157 H HG22 . THR A 1 44  ? 9.478   -8.556  -12.848 1.00 0.00 ? 141 THR A HG22 6  
ATOM 10158 H HG23 . THR A 1 44  ? 8.374   -9.682  -13.637 1.00 0.00 ? 141 THR A HG23 6  
ATOM 10159 N N    . LEU A 1 45  ? 11.825  -7.832  -12.104 1.00 0.00 ? 142 LEU A N    6  
ATOM 10160 C CA   . LEU A 1 45  ? 12.133  -7.024  -10.934 1.00 0.00 ? 142 LEU A CA   6  
ATOM 10161 C C    . LEU A 1 45  ? 11.101  -7.252  -9.842  1.00 0.00 ? 142 LEU A C    6  
ATOM 10162 O O    . LEU A 1 45  ? 9.901   -7.114  -10.067 1.00 0.00 ? 142 LEU A O    6  
ATOM 10163 C CB   . LEU A 1 45  ? 12.184  -5.541  -11.314 1.00 0.00 ? 142 LEU A CB   6  
ATOM 10164 C CG   . LEU A 1 45  ? 12.523  -4.577  -10.181 1.00 0.00 ? 142 LEU A CG   6  
ATOM 10165 C CD1  . LEU A 1 45  ? 13.882  -4.908  -9.593  1.00 0.00 ? 142 LEU A CD1  6  
ATOM 10166 C CD2  . LEU A 1 45  ? 12.496  -3.141  -10.683 1.00 0.00 ? 142 LEU A CD2  6  
ATOM 10167 H H    . LEU A 1 45  ? 11.393  -7.405  -12.878 1.00 0.00 ? 142 LEU A H    6  
ATOM 10168 H HA   . LEU A 1 45  ? 13.103  -7.328  -10.569 1.00 0.00 ? 142 LEU A HA   6  
ATOM 10169 H HB2  . LEU A 1 45  ? 12.923  -5.417  -12.088 1.00 0.00 ? 142 LEU A HB2  6  
ATOM 10170 H HB3  . LEU A 1 45  ? 11.221  -5.261  -11.713 1.00 0.00 ? 142 LEU A HB3  6  
ATOM 10171 H HG   . LEU A 1 45  ? 11.785  -4.674  -9.397  1.00 0.00 ? 142 LEU A HG   6  
ATOM 10172 H HD11 . LEU A 1 45  ? 14.623  -4.909  -10.378 1.00 0.00 ? 142 LEU A HD11 6  
ATOM 10173 H HD12 . LEU A 1 45  ? 13.846  -5.882  -9.129  1.00 0.00 ? 142 LEU A HD12 6  
ATOM 10174 H HD13 . LEU A 1 45  ? 14.144  -4.167  -8.853  1.00 0.00 ? 142 LEU A HD13 6  
ATOM 10175 H HD21 . LEU A 1 45  ? 13.227  -3.021  -11.469 1.00 0.00 ? 142 LEU A HD21 6  
ATOM 10176 H HD22 . LEU A 1 45  ? 12.729  -2.470  -9.870  1.00 0.00 ? 142 LEU A HD22 6  
ATOM 10177 H HD23 . LEU A 1 45  ? 11.513  -2.914  -11.068 1.00 0.00 ? 142 LEU A HD23 6  
ATOM 10178 N N    . LEU A 1 46  ? 11.581  -7.625  -8.667  1.00 0.00 ? 143 LEU A N    6  
ATOM 10179 C CA   . LEU A 1 46  ? 10.716  -7.873  -7.528  1.00 0.00 ? 143 LEU A CA   6  
ATOM 10180 C C    . LEU A 1 46  ? 10.499  -6.599  -6.728  1.00 0.00 ? 143 LEU A C    6  
ATOM 10181 O O    . LEU A 1 46  ? 11.421  -5.806  -6.530  1.00 0.00 ? 143 LEU A O    6  
ATOM 10182 C CB   . LEU A 1 46  ? 11.301  -8.976  -6.643  1.00 0.00 ? 143 LEU A CB   6  
ATOM 10183 C CG   . LEU A 1 46  ? 10.786  -10.392 -6.931  1.00 0.00 ? 143 LEU A CG   6  
ATOM 10184 C CD1  . LEU A 1 46  ? 10.785  -10.683 -8.421  1.00 0.00 ? 143 LEU A CD1  6  
ATOM 10185 C CD2  . LEU A 1 46  ? 11.628  -11.422 -6.198  1.00 0.00 ? 143 LEU A CD2  6  
ATOM 10186 H H    . LEU A 1 46  ? 12.552  -7.736  -8.561  1.00 0.00 ? 143 LEU A H    6  
ATOM 10187 H HA   . LEU A 1 46  ? 9.762   -8.203  -7.911  1.00 0.00 ? 143 LEU A HA   6  
ATOM 10188 H HB2  . LEU A 1 46  ? 12.375  -8.973  -6.767  1.00 0.00 ? 143 LEU A HB2  6  
ATOM 10189 H HB3  . LEU A 1 46  ? 11.076  -8.737  -5.616  1.00 0.00 ? 143 LEU A HB3  6  
ATOM 10190 H HG   . LEU A 1 46  ? 9.770   -10.477 -6.575  1.00 0.00 ? 143 LEU A HG   6  
ATOM 10191 H HD11 . LEU A 1 46  ? 11.786  -10.572 -8.810  1.00 0.00 ? 143 LEU A HD11 6  
ATOM 10192 H HD12 . LEU A 1 46  ? 10.124  -9.988  -8.919  1.00 0.00 ? 143 LEU A HD12 6  
ATOM 10193 H HD13 . LEU A 1 46  ? 10.441  -11.692 -8.590  1.00 0.00 ? 143 LEU A HD13 6  
ATOM 10194 H HD21 . LEU A 1 46  ? 11.245  -12.410 -6.404  1.00 0.00 ? 143 LEU A HD21 6  
ATOM 10195 H HD22 . LEU A 1 46  ? 11.583  -11.234 -5.136  1.00 0.00 ? 143 LEU A HD22 6  
ATOM 10196 H HD23 . LEU A 1 46  ? 12.652  -11.355 -6.533  1.00 0.00 ? 143 LEU A HD23 6  
ATOM 10197 N N    . TYR A 1 47  ? 9.272   -6.413  -6.277  1.00 0.00 ? 144 TYR A N    6  
ATOM 10198 C CA   . TYR A 1 47  ? 8.888   -5.206  -5.567  1.00 0.00 ? 144 TYR A CA   6  
ATOM 10199 C C    . TYR A 1 47  ? 8.524   -5.518  -4.122  1.00 0.00 ? 144 TYR A C    6  
ATOM 10200 O O    . TYR A 1 47  ? 8.031   -6.607  -3.809  1.00 0.00 ? 144 TYR A O    6  
ATOM 10201 C CB   . TYR A 1 47  ? 7.707   -4.538  -6.273  1.00 0.00 ? 144 TYR A CB   6  
ATOM 10202 C CG   . TYR A 1 47  ? 7.936   -4.337  -7.753  1.00 0.00 ? 144 TYR A CG   6  
ATOM 10203 C CD1  . TYR A 1 47  ? 8.698   -3.275  -8.219  1.00 0.00 ? 144 TYR A CD1  6  
ATOM 10204 C CD2  . TYR A 1 47  ? 7.400   -5.219  -8.682  1.00 0.00 ? 144 TYR A CD2  6  
ATOM 10205 C CE1  . TYR A 1 47  ? 8.919   -3.098  -9.571  1.00 0.00 ? 144 TYR A CE1  6  
ATOM 10206 C CE2  . TYR A 1 47  ? 7.616   -5.047  -10.033 1.00 0.00 ? 144 TYR A CE2  6  
ATOM 10207 C CZ   . TYR A 1 47  ? 8.377   -3.987  -10.473 1.00 0.00 ? 144 TYR A CZ   6  
ATOM 10208 O OH   . TYR A 1 47  ? 8.599   -3.816  -11.818 1.00 0.00 ? 144 TYR A OH   6  
ATOM 10209 H H    . TYR A 1 47  ? 8.598   -7.115  -6.431  1.00 0.00 ? 144 TYR A H    6  
ATOM 10210 H HA   . TYR A 1 47  ? 9.731   -4.532  -5.577  1.00 0.00 ? 144 TYR A HA   6  
ATOM 10211 H HB2  . TYR A 1 47  ? 6.829   -5.154  -6.152  1.00 0.00 ? 144 TYR A HB2  6  
ATOM 10212 H HB3  . TYR A 1 47  ? 7.529   -3.571  -5.827  1.00 0.00 ? 144 TYR A HB3  6  
ATOM 10213 H HD1  . TYR A 1 47  ? 9.119   -2.580  -7.511  1.00 0.00 ? 144 TYR A HD1  6  
ATOM 10214 H HD2  . TYR A 1 47  ? 6.802   -6.049  -8.333  1.00 0.00 ? 144 TYR A HD2  6  
ATOM 10215 H HE1  . TYR A 1 47  ? 9.516   -2.265  -9.916  1.00 0.00 ? 144 TYR A HE1  6  
ATOM 10216 H HE2  . TYR A 1 47  ? 7.189   -5.743  -10.741 1.00 0.00 ? 144 TYR A HE2  6  
ATOM 10217 H HH   . TYR A 1 47  ? 9.543   -3.704  -11.973 1.00 0.00 ? 144 TYR A HH   6  
ATOM 10218 N N    . GLU A 1 48  ? 8.763   -4.552  -3.251  1.00 0.00 ? 145 GLU A N    6  
ATOM 10219 C CA   . GLU A 1 48  ? 8.509   -4.710  -1.831  1.00 0.00 ? 145 GLU A CA   6  
ATOM 10220 C C    . GLU A 1 48  ? 7.765   -3.485  -1.311  1.00 0.00 ? 145 GLU A C    6  
ATOM 10221 O O    . GLU A 1 48  ? 8.137   -2.355  -1.623  1.00 0.00 ? 145 GLU A O    6  
ATOM 10222 C CB   . GLU A 1 48  ? 9.840   -4.891  -1.105  1.00 0.00 ? 145 GLU A CB   6  
ATOM 10223 C CG   . GLU A 1 48  ? 9.718   -5.300  0.348   1.00 0.00 ? 145 GLU A CG   6  
ATOM 10224 C CD   . GLU A 1 48  ? 11.073  -5.562  0.964   1.00 0.00 ? 145 GLU A CD   6  
ATOM 10225 O OE1  . GLU A 1 48  ? 11.833  -4.593  1.174   1.00 0.00 ? 145 GLU A OE1  6  
ATOM 10226 O OE2  . GLU A 1 48  ? 11.403  -6.744  1.204   1.00 0.00 ? 145 GLU A OE2  6  
ATOM 10227 H H    . GLU A 1 48  ? 9.120   -3.696  -3.578  1.00 0.00 ? 145 GLU A H    6  
ATOM 10228 H HA   . GLU A 1 48  ? 7.897   -5.587  -1.689  1.00 0.00 ? 145 GLU A HA   6  
ATOM 10229 H HB2  . GLU A 1 48  ? 10.413  -5.648  -1.617  1.00 0.00 ? 145 GLU A HB2  6  
ATOM 10230 H HB3  . GLU A 1 48  ? 10.383  -3.959  -1.145  1.00 0.00 ? 145 GLU A HB3  6  
ATOM 10231 H HG2  . GLU A 1 48  ? 9.229   -4.511  0.897   1.00 0.00 ? 145 GLU A HG2  6  
ATOM 10232 H HG3  . GLU A 1 48  ? 9.128   -6.201  0.410   1.00 0.00 ? 145 GLU A HG3  6  
ATOM 10233 N N    . ILE A 1 49  ? 6.711   -3.709  -0.537  1.00 0.00 ? 146 ILE A N    6  
ATOM 10234 C CA   . ILE A 1 49  ? 5.852   -2.623  -0.082  1.00 0.00 ? 146 ILE A CA   6  
ATOM 10235 C C    . ILE A 1 49  ? 5.956   -2.453  1.430   1.00 0.00 ? 146 ILE A C    6  
ATOM 10236 O O    . ILE A 1 49  ? 5.864   -3.424  2.180   1.00 0.00 ? 146 ILE A O    6  
ATOM 10237 C CB   . ILE A 1 49  ? 4.364   -2.862  -0.467  1.00 0.00 ? 146 ILE A CB   6  
ATOM 10238 C CG1  . ILE A 1 49  ? 4.205   -3.071  -1.976  1.00 0.00 ? 146 ILE A CG1  6  
ATOM 10239 C CG2  . ILE A 1 49  ? 3.489   -1.698  -0.020  1.00 0.00 ? 146 ILE A CG2  6  
ATOM 10240 C CD1  . ILE A 1 49  ? 4.540   -4.469  -2.447  1.00 0.00 ? 146 ILE A CD1  6  
ATOM 10241 H H    . ILE A 1 49  ? 6.505   -4.631  -0.258  1.00 0.00 ? 146 ILE A H    6  
ATOM 10242 H HA   . ILE A 1 49  ? 6.185   -1.714  -0.560  1.00 0.00 ? 146 ILE A HA   6  
ATOM 10243 H HB   . ILE A 1 49  ? 4.025   -3.750  0.047   1.00 0.00 ? 146 ILE A HB   6  
ATOM 10244 H HG12 . ILE A 1 49  ? 3.181   -2.869  -2.253  1.00 0.00 ? 146 ILE A HG12 6  
ATOM 10245 H HG13 . ILE A 1 49  ? 4.852   -2.381  -2.497  1.00 0.00 ? 146 ILE A HG13 6  
ATOM 10246 H HG21 . ILE A 1 49  ? 3.784   -0.804  -0.550  1.00 0.00 ? 146 ILE A HG21 6  
ATOM 10247 H HG22 . ILE A 1 49  ? 3.609   -1.544  1.041   1.00 0.00 ? 146 ILE A HG22 6  
ATOM 10248 H HG23 . ILE A 1 49  ? 2.455   -1.922  -0.238  1.00 0.00 ? 146 ILE A HG23 6  
ATOM 10249 H HD11 . ILE A 1 49  ? 4.427   -4.525  -3.519  1.00 0.00 ? 146 ILE A HD11 6  
ATOM 10250 H HD12 . ILE A 1 49  ? 3.873   -5.177  -1.977  1.00 0.00 ? 146 ILE A HD12 6  
ATOM 10251 H HD13 . ILE A 1 49  ? 5.560   -4.704  -2.180  1.00 0.00 ? 146 ILE A HD13 6  
ATOM 10252 N N    . ARG A 1 50  ? 6.149   -1.220  1.870   1.00 0.00 ? 147 ARG A N    6  
ATOM 10253 C CA   . ARG A 1 50  ? 6.212   -0.913  3.290   1.00 0.00 ? 147 ARG A CA   6  
ATOM 10254 C C    . ARG A 1 50  ? 5.084   0.038   3.650   1.00 0.00 ? 147 ARG A C    6  
ATOM 10255 O O    . ARG A 1 50  ? 5.000   1.135   3.106   1.00 0.00 ? 147 ARG A O    6  
ATOM 10256 C CB   . ARG A 1 50  ? 7.560   -0.279  3.651   1.00 0.00 ? 147 ARG A CB   6  
ATOM 10257 C CG   . ARG A 1 50  ? 7.804   -0.179  5.147   1.00 0.00 ? 147 ARG A CG   6  
ATOM 10258 C CD   . ARG A 1 50  ? 9.136   0.486   5.472   1.00 0.00 ? 147 ARG A CD   6  
ATOM 10259 N NE   . ARG A 1 50  ? 9.103   1.936   5.276   1.00 0.00 ? 147 ARG A NE   6  
ATOM 10260 C CZ   . ARG A 1 50  ? 9.779   2.805   6.032   1.00 0.00 ? 147 ARG A CZ   6  
ATOM 10261 N NH1  . ARG A 1 50  ? 10.574  2.368   7.002   1.00 0.00 ? 147 ARG A NH1  6  
ATOM 10262 N NH2  . ARG A 1 50  ? 9.665   4.114   5.811   1.00 0.00 ? 147 ARG A NH2  6  
ATOM 10263 H H    . ARG A 1 50  ? 6.230   -0.488  1.218   1.00 0.00 ? 147 ARG A H    6  
ATOM 10264 H HA   . ARG A 1 50  ? 6.090   -1.834  3.840   1.00 0.00 ? 147 ARG A HA   6  
ATOM 10265 H HB2  . ARG A 1 50  ? 8.351   -0.874  3.218   1.00 0.00 ? 147 ARG A HB2  6  
ATOM 10266 H HB3  . ARG A 1 50  ? 7.599   0.715   3.234   1.00 0.00 ? 147 ARG A HB3  6  
ATOM 10267 H HG2  . ARG A 1 50  ? 7.012   0.402   5.588   1.00 0.00 ? 147 ARG A HG2  6  
ATOM 10268 H HG3  . ARG A 1 50  ? 7.797   -1.174  5.566   1.00 0.00 ? 147 ARG A HG3  6  
ATOM 10269 H HD2  . ARG A 1 50  ? 9.380   0.279   6.502   1.00 0.00 ? 147 ARG A HD2  6  
ATOM 10270 H HD3  . ARG A 1 50  ? 9.898   0.063   4.832   1.00 0.00 ? 147 ARG A HD3  6  
ATOM 10271 H HE   . ARG A 1 50  ? 8.538   2.282   4.548   1.00 0.00 ? 147 ARG A HE   6  
ATOM 10272 H HH11 . ARG A 1 50  ? 10.672  1.384   7.169   1.00 0.00 ? 147 ARG A HH11 6  
ATOM 10273 H HH12 . ARG A 1 50  ? 11.078  3.020   7.575   1.00 0.00 ? 147 ARG A HH12 6  
ATOM 10274 H HH21 . ARG A 1 50  ? 9.066   4.452   5.070   1.00 0.00 ? 147 ARG A HH21 6  
ATOM 10275 H HH22 . ARG A 1 50  ? 10.170  4.770   6.379   1.00 0.00 ? 147 ARG A HH22 6  
ATOM 10276 N N    . LEU A 1 51  ? 4.218   -0.379  4.552   1.00 0.00 ? 148 LEU A N    6  
ATOM 10277 C CA   . LEU A 1 51  ? 3.082   0.442   4.933   1.00 0.00 ? 148 LEU A CA   6  
ATOM 10278 C C    . LEU A 1 51  ? 2.752   0.257   6.405   1.00 0.00 ? 148 LEU A C    6  
ATOM 10279 O O    . LEU A 1 51  ? 3.173   -0.719  7.023   1.00 0.00 ? 148 LEU A O    6  
ATOM 10280 C CB   . LEU A 1 51  ? 1.850   0.166   4.029   1.00 0.00 ? 148 LEU A CB   6  
ATOM 10281 C CG   . LEU A 1 51  ? 1.141   -1.209  4.119   1.00 0.00 ? 148 LEU A CG   6  
ATOM 10282 C CD1  . LEU A 1 51  ? 2.117   -2.371  4.025   1.00 0.00 ? 148 LEU A CD1  6  
ATOM 10283 C CD2  . LEU A 1 51  ? 0.284   -1.320  5.375   1.00 0.00 ? 148 LEU A CD2  6  
ATOM 10284 H H    . LEU A 1 51  ? 4.349   -1.255  4.981   1.00 0.00 ? 148 LEU A H    6  
ATOM 10285 H HA   . LEU A 1 51  ? 3.379   1.470   4.791   1.00 0.00 ? 148 LEU A HA   6  
ATOM 10286 H HB2  . LEU A 1 51  ? 1.113   0.921   4.248   1.00 0.00 ? 148 LEU A HB2  6  
ATOM 10287 H HB3  . LEU A 1 51  ? 2.167   0.303   3.004   1.00 0.00 ? 148 LEU A HB3  6  
ATOM 10288 H HG   . LEU A 1 51  ? 0.474   -1.294  3.274   1.00 0.00 ? 148 LEU A HG   6  
ATOM 10289 H HD11 . LEU A 1 51  ? 1.574   -3.304  4.081   1.00 0.00 ? 148 LEU A HD11 6  
ATOM 10290 H HD12 . LEU A 1 51  ? 2.823   -2.316  4.841   1.00 0.00 ? 148 LEU A HD12 6  
ATOM 10291 H HD13 . LEU A 1 51  ? 2.648   -2.319  3.087   1.00 0.00 ? 148 LEU A HD13 6  
ATOM 10292 H HD21 . LEU A 1 51  ? 0.912   -1.223  6.249   1.00 0.00 ? 148 LEU A HD21 6  
ATOM 10293 H HD22 . LEU A 1 51  ? -0.210  -2.280  5.392   1.00 0.00 ? 148 LEU A HD22 6  
ATOM 10294 H HD23 . LEU A 1 51  ? -0.456  -0.534  5.375   1.00 0.00 ? 148 LEU A HD23 6  
ATOM 10295 N N    . LYS A 1 52  ? 2.028   1.215   6.962   1.00 0.00 ? 149 LYS A N    6  
ATOM 10296 C CA   . LYS A 1 52  ? 1.570   1.136   8.340   1.00 0.00 ? 149 LYS A CA   6  
ATOM 10297 C C    . LYS A 1 52  ? 0.563   2.246   8.606   1.00 0.00 ? 149 LYS A C    6  
ATOM 10298 O O    . LYS A 1 52  ? 0.645   3.322   8.009   1.00 0.00 ? 149 LYS A O    6  
ATOM 10299 C CB   . LYS A 1 52  ? 2.746   1.255   9.323   1.00 0.00 ? 149 LYS A CB   6  
ATOM 10300 C CG   . LYS A 1 52  ? 3.267   2.674   9.503   1.00 0.00 ? 149 LYS A CG   6  
ATOM 10301 C CD   . LYS A 1 52  ? 4.332   2.743   10.584  1.00 0.00 ? 149 LYS A CD   6  
ATOM 10302 C CE   . LYS A 1 52  ? 4.715   4.180   10.898  1.00 0.00 ? 149 LYS A CE   6  
ATOM 10303 N NZ   . LYS A 1 52  ? 3.602   4.927   11.547  1.00 0.00 ? 149 LYS A NZ   6  
ATOM 10304 H H    . LYS A 1 52  ? 1.794   2.006   6.426   1.00 0.00 ? 149 LYS A H    6  
ATOM 10305 H HA   . LYS A 1 52  ? 1.086   0.180   8.476   1.00 0.00 ? 149 LYS A HA   6  
ATOM 10306 H HB2  . LYS A 1 52  ? 2.429   0.887   10.287  1.00 0.00 ? 149 LYS A HB2  6  
ATOM 10307 H HB3  . LYS A 1 52  ? 3.559   0.639   8.966   1.00 0.00 ? 149 LYS A HB3  6  
ATOM 10308 H HG2  . LYS A 1 52  ? 3.693   3.011   8.570   1.00 0.00 ? 149 LYS A HG2  6  
ATOM 10309 H HG3  . LYS A 1 52  ? 2.442   3.317   9.778   1.00 0.00 ? 149 LYS A HG3  6  
ATOM 10310 H HD2  . LYS A 1 52  ? 3.951   2.279   11.481  1.00 0.00 ? 149 LYS A HD2  6  
ATOM 10311 H HD3  . LYS A 1 52  ? 5.209   2.212   10.245  1.00 0.00 ? 149 LYS A HD3  6  
ATOM 10312 H HE2  . LYS A 1 52  ? 5.568   4.175   11.561  1.00 0.00 ? 149 LYS A HE2  6  
ATOM 10313 H HE3  . LYS A 1 52  ? 4.981   4.676   9.976   1.00 0.00 ? 149 LYS A HE3  6  
ATOM 10314 H HZ1  . LYS A 1 52  ? 3.871   5.923   11.683  1.00 0.00 ? 149 LYS A HZ1  6  
ATOM 10315 H HZ2  . LYS A 1 52  ? 3.384   4.508   12.478  1.00 0.00 ? 149 LYS A HZ2  6  
ATOM 10316 H HZ3  . LYS A 1 52  ? 2.749   4.891   10.955  1.00 0.00 ? 149 LYS A HZ3  6  
ATOM 10317 N N    . PRO A 1 53  ? -0.418  1.995   9.481   1.00 0.00 ? 150 PRO A N    6  
ATOM 10318 C CA   . PRO A 1 53  ? -1.353  3.026   9.913   1.00 0.00 ? 150 PRO A CA   6  
ATOM 10319 C C    . PRO A 1 53  ? -0.678  4.066   10.803  1.00 0.00 ? 150 PRO A C    6  
ATOM 10320 O O    . PRO A 1 53  ? 0.450   3.873   11.268  1.00 0.00 ? 150 PRO A O    6  
ATOM 10321 C CB   . PRO A 1 53  ? -2.416  2.253   10.698  1.00 0.00 ? 150 PRO A CB   6  
ATOM 10322 C CG   . PRO A 1 53  ? -1.734  1.006   11.145  1.00 0.00 ? 150 PRO A CG   6  
ATOM 10323 C CD   . PRO A 1 53  ? -0.710  0.684   10.091  1.00 0.00 ? 150 PRO A CD   6  
ATOM 10324 H HA   . PRO A 1 53  ? -1.813  3.521   9.070   1.00 0.00 ? 150 PRO A HA   6  
ATOM 10325 H HB2  . PRO A 1 53  ? -2.747  2.846   11.539  1.00 0.00 ? 150 PRO A HB2  6  
ATOM 10326 H HB3  . PRO A 1 53  ? -3.254  2.034   10.054  1.00 0.00 ? 150 PRO A HB3  6  
ATOM 10327 H HG2  . PRO A 1 53  ? -1.254  1.173   12.097  1.00 0.00 ? 150 PRO A HG2  6  
ATOM 10328 H HG3  . PRO A 1 53  ? -2.453  0.204   11.224  1.00 0.00 ? 150 PRO A HG3  6  
ATOM 10329 H HD2  . PRO A 1 53  ? 0.177   0.265   10.544  1.00 0.00 ? 150 PRO A HD2  6  
ATOM 10330 H HD3  . PRO A 1 53  ? -1.119  0.003   9.361   1.00 0.00 ? 150 PRO A HD3  6  
ATOM 10331 N N    . GLU A 1 54  ? -1.370  5.167   11.029  1.00 0.00 ? 151 GLU A N    6  
ATOM 10332 C CA   . GLU A 1 54  ? -0.870  6.244   11.871  1.00 0.00 ? 151 GLU A CA   6  
ATOM 10333 C C    . GLU A 1 54  ? -0.644  5.766   13.304  1.00 0.00 ? 151 GLU A C    6  
ATOM 10334 O O    . GLU A 1 54  ? 0.240   6.261   14.002  1.00 0.00 ? 151 GLU A O    6  
ATOM 10335 C CB   . GLU A 1 54  ? -1.861  7.408   11.856  1.00 0.00 ? 151 GLU A CB   6  
ATOM 10336 C CG   . GLU A 1 54  ? -3.273  6.998   12.246  1.00 0.00 ? 151 GLU A CG   6  
ATOM 10337 C CD   . GLU A 1 54  ? -4.234  8.163   12.303  1.00 0.00 ? 151 GLU A CD   6  
ATOM 10338 O OE1  . GLU A 1 54  ? -4.184  8.928   13.288  1.00 0.00 ? 151 GLU A OE1  6  
ATOM 10339 O OE2  . GLU A 1 54  ? -5.051  8.313   11.371  1.00 0.00 ? 151 GLU A OE2  6  
ATOM 10340 H H    . GLU A 1 54  ? -2.246  5.271   10.594  1.00 0.00 ? 151 GLU A H    6  
ATOM 10341 H HA   . GLU A 1 54  ? 0.071   6.575   11.463  1.00 0.00 ? 151 GLU A HA   6  
ATOM 10342 H HB2  . GLU A 1 54  ? -1.522  8.165   12.550  1.00 0.00 ? 151 GLU A HB2  6  
ATOM 10343 H HB3  . GLU A 1 54  ? -1.891  7.829   10.862  1.00 0.00 ? 151 GLU A HB3  6  
ATOM 10344 H HG2  . GLU A 1 54  ? -3.640  6.287   11.520  1.00 0.00 ? 151 GLU A HG2  6  
ATOM 10345 H HG3  . GLU A 1 54  ? -3.240  6.530   13.219  1.00 0.00 ? 151 GLU A HG3  6  
ATOM 10346 N N    . LYS A 1 55  ? -1.433  4.784   13.726  1.00 0.00 ? 152 LYS A N    6  
ATOM 10347 C CA   . LYS A 1 55  ? -1.357  4.273   15.088  1.00 0.00 ? 152 LYS A CA   6  
ATOM 10348 C C    . LYS A 1 55  ? -0.295  3.181   15.201  1.00 0.00 ? 152 LYS A C    6  
ATOM 10349 O O    . LYS A 1 55  ? -0.165  2.531   16.236  1.00 0.00 ? 152 LYS A O    6  
ATOM 10350 C CB   . LYS A 1 55  ? -2.716  3.720   15.527  1.00 0.00 ? 152 LYS A CB   6  
ATOM 10351 C CG   . LYS A 1 55  ? -3.885  4.662   15.271  1.00 0.00 ? 152 LYS A CG   6  
ATOM 10352 C CD   . LYS A 1 55  ? -3.700  6.012   15.951  1.00 0.00 ? 152 LYS A CD   6  
ATOM 10353 C CE   . LYS A 1 55  ? -4.897  6.920   15.706  1.00 0.00 ? 152 LYS A CE   6  
ATOM 10354 N NZ   . LYS A 1 55  ? -4.691  8.286   16.254  1.00 0.00 ? 152 LYS A NZ   6  
ATOM 10355 H H    . LYS A 1 55  ? -2.085  4.397   13.108  1.00 0.00 ? 152 LYS A H    6  
ATOM 10356 H HA   . LYS A 1 55  ? -1.085  5.093   15.735  1.00 0.00 ? 152 LYS A HA   6  
ATOM 10357 H HB2  . LYS A 1 55  ? -2.903  2.799   14.995  1.00 0.00 ? 152 LYS A HB2  6  
ATOM 10358 H HB3  . LYS A 1 55  ? -2.678  3.510   16.586  1.00 0.00 ? 152 LYS A HB3  6  
ATOM 10359 H HG2  . LYS A 1 55  ? -3.977  4.819   14.208  1.00 0.00 ? 152 LYS A HG2  6  
ATOM 10360 H HG3  . LYS A 1 55  ? -4.789  4.203   15.645  1.00 0.00 ? 152 LYS A HG3  6  
ATOM 10361 H HD2  . LYS A 1 55  ? -3.587  5.857   17.014  1.00 0.00 ? 152 LYS A HD2  6  
ATOM 10362 H HD3  . LYS A 1 55  ? -2.813  6.486   15.557  1.00 0.00 ? 152 LYS A HD3  6  
ATOM 10363 H HE2  . LYS A 1 55  ? -5.066  6.993   14.642  1.00 0.00 ? 152 LYS A HE2  6  
ATOM 10364 H HE3  . LYS A 1 55  ? -5.762  6.482   16.175  1.00 0.00 ? 152 LYS A HE3  6  
ATOM 10365 H HZ1  . LYS A 1 55  ? -3.912  8.759   15.754  1.00 0.00 ? 152 LYS A HZ1  6  
ATOM 10366 H HZ2  . LYS A 1 55  ? -4.462  8.236   17.266  1.00 0.00 ? 152 LYS A HZ2  6  
ATOM 10367 H HZ3  . LYS A 1 55  ? -5.556  8.852   16.136  1.00 0.00 ? 152 LYS A HZ3  6  
ATOM 10368 N N    . ALA A 1 56  ? 0.461   2.981   14.132  1.00 0.00 ? 153 ALA A N    6  
ATOM 10369 C CA   . ALA A 1 56  ? 1.482   1.945   14.107  1.00 0.00 ? 153 ALA A CA   6  
ATOM 10370 C C    . ALA A 1 56  ? 2.841   2.507   14.486  1.00 0.00 ? 153 ALA A C    6  
ATOM 10371 O O    . ALA A 1 56  ? 3.277   3.526   13.943  1.00 0.00 ? 153 ALA A O    6  
ATOM 10372 C CB   . ALA A 1 56  ? 1.551   1.308   12.734  1.00 0.00 ? 153 ALA A CB   6  
ATOM 10373 H H    . ALA A 1 56  ? 0.336   3.549   13.342  1.00 0.00 ? 153 ALA A H    6  
ATOM 10374 H HA   . ALA A 1 56  ? 1.202   1.183   14.821  1.00 0.00 ? 153 ALA A HA   6  
ATOM 10375 H HB1  . ALA A 1 56  ? 2.376   0.612   12.702  1.00 0.00 ? 153 ALA A HB1  6  
ATOM 10376 H HB2  . ALA A 1 56  ? 1.698   2.076   11.989  1.00 0.00 ? 153 ALA A HB2  6  
ATOM 10377 H HB3  . ALA A 1 56  ? 0.630   0.783   12.534  1.00 0.00 ? 153 ALA A HB3  6  
ATOM 10378 N N    . ALA A 1 57  ? 3.512   1.829   15.407  1.00 0.00 ? 154 ALA A N    6  
ATOM 10379 C CA   . ALA A 1 57  ? 4.825   2.254   15.868  1.00 0.00 ? 154 ALA A CA   6  
ATOM 10380 C C    . ALA A 1 57  ? 5.922   1.684   14.979  1.00 0.00 ? 154 ALA A C    6  
ATOM 10381 O O    . ALA A 1 57  ? 7.003   2.257   14.863  1.00 0.00 ? 154 ALA A O    6  
ATOM 10382 C CB   . ALA A 1 57  ? 5.045   1.830   17.311  1.00 0.00 ? 154 ALA A CB   6  
ATOM 10383 H H    . ALA A 1 57  ? 3.111   1.016   15.787  1.00 0.00 ? 154 ALA A H    6  
ATOM 10384 H HA   . ALA A 1 57  ? 4.863   3.333   15.823  1.00 0.00 ? 154 ALA A HA   6  
ATOM 10385 H HB1  . ALA A 1 57  ? 4.253   2.229   17.928  1.00 0.00 ? 154 ALA A HB1  6  
ATOM 10386 H HB2  . ALA A 1 57  ? 5.996   2.206   17.656  1.00 0.00 ? 154 ALA A HB2  6  
ATOM 10387 H HB3  . ALA A 1 57  ? 5.040   0.752   17.373  1.00 0.00 ? 154 ALA A HB3  6  
ATOM 10388 N N    . GLU A 1 58  ? 5.636   0.550   14.354  1.00 0.00 ? 155 GLU A N    6  
ATOM 10389 C CA   . GLU A 1 58  ? 6.597   -0.103  13.477  1.00 0.00 ? 155 GLU A CA   6  
ATOM 10390 C C    . GLU A 1 58  ? 5.997   -0.301  12.089  1.00 0.00 ? 155 GLU A C    6  
ATOM 10391 O O    . GLU A 1 58  ? 4.781   -0.448  11.943  1.00 0.00 ? 155 GLU A O    6  
ATOM 10392 C CB   . GLU A 1 58  ? 7.034   -1.446  14.072  1.00 0.00 ? 155 GLU A CB   6  
ATOM 10393 C CG   . GLU A 1 58  ? 5.884   -2.390  14.387  1.00 0.00 ? 155 GLU A CG   6  
ATOM 10394 C CD   . GLU A 1 58  ? 6.357   -3.689  15.005  1.00 0.00 ? 155 GLU A CD   6  
ATOM 10395 O OE1  . GLU A 1 58  ? 6.606   -3.714  16.228  1.00 0.00 ? 155 GLU A OE1  6  
ATOM 10396 O OE2  . GLU A 1 58  ? 6.489   -4.691  14.269  1.00 0.00 ? 155 GLU A OE2  6  
ATOM 10397 H H    . GLU A 1 58  ? 4.754   0.142   14.482  1.00 0.00 ? 155 GLU A H    6  
ATOM 10398 H HA   . GLU A 1 58  ? 7.459   0.542   13.393  1.00 0.00 ? 155 GLU A HA   6  
ATOM 10399 H HB2  . GLU A 1 58  ? 7.692   -1.938  13.372  1.00 0.00 ? 155 GLU A HB2  6  
ATOM 10400 H HB3  . GLU A 1 58  ? 7.576   -1.257  14.988  1.00 0.00 ? 155 GLU A HB3  6  
ATOM 10401 H HG2  . GLU A 1 58  ? 5.212   -1.903  15.078  1.00 0.00 ? 155 GLU A HG2  6  
ATOM 10402 H HG3  . GLU A 1 58  ? 5.358   -2.614  13.470  1.00 0.00 ? 155 GLU A HG3  6  
ATOM 10403 N N    . TRP A 1 59  ? 6.854   -0.290  11.078  1.00 0.00 ? 156 TRP A N    6  
ATOM 10404 C CA   . TRP A 1 59  ? 6.413   -0.424  9.698   1.00 0.00 ? 156 TRP A CA   6  
ATOM 10405 C C    . TRP A 1 59  ? 6.194   -1.880  9.321   1.00 0.00 ? 156 TRP A C    6  
ATOM 10406 O O    . TRP A 1 59  ? 6.910   -2.766  9.787   1.00 0.00 ? 156 TRP A O    6  
ATOM 10407 C CB   . TRP A 1 59  ? 7.439   0.183   8.749   1.00 0.00 ? 156 TRP A CB   6  
ATOM 10408 C CG   . TRP A 1 59  ? 7.430   1.679   8.714   1.00 0.00 ? 156 TRP A CG   6  
ATOM 10409 C CD1  . TRP A 1 59  ? 8.124   2.531   9.521   1.00 0.00 ? 156 TRP A CD1  6  
ATOM 10410 C CD2  . TRP A 1 59  ? 6.693   2.496   7.802   1.00 0.00 ? 156 TRP A CD2  6  
ATOM 10411 N NE1  . TRP A 1 59  ? 7.868   3.832   9.160   1.00 0.00 ? 156 TRP A NE1  6  
ATOM 10412 C CE2  . TRP A 1 59  ? 6.992   3.836   8.107   1.00 0.00 ? 156 TRP A CE2  6  
ATOM 10413 C CE3  . TRP A 1 59  ? 5.812   2.221   6.755   1.00 0.00 ? 156 TRP A CE3  6  
ATOM 10414 C CZ2  . TRP A 1 59  ? 6.438   4.900   7.398   1.00 0.00 ? 156 TRP A CZ2  6  
ATOM 10415 C CZ3  . TRP A 1 59  ? 5.265   3.276   6.053   1.00 0.00 ? 156 TRP A CZ3  6  
ATOM 10416 C CH2  . TRP A 1 59  ? 5.582   4.600   6.377   1.00 0.00 ? 156 TRP A CH2  6  
ATOM 10417 H H    . TRP A 1 59  ? 7.813   -0.196  11.265  1.00 0.00 ? 156 TRP A H    6  
ATOM 10418 H HA   . TRP A 1 59  ? 5.481   0.108   9.592   1.00 0.00 ? 156 TRP A HA   6  
ATOM 10419 H HB2  . TRP A 1 59  ? 8.425   -0.135  9.050   1.00 0.00 ? 156 TRP A HB2  6  
ATOM 10420 H HB3  . TRP A 1 59  ? 7.245   -0.174  7.749   1.00 0.00 ? 156 TRP A HB3  6  
ATOM 10421 H HD1  . TRP A 1 59  ? 8.778   2.218   10.321  1.00 0.00 ? 156 TRP A HD1  6  
ATOM 10422 H HE1  . TRP A 1 59  ? 8.254   4.630   9.587   1.00 0.00 ? 156 TRP A HE1  6  
ATOM 10423 H HE3  . TRP A 1 59  ? 5.554   1.201   6.497   1.00 0.00 ? 156 TRP A HE3  6  
ATOM 10424 H HZ2  . TRP A 1 59  ? 6.671   5.928   7.633   1.00 0.00 ? 156 TRP A HZ2  6  
ATOM 10425 H HZ3  . TRP A 1 59  ? 4.582   3.085   5.240   1.00 0.00 ? 156 TRP A HZ3  6  
ATOM 10426 H HH2  . TRP A 1 59  ? 5.132   5.394   5.802   1.00 0.00 ? 156 TRP A HH2  6  
ATOM 10427 N N    . GLU A 1 60  ? 5.210   -2.113  8.470   1.00 0.00 ? 157 GLU A N    6  
ATOM 10428 C CA   . GLU A 1 60  ? 4.945   -3.439  7.950   1.00 0.00 ? 157 GLU A CA   6  
ATOM 10429 C C    . GLU A 1 60  ? 5.556   -3.599  6.567   1.00 0.00 ? 157 GLU A C    6  
ATOM 10430 O O    . GLU A 1 60  ? 5.204   -2.873  5.634   1.00 0.00 ? 157 GLU A O    6  
ATOM 10431 C CB   . GLU A 1 60  ? 3.445   -3.692  7.868   1.00 0.00 ? 157 GLU A CB   6  
ATOM 10432 C CG   . GLU A 1 60  ? 2.790   -3.974  9.207   1.00 0.00 ? 157 GLU A CG   6  
ATOM 10433 C CD   . GLU A 1 60  ? 1.333   -4.352  9.053   1.00 0.00 ? 157 GLU A CD   6  
ATOM 10434 O OE1  . GLU A 1 60  ? 1.038   -5.264  8.249   1.00 0.00 ? 157 GLU A OE1  6  
ATOM 10435 O OE2  . GLU A 1 60  ? 0.474   -3.745  9.725   1.00 0.00 ? 157 GLU A OE2  6  
ATOM 10436 H H    . GLU A 1 60  ? 4.640   -1.366  8.178   1.00 0.00 ? 157 GLU A H    6  
ATOM 10437 H HA   . GLU A 1 60  ? 5.391   -4.159  8.618   1.00 0.00 ? 157 GLU A HA   6  
ATOM 10438 H HB2  . GLU A 1 60  ? 2.974   -2.818  7.440   1.00 0.00 ? 157 GLU A HB2  6  
ATOM 10439 H HB3  . GLU A 1 60  ? 3.269   -4.537  7.220   1.00 0.00 ? 157 GLU A HB3  6  
ATOM 10440 H HG2  . GLU A 1 60  ? 3.315   -4.787  9.686   1.00 0.00 ? 157 GLU A HG2  6  
ATOM 10441 H HG3  . GLU A 1 60  ? 2.857   -3.088  9.821   1.00 0.00 ? 157 GLU A HG3  6  
ATOM 10442 N N    . ILE A 1 61  ? 6.471   -4.541  6.439   1.00 0.00 ? 158 ILE A N    6  
ATOM 10443 C CA   . ILE A 1 61  ? 7.084   -4.835  5.155   1.00 0.00 ? 158 ILE A CA   6  
ATOM 10444 C C    . ILE A 1 61  ? 6.394   -6.037  4.522   1.00 0.00 ? 158 ILE A C    6  
ATOM 10445 O O    . ILE A 1 61  ? 6.417   -7.143  5.067   1.00 0.00 ? 158 ILE A O    6  
ATOM 10446 C CB   . ILE A 1 61  ? 8.611   -5.098  5.272   1.00 0.00 ? 158 ILE A CB   6  
ATOM 10447 C CG1  . ILE A 1 61  ? 9.390   -3.785  5.447   1.00 0.00 ? 158 ILE A CG1  6  
ATOM 10448 C CG2  . ILE A 1 61  ? 9.130   -5.844  4.048   1.00 0.00 ? 158 ILE A CG2  6  
ATOM 10449 C CD1  . ILE A 1 61  ? 9.138   -3.069  6.757   1.00 0.00 ? 158 ILE A CD1  6  
ATOM 10450 H H    . ILE A 1 61  ? 6.734   -5.064  7.228   1.00 0.00 ? 158 ILE A H    6  
ATOM 10451 H HA   . ILE A 1 61  ? 6.935   -3.975  4.514   1.00 0.00 ? 158 ILE A HA   6  
ATOM 10452 H HB   . ILE A 1 61  ? 8.777   -5.721  6.138   1.00 0.00 ? 158 ILE A HB   6  
ATOM 10453 H HG12 . ILE A 1 61  ? 10.445  -3.996  5.389   1.00 0.00 ? 158 ILE A HG12 6  
ATOM 10454 H HG13 . ILE A 1 61  ? 9.121   -3.111  4.645   1.00 0.00 ? 158 ILE A HG13 6  
ATOM 10455 H HG21 . ILE A 1 61  ? 8.624   -6.794  3.964   1.00 0.00 ? 158 ILE A HG21 6  
ATOM 10456 H HG22 . ILE A 1 61  ? 10.192  -6.010  4.152   1.00 0.00 ? 158 ILE A HG22 6  
ATOM 10457 H HG23 . ILE A 1 61  ? 8.944   -5.257  3.161   1.00 0.00 ? 158 ILE A HG23 6  
ATOM 10458 H HD11 . ILE A 1 61  ? 8.091   -2.812  6.834   1.00 0.00 ? 158 ILE A HD11 6  
ATOM 10459 H HD12 . ILE A 1 61  ? 9.732   -2.167  6.790   1.00 0.00 ? 158 ILE A HD12 6  
ATOM 10460 H HD13 . ILE A 1 61  ? 9.414   -3.712  7.579   1.00 0.00 ? 158 ILE A HD13 6  
ATOM 10461 N N    . HIS A 1 62  ? 5.757   -5.806  3.386   1.00 0.00 ? 159 HIS A N    6  
ATOM 10462 C CA   . HIS A 1 62  ? 5.034   -6.849  2.678   1.00 0.00 ? 159 HIS A CA   6  
ATOM 10463 C C    . HIS A 1 62  ? 5.619   -7.039  1.286   1.00 0.00 ? 159 HIS A C    6  
ATOM 10464 O O    . HIS A 1 62  ? 5.556   -6.140  0.450   1.00 0.00 ? 159 HIS A O    6  
ATOM 10465 C CB   . HIS A 1 62  ? 3.545   -6.499  2.569   1.00 0.00 ? 159 HIS A CB   6  
ATOM 10466 C CG   . HIS A 1 62  ? 2.805   -6.512  3.874   1.00 0.00 ? 159 HIS A CG   6  
ATOM 10467 N ND1  . HIS A 1 62  ? 1.841   -7.449  4.183   1.00 0.00 ? 159 HIS A ND1  6  
ATOM 10468 C CD2  . HIS A 1 62  ? 2.866   -5.677  4.938   1.00 0.00 ? 159 HIS A CD2  6  
ATOM 10469 C CE1  . HIS A 1 62  ? 1.344   -7.187  5.377   1.00 0.00 ? 159 HIS A CE1  6  
ATOM 10470 N NE2  . HIS A 1 62  ? 1.948   -6.121  5.856   1.00 0.00 ? 159 HIS A NE2  6  
ATOM 10471 H H    . HIS A 1 62  ? 5.786   -4.898  2.999   1.00 0.00 ? 159 HIS A H    6  
ATOM 10472 H HA   . HIS A 1 62  ? 5.144   -7.766  3.235   1.00 0.00 ? 159 HIS A HA   6  
ATOM 10473 H HB2  . HIS A 1 62  ? 3.449   -5.511  2.148   1.00 0.00 ? 159 HIS A HB2  6  
ATOM 10474 H HB3  . HIS A 1 62  ? 3.067   -7.210  1.911   1.00 0.00 ? 159 HIS A HB3  6  
ATOM 10475 H HD1  . HIS A 1 62  ? 1.570   -8.205  3.618   1.00 0.00 ? 159 HIS A HD1  6  
ATOM 10476 H HD2  . HIS A 1 62  ? 3.519   -4.822  5.046   1.00 0.00 ? 159 HIS A HD2  6  
ATOM 10477 H HE1  . HIS A 1 62  ? 0.574   -7.751  5.875   1.00 0.00 ? 159 HIS A HE1  6  
ATOM 10478 H HE2  . HIS A 1 62  ? 1.716   -5.671  6.709   1.00 0.00 ? 159 HIS A HE2  6  
ATOM 10479 N N    . PHE A 1 63  ? 6.195   -8.204  1.049   1.00 0.00 ? 160 PHE A N    6  
ATOM 10480 C CA   . PHE A 1 63  ? 6.786   -8.516  -0.241  1.00 0.00 ? 160 PHE A CA   6  
ATOM 10481 C C    . PHE A 1 63  ? 5.697   -8.955  -1.218  1.00 0.00 ? 160 PHE A C    6  
ATOM 10482 O O    . PHE A 1 63  ? 4.834   -9.761  -0.870  1.00 0.00 ? 160 PHE A O    6  
ATOM 10483 C CB   . PHE A 1 63  ? 7.828   -9.620  -0.077  1.00 0.00 ? 160 PHE A CB   6  
ATOM 10484 C CG   . PHE A 1 63  ? 8.862   -9.621  -1.157  1.00 0.00 ? 160 PHE A CG   6  
ATOM 10485 C CD1  . PHE A 1 63  ? 9.861   -8.666  -1.159  1.00 0.00 ? 160 PHE A CD1  6  
ATOM 10486 C CD2  . PHE A 1 63  ? 8.834   -10.563 -2.170  1.00 0.00 ? 160 PHE A CD2  6  
ATOM 10487 C CE1  . PHE A 1 63  ? 10.818  -8.648  -2.148  1.00 0.00 ? 160 PHE A CE1  6  
ATOM 10488 C CE2  . PHE A 1 63  ? 9.791   -10.550 -3.164  1.00 0.00 ? 160 PHE A CE2  6  
ATOM 10489 C CZ   . PHE A 1 63  ? 10.785  -9.590  -3.152  1.00 0.00 ? 160 PHE A CZ   6  
ATOM 10490 H H    . PHE A 1 63  ? 6.229   -8.875  1.765   1.00 0.00 ? 160 PHE A H    6  
ATOM 10491 H HA   . PHE A 1 63  ? 7.267   -7.625  -0.621  1.00 0.00 ? 160 PHE A HA   6  
ATOM 10492 H HB2  . PHE A 1 63  ? 8.334   -9.492  0.869   1.00 0.00 ? 160 PHE A HB2  6  
ATOM 10493 H HB3  . PHE A 1 63  ? 7.332   -10.579 -0.088  1.00 0.00 ? 160 PHE A HB3  6  
ATOM 10494 H HD1  . PHE A 1 63  ? 9.889   -7.928  -0.371  1.00 0.00 ? 160 PHE A HD1  6  
ATOM 10495 H HD2  . PHE A 1 63  ? 8.058   -11.313 -2.178  1.00 0.00 ? 160 PHE A HD2  6  
ATOM 10496 H HE1  . PHE A 1 63  ? 11.591  -7.895  -2.134  1.00 0.00 ? 160 PHE A HE1  6  
ATOM 10497 H HE2  . PHE A 1 63  ? 9.761   -11.289 -3.950  1.00 0.00 ? 160 PHE A HE2  6  
ATOM 10498 H HZ   . PHE A 1 63  ? 11.535  -9.579  -3.928  1.00 0.00 ? 160 PHE A HZ   6  
ATOM 10499 N N    . ALA A 1 64  ? 5.726   -8.416  -2.431  1.00 0.00 ? 161 ALA A N    6  
ATOM 10500 C CA   . ALA A 1 64  ? 4.700   -8.726  -3.421  1.00 0.00 ? 161 ALA A CA   6  
ATOM 10501 C C    . ALA A 1 64  ? 5.194   -9.747  -4.434  1.00 0.00 ? 161 ALA A C    6  
ATOM 10502 O O    . ALA A 1 64  ? 4.540   -10.760 -4.680  1.00 0.00 ? 161 ALA A O    6  
ATOM 10503 C CB   . ALA A 1 64  ? 4.252   -7.463  -4.138  1.00 0.00 ? 161 ALA A CB   6  
ATOM 10504 H H    . ALA A 1 64  ? 6.453   -7.797  -2.667  1.00 0.00 ? 161 ALA A H    6  
ATOM 10505 H HA   . ALA A 1 64  ? 3.849   -9.136  -2.898  1.00 0.00 ? 161 ALA A HA   6  
ATOM 10506 H HB1  . ALA A 1 64  ? 3.891   -6.749  -3.415  1.00 0.00 ? 161 ALA A HB1  6  
ATOM 10507 H HB2  . ALA A 1 64  ? 3.459   -7.706  -4.831  1.00 0.00 ? 161 ALA A HB2  6  
ATOM 10508 H HB3  . ALA A 1 64  ? 5.085   -7.040  -4.679  1.00 0.00 ? 161 ALA A HB3  6  
ATOM 10509 N N    . GLY A 1 65  ? 6.348   -9.474  -5.018  1.00 0.00 ? 162 GLY A N    6  
ATOM 10510 C CA   . GLY A 1 65  ? 6.872   -10.324 -6.063  1.00 0.00 ? 162 GLY A CA   6  
ATOM 10511 C C    . GLY A 1 65  ? 7.223   -9.516  -7.290  1.00 0.00 ? 162 GLY A C    6  
ATOM 10512 O O    . GLY A 1 65  ? 7.691   -8.388  -7.168  1.00 0.00 ? 162 GLY A O    6  
ATOM 10513 H H    . GLY A 1 65  ? 6.851   -8.678  -4.741  1.00 0.00 ? 162 GLY A H    6  
ATOM 10514 H HA2  . GLY A 1 65  ? 7.758   -10.827 -5.702  1.00 0.00 ? 162 GLY A HA2  6  
ATOM 10515 H HA3  . GLY A 1 65  ? 6.129   -11.060 -6.326  1.00 0.00 ? 162 GLY A HA3  6  
ATOM 10516 N N    . GLN A 1 66  ? 6.979   -10.065 -8.469  1.00 0.00 ? 163 GLN A N    6  
ATOM 10517 C CA   . GLN A 1 66  ? 7.278   -9.354  -9.707  1.00 0.00 ? 163 GLN A CA   6  
ATOM 10518 C C    . GLN A 1 66  ? 6.034   -8.668  -10.261 1.00 0.00 ? 163 GLN A C    6  
ATOM 10519 O O    . GLN A 1 66  ? 5.963   -8.334  -11.445 1.00 0.00 ? 163 GLN A O    6  
ATOM 10520 C CB   . GLN A 1 66  ? 7.906   -10.294 -10.748 1.00 0.00 ? 163 GLN A CB   6  
ATOM 10521 C CG   . GLN A 1 66  ? 7.185   -11.623 -10.960 1.00 0.00 ? 163 GLN A CG   6  
ATOM 10522 C CD   . GLN A 1 66  ? 5.845   -11.491 -11.659 1.00 0.00 ? 163 GLN A CD   6  
ATOM 10523 O OE1  . GLN A 1 66  ? 4.805   -11.342 -11.017 1.00 0.00 ? 163 GLN A OE1  6  
ATOM 10524 N NE2  . GLN A 1 66  ? 5.861   -11.552 -12.980 1.00 0.00 ? 163 GLN A NE2  6  
ATOM 10525 H H    . GLN A 1 66  ? 6.580   -10.962 -8.510  1.00 0.00 ? 163 GLN A H    6  
ATOM 10526 H HA   . GLN A 1 66  ? 7.999   -8.587  -9.463  1.00 0.00 ? 163 GLN A HA   6  
ATOM 10527 H HB2  . GLN A 1 66  ? 7.934   -9.781  -11.696 1.00 0.00 ? 163 GLN A HB2  6  
ATOM 10528 H HB3  . GLN A 1 66  ? 8.920   -10.510 -10.445 1.00 0.00 ? 163 GLN A HB3  6  
ATOM 10529 H HG2  . GLN A 1 66  ? 7.817   -12.257 -11.563 1.00 0.00 ? 163 GLN A HG2  6  
ATOM 10530 H HG3  . GLN A 1 66  ? 7.030   -12.088 -9.997  1.00 0.00 ? 163 GLN A HG3  6  
ATOM 10531 H HE21 . GLN A 1 66  ? 6.723   -11.675 -13.429 1.00 0.00 ? 163 GLN A HE21 6  
ATOM 10532 H HE22 . GLN A 1 66  ? 5.009   -11.472 -13.457 1.00 0.00 ? 163 GLN A HE22 6  
ATOM 10533 N N    . GLN A 1 67  ? 5.058   -8.459  -9.394  1.00 0.00 ? 164 GLN A N    6  
ATOM 10534 C CA   . GLN A 1 67  ? 3.817   -7.809  -9.778  1.00 0.00 ? 164 GLN A CA   6  
ATOM 10535 C C    . GLN A 1 67  ? 3.814   -6.370  -9.283  1.00 0.00 ? 164 GLN A C    6  
ATOM 10536 O O    . GLN A 1 67  ? 4.324   -6.076  -8.201  1.00 0.00 ? 164 GLN A O    6  
ATOM 10537 C CB   . GLN A 1 67  ? 2.610   -8.571  -9.224  1.00 0.00 ? 164 GLN A CB   6  
ATOM 10538 C CG   . GLN A 1 67  ? 2.601   -8.703  -7.708  1.00 0.00 ? 164 GLN A CG   6  
ATOM 10539 C CD   . GLN A 1 67  ? 1.391   -9.459  -7.184  1.00 0.00 ? 164 GLN A CD   6  
ATOM 10540 O OE1  . GLN A 1 67  ? 1.464   -10.129 -6.155  1.00 0.00 ? 164 GLN A OE1  6  
ATOM 10541 N NE2  . GLN A 1 67  ? 0.268   -9.357  -7.880  1.00 0.00 ? 164 GLN A NE2  6  
ATOM 10542 H H    . GLN A 1 67  ? 5.187   -8.729  -8.464  1.00 0.00 ? 164 GLN A H    6  
ATOM 10543 H HA   . GLN A 1 67  ? 3.768   -7.805  -10.856 1.00 0.00 ? 164 GLN A HA   6  
ATOM 10544 H HB2  . GLN A 1 67  ? 1.711   -8.053  -9.521  1.00 0.00 ? 164 GLN A HB2  6  
ATOM 10545 H HB3  . GLN A 1 67  ? 2.599   -9.564  -9.649  1.00 0.00 ? 164 GLN A HB3  6  
ATOM 10546 H HG2  . GLN A 1 67  ? 3.493   -9.230  -7.403  1.00 0.00 ? 164 GLN A HG2  6  
ATOM 10547 H HG3  . GLN A 1 67  ? 2.604   -7.714  -7.275  1.00 0.00 ? 164 GLN A HG3  6  
ATOM 10548 H HE21 . GLN A 1 67  ? 0.271   -8.808  -8.690  1.00 0.00 ? 164 GLN A HE21 6  
ATOM 10549 H HE22 . GLN A 1 67  ? -0.525  -9.832  -7.553  1.00 0.00 ? 164 GLN A HE22 6  
ATOM 10550 N N    . THR A 1 68  ? 3.242   -5.477  -10.070 1.00 0.00 ? 165 THR A N    6  
ATOM 10551 C CA   . THR A 1 68  ? 3.274   -4.063  -9.751  1.00 0.00 ? 165 THR A CA   6  
ATOM 10552 C C    . THR A 1 68  ? 2.001   -3.614  -9.039  1.00 0.00 ? 165 THR A C    6  
ATOM 10553 O O    . THR A 1 68  ? 1.514   -2.501  -9.249  1.00 0.00 ? 165 THR A O    6  
ATOM 10554 C CB   . THR A 1 68  ? 3.494   -3.218  -11.016 1.00 0.00 ? 165 THR A CB   6  
ATOM 10555 O OG1  . THR A 1 68  ? 2.523   -3.559  -12.017 1.00 0.00 ? 165 THR A OG1  6  
ATOM 10556 C CG2  . THR A 1 68  ? 4.892   -3.437  -11.569 1.00 0.00 ? 165 THR A CG2  6  
ATOM 10557 H H    . THR A 1 68  ? 2.780   -5.774  -10.885 1.00 0.00 ? 165 THR A H    6  
ATOM 10558 H HA   . THR A 1 68  ? 4.113   -3.897  -9.090  1.00 0.00 ? 165 THR A HA   6  
ATOM 10559 H HB   . THR A 1 68  ? 3.386   -2.177  -10.751 1.00 0.00 ? 165 THR A HB   6  
ATOM 10560 H HG1  . THR A 1 68  ? 1.988   -2.782  -12.221 1.00 0.00 ? 165 THR A HG1  6  
ATOM 10561 H HG21 . THR A 1 68  ? 5.621   -3.094  -10.849 1.00 0.00 ? 165 THR A HG21 6  
ATOM 10562 H HG22 . THR A 1 68  ? 5.008   -2.882  -12.489 1.00 0.00 ? 165 THR A HG22 6  
ATOM 10563 H HG23 . THR A 1 68  ? 5.043   -4.489  -11.759 1.00 0.00 ? 165 THR A HG23 6  
ATOM 10564 N N    . GLU A 1 69  ? 1.475   -4.486  -8.192  1.00 0.00 ? 166 GLU A N    6  
ATOM 10565 C CA   . GLU A 1 69  ? 0.308   -4.168  -7.387  1.00 0.00 ? 166 GLU A CA   6  
ATOM 10566 C C    . GLU A 1 69  ? 0.269   -5.050  -6.148  1.00 0.00 ? 166 GLU A C    6  
ATOM 10567 O O    . GLU A 1 69  ? 0.678   -6.210  -6.189  1.00 0.00 ? 166 GLU A O    6  
ATOM 10568 C CB   . GLU A 1 69  ? -0.984  -4.339  -8.191  1.00 0.00 ? 166 GLU A CB   6  
ATOM 10569 C CG   . GLU A 1 69  ? -1.177  -5.735  -8.762  1.00 0.00 ? 166 GLU A CG   6  
ATOM 10570 C CD   . GLU A 1 69  ? -2.552  -5.930  -9.364  1.00 0.00 ? 166 GLU A CD   6  
ATOM 10571 O OE1  . GLU A 1 69  ? -2.767  -5.508  -10.514 1.00 0.00 ? 166 GLU A OE1  6  
ATOM 10572 O OE2  . GLU A 1 69  ? -3.423  -6.515  -8.690  1.00 0.00 ? 166 GLU A OE2  6  
ATOM 10573 H H    . GLU A 1 69  ? 1.890   -5.369  -8.096  1.00 0.00 ? 166 GLU A H    6  
ATOM 10574 H HA   . GLU A 1 69  ? 0.394   -3.137  -7.075  1.00 0.00 ? 166 GLU A HA   6  
ATOM 10575 H HB2  . GLU A 1 69  ? -1.822  -4.120  -7.546  1.00 0.00 ? 166 GLU A HB2  6  
ATOM 10576 H HB3  . GLU A 1 69  ? -0.980  -3.634  -9.011  1.00 0.00 ? 166 GLU A HB3  6  
ATOM 10577 H HG2  . GLU A 1 69  ? -0.438  -5.902  -9.531  1.00 0.00 ? 166 GLU A HG2  6  
ATOM 10578 H HG3  . GLU A 1 69  ? -1.041  -6.456  -7.969  1.00 0.00 ? 166 GLU A HG3  6  
ATOM 10579 N N    . PHE A 1 70  ? -0.207  -4.492  -5.048  1.00 0.00 ? 167 PHE A N    6  
ATOM 10580 C CA   . PHE A 1 70  ? -0.349  -5.241  -3.811  1.00 0.00 ? 167 PHE A CA   6  
ATOM 10581 C C    . PHE A 1 70  ? -1.645  -4.839  -3.117  1.00 0.00 ? 167 PHE A C    6  
ATOM 10582 O O    . PHE A 1 70  ? -2.119  -3.713  -3.287  1.00 0.00 ? 167 PHE A O    6  
ATOM 10583 C CB   . PHE A 1 70  ? 0.855   -4.989  -2.898  1.00 0.00 ? 167 PHE A CB   6  
ATOM 10584 C CG   . PHE A 1 70  ? 0.951   -5.946  -1.744  1.00 0.00 ? 167 PHE A CG   6  
ATOM 10585 C CD1  . PHE A 1 70  ? 1.362   -7.253  -1.949  1.00 0.00 ? 167 PHE A CD1  6  
ATOM 10586 C CD2  . PHE A 1 70  ? 0.625   -5.542  -0.460  1.00 0.00 ? 167 PHE A CD2  6  
ATOM 10587 C CE1  . PHE A 1 70  ? 1.447   -8.140  -0.894  1.00 0.00 ? 167 PHE A CE1  6  
ATOM 10588 C CE2  . PHE A 1 70  ? 0.708   -6.427  0.598   1.00 0.00 ? 167 PHE A CE2  6  
ATOM 10589 C CZ   . PHE A 1 70  ? 1.118   -7.727  0.381   1.00 0.00 ? 167 PHE A CZ   6  
ATOM 10590 H H    . PHE A 1 70  ? -0.466  -3.542  -5.066  1.00 0.00 ? 167 PHE A H    6  
ATOM 10591 H HA   . PHE A 1 70  ? -0.395  -6.290  -4.059  1.00 0.00 ? 167 PHE A HA   6  
ATOM 10592 H HB2  . PHE A 1 70  ? 1.762   -5.080  -3.477  1.00 0.00 ? 167 PHE A HB2  6  
ATOM 10593 H HB3  . PHE A 1 70  ? 0.790   -3.989  -2.497  1.00 0.00 ? 167 PHE A HB3  6  
ATOM 10594 H HD1  . PHE A 1 70  ? 1.619   -7.576  -2.946  1.00 0.00 ? 167 PHE A HD1  6  
ATOM 10595 H HD2  . PHE A 1 70  ? 0.303   -4.527  -0.289  1.00 0.00 ? 167 PHE A HD2  6  
ATOM 10596 H HE1  . PHE A 1 70  ? 1.769   -9.156  -1.067  1.00 0.00 ? 167 PHE A HE1  6  
ATOM 10597 H HE2  . PHE A 1 70  ? 0.452   -6.098  1.596   1.00 0.00 ? 167 PHE A HE2  6  
ATOM 10598 H HZ   . PHE A 1 70  ? 1.183   -8.419  1.207   1.00 0.00 ? 167 PHE A HZ   6  
ATOM 10599 N N    . LYS A 1 71  ? -2.227  -5.758  -2.355  1.00 0.00 ? 168 LYS A N    6  
ATOM 10600 C CA   . LYS A 1 71  ? -3.492  -5.498  -1.678  1.00 0.00 ? 168 LYS A CA   6  
ATOM 10601 C C    . LYS A 1 71  ? -3.300  -5.548  -0.163  1.00 0.00 ? 168 LYS A C    6  
ATOM 10602 O O    . LYS A 1 71  ? -2.604  -6.425  0.351   1.00 0.00 ? 168 LYS A O    6  
ATOM 10603 C CB   . LYS A 1 71  ? -4.543  -6.539  -2.077  1.00 0.00 ? 168 LYS A CB   6  
ATOM 10604 C CG   . LYS A 1 71  ? -4.464  -7.009  -3.523  1.00 0.00 ? 168 LYS A CG   6  
ATOM 10605 C CD   . LYS A 1 71  ? -4.880  -5.950  -4.525  1.00 0.00 ? 168 LYS A CD   6  
ATOM 10606 C CE   . LYS A 1 71  ? -4.791  -6.507  -5.938  1.00 0.00 ? 168 LYS A CE   6  
ATOM 10607 N NZ   . LYS A 1 71  ? -5.429  -5.624  -6.945  1.00 0.00 ? 168 LYS A NZ   6  
ATOM 10608 H H    . LYS A 1 71  ? -1.793  -6.634  -2.241  1.00 0.00 ? 168 LYS A H    6  
ATOM 10609 H HA   . LYS A 1 71  ? -3.834  -4.515  -1.962  1.00 0.00 ? 168 LYS A HA   6  
ATOM 10610 H HB2  . LYS A 1 71  ? -4.430  -7.404  -1.440  1.00 0.00 ? 168 LYS A HB2  6  
ATOM 10611 H HB3  . LYS A 1 71  ? -5.524  -6.117  -1.914  1.00 0.00 ? 168 LYS A HB3  6  
ATOM 10612 H HG2  . LYS A 1 71  ? -3.449  -7.294  -3.739  1.00 0.00 ? 168 LYS A HG2  6  
ATOM 10613 H HG3  . LYS A 1 71  ? -5.111  -7.864  -3.640  1.00 0.00 ? 168 LYS A HG3  6  
ATOM 10614 H HD2  . LYS A 1 71  ? -5.895  -5.651  -4.322  1.00 0.00 ? 168 LYS A HD2  6  
ATOM 10615 H HD3  . LYS A 1 71  ? -4.221  -5.099  -4.438  1.00 0.00 ? 168 LYS A HD3  6  
ATOM 10616 H HE2  . LYS A 1 71  ? -3.750  -6.629  -6.195  1.00 0.00 ? 168 LYS A HE2  6  
ATOM 10617 H HE3  . LYS A 1 71  ? -5.277  -7.471  -5.958  1.00 0.00 ? 168 LYS A HE3  6  
ATOM 10618 H HZ1  . LYS A 1 71  ? -5.120  -4.644  -6.814  1.00 0.00 ? 168 LYS A HZ1  6  
ATOM 10619 H HZ2  . LYS A 1 71  ? -6.466  -5.663  -6.855  1.00 0.00 ? 168 LYS A HZ2  6  
ATOM 10620 H HZ3  . LYS A 1 71  ? -5.166  -5.931  -7.907  1.00 0.00 ? 168 LYS A HZ3  6  
ATOM 10621 N N    . ILE A 1 72  ? -3.911  -4.611  0.547   1.00 0.00 ? 169 ILE A N    6  
ATOM 10622 C CA   . ILE A 1 72  ? -3.881  -4.618  2.008   1.00 0.00 ? 169 ILE A CA   6  
ATOM 10623 C C    . ILE A 1 72  ? -5.276  -4.891  2.559   1.00 0.00 ? 169 ILE A C    6  
ATOM 10624 O O    . ILE A 1 72  ? -6.215  -4.144  2.282   1.00 0.00 ? 169 ILE A O    6  
ATOM 10625 C CB   . ILE A 1 72  ? -3.361  -3.284  2.590   1.00 0.00 ? 169 ILE A CB   6  
ATOM 10626 C CG1  . ILE A 1 72  ? -1.974  -2.951  2.035   1.00 0.00 ? 169 ILE A CG1  6  
ATOM 10627 C CG2  . ILE A 1 72  ? -3.314  -3.353  4.112   1.00 0.00 ? 169 ILE A CG2  6  
ATOM 10628 C CD1  . ILE A 1 72  ? -0.901  -3.940  2.438   1.00 0.00 ? 169 ILE A CD1  6  
ATOM 10629 H H    . ILE A 1 72  ? -4.398  -3.897  0.079   1.00 0.00 ? 169 ILE A H    6  
ATOM 10630 H HA   . ILE A 1 72  ? -3.219  -5.412  2.324   1.00 0.00 ? 169 ILE A HA   6  
ATOM 10631 H HB   . ILE A 1 72  ? -4.051  -2.502  2.312   1.00 0.00 ? 169 ILE A HB   6  
ATOM 10632 H HG12 . ILE A 1 72  ? -2.021  -2.937  0.957   1.00 0.00 ? 169 ILE A HG12 6  
ATOM 10633 H HG13 . ILE A 1 72  ? -1.677  -1.975  2.391   1.00 0.00 ? 169 ILE A HG13 6  
ATOM 10634 H HG21 . ILE A 1 72  ? -4.303  -3.554  4.496   1.00 0.00 ? 169 ILE A HG21 6  
ATOM 10635 H HG22 . ILE A 1 72  ? -2.960  -2.411  4.505   1.00 0.00 ? 169 ILE A HG22 6  
ATOM 10636 H HG23 . ILE A 1 72  ? -2.641  -4.144  4.414   1.00 0.00 ? 169 ILE A HG23 6  
ATOM 10637 H HD11 . ILE A 1 72  ? 0.045   -3.637  2.016   1.00 0.00 ? 169 ILE A HD11 6  
ATOM 10638 H HD12 . ILE A 1 72  ? -1.161  -4.922  2.072   1.00 0.00 ? 169 ILE A HD12 6  
ATOM 10639 H HD13 . ILE A 1 72  ? -0.822  -3.968  3.515   1.00 0.00 ? 169 ILE A HD13 6  
ATOM 10640 N N    . LEU A 1 73  ? -5.402  -5.963  3.331   1.00 0.00 ? 170 LEU A N    6  
ATOM 10641 C CA   . LEU A 1 73  ? -6.691  -6.373  3.879   1.00 0.00 ? 170 LEU A CA   6  
ATOM 10642 C C    . LEU A 1 73  ? -6.944  -5.720  5.233   1.00 0.00 ? 170 LEU A C    6  
ATOM 10643 O O    . LEU A 1 73  ? -8.067  -5.318  5.539   1.00 0.00 ? 170 LEU A O    6  
ATOM 10644 C CB   . LEU A 1 73  ? -6.762  -7.902  4.026   1.00 0.00 ? 170 LEU A CB   6  
ATOM 10645 C CG   . LEU A 1 73  ? -6.946  -8.706  2.729   1.00 0.00 ? 170 LEU A CG   6  
ATOM 10646 C CD1  . LEU A 1 73  ? -8.194  -8.252  1.991   1.00 0.00 ? 170 LEU A CD1  6  
ATOM 10647 C CD2  . LEU A 1 73  ? -5.721  -8.603  1.830   1.00 0.00 ? 170 LEU A CD2  6  
ATOM 10648 H H    . LEU A 1 73  ? -4.603  -6.494  3.542   1.00 0.00 ? 170 LEU A H    6  
ATOM 10649 H HA   . LEU A 1 73  ? -7.458  -6.051  3.194   1.00 0.00 ? 170 LEU A HA   6  
ATOM 10650 H HB2  . LEU A 1 73  ? -5.849  -8.235  4.497   1.00 0.00 ? 170 LEU A HB2  6  
ATOM 10651 H HB3  . LEU A 1 73  ? -7.586  -8.136  4.684   1.00 0.00 ? 170 LEU A HB3  6  
ATOM 10652 H HG   . LEU A 1 73  ? -7.081  -9.748  2.984   1.00 0.00 ? 170 LEU A HG   6  
ATOM 10653 H HD11 . LEU A 1 73  ? -9.060  -8.410  2.617   1.00 0.00 ? 170 LEU A HD11 6  
ATOM 10654 H HD12 . LEU A 1 73  ? -8.300  -8.818  1.079   1.00 0.00 ? 170 LEU A HD12 6  
ATOM 10655 H HD13 . LEU A 1 73  ? -8.107  -7.204  1.756   1.00 0.00 ? 170 LEU A HD13 6  
ATOM 10656 H HD21 . LEU A 1 73  ? -4.857  -8.987  2.353   1.00 0.00 ? 170 LEU A HD21 6  
ATOM 10657 H HD22 . LEU A 1 73  ? -5.553  -7.570  1.567   1.00 0.00 ? 170 LEU A HD22 6  
ATOM 10658 H HD23 . LEU A 1 73  ? -5.883  -9.181  0.932   1.00 0.00 ? 170 LEU A HD23 6  
ATOM 10659 N N    . SER A 1 74  ? -5.897  -5.617  6.037   1.00 0.00 ? 171 SER A N    6  
ATOM 10660 C CA   . SER A 1 74  ? -6.010  -5.055  7.375   1.00 0.00 ? 171 SER A CA   6  
ATOM 10661 C C    . SER A 1 74  ? -6.107  -3.534  7.328   1.00 0.00 ? 171 SER A C    6  
ATOM 10662 O O    . SER A 1 74  ? -5.105  -2.828  7.463   1.00 0.00 ? 171 SER A O    6  
ATOM 10663 C CB   . SER A 1 74  ? -4.811  -5.483  8.221   1.00 0.00 ? 171 SER A CB   6  
ATOM 10664 O OG   . SER A 1 74  ? -4.733  -6.896  8.304   1.00 0.00 ? 171 SER A OG   6  
ATOM 10665 H H    . SER A 1 74  ? -5.022  -5.928  5.724   1.00 0.00 ? 171 SER A H    6  
ATOM 10666 H HA   . SER A 1 74  ? -6.910  -5.446  7.821   1.00 0.00 ? 171 SER A HA   6  
ATOM 10667 H HB2  . SER A 1 74  ? -3.902  -5.109  7.771   1.00 0.00 ? 171 SER A HB2  6  
ATOM 10668 H HB3  . SER A 1 74  ? -4.913  -5.080  9.217   1.00 0.00 ? 171 SER A HB3  6  
ATOM 10669 H HG   . SER A 1 74  ? -5.467  -7.223  8.841   1.00 0.00 ? 171 SER A HG   6  
ATOM 10670 N N    . LEU A 1 75  ? -7.318  -3.035  7.129   1.00 0.00 ? 172 LEU A N    6  
ATOM 10671 C CA   . LEU A 1 75  ? -7.555  -1.602  7.078   1.00 0.00 ? 172 LEU A CA   6  
ATOM 10672 C C    . LEU A 1 75  ? -8.646  -1.201  8.059   1.00 0.00 ? 172 LEU A C    6  
ATOM 10673 O O    . LEU A 1 75  ? -9.696  -1.839  8.133   1.00 0.00 ? 172 LEU A O    6  
ATOM 10674 C CB   . LEU A 1 75  ? -7.958  -1.176  5.670   1.00 0.00 ? 172 LEU A CB   6  
ATOM 10675 C CG   . LEU A 1 75  ? -6.921  -1.444  4.584   1.00 0.00 ? 172 LEU A CG   6  
ATOM 10676 C CD1  . LEU A 1 75  ? -7.496  -1.102  3.224   1.00 0.00 ? 172 LEU A CD1  6  
ATOM 10677 C CD2  . LEU A 1 75  ? -5.654  -0.642  4.840   1.00 0.00 ? 172 LEU A CD2  6  
ATOM 10678 H H    . LEU A 1 75  ? -8.073  -3.650  7.008   1.00 0.00 ? 172 LEU A H    6  
ATOM 10679 H HA   . LEU A 1 75  ? -6.639  -1.102  7.350   1.00 0.00 ? 172 LEU A HA   6  
ATOM 10680 H HB2  . LEU A 1 75  ? -8.867  -1.696  5.406   1.00 0.00 ? 172 LEU A HB2  6  
ATOM 10681 H HB3  . LEU A 1 75  ? -8.163  -0.116  5.684   1.00 0.00 ? 172 LEU A HB3  6  
ATOM 10682 H HG   . LEU A 1 75  ? -6.665  -2.493  4.586   1.00 0.00 ? 172 LEU A HG   6  
ATOM 10683 H HD11 . LEU A 1 75  ? -6.754  -1.290  2.464   1.00 0.00 ? 172 LEU A HD11 6  
ATOM 10684 H HD12 . LEU A 1 75  ? -7.778  -0.060  3.205   1.00 0.00 ? 172 LEU A HD12 6  
ATOM 10685 H HD13 . LEU A 1 75  ? -8.365  -1.714  3.037   1.00 0.00 ? 172 LEU A HD13 6  
ATOM 10686 H HD21 . LEU A 1 75  ? -5.890  0.411   4.852   1.00 0.00 ? 172 LEU A HD21 6  
ATOM 10687 H HD22 . LEU A 1 75  ? -4.938  -0.841  4.056   1.00 0.00 ? 172 LEU A HD22 6  
ATOM 10688 H HD23 . LEU A 1 75  ? -5.232  -0.928  5.792   1.00 0.00 ? 172 LEU A HD23 6  
ATOM 10689 N N    . HIS A 1 76  ? -8.382  -0.151  8.817   1.00 0.00 ? 173 HIS A N    6  
ATOM 10690 C CA   . HIS A 1 76  ? -9.352  0.375   9.764   1.00 0.00 ? 173 HIS A CA   6  
ATOM 10691 C C    . HIS A 1 76  ? -10.010 1.629   9.196   1.00 0.00 ? 173 HIS A C    6  
ATOM 10692 O O    . HIS A 1 76  ? -9.320  2.572   8.809   1.00 0.00 ? 173 HIS A O    6  
ATOM 10693 C CB   . HIS A 1 76  ? -8.677  0.697   11.102  1.00 0.00 ? 173 HIS A CB   6  
ATOM 10694 C CG   . HIS A 1 76  ? -8.177  -0.508  11.840  1.00 0.00 ? 173 HIS A CG   6  
ATOM 10695 N ND1  . HIS A 1 76  ? -8.747  -0.963  13.006  1.00 0.00 ? 173 HIS A ND1  6  
ATOM 10696 C CD2  . HIS A 1 76  ? -7.145  -1.345  11.580  1.00 0.00 ? 173 HIS A CD2  6  
ATOM 10697 C CE1  . HIS A 1 76  ? -8.090  -2.021  13.435  1.00 0.00 ? 173 HIS A CE1  6  
ATOM 10698 N NE2  . HIS A 1 76  ? -7.113  -2.274  12.587  1.00 0.00 ? 173 HIS A NE2  6  
ATOM 10699 H H    . HIS A 1 76  ? -7.507  0.288   8.733   1.00 0.00 ? 173 HIS A H    6  
ATOM 10700 H HA   . HIS A 1 76  ? -10.107 -0.379  9.922   1.00 0.00 ? 173 HIS A HA   6  
ATOM 10701 H HB2  . HIS A 1 76  ? -7.834  1.346   10.922  1.00 0.00 ? 173 HIS A HB2  6  
ATOM 10702 H HB3  . HIS A 1 76  ? -9.386  1.206   11.739  1.00 0.00 ? 173 HIS A HB3  6  
ATOM 10703 H HD1  . HIS A 1 76  ? -9.529  -0.571  13.452  1.00 0.00 ? 173 HIS A HD1  6  
ATOM 10704 H HD2  . HIS A 1 76  ? -6.471  -1.289  10.736  1.00 0.00 ? 173 HIS A HD2  6  
ATOM 10705 H HE1  . HIS A 1 76  ? -8.314  -2.586  14.328  1.00 0.00 ? 173 HIS A HE1  6  
ATOM 10706 H HE2  . HIS A 1 76  ? -6.418  -2.960  12.713  1.00 0.00 ? 173 HIS A HE2  6  
ATOM 10707 N N    . PRO A 1 77  ? -11.351 1.646   9.115   1.00 0.00 ? 174 PRO A N    6  
ATOM 10708 C CA   . PRO A 1 77  ? -12.098 2.795   8.591   1.00 0.00 ? 174 PRO A CA   6  
ATOM 10709 C C    . PRO A 1 77  ? -11.858 4.064   9.404   1.00 0.00 ? 174 PRO A C    6  
ATOM 10710 O O    . PRO A 1 77  ? -12.060 4.081   10.622  1.00 0.00 ? 174 PRO A O    6  
ATOM 10711 C CB   . PRO A 1 77  ? -13.566 2.366   8.703   1.00 0.00 ? 174 PRO A CB   6  
ATOM 10712 C CG   . PRO A 1 77  ? -13.535 0.881   8.826   1.00 0.00 ? 174 PRO A CG   6  
ATOM 10713 C CD   . PRO A 1 77  ? -12.244 0.545   9.516   1.00 0.00 ? 174 PRO A CD   6  
ATOM 10714 H HA   . PRO A 1 77  ? -11.854 2.982   7.555   1.00 0.00 ? 174 PRO A HA   6  
ATOM 10715 H HB2  . PRO A 1 77  ? -14.007 2.824   9.576   1.00 0.00 ? 174 PRO A HB2  6  
ATOM 10716 H HB3  . PRO A 1 77  ? -14.102 2.676   7.820   1.00 0.00 ? 174 PRO A HB3  6  
ATOM 10717 H HG2  . PRO A 1 77  ? -14.373 0.545   9.417   1.00 0.00 ? 174 PRO A HG2  6  
ATOM 10718 H HG3  . PRO A 1 77  ? -13.563 0.431   7.845   1.00 0.00 ? 174 PRO A HG3  6  
ATOM 10719 H HD2  . PRO A 1 77  ? -12.381 0.530   10.588  1.00 0.00 ? 174 PRO A HD2  6  
ATOM 10720 H HD3  . PRO A 1 77  ? -11.868 -0.405  9.167   1.00 0.00 ? 174 PRO A HD3  6  
ATOM 10721 N N    . GLY A 1 78  ? -11.429 5.121   8.727   1.00 0.00 ? 175 GLY A N    6  
ATOM 10722 C CA   . GLY A 1 78  ? -11.198 6.388   9.389   1.00 0.00 ? 175 GLY A CA   6  
ATOM 10723 C C    . GLY A 1 78  ? -9.795  6.504   9.948   1.00 0.00 ? 175 GLY A C    6  
ATOM 10724 O O    . GLY A 1 78  ? -9.567  7.218   10.925  1.00 0.00 ? 175 GLY A O    6  
ATOM 10725 H H    . GLY A 1 78  ? -11.268 5.044   7.760   1.00 0.00 ? 175 GLY A H    6  
ATOM 10726 H HA2  . GLY A 1 78  ? -11.359 7.187   8.681   1.00 0.00 ? 175 GLY A HA2  6  
ATOM 10727 H HA3  . GLY A 1 78  ? -11.905 6.492   10.199  1.00 0.00 ? 175 GLY A HA3  6  
ATOM 10728 N N    . GLN A 1 79  ? -8.853  5.805   9.335   1.00 0.00 ? 176 GLN A N    6  
ATOM 10729 C CA   . GLN A 1 79  ? -7.469  5.833   9.789   1.00 0.00 ? 176 GLN A CA   6  
ATOM 10730 C C    . GLN A 1 79  ? -6.526  6.189   8.647   1.00 0.00 ? 176 GLN A C    6  
ATOM 10731 O O    . GLN A 1 79  ? -6.778  5.855   7.487   1.00 0.00 ? 176 GLN A O    6  
ATOM 10732 C CB   . GLN A 1 79  ? -7.069  4.483   10.391  1.00 0.00 ? 176 GLN A CB   6  
ATOM 10733 C CG   . GLN A 1 79  ? -7.798  4.146   11.683  1.00 0.00 ? 176 GLN A CG   6  
ATOM 10734 C CD   . GLN A 1 79  ? -7.553  5.167   12.777  1.00 0.00 ? 176 GLN A CD   6  
ATOM 10735 O OE1  . GLN A 1 79  ? -6.495  5.793   12.837  1.00 0.00 ? 176 GLN A OE1  6  
ATOM 10736 N NE2  . GLN A 1 79  ? -8.530  5.341   13.650  1.00 0.00 ? 176 GLN A NE2  6  
ATOM 10737 H H    . GLN A 1 79  ? -9.087  5.258   8.556   1.00 0.00 ? 176 GLN A H    6  
ATOM 10738 H HA   . GLN A 1 79  ? -7.389  6.592   10.553  1.00 0.00 ? 176 GLN A HA   6  
ATOM 10739 H HB2  . GLN A 1 79  ? -7.282  3.706   9.672   1.00 0.00 ? 176 GLN A HB2  6  
ATOM 10740 H HB3  . GLN A 1 79  ? -6.008  4.492   10.594  1.00 0.00 ? 176 GLN A HB3  6  
ATOM 10741 H HG2  . GLN A 1 79  ? -8.858  4.103   11.483  1.00 0.00 ? 176 GLN A HG2  6  
ATOM 10742 H HG3  . GLN A 1 79  ? -7.459  3.179   12.030  1.00 0.00 ? 176 GLN A HG3  6  
ATOM 10743 H HE21 . GLN A 1 79  ? -9.349  4.807   13.543  1.00 0.00 ? 176 GLN A HE21 6  
ATOM 10744 H HE22 . GLN A 1 79  ? -8.398  5.997   14.367  1.00 0.00 ? 176 GLN A HE22 6  
ATOM 10745 N N    . LYS A 1 80  ? -5.451  6.886   8.989   1.00 0.00 ? 177 LYS A N    6  
ATOM 10746 C CA   . LYS A 1 80  ? -4.427  7.261   8.031   1.00 0.00 ? 177 LYS A CA   6  
ATOM 10747 C C    . LYS A 1 80  ? -3.411  6.139   7.867   1.00 0.00 ? 177 LYS A C    6  
ATOM 10748 O O    . LYS A 1 80  ? -2.923  5.585   8.852   1.00 0.00 ? 177 LYS A O    6  
ATOM 10749 C CB   . LYS A 1 80  ? -3.732  8.531   8.512   1.00 0.00 ? 177 LYS A CB   6  
ATOM 10750 C CG   . LYS A 1 80  ? -2.489  8.900   7.726   1.00 0.00 ? 177 LYS A CG   6  
ATOM 10751 C CD   . LYS A 1 80  ? -1.706  9.981   8.441   1.00 0.00 ? 177 LYS A CD   6  
ATOM 10752 C CE   . LYS A 1 80  ? -2.423  11.319  8.393   1.00 0.00 ? 177 LYS A CE   6  
ATOM 10753 N NZ   . LYS A 1 80  ? -1.747  12.345  9.229   1.00 0.00 ? 177 LYS A NZ   6  
ATOM 10754 H H    . LYS A 1 80  ? -5.342  7.165   9.930   1.00 0.00 ? 177 LYS A H    6  
ATOM 10755 H HA   . LYS A 1 80  ? -4.900  7.457   7.083   1.00 0.00 ? 177 LYS A HA   6  
ATOM 10756 H HB2  . LYS A 1 80  ? -4.428  9.353   8.441   1.00 0.00 ? 177 LYS A HB2  6  
ATOM 10757 H HB3  . LYS A 1 80  ? -3.450  8.401   9.546   1.00 0.00 ? 177 LYS A HB3  6  
ATOM 10758 H HG2  . LYS A 1 80  ? -1.866  8.023   7.621   1.00 0.00 ? 177 LYS A HG2  6  
ATOM 10759 H HG3  . LYS A 1 80  ? -2.781  9.259   6.750   1.00 0.00 ? 177 LYS A HG3  6  
ATOM 10760 H HD2  . LYS A 1 80  ? -1.585  9.689   9.472   1.00 0.00 ? 177 LYS A HD2  6  
ATOM 10761 H HD3  . LYS A 1 80  ? -0.739  10.080  7.974   1.00 0.00 ? 177 LYS A HD3  6  
ATOM 10762 H HE2  . LYS A 1 80  ? -2.446  11.661  7.371   1.00 0.00 ? 177 LYS A HE2  6  
ATOM 10763 H HE3  . LYS A 1 80  ? -3.433  11.184  8.751   1.00 0.00 ? 177 LYS A HE3  6  
ATOM 10764 H HZ1  . LYS A 1 80  ? -0.761  12.466  8.922   1.00 0.00 ? 177 LYS A HZ1  6  
ATOM 10765 H HZ2  . LYS A 1 80  ? -1.753  12.056  10.227  1.00 0.00 ? 177 LYS A HZ2  6  
ATOM 10766 H HZ3  . LYS A 1 80  ? -2.237  13.257  9.144   1.00 0.00 ? 177 LYS A HZ3  6  
ATOM 10767 N N    . TYR A 1 81  ? -3.107  5.796   6.624   1.00 0.00 ? 178 TYR A N    6  
ATOM 10768 C CA   . TYR A 1 81  ? -2.092  4.797   6.331   1.00 0.00 ? 178 TYR A CA   6  
ATOM 10769 C C    . TYR A 1 81  ? -0.990  5.395   5.469   1.00 0.00 ? 178 TYR A C    6  
ATOM 10770 O O    . TYR A 1 81  ? -1.259  6.142   4.527   1.00 0.00 ? 178 TYR A O    6  
ATOM 10771 C CB   . TYR A 1 81  ? -2.705  3.580   5.626   1.00 0.00 ? 178 TYR A CB   6  
ATOM 10772 C CG   . TYR A 1 81  ? -3.455  2.643   6.545   1.00 0.00 ? 178 TYR A CG   6  
ATOM 10773 C CD1  . TYR A 1 81  ? -4.668  3.008   7.113   1.00 0.00 ? 178 TYR A CD1  6  
ATOM 10774 C CD2  . TYR A 1 81  ? -2.947  1.385   6.839   1.00 0.00 ? 178 TYR A CD2  6  
ATOM 10775 C CE1  . TYR A 1 81  ? -5.352  2.147   7.949   1.00 0.00 ? 178 TYR A CE1  6  
ATOM 10776 C CE2  . TYR A 1 81  ? -3.625  0.519   7.673   1.00 0.00 ? 178 TYR A CE2  6  
ATOM 10777 C CZ   . TYR A 1 81  ? -4.826  0.906   8.226   1.00 0.00 ? 178 TYR A CZ   6  
ATOM 10778 O OH   . TYR A 1 81  ? -5.506  0.046   9.059   1.00 0.00 ? 178 TYR A OH   6  
ATOM 10779 H H    . TYR A 1 81  ? -3.580  6.229   5.876   1.00 0.00 ? 178 TYR A H    6  
ATOM 10780 H HA   . TYR A 1 81  ? -1.663  4.479   7.269   1.00 0.00 ? 178 TYR A HA   6  
ATOM 10781 H HB2  . TYR A 1 81  ? -3.395  3.923   4.872   1.00 0.00 ? 178 TYR A HB2  6  
ATOM 10782 H HB3  . TYR A 1 81  ? -1.914  3.016   5.151   1.00 0.00 ? 178 TYR A HB3  6  
ATOM 10783 H HD1  . TYR A 1 81  ? -5.077  3.983   6.894   1.00 0.00 ? 178 TYR A HD1  6  
ATOM 10784 H HD2  . TYR A 1 81  ? -2.006  1.084   6.405   1.00 0.00 ? 178 TYR A HD2  6  
ATOM 10785 H HE1  . TYR A 1 81  ? -6.294  2.449   8.380   1.00 0.00 ? 178 TYR A HE1  6  
ATOM 10786 H HE2  . TYR A 1 81  ? -3.213  -0.454  7.891   1.00 0.00 ? 178 TYR A HE2  6  
ATOM 10787 H HH   . TYR A 1 81  ? -4.872  -0.440  9.599   1.00 0.00 ? 178 TYR A HH   6  
ATOM 10788 N N    . LEU A 1 82  ? 0.245   5.089   5.814   1.00 0.00 ? 179 LEU A N    6  
ATOM 10789 C CA   . LEU A 1 82  ? 1.390   5.525   5.032   1.00 0.00 ? 179 LEU A CA   6  
ATOM 10790 C C    . LEU A 1 82  ? 1.916   4.355   4.219   1.00 0.00 ? 179 LEU A C    6  
ATOM 10791 O O    . LEU A 1 82  ? 2.181   3.288   4.772   1.00 0.00 ? 179 LEU A O    6  
ATOM 10792 C CB   . LEU A 1 82  ? 2.504   6.064   5.935   1.00 0.00 ? 179 LEU A CB   6  
ATOM 10793 C CG   . LEU A 1 82  ? 2.277   7.449   6.556   1.00 0.00 ? 179 LEU A CG   6  
ATOM 10794 C CD1  . LEU A 1 82  ? 1.111   7.444   7.538   1.00 0.00 ? 179 LEU A CD1  6  
ATOM 10795 C CD2  . LEU A 1 82  ? 3.547   7.918   7.246   1.00 0.00 ? 179 LEU A CD2  6  
ATOM 10796 H H    . LEU A 1 82  ? 0.397   4.544   6.618   1.00 0.00 ? 179 LEU A H    6  
ATOM 10797 H HA   . LEU A 1 82  ? 1.062   6.306   4.360   1.00 0.00 ? 179 LEU A HA   6  
ATOM 10798 H HB2  . LEU A 1 82  ? 2.655   5.359   6.739   1.00 0.00 ? 179 LEU A HB2  6  
ATOM 10799 H HB3  . LEU A 1 82  ? 3.409   6.109   5.351   1.00 0.00 ? 179 LEU A HB3  6  
ATOM 10800 H HG   . LEU A 1 82  ? 2.049   8.153   5.771   1.00 0.00 ? 179 LEU A HG   6  
ATOM 10801 H HD11 . LEU A 1 82  ? 1.329   6.771   8.353   1.00 0.00 ? 179 LEU A HD11 6  
ATOM 10802 H HD12 . LEU A 1 82  ? 0.216   7.117   7.031   1.00 0.00 ? 179 LEU A HD12 6  
ATOM 10803 H HD13 . LEU A 1 82  ? 0.961   8.442   7.924   1.00 0.00 ? 179 LEU A HD13 6  
ATOM 10804 H HD21 . LEU A 1 82  ? 4.353   7.954   6.530   1.00 0.00 ? 179 LEU A HD21 6  
ATOM 10805 H HD22 . LEU A 1 82  ? 3.801   7.229   8.039   1.00 0.00 ? 179 LEU A HD22 6  
ATOM 10806 H HD23 . LEU A 1 82  ? 3.388   8.901   7.660   1.00 0.00 ? 179 LEU A HD23 6  
ATOM 10807 N N    . VAL A 1 83  ? 2.049   4.543   2.914   1.00 0.00 ? 180 VAL A N    6  
ATOM 10808 C CA   . VAL A 1 83  ? 2.487   3.465   2.038   1.00 0.00 ? 180 VAL A CA   6  
ATOM 10809 C C    . VAL A 1 83  ? 3.736   3.848   1.248   1.00 0.00 ? 180 VAL A C    6  
ATOM 10810 O O    . VAL A 1 83  ? 3.899   4.998   0.829   1.00 0.00 ? 180 VAL A O    6  
ATOM 10811 C CB   . VAL A 1 83  ? 1.376   3.035   1.053   1.00 0.00 ? 180 VAL A CB   6  
ATOM 10812 C CG1  . VAL A 1 83  ? 0.184   2.452   1.797   1.00 0.00 ? 180 VAL A CG1  6  
ATOM 10813 C CG2  . VAL A 1 83  ? 0.941   4.202   0.187   1.00 0.00 ? 180 VAL A CG2  6  
ATOM 10814 H H    . VAL A 1 83  ? 1.852   5.427   2.530   1.00 0.00 ? 180 VAL A H    6  
ATOM 10815 H HA   . VAL A 1 83  ? 2.726   2.616   2.663   1.00 0.00 ? 180 VAL A HA   6  
ATOM 10816 H HB   . VAL A 1 83  ? 1.776   2.268   0.407   1.00 0.00 ? 180 VAL A HB   6  
ATOM 10817 H HG11 . VAL A 1 83  ? -0.198  3.182   2.495   1.00 0.00 ? 180 VAL A HG11 6  
ATOM 10818 H HG12 . VAL A 1 83  ? 0.491   1.566   2.333   1.00 0.00 ? 180 VAL A HG12 6  
ATOM 10819 H HG13 . VAL A 1 83  ? -0.589  2.193   1.088   1.00 0.00 ? 180 VAL A HG13 6  
ATOM 10820 H HG21 . VAL A 1 83  ? 0.570   5.000   0.814   1.00 0.00 ? 180 VAL A HG21 6  
ATOM 10821 H HG22 . VAL A 1 83  ? 0.159   3.879   -0.484  1.00 0.00 ? 180 VAL A HG22 6  
ATOM 10822 H HG23 . VAL A 1 83  ? 1.784   4.557   -0.387  1.00 0.00 ? 180 VAL A HG23 6  
ATOM 10823 N N    . GLN A 1 84  ? 4.613   2.873   1.067   1.00 0.00 ? 181 GLN A N    6  
ATOM 10824 C CA   . GLN A 1 84  ? 5.832   3.035   0.288   1.00 0.00 ? 181 GLN A CA   6  
ATOM 10825 C C    . GLN A 1 84  ? 6.128   1.758   -0.481  1.00 0.00 ? 181 GLN A C    6  
ATOM 10826 O O    . GLN A 1 84  ? 5.670   0.680   -0.105  1.00 0.00 ? 181 GLN A O    6  
ATOM 10827 C CB   . GLN A 1 84  ? 7.016   3.355   1.198   1.00 0.00 ? 181 GLN A CB   6  
ATOM 10828 C CG   . GLN A 1 84  ? 7.031   4.777   1.716   1.00 0.00 ? 181 GLN A CG   6  
ATOM 10829 C CD   . GLN A 1 84  ? 8.068   4.977   2.792   1.00 0.00 ? 181 GLN A CD   6  
ATOM 10830 O OE1  . GLN A 1 84  ? 8.332   4.074   3.575   1.00 0.00 ? 181 GLN A OE1  6  
ATOM 10831 N NE2  . GLN A 1 84  ? 8.688   6.147   2.816   1.00 0.00 ? 181 GLN A NE2  6  
ATOM 10832 H H    . GLN A 1 84  ? 4.439   2.000   1.486   1.00 0.00 ? 181 GLN A H    6  
ATOM 10833 H HA   . GLN A 1 84  ? 5.685   3.845   -0.409  1.00 0.00 ? 181 GLN A HA   6  
ATOM 10834 H HB2  . GLN A 1 84  ? 6.992   2.689   2.048   1.00 0.00 ? 181 GLN A HB2  6  
ATOM 10835 H HB3  . GLN A 1 84  ? 7.930   3.189   0.649   1.00 0.00 ? 181 GLN A HB3  6  
ATOM 10836 H HG2  . GLN A 1 84  ? 7.245   5.447   0.896   1.00 0.00 ? 181 GLN A HG2  6  
ATOM 10837 H HG3  . GLN A 1 84  ? 6.058   5.007   2.126   1.00 0.00 ? 181 GLN A HG3  6  
ATOM 10838 H HE21 . GLN A 1 84  ? 8.444   6.814   2.141   1.00 0.00 ? 181 GLN A HE21 6  
ATOM 10839 H HE22 . GLN A 1 84  ? 9.362   6.302   3.513   1.00 0.00 ? 181 GLN A HE22 6  
ATOM 10840 N N    . VAL A 1 85  ? 6.902   1.877   -1.545  1.00 0.00 ? 182 VAL A N    6  
ATOM 10841 C CA   . VAL A 1 85  ? 7.290   0.723   -2.335  1.00 0.00 ? 182 VAL A CA   6  
ATOM 10842 C C    . VAL A 1 85  ? 8.731   0.874   -2.813  1.00 0.00 ? 182 VAL A C    6  
ATOM 10843 O O    . VAL A 1 85  ? 9.187   1.983   -3.095  1.00 0.00 ? 182 VAL A O    6  
ATOM 10844 C CB   . VAL A 1 85  ? 6.344   0.521   -3.544  1.00 0.00 ? 182 VAL A CB   6  
ATOM 10845 C CG1  . VAL A 1 85  ? 6.377   1.726   -4.472  1.00 0.00 ? 182 VAL A CG1  6  
ATOM 10846 C CG2  . VAL A 1 85  ? 6.691   -0.754  -4.302  1.00 0.00 ? 182 VAL A CG2  6  
ATOM 10847 H H    . VAL A 1 85  ? 7.226   2.763   -1.806  1.00 0.00 ? 182 VAL A H    6  
ATOM 10848 H HA   . VAL A 1 85  ? 7.222   -0.151  -1.702  1.00 0.00 ? 182 VAL A HA   6  
ATOM 10849 H HB   . VAL A 1 85  ? 5.337   0.420   -3.166  1.00 0.00 ? 182 VAL A HB   6  
ATOM 10850 H HG11 . VAL A 1 85  ? 7.386   1.883   -4.822  1.00 0.00 ? 182 VAL A HG11 6  
ATOM 10851 H HG12 . VAL A 1 85  ? 6.040   2.602   -3.937  1.00 0.00 ? 182 VAL A HG12 6  
ATOM 10852 H HG13 . VAL A 1 85  ? 5.728   1.548   -5.317  1.00 0.00 ? 182 VAL A HG13 6  
ATOM 10853 H HG21 . VAL A 1 85  ? 7.707   -0.693  -4.662  1.00 0.00 ? 182 VAL A HG21 6  
ATOM 10854 H HG22 . VAL A 1 85  ? 6.017   -0.870  -5.138  1.00 0.00 ? 182 VAL A HG22 6  
ATOM 10855 H HG23 . VAL A 1 85  ? 6.594   -1.603  -3.640  1.00 0.00 ? 182 VAL A HG23 6  
ATOM 10856 N N    . ARG A 1 86  ? 9.448   -0.236  -2.873  1.00 0.00 ? 183 ARG A N    6  
ATOM 10857 C CA   . ARG A 1 86  ? 10.818  -0.231  -3.354  1.00 0.00 ? 183 ARG A CA   6  
ATOM 10858 C C    . ARG A 1 86  ? 11.079  -1.436  -4.243  1.00 0.00 ? 183 ARG A C    6  
ATOM 10859 O O    . ARG A 1 86  ? 10.222  -2.305  -4.408  1.00 0.00 ? 183 ARG A O    6  
ATOM 10860 C CB   . ARG A 1 86  ? 11.813  -0.248  -2.191  1.00 0.00 ? 183 ARG A CB   6  
ATOM 10861 C CG   . ARG A 1 86  ? 11.664  -1.465  -1.297  1.00 0.00 ? 183 ARG A CG   6  
ATOM 10862 C CD   . ARG A 1 86  ? 12.999  -1.934  -0.751  1.00 0.00 ? 183 ARG A CD   6  
ATOM 10863 N NE   . ARG A 1 86  ? 13.826  -2.523  -1.802  1.00 0.00 ? 183 ARG A NE   6  
ATOM 10864 C CZ   . ARG A 1 86  ? 13.930  -3.837  -2.017  1.00 0.00 ? 183 ARG A CZ   6  
ATOM 10865 N NH1  . ARG A 1 86  ? 13.297  -4.700  -1.231  1.00 0.00 ? 183 ARG A NH1  6  
ATOM 10866 N NH2  . ARG A 1 86  ? 14.682  -4.287  -3.011  1.00 0.00 ? 183 ARG A NH2  6  
ATOM 10867 H H    . ARG A 1 86  ? 9.042   -1.087  -2.585  1.00 0.00 ? 183 ARG A H    6  
ATOM 10868 H HA   . ARG A 1 86  ? 10.966  0.669   -3.932  1.00 0.00 ? 183 ARG A HA   6  
ATOM 10869 H HB2  . ARG A 1 86  ? 12.817  -0.238  -2.589  1.00 0.00 ? 183 ARG A HB2  6  
ATOM 10870 H HB3  . ARG A 1 86  ? 11.663  0.637   -1.589  1.00 0.00 ? 183 ARG A HB3  6  
ATOM 10871 H HG2  . ARG A 1 86  ? 11.017  -1.215  -0.469  1.00 0.00 ? 183 ARG A HG2  6  
ATOM 10872 H HG3  . ARG A 1 86  ? 11.221  -2.264  -1.872  1.00 0.00 ? 183 ARG A HG3  6  
ATOM 10873 H HD2  . ARG A 1 86  ? 13.518  -1.089  -0.324  1.00 0.00 ? 183 ARG A HD2  6  
ATOM 10874 H HD3  . ARG A 1 86  ? 12.822  -2.673  0.017   1.00 0.00 ? 183 ARG A HD3  6  
ATOM 10875 H HE   . ARG A 1 86  ? 14.321  -1.908  -2.383  1.00 0.00 ? 183 ARG A HE   6  
ATOM 10876 H HH11 . ARG A 1 86  ? 12.732  -4.373  -0.460  1.00 0.00 ? 183 ARG A HH11 6  
ATOM 10877 H HH12 . ARG A 1 86  ? 13.378  -5.686  -1.398  1.00 0.00 ? 183 ARG A HH12 6  
ATOM 10878 H HH21 . ARG A 1 86  ? 15.172  -3.650  -3.604  1.00 0.00 ? 183 ARG A HH21 6  
ATOM 10879 H HH22 . ARG A 1 86  ? 14.753  -5.280  -3.178  1.00 0.00 ? 183 ARG A HH22 6  
ATOM 10880 N N    . CYS A 1 87  ? 12.274  -1.469  -4.802  1.00 0.00 ? 184 CYS A N    6  
ATOM 10881 C CA   . CYS A 1 87  ? 12.730  -2.570  -5.626  1.00 0.00 ? 184 CYS A CA   6  
ATOM 10882 C C    . CYS A 1 87  ? 14.250  -2.518  -5.698  1.00 0.00 ? 184 CYS A C    6  
ATOM 10883 O O    . CYS A 1 87  ? 14.872  -1.731  -4.978  1.00 0.00 ? 184 CYS A O    6  
ATOM 10884 C CB   . CYS A 1 87  ? 12.107  -2.478  -7.020  1.00 0.00 ? 184 CYS A CB   6  
ATOM 10885 S SG   . CYS A 1 87  ? 12.318  -0.870  -7.818  1.00 0.00 ? 184 CYS A SG   6  
ATOM 10886 H H    . CYS A 1 87  ? 12.883  -0.715  -4.657  1.00 0.00 ? 184 CYS A H    6  
ATOM 10887 H HA   . CYS A 1 87  ? 12.427  -3.495  -5.155  1.00 0.00 ? 184 CYS A HA   6  
ATOM 10888 H HB2  . CYS A 1 87  ? 12.559  -3.221  -7.659  1.00 0.00 ? 184 CYS A HB2  6  
ATOM 10889 H HB3  . CYS A 1 87  ? 11.048  -2.671  -6.946  1.00 0.00 ? 184 CYS A HB3  6  
ATOM 10890 H HG   . CYS A 1 87  ? 11.113  -0.349  -8.012  1.00 0.00 ? 184 CYS A HG   6  
ATOM 10891 N N    . LYS A 1 88  ? 14.856  -3.354  -6.527  1.00 0.00 ? 185 LYS A N    6  
ATOM 10892 C CA   . LYS A 1 88  ? 16.304  -3.321  -6.691  1.00 0.00 ? 185 LYS A CA   6  
ATOM 10893 C C    . LYS A 1 88  ? 16.700  -3.579  -8.140  1.00 0.00 ? 185 LYS A C    6  
ATOM 10894 O O    . LYS A 1 88  ? 16.884  -4.723  -8.557  1.00 0.00 ? 185 LYS A O    6  
ATOM 10895 C CB   . LYS A 1 88  ? 16.998  -4.314  -5.752  1.00 0.00 ? 185 LYS A CB   6  
ATOM 10896 C CG   . LYS A 1 88  ? 16.389  -5.708  -5.742  1.00 0.00 ? 185 LYS A CG   6  
ATOM 10897 C CD   . LYS A 1 88  ? 17.246  -6.674  -4.943  1.00 0.00 ? 185 LYS A CD   6  
ATOM 10898 C CE   . LYS A 1 88  ? 18.517  -7.037  -5.692  1.00 0.00 ? 185 LYS A CE   6  
ATOM 10899 N NZ   . LYS A 1 88  ? 19.353  -8.007  -4.940  1.00 0.00 ? 185 LYS A NZ   6  
ATOM 10900 H H    . LYS A 1 88  ? 14.321  -4.000  -7.047  1.00 0.00 ? 185 LYS A H    6  
ATOM 10901 H HA   . LYS A 1 88  ? 16.628  -2.324  -6.430  1.00 0.00 ? 185 LYS A HA   6  
ATOM 10902 H HB2  . LYS A 1 88  ? 18.032  -4.403  -6.048  1.00 0.00 ? 185 LYS A HB2  6  
ATOM 10903 H HB3  . LYS A 1 88  ? 16.957  -3.922  -4.747  1.00 0.00 ? 185 LYS A HB3  6  
ATOM 10904 H HG2  . LYS A 1 88  ? 15.407  -5.659  -5.298  1.00 0.00 ? 185 LYS A HG2  6  
ATOM 10905 H HG3  . LYS A 1 88  ? 16.310  -6.065  -6.759  1.00 0.00 ? 185 LYS A HG3  6  
ATOM 10906 H HD2  . LYS A 1 88  ? 17.516  -6.204  -4.008  1.00 0.00 ? 185 LYS A HD2  6  
ATOM 10907 H HD3  . LYS A 1 88  ? 16.679  -7.573  -4.751  1.00 0.00 ? 185 LYS A HD3  6  
ATOM 10908 H HE2  . LYS A 1 88  ? 18.245  -7.472  -6.642  1.00 0.00 ? 185 LYS A HE2  6  
ATOM 10909 H HE3  . LYS A 1 88  ? 19.088  -6.137  -5.860  1.00 0.00 ? 185 LYS A HE3  6  
ATOM 10910 H HZ1  . LYS A 1 88  ? 19.582  -7.631  -4.001  1.00 0.00 ? 185 LYS A HZ1  6  
ATOM 10911 H HZ2  . LYS A 1 88  ? 20.239  -8.187  -5.456  1.00 0.00 ? 185 LYS A HZ2  6  
ATOM 10912 H HZ3  . LYS A 1 88  ? 18.845  -8.908  -4.826  1.00 0.00 ? 185 LYS A HZ3  6  
ATOM 10913 N N    . PRO A 1 89  ? 16.832  -2.505  -8.926  1.00 0.00 ? 186 PRO A N    6  
ATOM 10914 C CA   . PRO A 1 89  ? 17.192  -2.600  -10.340 1.00 0.00 ? 186 PRO A CA   6  
ATOM 10915 C C    . PRO A 1 89  ? 18.634  -3.061  -10.534 1.00 0.00 ? 186 PRO A C    6  
ATOM 10916 O O    . PRO A 1 89  ? 19.505  -2.793  -9.707  1.00 0.00 ? 186 PRO A O    6  
ATOM 10917 C CB   . PRO A 1 89  ? 17.015  -1.168  -10.849 1.00 0.00 ? 186 PRO A CB   6  
ATOM 10918 C CG   . PRO A 1 89  ? 17.177  -0.308  -9.645  1.00 0.00 ? 186 PRO A CG   6  
ATOM 10919 C CD   . PRO A 1 89  ? 16.647  -1.108  -8.490  1.00 0.00 ? 186 PRO A CD   6  
ATOM 10920 H HA   . PRO A 1 89  ? 16.529  -3.262  -10.875 1.00 0.00 ? 186 PRO A HA   6  
ATOM 10921 H HB2  . PRO A 1 89  ? 17.768  -0.955  -11.592 1.00 0.00 ? 186 PRO A HB2  6  
ATOM 10922 H HB3  . PRO A 1 89  ? 16.031  -1.058  -11.284 1.00 0.00 ? 186 PRO A HB3  6  
ATOM 10923 H HG2  . PRO A 1 89  ? 18.221  -0.081  -9.495  1.00 0.00 ? 186 PRO A HG2  6  
ATOM 10924 H HG3  . PRO A 1 89  ? 16.607  0.603   -9.763  1.00 0.00 ? 186 PRO A HG3  6  
ATOM 10925 H HD2  . PRO A 1 89  ? 17.221  -0.905  -7.598  1.00 0.00 ? 186 PRO A HD2  6  
ATOM 10926 H HD3  . PRO A 1 89  ? 15.602  -0.892  -8.326  1.00 0.00 ? 186 PRO A HD3  6  
ATOM 10927 N N    . ASP A 1 90  ? 18.862  -3.753  -11.646 1.00 0.00 ? 187 ASP A N    6  
ATOM 10928 C CA   . ASP A 1 90  ? 20.167  -4.338  -11.968 1.00 0.00 ? 187 ASP A CA   6  
ATOM 10929 C C    . ASP A 1 90  ? 21.250  -3.271  -12.100 1.00 0.00 ? 187 ASP A C    6  
ATOM 10930 O O    . ASP A 1 90  ? 22.431  -3.549  -11.905 1.00 0.00 ? 187 ASP A O    6  
ATOM 10931 C CB   . ASP A 1 90  ? 20.068  -5.147  -13.267 1.00 0.00 ? 187 ASP A CB   6  
ATOM 10932 C CG   . ASP A 1 90  ? 21.402  -5.703  -13.730 1.00 0.00 ? 187 ASP A CG   6  
ATOM 10933 O OD1  . ASP A 1 90  ? 21.795  -6.793  -13.264 1.00 0.00 ? 187 ASP A OD1  6  
ATOM 10934 O OD2  . ASP A 1 90  ? 22.052  -5.057  -14.578 1.00 0.00 ? 187 ASP A OD2  6  
ATOM 10935 H H    . ASP A 1 90  ? 18.122  -3.887  -12.273 1.00 0.00 ? 187 ASP A H    6  
ATOM 10936 H HA   . ASP A 1 90  ? 20.436  -5.005  -11.163 1.00 0.00 ? 187 ASP A HA   6  
ATOM 10937 H HB2  . ASP A 1 90  ? 19.392  -5.974  -13.115 1.00 0.00 ? 187 ASP A HB2  6  
ATOM 10938 H HB3  . ASP A 1 90  ? 19.677  -4.510  -14.047 1.00 0.00 ? 187 ASP A HB3  6  
ATOM 10939 N N    . HIS A 1 91  ? 20.849  -2.049  -12.428 1.00 0.00 ? 188 HIS A N    6  
ATOM 10940 C CA   . HIS A 1 91  ? 21.805  -0.957  -12.568 1.00 0.00 ? 188 HIS A CA   6  
ATOM 10941 C C    . HIS A 1 91  ? 22.275  -0.490  -11.199 1.00 0.00 ? 188 HIS A C    6  
ATOM 10942 O O    . HIS A 1 91  ? 23.456  -0.218  -10.994 1.00 0.00 ? 188 HIS A O    6  
ATOM 10943 C CB   . HIS A 1 91  ? 21.192  0.225   -13.336 1.00 0.00 ? 188 HIS A CB   6  
ATOM 10944 C CG   . HIS A 1 91  ? 20.843  -0.083  -14.763 1.00 0.00 ? 188 HIS A CG   6  
ATOM 10945 N ND1  . HIS A 1 91  ? 21.386  0.589   -15.835 1.00 0.00 ? 188 HIS A ND1  6  
ATOM 10946 C CD2  . HIS A 1 91  ? 19.988  -0.992  -15.289 1.00 0.00 ? 188 HIS A CD2  6  
ATOM 10947 C CE1  . HIS A 1 91  ? 20.881  0.108   -16.954 1.00 0.00 ? 188 HIS A CE1  6  
ATOM 10948 N NE2  . HIS A 1 91  ? 20.031  -0.853  -16.653 1.00 0.00 ? 188 HIS A NE2  6  
ATOM 10949 H H    . HIS A 1 91  ? 19.897  -1.879  -12.568 1.00 0.00 ? 188 HIS A H    6  
ATOM 10950 H HA   . HIS A 1 91  ? 22.656  -1.329  -13.118 1.00 0.00 ? 188 HIS A HA   6  
ATOM 10951 H HB2  . HIS A 1 91  ? 20.290  0.539   -12.834 1.00 0.00 ? 188 HIS A HB2  6  
ATOM 10952 H HB3  . HIS A 1 91  ? 21.896  1.048   -13.335 1.00 0.00 ? 188 HIS A HB3  6  
ATOM 10953 H HD1  . HIS A 1 91  ? 22.043  1.321   -15.785 1.00 0.00 ? 188 HIS A HD1  6  
ATOM 10954 H HD2  . HIS A 1 91  ? 19.386  -1.700  -14.737 1.00 0.00 ? 188 HIS A HD2  6  
ATOM 10955 H HE1  . HIS A 1 91  ? 21.124  0.445   -17.951 1.00 0.00 ? 188 HIS A HE1  6  
ATOM 10956 H HE2  . HIS A 1 91  ? 19.655  -1.494  -17.296 1.00 0.00 ? 188 HIS A HE2  6  
ATOM 10957 N N    . GLY A 1 92  ? 21.352  -0.441  -10.250 1.00 0.00 ? 189 GLY A N    6  
ATOM 10958 C CA   . GLY A 1 92  ? 21.671  0.088   -8.943  1.00 0.00 ? 189 GLY A CA   6  
ATOM 10959 C C    . GLY A 1 92  ? 21.505  -0.931  -7.837  1.00 0.00 ? 189 GLY A C    6  
ATOM 10960 O O    . GLY A 1 92  ? 21.948  -2.075  -7.968  1.00 0.00 ? 189 GLY A O    6  
ATOM 10961 H H    . GLY A 1 92  ? 20.453  -0.783  -10.431 1.00 0.00 ? 189 GLY A H    6  
ATOM 10962 H HA2  . GLY A 1 92  ? 22.695  0.432   -8.949  1.00 0.00 ? 189 GLY A HA2  6  
ATOM 10963 H HA3  . GLY A 1 92  ? 21.025  0.931   -8.741  1.00 0.00 ? 189 GLY A HA3  6  
ATOM 10964 N N    . TYR A 1 93  ? 20.866  -0.517  -6.750  1.00 0.00 ? 190 TYR A N    6  
ATOM 10965 C CA   . TYR A 1 93  ? 20.691  -1.371  -5.585  1.00 0.00 ? 190 TYR A CA   6  
ATOM 10966 C C    . TYR A 1 93  ? 19.598  -0.785  -4.684  1.00 0.00 ? 190 TYR A C    6  
ATOM 10967 O O    . TYR A 1 93  ? 18.865  0.113   -5.108  1.00 0.00 ? 190 TYR A O    6  
ATOM 10968 C CB   . TYR A 1 93  ? 22.029  -1.477  -4.836  1.00 0.00 ? 190 TYR A CB   6  
ATOM 10969 C CG   . TYR A 1 93  ? 22.128  -2.634  -3.868  1.00 0.00 ? 190 TYR A CG   6  
ATOM 10970 C CD1  . TYR A 1 93  ? 22.134  -3.944  -4.325  1.00 0.00 ? 190 TYR A CD1  6  
ATOM 10971 C CD2  . TYR A 1 93  ? 22.223  -2.412  -2.499  1.00 0.00 ? 190 TYR A CD2  6  
ATOM 10972 C CE1  . TYR A 1 93  ? 22.231  -5.002  -3.445  1.00 0.00 ? 190 TYR A CE1  6  
ATOM 10973 C CE2  . TYR A 1 93  ? 22.320  -3.465  -1.613  1.00 0.00 ? 190 TYR A CE2  6  
ATOM 10974 C CZ   . TYR A 1 93  ? 22.325  -4.757  -2.091  1.00 0.00 ? 190 TYR A CZ   6  
ATOM 10975 O OH   . TYR A 1 93  ? 22.415  -5.809  -1.212  1.00 0.00 ? 190 TYR A OH   6  
ATOM 10976 H H    . TYR A 1 93  ? 20.504  0.395   -6.727  1.00 0.00 ? 190 TYR A H    6  
ATOM 10977 H HA   . TYR A 1 93  ? 20.388  -2.351  -5.924  1.00 0.00 ? 190 TYR A HA   6  
ATOM 10978 H HB2  . TYR A 1 93  ? 22.826  -1.587  -5.556  1.00 0.00 ? 190 TYR A HB2  6  
ATOM 10979 H HB3  . TYR A 1 93  ? 22.186  -0.566  -4.277  1.00 0.00 ? 190 TYR A HB3  6  
ATOM 10980 H HD1  . TYR A 1 93  ? 22.061  -4.131  -5.385  1.00 0.00 ? 190 TYR A HD1  6  
ATOM 10981 H HD2  . TYR A 1 93  ? 22.218  -1.398  -2.129  1.00 0.00 ? 190 TYR A HD2  6  
ATOM 10982 H HE1  . TYR A 1 93  ? 22.236  -6.014  -3.818  1.00 0.00 ? 190 TYR A HE1  6  
ATOM 10983 H HE2  . TYR A 1 93  ? 22.394  -3.275  -0.553  1.00 0.00 ? 190 TYR A HE2  6  
ATOM 10984 H HH   . TYR A 1 93  ? 23.125  -6.402  -1.496  1.00 0.00 ? 190 TYR A HH   6  
ATOM 10985 N N    . TRP A 1 94  ? 19.471  -1.307  -3.465  1.00 0.00 ? 191 TRP A N    6  
ATOM 10986 C CA   . TRP A 1 94  ? 18.555  -0.745  -2.473  1.00 0.00 ? 191 TRP A CA   6  
ATOM 10987 C C    . TRP A 1 94  ? 18.784  0.754   -2.303  1.00 0.00 ? 191 TRP A C    6  
ATOM 10988 O O    . TRP A 1 94  ? 19.923  1.221   -2.292  1.00 0.00 ? 191 TRP A O    6  
ATOM 10989 C CB   . TRP A 1 94  ? 18.748  -1.415  -1.109  1.00 0.00 ? 191 TRP A CB   6  
ATOM 10990 C CG   . TRP A 1 94  ? 18.227  -2.816  -1.012  1.00 0.00 ? 191 TRP A CG   6  
ATOM 10991 C CD1  . TRP A 1 94  ? 18.657  -3.905  -1.712  1.00 0.00 ? 191 TRP A CD1  6  
ATOM 10992 C CD2  . TRP A 1 94  ? 17.193  -3.281  -0.134  1.00 0.00 ? 191 TRP A CD2  6  
ATOM 10993 N NE1  . TRP A 1 94  ? 17.949  -5.017  -1.331  1.00 0.00 ? 191 TRP A NE1  6  
ATOM 10994 C CE2  . TRP A 1 94  ? 17.047  -4.663  -0.363  1.00 0.00 ? 191 TRP A CE2  6  
ATOM 10995 C CE3  . TRP A 1 94  ? 16.373  -2.666  0.824   1.00 0.00 ? 191 TRP A CE3  6  
ATOM 10996 C CZ2  . TRP A 1 94  ? 16.122  -5.439  0.329   1.00 0.00 ? 191 TRP A CZ2  6  
ATOM 10997 C CZ3  . TRP A 1 94  ? 15.455  -3.442  1.508   1.00 0.00 ? 191 TRP A CZ3  6  
ATOM 10998 C CH2  . TRP A 1 94  ? 15.337  -4.815  1.257   1.00 0.00 ? 191 TRP A CH2  6  
ATOM 10999 H H    . TRP A 1 94  ? 20.006  -2.092  -3.228  1.00 0.00 ? 191 TRP A H    6  
ATOM 11000 H HA   . TRP A 1 94  ? 17.544  -0.915  -2.812  1.00 0.00 ? 191 TRP A HA   6  
ATOM 11001 H HB2  . TRP A 1 94  ? 19.803  -1.444  -0.882  1.00 0.00 ? 191 TRP A HB2  6  
ATOM 11002 H HB3  . TRP A 1 94  ? 18.245  -0.822  -0.358  1.00 0.00 ? 191 TRP A HB3  6  
ATOM 11003 H HD1  . TRP A 1 94  ? 19.437  -3.879  -2.458  1.00 0.00 ? 191 TRP A HD1  6  
ATOM 11004 H HE1  . TRP A 1 94  ? 18.072  -5.924  -1.690  1.00 0.00 ? 191 TRP A HE1  6  
ATOM 11005 H HE3  . TRP A 1 94  ? 16.446  -1.605  1.032   1.00 0.00 ? 191 TRP A HE3  6  
ATOM 11006 H HZ2  . TRP A 1 94  ? 16.017  -6.499  0.150   1.00 0.00 ? 191 TRP A HZ2  6  
ATOM 11007 H HZ3  . TRP A 1 94  ? 14.816  -2.987  2.250   1.00 0.00 ? 191 TRP A HZ3  6  
ATOM 11008 H HH2  . TRP A 1 94  ? 14.605  -5.381  1.813   1.00 0.00 ? 191 TRP A HH2  6  
ATOM 11009 N N    . SER A 1 95  ? 17.701  1.499   -2.176  1.00 0.00 ? 192 SER A N    6  
ATOM 11010 C CA   . SER A 1 95  ? 17.785  2.927   -1.912  1.00 0.00 ? 192 SER A CA   6  
ATOM 11011 C C    . SER A 1 95  ? 16.785  3.316   -0.835  1.00 0.00 ? 192 SER A C    6  
ATOM 11012 O O    . SER A 1 95  ? 16.338  4.463   -0.769  1.00 0.00 ? 192 SER A O    6  
ATOM 11013 C CB   . SER A 1 95  ? 17.533  3.716   -3.194  1.00 0.00 ? 192 SER A CB   6  
ATOM 11014 O OG   . SER A 1 95  ? 18.479  3.366   -4.190  1.00 0.00 ? 192 SER A OG   6  
ATOM 11015 H H    . SER A 1 95  ? 16.820  1.086   -2.270  1.00 0.00 ? 192 SER A H    6  
ATOM 11016 H HA   . SER A 1 95  ? 18.782  3.139   -1.556  1.00 0.00 ? 192 SER A HA   6  
ATOM 11017 H HB2  . SER A 1 95  ? 16.541  3.497   -3.562  1.00 0.00 ? 192 SER A HB2  6  
ATOM 11018 H HB3  . SER A 1 95  ? 17.618  4.774   -2.989  1.00 0.00 ? 192 SER A HB3  6  
ATOM 11019 H HG   . SER A 1 95  ? 18.514  2.406   -4.274  1.00 0.00 ? 192 SER A HG   6  
ATOM 11020 N N    . ALA A 1 96  ? 16.446  2.340   0.008   1.00 0.00 ? 193 ALA A N    6  
ATOM 11021 C CA   . ALA A 1 96  ? 15.473  2.526   1.076   1.00 0.00 ? 193 ALA A CA   6  
ATOM 11022 C C    . ALA A 1 96  ? 14.123  2.968   0.517   1.00 0.00 ? 193 ALA A C    6  
ATOM 11023 O O    . ALA A 1 96  ? 13.775  2.647   -0.622  1.00 0.00 ? 193 ALA A O    6  
ATOM 11024 C CB   . ALA A 1 96  ? 16.006  3.515   2.104   1.00 0.00 ? 193 ALA A CB   6  
ATOM 11025 H H    . ALA A 1 96  ? 16.875  1.468   -0.087  1.00 0.00 ? 193 ALA A H    6  
ATOM 11026 H HA   . ALA A 1 96  ? 15.342  1.576   1.570   1.00 0.00 ? 193 ALA A HA   6  
ATOM 11027 H HB1  . ALA A 1 96  ? 16.086  4.494   1.656   1.00 0.00 ? 193 ALA A HB1  6  
ATOM 11028 H HB2  . ALA A 1 96  ? 16.979  3.190   2.440   1.00 0.00 ? 193 ALA A HB2  6  
ATOM 11029 H HB3  . ALA A 1 96  ? 15.332  3.557   2.946   1.00 0.00 ? 193 ALA A HB3  6  
ATOM 11030 N N    . TRP A 1 97  ? 13.363  3.684   1.328   1.00 0.00 ? 194 TRP A N    6  
ATOM 11031 C CA   . TRP A 1 97  ? 12.005  4.069   0.972   1.00 0.00 ? 194 TRP A CA   6  
ATOM 11032 C C    . TRP A 1 97  ? 11.881  5.587   0.882   1.00 0.00 ? 194 TRP A C    6  
ATOM 11033 O O    . TRP A 1 97  ? 12.040  6.290   1.883   1.00 0.00 ? 194 TRP A O    6  
ATOM 11034 C CB   . TRP A 1 97  ? 11.033  3.542   2.026   1.00 0.00 ? 194 TRP A CB   6  
ATOM 11035 C CG   . TRP A 1 97  ? 11.292  2.122   2.432   1.00 0.00 ? 194 TRP A CG   6  
ATOM 11036 C CD1  . TRP A 1 97  ? 12.197  1.690   3.358   1.00 0.00 ? 194 TRP A CD1  6  
ATOM 11037 C CD2  . TRP A 1 97  ? 10.636  0.951   1.935   1.00 0.00 ? 194 TRP A CD2  6  
ATOM 11038 N NE1  . TRP A 1 97  ? 12.151  0.324   3.460   1.00 0.00 ? 194 TRP A NE1  6  
ATOM 11039 C CE2  . TRP A 1 97  ? 11.201  -0.154  2.600   1.00 0.00 ? 194 TRP A CE2  6  
ATOM 11040 C CE3  . TRP A 1 97  ? 9.630   0.728   0.993   1.00 0.00 ? 194 TRP A CE3  6  
ATOM 11041 C CZ2  . TRP A 1 97  ? 10.792  -1.460  2.356   1.00 0.00 ? 194 TRP A CZ2  6  
ATOM 11042 C CZ3  . TRP A 1 97  ? 9.223   -0.569  0.752   1.00 0.00 ? 194 TRP A CZ3  6  
ATOM 11043 C CH2  . TRP A 1 97  ? 9.803   -1.648  1.431   1.00 0.00 ? 194 TRP A CH2  6  
ATOM 11044 H H    . TRP A 1 97  ? 13.725  3.962   2.193   1.00 0.00 ? 194 TRP A H    6  
ATOM 11045 H HA   . TRP A 1 97  ? 11.767  3.632   0.016   1.00 0.00 ? 194 TRP A HA   6  
ATOM 11046 H HB2  . TRP A 1 97  ? 11.105  4.157   2.911   1.00 0.00 ? 194 TRP A HB2  6  
ATOM 11047 H HB3  . TRP A 1 97  ? 10.027  3.599   1.636   1.00 0.00 ? 194 TRP A HB3  6  
ATOM 11048 H HD1  . TRP A 1 97  ? 12.854  2.341   3.916   1.00 0.00 ? 194 TRP A HD1  6  
ATOM 11049 H HE1  . TRP A 1 97  ? 12.709  -0.223  4.057   1.00 0.00 ? 194 TRP A HE1  6  
ATOM 11050 H HE3  . TRP A 1 97  ? 9.172   1.547   0.460   1.00 0.00 ? 194 TRP A HE3  6  
ATOM 11051 H HZ2  . TRP A 1 97  ? 11.232  -2.302  2.872   1.00 0.00 ? 194 TRP A HZ2  6  
ATOM 11052 H HZ3  . TRP A 1 97  ? 8.445   -0.762  0.029   1.00 0.00 ? 194 TRP A HZ3  6  
ATOM 11053 H HH2  . TRP A 1 97  ? 9.453   -2.643  1.210   1.00 0.00 ? 194 TRP A HH2  6  
ATOM 11054 N N    . SER A 1 98  ? 11.603  6.093   -0.312  1.00 0.00 ? 195 SER A N    6  
ATOM 11055 C CA   . SER A 1 98  ? 11.449  7.526   -0.504  1.00 0.00 ? 195 SER A CA   6  
ATOM 11056 C C    . SER A 1 98  ? 9.977   7.970   -0.645  1.00 0.00 ? 195 SER A C    6  
ATOM 11057 O O    . SER A 1 98  ? 9.554   8.881   0.066   1.00 0.00 ? 195 SER A O    6  
ATOM 11058 C CB   . SER A 1 98  ? 12.291  8.003   -1.695  1.00 0.00 ? 195 SER A CB   6  
ATOM 11059 O OG   . SER A 1 98  ? 12.236  7.090   -2.782  1.00 0.00 ? 195 SER A OG   6  
ATOM 11060 H H    . SER A 1 98  ? 11.520  5.494   -1.082  1.00 0.00 ? 195 SER A H    6  
ATOM 11061 H HA   . SER A 1 98  ? 11.843  7.996   0.386   1.00 0.00 ? 195 SER A HA   6  
ATOM 11062 H HB2  . SER A 1 98  ? 11.922  8.958   -2.028  1.00 0.00 ? 195 SER A HB2  6  
ATOM 11063 H HB3  . SER A 1 98  ? 13.319  8.107   -1.381  1.00 0.00 ? 195 SER A HB3  6  
ATOM 11064 H HG   . SER A 1 98  ? 11.929  7.558   -3.580  1.00 0.00 ? 195 SER A HG   6  
ATOM 11065 N N    . PRO A 1 99  ? 9.156   7.346   -1.526  1.00 0.00 ? 196 PRO A N    6  
ATOM 11066 C CA   . PRO A 1 99  ? 7.793   7.817   -1.788  1.00 0.00 ? 196 PRO A CA   6  
ATOM 11067 C C    . PRO A 1 99  ? 6.797   7.402   -0.705  1.00 0.00 ? 196 PRO A C    6  
ATOM 11068 O O    . PRO A 1 99  ? 6.057   6.432   -0.870  1.00 0.00 ? 196 PRO A O    6  
ATOM 11069 C CB   . PRO A 1 99  ? 7.421   7.152   -3.126  1.00 0.00 ? 196 PRO A CB   6  
ATOM 11070 C CG   . PRO A 1 99  ? 8.620   6.366   -3.555  1.00 0.00 ? 196 PRO A CG   6  
ATOM 11071 C CD   . PRO A 1 99  ? 9.452   6.152   -2.323  1.00 0.00 ? 196 PRO A CD   6  
ATOM 11072 H HA   . PRO A 1 99  ? 7.766   8.891   -1.902  1.00 0.00 ? 196 PRO A HA   6  
ATOM 11073 H HB2  . PRO A 1 99  ? 6.566   6.509   -2.978  1.00 0.00 ? 196 PRO A HB2  6  
ATOM 11074 H HB3  . PRO A 1 99  ? 7.175   7.915   -3.849  1.00 0.00 ? 196 PRO A HB3  6  
ATOM 11075 H HG2  . PRO A 1 99  ? 8.308   5.416   -3.962  1.00 0.00 ? 196 PRO A HG2  6  
ATOM 11076 H HG3  . PRO A 1 99  ? 9.180   6.924   -4.291  1.00 0.00 ? 196 PRO A HG3  6  
ATOM 11077 H HD2  . PRO A 1 99  ? 9.142   5.254   -1.808  1.00 0.00 ? 196 PRO A HD2  6  
ATOM 11078 H HD3  . PRO A 1 99  ? 10.501  6.104   -2.577  1.00 0.00 ? 196 PRO A HD3  6  
ATOM 11079 N N    . ALA A 1 100 ? 6.780   8.137   0.403   1.00 0.00 ? 197 ALA A N    6  
ATOM 11080 C CA   . ALA A 1 100 ? 5.826   7.874   1.473   1.00 0.00 ? 197 ALA A CA   6  
ATOM 11081 C C    . ALA A 1 100 ? 4.502   8.557   1.172   1.00 0.00 ? 197 ALA A C    6  
ATOM 11082 O O    . ALA A 1 100 ? 4.346   9.764   1.363   1.00 0.00 ? 197 ALA A O    6  
ATOM 11083 C CB   . ALA A 1 100 ? 6.373   8.319   2.824   1.00 0.00 ? 197 ALA A CB   6  
ATOM 11084 H H    . ALA A 1 100 ? 7.416   8.882   0.494   1.00 0.00 ? 197 ALA A H    6  
ATOM 11085 H HA   . ALA A 1 100 ? 5.661   6.808   1.511   1.00 0.00 ? 197 ALA A HA   6  
ATOM 11086 H HB1  . ALA A 1 100 ? 5.604   8.205   3.574   1.00 0.00 ? 197 ALA A HB1  6  
ATOM 11087 H HB2  . ALA A 1 100 ? 6.673   9.354   2.769   1.00 0.00 ? 197 ALA A HB2  6  
ATOM 11088 H HB3  . ALA A 1 100 ? 7.226   7.705   3.091   1.00 0.00 ? 197 ALA A HB3  6  
ATOM 11089 N N    . THR A 1 101 ? 3.559   7.769   0.694   1.00 0.00 ? 198 THR A N    6  
ATOM 11090 C CA   . THR A 1 101 ? 2.267   8.281   0.283   1.00 0.00 ? 198 THR A CA   6  
ATOM 11091 C C    . THR A 1 101 ? 1.248   8.132   1.408   1.00 0.00 ? 198 THR A C    6  
ATOM 11092 O O    . THR A 1 101 ? 1.135   7.069   2.023   1.00 0.00 ? 198 THR A O    6  
ATOM 11093 C CB   . THR A 1 101 ? 1.782   7.542   -0.977  1.00 0.00 ? 198 THR A CB   6  
ATOM 11094 O OG1  . THR A 1 101 ? 2.821   7.569   -1.966  1.00 0.00 ? 198 THR A OG1  6  
ATOM 11095 C CG2  . THR A 1 101 ? 0.520   8.178   -1.540  1.00 0.00 ? 198 THR A CG2  6  
ATOM 11096 H H    . THR A 1 101 ? 3.732   6.802   0.626   1.00 0.00 ? 198 THR A H    6  
ATOM 11097 H HA   . THR A 1 101 ? 2.381   9.328   0.045   1.00 0.00 ? 198 THR A HA   6  
ATOM 11098 H HB   . THR A 1 101 ? 1.567   6.516   -0.715  1.00 0.00 ? 198 THR A HB   6  
ATOM 11099 H HG1  . THR A 1 101 ? 3.651   7.300   -1.557  1.00 0.00 ? 198 THR A HG1  6  
ATOM 11100 H HG21 . THR A 1 101 ? -0.251  8.179   -0.783  1.00 0.00 ? 198 THR A HG21 6  
ATOM 11101 H HG22 . THR A 1 101 ? 0.185   7.615   -2.397  1.00 0.00 ? 198 THR A HG22 6  
ATOM 11102 H HG23 . THR A 1 101 ? 0.733   9.194   -1.838  1.00 0.00 ? 198 THR A HG23 6  
ATOM 11103 N N    . PHE A 1 102 ? 0.530   9.208   1.687   1.00 0.00 ? 199 PHE A N    6  
ATOM 11104 C CA   . PHE A 1 102 ? -0.464  9.218   2.750   1.00 0.00 ? 199 PHE A CA   6  
ATOM 11105 C C    . PHE A 1 102 ? -1.850  8.932   2.189   1.00 0.00 ? 199 PHE A C    6  
ATOM 11106 O O    . PHE A 1 102 ? -2.393  9.724   1.416   1.00 0.00 ? 199 PHE A O    6  
ATOM 11107 C CB   . PHE A 1 102 ? -0.460  10.569  3.468   1.00 0.00 ? 199 PHE A CB   6  
ATOM 11108 C CG   . PHE A 1 102 ? 0.817   10.862  4.204   1.00 0.00 ? 199 PHE A CG   6  
ATOM 11109 C CD1  . PHE A 1 102 ? 1.951   11.277  3.524   1.00 0.00 ? 199 PHE A CD1  6  
ATOM 11110 C CD2  . PHE A 1 102 ? 0.881   10.722  5.579   1.00 0.00 ? 199 PHE A CD2  6  
ATOM 11111 C CE1  . PHE A 1 102 ? 3.124   11.546  4.203   1.00 0.00 ? 199 PHE A CE1  6  
ATOM 11112 C CE2  . PHE A 1 102 ? 2.051   10.991  6.264   1.00 0.00 ? 199 PHE A CE2  6  
ATOM 11113 C CZ   . PHE A 1 102 ? 3.173   11.403  5.574   1.00 0.00 ? 199 PHE A CZ   6  
ATOM 11114 H H    . PHE A 1 102 ? 0.669   10.024  1.158   1.00 0.00 ? 199 PHE A H    6  
ATOM 11115 H HA   . PHE A 1 102 ? -0.205  8.442   3.454   1.00 0.00 ? 199 PHE A HA   6  
ATOM 11116 H HB2  . PHE A 1 102 ? -0.611  11.354  2.742   1.00 0.00 ? 199 PHE A HB2  6  
ATOM 11117 H HB3  . PHE A 1 102 ? -1.269  10.589  4.184   1.00 0.00 ? 199 PHE A HB3  6  
ATOM 11118 H HD1  . PHE A 1 102 ? 1.913   11.389  2.451   1.00 0.00 ? 199 PHE A HD1  6  
ATOM 11119 H HD2  . PHE A 1 102 ? 0.003   10.400  6.118   1.00 0.00 ? 199 PHE A HD2  6  
ATOM 11120 H HE1  . PHE A 1 102 ? 4.002   11.869  3.661   1.00 0.00 ? 199 PHE A HE1  6  
ATOM 11121 H HE2  . PHE A 1 102 ? 2.087   10.879  7.338   1.00 0.00 ? 199 PHE A HE2  6  
ATOM 11122 H HZ   . PHE A 1 102 ? 4.089   11.611  6.106   1.00 0.00 ? 199 PHE A HZ   6  
ATOM 11123 N N    . ILE A 1 103 ? -2.422  7.808   2.584   1.00 0.00 ? 200 ILE A N    6  
ATOM 11124 C CA   . ILE A 1 103 ? -3.736  7.414   2.108   1.00 0.00 ? 200 ILE A CA   6  
ATOM 11125 C C    . ILE A 1 103 ? -4.711  7.319   3.276   1.00 0.00 ? 200 ILE A C    6  
ATOM 11126 O O    . ILE A 1 103 ? -4.380  6.789   4.340   1.00 0.00 ? 200 ILE A O    6  
ATOM 11127 C CB   . ILE A 1 103 ? -3.685  6.068   1.337   1.00 0.00 ? 200 ILE A CB   6  
ATOM 11128 C CG1  . ILE A 1 103 ? -5.084  5.635   0.883   1.00 0.00 ? 200 ILE A CG1  6  
ATOM 11129 C CG2  . ILE A 1 103 ? -3.040  4.977   2.180   1.00 0.00 ? 200 ILE A CG2  6  
ATOM 11130 C CD1  . ILE A 1 103 ? -5.707  6.557   -0.143  1.00 0.00 ? 200 ILE A CD1  6  
ATOM 11131 H H    . ILE A 1 103 ? -1.958  7.235   3.234   1.00 0.00 ? 200 ILE A H    6  
ATOM 11132 H HA   . ILE A 1 103 ? -4.085  8.180   1.430   1.00 0.00 ? 200 ILE A HA   6  
ATOM 11133 H HB   . ILE A 1 103 ? -3.067  6.214   0.464   1.00 0.00 ? 200 ILE A HB   6  
ATOM 11134 H HG12 . ILE A 1 103 ? -5.022  4.650   0.445   1.00 0.00 ? 200 ILE A HG12 6  
ATOM 11135 H HG13 . ILE A 1 103 ? -5.738  5.601   1.742   1.00 0.00 ? 200 ILE A HG13 6  
ATOM 11136 H HG21 . ILE A 1 103 ? -2.028  5.263   2.426   1.00 0.00 ? 200 ILE A HG21 6  
ATOM 11137 H HG22 . ILE A 1 103 ? -3.028  4.052   1.624   1.00 0.00 ? 200 ILE A HG22 6  
ATOM 11138 H HG23 . ILE A 1 103 ? -3.607  4.845   3.089   1.00 0.00 ? 200 ILE A HG23 6  
ATOM 11139 H HD11 . ILE A 1 103 ? -5.821  7.542   0.283   1.00 0.00 ? 200 ILE A HD11 6  
ATOM 11140 H HD12 . ILE A 1 103 ? -6.676  6.174   -0.429  1.00 0.00 ? 200 ILE A HD12 6  
ATOM 11141 H HD13 . ILE A 1 103 ? -5.069  6.612   -1.013  1.00 0.00 ? 200 ILE A HD13 6  
ATOM 11142 N N    . GLN A 1 104 ? -5.896  7.868   3.086   1.00 0.00 ? 201 GLN A N    6  
ATOM 11143 C CA   . GLN A 1 104 ? -6.922  7.841   4.111   1.00 0.00 ? 201 GLN A CA   6  
ATOM 11144 C C    . GLN A 1 104 ? -7.969  6.784   3.805   1.00 0.00 ? 201 GLN A C    6  
ATOM 11145 O O    . GLN A 1 104 ? -8.427  6.659   2.666   1.00 0.00 ? 201 GLN A O    6  
ATOM 11146 C CB   . GLN A 1 104 ? -7.584  9.210   4.231   1.00 0.00 ? 201 GLN A CB   6  
ATOM 11147 C CG   . GLN A 1 104 ? -7.187  9.960   5.488   1.00 0.00 ? 201 GLN A CG   6  
ATOM 11148 C CD   . GLN A 1 104 ? -7.725  9.301   6.744   1.00 0.00 ? 201 GLN A CD   6  
ATOM 11149 O OE1  . GLN A 1 104 ? -8.778  8.662   6.726   1.00 0.00 ? 201 GLN A OE1  6  
ATOM 11150 N NE2  . GLN A 1 104 ? -7.009  9.452   7.843   1.00 0.00 ? 201 GLN A NE2  6  
ATOM 11151 H H    . GLN A 1 104 ? -6.089  8.304   2.229   1.00 0.00 ? 201 GLN A H    6  
ATOM 11152 H HA   . GLN A 1 104 ? -6.446  7.599   5.049   1.00 0.00 ? 201 GLN A HA   6  
ATOM 11153 H HB2  . GLN A 1 104 ? -7.308  9.809   3.375   1.00 0.00 ? 201 GLN A HB2  6  
ATOM 11154 H HB3  . GLN A 1 104 ? -8.656  9.081   4.237   1.00 0.00 ? 201 GLN A HB3  6  
ATOM 11155 H HG2  . GLN A 1 104 ? -6.108  9.991   5.547   1.00 0.00 ? 201 GLN A HG2  6  
ATOM 11156 H HG3  . GLN A 1 104 ? -7.574  10.967  5.432   1.00 0.00 ? 201 GLN A HG3  6  
ATOM 11157 H HE21 . GLN A 1 104 ? -6.182  9.975   7.790   1.00 0.00 ? 201 GLN A HE21 6  
ATOM 11158 H HE22 . GLN A 1 104 ? -7.336  9.036   8.668   1.00 0.00 ? 201 GLN A HE22 6  
ATOM 11159 N N    . ILE A 1 105 ? -8.333  6.019   4.821   1.00 0.00 ? 202 ILE A N    6  
ATOM 11160 C CA   . ILE A 1 105 ? -9.361  5.006   4.676   1.00 0.00 ? 202 ILE A CA   6  
ATOM 11161 C C    . ILE A 1 105 ? -10.717 5.597   5.043   1.00 0.00 ? 202 ILE A C    6  
ATOM 11162 O O    . ILE A 1 105 ? -10.929 6.001   6.185   1.00 0.00 ? 202 ILE A O    6  
ATOM 11163 C CB   . ILE A 1 105 ? -9.085  3.776   5.570   1.00 0.00 ? 202 ILE A CB   6  
ATOM 11164 C CG1  . ILE A 1 105 ? -7.663  3.256   5.343   1.00 0.00 ? 202 ILE A CG1  6  
ATOM 11165 C CG2  . ILE A 1 105 ? -10.100 2.673   5.295   1.00 0.00 ? 202 ILE A CG2  6  
ATOM 11166 C CD1  . ILE A 1 105 ? -7.367  2.895   3.904   1.00 0.00 ? 202 ILE A CD1  6  
ATOM 11167 H H    . ILE A 1 105 ? -7.902  6.145   5.695   1.00 0.00 ? 202 ILE A H    6  
ATOM 11168 H HA   . ILE A 1 105 ? -9.379  4.687   3.645   1.00 0.00 ? 202 ILE A HA   6  
ATOM 11169 H HB   . ILE A 1 105 ? -9.189  4.078   6.601   1.00 0.00 ? 202 ILE A HB   6  
ATOM 11170 H HG12 . ILE A 1 105 ? -6.958  4.017   5.642   1.00 0.00 ? 202 ILE A HG12 6  
ATOM 11171 H HG13 . ILE A 1 105 ? -7.510  2.374   5.947   1.00 0.00 ? 202 ILE A HG13 6  
ATOM 11172 H HG21 . ILE A 1 105 ? -10.002 2.337   4.272   1.00 0.00 ? 202 ILE A HG21 6  
ATOM 11173 H HG22 . ILE A 1 105 ? -11.098 3.055   5.454   1.00 0.00 ? 202 ILE A HG22 6  
ATOM 11174 H HG23 . ILE A 1 105 ? -9.922  1.843   5.965   1.00 0.00 ? 202 ILE A HG23 6  
ATOM 11175 H HD11 . ILE A 1 105 ? -7.429  3.781   3.290   1.00 0.00 ? 202 ILE A HD11 6  
ATOM 11176 H HD12 . ILE A 1 105 ? -8.087  2.166   3.560   1.00 0.00 ? 202 ILE A HD12 6  
ATOM 11177 H HD13 . ILE A 1 105 ? -6.374  2.478   3.837   1.00 0.00 ? 202 ILE A HD13 6  
ATOM 11178 N N    . PRO A 1 106 ? -11.645 5.664   4.077   1.00 0.00 ? 203 PRO A N    6  
ATOM 11179 C CA   . PRO A 1 106 ? -12.977 6.238   4.300   1.00 0.00 ? 203 PRO A CA   6  
ATOM 11180 C C    . PRO A 1 106 ? -13.755 5.481   5.369   1.00 0.00 ? 203 PRO A C    6  
ATOM 11181 O O    . PRO A 1 106 ? -13.574 4.278   5.555   1.00 0.00 ? 203 PRO A O    6  
ATOM 11182 C CB   . PRO A 1 106 ? -13.669 6.089   2.938   1.00 0.00 ? 203 PRO A CB   6  
ATOM 11183 C CG   . PRO A 1 106 ? -12.891 5.044   2.216   1.00 0.00 ? 203 PRO A CG   6  
ATOM 11184 C CD   . PRO A 1 106 ? -11.478 5.180   2.698   1.00 0.00 ? 203 PRO A CD   6  
ATOM 11185 H HA   . PRO A 1 106 ? -12.919 7.284   4.568   1.00 0.00 ? 203 PRO A HA   6  
ATOM 11186 H HB2  . PRO A 1 106 ? -14.694 5.784   3.087   1.00 0.00 ? 203 PRO A HB2  6  
ATOM 11187 H HB3  . PRO A 1 106 ? -13.642 7.032   2.414   1.00 0.00 ? 203 PRO A HB3  6  
ATOM 11188 H HG2  . PRO A 1 106 ? -13.277 4.064   2.460   1.00 0.00 ? 203 PRO A HG2  6  
ATOM 11189 H HG3  . PRO A 1 106 ? -12.943 5.215   1.152   1.00 0.00 ? 203 PRO A HG3  6  
ATOM 11190 H HD2  . PRO A 1 106 ? -10.981 4.221   2.681   1.00 0.00 ? 203 PRO A HD2  6  
ATOM 11191 H HD3  . PRO A 1 106 ? -10.939 5.898   2.098   1.00 0.00 ? 203 PRO A HD3  6  
ATOM 11192 N N    . SER A 1 107 ? -14.627 6.194   6.067   1.00 0.00 ? 204 SER A N    6  
ATOM 11193 C CA   . SER A 1 107 ? -15.455 5.600   7.104   1.00 0.00 ? 204 SER A CA   6  
ATOM 11194 C C    . SER A 1 107 ? -16.469 4.637   6.495   1.00 0.00 ? 204 SER A C    6  
ATOM 11195 O O    . SER A 1 107 ? -17.023 3.787   7.184   1.00 0.00 ? 204 SER A O    6  
ATOM 11196 C CB   . SER A 1 107 ? -16.172 6.697   7.894   1.00 0.00 ? 204 SER A CB   6  
ATOM 11197 O OG   . SER A 1 107 ? -16.860 7.582   7.025   1.00 0.00 ? 204 SER A OG   6  
ATOM 11198 H H    . SER A 1 107 ? -14.715 7.154   5.882   1.00 0.00 ? 204 SER A H    6  
ATOM 11199 H HA   . SER A 1 107 ? -14.810 5.049   7.772   1.00 0.00 ? 204 SER A HA   6  
ATOM 11200 H HB2  . SER A 1 107 ? -16.885 6.247   8.567   1.00 0.00 ? 204 SER A HB2  6  
ATOM 11201 H HB3  . SER A 1 107 ? -15.446 7.261   8.462   1.00 0.00 ? 204 SER A HB3  6  
ATOM 11202 H HG   . SER A 1 107 ? -16.403 8.436   7.010   1.00 0.00 ? 204 SER A HG   6  
ATOM 11203 N N    . ASP A 1 108 ? -16.697 4.772   5.191   1.00 0.00 ? 205 ASP A N    6  
ATOM 11204 C CA   . ASP A 1 108 ? -17.626 3.900   4.480   1.00 0.00 ? 205 ASP A CA   6  
ATOM 11205 C C    . ASP A 1 108 ? -16.924 2.629   4.020   1.00 0.00 ? 205 ASP A C    6  
ATOM 11206 O O    . ASP A 1 108 ? -17.466 1.853   3.229   1.00 0.00 ? 205 ASP A O    6  
ATOM 11207 C CB   . ASP A 1 108 ? -18.245 4.620   3.281   1.00 0.00 ? 205 ASP A CB   6  
ATOM 11208 C CG   . ASP A 1 108 ? -19.015 5.860   3.681   1.00 0.00 ? 205 ASP A CG   6  
ATOM 11209 O OD1  . ASP A 1 108 ? -19.986 5.741   4.461   1.00 0.00 ? 205 ASP A OD1  6  
ATOM 11210 O OD2  . ASP A 1 108 ? -18.644 6.965   3.234   1.00 0.00 ? 205 ASP A OD2  6  
ATOM 11211 H H    . ASP A 1 108 ? -16.234 5.481   4.699   1.00 0.00 ? 205 ASP A H    6  
ATOM 11212 H HA   . ASP A 1 108 ? -18.413 3.630   5.169   1.00 0.00 ? 205 ASP A HA   6  
ATOM 11213 H HB2  . ASP A 1 108 ? -17.459 4.911   2.600   1.00 0.00 ? 205 ASP A HB2  6  
ATOM 11214 H HB3  . ASP A 1 108 ? -18.920 3.946   2.775   1.00 0.00 ? 205 ASP A HB3  6  
ATOM 11215 N N    . PHE A 1 109 ? -15.704 2.434   4.508   1.00 0.00 ? 206 PHE A N    6  
ATOM 11216 C CA   . PHE A 1 109 ? -14.961 1.204   4.274   1.00 0.00 ? 206 PHE A CA   6  
ATOM 11217 C C    . PHE A 1 109 ? -15.692 0.048   4.944   1.00 0.00 ? 206 PHE A C    6  
ATOM 11218 O O    . PHE A 1 109 ? -15.754 -1.066  4.422   1.00 0.00 ? 206 PHE A O    6  
ATOM 11219 C CB   . PHE A 1 109 ? -13.548 1.344   4.846   1.00 0.00 ? 206 PHE A CB   6  
ATOM 11220 C CG   . PHE A 1 109 ? -12.621 0.208   4.522   1.00 0.00 ? 206 PHE A CG   6  
ATOM 11221 C CD1  . PHE A 1 109 ? -11.869 0.231   3.363   1.00 0.00 ? 206 PHE A CD1  6  
ATOM 11222 C CD2  . PHE A 1 109 ? -12.488 -0.869  5.383   1.00 0.00 ? 206 PHE A CD2  6  
ATOM 11223 C CE1  . PHE A 1 109 ? -11.003 -0.798  3.063   1.00 0.00 ? 206 PHE A CE1  6  
ATOM 11224 C CE2  . PHE A 1 109 ? -11.621 -1.903  5.089   1.00 0.00 ? 206 PHE A CE2  6  
ATOM 11225 C CZ   . PHE A 1 109 ? -10.877 -1.866  3.927   1.00 0.00 ? 206 PHE A CZ   6  
ATOM 11226 H H    . PHE A 1 109 ? -15.289 3.146   5.041   1.00 0.00 ? 206 PHE A H    6  
ATOM 11227 H HA   . PHE A 1 109 ? -14.908 1.029   3.210   1.00 0.00 ? 206 PHE A HA   6  
ATOM 11228 H HB2  . PHE A 1 109 ? -13.104 2.247   4.458   1.00 0.00 ? 206 PHE A HB2  6  
ATOM 11229 H HB3  . PHE A 1 109 ? -13.615 1.420   5.922   1.00 0.00 ? 206 PHE A HB3  6  
ATOM 11230 H HD1  . PHE A 1 109 ? -11.966 1.067   2.686   1.00 0.00 ? 206 PHE A HD1  6  
ATOM 11231 H HD2  . PHE A 1 109 ? -13.070 -0.899  6.291   1.00 0.00 ? 206 PHE A HD2  6  
ATOM 11232 H HE1  . PHE A 1 109 ? -10.421 -0.765  2.156   1.00 0.00 ? 206 PHE A HE1  6  
ATOM 11233 H HE2  . PHE A 1 109 ? -11.523 -2.736  5.769   1.00 0.00 ? 206 PHE A HE2  6  
ATOM 11234 H HZ   . PHE A 1 109 ? -10.197 -2.673  3.693   1.00 0.00 ? 206 PHE A HZ   6  
ATOM 11235 N N    . THR A 1 110 ? -16.238 0.343   6.110   1.00 0.00 ? 207 THR A N    6  
ATOM 11236 C CA   . THR A 1 110 ? -17.035 -0.595  6.873   1.00 0.00 ? 207 THR A CA   6  
ATOM 11237 C C    . THR A 1 110 ? -17.964 0.203   7.786   1.00 0.00 ? 207 THR A C    6  
ATOM 11238 O O    . THR A 1 110 ? -17.567 1.241   8.317   1.00 0.00 ? 207 THR A O    6  
ATOM 11239 C CB   . THR A 1 110 ? -16.138 -1.530  7.718   1.00 0.00 ? 207 THR A CB   6  
ATOM 11240 O OG1  . THR A 1 110 ? -15.117 -2.110  6.893   1.00 0.00 ? 207 THR A OG1  6  
ATOM 11241 C CG2  . THR A 1 110 ? -16.954 -2.643  8.351   1.00 0.00 ? 207 THR A CG2  6  
ATOM 11242 H H    . THR A 1 110 ? -16.104 1.241   6.479   1.00 0.00 ? 207 THR A H    6  
ATOM 11243 H HA   . THR A 1 110 ? -17.621 -1.189  6.188   1.00 0.00 ? 207 THR A HA   6  
ATOM 11244 H HB   . THR A 1 110 ? -15.675 -0.950  8.503   1.00 0.00 ? 207 THR A HB   6  
ATOM 11245 H HG1  . THR A 1 110 ? -15.310 -1.915  5.966   1.00 0.00 ? 207 THR A HG1  6  
ATOM 11246 H HG21 . THR A 1 110 ? -17.726 -2.215  8.974   1.00 0.00 ? 207 THR A HG21 6  
ATOM 11247 H HG22 . THR A 1 110 ? -16.309 -3.264  8.955   1.00 0.00 ? 207 THR A HG22 6  
ATOM 11248 H HG23 . THR A 1 110 ? -17.407 -3.242  7.576   1.00 0.00 ? 207 THR A HG23 6  
ATOM 11249 N N    . MET A 1 111 ? -19.204 -0.266  7.939   1.00 0.00 ? 208 MET A N    6  
ATOM 11250 C CA   . MET A 1 111 ? -20.224 0.455   8.711   1.00 0.00 ? 208 MET A CA   6  
ATOM 11251 C C    . MET A 1 111 ? -19.811 0.640   10.166  1.00 0.00 ? 208 MET A C    6  
ATOM 11252 O O    . MET A 1 111 ? -20.348 1.497   10.869  1.00 0.00 ? 208 MET A O    6  
ATOM 11253 C CB   . MET A 1 111 ? -21.574 -0.264  8.634   1.00 0.00 ? 208 MET A CB   6  
ATOM 11254 C CG   . MET A 1 111 ? -22.223 -0.191  7.260   1.00 0.00 ? 208 MET A CG   6  
ATOM 11255 S SD   . MET A 1 111 ? -23.843 -0.988  7.202   1.00 0.00 ? 208 MET A SD   6  
ATOM 11256 C CE   . MET A 1 111 ? -24.749 -0.017  8.406   1.00 0.00 ? 208 MET A CE   6  
ATOM 11257 H H    . MET A 1 111 ? -19.443 -1.120  7.517   1.00 0.00 ? 208 MET A H    6  
ATOM 11258 H HA   . MET A 1 111 ? -20.331 1.431   8.264   1.00 0.00 ? 208 MET A HA   6  
ATOM 11259 H HB2  . MET A 1 111 ? -21.430 -1.304  8.888   1.00 0.00 ? 208 MET A HB2  6  
ATOM 11260 H HB3  . MET A 1 111 ? -22.246 0.183   9.351   1.00 0.00 ? 208 MET A HB3  6  
ATOM 11261 H HG2  . MET A 1 111 ? -22.341 0.846   6.988   1.00 0.00 ? 208 MET A HG2  6  
ATOM 11262 H HG3  . MET A 1 111 ? -21.574 -0.676  6.545   1.00 0.00 ? 208 MET A HG3  6  
ATOM 11263 H HE1  . MET A 1 111 ? -24.740 1.023   8.110   1.00 0.00 ? 208 MET A HE1  6  
ATOM 11264 H HE2  . MET A 1 111 ? -24.284 -0.119  9.375   1.00 0.00 ? 208 MET A HE2  6  
ATOM 11265 H HE3  . MET A 1 111 ? -25.769 -0.368  8.457   1.00 0.00 ? 208 MET A HE3  6  
ATOM 11266 N N    . ASN A 1 112 ? -18.867 -0.170  10.615  1.00 0.00 ? 209 ASN A N    6  
ATOM 11267 C CA   . ASN A 1 112 ? -18.262 0.001   11.926  1.00 0.00 ? 209 ASN A CA   6  
ATOM 11268 C C    . ASN A 1 112 ? -16.745 0.008   11.789  1.00 0.00 ? 209 ASN A C    6  
ATOM 11269 O O    . ASN A 1 112 ? -16.197 -0.625  10.886  1.00 0.00 ? 209 ASN A O    6  
ATOM 11270 C CB   . ASN A 1 112 ? -18.720 -1.097  12.905  1.00 0.00 ? 209 ASN A CB   6  
ATOM 11271 C CG   . ASN A 1 112 ? -18.611 -2.512  12.348  1.00 0.00 ? 209 ASN A CG   6  
ATOM 11272 O OD1  . ASN A 1 112 ? -17.781 -2.807  11.491  1.00 0.00 ? 209 ASN A OD1  6  
ATOM 11273 N ND2  . ASN A 1 112 ? -19.455 -3.401  12.845  1.00 0.00 ? 209 ASN A ND2  6  
ATOM 11274 H H    . ASN A 1 112 ? -18.560 -0.905  10.045  1.00 0.00 ? 209 ASN A H    6  
ATOM 11275 H HA   . ASN A 1 112 ? -18.577 0.962   12.306  1.00 0.00 ? 209 ASN A HA   6  
ATOM 11276 H HB2  . ASN A 1 112 ? -18.116 -1.042  13.795  1.00 0.00 ? 209 ASN A HB2  6  
ATOM 11277 H HB3  . ASN A 1 112 ? -19.751 -0.916  13.171  1.00 0.00 ? 209 ASN A HB3  6  
ATOM 11278 H HD21 . ASN A 1 112 ? -20.090 -3.105  13.532  1.00 0.00 ? 209 ASN A HD21 6  
ATOM 11279 H HD22 . ASN A 1 112 ? -19.417 -4.320  12.502  1.00 0.00 ? 209 ASN A HD22 6  
ATOM 11280 N N    . ASP A 1 113 ? -16.068 0.748   12.651  1.00 0.00 ? 210 ASP A N    6  
ATOM 11281 C CA   . ASP A 1 113 ? -14.616 0.810   12.608  1.00 0.00 ? 210 ASP A CA   6  
ATOM 11282 C C    . ASP A 1 113 ? -14.020 0.002   13.753  1.00 0.00 ? 210 ASP A C    6  
ATOM 11283 O O    . ASP A 1 113 ? -13.496 -1.097  13.488  1.00 0.00 ? 210 ASP A O    6  
ATOM 11284 C CB   . ASP A 1 113 ? -14.108 2.265   12.621  1.00 0.00 ? 210 ASP A CB   6  
ATOM 11285 C CG   . ASP A 1 113 ? -14.445 3.032   13.887  1.00 0.00 ? 210 ASP A CG   6  
ATOM 11286 O OD1  . ASP A 1 113 ? -15.634 3.345   14.103  1.00 0.00 ? 210 ASP A OD1  6  
ATOM 11287 O OD2  . ASP A 1 113 ? -13.518 3.350   14.662  1.00 0.00 ? 210 ASP A OD2  6  
ATOM 11288 O OXT  . ASP A 1 113 ? -14.113 0.437   14.916  1.00 0.00 ? 210 ASP A OXT  6  
ATOM 11289 H H    . ASP A 1 113 ? -16.552 1.257   13.337  1.00 0.00 ? 210 ASP A H    6  
ATOM 11290 H HA   . ASP A 1 113 ? -14.308 0.348   11.680  1.00 0.00 ? 210 ASP A HA   6  
ATOM 11291 H HB2  . ASP A 1 113 ? -13.035 2.260   12.509  1.00 0.00 ? 210 ASP A HB2  6  
ATOM 11292 H HB3  . ASP A 1 113 ? -14.543 2.790   11.783  1.00 0.00 ? 210 ASP A HB3  6  
ATOM 11293 N N    . MET A 1 1   ? 31.085  8.003   -4.159  1.00 0.00 ? 98  MET A N    7  
ATOM 11294 C CA   . MET A 1 1   ? 29.882  8.616   -3.553  1.00 0.00 ? 98  MET A CA   7  
ATOM 11295 C C    . MET A 1 1   ? 28.809  7.557   -3.347  1.00 0.00 ? 98  MET A C    7  
ATOM 11296 O O    . MET A 1 1   ? 29.015  6.388   -3.674  1.00 0.00 ? 98  MET A O    7  
ATOM 11297 C CB   . MET A 1 1   ? 29.332  9.734   -4.448  1.00 0.00 ? 98  MET A CB   7  
ATOM 11298 C CG   . MET A 1 1   ? 30.354  10.799  -4.809  1.00 0.00 ? 98  MET A CG   7  
ATOM 11299 S SD   . MET A 1 1   ? 31.038  11.638  -3.368  1.00 0.00 ? 98  MET A SD   7  
ATOM 11300 C CE   . MET A 1 1   ? 29.579  12.456  -2.723  1.00 0.00 ? 98  MET A CE   7  
ATOM 11301 H H1   . MET A 1 1   ? 31.451  7.252   -3.540  1.00 0.00 ? 98  MET A H1   7  
ATOM 11302 H H2   . MET A 1 1   ? 31.829  8.716   -4.293  1.00 0.00 ? 98  MET A H2   7  
ATOM 11303 H H3   . MET A 1 1   ? 30.848  7.585   -5.082  1.00 0.00 ? 98  MET A H3   7  
ATOM 11304 H HA   . MET A 1 1   ? 30.156  9.030   -2.593  1.00 0.00 ? 98  MET A HA   7  
ATOM 11305 H HB2  . MET A 1 1   ? 28.964  9.296   -5.364  1.00 0.00 ? 98  MET A HB2  7  
ATOM 11306 H HB3  . MET A 1 1   ? 28.511  10.214  -3.938  1.00 0.00 ? 98  MET A HB3  7  
ATOM 11307 H HG2  . MET A 1 1   ? 31.162  10.333  -5.350  1.00 0.00 ? 98  MET A HG2  7  
ATOM 11308 H HG3  . MET A 1 1   ? 29.879  11.533  -5.443  1.00 0.00 ? 98  MET A HG3  7  
ATOM 11309 H HE1  . MET A 1 1   ? 29.852  13.062  -1.873  1.00 0.00 ? 98  MET A HE1  7  
ATOM 11310 H HE2  . MET A 1 1   ? 28.857  11.714  -2.419  1.00 0.00 ? 98  MET A HE2  7  
ATOM 11311 H HE3  . MET A 1 1   ? 29.150  13.083  -3.489  1.00 0.00 ? 98  MET A HE3  7  
ATOM 11312 N N    . TYR A 1 2   ? 27.670  7.960   -2.805  1.00 0.00 ? 99  TYR A N    7  
ATOM 11313 C CA   . TYR A 1 2   ? 26.553  7.049   -2.614  1.00 0.00 ? 99  TYR A CA   7  
ATOM 11314 C C    . TYR A 1 2   ? 25.976  6.614   -3.952  1.00 0.00 ? 99  TYR A C    7  
ATOM 11315 O O    . TYR A 1 2   ? 25.771  7.430   -4.853  1.00 0.00 ? 99  TYR A O    7  
ATOM 11316 C CB   . TYR A 1 2   ? 25.461  7.700   -1.753  1.00 0.00 ? 99  TYR A CB   7  
ATOM 11317 C CG   . TYR A 1 2   ? 24.121  6.991   -1.812  1.00 0.00 ? 99  TYR A CG   7  
ATOM 11318 C CD1  . TYR A 1 2   ? 23.984  5.669   -1.405  1.00 0.00 ? 99  TYR A CD1  7  
ATOM 11319 C CD2  . TYR A 1 2   ? 22.994  7.649   -2.285  1.00 0.00 ? 99  TYR A CD2  7  
ATOM 11320 C CE1  . TYR A 1 2   ? 22.762  5.027   -1.468  1.00 0.00 ? 99  TYR A CE1  7  
ATOM 11321 C CE2  . TYR A 1 2   ? 21.769  7.014   -2.350  1.00 0.00 ? 99  TYR A CE2  7  
ATOM 11322 C CZ   . TYR A 1 2   ? 21.658  5.703   -1.941  1.00 0.00 ? 99  TYR A CZ   7  
ATOM 11323 O OH   . TYR A 1 2   ? 20.437  5.068   -2.005  1.00 0.00 ? 99  TYR A OH   7  
ATOM 11324 H H    . TYR A 1 2   ? 27.578  8.897   -2.524  1.00 0.00 ? 99  TYR A H    7  
ATOM 11325 H HA   . TYR A 1 2   ? 26.925  6.171   -2.104  1.00 0.00 ? 99  TYR A HA   7  
ATOM 11326 H HB2  . TYR A 1 2   ? 25.783  7.708   -0.723  1.00 0.00 ? 99  TYR A HB2  7  
ATOM 11327 H HB3  . TYR A 1 2   ? 25.313  8.716   -2.085  1.00 0.00 ? 99  TYR A HB3  7  
ATOM 11328 H HD1  . TYR A 1 2   ? 24.848  5.142   -1.035  1.00 0.00 ? 99  TYR A HD1  7  
ATOM 11329 H HD2  . TYR A 1 2   ? 23.083  8.677   -2.608  1.00 0.00 ? 99  TYR A HD2  7  
ATOM 11330 H HE1  . TYR A 1 2   ? 22.678  3.997   -1.154  1.00 0.00 ? 99  TYR A HE1  7  
ATOM 11331 H HE2  . TYR A 1 2   ? 20.907  7.544   -2.722  1.00 0.00 ? 99  TYR A HE2  7  
ATOM 11332 H HH   . TYR A 1 2   ? 20.008  5.282   -2.842  1.00 0.00 ? 99  TYR A HH   7  
ATOM 11333 N N    . ILE A 1 3   ? 25.747  5.319   -4.070  1.00 0.00 ? 100 ILE A N    7  
ATOM 11334 C CA   . ILE A 1 3   ? 25.106  4.746   -5.238  1.00 0.00 ? 100 ILE A CA   7  
ATOM 11335 C C    . ILE A 1 3   ? 23.644  5.161   -5.291  1.00 0.00 ? 100 ILE A C    7  
ATOM 11336 O O    . ILE A 1 3   ? 22.811  4.660   -4.534  1.00 0.00 ? 100 ILE A O    7  
ATOM 11337 C CB   . ILE A 1 3   ? 25.213  3.216   -5.208  1.00 0.00 ? 100 ILE A CB   7  
ATOM 11338 C CG1  . ILE A 1 3   ? 26.682  2.809   -5.250  1.00 0.00 ? 100 ILE A CG1  7  
ATOM 11339 C CG2  . ILE A 1 3   ? 24.440  2.595   -6.362  1.00 0.00 ? 100 ILE A CG2  7  
ATOM 11340 C CD1  . ILE A 1 3   ? 26.917  1.383   -4.834  1.00 0.00 ? 100 ILE A CD1  7  
ATOM 11341 H H    . ILE A 1 3   ? 26.022  4.722   -3.343  1.00 0.00 ? 100 ILE A H    7  
ATOM 11342 H HA   . ILE A 1 3   ? 25.613  5.111   -6.118  1.00 0.00 ? 100 ILE A HA   7  
ATOM 11343 H HB   . ILE A 1 3   ? 24.776  2.864   -4.284  1.00 0.00 ? 100 ILE A HB   7  
ATOM 11344 H HG12 . ILE A 1 3   ? 27.053  2.926   -6.258  1.00 0.00 ? 100 ILE A HG12 7  
ATOM 11345 H HG13 . ILE A 1 3   ? 27.244  3.448   -4.586  1.00 0.00 ? 100 ILE A HG13 7  
ATOM 11346 H HG21 . ILE A 1 3   ? 23.393  2.846   -6.265  1.00 0.00 ? 100 ILE A HG21 7  
ATOM 11347 H HG22 . ILE A 1 3   ? 24.558  1.522   -6.340  1.00 0.00 ? 100 ILE A HG22 7  
ATOM 11348 H HG23 . ILE A 1 3   ? 24.817  2.981   -7.298  1.00 0.00 ? 100 ILE A HG23 7  
ATOM 11349 H HD11 . ILE A 1 3   ? 26.608  1.259   -3.806  1.00 0.00 ? 100 ILE A HD11 7  
ATOM 11350 H HD12 . ILE A 1 3   ? 27.966  1.149   -4.927  1.00 0.00 ? 100 ILE A HD12 7  
ATOM 11351 H HD13 . ILE A 1 3   ? 26.340  0.727   -5.466  1.00 0.00 ? 100 ILE A HD13 7  
ATOM 11352 N N    . VAL A 1 4   ? 23.347  6.079   -6.185  1.00 0.00 ? 101 VAL A N    7  
ATOM 11353 C CA   . VAL A 1 4   ? 22.014  6.643   -6.285  1.00 0.00 ? 101 VAL A CA   7  
ATOM 11354 C C    . VAL A 1 4   ? 21.186  5.881   -7.313  1.00 0.00 ? 101 VAL A C    7  
ATOM 11355 O O    . VAL A 1 4   ? 21.663  5.562   -8.403  1.00 0.00 ? 101 VAL A O    7  
ATOM 11356 C CB   . VAL A 1 4   ? 22.062  8.151   -6.637  1.00 0.00 ? 101 VAL A CB   7  
ATOM 11357 C CG1  . VAL A 1 4   ? 22.795  8.389   -7.950  1.00 0.00 ? 101 VAL A CG1  7  
ATOM 11358 C CG2  . VAL A 1 4   ? 20.660  8.747   -6.687  1.00 0.00 ? 101 VAL A CG2  7  
ATOM 11359 H H    . VAL A 1 4   ? 24.042  6.369   -6.813  1.00 0.00 ? 101 VAL A H    7  
ATOM 11360 H HA   . VAL A 1 4   ? 21.542  6.540   -5.318  1.00 0.00 ? 101 VAL A HA   7  
ATOM 11361 H HB   . VAL A 1 4   ? 22.611  8.657   -5.857  1.00 0.00 ? 101 VAL A HB   7  
ATOM 11362 H HG11 . VAL A 1 4   ? 22.299  7.847   -8.743  1.00 0.00 ? 101 VAL A HG11 7  
ATOM 11363 H HG12 . VAL A 1 4   ? 23.814  8.043   -7.861  1.00 0.00 ? 101 VAL A HG12 7  
ATOM 11364 H HG13 . VAL A 1 4   ? 22.792  9.444   -8.178  1.00 0.00 ? 101 VAL A HG13 7  
ATOM 11365 H HG21 . VAL A 1 4   ? 20.723  9.797   -6.928  1.00 0.00 ? 101 VAL A HG21 7  
ATOM 11366 H HG22 . VAL A 1 4   ? 20.182  8.625   -5.726  1.00 0.00 ? 101 VAL A HG22 7  
ATOM 11367 H HG23 . VAL A 1 4   ? 20.080  8.239   -7.444  1.00 0.00 ? 101 VAL A HG23 7  
ATOM 11368 N N    . GLN A 1 5   ? 19.957  5.566   -6.943  1.00 0.00 ? 102 GLN A N    7  
ATOM 11369 C CA   . GLN A 1 5   ? 19.057  4.834   -7.817  1.00 0.00 ? 102 GLN A CA   7  
ATOM 11370 C C    . GLN A 1 5   ? 18.072  5.785   -8.482  1.00 0.00 ? 102 GLN A C    7  
ATOM 11371 O O    . GLN A 1 5   ? 17.155  6.286   -7.832  1.00 0.00 ? 102 GLN A O    7  
ATOM 11372 C CB   . GLN A 1 5   ? 18.285  3.759   -7.036  1.00 0.00 ? 102 GLN A CB   7  
ATOM 11373 C CG   . GLN A 1 5   ? 19.086  2.501   -6.724  1.00 0.00 ? 102 GLN A CG   7  
ATOM 11374 C CD   . GLN A 1 5   ? 20.194  2.707   -5.706  1.00 0.00 ? 102 GLN A CD   7  
ATOM 11375 O OE1  . GLN A 1 5   ? 21.231  2.044   -5.759  1.00 0.00 ? 102 GLN A OE1  7  
ATOM 11376 N NE2  . GLN A 1 5   ? 19.980  3.604   -4.753  1.00 0.00 ? 102 GLN A NE2  7  
ATOM 11377 H H    . GLN A 1 5   ? 19.643  5.837   -6.054  1.00 0.00 ? 102 GLN A H    7  
ATOM 11378 H HA   . GLN A 1 5   ? 19.652  4.355   -8.580  1.00 0.00 ? 102 GLN A HA   7  
ATOM 11379 H HB2  . GLN A 1 5   ? 17.954  4.185   -6.100  1.00 0.00 ? 102 GLN A HB2  7  
ATOM 11380 H HB3  . GLN A 1 5   ? 17.417  3.472   -7.612  1.00 0.00 ? 102 GLN A HB3  7  
ATOM 11381 H HG2  . GLN A 1 5   ? 18.409  1.751   -6.340  1.00 0.00 ? 102 GLN A HG2  7  
ATOM 11382 H HG3  . GLN A 1 5   ? 19.527  2.141   -7.643  1.00 0.00 ? 102 GLN A HG3  7  
ATOM 11383 H HE21 . GLN A 1 5   ? 19.124  4.083   -4.750  1.00 0.00 ? 102 GLN A HE21 7  
ATOM 11384 H HE22 . GLN A 1 5   ? 20.691  3.759   -4.094  1.00 0.00 ? 102 GLN A HE22 7  
ATOM 11385 N N    . PRO A 1 6   ? 18.256  6.070   -9.776  1.00 0.00 ? 103 PRO A N    7  
ATOM 11386 C CA   . PRO A 1 6   ? 17.325  6.879   -10.542 1.00 0.00 ? 103 PRO A CA   7  
ATOM 11387 C C    . PRO A 1 6   ? 16.266  6.003   -11.186 1.00 0.00 ? 103 PRO A C    7  
ATOM 11388 O O    . PRO A 1 6   ? 16.219  4.799   -10.914 1.00 0.00 ? 103 PRO A O    7  
ATOM 11389 C CB   . PRO A 1 6   ? 18.235  7.475   -11.598 1.00 0.00 ? 103 PRO A CB   7  
ATOM 11390 C CG   . PRO A 1 6   ? 19.113  6.330   -11.938 1.00 0.00 ? 103 PRO A CG   7  
ATOM 11391 C CD   . PRO A 1 6   ? 19.383  5.629   -10.623 1.00 0.00 ? 103 PRO A CD   7  
ATOM 11392 H HA   . PRO A 1 6   ? 16.867  7.658   -9.950  1.00 0.00 ? 103 PRO A HA   7  
ATOM 11393 H HB2  . PRO A 1 6   ? 17.652  7.806   -12.446 1.00 0.00 ? 103 PRO A HB2  7  
ATOM 11394 H HB3  . PRO A 1 6   ? 18.796  8.298   -11.184 1.00 0.00 ? 103 PRO A HB3  7  
ATOM 11395 H HG2  . PRO A 1 6   ? 18.586  5.670   -12.617 1.00 0.00 ? 103 PRO A HG2  7  
ATOM 11396 H HG3  . PRO A 1 6   ? 20.032  6.681   -12.380 1.00 0.00 ? 103 PRO A HG3  7  
ATOM 11397 H HD2  . PRO A 1 6   ? 19.373  4.557   -10.755 1.00 0.00 ? 103 PRO A HD2  7  
ATOM 11398 H HD3  . PRO A 1 6   ? 20.327  5.953   -10.207 1.00 0.00 ? 103 PRO A HD3  7  
ATOM 11399 N N    . ASP A 1 7   ? 15.458  6.606   -12.059 1.00 0.00 ? 104 ASP A N    7  
ATOM 11400 C CA   . ASP A 1 7   ? 14.354  5.919   -12.740 1.00 0.00 ? 104 ASP A CA   7  
ATOM 11401 C C    . ASP A 1 7   ? 13.683  4.864   -11.848 1.00 0.00 ? 104 ASP A C    7  
ATOM 11402 O O    . ASP A 1 7   ? 13.598  3.691   -12.208 1.00 0.00 ? 104 ASP A O    7  
ATOM 11403 C CB   . ASP A 1 7   ? 14.796  5.311   -14.090 1.00 0.00 ? 104 ASP A CB   7  
ATOM 11404 C CG   . ASP A 1 7   ? 16.065  4.473   -14.031 1.00 0.00 ? 104 ASP A CG   7  
ATOM 11405 O OD1  . ASP A 1 7   ? 15.983  3.259   -13.752 1.00 0.00 ? 104 ASP A OD1  7  
ATOM 11406 O OD2  . ASP A 1 7   ? 17.155  5.020   -14.321 1.00 0.00 ? 104 ASP A OD2  7  
ATOM 11407 H H    . ASP A 1 7   ? 15.604  7.557   -12.250 1.00 0.00 ? 104 ASP A H    7  
ATOM 11408 H HA   . ASP A 1 7   ? 13.623  6.678   -12.947 1.00 0.00 ? 104 ASP A HA   7  
ATOM 11409 H HB2  . ASP A 1 7   ? 14.003  4.684   -14.460 1.00 0.00 ? 104 ASP A HB2  7  
ATOM 11410 H HB3  . ASP A 1 7   ? 14.957  6.117   -14.792 1.00 0.00 ? 104 ASP A HB3  7  
ATOM 11411 N N    . PRO A 1 8   ? 13.179  5.279   -10.672 1.00 0.00 ? 105 PRO A N    7  
ATOM 11412 C CA   . PRO A 1 8   ? 12.645  4.372   -9.671  1.00 0.00 ? 105 PRO A CA   7  
ATOM 11413 C C    . PRO A 1 8   ? 11.141  4.155   -9.831  1.00 0.00 ? 105 PRO A C    7  
ATOM 11414 O O    . PRO A 1 8   ? 10.516  4.763   -10.701 1.00 0.00 ? 105 PRO A O    7  
ATOM 11415 C CB   . PRO A 1 8   ? 12.962  5.110   -8.365  1.00 0.00 ? 105 PRO A CB   7  
ATOM 11416 C CG   . PRO A 1 8   ? 13.052  6.566   -8.721  1.00 0.00 ? 105 PRO A CG   7  
ATOM 11417 C CD   . PRO A 1 8   ? 13.056  6.671   -10.227 1.00 0.00 ? 105 PRO A CD   7  
ATOM 11418 H HA   . PRO A 1 8   ? 13.152  3.419   -9.685  1.00 0.00 ? 105 PRO A HA   7  
ATOM 11419 H HB2  . PRO A 1 8   ? 12.170  4.932   -7.653  1.00 0.00 ? 105 PRO A HB2  7  
ATOM 11420 H HB3  . PRO A 1 8   ? 13.896  4.747   -7.964  1.00 0.00 ? 105 PRO A HB3  7  
ATOM 11421 H HG2  . PRO A 1 8   ? 12.200  7.091   -8.318  1.00 0.00 ? 105 PRO A HG2  7  
ATOM 11422 H HG3  . PRO A 1 8   ? 13.965  6.980   -8.318  1.00 0.00 ? 105 PRO A HG3  7  
ATOM 11423 H HD2  . PRO A 1 8   ? 12.131  7.105   -10.578 1.00 0.00 ? 105 PRO A HD2  7  
ATOM 11424 H HD3  . PRO A 1 8   ? 13.899  7.257   -10.563 1.00 0.00 ? 105 PRO A HD3  7  
ATOM 11425 N N    . PRO A 1 9   ? 10.542  3.267   -9.011  1.00 0.00 ? 106 PRO A N    7  
ATOM 11426 C CA   . PRO A 1 9   ? 9.091   3.074   -8.989  1.00 0.00 ? 106 PRO A CA   7  
ATOM 11427 C C    . PRO A 1 9   ? 8.362   4.394   -8.765  1.00 0.00 ? 106 PRO A C    7  
ATOM 11428 O O    . PRO A 1 9   ? 8.444   4.998   -7.691  1.00 0.00 ? 106 PRO A O    7  
ATOM 11429 C CB   . PRO A 1 9   ? 8.857   2.110   -7.813  1.00 0.00 ? 106 PRO A CB   7  
ATOM 11430 C CG   . PRO A 1 9   ? 10.144  2.082   -7.057  1.00 0.00 ? 106 PRO A CG   7  
ATOM 11431 C CD   . PRO A 1 9   ? 11.219  2.371   -8.063  1.00 0.00 ? 106 PRO A CD   7  
ATOM 11432 H HA   . PRO A 1 9   ? 8.739   2.623   -9.906  1.00 0.00 ? 106 PRO A HA   7  
ATOM 11433 H HB2  . PRO A 1 9   ? 8.048   2.478   -7.199  1.00 0.00 ? 106 PRO A HB2  7  
ATOM 11434 H HB3  . PRO A 1 9   ? 8.605   1.130   -8.194  1.00 0.00 ? 106 PRO A HB3  7  
ATOM 11435 H HG2  . PRO A 1 9   ? 10.134  2.842   -6.289  1.00 0.00 ? 106 PRO A HG2  7  
ATOM 11436 H HG3  . PRO A 1 9   ? 10.292  1.106   -6.619  1.00 0.00 ? 106 PRO A HG3  7  
ATOM 11437 H HD2  . PRO A 1 9   ? 12.057  2.866   -7.592  1.00 0.00 ? 106 PRO A HD2  7  
ATOM 11438 H HD3  . PRO A 1 9   ? 11.539  1.462   -8.550  1.00 0.00 ? 106 PRO A HD3  7  
ATOM 11439 N N    . LEU A 1 10  ? 7.669   4.845   -9.793  1.00 0.00 ? 107 LEU A N    7  
ATOM 11440 C CA   . LEU A 1 10  ? 6.999   6.129   -9.764  1.00 0.00 ? 107 LEU A CA   7  
ATOM 11441 C C    . LEU A 1 10  ? 5.510   5.967   -10.037 1.00 0.00 ? 107 LEU A C    7  
ATOM 11442 O O    . LEU A 1 10  ? 5.037   4.850   -10.257 1.00 0.00 ? 107 LEU A O    7  
ATOM 11443 C CB   . LEU A 1 10  ? 7.657   7.087   -10.771 1.00 0.00 ? 107 LEU A CB   7  
ATOM 11444 C CG   . LEU A 1 10  ? 8.107   6.463   -12.101 1.00 0.00 ? 107 LEU A CG   7  
ATOM 11445 C CD1  . LEU A 1 10  ? 6.921   6.156   -13.001 1.00 0.00 ? 107 LEU A CD1  7  
ATOM 11446 C CD2  . LEU A 1 10  ? 9.090   7.381   -12.809 1.00 0.00 ? 107 LEU A CD2  7  
ATOM 11447 H H    . LEU A 1 10  ? 7.596   4.287   -10.602 1.00 0.00 ? 107 LEU A H    7  
ATOM 11448 H HA   . LEU A 1 10  ? 7.121   6.535   -8.771  1.00 0.00 ? 107 LEU A HA   7  
ATOM 11449 H HB2  . LEU A 1 10  ? 6.951   7.874   -10.994 1.00 0.00 ? 107 LEU A HB2  7  
ATOM 11450 H HB3  . LEU A 1 10  ? 8.520   7.529   -10.300 1.00 0.00 ? 107 LEU A HB3  7  
ATOM 11451 H HG   . LEU A 1 10  ? 8.614   5.532   -11.895 1.00 0.00 ? 107 LEU A HG   7  
ATOM 11452 H HD11 . LEU A 1 10  ? 6.247   5.485   -12.489 1.00 0.00 ? 107 LEU A HD11 7  
ATOM 11453 H HD12 . LEU A 1 10  ? 7.271   5.690   -13.909 1.00 0.00 ? 107 LEU A HD12 7  
ATOM 11454 H HD13 . LEU A 1 10  ? 6.405   7.072   -13.242 1.00 0.00 ? 107 LEU A HD13 7  
ATOM 11455 H HD21 . LEU A 1 10  ? 9.412   6.920   -13.730 1.00 0.00 ? 107 LEU A HD21 7  
ATOM 11456 H HD22 . LEU A 1 10  ? 9.947   7.550   -12.174 1.00 0.00 ? 107 LEU A HD22 7  
ATOM 11457 H HD23 . LEU A 1 10  ? 8.611   8.324   -13.026 1.00 0.00 ? 107 LEU A HD23 7  
ATOM 11458 N N    . GLU A 1 11  ? 4.785   7.084   -10.013 1.00 0.00 ? 108 GLU A N    7  
ATOM 11459 C CA   . GLU A 1 11  ? 3.336   7.082   -10.204 1.00 0.00 ? 108 GLU A CA   7  
ATOM 11460 C C    . GLU A 1 11  ? 2.666   6.108   -9.239  1.00 0.00 ? 108 GLU A C    7  
ATOM 11461 O O    . GLU A 1 11  ? 1.811   5.311   -9.631  1.00 0.00 ? 108 GLU A O    7  
ATOM 11462 C CB   . GLU A 1 11  ? 2.976   6.736   -11.651 1.00 0.00 ? 108 GLU A CB   7  
ATOM 11463 C CG   . GLU A 1 11  ? 3.504   7.739   -12.663 1.00 0.00 ? 108 GLU A CG   7  
ATOM 11464 C CD   . GLU A 1 11  ? 3.009   7.466   -14.065 1.00 0.00 ? 108 GLU A CD   7  
ATOM 11465 O OE1  . GLU A 1 11  ? 3.666   6.702   -14.798 1.00 0.00 ? 108 GLU A OE1  7  
ATOM 11466 O OE2  . GLU A 1 11  ? 1.960   8.022   -14.447 1.00 0.00 ? 108 GLU A OE2  7  
ATOM 11467 H H    . GLU A 1 11  ? 5.238   7.940   -9.863  1.00 0.00 ? 108 GLU A H    7  
ATOM 11468 H HA   . GLU A 1 11  ? 2.978   8.078   -9.985  1.00 0.00 ? 108 GLU A HA   7  
ATOM 11469 H HB2  . GLU A 1 11  ? 3.388   5.766   -11.890 1.00 0.00 ? 108 GLU A HB2  7  
ATOM 11470 H HB3  . GLU A 1 11  ? 1.901   6.694   -11.745 1.00 0.00 ? 108 GLU A HB3  7  
ATOM 11471 H HG2  . GLU A 1 11  ? 3.183   8.728   -12.370 1.00 0.00 ? 108 GLU A HG2  7  
ATOM 11472 H HG3  . GLU A 1 11  ? 4.582   7.698   -12.662 1.00 0.00 ? 108 GLU A HG3  7  
ATOM 11473 N N    . LEU A 1 12  ? 3.075   6.172   -7.978  1.00 0.00 ? 109 LEU A N    7  
ATOM 11474 C CA   . LEU A 1 12  ? 2.517   5.315   -6.948  1.00 0.00 ? 109 LEU A CA   7  
ATOM 11475 C C    . LEU A 1 12  ? 1.082   5.731   -6.648  1.00 0.00 ? 109 LEU A C    7  
ATOM 11476 O O    . LEU A 1 12  ? 0.840   6.702   -5.929  1.00 0.00 ? 109 LEU A O    7  
ATOM 11477 C CB   . LEU A 1 12  ? 3.375   5.381   -5.679  1.00 0.00 ? 109 LEU A CB   7  
ATOM 11478 C CG   . LEU A 1 12  ? 2.935   4.459   -4.538  1.00 0.00 ? 109 LEU A CG   7  
ATOM 11479 C CD1  . LEU A 1 12  ? 2.971   3.005   -4.980  1.00 0.00 ? 109 LEU A CD1  7  
ATOM 11480 C CD2  . LEU A 1 12  ? 3.821   4.661   -3.319  1.00 0.00 ? 109 LEU A CD2  7  
ATOM 11481 H H    . LEU A 1 12  ? 3.771   6.819   -7.734  1.00 0.00 ? 109 LEU A H    7  
ATOM 11482 H HA   . LEU A 1 12  ? 2.518   4.302   -7.322  1.00 0.00 ? 109 LEU A HA   7  
ATOM 11483 H HB2  . LEU A 1 12  ? 4.390   5.128   -5.946  1.00 0.00 ? 109 LEU A HB2  7  
ATOM 11484 H HB3  . LEU A 1 12  ? 3.361   6.398   -5.315  1.00 0.00 ? 109 LEU A HB3  7  
ATOM 11485 H HG   . LEU A 1 12  ? 1.919   4.699   -4.259  1.00 0.00 ? 109 LEU A HG   7  
ATOM 11486 H HD11 . LEU A 1 12  ? 2.310   2.867   -5.821  1.00 0.00 ? 109 LEU A HD11 7  
ATOM 11487 H HD12 . LEU A 1 12  ? 2.653   2.373   -4.165  1.00 0.00 ? 109 LEU A HD12 7  
ATOM 11488 H HD13 . LEU A 1 12  ? 3.979   2.743   -5.264  1.00 0.00 ? 109 LEU A HD13 7  
ATOM 11489 H HD21 . LEU A 1 12  ? 4.841   4.416   -3.572  1.00 0.00 ? 109 LEU A HD21 7  
ATOM 11490 H HD22 . LEU A 1 12  ? 3.484   4.018   -2.519  1.00 0.00 ? 109 LEU A HD22 7  
ATOM 11491 H HD23 . LEU A 1 12  ? 3.765   5.691   -3.001  1.00 0.00 ? 109 LEU A HD23 7  
ATOM 11492 N N    . ALA A 1 13  ? 0.140   5.011   -7.230  1.00 0.00 ? 110 ALA A N    7  
ATOM 11493 C CA   . ALA A 1 13  ? -1.269  5.311   -7.067  1.00 0.00 ? 110 ALA A CA   7  
ATOM 11494 C C    . ALA A 1 13  ? -1.888  4.390   -6.033  1.00 0.00 ? 110 ALA A C    7  
ATOM 11495 O O    . ALA A 1 13  ? -1.714  3.173   -6.086  1.00 0.00 ? 110 ALA A O    7  
ATOM 11496 C CB   . ALA A 1 13  ? -1.996  5.181   -8.394  1.00 0.00 ? 110 ALA A CB   7  
ATOM 11497 H H    . ALA A 1 13  ? 0.402   4.236   -7.779  1.00 0.00 ? 110 ALA A H    7  
ATOM 11498 H HA   . ALA A 1 13  ? -1.359  6.332   -6.728  1.00 0.00 ? 110 ALA A HA   7  
ATOM 11499 H HB1  . ALA A 1 13  ? -1.540  5.839   -9.118  1.00 0.00 ? 110 ALA A HB1  7  
ATOM 11500 H HB2  . ALA A 1 13  ? -3.033  5.452   -8.265  1.00 0.00 ? 110 ALA A HB2  7  
ATOM 11501 H HB3  . ALA A 1 13  ? -1.929  4.161   -8.743  1.00 0.00 ? 110 ALA A HB3  7  
ATOM 11502 N N    . VAL A 1 14  ? -2.599  4.976   -5.090  1.00 0.00 ? 111 VAL A N    7  
ATOM 11503 C CA   . VAL A 1 14  ? -3.230  4.210   -4.033  1.00 0.00 ? 111 VAL A CA   7  
ATOM 11504 C C    . VAL A 1 14  ? -4.723  4.495   -4.011  1.00 0.00 ? 111 VAL A C    7  
ATOM 11505 O O    . VAL A 1 14  ? -5.141  5.655   -3.970  1.00 0.00 ? 111 VAL A O    7  
ATOM 11506 C CB   . VAL A 1 14  ? -2.631  4.549   -2.654  1.00 0.00 ? 111 VAL A CB   7  
ATOM 11507 C CG1  . VAL A 1 14  ? -3.047  3.517   -1.622  1.00 0.00 ? 111 VAL A CG1  7  
ATOM 11508 C CG2  . VAL A 1 14  ? -1.115  4.660   -2.730  1.00 0.00 ? 111 VAL A CG2  7  
ATOM 11509 H H    . VAL A 1 14  ? -2.708  5.951   -5.104  1.00 0.00 ? 111 VAL A H    7  
ATOM 11510 H HA   . VAL A 1 14  ? -3.070  3.160   -4.232  1.00 0.00 ? 111 VAL A HA   7  
ATOM 11511 H HB   . VAL A 1 14  ? -3.024  5.506   -2.345  1.00 0.00 ? 111 VAL A HB   7  
ATOM 11512 H HG11 . VAL A 1 14  ? -2.619  3.773   -0.665  1.00 0.00 ? 111 VAL A HG11 7  
ATOM 11513 H HG12 . VAL A 1 14  ? -2.695  2.543   -1.926  1.00 0.00 ? 111 VAL A HG12 7  
ATOM 11514 H HG13 . VAL A 1 14  ? -4.123  3.502   -1.543  1.00 0.00 ? 111 VAL A HG13 7  
ATOM 11515 H HG21 . VAL A 1 14  ? -0.733  5.008   -1.784  1.00 0.00 ? 111 VAL A HG21 7  
ATOM 11516 H HG22 . VAL A 1 14  ? -0.846  5.361   -3.506  1.00 0.00 ? 111 VAL A HG22 7  
ATOM 11517 H HG23 . VAL A 1 14  ? -0.694  3.692   -2.956  1.00 0.00 ? 111 VAL A HG23 7  
ATOM 11518 N N    . GLU A 1 15  ? -5.524  3.447   -4.056  1.00 0.00 ? 112 GLU A N    7  
ATOM 11519 C CA   . GLU A 1 15  ? -6.967  3.602   -4.028  1.00 0.00 ? 112 GLU A CA   7  
ATOM 11520 C C    . GLU A 1 15  ? -7.615  2.484   -3.232  1.00 0.00 ? 112 GLU A C    7  
ATOM 11521 O O    . GLU A 1 15  ? -7.025  1.429   -3.031  1.00 0.00 ? 112 GLU A O    7  
ATOM 11522 C CB   . GLU A 1 15  ? -7.541  3.643   -5.445  1.00 0.00 ? 112 GLU A CB   7  
ATOM 11523 C CG   . GLU A 1 15  ? -7.268  2.416   -6.282  1.00 0.00 ? 112 GLU A CG   7  
ATOM 11524 C CD   . GLU A 1 15  ? -7.841  2.556   -7.678  1.00 0.00 ? 112 GLU A CD   7  
ATOM 11525 O OE1  . GLU A 1 15  ? -9.052  2.300   -7.861  1.00 0.00 ? 112 GLU A OE1  7  
ATOM 11526 O OE2  . GLU A 1 15  ? -7.092  2.943   -8.597  1.00 0.00 ? 112 GLU A OE2  7  
ATOM 11527 H H    . GLU A 1 15  ? -5.136  2.544   -4.104  1.00 0.00 ? 112 GLU A H    7  
ATOM 11528 H HA   . GLU A 1 15  ? -7.184  4.540   -3.538  1.00 0.00 ? 112 GLU A HA   7  
ATOM 11529 H HB2  . GLU A 1 15  ? -8.608  3.754   -5.376  1.00 0.00 ? 112 GLU A HB2  7  
ATOM 11530 H HB3  . GLU A 1 15  ? -7.131  4.497   -5.959  1.00 0.00 ? 112 GLU A HB3  7  
ATOM 11531 H HG2  . GLU A 1 15  ? -6.199  2.271   -6.355  1.00 0.00 ? 112 GLU A HG2  7  
ATOM 11532 H HG3  . GLU A 1 15  ? -7.719  1.562   -5.802  1.00 0.00 ? 112 GLU A HG3  7  
ATOM 11533 N N    . VAL A 1 16  ? -8.827  2.727   -2.777  1.00 0.00 ? 113 VAL A N    7  
ATOM 11534 C CA   . VAL A 1 16  ? -9.542  1.757   -1.971  1.00 0.00 ? 113 VAL A CA   7  
ATOM 11535 C C    . VAL A 1 16  ? -10.661 1.112   -2.783  1.00 0.00 ? 113 VAL A C    7  
ATOM 11536 O O    . VAL A 1 16  ? -11.451 1.798   -3.433  1.00 0.00 ? 113 VAL A O    7  
ATOM 11537 C CB   . VAL A 1 16  ? -10.105 2.408   -0.686  1.00 0.00 ? 113 VAL A CB   7  
ATOM 11538 C CG1  . VAL A 1 16  ? -11.014 3.584   -1.011  1.00 0.00 ? 113 VAL A CG1  7  
ATOM 11539 C CG2  . VAL A 1 16  ? -10.834 1.381   0.166   1.00 0.00 ? 113 VAL A CG2  7  
ATOM 11540 H H