data_2LP8
# 
_entry.id   2LP8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LP8         
RCSB  RCSB102661   
BMRB  18238        
WWPDB D_1000102661 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 18238 BMRB . 
unspecified 2LPC  PDB  . 
unspecified 18250 BMRB . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LP8 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-03 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wysoczanski, P.'    1 
'Mart, R.J.'         2 
'Loveridge, J.E.'    3 
'Williams, C.'       4 
'Whittaker, S.B.-M.' 5 
'Crump, M.P.'        6 
'Allemann, R.K.'     7 
# 
_citation.id                        primary 
_citation.title                     
'NMR Solution Structure of a Photoswitchable Apoptosis Activating Bak Peptide Bound to Bcl-x(L).' 
_citation.journal_abbrev            J.Am.Chem.Soc. 
_citation.journal_volume            134 
_citation.page_first                7644 
_citation.page_last                 7647 
_citation.year                      2012 
_citation.journal_id_ASTM           JACSAT 
_citation.country                   US 
_citation.journal_id_ISSN           0002-7863 
_citation.journal_id_CSD            0004 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22515821 
_citation.pdbx_database_id_DOI      10.1021/ja302390a 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wysoczanski, P.' 1 
primary 'Mart, R.J.'      2 
primary 'Loveridge, E.J.' 3 
primary 'Williams, C.'    4 
primary 'Whittaker, S.B.' 5 
primary 'Crump, M.P.'     6 
primary 'Allemann, R.K.'  7 
# 
_cell.entry_id           2LP8 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2LP8 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Bcl-2-like protein 1'                                                      21455.523 1 ? ? ? ? 
2 polymer     syn 'Bcl-2 homologous antagonist/killer'                                        1648.934  1 ? 
'Q73C, Q77A, I80A, I81F, D84C' 'BH3 domain residues 72-87' ? 
3 non-polymer syn 
;3,3'-(E)-diazene-1,2-diylbis{6-[(chloroacetyl)amino]benzenesulfonic acid}
;
525.340   1 ? ?                              ?                           ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Bcl2-L-1, Apoptosis regulator Bcl-X'                     
2 'Apoptosis regulator BAK, Bcl-2-like protein 7, Bcl2-L-7' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
AESRKGQERLEHHHHHHLEHHHHHH
;
;MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
AESRKGQERLEHHHHHHLEHHHHHH
;
A ? 
2 'polypeptide(L)' no yes '(ACE)GCVGRALAAFGDCINR(NH2)' XGCVGRALAAFGDCINRX B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLN n 
1 4   SER n 
1 5   ASN n 
1 6   ARG n 
1 7   GLU n 
1 8   LEU n 
1 9   VAL n 
1 10  VAL n 
1 11  ASP n 
1 12  PHE n 
1 13  LEU n 
1 14  SER n 
1 15  TYR n 
1 16  LYS n 
1 17  LEU n 
1 18  SER n 
1 19  GLN n 
1 20  LYS n 
1 21  GLY n 
1 22  TYR n 
1 23  SER n 
1 24  TRP n 
1 25  SER n 
1 26  GLN n 
1 27  PHE n 
1 28  SER n 
1 29  ASP n 
1 30  VAL n 
1 31  GLU n 
1 32  GLU n 
1 33  ASN n 
1 34  ARG n 
1 35  THR n 
1 36  GLU n 
1 37  ALA n 
1 38  PRO n 
1 39  GLU n 
1 40  GLY n 
1 41  THR n 
1 42  GLU n 
1 43  SER n 
1 44  GLU n 
1 45  ALA n 
1 46  VAL n 
1 47  LYS n 
1 48  GLN n 
1 49  ALA n 
1 50  LEU n 
1 51  ARG n 
1 52  GLU n 
1 53  ALA n 
1 54  GLY n 
1 55  ASP n 
1 56  GLU n 
1 57  PHE n 
1 58  GLU n 
1 59  LEU n 
1 60  ARG n 
1 61  TYR n 
1 62  ARG n 
1 63  ARG n 
1 64  ALA n 
1 65  PHE n 
1 66  SER n 
1 67  ASP n 
1 68  LEU n 
1 69  THR n 
1 70  SER n 
1 71  GLN n 
1 72  LEU n 
1 73  HIS n 
1 74  ILE n 
1 75  THR n 
1 76  PRO n 
1 77  GLY n 
1 78  THR n 
1 79  ALA n 
1 80  TYR n 
1 81  GLN n 
1 82  SER n 
1 83  PHE n 
1 84  GLU n 
1 85  GLN n 
1 86  VAL n 
1 87  VAL n 
1 88  ASN n 
1 89  GLU n 
1 90  LEU n 
1 91  PHE n 
1 92  ARG n 
1 93  ASP n 
1 94  GLY n 
1 95  VAL n 
1 96  ASN n 
1 97  TRP n 
1 98  GLY n 
1 99  ARG n 
1 100 ILE n 
1 101 VAL n 
1 102 ALA n 
1 103 PHE n 
1 104 PHE n 
1 105 SER n 
1 106 PHE n 
1 107 GLY n 
1 108 GLY n 
1 109 ALA n 
1 110 LEU n 
1 111 CYS n 
1 112 VAL n 
1 113 GLU n 
1 114 SER n 
1 115 VAL n 
1 116 ASP n 
1 117 LYS n 
1 118 GLU n 
1 119 MET n 
1 120 GLN n 
1 121 VAL n 
1 122 LEU n 
1 123 VAL n 
1 124 SER n 
1 125 ARG n 
1 126 ILE n 
1 127 ALA n 
1 128 ALA n 
1 129 TRP n 
1 130 MET n 
1 131 ALA n 
1 132 THR n 
1 133 TYR n 
1 134 LEU n 
1 135 ASN n 
1 136 ASP n 
1 137 HIS n 
1 138 LEU n 
1 139 GLU n 
1 140 PRO n 
1 141 TRP n 
1 142 ILE n 
1 143 GLN n 
1 144 GLU n 
1 145 ASN n 
1 146 GLY n 
1 147 GLY n 
1 148 TRP n 
1 149 ASP n 
1 150 THR n 
1 151 PHE n 
1 152 VAL n 
1 153 GLU n 
1 154 LEU n 
1 155 TYR n 
1 156 GLY n 
1 157 ASN n 
1 158 ASN n 
1 159 ALA n 
1 160 ALA n 
1 161 ALA n 
1 162 GLU n 
1 163 SER n 
1 164 ARG n 
1 165 LYS n 
1 166 GLY n 
1 167 GLN n 
1 168 GLU n 
1 169 ARG n 
1 170 LEU n 
1 171 GLU n 
1 172 HIS n 
1 173 HIS n 
1 174 HIS n 
1 175 HIS n 
1 176 HIS n 
1 177 HIS n 
1 178 LEU n 
1 179 GLU n 
1 180 HIS n 
1 181 HIS n 
1 182 HIS n 
1 183 HIS n 
1 184 HIS n 
1 185 HIS n 
2 1   ACE n 
2 2   GLY n 
2 3   CYS n 
2 4   VAL n 
2 5   GLY n 
2 6   ARG n 
2 7   ALA n 
2 8   LEU n 
2 9   ALA n 
2 10  ALA n 
2 11  PHE n 
2 12  GLY n 
2 13  ASP n 
2 14  CYS n 
2 15  ILE n 
2 16  ASN n 
2 17  ARG n 
2 18  NH2 n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BCL2L, BCL2L1, BCLX' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET19b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP B2CL1_HUMAN Q07817 1 MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE 1  ? 
2 UNP B2CL1_HUMAN Q07817 1 
;AVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVS
RIAAWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQER
;
85 ? 
3 UNP BAK_HUMAN   Q16611 2 GQVGRQLAIIGDDINR 72 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LP8 A 1  ? 44  ? Q07817 1  ? 44  ? 1    44   
2 2 2LP8 A 45 ? 169 ? Q07817 85 ? 209 ? 45   169  
3 3 2LP8 B 2  ? 17  ? Q16611 72 ? 87  ? 1002 1017 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 2LP8 LEU A 170 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      170  1  
2 2LP8 GLU A 171 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      171  2  
2 2LP8 HIS A 172 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      172  3  
2 2LP8 HIS A 173 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      173  4  
2 2LP8 HIS A 174 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      174  5  
2 2LP8 HIS A 175 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      175  6  
2 2LP8 HIS A 176 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      176  7  
2 2LP8 HIS A 177 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      177  8  
2 2LP8 LEU A 178 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      178  9  
2 2LP8 GLU A 179 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      179  10 
2 2LP8 HIS A 180 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      180  11 
2 2LP8 HIS A 181 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      181  12 
2 2LP8 HIS A 182 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      182  13 
2 2LP8 HIS A 183 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      183  14 
2 2LP8 HIS A 184 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      184  15 
2 2LP8 HIS A 185 ? UNP Q07817 ?   ?  'EXPRESSION TAG'      185  16 
3 2LP8 ACE B 1   ? UNP Q16611 ?   ?  ACETYLATION           1001 17 
3 2LP8 CYS B 3   ? UNP Q16611 GLN 73 'ENGINEERED MUTATION' 1003 18 
3 2LP8 ALA B 7   ? UNP Q16611 GLN 77 'ENGINEERED MUTATION' 1007 19 
3 2LP8 ALA B 10  ? UNP Q16611 ILE 80 'ENGINEERED MUTATION' 1010 20 
3 2LP8 PHE B 11  ? UNP Q16611 ILE 81 'ENGINEERED MUTATION' 1011 21 
3 2LP8 CYS B 14  ? UNP Q16611 ASP 84 'ENGINEERED MUTATION' 1014 22 
3 2LP8 NH2 B 18  ? UNP Q16611 ?   ?  AMIDATION             1018 23 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
33B non-polymer         . 
;3,3'-(E)-diazene-1,2-diylbis{6-[(chloroacetyl)amino]benzenesulfonic acid}
;
? 'C16 H14 Cl2 N4 O8 S2' 525.340 
ACE non-polymer         . 'ACETYL GROUP'                                                              ? 'C2 H4 O'              
44.053  
ALA 'L-peptide linking' y ALANINE                                                                     ? 'C3 H7 N O2'           
89.093  
ARG 'L-peptide linking' y ARGININE                                                                    ? 'C6 H15 N4 O2 1'       
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                  ? 'C4 H8 N2 O3'          
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                             ? 'C4 H7 N O4'           
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                    ? 'C3 H7 N O2 S'         
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                   ? 'C5 H10 N2 O3'         
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                             ? 'C5 H9 N O4'           
147.129 
GLY 'peptide linking'   y GLYCINE                                                                     ? 'C2 H5 N O2'           
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                   ? 'C6 H10 N3 O2 1'       
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                  ? 'C6 H13 N O2'          
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                     ? 'C6 H13 N O2'          
131.173 
LYS 'L-peptide linking' y LYSINE                                                                      ? 'C6 H15 N2 O2 1'       
147.195 
MET 'L-peptide linking' y METHIONINE                                                                  ? 'C5 H11 N O2 S'        
149.211 
NH2 non-polymer         . 'AMINO GROUP'                                                               ? 'H2 N'                 
16.023  
PHE 'L-peptide linking' y PHENYLALANINE                                                               ? 'C9 H11 N O2'          
165.189 
PRO 'L-peptide linking' y PROLINE                                                                     ? 'C5 H9 N O2'           
115.130 
SER 'L-peptide linking' y SERINE                                                                      ? 'C3 H7 N O3'           
105.093 
THR 'L-peptide linking' y THREONINE                                                                   ? 'C4 H9 N O3'           
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                  ? 'C11 H12 N2 O2'        
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                    ? 'C9 H11 N O3'          
181.189 
VAL 'L-peptide linking' y VALINE                                                                      ? 'C5 H11 N O2'          
117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1  1  '2D 1H-15N HSQC'             1 
2  2  '2D 1H-13C HSQC'             1 
3  3  '3D HCCH-TOCSY'              1 
4  4  '3D CBCA(CO)NH'              1 
5  5  '3D C(CO)NH'                 1 
6  6  '3D HNCO'                    1 
7  7  '3D HNCA'                    1 
8  8  '3D HNCACB'                  1 
9  9  '3D H(CCO)NH'                1 
10 10 '3D 1H-15N NOESY'            1 
11 11 '3D 1H-13C NOESY'            1 
12 12 13C                          1 
13 12 '15N F1'                     1 
14 12 'F2 FILTERED 2D 1H-1H NOESY' 1 
15 13 13C                          1 
16 13 '15N F1'                     1 
17 13 'F2 FILTERED 2D 1H-1H TOCSY' 1 
18 14 13C                          1 
19 14 '15N F2F 2D 1H-1H NOESY'     1 
20 15 '3D 1H-15N TOCSY'            1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                  7.3 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '1 MM [U-98% 13C'                                                                                                 ? 
2 'U-98% 15N] BCL- XL, 1.1 MM PHOTOSWITCHABLE BAK, 5 MM SODIUM PHOSPHATE, 5 MM 2- MERCAPTOETHANOL, 90% H2O/10% D2O' ? 
3 '1 MM [U-98% 13C'                                                                                                 ? 
4 'U-98% 15N] BCL- XL, 1.1 MM PHOTOSWITCHABLE BAK, 5 MM SODIUM PHOSPHATE, 90% H2O/10% D2O'                          ? 
5 '1 MM [U-98% 13C'                                                                                                 ? 
6 'U-98% 15N] BCL-XL, 1.1 MM PHOTOSWITCHABLE BAK, 5 MM SODIUM PHOSPHATE, 100% D2O'                                  ? 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 600 ? 
2 ?     Varian 900 ? 
# 
_pdbx_nmr_refine.entry_id           2LP8 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      2LP8 
_pdbx_nmr_ensemble.conformers_calculated_total_number            500 
_pdbx_nmr_ensemble.conformers_submitted_total_number             21 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             2LP8 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement           'CNS, ARIA 2.3, NMRPIPE' ? 
;BRUNGER A. T. ET.AL. (CNS), LINGE, O'DONOGHUE
;
1 
'structure solution' 'ARIA 2.3'               ? ?                                               2 
'structure solution' NMRPIPE                  ? ?                                               3 
# 
_exptl.entry_id          2LP8 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  2LP8 
_struct.title                     'SOLUTION STRUCTURE OF AN APOPTOSIS ACTIVATING PHOTOSWITCHABLE BAK PEPTIDE BOUND to BCL-XL' 
_struct.pdbx_descriptor           'Bcl-2-like protein 1/BAK protein' 
_struct.pdbx_model_details        'closest to the average, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LP8 
_struct_keywords.pdbx_keywords   'APOPTOSIS/APOPTOSIS ACTIVATOR' 
_struct_keywords.text            
'APOPTOSIS, AZOBENZENE, PHOTOSWITCH, PHOTOCONTROL, APOPTOSIS INHIBITOR, APOPTOSIS-APOPTOSIS ACTIVATOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 4   ? GLN A 19  ? SER A 4    GLN A 19   1 ? 16 
HELX_P HELX_P2  2  TRP A 24  ? SER A 28  ? TRP A 24   SER A 28   5 ? 5  
HELX_P HELX_P3  3  GLU A 42  ? HIS A 73  ? GLU A 42   HIS A 73   1 ? 32 
HELX_P HELX_P4  4  THR A 78  ? ASP A 93  ? THR A 78   ASP A 93   1 ? 16 
HELX_P HELX_P5  5  ASN A 96  ? LYS A 117 ? ASN A 96   LYS A 117  1 ? 22 
HELX_P HELX_P6  6  VAL A 121 ? HIS A 137 ? VAL A 121  HIS A 137  1 ? 17 
HELX_P HELX_P7  7  HIS A 137 ? ASN A 145 ? HIS A 137  ASN A 145  1 ? 9  
HELX_P HELX_P8  8  GLY A 147 ? GLY A 156 ? GLY A 147  GLY A 156  1 ? 10 
HELX_P HELX_P9  9  ASN A 157 ? ARG A 169 ? ASN A 157  ARG A 169  1 ? 13 
HELX_P HELX_P10 10 VAL B 4   ? GLY B 12  ? VAL B 1004 GLY B 1012 1 ? 9  
HELX_P HELX_P11 11 ASP B 13  ? ILE B 15  ? ASP B 1013 ILE B 1015 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B ACE 1  C  ? ? ? 1_555 B GLY 2  N   ? ? B ACE 1001 B GLY 1002 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale2 covale ? ? B ARG 17 C  ? ? ? 1_555 B NH2 18 N   ? ? B ARG 1017 B NH2 1018 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale3 covale ? ? B CYS 3  SG ? ? ? 1_555 C 33B .  C1  ? ? B CYS 1003 B 33B 1100 1_555 ? ? ? ? ? ? ? 1.808 ? 
covale4 covale ? ? B CYS 14 SG ? ? ? 1_555 C 33B .  C20 ? ? B CYS 1014 B 33B 1100 1_555 ? ? ? ? ? ? ? 1.808 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'BINDING SITE FOR RESIDUE 33B B 1100' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 CYS B 3  ? CYS B 1003 . ? 1_555 ? 
2 AC1 5 ALA B 7  ? ALA B 1007 . ? 1_555 ? 
3 AC1 5 ALA B 10 ? ALA B 1010 . ? 1_555 ? 
4 AC1 5 PHE B 11 ? PHE B 1011 . ? 1_555 ? 
5 AC1 5 CYS B 14 ? CYS B 1014 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2LP8 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . MET A 1 1   ? 5.260   10.495  11.127  1.00 4.13  ? 1    MET A N    1  
ATOM   2     C CA   . MET A 1 1   ? 5.403   9.985   12.510  1.00 3.61  ? 1    MET A CA   1  
ATOM   3     C C    . MET A 1 1   ? 4.377   8.894   12.795  1.00 2.48  ? 1    MET A C    1  
ATOM   4     O O    . MET A 1 1   ? 4.736   7.744   13.049  1.00 2.89  ? 1    MET A O    1  
ATOM   5     C CB   . MET A 1 1   ? 5.256   11.126  13.523  1.00 4.18  ? 1    MET A CB   1  
ATOM   6     C CG   . MET A 1 1   ? 5.177   10.646  14.965  1.00 4.89  ? 1    MET A CG   1  
ATOM   7     S SD   . MET A 1 1   ? 6.592   9.636   15.443  1.00 5.86  ? 1    MET A SD   1  
ATOM   8     C CE   . MET A 1 1   ? 6.041   9.029   17.035  1.00 6.21  ? 1    MET A CE   1  
ATOM   9     H H1   . MET A 1 1   ? 5.431   9.718   10.444  1.00 4.36  ? 1    MET A H1   1  
ATOM   10    H H2   . MET A 1 1   ? 5.949   11.255  10.948  1.00 4.50  ? 1    MET A H2   1  
ATOM   11    H H3   . MET A 1 1   ? 4.299   10.868  10.975  1.00 4.37  ? 1    MET A H3   1  
ATOM   12    H HA   . MET A 1 1   ? 6.390   9.558   12.606  1.00 4.14  ? 1    MET A HA   1  
ATOM   13    H HB2  . MET A 1 1   ? 6.105   11.786  13.431  1.00 4.47  ? 1    MET A HB2  1  
ATOM   14    H HB3  . MET A 1 1   ? 4.355   11.677  13.300  1.00 4.35  ? 1    MET A HB3  1  
ATOM   15    H HG2  . MET A 1 1   ? 5.134   11.509  15.614  1.00 5.14  ? 1    MET A HG2  1  
ATOM   16    H HG3  . MET A 1 1   ? 4.277   10.062  15.086  1.00 5.02  ? 1    MET A HG3  1  
ATOM   17    H HE1  . MET A 1 1   ? 6.801   8.391   17.460  1.00 6.39  ? 1    MET A HE1  1  
ATOM   18    H HE2  . MET A 1 1   ? 5.127   8.468   16.910  1.00 6.45  ? 1    MET A HE2  1  
ATOM   19    H HE3  . MET A 1 1   ? 5.863   9.864   17.696  1.00 6.36  ? 1    MET A HE3  1  
ATOM   20    N N    . SER A 1 2   ? 3.102   9.255   12.753  1.00 1.64  ? 2    SER A N    1  
ATOM   21    C CA   . SER A 1 2   ? 2.037   8.309   13.036  1.00 0.95  ? 2    SER A CA   1  
ATOM   22    C C    . SER A 1 2   ? 0.943   8.391   11.974  1.00 0.84  ? 2    SER A C    1  
ATOM   23    O O    . SER A 1 2   ? 0.687   7.422   11.269  1.00 1.03  ? 2    SER A O    1  
ATOM   24    C CB   . SER A 1 2   ? 1.461   8.565   14.431  1.00 1.55  ? 2    SER A CB   1  
ATOM   25    O OG   . SER A 1 2   ? 2.464   8.429   15.430  1.00 1.87  ? 2    SER A OG   1  
ATOM   26    H H    . SER A 1 2   ? 2.870   10.182  12.526  1.00 2.17  ? 2    SER A H    1  
ATOM   27    H HA   . SER A 1 2   ? 2.465   7.317   13.012  1.00 1.52  ? 2    SER A HA   1  
ATOM   28    H HB2  . SER A 1 2   ? 1.059   9.567   14.476  1.00 2.02  ? 2    SER A HB2  1  
ATOM   29    H HB3  . SER A 1 2   ? 0.675   7.851   14.630  1.00 2.26  ? 2    SER A HB3  1  
ATOM   30    H HG   . SER A 1 2   ? 2.933   7.588   15.297  1.00 2.17  ? 2    SER A HG   1  
ATOM   31    N N    . GLN A 1 3   ? 0.332   9.567   11.830  1.00 0.73  ? 3    GLN A N    1  
ATOM   32    C CA   . GLN A 1 3   ? -0.769  9.751   10.877  1.00 0.73  ? 3    GLN A CA   1  
ATOM   33    C C    . GLN A 1 3   ? -0.290  9.702   9.428   1.00 0.61  ? 3    GLN A C    1  
ATOM   34    O O    . GLN A 1 3   ? -1.087  9.850   8.502   1.00 0.64  ? 3    GLN A O    1  
ATOM   35    C CB   . GLN A 1 3   ? -1.509  11.070  11.124  1.00 0.83  ? 3    GLN A CB   1  
ATOM   36    C CG   . GLN A 1 3   ? -2.468  11.031  12.303  1.00 1.13  ? 3    GLN A CG   1  
ATOM   37    C CD   . GLN A 1 3   ? -1.762  10.953  13.639  1.00 1.76  ? 3    GLN A CD   1  
ATOM   38    O OE1  . GLN A 1 3   ? -0.658  11.469  13.801  1.00 2.42  ? 3    GLN A OE1  1  
ATOM   39    N NE2  . GLN A 1 3   ? -2.391  10.302  14.601  1.00 2.22  ? 3    GLN A NE2  1  
ATOM   40    H H    . GLN A 1 3   ? 0.618   10.328  12.381  1.00 0.80  ? 3    GLN A H    1  
ATOM   41    H HA   . GLN A 1 3   ? -1.463  8.937   11.031  1.00 0.87  ? 3    GLN A HA   1  
ATOM   42    H HB2  . GLN A 1 3   ? -0.782  11.847  11.309  1.00 1.10  ? 3    GLN A HB2  1  
ATOM   43    H HB3  . GLN A 1 3   ? -2.073  11.322  10.238  1.00 1.10  ? 3    GLN A HB3  1  
ATOM   44    H HG2  . GLN A 1 3   ? -3.073  11.924  12.288  1.00 1.52  ? 3    GLN A HG2  1  
ATOM   45    H HG3  . GLN A 1 3   ? -3.107  10.166  12.200  1.00 1.61  ? 3    GLN A HG3  1  
ATOM   46    H HE21 . GLN A 1 3   ? -3.269  9.904   14.401  1.00 2.34  ? 3    GLN A HE21 1  
ATOM   47    H HE22 . GLN A 1 3   ? -1.960  10.251  15.484  1.00 2.76  ? 3    GLN A HE22 1  
ATOM   48    N N    . SER A 1 4   ? 1.002   9.485   9.232   1.00 0.55  ? 4    SER A N    1  
ATOM   49    C CA   . SER A 1 4   ? 1.569   9.382   7.895   1.00 0.52  ? 4    SER A CA   1  
ATOM   50    C C    . SER A 1 4   ? 1.022   8.151   7.165   1.00 0.45  ? 4    SER A C    1  
ATOM   51    O O    . SER A 1 4   ? 1.085   8.065   5.939   1.00 0.46  ? 4    SER A O    1  
ATOM   52    C CB   . SER A 1 4   ? 3.091   9.329   7.990   1.00 0.61  ? 4    SER A CB   1  
ATOM   53    O OG   . SER A 1 4   ? 3.574   10.402  8.784   1.00 1.25  ? 4    SER A OG   1  
ATOM   54    H H    . SER A 1 4   ? 1.592   9.393   10.007  1.00 0.59  ? 4    SER A H    1  
ATOM   55    H HA   . SER A 1 4   ? 1.281   10.266  7.346   1.00 0.57  ? 4    SER A HA   1  
ATOM   56    H HB2  . SER A 1 4   ? 3.393   8.395   8.440   1.00 1.02  ? 4    SER A HB2  1  
ATOM   57    H HB3  . SER A 1 4   ? 3.516   9.410   7.000   1.00 1.08  ? 4    SER A HB3  1  
ATOM   58    H HG   . SER A 1 4   ? 3.225   11.230  8.439   1.00 1.54  ? 4    SER A HG   1  
ATOM   59    N N    . ASN A 1 5   ? 0.464   7.216   7.932   1.00 0.43  ? 5    ASN A N    1  
ATOM   60    C CA   . ASN A 1 5   ? -0.220  6.051   7.368   1.00 0.39  ? 5    ASN A CA   1  
ATOM   61    C C    . ASN A 1 5   ? -1.380  6.478   6.472   1.00 0.35  ? 5    ASN A C    1  
ATOM   62    O O    . ASN A 1 5   ? -1.760  5.761   5.545   1.00 0.35  ? 5    ASN A O    1  
ATOM   63    C CB   . ASN A 1 5   ? -0.746  5.129   8.476   1.00 0.40  ? 5    ASN A CB   1  
ATOM   64    C CG   . ASN A 1 5   ? -1.335  5.884   9.648   1.00 0.80  ? 5    ASN A CG   1  
ATOM   65    O OD1  . ASN A 1 5   ? -1.898  6.969   9.493   1.00 1.78  ? 5    ASN A OD1  1  
ATOM   66    N ND2  . ASN A 1 5   ? -1.200  5.322   10.840  1.00 0.53  ? 5    ASN A ND2  1  
ATOM   67    H H    . ASN A 1 5   ? 0.510   7.314   8.909   1.00 0.46  ? 5    ASN A H    1  
ATOM   68    H HA   . ASN A 1 5   ? 0.496   5.506   6.770   1.00 0.42  ? 5    ASN A HA   1  
ATOM   69    H HB2  . ASN A 1 5   ? -1.518  4.500   8.066   1.00 0.91  ? 5    ASN A HB2  1  
ATOM   70    H HB3  . ASN A 1 5   ? 0.054   4.505   8.840   1.00 0.85  ? 5    ASN A HB3  1  
ATOM   71    H HD21 . ASN A 1 5   ? -0.736  4.464   10.901  1.00 0.61  ? 5    ASN A HD21 1  
ATOM   72    H HD22 . ASN A 1 5   ? -1.554  5.800   11.620  1.00 1.03  ? 5    ASN A HD22 1  
ATOM   73    N N    . ARG A 1 6   ? -1.935  7.650   6.763   1.00 0.35  ? 6    ARG A N    1  
ATOM   74    C CA   . ARG A 1 6   ? -3.018  8.210   5.971   1.00 0.34  ? 6    ARG A CA   1  
ATOM   75    C C    . ARG A 1 6   ? -2.577  8.388   4.526   1.00 0.31  ? 6    ARG A C    1  
ATOM   76    O O    . ARG A 1 6   ? -3.273  7.977   3.599   1.00 0.30  ? 6    ARG A O    1  
ATOM   77    C CB   . ARG A 1 6   ? -3.458  9.554   6.560   1.00 0.41  ? 6    ARG A CB   1  
ATOM   78    C CG   . ARG A 1 6   ? -4.531  10.256  5.748   1.00 0.59  ? 6    ARG A CG   1  
ATOM   79    C CD   . ARG A 1 6   ? -5.744  9.365   5.552   1.00 0.41  ? 6    ARG A CD   1  
ATOM   80    N NE   . ARG A 1 6   ? -6.406  9.051   6.822   1.00 0.68  ? 6    ARG A NE   1  
ATOM   81    C CZ   . ARG A 1 6   ? -7.669  9.370   7.112   1.00 0.69  ? 6    ARG A CZ   1  
ATOM   82    N NH1  . ARG A 1 6   ? -8.406  10.046  6.241   1.00 1.40  ? 6    ARG A NH1  1  
ATOM   83    N NH2  . ARG A 1 6   ? -8.185  9.012   8.279   1.00 0.93  ? 6    ARG A NH2  1  
ATOM   84    H H    . ARG A 1 6   ? -1.600  8.155   7.537   1.00 0.37  ? 6    ARG A H    1  
ATOM   85    H HA   . ARG A 1 6   ? -3.848  7.521   6.001   1.00 0.35  ? 6    ARG A HA   1  
ATOM   86    H HB2  . ARG A 1 6   ? -3.842  9.387   7.556   1.00 0.72  ? 6    ARG A HB2  1  
ATOM   87    H HB3  . ARG A 1 6   ? -2.598  10.206  6.620   1.00 0.62  ? 6    ARG A HB3  1  
ATOM   88    H HG2  . ARG A 1 6   ? -4.835  11.153  6.268   1.00 1.01  ? 6    ARG A HG2  1  
ATOM   89    H HG3  . ARG A 1 6   ? -4.126  10.516  4.781   1.00 1.02  ? 6    ARG A HG3  1  
ATOM   90    H HD2  . ARG A 1 6   ? -6.443  9.865   4.899   1.00 0.55  ? 6    ARG A HD2  1  
ATOM   91    H HD3  . ARG A 1 6   ? -5.412  8.442   5.089   1.00 0.42  ? 6    ARG A HD3  1  
ATOM   92    H HE   . ARG A 1 6   ? -5.879  8.561   7.497   1.00 1.36  ? 6    ARG A HE   1  
ATOM   93    H HH11 . ARG A 1 6   ? -8.019  10.319  5.363   1.00 1.68  ? 6    ARG A HH11 1  
ATOM   94    H HH12 . ARG A 1 6   ? -9.364  10.293  6.461   1.00 1.90  ? 6    ARG A HH12 1  
ATOM   95    H HH21 . ARG A 1 6   ? -7.624  8.501   8.943   1.00 1.42  ? 6    ARG A HH21 1  
ATOM   96    H HH22 . ARG A 1 6   ? -9.139  9.252   8.512   1.00 1.07  ? 6    ARG A HH22 1  
ATOM   97    N N    . GLU A 1 7   ? -1.403  8.976   4.361   1.00 0.30  ? 7    GLU A N    1  
ATOM   98    C CA   . GLU A 1 7   ? -0.834  9.239   3.045   1.00 0.29  ? 7    GLU A CA   1  
ATOM   99    C C    . GLU A 1 7   ? -0.767  7.974   2.226   1.00 0.25  ? 7    GLU A C    1  
ATOM   100   O O    . GLU A 1 7   ? -1.147  7.948   1.060   1.00 0.26  ? 7    GLU A O    1  
ATOM   101   C CB   . GLU A 1 7   ? 0.594   9.746   3.173   1.00 0.31  ? 7    GLU A CB   1  
ATOM   102   C CG   . GLU A 1 7   ? 0.755   11.023  3.952   1.00 0.40  ? 7    GLU A CG   1  
ATOM   103   C CD   . GLU A 1 7   ? 2.215   11.349  4.162   1.00 0.51  ? 7    GLU A CD   1  
ATOM   104   O OE1  . GLU A 1 7   ? 2.906   11.600  3.156   1.00 0.68  ? 7    GLU A OE1  1  
ATOM   105   O OE2  . GLU A 1 7   ? 2.689   11.315  5.315   1.00 0.53  ? 7    GLU A OE2  1  
ATOM   106   H H    . GLU A 1 7   ? -0.897  9.231   5.155   1.00 0.33  ? 7    GLU A H    1  
ATOM   107   H HA   . GLU A 1 7   ? -1.447  9.973   2.541   1.00 0.32  ? 7    GLU A HA   1  
ATOM   108   H HB2  . GLU A 1 7   ? 1.185   8.986   3.659   1.00 0.33  ? 7    GLU A HB2  1  
ATOM   109   H HB3  . GLU A 1 7   ? 0.989   9.908   2.180   1.00 0.33  ? 7    GLU A HB3  1  
ATOM   110   H HG2  . GLU A 1 7   ? 0.295   11.820  3.399   1.00 0.46  ? 7    GLU A HG2  1  
ATOM   111   H HG3  . GLU A 1 7   ? 0.276   10.915  4.913   1.00 0.40  ? 7    GLU A HG3  1  
ATOM   112   N N    . LEU A 1 8   ? -0.253  6.936   2.862   1.00 0.26  ? 8    LEU A N    1  
ATOM   113   C CA   . LEU A 1 8   ? 0.019   5.676   2.205   1.00 0.27  ? 8    LEU A CA   1  
ATOM   114   C C    . LEU A 1 8   ? -1.259  5.130   1.588   1.00 0.28  ? 8    LEU A C    1  
ATOM   115   O O    . LEU A 1 8   ? -1.257  4.628   0.469   1.00 0.40  ? 8    LEU A O    1  
ATOM   116   C CB   . LEU A 1 8   ? 0.612   4.693   3.218   1.00 0.34  ? 8    LEU A CB   1  
ATOM   117   C CG   . LEU A 1 8   ? 1.585   5.321   4.230   1.00 0.41  ? 8    LEU A CG   1  
ATOM   118   C CD1  . LEU A 1 8   ? 2.265   4.250   5.064   1.00 1.00  ? 8    LEU A CD1  1  
ATOM   119   C CD2  . LEU A 1 8   ? 2.621   6.199   3.536   1.00 1.16  ? 8    LEU A CD2  1  
ATOM   120   H H    . LEU A 1 8   ? -0.046  7.025   3.816   1.00 0.31  ? 8    LEU A H    1  
ATOM   121   H HA   . LEU A 1 8   ? 0.739   5.855   1.422   1.00 0.30  ? 8    LEU A HA   1  
ATOM   122   H HB2  . LEU A 1 8   ? -0.201  4.237   3.764   1.00 0.48  ? 8    LEU A HB2  1  
ATOM   123   H HB3  . LEU A 1 8   ? 1.138   3.922   2.677   1.00 0.55  ? 8    LEU A HB3  1  
ATOM   124   H HG   . LEU A 1 8   ? 1.022   5.949   4.906   1.00 1.15  ? 8    LEU A HG   1  
ATOM   125   H HD11 . LEU A 1 8   ? 2.661   3.485   4.412   1.00 1.57  ? 8    LEU A HD11 1  
ATOM   126   H HD12 . LEU A 1 8   ? 1.551   3.813   5.746   1.00 1.63  ? 8    LEU A HD12 1  
ATOM   127   H HD13 . LEU A 1 8   ? 3.080   4.695   5.624   1.00 1.61  ? 8    LEU A HD13 1  
ATOM   128   H HD21 . LEU A 1 8   ? 3.375   6.515   4.257   1.00 1.72  ? 8    LEU A HD21 1  
ATOM   129   H HD22 . LEU A 1 8   ? 2.135   7.073   3.123   1.00 1.80  ? 8    LEU A HD22 1  
ATOM   130   H HD23 . LEU A 1 8   ? 3.096   5.643   2.743   1.00 1.65  ? 8    LEU A HD23 1  
ATOM   131   N N    . VAL A 1 9   ? -2.355  5.277   2.319   1.00 0.23  ? 9    VAL A N    1  
ATOM   132   C CA   . VAL A 1 9   ? -3.666  4.916   1.814   1.00 0.23  ? 9    VAL A CA   1  
ATOM   133   C C    . VAL A 1 9   ? -4.070  5.853   0.681   1.00 0.23  ? 9    VAL A C    1  
ATOM   134   O O    . VAL A 1 9   ? -4.295  5.427   -0.451  1.00 0.24  ? 9    VAL A O    1  
ATOM   135   C CB   . VAL A 1 9   ? -4.715  4.992   2.940   1.00 0.25  ? 9    VAL A CB   1  
ATOM   136   C CG1  . VAL A 1 9   ? -6.119  4.802   2.395   1.00 0.26  ? 9    VAL A CG1  1  
ATOM   137   C CG2  . VAL A 1 9   ? -4.415  3.963   4.015   1.00 0.27  ? 9    VAL A CG2  1  
ATOM   138   H H    . VAL A 1 9   ? -2.279  5.654   3.224   1.00 0.26  ? 9    VAL A H    1  
ATOM   139   H HA   . VAL A 1 9   ? -3.625  3.902   1.448   1.00 0.25  ? 9    VAL A HA   1  
ATOM   140   H HB   . VAL A 1 9   ? -4.660  5.973   3.390   1.00 0.26  ? 9    VAL A HB   1  
ATOM   141   H HG11 . VAL A 1 9   ? -6.184  3.852   1.881   1.00 1.05  ? 9    VAL A HG11 1  
ATOM   142   H HG12 . VAL A 1 9   ? -6.347  5.601   1.702   1.00 1.03  ? 9    VAL A HG12 1  
ATOM   143   H HG13 . VAL A 1 9   ? -6.825  4.820   3.213   1.00 0.93  ? 9    VAL A HG13 1  
ATOM   144   H HG21 . VAL A 1 9   ? -4.374  2.979   3.570   1.00 1.00  ? 9    VAL A HG21 1  
ATOM   145   H HG22 . VAL A 1 9   ? -5.196  3.987   4.762   1.00 1.04  ? 9    VAL A HG22 1  
ATOM   146   H HG23 . VAL A 1 9   ? -3.465  4.193   4.476   1.00 1.07  ? 9    VAL A HG23 1  
ATOM   147   N N    . VAL A 1 10  ? -4.135  7.136   1.008   1.00 0.23  ? 10   VAL A N    1  
ATOM   148   C CA   . VAL A 1 10  ? -4.618  8.163   0.091   1.00 0.25  ? 10   VAL A CA   1  
ATOM   149   C C    . VAL A 1 10  ? -3.888  8.145   -1.247  1.00 0.25  ? 10   VAL A C    1  
ATOM   150   O O    . VAL A 1 10  ? -4.528  8.125   -2.301  1.00 0.27  ? 10   VAL A O    1  
ATOM   151   C CB   . VAL A 1 10  ? -4.472  9.552   0.730   1.00 0.28  ? 10   VAL A CB   1  
ATOM   152   C CG1  . VAL A 1 10  ? -4.963  10.642  -0.197  1.00 0.33  ? 10   VAL A CG1  1  
ATOM   153   C CG2  . VAL A 1 10  ? -5.228  9.588   2.035   1.00 0.32  ? 10   VAL A CG2  1  
ATOM   154   H H    . VAL A 1 10  ? -3.837  7.407   1.908   1.00 0.24  ? 10   VAL A H    1  
ATOM   155   H HA   . VAL A 1 10  ? -5.668  7.985   -0.083  1.00 0.27  ? 10   VAL A HA   1  
ATOM   156   H HB   . VAL A 1 10  ? -3.427  9.726   0.939   1.00 0.28  ? 10   VAL A HB   1  
ATOM   157   H HG11 . VAL A 1 10  ? -4.411  10.602  -1.124  1.00 1.13  ? 10   VAL A HG11 1  
ATOM   158   H HG12 . VAL A 1 10  ? -4.810  11.602  0.273   1.00 1.03  ? 10   VAL A HG12 1  
ATOM   159   H HG13 . VAL A 1 10  ? -6.015  10.500  -0.394  1.00 1.05  ? 10   VAL A HG13 1  
ATOM   160   H HG21 . VAL A 1 10  ? -4.675  9.033   2.779   1.00 1.06  ? 10   VAL A HG21 1  
ATOM   161   H HG22 . VAL A 1 10  ? -6.197  9.130   1.894   1.00 1.04  ? 10   VAL A HG22 1  
ATOM   162   H HG23 . VAL A 1 10  ? -5.348  10.611  2.358   1.00 1.04  ? 10   VAL A HG23 1  
ATOM   163   N N    . ASP A 1 11  ? -2.560  8.153   -1.203  1.00 0.26  ? 11   ASP A N    1  
ATOM   164   C CA   . ASP A 1 11  ? -1.754  8.203   -2.419  1.00 0.28  ? 11   ASP A CA   1  
ATOM   165   C C    . ASP A 1 11  ? -2.099  7.045   -3.347  1.00 0.31  ? 11   ASP A C    1  
ATOM   166   O O    . ASP A 1 11  ? -2.151  7.207   -4.570  1.00 0.35  ? 11   ASP A O    1  
ATOM   167   C CB   . ASP A 1 11  ? -0.261  8.169   -2.085  1.00 0.32  ? 11   ASP A CB   1  
ATOM   168   C CG   . ASP A 1 11  ? 0.609   8.348   -3.315  1.00 0.39  ? 11   ASP A CG   1  
ATOM   169   O OD1  . ASP A 1 11  ? 0.704   9.490   -3.816  1.00 0.59  ? 11   ASP A OD1  1  
ATOM   170   O OD2  . ASP A 1 11  ? 1.199   7.355   -3.787  1.00 0.49  ? 11   ASP A OD2  1  
ATOM   171   H H    . ASP A 1 11  ? -2.107  8.117   -0.327  1.00 0.26  ? 11   ASP A H    1  
ATOM   172   H HA   . ASP A 1 11  ? -1.978  9.129   -2.925  1.00 0.31  ? 11   ASP A HA   1  
ATOM   173   H HB2  . ASP A 1 11  ? -0.036  8.962   -1.389  1.00 0.36  ? 11   ASP A HB2  1  
ATOM   174   H HB3  . ASP A 1 11  ? -0.021  7.218   -1.632  1.00 0.36  ? 11   ASP A HB3  1  
ATOM   175   N N    . PHE A 1 12  ? -2.370  5.886   -2.764  1.00 0.32  ? 12   PHE A N    1  
ATOM   176   C CA   . PHE A 1 12  ? -2.689  4.713   -3.549  1.00 0.38  ? 12   PHE A CA   1  
ATOM   177   C C    . PHE A 1 12  ? -4.086  4.820   -4.135  1.00 0.34  ? 12   PHE A C    1  
ATOM   178   O O    . PHE A 1 12  ? -4.272  4.570   -5.325  1.00 0.39  ? 12   PHE A O    1  
ATOM   179   C CB   . PHE A 1 12  ? -2.572  3.443   -2.721  1.00 0.46  ? 12   PHE A CB   1  
ATOM   180   C CG   . PHE A 1 12  ? -2.533  2.194   -3.556  1.00 0.76  ? 12   PHE A CG   1  
ATOM   181   C CD1  . PHE A 1 12  ? -1.382  1.845   -4.245  1.00 1.24  ? 12   PHE A CD1  1  
ATOM   182   C CD2  . PHE A 1 12  ? -3.641  1.371   -3.652  1.00 0.98  ? 12   PHE A CD2  1  
ATOM   183   C CE1  . PHE A 1 12  ? -1.337  0.699   -5.012  1.00 1.61  ? 12   PHE A CE1  1  
ATOM   184   C CE2  . PHE A 1 12  ? -3.602  0.223   -4.420  1.00 1.38  ? 12   PHE A CE2  1  
ATOM   185   C CZ   . PHE A 1 12  ? -2.449  -0.113  -5.100  1.00 1.61  ? 12   PHE A CZ   1  
ATOM   186   H H    . PHE A 1 12  ? -2.354  5.823   -1.783  1.00 0.31  ? 12   PHE A H    1  
ATOM   187   H HA   . PHE A 1 12  ? -1.980  4.664   -4.362  1.00 0.45  ? 12   PHE A HA   1  
ATOM   188   H HB2  . PHE A 1 12  ? -1.664  3.483   -2.137  1.00 0.57  ? 12   PHE A HB2  1  
ATOM   189   H HB3  . PHE A 1 12  ? -3.420  3.375   -2.056  1.00 0.57  ? 12   PHE A HB3  1  
ATOM   190   H HD1  . PHE A 1 12  ? -0.512  2.480   -4.176  1.00 1.46  ? 12   PHE A HD1  1  
ATOM   191   H HD2  . PHE A 1 12  ? -4.545  1.632   -3.120  1.00 1.09  ? 12   PHE A HD2  1  
ATOM   192   H HE1  . PHE A 1 12  ? -0.433  0.438   -5.544  1.00 2.02  ? 12   PHE A HE1  1  
ATOM   193   H HE2  . PHE A 1 12  ? -4.473  -0.411  -4.488  1.00 1.67  ? 12   PHE A HE2  1  
ATOM   194   H HZ   . PHE A 1 12  ? -2.417  -1.011  -5.701  1.00 1.95  ? 12   PHE A HZ   1  
ATOM   195   N N    . LEU A 1 13  ? -5.071  5.199   -3.314  1.00 0.28  ? 13   LEU A N    1  
ATOM   196   C CA   . LEU A 1 13  ? -6.430  5.352   -3.819  1.00 0.28  ? 13   LEU A CA   1  
ATOM   197   C C    . LEU A 1 13  ? -6.452  6.389   -4.936  1.00 0.30  ? 13   LEU A C    1  
ATOM   198   O O    . LEU A 1 13  ? -7.137  6.211   -5.939  1.00 0.34  ? 13   LEU A O    1  
ATOM   199   C CB   . LEU A 1 13  ? -7.428  5.720   -2.707  1.00 0.25  ? 13   LEU A CB   1  
ATOM   200   C CG   . LEU A 1 13  ? -7.969  4.532   -1.895  1.00 0.26  ? 13   LEU A CG   1  
ATOM   201   C CD1  . LEU A 1 13  ? -7.026  4.137   -0.787  1.00 0.26  ? 13   LEU A CD1  1  
ATOM   202   C CD2  . LEU A 1 13  ? -9.346  4.830   -1.329  1.00 0.27  ? 13   LEU A CD2  1  
ATOM   203   H H    . LEU A 1 13  ? -4.881  5.385   -2.359  1.00 0.26  ? 13   LEU A H    1  
ATOM   204   H HA   . LEU A 1 13  ? -6.719  4.400   -4.241  1.00 0.31  ? 13   LEU A HA   1  
ATOM   205   H HB2  . LEU A 1 13  ? -6.938  6.401   -2.025  1.00 0.23  ? 13   LEU A HB2  1  
ATOM   206   H HB3  . LEU A 1 13  ? -8.266  6.229   -3.158  1.00 0.27  ? 13   LEU A HB3  1  
ATOM   207   H HG   . LEU A 1 13  ? -8.058  3.682   -2.545  1.00 0.29  ? 13   LEU A HG   1  
ATOM   208   H HD11 . LEU A 1 13  ? -6.066  3.874   -1.207  1.00 0.91  ? 13   LEU A HD11 1  
ATOM   209   H HD12 . LEU A 1 13  ? -7.438  3.287   -0.258  1.00 0.87  ? 13   LEU A HD12 1  
ATOM   210   H HD13 . LEU A 1 13  ? -6.910  4.966   -0.104  1.00 0.89  ? 13   LEU A HD13 1  
ATOM   211   H HD21 . LEU A 1 13  ? -9.283  5.665   -0.646  1.00 1.06  ? 13   LEU A HD21 1  
ATOM   212   H HD22 . LEU A 1 13  ? -9.715  3.958   -0.802  1.00 1.03  ? 13   LEU A HD22 1  
ATOM   213   H HD23 . LEU A 1 13  ? -10.021 5.073   -2.137  1.00 1.05  ? 13   LEU A HD23 1  
ATOM   214   N N    . SER A 1 14  ? -5.659  7.442   -4.773  1.00 0.29  ? 14   SER A N    1  
ATOM   215   C CA   . SER A 1 14  ? -5.510  8.465   -5.805  1.00 0.33  ? 14   SER A CA   1  
ATOM   216   C C    . SER A 1 14  ? -5.082  7.841   -7.131  1.00 0.37  ? 14   SER A C    1  
ATOM   217   O O    . SER A 1 14  ? -5.697  8.079   -8.172  1.00 0.42  ? 14   SER A O    1  
ATOM   218   C CB   . SER A 1 14  ? -4.478  9.508   -5.373  1.00 0.33  ? 14   SER A CB   1  
ATOM   219   O OG   . SER A 1 14  ? -4.813  10.078  -4.119  1.00 1.05  ? 14   SER A OG   1  
ATOM   220   H H    . SER A 1 14  ? -5.166  7.537   -3.929  1.00 0.27  ? 14   SER A H    1  
ATOM   221   H HA   . SER A 1 14  ? -6.465  8.948   -5.940  1.00 0.36  ? 14   SER A HA   1  
ATOM   222   H HB2  . SER A 1 14  ? -3.509  9.039   -5.292  1.00 0.91  ? 14   SER A HB2  1  
ATOM   223   H HB3  . SER A 1 14  ? -4.434  10.295  -6.112  1.00 0.81  ? 14   SER A HB3  1  
ATOM   224   H HG   . SER A 1 14  ? -4.728  9.407   -3.426  1.00 1.60  ? 14   SER A HG   1  
ATOM   225   N N    . TYR A 1 15  ? -4.037  7.022   -7.079  1.00 0.37  ? 15   TYR A N    1  
ATOM   226   C CA   . TYR A 1 15  ? -3.523  6.361   -8.272  1.00 0.45  ? 15   TYR A CA   1  
ATOM   227   C C    . TYR A 1 15  ? -4.561  5.393   -8.835  1.00 0.43  ? 15   TYR A C    1  
ATOM   228   O O    . TYR A 1 15  ? -4.649  5.190   -10.046 1.00 0.55  ? 15   TYR A O    1  
ATOM   229   C CB   . TYR A 1 15  ? -2.226  5.612   -7.947  1.00 0.52  ? 15   TYR A CB   1  
ATOM   230   C CG   . TYR A 1 15  ? -1.492  5.113   -9.172  1.00 0.67  ? 15   TYR A CG   1  
ATOM   231   C CD1  . TYR A 1 15  ? -0.578  5.925   -9.828  1.00 0.72  ? 15   TYR A CD1  1  
ATOM   232   C CD2  . TYR A 1 15  ? -1.713  3.837   -9.675  1.00 0.89  ? 15   TYR A CD2  1  
ATOM   233   C CE1  . TYR A 1 15  ? 0.094   5.483   -10.948 1.00 0.89  ? 15   TYR A CE1  1  
ATOM   234   C CE2  . TYR A 1 15  ? -1.046  3.386   -10.798 1.00 1.06  ? 15   TYR A CE2  1  
ATOM   235   C CZ   . TYR A 1 15  ? -0.143  4.215   -11.430 1.00 1.03  ? 15   TYR A CZ   1  
ATOM   236   O OH   . TYR A 1 15  ? 0.527   3.775   -12.550 1.00 1.22  ? 15   TYR A OH   1  
ATOM   237   H H    . TYR A 1 15  ? -3.596  6.863   -6.217  1.00 0.36  ? 15   TYR A H    1  
ATOM   238   H HA   . TYR A 1 15  ? -3.316  7.121   -9.011  1.00 0.50  ? 15   TYR A HA   1  
ATOM   239   H HB2  . TYR A 1 15  ? -1.562  6.272   -7.409  1.00 0.53  ? 15   TYR A HB2  1  
ATOM   240   H HB3  . TYR A 1 15  ? -2.458  4.759   -7.326  1.00 0.52  ? 15   TYR A HB3  1  
ATOM   241   H HD1  . TYR A 1 15  ? -0.392  6.919   -9.449  1.00 0.72  ? 15   TYR A HD1  1  
ATOM   242   H HD2  . TYR A 1 15  ? -2.421  3.191   -9.176  1.00 0.98  ? 15   TYR A HD2  1  
ATOM   243   H HE1  . TYR A 1 15  ? 0.801   6.130   -11.444 1.00 0.98  ? 15   TYR A HE1  1  
ATOM   244   H HE2  . TYR A 1 15  ? -1.232  2.391   -11.174 1.00 1.26  ? 15   TYR A HE2  1  
ATOM   245   H HH   . TYR A 1 15  ? 1.475   3.953   -12.448 1.00 1.49  ? 15   TYR A HH   1  
ATOM   246   N N    . LYS A 1 16  ? -5.355  4.811   -7.946  1.00 0.33  ? 16   LYS A N    1  
ATOM   247   C CA   . LYS A 1 16  ? -6.372  3.844   -8.338  1.00 0.33  ? 16   LYS A CA   1  
ATOM   248   C C    . LYS A 1 16  ? -7.423  4.477   -9.210  1.00 0.33  ? 16   LYS A C    1  
ATOM   249   O O    . LYS A 1 16  ? -7.816  3.909   -10.215 1.00 0.42  ? 16   LYS A O    1  
ATOM   250   C CB   . LYS A 1 16  ? -7.023  3.210   -7.112  1.00 0.34  ? 16   LYS A CB   1  
ATOM   251   C CG   . LYS A 1 16  ? -6.095  2.307   -6.313  1.00 0.61  ? 16   LYS A CG   1  
ATOM   252   C CD   . LYS A 1 16  ? -5.313  1.344   -7.198  1.00 0.57  ? 16   LYS A CD   1  
ATOM   253   C CE   . LYS A 1 16  ? -4.018  1.973   -7.696  1.00 1.18  ? 16   LYS A CE   1  
ATOM   254   N NZ   . LYS A 1 16  ? -3.162  1.000   -8.418  1.00 1.41  ? 16   LYS A NZ   1  
ATOM   255   H H    . LYS A 1 16  ? -5.255  5.042   -6.995  1.00 0.32  ? 16   LYS A H    1  
ATOM   256   H HA   . LYS A 1 16  ? -5.888  3.069   -8.909  1.00 0.38  ? 16   LYS A HA   1  
ATOM   257   H HB2  . LYS A 1 16  ? -7.365  3.999   -6.460  1.00 0.62  ? 16   LYS A HB2  1  
ATOM   258   H HB3  . LYS A 1 16  ? -7.873  2.629   -7.431  1.00 0.63  ? 16   LYS A HB3  1  
ATOM   259   H HG2  . LYS A 1 16  ? -5.395  2.923   -5.770  1.00 0.97  ? 16   LYS A HG2  1  
ATOM   260   H HG3  . LYS A 1 16  ? -6.687  1.736   -5.612  1.00 0.99  ? 16   LYS A HG3  1  
ATOM   261   H HD2  . LYS A 1 16  ? -5.075  0.458   -6.628  1.00 0.75  ? 16   LYS A HD2  1  
ATOM   262   H HD3  . LYS A 1 16  ? -5.922  1.075   -8.048  1.00 0.97  ? 16   LYS A HD3  1  
ATOM   263   H HE2  . LYS A 1 16  ? -4.263  2.779   -8.369  1.00 1.56  ? 16   LYS A HE2  1  
ATOM   264   H HE3  . LYS A 1 16  ? -3.483  2.376   -6.854  1.00 1.44  ? 16   LYS A HE3  1  
ATOM   265   H HZ1  . LYS A 1 16  ? -3.434  0.961   -9.424  1.00 1.70  ? 16   LYS A HZ1  1  
ATOM   266   H HZ2  . LYS A 1 16  ? -3.278  0.044   -8.011  1.00 1.51  ? 16   LYS A HZ2  1  
ATOM   267   H HZ3  . LYS A 1 16  ? -2.157  1.273   -8.351  1.00 1.84  ? 16   LYS A HZ3  1  
ATOM   268   N N    . LEU A 1 17  ? -7.869  5.655   -8.838  1.00 0.33  ? 17   LEU A N    1  
ATOM   269   C CA   . LEU A 1 17  ? -8.867  6.350   -9.645  1.00 0.32  ? 17   LEU A CA   1  
ATOM   270   C C    . LEU A 1 17  ? -8.237  6.853   -10.936 1.00 0.35  ? 17   LEU A C    1  
ATOM   271   O O    . LEU A 1 17  ? -8.894  6.922   -11.977 1.00 0.36  ? 17   LEU A O    1  
ATOM   272   C CB   . LEU A 1 17  ? -9.516  7.511   -8.883  1.00 0.35  ? 17   LEU A CB   1  
ATOM   273   C CG   . LEU A 1 17  ? -10.492 7.116   -7.772  1.00 0.53  ? 17   LEU A CG   1  
ATOM   274   C CD1  . LEU A 1 17  ? -11.011 5.700   -7.964  1.00 1.35  ? 17   LEU A CD1  1  
ATOM   275   C CD2  . LEU A 1 17  ? -9.832  7.277   -6.424  1.00 1.15  ? 17   LEU A CD2  1  
ATOM   276   H H    . LEU A 1 17  ? -7.517  6.062   -8.012  1.00 0.38  ? 17   LEU A H    1  
ATOM   277   H HA   . LEU A 1 17  ? -9.634  5.630   -9.898  1.00 0.31  ? 17   LEU A HA   1  
ATOM   278   H HB2  . LEU A 1 17  ? -8.727  8.103   -8.438  1.00 0.33  ? 17   LEU A HB2  1  
ATOM   279   H HB3  . LEU A 1 17  ? -10.046 8.128   -9.588  1.00 0.43  ? 17   LEU A HB3  1  
ATOM   280   H HG   . LEU A 1 17  ? -11.345 7.775   -7.803  1.00 1.53  ? 17   LEU A HG   1  
ATOM   281   H HD11 . LEU A 1 17  ? -11.540 5.634   -8.902  1.00 1.98  ? 17   LEU A HD11 1  
ATOM   282   H HD12 . LEU A 1 17  ? -11.681 5.450   -7.153  1.00 1.90  ? 17   LEU A HD12 1  
ATOM   283   H HD13 . LEU A 1 17  ? -10.180 5.010   -7.969  1.00 1.88  ? 17   LEU A HD13 1  
ATOM   284   H HD21 . LEU A 1 17  ? -8.999  6.591   -6.348  1.00 1.75  ? 17   LEU A HD21 1  
ATOM   285   H HD22 . LEU A 1 17  ? -10.548 7.065   -5.645  1.00 1.77  ? 17   LEU A HD22 1  
ATOM   286   H HD23 . LEU A 1 17  ? -9.474  8.290   -6.322  1.00 1.74  ? 17   LEU A HD23 1  
ATOM   287   N N    . SER A 1 18  ? -6.951  7.161   -10.864 1.00 0.41  ? 18   SER A N    1  
ATOM   288   C CA   . SER A 1 18  ? -6.213  7.690   -12.001 1.00 0.48  ? 18   SER A CA   1  
ATOM   289   C C    . SER A 1 18  ? -6.211  6.699   -13.172 1.00 0.51  ? 18   SER A C    1  
ATOM   290   O O    . SER A 1 18  ? -6.379  7.094   -14.327 1.00 0.58  ? 18   SER A O    1  
ATOM   291   C CB   . SER A 1 18  ? -4.780  8.018   -11.573 1.00 0.57  ? 18   SER A CB   1  
ATOM   292   O OG   . SER A 1 18  ? -4.108  8.793   -12.550 1.00 0.94  ? 18   SER A OG   1  
ATOM   293   H H    . SER A 1 18  ? -6.480  7.035   -10.012 1.00 0.41  ? 18   SER A H    1  
ATOM   294   H HA   . SER A 1 18  ? -6.701  8.599   -12.316 1.00 0.51  ? 18   SER A HA   1  
ATOM   295   H HB2  . SER A 1 18  ? -4.804  8.575   -10.648 1.00 0.86  ? 18   SER A HB2  1  
ATOM   296   H HB3  . SER A 1 18  ? -4.234  7.098   -11.422 1.00 0.69  ? 18   SER A HB3  1  
ATOM   297   H HG   . SER A 1 18  ? -4.219  9.738   -12.338 1.00 1.38  ? 18   SER A HG   1  
ATOM   298   N N    . GLN A 1 19  ? -6.059  5.411   -12.867 1.00 0.52  ? 19   GLN A N    1  
ATOM   299   C CA   . GLN A 1 19  ? -6.007  4.372   -13.900 1.00 0.57  ? 19   GLN A CA   1  
ATOM   300   C C    . GLN A 1 19  ? -7.395  4.012   -14.419 1.00 0.51  ? 19   GLN A C    1  
ATOM   301   O O    . GLN A 1 19  ? -7.543  3.152   -15.286 1.00 0.59  ? 19   GLN A O    1  
ATOM   302   C CB   . GLN A 1 19  ? -5.308  3.123   -13.367 1.00 0.68  ? 19   GLN A CB   1  
ATOM   303   C CG   . GLN A 1 19  ? -5.813  2.700   -12.007 1.00 0.84  ? 19   GLN A CG   1  
ATOM   304   C CD   . GLN A 1 19  ? -5.214  1.398   -11.526 1.00 0.97  ? 19   GLN A CD   1  
ATOM   305   O OE1  . GLN A 1 19  ? -4.158  1.378   -10.898 1.00 1.37  ? 19   GLN A OE1  1  
ATOM   306   N NE2  . GLN A 1 19  ? -5.902  0.302   -11.795 1.00 1.19  ? 19   GLN A NE2  1  
ATOM   307   H H    . GLN A 1 19  ? -5.974  5.151   -11.923 1.00 0.53  ? 19   GLN A H    1  
ATOM   308   H HA   . GLN A 1 19  ? -5.435  4.760   -14.715 1.00 0.66  ? 19   GLN A HA   1  
ATOM   309   H HB2  . GLN A 1 19  ? -5.472  2.310   -14.057 1.00 0.89  ? 19   GLN A HB2  1  
ATOM   310   H HB3  . GLN A 1 19  ? -4.249  3.317   -13.292 1.00 0.96  ? 19   GLN A HB3  1  
ATOM   311   H HG2  . GLN A 1 19  ? -5.568  3.475   -11.300 1.00 1.09  ? 19   GLN A HG2  1  
ATOM   312   H HG3  . GLN A 1 19  ? -6.886  2.588   -12.056 1.00 1.03  ? 19   GLN A HG3  1  
ATOM   313   H HE21 . GLN A 1 19  ? -6.750  0.393   -12.281 1.00 1.51  ? 19   GLN A HE21 1  
ATOM   314   H HE22 . GLN A 1 19  ? -5.533  -0.562  -11.499 1.00 1.29  ? 19   GLN A HE22 1  
ATOM   315   N N    . LYS A 1 20  ? -8.408  4.669   -13.887 1.00 0.45  ? 20   LYS A N    1  
ATOM   316   C CA   . LYS A 1 20  ? -9.783  4.433   -14.310 1.00 0.49  ? 20   LYS A CA   1  
ATOM   317   C C    . LYS A 1 20  ? -10.293 5.653   -15.036 1.00 0.48  ? 20   LYS A C    1  
ATOM   318   O O    . LYS A 1 20  ? -11.182 5.581   -15.883 1.00 0.53  ? 20   LYS A O    1  
ATOM   319   C CB   . LYS A 1 20  ? -10.672 4.168   -13.102 1.00 0.57  ? 20   LYS A CB   1  
ATOM   320   C CG   . LYS A 1 20  ? -9.981  3.399   -12.001 1.00 0.49  ? 20   LYS A CG   1  
ATOM   321   C CD   . LYS A 1 20  ? -9.536  2.021   -12.454 1.00 1.20  ? 20   LYS A CD   1  
ATOM   322   C CE   . LYS A 1 20  ? -10.700 1.218   -13.005 1.00 1.75  ? 20   LYS A CE   1  
ATOM   323   N NZ   . LYS A 1 20  ? -10.277 -0.123  -13.485 1.00 2.20  ? 20   LYS A NZ   1  
ATOM   324   H H    . LYS A 1 20  ? -8.228  5.339   -13.195 1.00 0.45  ? 20   LYS A H    1  
ATOM   325   H HA   . LYS A 1 20  ? -9.802  3.580   -14.972 1.00 0.54  ? 20   LYS A HA   1  
ATOM   326   H HB2  . LYS A 1 20  ? -11.005 5.110   -12.697 1.00 0.67  ? 20   LYS A HB2  1  
ATOM   327   H HB3  . LYS A 1 20  ? -11.532 3.600   -13.420 1.00 0.70  ? 20   LYS A HB3  1  
ATOM   328   H HG2  . LYS A 1 20  ? -9.113  3.955   -11.688 1.00 1.16  ? 20   LYS A HG2  1  
ATOM   329   H HG3  . LYS A 1 20  ? -10.656 3.301   -11.177 1.00 1.06  ? 20   LYS A HG3  1  
ATOM   330   H HD2  . LYS A 1 20  ? -8.784  2.132   -13.225 1.00 1.65  ? 20   LYS A HD2  1  
ATOM   331   H HD3  . LYS A 1 20  ? -9.115  1.497   -11.606 1.00 1.68  ? 20   LYS A HD3  1  
ATOM   332   H HE2  . LYS A 1 20  ? -11.437 1.098   -12.220 1.00 2.01  ? 20   LYS A HE2  1  
ATOM   333   H HE3  . LYS A 1 20  ? -11.138 1.767   -13.825 1.00 1.68  ? 20   LYS A HE3  1  
ATOM   334   H HZ1  . LYS A 1 20  ? -10.013 -0.728  -12.679 1.00 2.49  ? 20   LYS A HZ1  1  
ATOM   335   H HZ2  . LYS A 1 20  ? -9.455  -0.035  -14.121 1.00 2.36  ? 20   LYS A HZ2  1  
ATOM   336   H HZ3  . LYS A 1 20  ? -11.057 -0.579  -14.010 1.00 2.65  ? 20   LYS A HZ3  1  
ATOM   337   N N    . GLY A 1 21  ? -9.714  6.775   -14.672 1.00 0.45  ? 21   GLY A N    1  
ATOM   338   C CA   . GLY A 1 21  ? -10.068 8.040   -15.271 1.00 0.49  ? 21   GLY A CA   1  
ATOM   339   C C    . GLY A 1 21  ? -10.956 8.856   -14.365 1.00 0.47  ? 21   GLY A C    1  
ATOM   340   O O    . GLY A 1 21  ? -11.662 9.760   -14.811 1.00 0.53  ? 21   GLY A O    1  
ATOM   341   H H    . GLY A 1 21  ? -9.049  6.744   -13.951 1.00 0.44  ? 21   GLY A H    1  
ATOM   342   H HA2  . GLY A 1 21  ? -9.164  8.594   -15.472 1.00 0.52  ? 21   GLY A HA2  1  
ATOM   343   H HA3  . GLY A 1 21  ? -10.585 7.857   -16.201 1.00 0.54  ? 21   GLY A HA3  1  
ATOM   344   N N    . TYR A 1 22  ? -10.922 8.522   -13.086 1.00 0.40  ? 22   TYR A N    1  
ATOM   345   C CA   . TYR A 1 22  ? -11.629 9.278   -12.070 1.00 0.37  ? 22   TYR A CA   1  
ATOM   346   C C    . TYR A 1 22  ? -10.630 10.046  -11.229 1.00 0.36  ? 22   TYR A C    1  
ATOM   347   O O    . TYR A 1 22  ? -9.426  9.800   -11.309 1.00 0.38  ? 22   TYR A O    1  
ATOM   348   C CB   . TYR A 1 22  ? -12.451 8.360   -11.164 1.00 0.34  ? 22   TYR A CB   1  
ATOM   349   C CG   . TYR A 1 22  ? -13.649 7.727   -11.844 1.00 0.38  ? 22   TYR A CG   1  
ATOM   350   C CD1  . TYR A 1 22  ? -13.487 6.717   -12.784 1.00 0.50  ? 22   TYR A CD1  1  
ATOM   351   C CD2  . TYR A 1 22  ? -14.940 8.140   -11.542 1.00 0.50  ? 22   TYR A CD2  1  
ATOM   352   C CE1  . TYR A 1 22  ? -14.577 6.136   -13.403 1.00 0.60  ? 22   TYR A CE1  1  
ATOM   353   C CE2  . TYR A 1 22  ? -16.037 7.561   -12.155 1.00 0.62  ? 22   TYR A CE2  1  
ATOM   354   C CZ   . TYR A 1 22  ? -15.850 6.560   -13.085 1.00 0.62  ? 22   TYR A CZ   1  
ATOM   355   O OH   . TYR A 1 22  ? -16.941 5.978   -13.696 1.00 0.76  ? 22   TYR A OH   1  
ATOM   356   H H    . TYR A 1 22  ? -10.388 7.746   -12.812 1.00 0.40  ? 22   TYR A H    1  
ATOM   357   H HA   . TYR A 1 22  ? -12.287 9.977   -12.565 1.00 0.42  ? 22   TYR A HA   1  
ATOM   358   H HB2  . TYR A 1 22  ? -11.817 7.559   -10.799 1.00 0.37  ? 22   TYR A HB2  1  
ATOM   359   H HB3  . TYR A 1 22  ? -12.808 8.942   -10.323 1.00 0.32  ? 22   TYR A HB3  1  
ATOM   360   H HD1  . TYR A 1 22  ? -12.489 6.386   -13.032 1.00 0.61  ? 22   TYR A HD1  1  
ATOM   361   H HD2  . TYR A 1 22  ? -15.084 8.924   -10.813 1.00 0.60  ? 22   TYR A HD2  1  
ATOM   362   H HE1  . TYR A 1 22  ? -14.429 5.352   -14.132 1.00 0.74  ? 22   TYR A HE1  1  
ATOM   363   H HE2  . TYR A 1 22  ? -17.033 7.896   -11.906 1.00 0.78  ? 22   TYR A HE2  1  
ATOM   364   H HH   . TYR A 1 22  ? -17.632 6.651   -13.830 1.00 1.12  ? 22   TYR A HH   1  
ATOM   365   N N    . SER A 1 23  ? -11.116 10.974  -10.434 1.00 0.37  ? 23   SER A N    1  
ATOM   366   C CA   . SER A 1 23  ? -10.254 11.709  -9.549  1.00 0.39  ? 23   SER A CA   1  
ATOM   367   C C    . SER A 1 23  ? -10.522 11.321  -8.110  1.00 0.35  ? 23   SER A C    1  
ATOM   368   O O    . SER A 1 23  ? -11.660 11.056  -7.725  1.00 0.34  ? 23   SER A O    1  
ATOM   369   C CB   . SER A 1 23  ? -10.473 13.200  -9.721  1.00 0.45  ? 23   SER A CB   1  
ATOM   370   O OG   . SER A 1 23  ? -9.353  13.939  -9.264  1.00 0.52  ? 23   SER A OG   1  
ATOM   371   H H    . SER A 1 23  ? -12.077 11.183  -10.453 1.00 0.39  ? 23   SER A H    1  
ATOM   372   H HA   . SER A 1 23  ? -9.231  11.469  -9.796  1.00 0.43  ? 23   SER A HA   1  
ATOM   373   H HB2  . SER A 1 23  ? -10.644 13.417  -10.758 1.00 0.48  ? 23   SER A HB2  1  
ATOM   374   H HB3  . SER A 1 23  ? -11.337 13.493  -9.146  1.00 0.45  ? 23   SER A HB3  1  
ATOM   375   H HG   . SER A 1 23  ? -8.586  13.349  -9.184  1.00 0.75  ? 23   SER A HG   1  
ATOM   376   N N    . TRP A 1 24  ? -9.467  11.294  -7.324  1.00 0.37  ? 24   TRP A N    1  
ATOM   377   C CA   . TRP A 1 24  ? -9.590  11.044  -5.907  1.00 0.36  ? 24   TRP A CA   1  
ATOM   378   C C    . TRP A 1 24  ? -10.150 12.279  -5.212  1.00 0.35  ? 24   TRP A C    1  
ATOM   379   O O    . TRP A 1 24  ? -11.109 12.188  -4.453  1.00 0.34  ? 24   TRP A O    1  
ATOM   380   C CB   . TRP A 1 24  ? -8.230  10.652  -5.315  1.00 0.45  ? 24   TRP A CB   1  
ATOM   381   C CG   . TRP A 1 24  ? -8.022  11.138  -3.913  1.00 0.43  ? 24   TRP A CG   1  
ATOM   382   C CD1  . TRP A 1 24  ? -8.533  10.601  -2.769  1.00 0.96  ? 24   TRP A CD1  1  
ATOM   383   C CD2  . TRP A 1 24  ? -7.246  12.274  -3.515  1.00 1.27  ? 24   TRP A CD2  1  
ATOM   384   N NE1  . TRP A 1 24  ? -8.136  11.346  -1.685  1.00 0.61  ? 24   TRP A NE1  1  
ATOM   385   C CE2  . TRP A 1 24  ? -7.341  12.374  -2.118  1.00 1.10  ? 24   TRP A CE2  1  
ATOM   386   C CE3  . TRP A 1 24  ? -6.483  13.218  -4.209  1.00 2.43  ? 24   TRP A CE3  1  
ATOM   387   C CZ2  . TRP A 1 24  ? -6.703  13.381  -1.400  1.00 2.00  ? 24   TRP A CZ2  1  
ATOM   388   C CZ3  . TRP A 1 24  ? -5.849  14.216  -3.495  1.00 3.36  ? 24   TRP A CZ3  1  
ATOM   389   C CH2  . TRP A 1 24  ? -5.962  14.290  -2.103  1.00 3.13  ? 24   TRP A CH2  1  
ATOM   390   H H    . TRP A 1 24  ? -8.577  11.459  -7.713  1.00 0.43  ? 24   TRP A H    1  
ATOM   391   H HA   . TRP A 1 24  ? -10.283 10.226  -5.773  1.00 0.34  ? 24   TRP A HA   1  
ATOM   392   H HB2  . TRP A 1 24  ? -8.149  9.576   -5.306  1.00 0.57  ? 24   TRP A HB2  1  
ATOM   393   H HB3  . TRP A 1 24  ? -7.445  11.062  -5.933  1.00 0.57  ? 24   TRP A HB3  1  
ATOM   394   H HD1  . TRP A 1 24  ? -9.166  9.727   -2.735  1.00 1.86  ? 24   TRP A HD1  1  
ATOM   395   H HE1  . TRP A 1 24  ? -8.378  11.170  -0.758  1.00 0.92  ? 24   TRP A HE1  1  
ATOM   396   H HE3  . TRP A 1 24  ? -6.384  13.176  -5.283  1.00 2.64  ? 24   TRP A HE3  1  
ATOM   397   H HZ2  . TRP A 1 24  ? -6.781  13.453  -0.325  1.00 1.86  ? 24   TRP A HZ2  1  
ATOM   398   H HZ3  . TRP A 1 24  ? -5.254  14.953  -4.013  1.00 4.29  ? 24   TRP A HZ3  1  
ATOM   399   H HH2  . TRP A 1 24  ? -5.451  15.088  -1.585  1.00 3.88  ? 24   TRP A HH2  1  
ATOM   400   N N    . SER A 1 25  ? -9.569  13.433  -5.517  1.00 0.39  ? 25   SER A N    1  
ATOM   401   C CA   . SER A 1 25  ? -9.902  14.669  -4.826  1.00 0.44  ? 25   SER A CA   1  
ATOM   402   C C    . SER A 1 25  ? -11.339 15.108  -5.103  1.00 0.43  ? 25   SER A C    1  
ATOM   403   O O    . SER A 1 25  ? -11.990 15.700  -4.243  1.00 0.49  ? 25   SER A O    1  
ATOM   404   C CB   . SER A 1 25  ? -8.912  15.762  -5.222  1.00 0.53  ? 25   SER A CB   1  
ATOM   405   O OG   . SER A 1 25  ? -8.564  15.658  -6.595  1.00 1.37  ? 25   SER A OG   1  
ATOM   406   H H    . SER A 1 25  ? -8.895  13.457  -6.227  1.00 0.42  ? 25   SER A H    1  
ATOM   407   H HA   . SER A 1 25  ? -9.800  14.478  -3.764  1.00 0.46  ? 25   SER A HA   1  
ATOM   408   H HB2  . SER A 1 25  ? -9.359  16.731  -5.049  1.00 1.05  ? 25   SER A HB2  1  
ATOM   409   H HB3  . SER A 1 25  ? -8.016  15.667  -4.627  1.00 1.16  ? 25   SER A HB3  1  
ATOM   410   H HG   . SER A 1 25  ? -7.608  15.801  -6.691  1.00 1.86  ? 25   SER A HG   1  
ATOM   411   N N    . GLN A 1 26  ? -11.846 14.797  -6.295  1.00 0.40  ? 26   GLN A N    1  
ATOM   412   C CA   . GLN A 1 26  ? -13.226 15.131  -6.638  1.00 0.42  ? 26   GLN A CA   1  
ATOM   413   C C    . GLN A 1 26  ? -14.208 14.429  -5.710  1.00 0.38  ? 26   GLN A C    1  
ATOM   414   O O    . GLN A 1 26  ? -15.333 14.884  -5.509  1.00 0.41  ? 26   GLN A O    1  
ATOM   415   C CB   . GLN A 1 26  ? -13.533 14.750  -8.077  1.00 0.47  ? 26   GLN A CB   1  
ATOM   416   C CG   . GLN A 1 26  ? -12.786 15.589  -9.087  1.00 0.59  ? 26   GLN A CG   1  
ATOM   417   C CD   . GLN A 1 26  ? -13.240 15.333  -10.508 1.00 0.73  ? 26   GLN A CD   1  
ATOM   418   O OE1  . GLN A 1 26  ? -13.699 14.241  -10.837 1.00 1.11  ? 26   GLN A OE1  1  
ATOM   419   N NE2  . GLN A 1 26  ? -13.115 16.335  -11.359 1.00 1.10  ? 26   GLN A NE2  1  
ATOM   420   H H    . GLN A 1 26  ? -11.279 14.347  -6.958  1.00 0.39  ? 26   GLN A H    1  
ATOM   421   H HA   . GLN A 1 26  ? -13.338 16.197  -6.533  1.00 0.50  ? 26   GLN A HA   1  
ATOM   422   H HB2  . GLN A 1 26  ? -13.259 13.717  -8.229  1.00 0.43  ? 26   GLN A HB2  1  
ATOM   423   H HB3  . GLN A 1 26  ? -14.589 14.862  -8.251  1.00 0.53  ? 26   GLN A HB3  1  
ATOM   424   H HG2  . GLN A 1 26  ? -12.942 16.631  -8.856  1.00 0.70  ? 26   GLN A HG2  1  
ATOM   425   H HG3  . GLN A 1 26  ? -11.737 15.356  -9.010  1.00 0.53  ? 26   GLN A HG3  1  
ATOM   426   H HE21 . GLN A 1 26  ? -12.738 17.185  -11.028 1.00 1.52  ? 26   GLN A HE21 1  
ATOM   427   H HE22 . GLN A 1 26  ? -13.398 16.191  -12.292 1.00 1.17  ? 26   GLN A HE22 1  
ATOM   428   N N    . PHE A 1 27  ? -13.770 13.312  -5.156  1.00 0.35  ? 27   PHE A N    1  
ATOM   429   C CA   . PHE A 1 27  ? -14.607 12.483  -4.311  1.00 0.38  ? 27   PHE A CA   1  
ATOM   430   C C    . PHE A 1 27  ? -13.997 12.324  -2.923  1.00 0.43  ? 27   PHE A C    1  
ATOM   431   O O    . PHE A 1 27  ? -14.387 11.438  -2.159  1.00 0.67  ? 27   PHE A O    1  
ATOM   432   C CB   . PHE A 1 27  ? -14.776 11.125  -4.984  1.00 0.43  ? 27   PHE A CB   1  
ATOM   433   C CG   . PHE A 1 27  ? -15.473 11.231  -6.310  1.00 0.67  ? 27   PHE A CG   1  
ATOM   434   C CD1  . PHE A 1 27  ? -16.809 11.593  -6.379  1.00 0.85  ? 27   PHE A CD1  1  
ATOM   435   C CD2  . PHE A 1 27  ? -14.784 10.997  -7.490  1.00 0.94  ? 27   PHE A CD2  1  
ATOM   436   C CE1  . PHE A 1 27  ? -17.445 11.714  -7.599  1.00 1.16  ? 27   PHE A CE1  1  
ATOM   437   C CE2  . PHE A 1 27  ? -15.414 11.120  -8.713  1.00 1.20  ? 27   PHE A CE2  1  
ATOM   438   C CZ   . PHE A 1 27  ? -16.746 11.478  -8.767  1.00 1.28  ? 27   PHE A CZ   1  
ATOM   439   H H    . PHE A 1 27  ? -12.849 13.030  -5.328  1.00 0.34  ? 27   PHE A H    1  
ATOM   440   H HA   . PHE A 1 27  ? -15.572 12.957  -4.222  1.00 0.42  ? 27   PHE A HA   1  
ATOM   441   H HB2  . PHE A 1 27  ? -13.800 10.693  -5.155  1.00 0.52  ? 27   PHE A HB2  1  
ATOM   442   H HB3  . PHE A 1 27  ? -15.346 10.471  -4.347  1.00 0.39  ? 27   PHE A HB3  1  
ATOM   443   H HD1  . PHE A 1 27  ? -17.356 11.778  -5.466  1.00 0.88  ? 27   PHE A HD1  1  
ATOM   444   H HD2  . PHE A 1 27  ? -13.743 10.715  -7.448  1.00 1.05  ? 27   PHE A HD2  1  
ATOM   445   H HE1  . PHE A 1 27  ? -18.487 11.995  -7.639  1.00 1.39  ? 27   PHE A HE1  1  
ATOM   446   H HE2  . PHE A 1 27  ? -14.866 10.936  -9.625  1.00 1.44  ? 27   PHE A HE2  1  
ATOM   447   H HZ   . PHE A 1 27  ? -17.240 11.574  -9.722  1.00 1.53  ? 27   PHE A HZ   1  
ATOM   448   N N    . SER A 1 28  ? -13.065 13.204  -2.588  1.00 0.39  ? 28   SER A N    1  
ATOM   449   C CA   . SER A 1 28  ? -12.289 13.053  -1.372  1.00 0.42  ? 28   SER A CA   1  
ATOM   450   C C    . SER A 1 28  ? -12.798 13.938  -0.246  1.00 0.58  ? 28   SER A C    1  
ATOM   451   O O    . SER A 1 28  ? -13.801 14.638  -0.382  1.00 1.01  ? 28   SER A O    1  
ATOM   452   C CB   . SER A 1 28  ? -10.812 13.338  -1.635  1.00 0.62  ? 28   SER A CB   1  
ATOM   453   O OG   . SER A 1 28  ? -10.561 14.725  -1.805  1.00 1.81  ? 28   SER A OG   1  
ATOM   454   H H    . SER A 1 28  ? -12.902 13.977  -3.170  1.00 0.51  ? 28   SER A H    1  
ATOM   455   H HA   . SER A 1 28  ? -12.384 12.027  -1.055  1.00 0.57  ? 28   SER A HA   1  
ATOM   456   H HB2  . SER A 1 28  ? -10.229 12.976  -0.802  1.00 0.85  ? 28   SER A HB2  1  
ATOM   457   H HB3  . SER A 1 28  ? -10.507 12.820  -2.534  1.00 1.08  ? 28   SER A HB3  1  
ATOM   458   H HG   . SER A 1 28  ? -11.399 15.217  -1.808  1.00 2.04  ? 28   SER A HG   1  
ATOM   459   N N    . ASP A 1 29  ? -12.094 13.860  0.870   1.00 0.63  ? 29   ASP A N    1  
ATOM   460   C CA   . ASP A 1 29  ? -12.427 14.589  2.084   1.00 0.84  ? 29   ASP A CA   1  
ATOM   461   C C    . ASP A 1 29  ? -11.299 14.417  3.093   1.00 0.88  ? 29   ASP A C    1  
ATOM   462   O O    . ASP A 1 29  ? -11.075 15.272  3.951   1.00 1.03  ? 29   ASP A O    1  
ATOM   463   C CB   . ASP A 1 29  ? -13.744 14.070  2.663   1.00 1.04  ? 29   ASP A CB   1  
ATOM   464   C CG   . ASP A 1 29  ? -14.009 14.563  4.072   1.00 1.69  ? 29   ASP A CG   1  
ATOM   465   O OD1  . ASP A 1 29  ? -14.556 15.670  4.222   1.00 1.85  ? 29   ASP A OD1  1  
ATOM   466   O OD2  . ASP A 1 29  ? -13.675 13.842  5.035   1.00 2.31  ? 29   ASP A OD2  1  
ATOM   467   H H    . ASP A 1 29  ? -11.311 13.281  0.878   1.00 0.79  ? 29   ASP A H    1  
ATOM   468   H HA   . ASP A 1 29  ? -12.529 15.636  1.836   1.00 0.91  ? 29   ASP A HA   1  
ATOM   469   H HB2  . ASP A 1 29  ? -14.553 14.401  2.031   1.00 1.07  ? 29   ASP A HB2  1  
ATOM   470   H HB3  . ASP A 1 29  ? -13.721 12.990  2.673   1.00 1.38  ? 29   ASP A HB3  1  
ATOM   471   N N    . VAL A 1 30  ? -10.560 13.322  2.908   1.00 0.80  ? 30   VAL A N    1  
ATOM   472   C CA   . VAL A 1 30  ? -9.497  12.884  3.811   1.00 0.82  ? 30   VAL A CA   1  
ATOM   473   C C    . VAL A 1 30  ? -8.547  14.023  4.201   1.00 0.82  ? 30   VAL A C    1  
ATOM   474   O O    . VAL A 1 30  ? -8.554  14.472  5.341   1.00 0.92  ? 30   VAL A O    1  
ATOM   475   C CB   . VAL A 1 30  ? -8.711  11.713  3.164   1.00 0.81  ? 30   VAL A CB   1  
ATOM   476   C CG1  . VAL A 1 30  ? -9.540  10.438  3.193   1.00 0.89  ? 30   VAL A CG1  1  
ATOM   477   C CG2  . VAL A 1 30  ? -8.323  12.037  1.724   1.00 0.76  ? 30   VAL A CG2  1  
ATOM   478   H H    . VAL A 1 30  ? -10.743 12.779  2.124   1.00 0.76  ? 30   VAL A H    1  
ATOM   479   H HA   . VAL A 1 30  ? -9.967  12.509  4.709   1.00 0.90  ? 30   VAL A HA   1  
ATOM   480   H HB   . VAL A 1 30  ? -7.808  11.547  3.734   1.00 0.84  ? 30   VAL A HB   1  
ATOM   481   H HG11 . VAL A 1 30  ? -9.797  10.197  4.214   1.00 1.41  ? 30   VAL A HG11 1  
ATOM   482   H HG12 . VAL A 1 30  ? -8.969  9.628   2.764   1.00 1.34  ? 30   VAL A HG12 1  
ATOM   483   H HG13 . VAL A 1 30  ? -10.444 10.584  2.618   1.00 1.34  ? 30   VAL A HG13 1  
ATOM   484   H HG21 . VAL A 1 30  ? -9.166  12.491  1.220   1.00 1.12  ? 30   VAL A HG21 1  
ATOM   485   H HG22 . VAL A 1 30  ? -8.047  11.126  1.213   1.00 1.29  ? 30   VAL A HG22 1  
ATOM   486   H HG23 . VAL A 1 30  ? -7.488  12.719  1.719   1.00 1.35  ? 30   VAL A HG23 1  
ATOM   487   N N    . GLU A 1 31  ? -7.732  14.479  3.261   1.00 0.78  ? 31   GLU A N    1  
ATOM   488   C CA   . GLU A 1 31  ? -6.853  15.614  3.500   1.00 0.83  ? 31   GLU A CA   1  
ATOM   489   C C    . GLU A 1 31  ? -7.467  16.861  2.886   1.00 0.88  ? 31   GLU A C    1  
ATOM   490   O O    . GLU A 1 31  ? -6.899  17.954  2.942   1.00 0.98  ? 31   GLU A O    1  
ATOM   491   C CB   . GLU A 1 31  ? -5.452  15.367  2.928   1.00 0.93  ? 31   GLU A CB   1  
ATOM   492   C CG   . GLU A 1 31  ? -5.433  15.064  1.439   1.00 1.05  ? 31   GLU A CG   1  
ATOM   493   C CD   . GLU A 1 31  ? -4.029  15.053  0.869   1.00 2.05  ? 31   GLU A CD   1  
ATOM   494   O OE1  . GLU A 1 31  ? -3.370  13.993  0.913   1.00 2.74  ? 31   GLU A OE1  1  
ATOM   495   O OE2  . GLU A 1 31  ? -3.572  16.112  0.380   1.00 2.46  ? 31   GLU A OE2  1  
ATOM   496   H H    . GLU A 1 31  ? -7.732  14.053  2.383   1.00 0.75  ? 31   GLU A H    1  
ATOM   497   H HA   . GLU A 1 31  ? -6.779  15.753  4.568   1.00 0.84  ? 31   GLU A HA   1  
ATOM   498   H HB2  . GLU A 1 31  ? -4.848  16.246  3.099   1.00 1.51  ? 31   GLU A HB2  1  
ATOM   499   H HB3  . GLU A 1 31  ? -5.008  14.531  3.448   1.00 1.30  ? 31   GLU A HB3  1  
ATOM   500   H HG2  . GLU A 1 31  ? -5.878  14.093  1.276   1.00 1.41  ? 31   GLU A HG2  1  
ATOM   501   H HG3  . GLU A 1 31  ? -6.011  15.817  0.923   1.00 1.38  ? 31   GLU A HG3  1  
ATOM   502   N N    . GLU A 1 32  ? -8.643  16.673  2.303   1.00 0.87  ? 32   GLU A N    1  
ATOM   503   C CA   . GLU A 1 32  ? -9.343  17.733  1.604   1.00 0.98  ? 32   GLU A CA   1  
ATOM   504   C C    . GLU A 1 32  ? -9.821  18.803  2.578   1.00 1.09  ? 32   GLU A C    1  
ATOM   505   O O    . GLU A 1 32  ? -9.522  19.988  2.421   1.00 1.24  ? 32   GLU A O    1  
ATOM   506   C CB   . GLU A 1 32  ? -10.529 17.146  0.840   1.00 0.98  ? 32   GLU A CB   1  
ATOM   507   C CG   . GLU A 1 32  ? -11.447 18.195  0.236   1.00 1.12  ? 32   GLU A CG   1  
ATOM   508   C CD   . GLU A 1 32  ? -12.593 17.592  -0.544  1.00 1.20  ? 32   GLU A CD   1  
ATOM   509   O OE1  . GLU A 1 32  ? -12.331 16.828  -1.500  1.00 1.45  ? 32   GLU A OE1  1  
ATOM   510   O OE2  . GLU A 1 32  ? -13.759 17.869  -0.201  1.00 1.17  ? 32   GLU A OE2  1  
ATOM   511   H H    . GLU A 1 32  ? -9.063  15.792  2.361   1.00 0.81  ? 32   GLU A H    1  
ATOM   512   H HA   . GLU A 1 32  ? -8.658  18.174  0.902   1.00 1.06  ? 32   GLU A HA   1  
ATOM   513   H HB2  . GLU A 1 32  ? -10.153 16.525  0.039   1.00 0.98  ? 32   GLU A HB2  1  
ATOM   514   H HB3  . GLU A 1 32  ? -11.108 16.532  1.516   1.00 0.94  ? 32   GLU A HB3  1  
ATOM   515   H HG2  . GLU A 1 32  ? -11.857 18.793  1.034   1.00 1.13  ? 32   GLU A HG2  1  
ATOM   516   H HG3  . GLU A 1 32  ? -10.869 18.822  -0.426  1.00 1.25  ? 32   GLU A HG3  1  
ATOM   517   N N    . ASN A 1 33  ? -10.553 18.376  3.594   1.00 1.09  ? 33   ASN A N    1  
ATOM   518   C CA   . ASN A 1 33  ? -11.156 19.304  4.533   1.00 1.27  ? 33   ASN A CA   1  
ATOM   519   C C    . ASN A 1 33  ? -10.355 19.383  5.822   1.00 1.32  ? 33   ASN A C    1  
ATOM   520   O O    . ASN A 1 33  ? -10.339 20.414  6.491   1.00 1.68  ? 33   ASN A O    1  
ATOM   521   C CB   . ASN A 1 33  ? -12.597 18.890  4.818   1.00 1.36  ? 33   ASN A CB   1  
ATOM   522   C CG   . ASN A 1 33  ? -13.478 19.011  3.590   1.00 1.48  ? 33   ASN A CG   1  
ATOM   523   O OD1  . ASN A 1 33  ? -14.042 20.070  3.316   1.00 1.87  ? 33   ASN A OD1  1  
ATOM   524   N ND2  . ASN A 1 33  ? -13.609 17.922  2.845   1.00 1.35  ? 33   ASN A ND2  1  
ATOM   525   H H    . ASN A 1 33  ? -10.695 17.415  3.716   1.00 1.02  ? 33   ASN A H    1  
ATOM   526   H HA   . ASN A 1 33  ? -11.162 20.280  4.071   1.00 1.40  ? 33   ASN A HA   1  
ATOM   527   H HB2  . ASN A 1 33  ? -12.609 17.860  5.145   1.00 1.36  ? 33   ASN A HB2  1  
ATOM   528   H HB3  . ASN A 1 33  ? -13.000 19.518  5.594   1.00 1.57  ? 33   ASN A HB3  1  
ATOM   529   H HD21 . ASN A 1 33  ? -13.141 17.108  3.128   1.00 1.19  ? 33   ASN A HD21 1  
ATOM   530   H HD22 . ASN A 1 33  ? -14.161 17.975  2.035   1.00 1.55  ? 33   ASN A HD22 1  
ATOM   531   N N    . ARG A 1 34  ? -9.683  18.297  6.164   1.00 1.22  ? 34   ARG A N    1  
ATOM   532   C CA   . ARG A 1 34  ? -8.832  18.273  7.342   1.00 1.29  ? 34   ARG A CA   1  
ATOM   533   C C    . ARG A 1 34  ? -7.433  17.832  6.953   1.00 1.17  ? 34   ARG A C    1  
ATOM   534   O O    . ARG A 1 34  ? -7.258  17.068  6.008   1.00 1.24  ? 34   ARG A O    1  
ATOM   535   C CB   . ARG A 1 34  ? -9.405  17.334  8.406   1.00 1.50  ? 34   ARG A CB   1  
ATOM   536   C CG   . ARG A 1 34  ? -9.425  15.870  7.993   1.00 1.52  ? 34   ARG A CG   1  
ATOM   537   C CD   . ARG A 1 34  ? -10.063 14.997  9.059   1.00 1.91  ? 34   ARG A CD   1  
ATOM   538   N NE   . ARG A 1 34  ? -11.504 15.220  9.160   1.00 2.18  ? 34   ARG A NE   1  
ATOM   539   C CZ   . ARG A 1 34  ? -12.177 15.257  10.308  1.00 2.65  ? 34   ARG A CZ   1  
ATOM   540   N NH1  . ARG A 1 34  ? -11.532 15.165  11.469  1.00 2.89  ? 34   ARG A NH1  1  
ATOM   541   N NH2  . ARG A 1 34  ? -13.498 15.403  10.296  1.00 3.39  ? 34   ARG A NH2  1  
ATOM   542   H H    . ARG A 1 34  ? -9.751  17.492  5.611   1.00 1.29  ? 34   ARG A H    1  
ATOM   543   H HA   . ARG A 1 34  ? -8.785  19.275  7.740   1.00 1.52  ? 34   ARG A HA   1  
ATOM   544   H HB2  . ARG A 1 34  ? -8.810  17.423  9.303   1.00 1.67  ? 34   ARG A HB2  1  
ATOM   545   H HB3  . ARG A 1 34  ? -10.414 17.639  8.625   1.00 1.85  ? 34   ARG A HB3  1  
ATOM   546   H HG2  . ARG A 1 34  ? -9.990  15.773  7.079   1.00 1.71  ? 34   ARG A HG2  1  
ATOM   547   H HG3  . ARG A 1 34  ? -8.410  15.539  7.830   1.00 1.50  ? 34   ARG A HG3  1  
ATOM   548   H HD2  . ARG A 1 34  ? -9.886  13.961  8.812   1.00 2.31  ? 34   ARG A HD2  1  
ATOM   549   H HD3  . ARG A 1 34  ? -9.606  15.222  10.012  1.00 2.37  ? 34   ARG A HD3  1  
ATOM   550   H HE   . ARG A 1 34  ? -12.003 15.328  8.312   1.00 2.49  ? 34   ARG A HE   1  
ATOM   551   H HH11 . ARG A 1 34  ? -10.527 15.067  11.485  1.00 2.91  ? 34   ARG A HH11 1  
ATOM   552   H HH12 . ARG A 1 34  ? -12.042 15.201  12.337  1.00 3.40  ? 34   ARG A HH12 1  
ATOM   553   H HH21 . ARG A 1 34  ? -13.994 15.490  9.424   1.00 3.75  ? 34   ARG A HH21 1  
ATOM   554   H HH22 . ARG A 1 34  ? -14.014 15.422  11.162  1.00 3.82  ? 34   ARG A HH22 1  
ATOM   555   N N    . THR A 1 35  ? -6.438  18.321  7.660   1.00 1.31  ? 35   THR A N    1  
ATOM   556   C CA   . THR A 1 35  ? -5.069  17.949  7.365   1.00 1.39  ? 35   THR A CA   1  
ATOM   557   C C    . THR A 1 35  ? -4.532  16.966  8.390   1.00 1.34  ? 35   THR A C    1  
ATOM   558   O O    . THR A 1 35  ? -4.284  17.312  9.549   1.00 1.55  ? 35   THR A O    1  
ATOM   559   C CB   . THR A 1 35  ? -4.143  19.170  7.286   1.00 1.82  ? 35   THR A CB   1  
ATOM   560   O OG1  . THR A 1 35  ? -4.387  20.062  8.383   1.00 2.05  ? 35   THR A OG1  1  
ATOM   561   C CG2  . THR A 1 35  ? -4.322  19.905  5.970   1.00 2.25  ? 35   THR A CG2  1  
ATOM   562   H H    . THR A 1 35  ? -6.628  18.940  8.403   1.00 1.51  ? 35   THR A H    1  
ATOM   563   H HA   . THR A 1 35  ? -5.066  17.467  6.397   1.00 1.50  ? 35   THR A HA   1  
ATOM   564   H HB   . THR A 1 35  ? -3.126  18.814  7.341   1.00 1.91  ? 35   THR A HB   1  
ATOM   565   H HG1  . THR A 1 35  ? -4.937  20.801  8.078   1.00 2.37  ? 35   THR A HG1  1  
ATOM   566   H HG21 . THR A 1 35  ? -4.093  19.240  5.152   1.00 2.57  ? 35   THR A HG21 1  
ATOM   567   H HG22 . THR A 1 35  ? -3.658  20.756  5.941   1.00 2.67  ? 35   THR A HG22 1  
ATOM   568   H HG23 . THR A 1 35  ? -5.344  20.243  5.883   1.00 2.39  ? 35   THR A HG23 1  
ATOM   569   N N    . GLU A 1 36  ? -4.384  15.731  7.955   1.00 1.44  ? 36   GLU A N    1  
ATOM   570   C CA   . GLU A 1 36  ? -3.883  14.669  8.807   1.00 1.68  ? 36   GLU A CA   1  
ATOM   571   C C    . GLU A 1 36  ? -2.365  14.600  8.708   1.00 1.43  ? 36   GLU A C    1  
ATOM   572   O O    . GLU A 1 36  ? -1.650  15.113  9.568   1.00 1.46  ? 36   GLU A O    1  
ATOM   573   C CB   . GLU A 1 36  ? -4.497  13.326  8.399   1.00 2.17  ? 36   GLU A CB   1  
ATOM   574   C CG   . GLU A 1 36  ? -6.018  13.317  8.411   1.00 2.49  ? 36   GLU A CG   1  
ATOM   575   C CD   . GLU A 1 36  ? -6.591  13.511  9.798   1.00 2.96  ? 36   GLU A CD   1  
ATOM   576   O OE1  . GLU A 1 36  ? -6.777  12.505  10.513  1.00 3.30  ? 36   GLU A OE1  1  
ATOM   577   O OE2  . GLU A 1 36  ? -6.854  14.667  10.186  1.00 3.34  ? 36   GLU A OE2  1  
ATOM   578   H H    . GLU A 1 36  ? -4.603  15.534  7.024   1.00 1.59  ? 36   GLU A H    1  
ATOM   579   H HA   . GLU A 1 36  ? -4.162  14.894  9.826   1.00 1.91  ? 36   GLU A HA   1  
ATOM   580   H HB2  . GLU A 1 36  ? -4.166  13.082  7.401   1.00 2.46  ? 36   GLU A HB2  1  
ATOM   581   H HB3  . GLU A 1 36  ? -4.149  12.564  9.081   1.00 2.51  ? 36   GLU A HB3  1  
ATOM   582   H HG2  . GLU A 1 36  ? -6.375  14.115  7.777   1.00 2.59  ? 36   GLU A HG2  1  
ATOM   583   H HG3  . GLU A 1 36  ? -6.363  12.370  8.024   1.00 2.88  ? 36   GLU A HG3  1  
ATOM   584   N N    . ALA A 1 37  ? -1.887  13.964  7.651   1.00 1.50  ? 37   ALA A N    1  
ATOM   585   C CA   . ALA A 1 37  ? -0.463  13.865  7.390   1.00 1.39  ? 37   ALA A CA   1  
ATOM   586   C C    . ALA A 1 37  ? -0.040  14.844  6.299   1.00 1.27  ? 37   ALA A C    1  
ATOM   587   O O    . ALA A 1 37  ? -0.874  15.291  5.505   1.00 1.58  ? 37   ALA A O    1  
ATOM   588   C CB   . ALA A 1 37  ? -0.108  12.442  6.993   1.00 1.92  ? 37   ALA A CB   1  
ATOM   589   H H    . ALA A 1 37  ? -2.512  13.558  7.018   1.00 1.80  ? 37   ALA A H    1  
ATOM   590   H HA   . ALA A 1 37  ? 0.063   14.104  8.302   1.00 1.33  ? 37   ALA A HA   1  
ATOM   591   H HB1  . ALA A 1 37  ? 0.959   12.364  6.850   1.00 2.29  ? 37   ALA A HB1  1  
ATOM   592   H HB2  . ALA A 1 37  ? -0.614  12.187  6.074   1.00 2.44  ? 37   ALA A HB2  1  
ATOM   593   H HB3  . ALA A 1 37  ? -0.416  11.763  7.774   1.00 2.11  ? 37   ALA A HB3  1  
ATOM   594   N N    . PRO A 1 38  ? 1.255   15.210  6.268   1.00 1.10  ? 38   PRO A N    1  
ATOM   595   C CA   . PRO A 1 38  ? 1.846   16.011  5.181   1.00 1.43  ? 38   PRO A CA   1  
ATOM   596   C C    . PRO A 1 38  ? 1.692   15.357  3.803   1.00 1.79  ? 38   PRO A C    1  
ATOM   597   O O    . PRO A 1 38  ? 1.058   14.311  3.660   1.00 1.87  ? 38   PRO A O    1  
ATOM   598   C CB   . PRO A 1 38  ? 3.330   16.096  5.576   1.00 1.34  ? 38   PRO A CB   1  
ATOM   599   C CG   . PRO A 1 38  ? 3.333   15.900  7.046   1.00 1.26  ? 38   PRO A CG   1  
ATOM   600   C CD   . PRO A 1 38  ? 2.240   14.913  7.320   1.00 1.01  ? 38   PRO A CD   1  
ATOM   601   H HA   . PRO A 1 38  ? 1.425   17.004  5.151   1.00 1.71  ? 38   PRO A HA   1  
ATOM   602   H HB2  . PRO A 1 38  ? 3.903   15.321  5.076   1.00 1.29  ? 38   PRO A HB2  1  
ATOM   603   H HB3  . PRO A 1 38  ? 3.722   17.063  5.309   1.00 1.71  ? 38   PRO A HB3  1  
ATOM   604   H HG2  . PRO A 1 38  ? 4.284   15.497  7.357   1.00 1.41  ? 38   PRO A HG2  1  
ATOM   605   H HG3  . PRO A 1 38  ? 3.133   16.835  7.547   1.00 1.71  ? 38   PRO A HG3  1  
ATOM   606   H HD2  . PRO A 1 38  ? 2.615   13.905  7.229   1.00 1.08  ? 38   PRO A HD2  1  
ATOM   607   H HD3  . PRO A 1 38  ? 1.820   15.076  8.301   1.00 1.25  ? 38   PRO A HD3  1  
ATOM   608   N N    . GLU A 1 39  ? 2.275   15.979  2.788   1.00 2.28  ? 39   GLU A N    1  
ATOM   609   C CA   . GLU A 1 39  ? 2.214   15.455  1.434   1.00 2.76  ? 39   GLU A CA   1  
ATOM   610   C C    . GLU A 1 39  ? 3.239   14.341  1.246   1.00 2.66  ? 39   GLU A C    1  
ATOM   611   O O    . GLU A 1 39  ? 3.236   13.628  0.240   1.00 3.08  ? 39   GLU A O    1  
ATOM   612   C CB   . GLU A 1 39  ? 2.439   16.572  0.406   1.00 3.38  ? 39   GLU A CB   1  
ATOM   613   C CG   . GLU A 1 39  ? 3.697   17.398  0.644   1.00 3.52  ? 39   GLU A CG   1  
ATOM   614   C CD   . GLU A 1 39  ? 3.513   18.484  1.684   1.00 4.22  ? 39   GLU A CD   1  
ATOM   615   O OE1  . GLU A 1 39  ? 3.729   18.204  2.882   1.00 4.64  ? 39   GLU A OE1  1  
ATOM   616   O OE2  . GLU A 1 39  ? 3.158   19.619  1.310   1.00 4.44  ? 39   GLU A OE2  1  
ATOM   617   H H    . GLU A 1 39  ? 2.765   16.819  2.952   1.00 2.42  ? 39   GLU A H    1  
ATOM   618   H HA   . GLU A 1 39  ? 1.228   15.043  1.292   1.00 2.84  ? 39   GLU A HA   1  
ATOM   619   H HB2  . GLU A 1 39  ? 2.508   16.131  -0.576  1.00 3.74  ? 39   GLU A HB2  1  
ATOM   620   H HB3  . GLU A 1 39  ? 1.588   17.239  0.429   1.00 3.48  ? 39   GLU A HB3  1  
ATOM   621   H HG2  . GLU A 1 39  ? 4.479   16.737  0.982   1.00 3.29  ? 39   GLU A HG2  1  
ATOM   622   H HG3  . GLU A 1 39  ? 3.993   17.858  -0.289  1.00 3.47  ? 39   GLU A HG3  1  
ATOM   623   N N    . GLY A 1 40  ? 4.118   14.201  2.224   1.00 2.15  ? 40   GLY A N    1  
ATOM   624   C CA   . GLY A 1 40  ? 5.117   13.156  2.187   1.00 2.04  ? 40   GLY A CA   1  
ATOM   625   C C    . GLY A 1 40  ? 6.197   13.379  3.215   1.00 1.57  ? 40   GLY A C    1  
ATOM   626   O O    . GLY A 1 40  ? 7.362   13.560  2.864   1.00 1.75  ? 40   GLY A O    1  
ATOM   627   H H    . GLY A 1 40  ? 4.094   14.824  2.981   1.00 1.90  ? 40   GLY A H    1  
ATOM   628   H HA2  . GLY A 1 40  ? 4.637   12.207  2.379   1.00 2.04  ? 40   GLY A HA2  1  
ATOM   629   H HA3  . GLY A 1 40  ? 5.566   13.132  1.205   1.00 2.40  ? 40   GLY A HA3  1  
ATOM   630   N N    . THR A 1 41  ? 5.820   13.356  4.492   1.00 1.12  ? 41   THR A N    1  
ATOM   631   C CA   . THR A 1 41  ? 6.767   13.664  5.552   1.00 0.86  ? 41   THR A CA   1  
ATOM   632   C C    . THR A 1 41  ? 7.840   12.571  5.648   1.00 0.75  ? 41   THR A C    1  
ATOM   633   O O    . THR A 1 41  ? 8.973   12.763  5.202   1.00 0.85  ? 41   THR A O    1  
ATOM   634   C CB   . THR A 1 41  ? 6.041   13.843  6.911   1.00 0.80  ? 41   THR A CB   1  
ATOM   635   O OG1  . THR A 1 41  ? 6.972   13.792  8.001   1.00 0.95  ? 41   THR A OG1  1  
ATOM   636   C CG2  . THR A 1 41  ? 4.957   12.791  7.108   1.00 0.91  ? 41   THR A CG2  1  
ATOM   637   H H    . THR A 1 41  ? 4.894   13.113  4.720   1.00 1.17  ? 41   THR A H    1  
ATOM   638   H HA   . THR A 1 41  ? 7.234   14.603  5.298   1.00 1.14  ? 41   THR A HA   1  
ATOM   639   H HB   . THR A 1 41  ? 5.568   14.815  6.911   1.00 0.93  ? 41   THR A HB   1  
ATOM   640   H HG1  . THR A 1 41  ? 7.728   14.371  7.810   1.00 1.29  ? 41   THR A HG1  1  
ATOM   641   H HG21 . THR A 1 41  ? 5.397   11.806  7.060   1.00 1.35  ? 41   THR A HG21 1  
ATOM   642   H HG22 . THR A 1 41  ? 4.214   12.894  6.331   1.00 1.45  ? 41   THR A HG22 1  
ATOM   643   H HG23 . THR A 1 41  ? 4.491   12.933  8.072   1.00 1.31  ? 41   THR A HG23 1  
ATOM   644   N N    . GLU A 1 42  ? 7.477   11.427  6.210   1.00 0.69  ? 42   GLU A N    1  
ATOM   645   C CA   . GLU A 1 42  ? 8.325   10.247  6.171   1.00 0.66  ? 42   GLU A CA   1  
ATOM   646   C C    . GLU A 1 42  ? 7.930   9.398   4.984   1.00 0.54  ? 42   GLU A C    1  
ATOM   647   O O    . GLU A 1 42  ? 8.746   8.720   4.358   1.00 0.56  ? 42   GLU A O    1  
ATOM   648   C CB   . GLU A 1 42  ? 8.163   9.429   7.450   1.00 0.74  ? 42   GLU A CB   1  
ATOM   649   C CG   . GLU A 1 42  ? 6.786   8.794   7.621   1.00 0.65  ? 42   GLU A CG   1  
ATOM   650   C CD   . GLU A 1 42  ? 6.707   7.951   8.874   1.00 1.20  ? 42   GLU A CD   1  
ATOM   651   O OE1  . GLU A 1 42  ? 7.378   6.898   8.931   1.00 2.02  ? 42   GLU A OE1  1  
ATOM   652   O OE2  . GLU A 1 42  ? 6.010   8.358   9.826   1.00 1.17  ? 42   GLU A OE2  1  
ATOM   653   H H    . GLU A 1 42  ? 6.619   11.378  6.676   1.00 0.76  ? 42   GLU A H    1  
ATOM   654   H HA   . GLU A 1 42  ? 9.351   10.560  6.066   1.00 0.71  ? 42   GLU A HA   1  
ATOM   655   H HB2  . GLU A 1 42  ? 8.896   8.640   7.449   1.00 0.79  ? 42   GLU A HB2  1  
ATOM   656   H HB3  . GLU A 1 42  ? 8.342   10.075  8.295   1.00 0.86  ? 42   GLU A HB3  1  
ATOM   657   H HG2  . GLU A 1 42  ? 6.044   9.578   7.681   1.00 0.88  ? 42   GLU A HG2  1  
ATOM   658   H HG3  . GLU A 1 42  ? 6.574   8.166   6.761   1.00 0.91  ? 42   GLU A HG3  1  
ATOM   659   N N    . SER A 1 43  ? 6.646   9.474   4.692   1.00 0.48  ? 43   SER A N    1  
ATOM   660   C CA   . SER A 1 43  ? 5.999   8.607   3.739   1.00 0.43  ? 43   SER A CA   1  
ATOM   661   C C    . SER A 1 43  ? 6.590   8.690   2.351   1.00 0.43  ? 43   SER A C    1  
ATOM   662   O O    . SER A 1 43  ? 6.479   7.739   1.612   1.00 0.49  ? 43   SER A O    1  
ATOM   663   C CB   . SER A 1 43  ? 4.532   8.942   3.663   1.00 0.50  ? 43   SER A CB   1  
ATOM   664   O OG   . SER A 1 43  ? 3.890   8.743   4.907   1.00 1.25  ? 43   SER A OG   1  
ATOM   665   H H    . SER A 1 43  ? 6.102   10.131  5.168   1.00 0.54  ? 43   SER A H    1  
ATOM   666   H HA   . SER A 1 43  ? 6.098   7.595   4.095   1.00 0.49  ? 43   SER A HA   1  
ATOM   667   H HB2  . SER A 1 43  ? 4.427   9.969   3.387   1.00 0.71  ? 43   SER A HB2  1  
ATOM   668   H HB3  . SER A 1 43  ? 4.067   8.320   2.911   1.00 0.91  ? 43   SER A HB3  1  
ATOM   669   H HG   . SER A 1 43  ? 3.367   9.530   5.129   1.00 1.24  ? 43   SER A HG   1  
ATOM   670   N N    . GLU A 1 44  ? 7.199   9.811   1.998   1.00 0.46  ? 44   GLU A N    1  
ATOM   671   C CA   . GLU A 1 44  ? 7.744   9.993   0.647   1.00 0.52  ? 44   GLU A CA   1  
ATOM   672   C C    . GLU A 1 44  ? 8.498   8.746   0.171   1.00 0.51  ? 44   GLU A C    1  
ATOM   673   O O    . GLU A 1 44  ? 8.386   8.356   -0.985  1.00 0.58  ? 44   GLU A O    1  
ATOM   674   C CB   . GLU A 1 44  ? 8.652   11.220  0.588   1.00 0.61  ? 44   GLU A CB   1  
ATOM   675   C CG   . GLU A 1 44  ? 9.303   11.422  -0.771  1.00 0.72  ? 44   GLU A CG   1  
ATOM   676   C CD   . GLU A 1 44  ? 10.217  12.627  -0.815  1.00 1.17  ? 44   GLU A CD   1  
ATOM   677   O OE1  . GLU A 1 44  ? 9.726   13.744  -1.083  1.00 1.29  ? 44   GLU A OE1  1  
ATOM   678   O OE2  . GLU A 1 44  ? 11.433  12.465  -0.588  1.00 1.91  ? 44   GLU A OE2  1  
ATOM   679   H H    . GLU A 1 44  ? 7.280   10.531  2.651   1.00 0.47  ? 44   GLU A H    1  
ATOM   680   H HA   . GLU A 1 44  ? 6.906   10.153  -0.015  1.00 0.54  ? 44   GLU A HA   1  
ATOM   681   H HB2  . GLU A 1 44  ? 8.059   12.094  0.810   1.00 0.63  ? 44   GLU A HB2  1  
ATOM   682   H HB3  . GLU A 1 44  ? 9.430   11.119  1.327   1.00 0.61  ? 44   GLU A HB3  1  
ATOM   683   H HG2  . GLU A 1 44  ? 9.882   10.542  -1.009  1.00 1.13  ? 44   GLU A HG2  1  
ATOM   684   H HG3  . GLU A 1 44  ? 8.526   11.551  -1.511  1.00 1.04  ? 44   GLU A HG3  1  
ATOM   685   N N    . ALA A 1 45  ? 9.232   8.110   1.072   1.00 0.48  ? 45   ALA A N    1  
ATOM   686   C CA   . ALA A 1 45  ? 9.893   6.850   0.758   1.00 0.48  ? 45   ALA A CA   1  
ATOM   687   C C    . ALA A 1 45  ? 8.964   5.658   0.980   1.00 0.41  ? 45   ALA A C    1  
ATOM   688   O O    . ALA A 1 45  ? 8.923   4.740   0.162   1.00 0.41  ? 45   ALA A O    1  
ATOM   689   C CB   . ALA A 1 45  ? 11.154  6.694   1.587   1.00 0.52  ? 45   ALA A CB   1  
ATOM   690   H H    . ALA A 1 45  ? 9.345   8.504   1.966   1.00 0.49  ? 45   ALA A H    1  
ATOM   691   H HA   . ALA A 1 45  ? 10.178  6.870   -0.286  1.00 0.52  ? 45   ALA A HA   1  
ATOM   692   H HB1  . ALA A 1 45  ? 10.893  6.645   2.634   1.00 1.14  ? 45   ALA A HB1  1  
ATOM   693   H HB2  . ALA A 1 45  ? 11.804  7.539   1.417   1.00 1.18  ? 45   ALA A HB2  1  
ATOM   694   H HB3  . ALA A 1 45  ? 11.661  5.785   1.301   1.00 1.13  ? 45   ALA A HB3  1  
ATOM   695   N N    . VAL A 1 46  ? 8.207   5.668   2.076   1.00 0.37  ? 46   VAL A N    1  
ATOM   696   C CA   . VAL A 1 46  ? 7.365   4.522   2.418   1.00 0.34  ? 46   VAL A CA   1  
ATOM   697   C C    . VAL A 1 46  ? 6.206   4.350   1.426   1.00 0.34  ? 46   VAL A C    1  
ATOM   698   O O    . VAL A 1 46  ? 5.914   3.235   1.020   1.00 0.39  ? 46   VAL A O    1  
ATOM   699   C CB   . VAL A 1 46  ? 6.835   4.564   3.883   1.00 0.49  ? 46   VAL A CB   1  
ATOM   700   C CG1  . VAL A 1 46  ? 7.407   5.722   4.667   1.00 1.41  ? 46   VAL A CG1  1  
ATOM   701   C CG2  . VAL A 1 46  ? 5.330   4.628   3.939   1.00 1.13  ? 46   VAL A CG2  1  
ATOM   702   H H    . VAL A 1 46  ? 8.214   6.454   2.660   1.00 0.38  ? 46   VAL A H    1  
ATOM   703   H HA   . VAL A 1 46  ? 7.992   3.646   2.333   1.00 0.36  ? 46   VAL A HA   1  
ATOM   704   H HB   . VAL A 1 46  ? 7.144   3.652   4.373   1.00 1.47  ? 46   VAL A HB   1  
ATOM   705   H HG11 . VAL A 1 46  ? 8.479   5.621   4.739   1.00 2.01  ? 46   VAL A HG11 1  
ATOM   706   H HG12 . VAL A 1 46  ? 6.970   5.723   5.657   1.00 1.93  ? 46   VAL A HG12 1  
ATOM   707   H HG13 . VAL A 1 46  ? 7.159   6.646   4.167   1.00 2.01  ? 46   VAL A HG13 1  
ATOM   708   H HG21 . VAL A 1 46  ? 5.002   4.490   4.958   1.00 1.65  ? 46   VAL A HG21 1  
ATOM   709   H HG22 . VAL A 1 46  ? 4.911   3.852   3.314   1.00 1.69  ? 46   VAL A HG22 1  
ATOM   710   H HG23 . VAL A 1 46  ? 4.998   5.601   3.584   1.00 1.88  ? 46   VAL A HG23 1  
ATOM   711   N N    . LYS A 1 47  ? 5.563   5.448   1.023   1.00 0.34  ? 47   LYS A N    1  
ATOM   712   C CA   . LYS A 1 47  ? 4.476   5.381   0.050   1.00 0.36  ? 47   LYS A CA   1  
ATOM   713   C C    . LYS A 1 47  ? 5.041   4.985   -1.301  1.00 0.39  ? 47   LYS A C    1  
ATOM   714   O O    . LYS A 1 47  ? 4.416   4.248   -2.058  1.00 0.43  ? 47   LYS A O    1  
ATOM   715   C CB   . LYS A 1 47  ? 3.726   6.720   -0.057  1.00 0.38  ? 47   LYS A CB   1  
ATOM   716   C CG   . LYS A 1 47  ? 4.608   7.881   -0.486  1.00 0.49  ? 47   LYS A CG   1  
ATOM   717   C CD   . LYS A 1 47  ? 3.841   9.179   -0.655  1.00 0.47  ? 47   LYS A CD   1  
ATOM   718   C CE   . LYS A 1 47  ? 3.048   9.524   0.588   1.00 0.47  ? 47   LYS A CE   1  
ATOM   719   N NZ   . LYS A 1 47  ? 2.513   10.913  0.549   1.00 0.67  ? 47   LYS A NZ   1  
ATOM   720   H H    . LYS A 1 47  ? 5.836   6.322   1.379   1.00 0.36  ? 47   LYS A H    1  
ATOM   721   H HA   . LYS A 1 47  ? 3.788   4.616   0.375   1.00 0.36  ? 47   LYS A HA   1  
ATOM   722   H HB2  . LYS A 1 47  ? 2.928   6.615   -0.778  1.00 0.47  ? 47   LYS A HB2  1  
ATOM   723   H HB3  . LYS A 1 47  ? 3.300   6.957   0.906   1.00 0.38  ? 47   LYS A HB3  1  
ATOM   724   H HG2  . LYS A 1 47  ? 5.368   8.031   0.263   1.00 0.64  ? 47   LYS A HG2  1  
ATOM   725   H HG3  . LYS A 1 47  ? 5.075   7.629   -1.417  1.00 0.78  ? 47   LYS A HG3  1  
ATOM   726   H HD2  . LYS A 1 47  ? 4.549   9.970   -0.844  1.00 0.84  ? 47   LYS A HD2  1  
ATOM   727   H HD3  . LYS A 1 47  ? 3.164   9.086   -1.494  1.00 0.74  ? 47   LYS A HD3  1  
ATOM   728   H HE2  . LYS A 1 47  ? 2.222   8.834   0.672   1.00 0.52  ? 47   LYS A HE2  1  
ATOM   729   H HE3  . LYS A 1 47  ? 3.692   9.415   1.446   1.00 0.75  ? 47   LYS A HE3  1  
ATOM   730   H HZ1  . LYS A 1 47  ? 1.769   10.993  -0.182  1.00 1.13  ? 47   LYS A HZ1  1  
ATOM   731   H HZ2  . LYS A 1 47  ? 3.272   11.587  0.322   1.00 1.14  ? 47   LYS A HZ2  1  
ATOM   732   H HZ3  . LYS A 1 47  ? 2.109   11.171  1.475   1.00 1.38  ? 47   LYS A HZ3  1  
ATOM   733   N N    . GLN A 1 48  ? 6.241   5.478   -1.588  1.00 0.40  ? 48   GLN A N    1  
ATOM   734   C CA   . GLN A 1 48  ? 6.961   5.082   -2.790  1.00 0.46  ? 48   GLN A CA   1  
ATOM   735   C C    . GLN A 1 48  ? 7.251   3.587   -2.797  1.00 0.45  ? 48   GLN A C    1  
ATOM   736   O O    . GLN A 1 48  ? 7.227   2.959   -3.847  1.00 0.50  ? 48   GLN A O    1  
ATOM   737   C CB   . GLN A 1 48  ? 8.269   5.855   -2.940  1.00 0.52  ? 48   GLN A CB   1  
ATOM   738   C CG   . GLN A 1 48  ? 8.132   7.143   -3.728  1.00 0.58  ? 48   GLN A CG   1  
ATOM   739   C CD   . GLN A 1 48  ? 7.447   6.971   -5.075  1.00 0.67  ? 48   GLN A CD   1  
ATOM   740   O OE1  . GLN A 1 48  ? 6.790   7.886   -5.563  1.00 0.99  ? 48   GLN A OE1  1  
ATOM   741   N NE2  . GLN A 1 48  ? 7.584   5.802   -5.686  1.00 0.63  ? 48   GLN A NE2  1  
ATOM   742   H H    . GLN A 1 48  ? 6.638   6.143   -0.980  1.00 0.39  ? 48   GLN A H    1  
ATOM   743   H HA   . GLN A 1 48  ? 6.328   5.311   -3.635  1.00 0.48  ? 48   GLN A HA   1  
ATOM   744   H HB2  . GLN A 1 48  ? 8.634   6.104   -1.955  1.00 0.49  ? 48   GLN A HB2  1  
ATOM   745   H HB3  . GLN A 1 48  ? 8.996   5.229   -3.431  1.00 0.58  ? 48   GLN A HB3  1  
ATOM   746   H HG2  . GLN A 1 48  ? 7.564   7.848   -3.143  1.00 0.58  ? 48   GLN A HG2  1  
ATOM   747   H HG3  . GLN A 1 48  ? 9.123   7.538   -3.899  1.00 0.65  ? 48   GLN A HG3  1  
ATOM   748   H HE21 . GLN A 1 48  ? 8.108   5.099   -5.243  1.00 0.74  ? 48   GLN A HE21 1  
ATOM   749   H HE22 . GLN A 1 48  ? 7.169   5.690   -6.573  1.00 0.66  ? 48   GLN A HE22 1  
ATOM   750   N N    . ALA A 1 49  ? 7.543   3.026   -1.632  1.00 0.42  ? 49   ALA A N    1  
ATOM   751   C CA   . ALA A 1 49  ? 7.738   1.587   -1.509  1.00 0.41  ? 49   ALA A CA   1  
ATOM   752   C C    . ALA A 1 49  ? 6.394   0.869   -1.549  1.00 0.39  ? 49   ALA A C    1  
ATOM   753   O O    . ALA A 1 49  ? 6.237   -0.176  -2.184  1.00 0.42  ? 49   ALA A O    1  
ATOM   754   C CB   . ALA A 1 49  ? 8.481   1.261   -0.224  1.00 0.42  ? 49   ALA A CB   1  
ATOM   755   H H    . ALA A 1 49  ? 7.641   3.594   -0.837  1.00 0.42  ? 49   ALA A H    1  
ATOM   756   H HA   . ALA A 1 49  ? 8.343   1.259   -2.338  1.00 0.45  ? 49   ALA A HA   1  
ATOM   757   H HB1  . ALA A 1 49  ? 9.396   1.831   -0.183  1.00 1.14  ? 49   ALA A HB1  1  
ATOM   758   H HB2  . ALA A 1 49  ? 8.716   0.204   -0.199  1.00 1.06  ? 49   ALA A HB2  1  
ATOM   759   H HB3  . ALA A 1 49  ? 7.860   1.512   0.624   1.00 1.08  ? 49   ALA A HB3  1  
ATOM   760   N N    . LEU A 1 50  ? 5.424   1.470   -0.874  1.00 0.38  ? 50   LEU A N    1  
ATOM   761   C CA   . LEU A 1 50  ? 4.069   0.944   -0.762  1.00 0.40  ? 50   LEU A CA   1  
ATOM   762   C C    . LEU A 1 50  ? 3.426   0.718   -2.127  1.00 0.41  ? 50   LEU A C    1  
ATOM   763   O O    . LEU A 1 50  ? 2.784   -0.303  -2.343  1.00 0.43  ? 50   LEU A O    1  
ATOM   764   C CB   . LEU A 1 50  ? 3.212   1.917   0.065   1.00 0.45  ? 50   LEU A CB   1  
ATOM   765   C CG   . LEU A 1 50  ? 3.025   1.588   1.549   1.00 0.69  ? 50   LEU A CG   1  
ATOM   766   C CD1  . LEU A 1 50  ? 1.637   1.045   1.827   1.00 1.33  ? 50   LEU A CD1  1  
ATOM   767   C CD2  . LEU A 1 50  ? 4.066   0.598   1.999   1.00 1.20  ? 50   LEU A CD2  1  
ATOM   768   H H    . LEU A 1 50  ? 5.635   2.311   -0.411  1.00 0.39  ? 50   LEU A H    1  
ATOM   769   H HA   . LEU A 1 50  ? 4.121   0.000   -0.243  1.00 0.43  ? 50   LEU A HA   1  
ATOM   770   H HB2  . LEU A 1 50  ? 3.688   2.879   0.015   1.00 0.74  ? 50   LEU A HB2  1  
ATOM   771   H HB3  . LEU A 1 50  ? 2.236   1.989   -0.394  1.00 0.48  ? 50   LEU A HB3  1  
ATOM   772   H HG   . LEU A 1 50  ? 3.151   2.491   2.129   1.00 1.64  ? 50   LEU A HG   1  
ATOM   773   H HD11 . LEU A 1 50  ? 1.555   0.787   2.872   1.00 1.95  ? 50   LEU A HD11 1  
ATOM   774   H HD12 . LEU A 1 50  ? 1.466   0.165   1.223   1.00 1.77  ? 50   LEU A HD12 1  
ATOM   775   H HD13 . LEU A 1 50  ? 0.901   1.798   1.584   1.00 1.93  ? 50   LEU A HD13 1  
ATOM   776   H HD21 . LEU A 1 50  ? 5.040   0.977   1.728   1.00 1.81  ? 50   LEU A HD21 1  
ATOM   777   H HD22 . LEU A 1 50  ? 3.892   -0.350  1.509   1.00 1.85  ? 50   LEU A HD22 1  
ATOM   778   H HD23 . LEU A 1 50  ? 4.008   0.472   3.068   1.00 1.62  ? 50   LEU A HD23 1  
ATOM   779   N N    . ARG A 1 51  ? 3.633   1.638   -3.064  1.00 0.44  ? 51   ARG A N    1  
ATOM   780   C CA   . ARG A 1 51  ? 2.878   1.612   -4.313  1.00 0.50  ? 51   ARG A CA   1  
ATOM   781   C C    . ARG A 1 51  ? 3.410   0.513   -5.205  1.00 0.52  ? 51   ARG A C    1  
ATOM   782   O O    . ARG A 1 51  ? 2.683   -0.093  -5.989  1.00 0.59  ? 51   ARG A O    1  
ATOM   783   C CB   . ARG A 1 51  ? 2.971   2.962   -5.022  1.00 0.53  ? 51   ARG A CB   1  
ATOM   784   C CG   . ARG A 1 51  ? 4.376   3.529   -5.032  1.00 0.52  ? 51   ARG A CG   1  
ATOM   785   C CD   . ARG A 1 51  ? 4.508   4.714   -5.961  1.00 0.73  ? 51   ARG A CD   1  
ATOM   786   N NE   . ARG A 1 51  ? 3.566   5.791   -5.655  1.00 1.21  ? 51   ARG A NE   1  
ATOM   787   C CZ   . ARG A 1 51  ? 3.508   6.939   -6.333  1.00 1.63  ? 51   ARG A CZ   1  
ATOM   788   N NH1  . ARG A 1 51  ? 4.308   7.139   -7.378  1.00 1.96  ? 51   ARG A NH1  1  
ATOM   789   N NH2  . ARG A 1 51  ? 2.651   7.883   -5.964  1.00 2.17  ? 51   ARG A NH2  1  
ATOM   790   H H    . ARG A 1 51  ? 4.354   2.304   -2.949  1.00 0.43  ? 51   ARG A H    1  
ATOM   791   H HA   . ARG A 1 51  ? 1.846   1.404   -4.075  1.00 0.55  ? 51   ARG A HA   1  
ATOM   792   H HB2  . ARG A 1 51  ? 2.643   2.843   -6.044  1.00 0.59  ? 51   ARG A HB2  1  
ATOM   793   H HB3  . ARG A 1 51  ? 2.321   3.665   -4.522  1.00 0.58  ? 51   ARG A HB3  1  
ATOM   794   H HG2  . ARG A 1 51  ? 4.630   3.843   -4.030  1.00 0.67  ? 51   ARG A HG2  1  
ATOM   795   H HG3  . ARG A 1 51  ? 5.061   2.755   -5.349  1.00 0.66  ? 51   ARG A HG3  1  
ATOM   796   H HD2  . ARG A 1 51  ? 5.510   5.101   -5.875  1.00 0.90  ? 51   ARG A HD2  1  
ATOM   797   H HD3  . ARG A 1 51  ? 4.347   4.372   -6.967  1.00 1.12  ? 51   ARG A HD3  1  
ATOM   798   H HE   . ARG A 1 51  ? 2.956   5.659   -4.893  1.00 1.60  ? 51   ARG A HE   1  
ATOM   799   H HH11 . ARG A 1 51  ? 4.955   6.426   -7.662  1.00 1.99  ? 51   ARG A HH11 1  
ATOM   800   H HH12 . ARG A 1 51  ? 4.279   8.013   -7.881  1.00 2.46  ? 51   ARG A HH12 1  
ATOM   801   H HH21 . ARG A 1 51  ? 2.041   7.736   -5.165  1.00 2.45  ? 51   ARG A HH21 1  
ATOM   802   H HH22 . ARG A 1 51  ? 2.599   8.753   -6.475  1.00 2.51  ? 51   ARG A HH22 1  
ATOM   803   N N    . GLU A 1 52  ? 4.688   0.255   -5.041  1.00 0.49  ? 52   GLU A N    1  
ATOM   804   C CA   . GLU A 1 52  ? 5.381   -0.768  -5.786  1.00 0.54  ? 52   GLU A CA   1  
ATOM   805   C C    . GLU A 1 52  ? 4.957   -2.141  -5.294  1.00 0.53  ? 52   GLU A C    1  
ATOM   806   O O    . GLU A 1 52  ? 4.609   -3.021  -6.080  1.00 0.58  ? 52   GLU A O    1  
ATOM   807   C CB   . GLU A 1 52  ? 6.871   -0.559  -5.588  1.00 0.59  ? 52   GLU A CB   1  
ATOM   808   C CG   . GLU A 1 52  ? 7.277   0.885   -5.820  1.00 0.63  ? 52   GLU A CG   1  
ATOM   809   C CD   . GLU A 1 52  ? 7.207   1.275   -7.281  1.00 0.87  ? 52   GLU A CD   1  
ATOM   810   O OE1  . GLU A 1 52  ? 7.814   0.576   -8.117  1.00 1.10  ? 52   GLU A OE1  1  
ATOM   811   O OE2  . GLU A 1 52  ? 6.541   2.282   -7.599  1.00 1.07  ? 52   GLU A OE2  1  
ATOM   812   H H    . GLU A 1 52  ? 5.190   0.781   -4.387  1.00 0.46  ? 52   GLU A H    1  
ATOM   813   H HA   . GLU A 1 52  ? 5.135   -0.664  -6.830  1.00 0.59  ? 52   GLU A HA   1  
ATOM   814   H HB2  . GLU A 1 52  ? 7.137   -0.835  -4.578  1.00 0.56  ? 52   GLU A HB2  1  
ATOM   815   H HB3  . GLU A 1 52  ? 7.412   -1.181  -6.284  1.00 0.67  ? 52   GLU A HB3  1  
ATOM   816   H HG2  . GLU A 1 52  ? 6.607   1.531   -5.263  1.00 0.66  ? 52   GLU A HG2  1  
ATOM   817   H HG3  . GLU A 1 52  ? 8.272   1.035   -5.456  1.00 0.69  ? 52   GLU A HG3  1  
ATOM   818   N N    . ALA A 1 53  ? 4.972   -2.307  -3.979  1.00 0.49  ? 53   ALA A N    1  
ATOM   819   C CA   . ALA A 1 53  ? 4.518   -3.539  -3.362  1.00 0.48  ? 53   ALA A CA   1  
ATOM   820   C C    . ALA A 1 53  ? 3.023   -3.730  -3.596  1.00 0.49  ? 53   ALA A C    1  
ATOM   821   O O    . ALA A 1 53  ? 2.553   -4.849  -3.807  1.00 0.53  ? 53   ALA A O    1  
ATOM   822   C CB   . ALA A 1 53  ? 4.837   -3.525  -1.878  1.00 0.45  ? 53   ALA A CB   1  
ATOM   823   H H    . ALA A 1 53  ? 5.304   -1.578  -3.408  1.00 0.48  ? 53   ALA A H    1  
ATOM   824   H HA   . ALA A 1 53  ? 5.053   -4.360  -3.817  1.00 0.51  ? 53   ALA A HA   1  
ATOM   825   H HB1  . ALA A 1 53  ? 4.506   -4.450  -1.430  1.00 1.04  ? 53   ALA A HB1  1  
ATOM   826   H HB2  . ALA A 1 53  ? 4.332   -2.694  -1.407  1.00 1.03  ? 53   ALA A HB2  1  
ATOM   827   H HB3  . ALA A 1 53  ? 5.904   -3.422  -1.740  1.00 1.01  ? 53   ALA A HB3  1  
ATOM   828   N N    . GLY A 1 54  ? 2.284   -2.625  -3.564  1.00 0.49  ? 54   GLY A N    1  
ATOM   829   C CA   . GLY A 1 54  ? 0.861   -2.664  -3.837  1.00 0.53  ? 54   GLY A CA   1  
ATOM   830   C C    . GLY A 1 54  ? 0.572   -3.147  -5.240  1.00 0.60  ? 54   GLY A C    1  
ATOM   831   O O    . GLY A 1 54  ? -0.335  -3.951  -5.447  1.00 0.70  ? 54   GLY A O    1  
ATOM   832   H H    . GLY A 1 54  ? 2.712   -1.767  -3.343  1.00 0.49  ? 54   GLY A H    1  
ATOM   833   H HA2  . GLY A 1 54  ? 0.388   -3.332  -3.131  1.00 0.53  ? 54   GLY A HA2  1  
ATOM   834   H HA3  . GLY A 1 54  ? 0.450   -1.674  -3.715  1.00 0.56  ? 54   GLY A HA3  1  
ATOM   835   N N    . ASP A 1 55  ? 1.357   -2.662  -6.198  1.00 0.61  ? 55   ASP A N    1  
ATOM   836   C CA   . ASP A 1 55  ? 1.256   -3.105  -7.588  1.00 0.69  ? 55   ASP A CA   1  
ATOM   837   C C    . ASP A 1 55  ? 1.482   -4.607  -7.687  1.00 0.70  ? 55   ASP A C    1  
ATOM   838   O O    . ASP A 1 55  ? 0.760   -5.312  -8.393  1.00 0.79  ? 55   ASP A O    1  
ATOM   839   C CB   . ASP A 1 55  ? 2.283   -2.375  -8.452  1.00 0.73  ? 55   ASP A CB   1  
ATOM   840   C CG   . ASP A 1 55  ? 2.298   -2.871  -9.884  1.00 0.85  ? 55   ASP A CG   1  
ATOM   841   O OD1  . ASP A 1 55  ? 1.383   -2.512  -10.653 1.00 1.04  ? 55   ASP A OD1  1  
ATOM   842   O OD2  . ASP A 1 55  ? 3.233   -3.620  -10.250 1.00 0.82  ? 55   ASP A OD2  1  
ATOM   843   H H    . ASP A 1 55  ? 2.022   -1.977  -5.965  1.00 0.59  ? 55   ASP A H    1  
ATOM   844   H HA   . ASP A 1 55  ? 0.263   -2.874  -7.944  1.00 0.77  ? 55   ASP A HA   1  
ATOM   845   H HB2  . ASP A 1 55  ? 2.054   -1.321  -8.459  1.00 0.77  ? 55   ASP A HB2  1  
ATOM   846   H HB3  . ASP A 1 55  ? 3.266   -2.522  -8.031  1.00 0.69  ? 55   ASP A HB3  1  
ATOM   847   N N    . GLU A 1 56  ? 2.484   -5.083  -6.952  1.00 0.66  ? 56   GLU A N    1  
ATOM   848   C CA   . GLU A 1 56  ? 2.800   -6.507  -6.880  1.00 0.74  ? 56   GLU A CA   1  
ATOM   849   C C    . GLU A 1 56  ? 1.601   -7.315  -6.397  1.00 0.77  ? 56   GLU A C    1  
ATOM   850   O O    . GLU A 1 56  ? 1.467   -8.497  -6.698  1.00 0.88  ? 56   GLU A O    1  
ATOM   851   C CB   . GLU A 1 56  ? 3.985   -6.743  -5.944  1.00 0.79  ? 56   GLU A CB   1  
ATOM   852   C CG   . GLU A 1 56  ? 5.294   -6.160  -6.444  1.00 1.24  ? 56   GLU A CG   1  
ATOM   853   C CD   . GLU A 1 56  ? 5.853   -6.906  -7.636  1.00 1.52  ? 56   GLU A CD   1  
ATOM   854   O OE1  . GLU A 1 56  ? 6.062   -8.135  -7.531  1.00 1.43  ? 56   GLU A OE1  1  
ATOM   855   O OE2  . GLU A 1 56  ? 6.078   -6.267  -8.683  1.00 2.29  ? 56   GLU A OE2  1  
ATOM   856   H H    . GLU A 1 56  ? 3.035   -4.449  -6.445  1.00 0.63  ? 56   GLU A H    1  
ATOM   857   H HA   . GLU A 1 56  ? 3.062   -6.837  -7.869  1.00 0.78  ? 56   GLU A HA   1  
ATOM   858   H HB2  . GLU A 1 56  ? 3.762   -6.297  -4.985  1.00 0.99  ? 56   GLU A HB2  1  
ATOM   859   H HB3  . GLU A 1 56  ? 4.116   -7.807  -5.812  1.00 1.14  ? 56   GLU A HB3  1  
ATOM   860   H HG2  . GLU A 1 56  ? 5.122   -5.135  -6.736  1.00 1.86  ? 56   GLU A HG2  1  
ATOM   861   H HG3  . GLU A 1 56  ? 6.019   -6.191  -5.644  1.00 1.73  ? 56   GLU A HG3  1  
ATOM   862   N N    . PHE A 1 57  ? 0.755   -6.686  -5.612  1.00 0.71  ? 57   PHE A N    1  
ATOM   863   C CA   . PHE A 1 57  ? -0.440  -7.344  -5.118  1.00 0.75  ? 57   PHE A CA   1  
ATOM   864   C C    . PHE A 1 57  ? -1.558  -7.303  -6.160  1.00 0.78  ? 57   PHE A C    1  
ATOM   865   O O    . PHE A 1 57  ? -2.263  -8.294  -6.360  1.00 0.91  ? 57   PHE A O    1  
ATOM   866   C CB   . PHE A 1 57  ? -0.906  -6.706  -3.809  1.00 0.76  ? 57   PHE A CB   1  
ATOM   867   C CG   . PHE A 1 57  ? -1.994  -7.486  -3.123  1.00 1.09  ? 57   PHE A CG   1  
ATOM   868   C CD1  . PHE A 1 57  ? -1.860  -8.846  -2.905  1.00 1.37  ? 57   PHE A CD1  1  
ATOM   869   C CD2  . PHE A 1 57  ? -3.154  -6.856  -2.698  1.00 1.71  ? 57   PHE A CD2  1  
ATOM   870   C CE1  . PHE A 1 57  ? -2.859  -9.565  -2.275  1.00 1.79  ? 57   PHE A CE1  1  
ATOM   871   C CE2  . PHE A 1 57  ? -4.157  -7.569  -2.068  1.00 2.29  ? 57   PHE A CE2  1  
ATOM   872   C CZ   . PHE A 1 57  ? -4.000  -8.934  -1.853  1.00 2.20  ? 57   PHE A CZ   1  
ATOM   873   H H    . PHE A 1 57  ? 0.935   -5.756  -5.367  1.00 0.67  ? 57   PHE A H    1  
ATOM   874   H HA   . PHE A 1 57  ? -0.187  -8.376  -4.929  1.00 0.80  ? 57   PHE A HA   1  
ATOM   875   H HB2  . PHE A 1 57  ? -0.070  -6.632  -3.136  1.00 0.99  ? 57   PHE A HB2  1  
ATOM   876   H HB3  . PHE A 1 57  ? -1.283  -5.714  -4.012  1.00 0.73  ? 57   PHE A HB3  1  
ATOM   877   H HD1  . PHE A 1 57  ? -0.962  -9.348  -3.232  1.00 1.61  ? 57   PHE A HD1  1  
ATOM   878   H HD2  . PHE A 1 57  ? -3.272  -5.795  -2.862  1.00 1.95  ? 57   PHE A HD2  1  
ATOM   879   H HE1  . PHE A 1 57  ? -2.741  -10.626 -2.111  1.00 2.07  ? 57   PHE A HE1  1  
ATOM   880   H HE2  . PHE A 1 57  ? -5.055  -7.066  -1.741  1.00 2.93  ? 57   PHE A HE2  1  
ATOM   881   H HZ   . PHE A 1 57  ? -4.780  -9.495  -1.359  1.00 2.67  ? 57   PHE A HZ   1  
ATOM   882   N N    . GLU A 1 58  ? -1.675  -6.170  -6.851  1.00 0.73  ? 58   GLU A N    1  
ATOM   883   C CA   . GLU A 1 58  ? -2.833  -5.893  -7.703  1.00 0.82  ? 58   GLU A CA   1  
ATOM   884   C C    . GLU A 1 58  ? -2.985  -6.912  -8.810  1.00 0.82  ? 58   GLU A C    1  
ATOM   885   O O    . GLU A 1 58  ? -3.976  -7.638  -8.857  1.00 0.89  ? 58   GLU A O    1  
ATOM   886   C CB   . GLU A 1 58  ? -2.737  -4.506  -8.320  1.00 0.86  ? 58   GLU A CB   1  
ATOM   887   C CG   . GLU A 1 58  ? -2.684  -3.396  -7.301  1.00 0.91  ? 58   GLU A CG   1  
ATOM   888   C CD   . GLU A 1 58  ? -2.790  -2.034  -7.940  1.00 0.93  ? 58   GLU A CD   1  
ATOM   889   O OE1  . GLU A 1 58  ? -3.918  -1.544  -8.141  1.00 1.30  ? 58   GLU A OE1  1  
ATOM   890   O OE2  . GLU A 1 58  ? -1.738  -1.430  -8.237  1.00 1.24  ? 58   GLU A OE2  1  
ATOM   891   H H    . GLU A 1 58  ? -0.950  -5.508  -6.803  1.00 0.69  ? 58   GLU A H    1  
ATOM   892   H HA   . GLU A 1 58  ? -3.713  -5.932  -7.078  1.00 0.95  ? 58   GLU A HA   1  
ATOM   893   H HB2  . GLU A 1 58  ? -1.844  -4.454  -8.926  1.00 0.80  ? 58   GLU A HB2  1  
ATOM   894   H HB3  . GLU A 1 58  ? -3.599  -4.346  -8.951  1.00 0.98  ? 58   GLU A HB3  1  
ATOM   895   H HG2  . GLU A 1 58  ? -3.502  -3.520  -6.607  1.00 1.09  ? 58   GLU A HG2  1  
ATOM   896   H HG3  . GLU A 1 58  ? -1.743  -3.466  -6.769  1.00 1.00  ? 58   GLU A HG3  1  
ATOM   897   N N    . LEU A 1 59  ? -2.001  -6.954  -9.696  1.00 0.81  ? 59   LEU A N    1  
ATOM   898   C CA   . LEU A 1 59  ? -2.024  -7.860  -10.837 1.00 0.87  ? 59   LEU A CA   1  
ATOM   899   C C    . LEU A 1 59  ? -2.347  -9.294  -10.432 1.00 0.85  ? 59   LEU A C    1  
ATOM   900   O O    . LEU A 1 59  ? -3.055  -10.005 -11.142 1.00 0.96  ? 59   LEU A O    1  
ATOM   901   C CB   . LEU A 1 59  ? -0.693  -7.824  -11.596 1.00 0.96  ? 59   LEU A CB   1  
ATOM   902   C CG   . LEU A 1 59  ? 0.582   -7.508  -10.796 1.00 1.06  ? 59   LEU A CG   1  
ATOM   903   C CD1  . LEU A 1 59  ? 0.676   -8.309  -9.524  1.00 1.54  ? 59   LEU A CD1  1  
ATOM   904   C CD2  . LEU A 1 59  ? 1.784   -7.835  -11.629 1.00 1.46  ? 59   LEU A CD2  1  
ATOM   905   H H    . LEU A 1 59  ? -1.233  -6.350  -9.582  1.00 0.83  ? 59   LEU A H    1  
ATOM   906   H HA   . LEU A 1 59  ? -2.802  -7.517  -11.502 1.00 0.94  ? 59   LEU A HA   1  
ATOM   907   H HB2  . LEU A 1 59  ? -0.552  -8.790  -12.053 1.00 1.04  ? 59   LEU A HB2  1  
ATOM   908   H HB3  . LEU A 1 59  ? -0.782  -7.088  -12.377 1.00 1.06  ? 59   LEU A HB3  1  
ATOM   909   H HG   . LEU A 1 59  ? 0.613   -6.460  -10.549 1.00 1.87  ? 59   LEU A HG   1  
ATOM   910   H HD11 . LEU A 1 59  ? -0.139  -8.040  -8.870  1.00 2.19  ? 59   LEU A HD11 1  
ATOM   911   H HD12 . LEU A 1 59  ? 1.618   -8.100  -9.034  1.00 1.96  ? 59   LEU A HD12 1  
ATOM   912   H HD13 . LEU A 1 59  ? 0.614   -9.359  -9.762  1.00 2.00  ? 59   LEU A HD13 1  
ATOM   913   H HD21 . LEU A 1 59  ? 2.675   -7.574  -11.080 1.00 1.91  ? 59   LEU A HD21 1  
ATOM   914   H HD22 . LEU A 1 59  ? 1.745   -7.283  -12.554 1.00 1.97  ? 59   LEU A HD22 1  
ATOM   915   H HD23 . LEU A 1 59  ? 1.780   -8.897  -11.830 1.00 2.00  ? 59   LEU A HD23 1  
ATOM   916   N N    . ARG A 1 60  ? -1.833  -9.706  -9.286  1.00 0.83  ? 60   ARG A N    1  
ATOM   917   C CA   . ARG A 1 60  ? -2.017  -11.062 -8.812  1.00 0.90  ? 60   ARG A CA   1  
ATOM   918   C C    . ARG A 1 60  ? -3.493  -11.372 -8.538  1.00 0.98  ? 60   ARG A C    1  
ATOM   919   O O    . ARG A 1 60  ? -3.986  -12.431 -8.923  1.00 1.15  ? 60   ARG A O    1  
ATOM   920   C CB   . ARG A 1 60  ? -1.173  -11.316 -7.559  1.00 1.03  ? 60   ARG A CB   1  
ATOM   921   C CG   . ARG A 1 60  ? 0.316   -11.440 -7.851  1.00 1.00  ? 60   ARG A CG   1  
ATOM   922   C CD   . ARG A 1 60  ? 1.135   -11.590 -6.579  1.00 1.07  ? 60   ARG A CD   1  
ATOM   923   N NE   . ARG A 1 60  ? 2.549   -11.834 -6.868  1.00 1.41  ? 60   ARG A NE   1  
ATOM   924   C CZ   . ARG A 1 60  ? 3.557   -11.152 -6.323  1.00 1.94  ? 60   ARG A CZ   1  
ATOM   925   N NH1  . ARG A 1 60  ? 3.321   -10.156 -5.482  1.00 2.43  ? 60   ARG A NH1  1  
ATOM   926   N NH2  . ARG A 1 60  ? 4.810   -11.456 -6.635  1.00 2.58  ? 60   ARG A NH2  1  
ATOM   927   H H    . ARG A 1 60  ? -1.291  -9.081  -8.759  1.00 0.86  ? 60   ARG A H    1  
ATOM   928   H HA   . ARG A 1 60  ? -1.662  -11.712 -9.600  1.00 0.94  ? 60   ARG A HA   1  
ATOM   929   H HB2  . ARG A 1 60  ? -1.317  -10.498 -6.868  1.00 1.31  ? 60   ARG A HB2  1  
ATOM   930   H HB3  . ARG A 1 60  ? -1.505  -12.233 -7.094  1.00 1.36  ? 60   ARG A HB3  1  
ATOM   931   H HG2  . ARG A 1 60  ? 0.477   -12.307 -8.473  1.00 1.39  ? 60   ARG A HG2  1  
ATOM   932   H HG3  . ARG A 1 60  ? 0.643   -10.554 -8.377  1.00 1.32  ? 60   ARG A HG3  1  
ATOM   933   H HD2  . ARG A 1 60  ? 1.046   -10.684 -5.998  1.00 1.41  ? 60   ARG A HD2  1  
ATOM   934   H HD3  . ARG A 1 60  ? 0.745   -12.421 -6.010  1.00 1.40  ? 60   ARG A HD3  1  
ATOM   935   H HE   . ARG A 1 60  ? 2.759   -12.556 -7.508  1.00 1.85  ? 60   ARG A HE   1  
ATOM   936   H HH11 . ARG A 1 60  ? 2.379   -9.903  -5.251  1.00 2.42  ? 60   ARG A HH11 1  
ATOM   937   H HH12 . ARG A 1 60  ? 4.089   -9.643  -5.082  1.00 3.14  ? 60   ARG A HH12 1  
ATOM   938   H HH21 . ARG A 1 60  ? 5.005   -12.199 -7.280  1.00 2.82  ? 60   ARG A HH21 1  
ATOM   939   H HH22 . ARG A 1 60  ? 5.571   -10.938 -6.227  1.00 3.11  ? 60   ARG A HH22 1  
ATOM   940   N N    . TYR A 1 61  ? -4.205  -10.453 -7.882  1.00 1.04  ? 61   TYR A N    1  
ATOM   941   C CA   . TYR A 1 61  ? -5.616  -10.685 -7.570  1.00 1.26  ? 61   TYR A CA   1  
ATOM   942   C C    . TYR A 1 61  ? -6.528  -10.158 -8.676  1.00 1.32  ? 61   TYR A C    1  
ATOM   943   O O    . TYR A 1 61  ? -7.734  -10.398 -8.656  1.00 1.59  ? 61   TYR A O    1  
ATOM   944   C CB   . TYR A 1 61  ? -6.017  -10.066 -6.215  1.00 1.52  ? 61   TYR A CB   1  
ATOM   945   C CG   . TYR A 1 61  ? -5.988  -8.545  -6.146  1.00 2.19  ? 61   TYR A CG   1  
ATOM   946   C CD1  . TYR A 1 61  ? -6.904  -7.789  -6.859  1.00 2.84  ? 61   TYR A CD1  1  
ATOM   947   C CD2  . TYR A 1 61  ? -5.035  -7.867  -5.391  1.00 2.70  ? 61   TYR A CD2  1  
ATOM   948   C CE1  . TYR A 1 61  ? -6.877  -6.408  -6.820  1.00 3.86  ? 61   TYR A CE1  1  
ATOM   949   C CE2  . TYR A 1 61  ? -5.007  -6.485  -5.344  1.00 3.67  ? 61   TYR A CE2  1  
ATOM   950   C CZ   . TYR A 1 61  ? -5.936  -5.765  -5.977  1.00 4.23  ? 61   TYR A CZ   1  
ATOM   951   O OH   . TYR A 1 61  ? -5.909  -4.386  -6.024  1.00 5.32  ? 61   TYR A OH   1  
ATOM   952   H H    . TYR A 1 61  ? -3.779  -9.609  -7.613  1.00 1.06  ? 61   TYR A H    1  
ATOM   953   H HA   . TYR A 1 61  ? -5.753  -11.755 -7.508  1.00 1.33  ? 61   TYR A HA   1  
ATOM   954   H HB2  . TYR A 1 61  ? -7.022  -10.378 -5.976  1.00 1.78  ? 61   TYR A HB2  1  
ATOM   955   H HB3  . TYR A 1 61  ? -5.349  -10.441 -5.453  1.00 1.83  ? 61   TYR A HB3  1  
ATOM   956   H HD1  . TYR A 1 61  ? -7.651  -8.294  -7.452  1.00 2.77  ? 61   TYR A HD1  1  
ATOM   957   H HD2  . TYR A 1 61  ? -4.311  -8.437  -4.826  1.00 2.59  ? 61   TYR A HD2  1  
ATOM   958   H HE1  . TYR A 1 61  ? -7.603  -5.841  -7.384  1.00 4.50  ? 61   TYR A HE1  1  
ATOM   959   H HE2  . TYR A 1 61  ? -4.261  -5.980  -4.748  1.00 4.15  ? 61   TYR A HE2  1  
ATOM   960   H HH   . TYR A 1 61  ? -6.807  -4.047  -6.136  1.00 5.59  ? 61   TYR A HH   1  
ATOM   961   N N    . ARG A 1 62  ? -5.944  -9.449  -9.637  1.00 1.28  ? 62   ARG A N    1  
ATOM   962   C CA   . ARG A 1 62  ? -6.708  -8.789  -10.698 1.00 1.39  ? 62   ARG A CA   1  
ATOM   963   C C    . ARG A 1 62  ? -7.548  -9.793  -11.487 1.00 1.07  ? 62   ARG A C    1  
ATOM   964   O O    . ARG A 1 62  ? -8.582  -9.440  -12.055 1.00 1.30  ? 62   ARG A O    1  
ATOM   965   C CB   . ARG A 1 62  ? -5.758  -8.029  -11.627 1.00 1.72  ? 62   ARG A CB   1  
ATOM   966   C CG   . ARG A 1 62  ? -6.459  -7.162  -12.659 1.00 2.15  ? 62   ARG A CG   1  
ATOM   967   C CD   . ARG A 1 62  ? -5.463  -6.320  -13.437 1.00 2.51  ? 62   ARG A CD   1  
ATOM   968   N NE   . ARG A 1 62  ? -6.105  -5.516  -14.476 1.00 3.10  ? 62   ARG A NE   1  
ATOM   969   C CZ   . ARG A 1 62  ? -5.541  -4.452  -15.047 1.00 3.59  ? 62   ARG A CZ   1  
ATOM   970   N NH1  . ARG A 1 62  ? -4.371  -4.004  -14.610 1.00 3.59  ? 62   ARG A NH1  1  
ATOM   971   N NH2  . ARG A 1 62  ? -6.162  -3.814  -16.033 1.00 4.48  ? 62   ARG A NH2  1  
ATOM   972   H H    . ARG A 1 62  ? -4.966  -9.355  -9.629  1.00 1.33  ? 62   ARG A H    1  
ATOM   973   H HA   . ARG A 1 62  ? -7.373  -8.082  -10.228 1.00 1.73  ? 62   ARG A HA   1  
ATOM   974   H HB2  . ARG A 1 62  ? -5.123  -7.393  -11.030 1.00 1.93  ? 62   ARG A HB2  1  
ATOM   975   H HB3  . ARG A 1 62  ? -5.143  -8.744  -12.152 1.00 1.76  ? 62   ARG A HB3  1  
ATOM   976   H HG2  . ARG A 1 62  ? -6.996  -7.798  -13.347 1.00 2.42  ? 62   ARG A HG2  1  
ATOM   977   H HG3  . ARG A 1 62  ? -7.154  -6.507  -12.153 1.00 2.45  ? 62   ARG A HG3  1  
ATOM   978   H HD2  . ARG A 1 62  ? -4.956  -5.659  -12.748 1.00 2.64  ? 62   ARG A HD2  1  
ATOM   979   H HD3  . ARG A 1 62  ? -4.741  -6.978  -13.899 1.00 2.92  ? 62   ARG A HD3  1  
ATOM   980   H HE   . ARG A 1 62  ? -7.003  -5.800  -14.776 1.00 3.50  ? 62   ARG A HE   1  
ATOM   981   H HH11 . ARG A 1 62  ? -3.907  -4.462  -13.841 1.00 3.34  ? 62   ARG A HH11 1  
ATOM   982   H HH12 . ARG A 1 62  ? -3.940  -3.204  -15.043 1.00 4.14  ? 62   ARG A HH12 1  
ATOM   983   H HH21 . ARG A 1 62  ? -7.061  -4.127  -16.351 1.00 4.87  ? 62   ARG A HH21 1  
ATOM   984   H HH22 . ARG A 1 62  ? -5.732  -3.015  -16.465 1.00 4.93  ? 62   ARG A HH22 1  
ATOM   985   N N    . ARG A 1 63  ? -7.101  -11.042 -11.502 1.00 0.98  ? 63   ARG A N    1  
ATOM   986   C CA   . ARG A 1 63  ? -7.852  -12.130 -12.116 1.00 1.19  ? 63   ARG A CA   1  
ATOM   987   C C    . ARG A 1 63  ? -9.258  -12.230 -11.518 1.00 1.20  ? 63   ARG A C    1  
ATOM   988   O O    . ARG A 1 63  ? -10.244 -12.341 -12.243 1.00 1.45  ? 63   ARG A O    1  
ATOM   989   C CB   . ARG A 1 63  ? -7.095  -13.450 -11.925 1.00 1.61  ? 63   ARG A CB   1  
ATOM   990   C CG   . ARG A 1 63  ? -7.876  -14.686 -12.346 1.00 2.18  ? 63   ARG A CG   1  
ATOM   991   C CD   . ARG A 1 63  ? -7.026  -15.943 -12.241 1.00 2.52  ? 63   ARG A CD   1  
ATOM   992   N NE   . ARG A 1 63  ? -5.973  -15.977 -13.255 1.00 3.12  ? 63   ARG A NE   1  
ATOM   993   C CZ   . ARG A 1 63  ? -4.899  -16.767 -13.197 1.00 3.84  ? 63   ARG A CZ   1  
ATOM   994   N NH1  . ARG A 1 63  ? -4.701  -17.557 -12.150 1.00 4.07  ? 63   ARG A NH1  1  
ATOM   995   N NH2  . ARG A 1 63  ? -4.017  -16.758 -14.186 1.00 4.72  ? 63   ARG A NH2  1  
ATOM   996   H H    . ARG A 1 63  ? -6.228  -11.237 -11.099 1.00 1.11  ? 63   ARG A H    1  
ATOM   997   H HA   . ARG A 1 63  ? -7.935  -11.922 -13.172 1.00 1.34  ? 63   ARG A HA   1  
ATOM   998   H HB2  . ARG A 1 63  ? -6.185  -13.413 -12.505 1.00 1.92  ? 63   ARG A HB2  1  
ATOM   999   H HB3  . ARG A 1 63  ? -6.840  -13.552 -10.880 1.00 2.09  ? 63   ARG A HB3  1  
ATOM   1000  H HG2  . ARG A 1 63  ? -8.738  -14.791 -11.706 1.00 2.77  ? 63   ARG A HG2  1  
ATOM   1001  H HG3  . ARG A 1 63  ? -8.198  -14.564 -13.370 1.00 2.59  ? 63   ARG A HG3  1  
ATOM   1002  H HD2  . ARG A 1 63  ? -6.572  -15.975 -11.261 1.00 3.00  ? 63   ARG A HD2  1  
ATOM   1003  H HD3  . ARG A 1 63  ? -7.666  -16.805 -12.368 1.00 2.63  ? 63   ARG A HD3  1  
ATOM   1004  H HE   . ARG A 1 63  ? -6.087  -15.388 -14.040 1.00 3.38  ? 63   ARG A HE   1  
ATOM   1005  H HH11 . ARG A 1 63  ? -5.357  -17.566 -11.384 1.00 3.81  ? 63   ARG A HH11 1  
ATOM   1006  H HH12 . ARG A 1 63  ? -3.896  -18.163 -12.116 1.00 4.78  ? 63   ARG A HH12 1  
ATOM   1007  H HH21 . ARG A 1 63  ? -4.152  -16.157 -14.982 1.00 4.96  ? 63   ARG A HH21 1  
ATOM   1008  H HH22 . ARG A 1 63  ? -3.203  -17.349 -14.146 1.00 5.35  ? 63   ARG A HH22 1  
ATOM   1009  N N    . ALA A 1 64  ? -9.342  -12.173 -10.196 1.00 1.07  ? 64   ALA A N    1  
ATOM   1010  C CA   . ALA A 1 64  ? -10.619 -12.291 -9.502  1.00 1.09  ? 64   ALA A CA   1  
ATOM   1011  C C    . ALA A 1 64  ? -11.267 -10.928 -9.289  1.00 1.08  ? 64   ALA A C    1  
ATOM   1012  O O    . ALA A 1 64  ? -12.488 -10.811 -9.313  1.00 1.05  ? 64   ALA A O    1  
ATOM   1013  C CB   . ALA A 1 64  ? -10.427 -12.989 -8.163  1.00 1.17  ? 64   ALA A CB   1  
ATOM   1014  H H    . ALA A 1 64  ? -8.525  -12.035 -9.671  1.00 1.05  ? 64   ALA A H    1  
ATOM   1015  H HA   . ALA A 1 64  ? -11.275 -12.901 -10.107 1.00 1.12  ? 64   ALA A HA   1  
ATOM   1016  H HB1  . ALA A 1 64  ? -11.384 -13.097 -7.672  1.00 1.70  ? 64   ALA A HB1  1  
ATOM   1017  H HB2  . ALA A 1 64  ? -9.773  -12.397 -7.539  1.00 1.43  ? 64   ALA A HB2  1  
ATOM   1018  H HB3  . ALA A 1 64  ? -9.992  -13.963 -8.319  1.00 1.55  ? 64   ALA A HB3  1  
ATOM   1019  N N    . PHE A 1 65  ? -10.431 -9.908  -9.099  1.00 1.14  ? 65   PHE A N    1  
ATOM   1020  C CA   . PHE A 1 65  ? -10.867 -8.562  -8.701  1.00 1.22  ? 65   PHE A CA   1  
ATOM   1021  C C    . PHE A 1 65  ? -12.114 -8.073  -9.444  1.00 1.19  ? 65   PHE A C    1  
ATOM   1022  O O    . PHE A 1 65  ? -13.051 -7.569  -8.826  1.00 1.22  ? 65   PHE A O    1  
ATOM   1023  C CB   . PHE A 1 65  ? -9.719  -7.570  -8.908  1.00 1.47  ? 65   PHE A CB   1  
ATOM   1024  C CG   . PHE A 1 65  ? -10.120 -6.135  -8.736  1.00 1.41  ? 65   PHE A CG   1  
ATOM   1025  C CD1  . PHE A 1 65  ? -10.540 -5.666  -7.503  1.00 1.67  ? 65   PHE A CD1  1  
ATOM   1026  C CD2  . PHE A 1 65  ? -10.075 -5.257  -9.804  1.00 1.98  ? 65   PHE A CD2  1  
ATOM   1027  C CE1  . PHE A 1 65  ? -10.908 -4.347  -7.340  1.00 2.44  ? 65   PHE A CE1  1  
ATOM   1028  C CE2  . PHE A 1 65  ? -10.441 -3.938  -9.645  1.00 2.59  ? 65   PHE A CE2  1  
ATOM   1029  C CZ   . PHE A 1 65  ? -10.863 -3.482  -8.421  1.00 2.81  ? 65   PHE A CZ   1  
ATOM   1030  H H    . PHE A 1 65  ? -9.469  -10.066 -9.227  1.00 1.17  ? 65   PHE A H    1  
ATOM   1031  H HA   . PHE A 1 65  ? -11.095 -8.598  -7.647  1.00 1.22  ? 65   PHE A HA   1  
ATOM   1032  H HB2  . PHE A 1 65  ? -8.937  -7.780  -8.193  1.00 1.77  ? 65   PHE A HB2  1  
ATOM   1033  H HB3  . PHE A 1 65  ? -9.326  -7.689  -9.908  1.00 2.14  ? 65   PHE A HB3  1  
ATOM   1034  H HD1  . PHE A 1 65  ? -10.579 -6.344  -6.663  1.00 1.72  ? 65   PHE A HD1  1  
ATOM   1035  H HD2  . PHE A 1 65  ? -9.750  -5.613  -10.770 1.00 2.28  ? 65   PHE A HD2  1  
ATOM   1036  H HE1  . PHE A 1 65  ? -11.234 -3.992  -6.373  1.00 2.98  ? 65   PHE A HE1  1  
ATOM   1037  H HE2  . PHE A 1 65  ? -10.402 -3.262  -10.486 1.00 3.15  ? 65   PHE A HE2  1  
ATOM   1038  H HZ   . PHE A 1 65  ? -11.154 -2.448  -8.298  1.00 3.52  ? 65   PHE A HZ   1  
ATOM   1039  N N    . SER A 1 66  ? -12.133 -8.230  -10.756 1.00 1.20  ? 66   SER A N    1  
ATOM   1040  C CA   . SER A 1 66  ? -13.224 -7.704  -11.568 1.00 1.24  ? 66   SER A CA   1  
ATOM   1041  C C    . SER A 1 66  ? -14.535 -8.447  -11.300 1.00 1.13  ? 66   SER A C    1  
ATOM   1042  O O    . SER A 1 66  ? -15.624 -7.884  -11.444 1.00 1.16  ? 66   SER A O    1  
ATOM   1043  C CB   . SER A 1 66  ? -12.840 -7.789  -13.044 1.00 1.45  ? 66   SER A CB   1  
ATOM   1044  O OG   . SER A 1 66  ? -12.198 -9.022  -13.325 1.00 2.19  ? 66   SER A OG   1  
ATOM   1045  H H    . SER A 1 66  ? -11.404 -8.721  -11.194 1.00 1.21  ? 66   SER A H    1  
ATOM   1046  H HA   . SER A 1 66  ? -13.359 -6.665  -11.301 1.00 1.29  ? 66   SER A HA   1  
ATOM   1047  H HB2  . SER A 1 66  ? -13.729 -7.711  -13.653 1.00 1.81  ? 66   SER A HB2  1  
ATOM   1048  H HB3  . SER A 1 66  ? -12.164 -6.982  -13.287 1.00 1.57  ? 66   SER A HB3  1  
ATOM   1049  H HG   . SER A 1 66  ? -12.503 -9.353  -14.185 1.00 2.59  ? 66   SER A HG   1  
ATOM   1050  N N    . ASP A 1 67  ? -14.419 -9.700  -10.891 1.00 1.09  ? 67   ASP A N    1  
ATOM   1051  C CA   . ASP A 1 67  ? -15.577 -10.537 -10.609 1.00 1.08  ? 67   ASP A CA   1  
ATOM   1052  C C    . ASP A 1 67  ? -16.006 -10.426 -9.152  1.00 0.97  ? 67   ASP A C    1  
ATOM   1053  O O    . ASP A 1 67  ? -17.187 -10.570 -8.828  1.00 1.01  ? 67   ASP A O    1  
ATOM   1054  C CB   . ASP A 1 67  ? -15.265 -12.001 -10.928 1.00 1.18  ? 67   ASP A CB   1  
ATOM   1055  C CG   . ASP A 1 67  ? -15.434 -12.336 -12.392 1.00 1.86  ? 67   ASP A CG   1  
ATOM   1056  O OD1  . ASP A 1 67  ? -14.542 -11.981 -13.191 1.00 2.72  ? 67   ASP A OD1  1  
ATOM   1057  O OD2  . ASP A 1 67  ? -16.463 -12.941 -12.760 1.00 2.06  ? 67   ASP A OD2  1  
ATOM   1058  H H    . ASP A 1 67  ? -13.519 -10.076 -10.768 1.00 1.12  ? 67   ASP A H    1  
ATOM   1059  H HA   . ASP A 1 67  ? -16.388 -10.206 -11.240 1.00 1.16  ? 67   ASP A HA   1  
ATOM   1060  H HB2  . ASP A 1 67  ? -14.243 -12.211 -10.649 1.00 1.30  ? 67   ASP A HB2  1  
ATOM   1061  H HB3  . ASP A 1 67  ? -15.924 -12.635 -10.354 1.00 1.39  ? 67   ASP A HB3  1  
ATOM   1062  N N    . LEU A 1 68  ? -15.046 -10.152 -8.274  1.00 0.89  ? 68   LEU A N    1  
ATOM   1063  C CA   . LEU A 1 68  ? -15.282 -10.205 -6.835  1.00 0.85  ? 68   LEU A CA   1  
ATOM   1064  C C    . LEU A 1 68  ? -16.254 -9.135  -6.354  1.00 0.76  ? 68   LEU A C    1  
ATOM   1065  O O    . LEU A 1 68  ? -16.810 -9.265  -5.269  1.00 0.77  ? 68   LEU A O    1  
ATOM   1066  C CB   . LEU A 1 68  ? -13.975 -10.081 -6.061  1.00 0.91  ? 68   LEU A CB   1  
ATOM   1067  C CG   . LEU A 1 68  ? -12.901 -11.101 -6.422  1.00 1.06  ? 68   LEU A CG   1  
ATOM   1068  C CD1  . LEU A 1 68  ? -11.692 -10.909 -5.540  1.00 1.54  ? 68   LEU A CD1  1  
ATOM   1069  C CD2  . LEU A 1 68  ? -13.427 -12.517 -6.297  1.00 1.56  ? 68   LEU A CD2  1  
ATOM   1070  H H    . LEU A 1 68  ? -14.149 -9.917  -8.601  1.00 0.92  ? 68   LEU A H    1  
ATOM   1071  H HA   . LEU A 1 68  ? -15.713 -11.172 -6.619  1.00 0.96  ? 68   LEU A HA   1  
ATOM   1072  H HB2  . LEU A 1 68  ? -13.575 -9.094  -6.220  1.00 1.15  ? 68   LEU A HB2  1  
ATOM   1073  H HB3  . LEU A 1 68  ? -14.198 -10.191 -5.010  1.00 1.11  ? 68   LEU A HB3  1  
ATOM   1074  H HG   . LEU A 1 68  ? -12.595 -10.944 -7.446  1.00 1.87  ? 68   LEU A HG   1  
ATOM   1075  H HD11 . LEU A 1 68  ? -10.994 -11.721 -5.700  1.00 2.00  ? 68   LEU A HD11 1  
ATOM   1076  H HD12 . LEU A 1 68  ? -12.012 -10.899 -4.510  1.00 2.00  ? 68   LEU A HD12 1  
ATOM   1077  H HD13 . LEU A 1 68  ? -11.219 -9.970  -5.782  1.00 2.16  ? 68   LEU A HD13 1  
ATOM   1078  H HD21 . LEU A 1 68  ? -14.200 -12.680 -7.033  1.00 1.93  ? 68   LEU A HD21 1  
ATOM   1079  H HD22 . LEU A 1 68  ? -13.835 -12.661 -5.307  1.00 2.25  ? 68   LEU A HD22 1  
ATOM   1080  H HD23 . LEU A 1 68  ? -12.622 -13.217 -6.458  1.00 1.99  ? 68   LEU A HD23 1  
ATOM   1081  N N    . THR A 1 69  ? -16.481 -8.099  -7.152  1.00 0.70  ? 69   THR A N    1  
ATOM   1082  C CA   . THR A 1 69  ? -17.348 -6.999  -6.734  1.00 0.62  ? 69   THR A CA   1  
ATOM   1083  C C    . THR A 1 69  ? -18.761 -7.499  -6.468  1.00 0.63  ? 69   THR A C    1  
ATOM   1084  O O    . THR A 1 69  ? -19.517 -6.908  -5.694  1.00 0.60  ? 69   THR A O    1  
ATOM   1085  C CB   . THR A 1 69  ? -17.395 -5.882  -7.788  1.00 0.62  ? 69   THR A CB   1  
ATOM   1086  O OG1  . THR A 1 69  ? -17.526 -6.453  -9.096  1.00 0.69  ? 69   THR A OG1  1  
ATOM   1087  C CG2  . THR A 1 69  ? -16.151 -5.024  -7.723  1.00 0.63  ? 69   THR A CG2  1  
ATOM   1088  H H    . THR A 1 69  ? -16.084 -8.083  -8.044  1.00 0.73  ? 69   THR A H    1  
ATOM   1089  H HA   . THR A 1 69  ? -16.946 -6.586  -5.819  1.00 0.59  ? 69   THR A HA   1  
ATOM   1090  H HB   . THR A 1 69  ? -18.254 -5.255  -7.585  1.00 0.61  ? 69   THR A HB   1  
ATOM   1091  H HG1  . THR A 1 69  ? -17.227 -5.809  -9.757  1.00 0.77  ? 69   THR A HG1  1  
ATOM   1092  H HG21 . THR A 1 69  ? -16.103 -4.530  -6.759  1.00 1.26  ? 69   THR A HG21 1  
ATOM   1093  H HG22 . THR A 1 69  ? -16.184 -4.282  -8.506  1.00 1.12  ? 69   THR A HG22 1  
ATOM   1094  H HG23 . THR A 1 69  ? -15.277 -5.645  -7.853  1.00 1.21  ? 69   THR A HG23 1  
ATOM   1095  N N    . SER A 1 70  ? -19.089 -8.606  -7.112  1.00 0.72  ? 70   SER A N    1  
ATOM   1096  C CA   . SER A 1 70  ? -20.356 -9.276  -6.922  1.00 0.80  ? 70   SER A CA   1  
ATOM   1097  C C    . SER A 1 70  ? -20.373 -10.020 -5.588  1.00 0.76  ? 70   SER A C    1  
ATOM   1098  O O    . SER A 1 70  ? -21.416 -10.171 -4.956  1.00 0.76  ? 70   SER A O    1  
ATOM   1099  C CB   . SER A 1 70  ? -20.555 -10.257 -8.070  1.00 0.96  ? 70   SER A CB   1  
ATOM   1100  O OG   . SER A 1 70  ? -20.539 -9.585  -9.320  1.00 1.34  ? 70   SER A OG   1  
ATOM   1101  H H    . SER A 1 70  ? -18.450 -8.983  -7.753  1.00 0.77  ? 70   SER A H    1  
ATOM   1102  H HA   . SER A 1 70  ? -21.142 -8.539  -6.936  1.00 0.83  ? 70   SER A HA   1  
ATOM   1103  H HB2  . SER A 1 70  ? -19.746 -10.977 -8.056  1.00 1.16  ? 70   SER A HB2  1  
ATOM   1104  H HB3  . SER A 1 70  ? -21.500 -10.766 -7.955  1.00 1.25  ? 70   SER A HB3  1  
ATOM   1105  H HG   . SER A 1 70  ? -20.849 -10.191 -10.013 1.00 1.80  ? 70   SER A HG   1  
ATOM   1106  N N    . GLN A 1 71  ? -19.194 -10.457 -5.163  1.00 0.77  ? 71   GLN A N    1  
ATOM   1107  C CA   . GLN A 1 71  ? -19.041 -11.233 -3.941  1.00 0.77  ? 71   GLN A CA   1  
ATOM   1108  C C    . GLN A 1 71  ? -19.004 -10.319 -2.733  1.00 0.67  ? 71   GLN A C    1  
ATOM   1109  O O    . GLN A 1 71  ? -19.710 -10.540 -1.750  1.00 0.74  ? 71   GLN A O    1  
ATOM   1110  C CB   . GLN A 1 71  ? -17.754 -12.046 -3.990  1.00 0.81  ? 71   GLN A CB   1  
ATOM   1111  C CG   . GLN A 1 71  ? -17.585 -12.833 -5.267  1.00 0.99  ? 71   GLN A CG   1  
ATOM   1112  C CD   . GLN A 1 71  ? -16.461 -13.833 -5.163  1.00 1.09  ? 71   GLN A CD   1  
ATOM   1113  O OE1  . GLN A 1 71  ? -16.473 -14.878 -5.810  1.00 1.31  ? 71   GLN A OE1  1  
ATOM   1114  N NE2  . GLN A 1 71  ? -15.484 -13.521 -4.331  1.00 1.42  ? 71   GLN A NE2  1  
ATOM   1115  H H    . GLN A 1 71  ? -18.393 -10.234 -5.684  1.00 0.83  ? 71   GLN A H    1  
ATOM   1116  H HA   . GLN A 1 71  ? -19.883 -11.903 -3.856  1.00 0.86  ? 71   GLN A HA   1  
ATOM   1117  H HB2  . GLN A 1 71  ? -16.907 -11.374 -3.900  1.00 0.73  ? 71   GLN A HB2  1  
ATOM   1118  H HB3  . GLN A 1 71  ? -17.742 -12.737 -3.162  1.00 0.90  ? 71   GLN A HB3  1  
ATOM   1119  H HG2  . GLN A 1 71  ? -18.503 -13.360 -5.483  1.00 1.41  ? 71   GLN A HG2  1  
ATOM   1120  H HG3  . GLN A 1 71  ? -17.362 -12.142 -6.068  1.00 1.35  ? 71   GLN A HG3  1  
ATOM   1121  H HE21 . GLN A 1 71  ? -15.542 -12.672 -3.834  1.00 1.32  ? 71   GLN A HE21 1  
ATOM   1122  H HE22 . GLN A 1 71  ? -14.745 -14.151 -4.240  1.00 1.89  ? 71   GLN A HE22 1  
ATOM   1123  N N    . LEU A 1 72  ? -18.165 -9.291  -2.813  1.00 0.59  ? 72   LEU A N    1  
ATOM   1124  C CA   . LEU A 1 72  ? -18.093 -8.294  -1.761  1.00 0.55  ? 72   LEU A CA   1  
ATOM   1125  C C    . LEU A 1 72  ? -19.404 -7.528  -1.712  1.00 0.47  ? 72   LEU A C    1  
ATOM   1126  O O    . LEU A 1 72  ? -19.817 -7.051  -0.660  1.00 0.48  ? 72   LEU A O    1  
ATOM   1127  C CB   . LEU A 1 72  ? -16.933 -7.314  -1.993  1.00 0.59  ? 72   LEU A CB   1  
ATOM   1128  C CG   . LEU A 1 72  ? -15.527 -7.925  -2.045  1.00 0.76  ? 72   LEU A CG   1  
ATOM   1129  C CD1  . LEU A 1 72  ? -14.962 -7.843  -3.453  1.00 1.37  ? 72   LEU A CD1  1  
ATOM   1130  C CD2  . LEU A 1 72  ? -14.597 -7.224  -1.065  1.00 1.35  ? 72   LEU A CD2  1  
ATOM   1131  H H    . LEU A 1 72  ? -17.583 -9.203  -3.600  1.00 0.60  ? 72   LEU A H    1  
ATOM   1132  H HA   . LEU A 1 72  ? -17.946 -8.806  -0.823  1.00 0.62  ? 72   LEU A HA   1  
ATOM   1133  H HB2  . LEU A 1 72  ? -17.110 -6.803  -2.928  1.00 0.55  ? 72   LEU A HB2  1  
ATOM   1134  H HB3  . LEU A 1 72  ? -16.950 -6.582  -1.199  1.00 0.70  ? 72   LEU A HB3  1  
ATOM   1135  H HG   . LEU A 1 72  ? -15.584 -8.967  -1.768  1.00 1.69  ? 72   LEU A HG   1  
ATOM   1136  H HD11 . LEU A 1 72  ? -14.980 -6.815  -3.793  1.00 1.90  ? 72   LEU A HD11 1  
ATOM   1137  H HD12 . LEU A 1 72  ? -15.560 -8.454  -4.119  1.00 1.96  ? 72   LEU A HD12 1  
ATOM   1138  H HD13 . LEU A 1 72  ? -13.943 -8.203  -3.453  1.00 1.98  ? 72   LEU A HD13 1  
ATOM   1139  H HD21 . LEU A 1 72  ? -13.609 -7.660  -1.129  1.00 1.79  ? 72   LEU A HD21 1  
ATOM   1140  H HD22 . LEU A 1 72  ? -14.977 -7.340  -0.061  1.00 1.93  ? 72   LEU A HD22 1  
ATOM   1141  H HD23 . LEU A 1 72  ? -14.542 -6.175  -1.310  1.00 1.96  ? 72   LEU A HD23 1  
ATOM   1142  N N    . HIS A 1 73  ? -20.058 -7.437  -2.867  1.00 0.48  ? 73   HIS A N    1  
ATOM   1143  C CA   . HIS A 1 73  ? -21.292 -6.678  -3.006  1.00 0.48  ? 73   HIS A CA   1  
ATOM   1144  C C    . HIS A 1 73  ? -20.981 -5.217  -2.756  1.00 0.43  ? 73   HIS A C    1  
ATOM   1145  O O    . HIS A 1 73  ? -21.547 -4.566  -1.878  1.00 0.52  ? 73   HIS A O    1  
ATOM   1146  C CB   . HIS A 1 73  ? -22.382 -7.194  -2.053  1.00 0.55  ? 73   HIS A CB   1  
ATOM   1147  C CG   . HIS A 1 73  ? -23.733 -6.582  -2.280  1.00 1.20  ? 73   HIS A CG   1  
ATOM   1148  N ND1  . HIS A 1 73  ? -24.581 -6.988  -3.287  1.00 2.06  ? 73   HIS A ND1  1  
ATOM   1149  C CD2  . HIS A 1 73  ? -24.381 -5.587  -1.626  1.00 1.97  ? 73   HIS A CD2  1  
ATOM   1150  C CE1  . HIS A 1 73  ? -25.687 -6.271  -3.245  1.00 2.72  ? 73   HIS A CE1  1  
ATOM   1151  N NE2  . HIS A 1 73  ? -25.592 -5.416  -2.248  1.00 2.62  ? 73   HIS A NE2  1  
ATOM   1152  H H    . HIS A 1 73  ? -19.685 -7.880  -3.660  1.00 0.53  ? 73   HIS A H    1  
ATOM   1153  H HA   . HIS A 1 73  ? -21.629 -6.785  -4.027  1.00 0.56  ? 73   HIS A HA   1  
ATOM   1154  H HB2  . HIS A 1 73  ? -22.478 -8.262  -2.179  1.00 1.05  ? 73   HIS A HB2  1  
ATOM   1155  H HB3  . HIS A 1 73  ? -22.085 -6.983  -1.037  1.00 0.86  ? 73   HIS A HB3  1  
ATOM   1156  H HD1  . HIS A 1 73  ? -24.399 -7.709  -3.938  1.00 2.50  ? 73   HIS A HD1  1  
ATOM   1157  H HD2  . HIS A 1 73  ? -24.013 -5.032  -0.775  1.00 2.48  ? 73   HIS A HD2  1  
ATOM   1158  H HE1  . HIS A 1 73  ? -26.528 -6.370  -3.916  1.00 3.54  ? 73   HIS A HE1  1  
ATOM   1159  H HE2  . HIS A 1 73  ? -26.256 -4.717  -2.035  1.00 3.26  ? 73   HIS A HE2  1  
ATOM   1160  N N    . ILE A 1 74  ? -20.026 -4.741  -3.528  1.00 0.45  ? 74   ILE A N    1  
ATOM   1161  C CA   . ILE A 1 74  ? -19.547 -3.379  -3.441  1.00 0.41  ? 74   ILE A CA   1  
ATOM   1162  C C    . ILE A 1 74  ? -20.686 -2.396  -3.648  1.00 0.49  ? 74   ILE A C    1  
ATOM   1163  O O    . ILE A 1 74  ? -21.244 -2.286  -4.744  1.00 0.91  ? 74   ILE A O    1  
ATOM   1164  C CB   . ILE A 1 74  ? -18.456 -3.149  -4.484  1.00 0.38  ? 74   ILE A CB   1  
ATOM   1165  C CG1  . ILE A 1 74  ? -17.365 -4.209  -4.328  1.00 0.36  ? 74   ILE A CG1  1  
ATOM   1166  C CG2  . ILE A 1 74  ? -17.875 -1.760  -4.330  1.00 0.44  ? 74   ILE A CG2  1  
ATOM   1167  C CD1  . ILE A 1 74  ? -16.487 -4.013  -3.112  1.00 0.39  ? 74   ILE A CD1  1  
ATOM   1168  H H    . ILE A 1 74  ? -19.622 -5.339  -4.190  1.00 0.57  ? 74   ILE A H    1  
ATOM   1169  H HA   . ILE A 1 74  ? -19.122 -3.230  -2.459  1.00 0.40  ? 74   ILE A HA   1  
ATOM   1170  H HB   . ILE A 1 74  ? -18.896 -3.231  -5.466  1.00 0.44  ? 74   ILE A HB   1  
ATOM   1171  H HG12 . ILE A 1 74  ? -17.831 -5.174  -4.237  1.00 0.38  ? 74   ILE A HG12 1  
ATOM   1172  H HG13 . ILE A 1 74  ? -16.737 -4.205  -5.201  1.00 0.36  ? 74   ILE A HG13 1  
ATOM   1173  H HG21 . ILE A 1 74  ? -18.644 -1.026  -4.512  1.00 0.98  ? 74   ILE A HG21 1  
ATOM   1174  H HG22 . ILE A 1 74  ? -17.075 -1.633  -5.049  1.00 1.15  ? 74   ILE A HG22 1  
ATOM   1175  H HG23 . ILE A 1 74  ? -17.486 -1.641  -3.330  1.00 1.08  ? 74   ILE A HG23 1  
ATOM   1176  H HD11 . ILE A 1 74  ? -17.103 -3.951  -2.225  1.00 1.10  ? 74   ILE A HD11 1  
ATOM   1177  H HD12 . ILE A 1 74  ? -15.918 -3.101  -3.224  1.00 1.13  ? 74   ILE A HD12 1  
ATOM   1178  H HD13 . ILE A 1 74  ? -15.809 -4.849  -3.022  1.00 1.05  ? 74   ILE A HD13 1  
ATOM   1179  N N    . THR A 1 75  ? -21.013 -1.696  -2.581  1.00 0.38  ? 75   THR A N    1  
ATOM   1180  C CA   . THR A 1 75  ? -22.205 -0.883  -2.507  1.00 0.40  ? 75   THR A CA   1  
ATOM   1181  C C    . THR A 1 75  ? -21.915 0.276   -1.524  1.00 0.37  ? 75   THR A C    1  
ATOM   1182  O O    . THR A 1 75  ? -20.740 0.521   -1.241  1.00 0.34  ? 75   THR A O    1  
ATOM   1183  C CB   . THR A 1 75  ? -23.372 -1.811  -2.046  1.00 0.46  ? 75   THR A CB   1  
ATOM   1184  O OG1  . THR A 1 75  ? -24.632 -1.385  -2.583  1.00 0.51  ? 75   THR A OG1  1  
ATOM   1185  C CG2  . THR A 1 75  ? -23.457 -1.906  -0.526  1.00 0.46  ? 75   THR A CG2  1  
ATOM   1186  H H    . THR A 1 75  ? -20.419 -1.720  -1.800  1.00 0.63  ? 75   THR A H    1  
ATOM   1187  H HA   . THR A 1 75  ? -22.422 -0.489  -3.491  1.00 0.42  ? 75   THR A HA   1  
ATOM   1188  H HB   . THR A 1 75  ? -23.167 -2.803  -2.425  1.00 0.48  ? 75   THR A HB   1  
ATOM   1189  H HG1  . THR A 1 75  ? -25.289 -1.344  -1.869  1.00 0.93  ? 75   THR A HG1  1  
ATOM   1190  H HG21 . THR A 1 75  ? -22.521 -2.276  -0.134  1.00 1.10  ? 75   THR A HG21 1  
ATOM   1191  H HG22 . THR A 1 75  ? -24.255 -2.580  -0.252  1.00 1.12  ? 75   THR A HG22 1  
ATOM   1192  H HG23 . THR A 1 75  ? -23.657 -0.924  -0.117  1.00 1.04  ? 75   THR A HG23 1  
ATOM   1193  N N    . PRO A 1 76  ? -22.934 1.054   -1.062  1.00 0.38  ? 76   PRO A N    1  
ATOM   1194  C CA   . PRO A 1 76  ? -22.850 1.926   0.116   1.00 0.37  ? 76   PRO A CA   1  
ATOM   1195  C C    . PRO A 1 76  ? -21.866 1.457   1.206   1.00 0.35  ? 76   PRO A C    1  
ATOM   1196  O O    . PRO A 1 76  ? -21.418 0.314   1.205   1.00 0.35  ? 76   PRO A O    1  
ATOM   1197  C CB   . PRO A 1 76  ? -24.285 1.887   0.645   1.00 0.42  ? 76   PRO A CB   1  
ATOM   1198  C CG   . PRO A 1 76  ? -25.151 1.544   -0.533  1.00 0.47  ? 76   PRO A CG   1  
ATOM   1199  C CD   . PRO A 1 76  ? -24.238 1.246   -1.696  1.00 0.44  ? 76   PRO A CD   1  
ATOM   1200  H HA   . PRO A 1 76  ? -22.607 2.939   -0.165  1.00 0.37  ? 76   PRO A HA   1  
ATOM   1201  H HB2  . PRO A 1 76  ? -24.362 1.136   1.413   1.00 0.42  ? 76   PRO A HB2  1  
ATOM   1202  H HB3  . PRO A 1 76  ? -24.544 2.853   1.053   1.00 0.45  ? 76   PRO A HB3  1  
ATOM   1203  H HG2  . PRO A 1 76  ? -25.749 0.675   -0.302  1.00 0.52  ? 76   PRO A HG2  1  
ATOM   1204  H HG3  . PRO A 1 76  ? -25.790 2.381   -0.768  1.00 0.53  ? 76   PRO A HG3  1  
ATOM   1205  H HD2  . PRO A 1 76  ? -24.554 0.348   -2.206  1.00 0.46  ? 76   PRO A HD2  1  
ATOM   1206  H HD3  . PRO A 1 76  ? -24.216 2.080   -2.376  1.00 0.44  ? 76   PRO A HD3  1  
ATOM   1207  N N    . GLY A 1 77  ? -21.565 2.380   2.132   1.00 0.36  ? 77   GLY A N    1  
ATOM   1208  C CA   . GLY A 1 77  ? -20.524 2.224   3.164   1.00 0.37  ? 77   GLY A CA   1  
ATOM   1209  C C    . GLY A 1 77  ? -20.310 0.824   3.734   1.00 0.38  ? 77   GLY A C    1  
ATOM   1210  O O    . GLY A 1 77  ? -19.216 0.519   4.218   1.00 0.40  ? 77   GLY A O    1  
ATOM   1211  H H    . GLY A 1 77  ? -22.085 3.217   2.124   1.00 0.38  ? 77   GLY A H    1  
ATOM   1212  H HA2  . GLY A 1 77  ? -19.587 2.558   2.748   1.00 0.35  ? 77   GLY A HA2  1  
ATOM   1213  H HA3  . GLY A 1 77  ? -20.778 2.881   3.985   1.00 0.41  ? 77   GLY A HA3  1  
ATOM   1214  N N    . THR A 1 78  ? -21.318 -0.027  3.680   1.00 0.40  ? 78   THR A N    1  
ATOM   1215  C CA   . THR A 1 78  ? -21.211 -1.380  4.198   1.00 0.42  ? 78   THR A CA   1  
ATOM   1216  C C    . THR A 1 78  ? -20.271 -2.247  3.355   1.00 0.38  ? 78   THR A C    1  
ATOM   1217  O O    . THR A 1 78  ? -20.084 -3.433  3.635   1.00 0.40  ? 78   THR A O    1  
ATOM   1218  C CB   . THR A 1 78  ? -22.594 -2.034  4.293   1.00 0.49  ? 78   THR A CB   1  
ATOM   1219  O OG1  . THR A 1 78  ? -23.266 -1.957  3.027   1.00 0.50  ? 78   THR A OG1  1  
ATOM   1220  C CG2  . THR A 1 78  ? -23.416 -1.332  5.355   1.00 0.56  ? 78   THR A CG2  1  
ATOM   1221  H H    . THR A 1 78  ? -22.153 0.249   3.250   1.00 0.41  ? 78   THR A H    1  
ATOM   1222  H HA   . THR A 1 78  ? -20.806 -1.313  5.198   1.00 0.46  ? 78   THR A HA   1  
ATOM   1223  H HB   . THR A 1 78  ? -22.474 -3.071  4.573   1.00 0.49  ? 78   THR A HB   1  
ATOM   1224  H HG1  . THR A 1 78  ? -23.140 -2.794  2.547   1.00 0.80  ? 78   THR A HG1  1  
ATOM   1225  H HG21 . THR A 1 78  ? -23.453 -0.275  5.133   1.00 1.12  ? 78   THR A HG21 1  
ATOM   1226  H HG22 . THR A 1 78  ? -22.954 -1.481  6.319   1.00 1.22  ? 78   THR A HG22 1  
ATOM   1227  H HG23 . THR A 1 78  ? -24.416 -1.736  5.364   1.00 1.14  ? 78   THR A HG23 1  
ATOM   1228  N N    . ALA A 1 79  ? -19.651 -1.639  2.344   1.00 0.34  ? 79   ALA A N    1  
ATOM   1229  C CA   . ALA A 1 79  ? -18.627 -2.309  1.557   1.00 0.31  ? 79   ALA A CA   1  
ATOM   1230  C C    . ALA A 1 79  ? -17.361 -2.480  2.388   1.00 0.30  ? 79   ALA A C    1  
ATOM   1231  O O    . ALA A 1 79  ? -16.467 -3.250  2.039   1.00 0.31  ? 79   ALA A O    1  
ATOM   1232  C CB   . ALA A 1 79  ? -18.333 -1.527  0.286   1.00 0.32  ? 79   ALA A CB   1  
ATOM   1233  H H    . ALA A 1 79  ? -19.901 -0.713  2.117   1.00 0.36  ? 79   ALA A H    1  
ATOM   1234  H HA   . ALA A 1 79  ? -19.002 -3.284  1.279   1.00 0.33  ? 79   ALA A HA   1  
ATOM   1235  H HB1  . ALA A 1 79  ? -19.256 -1.334  -0.238  1.00 1.07  ? 79   ALA A HB1  1  
ATOM   1236  H HB2  . ALA A 1 79  ? -17.670 -2.103  -0.348  1.00 1.03  ? 79   ALA A HB2  1  
ATOM   1237  H HB3  . ALA A 1 79  ? -17.861 -0.590  0.544   1.00 1.05  ? 79   ALA A HB3  1  
ATOM   1238  N N    . TYR A 1 80  ? -17.299 -1.766  3.507   1.00 0.33  ? 80   TYR A N    1  
ATOM   1239  C CA   . TYR A 1 80  ? -16.182 -1.890  4.432   1.00 0.36  ? 80   TYR A CA   1  
ATOM   1240  C C    . TYR A 1 80  ? -16.349 -3.151  5.265   1.00 0.36  ? 80   TYR A C    1  
ATOM   1241  O O    . TYR A 1 80  ? -15.406 -3.628  5.886   1.00 0.38  ? 80   TYR A O    1  
ATOM   1242  C CB   . TYR A 1 80  ? -16.080 -0.650  5.326   1.00 0.44  ? 80   TYR A CB   1  
ATOM   1243  C CG   . TYR A 1 80  ? -14.868 -0.653  6.234   1.00 1.15  ? 80   TYR A CG   1  
ATOM   1244  C CD1  . TYR A 1 80  ? -13.583 -0.594  5.710   1.00 2.21  ? 80   TYR A CD1  1  
ATOM   1245  C CD2  . TYR A 1 80  ? -15.012 -0.700  7.616   1.00 1.69  ? 80   TYR A CD2  1  
ATOM   1246  C CE1  . TYR A 1 80  ? -12.476 -0.583  6.537   1.00 3.13  ? 80   TYR A CE1  1  
ATOM   1247  C CE2  . TYR A 1 80  ? -13.909 -0.690  8.449   1.00 2.52  ? 80   TYR A CE2  1  
ATOM   1248  C CZ   . TYR A 1 80  ? -12.641 -0.685  7.899   1.00 3.12  ? 80   TYR A CZ   1  
ATOM   1249  O OH   . TYR A 1 80  ? -11.543 -0.618  8.732   1.00 4.13  ? 80   TYR A OH   1  
ATOM   1250  H H    . TYR A 1 80  ? -18.033 -1.141  3.717   1.00 0.35  ? 80   TYR A H    1  
ATOM   1251  H HA   . TYR A 1 80  ? -15.275 -1.987  3.852   1.00 0.36  ? 80   TYR A HA   1  
ATOM   1252  H HB2  . TYR A 1 80  ? -16.024 0.231   4.703   1.00 1.09  ? 80   TYR A HB2  1  
ATOM   1253  H HB3  . TYR A 1 80  ? -16.961 -0.590  5.948   1.00 0.85  ? 80   TYR A HB3  1  
ATOM   1254  H HD1  . TYR A 1 80  ? -13.454 -0.556  4.638   1.00 2.57  ? 80   TYR A HD1  1  
ATOM   1255  H HD2  . TYR A 1 80  ? -16.005 -0.748  8.039   1.00 1.99  ? 80   TYR A HD2  1  
ATOM   1256  H HE1  . TYR A 1 80  ? -11.485 -0.535  6.111   1.00 4.05  ? 80   TYR A HE1  1  
ATOM   1257  H HE2  . TYR A 1 80  ? -14.042 -0.728  9.519   1.00 3.04  ? 80   TYR A HE2  1  
ATOM   1258  H HH   . TYR A 1 80  ? -11.631 -1.314  9.392   1.00 4.31  ? 80   TYR A HH   1  
ATOM   1259  N N    . GLN A 1 81  ? -17.555 -3.696  5.255   1.00 0.37  ? 81   GLN A N    1  
ATOM   1260  C CA   . GLN A 1 81  ? -17.817 -4.973  5.894   1.00 0.41  ? 81   GLN A CA   1  
ATOM   1261  C C    . GLN A 1 81  ? -17.543 -6.101  4.914   1.00 0.41  ? 81   GLN A C    1  
ATOM   1262  O O    . GLN A 1 81  ? -17.284 -7.240  5.294   1.00 0.46  ? 81   GLN A O    1  
ATOM   1263  C CB   . GLN A 1 81  ? -19.246 -5.025  6.411   1.00 0.45  ? 81   GLN A CB   1  
ATOM   1264  C CG   . GLN A 1 81  ? -19.418 -4.320  7.746   1.00 0.58  ? 81   GLN A CG   1  
ATOM   1265  C CD   . GLN A 1 81  ? -20.868 -4.155  8.133   1.00 0.68  ? 81   GLN A CD   1  
ATOM   1266  O OE1  . GLN A 1 81  ? -21.460 -5.028  8.765   1.00 1.03  ? 81   GLN A OE1  1  
ATOM   1267  N NE2  . GLN A 1 81  ? -21.444 -3.023  7.773   1.00 0.79  ? 81   GLN A NE2  1  
ATOM   1268  H H    . GLN A 1 81  ? -18.289 -3.227  4.800   1.00 0.36  ? 81   GLN A H    1  
ATOM   1269  H HA   . GLN A 1 81  ? -17.137 -5.067  6.720   1.00 0.44  ? 81   GLN A HA   1  
ATOM   1270  H HB2  . GLN A 1 81  ? -19.898 -4.550  5.690   1.00 0.45  ? 81   GLN A HB2  1  
ATOM   1271  H HB3  . GLN A 1 81  ? -19.538 -6.055  6.525   1.00 0.47  ? 81   GLN A HB3  1  
ATOM   1272  H HG2  . GLN A 1 81  ? -18.922 -4.899  8.511   1.00 0.67  ? 81   GLN A HG2  1  
ATOM   1273  H HG3  . GLN A 1 81  ? -18.963 -3.342  7.683   1.00 0.63  ? 81   GLN A HG3  1  
ATOM   1274  H HE21 . GLN A 1 81  ? -20.902 -2.360  7.286   1.00 1.01  ? 81   GLN A HE21 1  
ATOM   1275  H HE22 . GLN A 1 81  ? -22.394 -2.893  7.995   1.00 0.89  ? 81   GLN A HE22 1  
ATOM   1276  N N    . SER A 1 82  ? -17.598 -5.753  3.652   1.00 0.39  ? 82   SER A N    1  
ATOM   1277  C CA   . SER A 1 82  ? -17.177 -6.635  2.576   1.00 0.41  ? 82   SER A CA   1  
ATOM   1278  C C    . SER A 1 82  ? -15.655 -6.743  2.579   1.00 0.41  ? 82   SER A C    1  
ATOM   1279  O O    . SER A 1 82  ? -15.083 -7.830  2.539   1.00 0.48  ? 82   SER A O    1  
ATOM   1280  C CB   . SER A 1 82  ? -17.660 -6.056  1.253   1.00 0.41  ? 82   SER A CB   1  
ATOM   1281  O OG   . SER A 1 82  ? -19.016 -5.651  1.357   1.00 0.43  ? 82   SER A OG   1  
ATOM   1282  H H    . SER A 1 82  ? -17.952 -4.871  3.431   1.00 0.39  ? 82   SER A H    1  
ATOM   1283  H HA   . SER A 1 82  ? -17.612 -7.611  2.732   1.00 0.44  ? 82   SER A HA   1  
ATOM   1284  H HB2  . SER A 1 82  ? -17.060 -5.195  0.999   1.00 0.41  ? 82   SER A HB2  1  
ATOM   1285  H HB3  . SER A 1 82  ? -17.574 -6.799  0.475   1.00 0.42  ? 82   SER A HB3  1  
ATOM   1286  H HG   . SER A 1 82  ? -19.527 -6.076  0.649   1.00 0.43  ? 82   SER A HG   1  
ATOM   1287  N N    . PHE A 1 83  ? -15.012 -5.588  2.643   1.00 0.38  ? 83   PHE A N    1  
ATOM   1288  C CA   . PHE A 1 83  ? -13.567 -5.500  2.786   1.00 0.37  ? 83   PHE A CA   1  
ATOM   1289  C C    . PHE A 1 83  ? -13.151 -5.943  4.190   1.00 0.38  ? 83   PHE A C    1  
ATOM   1290  O O    . PHE A 1 83  ? -11.981 -6.209  4.457   1.00 0.39  ? 83   PHE A O    1  
ATOM   1291  C CB   . PHE A 1 83  ? -13.106 -4.068  2.475   1.00 0.36  ? 83   PHE A CB   1  
ATOM   1292  C CG   . PHE A 1 83  ? -11.625 -3.847  2.610   1.00 0.56  ? 83   PHE A CG   1  
ATOM   1293  C CD1  . PHE A 1 83  ? -10.745 -4.376  1.682   1.00 0.79  ? 83   PHE A CD1  1  
ATOM   1294  C CD2  . PHE A 1 83  ? -11.116 -3.110  3.667   1.00 0.75  ? 83   PHE A CD2  1  
ATOM   1295  C CE1  . PHE A 1 83  ? -9.385  -4.174  1.804   1.00 1.07  ? 83   PHE A CE1  1  
ATOM   1296  C CE2  . PHE A 1 83  ? -9.758  -2.904  3.796   1.00 1.05  ? 83   PHE A CE2  1  
ATOM   1297  C CZ   . PHE A 1 83  ? -8.890  -3.443  2.858   1.00 1.18  ? 83   PHE A CZ   1  
ATOM   1298  H H    . PHE A 1 83  ? -15.533 -4.754  2.577   1.00 0.37  ? 83   PHE A H    1  
ATOM   1299  H HA   . PHE A 1 83  ? -13.120 -6.184  2.069   1.00 0.40  ? 83   PHE A HA   1  
ATOM   1300  H HB2  . PHE A 1 83  ? -13.375 -3.831  1.456   1.00 0.49  ? 83   PHE A HB2  1  
ATOM   1301  H HB3  . PHE A 1 83  ? -13.610 -3.380  3.137   1.00 0.41  ? 83   PHE A HB3  1  
ATOM   1302  H HD1  . PHE A 1 83  ? -11.131 -4.952  0.854   1.00 0.86  ? 83   PHE A HD1  1  
ATOM   1303  H HD2  . PHE A 1 83  ? -11.795 -2.693  4.398   1.00 0.78  ? 83   PHE A HD2  1  
ATOM   1304  H HE1  . PHE A 1 83  ? -8.709  -4.592  1.074   1.00 1.29  ? 83   PHE A HE1  1  
ATOM   1305  H HE2  . PHE A 1 83  ? -9.373  -2.328  4.624   1.00 1.26  ? 83   PHE A HE2  1  
ATOM   1306  H HZ   . PHE A 1 83  ? -7.825  -3.286  2.956   1.00 1.44  ? 83   PHE A HZ   1  
ATOM   1307  N N    . GLU A 1 84  ? -14.114 -6.006  5.091   1.00 0.41  ? 84   GLU A N    1  
ATOM   1308  C CA   . GLU A 1 84  ? -13.865 -6.508  6.431   1.00 0.48  ? 84   GLU A CA   1  
ATOM   1309  C C    . GLU A 1 84  ? -13.481 -7.974  6.380   1.00 0.52  ? 84   GLU A C    1  
ATOM   1310  O O    . GLU A 1 84  ? -12.506 -8.397  6.994   1.00 0.55  ? 84   GLU A O    1  
ATOM   1311  C CB   . GLU A 1 84  ? -15.100 -6.367  7.299   1.00 0.55  ? 84   GLU A CB   1  
ATOM   1312  C CG   . GLU A 1 84  ? -14.904 -6.916  8.692   1.00 0.62  ? 84   GLU A CG   1  
ATOM   1313  C CD   . GLU A 1 84  ? -16.077 -6.645  9.605   1.00 0.71  ? 84   GLU A CD   1  
ATOM   1314  O OE1  . GLU A 1 84  ? -17.083 -7.377  9.521   1.00 0.78  ? 84   GLU A OE1  1  
ATOM   1315  O OE2  . GLU A 1 84  ? -16.004 -5.682  10.402  1.00 0.80  ? 84   GLU A OE2  1  
ATOM   1316  H H    . GLU A 1 84  ? -15.016 -5.716  4.849   1.00 0.40  ? 84   GLU A H    1  
ATOM   1317  H HA   . GLU A 1 84  ? -13.056 -5.934  6.858   1.00 0.48  ? 84   GLU A HA   1  
ATOM   1318  H HB2  . GLU A 1 84  ? -15.364 -5.331  7.367   1.00 0.56  ? 84   GLU A HB2  1  
ATOM   1319  H HB3  . GLU A 1 84  ? -15.914 -6.904  6.835   1.00 0.57  ? 84   GLU A HB3  1  
ATOM   1320  H HG2  . GLU A 1 84  ? -14.764 -7.987  8.621   1.00 0.64  ? 84   GLU A HG2  1  
ATOM   1321  H HG3  . GLU A 1 84  ? -14.017 -6.471  9.107   1.00 0.63  ? 84   GLU A HG3  1  
ATOM   1322  N N    . GLN A 1 85  ? -14.287 -8.727  5.653   1.00 0.57  ? 85   GLN A N    1  
ATOM   1323  C CA   . GLN A 1 85  ? -14.086 -10.164 5.441   1.00 0.65  ? 85   GLN A CA   1  
ATOM   1324  C C    . GLN A 1 85  ? -12.637 -10.480 5.162   1.00 0.64  ? 85   GLN A C    1  
ATOM   1325  O O    . GLN A 1 85  ? -12.054 -11.417 5.710   1.00 0.71  ? 85   GLN A O    1  
ATOM   1326  C CB   . GLN A 1 85  ? -14.904 -10.612 4.237   1.00 0.69  ? 85   GLN A CB   1  
ATOM   1327  C CG   . GLN A 1 85  ? -16.333 -10.137 4.279   1.00 0.79  ? 85   GLN A CG   1  
ATOM   1328  C CD   . GLN A 1 85  ? -17.128 -10.541 3.055   1.00 1.13  ? 85   GLN A CD   1  
ATOM   1329  O OE1  . GLN A 1 85  ? -16.579 -10.703 1.964   1.00 1.44  ? 85   GLN A OE1  1  
ATOM   1330  N NE2  . GLN A 1 85  ? -18.429 -10.705 3.226   1.00 1.62  ? 85   GLN A NE2  1  
ATOM   1331  H H    . GLN A 1 85  ? -15.072 -8.299  5.250   1.00 0.56  ? 85   GLN A H    1  
ATOM   1332  H HA   . GLN A 1 85  ? -14.407 -10.690 6.316   1.00 0.72  ? 85   GLN A HA   1  
ATOM   1333  H HB2  . GLN A 1 85  ? -14.447 -10.214 3.343   1.00 0.74  ? 85   GLN A HB2  1  
ATOM   1334  H HB3  . GLN A 1 85  ? -14.903 -11.691 4.190   1.00 0.91  ? 85   GLN A HB3  1  
ATOM   1335  H HG2  . GLN A 1 85  ? -16.796 -10.555 5.145   1.00 1.13  ? 85   GLN A HG2  1  
ATOM   1336  H HG3  . GLN A 1 85  ? -16.333 -9.058  4.354   1.00 1.03  ? 85   GLN A HG3  1  
ATOM   1337  H HE21 . GLN A 1 85  ? -18.798 -10.563 4.125   1.00 1.78  ? 85   GLN A HE21 1  
ATOM   1338  H HE22 . GLN A 1 85  ? -18.975 -10.953 2.444   1.00 1.99  ? 85   GLN A HE22 1  
ATOM   1339  N N    . VAL A 1 86  ? -12.074 -9.666  4.311   1.00 0.58  ? 86   VAL A N    1  
ATOM   1340  C CA   . VAL A 1 86  ? -10.755 -9.882  3.795   1.00 0.62  ? 86   VAL A CA   1  
ATOM   1341  C C    . VAL A 1 86  ? -9.691  -9.305  4.708   1.00 0.55  ? 86   VAL A C    1  
ATOM   1342  O O    . VAL A 1 86  ? -8.692  -9.961  4.992   1.00 0.59  ? 86   VAL A O    1  
ATOM   1343  C CB   . VAL A 1 86  ? -10.657 -9.303  2.393   1.00 0.70  ? 86   VAL A CB   1  
ATOM   1344  C CG1  . VAL A 1 86  ? -11.401 -8.013  2.314   1.00 1.13  ? 86   VAL A CG1  1  
ATOM   1345  C CG2  . VAL A 1 86  ? -9.218  -9.157  1.953   1.00 1.30  ? 86   VAL A CG2  1  
ATOM   1346  H H    . VAL A 1 86  ? -12.573 -8.875  4.024   1.00 0.55  ? 86   VAL A H    1  
ATOM   1347  H HA   . VAL A 1 86  ? -10.614 -10.934 3.715   1.00 0.70  ? 86   VAL A HA   1  
ATOM   1348  H HB   . VAL A 1 86  ? -11.145 -9.975  1.741   1.00 1.43  ? 86   VAL A HB   1  
ATOM   1349  H HG11 . VAL A 1 86  ? -10.908 -7.281  2.930   1.00 1.61  ? 86   VAL A HG11 1  
ATOM   1350  H HG12 . VAL A 1 86  ? -12.409 -8.181  2.690   1.00 1.74  ? 86   VAL A HG12 1  
ATOM   1351  H HG13 . VAL A 1 86  ? -11.437 -7.675  1.291   1.00 1.76  ? 86   VAL A HG13 1  
ATOM   1352  H HG21 . VAL A 1 86  ? -8.737  -8.386  2.537   1.00 1.79  ? 86   VAL A HG21 1  
ATOM   1353  H HG22 . VAL A 1 86  ? -9.190  -8.894  0.905   1.00 1.90  ? 86   VAL A HG22 1  
ATOM   1354  H HG23 . VAL A 1 86  ? -8.703  -10.097 2.104   1.00 1.83  ? 86   VAL A HG23 1  
ATOM   1355  N N    . VAL A 1 87  ? -9.922  -8.091  5.185   1.00 0.51  ? 87   VAL A N    1  
ATOM   1356  C CA   . VAL A 1 87  ? -8.984  -7.448  6.107   1.00 0.51  ? 87   VAL A CA   1  
ATOM   1357  C C    . VAL A 1 87  ? -8.878  -8.264  7.392   1.00 0.56  ? 87   VAL A C    1  
ATOM   1358  O O    . VAL A 1 87  ? -7.885  -8.213  8.116   1.00 0.60  ? 87   VAL A O    1  
ATOM   1359  C CB   . VAL A 1 87  ? -9.399  -5.997  6.446   1.00 0.54  ? 87   VAL A CB   1  
ATOM   1360  C CG1  . VAL A 1 87  ? -10.614 -5.950  7.360   1.00 0.75  ? 87   VAL A CG1  1  
ATOM   1361  C CG2  . VAL A 1 87  ? -8.239  -5.251  7.071   1.00 0.85  ? 87   VAL A CG2  1  
ATOM   1362  H H    . VAL A 1 87  ? -10.741 -7.618  4.907   1.00 0.50  ? 87   VAL A H    1  
ATOM   1363  H HA   . VAL A 1 87  ? -8.014  -7.423  5.631   1.00 0.53  ? 87   VAL A HA   1  
ATOM   1364  H HB   . VAL A 1 87  ? -9.660  -5.503  5.526   1.00 0.77  ? 87   VAL A HB   1  
ATOM   1365  H HG11 . VAL A 1 87  ? -10.390 -6.463  8.283   1.00 1.28  ? 87   VAL A HG11 1  
ATOM   1366  H HG12 . VAL A 1 87  ? -11.449 -6.432  6.872   1.00 1.30  ? 87   VAL A HG12 1  
ATOM   1367  H HG13 . VAL A 1 87  ? -10.865 -4.921  7.570   1.00 1.40  ? 87   VAL A HG13 1  
ATOM   1368  H HG21 . VAL A 1 87  ? -7.932  -5.760  7.973   1.00 1.36  ? 87   VAL A HG21 1  
ATOM   1369  H HG22 . VAL A 1 87  ? -8.547  -4.245  7.312   1.00 1.39  ? 87   VAL A HG22 1  
ATOM   1370  H HG23 . VAL A 1 87  ? -7.415  -5.221  6.376   1.00 1.43  ? 87   VAL A HG23 1  
ATOM   1371  N N    . ASN A 1 88  ? -9.923  -9.029  7.638   1.00 0.61  ? 88   ASN A N    1  
ATOM   1372  C CA   . ASN A 1 88  ? -9.992  -9.934  8.772   1.00 0.71  ? 88   ASN A CA   1  
ATOM   1373  C C    . ASN A 1 88  ? -8.946  -11.034 8.654   1.00 0.78  ? 88   ASN A C    1  
ATOM   1374  O O    . ASN A 1 88  ? -8.189  -11.292 9.591   1.00 0.91  ? 88   ASN A O    1  
ATOM   1375  C CB   . ASN A 1 88  ? -11.391 -10.529 8.839   1.00 0.73  ? 88   ASN A CB   1  
ATOM   1376  C CG   . ASN A 1 88  ? -12.176 -10.023 10.024  1.00 0.78  ? 88   ASN A CG   1  
ATOM   1377  O OD1  . ASN A 1 88  ? -12.187 -10.643 11.086  1.00 0.87  ? 88   ASN A OD1  1  
ATOM   1378  N ND2  . ASN A 1 88  ? -12.830 -8.888  9.857   1.00 0.73  ? 88   ASN A ND2  1  
ATOM   1379  H H    . ASN A 1 88  ? -10.695 -8.971  7.027   1.00 0.61  ? 88   ASN A H    1  
ATOM   1380  H HA   . ASN A 1 88  ? -9.807  -9.365  9.668   1.00 0.76  ? 88   ASN A HA   1  
ATOM   1381  H HB2  . ASN A 1 88  ? -11.919 -10.258 7.939   1.00 0.68  ? 88   ASN A HB2  1  
ATOM   1382  H HB3  . ASN A 1 88  ? -11.326 -11.600 8.898   1.00 0.79  ? 88   ASN A HB3  1  
ATOM   1383  H HD21 . ASN A 1 88  ? -12.772 -8.441  8.981   1.00 0.66  ? 88   ASN A HD21 1  
ATOM   1384  H HD22 . ASN A 1 88  ? -13.344 -8.534  10.611  1.00 0.78  ? 88   ASN A HD22 1  
ATOM   1385  N N    . GLU A 1 89  ? -8.886  -11.653 7.484   1.00 0.75  ? 89   GLU A N    1  
ATOM   1386  C CA   . GLU A 1 89  ? -7.923  -12.704 7.215   1.00 0.84  ? 89   GLU A CA   1  
ATOM   1387  C C    . GLU A 1 89  ? -6.555  -12.102 7.159   1.00 0.82  ? 89   GLU A C    1  
ATOM   1388  O O    . GLU A 1 89  ? -5.581  -12.623 7.704   1.00 0.98  ? 89   GLU A O    1  
ATOM   1389  C CB   . GLU A 1 89  ? -8.187  -13.306 5.856   1.00 0.87  ? 89   GLU A CB   1  
ATOM   1390  C CG   . GLU A 1 89  ? -9.580  -13.813 5.651   1.00 1.25  ? 89   GLU A CG   1  
ATOM   1391  C CD   . GLU A 1 89  ? -9.958  -14.921 6.599   1.00 2.21  ? 89   GLU A CD   1  
ATOM   1392  O OE1  . GLU A 1 89  ? -10.240 -14.621 7.774   1.00 2.58  ? 89   GLU A OE1  1  
ATOM   1393  O OE2  . GLU A 1 89  ? -9.960  -16.094 6.177   1.00 2.87  ? 89   GLU A OE2  1  
ATOM   1394  H H    . GLU A 1 89  ? -9.485  -11.374 6.765   1.00 0.71  ? 89   GLU A H    1  
ATOM   1395  H HA   . GLU A 1 89  ? -7.978  -13.460 7.982   1.00 0.91  ? 89   GLU A HA   1  
ATOM   1396  H HB2  . GLU A 1 89  ? -8.001  -12.549 5.109   1.00 1.01  ? 89   GLU A HB2  1  
ATOM   1397  H HB3  . GLU A 1 89  ? -7.502  -14.120 5.694   1.00 1.09  ? 89   GLU A HB3  1  
ATOM   1398  H HG2  . GLU A 1 89  ? -10.264 -12.993 5.768   1.00 1.39  ? 89   GLU A HG2  1  
ATOM   1399  H HG3  . GLU A 1 89  ? -9.639  -14.187 4.638   1.00 1.35  ? 89   GLU A HG3  1  
ATOM   1400  N N    . LEU A 1 90  ? -6.532  -10.977 6.478   1.00 0.69  ? 90   LEU A N    1  
ATOM   1401  C CA   . LEU A 1 90  ? -5.341  -10.269 6.153   1.00 0.64  ? 90   LEU A CA   1  
ATOM   1402  C C    . LEU A 1 90  ? -4.512  -9.957  7.406   1.00 0.70  ? 90   LEU A C    1  
ATOM   1403  O O    . LEU A 1 90  ? -3.298  -9.823  7.339   1.00 0.80  ? 90   LEU A O    1  
ATOM   1404  C CB   . LEU A 1 90  ? -5.798  -9.001  5.466   1.00 0.56  ? 90   LEU A CB   1  
ATOM   1405  C CG   . LEU A 1 90  ? -4.815  -8.293  4.556   1.00 0.67  ? 90   LEU A CG   1  
ATOM   1406  C CD1  . LEU A 1 90  ? -4.079  -9.243  3.631   1.00 1.25  ? 90   LEU A CD1  1  
ATOM   1407  C CD2  . LEU A 1 90  ? -5.599  -7.293  3.752   1.00 1.28  ? 90   LEU A CD2  1  
ATOM   1408  H H    . LEU A 1 90  ? -7.389  -10.597 6.158   1.00 0.65  ? 90   LEU A H    1  
ATOM   1409  H HA   . LEU A 1 90  ? -4.782  -10.866 5.456   1.00 0.66  ? 90   LEU A HA   1  
ATOM   1410  H HB2  . LEU A 1 90  ? -6.670  -9.243  4.877   1.00 0.73  ? 90   LEU A HB2  1  
ATOM   1411  H HB3  . LEU A 1 90  ? -6.099  -8.303  6.234   1.00 0.77  ? 90   LEU A HB3  1  
ATOM   1412  H HG   . LEU A 1 90  ? -4.095  -7.769  5.142   1.00 1.55  ? 90   LEU A HG   1  
ATOM   1413  H HD11 . LEU A 1 90  ? -3.638  -10.039 4.209   1.00 1.79  ? 90   LEU A HD11 1  
ATOM   1414  H HD12 . LEU A 1 90  ? -3.294  -8.696  3.119   1.00 1.83  ? 90   LEU A HD12 1  
ATOM   1415  H HD13 . LEU A 1 90  ? -4.767  -9.652  2.908   1.00 1.78  ? 90   LEU A HD13 1  
ATOM   1416  H HD21 . LEU A 1 90  ? -4.992  -6.912  2.948   1.00 1.76  ? 90   LEU A HD21 1  
ATOM   1417  H HD22 . LEU A 1 90  ? -5.910  -6.484  4.393   1.00 1.82  ? 90   LEU A HD22 1  
ATOM   1418  H HD23 . LEU A 1 90  ? -6.473  -7.790  3.349   1.00 1.92  ? 90   LEU A HD23 1  
ATOM   1419  N N    . PHE A 1 91  ? -5.174  -9.890  8.559   1.00 0.73  ? 91   PHE A N    1  
ATOM   1420  C CA   . PHE A 1 91  ? -4.519  -9.455  9.786   1.00 0.82  ? 91   PHE A CA   1  
ATOM   1421  C C    . PHE A 1 91  ? -4.133  -10.646 10.647  1.00 0.91  ? 91   PHE A C    1  
ATOM   1422  O O    . PHE A 1 91  ? -3.095  -10.656 11.306  1.00 1.06  ? 91   PHE A O    1  
ATOM   1423  C CB   . PHE A 1 91  ? -5.448  -8.525  10.570  1.00 0.88  ? 91   PHE A CB   1  
ATOM   1424  C CG   . PHE A 1 91  ? -4.861  -7.992  11.848  1.00 1.04  ? 91   PHE A CG   1  
ATOM   1425  C CD1  . PHE A 1 91  ? -4.073  -6.854  11.843  1.00 1.70  ? 91   PHE A CD1  1  
ATOM   1426  C CD2  . PHE A 1 91  ? -5.101  -8.628  13.058  1.00 1.26  ? 91   PHE A CD2  1  
ATOM   1427  C CE1  . PHE A 1 91  ? -3.534  -6.360  13.015  1.00 2.30  ? 91   PHE A CE1  1  
ATOM   1428  C CE2  . PHE A 1 91  ? -4.566  -8.140  14.233  1.00 1.75  ? 91   PHE A CE2  1  
ATOM   1429  C CZ   . PHE A 1 91  ? -3.780  -7.004  14.211  1.00 2.23  ? 91   PHE A CZ   1  
ATOM   1430  H H    . PHE A 1 91  ? -6.117  -10.172 8.594   1.00 0.72  ? 91   PHE A H    1  
ATOM   1431  H HA   . PHE A 1 91  ? -3.630  -8.920  9.516   1.00 0.82  ? 91   PHE A HA   1  
ATOM   1432  H HB2  . PHE A 1 91  ? -5.708  -7.685  9.950   1.00 1.16  ? 91   PHE A HB2  1  
ATOM   1433  H HB3  . PHE A 1 91  ? -6.344  -9.066  10.821  1.00 1.18  ? 91   PHE A HB3  1  
ATOM   1434  H HD1  . PHE A 1 91  ? -3.878  -6.348  10.908  1.00 1.96  ? 91   PHE A HD1  1  
ATOM   1435  H HD2  . PHE A 1 91  ? -5.715  -9.517  13.076  1.00 1.47  ? 91   PHE A HD2  1  
ATOM   1436  H HE1  . PHE A 1 91  ? -2.921  -5.471  12.997  1.00 2.97  ? 91   PHE A HE1  1  
ATOM   1437  H HE2  . PHE A 1 91  ? -4.758  -8.645  15.168  1.00 2.04  ? 91   PHE A HE2  1  
ATOM   1438  H HZ   . PHE A 1 91  ? -3.360  -6.621  15.129  1.00 2.76  ? 91   PHE A HZ   1  
ATOM   1439  N N    . ARG A 1 92  ? -4.969  -11.651 10.625  1.00 0.96  ? 92   ARG A N    1  
ATOM   1440  C CA   . ARG A 1 92  ? -4.808  -12.787 11.510  1.00 1.11  ? 92   ARG A CA   1  
ATOM   1441  C C    . ARG A 1 92  ? -3.719  -13.727 11.015  1.00 0.83  ? 92   ARG A C    1  
ATOM   1442  O O    . ARG A 1 92  ? -2.982  -14.320 11.800  1.00 0.90  ? 92   ARG A O    1  
ATOM   1443  C CB   . ARG A 1 92  ? -6.129  -13.530 11.584  1.00 1.53  ? 92   ARG A CB   1  
ATOM   1444  C CG   . ARG A 1 92  ? -6.484  -14.212 10.283  1.00 1.62  ? 92   ARG A CG   1  
ATOM   1445  C CD   . ARG A 1 92  ? -7.958  -14.482 10.172  1.00 2.21  ? 92   ARG A CD   1  
ATOM   1446  N NE   . ARG A 1 92  ? -8.406  -15.504 11.121  1.00 3.27  ? 92   ARG A NE   1  
ATOM   1447  C CZ   . ARG A 1 92  ? -9.499  -16.253 10.963  1.00 4.05  ? 92   ARG A CZ   1  
ATOM   1448  N NH1  . ARG A 1 92  ? -10.233 -16.155 9.863   1.00 3.96  ? 92   ARG A NH1  1  
ATOM   1449  N NH2  . ARG A 1 92  ? -9.853  -17.112 11.909  1.00 5.06  ? 92   ARG A NH2  1  
ATOM   1450  H H    . ARG A 1 92  ? -5.720  -11.634 9.992   1.00 0.99  ? 92   ARG A H    1  
ATOM   1451  H HA   . ARG A 1 92  ? -4.551  -12.420 12.487  1.00 1.30  ? 92   ARG A HA   1  
ATOM   1452  H HB2  . ARG A 1 92  ? -6.079  -14.273 12.365  1.00 1.76  ? 92   ARG A HB2  1  
ATOM   1453  H HB3  . ARG A 1 92  ? -6.903  -12.823 11.811  1.00 1.84  ? 92   ARG A HB3  1  
ATOM   1454  H HG2  . ARG A 1 92  ? -6.185  -13.578 9.463   1.00 1.69  ? 92   ARG A HG2  1  
ATOM   1455  H HG3  . ARG A 1 92  ? -5.952  -15.151 10.225  1.00 1.81  ? 92   ARG A HG3  1  
ATOM   1456  H HD2  . ARG A 1 92  ? -8.490  -13.558 10.363  1.00 2.25  ? 92   ARG A HD2  1  
ATOM   1457  H HD3  . ARG A 1 92  ? -8.154  -14.804 9.168   1.00 2.27  ? 92   ARG A HD3  1  
ATOM   1458  H HE   . ARG A 1 92  ? -7.861  -15.628 11.937  1.00 3.54  ? 92   ARG A HE   1  
ATOM   1459  H HH11 . ARG A 1 92  ? -9.972  -15.508 9.128   1.00 3.34  ? 92   ARG A HH11 1  
ATOM   1460  H HH12 . ARG A 1 92  ? -11.052 -16.728 9.747   1.00 4.64  ? 92   ARG A HH12 1  
ATOM   1461  H HH21 . ARG A 1 92  ? -9.299  -17.201 12.746  1.00 5.28  ? 92   ARG A HH21 1  
ATOM   1462  H HH22 . ARG A 1 92  ? -10.682 -17.675 11.800  1.00 5.67  ? 92   ARG A HH22 1  
ATOM   1463  N N    . ASP A 1 93  ? -3.624  -13.843 9.704   1.00 0.84  ? 93   ASP A N    1  
ATOM   1464  C CA   . ASP A 1 93  ? -2.793  -14.862 9.087   1.00 1.10  ? 93   ASP A CA   1  
ATOM   1465  C C    . ASP A 1 93  ? -1.387  -14.362 8.765   1.00 1.31  ? 93   ASP A C    1  
ATOM   1466  O O    . ASP A 1 93  ? -0.698  -14.954 7.934   1.00 1.88  ? 93   ASP A O    1  
ATOM   1467  C CB   . ASP A 1 93  ? -3.473  -15.380 7.813   1.00 1.65  ? 93   ASP A CB   1  
ATOM   1468  C CG   . ASP A 1 93  ? -2.885  -16.692 7.325   1.00 2.40  ? 93   ASP A CG   1  
ATOM   1469  O OD1  . ASP A 1 93  ? -2.952  -17.690 8.077   1.00 2.58  ? 93   ASP A OD1  1  
ATOM   1470  O OD2  . ASP A 1 93  ? -2.368  -16.738 6.189   1.00 3.12  ? 93   ASP A OD2  1  
ATOM   1471  H H    . ASP A 1 93  ? -4.156  -13.247 9.136   1.00 0.93  ? 93   ASP A H    1  
ATOM   1472  H HA   . ASP A 1 93  ? -2.710  -15.680 9.785   1.00 1.08  ? 93   ASP A HA   1  
ATOM   1473  H HB2  . ASP A 1 93  ? -4.523  -15.532 8.011   1.00 1.91  ? 93   ASP A HB2  1  
ATOM   1474  H HB3  . ASP A 1 93  ? -3.363  -14.644 7.030   1.00 1.73  ? 93   ASP A HB3  1  
ATOM   1475  N N    . GLY A 1 94  ? -0.926  -13.293 9.408   1.00 1.11  ? 94   GLY A N    1  
ATOM   1476  C CA   . GLY A 1 94  ? 0.451   -12.920 9.167   1.00 1.69  ? 94   GLY A CA   1  
ATOM   1477  C C    . GLY A 1 94  ? 0.687   -11.476 8.769   1.00 1.62  ? 94   GLY A C    1  
ATOM   1478  O O    . GLY A 1 94  ? 1.041   -11.213 7.625   1.00 2.31  ? 94   GLY A O    1  
ATOM   1479  H H    . GLY A 1 94  ? -1.500  -12.782 10.015  1.00 0.79  ? 94   GLY A H    1  
ATOM   1480  H HA2  . GLY A 1 94  ? 1.019   -13.122 10.061  1.00 1.93  ? 94   GLY A HA2  1  
ATOM   1481  H HA3  . GLY A 1 94  ? 0.820   -13.556 8.379   1.00 2.14  ? 94   GLY A HA3  1  
ATOM   1482  N N    . VAL A 1 95  ? 0.478   -10.525 9.671   1.00 0.85  ? 95   VAL A N    1  
ATOM   1483  C CA   . VAL A 1 95  ? 0.747   -9.131  9.338   1.00 0.67  ? 95   VAL A CA   1  
ATOM   1484  C C    . VAL A 1 95  ? 2.240   -8.847  9.280   1.00 0.62  ? 95   VAL A C    1  
ATOM   1485  O O    . VAL A 1 95  ? 2.913   -8.681  10.296  1.00 0.61  ? 95   VAL A O    1  
ATOM   1486  C CB   . VAL A 1 95  ? 0.090   -8.136  10.317  1.00 0.59  ? 95   VAL A CB   1  
ATOM   1487  C CG1  . VAL A 1 95  ? 0.420   -6.700  9.919   1.00 0.84  ? 95   VAL A CG1  1  
ATOM   1488  C CG2  . VAL A 1 95  ? -1.409  -8.347  10.368  1.00 1.06  ? 95   VAL A CG2  1  
ATOM   1489  H H    . VAL A 1 95  ? 0.139   -10.760 10.569  1.00 0.60  ? 95   VAL A H    1  
ATOM   1490  H HA   . VAL A 1 95  ? 0.352   -8.968  8.358   1.00 0.79  ? 95   VAL A HA   1  
ATOM   1491  H HB   . VAL A 1 95  ? 0.493   -8.314  11.304  1.00 0.99  ? 95   VAL A HB   1  
ATOM   1492  H HG11 . VAL A 1 95  ? 0.041   -6.505  8.926   1.00 1.32  ? 95   VAL A HG11 1  
ATOM   1493  H HG12 . VAL A 1 95  ? 1.492   -6.565  9.925   1.00 1.50  ? 95   VAL A HG12 1  
ATOM   1494  H HG13 . VAL A 1 95  ? -0.035  -6.013  10.620  1.00 1.39  ? 95   VAL A HG13 1  
ATOM   1495  H HG21 . VAL A 1 95  ? -1.849  -7.653  11.070  1.00 1.40  ? 95   VAL A HG21 1  
ATOM   1496  H HG22 . VAL A 1 95  ? -1.619  -9.359  10.684  1.00 1.68  ? 95   VAL A HG22 1  
ATOM   1497  H HG23 . VAL A 1 95  ? -1.831  -8.182  9.388   1.00 1.61  ? 95   VAL A HG23 1  
ATOM   1498  N N    . ASN A 1 96  ? 2.748   -8.855  8.062   1.00 0.76  ? 96   ASN A N    1  
ATOM   1499  C CA   . ASN A 1 96  ? 4.153   -8.597  7.797   1.00 0.86  ? 96   ASN A CA   1  
ATOM   1500  C C    . ASN A 1 96  ? 4.282   -7.278  7.052   1.00 0.72  ? 96   ASN A C    1  
ATOM   1501  O O    . ASN A 1 96  ? 3.296   -6.554  6.903   1.00 0.62  ? 96   ASN A O    1  
ATOM   1502  C CB   . ASN A 1 96  ? 4.773   -9.739  6.971   1.00 1.17  ? 96   ASN A CB   1  
ATOM   1503  C CG   . ASN A 1 96  ? 4.257   -11.113 7.374   1.00 1.47  ? 96   ASN A CG   1  
ATOM   1504  O OD1  . ASN A 1 96  ? 4.242   -12.044 6.570   1.00 2.12  ? 96   ASN A OD1  1  
ATOM   1505  N ND2  . ASN A 1 96  ? 3.825   -11.247 8.618   1.00 1.67  ? 96   ASN A ND2  1  
ATOM   1506  H H    . ASN A 1 96  ? 2.153   -9.036  7.311   1.00 0.86  ? 96   ASN A H    1  
ATOM   1507  H HA   . ASN A 1 96  ? 4.666   -8.520  8.744   1.00 0.91  ? 96   ASN A HA   1  
ATOM   1508  H HB2  . ASN A 1 96  ? 4.544   -9.584  5.928   1.00 1.53  ? 96   ASN A HB2  1  
ATOM   1509  H HB3  . ASN A 1 96  ? 5.845   -9.726  7.103   1.00 1.33  ? 96   ASN A HB3  1  
ATOM   1510  H HD21 . ASN A 1 96  ? 3.879   -10.466 9.211   1.00 1.78  ? 96   ASN A HD21 1  
ATOM   1511  H HD22 . ASN A 1 96  ? 3.406   -12.087 8.877   1.00 2.08  ? 96   ASN A HD22 1  
ATOM   1512  N N    . TRP A 1 97  ? 5.478   -6.981  6.566   1.00 0.77  ? 97   TRP A N    1  
ATOM   1513  C CA   . TRP A 1 97  ? 5.722   -5.744  5.833   1.00 0.72  ? 97   TRP A CA   1  
ATOM   1514  C C    . TRP A 1 97  ? 4.905   -5.712  4.542   1.00 0.63  ? 97   TRP A C    1  
ATOM   1515  O O    . TRP A 1 97  ? 4.012   -4.877  4.378   1.00 0.59  ? 97   TRP A O    1  
ATOM   1516  C CB   . TRP A 1 97  ? 7.212   -5.602  5.505   1.00 0.86  ? 97   TRP A CB   1  
ATOM   1517  C CG   . TRP A 1 97  ? 8.100   -5.598  6.713   1.00 0.68  ? 97   TRP A CG   1  
ATOM   1518  C CD1  . TRP A 1 97  ? 8.514   -4.507  7.422   1.00 0.83  ? 97   TRP A CD1  1  
ATOM   1519  C CD2  . TRP A 1 97  ? 8.692   -6.738  7.348   1.00 1.43  ? 97   TRP A CD2  1  
ATOM   1520  N NE1  . TRP A 1 97  ? 9.328   -4.901  8.457   1.00 0.99  ? 97   TRP A NE1  1  
ATOM   1521  C CE2  . TRP A 1 97  ? 9.452   -6.264  8.433   1.00 1.60  ? 97   TRP A CE2  1  
ATOM   1522  C CE3  . TRP A 1 97  ? 8.653   -8.114  7.102   1.00 2.29  ? 97   TRP A CE3  1  
ATOM   1523  C CZ2  . TRP A 1 97  ? 10.165  -7.117  9.270   1.00 2.54  ? 97   TRP A CZ2  1  
ATOM   1524  C CZ3  . TRP A 1 97  ? 9.361   -8.958  7.935   1.00 3.24  ? 97   TRP A CZ3  1  
ATOM   1525  C CH2  . TRP A 1 97  ? 10.108  -8.456  9.007   1.00 3.34  ? 97   TRP A CH2  1  
ATOM   1526  H H    . TRP A 1 97  ? 6.217   -7.612  6.692   1.00 0.88  ? 97   TRP A H    1  
ATOM   1527  H HA   . TRP A 1 97  ? 5.418   -4.920  6.460   1.00 0.72  ? 97   TRP A HA   1  
ATOM   1528  H HB2  . TRP A 1 97  ? 7.514   -6.425  4.875   1.00 1.09  ? 97   TRP A HB2  1  
ATOM   1529  H HB3  . TRP A 1 97  ? 7.366   -4.675  4.974   1.00 1.26  ? 97   TRP A HB3  1  
ATOM   1530  H HD1  . TRP A 1 97  ? 8.237   -3.489  7.190   1.00 1.43  ? 97   TRP A HD1  1  
ATOM   1531  H HE1  . TRP A 1 97  ? 9.752   -4.302  9.111   1.00 1.14  ? 97   TRP A HE1  1  
ATOM   1532  H HE3  . TRP A 1 97  ? 8.082   -8.518  6.280   1.00 2.29  ? 97   TRP A HE3  1  
ATOM   1533  H HZ2  . TRP A 1 97  ? 10.745  -6.747  10.102  1.00 2.71  ? 97   TRP A HZ2  1  
ATOM   1534  H HZ3  . TRP A 1 97  ? 9.343   -10.023 7.761   1.00 3.95  ? 97   TRP A HZ3  1  
ATOM   1535  H HH2  . TRP A 1 97  ? 10.646  -9.154  9.632   1.00 4.12  ? 97   TRP A HH2  1  
ATOM   1536  N N    . GLY A 1 98  ? 5.199   -6.647  3.645   1.00 0.69  ? 98   GLY A N    1  
ATOM   1537  C CA   . GLY A 1 98  ? 4.534   -6.687  2.353   1.00 0.69  ? 98   GLY A CA   1  
ATOM   1538  C C    . GLY A 1 98  ? 3.061   -7.026  2.463   1.00 0.62  ? 98   GLY A C    1  
ATOM   1539  O O    . GLY A 1 98  ? 2.263   -6.642  1.616   1.00 0.61  ? 98   GLY A O    1  
ATOM   1540  H H    . GLY A 1 98  ? 5.881   -7.323  3.863   1.00 0.78  ? 98   GLY A H    1  
ATOM   1541  H HA2  . GLY A 1 98  ? 4.633   -5.722  1.881   1.00 0.69  ? 98   GLY A HA2  1  
ATOM   1542  H HA3  . GLY A 1 98  ? 5.018   -7.429  1.737   1.00 0.80  ? 98   GLY A HA3  1  
ATOM   1543  N N    . ARG A 1 99  ? 2.701   -7.741  3.513   1.00 0.65  ? 99   ARG A N    1  
ATOM   1544  C CA   . ARG A 1 99  ? 1.317   -8.110  3.761   1.00 0.67  ? 99   ARG A CA   1  
ATOM   1545  C C    . ARG A 1 99  ? 0.445   -6.857  3.866   1.00 0.53  ? 99   ARG A C    1  
ATOM   1546  O O    . ARG A 1 99  ? -0.674  -6.821  3.357   1.00 0.55  ? 99   ARG A O    1  
ATOM   1547  C CB   . ARG A 1 99  ? 1.246   -8.928  5.053   1.00 0.82  ? 99   ARG A CB   1  
ATOM   1548  C CG   . ARG A 1 99  ? 0.019   -9.816  5.170   1.00 1.04  ? 99   ARG A CG   1  
ATOM   1549  C CD   . ARG A 1 99  ? -1.251  -9.001  5.273   1.00 1.50  ? 99   ARG A CD   1  
ATOM   1550  N NE   . ARG A 1 99  ? -1.306  -8.191  6.493   1.00 2.48  ? 99   ARG A NE   1  
ATOM   1551  C CZ   . ARG A 1 99  ? -1.941  -7.021  6.580   1.00 3.32  ? 99   ARG A CZ   1  
ATOM   1552  N NH1  . ARG A 1 99  ? -2.460  -6.464  5.496   1.00 3.44  ? 99   ARG A NH1  1  
ATOM   1553  N NH2  . ARG A 1 99  ? -2.037  -6.398  7.747   1.00 4.24  ? 99   ARG A NH2  1  
ATOM   1554  H H    . ARG A 1 99  ? 3.388   -8.038  4.140   1.00 0.70  ? 99   ARG A H    1  
ATOM   1555  H HA   . ARG A 1 99  ? 0.962   -8.714  2.937   1.00 0.74  ? 99   ARG A HA   1  
ATOM   1556  H HB2  . ARG A 1 99  ? 2.122   -9.557  5.116   1.00 1.58  ? 99   ARG A HB2  1  
ATOM   1557  H HB3  . ARG A 1 99  ? 1.246   -8.244  5.888   1.00 1.33  ? 99   ARG A HB3  1  
ATOM   1558  H HG2  . ARG A 1 99  ? -0.042  -10.447 4.297   1.00 1.48  ? 99   ARG A HG2  1  
ATOM   1559  H HG3  . ARG A 1 99  ? 0.115   -10.430 6.054   1.00 1.63  ? 99   ARG A HG3  1  
ATOM   1560  H HD2  . ARG A 1 99  ? -1.298  -8.341  4.419   1.00 1.65  ? 99   ARG A HD2  1  
ATOM   1561  H HD3  . ARG A 1 99  ? -2.098  -9.672  5.258   1.00 1.57  ? 99   ARG A HD3  1  
ATOM   1562  H HE   . ARG A 1 99  ? -0.889  -8.569  7.298   1.00 2.71  ? 99   ARG A HE   1  
ATOM   1563  H HH11 . ARG A 1 99  ? -2.371  -6.922  4.605   1.00 2.93  ? 99   ARG A HH11 1  
ATOM   1564  H HH12 . ARG A 1 99  ? -2.950  -5.593  5.559   1.00 4.20  ? 99   ARG A HH12 1  
ATOM   1565  H HH21 . ARG A 1 99  ? -1.634  -6.804  8.570   1.00 4.35  ? 99   ARG A HH21 1  
ATOM   1566  H HH22 . ARG A 1 99  ? -2.516  -5.521  7.813   1.00 4.91  ? 99   ARG A HH22 1  
ATOM   1567  N N    . ILE A 1 100 ? 0.964   -5.829  4.517   1.00 0.44  ? 100  ILE A N    1  
ATOM   1568  C CA   . ILE A 1 100 ? 0.193   -4.617  4.755   1.00 0.36  ? 100  ILE A CA   1  
ATOM   1569  C C    . ILE A 1 100 ? -0.090  -3.864  3.455   1.00 0.33  ? 100  ILE A C    1  
ATOM   1570  O O    . ILE A 1 100 ? -1.123  -3.200  3.324   1.00 0.34  ? 100  ILE A O    1  
ATOM   1571  C CB   . ILE A 1 100 ? 0.897   -3.713  5.789   1.00 0.32  ? 100  ILE A CB   1  
ATOM   1572  C CG1  . ILE A 1 100 ? 0.769   -4.354  7.172   1.00 0.33  ? 100  ILE A CG1  1  
ATOM   1573  C CG2  . ILE A 1 100 ? 0.317   -2.305  5.786   1.00 0.34  ? 100  ILE A CG2  1  
ATOM   1574  C CD1  . ILE A 1 100 ? 1.458   -3.590  8.273   1.00 0.34  ? 100  ILE A CD1  1  
ATOM   1575  H H    . ILE A 1 100 ? 1.893   -5.879  4.838   1.00 0.47  ? 100  ILE A H    1  
ATOM   1576  H HA   . ILE A 1 100 ? -0.754  -4.922  5.177   1.00 0.43  ? 100  ILE A HA   1  
ATOM   1577  H HB   . ILE A 1 100 ? 1.941   -3.647  5.528   1.00 0.34  ? 100  ILE A HB   1  
ATOM   1578  H HG12 . ILE A 1 100 ? -0.277  -4.426  7.430   1.00 0.37  ? 100  ILE A HG12 1  
ATOM   1579  H HG13 . ILE A 1 100 ? 1.192   -5.345  7.141   1.00 0.35  ? 100  ILE A HG13 1  
ATOM   1580  H HG21 . ILE A 1 100 ? 0.431   -1.874  4.802   1.00 0.97  ? 100  ILE A HG21 1  
ATOM   1581  H HG22 . ILE A 1 100 ? 0.843   -1.700  6.509   1.00 1.06  ? 100  ILE A HG22 1  
ATOM   1582  H HG23 . ILE A 1 100 ? -0.730  -2.347  6.042   1.00 1.06  ? 100  ILE A HG23 1  
ATOM   1583  H HD11 . ILE A 1 100 ? 2.518   -3.545  8.073   1.00 1.05  ? 100  ILE A HD11 1  
ATOM   1584  H HD12 . ILE A 1 100 ? 1.288   -4.089  9.217   1.00 1.11  ? 100  ILE A HD12 1  
ATOM   1585  H HD13 . ILE A 1 100 ? 1.058   -2.588  8.320   1.00 1.07  ? 100  ILE A HD13 1  
ATOM   1586  N N    . VAL A 1 101 ? 0.794   -4.014  2.478   1.00 0.33  ? 101  VAL A N    1  
ATOM   1587  C CA   . VAL A 1 101 ? 0.590   -3.406  1.169   1.00 0.35  ? 101  VAL A CA   1  
ATOM   1588  C C    . VAL A 1 101 ? -0.647  -4.005  0.499   1.00 0.37  ? 101  VAL A C    1  
ATOM   1589  O O    . VAL A 1 101 ? -1.286  -3.377  -0.331  1.00 0.45  ? 101  VAL A O    1  
ATOM   1590  C CB   . VAL A 1 101 ? 1.815   -3.589  0.247   1.00 0.46  ? 101  VAL A CB   1  
ATOM   1591  C CG1  . VAL A 1 101 ? 3.086   -3.722  1.062   1.00 1.35  ? 101  VAL A CG1  1  
ATOM   1592  C CG2  . VAL A 1 101 ? 1.624   -4.762  -0.690  1.00 1.32  ? 101  VAL A CG2  1  
ATOM   1593  H H    . VAL A 1 101 ? 1.607   -4.537  2.642   1.00 0.36  ? 101  VAL A H    1  
ATOM   1594  H HA   . VAL A 1 101 ? 0.433   -2.348  1.313   1.00 0.36  ? 101  VAL A HA   1  
ATOM   1595  H HB   . VAL A 1 101 ? 1.917   -2.710  -0.358  1.00 1.36  ? 101  VAL A HB   1  
ATOM   1596  H HG11 . VAL A 1 101 ? 3.003   -4.577  1.716   1.00 1.85  ? 101  VAL A HG11 1  
ATOM   1597  H HG12 . VAL A 1 101 ? 3.231   -2.829  1.652   1.00 1.99  ? 101  VAL A HG12 1  
ATOM   1598  H HG13 . VAL A 1 101 ? 3.928   -3.855  0.398   1.00 1.94  ? 101  VAL A HG13 1  
ATOM   1599  H HG21 . VAL A 1 101 ? 1.470   -5.656  -0.111  1.00 1.92  ? 101  VAL A HG21 1  
ATOM   1600  H HG22 . VAL A 1 101 ? 2.496   -4.867  -1.314  1.00 1.70  ? 101  VAL A HG22 1  
ATOM   1601  H HG23 . VAL A 1 101 ? 0.757   -4.581  -1.311  1.00 2.03  ? 101  VAL A HG23 1  
ATOM   1602  N N    . ALA A 1 102 ? -0.983  -5.229  0.876   1.00 0.37  ? 102  ALA A N    1  
ATOM   1603  C CA   . ALA A 1 102 ? -2.167  -5.884  0.349   1.00 0.39  ? 102  ALA A CA   1  
ATOM   1604  C C    . ALA A 1 102 ? -3.415  -5.177  0.827   1.00 0.35  ? 102  ALA A C    1  
ATOM   1605  O O    . ALA A 1 102 ? -4.376  -4.985  0.082   1.00 0.34  ? 102  ALA A O    1  
ATOM   1606  C CB   . ALA A 1 102 ? -2.204  -7.327  0.792   1.00 0.44  ? 102  ALA A CB   1  
ATOM   1607  H H    . ALA A 1 102 ? -0.412  -5.705  1.517   1.00 0.42  ? 102  ALA A H    1  
ATOM   1608  H HA   . ALA A 1 102 ? -2.127  -5.856  -0.730  1.00 0.41  ? 102  ALA A HA   1  
ATOM   1609  H HB1  . ALA A 1 102 ? -3.034  -7.825  0.318   1.00 1.06  ? 102  ALA A HB1  1  
ATOM   1610  H HB2  . ALA A 1 102 ? -2.321  -7.369  1.865   1.00 1.03  ? 102  ALA A HB2  1  
ATOM   1611  H HB3  . ALA A 1 102 ? -1.280  -7.805  0.512   1.00 1.04  ? 102  ALA A HB3  1  
ATOM   1612  N N    . PHE A 1 103 ? -3.366  -4.776  2.081   1.00 0.35  ? 103  PHE A N    1  
ATOM   1613  C CA   . PHE A 1 103 ? -4.475  -4.118  2.731   1.00 0.34  ? 103  PHE A CA   1  
ATOM   1614  C C    . PHE A 1 103 ? -4.776  -2.779  2.070   1.00 0.31  ? 103  PHE A C    1  
ATOM   1615  O O    . PHE A 1 103 ? -5.928  -2.468  1.774   1.00 0.32  ? 103  PHE A O    1  
ATOM   1616  C CB   . PHE A 1 103 ? -4.147  -3.948  4.215   1.00 0.36  ? 103  PHE A CB   1  
ATOM   1617  C CG   . PHE A 1 103 ? -4.991  -2.924  4.919   1.00 0.62  ? 103  PHE A CG   1  
ATOM   1618  C CD1  . PHE A 1 103 ? -6.304  -3.194  5.257   1.00 0.67  ? 103  PHE A CD1  1  
ATOM   1619  C CD2  . PHE A 1 103 ? -4.463  -1.682  5.240   1.00 1.03  ? 103  PHE A CD2  1  
ATOM   1620  C CE1  . PHE A 1 103 ? -7.076  -2.247  5.901   1.00 1.09  ? 103  PHE A CE1  1  
ATOM   1621  C CE2  . PHE A 1 103 ? -5.230  -0.734  5.884   1.00 1.48  ? 103  PHE A CE2  1  
ATOM   1622  C CZ   . PHE A 1 103 ? -6.539  -1.017  6.215   1.00 1.49  ? 103  PHE A CZ   1  
ATOM   1623  H H    . PHE A 1 103 ? -2.537  -4.914  2.584   1.00 0.38  ? 103  PHE A H    1  
ATOM   1624  H HA   . PHE A 1 103 ? -5.340  -4.757  2.635   1.00 0.38  ? 103  PHE A HA   1  
ATOM   1625  H HB2  . PHE A 1 103 ? -4.288  -4.903  4.711   1.00 0.52  ? 103  PHE A HB2  1  
ATOM   1626  H HB3  . PHE A 1 103 ? -3.113  -3.651  4.312   1.00 0.60  ? 103  PHE A HB3  1  
ATOM   1627  H HD1  . PHE A 1 103 ? -6.727  -4.158  5.012   1.00 0.52  ? 103  PHE A HD1  1  
ATOM   1628  H HD2  . PHE A 1 103 ? -3.438  -1.460  4.981   1.00 1.05  ? 103  PHE A HD2  1  
ATOM   1629  H HE1  . PHE A 1 103 ? -8.101  -2.471  6.159   1.00 1.14  ? 103  PHE A HE1  1  
ATOM   1630  H HE2  . PHE A 1 103 ? -4.807  0.230   6.129   1.00 1.84  ? 103  PHE A HE2  1  
ATOM   1631  H HZ   . PHE A 1 103 ? -7.142  -0.275  6.719   1.00 1.84  ? 103  PHE A HZ   1  
ATOM   1632  N N    . PHE A 1 104 ? -3.737  -1.999  1.818   1.00 0.33  ? 104  PHE A N    1  
ATOM   1633  C CA   . PHE A 1 104 ? -3.926  -0.688  1.224   1.00 0.40  ? 104  PHE A CA   1  
ATOM   1634  C C    . PHE A 1 104 ? -4.120  -0.807  -0.293  1.00 0.39  ? 104  PHE A C    1  
ATOM   1635  O O    . PHE A 1 104 ? -4.654  0.098   -0.931  1.00 0.47  ? 104  PHE A O    1  
ATOM   1636  C CB   . PHE A 1 104 ? -2.758  0.246   1.603   1.00 0.56  ? 104  PHE A CB   1  
ATOM   1637  C CG   . PHE A 1 104 ? -1.710  0.438   0.543   1.00 0.97  ? 104  PHE A CG   1  
ATOM   1638  C CD1  . PHE A 1 104 ? -0.970  -0.627  0.070   1.00 1.47  ? 104  PHE A CD1  1  
ATOM   1639  C CD2  . PHE A 1 104 ? -1.458  1.695   0.035   1.00 1.79  ? 104  PHE A CD2  1  
ATOM   1640  C CE1  . PHE A 1 104 ? -0.005  -0.445  -0.897  1.00 2.61  ? 104  PHE A CE1  1  
ATOM   1641  C CE2  . PHE A 1 104 ? -0.493  1.886   -0.931  1.00 2.90  ? 104  PHE A CE2  1  
ATOM   1642  C CZ   . PHE A 1 104 ? 0.233   0.815   -1.397  1.00 3.29  ? 104  PHE A CZ   1  
ATOM   1643  H H    . PHE A 1 104 ? -2.832  -2.308  2.036   1.00 0.34  ? 104  PHE A H    1  
ATOM   1644  H HA   . PHE A 1 104 ? -4.836  -0.281  1.643   1.00 0.42  ? 104  PHE A HA   1  
ATOM   1645  H HB2  . PHE A 1 104 ? -3.157  1.219   1.839   1.00 1.36  ? 104  PHE A HB2  1  
ATOM   1646  H HB3  . PHE A 1 104 ? -2.265  -0.151  2.480   1.00 1.38  ? 104  PHE A HB3  1  
ATOM   1647  H HD1  . PHE A 1 104 ? -1.158  -1.616  0.460   1.00 1.21  ? 104  PHE A HD1  1  
ATOM   1648  H HD2  . PHE A 1 104 ? -2.026  2.539   0.401   1.00 1.71  ? 104  PHE A HD2  1  
ATOM   1649  H HE1  . PHE A 1 104 ? 0.567   -1.288  -1.257  1.00 3.05  ? 104  PHE A HE1  1  
ATOM   1650  H HE2  . PHE A 1 104 ? -0.307  2.876   -1.321  1.00 3.55  ? 104  PHE A HE2  1  
ATOM   1651  H HZ   . PHE A 1 104 ? 0.988   0.962   -2.154  1.00 4.21  ? 104  PHE A HZ   1  
ATOM   1652  N N    . SER A 1 105 ? -3.713  -1.946  -0.855  1.00 0.37  ? 105  SER A N    1  
ATOM   1653  C CA   . SER A 1 105 ? -3.872  -2.201  -2.283  1.00 0.44  ? 105  SER A CA   1  
ATOM   1654  C C    . SER A 1 105 ? -5.325  -2.527  -2.611  1.00 0.40  ? 105  SER A C    1  
ATOM   1655  O O    . SER A 1 105 ? -5.952  -1.840  -3.419  1.00 0.45  ? 105  SER A O    1  
ATOM   1656  C CB   . SER A 1 105 ? -2.955  -3.342  -2.739  1.00 0.50  ? 105  SER A CB   1  
ATOM   1657  O OG   . SER A 1 105 ? -3.051  -3.561  -4.137  1.00 1.19  ? 105  SER A OG   1  
ATOM   1658  H H    . SER A 1 105 ? -3.285  -2.627  -0.295  1.00 0.36  ? 105  SER A H    1  
ATOM   1659  H HA   . SER A 1 105 ? -3.594  -1.300  -2.808  1.00 0.52  ? 105  SER A HA   1  
ATOM   1660  H HB2  . SER A 1 105 ? -1.931  -3.095  -2.499  1.00 1.07  ? 105  SER A HB2  1  
ATOM   1661  H HB3  . SER A 1 105 ? -3.234  -4.250  -2.225  1.00 0.98  ? 105  SER A HB3  1  
ATOM   1662  H HG   . SER A 1 105 ? -2.164  -3.633  -4.514  1.00 1.55  ? 105  SER A HG   1  
ATOM   1663  N N    . PHE A 1 106 ? -5.868  -3.561  -1.971  1.00 0.35  ? 106  PHE A N    1  
ATOM   1664  C CA   . PHE A 1 106 ? -7.254  -3.946  -2.206  1.00 0.37  ? 106  PHE A CA   1  
ATOM   1665  C C    . PHE A 1 106 ? -8.180  -2.871  -1.656  1.00 0.31  ? 106  PHE A C    1  
ATOM   1666  O O    . PHE A 1 106 ? -9.312  -2.733  -2.094  1.00 0.30  ? 106  PHE A O    1  
ATOM   1667  C CB   . PHE A 1 106 ? -7.574  -5.301  -1.566  1.00 0.46  ? 106  PHE A CB   1  
ATOM   1668  C CG   . PHE A 1 106 ? -8.747  -6.000  -2.196  1.00 0.99  ? 106  PHE A CG   1  
ATOM   1669  C CD1  . PHE A 1 106 ? -8.616  -6.644  -3.415  1.00 1.56  ? 106  PHE A CD1  1  
ATOM   1670  C CD2  . PHE A 1 106 ? -9.982  -6.010  -1.567  1.00 1.64  ? 106  PHE A CD2  1  
ATOM   1671  C CE1  . PHE A 1 106 ? -9.694  -7.286  -3.996  1.00 2.46  ? 106  PHE A CE1  1  
ATOM   1672  C CE2  . PHE A 1 106 ? -11.063 -6.651  -2.143  1.00 2.53  ? 106  PHE A CE2  1  
ATOM   1673  C CZ   . PHE A 1 106 ? -10.914 -7.295  -3.363  1.00 2.89  ? 106  PHE A CZ   1  
ATOM   1674  H H    . PHE A 1 106 ? -5.328  -4.075  -1.334  1.00 0.35  ? 106  PHE A H    1  
ATOM   1675  H HA   . PHE A 1 106 ? -7.401  -4.017  -3.274  1.00 0.42  ? 106  PHE A HA   1  
ATOM   1676  H HB2  . PHE A 1 106 ? -6.714  -5.947  -1.648  1.00 1.15  ? 106  PHE A HB2  1  
ATOM   1677  H HB3  . PHE A 1 106 ? -7.808  -5.148  -0.522  1.00 0.85  ? 106  PHE A HB3  1  
ATOM   1678  H HD1  . PHE A 1 106 ? -7.659  -6.642  -3.915  1.00 1.56  ? 106  PHE A HD1  1  
ATOM   1679  H HD2  . PHE A 1 106 ? -10.097 -5.512  -0.616  1.00 1.67  ? 106  PHE A HD2  1  
ATOM   1680  H HE1  . PHE A 1 106 ? -9.578  -7.785  -4.947  1.00 2.96  ? 106  PHE A HE1  1  
ATOM   1681  H HE2  . PHE A 1 106 ? -12.020 -6.652  -1.642  1.00 3.09  ? 106  PHE A HE2  1  
ATOM   1682  H HZ   . PHE A 1 106 ? -11.756 -7.797  -3.816  1.00 3.64  ? 106  PHE A HZ   1  
ATOM   1683  N N    . GLY A 1 107 ? -7.683  -2.110  -0.688  1.00 0.30  ? 107  GLY A N    1  
ATOM   1684  C CA   . GLY A 1 107 ? -8.418  -0.963  -0.199  1.00 0.28  ? 107  GLY A CA   1  
ATOM   1685  C C    . GLY A 1 107 ? -8.523  0.118   -1.253  1.00 0.24  ? 107  GLY A C    1  
ATOM   1686  O O    . GLY A 1 107 ? -9.579  0.723   -1.439  1.00 0.27  ? 107  GLY A O    1  
ATOM   1687  H H    . GLY A 1 107 ? -6.813  -2.336  -0.298  1.00 0.32  ? 107  GLY A H    1  
ATOM   1688  H HA2  . GLY A 1 107 ? -9.408  -1.272  0.089   1.00 0.28  ? 107  GLY A HA2  1  
ATOM   1689  H HA3  . GLY A 1 107 ? -7.909  -0.561  0.665   1.00 0.29  ? 107  GLY A HA3  1  
ATOM   1690  N N    . GLY A 1 108 ? -7.420  0.355   -1.955  1.00 0.23  ? 108  GLY A N    1  
ATOM   1691  C CA   . GLY A 1 108 ? -7.433  1.294   -3.053  1.00 0.22  ? 108  GLY A CA   1  
ATOM   1692  C C    . GLY A 1 108 ? -8.308  0.806   -4.186  1.00 0.22  ? 108  GLY A C    1  
ATOM   1693  O O    . GLY A 1 108 ? -8.909  1.597   -4.911  1.00 0.23  ? 108  GLY A O    1  
ATOM   1694  H H    . GLY A 1 108 ? -6.590  -0.112  -1.721  1.00 0.24  ? 108  GLY A H    1  
ATOM   1695  H HA2  . GLY A 1 108 ? -7.808  2.244   -2.698  1.00 0.22  ? 108  GLY A HA2  1  
ATOM   1696  H HA3  . GLY A 1 108 ? -6.425  1.425   -3.418  1.00 0.24  ? 108  GLY A HA3  1  
ATOM   1697  N N    . ALA A 1 109 ? -8.374  -0.506  -4.335  1.00 0.24  ? 109  ALA A N    1  
ATOM   1698  C CA   . ALA A 1 109 ? -9.236  -1.121  -5.328  1.00 0.26  ? 109  ALA A CA   1  
ATOM   1699  C C    . ALA A 1 109 ? -10.691 -1.071  -4.878  1.00 0.27  ? 109  ALA A C    1  
ATOM   1700  O O    . ALA A 1 109 ? -11.594 -0.913  -5.697  1.00 0.31  ? 109  ALA A O    1  
ATOM   1701  C CB   . ALA A 1 109 ? -8.805  -2.552  -5.579  1.00 0.29  ? 109  ALA A CB   1  
ATOM   1702  H H    . ALA A 1 109 ? -7.817  -1.079  -3.765  1.00 0.24  ? 109  ALA A H    1  
ATOM   1703  H HA   . ALA A 1 109 ? -9.133  -0.569  -6.252  1.00 0.29  ? 109  ALA A HA   1  
ATOM   1704  H HB1  . ALA A 1 109 ? -9.441  -2.986  -6.337  1.00 0.96  ? 109  ALA A HB1  1  
ATOM   1705  H HB2  . ALA A 1 109 ? -8.889  -3.122  -4.663  1.00 1.05  ? 109  ALA A HB2  1  
ATOM   1706  H HB3  . ALA A 1 109 ? -7.782  -2.565  -5.919  1.00 1.04  ? 109  ALA A HB3  1  
ATOM   1707  N N    . LEU A 1 110 ? -10.890 -1.164  -3.564  1.00 0.25  ? 110  LEU A N    1  
ATOM   1708  C CA   . LEU A 1 110 ? -12.221 -1.116  -2.957  1.00 0.28  ? 110  LEU A CA   1  
ATOM   1709  C C    . LEU A 1 110 ? -12.854 0.208   -3.325  1.00 0.24  ? 110  LEU A C    1  
ATOM   1710  O O    . LEU A 1 110 ? -14.051 0.310   -3.613  1.00 0.24  ? 110  LEU A O    1  
ATOM   1711  C CB   . LEU A 1 110 ? -12.093 -1.223  -1.434  1.00 0.32  ? 110  LEU A CB   1  
ATOM   1712  C CG   . LEU A 1 110 ? -13.171 -2.044  -0.711  1.00 0.45  ? 110  LEU A CG   1  
ATOM   1713  C CD1  . LEU A 1 110 ? -14.555 -1.448  -0.892  1.00 1.11  ? 110  LEU A CD1  1  
ATOM   1714  C CD2  . LEU A 1 110 ? -13.147 -3.489  -1.182  1.00 1.12  ? 110  LEU A CD2  1  
ATOM   1715  H H    . LEU A 1 110 ? -10.110 -1.256  -2.977  1.00 0.23  ? 110  LEU A H    1  
ATOM   1716  H HA   . LEU A 1 110 ? -12.816 -1.932  -3.336  1.00 0.34  ? 110  LEU A HA   1  
ATOM   1717  H HB2  . LEU A 1 110 ? -11.133 -1.664  -1.211  1.00 0.36  ? 110  LEU A HB2  1  
ATOM   1718  H HB3  . LEU A 1 110 ? -12.107 -0.218  -1.031  1.00 0.29  ? 110  LEU A HB3  1  
ATOM   1719  H HG   . LEU A 1 110 ? -12.955 -2.039  0.342   1.00 1.32  ? 110  LEU A HG   1  
ATOM   1720  H HD11 . LEU A 1 110 ? -14.833 -1.488  -1.935  1.00 1.67  ? 110  LEU A HD11 1  
ATOM   1721  H HD12 . LEU A 1 110 ? -14.551 -0.421  -0.559  1.00 1.63  ? 110  LEU A HD12 1  
ATOM   1722  H HD13 . LEU A 1 110 ? -15.265 -2.014  -0.305  1.00 1.78  ? 110  LEU A HD13 1  
ATOM   1723  H HD21 . LEU A 1 110 ? -13.321 -3.522  -2.248  1.00 1.67  ? 110  LEU A HD21 1  
ATOM   1724  H HD22 . LEU A 1 110 ? -13.920 -4.045  -0.674  1.00 1.70  ? 110  LEU A HD22 1  
ATOM   1725  H HD23 . LEU A 1 110 ? -12.185 -3.925  -0.960  1.00 1.78  ? 110  LEU A HD23 1  
ATOM   1726  N N    . CYS A 1 111 ? -12.003 1.221   -3.302  1.00 0.21  ? 111  CYS A N    1  
ATOM   1727  C CA   . CYS A 1 111 ? -12.334 2.542   -3.774  1.00 0.19  ? 111  CYS A CA   1  
ATOM   1728  C C    . CYS A 1 111 ? -12.958 2.464   -5.155  1.00 0.20  ? 111  CYS A C    1  
ATOM   1729  O O    . CYS A 1 111 ? -14.132 2.784   -5.324  1.00 0.26  ? 111  CYS A O    1  
ATOM   1730  C CB   . CYS A 1 111 ? -11.057 3.372   -3.803  1.00 0.20  ? 111  CYS A CB   1  
ATOM   1731  S SG   . CYS A 1 111 ? -11.224 4.992   -4.557  1.00 0.22  ? 111  CYS A SG   1  
ATOM   1732  H H    . CYS A 1 111 ? -11.103 1.061   -2.948  1.00 0.22  ? 111  CYS A H    1  
ATOM   1733  H HA   . CYS A 1 111 ? -13.038 2.992   -3.090  1.00 0.19  ? 111  CYS A HA   1  
ATOM   1734  H HB2  . CYS A 1 111 ? -10.718 3.521   -2.791  1.00 0.21  ? 111  CYS A HB2  1  
ATOM   1735  H HB3  . CYS A 1 111 ? -10.302 2.833   -4.356  1.00 0.22  ? 111  CYS A HB3  1  
ATOM   1736  H HG   . CYS A 1 111 ? -10.022 5.383   -4.956  1.00 0.90  ? 111  CYS A HG   1  
ATOM   1737  N N    . VAL A 1 112 ? -12.189 1.978   -6.124  1.00 0.20  ? 112  VAL A N    1  
ATOM   1738  C CA   . VAL A 1 112 ? -12.642 1.924   -7.507  1.00 0.22  ? 112  VAL A CA   1  
ATOM   1739  C C    . VAL A 1 112 ? -13.850 1.009   -7.663  1.00 0.22  ? 112  VAL A C    1  
ATOM   1740  O O    . VAL A 1 112 ? -14.728 1.289   -8.471  1.00 0.26  ? 112  VAL A O    1  
ATOM   1741  C CB   . VAL A 1 112 ? -11.542 1.451   -8.468  1.00 0.26  ? 112  VAL A CB   1  
ATOM   1742  C CG1  . VAL A 1 112 ? -12.067 1.500   -9.892  1.00 0.35  ? 112  VAL A CG1  1  
ATOM   1743  C CG2  . VAL A 1 112 ? -10.293 2.301   -8.327  1.00 0.27  ? 112  VAL A CG2  1  
ATOM   1744  H H    . VAL A 1 112 ? -11.298 1.636   -5.897  1.00 0.21  ? 112  VAL A H    1  
ATOM   1745  H HA   . VAL A 1 112 ? -12.939 2.937   -7.802  1.00 0.25  ? 112  VAL A HA   1  
ATOM   1746  H HB   . VAL A 1 112 ? -11.287 0.420   -8.225  1.00 0.27  ? 112  VAL A HB   1  
ATOM   1747  H HG11 . VAL A 1 112 ? -12.435 2.500   -10.104 1.00 1.07  ? 112  VAL A HG11 1  
ATOM   1748  H HG12 . VAL A 1 112 ? -12.878 0.791   -10.001 1.00 1.20  ? 112  VAL A HG12 1  
ATOM   1749  H HG13 . VAL A 1 112 ? -11.274 1.254   -10.581 1.00 0.97  ? 112  VAL A HG13 1  
ATOM   1750  H HG21 . VAL A 1 112 ? -9.888  2.183   -7.331  1.00 1.02  ? 112  VAL A HG21 1  
ATOM   1751  H HG22 . VAL A 1 112 ? -10.543 3.342   -8.496  1.00 1.02  ? 112  VAL A HG22 1  
ATOM   1752  H HG23 . VAL A 1 112 ? -9.557  1.986   -9.055  1.00 1.08  ? 112  VAL A HG23 1  
ATOM   1753  N N    . GLU A 1 113 ? -13.910 -0.069  -6.888  1.00 0.23  ? 113  GLU A N    1  
ATOM   1754  C CA   . GLU A 1 113 ? -15.065 -0.962  -6.928  1.00 0.28  ? 113  GLU A CA   1  
ATOM   1755  C C    . GLU A 1 113 ? -16.348 -0.185  -6.653  1.00 0.23  ? 113  GLU A C    1  
ATOM   1756  O O    . GLU A 1 113 ? -17.432 -0.564  -7.105  1.00 0.29  ? 113  GLU A O    1  
ATOM   1757  C CB   . GLU A 1 113 ? -14.924 -2.106  -5.914  1.00 0.40  ? 113  GLU A CB   1  
ATOM   1758  C CG   . GLU A 1 113 ? -13.893 -3.154  -6.294  1.00 0.53  ? 113  GLU A CG   1  
ATOM   1759  C CD   . GLU A 1 113 ? -13.604 -4.142  -5.183  1.00 1.86  ? 113  GLU A CD   1  
ATOM   1760  O OE1  . GLU A 1 113 ? -12.727 -3.858  -4.348  1.00 2.51  ? 113  GLU A OE1  1  
ATOM   1761  O OE2  . GLU A 1 113 ? -14.253 -5.210  -5.159  1.00 2.34  ? 113  GLU A OE2  1  
ATOM   1762  H H    . GLU A 1 113 ? -13.161 -0.276  -6.281  1.00 0.23  ? 113  GLU A H    1  
ATOM   1763  H HA   . GLU A 1 113 ? -15.121 -1.376  -7.923  1.00 0.34  ? 113  GLU A HA   1  
ATOM   1764  H HB2  . GLU A 1 113 ? -14.655 -1.697  -4.953  1.00 0.39  ? 113  GLU A HB2  1  
ATOM   1765  H HB3  . GLU A 1 113 ? -15.884 -2.597  -5.825  1.00 0.45  ? 113  GLU A HB3  1  
ATOM   1766  H HG2  . GLU A 1 113 ? -14.274 -3.713  -7.133  1.00 0.87  ? 113  GLU A HG2  1  
ATOM   1767  H HG3  . GLU A 1 113 ? -12.977 -2.664  -6.574  1.00 1.02  ? 113  GLU A HG3  1  
ATOM   1768  N N    . SER A 1 114 ? -16.211 0.927   -5.946  1.00 0.18  ? 114  SER A N    1  
ATOM   1769  C CA   . SER A 1 114 ? -17.342 1.744   -5.581  1.00 0.19  ? 114  SER A CA   1  
ATOM   1770  C C    . SER A 1 114 ? -17.642 2.682   -6.722  1.00 0.22  ? 114  SER A C    1  
ATOM   1771  O O    . SER A 1 114 ? -18.786 2.865   -7.120  1.00 0.28  ? 114  SER A O    1  
ATOM   1772  C CB   . SER A 1 114 ? -17.018 2.530   -4.313  1.00 0.18  ? 114  SER A CB   1  
ATOM   1773  O OG   . SER A 1 114 ? -16.755 1.653   -3.230  1.00 0.20  ? 114  SER A OG   1  
ATOM   1774  H H    . SER A 1 114 ? -15.308 1.239   -5.708  1.00 0.20  ? 114  SER A H    1  
ATOM   1775  H HA   . SER A 1 114 ? -18.195 1.107   -5.409  1.00 0.20  ? 114  SER A HA   1  
ATOM   1776  H HB2  . SER A 1 114 ? -16.140 3.135   -4.487  1.00 0.18  ? 114  SER A HB2  1  
ATOM   1777  H HB3  . SER A 1 114 ? -17.847 3.171   -4.057  1.00 0.19  ? 114  SER A HB3  1  
ATOM   1778  H HG   . SER A 1 114 ? -15.957 1.140   -3.414  1.00 0.17  ? 114  SER A HG   1  
ATOM   1779  N N    . VAL A 1 115 ? -16.582 3.213   -7.291  1.00 0.21  ? 115  VAL A N    1  
ATOM   1780  C CA   . VAL A 1 115 ? -16.685 4.167   -8.354  1.00 0.27  ? 115  VAL A CA   1  
ATOM   1781  C C    . VAL A 1 115 ? -17.213 3.477   -9.604  1.00 0.28  ? 115  VAL A C    1  
ATOM   1782  O O    . VAL A 1 115 ? -17.888 4.073   -10.440 1.00 0.31  ? 115  VAL A O    1  
ATOM   1783  C CB   . VAL A 1 115 ? -15.327 4.824   -8.617  1.00 0.34  ? 115  VAL A CB   1  
ATOM   1784  C CG1  . VAL A 1 115 ? -14.359 4.581   -7.507  1.00 1.23  ? 115  VAL A CG1  1  
ATOM   1785  C CG2  . VAL A 1 115 ? -14.765 4.453   -9.953  1.00 1.10  ? 115  VAL A CG2  1  
ATOM   1786  H H    . VAL A 1 115 ? -15.694 2.927   -7.003  1.00 0.21  ? 115  VAL A H    1  
ATOM   1787  H HA   . VAL A 1 115 ? -17.370 4.930   -8.050  1.00 0.31  ? 115  VAL A HA   1  
ATOM   1788  H HB   . VAL A 1 115 ? -15.482 5.839   -8.618  1.00 1.10  ? 115  VAL A HB   1  
ATOM   1789  H HG11 . VAL A 1 115 ? -13.377 4.929   -7.799  1.00 1.83  ? 115  VAL A HG11 1  
ATOM   1790  H HG12 . VAL A 1 115 ? -14.325 3.527   -7.290  1.00 1.82  ? 115  VAL A HG12 1  
ATOM   1791  H HG13 . VAL A 1 115 ? -14.690 5.122   -6.630  1.00 1.79  ? 115  VAL A HG13 1  
ATOM   1792  H HG21 . VAL A 1 115 ? -14.575 3.396   -9.980  1.00 1.68  ? 115  VAL A HG21 1  
ATOM   1793  H HG22 . VAL A 1 115 ? -13.854 5.002   -10.120 1.00 1.73  ? 115  VAL A HG22 1  
ATOM   1794  H HG23 . VAL A 1 115 ? -15.495 4.712   -10.702 1.00 1.69  ? 115  VAL A HG23 1  
ATOM   1795  N N    . ASP A 1 116 ? -16.879 2.206   -9.675  1.00 0.28  ? 116  ASP A N    1  
ATOM   1796  C CA   . ASP A 1 116 ? -17.326 1.288   -10.713 1.00 0.34  ? 116  ASP A CA   1  
ATOM   1797  C C    . ASP A 1 116 ? -18.837 1.323   -10.877 1.00 0.35  ? 116  ASP A C    1  
ATOM   1798  O O    . ASP A 1 116 ? -19.358 1.489   -11.981 1.00 0.41  ? 116  ASP A O    1  
ATOM   1799  C CB   . ASP A 1 116 ? -16.899 -0.120  -10.317 1.00 0.37  ? 116  ASP A CB   1  
ATOM   1800  C CG   . ASP A 1 116 ? -17.138 -1.138  -11.412 1.00 0.48  ? 116  ASP A CG   1  
ATOM   1801  O OD1  . ASP A 1 116 ? -16.566 -0.981  -12.509 1.00 0.60  ? 116  ASP A OD1  1  
ATOM   1802  O OD2  . ASP A 1 116 ? -17.880 -2.114  -11.175 1.00 0.60  ? 116  ASP A OD2  1  
ATOM   1803  H H    . ASP A 1 116 ? -16.255 1.867   -8.994  1.00 0.26  ? 116  ASP A H    1  
ATOM   1804  H HA   . ASP A 1 116 ? -16.852 1.557   -11.644 1.00 0.39  ? 116  ASP A HA   1  
ATOM   1805  H HB2  . ASP A 1 116 ? -15.846 -0.111  -10.074 1.00 0.37  ? 116  ASP A HB2  1  
ATOM   1806  H HB3  . ASP A 1 116 ? -17.465 -0.415  -9.434  1.00 0.34  ? 116  ASP A HB3  1  
ATOM   1807  N N    . LYS A 1 117 ? -19.540 1.178   -9.763  1.00 0.32  ? 117  LYS A N    1  
ATOM   1808  C CA   . LYS A 1 117 ? -20.995 1.206   -9.764  1.00 0.35  ? 117  LYS A CA   1  
ATOM   1809  C C    . LYS A 1 117 ? -21.482 2.649   -9.724  1.00 0.34  ? 117  LYS A C    1  
ATOM   1810  O O    . LYS A 1 117 ? -22.665 2.913   -9.516  1.00 0.37  ? 117  LYS A O    1  
ATOM   1811  C CB   . LYS A 1 117 ? -21.540 0.458   -8.548  1.00 0.37  ? 117  LYS A CB   1  
ATOM   1812  C CG   . LYS A 1 117 ? -20.624 -0.634  -8.016  1.00 0.36  ? 117  LYS A CG   1  
ATOM   1813  C CD   . LYS A 1 117 ? -20.405 -1.739  -9.024  1.00 0.45  ? 117  LYS A CD   1  
ATOM   1814  C CE   . LYS A 1 117 ? -19.852 -2.985  -8.357  1.00 0.61  ? 117  LYS A CE   1  
ATOM   1815  N NZ   . LYS A 1 117 ? -20.827 -3.570  -7.394  1.00 1.62  ? 117  LYS A NZ   1  
ATOM   1816  H H    . LYS A 1 117 ? -19.069 1.030   -8.917  1.00 0.29  ? 117  LYS A H    1  
ATOM   1817  H HA   . LYS A 1 117 ? -21.347 0.733   -10.668 1.00 0.40  ? 117  LYS A HA   1  
ATOM   1818  H HB2  . LYS A 1 117 ? -21.714 1.166   -7.753  1.00 0.35  ? 117  LYS A HB2  1  
ATOM   1819  H HB3  . LYS A 1 117 ? -22.480 0.001   -8.820  1.00 0.43  ? 117  LYS A HB3  1  
ATOM   1820  H HG2  . LYS A 1 117 ? -19.668 -0.195  -7.773  1.00 0.30  ? 117  LYS A HG2  1  
ATOM   1821  H HG3  . LYS A 1 117 ? -21.060 -1.054  -7.125  1.00 0.39  ? 117  LYS A HG3  1  
ATOM   1822  H HD2  . LYS A 1 117 ? -21.344 -1.977  -9.492  1.00 0.52  ? 117  LYS A HD2  1  
ATOM   1823  H HD3  . LYS A 1 117 ? -19.706 -1.398  -9.770  1.00 0.41  ? 117  LYS A HD3  1  
ATOM   1824  H HE2  . LYS A 1 117 ? -19.623 -3.715  -9.117  1.00 1.09  ? 117  LYS A HE2  1  
ATOM   1825  H HE3  . LYS A 1 117 ? -18.946 -2.720  -7.825  1.00 0.69  ? 117  LYS A HE3  1  
ATOM   1826  H HZ1  . LYS A 1 117 ? -21.797 -3.493  -7.777  1.00 2.16  ? 117  LYS A HZ1  1  
ATOM   1827  H HZ2  . LYS A 1 117 ? -20.789 -3.069  -6.482  1.00 2.12  ? 117  LYS A HZ2  1  
ATOM   1828  H HZ3  . LYS A 1 117 ? -20.615 -4.577  -7.237  1.00 2.13  ? 117  LYS A HZ3  1  
ATOM   1829  N N    . GLU A 1 118 ? -20.543 3.570   -9.918  1.00 0.31  ? 118  GLU A N    1  
ATOM   1830  C CA   . GLU A 1 118 ? -20.801 4.998   -9.832  1.00 0.33  ? 118  GLU A CA   1  
ATOM   1831  C C    . GLU A 1 118 ? -21.226 5.359   -8.423  1.00 0.31  ? 118  GLU A C    1  
ATOM   1832  O O    . GLU A 1 118 ? -22.289 5.929   -8.186  1.00 0.38  ? 118  GLU A O    1  
ATOM   1833  C CB   . GLU A 1 118 ? -21.824 5.444   -10.876 1.00 0.40  ? 118  GLU A CB   1  
ATOM   1834  C CG   . GLU A 1 118 ? -21.339 5.212   -12.297 1.00 0.49  ? 118  GLU A CG   1  
ATOM   1835  C CD   . GLU A 1 118 ? -22.197 5.902   -13.330 1.00 1.12  ? 118  GLU A CD   1  
ATOM   1836  O OE1  . GLU A 1 118 ? -21.933 7.082   -13.638 1.00 1.07  ? 118  GLU A OE1  1  
ATOM   1837  O OE2  . GLU A 1 118 ? -23.150 5.270   -13.832 1.00 1.88  ? 118  GLU A OE2  1  
ATOM   1838  H H    . GLU A 1 118 ? -19.630 3.271   -10.123 1.00 0.31  ? 118  GLU A H    1  
ATOM   1839  H HA   . GLU A 1 118 ? -19.862 5.503   -10.034 1.00 0.33  ? 118  GLU A HA   1  
ATOM   1840  H HB2  . GLU A 1 118 ? -22.742 4.890   -10.731 1.00 0.42  ? 118  GLU A HB2  1  
ATOM   1841  H HB3  . GLU A 1 118 ? -22.021 6.497   -10.750 1.00 0.40  ? 118  GLU A HB3  1  
ATOM   1842  H HG2  . GLU A 1 118 ? -20.330 5.586   -12.384 1.00 0.66  ? 118  GLU A HG2  1  
ATOM   1843  H HG3  . GLU A 1 118 ? -21.344 4.150   -12.495 1.00 0.78  ? 118  GLU A HG3  1  
ATOM   1844  N N    . MET A 1 119 ? -20.360 4.993   -7.493  1.00 0.26  ? 119  MET A N    1  
ATOM   1845  C CA   . MET A 1 119 ? -20.549 5.253   -6.077  1.00 0.26  ? 119  MET A CA   1  
ATOM   1846  C C    . MET A 1 119 ? -19.235 5.770   -5.528  1.00 0.25  ? 119  MET A C    1  
ATOM   1847  O O    . MET A 1 119 ? -18.830 5.436   -4.418  1.00 0.23  ? 119  MET A O    1  
ATOM   1848  C CB   . MET A 1 119 ? -20.937 3.975   -5.326  1.00 0.25  ? 119  MET A CB   1  
ATOM   1849  C CG   . MET A 1 119 ? -22.107 3.220   -5.926  1.00 0.28  ? 119  MET A CG   1  
ATOM   1850  S SD   . MET A 1 119 ? -22.378 1.634   -5.112  1.00 0.31  ? 119  MET A SD   1  
ATOM   1851  C CE   . MET A 1 119 ? -20.709 0.972   -5.131  1.00 0.29  ? 119  MET A CE   1  
ATOM   1852  H H    . MET A 1 119 ? -19.537 4.528   -7.777  1.00 0.26  ? 119  MET A H    1  
ATOM   1853  H HA   . MET A 1 119 ? -21.318 6.003   -5.957  1.00 0.29  ? 119  MET A HA   1  
ATOM   1854  H HB2  . MET A 1 119 ? -20.084 3.312   -5.312  1.00 0.23  ? 119  MET A HB2  1  
ATOM   1855  H HB3  . MET A 1 119 ? -21.190 4.235   -4.309  1.00 0.27  ? 119  MET A HB3  1  
ATOM   1856  H HG2  . MET A 1 119 ? -22.997 3.820   -5.823  1.00 0.30  ? 119  MET A HG2  1  
ATOM   1857  H HG3  . MET A 1 119 ? -21.909 3.043   -6.974  1.00 0.28  ? 119  MET A HG3  1  
ATOM   1858  H HE1  . MET A 1 119 ? -20.696 0.012   -4.636  1.00 1.08  ? 119  MET A HE1  1  
ATOM   1859  H HE2  . MET A 1 119 ? -20.048 1.652   -4.614  1.00 1.01  ? 119  MET A HE2  1  
ATOM   1860  H HE3  . MET A 1 119 ? -20.374 0.853   -6.157  1.00 1.08  ? 119  MET A HE3  1  
ATOM   1861  N N    . GLN A 1 120 ? -18.562 6.569   -6.348  1.00 0.31  ? 120  GLN A N    1  
ATOM   1862  C CA   . GLN A 1 120 ? -17.265 7.145   -6.027  1.00 0.31  ? 120  GLN A CA   1  
ATOM   1863  C C    . GLN A 1 120 ? -17.241 7.881   -4.669  1.00 0.32  ? 120  GLN A C    1  
ATOM   1864  O O    . GLN A 1 120 ? -16.195 8.321   -4.221  1.00 0.33  ? 120  GLN A O    1  
ATOM   1865  C CB   . GLN A 1 120 ? -16.853 8.099   -7.136  1.00 0.36  ? 120  GLN A CB   1  
ATOM   1866  C CG   . GLN A 1 120 ? -17.149 7.575   -8.527  1.00 0.36  ? 120  GLN A CG   1  
ATOM   1867  C CD   . GLN A 1 120 ? -18.432 8.130   -9.118  1.00 0.58  ? 120  GLN A CD   1  
ATOM   1868  O OE1  . GLN A 1 120 ? -18.906 9.192   -8.724  1.00 1.15  ? 120  GLN A OE1  1  
ATOM   1869  N NE2  . GLN A 1 120 ? -18.974 7.436   -10.100 1.00 0.55  ? 120  GLN A NE2  1  
ATOM   1870  H H    . GLN A 1 120 ? -18.943 6.762   -7.231  1.00 0.39  ? 120  GLN A H    1  
ATOM   1871  H HA   . GLN A 1 120 ? -16.551 6.332   -6.004  1.00 0.29  ? 120  GLN A HA   1  
ATOM   1872  H HB2  . GLN A 1 120 ? -17.376 9.035   -7.008  1.00 0.41  ? 120  GLN A HB2  1  
ATOM   1873  H HB3  . GLN A 1 120 ? -15.790 8.276   -7.065  1.00 0.39  ? 120  GLN A HB3  1  
ATOM   1874  H HG2  . GLN A 1 120 ? -16.337 7.817   -9.169  1.00 0.52  ? 120  GLN A HG2  1  
ATOM   1875  H HG3  . GLN A 1 120 ? -17.241 6.504   -8.470  1.00 0.47  ? 120  GLN A HG3  1  
ATOM   1876  H HE21 . GLN A 1 120 ? -18.528 6.614   -10.393 1.00 0.74  ? 120  GLN A HE21 1  
ATOM   1877  H HE22 . GLN A 1 120 ? -19.801 7.784   -10.513 1.00 0.71  ? 120  GLN A HE22 1  
ATOM   1878  N N    . VAL A 1 121 ? -18.390 8.043   -4.029  1.00 0.32  ? 121  VAL A N    1  
ATOM   1879  C CA   . VAL A 1 121 ? -18.446 8.669   -2.709  1.00 0.35  ? 121  VAL A CA   1  
ATOM   1880  C C    . VAL A 1 121 ? -17.776 7.801   -1.634  1.00 0.31  ? 121  VAL A C    1  
ATOM   1881  O O    . VAL A 1 121 ? -17.351 8.304   -0.595  1.00 0.36  ? 121  VAL A O    1  
ATOM   1882  C CB   . VAL A 1 121 ? -19.896 8.967   -2.286  1.00 0.39  ? 121  VAL A CB   1  
ATOM   1883  C CG1  . VAL A 1 121 ? -20.529 9.980   -3.224  1.00 0.46  ? 121  VAL A CG1  1  
ATOM   1884  C CG2  . VAL A 1 121 ? -20.710 7.686   -2.248  1.00 0.38  ? 121  VAL A CG2  1  
ATOM   1885  H H    . VAL A 1 121 ? -19.220 7.741   -4.453  1.00 0.32  ? 121  VAL A H    1  
ATOM   1886  H HA   . VAL A 1 121 ? -17.916 9.609   -2.770  1.00 0.39  ? 121  VAL A HA   1  
ATOM   1887  H HB   . VAL A 1 121 ? -19.881 9.390   -1.291  1.00 0.42  ? 121  VAL A HB   1  
ATOM   1888  H HG11 . VAL A 1 121 ? -21.545 10.171  -2.916  1.00 1.05  ? 121  VAL A HG11 1  
ATOM   1889  H HG12 . VAL A 1 121 ? -20.525 9.589   -4.231  1.00 1.09  ? 121  VAL A HG12 1  
ATOM   1890  H HG13 . VAL A 1 121 ? -19.964 10.900  -3.194  1.00 1.19  ? 121  VAL A HG13 1  
ATOM   1891  H HG21 . VAL A 1 121 ? -20.737 7.249   -3.236  1.00 1.03  ? 121  VAL A HG21 1  
ATOM   1892  H HG22 . VAL A 1 121 ? -21.714 7.904   -1.921  1.00 1.06  ? 121  VAL A HG22 1  
ATOM   1893  H HG23 . VAL A 1 121 ? -20.248 6.990   -1.562  1.00 1.07  ? 121  VAL A HG23 1  
ATOM   1894  N N    . LEU A 1 122 ? -17.670 6.499   -1.890  1.00 0.24  ? 122  LEU A N    1  
ATOM   1895  C CA   . LEU A 1 122 ? -17.012 5.583   -0.956  1.00 0.21  ? 122  LEU A CA   1  
ATOM   1896  C C    . LEU A 1 122 ? -15.522 5.820   -0.967  1.00 0.19  ? 122  LEU A C    1  
ATOM   1897  O O    . LEU A 1 122 ? -14.829 5.527   0.000   1.00 0.19  ? 122  LEU A O    1  
ATOM   1898  C CB   . LEU A 1 122 ? -17.278 4.116   -1.309  1.00 0.18  ? 122  LEU A CB   1  
ATOM   1899  C CG   . LEU A 1 122 ? -18.652 3.565   -0.936  1.00 0.22  ? 122  LEU A CG   1  
ATOM   1900  C CD1  . LEU A 1 122 ? -18.960 3.867   0.520   1.00 0.26  ? 122  LEU A CD1  1  
ATOM   1901  C CD2  . LEU A 1 122 ? -19.725 4.117   -1.860  1.00 0.22  ? 122  LEU A CD2  1  
ATOM   1902  H H    . LEU A 1 122 ? -18.033 6.146   -2.729  1.00 0.23  ? 122  LEU A H    1  
ATOM   1903  H HA   . LEU A 1 122 ? -17.388 5.782   0.038   1.00 0.24  ? 122  LEU A HA   1  
ATOM   1904  H HB2  . LEU A 1 122 ? -17.152 4.003   -2.376  1.00 0.17  ? 122  LEU A HB2  1  
ATOM   1905  H HB3  . LEU A 1 122 ? -16.529 3.515   -0.814  1.00 0.18  ? 122  LEU A HB3  1  
ATOM   1906  H HG   . LEU A 1 122 ? -18.637 2.491   -1.051  1.00 0.24  ? 122  LEU A HG   1  
ATOM   1907  H HD11 . LEU A 1 122 ? -18.981 4.937   0.671   1.00 1.06  ? 122  LEU A HD11 1  
ATOM   1908  H HD12 . LEU A 1 122 ? -18.193 3.431   1.146   1.00 0.97  ? 122  LEU A HD12 1  
ATOM   1909  H HD13 . LEU A 1 122 ? -19.920 3.445   0.782   1.00 1.03  ? 122  LEU A HD13 1  
ATOM   1910  H HD21 . LEU A 1 122 ? -19.774 5.192   -1.756  1.00 1.00  ? 122  LEU A HD21 1  
ATOM   1911  H HD22 . LEU A 1 122 ? -20.681 3.686   -1.606  1.00 1.01  ? 122  LEU A HD22 1  
ATOM   1912  H HD23 . LEU A 1 122 ? -19.476 3.870   -2.886  1.00 1.00  ? 122  LEU A HD23 1  
ATOM   1913  N N    . VAL A 1 123 ? -15.057 6.354   -2.079  1.00 0.19  ? 123  VAL A N    1  
ATOM   1914  C CA   . VAL A 1 123 ? -13.647 6.620   -2.313  1.00 0.20  ? 123  VAL A CA   1  
ATOM   1915  C C    . VAL A 1 123 ? -12.963 7.275   -1.107  1.00 0.22  ? 123  VAL A C    1  
ATOM   1916  O O    . VAL A 1 123 ? -11.912 6.813   -0.660  1.00 0.25  ? 123  VAL A O    1  
ATOM   1917  C CB   . VAL A 1 123 ? -13.511 7.492   -3.573  1.00 0.22  ? 123  VAL A CB   1  
ATOM   1918  C CG1  . VAL A 1 123 ? -12.115 8.076   -3.720  1.00 0.23  ? 123  VAL A CG1  1  
ATOM   1919  C CG2  . VAL A 1 123 ? -13.896 6.661   -4.795  1.00 0.23  ? 123  VAL A CG2  1  
ATOM   1920  H H    . VAL A 1 123 ? -15.697 6.586   -2.787  1.00 0.21  ? 123  VAL A H    1  
ATOM   1921  H HA   . VAL A 1 123 ? -13.166 5.674   -2.510  1.00 0.19  ? 123  VAL A HA   1  
ATOM   1922  H HB   . VAL A 1 123 ? -14.211 8.311   -3.495  1.00 0.24  ? 123  VAL A HB   1  
ATOM   1923  H HG11 . VAL A 1 123 ? -11.886 8.685   -2.858  1.00 0.99  ? 123  VAL A HG11 1  
ATOM   1924  H HG12 . VAL A 1 123 ? -12.079 8.688   -4.610  1.00 1.00  ? 123  VAL A HG12 1  
ATOM   1925  H HG13 . VAL A 1 123 ? -11.396 7.273   -3.800  1.00 0.91  ? 123  VAL A HG13 1  
ATOM   1926  H HG21 . VAL A 1 123 ? -13.285 5.768   -4.828  1.00 0.99  ? 123  VAL A HG21 1  
ATOM   1927  H HG22 . VAL A 1 123 ? -13.740 7.239   -5.693  1.00 0.98  ? 123  VAL A HG22 1  
ATOM   1928  H HG23 . VAL A 1 123 ? -14.942 6.374   -4.726  1.00 0.93  ? 123  VAL A HG23 1  
ATOM   1929  N N    . SER A 1 124 ? -13.558 8.327   -0.564  1.00 0.24  ? 124  SER A N    1  
ATOM   1930  C CA   . SER A 1 124 ? -12.966 8.998   0.590   1.00 0.28  ? 124  SER A CA   1  
ATOM   1931  C C    . SER A 1 124 ? -13.240 8.208   1.870   1.00 0.27  ? 124  SER A C    1  
ATOM   1932  O O    . SER A 1 124 ? -12.400 8.152   2.770   1.00 0.33  ? 124  SER A O    1  
ATOM   1933  C CB   . SER A 1 124 ? -13.508 10.419  0.738   1.00 0.36  ? 124  SER A CB   1  
ATOM   1934  O OG   . SER A 1 124 ? -12.725 11.168  1.656   1.00 1.35  ? 124  SER A OG   1  
ATOM   1935  H H    . SER A 1 124 ? -14.405 8.652   -0.942  1.00 0.23  ? 124  SER A H    1  
ATOM   1936  H HA   . SER A 1 124 ? -11.896 9.045   0.433   1.00 0.30  ? 124  SER A HA   1  
ATOM   1937  H HB2  . SER A 1 124 ? -13.488 10.911  -0.221  1.00 0.96  ? 124  SER A HB2  1  
ATOM   1938  H HB3  . SER A 1 124 ? -14.525 10.379  1.100   1.00 0.82  ? 124  SER A HB3  1  
ATOM   1939  H HG   . SER A 1 124 ? -13.067 11.040  2.556   1.00 1.66  ? 124  SER A HG   1  
ATOM   1940  N N    . ARG A 1 125 ? -14.413 7.586   1.931   1.00 0.23  ? 125  ARG A N    1  
ATOM   1941  C CA   . ARG A 1 125 ? -14.842 6.858   3.119   1.00 0.23  ? 125  ARG A CA   1  
ATOM   1942  C C    . ARG A 1 125 ? -13.903 5.691   3.395   1.00 0.21  ? 125  ARG A C    1  
ATOM   1943  O O    . ARG A 1 125 ? -13.425 5.509   4.514   1.00 0.25  ? 125  ARG A O    1  
ATOM   1944  C CB   . ARG A 1 125 ? -16.271 6.336   2.940   1.00 0.28  ? 125  ARG A CB   1  
ATOM   1945  C CG   . ARG A 1 125 ? -17.260 7.395   2.482   1.00 0.55  ? 125  ARG A CG   1  
ATOM   1946  C CD   . ARG A 1 125 ? -18.684 6.883   2.520   1.00 0.55  ? 125  ARG A CD   1  
ATOM   1947  N NE   . ARG A 1 125 ? -19.651 7.912   2.144   1.00 1.44  ? 125  ARG A NE   1  
ATOM   1948  C CZ   . ARG A 1 125 ? -20.919 7.929   2.558   1.00 1.65  ? 125  ARG A CZ   1  
ATOM   1949  N NH1  . ARG A 1 125 ? -21.359 7.002   3.401   1.00 1.06  ? 125  ARG A NH1  1  
ATOM   1950  N NH2  . ARG A 1 125 ? -21.738 8.886   2.141   1.00 2.67  ? 125  ARG A NH2  1  
ATOM   1951  H H    . ARG A 1 125 ? -15.000 7.602   1.149   1.00 0.24  ? 125  ARG A H    1  
ATOM   1952  H HA   . ARG A 1 125 ? -14.815 7.537   3.957   1.00 0.27  ? 125  ARG A HA   1  
ATOM   1953  H HB2  . ARG A 1 125 ? -16.262 5.544   2.206   1.00 0.57  ? 125  ARG A HB2  1  
ATOM   1954  H HB3  . ARG A 1 125 ? -16.615 5.938   3.881   1.00 0.56  ? 125  ARG A HB3  1  
ATOM   1955  H HG2  . ARG A 1 125 ? -17.178 8.256   3.122   1.00 0.83  ? 125  ARG A HG2  1  
ATOM   1956  H HG3  . ARG A 1 125 ? -17.024 7.675   1.471   1.00 0.83  ? 125  ARG A HG3  1  
ATOM   1957  H HD2  . ARG A 1 125 ? -18.773 6.053   1.835   1.00 0.92  ? 125  ARG A HD2  1  
ATOM   1958  H HD3  . ARG A 1 125 ? -18.896 6.548   3.517   1.00 0.90  ? 125  ARG A HD3  1  
ATOM   1959  H HE   . ARG A 1 125 ? -19.337 8.634   1.541   1.00 2.07  ? 125  ARG A HE   1  
ATOM   1960  H HH11 . ARG A 1 125 ? -20.738 6.285   3.738   1.00 0.84  ? 125  ARG A HH11 1  
ATOM   1961  H HH12 . ARG A 1 125 ? -22.323 7.009   3.708   1.00 1.32  ? 125  ARG A HH12 1  
ATOM   1962  H HH21 . ARG A 1 125 ? -21.408 9.597   1.511   1.00 3.30  ? 125  ARG A HH21 1  
ATOM   1963  H HH22 . ARG A 1 125 ? -22.693 8.909   2.460   1.00 2.85  ? 125  ARG A HH22 1  
ATOM   1964  N N    . ILE A 1 126 ? -13.644 4.911   2.358   1.00 0.19  ? 126  ILE A N    1  
ATOM   1965  C CA   . ILE A 1 126 ? -12.747 3.769   2.450   1.00 0.19  ? 126  ILE A CA   1  
ATOM   1966  C C    . ILE A 1 126 ? -11.366 4.204   2.918   1.00 0.20  ? 126  ILE A C    1  
ATOM   1967  O O    . ILE A 1 126 ? -10.844 3.663   3.890   1.00 0.23  ? 126  ILE A O    1  
ATOM   1968  C CB   . ILE A 1 126 ? -12.640 3.054   1.089   1.00 0.19  ? 126  ILE A CB   1  
ATOM   1969  C CG1  . ILE A 1 126 ? -14.043 2.640   0.634   1.00 0.18  ? 126  ILE A CG1  1  
ATOM   1970  C CG2  . ILE A 1 126 ? -11.722 1.845   1.183   1.00 0.22  ? 126  ILE A CG2  1  
ATOM   1971  C CD1  . ILE A 1 126 ? -14.103 2.097   -0.771  1.00 0.18  ? 126  ILE A CD1  1  
ATOM   1972  H H    . ILE A 1 126 ? -14.077 5.107   1.494   1.00 0.20  ? 126  ILE A H    1  
ATOM   1973  H HA   . ILE A 1 126 ? -13.160 3.075   3.168   1.00 0.22  ? 126  ILE A HA   1  
ATOM   1974  H HB   . ILE A 1 126 ? -12.215 3.743   0.371   1.00 0.18  ? 126  ILE A HB   1  
ATOM   1975  H HG12 . ILE A 1 126 ? -14.416 1.874   1.297   1.00 0.21  ? 126  ILE A HG12 1  
ATOM   1976  H HG13 . ILE A 1 126 ? -14.697 3.500   0.684   1.00 0.19  ? 126  ILE A HG13 1  
ATOM   1977  H HG21 . ILE A 1 126 ? -12.099 1.162   1.930   1.00 0.98  ? 126  ILE A HG21 1  
ATOM   1978  H HG22 . ILE A 1 126 ? -10.727 2.169   1.459   1.00 1.02  ? 126  ILE A HG22 1  
ATOM   1979  H HG23 . ILE A 1 126 ? -11.684 1.346   0.225   1.00 1.04  ? 126  ILE A HG23 1  
ATOM   1980  H HD11 . ILE A 1 126 ? -13.546 1.172   -0.824  1.00 1.04  ? 126  ILE A HD11 1  
ATOM   1981  H HD12 . ILE A 1 126 ? -13.673 2.817   -1.453  1.00 1.00  ? 126  ILE A HD12 1  
ATOM   1982  H HD13 . ILE A 1 126 ? -15.133 1.914   -1.042  1.00 1.06  ? 126  ILE A HD13 1  
ATOM   1983  N N    . ALA A 1 127 ? -10.796 5.199   2.242   1.00 0.21  ? 127  ALA A N    1  
ATOM   1984  C CA   . ALA A 1 127 ? -9.462  5.697   2.576   1.00 0.24  ? 127  ALA A CA   1  
ATOM   1985  C C    . ALA A 1 127 ? -9.368  6.090   4.050   1.00 0.24  ? 127  ALA A C    1  
ATOM   1986  O O    . ALA A 1 127 ? -8.336  5.886   4.694   1.00 0.29  ? 127  ALA A O    1  
ATOM   1987  C CB   . ALA A 1 127 ? -9.104  6.879   1.690   1.00 0.27  ? 127  ALA A CB   1  
ATOM   1988  H H    . ALA A 1 127 ? -11.288 5.612   1.500   1.00 0.22  ? 127  ALA A H    1  
ATOM   1989  H HA   . ALA A 1 127 ? -8.755  4.905   2.381   1.00 0.25  ? 127  ALA A HA   1  
ATOM   1990  H HB1  . ALA A 1 127 ? -9.136  6.574   0.654   1.00 1.10  ? 127  ALA A HB1  1  
ATOM   1991  H HB2  . ALA A 1 127 ? -8.109  7.221   1.935   1.00 1.00  ? 127  ALA A HB2  1  
ATOM   1992  H HB3  . ALA A 1 127 ? -9.810  7.679   1.854   1.00 1.00  ? 127  ALA A HB3  1  
ATOM   1993  N N    . ALA A 1 128 ? -10.453 6.648   4.572   1.00 0.21  ? 128  ALA A N    1  
ATOM   1994  C CA   . ALA A 1 128 ? -10.533 7.019   5.978   1.00 0.22  ? 128  ALA A CA   1  
ATOM   1995  C C    . ALA A 1 128 ? -10.382 5.800   6.874   1.00 0.23  ? 128  ALA A C    1  
ATOM   1996  O O    . ALA A 1 128 ? -9.497  5.739   7.731   1.00 0.28  ? 128  ALA A O    1  
ATOM   1997  C CB   . ALA A 1 128 ? -11.867 7.689   6.267   1.00 0.23  ? 128  ALA A CB   1  
ATOM   1998  H H    . ALA A 1 128 ? -11.227 6.815   3.991   1.00 0.23  ? 128  ALA A H    1  
ATOM   1999  H HA   . ALA A 1 128 ? -9.743  7.722   6.194   1.00 0.26  ? 128  ALA A HA   1  
ATOM   2000  H HB1  . ALA A 1 128 ? -11.854 8.102   7.263   1.00 1.12  ? 128  ALA A HB1  1  
ATOM   2001  H HB2  . ALA A 1 128 ? -12.657 6.950   6.196   1.00 0.96  ? 128  ALA A HB2  1  
ATOM   2002  H HB3  . ALA A 1 128 ? -12.040 8.476   5.549   1.00 1.02  ? 128  ALA A HB3  1  
ATOM   2003  N N    . TRP A 1 129 ? -11.244 4.825   6.648   1.00 0.25  ? 129  TRP A N    1  
ATOM   2004  C CA   . TRP A 1 129 ? -11.306 3.643   7.487   1.00 0.35  ? 129  TRP A CA   1  
ATOM   2005  C C    . TRP A 1 129 ? -10.109 2.723   7.253   1.00 0.25  ? 129  TRP A C    1  
ATOM   2006  O O    . TRP A 1 129 ? -9.746  1.932   8.125   1.00 0.27  ? 129  TRP A O    1  
ATOM   2007  C CB   . TRP A 1 129 ? -12.619 2.904   7.236   1.00 0.56  ? 129  TRP A CB   1  
ATOM   2008  C CG   . TRP A 1 129 ? -13.827 3.701   7.626   1.00 0.60  ? 129  TRP A CG   1  
ATOM   2009  C CD1  . TRP A 1 129 ? -14.806 4.165   6.796   1.00 0.49  ? 129  TRP A CD1  1  
ATOM   2010  C CD2  . TRP A 1 129 ? -14.175 4.139   8.943   1.00 1.73  ? 129  TRP A CD2  1  
ATOM   2011  N NE1  . TRP A 1 129 ? -15.741 4.866   7.516   1.00 1.14  ? 129  TRP A NE1  1  
ATOM   2012  C CE2  . TRP A 1 129 ? -15.378 4.862   8.837   1.00 1.99  ? 129  TRP A CE2  1  
ATOM   2013  C CE3  . TRP A 1 129 ? -13.589 3.988   10.203  1.00 2.63  ? 129  TRP A CE3  1  
ATOM   2014  C CZ2  . TRP A 1 129 ? -16.002 5.434   9.941   1.00 3.08  ? 129  TRP A CZ2  1  
ATOM   2015  C CZ3  . TRP A 1 129 ? -14.211 4.556   11.298  1.00 3.70  ? 129  TRP A CZ3  1  
ATOM   2016  C CH2  . TRP A 1 129 ? -15.406 5.271   11.159  1.00 3.91  ? 129  TRP A CH2  1  
ATOM   2017  H H    . TRP A 1 129 ? -11.865 4.906   5.890   1.00 0.26  ? 129  TRP A H    1  
ATOM   2018  H HA   . TRP A 1 129 ? -11.288 3.972   8.515   1.00 0.47  ? 129  TRP A HA   1  
ATOM   2019  H HB2  . TRP A 1 129 ? -12.698 2.675   6.184   1.00 1.10  ? 129  TRP A HB2  1  
ATOM   2020  H HB3  . TRP A 1 129 ? -12.623 1.990   7.803   1.00 0.98  ? 129  TRP A HB3  1  
ATOM   2021  H HD1  . TRP A 1 129 ? -14.827 3.999   5.728   1.00 1.00  ? 129  TRP A HD1  1  
ATOM   2022  H HE1  . TRP A 1 129 ? -16.540 5.297   7.143   1.00 1.24  ? 129  TRP A HE1  1  
ATOM   2023  H HE3  . TRP A 1 129 ? -12.667 3.439   10.329  1.00 2.55  ? 129  TRP A HE3  1  
ATOM   2024  H HZ2  . TRP A 1 129 ? -16.924 5.989   9.851   1.00 3.31  ? 129  TRP A HZ2  1  
ATOM   2025  H HZ3  . TRP A 1 129 ? -13.772 4.451   12.279  1.00 4.42  ? 129  TRP A HZ3  1  
ATOM   2026  H HH2  . TRP A 1 129 ? -15.857 5.700   12.043  1.00 4.77  ? 129  TRP A HH2  1  
ATOM   2027  N N    . MET A 1 130 ? -9.499  2.830   6.078   1.00 0.24  ? 130  MET A N    1  
ATOM   2028  C CA   . MET A 1 130 ? -8.275  2.093   5.782   1.00 0.26  ? 130  MET A CA   1  
ATOM   2029  C C    . MET A 1 130 ? -7.140  2.582   6.660   1.00 0.25  ? 130  MET A C    1  
ATOM   2030  O O    . MET A 1 130 ? -6.554  1.817   7.427   1.00 0.29  ? 130  MET A O    1  
ATOM   2031  C CB   . MET A 1 130 ? -7.878  2.263   4.320   1.00 0.31  ? 130  MET A CB   1  
ATOM   2032  C CG   . MET A 1 130 ? -8.780  1.538   3.349   1.00 0.29  ? 130  MET A CG   1  
ATOM   2033  S SD   . MET A 1 130 ? -8.340  1.879   1.639   1.00 1.08  ? 130  MET A SD   1  
ATOM   2034  C CE   . MET A 1 130 ? -6.668  1.251   1.610   1.00 0.31  ? 130  MET A CE   1  
ATOM   2035  H H    . MET A 1 130 ? -9.888  3.417   5.387   1.00 0.26  ? 130  MET A H    1  
ATOM   2036  H HA   . MET A 1 130 ? -8.451  1.046   5.980   1.00 0.28  ? 130  MET A HA   1  
ATOM   2037  H HB2  . MET A 1 130 ? -7.897  3.314   4.075   1.00 0.40  ? 130  MET A HB2  1  
ATOM   2038  H HB3  . MET A 1 130 ? -6.872  1.891   4.189   1.00 0.40  ? 130  MET A HB3  1  
ATOM   2039  H HG2  . MET A 1 130 ? -8.696  0.477   3.526   1.00 0.69  ? 130  MET A HG2  1  
ATOM   2040  H HG3  . MET A 1 130 ? -9.796  1.855   3.518   1.00 0.67  ? 130  MET A HG3  1  
ATOM   2041  H HE1  . MET A 1 130 ? -6.226  1.456   0.647   1.00 1.03  ? 130  MET A HE1  1  
ATOM   2042  H HE2  . MET A 1 130 ? -6.688  0.185   1.780   1.00 1.09  ? 130  MET A HE2  1  
ATOM   2043  H HE3  . MET A 1 130 ? -6.090  1.730   2.386   1.00 1.02  ? 130  MET A HE3  1  
ATOM   2044  N N    . ALA A 1 131 ? -6.845  3.870   6.554   1.00 0.24  ? 131  ALA A N    1  
ATOM   2045  C CA   . ALA A 1 131 ? -5.761  4.463   7.312   1.00 0.24  ? 131  ALA A CA   1  
ATOM   2046  C C    . ALA A 1 131 ? -6.023  4.348   8.803   1.00 0.24  ? 131  ALA A C    1  
ATOM   2047  O O    . ALA A 1 131 ? -5.098  4.156   9.588   1.00 0.25  ? 131  ALA A O    1  
ATOM   2048  C CB   . ALA A 1 131 ? -5.566  5.911   6.915   1.00 0.25  ? 131  ALA A CB   1  
ATOM   2049  H H    . ALA A 1 131 ? -7.374  4.436   5.949   1.00 0.25  ? 131  ALA A H    1  
ATOM   2050  H HA   . ALA A 1 131 ? -4.855  3.923   7.074   1.00 0.25  ? 131  ALA A HA   1  
ATOM   2051  H HB1  . ALA A 1 131 ? -5.420  5.976   5.842   1.00 1.04  ? 131  ALA A HB1  1  
ATOM   2052  H HB2  . ALA A 1 131 ? -4.697  6.305   7.424   1.00 1.01  ? 131  ALA A HB2  1  
ATOM   2053  H HB3  . ALA A 1 131 ? -6.437  6.480   7.199   1.00 1.05  ? 131  ALA A HB3  1  
ATOM   2054  N N    . THR A 1 132 ? -7.287  4.464   9.191   1.00 0.26  ? 132  THR A N    1  
ATOM   2055  C CA   . THR A 1 132 ? -7.659  4.294   10.585  1.00 0.29  ? 132  THR A CA   1  
ATOM   2056  C C    . THR A 1 132 ? -7.365  2.873   11.059  1.00 0.30  ? 132  THR A C    1  
ATOM   2057  O O    . THR A 1 132 ? -6.798  2.678   12.134  1.00 0.32  ? 132  THR A O    1  
ATOM   2058  C CB   . THR A 1 132 ? -9.144  4.599   10.831  1.00 0.32  ? 132  THR A CB   1  
ATOM   2059  O OG1  . THR A 1 132 ? -9.438  5.949   10.447  1.00 0.35  ? 132  THR A OG1  1  
ATOM   2060  C CG2  . THR A 1 132 ? -9.478  4.388   12.300  1.00 0.40  ? 132  THR A CG2  1  
ATOM   2061  H H    . THR A 1 132 ? -7.980  4.684   8.530   1.00 0.28  ? 132  THR A H    1  
ATOM   2062  H HA   . THR A 1 132 ? -7.069  4.986   11.166  1.00 0.31  ? 132  THR A HA   1  
ATOM   2063  H HB   . THR A 1 132 ? -9.743  3.923   10.238  1.00 0.33  ? 132  THR A HB   1  
ATOM   2064  H HG1  . THR A 1 132 ? -9.765  5.960   9.535   1.00 1.04  ? 132  THR A HG1  1  
ATOM   2065  H HG21 . THR A 1 132 ? -8.967  5.130   12.896  1.00 1.11  ? 132  THR A HG21 1  
ATOM   2066  H HG22 . THR A 1 132 ? -9.144  3.400   12.599  1.00 1.07  ? 132  THR A HG22 1  
ATOM   2067  H HG23 . THR A 1 132 ? -10.544 4.470   12.448  1.00 1.13  ? 132  THR A HG23 1  
ATOM   2068  N N    . TYR A 1 133 ? -7.759  1.881   10.264  1.00 0.30  ? 133  TYR A N    1  
ATOM   2069  C CA   . TYR A 1 133 ? -7.475  0.493   10.601  1.00 0.32  ? 133  TYR A CA   1  
ATOM   2070  C C    . TYR A 1 133 ? -5.976  0.301   10.781  1.00 0.32  ? 133  TYR A C    1  
ATOM   2071  O O    . TYR A 1 133 ? -5.535  -0.419  11.675  1.00 0.37  ? 133  TYR A O    1  
ATOM   2072  C CB   . TYR A 1 133 ? -8.001  -0.464  9.529   1.00 0.33  ? 133  TYR A CB   1  
ATOM   2073  C CG   . TYR A 1 133 ? -7.858  -1.919  9.921   1.00 0.93  ? 133  TYR A CG   1  
ATOM   2074  C CD1  . TYR A 1 133 ? -8.830  -2.556  10.683  1.00 1.29  ? 133  TYR A CD1  1  
ATOM   2075  C CD2  . TYR A 1 133 ? -6.758  -2.659  9.508   1.00 1.72  ? 133  TYR A CD2  1  
ATOM   2076  C CE1  . TYR A 1 133 ? -8.707  -3.888  11.024  1.00 1.93  ? 133  TYR A CE1  1  
ATOM   2077  C CE2  . TYR A 1 133 ? -6.632  -3.993  9.841   1.00 2.40  ? 133  TYR A CE2  1  
ATOM   2078  C CZ   . TYR A 1 133 ? -7.585  -4.577  10.682  1.00 2.40  ? 133  TYR A CZ   1  
ATOM   2079  O OH   . TYR A 1 133 ? -7.492  -5.931  10.924  1.00 3.13  ? 133  TYR A OH   1  
ATOM   2080  H H    . TYR A 1 133 ? -8.255  2.086   9.443   1.00 0.30  ? 133  TYR A H    1  
ATOM   2081  H HA   . TYR A 1 133 ? -7.967  0.276   11.538  1.00 0.34  ? 133  TYR A HA   1  
ATOM   2082  H HB2  . TYR A 1 133 ? -9.046  -0.265  9.357   1.00 0.63  ? 133  TYR A HB2  1  
ATOM   2083  H HB3  . TYR A 1 133 ? -7.451  -0.309  8.611   1.00 0.67  ? 133  TYR A HB3  1  
ATOM   2084  H HD1  . TYR A 1 133 ? -9.691  -1.994  11.014  1.00 1.45  ? 133  TYR A HD1  1  
ATOM   2085  H HD2  . TYR A 1 133 ? -5.994  -2.178  8.914   1.00 1.99  ? 133  TYR A HD2  1  
ATOM   2086  H HE1  . TYR A 1 133 ? -9.472  -4.366  11.619  1.00 2.31  ? 133  TYR A HE1  1  
ATOM   2087  H HE2  . TYR A 1 133 ? -5.770  -4.552  9.511   1.00 3.06  ? 133  TYR A HE2  1  
ATOM   2088  H HH   . TYR A 1 133 ? -6.576  -6.127  11.168  1.00 3.35  ? 133  TYR A HH   1  
ATOM   2089  N N    . LEU A 1 134 ? -5.196  0.957   9.933   1.00 0.29  ? 134  LEU A N    1  
ATOM   2090  C CA   . LEU A 1 134 ? -3.755  0.951   10.084  1.00 0.30  ? 134  LEU A CA   1  
ATOM   2091  C C    . LEU A 1 134 ? -3.392  1.611   11.412  1.00 0.32  ? 134  LEU A C    1  
ATOM   2092  O O    . LEU A 1 134 ? -2.674  1.036   12.216  1.00 0.35  ? 134  LEU A O    1  
ATOM   2093  C CB   . LEU A 1 134 ? -3.082  1.676   8.905   1.00 0.29  ? 134  LEU A CB   1  
ATOM   2094  C CG   . LEU A 1 134 ? -1.583  1.394   8.717   1.00 0.48  ? 134  LEU A CG   1  
ATOM   2095  C CD1  . LEU A 1 134 ? -1.123  1.864   7.347   1.00 0.95  ? 134  LEU A CD1  1  
ATOM   2096  C CD2  . LEU A 1 134 ? -0.753  2.065   9.801   1.00 0.88  ? 134  LEU A CD2  1  
ATOM   2097  H H    . LEU A 1 134 ? -5.604  1.453   9.189   1.00 0.28  ? 134  LEU A H    1  
ATOM   2098  H HA   . LEU A 1 134 ? -3.426  -0.077  10.104  1.00 0.31  ? 134  LEU A HA   1  
ATOM   2099  H HB2  . LEU A 1 134 ? -3.594  1.393   7.998   1.00 0.33  ? 134  LEU A HB2  1  
ATOM   2100  H HB3  . LEU A 1 134 ? -3.208  2.739   9.049   1.00 0.42  ? 134  LEU A HB3  1  
ATOM   2101  H HG   . LEU A 1 134 ? -1.413  0.331   8.777   1.00 1.16  ? 134  LEU A HG   1  
ATOM   2102  H HD11 . LEU A 1 134 ? -1.664  1.328   6.583   1.00 1.59  ? 134  LEU A HD11 1  
ATOM   2103  H HD12 . LEU A 1 134 ? -0.065  1.674   7.240   1.00 1.54  ? 134  LEU A HD12 1  
ATOM   2104  H HD13 . LEU A 1 134 ? -1.311  2.923   7.248   1.00 1.45  ? 134  LEU A HD13 1  
ATOM   2105  H HD21 . LEU A 1 134 ? -0.906  3.134   9.762   1.00 1.30  ? 134  LEU A HD21 1  
ATOM   2106  H HD22 . LEU A 1 134 ? 0.291   1.845   9.642   1.00 1.49  ? 134  LEU A HD22 1  
ATOM   2107  H HD23 . LEU A 1 134 ? -1.058  1.694   10.769  1.00 1.46  ? 134  LEU A HD23 1  
ATOM   2108  N N    . ASN A 1 135 ? -3.932  2.798   11.639  1.00 0.31  ? 135  ASN A N    1  
ATOM   2109  C CA   . ASN A 1 135 ? -3.671  3.568   12.856  1.00 0.35  ? 135  ASN A CA   1  
ATOM   2110  C C    . ASN A 1 135 ? -3.898  2.755   14.126  1.00 0.38  ? 135  ASN A C    1  
ATOM   2111  O O    . ASN A 1 135 ? -3.050  2.740   15.020  1.00 0.43  ? 135  ASN A O    1  
ATOM   2112  C CB   . ASN A 1 135 ? -4.563  4.813   12.891  1.00 0.36  ? 135  ASN A CB   1  
ATOM   2113  C CG   . ASN A 1 135 ? -3.895  6.040   12.316  1.00 0.38  ? 135  ASN A CG   1  
ATOM   2114  O OD1  . ASN A 1 135 ? -3.281  6.826   13.038  1.00 0.46  ? 135  ASN A OD1  1  
ATOM   2115  N ND2  . ASN A 1 135 ? -3.990  6.206   11.012  1.00 0.34  ? 135  ASN A ND2  1  
ATOM   2116  H H    . ASN A 1 135 ? -4.531  3.180   10.959  1.00 0.30  ? 135  ASN A H    1  
ATOM   2117  H HA   . ASN A 1 135 ? -2.641  3.876   12.830  1.00 0.37  ? 135  ASN A HA   1  
ATOM   2118  H HB2  . ASN A 1 135 ? -5.457  4.618   12.319  1.00 0.34  ? 135  ASN A HB2  1  
ATOM   2119  H HB3  . ASN A 1 135 ? -4.838  5.022   13.909  1.00 0.40  ? 135  ASN A HB3  1  
ATOM   2120  H HD21 . ASN A 1 135 ? -4.477  5.530   10.491  1.00 0.30  ? 135  ASN A HD21 1  
ATOM   2121  H HD22 . ASN A 1 135 ? -3.559  6.992   10.611  1.00 0.37  ? 135  ASN A HD22 1  
ATOM   2122  N N    . ASP A 1 136 ? -5.042  2.094   14.215  1.00 0.38  ? 136  ASP A N    1  
ATOM   2123  C CA   . ASP A 1 136 ? -5.391  1.351   15.419  1.00 0.42  ? 136  ASP A CA   1  
ATOM   2124  C C    . ASP A 1 136 ? -4.762  -0.041  15.438  1.00 0.40  ? 136  ASP A C    1  
ATOM   2125  O O    . ASP A 1 136 ? -4.114  -0.431  16.408  1.00 0.43  ? 136  ASP A O    1  
ATOM   2126  C CB   . ASP A 1 136 ? -6.913  1.240   15.535  1.00 0.45  ? 136  ASP A CB   1  
ATOM   2127  C CG   . ASP A 1 136 ? -7.349  0.217   16.564  1.00 0.53  ? 136  ASP A CG   1  
ATOM   2128  O OD1  . ASP A 1 136 ? -7.278  0.509   17.776  1.00 0.59  ? 136  ASP A OD1  1  
ATOM   2129  O OD2  . ASP A 1 136 ? -7.777  -0.882  16.159  1.00 0.58  ? 136  ASP A OD2  1  
ATOM   2130  H H    . ASP A 1 136 ? -5.677  2.113   13.457  1.00 0.37  ? 136  ASP A H    1  
ATOM   2131  H HA   . ASP A 1 136 ? -5.020  1.907   16.267  1.00 0.46  ? 136  ASP A HA   1  
ATOM   2132  H HB2  . ASP A 1 136 ? -7.317  2.200   15.819  1.00 0.48  ? 136  ASP A HB2  1  
ATOM   2133  H HB3  . ASP A 1 136 ? -7.319  0.953   14.577  1.00 0.44  ? 136  ASP A HB3  1  
ATOM   2134  N N    . HIS A 1 137 ? -4.952  -0.780  14.361  1.00 0.38  ? 137  HIS A N    1  
ATOM   2135  C CA   . HIS A 1 137 ? -4.591  -2.193  14.323  1.00 0.38  ? 137  HIS A CA   1  
ATOM   2136  C C    . HIS A 1 137 ? -3.170  -2.436  13.815  1.00 0.35  ? 137  HIS A C    1  
ATOM   2137  O O    . HIS A 1 137 ? -2.391  -3.149  14.446  1.00 0.37  ? 137  HIS A O    1  
ATOM   2138  C CB   . HIS A 1 137 ? -5.587  -2.937  13.435  1.00 0.40  ? 137  HIS A CB   1  
ATOM   2139  C CG   . HIS A 1 137 ? -6.597  -3.751  14.189  1.00 0.63  ? 137  HIS A CG   1  
ATOM   2140  N ND1  . HIS A 1 137 ? -7.505  -3.209  15.073  1.00 1.18  ? 137  HIS A ND1  1  
ATOM   2141  C CD2  . HIS A 1 137 ? -6.850  -5.082  14.171  1.00 1.45  ? 137  HIS A CD2  1  
ATOM   2142  C CE1  . HIS A 1 137 ? -8.270  -4.165  15.560  1.00 1.13  ? 137  HIS A CE1  1  
ATOM   2143  N NE2  . HIS A 1 137 ? -7.895  -5.310  15.029  1.00 1.34  ? 137  HIS A NE2  1  
ATOM   2144  H H    . HIS A 1 137 ? -5.339  -0.365  13.559  1.00 0.37  ? 137  HIS A H    1  
ATOM   2145  H HA   . HIS A 1 137 ? -4.670  -2.580  15.327  1.00 0.42  ? 137  HIS A HA   1  
ATOM   2146  H HB2  . HIS A 1 137 ? -6.127  -2.209  12.844  1.00 0.51  ? 137  HIS A HB2  1  
ATOM   2147  H HB3  . HIS A 1 137 ? -5.045  -3.599  12.772  1.00 0.41  ? 137  HIS A HB3  1  
ATOM   2148  H HD1  . HIS A 1 137 ? -7.570  -2.250  15.328  1.00 1.96  ? 137  HIS A HD1  1  
ATOM   2149  H HD2  . HIS A 1 137 ? -6.328  -5.825  13.585  1.00 2.34  ? 137  HIS A HD2  1  
ATOM   2150  H HE1  . HIS A 1 137 ? -9.070  -4.032  16.273  1.00 1.61  ? 137  HIS A HE1  1  
ATOM   2151  H HE2  . HIS A 1 137 ? -8.204  -6.201  15.328  1.00 1.90  ? 137  HIS A HE2  1  
ATOM   2152  N N    . LEU A 1 138 ? -2.841  -1.845  12.679  1.00 0.32  ? 138  LEU A N    1  
ATOM   2153  C CA   . LEU A 1 138 ? -1.631  -2.177  11.956  1.00 0.29  ? 138  LEU A CA   1  
ATOM   2154  C C    . LEU A 1 138 ? -0.387  -1.504  12.512  1.00 0.27  ? 138  LEU A C    1  
ATOM   2155  O O    . LEU A 1 138 ? 0.656   -2.138  12.643  1.00 0.27  ? 138  LEU A O    1  
ATOM   2156  C CB   . LEU A 1 138 ? -1.837  -1.767  10.516  1.00 0.30  ? 138  LEU A CB   1  
ATOM   2157  C CG   . LEU A 1 138 ? -1.962  -2.913  9.537   1.00 0.59  ? 138  LEU A CG   1  
ATOM   2158  C CD1  . LEU A 1 138 ? -2.586  -4.137  10.186  1.00 1.20  ? 138  LEU A CD1  1  
ATOM   2159  C CD2  . LEU A 1 138 ? -2.776  -2.481  8.334   1.00 1.20  ? 138  LEU A CD2  1  
ATOM   2160  H H    . LEU A 1 138 ? -3.433  -1.165  12.297  1.00 0.33  ? 138  LEU A H    1  
ATOM   2161  H HA   . LEU A 1 138 ? -1.500  -3.246  11.996  1.00 0.32  ? 138  LEU A HA   1  
ATOM   2162  H HB2  . LEU A 1 138 ? -2.736  -1.171  10.459  1.00 0.58  ? 138  LEU A HB2  1  
ATOM   2163  H HB3  . LEU A 1 138 ? -0.999  -1.156  10.214  1.00 0.58  ? 138  LEU A HB3  1  
ATOM   2164  H HG   . LEU A 1 138 ? -0.985  -3.171  9.209   1.00 1.51  ? 138  LEU A HG   1  
ATOM   2165  H HD11 . LEU A 1 138 ? -1.972  -4.454  11.016  1.00 1.82  ? 138  LEU A HD11 1  
ATOM   2166  H HD12 . LEU A 1 138 ? -2.648  -4.936  9.460   1.00 1.75  ? 138  LEU A HD12 1  
ATOM   2167  H HD13 . LEU A 1 138 ? -3.576  -3.893  10.541  1.00 1.75  ? 138  LEU A HD13 1  
ATOM   2168  H HD21 . LEU A 1 138 ? -2.874  -3.309  7.649   1.00 1.73  ? 138  LEU A HD21 1  
ATOM   2169  H HD22 . LEU A 1 138 ? -2.282  -1.659  7.841   1.00 1.90  ? 138  LEU A HD22 1  
ATOM   2170  H HD23 . LEU A 1 138 ? -3.758  -2.168  8.665   1.00 1.66  ? 138  LEU A HD23 1  
ATOM   2171  N N    . GLU A 1 139 ? -0.506  -0.220  12.803  1.00 0.30  ? 139  GLU A N    1  
ATOM   2172  C CA   . GLU A 1 139 ? 0.617   0.601   13.246  1.00 0.31  ? 139  GLU A CA   1  
ATOM   2173  C C    . GLU A 1 139 ? 1.438   -0.074  14.356  1.00 0.30  ? 139  GLU A C    1  
ATOM   2174  O O    . GLU A 1 139 ? 2.660   -0.156  14.232  1.00 0.30  ? 139  GLU A O    1  
ATOM   2175  C CB   . GLU A 1 139 ? 0.135   1.980   13.703  1.00 0.38  ? 139  GLU A CB   1  
ATOM   2176  C CG   . GLU A 1 139 ? 1.261   2.975   13.904  1.00 0.40  ? 139  GLU A CG   1  
ATOM   2177  C CD   . GLU A 1 139 ? 0.786   4.264   14.534  1.00 0.49  ? 139  GLU A CD   1  
ATOM   2178  O OE1  . GLU A 1 139 ? 0.158   5.080   13.835  1.00 0.75  ? 139  GLU A OE1  1  
ATOM   2179  O OE2  . GLU A 1 139 ? 1.038   4.461   15.743  1.00 0.61  ? 139  GLU A OE2  1  
ATOM   2180  H H    . GLU A 1 139 ? -1.388  0.200   12.701  1.00 0.34  ? 139  GLU A H    1  
ATOM   2181  H HA   . GLU A 1 139 ? 1.263   0.738   12.391  1.00 0.30  ? 139  GLU A HA   1  
ATOM   2182  H HB2  . GLU A 1 139 ? -0.540  2.376   12.959  1.00 0.44  ? 139  GLU A HB2  1  
ATOM   2183  H HB3  . GLU A 1 139 ? -0.394  1.876   14.636  1.00 0.42  ? 139  GLU A HB3  1  
ATOM   2184  H HG2  . GLU A 1 139 ? 2.006   2.532   14.547  1.00 0.40  ? 139  GLU A HG2  1  
ATOM   2185  H HG3  . GLU A 1 139 ? 1.702   3.201   12.943  1.00 0.42  ? 139  GLU A HG3  1  
ATOM   2186  N N    . PRO A 1 140 ? 0.803   -0.576  15.447  1.00 0.32  ? 140  PRO A N    1  
ATOM   2187  C CA   . PRO A 1 140 ? 1.529   -1.295  16.500  1.00 0.34  ? 140  PRO A CA   1  
ATOM   2188  C C    . PRO A 1 140 ? 2.367   -2.434  15.931  1.00 0.32  ? 140  PRO A C    1  
ATOM   2189  O O    . PRO A 1 140 ? 3.558   -2.545  16.216  1.00 0.34  ? 140  PRO A O    1  
ATOM   2190  C CB   . PRO A 1 140 ? 0.420   -1.852  17.392  1.00 0.40  ? 140  PRO A CB   1  
ATOM   2191  C CG   . PRO A 1 140 ? -0.738  -0.949  17.175  1.00 0.56  ? 140  PRO A CG   1  
ATOM   2192  C CD   . PRO A 1 140 ? -0.642  -0.483  15.752  1.00 0.36  ? 140  PRO A CD   1  
ATOM   2193  H HA   . PRO A 1 140 ? 2.161   -0.631  17.072  1.00 0.37  ? 140  PRO A HA   1  
ATOM   2194  H HB2  . PRO A 1 140 ? 0.190   -2.863  17.093  1.00 0.48  ? 140  PRO A HB2  1  
ATOM   2195  H HB3  . PRO A 1 140 ? 0.742   -1.840  18.422  1.00 0.52  ? 140  PRO A HB3  1  
ATOM   2196  H HG2  . PRO A 1 140 ? -1.656  -1.496  17.326  1.00 0.82  ? 140  PRO A HG2  1  
ATOM   2197  H HG3  . PRO A 1 140 ? -0.684  -0.108  17.850  1.00 0.87  ? 140  PRO A HG3  1  
ATOM   2198  H HD2  . PRO A 1 140 ? -1.212  -1.134  15.105  1.00 0.42  ? 140  PRO A HD2  1  
ATOM   2199  H HD3  . PRO A 1 140 ? -0.990  0.534   15.667  1.00 0.46  ? 140  PRO A HD3  1  
ATOM   2200  N N    . TRP A 1 141 ? 1.730   -3.260  15.112  1.00 0.31  ? 141  TRP A N    1  
ATOM   2201  C CA   . TRP A 1 141 ? 2.390   -4.387  14.459  1.00 0.32  ? 141  TRP A CA   1  
ATOM   2202  C C    . TRP A 1 141 ? 3.556   -3.901  13.603  1.00 0.31  ? 141  TRP A C    1  
ATOM   2203  O O    . TRP A 1 141 ? 4.658   -4.429  13.684  1.00 0.36  ? 141  TRP A O    1  
ATOM   2204  C CB   . TRP A 1 141 ? 1.378   -5.128  13.587  1.00 0.35  ? 141  TRP A CB   1  
ATOM   2205  C CG   . TRP A 1 141 ? 1.442   -6.617  13.715  1.00 0.36  ? 141  TRP A CG   1  
ATOM   2206  C CD1  . TRP A 1 141 ? 2.224   -7.468  12.994  1.00 0.43  ? 141  TRP A CD1  1  
ATOM   2207  C CD2  . TRP A 1 141 ? 0.686   -7.430  14.619  1.00 0.63  ? 141  TRP A CD2  1  
ATOM   2208  N NE1  . TRP A 1 141 ? 1.992   -8.764  13.384  1.00 0.60  ? 141  TRP A NE1  1  
ATOM   2209  C CE2  . TRP A 1 141 ? 1.057   -8.767  14.385  1.00 0.70  ? 141  TRP A CE2  1  
ATOM   2210  C CE3  . TRP A 1 141 ? -0.268  -7.159  15.604  1.00 0.91  ? 141  TRP A CE3  1  
ATOM   2211  C CZ2  . TRP A 1 141 ? 0.506   -9.827  15.097  1.00 0.98  ? 141  TRP A CZ2  1  
ATOM   2212  C CZ3  . TRP A 1 141 ? -0.812  -8.213  16.312  1.00 1.19  ? 141  TRP A CZ3  1  
ATOM   2213  C CH2  . TRP A 1 141 ? -0.424  -9.533  16.055  1.00 1.20  ? 141  TRP A CH2  1  
ATOM   2214  H H    . TRP A 1 141 ? 0.777   -3.104  14.938  1.00 0.32  ? 141  TRP A H    1  
ATOM   2215  H HA   . TRP A 1 141 ? 2.767   -5.055  15.219  1.00 0.36  ? 141  TRP A HA   1  
ATOM   2216  H HB2  . TRP A 1 141 ? 0.382   -4.816  13.863  1.00 0.48  ? 141  TRP A HB2  1  
ATOM   2217  H HB3  . TRP A 1 141 ? 1.554   -4.873  12.552  1.00 0.41  ? 141  TRP A HB3  1  
ATOM   2218  H HD1  . TRP A 1 141 ? 2.912   -7.157  12.223  1.00 0.54  ? 141  TRP A HD1  1  
ATOM   2219  H HE1  . TRP A 1 141 ? 2.429   -9.561  13.007  1.00 0.74  ? 141  TRP A HE1  1  
ATOM   2220  H HE3  . TRP A 1 141 ? -0.580  -6.146  15.815  1.00 0.97  ? 141  TRP A HE3  1  
ATOM   2221  H HZ2  . TRP A 1 141 ? 0.795   -10.851 14.911  1.00 1.08  ? 141  TRP A HZ2  1  
ATOM   2222  H HZ3  . TRP A 1 141 ? -1.551  -8.022  17.075  1.00 1.43  ? 141  TRP A HZ3  1  
ATOM   2223  H HH2  . TRP A 1 141 ? -0.877  -10.326 16.630  1.00 1.43  ? 141  TRP A HH2  1  
ATOM   2224  N N    . ILE A 1 142 ? 3.300   -2.884  12.795  1.00 0.26  ? 142  ILE A N    1  
ATOM   2225  C CA   . ILE A 1 142 ? 4.325   -2.255  11.967  1.00 0.26  ? 142  ILE A CA   1  
ATOM   2226  C C    . ILE A 1 142 ? 5.559   -1.903  12.785  1.00 0.29  ? 142  ILE A C    1  
ATOM   2227  O O    . ILE A 1 142 ? 6.683   -2.242  12.416  1.00 0.32  ? 142  ILE A O    1  
ATOM   2228  C CB   . ILE A 1 142 ? 3.752   -0.979  11.326  1.00 0.25  ? 142  ILE A CB   1  
ATOM   2229  C CG1  . ILE A 1 142 ? 2.749   -1.362  10.250  1.00 0.28  ? 142  ILE A CG1  1  
ATOM   2230  C CG2  . ILE A 1 142 ? 4.853   -0.096  10.760  1.00 0.28  ? 142  ILE A CG2  1  
ATOM   2231  C CD1  . ILE A 1 142 ? 1.764   -0.273  9.932   1.00 0.26  ? 142  ILE A CD1  1  
ATOM   2232  H H    . ILE A 1 142 ? 2.377   -2.540  12.748  1.00 0.25  ? 142  ILE A H    1  
ATOM   2233  H HA   . ILE A 1 142 ? 4.602   -2.943  11.180  1.00 0.28  ? 142  ILE A HA   1  
ATOM   2234  H HB   . ILE A 1 142 ? 3.240   -0.420  12.094  1.00 0.26  ? 142  ILE A HB   1  
ATOM   2235  H HG12 . ILE A 1 142 ? 3.281   -1.603  9.341   1.00 0.40  ? 142  ILE A HG12 1  
ATOM   2236  H HG13 . ILE A 1 142 ? 2.194   -2.230  10.577  1.00 0.41  ? 142  ILE A HG13 1  
ATOM   2237  H HG21 . ILE A 1 142 ? 5.516   0.202   11.563  1.00 1.13  ? 142  ILE A HG21 1  
ATOM   2238  H HG22 . ILE A 1 142 ? 4.418   0.784   10.307  1.00 1.06  ? 142  ILE A HG22 1  
ATOM   2239  H HG23 . ILE A 1 142 ? 5.412   -0.645  10.018  1.00 0.97  ? 142  ILE A HG23 1  
ATOM   2240  H HD11 . ILE A 1 142 ? 1.007   -0.660  9.264   1.00 1.01  ? 142  ILE A HD11 1  
ATOM   2241  H HD12 . ILE A 1 142 ? 2.278   0.553   9.464   1.00 1.00  ? 142  ILE A HD12 1  
ATOM   2242  H HD13 . ILE A 1 142 ? 1.301   0.062   10.850  1.00 1.07  ? 142  ILE A HD13 1  
ATOM   2243  N N    . GLN A 1 143 ? 5.333   -1.219  13.891  1.00 0.30  ? 143  GLN A N    1  
ATOM   2244  C CA   . GLN A 1 143 ? 6.411   -0.795  14.773  1.00 0.35  ? 143  GLN A CA   1  
ATOM   2245  C C    . GLN A 1 143 ? 7.198   -1.991  15.316  1.00 0.39  ? 143  GLN A C    1  
ATOM   2246  O O    . GLN A 1 143 ? 8.403   -1.892  15.542  1.00 0.43  ? 143  GLN A O    1  
ATOM   2247  C CB   . GLN A 1 143 ? 5.843   0.032   15.919  1.00 0.41  ? 143  GLN A CB   1  
ATOM   2248  C CG   . GLN A 1 143 ? 5.051   1.245   15.452  1.00 0.43  ? 143  GLN A CG   1  
ATOM   2249  C CD   . GLN A 1 143 ? 5.898   2.242   14.685  1.00 0.48  ? 143  GLN A CD   1  
ATOM   2250  O OE1  . GLN A 1 143 ? 7.102   2.360   14.912  1.00 0.57  ? 143  GLN A OE1  1  
ATOM   2251  N NE2  . GLN A 1 143 ? 5.272   2.969   13.775  1.00 0.52  ? 143  GLN A NE2  1  
ATOM   2252  H H    . GLN A 1 143 ? 4.409   -0.978  14.119  1.00 0.29  ? 143  GLN A H    1  
ATOM   2253  H HA   . GLN A 1 143 ? 7.080   -0.173  14.196  1.00 0.36  ? 143  GLN A HA   1  
ATOM   2254  H HB2  . GLN A 1 143 ? 5.192   -0.594  16.512  1.00 0.42  ? 143  GLN A HB2  1  
ATOM   2255  H HB3  . GLN A 1 143 ? 6.658   0.378   16.535  1.00 0.45  ? 143  GLN A HB3  1  
ATOM   2256  H HG2  . GLN A 1 143 ? 4.253   0.907   14.801  1.00 0.38  ? 143  GLN A HG2  1  
ATOM   2257  H HG3  . GLN A 1 143 ? 4.627   1.739   16.314  1.00 0.50  ? 143  GLN A HG3  1  
ATOM   2258  H HE21 . GLN A 1 143 ? 4.311   2.825   13.648  1.00 0.56  ? 143  GLN A HE21 1  
ATOM   2259  H HE22 . GLN A 1 143 ? 5.793   3.628   13.272  1.00 0.58  ? 143  GLN A HE22 1  
ATOM   2260  N N    . GLU A 1 144 ? 6.523   -3.128  15.498  1.00 0.40  ? 144  GLU A N    1  
ATOM   2261  C CA   . GLU A 1 144 ? 7.175   -4.355  15.953  1.00 0.47  ? 144  GLU A CA   1  
ATOM   2262  C C    . GLU A 1 144 ? 8.165   -4.856  14.911  1.00 0.48  ? 144  GLU A C    1  
ATOM   2263  O O    . GLU A 1 144 ? 9.079   -5.625  15.209  1.00 0.55  ? 144  GLU A O    1  
ATOM   2264  C CB   . GLU A 1 144 ? 6.118   -5.427  16.195  1.00 0.51  ? 144  GLU A CB   1  
ATOM   2265  C CG   . GLU A 1 144 ? 5.033   -4.994  17.151  1.00 0.52  ? 144  GLU A CG   1  
ATOM   2266  C CD   . GLU A 1 144 ? 5.458   -5.068  18.600  1.00 0.61  ? 144  GLU A CD   1  
ATOM   2267  O OE1  . GLU A 1 144 ? 6.239   -4.199  19.045  1.00 0.67  ? 144  GLU A OE1  1  
ATOM   2268  O OE2  . GLU A 1 144 ? 5.005   -5.991  19.308  1.00 0.78  ? 144  GLU A OE2  1  
ATOM   2269  H H    . GLU A 1 144 ? 5.551   -3.146  15.330  1.00 0.38  ? 144  GLU A H    1  
ATOM   2270  H HA   . GLU A 1 144 ? 7.695   -4.147  16.873  1.00 0.51  ? 144  GLU A HA   1  
ATOM   2271  H HB2  . GLU A 1 144 ? 5.650   -5.678  15.253  1.00 0.50  ? 144  GLU A HB2  1  
ATOM   2272  H HB3  . GLU A 1 144 ? 6.597   -6.307  16.599  1.00 0.57  ? 144  GLU A HB3  1  
ATOM   2273  H HG2  . GLU A 1 144 ? 4.767   -3.972  16.923  1.00 0.47  ? 144  GLU A HG2  1  
ATOM   2274  H HG3  . GLU A 1 144 ? 4.177   -5.626  16.998  1.00 0.55  ? 144  GLU A HG3  1  
ATOM   2275  N N    . ASN A 1 145 ? 7.965   -4.406  13.688  1.00 0.44  ? 145  ASN A N    1  
ATOM   2276  C CA   . ASN A 1 145 ? 8.741   -4.862  12.552  1.00 0.48  ? 145  ASN A CA   1  
ATOM   2277  C C    . ASN A 1 145 ? 9.632   -3.744  12.037  1.00 0.47  ? 145  ASN A C    1  
ATOM   2278  O O    . ASN A 1 145 ? 10.296  -3.873  11.007  1.00 0.57  ? 145  ASN A O    1  
ATOM   2279  C CB   . ASN A 1 145 ? 7.786   -5.356  11.468  1.00 0.49  ? 145  ASN A CB   1  
ATOM   2280  C CG   . ASN A 1 145 ? 7.057   -6.607  11.910  1.00 0.58  ? 145  ASN A CG   1  
ATOM   2281  O OD1  . ASN A 1 145 ? 7.444   -7.726  11.568  1.00 0.93  ? 145  ASN A OD1  1  
ATOM   2282  N ND2  . ASN A 1 145 ? 6.014   -6.428  12.703  1.00 0.54  ? 145  ASN A ND2  1  
ATOM   2283  H H    . ASN A 1 145 ? 7.261   -3.740  13.543  1.00 0.39  ? 145  ASN A H    1  
ATOM   2284  H HA   . ASN A 1 145 ? 9.361   -5.683  12.878  1.00 0.55  ? 145  ASN A HA   1  
ATOM   2285  H HB2  . ASN A 1 145 ? 7.056   -4.587  11.258  1.00 0.44  ? 145  ASN A HB2  1  
ATOM   2286  H HB3  . ASN A 1 145 ? 8.343   -5.575  10.572  1.00 0.52  ? 145  ASN A HB3  1  
ATOM   2287  H HD21 . ASN A 1 145 ? 5.766   -5.508  12.951  1.00 0.69  ? 145  ASN A HD21 1  
ATOM   2288  H HD22 . ASN A 1 145 ? 5.548   -7.216  13.050  1.00 0.56  ? 145  ASN A HD22 1  
ATOM   2289  N N    . GLY A 1 146 ? 9.632   -2.640  12.765  1.00 0.42  ? 146  GLY A N    1  
ATOM   2290  C CA   . GLY A 1 146 ? 10.538  -1.558  12.474  1.00 0.45  ? 146  GLY A CA   1  
ATOM   2291  C C    . GLY A 1 146 ? 9.834   -0.260  12.147  1.00 0.44  ? 146  GLY A C    1  
ATOM   2292  O O    . GLY A 1 146 ? 10.190  0.795   12.672  1.00 0.56  ? 146  GLY A O    1  
ATOM   2293  H H    . GLY A 1 146 ? 9.006   -2.561  13.513  1.00 0.44  ? 146  GLY A H    1  
ATOM   2294  H HA2  . GLY A 1 146 ? 11.163  -1.403  13.337  1.00 0.49  ? 146  GLY A HA2  1  
ATOM   2295  H HA3  . GLY A 1 146 ? 11.162  -1.840  11.639  1.00 0.47  ? 146  GLY A HA3  1  
ATOM   2296  N N    . GLY A 1 147 ? 8.838   -0.329  11.285  1.00 0.36  ? 147  GLY A N    1  
ATOM   2297  C CA   . GLY A 1 147 ? 8.140   0.870   10.872  1.00 0.36  ? 147  GLY A CA   1  
ATOM   2298  C C    . GLY A 1 147 ? 8.022   0.969   9.367   1.00 0.38  ? 147  GLY A C    1  
ATOM   2299  O O    . GLY A 1 147 ? 8.380   0.033   8.649   1.00 0.49  ? 147  GLY A O    1  
ATOM   2300  H H    . GLY A 1 147 ? 8.570   -1.200  10.924  1.00 0.37  ? 147  GLY A H    1  
ATOM   2301  H HA2  . GLY A 1 147 ? 7.150   0.863   11.304  1.00 0.35  ? 147  GLY A HA2  1  
ATOM   2302  H HA3  . GLY A 1 147 ? 8.678   1.732   11.238  1.00 0.39  ? 147  GLY A HA3  1  
ATOM   2303  N N    . TRP A 1 148 ? 7.538   2.105   8.889   1.00 0.35  ? 148  TRP A N    1  
ATOM   2304  C CA   . TRP A 1 148 ? 7.317   2.310   7.469   1.00 0.37  ? 148  TRP A CA   1  
ATOM   2305  C C    . TRP A 1 148 ? 8.635   2.563   6.749   1.00 0.38  ? 148  TRP A C    1  
ATOM   2306  O O    . TRP A 1 148 ? 8.818   2.133   5.612   1.00 0.40  ? 148  TRP A O    1  
ATOM   2307  C CB   . TRP A 1 148 ? 6.357   3.475   7.252   1.00 0.39  ? 148  TRP A CB   1  
ATOM   2308  C CG   . TRP A 1 148 ? 5.009   3.263   7.875   1.00 0.46  ? 148  TRP A CG   1  
ATOM   2309  C CD1  . TRP A 1 148 ? 4.030   2.418   7.438   1.00 0.79  ? 148  TRP A CD1  1  
ATOM   2310  C CD2  . TRP A 1 148 ? 4.487   3.913   9.040   1.00 1.45  ? 148  TRP A CD2  1  
ATOM   2311  N NE1  . TRP A 1 148 ? 2.932   2.503   8.260   1.00 0.52  ? 148  TRP A NE1  1  
ATOM   2312  C CE2  . TRP A 1 148 ? 3.188   3.414   9.251   1.00 1.25  ? 148  TRP A CE2  1  
ATOM   2313  C CE3  . TRP A 1 148 ? 4.993   4.870   9.926   1.00 2.64  ? 148  TRP A CE3  1  
ATOM   2314  C CZ2  . TRP A 1 148 ? 2.391   3.839   10.310  1.00 2.17  ? 148  TRP A CZ2  1  
ATOM   2315  C CZ3  . TRP A 1 148 ? 4.200   5.290   10.976  1.00 3.57  ? 148  TRP A CZ3  1  
ATOM   2316  C CH2  . TRP A 1 148 ? 2.912   4.774   11.161  1.00 3.32  ? 148  TRP A CH2  1  
ATOM   2317  H H    . TRP A 1 148 ? 7.335   2.840   9.508   1.00 0.36  ? 148  TRP A H    1  
ATOM   2318  H HA   . TRP A 1 148 ? 6.872   1.413   7.068   1.00 0.40  ? 148  TRP A HA   1  
ATOM   2319  H HB2  . TRP A 1 148 ? 6.786   4.365   7.680   1.00 0.42  ? 148  TRP A HB2  1  
ATOM   2320  H HB3  . TRP A 1 148 ? 6.218   3.623   6.193   1.00 0.46  ? 148  TRP A HB3  1  
ATOM   2321  H HD1  . TRP A 1 148 ? 4.119   1.782   6.570   1.00 1.69  ? 148  TRP A HD1  1  
ATOM   2322  H HE1  . TRP A 1 148 ? 2.102   1.995   8.154   1.00 0.78  ? 148  TRP A HE1  1  
ATOM   2323  H HE3  . TRP A 1 148 ? 5.984   5.278   9.800   1.00 2.86  ? 148  TRP A HE3  1  
ATOM   2324  H HZ2  . TRP A 1 148 ? 1.395   3.451   10.468  1.00 2.01  ? 148  TRP A HZ2  1  
ATOM   2325  H HZ3  . TRP A 1 148 ? 4.575   6.028   11.670  1.00 4.52  ? 148  TRP A HZ3  1  
ATOM   2326  H HH2  . TRP A 1 148 ? 2.327   5.133   11.996  1.00 4.08  ? 148  TRP A HH2  1  
ATOM   2327  N N    . ASP A 1 149 ? 9.556   3.256   7.417   1.00 0.42  ? 149  ASP A N    1  
ATOM   2328  C CA   . ASP A 1 149 ? 10.896  3.474   6.869   1.00 0.47  ? 149  ASP A CA   1  
ATOM   2329  C C    . ASP A 1 149 ? 11.569  2.136   6.614   1.00 0.47  ? 149  ASP A C    1  
ATOM   2330  O O    . ASP A 1 149 ? 12.176  1.917   5.564   1.00 0.52  ? 149  ASP A O    1  
ATOM   2331  C CB   . ASP A 1 149 ? 11.751  4.300   7.830   1.00 0.56  ? 149  ASP A CB   1  
ATOM   2332  C CG   . ASP A 1 149 ? 13.144  4.581   7.289   1.00 1.23  ? 149  ASP A CG   1  
ATOM   2333  O OD1  . ASP A 1 149 ? 14.060  3.756   7.507   1.00 1.96  ? 149  ASP A OD1  1  
ATOM   2334  O OD2  . ASP A 1 149 ? 13.334  5.643   6.653   1.00 1.72  ? 149  ASP A OD2  1  
ATOM   2335  H H    . ASP A 1 149 ? 9.325   3.637   8.298   1.00 0.44  ? 149  ASP A H    1  
ATOM   2336  H HA   . ASP A 1 149 ? 10.795  4.003   5.934   1.00 0.50  ? 149  ASP A HA   1  
ATOM   2337  H HB2  . ASP A 1 149 ? 11.261  5.243   8.010   1.00 1.33  ? 149  ASP A HB2  1  
ATOM   2338  H HB3  . ASP A 1 149 ? 11.848  3.765   8.762   1.00 1.06  ? 149  ASP A HB3  1  
ATOM   2339  N N    . THR A 1 150 ? 11.431  1.239   7.581   1.00 0.47  ? 150  THR A N    1  
ATOM   2340  C CA   . THR A 1 150 ? 11.987  -0.096  7.484   1.00 0.51  ? 150  THR A CA   1  
ATOM   2341  C C    . THR A 1 150 ? 11.410  -0.843  6.287   1.00 0.50  ? 150  THR A C    1  
ATOM   2342  O O    . THR A 1 150 ? 12.108  -1.617  5.636   1.00 0.56  ? 150  THR A O    1  
ATOM   2343  C CB   . THR A 1 150 ? 11.719  -0.898  8.768   1.00 0.56  ? 150  THR A CB   1  
ATOM   2344  O OG1  . THR A 1 150 ? 12.325  -0.238  9.889   1.00 0.62  ? 150  THR A OG1  1  
ATOM   2345  C CG2  . THR A 1 150 ? 12.259  -2.314  8.645   1.00 0.67  ? 150  THR A CG2  1  
ATOM   2346  H H    . THR A 1 150 ? 10.938  1.489   8.390   1.00 0.47  ? 150  THR A H    1  
ATOM   2347  H HA   . THR A 1 150 ? 13.056  -0.004  7.358   1.00 0.56  ? 150  THR A HA   1  
ATOM   2348  H HB   . THR A 1 150 ? 10.651  -0.949  8.926   1.00 0.52  ? 150  THR A HB   1  
ATOM   2349  H HG1  . THR A 1 150 ? 12.932  0.451   9.568   1.00 0.91  ? 150  THR A HG1  1  
ATOM   2350  H HG21 . THR A 1 150 ? 13.311  -2.276  8.397   1.00 1.10  ? 150  THR A HG21 1  
ATOM   2351  H HG22 . THR A 1 150 ? 11.725  -2.835  7.861   1.00 1.24  ? 150  THR A HG22 1  
ATOM   2352  H HG23 . THR A 1 150 ? 12.126  -2.835  9.580   1.00 1.22  ? 150  THR A HG23 1  
ATOM   2353  N N    . PHE A 1 151 ? 10.147  -0.594  5.976   1.00 0.45  ? 151  PHE A N    1  
ATOM   2354  C CA   . PHE A 1 151 ? 9.522   -1.258  4.846   1.00 0.47  ? 151  PHE A CA   1  
ATOM   2355  C C    . PHE A 1 151 ? 10.259  -0.913  3.560   1.00 0.48  ? 151  PHE A C    1  
ATOM   2356  O O    . PHE A 1 151 ? 10.490  -1.780  2.726   1.00 0.55  ? 151  PHE A O    1  
ATOM   2357  C CB   . PHE A 1 151 ? 8.043   -0.889  4.710   1.00 0.47  ? 151  PHE A CB   1  
ATOM   2358  C CG   . PHE A 1 151 ? 7.412   -1.519  3.503   1.00 1.18  ? 151  PHE A CG   1  
ATOM   2359  C CD1  . PHE A 1 151 ? 6.970   -2.831  3.538   1.00 1.80  ? 151  PHE A CD1  1  
ATOM   2360  C CD2  . PHE A 1 151 ? 7.233   -0.790  2.341   1.00 1.75  ? 151  PHE A CD2  1  
ATOM   2361  C CE1  . PHE A 1 151 ? 6.366   -3.403  2.435   1.00 2.65  ? 151  PHE A CE1  1  
ATOM   2362  C CE2  . PHE A 1 151 ? 6.626   -1.355  1.238   1.00 2.61  ? 151  PHE A CE2  1  
ATOM   2363  C CZ   . PHE A 1 151 ? 6.297   -2.704  1.253   1.00 3.00  ? 151  PHE A CZ   1  
ATOM   2364  H H    . PHE A 1 151 ? 9.634   0.050   6.506   1.00 0.43  ? 151  PHE A H    1  
ATOM   2365  H HA   . PHE A 1 151 ? 9.602   -2.325  5.012   1.00 0.52  ? 151  PHE A HA   1  
ATOM   2366  H HB2  . PHE A 1 151 ? 7.509   -1.225  5.586   1.00 0.93  ? 151  PHE A HB2  1  
ATOM   2367  H HB3  . PHE A 1 151 ? 7.948   0.183   4.618   1.00 0.79  ? 151  PHE A HB3  1  
ATOM   2368  H HD1  . PHE A 1 151 ? 7.105   -3.412  4.438   1.00 1.84  ? 151  PHE A HD1  1  
ATOM   2369  H HD2  . PHE A 1 151 ? 7.573   0.234   2.301   1.00 1.77  ? 151  PHE A HD2  1  
ATOM   2370  H HE1  . PHE A 1 151 ? 6.027   -4.428  2.476   1.00 3.20  ? 151  PHE A HE1  1  
ATOM   2371  H HE2  . PHE A 1 151 ? 6.492   -0.775  0.338   1.00 3.13  ? 151  PHE A HE2  1  
ATOM   2372  H HZ   . PHE A 1 151 ? 5.864   -3.165  0.378   1.00 3.72  ? 151  PHE A HZ   1  
ATOM   2373  N N    . VAL A 1 152 ? 10.644  0.347   3.411   1.00 0.45  ? 152  VAL A N    1  
ATOM   2374  C CA   . VAL A 1 152 ? 11.361  0.774   2.219   1.00 0.49  ? 152  VAL A CA   1  
ATOM   2375  C C    . VAL A 1 152 ? 12.821  0.312   2.277   1.00 0.57  ? 152  VAL A C    1  
ATOM   2376  O O    . VAL A 1 152 ? 13.462  0.109   1.245   1.00 0.64  ? 152  VAL A O    1  
ATOM   2377  C CB   . VAL A 1 152 ? 11.247  2.305   1.961   1.00 0.60  ? 152  VAL A CB   1  
ATOM   2378  C CG1  . VAL A 1 152 ? 10.315  2.963   2.962   1.00 1.15  ? 152  VAL A CG1  1  
ATOM   2379  C CG2  . VAL A 1 152 ? 12.603  2.993   1.945   1.00 0.91  ? 152  VAL A CG2  1  
ATOM   2380  H H    . VAL A 1 152 ? 10.444  0.999   4.116   1.00 0.43  ? 152  VAL A H    1  
ATOM   2381  H HA   . VAL A 1 152 ? 10.894  0.270   1.381   1.00 0.51  ? 152  VAL A HA   1  
ATOM   2382  H HB   . VAL A 1 152 ? 10.806  2.434   0.982   1.00 1.21  ? 152  VAL A HB   1  
ATOM   2383  H HG11 . VAL A 1 152 ? 9.319   2.562   2.835   1.00 1.86  ? 152  VAL A HG11 1  
ATOM   2384  H HG12 . VAL A 1 152 ? 10.298  4.030   2.790   1.00 1.51  ? 152  VAL A HG12 1  
ATOM   2385  H HG13 . VAL A 1 152 ? 10.660  2.762   3.970   1.00 1.68  ? 152  VAL A HG13 1  
ATOM   2386  H HG21 . VAL A 1 152 ? 13.063  2.906   2.918   1.00 1.44  ? 152  VAL A HG21 1  
ATOM   2387  H HG22 . VAL A 1 152 ? 12.473  4.038   1.694   1.00 1.54  ? 152  VAL A HG22 1  
ATOM   2388  H HG23 . VAL A 1 152 ? 13.231  2.519   1.204   1.00 1.45  ? 152  VAL A HG23 1  
ATOM   2389  N N    . GLU A 1 153 ? 13.342  0.141   3.487   1.00 0.59  ? 153  GLU A N    1  
ATOM   2390  C CA   . GLU A 1 153 ? 14.648  -0.485  3.664   1.00 0.69  ? 153  GLU A CA   1  
ATOM   2391  C C    . GLU A 1 153 ? 14.649  -1.863  3.002   1.00 0.70  ? 153  GLU A C    1  
ATOM   2392  O O    . GLU A 1 153 ? 15.560  -2.212  2.251   1.00 0.80  ? 153  GLU A O    1  
ATOM   2393  C CB   . GLU A 1 153 ? 14.980  -0.623  5.154   1.00 0.76  ? 153  GLU A CB   1  
ATOM   2394  C CG   . GLU A 1 153 ? 15.143  0.707   5.866   1.00 0.80  ? 153  GLU A CG   1  
ATOM   2395  C CD   . GLU A 1 153 ? 16.473  1.365   5.579   1.00 1.31  ? 153  GLU A CD   1  
ATOM   2396  O OE1  . GLU A 1 153 ? 16.608  2.008   4.516   1.00 1.67  ? 153  GLU A OE1  1  
ATOM   2397  O OE2  . GLU A 1 153 ? 17.398  1.235   6.401   1.00 1.58  ? 153  GLU A OE2  1  
ATOM   2398  H H    . GLU A 1 153 ? 12.842  0.445   4.275   1.00 0.57  ? 153  GLU A H    1  
ATOM   2399  H HA   . GLU A 1 153 ? 15.388  0.141   3.190   1.00 0.73  ? 153  GLU A HA   1  
ATOM   2400  H HB2  . GLU A 1 153 ? 14.184  -1.172  5.642   1.00 0.71  ? 153  GLU A HB2  1  
ATOM   2401  H HB3  . GLU A 1 153 ? 15.901  -1.178  5.257   1.00 0.86  ? 153  GLU A HB3  1  
ATOM   2402  H HG2  . GLU A 1 153 ? 14.358  1.368   5.534   1.00 0.86  ? 153  GLU A HG2  1  
ATOM   2403  H HG3  . GLU A 1 153 ? 15.054  0.548   6.931   1.00 0.92  ? 153  GLU A HG3  1  
ATOM   2404  N N    . LEU A 1 154 ? 13.607  -2.630  3.293   1.00 0.67  ? 154  LEU A N    1  
ATOM   2405  C CA   . LEU A 1 154 ? 13.426  -3.963  2.752   1.00 0.72  ? 154  LEU A CA   1  
ATOM   2406  C C    . LEU A 1 154 ? 12.908  -3.956  1.309   1.00 0.74  ? 154  LEU A C    1  
ATOM   2407  O O    . LEU A 1 154 ? 13.578  -4.435  0.397   1.00 0.83  ? 154  LEU A O    1  
ATOM   2408  C CB   . LEU A 1 154 ? 12.432  -4.708  3.641   1.00 0.72  ? 154  LEU A CB   1  
ATOM   2409  C CG   . LEU A 1 154 ? 12.987  -5.233  4.966   1.00 0.83  ? 154  LEU A CG   1  
ATOM   2410  C CD1  . LEU A 1 154 ? 13.678  -4.153  5.779   1.00 1.30  ? 154  LEU A CD1  1  
ATOM   2411  C CD2  . LEU A 1 154 ? 11.876  -5.862  5.782   1.00 1.14  ? 154  LEU A CD2  1  
ATOM   2412  H H    . LEU A 1 154 ? 12.953  -2.310  3.945   1.00 0.67  ? 154  LEU A H    1  
ATOM   2413  H HA   . LEU A 1 154 ? 14.375  -4.472  2.788   1.00 0.79  ? 154  LEU A HA   1  
ATOM   2414  H HB2  . LEU A 1 154 ? 11.611  -4.039  3.860   1.00 0.83  ? 154  LEU A HB2  1  
ATOM   2415  H HB3  . LEU A 1 154 ? 12.046  -5.547  3.081   1.00 0.78  ? 154  LEU A HB3  1  
ATOM   2416  H HG   . LEU A 1 154 ? 13.712  -5.982  4.750   1.00 1.45  ? 154  LEU A HG   1  
ATOM   2417  H HD11 . LEU A 1 154 ? 14.071  -4.582  6.689   1.00 1.82  ? 154  LEU A HD11 1  
ATOM   2418  H HD12 . LEU A 1 154 ? 12.968  -3.375  6.024   1.00 1.62  ? 154  LEU A HD12 1  
ATOM   2419  H HD13 . LEU A 1 154 ? 14.488  -3.731  5.200   1.00 1.96  ? 154  LEU A HD13 1  
ATOM   2420  H HD21 . LEU A 1 154 ? 12.291  -6.299  6.678   1.00 1.60  ? 154  LEU A HD21 1  
ATOM   2421  H HD22 . LEU A 1 154 ? 11.386  -6.627  5.198   1.00 1.52  ? 154  LEU A HD22 1  
ATOM   2422  H HD23 . LEU A 1 154 ? 11.157  -5.098  6.056   1.00 1.78  ? 154  LEU A HD23 1  
ATOM   2423  N N    . TYR A 1 155 ? 11.723  -3.391  1.110   1.00 0.69  ? 155  TYR A N    1  
ATOM   2424  C CA   . TYR A 1 155 ? 10.995  -3.522  -0.150  1.00 0.78  ? 155  TYR A CA   1  
ATOM   2425  C C    . TYR A 1 155 ? 10.740  -2.148  -0.763  1.00 0.77  ? 155  TYR A C    1  
ATOM   2426  O O    . TYR A 1 155 ? 9.752   -1.934  -1.462  1.00 1.15  ? 155  TYR A O    1  
ATOM   2427  C CB   . TYR A 1 155 ? 9.669   -4.239  0.114   1.00 0.86  ? 155  TYR A CB   1  
ATOM   2428  C CG   . TYR A 1 155 ? 9.154   -5.066  -1.048  1.00 1.40  ? 155  TYR A CG   1  
ATOM   2429  C CD1  . TYR A 1 155 ? 8.337   -4.498  -2.019  1.00 2.24  ? 155  TYR A CD1  1  
ATOM   2430  C CD2  . TYR A 1 155 ? 9.492   -6.408  -1.183  1.00 1.83  ? 155  TYR A CD2  1  
ATOM   2431  C CE1  . TYR A 1 155 ? 7.873   -5.243  -3.087  1.00 3.16  ? 155  TYR A CE1  1  
ATOM   2432  C CE2  . TYR A 1 155 ? 9.030   -7.159  -2.247  1.00 2.65  ? 155  TYR A CE2  1  
ATOM   2433  C CZ   . TYR A 1 155 ? 8.197   -6.598  -3.168  1.00 3.24  ? 155  TYR A CZ   1  
ATOM   2434  O OH   . TYR A 1 155 ? 7.761   -7.319  -4.262  1.00 4.24  ? 155  TYR A OH   1  
ATOM   2435  H H    . TYR A 1 155 ? 11.327  -2.847  1.831   1.00 0.63  ? 155  TYR A H    1  
ATOM   2436  H HA   . TYR A 1 155 ? 11.589  -4.110  -0.828  1.00 0.86  ? 155  TYR A HA   1  
ATOM   2437  H HB2  . TYR A 1 155 ? 9.794   -4.897  0.956   1.00 1.32  ? 155  TYR A HB2  1  
ATOM   2438  H HB3  . TYR A 1 155 ? 8.919   -3.501  0.351   1.00 1.12  ? 155  TYR A HB3  1  
ATOM   2439  H HD1  . TYR A 1 155 ? 8.064   -3.458  -1.930  1.00 2.42  ? 155  TYR A HD1  1  
ATOM   2440  H HD2  . TYR A 1 155 ? 10.125  -6.865  -0.438  1.00 1.93  ? 155  TYR A HD2  1  
ATOM   2441  H HE1  . TYR A 1 155 ? 7.240   -4.782  -3.831  1.00 3.94  ? 155  TYR A HE1  1  
ATOM   2442  H HE2  . TYR A 1 155 ? 9.305   -8.200  -2.332  1.00 3.07  ? 155  TYR A HE2  1  
ATOM   2443  H HH   . TYR A 1 155 ? 7.444   -8.171  -3.938  1.00 4.39  ? 155  TYR A HH   1  
ATOM   2444  N N    . GLY A 1 156 ? 11.644  -1.224  -0.484  1.00 0.66  ? 156  GLY A N    1  
ATOM   2445  C CA   . GLY A 1 156 ? 11.532  0.130   -0.991  1.00 0.64  ? 156  GLY A CA   1  
ATOM   2446  C C    . GLY A 1 156 ? 11.491  0.223   -2.494  1.00 0.78  ? 156  GLY A C    1  
ATOM   2447  O O    . GLY A 1 156 ? 11.808  -0.730  -3.213  1.00 1.10  ? 156  GLY A O    1  
ATOM   2448  H H    . GLY A 1 156 ? 12.397  -1.458  0.093   1.00 0.85  ? 156  GLY A H    1  
ATOM   2449  H HA2  . GLY A 1 156 ? 10.628  0.579   -0.603  1.00 0.61  ? 156  GLY A HA2  1  
ATOM   2450  H HA3  . GLY A 1 156 ? 12.371  0.704   -0.634  1.00 0.66  ? 156  GLY A HA3  1  
ATOM   2451  N N    . ASN A 1 157 ? 11.106  1.396   -2.943  1.00 0.70  ? 157  ASN A N    1  
ATOM   2452  C CA   . ASN A 1 157 ? 10.971  1.716   -4.345  1.00 0.80  ? 157  ASN A CA   1  
ATOM   2453  C C    . ASN A 1 157 ? 12.278  1.467   -5.092  1.00 1.14  ? 157  ASN A C    1  
ATOM   2454  O O    . ASN A 1 157 ? 13.261  2.187   -4.906  1.00 1.29  ? 157  ASN A O    1  
ATOM   2455  C CB   . ASN A 1 157 ? 10.564  3.178   -4.433  1.00 0.70  ? 157  ASN A CB   1  
ATOM   2456  C CG   . ASN A 1 157 ? 10.310  3.662   -5.843  1.00 0.77  ? 157  ASN A CG   1  
ATOM   2457  O OD1  . ASN A 1 157 ? 11.220  4.125   -6.529  1.00 0.88  ? 157  ASN A OD1  1  
ATOM   2458  N ND2  . ASN A 1 157 ? 9.067   3.575   -6.284  1.00 0.76  ? 157  ASN A ND2  1  
ATOM   2459  H H    . ASN A 1 157 ? 10.908  2.102   -2.287  1.00 0.75  ? 157  ASN A H    1  
ATOM   2460  H HA   . ASN A 1 157 ? 10.191  1.102   -4.762  1.00 0.86  ? 157  ASN A HA   1  
ATOM   2461  H HB2  . ASN A 1 157 ? 9.661   3.314   -3.859  1.00 0.60  ? 157  ASN A HB2  1  
ATOM   2462  H HB3  . ASN A 1 157 ? 11.349  3.777   -3.996  1.00 0.83  ? 157  ASN A HB3  1  
ATOM   2463  H HD21 . ASN A 1 157 ? 8.381   3.195   -5.687  1.00 0.72  ? 157  ASN A HD21 1  
ATOM   2464  H HD22 . ASN A 1 157 ? 8.871   3.915   -7.180  1.00 0.83  ? 157  ASN A HD22 1  
ATOM   2465  N N    . ASN A 1 158 ? 12.287  0.444   -5.936  1.00 1.40  ? 158  ASN A N    1  
ATOM   2466  C CA   . ASN A 1 158 ? 13.494  0.029   -6.608  1.00 1.79  ? 158  ASN A CA   1  
ATOM   2467  C C    . ASN A 1 158 ? 13.748  0.903   -7.831  1.00 1.93  ? 158  ASN A C    1  
ATOM   2468  O O    . ASN A 1 158 ? 14.853  0.929   -8.364  1.00 2.18  ? 158  ASN A O    1  
ATOM   2469  C CB   . ASN A 1 158 ? 13.375  -1.434  -7.004  1.00 2.11  ? 158  ASN A CB   1  
ATOM   2470  C CG   . ASN A 1 158 ? 14.696  -2.049  -7.382  1.00 2.55  ? 158  ASN A CG   1  
ATOM   2471  O OD1  . ASN A 1 158 ? 15.447  -2.525  -6.530  1.00 2.99  ? 158  ASN A OD1  1  
ATOM   2472  N ND2  . ASN A 1 158 ? 14.979  -2.063  -8.664  1.00 2.94  ? 158  ASN A ND2  1  
ATOM   2473  H H    . ASN A 1 158 ? 11.461  -0.046  -6.119  1.00 1.40  ? 158  ASN A H    1  
ATOM   2474  H HA   . ASN A 1 158 ? 14.316  0.143   -5.918  1.00 1.90  ? 158  ASN A HA   1  
ATOM   2475  H HB2  . ASN A 1 158 ? 12.955  -1.997  -6.185  1.00 2.60  ? 158  ASN A HB2  1  
ATOM   2476  H HB3  . ASN A 1 158 ? 12.724  -1.501  -7.855  1.00 2.06  ? 158  ASN A HB3  1  
ATOM   2477  H HD21 . ASN A 1 158 ? 14.323  -1.676  -9.290  1.00 2.95  ? 158  ASN A HD21 1  
ATOM   2478  H HD22 . ASN A 1 158 ? 15.821  -2.460  -8.942  1.00 3.44  ? 158  ASN A HD22 1  
ATOM   2479  N N    . ALA A 1 159 ? 12.723  1.620   -8.271  1.00 1.86  ? 159  ALA A N    1  
ATOM   2480  C CA   . ALA A 1 159 ? 12.889  2.605   -9.333  1.00 2.10  ? 159  ALA A CA   1  
ATOM   2481  C C    . ALA A 1 159 ? 13.911  3.652   -8.906  1.00 2.25  ? 159  ALA A C    1  
ATOM   2482  O O    . ALA A 1 159 ? 14.885  3.916   -9.613  1.00 2.52  ? 159  ALA A O    1  
ATOM   2483  C CB   . ALA A 1 159 ? 11.556  3.256   -9.672  1.00 2.14  ? 159  ALA A CB   1  
ATOM   2484  H H    . ALA A 1 159 ? 11.833  1.474   -7.883  1.00 1.72  ? 159  ALA A H    1  
ATOM   2485  H HA   . ALA A 1 159 ? 13.254  2.093   -10.212 1.00 2.27  ? 159  ALA A HA   1  
ATOM   2486  H HB1  . ALA A 1 159 ? 10.847  2.496   -9.966  1.00 2.67  ? 159  ALA A HB1  1  
ATOM   2487  H HB2  . ALA A 1 159 ? 11.694  3.954   -10.486 1.00 2.16  ? 159  ALA A HB2  1  
ATOM   2488  H HB3  . ALA A 1 159 ? 11.181  3.782   -8.807  1.00 2.26  ? 159  ALA A HB3  1  
ATOM   2489  N N    . ALA A 1 160 ? 13.696  4.216   -7.721  1.00 2.17  ? 160  ALA A N    1  
ATOM   2490  C CA   . ALA A 1 160 ? 14.639  5.156   -7.133  1.00 2.44  ? 160  ALA A CA   1  
ATOM   2491  C C    . ALA A 1 160 ? 15.936  4.446   -6.775  1.00 2.55  ? 160  ALA A C    1  
ATOM   2492  O O    . ALA A 1 160 ? 17.017  5.036   -6.838  1.00 2.87  ? 160  ALA A O    1  
ATOM   2493  C CB   . ALA A 1 160 ? 14.040  5.809   -5.901  1.00 2.45  ? 160  ALA A CB   1  
ATOM   2494  H H    . ALA A 1 160 ? 12.871  4.001   -7.232  1.00 1.99  ? 160  ALA A H    1  
ATOM   2495  H HA   . ALA A 1 160 ? 14.846  5.927   -7.862  1.00 2.68  ? 160  ALA A HA   1  
ATOM   2496  H HB1  . ALA A 1 160 ? 13.847  5.054   -5.152  1.00 2.39  ? 160  ALA A HB1  1  
ATOM   2497  H HB2  . ALA A 1 160 ? 13.115  6.299   -6.165  1.00 2.74  ? 160  ALA A HB2  1  
ATOM   2498  H HB3  . ALA A 1 160 ? 14.734  6.537   -5.506  1.00 2.79  ? 160  ALA A HB3  1  
ATOM   2499  N N    . ALA A 1 161 ? 15.814  3.175   -6.401  1.00 2.37  ? 161  ALA A N    1  
ATOM   2500  C CA   . ALA A 1 161 ? 16.971  2.341   -6.108  1.00 2.60  ? 161  ALA A CA   1  
ATOM   2501  C C    . ALA A 1 161 ? 17.906  2.282   -7.313  1.00 2.85  ? 161  ALA A C    1  
ATOM   2502  O O    . ALA A 1 161 ? 19.095  2.562   -7.200  1.00 3.20  ? 161  ALA A O    1  
ATOM   2503  C CB   . ALA A 1 161 ? 16.528  0.939   -5.704  1.00 2.50  ? 161  ALA A CB   1  
ATOM   2504  H H    . ALA A 1 161 ? 14.915  2.793   -6.309  1.00 2.16  ? 161  ALA A H    1  
ATOM   2505  H HA   . ALA A 1 161 ? 17.499  2.782   -5.275  1.00 2.77  ? 161  ALA A HA   1  
ATOM   2506  H HB1  . ALA A 1 161 ? 15.945  0.994   -4.797  1.00 2.69  ? 161  ALA A HB1  1  
ATOM   2507  H HB2  . ALA A 1 161 ? 17.396  0.318   -5.538  1.00 2.61  ? 161  ALA A HB2  1  
ATOM   2508  H HB3  . ALA A 1 161 ? 15.920  0.506   -6.495  1.00 2.76  ? 161  ALA A HB3  1  
ATOM   2509  N N    . GLU A 1 162 ? 17.351  1.944   -8.471  1.00 2.76  ? 162  GLU A N    1  
ATOM   2510  C CA   . GLU A 1 162 ? 18.125  1.873   -9.705  1.00 3.08  ? 162  GLU A CA   1  
ATOM   2511  C C    . GLU A 1 162 ? 18.583  3.261   -10.135 1.00 3.31  ? 162  GLU A C    1  
ATOM   2512  O O    . GLU A 1 162 ? 19.648  3.415   -10.735 1.00 3.67  ? 162  GLU A O    1  
ATOM   2513  C CB   . GLU A 1 162 ? 17.299  1.233   -10.818 1.00 3.06  ? 162  GLU A CB   1  
ATOM   2514  C CG   . GLU A 1 162 ? 16.825  -0.172  -10.497 1.00 3.25  ? 162  GLU A CG   1  
ATOM   2515  C CD   . GLU A 1 162 ? 16.094  -0.810  -11.655 1.00 3.48  ? 162  GLU A CD   1  
ATOM   2516  O OE1  . GLU A 1 162 ? 14.863  -0.627  -11.757 1.00 3.72  ? 162  GLU A OE1  1  
ATOM   2517  O OE2  . GLU A 1 162 ? 16.740  -1.502  -12.466 1.00 3.71  ? 162  GLU A OE2  1  
ATOM   2518  H H    . GLU A 1 162 ? 16.390  1.727   -8.497  1.00 2.53  ? 162  GLU A H    1  
ATOM   2519  H HA   . GLU A 1 162 ? 18.995  1.261   -9.517  1.00 3.27  ? 162  GLU A HA   1  
ATOM   2520  H HB2  . GLU A 1 162 ? 16.432  1.849   -11.002 1.00 3.33  ? 162  GLU A HB2  1  
ATOM   2521  H HB3  . GLU A 1 162 ? 17.897  1.193   -11.717 1.00 3.04  ? 162  GLU A HB3  1  
ATOM   2522  H HG2  . GLU A 1 162 ? 17.680  -0.782  -10.250 1.00 3.26  ? 162  GLU A HG2  1  
ATOM   2523  H HG3  . GLU A 1 162 ? 16.154  -0.129  -9.648  1.00 3.57  ? 162  GLU A HG3  1  
ATOM   2524  N N    . SER A 1 163 ? 17.774  4.266   -9.820  1.00 3.19  ? 163  SER A N    1  
ATOM   2525  C CA   . SER A 1 163 ? 18.099  5.647   -10.142 1.00 3.52  ? 163  SER A CA   1  
ATOM   2526  C C    . SER A 1 163 ? 19.430  6.049   -9.507  1.00 3.81  ? 163  SER A C    1  
ATOM   2527  O O    . SER A 1 163 ? 20.293  6.620   -10.172 1.00 4.18  ? 163  SER A O    1  
ATOM   2528  C CB   . SER A 1 163 ? 16.975  6.582   -9.675  1.00 3.44  ? 163  SER A CB   1  
ATOM   2529  O OG   . SER A 1 163 ? 17.240  7.929   -10.026 1.00 3.87  ? 163  SER A OG   1  
ATOM   2530  H H    . SER A 1 163 ? 16.924  4.070   -9.367  1.00 2.92  ? 163  SER A H    1  
ATOM   2531  H HA   . SER A 1 163 ? 18.192  5.721   -11.215 1.00 3.71  ? 163  SER A HA   1  
ATOM   2532  H HB2  . SER A 1 163 ? 16.046  6.281   -10.136 1.00 3.31  ? 163  SER A HB2  1  
ATOM   2533  H HB3  . SER A 1 163 ? 16.879  6.514   -8.601  1.00 3.45  ? 163  SER A HB3  1  
ATOM   2534  H HG   . SER A 1 163 ? 17.303  8.003   -10.990 1.00 4.20  ? 163  SER A HG   1  
ATOM   2535  N N    . ARG A 1 164 ? 19.610  5.719   -8.232  1.00 3.70  ? 164  ARG A N    1  
ATOM   2536  C CA   . ARG A 1 164 ? 20.843  6.062   -7.529  1.00 4.07  ? 164  ARG A CA   1  
ATOM   2537  C C    . ARG A 1 164 ? 21.905  4.992   -7.718  1.00 4.24  ? 164  ARG A C    1  
ATOM   2538  O O    . ARG A 1 164 ? 23.087  5.223   -7.466  1.00 4.61  ? 164  ARG A O    1  
ATOM   2539  C CB   . ARG A 1 164 ? 20.574  6.280   -6.043  1.00 4.05  ? 164  ARG A CB   1  
ATOM   2540  C CG   . ARG A 1 164 ? 19.817  7.561   -5.765  1.00 4.12  ? 164  ARG A CG   1  
ATOM   2541  C CD   . ARG A 1 164 ? 20.659  8.790   -6.074  1.00 4.41  ? 164  ARG A CD   1  
ATOM   2542  N NE   . ARG A 1 164 ? 19.915  10.029  -5.844  1.00 4.73  ? 164  ARG A NE   1  
ATOM   2543  C CZ   . ARG A 1 164 ? 20.331  11.235  -6.230  1.00 5.32  ? 164  ARG A CZ   1  
ATOM   2544  N NH1  . ARG A 1 164 ? 21.510  11.380  -6.824  1.00 5.65  ? 164  ARG A NH1  1  
ATOM   2545  N NH2  . ARG A 1 164 ? 19.565  12.295  -6.011  1.00 5.82  ? 164  ARG A NH2  1  
ATOM   2546  H H    . ARG A 1 164 ? 18.899  5.238   -7.753  1.00 3.42  ? 164  ARG A H    1  
ATOM   2547  H HA   . ARG A 1 164 ? 21.203  6.981   -7.951  1.00 4.33  ? 164  ARG A HA   1  
ATOM   2548  H HB2  . ARG A 1 164 ? 19.992  5.452   -5.666  1.00 3.79  ? 164  ARG A HB2  1  
ATOM   2549  H HB3  . ARG A 1 164 ? 21.516  6.320   -5.518  1.00 4.41  ? 164  ARG A HB3  1  
ATOM   2550  H HG2  . ARG A 1 164 ? 18.938  7.581   -6.391  1.00 4.04  ? 164  ARG A HG2  1  
ATOM   2551  H HG3  . ARG A 1 164 ? 19.526  7.582   -4.725  1.00 4.42  ? 164  ARG A HG3  1  
ATOM   2552  H HD2  . ARG A 1 164 ? 21.532  8.783   -5.439  1.00 4.55  ? 164  ARG A HD2  1  
ATOM   2553  H HD3  . ARG A 1 164 ? 20.966  8.751   -7.108  1.00 4.64  ? 164  ARG A HD3  1  
ATOM   2554  H HE   . ARG A 1 164 ? 19.047  9.952   -5.383  1.00 4.71  ? 164  ARG A HE   1  
ATOM   2555  H HH11 . ARG A 1 164 ? 22.100  10.579  -6.984  1.00 5.49  ? 164  ARG A HH11 1  
ATOM   2556  H HH12 . ARG A 1 164 ? 21.822  12.291  -7.121  1.00 6.23  ? 164  ARG A HH12 1  
ATOM   2557  H HH21 . ARG A 1 164 ? 18.668  12.192  -5.558  1.00 5.80  ? 164  ARG A HH21 1  
ATOM   2558  H HH22 . ARG A 1 164 ? 19.874  13.213  -6.298  1.00 6.37  ? 164  ARG A HH22 1  
ATOM   2559  N N    . LYS A 1 165 ? 21.474  3.825   -8.170  1.00 4.03  ? 165  LYS A N    1  
ATOM   2560  C CA   . LYS A 1 165 ? 22.376  2.702   -8.399  1.00 4.26  ? 165  LYS A CA   1  
ATOM   2561  C C    . LYS A 1 165 ? 23.325  3.003   -9.551  1.00 4.49  ? 165  LYS A C    1  
ATOM   2562  O O    . LYS A 1 165 ? 24.453  2.515   -9.579  1.00 4.77  ? 165  LYS A O    1  
ATOM   2563  C CB   . LYS A 1 165 ? 21.578  1.434   -8.709  1.00 4.10  ? 165  LYS A CB   1  
ATOM   2564  C CG   . LYS A 1 165 ? 22.436  0.185   -8.845  1.00 4.47  ? 165  LYS A CG   1  
ATOM   2565  C CD   . LYS A 1 165 ? 21.635  -0.990  -9.376  1.00 4.47  ? 165  LYS A CD   1  
ATOM   2566  C CE   . LYS A 1 165 ? 20.457  -1.324  -8.476  1.00 4.43  ? 165  LYS A CE   1  
ATOM   2567  N NZ   . LYS A 1 165 ? 19.718  -2.522  -8.952  1.00 4.72  ? 165  LYS A NZ   1  
ATOM   2568  H H    . LYS A 1 165 ? 20.519  3.714   -8.346  1.00 3.77  ? 165  LYS A H    1  
ATOM   2569  H HA   . LYS A 1 165 ? 22.953  2.547   -7.500  1.00 4.47  ? 165  LYS A HA   1  
ATOM   2570  H HB2  . LYS A 1 165 ? 20.865  1.269   -7.915  1.00 3.95  ? 165  LYS A HB2  1  
ATOM   2571  H HB3  . LYS A 1 165 ? 21.043  1.578   -9.636  1.00 3.94  ? 165  LYS A HB3  1  
ATOM   2572  H HG2  . LYS A 1 165 ? 23.245  0.389   -9.527  1.00 4.66  ? 165  LYS A HG2  1  
ATOM   2573  H HG3  . LYS A 1 165 ? 22.835  -0.072  -7.874  1.00 4.64  ? 165  LYS A HG3  1  
ATOM   2574  H HD2  . LYS A 1 165 ? 21.264  -0.739  -10.358 1.00 4.54  ? 165  LYS A HD2  1  
ATOM   2575  H HD3  . LYS A 1 165 ? 22.283  -1.850  -9.442  1.00 4.70  ? 165  LYS A HD3  1  
ATOM   2576  H HE2  . LYS A 1 165 ? 20.825  -1.512  -7.478  1.00 4.54  ? 165  LYS A HE2  1  
ATOM   2577  H HE3  . LYS A 1 165 ? 19.783  -0.480  -8.459  1.00 4.38  ? 165  LYS A HE3  1  
ATOM   2578  H HZ1  . LYS A 1 165 ? 18.899  -2.707  -8.333  1.00 4.85  ? 165  LYS A HZ1  1  
ATOM   2579  H HZ2  . LYS A 1 165 ? 20.339  -3.360  -8.937  1.00 4.87  ? 165  LYS A HZ2  1  
ATOM   2580  H HZ3  . LYS A 1 165 ? 19.378  -2.375  -9.927  1.00 5.01  ? 165  LYS A HZ3  1  
ATOM   2581  N N    . GLY A 1 166 ? 22.856  3.816   -10.493 1.00 4.45  ? 166  GLY A N    1  
ATOM   2582  C CA   . GLY A 1 166 ? 23.656  4.160   -11.652 1.00 4.72  ? 166  GLY A CA   1  
ATOM   2583  C C    . GLY A 1 166 ? 24.998  4.756   -11.275 1.00 4.91  ? 166  GLY A C    1  
ATOM   2584  O O    . GLY A 1 166 ? 26.046  4.240   -11.662 1.00 5.10  ? 166  GLY A O    1  
ATOM   2585  H H    . GLY A 1 166 ? 21.953  4.182   -10.400 1.00 4.27  ? 166  GLY A H    1  
ATOM   2586  H HA2  . GLY A 1 166 ? 23.823  3.265   -12.235 1.00 4.83  ? 166  GLY A HA2  1  
ATOM   2587  H HA3  . GLY A 1 166 ? 23.112  4.872   -12.254 1.00 4.76  ? 166  GLY A HA3  1  
ATOM   2588  N N    . GLN A 1 167 ? 24.972  5.834   -10.505 1.00 4.92  ? 167  GLN A N    1  
ATOM   2589  C CA   . GLN A 1 167 ? 26.203  6.472   -10.059 1.00 5.16  ? 167  GLN A CA   1  
ATOM   2590  C C    . GLN A 1 167 ? 26.861  5.670   -8.948  1.00 5.19  ? 167  GLN A C    1  
ATOM   2591  O O    . GLN A 1 167 ? 28.072  5.751   -8.741  1.00 5.45  ? 167  GLN A O    1  
ATOM   2592  C CB   . GLN A 1 167 ? 25.931  7.900   -9.588  1.00 5.30  ? 167  GLN A CB   1  
ATOM   2593  C CG   . GLN A 1 167 ? 24.934  7.983   -8.443  1.00 5.16  ? 167  GLN A CG   1  
ATOM   2594  C CD   . GLN A 1 167 ? 24.686  9.400   -7.969  1.00 5.42  ? 167  GLN A CD   1  
ATOM   2595  O OE1  . GLN A 1 167 ? 23.596  9.728   -7.500  1.00 5.60  ? 167  GLN A OE1  1  
ATOM   2596  N NE2  . GLN A 1 167 ? 25.693  10.253  -8.086  1.00 5.72  ? 167  GLN A NE2  1  
ATOM   2597  H H    . GLN A 1 167 ? 24.106  6.220   -10.242 1.00 4.80  ? 167  GLN A H    1  
ATOM   2598  H HA   . GLN A 1 167 ? 26.875  6.499   -10.898 1.00 5.34  ? 167  GLN A HA   1  
ATOM   2599  H HB2  . GLN A 1 167 ? 26.860  8.344   -9.263  1.00 5.51  ? 167  GLN A HB2  1  
ATOM   2600  H HB3  . GLN A 1 167 ? 25.542  8.467   -10.419 1.00 5.38  ? 167  GLN A HB3  1  
ATOM   2601  H HG2  . GLN A 1 167 ? 23.995  7.564   -8.771  1.00 4.96  ? 167  GLN A HG2  1  
ATOM   2602  H HG3  . GLN A 1 167 ? 25.312  7.404   -7.613  1.00 5.16  ? 167  GLN A HG3  1  
ATOM   2603  H HE21 . GLN A 1 167 ? 26.534  9.928   -8.469  1.00 5.86  ? 167  GLN A HE21 1  
ATOM   2604  H HE22 . GLN A 1 167 ? 25.556  11.177  -7.776  1.00 5.94  ? 167  GLN A HE22 1  
ATOM   2605  N N    . GLU A 1 168 ? 26.065  4.878   -8.244  1.00 5.02  ? 168  GLU A N    1  
ATOM   2606  C CA   . GLU A 1 168 ? 26.586  4.053   -7.170  1.00 5.17  ? 168  GLU A CA   1  
ATOM   2607  C C    . GLU A 1 168 ? 27.382  2.891   -7.748  1.00 5.30  ? 168  GLU A C    1  
ATOM   2608  O O    . GLU A 1 168 ? 28.121  2.211   -7.035  1.00 5.55  ? 168  GLU A O    1  
ATOM   2609  C CB   . GLU A 1 168 ? 25.454  3.531   -6.289  1.00 5.10  ? 168  GLU A CB   1  
ATOM   2610  C CG   . GLU A 1 168 ? 25.902  3.194   -4.879  1.00 5.39  ? 168  GLU A CG   1  
ATOM   2611  C CD   . GLU A 1 168 ? 26.385  4.420   -4.133  1.00 5.63  ? 168  GLU A CD   1  
ATOM   2612  O OE1  . GLU A 1 168 ? 27.540  4.851   -4.359  1.00 5.88  ? 168  GLU A OE1  1  
ATOM   2613  O OE2  . GLU A 1 168 ? 25.608  4.977   -3.332  1.00 5.81  ? 168  GLU A OE2  1  
ATOM   2614  H H    . GLU A 1 168 ? 25.107  4.851   -8.451  1.00 4.84  ? 168  GLU A H    1  
ATOM   2615  H HA   . GLU A 1 168 ? 27.243  4.664   -6.572  1.00 5.35  ? 168  GLU A HA   1  
ATOM   2616  H HB2  . GLU A 1 168 ? 24.685  4.286   -6.230  1.00 4.92  ? 168  GLU A HB2  1  
ATOM   2617  H HB3  . GLU A 1 168 ? 25.041  2.641   -6.738  1.00 5.27  ? 168  GLU A HB3  1  
ATOM   2618  H HG2  . GLU A 1 168 ? 25.069  2.764   -4.341  1.00 5.77  ? 168  GLU A HG2  1  
ATOM   2619  H HG3  . GLU A 1 168 ? 26.707  2.478   -4.930  1.00 5.44  ? 168  GLU A HG3  1  
ATOM   2620  N N    . ARG A 1 169 ? 27.251  2.689   -9.054  1.00 5.23  ? 169  ARG A N    1  
ATOM   2621  C CA   . ARG A 1 169 ? 27.971  1.624   -9.735  1.00 5.45  ? 169  ARG A CA   1  
ATOM   2622  C C    . ARG A 1 169 ? 29.440  2.010   -9.830  1.00 5.78  ? 169  ARG A C    1  
ATOM   2623  O O    . ARG A 1 169 ? 30.334  1.162   -9.795  1.00 6.09  ? 169  ARG A O    1  
ATOM   2624  C CB   . ARG A 1 169 ? 27.365  1.380   -11.127 1.00 5.37  ? 169  ARG A CB   1  
ATOM   2625  C CG   . ARG A 1 169 ? 27.816  0.087   -11.797 1.00 5.66  ? 169  ARG A CG   1  
ATOM   2626  C CD   . ARG A 1 169 ? 29.218  0.198   -12.370 1.00 6.08  ? 169  ARG A CD   1  
ATOM   2627  N NE   . ARG A 1 169 ? 29.705  -1.070  -12.900 1.00 6.39  ? 169  ARG A NE   1  
ATOM   2628  C CZ   . ARG A 1 169 ? 30.898  -1.582  -12.608 1.00 6.90  ? 169  ARG A CZ   1  
ATOM   2629  N NH1  . ARG A 1 169 ? 31.682  -0.979  -11.721 1.00 7.13  ? 169  ARG A NH1  1  
ATOM   2630  N NH2  . ARG A 1 169 ? 31.295  -2.708  -13.183 1.00 7.34  ? 169  ARG A NH2  1  
ATOM   2631  H H    . ARG A 1 169 ? 26.659  3.285   -9.577  1.00 5.10  ? 169  ARG A H    1  
ATOM   2632  H HA   . ARG A 1 169 ? 27.880  0.724   -9.144  1.00 5.55  ? 169  ARG A HA   1  
ATOM   2633  H HB2  . ARG A 1 169 ? 26.290  1.351   -11.035 1.00 5.16  ? 169  ARG A HB2  1  
ATOM   2634  H HB3  . ARG A 1 169 ? 27.637  2.205   -11.770 1.00 5.44  ? 169  ARG A HB3  1  
ATOM   2635  H HG2  . ARG A 1 169 ? 27.803  -0.707  -11.066 1.00 5.71  ? 169  ARG A HG2  1  
ATOM   2636  H HG3  . ARG A 1 169 ? 27.129  -0.147  -12.594 1.00 5.72  ? 169  ARG A HG3  1  
ATOM   2637  H HD2  . ARG A 1 169 ? 29.210  0.928   -13.167 1.00 6.24  ? 169  ARG A HD2  1  
ATOM   2638  H HD3  . ARG A 1 169 ? 29.886  0.531   -11.588 1.00 6.23  ? 169  ARG A HD3  1  
ATOM   2639  H HE   . ARG A 1 169 ? 29.117  -1.551  -13.532 1.00 6.35  ? 169  ARG A HE   1  
ATOM   2640  H HH11 . ARG A 1 169 ? 31.374  -0.141  -11.264 1.00 6.96  ? 169  ARG A HH11 1  
ATOM   2641  H HH12 . ARG A 1 169 ? 32.595  -1.356  -11.509 1.00 7.60  ? 169  ARG A HH12 1  
ATOM   2642  H HH21 . ARG A 1 169 ? 30.695  -3.182  -13.841 1.00 7.32  ? 169  ARG A HH21 1  
ATOM   2643  H HH22 . ARG A 1 169 ? 32.203  -3.094  -12.973 1.00 7.80  ? 169  ARG A HH22 1  
ATOM   2644  N N    . LEU A 1 170 ? 29.677  3.307   -9.931  1.00 5.79  ? 170  LEU A N    1  
ATOM   2645  C CA   . LEU A 1 170 ? 31.027  3.838   -9.960  1.00 6.19  ? 170  LEU A CA   1  
ATOM   2646  C C    . LEU A 1 170 ? 31.540  4.018   -8.541  1.00 6.32  ? 170  LEU A C    1  
ATOM   2647  O O    . LEU A 1 170 ? 32.737  4.218   -8.326  1.00 6.79  ? 170  LEU A O    1  
ATOM   2648  C CB   . LEU A 1 170 ? 31.076  5.168   -10.707 1.00 6.33  ? 170  LEU A CB   1  
ATOM   2649  C CG   . LEU A 1 170 ? 30.879  5.096   -12.228 1.00 6.61  ? 170  LEU A CG   1  
ATOM   2650  C CD1  . LEU A 1 170 ? 31.831  4.081   -12.841 1.00 6.97  ? 170  LEU A CD1  1  
ATOM   2651  C CD2  . LEU A 1 170 ? 29.436  4.770   -12.587 1.00 6.43  ? 170  LEU A CD2  1  
ATOM   2652  H H    . LEU A 1 170 ? 28.919  3.928   -9.980  1.00 5.59  ? 170  LEU A H    1  
ATOM   2653  H HA   . LEU A 1 170 ? 31.649  3.133   -10.470 1.00 6.42  ? 170  LEU A HA   1  
ATOM   2654  H HB2  . LEU A 1 170 ? 30.306  5.790   -10.302 1.00 6.17  ? 170  LEU A HB2  1  
ATOM   2655  H HB3  . LEU A 1 170 ? 32.031  5.631   -10.512 1.00 6.57  ? 170  LEU A HB3  1  
ATOM   2656  H HG   . LEU A 1 170 ? 31.116  6.062   -12.654 1.00 6.85  ? 170  LEU A HG   1  
ATOM   2657  H HD11 . LEU A 1 170 ? 31.677  4.043   -13.909 1.00 7.12  ? 170  LEU A HD11 1  
ATOM   2658  H HD12 . LEU A 1 170 ? 31.640  3.108   -12.414 1.00 7.02  ? 170  LEU A HD12 1  
ATOM   2659  H HD13 . LEU A 1 170 ? 32.850  4.372   -12.634 1.00 7.29  ? 170  LEU A HD13 1  
ATOM   2660  H HD21 . LEU A 1 170 ? 29.332  4.723   -13.661 1.00 6.56  ? 170  LEU A HD21 1  
ATOM   2661  H HD22 . LEU A 1 170 ? 28.785  5.538   -12.195 1.00 6.26  ? 170  LEU A HD22 1  
ATOM   2662  H HD23 . LEU A 1 170 ? 29.166  3.816   -12.157 1.00 6.64  ? 170  LEU A HD23 1  
ATOM   2663  N N    . GLU A 1 171 ? 30.611  3.919   -7.585  1.00 6.03  ? 171  GLU A N    1  
ATOM   2664  C CA   . GLU A 1 171 ? 30.895  4.120   -6.167  1.00 6.27  ? 171  GLU A CA   1  
ATOM   2665  C C    . GLU A 1 171 ? 31.294  5.566   -5.895  1.00 6.70  ? 171  GLU A C    1  
ATOM   2666  O O    . GLU A 1 171 ? 32.407  5.984   -6.212  1.00 6.90  ? 171  GLU A O    1  
ATOM   2667  C CB   . GLU A 1 171 ? 31.991  3.171   -5.680  1.00 6.34  ? 171  GLU A CB   1  
ATOM   2668  C CG   . GLU A 1 171 ? 31.590  1.708   -5.696  1.00 6.31  ? 171  GLU A CG   1  
ATOM   2669  C CD   . GLU A 1 171 ? 32.691  0.810   -5.180  1.00 6.67  ? 171  GLU A CD   1  
ATOM   2670  O OE1  . GLU A 1 171 ? 32.930  0.794   -3.957  1.00 6.97  ? 171  GLU A OE1  1  
ATOM   2671  O OE2  . GLU A 1 171 ? 33.316  0.099   -5.998  1.00 6.91  ? 171  GLU A OE2  1  
ATOM   2672  H H    . GLU A 1 171 ? 29.695  3.695   -7.849  1.00 5.72  ? 171  GLU A H    1  
ATOM   2673  H HA   . GLU A 1 171 ? 29.988  3.910   -5.621  1.00 6.42  ? 171  GLU A HA   1  
ATOM   2674  H HB2  . GLU A 1 171 ? 32.859  3.289   -6.312  1.00 6.52  ? 171  GLU A HB2  1  
ATOM   2675  H HB3  . GLU A 1 171 ? 32.256  3.437   -4.668  1.00 6.61  ? 171  GLU A HB3  1  
ATOM   2676  H HG2  . GLU A 1 171 ? 30.718  1.579   -5.075  1.00 6.37  ? 171  GLU A HG2  1  
ATOM   2677  H HG3  . GLU A 1 171 ? 31.357  1.422   -6.712  1.00 6.37  ? 171  GLU A HG3  1  
ATOM   2678  N N    . HIS A 1 172 ? 30.383  6.333   -5.313  1.00 7.18  ? 172  HIS A N    1  
ATOM   2679  C CA   . HIS A 1 172 ? 30.657  7.738   -5.056  1.00 7.91  ? 172  HIS A CA   1  
ATOM   2680  C C    . HIS A 1 172 ? 31.467  7.904   -3.770  1.00 8.34  ? 172  HIS A C    1  
ATOM   2681  O O    . HIS A 1 172 ? 32.376  8.733   -3.711  1.00 8.55  ? 172  HIS A O    1  
ATOM   2682  C CB   . HIS A 1 172 ? 29.357  8.570   -5.025  1.00 8.43  ? 172  HIS A CB   1  
ATOM   2683  C CG   . HIS A 1 172 ? 28.511  8.435   -3.785  1.00 8.65  ? 172  HIS A CG   1  
ATOM   2684  N ND1  . HIS A 1 172 ? 27.682  7.362   -3.538  1.00 8.91  ? 172  HIS A ND1  1  
ATOM   2685  C CD2  . HIS A 1 172 ? 28.340  9.280   -2.740  1.00 8.94  ? 172  HIS A CD2  1  
ATOM   2686  C CE1  . HIS A 1 172 ? 27.041  7.557   -2.401  1.00 9.32  ? 172  HIS A CE1  1  
ATOM   2687  N NE2  . HIS A 1 172 ? 27.421  8.712   -1.895  1.00 9.35  ? 172  HIS A NE2  1  
ATOM   2688  H H    . HIS A 1 172 ? 29.520  5.946   -5.051  1.00 7.23  ? 172  HIS A H    1  
ATOM   2689  H HA   . HIS A 1 172 ? 31.266  8.094   -5.876  1.00 8.05  ? 172  HIS A HA   1  
ATOM   2690  H HB2  . HIS A 1 172 ? 29.613  9.613   -5.123  1.00 8.63  ? 172  HIS A HB2  1  
ATOM   2691  H HB3  . HIS A 1 172 ? 28.747  8.284   -5.870  1.00 8.77  ? 172  HIS A HB3  1  
ATOM   2692  H HD1  . HIS A 1 172 ? 27.576  6.559   -4.109  1.00 8.98  ? 172  HIS A HD1  1  
ATOM   2693  H HD2  . HIS A 1 172 ? 28.839  10.229  -2.598  1.00 9.04  ? 172  HIS A HD2  1  
ATOM   2694  H HE1  . HIS A 1 172 ? 26.325  6.881   -1.957  1.00 9.74  ? 172  HIS A HE1  1  
ATOM   2695  H HE2  . HIS A 1 172 ? 26.937  9.191   -1.180  1.00 9.81  ? 172  HIS A HE2  1  
ATOM   2696  N N    . HIS A 1 173 ? 31.153  7.086   -2.758  1.00 8.71  ? 173  HIS A N    1  
ATOM   2697  C CA   . HIS A 1 173 ? 31.834  7.144   -1.459  1.00 9.35  ? 173  HIS A CA   1  
ATOM   2698  C C    . HIS A 1 173 ? 31.920  8.578   -0.935  1.00 9.73  ? 173  HIS A C    1  
ATOM   2699  O O    . HIS A 1 173 ? 31.121  9.439   -1.317  1.00 10.12 ? 173  HIS A O    1  
ATOM   2700  C CB   . HIS A 1 173 ? 33.243  6.539   -1.559  1.00 9.85  ? 173  HIS A CB   1  
ATOM   2701  C CG   . HIS A 1 173 ? 33.258  5.050   -1.731  1.00 10.34 ? 173  HIS A CG   1  
ATOM   2702  N ND1  . HIS A 1 173 ? 33.161  4.172   -0.677  1.00 10.84 ? 173  HIS A ND1  1  
ATOM   2703  C CD2  . HIS A 1 173 ? 33.357  4.287   -2.842  1.00 10.66 ? 173  HIS A CD2  1  
ATOM   2704  C CE1  . HIS A 1 173 ? 33.201  2.935   -1.130  1.00 11.40 ? 173  HIS A CE1  1  
ATOM   2705  N NE2  . HIS A 1 173 ? 33.318  2.975   -2.441  1.00 11.31 ? 173  HIS A NE2  1  
ATOM   2706  H H    . HIS A 1 173 ? 30.447  6.417   -2.891  1.00 8.72  ? 173  HIS A H    1  
ATOM   2707  H HA   . HIS A 1 173 ? 31.254  6.560   -0.761  1.00 9.44  ? 173  HIS A HA   1  
ATOM   2708  H HB2  . HIS A 1 173 ? 33.753  6.973   -2.405  1.00 9.81  ? 173  HIS A HB2  1  
ATOM   2709  H HB3  . HIS A 1 173 ? 33.790  6.774   -0.658  1.00 10.14 ? 173  HIS A HB3  1  
ATOM   2710  H HD1  . HIS A 1 173 ? 33.065  4.419   0.277   1.00 10.92 ? 173  HIS A HD1  1  
ATOM   2711  H HD2  . HIS A 1 173 ? 33.448  4.644   -3.858  1.00 10.59 ? 173  HIS A HD2  1  
ATOM   2712  H HE1  . HIS A 1 173 ? 33.146  2.038   -0.528  1.00 11.99 ? 173  HIS A HE1  1  
ATOM   2713  H HE2  . HIS A 1 173 ? 33.201  2.196   -3.042  1.00 11.79 ? 173  HIS A HE2  1  
ATOM   2714  N N    . HIS A 1 174 ? 32.879  8.818   -0.038  1.00 9.86  ? 174  HIS A N    1  
ATOM   2715  C CA   . HIS A 1 174 ? 33.172  10.162  0.466   1.00 10.40 ? 174  HIS A CA   1  
ATOM   2716  C C    . HIS A 1 174 ? 31.993  10.725  1.251   1.00 11.06 ? 174  HIS A C    1  
ATOM   2717  O O    . HIS A 1 174 ? 31.881  11.938  1.437   1.00 11.27 ? 174  HIS A O    1  
ATOM   2718  C CB   . HIS A 1 174 ? 33.528  11.110  -0.688  1.00 10.58 ? 174  HIS A CB   1  
ATOM   2719  C CG   . HIS A 1 174 ? 34.722  10.676  -1.480  1.00 10.83 ? 174  HIS A CG   1  
ATOM   2720  N ND1  . HIS A 1 174 ? 34.628  10.043  -2.699  1.00 11.12 ? 174  HIS A ND1  1  
ATOM   2721  C CD2  . HIS A 1 174 ? 36.046  10.790  -1.220  1.00 11.10 ? 174  HIS A CD2  1  
ATOM   2722  C CE1  . HIS A 1 174 ? 35.839  9.783   -3.152  1.00 11.52 ? 174  HIS A CE1  1  
ATOM   2723  N NE2  . HIS A 1 174 ? 36.718  10.226  -2.275  1.00 11.52 ? 174  HIS A NE2  1  
ATOM   2724  H H    . HIS A 1 174 ? 33.402  8.060   0.312   1.00 9.73  ? 174  HIS A H    1  
ATOM   2725  H HA   . HIS A 1 174 ? 34.021  10.086  1.129   1.00 10.44 ? 174  HIS A HA   1  
ATOM   2726  H HB2  . HIS A 1 174 ? 32.689  11.172  -1.363  1.00 10.52 ? 174  HIS A HB2  1  
ATOM   2727  H HB3  . HIS A 1 174 ? 33.732  12.093  -0.286  1.00 10.82 ? 174  HIS A HB3  1  
ATOM   2728  H HD1  . HIS A 1 174 ? 33.789  9.812   -3.167  1.00 11.17 ? 174  HIS A HD1  1  
ATOM   2729  H HD2  . HIS A 1 174 ? 36.490  11.240  -0.343  1.00 11.16 ? 174  HIS A HD2  1  
ATOM   2730  H HE1  . HIS A 1 174 ? 36.071  9.290   -4.084  1.00 11.95 ? 174  HIS A HE1  1  
ATOM   2731  H HE2  . HIS A 1 174 ? 37.678  9.992   -2.277  1.00 11.89 ? 174  HIS A HE2  1  
ATOM   2732  N N    . HIS A 1 175 ? 31.133  9.840   1.729   1.00 11.59 ? 175  HIS A N    1  
ATOM   2733  C CA   . HIS A 1 175 ? 29.937  10.248  2.442   1.00 12.41 ? 175  HIS A CA   1  
ATOM   2734  C C    . HIS A 1 175 ? 29.990  9.784   3.893   1.00 12.84 ? 175  HIS A C    1  
ATOM   2735  O O    . HIS A 1 175 ? 29.813  8.599   4.186   1.00 13.21 ? 175  HIS A O    1  
ATOM   2736  C CB   . HIS A 1 175 ? 28.695  9.684   1.745   1.00 12.99 ? 175  HIS A CB   1  
ATOM   2737  C CG   . HIS A 1 175 ? 27.399  10.160  2.326   1.00 13.51 ? 175  HIS A CG   1  
ATOM   2738  N ND1  . HIS A 1 175 ? 26.426  9.304   2.795   1.00 13.89 ? 175  HIS A ND1  1  
ATOM   2739  C CD2  . HIS A 1 175 ? 26.907  11.411  2.488   1.00 13.89 ? 175  HIS A CD2  1  
ATOM   2740  C CE1  . HIS A 1 175 ? 25.392  10.008  3.217   1.00 14.46 ? 175  HIS A CE1  1  
ATOM   2741  N NE2  . HIS A 1 175 ? 25.660  11.286  3.043   1.00 14.48 ? 175  HIS A NE2  1  
ATOM   2742  H H    . HIS A 1 175 ? 31.311  8.879   1.604   1.00 11.55 ? 175  HIS A H    1  
ATOM   2743  H HA   . HIS A 1 175 ? 29.891  11.327  2.423   1.00 12.49 ? 175  HIS A HA   1  
ATOM   2744  H HB2  . HIS A 1 175 ? 28.715  9.971   0.704   1.00 12.92 ? 175  HIS A HB2  1  
ATOM   2745  H HB3  . HIS A 1 175 ? 28.714  8.605   1.813   1.00 13.31 ? 175  HIS A HB3  1  
ATOM   2746  H HD1  . HIS A 1 175 ? 26.482  8.317   2.810   1.00 13.86 ? 175  HIS A HD1  1  
ATOM   2747  H HD2  . HIS A 1 175 ? 27.403  12.335  2.229   1.00 13.88 ? 175  HIS A HD2  1  
ATOM   2748  H HE1  . HIS A 1 175 ? 24.482  9.604   3.635   1.00 14.94 ? 175  HIS A HE1  1  
ATOM   2749  H HE2  . HIS A 1 175 ? 25.036  12.032  3.235   1.00 14.95 ? 175  HIS A HE2  1  
ATOM   2750  N N    . HIS A 1 176 ? 30.246  10.720  4.793   1.00 12.98 ? 176  HIS A N    1  
ATOM   2751  C CA   . HIS A 1 176 ? 30.279  10.424  6.219   1.00 13.55 ? 176  HIS A CA   1  
ATOM   2752  C C    . HIS A 1 176 ? 29.033  10.994  6.885   1.00 13.90 ? 176  HIS A C    1  
ATOM   2753  O O    . HIS A 1 176 ? 28.422  11.927  6.364   1.00 14.09 ? 176  HIS A O    1  
ATOM   2754  C CB   . HIS A 1 176 ? 31.552  10.992  6.874   1.00 13.99 ? 176  HIS A CB   1  
ATOM   2755  C CG   . HIS A 1 176 ? 31.619  12.496  6.930   1.00 14.45 ? 176  HIS A CG   1  
ATOM   2756  N ND1  . HIS A 1 176 ? 32.201  13.267  5.944   1.00 14.88 ? 176  HIS A ND1  1  
ATOM   2757  C CD2  . HIS A 1 176 ? 31.186  13.367  7.873   1.00 14.71 ? 176  HIS A CD2  1  
ATOM   2758  C CE1  . HIS A 1 176 ? 32.123  14.540  6.280   1.00 15.37 ? 176  HIS A CE1  1  
ATOM   2759  N NE2  . HIS A 1 176 ? 31.512  14.626  7.443   1.00 15.28 ? 176  HIS A NE2  1  
ATOM   2760  H H    . HIS A 1 176 ? 30.404  11.646  4.489   1.00 12.81 ? 176  HIS A H    1  
ATOM   2761  H HA   . HIS A 1 176 ? 30.272  9.350   6.334   1.00 13.61 ? 176  HIS A HA   1  
ATOM   2762  H HB2  . HIS A 1 176 ? 31.614  10.626  7.888   1.00 14.08 ? 176  HIS A HB2  1  
ATOM   2763  H HB3  . HIS A 1 176 ? 32.412  10.643  6.321   1.00 14.07 ? 176  HIS A HB3  1  
ATOM   2764  H HD1  . HIS A 1 176 ? 32.611  12.929  5.111   1.00 14.94 ? 176  HIS A HD1  1  
ATOM   2765  H HD2  . HIS A 1 176 ? 30.678  13.115  8.794   1.00 14.62 ? 176  HIS A HD2  1  
ATOM   2766  H HE1  . HIS A 1 176 ? 32.494  15.371  5.700   1.00 15.88 ? 176  HIS A HE1  1  
ATOM   2767  H HE2  . HIS A 1 176 ? 31.310  15.471  7.921   1.00 15.66 ? 176  HIS A HE2  1  
ATOM   2768  N N    . HIS A 1 177 ? 28.660  10.447  8.030   1.00 14.14 ? 177  HIS A N    1  
ATOM   2769  C CA   . HIS A 1 177 ? 27.458  10.890  8.716   1.00 14.65 ? 177  HIS A CA   1  
ATOM   2770  C C    . HIS A 1 177 ? 27.735  11.187  10.181  1.00 15.60 ? 177  HIS A C    1  
ATOM   2771  O O    . HIS A 1 177 ? 28.324  10.377  10.897  1.00 16.02 ? 177  HIS A O    1  
ATOM   2772  C CB   . HIS A 1 177 ? 26.327  9.855   8.579   1.00 14.60 ? 177  HIS A CB   1  
ATOM   2773  C CG   . HIS A 1 177 ? 26.621  8.502   9.169   1.00 14.47 ? 177  HIS A CG   1  
ATOM   2774  N ND1  . HIS A 1 177 ? 27.263  7.502   8.475   1.00 14.51 ? 177  HIS A ND1  1  
ATOM   2775  C CD2  . HIS A 1 177 ? 26.339  7.986   10.389  1.00 14.51 ? 177  HIS A CD2  1  
ATOM   2776  C CE1  . HIS A 1 177 ? 27.363  6.432   9.239   1.00 14.56 ? 177  HIS A CE1  1  
ATOM   2777  N NE2  . HIS A 1 177 ? 26.809  6.697   10.407  1.00 14.56 ? 177  HIS A NE2  1  
ATOM   2778  H H    . HIS A 1 177 ? 29.214  9.734   8.434   1.00 14.09 ? 177  HIS A H    1  
ATOM   2779  H HA   . HIS A 1 177 ? 27.140  11.808  8.242   1.00 14.57 ? 177  HIS A HA   1  
ATOM   2780  H HB2  . HIS A 1 177 ? 25.446  10.238  9.071   1.00 14.44 ? 177  HIS A HB2  1  
ATOM   2781  H HB3  . HIS A 1 177 ? 26.108  9.716   7.530   1.00 14.99 ? 177  HIS A HB3  1  
ATOM   2782  H HD1  . HIS A 1 177 ? 27.585  7.563   7.542   1.00 14.60 ? 177  HIS A HD1  1  
ATOM   2783  H HD2  . HIS A 1 177 ? 25.834  8.495   11.198  1.00 14.61 ? 177  HIS A HD2  1  
ATOM   2784  H HE1  . HIS A 1 177 ? 27.823  5.497   8.957   1.00 14.72 ? 177  HIS A HE1  1  
ATOM   2785  H HE2  . HIS A 1 177 ? 26.550  6.013   11.070  1.00 14.72 ? 177  HIS A HE2  1  
ATOM   2786  N N    . LEU A 1 178 ? 27.336  12.368  10.612  1.00 16.06 ? 178  LEU A N    1  
ATOM   2787  C CA   . LEU A 1 178 ? 27.419  12.736  12.015  1.00 17.08 ? 178  LEU A CA   1  
ATOM   2788  C C    . LEU A 1 178 ? 26.023  12.720  12.615  1.00 17.58 ? 178  LEU A C    1  
ATOM   2789  O O    . LEU A 1 178 ? 25.833  12.970  13.806  1.00 17.74 ? 178  LEU A O    1  
ATOM   2790  C CB   . LEU A 1 178 ? 28.049  14.122  12.177  1.00 17.47 ? 178  LEU A CB   1  
ATOM   2791  C CG   . LEU A 1 178 ? 29.451  14.278  11.578  1.00 17.56 ? 178  LEU A CG   1  
ATOM   2792  C CD1  . LEU A 1 178 ? 29.989  15.675  11.838  1.00 17.99 ? 178  LEU A CD1  1  
ATOM   2793  C CD2  . LEU A 1 178 ? 30.397  13.228  12.142  1.00 17.68 ? 178  LEU A CD2  1  
ATOM   2794  H H    . LEU A 1 178 ? 26.979  13.022  9.962   1.00 15.79 ? 178  LEU A H    1  
ATOM   2795  H HA   . LEU A 1 178 ? 28.030  12.002  12.518  1.00 17.35 ? 178  LEU A HA   1  
ATOM   2796  H HB2  . LEU A 1 178 ? 27.398  14.847  11.710  1.00 17.43 ? 178  LEU A HB2  1  
ATOM   2797  H HB3  . LEU A 1 178 ? 28.108  14.345  13.232  1.00 17.90 ? 178  LEU A HB3  1  
ATOM   2798  H HG   . LEU A 1 178 ? 29.394  14.137  10.508  1.00 17.40 ? 178  LEU A HG   1  
ATOM   2799  H HD11 . LEU A 1 178 ? 30.976  15.765  11.411  1.00 18.20 ? 178  LEU A HD11 1  
ATOM   2800  H HD12 . LEU A 1 178 ? 30.039  15.847  12.904  1.00 18.21 ? 178  LEU A HD12 1  
ATOM   2801  H HD13 . LEU A 1 178 ? 29.332  16.404  11.387  1.00 17.98 ? 178  LEU A HD13 1  
ATOM   2802  H HD21 . LEU A 1 178 ? 30.463  13.342  13.215  1.00 17.91 ? 178  LEU A HD21 1  
ATOM   2803  H HD22 . LEU A 1 178 ? 31.376  13.354  11.705  1.00 17.74 ? 178  LEU A HD22 1  
ATOM   2804  H HD23 . LEU A 1 178 ? 30.022  12.242  11.909  1.00 17.62 ? 178  LEU A HD23 1  
ATOM   2805  N N    . GLU A 1 179 ? 25.049  12.415  11.767  1.00 17.95 ? 179  GLU A N    1  
ATOM   2806  C CA   . GLU A 1 179 ? 23.656  12.359  12.172  1.00 18.57 ? 179  GLU A CA   1  
ATOM   2807  C C    . GLU A 1 179 ? 23.340  11.008  12.796  1.00 19.13 ? 179  GLU A C    1  
ATOM   2808  O O    . GLU A 1 179 ? 23.944  9.996   12.439  1.00 19.11 ? 179  GLU A O    1  
ATOM   2809  C CB   . GLU A 1 179 ? 22.747  12.595  10.967  1.00 18.91 ? 179  GLU A CB   1  
ATOM   2810  C CG   . GLU A 1 179 ? 23.058  13.876  10.212  1.00 18.77 ? 179  GLU A CG   1  
ATOM   2811  C CD   . GLU A 1 179 ? 22.160  14.074  9.012   1.00 18.94 ? 179  GLU A CD   1  
ATOM   2812  O OE1  . GLU A 1 179 ? 22.360  13.379  7.995   1.00 18.93 ? 179  GLU A OE1  1  
ATOM   2813  O OE2  . GLU A 1 179 ? 21.247  14.923  9.079   1.00 19.19 ? 179  GLU A OE2  1  
ATOM   2814  H H    . GLU A 1 179 ? 25.278  12.218  10.837  1.00 17.89 ? 179  GLU A H    1  
ATOM   2815  H HA   . GLU A 1 179 ? 23.486  13.136  12.903  1.00 18.54 ? 179  GLU A HA   1  
ATOM   2816  H HB2  . GLU A 1 179 ? 22.852  11.764  10.283  1.00 19.08 ? 179  GLU A HB2  1  
ATOM   2817  H HB3  . GLU A 1 179 ? 21.723  12.642  11.306  1.00 19.22 ? 179  GLU A HB3  1  
ATOM   2818  H HG2  . GLU A 1 179 ? 22.928  14.713  10.881  1.00 18.73 ? 179  GLU A HG2  1  
ATOM   2819  H HG3  . GLU A 1 179 ? 24.083  13.839  9.876   1.00 18.73 ? 179  GLU A HG3  1  
ATOM   2820  N N    . HIS A 1 180 ? 22.408  10.999  13.734  1.00 19.74 ? 180  HIS A N    1  
ATOM   2821  C CA   . HIS A 1 180 ? 21.992  9.766   14.383  1.00 20.41 ? 180  HIS A CA   1  
ATOM   2822  C C    . HIS A 1 180 ? 20.480  9.603   14.324  1.00 20.84 ? 180  HIS A C    1  
ATOM   2823  O O    . HIS A 1 180 ? 19.757  10.180  15.138  1.00 21.13 ? 180  HIS A O    1  
ATOM   2824  C CB   . HIS A 1 180 ? 22.469  9.728   15.838  1.00 21.03 ? 180  HIS A CB   1  
ATOM   2825  C CG   . HIS A 1 180 ? 23.945  9.532   15.985  1.00 21.37 ? 180  HIS A CG   1  
ATOM   2826  N ND1  . HIS A 1 180 ? 24.765  10.418  16.648  1.00 21.96 ? 180  HIS A ND1  1  
ATOM   2827  C CD2  . HIS A 1 180 ? 24.747  8.530   15.560  1.00 21.34 ? 180  HIS A CD2  1  
ATOM   2828  C CE1  . HIS A 1 180 ? 26.004  9.972   16.620  1.00 22.26 ? 180  HIS A CE1  1  
ATOM   2829  N NE2  . HIS A 1 180 ? 26.022  8.828   15.967  1.00 21.90 ? 180  HIS A NE2  1  
ATOM   2830  H H    . HIS A 1 180 ? 21.989  11.849  14.003  1.00 19.81 ? 180  HIS A H    1  
ATOM   2831  H HA   . HIS A 1 180 ? 22.446  8.946   13.848  1.00 20.26 ? 180  HIS A HA   1  
ATOM   2832  H HB2  . HIS A 1 180 ? 22.210  10.661  16.317  1.00 21.05 ? 180  HIS A HB2  1  
ATOM   2833  H HB3  . HIS A 1 180 ? 21.972  8.917   16.351  1.00 21.34 ? 180  HIS A HB3  1  
ATOM   2834  H HD1  . HIS A 1 180 ? 24.477  11.255  17.090  1.00 22.20 ? 180  HIS A HD1  1  
ATOM   2835  H HD2  . HIS A 1 180 ? 24.440  7.658   15.001  1.00 21.02 ? 180  HIS A HD2  1  
ATOM   2836  H HE1  . HIS A 1 180 ? 26.860  10.463  17.058  1.00 22.80 ? 180  HIS A HE1  1  
ATOM   2837  H HE2  . HIS A 1 180 ? 26.774  8.187   15.982  1.00 22.10 ? 180  HIS A HE2  1  
ATOM   2838  N N    . HIS A 1 181 ? 20.018  8.836   13.337  1.00 20.99 ? 181  HIS A N    1  
ATOM   2839  C CA   . HIS A 1 181 ? 18.594  8.525   13.173  1.00 21.54 ? 181  HIS A CA   1  
ATOM   2840  C C    . HIS A 1 181 ? 17.774  9.769   12.834  1.00 22.31 ? 181  HIS A C    1  
ATOM   2841  O O    . HIS A 1 181 ? 18.315  10.856  12.621  1.00 22.51 ? 181  HIS A O    1  
ATOM   2842  C CB   . HIS A 1 181 ? 18.023  7.868   14.437  1.00 21.37 ? 181  HIS A CB   1  
ATOM   2843  C CG   . HIS A 1 181 ? 18.492  6.466   14.669  1.00 21.01 ? 181  HIS A CG   1  
ATOM   2844  N ND1  . HIS A 1 181 ? 19.489  6.142   15.559  1.00 20.83 ? 181  HIS A ND1  1  
ATOM   2845  C CD2  . HIS A 1 181 ? 18.073  5.296   14.136  1.00 20.92 ? 181  HIS A CD2  1  
ATOM   2846  C CE1  . HIS A 1 181 ? 19.665  4.837   15.561  1.00 20.64 ? 181  HIS A CE1  1  
ATOM   2847  N NE2  . HIS A 1 181 ? 18.817  4.294   14.707  1.00 20.70 ? 181  HIS A NE2  1  
ATOM   2848  H H    . HIS A 1 181 ? 20.657  8.472   12.683  1.00 20.81 ? 181  HIS A H    1  
ATOM   2849  H HA   . HIS A 1 181 ? 18.507  7.826   12.354  1.00 21.64 ? 181  HIS A HA   1  
ATOM   2850  H HB2  . HIS A 1 181 ? 18.309  8.455   15.296  1.00 21.28 ? 181  HIS A HB2  1  
ATOM   2851  H HB3  . HIS A 1 181 ? 16.945  7.850   14.366  1.00 21.73 ? 181  HIS A HB3  1  
ATOM   2852  H HD1  . HIS A 1 181 ? 19.990  6.781   16.126  1.00 20.90 ? 181  HIS A HD1  1  
ATOM   2853  H HD2  . HIS A 1 181 ? 17.296  5.172   13.394  1.00 21.08 ? 181  HIS A HD2  1  
ATOM   2854  H HE1  . HIS A 1 181 ? 20.385  4.298   16.161  1.00 20.55 ? 181  HIS A HE1  1  
ATOM   2855  H HE2  . HIS A 1 181 ? 18.563  3.340   14.709  1.00 20.67 ? 181  HIS A HE2  1  
ATOM   2856  N N    . HIS A 1 182 ? 16.461  9.590   12.773  1.00 22.83 ? 182  HIS A N    1  
ATOM   2857  C CA   . HIS A 1 182 ? 15.544  10.694  12.550  1.00 23.69 ? 182  HIS A CA   1  
ATOM   2858  C C    . HIS A 1 182 ? 15.148  11.298  13.890  1.00 24.16 ? 182  HIS A C    1  
ATOM   2859  O O    . HIS A 1 182 ? 14.636  10.602  14.764  1.00 24.40 ? 182  HIS A O    1  
ATOM   2860  C CB   . HIS A 1 182 ? 14.298  10.207  11.795  1.00 24.01 ? 182  HIS A CB   1  
ATOM   2861  C CG   . HIS A 1 182 ? 13.298  11.287  11.502  1.00 24.24 ? 182  HIS A CG   1  
ATOM   2862  N ND1  . HIS A 1 182 ? 12.173  11.505  12.270  1.00 24.67 ? 182  HIS A ND1  1  
ATOM   2863  C CD2  . HIS A 1 182 ? 13.257  12.208  10.511  1.00 24.22 ? 182  HIS A CD2  1  
ATOM   2864  C CE1  . HIS A 1 182 ? 11.485  12.511  11.763  1.00 24.89 ? 182  HIS A CE1  1  
ATOM   2865  N NE2  . HIS A 1 182 ? 12.121  12.957  10.696  1.00 24.63 ? 182  HIS A NE2  1  
ATOM   2866  H H    . HIS A 1 182 ? 16.094  8.686   12.892  1.00 22.69 ? 182  HIS A H    1  
ATOM   2867  H HA   . HIS A 1 182 ? 16.052  11.441  11.958  1.00 23.87 ? 182  HIS A HA   1  
ATOM   2868  H HB2  . HIS A 1 182 ? 14.603  9.777   10.854  1.00 23.75 ? 182  HIS A HB2  1  
ATOM   2869  H HB3  . HIS A 1 182 ? 13.804  9.449   12.387  1.00 24.46 ? 182  HIS A HB3  1  
ATOM   2870  H HD1  . HIS A 1 182 ? 11.913  10.991  13.076  1.00 24.84 ? 182  HIS A HD1  1  
ATOM   2871  H HD2  . HIS A 1 182 ? 13.985  12.332  9.722   1.00 24.00 ? 182  HIS A HD2  1  
ATOM   2872  H HE1  . HIS A 1 182 ? 10.560  12.906  12.156  1.00 25.30 ? 182  HIS A HE1  1  
ATOM   2873  H HE2  . HIS A 1 182 ? 11.916  13.803  10.227  1.00 24.80 ? 182  HIS A HE2  1  
ATOM   2874  N N    . HIS A 1 183 ? 15.403  12.582  14.057  1.00 24.38 ? 183  HIS A N    1  
ATOM   2875  C CA   . HIS A 1 183 ? 15.070  13.265  15.297  1.00 24.93 ? 183  HIS A CA   1  
ATOM   2876  C C    . HIS A 1 183 ? 13.694  13.908  15.203  1.00 25.44 ? 183  HIS A C    1  
ATOM   2877  O O    . HIS A 1 183 ? 13.209  14.202  14.109  1.00 25.58 ? 183  HIS A O    1  
ATOM   2878  C CB   . HIS A 1 183 ? 16.128  14.315  15.635  1.00 25.08 ? 183  HIS A CB   1  
ATOM   2879  C CG   . HIS A 1 183 ? 17.450  13.721  16.010  1.00 25.22 ? 183  HIS A CG   1  
ATOM   2880  N ND1  . HIS A 1 183 ? 18.575  13.816  15.223  1.00 25.36 ? 183  HIS A ND1  1  
ATOM   2881  C CD2  . HIS A 1 183 ? 17.820  13.018  17.106  1.00 25.35 ? 183  HIS A CD2  1  
ATOM   2882  C CE1  . HIS A 1 183 ? 19.576  13.198  15.817  1.00 25.56 ? 183  HIS A CE1  1  
ATOM   2883  N NE2  . HIS A 1 183 ? 19.147  12.705  16.960  1.00 25.56 ? 183  HIS A NE2  1  
ATOM   2884  H H    . HIS A 1 183 ? 15.831  13.089  13.326  1.00 24.25 ? 183  HIS A H    1  
ATOM   2885  H HA   . HIS A 1 183 ? 15.050  12.525  16.083  1.00 24.97 ? 183  HIS A HA   1  
ATOM   2886  H HB2  . HIS A 1 183 ? 16.282  14.952  14.777  1.00 24.96 ? 183  HIS A HB2  1  
ATOM   2887  H HB3  . HIS A 1 183 ? 15.782  14.914  16.465  1.00 25.31 ? 183  HIS A HB3  1  
ATOM   2888  H HD1  . HIS A 1 183 ? 18.634  14.261  14.344  1.00 25.37 ? 183  HIS A HD1  1  
ATOM   2889  H HD2  . HIS A 1 183 ? 17.188  12.753  17.941  1.00 25.36 ? 183  HIS A HD2  1  
ATOM   2890  H HE1  . HIS A 1 183 ? 20.581  13.111  15.430  1.00 25.77 ? 183  HIS A HE1  1  
ATOM   2891  H HE2  . HIS A 1 183 ? 19.636  12.039  17.501  1.00 25.74 ? 183  HIS A HE2  1  
ATOM   2892  N N    . HIS A 1 184 ? 13.067  14.114  16.351  1.00 25.80 ? 184  HIS A N    1  
ATOM   2893  C CA   . HIS A 1 184 ? 11.728  14.683  16.399  1.00 26.40 ? 184  HIS A CA   1  
ATOM   2894  C C    . HIS A 1 184 ? 11.712  15.922  17.285  1.00 26.96 ? 184  HIS A C    1  
ATOM   2895  O O    . HIS A 1 184 ? 12.703  16.232  17.945  1.00 27.37 ? 184  HIS A O    1  
ATOM   2896  C CB   . HIS A 1 184 ? 10.716  13.647  16.918  1.00 26.76 ? 184  HIS A CB   1  
ATOM   2897  C CG   . HIS A 1 184 ? 10.901  13.266  18.360  1.00 26.84 ? 184  HIS A CG   1  
ATOM   2898  N ND1  . HIS A 1 184 ? 11.724  12.242  18.771  1.00 26.92 ? 184  HIS A ND1  1  
ATOM   2899  C CD2  . HIS A 1 184 ? 10.359  13.781  19.491  1.00 26.96 ? 184  HIS A CD2  1  
ATOM   2900  C CE1  . HIS A 1 184 ? 11.681  12.144  20.087  1.00 27.09 ? 184  HIS A CE1  1  
ATOM   2901  N NE2  . HIS A 1 184 ? 10.863  13.066  20.546  1.00 27.11 ? 184  HIS A NE2  1  
ATOM   2902  H H    . HIS A 1 184 ? 13.526  13.888  17.194  1.00 25.73 ? 184  HIS A H    1  
ATOM   2903  H HA   . HIS A 1 184 ? 11.453  14.970  15.395  1.00 26.29 ? 184  HIS A HA   1  
ATOM   2904  H HB2  . HIS A 1 184 ? 9.719   14.046  16.809  1.00 26.84 ? 184  HIS A HB2  1  
ATOM   2905  H HB3  . HIS A 1 184 ? 10.803  12.748  16.323  1.00 26.98 ? 184  HIS A HB3  1  
ATOM   2906  H HD1  . HIS A 1 184 ? 12.267  11.663  18.179  1.00 26.92 ? 184  HIS A HD1  1  
ATOM   2907  H HD2  . HIS A 1 184 ? 9.661   14.605  19.549  1.00 27.01 ? 184  HIS A HD2  1  
ATOM   2908  H HE1  . HIS A 1 184 ? 12.230  11.431  20.685  1.00 27.25 ? 184  HIS A HE1  1  
ATOM   2909  H HE2  . HIS A 1 184 ? 10.566  13.147  21.487  1.00 27.29 ? 184  HIS A HE2  1  
ATOM   2910  N N    . HIS A 1 185 ? 10.582  16.610  17.311  1.00 27.04 ? 185  HIS A N    1  
ATOM   2911  C CA   . HIS A 1 185 ? 10.432  17.797  18.139  1.00 27.63 ? 185  HIS A CA   1  
ATOM   2912  C C    . HIS A 1 185 ? 9.121   17.740  18.915  1.00 27.78 ? 185  HIS A C    1  
ATOM   2913  O O    . HIS A 1 185 ? 8.218   18.558  18.648  1.00 27.59 ? 185  HIS A O    1  
ATOM   2914  C CB   . HIS A 1 185 ? 10.516  19.076  17.288  1.00 28.05 ? 185  HIS A CB   1  
ATOM   2915  C CG   . HIS A 1 185 ? 9.666   19.061  16.048  1.00 28.32 ? 185  HIS A CG   1  
ATOM   2916  N ND1  . HIS A 1 185 ? 8.377   19.540  16.010  1.00 28.85 ? 185  HIS A ND1  1  
ATOM   2917  C CD2  . HIS A 1 185 ? 9.941   18.631  14.794  1.00 28.21 ? 185  HIS A CD2  1  
ATOM   2918  C CE1  . HIS A 1 185 ? 7.896   19.404  14.791  1.00 29.06 ? 185  HIS A CE1  1  
ATOM   2919  N NE2  . HIS A 1 185 ? 8.825   18.858  14.030  1.00 28.68 ? 185  HIS A NE2  1  
ATOM   2920  O OXT  . HIS A 1 185 ? 8.990   16.858  19.783  1.00 28.16 ? 185  HIS A OXT  1  
ATOM   2921  H H    . HIS A 1 185 ? 9.820   16.307  16.769  1.00 26.76 ? 185  HIS A H    1  
ATOM   2922  H HA   . HIS A 1 185 ? 11.248  17.800  18.849  1.00 27.76 ? 185  HIS A HA   1  
ATOM   2923  H HB2  . HIS A 1 185 ? 10.202  19.917  17.888  1.00 28.24 ? 185  HIS A HB2  1  
ATOM   2924  H HB3  . HIS A 1 185 ? 11.541  19.227  16.984  1.00 28.07 ? 185  HIS A HB3  1  
ATOM   2925  H HD1  . HIS A 1 185 ? 7.880   19.924  16.771  1.00 29.11 ? 185  HIS A HD1  1  
ATOM   2926  H HD2  . HIS A 1 185 ? 10.869  18.191  14.458  1.00 27.89 ? 185  HIS A HD2  1  
ATOM   2927  H HE1  . HIS A 1 185 ? 6.907   19.696  14.467  1.00 29.52 ? 185  HIS A HE1  1  
ATOM   2928  H HE2  . HIS A 1 185 ? 8.819   18.886  13.042  1.00 28.82 ? 185  HIS A HE2  1  
HETATM 2929  C C    . ACE B 2 1   ? -19.323 -15.319 -1.152  1.00 3.23  ? 1001 ACE B C    1  
HETATM 2930  O O    . ACE B 2 1   ? -19.522 -16.164 -2.029  1.00 3.56  ? 1001 ACE B O    1  
HETATM 2931  C CH3  . ACE B 2 1   ? -20.384 -14.272 -0.872  1.00 4.05  ? 1001 ACE B CH3  1  
HETATM 2932  H H1   . ACE B 2 1   ? -21.286 -14.534 -1.404  1.00 4.41  ? 1001 ACE B H1   1  
HETATM 2933  H H2   . ACE B 2 1   ? -20.025 -13.310 -1.207  1.00 4.42  ? 1001 ACE B H2   1  
HETATM 2934  H H3   . ACE B 2 1   ? -20.577 -14.243 0.190   1.00 4.33  ? 1001 ACE B H3   1  
ATOM   2935  N N    . GLY B 2 2   ? -18.202 -15.294 -0.446  1.00 2.68  ? 1002 GLY B N    1  
ATOM   2936  C CA   . GLY B 2 2   ? -17.164 -16.278 -0.661  1.00 2.37  ? 1002 GLY B CA   1  
ATOM   2937  C C    . GLY B 2 2   ? -15.881 -15.649 -1.162  1.00 2.24  ? 1002 GLY B C    1  
ATOM   2938  O O    . GLY B 2 2   ? -15.890 -14.504 -1.616  1.00 2.97  ? 1002 GLY B O    1  
ATOM   2939  H H    . GLY B 2 2   ? -18.071 -14.585 0.227   1.00 2.99  ? 1002 GLY B H    1  
ATOM   2940  H HA2  . GLY B 2 2   ? -16.964 -16.788 0.270   1.00 2.60  ? 1002 GLY B HA2  1  
ATOM   2941  H HA3  . GLY B 2 2   ? -17.507 -16.996 -1.389  1.00 2.58  ? 1002 GLY B HA3  1  
ATOM   2942  N N    . CYS B 2 3   ? -14.781 -16.395 -1.070  1.00 1.72  ? 1003 CYS B N    1  
ATOM   2943  C CA   . CYS B 2 3   ? -13.477 -15.930 -1.544  1.00 1.60  ? 1003 CYS B CA   1  
ATOM   2944  C C    . CYS B 2 3   ? -13.000 -14.743 -0.732  1.00 1.42  ? 1003 CYS B C    1  
ATOM   2945  O O    . CYS B 2 3   ? -13.165 -14.725 0.484   1.00 1.55  ? 1003 CYS B O    1  
ATOM   2946  C CB   . CYS B 2 3   ? -13.546 -15.530 -3.011  1.00 1.63  ? 1003 CYS B CB   1  
ATOM   2947  S SG   . CYS B 2 3   ? -14.389 -16.734 -4.076  1.00 1.94  ? 1003 CYS B SG   1  
ATOM   2948  H H    . CYS B 2 3   ? -14.847 -17.287 -0.661  1.00 1.84  ? 1003 CYS B H    1  
ATOM   2949  H HA   . CYS B 2 3   ? -12.770 -16.729 -1.434  1.00 1.76  ? 1003 CYS B HA   1  
ATOM   2950  H HB2  . CYS B 2 3   ? -14.058 -14.577 -3.092  1.00 1.60  ? 1003 CYS B HB2  1  
ATOM   2951  H HB3  . CYS B 2 3   ? -12.539 -15.422 -3.388  1.00 1.65  ? 1003 CYS B HB3  1  
ATOM   2952  N N    . VAL B 2 4   ? -12.392 -13.775 -1.440  1.00 1.37  ? 1004 VAL B N    1  
ATOM   2953  C CA   . VAL B 2 4   ? -11.935 -12.493 -0.904  1.00 1.19  ? 1004 VAL B CA   1  
ATOM   2954  C C    . VAL B 2 4   ? -11.281 -12.581 0.466   1.00 1.19  ? 1004 VAL B C    1  
ATOM   2955  O O    . VAL B 2 4   ? -10.060 -12.527 0.529   1.00 1.63  ? 1004 VAL B O    1  
ATOM   2956  C CB   . VAL B 2 4   ? -13.013 -11.416 -0.973  1.00 1.15  ? 1004 VAL B CB   1  
ATOM   2957  C CG1  . VAL B 2 4   ? -13.095 -10.877 -2.383  1.00 1.41  ? 1004 VAL B CG1  1  
ATOM   2958  C CG2  . VAL B 2 4   ? -14.329 -11.982 -0.587  1.00 1.42  ? 1004 VAL B CG2  1  
ATOM   2959  H H    . VAL B 2 4   ? -12.242 -13.934 -2.390  1.00 1.62  ? 1004 VAL B H    1  
ATOM   2960  H HA   . VAL B 2 4   ? -11.173 -12.178 -1.575  1.00 1.20  ? 1004 VAL B HA   1  
ATOM   2961  H HB   . VAL B 2 4   ? -12.759 -10.621 -0.303  1.00 0.94  ? 1004 VAL B HB   1  
ATOM   2962  H HG11 . VAL B 2 4   ? -13.280 -11.699 -3.063  1.00 1.79  ? 1004 VAL B HG11 1  
ATOM   2963  H HG12 . VAL B 2 4   ? -12.162 -10.398 -2.641  1.00 1.93  ? 1004 VAL B HG12 1  
ATOM   2964  H HG13 . VAL B 2 4   ? -13.902 -10.164 -2.452  1.00 1.62  ? 1004 VAL B HG13 1  
ATOM   2965  H HG21 . VAL B 2 4   ? -14.294 -12.273 0.446   1.00 1.73  ? 1004 VAL B HG21 1  
ATOM   2966  H HG22 . VAL B 2 4   ? -14.504 -12.848 -1.207  1.00 1.78  ? 1004 VAL B HG22 1  
ATOM   2967  H HG23 . VAL B 2 4   ? -15.100 -11.256 -0.748  1.00 1.94  ? 1004 VAL B HG23 1  
ATOM   2968  N N    . GLY B 2 5   ? -12.045 -12.677 1.554   1.00 1.02  ? 1005 GLY B N    1  
ATOM   2969  C CA   . GLY B 2 5   ? -11.434 -13.002 2.811   1.00 1.07  ? 1005 GLY B CA   1  
ATOM   2970  C C    . GLY B 2 5   ? -10.421 -14.123 2.631   1.00 1.05  ? 1005 GLY B C    1  
ATOM   2971  O O    . GLY B 2 5   ? -9.226  -13.911 2.795   1.00 1.20  ? 1005 GLY B O    1  
ATOM   2972  H H    . GLY B 2 5   ? -13.007 -12.527 1.508   1.00 1.09  ? 1005 GLY B H    1  
ATOM   2973  H HA2  . GLY B 2 5   ? -10.943 -12.116 3.194   1.00 1.07  ? 1005 GLY B HA2  1  
ATOM   2974  H HA3  . GLY B 2 5   ? -12.199 -13.319 3.506   1.00 1.26  ? 1005 GLY B HA3  1  
ATOM   2975  N N    . ARG B 2 6   ? -10.897 -15.287 2.201   1.00 1.08  ? 1006 ARG B N    1  
ATOM   2976  C CA   . ARG B 2 6   ? -10.030 -16.437 1.936   1.00 1.08  ? 1006 ARG B CA   1  
ATOM   2977  C C    . ARG B 2 6   ? -9.005  -16.139 0.843   1.00 1.04  ? 1006 ARG B C    1  
ATOM   2978  O O    . ARG B 2 6   ? -7.838  -16.504 0.960   1.00 1.10  ? 1006 ARG B O    1  
ATOM   2979  C CB   . ARG B 2 6   ? -10.869 -17.641 1.506   1.00 1.14  ? 1006 ARG B CB   1  
ATOM   2980  C CG   . ARG B 2 6   ? -11.003 -18.718 2.565   1.00 1.24  ? 1006 ARG B CG   1  
ATOM   2981  C CD   . ARG B 2 6   ? -11.526 -18.159 3.873   1.00 1.55  ? 1006 ARG B CD   1  
ATOM   2982  N NE   . ARG B 2 6   ? -11.969 -19.220 4.777   1.00 1.88  ? 1006 ARG B NE   1  
ATOM   2983  C CZ   . ARG B 2 6   ? -12.072 -19.099 6.103   1.00 2.43  ? 1006 ARG B CZ   1  
ATOM   2984  N NH1  . ARG B 2 6   ? -11.665 -17.999 6.723   1.00 2.88  ? 1006 ARG B NH1  1  
ATOM   2985  N NH2  . ARG B 2 6   ? -12.558 -20.104 6.818   1.00 2.87  ? 1006 ARG B NH2  1  
ATOM   2986  H H    . ARG B 2 6   ? -11.864 -15.376 2.051   1.00 1.23  ? 1006 ARG B H    1  
ATOM   2987  H HA   . ARG B 2 6   ? -9.508  -16.683 2.848   1.00 1.16  ? 1006 ARG B HA   1  
ATOM   2988  H HB2  . ARG B 2 6   ? -11.859 -17.296 1.250   1.00 1.38  ? 1006 ARG B HB2  1  
ATOM   2989  H HB3  . ARG B 2 6   ? -10.415 -18.083 0.631   1.00 1.34  ? 1006 ARG B HB3  1  
ATOM   2990  H HG2  . ARG B 2 6   ? -11.687 -19.471 2.208   1.00 1.62  ? 1006 ARG B HG2  1  
ATOM   2991  H HG3  . ARG B 2 6   ? -10.033 -19.163 2.737   1.00 1.60  ? 1006 ARG B HG3  1  
ATOM   2992  H HD2  . ARG B 2 6   ? -10.736 -17.597 4.346   1.00 1.88  ? 1006 ARG B HD2  1  
ATOM   2993  H HD3  . ARG B 2 6   ? -12.357 -17.506 3.658   1.00 1.96  ? 1006 ARG B HD3  1  
ATOM   2994  H HE   . ARG B 2 6   ? -12.235 -20.078 4.359   1.00 2.02  ? 1006 ARG B HE   1  
ATOM   2995  H HH11 . ARG B 2 6   ? -11.258 -17.235 6.200   1.00 2.84  ? 1006 ARG B HH11 1  
ATOM   2996  H HH12 . ARG B 2 6   ? -11.764 -17.916 7.721   1.00 3.45  ? 1006 ARG B HH12 1  
ATOM   2997  H HH21 . ARG B 2 6   ? -12.848 -20.955 6.368   1.00 2.94  ? 1006 ARG B HH21 1  
ATOM   2998  H HH22 . ARG B 2 6   ? -12.635 -20.025 7.818   1.00 3.33  ? 1006 ARG B HH22 1  
ATOM   2999  N N    . ALA B 2 7   ? -9.447  -15.469 -0.213  1.00 1.02  ? 1007 ALA B N    1  
ATOM   3000  C CA   . ALA B 2 7   ? -8.619  -15.280 -1.398  1.00 1.05  ? 1007 ALA B CA   1  
ATOM   3001  C C    . ALA B 2 7   ? -7.467  -14.310 -1.152  1.00 1.02  ? 1007 ALA B C    1  
ATOM   3002  O O    . ALA B 2 7   ? -6.324  -14.621 -1.467  1.00 1.31  ? 1007 ALA B O    1  
ATOM   3003  C CB   . ALA B 2 7   ? -9.467  -14.818 -2.569  1.00 1.10  ? 1007 ALA B CB   1  
ATOM   3004  H H    . ALA B 2 7   ? -10.346 -15.085 -0.190  1.00 1.04  ? 1007 ALA B H    1  
ATOM   3005  H HA   . ALA B 2 7   ? -8.202  -16.242 -1.657  1.00 1.14  ? 1007 ALA B HA   1  
ATOM   3006  H HB1  . ALA B 2 7   ? -8.850  -14.735 -3.450  1.00 1.51  ? 1007 ALA B HB1  1  
ATOM   3007  H HB2  . ALA B 2 7   ? -9.905  -13.857 -2.341  1.00 1.54  ? 1007 ALA B HB2  1  
ATOM   3008  H HB3  . ALA B 2 7   ? -10.252 -15.540 -2.746  1.00 1.46  ? 1007 ALA B HB3  1  
ATOM   3009  N N    . LEU B 2 8   ? -7.760  -13.148 -0.586  1.00 0.84  ? 1008 LEU B N    1  
ATOM   3010  C CA   . LEU B 2 8   ? -6.727  -12.146 -0.346  1.00 0.83  ? 1008 LEU B CA   1  
ATOM   3011  C C    . LEU B 2 8   ? -5.839  -12.566 0.820   1.00 0.78  ? 1008 LEU B C    1  
ATOM   3012  O O    . LEU B 2 8   ? -4.642  -12.288 0.825   1.00 0.79  ? 1008 LEU B O    1  
ATOM   3013  C CB   . LEU B 2 8   ? -7.331  -10.759 -0.087  1.00 0.90  ? 1008 LEU B CB   1  
ATOM   3014  C CG   . LEU B 2 8   ? -7.975  -10.064 -1.300  1.00 0.88  ? 1008 LEU B CG   1  
ATOM   3015  C CD1  . LEU B 2 8   ? -7.151  -10.313 -2.543  1.00 1.13  ? 1008 LEU B CD1  1  
ATOM   3016  C CD2  . LEU B 2 8   ? -9.412  -10.516 -1.521  1.00 1.33  ? 1008 LEU B CD2  1  
ATOM   3017  H H    . LEU B 2 8   ? -8.685  -12.962 -0.308  1.00 0.85  ? 1008 LEU B H    1  
ATOM   3018  H HA   . LEU B 2 8   ? -6.115  -12.096 -1.234  1.00 0.87  ? 1008 LEU B HA   1  
ATOM   3019  H HB2  . LEU B 2 8   ? -8.085  -10.860 0.680   1.00 0.95  ? 1008 LEU B HB2  1  
ATOM   3020  H HB3  . LEU B 2 8   ? -6.548  -10.117 0.288   1.00 1.05  ? 1008 LEU B HB3  1  
ATOM   3021  H HG   . LEU B 2 8   ? -7.986  -8.998  -1.124  1.00 1.38  ? 1008 LEU B HG   1  
ATOM   3022  H HD11 . LEU B 2 8   ? -7.057  -11.379 -2.696  1.00 1.77  ? 1008 LEU B HD11 1  
ATOM   3023  H HD12 . LEU B 2 8   ? -6.171  -9.878  -2.417  1.00 1.55  ? 1008 LEU B HD12 1  
ATOM   3024  H HD13 . LEU B 2 8   ? -7.642  -9.867  -3.394  1.00 1.60  ? 1008 LEU B HD13 1  
ATOM   3025  H HD21 . LEU B 2 8   ? -9.851  -9.948  -2.327  1.00 1.85  ? 1008 LEU B HD21 1  
ATOM   3026  H HD22 . LEU B 2 8   ? -9.989  -10.362 -0.617  1.00 1.90  ? 1008 LEU B HD22 1  
ATOM   3027  H HD23 . LEU B 2 8   ? -9.421  -11.565 -1.775  1.00 1.64  ? 1008 LEU B HD23 1  
ATOM   3028  N N    . ALA B 2 9   ? -6.441  -13.221 1.811   1.00 0.78  ? 1009 ALA B N    1  
ATOM   3029  C CA   . ALA B 2 9   ? -5.689  -13.893 2.868   1.00 0.78  ? 1009 ALA B CA   1  
ATOM   3030  C C    . ALA B 2 9   ? -4.565  -14.735 2.268   1.00 0.80  ? 1009 ALA B C    1  
ATOM   3031  O O    . ALA B 2 9   ? -3.415  -14.702 2.713   1.00 0.76  ? 1009 ALA B O    1  
ATOM   3032  C CB   . ALA B 2 9   ? -6.587  -14.824 3.645   1.00 0.88  ? 1009 ALA B CB   1  
ATOM   3033  H H    . ALA B 2 9   ? -7.416  -13.220 1.852   1.00 0.82  ? 1009 ALA B H    1  
ATOM   3034  H HA   . ALA B 2 9   ? -5.312  -13.144 3.553   1.00 0.73  ? 1009 ALA B HA   1  
ATOM   3035  H HB1  . ALA B 2 9   ? -7.396  -14.259 4.081   1.00 1.23  ? 1009 ALA B HB1  1  
ATOM   3036  H HB2  . ALA B 2 9   ? -6.015  -15.301 4.428   1.00 1.37  ? 1009 ALA B HB2  1  
ATOM   3037  H HB3  . ALA B 2 9   ? -6.987  -15.575 2.982   1.00 1.45  ? 1009 ALA B HB3  1  
ATOM   3038  N N    . ALA B 2 10  ? -4.947  -15.502 1.249   1.00 0.89  ? 1010 ALA B N    1  
ATOM   3039  C CA   . ALA B 2 10  ? -4.075  -16.471 0.604   1.00 0.94  ? 1010 ALA B CA   1  
ATOM   3040  C C    . ALA B 2 10  ? -3.125  -15.809 -0.387  1.00 0.92  ? 1010 ALA B C    1  
ATOM   3041  O O    . ALA B 2 10  ? -1.905  -15.919 -0.260  1.00 0.92  ? 1010 ALA B O    1  
ATOM   3042  C CB   . ALA B 2 10  ? -4.928  -17.503 -0.110  1.00 1.03  ? 1010 ALA B CB   1  
ATOM   3043  H H    . ALA B 2 10  ? -5.865  -15.412 0.919   1.00 0.96  ? 1010 ALA B H    1  
ATOM   3044  H HA   . ALA B 2 10  ? -3.500  -16.975 1.367   1.00 0.94  ? 1010 ALA B HA   1  
ATOM   3045  H HB1  . ALA B 2 10  ? -5.386  -18.161 0.613   1.00 1.35  ? 1010 ALA B HB1  1  
ATOM   3046  H HB2  . ALA B 2 10  ? -4.311  -18.078 -0.796  1.00 1.44  ? 1010 ALA B HB2  1  
ATOM   3047  H HB3  . ALA B 2 10  ? -5.703  -17.000 -0.676  1.00 1.51  ? 1010 ALA B HB3  1  
ATOM   3048  N N    . PHE B 2 11  ? -3.693  -15.121 -1.373  1.00 0.93  ? 1011 PHE B N    1  
ATOM   3049  C CA   . PHE B 2 11  ? -2.907  -14.460 -2.412  1.00 0.93  ? 1011 PHE B CA   1  
ATOM   3050  C C    . PHE B 2 11  ? -1.995  -13.394 -1.817  1.00 0.85  ? 1011 PHE B C    1  
ATOM   3051  O O    . PHE B 2 11  ? -1.014  -12.981 -2.439  1.00 0.89  ? 1011 PHE B O    1  
ATOM   3052  C CB   . PHE B 2 11  ? -3.825  -13.824 -3.462  1.00 0.97  ? 1011 PHE B CB   1  
ATOM   3053  C CG   . PHE B 2 11  ? -4.353  -14.786 -4.491  1.00 1.12  ? 1011 PHE B CG   1  
ATOM   3054  C CD1  . PHE B 2 11  ? -3.559  -15.165 -5.560  1.00 1.50  ? 1011 PHE B CD1  1  
ATOM   3055  C CD2  . PHE B 2 11  ? -5.642  -15.296 -4.409  1.00 1.18  ? 1011 PHE B CD2  1  
ATOM   3056  C CE1  . PHE B 2 11  ? -4.034  -16.035 -6.520  1.00 1.67  ? 1011 PHE B CE1  1  
ATOM   3057  C CE2  . PHE B 2 11  ? -6.122  -16.160 -5.366  1.00 1.32  ? 1011 PHE B CE2  1  
ATOM   3058  C CZ   . PHE B 2 11  ? -5.318  -16.533 -6.424  1.00 1.46  ? 1011 PHE B CZ   1  
ATOM   3059  H H    . PHE B 2 11  ? -4.674  -15.047 -1.398  1.00 0.95  ? 1011 PHE B H    1  
ATOM   3060  H HA   . PHE B 2 11  ? -2.296  -15.211 -2.891  1.00 0.99  ? 1011 PHE B HA   1  
ATOM   3061  H HB2  . PHE B 2 11  ? -4.672  -13.379 -2.963  1.00 0.92  ? 1011 PHE B HB2  1  
ATOM   3062  H HB3  . PHE B 2 11  ? -3.278  -13.050 -3.981  1.00 1.00  ? 1011 PHE B HB3  1  
ATOM   3063  H HD1  . PHE B 2 11  ? -2.555  -14.777 -5.637  1.00 1.78  ? 1011 PHE B HD1  1  
ATOM   3064  H HD2  . PHE B 2 11  ? -6.276  -15.019 -3.584  1.00 1.34  ? 1011 PHE B HD2  1  
ATOM   3065  H HE1  . PHE B 2 11  ? -3.400  -16.327 -7.344  1.00 2.07  ? 1011 PHE B HE1  1  
ATOM   3066  H HE2  . PHE B 2 11  ? -7.129  -16.544 -5.284  1.00 1.50  ? 1011 PHE B HE2  1  
ATOM   3067  H HZ   . PHE B 2 11  ? -5.692  -17.212 -7.177  1.00 1.60  ? 1011 PHE B HZ   1  
ATOM   3068  N N    . GLY B 2 12  ? -2.320  -12.963 -0.608  1.00 0.78  ? 1012 GLY B N    1  
ATOM   3069  C CA   . GLY B 2 12  ? -1.549  -11.937 0.047   1.00 0.72  ? 1012 GLY B CA   1  
ATOM   3070  C C    . GLY B 2 12  ? -0.216  -12.431 0.555   1.00 0.73  ? 1012 GLY B C    1  
ATOM   3071  O O    . GLY B 2 12  ? 0.728   -11.653 0.687   1.00 0.78  ? 1012 GLY B O    1  
ATOM   3072  H H    . GLY B 2 12  ? -3.105  -13.343 -0.159  1.00 0.80  ? 1012 GLY B H    1  
ATOM   3073  H HA2  . GLY B 2 12  ? -1.374  -11.145 -0.658  1.00 0.74  ? 1012 GLY B HA2  1  
ATOM   3074  H HA3  . GLY B 2 12  ? -2.120  -11.555 0.880   1.00 0.72  ? 1012 GLY B HA3  1  
ATOM   3075  N N    . ASP B 2 13  ? -0.121  -13.725 0.818   1.00 0.78  ? 1013 ASP B N    1  
ATOM   3076  C CA   . ASP B 2 13  ? 1.126   -14.308 1.299   1.00 0.86  ? 1013 ASP B CA   1  
ATOM   3077  C C    . ASP B 2 13  ? 2.122   -14.472 0.146   1.00 0.93  ? 1013 ASP B C    1  
ATOM   3078  O O    . ASP B 2 13  ? 3.212   -15.024 0.312   1.00 1.06  ? 1013 ASP B O    1  
ATOM   3079  C CB   . ASP B 2 13  ? 0.858   -15.656 1.980   1.00 0.98  ? 1013 ASP B CB   1  
ATOM   3080  C CG   . ASP B 2 13  ? 2.056   -16.161 2.762   1.00 1.18  ? 1013 ASP B CG   1  
ATOM   3081  O OD1  . ASP B 2 13  ? 2.495   -15.469 3.706   1.00 1.48  ? 1013 ASP B OD1  1  
ATOM   3082  O OD2  . ASP B 2 13  ? 2.563   -17.259 2.442   1.00 1.90  ? 1013 ASP B OD2  1  
ATOM   3083  H H    . ASP B 2 13  ? -0.910  -14.303 0.694   1.00 0.80  ? 1013 ASP B H    1  
ATOM   3084  H HA   . ASP B 2 13  ? 1.548   -13.628 2.024   1.00 0.88  ? 1013 ASP B HA   1  
ATOM   3085  H HB2  . ASP B 2 13  ? 0.026   -15.550 2.659   1.00 1.08  ? 1013 ASP B HB2  1  
ATOM   3086  H HB3  . ASP B 2 13  ? 0.610   -16.388 1.225   1.00 1.09  ? 1013 ASP B HB3  1  
ATOM   3087  N N    . CYS B 2 14  ? 1.749   -13.964 -1.023  1.00 0.93  ? 1014 CYS B N    1  
ATOM   3088  C CA   . CYS B 2 14  ? 2.588   -14.075 -2.208  1.00 1.06  ? 1014 CYS B CA   1  
ATOM   3089  C C    . CYS B 2 14  ? 3.331   -12.768 -2.480  1.00 1.08  ? 1014 CYS B C    1  
ATOM   3090  O O    . CYS B 2 14  ? 4.027   -12.643 -3.488  1.00 1.44  ? 1014 CYS B O    1  
ATOM   3091  C CB   . CYS B 2 14  ? 1.742   -14.448 -3.423  1.00 1.12  ? 1014 CYS B CB   1  
ATOM   3092  S SG   . CYS B 2 14  ? 0.671   -15.899 -3.168  1.00 1.34  ? 1014 CYS B SG   1  
ATOM   3093  H H    . CYS B 2 14  ? 0.888   -13.502 -1.089  1.00 0.89  ? 1014 CYS B H    1  
ATOM   3094  H HA   . CYS B 2 14  ? 3.311   -14.856 -2.030  1.00 1.22  ? 1014 CYS B HA   1  
ATOM   3095  H HB2  . CYS B 2 14  ? 1.104   -13.610 -3.679  1.00 1.12  ? 1014 CYS B HB2  1  
ATOM   3096  H HB3  . CYS B 2 14  ? 2.402   -14.667 -4.256  1.00 1.42  ? 1014 CYS B HB3  1  
ATOM   3097  N N    . ILE B 2 15  ? 3.188   -11.795 -1.582  1.00 1.14  ? 1015 ILE B N    1  
ATOM   3098  C CA   . ILE B 2 15  ? 3.875   -10.517 -1.735  1.00 1.23  ? 1015 ILE B CA   1  
ATOM   3099  C C    . ILE B 2 15  ? 5.327   -10.646 -1.282  1.00 1.67  ? 1015 ILE B C    1  
ATOM   3100  O O    . ILE B 2 15  ? 5.740   -10.103 -0.254  1.00 2.20  ? 1015 ILE B O    1  
ATOM   3101  C CB   . ILE B 2 15  ? 3.167   -9.385  -0.959  1.00 1.32  ? 1015 ILE B CB   1  
ATOM   3102  C CG1  . ILE B 2 15  ? 1.691   -9.336  -1.364  1.00 2.19  ? 1015 ILE B CG1  1  
ATOM   3103  C CG2  . ILE B 2 15  ? 3.839   -8.040  -1.238  1.00 1.41  ? 1015 ILE B CG2  1  
ATOM   3104  C CD1  . ILE B 2 15  ? 0.876   -8.328  -0.589  1.00 2.91  ? 1015 ILE B CD1  1  
ATOM   3105  H H    . ILE B 2 15  ? 2.612   -11.941 -0.801  1.00 1.40  ? 1015 ILE B H    1  
ATOM   3106  H HA   . ILE B 2 15  ? 3.864   -10.265 -2.788  1.00 1.28  ? 1015 ILE B HA   1  
ATOM   3107  H HB   . ILE B 2 15  ? 3.241   -9.593  0.098   1.00 1.55  ? 1015 ILE B HB   1  
ATOM   3108  H HG12 . ILE B 2 15  ? 1.622   -9.079  -2.410  1.00 2.59  ? 1015 ILE B HG12 1  
ATOM   3109  H HG13 . ILE B 2 15  ? 1.251   -10.310 -1.207  1.00 2.56  ? 1015 ILE B HG13 1  
ATOM   3110  H HG21 . ILE B 2 15  ? 3.591   -7.711  -2.236  1.00 1.41  ? 1015 ILE B HG21 1  
ATOM   3111  H HG22 . ILE B 2 15  ? 4.910   -8.152  -1.155  1.00 1.83  ? 1015 ILE B HG22 1  
ATOM   3112  H HG23 . ILE B 2 15  ? 3.500   -7.308  -0.520  1.00 2.10  ? 1015 ILE B HG23 1  
ATOM   3113  H HD11 . ILE B 2 15  ? -0.147  -8.350  -0.935  1.00 3.43  ? 1015 ILE B HD11 1  
ATOM   3114  H HD12 . ILE B 2 15  ? 1.286   -7.340  -0.742  1.00 3.20  ? 1015 ILE B HD12 1  
ATOM   3115  H HD13 . ILE B 2 15  ? 0.906   -8.571  0.463   1.00 3.23  ? 1015 ILE B HD13 1  
ATOM   3116  N N    . ASN B 2 16  ? 6.074   -11.422 -2.052  1.00 2.03  ? 1016 ASN B N    1  
ATOM   3117  C CA   . ASN B 2 16  ? 7.487   -11.669 -1.811  1.00 2.59  ? 1016 ASN B CA   1  
ATOM   3118  C C    . ASN B 2 16  ? 7.995   -12.567 -2.927  1.00 2.83  ? 1016 ASN B C    1  
ATOM   3119  O O    . ASN B 2 16  ? 8.980   -12.259 -3.601  1.00 3.29  ? 1016 ASN B O    1  
ATOM   3120  C CB   . ASN B 2 16  ? 7.706   -12.345 -0.448  1.00 3.32  ? 1016 ASN B CB   1  
ATOM   3121  C CG   . ASN B 2 16  ? 9.144   -12.249 0.037   1.00 3.73  ? 1016 ASN B CG   1  
ATOM   3122  O OD1  . ASN B 2 16  ? 10.081  -12.146 -0.755  1.00 4.03  ? 1016 ASN B OD1  1  
ATOM   3123  N ND2  . ASN B 2 16  ? 9.325   -12.293 1.348   1.00 4.29  ? 1016 ASN B ND2  1  
ATOM   3124  H H    . ASN B 2 16  ? 5.649   -11.857 -2.826  1.00 2.26  ? 1016 ASN B H    1  
ATOM   3125  H HA   . ASN B 2 16  ? 8.012   -10.725 -1.842  1.00 2.85  ? 1016 ASN B HA   1  
ATOM   3126  H HB2  . ASN B 2 16  ? 7.070   -11.873 0.286   1.00 3.88  ? 1016 ASN B HB2  1  
ATOM   3127  H HB3  . ASN B 2 16  ? 7.442   -13.390 -0.528  1.00 3.60  ? 1016 ASN B HB3  1  
ATOM   3128  H HD21 . ASN B 2 16  ? 8.532   -12.386 1.927   1.00 4.45  ? 1016 ASN B HD21 1  
ATOM   3129  H HD22 . ASN B 2 16  ? 10.245  -12.226 1.695   1.00 4.79  ? 1016 ASN B HD22 1  
ATOM   3130  N N    . ARG B 2 17  ? 7.280   -13.666 -3.131  1.00 3.18  ? 1017 ARG B N    1  
ATOM   3131  C CA   . ARG B 2 17  ? 7.561   -14.588 -4.217  1.00 3.90  ? 1017 ARG B CA   1  
ATOM   3132  C C    . ARG B 2 17  ? 6.264   -14.983 -4.917  1.00 4.54  ? 1017 ARG B C    1  
ATOM   3133  O O    . ARG B 2 17  ? 5.521   -15.839 -4.437  1.00 5.06  ? 1017 ARG B O    1  
ATOM   3134  C CB   . ARG B 2 17  ? 8.271   -15.834 -3.692  1.00 4.55  ? 1017 ARG B CB   1  
ATOM   3135  C CG   . ARG B 2 17  ? 8.674   -16.810 -4.785  1.00 5.10  ? 1017 ARG B CG   1  
ATOM   3136  C CD   . ARG B 2 17  ? 9.408   -18.010 -4.217  1.00 5.97  ? 1017 ARG B CD   1  
ATOM   3137  N NE   . ARG B 2 17  ? 10.611  -17.619 -3.486  1.00 6.51  ? 1017 ARG B NE   1  
ATOM   3138  C CZ   . ARG B 2 17  ? 11.629  -18.437 -3.236  1.00 7.49  ? 1017 ARG B CZ   1  
ATOM   3139  N NH1  . ARG B 2 17  ? 11.604  -19.692 -3.671  1.00 8.03  ? 1017 ARG B NH1  1  
ATOM   3140  N NH2  . ARG B 2 17  ? 12.675  -17.995 -2.553  1.00 8.17  ? 1017 ARG B NH2  1  
ATOM   3141  H H    . ARG B 2 17  ? 6.533   -13.871 -2.520  1.00 3.33  ? 1017 ARG B H    1  
ATOM   3142  H HA   . ARG B 2 17  ? 8.203   -14.085 -4.926  1.00 4.04  ? 1017 ARG B HA   1  
ATOM   3143  H HB2  . ARG B 2 17  ? 9.163   -15.531 -3.163  1.00 4.75  ? 1017 ARG B HB2  1  
ATOM   3144  H HB3  . ARG B 2 17  ? 7.613   -16.348 -3.006  1.00 4.95  ? 1017 ARG B HB3  1  
ATOM   3145  H HG2  . ARG B 2 17  ? 7.786   -17.151 -5.296  1.00 5.26  ? 1017 ARG B HG2  1  
ATOM   3146  H HG3  . ARG B 2 17  ? 9.321   -16.302 -5.486  1.00 5.16  ? 1017 ARG B HG3  1  
ATOM   3147  H HD2  . ARG B 2 17  ? 8.746   -18.536 -3.546  1.00 6.32  ? 1017 ARG B HD2  1  
ATOM   3148  H HD3  . ARG B 2 17  ? 9.688   -18.663 -5.031  1.00 6.23  ? 1017 ARG B HD3  1  
ATOM   3149  H HE   . ARG B 2 17  ? 10.659  -16.685 -3.157  1.00 6.33  ? 1017 ARG B HE   1  
ATOM   3150  H HH11 . ARG B 2 17  ? 10.813  -20.032 -4.195  1.00 7.76  ? 1017 ARG B HH11 1  
ATOM   3151  H HH12 . ARG B 2 17  ? 12.379  -20.312 -3.486  1.00 8.86  ? 1017 ARG B HH12 1  
ATOM   3152  H HH21 . ARG B 2 17  ? 12.698  -17.046 -2.222  1.00 8.01  ? 1017 ARG B HH21 1  
ATOM   3153  H HH22 . ARG B 2 17  ? 13.455  -18.604 -2.368  1.00 8.98  ? 1017 ARG B HH22 1  
HETATM 3154  N N    . NH2 B 2 18  ? 5.978   -14.337 -6.033  1.00 4.96  ? 1018 NH2 B N    1  
HETATM 3155  H HN1  . NH2 B 2 18  ? 6.607   -13.650 -6.347  1.00 4.86  ? 1018 NH2 B HN1  1  
HETATM 3156  H HN2  . NH2 B 2 18  ? 5.153   -14.575 -6.506  1.00 5.57  ? 1018 NH2 B HN2  1  
HETATM 3157  C C1   . 33B C 3 .   ? -13.370 -18.192 -3.754  1.00 1.93  ? 1100 33B B C1   1  
HETATM 3158  C C2   . 33B C 3 .   ? -11.884 -17.830 -3.637  1.00 1.78  ? 1100 33B B C2   1  
HETATM 3159  O O2   . 33B C 3 .   ? -11.433 -16.804 -4.144  1.00 2.16  ? 1100 33B B O2   1  
HETATM 3160  N N3   . 33B C 3 .   ? -11.155 -18.689 -2.939  1.00 1.51  ? 1100 33B B N3   1  
HETATM 3161  C C4   . 33B C 3 .   ? -9.823  -18.655 -3.030  1.00 1.44  ? 1100 33B B C4   1  
HETATM 3162  C C5   . 33B C 3 .   ? -9.059  -18.859 -1.874  1.00 1.42  ? 1100 33B B C5   1  
HETATM 3163  C C6   . 33B C 3 .   ? -9.174  -18.432 -4.260  1.00 1.47  ? 1100 33B B C6   1  
HETATM 3164  S S6   . 33B C 3 .   ? -10.047 -18.240 -5.777  1.00 1.71  ? 1100 33B B S6   1  
HETATM 3165  C C7   . 33B C 3 .   ? -7.665  -18.859 -1.948  1.00 1.43  ? 1100 33B B C7   1  
HETATM 3166  C C8   . 33B C 3 .   ? -7.791  -18.423 -4.308  1.00 1.42  ? 1100 33B B C8   1  
HETATM 3167  C C9   . 33B C 3 .   ? -7.039  -18.646 -3.171  1.00 1.39  ? 1100 33B B C9   1  
HETATM 3168  N N10  . 33B C 3 .   ? -5.715  -18.692 -3.293  1.00 1.40  ? 1100 33B B N10  1  
HETATM 3169  N N11  . 33B C 3 .   ? -4.963  -18.911 -2.348  1.00 1.51  ? 1100 33B B N11  1  
HETATM 3170  C C12  . 33B C 3 .   ? -3.658  -18.919 -2.596  1.00 1.54  ? 1100 33B B C12  1  
HETATM 3171  C C13  . 33B C 3 .   ? -2.724  -19.162 -1.591  1.00 1.75  ? 1100 33B B C13  1  
HETATM 3172  C C14  . 33B C 3 .   ? -3.238  -18.675 -3.883  1.00 1.42  ? 1100 33B B C14  1  
HETATM 3173  C C15  . 33B C 3 .   ? -1.364  -19.150 -1.895  1.00 1.78  ? 1100 33B B C15  1  
HETATM 3174  C C16  . 33B C 3 .   ? -1.890  -18.665 -4.194  1.00 1.45  ? 1100 33B B C16  1  
HETATM 3175  C C17  . 33B C 3 .   ? -0.950  -18.899 -3.204  1.00 1.60  ? 1100 33B B C17  1  
HETATM 3176  S S17  . 33B C 3 .   ? -1.370  -18.346 -5.831  1.00 1.38  ? 1100 33B B S17  1  
HETATM 3177  N N18  . 33B C 3 .   ? 0.341   -18.834 -3.510  1.00 1.62  ? 1100 33B B N18  1  
HETATM 3178  C C19  . 33B C 3 .   ? 1.200   -18.516 -2.548  1.00 1.65  ? 1100 33B B C19  1  
HETATM 3179  O O19  . 33B C 3 .   ? 1.445   -19.228 -1.575  1.00 1.92  ? 1100 33B B O19  1  
HETATM 3180  C C20  . 33B C 3 .   ? 1.887   -17.165 -2.735  1.00 1.43  ? 1100 33B B C20  1  
HETATM 3181  O O61  . 33B C 3 .   ? -9.315  -18.986 -6.860  1.00 2.30  ? 1100 33B B O61  1  
HETATM 3182  O O62  . 33B C 3 .   ? -11.434 -18.806 -5.686  1.00 2.13  ? 1100 33B B O62  1  
HETATM 3183  O O63  . 33B C 3 .   ? -10.120 -16.788 -6.146  1.00 2.30  ? 1100 33B B O63  1  
HETATM 3184  O O71  . 33B C 3 .   ? -0.365  -19.378 -6.256  1.00 2.03  ? 1100 33B B O71  1  
HETATM 3185  O O72  . 33B C 3 .   ? -0.753  -16.977 -5.909  1.00 1.73  ? 1100 33B B O72  1  
HETATM 3186  O O73  . 33B C 3 .   ? -2.548  -18.410 -6.755  1.00 2.14  ? 1100 33B B O73  1  
HETATM 3187  H HN3  . 33B C 3 .   ? -11.570 -19.403 -2.411  1.00 1.56  ? 1100 33B B HN3  1  
HETATM 3188  H H5   . 33B C 3 .   ? -9.549  -19.013 -0.920  1.00 1.48  ? 1100 33B B H5   1  
HETATM 3189  H H7   . 33B C 3 .   ? -7.076  -19.034 -1.059  1.00 1.52  ? 1100 33B B H7   1  
HETATM 3190  H H8   . 33B C 3 .   ? -7.289  -18.237 -5.245  1.00 1.47  ? 1100 33B B H8   1  
HETATM 3191  H H1   . 33B C 3 .   ? -13.694 -18.652 -2.832  1.00 1.83  ? 1100 33B B H1   1  
HETATM 3192  H H13  . 33B C 3 .   ? -3.053  -19.357 -0.580  1.00 1.91  ? 1100 33B B H13  1  
HETATM 3193  H H14  . 33B C 3 .   ? -3.971  -18.482 -4.642  1.00 1.37  ? 1100 33B B H14  1  
HETATM 3194  H H15  . 33B C 3 .   ? -0.633  -19.333 -1.120  1.00 1.97  ? 1100 33B B H15  1  
HETATM 3195  H HN18 . 33B C 3 .   ? 0.645   -18.974 -4.431  1.00 1.61  ? 1100 33B B HN18 1  
HETATM 3196  H H20  . 33B C 3 .   ? 2.381   -16.885 -1.817  1.00 1.84  ? 1100 33B B H20  1  
HETATM 3197  H H1A  . 33B C 3 .   ? -13.498 -18.897 -4.563  1.00 2.26  ? 1100 33B B H1A  1  
HETATM 3198  H H20A . 33B C 3 .   ? 2.619   -17.243 -3.527  1.00 1.72  ? 1100 33B B H20A 1  
ATOM   3199  N N    . MET A 1 1   ? 4.998   8.334   12.834  1.00 4.13  ? 1    MET A N    2  
ATOM   3200  C CA   . MET A 1 1   ? 3.815   9.205   13.005  1.00 3.61  ? 1    MET A CA   2  
ATOM   3201  C C    . MET A 1 1   ? 2.546   8.398   12.768  1.00 2.48  ? 1    MET A C    2  
ATOM   3202  O O    . MET A 1 1   ? 2.612   7.257   12.316  1.00 2.89  ? 1    MET A O    2  
ATOM   3203  C CB   . MET A 1 1   ? 3.872   10.381  12.026  1.00 4.18  ? 1    MET A CB   2  
ATOM   3204  C CG   . MET A 1 1   ? 5.085   11.292  12.192  1.00 4.89  ? 1    MET A CG   2  
ATOM   3205  S SD   . MET A 1 1   ? 4.986   12.382  13.633  1.00 5.86  ? 1    MET A SD   2  
ATOM   3206  C CE   . MET A 1 1   ? 5.405   11.269  14.975  1.00 6.21  ? 1    MET A CE   2  
ATOM   3207  H H1   . MET A 1 1   ? 4.959   7.541   13.508  1.00 4.36  ? 1    MET A H1   2  
ATOM   3208  H H2   . MET A 1 1   ? 5.877   8.870   12.994  1.00 4.50  ? 1    MET A H2   2  
ATOM   3209  H H3   . MET A 1 1   ? 5.016   7.944   11.863  1.00 4.37  ? 1    MET A H3   2  
ATOM   3210  H HA   . MET A 1 1   ? 3.809   9.580   14.018  1.00 4.14  ? 1    MET A HA   2  
ATOM   3211  H HB2  . MET A 1 1   ? 3.884   9.993   11.019  1.00 4.47  ? 1    MET A HB2  2  
ATOM   3212  H HB3  . MET A 1 1   ? 2.983   10.981  12.156  1.00 4.35  ? 1    MET A HB3  2  
ATOM   3213  H HG2  . MET A 1 1   ? 5.965   10.676  12.293  1.00 5.14  ? 1    MET A HG2  2  
ATOM   3214  H HG3  . MET A 1 1   ? 5.180   11.903  11.306  1.00 5.02  ? 1    MET A HG3  2  
ATOM   3215  H HE1  . MET A 1 1   ? 6.395   10.867  14.813  1.00 6.39  ? 1    MET A HE1  2  
ATOM   3216  H HE2  . MET A 1 1   ? 4.689   10.461  15.008  1.00 6.45  ? 1    MET A HE2  2  
ATOM   3217  H HE3  . MET A 1 1   ? 5.383   11.809  15.910  1.00 6.36  ? 1    MET A HE3  2  
ATOM   3218  N N    . SER A 1 2   ? 1.399   8.983   13.081  1.00 1.64  ? 2    SER A N    2  
ATOM   3219  C CA   . SER A 1 2   ? 0.123   8.310   12.875  1.00 0.95  ? 2    SER A CA   2  
ATOM   3220  C C    . SER A 1 2   ? -0.642  8.915   11.699  1.00 0.84  ? 2    SER A C    2  
ATOM   3221  O O    . SER A 1 2   ? -1.288  8.202   10.927  1.00 1.03  ? 2    SER A O    2  
ATOM   3222  C CB   . SER A 1 2   ? -0.709  8.377   14.157  1.00 1.55  ? 2    SER A CB   2  
ATOM   3223  O OG   . SER A 1 2   ? -0.093  7.629   15.192  1.00 1.87  ? 2    SER A OG   2  
ATOM   3224  H H    . SER A 1 2   ? 1.410   9.878   13.485  1.00 2.17  ? 2    SER A H    2  
ATOM   3225  H HA   . SER A 1 2   ? 0.333   7.275   12.651  1.00 1.52  ? 2    SER A HA   2  
ATOM   3226  H HB2  . SER A 1 2   ? -0.798  9.406   14.474  1.00 2.02  ? 2    SER A HB2  2  
ATOM   3227  H HB3  . SER A 1 2   ? -1.692  7.971   13.968  1.00 2.26  ? 2    SER A HB3  2  
ATOM   3228  H HG   . SER A 1 2   ? 0.206   6.776   14.827  1.00 2.17  ? 2    SER A HG   2  
ATOM   3229  N N    . GLN A 1 3   ? -0.549  10.231  11.548  1.00 0.73  ? 3    GLN A N    2  
ATOM   3230  C CA   . GLN A 1 3   ? -1.234  10.927  10.465  1.00 0.73  ? 3    GLN A CA   2  
ATOM   3231  C C    . GLN A 1 3   ? -0.584  10.608  9.126   1.00 0.61  ? 3    GLN A C    2  
ATOM   3232  O O    . GLN A 1 3   ? -1.164  10.841  8.070   1.00 0.64  ? 3    GLN A O    2  
ATOM   3233  C CB   . GLN A 1 3   ? -1.239  12.441  10.703  1.00 0.83  ? 3    GLN A CB   2  
ATOM   3234  C CG   . GLN A 1 3   ? -2.172  12.893  11.820  1.00 1.13  ? 3    GLN A CG   2  
ATOM   3235  C CD   . GLN A 1 3   ? -1.752  12.405  13.196  1.00 1.76  ? 3    GLN A CD   2  
ATOM   3236  O OE1  . GLN A 1 3   ? -0.564  12.233  13.480  1.00 2.42  ? 3    GLN A OE1  2  
ATOM   3237  N NE2  . GLN A 1 3   ? -2.728  12.163  14.053  1.00 2.22  ? 3    GLN A NE2  2  
ATOM   3238  H H    . GLN A 1 3   ? -0.012  10.750  12.185  1.00 0.80  ? 3    GLN A H    2  
ATOM   3239  H HA   . GLN A 1 3   ? -2.254  10.573  10.445  1.00 0.87  ? 3    GLN A HA   2  
ATOM   3240  H HB2  . GLN A 1 3   ? -0.237  12.756  10.955  1.00 1.10  ? 3    GLN A HB2  2  
ATOM   3241  H HB3  . GLN A 1 3   ? -1.541  12.934  9.791   1.00 1.10  ? 3    GLN A HB3  2  
ATOM   3242  H HG2  . GLN A 1 3   ? -2.194  13.972  11.833  1.00 1.52  ? 3    GLN A HG2  2  
ATOM   3243  H HG3  . GLN A 1 3   ? -3.164  12.519  11.610  1.00 1.61  ? 3    GLN A HG3  2  
ATOM   3244  H HE21 . GLN A 1 3   ? -3.655  12.308  13.753  1.00 2.34  ? 3    GLN A HE21 2  
ATOM   3245  H HE22 . GLN A 1 3   ? -2.491  11.854  14.958  1.00 2.76  ? 3    GLN A HE22 2  
ATOM   3246  N N    . SER A 1 4   ? 0.615   10.055  9.179   1.00 0.55  ? 4    SER A N    2  
ATOM   3247  C CA   . SER A 1 4   ? 1.341   9.673   7.982   1.00 0.52  ? 4    SER A CA   2  
ATOM   3248  C C    . SER A 1 4   ? 0.669   8.496   7.282   1.00 0.45  ? 4    SER A C    2  
ATOM   3249  O O    . SER A 1 4   ? 0.698   8.398   6.055   1.00 0.46  ? 4    SER A O    2  
ATOM   3250  C CB   . SER A 1 4   ? 2.774   9.319   8.359   1.00 0.61  ? 4    SER A CB   2  
ATOM   3251  O OG   . SER A 1 4   ? 2.794   8.535   9.538   1.00 1.25  ? 4    SER A OG   2  
ATOM   3252  H H    . SER A 1 4   ? 1.028   9.896   10.053  1.00 0.59  ? 4    SER A H    2  
ATOM   3253  H HA   . SER A 1 4   ? 1.348   10.519  7.313   1.00 0.57  ? 4    SER A HA   2  
ATOM   3254  H HB2  . SER A 1 4   ? 3.229   8.758   7.555   1.00 1.02  ? 4    SER A HB2  2  
ATOM   3255  H HB3  . SER A 1 4   ? 3.335   10.226  8.532   1.00 1.08  ? 4    SER A HB3  2  
ATOM   3256  H HG   . SER A 1 4   ? 3.688   8.176   9.677   1.00 1.54  ? 4    SER A HG   2  
ATOM   3257  N N    . ASN A 1 5   ? 0.045   7.617   8.067   1.00 0.43  ? 5    ASN A N    2  
ATOM   3258  C CA   . ASN A 1 5   ? -0.640  6.447   7.518   1.00 0.39  ? 5    ASN A CA   2  
ATOM   3259  C C    . ASN A 1 5   ? -1.776  6.885   6.609   1.00 0.35  ? 5    ASN A C    2  
ATOM   3260  O O    . ASN A 1 5   ? -2.168  6.166   5.691   1.00 0.35  ? 5    ASN A O    2  
ATOM   3261  C CB   . ASN A 1 5   ? -1.212  5.561   8.624   1.00 0.40  ? 5    ASN A CB   2  
ATOM   3262  C CG   . ASN A 1 5   ? -0.201  5.161   9.674   1.00 0.80  ? 5    ASN A CG   2  
ATOM   3263  O OD1  . ASN A 1 5   ? 0.981   4.971   9.387   1.00 1.78  ? 5    ASN A OD1  2  
ATOM   3264  N ND2  . ASN A 1 5   ? -0.671  5.039   10.905  1.00 0.53  ? 5    ASN A ND2  2  
ATOM   3265  H H    . ASN A 1 5   ? 0.053   7.756   9.039   1.00 0.46  ? 5    ASN A H    2  
ATOM   3266  H HA   . ASN A 1 5   ? 0.074   5.879   6.940   1.00 0.42  ? 5    ASN A HA   2  
ATOM   3267  H HB2  . ASN A 1 5   ? -2.005  6.073   9.108   1.00 0.91  ? 5    ASN A HB2  2  
ATOM   3268  H HB3  . ASN A 1 5   ? -1.611  4.667   8.180   1.00 0.85  ? 5    ASN A HB3  2  
ATOM   3269  H HD21 . ASN A 1 5   ? -1.621  5.216   11.057  1.00 0.61  ? 5    ASN A HD21 2  
ATOM   3270  H HD22 . ASN A 1 5   ? -0.050  4.777   11.619  1.00 1.03  ? 5    ASN A HD22 2  
ATOM   3271  N N    . ARG A 1 6   ? -2.298  8.074   6.880   1.00 0.35  ? 6    ARG A N    2  
ATOM   3272  C CA   . ARG A 1 6   ? -3.345  8.665   6.067   1.00 0.34  ? 6    ARG A CA   2  
ATOM   3273  C C    . ARG A 1 6   ? -2.874  8.782   4.625   1.00 0.31  ? 6    ARG A C    2  
ATOM   3274  O O    . ARG A 1 6   ? -3.556  8.346   3.703   1.00 0.30  ? 6    ARG A O    2  
ATOM   3275  C CB   . ARG A 1 6   ? -3.720  10.036  6.635   1.00 0.41  ? 6    ARG A CB   2  
ATOM   3276  C CG   . ARG A 1 6   ? -4.720  10.810  5.794   1.00 0.59  ? 6    ARG A CG   2  
ATOM   3277  C CD   . ARG A 1 6   ? -5.978  10.001  5.525   1.00 0.41  ? 6    ARG A CD   2  
ATOM   3278  N NE   . ARG A 1 6   ? -6.712  9.672   6.748   1.00 0.68  ? 6    ARG A NE   2  
ATOM   3279  C CZ   . ARG A 1 6   ? -7.847  10.267  7.121   1.00 0.69  ? 6    ARG A CZ   2  
ATOM   3280  N NH1  . ARG A 1 6   ? -8.289  11.344  6.481   1.00 1.40  ? 6    ARG A NH1  2  
ATOM   3281  N NH2  . ARG A 1 6   ? -8.509  9.812   8.177   1.00 0.93  ? 6    ARG A NH2  2  
ATOM   3282  H H    . ARG A 1 6   ? -1.952  8.577   7.648   1.00 0.37  ? 6    ARG A H    2  
ATOM   3283  H HA   . ARG A 1 6   ? -4.208  8.017   6.101   1.00 0.35  ? 6    ARG A HA   2  
ATOM   3284  H HB2  . ARG A 1 6   ? -4.143  9.899   7.619   1.00 0.72  ? 6    ARG A HB2  2  
ATOM   3285  H HB3  . ARG A 1 6   ? -2.817  10.631  6.722   1.00 0.62  ? 6    ARG A HB3  2  
ATOM   3286  H HG2  . ARG A 1 6   ? -4.993  11.714  6.319   1.00 1.01  ? 6    ARG A HG2  2  
ATOM   3287  H HG3  . ARG A 1 6   ? -4.259  11.065  4.851   1.00 1.02  ? 6    ARG A HG3  2  
ATOM   3288  H HD2  . ARG A 1 6   ? -6.622  10.571  4.872   1.00 0.55  ? 6    ARG A HD2  2  
ATOM   3289  H HD3  . ARG A 1 6   ? -5.689  9.081   5.030   1.00 0.42  ? 6    ARG A HD3  2  
ATOM   3290  H HE   . ARG A 1 6   ? -6.363  8.936   7.298   1.00 1.36  ? 6    ARG A HE   2  
ATOM   3291  H HH11 . ARG A 1 6   ? -7.763  11.735  5.706   1.00 1.68  ? 6    ARG A HH11 2  
ATOM   3292  H HH12 . ARG A 1 6   ? -9.155  11.779  6.762   1.00 1.90  ? 6    ARG A HH12 2  
ATOM   3293  H HH21 . ARG A 1 6   ? -8.154  9.026   8.693   1.00 1.42  ? 6    ARG A HH21 2  
ATOM   3294  H HH22 . ARG A 1 6   ? -9.368  10.253  8.467   1.00 1.07  ? 6    ARG A HH22 2  
ATOM   3295  N N    . GLU A 1 7   ? -1.685  9.336   4.457   1.00 0.30  ? 7    GLU A N    2  
ATOM   3296  C CA   . GLU A 1 7   ? -1.077  9.496   3.142   1.00 0.29  ? 7    GLU A CA   2  
ATOM   3297  C C    . GLU A 1 7   ? -0.950  8.167   2.437   1.00 0.25  ? 7    GLU A C    2  
ATOM   3298  O O    . GLU A 1 7   ? -1.250  8.041   1.254   1.00 0.26  ? 7    GLU A O    2  
ATOM   3299  C CB   . GLU A 1 7   ? 0.322   10.070  3.287   1.00 0.31  ? 7    GLU A CB   2  
ATOM   3300  C CG   . GLU A 1 7   ? 0.359   11.458  3.862   1.00 0.40  ? 7    GLU A CG   2  
ATOM   3301  C CD   . GLU A 1 7   ? 1.765   11.968  4.008   1.00 0.51  ? 7    GLU A CD   2  
ATOM   3302  O OE1  . GLU A 1 7   ? 2.394   12.324  2.991   1.00 0.68  ? 7    GLU A OE1  2  
ATOM   3303  O OE2  . GLU A 1 7   ? 2.230   12.058  5.157   1.00 0.53  ? 7    GLU A OE2  2  
ATOM   3304  H H    . GLU A 1 7   ? -1.196  9.646   5.244   1.00 0.33  ? 7    GLU A H    2  
ATOM   3305  H HA   . GLU A 1 7   ? -1.691  10.165  2.556   1.00 0.32  ? 7    GLU A HA   2  
ATOM   3306  H HB2  . GLU A 1 7   ? 0.896   9.424   3.935   1.00 0.33  ? 7    GLU A HB2  2  
ATOM   3307  H HB3  . GLU A 1 7   ? 0.790   10.094  2.314   1.00 0.33  ? 7    GLU A HB3  2  
ATOM   3308  H HG2  . GLU A 1 7   ? -0.165  12.101  3.191   1.00 0.46  ? 7    GLU A HG2  2  
ATOM   3309  H HG3  . GLU A 1 7   ? -0.121  11.458  4.829   1.00 0.40  ? 7    GLU A HG3  2  
ATOM   3310  N N    . LEU A 1 8   ? -0.488  7.190   3.189   1.00 0.26  ? 8    LEU A N    2  
ATOM   3311  C CA   . LEU A 1 8   ? -0.190  5.870   2.664   1.00 0.27  ? 8    LEU A CA   2  
ATOM   3312  C C    . LEU A 1 8   ? -1.447  5.242   2.084   1.00 0.28  ? 8    LEU A C    2  
ATOM   3313  O O    . LEU A 1 8   ? -1.392  4.448   1.148   1.00 0.40  ? 8    LEU A O    2  
ATOM   3314  C CB   . LEU A 1 8   ? 0.388   5.017   3.789   1.00 0.34  ? 8    LEU A CB   2  
ATOM   3315  C CG   . LEU A 1 8   ? 1.336   5.778   4.723   1.00 0.41  ? 8    LEU A CG   2  
ATOM   3316  C CD1  . LEU A 1 8   ? 1.911   4.868   5.793   1.00 1.00  ? 8    LEU A CD1  2  
ATOM   3317  C CD2  . LEU A 1 8   ? 2.441   6.466   3.932   1.00 1.16  ? 8    LEU A CD2  2  
ATOM   3318  H H    . LEU A 1 8   ? -0.338  7.363   4.143   1.00 0.31  ? 8    LEU A H    2  
ATOM   3319  H HA   . LEU A 1 8   ? 0.547   5.976   1.882   1.00 0.30  ? 8    LEU A HA   2  
ATOM   3320  H HB2  . LEU A 1 8   ? -0.430  4.622   4.375   1.00 0.48  ? 8    LEU A HB2  2  
ATOM   3321  H HB3  . LEU A 1 8   ? 0.931   4.193   3.351   1.00 0.55  ? 8    LEU A HB3  2  
ATOM   3322  H HG   . LEU A 1 8   ? 0.771   6.549   5.228   1.00 1.15  ? 8    LEU A HG   2  
ATOM   3323  H HD11 . LEU A 1 8   ? 2.190   3.924   5.352   1.00 1.57  ? 8    LEU A HD11 2  
ATOM   3324  H HD12 . LEU A 1 8   ? 1.164   4.706   6.566   1.00 1.63  ? 8    LEU A HD12 2  
ATOM   3325  H HD13 . LEU A 1 8   ? 2.786   5.334   6.227   1.00 1.61  ? 8    LEU A HD13 2  
ATOM   3326  H HD21 . LEU A 1 8   ? 3.201   6.824   4.611   1.00 1.72  ? 8    LEU A HD21 2  
ATOM   3327  H HD22 . LEU A 1 8   ? 2.021   7.309   3.390   1.00 1.80  ? 8    LEU A HD22 2  
ATOM   3328  H HD23 . LEU A 1 8   ? 2.877   5.767   3.234   1.00 1.65  ? 8    LEU A HD23 2  
ATOM   3329  N N    . VAL A 1 9   ? -2.577  5.627   2.650   1.00 0.23  ? 9    VAL A N    2  
ATOM   3330  C CA   . VAL A 1 9   ? -3.869  5.229   2.140   1.00 0.23  ? 9    VAL A CA   2  
ATOM   3331  C C    . VAL A 1 9   ? -4.260  6.107   0.957   1.00 0.23  ? 9    VAL A C    2  
ATOM   3332  O O    . VAL A 1 9   ? -4.466  5.620   -0.152  1.00 0.24  ? 9    VAL A O    2  
ATOM   3333  C CB   . VAL A 1 9   ? -4.929  5.348   3.245   1.00 0.25  ? 9    VAL A CB   2  
ATOM   3334  C CG1  . VAL A 1 9   ? -6.328  5.158   2.692   1.00 0.26  ? 9    VAL A CG1  2  
ATOM   3335  C CG2  . VAL A 1 9   ? -4.645  4.343   4.342   1.00 0.27  ? 9    VAL A CG2  2  
ATOM   3336  H H    . VAL A 1 9   ? -2.539  6.207   3.444   1.00 0.26  ? 9    VAL A H    2  
ATOM   3337  H HA   . VAL A 1 9   ? -3.812  4.199   1.823   1.00 0.25  ? 9    VAL A HA   2  
ATOM   3338  H HB   . VAL A 1 9   ? -4.866  6.338   3.672   1.00 0.26  ? 9    VAL A HB   2  
ATOM   3339  H HG11 . VAL A 1 9   ? -6.551  5.958   1.999   1.00 1.05  ? 9    VAL A HG11 2  
ATOM   3340  H HG12 . VAL A 1 9   ? -7.040  5.174   3.502   1.00 1.03  ? 9    VAL A HG12 2  
ATOM   3341  H HG13 . VAL A 1 9   ? -6.389  4.209   2.175   1.00 0.93  ? 9    VAL A HG13 2  
ATOM   3342  H HG21 . VAL A 1 9   ? -4.625  3.348   3.925   1.00 1.00  ? 9    VAL A HG21 2  
ATOM   3343  H HG22 . VAL A 1 9   ? -5.419  4.402   5.093   1.00 1.04  ? 9    VAL A HG22 2  
ATOM   3344  H HG23 . VAL A 1 9   ? -3.687  4.565   4.794   1.00 1.07  ? 9    VAL A HG23 2  
ATOM   3345  N N    . VAL A 1 10  ? -4.345  7.405   1.216   1.00 0.23  ? 10   VAL A N    2  
ATOM   3346  C CA   . VAL A 1 10  ? -4.799  8.382   0.232   1.00 0.25  ? 10   VAL A CA   2  
ATOM   3347  C C    . VAL A 1 10  ? -4.039  8.279   -1.084  1.00 0.25  ? 10   VAL A C    2  
ATOM   3348  O O    . VAL A 1 10  ? -4.652  8.137   -2.143  1.00 0.27  ? 10   VAL A O    2  
ATOM   3349  C CB   . VAL A 1 10  ? -4.656  9.806   0.784   1.00 0.28  ? 10   VAL A CB   2  
ATOM   3350  C CG1  . VAL A 1 10  ? -5.088  10.836  -0.239  1.00 0.33  ? 10   VAL A CG1  2  
ATOM   3351  C CG2  . VAL A 1 10  ? -5.464  9.944   2.053   1.00 0.32  ? 10   VAL A CG2  2  
ATOM   3352  H H    . VAL A 1 10  ? -4.087  7.723   2.111   1.00 0.24  ? 10   VAL A H    2  
ATOM   3353  H HA   . VAL A 1 10  ? -5.847  8.200   0.044   1.00 0.27  ? 10   VAL A HA   2  
ATOM   3354  H HB   . VAL A 1 10  ? -3.617  9.979   1.024   1.00 0.28  ? 10   VAL A HB   2  
ATOM   3355  H HG11 . VAL A 1 10  ? -4.934  11.825  0.164   1.00 1.13  ? 10   VAL A HG11 2  
ATOM   3356  H HG12 . VAL A 1 10  ? -6.137  10.697  -0.464  1.00 1.03  ? 10   VAL A HG12 2  
ATOM   3357  H HG13 . VAL A 1 10  ? -4.505  10.715  -1.139  1.00 1.05  ? 10   VAL A HG13 2  
ATOM   3358  H HG21 . VAL A 1 10  ? -6.454  9.539   1.890   1.00 1.06  ? 10   VAL A HG21 2  
ATOM   3359  H HG22 . VAL A 1 10  ? -5.534  10.985  2.326   1.00 1.04  ? 10   VAL A HG22 2  
ATOM   3360  H HG23 . VAL A 1 10  ? -4.974  9.393   2.843   1.00 1.04  ? 10   VAL A HG23 2  
ATOM   3361  N N    . ASP A 1 11  ? -2.713  8.355   -1.015  1.00 0.26  ? 11   ASP A N    2  
ATOM   3362  C CA   . ASP A 1 11  ? -1.879  8.310   -2.213  1.00 0.28  ? 11   ASP A CA   2  
ATOM   3363  C C    . ASP A 1 11  ? -2.152  7.038   -3.000  1.00 0.31  ? 11   ASP A C    2  
ATOM   3364  O O    . ASP A 1 11  ? -2.167  7.045   -4.230  1.00 0.35  ? 11   ASP A O    2  
ATOM   3365  C CB   . ASP A 1 11  ? -0.396  8.380   -1.841  1.00 0.32  ? 11   ASP A CB   2  
ATOM   3366  C CG   . ASP A 1 11  ? 0.500   8.549   -3.053  1.00 0.39  ? 11   ASP A CG   2  
ATOM   3367  O OD1  . ASP A 1 11  ? 0.595   9.683   -3.571  1.00 0.59  ? 11   ASP A OD1  2  
ATOM   3368  O OD2  . ASP A 1 11  ? 1.129   7.561   -3.484  1.00 0.49  ? 11   ASP A OD2  2  
ATOM   3369  H H    . ASP A 1 11  ? -2.280  8.431   -0.133  1.00 0.26  ? 11   ASP A H    2  
ATOM   3370  H HA   . ASP A 1 11  ? -2.132  9.162   -2.826  1.00 0.31  ? 11   ASP A HA   2  
ATOM   3371  H HB2  . ASP A 1 11  ? -0.237  9.219   -1.180  1.00 0.36  ? 11   ASP A HB2  2  
ATOM   3372  H HB3  . ASP A 1 11  ? -0.115  7.470   -1.333  1.00 0.36  ? 11   ASP A HB3  2  
ATOM   3373  N N    . PHE A 1 12  ? -2.410  5.954   -2.277  1.00 0.32  ? 12   PHE A N    2  
ATOM   3374  C CA   . PHE A 1 12  ? -2.663  4.672   -2.904  1.00 0.38  ? 12   PHE A CA   2  
ATOM   3375  C C    . PHE A 1 12  ? -4.036  4.666   -3.572  1.00 0.34  ? 12   PHE A C    2  
ATOM   3376  O O    . PHE A 1 12  ? -4.157  4.266   -4.731  1.00 0.39  ? 12   PHE A O    2  
ATOM   3377  C CB   . PHE A 1 12  ? -2.557  3.535   -1.886  1.00 0.46  ? 12   PHE A CB   2  
ATOM   3378  C CG   . PHE A 1 12  ? -2.254  2.202   -2.515  1.00 0.76  ? 12   PHE A CG   2  
ATOM   3379  C CD1  . PHE A 1 12  ? -3.257  1.451   -3.108  1.00 0.98  ? 12   PHE A CD1  2  
ATOM   3380  C CD2  . PHE A 1 12  ? -0.960  1.706   -2.517  1.00 1.24  ? 12   PHE A CD2  2  
ATOM   3381  C CE1  . PHE A 1 12  ? -2.973  0.230   -3.691  1.00 1.38  ? 12   PHE A CE1  2  
ATOM   3382  C CE2  . PHE A 1 12  ? -0.671  0.485   -3.097  1.00 1.61  ? 12   PHE A CE2  2  
ATOM   3383  C CZ   . PHE A 1 12  ? -1.679  -0.252  -3.685  1.00 1.61  ? 12   PHE A CZ   2  
ATOM   3384  H H    . PHE A 1 12  ? -2.431  6.024   -1.300  1.00 0.31  ? 12   PHE A H    2  
ATOM   3385  H HA   . PHE A 1 12  ? -1.911  4.530   -3.666  1.00 0.45  ? 12   PHE A HA   2  
ATOM   3386  H HB2  . PHE A 1 12  ? -1.768  3.759   -1.185  1.00 0.57  ? 12   PHE A HB2  2  
ATOM   3387  H HB3  . PHE A 1 12  ? -3.493  3.448   -1.353  1.00 0.57  ? 12   PHE A HB3  2  
ATOM   3388  H HD1  . PHE A 1 12  ? -4.269  1.827   -3.115  1.00 1.09  ? 12   PHE A HD1  2  
ATOM   3389  H HD2  . PHE A 1 12  ? -0.170  2.282   -2.058  1.00 1.46  ? 12   PHE A HD2  2  
ATOM   3390  H HE1  . PHE A 1 12  ? -3.763  -0.346  -4.150  1.00 1.67  ? 12   PHE A HE1  2  
ATOM   3391  H HE2  . PHE A 1 12  ? 0.341   0.109   -3.091  1.00 2.02  ? 12   PHE A HE2  2  
ATOM   3392  H HZ   . PHE A 1 12  ? -1.456  -1.207  -4.139  1.00 1.95  ? 12   PHE A HZ   2  
ATOM   3393  N N    . LEU A 1 13  ? -5.073  5.118   -2.857  1.00 0.28  ? 13   LEU A N    2  
ATOM   3394  C CA   . LEU A 1 13  ? -6.410  5.186   -3.440  1.00 0.28  ? 13   LEU A CA   2  
ATOM   3395  C C    . LEU A 1 13  ? -6.424  6.131   -4.635  1.00 0.30  ? 13   LEU A C    2  
ATOM   3396  O O    . LEU A 1 13  ? -7.014  5.823   -5.670  1.00 0.34  ? 13   LEU A O    2  
ATOM   3397  C CB   . LEU A 1 13  ? -7.464  5.622   -2.410  1.00 0.25  ? 13   LEU A CB   2  
ATOM   3398  C CG   . LEU A 1 13  ? -8.036  4.494   -1.546  1.00 0.26  ? 13   LEU A CG   2  
ATOM   3399  C CD1  . LEU A 1 13  ? -7.144  4.190   -0.369  1.00 0.26  ? 13   LEU A CD1  2  
ATOM   3400  C CD2  . LEU A 1 13  ? -9.440  4.830   -1.072  1.00 0.27  ? 13   LEU A CD2  2  
ATOM   3401  H H    . LEU A 1 13  ? -4.935  5.416   -1.923  1.00 0.26  ? 13   LEU A H    2  
ATOM   3402  H HA   . LEU A 1 13  ? -6.660  4.194   -3.789  1.00 0.31  ? 13   LEU A HA   2  
ATOM   3403  H HB2  . LEU A 1 13  ? -7.015  6.356   -1.757  1.00 0.23  ? 13   LEU A HB2  2  
ATOM   3404  H HB3  . LEU A 1 13  ? -8.281  6.088   -2.938  1.00 0.27  ? 13   LEU A HB3  2  
ATOM   3405  H HG   . LEU A 1 13  ? -8.092  3.601   -2.139  1.00 0.29  ? 13   LEU A HG   2  
ATOM   3406  H HD11 . LEU A 1 13  ? -7.546  3.346   0.174   1.00 0.91  ? 13   LEU A HD11 2  
ATOM   3407  H HD12 . LEU A 1 13  ? -7.107  5.052   0.281   1.00 0.87  ? 13   LEU A HD12 2  
ATOM   3408  H HD13 . LEU A 1 13  ? -6.151  3.956   -0.721  1.00 0.89  ? 13   LEU A HD13 2  
ATOM   3409  H HD21 . LEU A 1 13  ? -9.407  5.697   -0.430  1.00 1.06  ? 13   LEU A HD21 2  
ATOM   3410  H HD22 . LEU A 1 13  ? -9.846  3.989   -0.527  1.00 1.03  ? 13   LEU A HD22 2  
ATOM   3411  H HD23 . LEU A 1 13  ? -10.065 5.039   -1.927  1.00 1.05  ? 13   LEU A HD23 2  
ATOM   3412  N N    . SER A 1 14  ? -5.750  7.265   -4.491  1.00 0.29  ? 14   SER A N    2  
ATOM   3413  C CA   . SER A 1 14  ? -5.640  8.240   -5.570  1.00 0.33  ? 14   SER A CA   2  
ATOM   3414  C C    . SER A 1 14  ? -4.988  7.600   -6.792  1.00 0.37  ? 14   SER A C    2  
ATOM   3415  O O    . SER A 1 14  ? -5.466  7.750   -7.919  1.00 0.42  ? 14   SER A O    2  
ATOM   3416  C CB   . SER A 1 14  ? -4.820  9.450   -5.105  1.00 0.33  ? 14   SER A CB   2  
ATOM   3417  O OG   . SER A 1 14  ? -4.772  10.457  -6.103  1.00 1.05  ? 14   SER A OG   2  
ATOM   3418  H H    . SER A 1 14  ? -5.313  7.455   -3.628  1.00 0.27  ? 14   SER A H    2  
ATOM   3419  H HA   . SER A 1 14  ? -6.636  8.565   -5.831  1.00 0.36  ? 14   SER A HA   2  
ATOM   3420  H HB2  . SER A 1 14  ? -5.270  9.866   -4.216  1.00 0.91  ? 14   SER A HB2  2  
ATOM   3421  H HB3  . SER A 1 14  ? -3.811  9.134   -4.882  1.00 0.81  ? 14   SER A HB3  2  
ATOM   3422  H HG   . SER A 1 14  ? -3.875  10.813  -6.157  1.00 1.60  ? 14   SER A HG   2  
ATOM   3423  N N    . TYR A 1 15  ? -3.909  6.866   -6.545  1.00 0.37  ? 15   TYR A N    2  
ATOM   3424  C CA   . TYR A 1 15  ? -3.179  6.165   -7.593  1.00 0.45  ? 15   TYR A CA   2  
ATOM   3425  C C    . TYR A 1 15  ? -4.085  5.166   -8.316  1.00 0.43  ? 15   TYR A C    2  
ATOM   3426  O O    . TYR A 1 15  ? -3.950  4.949   -9.520  1.00 0.55  ? 15   TYR A O    2  
ATOM   3427  C CB   . TYR A 1 15  ? -1.969  5.450   -6.973  1.00 0.52  ? 15   TYR A CB   2  
ATOM   3428  C CG   . TYR A 1 15  ? -1.070  4.737   -7.961  1.00 0.67  ? 15   TYR A CG   2  
ATOM   3429  C CD1  . TYR A 1 15  ? -0.634  5.378   -9.115  1.00 0.72  ? 15   TYR A CD1  2  
ATOM   3430  C CD2  . TYR A 1 15  ? -0.677  3.423   -7.755  1.00 0.89  ? 15   TYR A CD2  2  
ATOM   3431  C CE1  . TYR A 1 15  ? 0.173   4.732   -10.031 1.00 0.89  ? 15   TYR A CE1  2  
ATOM   3432  C CE2  . TYR A 1 15  ? 0.128   2.768   -8.667  1.00 1.06  ? 15   TYR A CE2  2  
ATOM   3433  C CZ   . TYR A 1 15  ? 0.610   3.430   -9.751  1.00 1.03  ? 15   TYR A CZ   2  
ATOM   3434  O OH   . TYR A 1 15  ? 1.349   2.773   -10.714 1.00 1.22  ? 15   TYR A OH   2  
ATOM   3435  H H    . TYR A 1 15  ? -3.583  6.799   -5.619  1.00 0.36  ? 15   TYR A H    2  
ATOM   3436  H HA   . TYR A 1 15  ? -2.828  6.899   -8.304  1.00 0.50  ? 15   TYR A HA   2  
ATOM   3437  H HB2  . TYR A 1 15  ? -1.365  6.177   -6.451  1.00 0.53  ? 15   TYR A HB2  2  
ATOM   3438  H HB3  . TYR A 1 15  ? -2.326  4.717   -6.263  1.00 0.52  ? 15   TYR A HB3  2  
ATOM   3439  H HD1  . TYR A 1 15  ? -0.932  6.403   -9.291  1.00 0.72  ? 15   TYR A HD1  2  
ATOM   3440  H HD2  . TYR A 1 15  ? -1.007  2.909   -6.864  1.00 0.98  ? 15   TYR A HD2  2  
ATOM   3441  H HE1  . TYR A 1 15  ? 0.504   5.248   -10.920 1.00 0.98  ? 15   TYR A HE1  2  
ATOM   3442  H HE2  . TYR A 1 15  ? 0.424   1.744   -8.489  1.00 1.26  ? 15   TYR A HE2  2  
ATOM   3443  H HH   . TYR A 1 15  ? 1.098   1.836   -10.741 1.00 1.49  ? 15   TYR A HH   2  
ATOM   3444  N N    . LYS A 1 16  ? -5.017  4.573   -7.578  1.00 0.33  ? 16   LYS A N    2  
ATOM   3445  C CA   . LYS A 1 16  ? -5.934  3.598   -8.148  1.00 0.33  ? 16   LYS A CA   2  
ATOM   3446  C C    . LYS A 1 16  ? -7.024  4.261   -8.981  1.00 0.33  ? 16   LYS A C    2  
ATOM   3447  O O    . LYS A 1 16  ? -7.497  3.679   -9.950  1.00 0.42  ? 16   LYS A O    2  
ATOM   3448  C CB   . LYS A 1 16  ? -6.550  2.733   -7.048  1.00 0.34  ? 16   LYS A CB   2  
ATOM   3449  C CG   . LYS A 1 16  ? -5.533  1.975   -6.197  1.00 0.61  ? 16   LYS A CG   2  
ATOM   3450  C CD   . LYS A 1 16  ? -4.828  0.853   -6.958  1.00 0.57  ? 16   LYS A CD   2  
ATOM   3451  C CE   . LYS A 1 16  ? -3.747  1.364   -7.902  1.00 1.18  ? 16   LYS A CE   2  
ATOM   3452  N NZ   . LYS A 1 16  ? -2.817  0.290   -8.331  1.00 1.41  ? 16   LYS A NZ   2  
ATOM   3453  H H    . LYS A 1 16  ? -5.080  4.785   -6.622  1.00 0.32  ? 16   LYS A H    2  
ATOM   3454  H HA   . LYS A 1 16  ? -5.364  2.966   -8.799  1.00 0.38  ? 16   LYS A HA   2  
ATOM   3455  H HB2  . LYS A 1 16  ? -7.128  3.368   -6.392  1.00 0.62  ? 16   LYS A HB2  2  
ATOM   3456  H HB3  . LYS A 1 16  ? -7.210  2.011   -7.506  1.00 0.63  ? 16   LYS A HB3  2  
ATOM   3457  H HG2  . LYS A 1 16  ? -4.788  2.672   -5.849  1.00 0.97  ? 16   LYS A HG2  2  
ATOM   3458  H HG3  . LYS A 1 16  ? -6.046  1.549   -5.347  1.00 0.99  ? 16   LYS A HG3  2  
ATOM   3459  H HD2  . LYS A 1 16  ? -4.374  0.183   -6.247  1.00 0.75  ? 16   LYS A HD2  2  
ATOM   3460  H HD3  . LYS A 1 16  ? -5.565  0.318   -7.533  1.00 0.97  ? 16   LYS A HD3  2  
ATOM   3461  H HE2  . LYS A 1 16  ? -4.218  1.766   -8.780  1.00 1.56  ? 16   LYS A HE2  2  
ATOM   3462  H HE3  . LYS A 1 16  ? -3.187  2.143   -7.406  1.00 1.44  ? 16   LYS A HE3  2  
ATOM   3463  H HZ1  . LYS A 1 16  ? -2.165  0.042   -7.556  1.00 1.70  ? 16   LYS A HZ1  2  
ATOM   3464  H HZ2  . LYS A 1 16  ? -2.259  0.602   -9.153  1.00 1.51  ? 16   LYS A HZ2  2  
ATOM   3465  H HZ3  . LYS A 1 16  ? -3.354  -0.567  -8.603  1.00 1.84  ? 16   LYS A HZ3  2  
ATOM   3466  N N    . LEU A 1 17  ? -7.422  5.474   -8.626  1.00 0.33  ? 17   LEU A N    2  
ATOM   3467  C CA   . LEU A 1 17  ? -8.410  6.191   -9.432  1.00 0.32  ? 17   LEU A CA   2  
ATOM   3468  C C    . LEU A 1 17  ? -7.798  6.616   -10.763 1.00 0.35  ? 17   LEU A C    2  
ATOM   3469  O O    . LEU A 1 17  ? -8.499  6.745   -11.770 1.00 0.36  ? 17   LEU A O    2  
ATOM   3470  C CB   . LEU A 1 17  ? -8.972  7.423   -8.705  1.00 0.35  ? 17   LEU A CB   2  
ATOM   3471  C CG   . LEU A 1 17  ? -10.089 7.162   -7.685  1.00 0.53  ? 17   LEU A CG   2  
ATOM   3472  C CD1  . LEU A 1 17  ? -10.648 5.755   -7.813  1.00 1.35  ? 17   LEU A CD1  2  
ATOM   3473  C CD2  . LEU A 1 17  ? -9.593  7.423   -6.278  1.00 1.15  ? 17   LEU A CD2  2  
ATOM   3474  H H    . LEU A 1 17  ? -7.048  5.891   -7.819  1.00 0.38  ? 17   LEU A H    2  
ATOM   3475  H HA   . LEU A 1 17  ? -9.225  5.507   -9.633  1.00 0.31  ? 17   LEU A HA   2  
ATOM   3476  H HB2  . LEU A 1 17  ? -8.158  7.907   -8.190  1.00 0.33  ? 17   LEU A HB2  2  
ATOM   3477  H HB3  . LEU A 1 17  ? -9.354  8.105   -9.447  1.00 0.43  ? 17   LEU A HB3  2  
ATOM   3478  H HG   . LEU A 1 17  ? -10.901 7.846   -7.879  1.00 1.53  ? 17   LEU A HG   2  
ATOM   3479  H HD11 . LEU A 1 17  ? -11.436 5.613   -7.086  1.00 1.98  ? 17   LEU A HD11 2  
ATOM   3480  H HD12 . LEU A 1 17  ? -9.860  5.037   -7.636  1.00 1.90  ? 17   LEU A HD12 2  
ATOM   3481  H HD13 . LEU A 1 17  ? -11.047 5.614   -8.807  1.00 1.88  ? 17   LEU A HD13 2  
ATOM   3482  H HD21 . LEU A 1 17  ? -9.254  8.445   -6.202  1.00 1.75  ? 17   LEU A HD21 2  
ATOM   3483  H HD22 . LEU A 1 17  ? -8.773  6.754   -6.056  1.00 1.77  ? 17   LEU A HD22 2  
ATOM   3484  H HD23 . LEU A 1 17  ? -10.398 7.255   -5.576  1.00 1.74  ? 17   LEU A HD23 2  
ATOM   3485  N N    . SER A 1 18  ? -6.485  6.815   -10.760 1.00 0.41  ? 18   SER A N    2  
ATOM   3486  C CA   . SER A 1 18  ? -5.757  7.249   -11.931 1.00 0.48  ? 18   SER A CA   2  
ATOM   3487  C C    . SER A 1 18  ? -5.913  6.280   -13.104 1.00 0.51  ? 18   SER A C    2  
ATOM   3488  O O    . SER A 1 18  ? -6.148  6.704   -14.235 1.00 0.58  ? 18   SER A O    2  
ATOM   3489  C CB   . SER A 1 18  ? -4.294  7.395   -11.549 1.00 0.57  ? 18   SER A CB   2  
ATOM   3490  O OG   . SER A 1 18  ? -4.155  8.197   -10.391 1.00 0.94  ? 18   SER A OG   2  
ATOM   3491  H H    . SER A 1 18  ? -5.982  6.686   -9.930  1.00 0.41  ? 18   SER A H    2  
ATOM   3492  H HA   . SER A 1 18  ? -6.138  8.215   -12.222 1.00 0.51  ? 18   SER A HA   2  
ATOM   3493  H HB2  . SER A 1 18  ? -3.873  6.420   -11.352 1.00 0.86  ? 18   SER A HB2  2  
ATOM   3494  H HB3  . SER A 1 18  ? -3.766  7.856   -12.353 1.00 0.69  ? 18   SER A HB3  2  
ATOM   3495  H HG   . SER A 1 18  ? -4.886  8.832   -10.354 1.00 1.38  ? 18   SER A HG   2  
ATOM   3496  N N    . GLN A 1 19  ? -5.824  4.979   -12.826 1.00 0.52  ? 19   GLN A N    2  
ATOM   3497  C CA   . GLN A 1 19  ? -5.907  3.958   -13.874 1.00 0.57  ? 19   GLN A CA   2  
ATOM   3498  C C    . GLN A 1 19  ? -7.328  3.817   -14.407 1.00 0.51  ? 19   GLN A C    2  
ATOM   3499  O O    . GLN A 1 19  ? -7.592  3.042   -15.329 1.00 0.59  ? 19   GLN A O    2  
ATOM   3500  C CB   . GLN A 1 19  ? -5.410  2.613   -13.351 1.00 0.68  ? 19   GLN A CB   2  
ATOM   3501  C CG   . GLN A 1 19  ? -6.042  2.219   -12.037 1.00 0.84  ? 19   GLN A CG   2  
ATOM   3502  C CD   . GLN A 1 19  ? -5.609  0.854   -11.552 1.00 0.97  ? 19   GLN A CD   2  
ATOM   3503  O OE1  . GLN A 1 19  ? -4.606  0.719   -10.856 1.00 1.37  ? 19   GLN A OE1  2  
ATOM   3504  N NE2  . GLN A 1 19  ? -6.375  -0.164  -11.899 1.00 1.19  ? 19   GLN A NE2  2  
ATOM   3505  H H    . GLN A 1 19  ? -5.700  4.697   -11.895 1.00 0.53  ? 19   GLN A H    2  
ATOM   3506  H HA   . GLN A 1 19  ? -5.275  4.268   -14.676 1.00 0.66  ? 19   GLN A HA   2  
ATOM   3507  H HB2  . GLN A 1 19  ? -5.636  1.849   -14.079 1.00 0.89  ? 19   GLN A HB2  2  
ATOM   3508  H HB3  . GLN A 1 19  ? -4.340  2.663   -13.212 1.00 0.96  ? 19   GLN A HB3  2  
ATOM   3509  H HG2  . GLN A 1 19  ? -5.765  2.954   -11.299 1.00 1.09  ? 19   GLN A HG2  2  
ATOM   3510  H HG3  . GLN A 1 19  ? -7.115  2.221   -12.157 1.00 1.03  ? 19   GLN A HG3  2  
ATOM   3511  H HE21 . GLN A 1 19  ? -7.173  0.017   -12.449 1.00 1.51  ? 19   GLN A HE21 2  
ATOM   3512  H HE22 . GLN A 1 19  ? -6.121  -1.062  -11.591 1.00 1.29  ? 19   GLN A HE22 2  
ATOM   3513  N N    . LYS A 1 20  ? -8.236  4.569   -13.820 1.00 0.45  ? 20   LYS A N    2  
ATOM   3514  C CA   . LYS A 1 20  ? -9.635  4.533   -14.206 1.00 0.49  ? 20   LYS A CA   2  
ATOM   3515  C C    . LYS A 1 20  ? -9.986  5.825   -14.905 1.00 0.48  ? 20   LYS A C    2  
ATOM   3516  O O    . LYS A 1 20  ? -10.906 5.896   -15.717 1.00 0.53  ? 20   LYS A O    2  
ATOM   3517  C CB   . LYS A 1 20  ? -10.505 4.360   -12.966 1.00 0.57  ? 20   LYS A CB   2  
ATOM   3518  C CG   . LYS A 1 20  ? -9.873  3.477   -11.919 1.00 0.49  ? 20   LYS A CG   2  
ATOM   3519  C CD   . LYS A 1 20  ? -9.683  2.060   -12.422 1.00 1.20  ? 20   LYS A CD   2  
ATOM   3520  C CE   . LYS A 1 20  ? -10.990 1.485   -12.947 1.00 1.75  ? 20   LYS A CE   2  
ATOM   3521  N NZ   . LYS A 1 20  ? -10.839 0.078   -13.404 1.00 2.20  ? 20   LYS A NZ   2  
ATOM   3522  H H    . LYS A 1 20  ? -7.954  5.177   -13.107 1.00 0.45  ? 20   LYS A H    2  
ATOM   3523  H HA   . LYS A 1 20  ? -9.789  3.704   -14.877 1.00 0.54  ? 20   LYS A HA   2  
ATOM   3524  H HB2  . LYS A 1 20  ? -10.693 5.324   -12.522 1.00 0.67  ? 20   LYS A HB2  2  
ATOM   3525  H HB3  . LYS A 1 20  ? -11.444 3.918   -13.257 1.00 0.70  ? 20   LYS A HB3  2  
ATOM   3526  H HG2  . LYS A 1 20  ? -8.908  3.885   -11.660 1.00 1.16  ? 20   LYS A HG2  2  
ATOM   3527  H HG3  . LYS A 1 20  ? -10.500 3.466   -11.052 1.00 1.06  ? 20   LYS A HG3  2  
ATOM   3528  H HD2  . LYS A 1 20  ? -8.948  2.068   -13.218 1.00 1.65  ? 20   LYS A HD2  2  
ATOM   3529  H HD3  . LYS A 1 20  ? -9.329  1.448   -11.602 1.00 1.68  ? 20   LYS A HD3  2  
ATOM   3530  H HE2  . LYS A 1 20  ? -11.726 1.524   -12.153 1.00 2.01  ? 20   LYS A HE2  2  
ATOM   3531  H HE3  . LYS A 1 20  ? -11.326 2.093   -13.775 1.00 1.68  ? 20   LYS A HE3  2  
ATOM   3532  H HZ1  . LYS A 1 20  ? -11.739 -0.272  -13.796 1.00 2.49  ? 20   LYS A HZ1  2  
ATOM   3533  H HZ2  . LYS A 1 20  ? -10.566 -0.531  -12.601 1.00 2.36  ? 20   LYS A HZ2  2  
ATOM   3534  H HZ3  . LYS A 1 20  ? -10.103 0.015   -14.137 1.00 2.65  ? 20   LYS A HZ3  2  
ATOM   3535  N N    . GLY A 1 21  ? -9.230  6.843   -14.552 1.00 0.45  ? 21   GLY A N    2  
ATOM   3536  C CA   . GLY A 1 21  ? -9.401  8.149   -15.141 1.00 0.49  ? 21   GLY A CA   2  
ATOM   3537  C C    . GLY A 1 21  ? -10.166 9.065   -14.221 1.00 0.47  ? 21   GLY A C    2  
ATOM   3538  O O    . GLY A 1 21  ? -10.764 10.048  -14.652 1.00 0.53  ? 21   GLY A O    2  
ATOM   3539  H H    . GLY A 1 21  ? -8.554  6.705   -13.856 1.00 0.44  ? 21   GLY A H    2  
ATOM   3540  H HA2  . GLY A 1 21  ? -8.428  8.571   -15.333 1.00 0.52  ? 21   GLY A HA2  2  
ATOM   3541  H HA3  . GLY A 1 21  ? -9.939  8.053   -16.073 1.00 0.54  ? 21   GLY A HA3  2  
ATOM   3542  N N    . TYR A 1 22  ? -10.145 8.731   -12.942 1.00 0.40  ? 22   TYR A N    2  
ATOM   3543  C CA   . TYR A 1 22  ? -10.851 9.503   -11.941 1.00 0.37  ? 22   TYR A CA   2  
ATOM   3544  C C    . TYR A 1 22  ? -9.880  10.159  -10.984 1.00 0.36  ? 22   TYR A C    2  
ATOM   3545  O O    . TYR A 1 22  ? -8.700  9.813   -10.944 1.00 0.38  ? 22   TYR A O    2  
ATOM   3546  C CB   . TYR A 1 22  ? -11.816 8.617   -11.160 1.00 0.34  ? 22   TYR A CB   2  
ATOM   3547  C CG   . TYR A 1 22  ? -12.947 8.076   -12.004 1.00 0.38  ? 22   TYR A CG   2  
ATOM   3548  C CD1  . TYR A 1 22  ? -12.800 6.895   -12.720 1.00 0.50  ? 22   TYR A CD1  2  
ATOM   3549  C CD2  . TYR A 1 22  ? -14.158 8.748   -12.091 1.00 0.50  ? 22   TYR A CD2  2  
ATOM   3550  C CE1  . TYR A 1 22  ? -13.827 6.399   -13.497 1.00 0.60  ? 22   TYR A CE1  2  
ATOM   3551  C CE2  . TYR A 1 22  ? -15.190 8.258   -12.866 1.00 0.62  ? 22   TYR A CE2  2  
ATOM   3552  C CZ   . TYR A 1 22  ? -15.020 7.084   -13.566 1.00 0.62  ? 22   TYR A CZ   2  
ATOM   3553  O OH   . TYR A 1 22  ? -16.048 6.593   -14.336 1.00 0.76  ? 22   TYR A OH   2  
ATOM   3554  H H    . TYR A 1 22  ? -9.631  7.942   -12.662 1.00 0.40  ? 22   TYR A H    2  
ATOM   3555  H HA   . TYR A 1 22  ? -11.414 10.271  -12.449 1.00 0.42  ? 22   TYR A HA   2  
ATOM   3556  H HB2  . TYR A 1 22  ? -11.275 7.772   -10.743 1.00 0.37  ? 22   TYR A HB2  2  
ATOM   3557  H HB3  . TYR A 1 22  ? -12.243 9.202   -10.354 1.00 0.32  ? 22   TYR A HB3  2  
ATOM   3558  H HD1  . TYR A 1 22  ? -11.862 6.361   -12.664 1.00 0.61  ? 22   TYR A HD1  2  
ATOM   3559  H HD2  . TYR A 1 22  ? -14.288 9.667   -11.540 1.00 0.60  ? 22   TYR A HD2  2  
ATOM   3560  H HE1  . TYR A 1 22  ? -13.693 5.480   -14.046 1.00 0.74  ? 22   TYR A HE1  2  
ATOM   3561  H HE2  . TYR A 1 22  ? -16.126 8.795   -12.920 1.00 0.78  ? 22   TYR A HE2  2  
ATOM   3562  H HH   . TYR A 1 22  ? -16.129 5.639   -14.186 1.00 1.12  ? 22   TYR A HH   2  
ATOM   3563  N N    . SER A 1 23  ? -10.380 11.111  -10.225 1.00 0.37  ? 23   SER A N    2  
ATOM   3564  C CA   . SER A 1 23  ? -9.574  11.791  -9.239  1.00 0.39  ? 23   SER A CA   2  
ATOM   3565  C C    . SER A 1 23  ? -10.034 11.411  -7.845  1.00 0.35  ? 23   SER A C    2  
ATOM   3566  O O    . SER A 1 23  ? -11.231 11.278  -7.595  1.00 0.34  ? 23   SER A O    2  
ATOM   3567  C CB   . SER A 1 23  ? -9.704  13.292  -9.414  1.00 0.45  ? 23   SER A CB   2  
ATOM   3568  O OG   . SER A 1 23  ? -8.607  13.983  -8.845  1.00 0.52  ? 23   SER A OG   2  
ATOM   3569  H H    . SER A 1 23  ? -11.320 11.364  -10.327 1.00 0.39  ? 23   SER A H    2  
ATOM   3570  H HA   . SER A 1 23  ? -8.544  11.498  -9.373  1.00 0.43  ? 23   SER A HA   2  
ATOM   3571  H HB2  . SER A 1 23  ? -9.766  13.524  -10.463 1.00 0.48  ? 23   SER A HB2  2  
ATOM   3572  H HB3  . SER A 1 23  ? -10.605 13.616  -8.922  1.00 0.45  ? 23   SER A HB3  2  
ATOM   3573  H HG   . SER A 1 23  ? -8.701  14.934  -9.022  1.00 0.75  ? 23   SER A HG   2  
ATOM   3574  N N    . TRP A 1 24  ? -9.086  11.246  -6.947  1.00 0.37  ? 24   TRP A N    2  
ATOM   3575  C CA   . TRP A 1 24  ? -9.399  11.007  -5.551  1.00 0.36  ? 24   TRP A CA   2  
ATOM   3576  C C    . TRP A 1 24  ? -10.073 12.233  -4.951  1.00 0.35  ? 24   TRP A C    2  
ATOM   3577  O O    . TRP A 1 24  ? -11.100 12.128  -4.284  1.00 0.34  ? 24   TRP A O    2  
ATOM   3578  C CB   . TRP A 1 24  ? -8.127  10.662  -4.764  1.00 0.45  ? 24   TRP A CB   2  
ATOM   3579  C CG   . TRP A 1 24  ? -8.152  11.160  -3.348  1.00 0.43  ? 24   TRP A CG   2  
ATOM   3580  C CD1  . TRP A 1 24  ? -8.817  10.612  -2.290  1.00 0.96  ? 24   TRP A CD1  2  
ATOM   3581  C CD2  . TRP A 1 24  ? -7.492  12.329  -2.847  1.00 1.27  ? 24   TRP A CD2  2  
ATOM   3582  N NE1  . TRP A 1 24  ? -8.623  11.379  -1.167  1.00 0.61  ? 24   TRP A NE1  2  
ATOM   3583  C CE2  . TRP A 1 24  ? -7.808  12.434  -1.482  1.00 1.10  ? 24   TRP A CE2  2  
ATOM   3584  C CE3  . TRP A 1 24  ? -6.663  13.298  -3.423  1.00 2.43  ? 24   TRP A CE3  2  
ATOM   3585  C CZ2  . TRP A 1 24  ? -7.329  13.467  -0.685  1.00 2.00  ? 24   TRP A CZ2  2  
ATOM   3586  C CZ3  . TRP A 1 24  ? -6.187  14.323  -2.629  1.00 3.36  ? 24   TRP A CZ3  2  
ATOM   3587  C CH2  . TRP A 1 24  ? -6.521  14.401  -1.273  1.00 3.13  ? 24   TRP A CH2  2  
ATOM   3588  H H    . TRP A 1 24  ? -8.146  11.293  -7.232  1.00 0.43  ? 24   TRP A H    2  
ATOM   3589  H HA   . TRP A 1 24  ? -10.083 10.172  -5.502  1.00 0.34  ? 24   TRP A HA   2  
ATOM   3590  H HB2  . TRP A 1 24  ? -8.008  9.588   -4.735  1.00 0.57  ? 24   TRP A HB2  2  
ATOM   3591  H HB3  . TRP A 1 24  ? -7.273  11.100  -5.259  1.00 0.57  ? 24   TRP A HB3  2  
ATOM   3592  H HD1  . TRP A 1 24  ? -9.415  9.714   -2.346  1.00 1.86  ? 24   TRP A HD1  2  
ATOM   3593  H HE1  . TRP A 1 24  ? -9.001  11.198  -0.285  1.00 0.92  ? 24   TRP A HE1  2  
ATOM   3594  H HE3  . TRP A 1 24  ? -6.396  13.253  -4.468  1.00 2.64  ? 24   TRP A HE3  2  
ATOM   3595  H HZ2  . TRP A 1 24  ? -7.576  13.541  0.363   1.00 1.86  ? 24   TRP A HZ2  2  
ATOM   3596  H HZ3  . TRP A 1 24  ? -5.547  15.080  -3.056  1.00 4.29  ? 24   TRP A HZ3  2  
ATOM   3597  H HH2  . TRP A 1 24  ? -6.127  15.219  -0.689  1.00 3.88  ? 24   TRP A HH2  2  
ATOM   3598  N N    . SER A 1 25  ? -9.502  13.397  -5.227  1.00 0.39  ? 25   SER A N    2  
ATOM   3599  C CA   . SER A 1 25  ? -9.924  14.634  -4.594  1.00 0.44  ? 25   SER A CA   2  
ATOM   3600  C C    . SER A 1 25  ? -11.355 15.007  -4.974  1.00 0.43  ? 25   SER A C    2  
ATOM   3601  O O    . SER A 1 25  ? -12.106 15.519  -4.139  1.00 0.49  ? 25   SER A O    2  
ATOM   3602  C CB   . SER A 1 25  ? -8.959  15.752  -4.976  1.00 0.53  ? 25   SER A CB   2  
ATOM   3603  O OG   . SER A 1 25  ? -8.696  15.736  -6.369  1.00 1.37  ? 25   SER A OG   2  
ATOM   3604  H H    . SER A 1 25  ? -8.773  13.427  -5.881  1.00 0.42  ? 25   SER A H    2  
ATOM   3605  H HA   . SER A 1 25  ? -9.876  14.483  -3.523  1.00 0.46  ? 25   SER A HA   2  
ATOM   3606  H HB2  . SER A 1 25  ? -9.391  16.706  -4.713  1.00 1.05  ? 25   SER A HB2  2  
ATOM   3607  H HB3  . SER A 1 25  ? -8.028  15.619  -4.443  1.00 1.16  ? 25   SER A HB3  2  
ATOM   3608  H HG   . SER A 1 25  ? -8.014  16.391  -6.573  1.00 1.86  ? 25   SER A HG   2  
ATOM   3609  N N    . GLN A 1 26  ? -11.733 14.736  -6.223  1.00 0.40  ? 26   GLN A N    2  
ATOM   3610  C CA   . GLN A 1 26  ? -13.085 15.026  -6.693  1.00 0.42  ? 26   GLN A CA   2  
ATOM   3611  C C    . GLN A 1 26  ? -14.126 14.278  -5.873  1.00 0.38  ? 26   GLN A C    2  
ATOM   3612  O O    . GLN A 1 26  ? -15.248 14.749  -5.689  1.00 0.41  ? 26   GLN A O    2  
ATOM   3613  C CB   . GLN A 1 26  ? -13.249 14.646  -8.162  1.00 0.47  ? 26   GLN A CB   2  
ATOM   3614  C CG   . GLN A 1 26  ? -12.505 15.554  -9.116  1.00 0.59  ? 26   GLN A CG   2  
ATOM   3615  C CD   . GLN A 1 26  ? -12.755 15.191  -10.559 1.00 0.73  ? 26   GLN A CD   2  
ATOM   3616  O OE1  . GLN A 1 26  ? -12.050 14.373  -11.148 1.00 1.11  ? 26   GLN A OE1  2  
ATOM   3617  N NE2  . GLN A 1 26  ? -13.761 15.809  -11.134 1.00 1.10  ? 26   GLN A NE2  2  
ATOM   3618  H H    . GLN A 1 26  ? -11.083 14.338  -6.845  1.00 0.39  ? 26   GLN A H    2  
ATOM   3619  H HA   . GLN A 1 26  ? -13.249 16.086  -6.589  1.00 0.50  ? 26   GLN A HA   2  
ATOM   3620  H HB2  . GLN A 1 26  ? -12.885 13.641  -8.304  1.00 0.43  ? 26   GLN A HB2  2  
ATOM   3621  H HB3  . GLN A 1 26  ? -14.298 14.678  -8.415  1.00 0.53  ? 26   GLN A HB3  2  
ATOM   3622  H HG2  . GLN A 1 26  ? -12.830 16.569  -8.953  1.00 0.70  ? 26   GLN A HG2  2  
ATOM   3623  H HG3  . GLN A 1 26  ? -11.455 15.480  -8.919  1.00 0.53  ? 26   GLN A HG3  2  
ATOM   3624  H HE21 . GLN A 1 26  ? -14.264 16.454  -10.597 1.00 1.52  ? 26   GLN A HE21 2  
ATOM   3625  H HE22 . GLN A 1 26  ? -13.974 15.588  -12.069 1.00 1.17  ? 26   GLN A HE22 2  
ATOM   3626  N N    . PHE A 1 27  ? -13.746 13.110  -5.385  1.00 0.35  ? 27   PHE A N    2  
ATOM   3627  C CA   . PHE A 1 27  ? -14.666 12.245  -4.675  1.00 0.38  ? 27   PHE A CA   2  
ATOM   3628  C C    . PHE A 1 27  ? -14.275 12.143  -3.209  1.00 0.43  ? 27   PHE A C    2  
ATOM   3629  O O    . PHE A 1 27  ? -14.774 11.284  -2.479  1.00 0.67  ? 27   PHE A O    2  
ATOM   3630  C CB   . PHE A 1 27  ? -14.662 10.861  -5.321  1.00 0.43  ? 27   PHE A CB   2  
ATOM   3631  C CG   . PHE A 1 27  ? -14.883 10.904  -6.806  1.00 0.67  ? 27   PHE A CG   2  
ATOM   3632  C CD1  . PHE A 1 27  ? -15.888 11.688  -7.344  1.00 0.85  ? 27   PHE A CD1  2  
ATOM   3633  C CD2  . PHE A 1 27  ? -14.094 10.152  -7.663  1.00 0.94  ? 27   PHE A CD2  2  
ATOM   3634  C CE1  . PHE A 1 27  ? -16.103 11.721  -8.707  1.00 1.16  ? 27   PHE A CE1  2  
ATOM   3635  C CE2  . PHE A 1 27  ? -14.307 10.178  -9.025  1.00 1.20  ? 27   PHE A CE2  2  
ATOM   3636  C CZ   . PHE A 1 27  ? -15.270 11.002  -9.554  1.00 1.28  ? 27   PHE A CZ   2  
ATOM   3637  H H    . PHE A 1 27  ? -12.818 12.818  -5.505  1.00 0.34  ? 27   PHE A H    2  
ATOM   3638  H HA   . PHE A 1 27  ? -15.655 12.670  -4.750  1.00 0.42  ? 27   PHE A HA   2  
ATOM   3639  H HB2  . PHE A 1 27  ? -13.707 10.391  -5.141  1.00 0.52  ? 27   PHE A HB2  2  
ATOM   3640  H HB3  . PHE A 1 27  ? -15.440 10.261  -4.880  1.00 0.39  ? 27   PHE A HB3  2  
ATOM   3641  H HD1  . PHE A 1 27  ? -16.506 12.281  -6.687  1.00 0.88  ? 27   PHE A HD1  2  
ATOM   3642  H HD2  . PHE A 1 27  ? -13.306 9.535   -7.253  1.00 1.05  ? 27   PHE A HD2  2  
ATOM   3643  H HE1  . PHE A 1 27  ? -16.890 12.339  -9.115  1.00 1.39  ? 27   PHE A HE1  2  
ATOM   3644  H HE2  . PHE A 1 27  ? -13.685 9.588   -9.681  1.00 1.44  ? 27   PHE A HE2  2  
ATOM   3645  H HZ   . PHE A 1 27  ? -15.419 11.041  -10.624 1.00 1.53  ? 27   PHE A HZ   2  
ATOM   3646  N N    . SER A 1 28  ? -13.392 13.030  -2.775  1.00 0.39  ? 28   SER A N    2  
ATOM   3647  C CA   . SER A 1 28  ? -12.892 12.973  -1.417  1.00 0.42  ? 28   SER A CA   2  
ATOM   3648  C C    . SER A 1 28  ? -13.650 13.919  -0.505  1.00 0.58  ? 28   SER A C    2  
ATOM   3649  O O    . SER A 1 28  ? -14.587 14.602  -0.917  1.00 1.01  ? 28   SER A O    2  
ATOM   3650  C CB   . SER A 1 28  ? -11.394 13.274  -1.351  1.00 0.62  ? 28   SER A CB   2  
ATOM   3651  O OG   . SER A 1 28  ? -11.122 14.636  -1.635  1.00 1.81  ? 28   SER A OG   2  
ATOM   3652  H H    . SER A 1 28  ? -13.077 13.733  -3.380  1.00 0.51  ? 28   SER A H    2  
ATOM   3653  H HA   . SER A 1 28  ? -13.051 11.969  -1.063  1.00 0.57  ? 28   SER A HA   2  
ATOM   3654  H HB2  . SER A 1 28  ? -11.032 13.045  -0.353  1.00 0.85  ? 28   SER A HB2  2  
ATOM   3655  H HB3  . SER A 1 28  ? -10.875 12.659  -2.069  1.00 1.08  ? 28   SER A HB3  2  
ATOM   3656  H HG   . SER A 1 28  ? -11.756 14.964  -2.286  1.00 2.04  ? 28   SER A HG   2  
ATOM   3657  N N    . ASP A 1 29  ? -13.225 13.917  0.739   1.00 0.63  ? 29   ASP A N    2  
ATOM   3658  C CA   . ASP A 1 29  ? -13.828 14.697  1.805   1.00 0.84  ? 29   ASP A CA   2  
ATOM   3659  C C    . ASP A 1 29  ? -12.852 14.724  2.968   1.00 0.88  ? 29   ASP A C    2  
ATOM   3660  O O    . ASP A 1 29  ? -12.814 15.665  3.761   1.00 1.03  ? 29   ASP A O    2  
ATOM   3661  C CB   . ASP A 1 29  ? -15.149 14.045  2.217   1.00 1.04  ? 29   ASP A CB   2  
ATOM   3662  C CG   . ASP A 1 29  ? -15.740 14.605  3.494   1.00 1.69  ? 29   ASP A CG   2  
ATOM   3663  O OD1  . ASP A 1 29  ? -15.323 14.165  4.583   1.00 2.31  ? 29   ASP A OD1  2  
ATOM   3664  O OD2  . ASP A 1 29  ? -16.601 15.513  3.413   1.00 1.85  ? 29   ASP A OD2  2  
ATOM   3665  H H    . ASP A 1 29  ? -12.464 13.349  0.960   1.00 0.79  ? 29   ASP A H    2  
ATOM   3666  H HA   . ASP A 1 29  ? -14.005 15.700  1.448   1.00 0.91  ? 29   ASP A HA   2  
ATOM   3667  H HB2  . ASP A 1 29  ? -15.865 14.193  1.425   1.00 1.07  ? 29   ASP A HB2  2  
ATOM   3668  H HB3  . ASP A 1 29  ? -14.984 12.986  2.351   1.00 1.38  ? 29   ASP A HB3  2  
ATOM   3669  N N    . VAL A 1 30  ? -12.031 13.681  3.001   1.00 0.80  ? 30   VAL A N    2  
ATOM   3670  C CA   . VAL A 1 30  ? -11.041 13.462  4.043   1.00 0.82  ? 30   VAL A CA   2  
ATOM   3671  C C    . VAL A 1 30  ? -10.024 14.606  4.130   1.00 0.82  ? 30   VAL A C    2  
ATOM   3672  O O    . VAL A 1 30  ? -10.129 15.465  4.999   1.00 0.92  ? 30   VAL A O    2  
ATOM   3673  C CB   . VAL A 1 30  ? -10.320 12.119  3.760   1.00 0.81  ? 30   VAL A CB   2  
ATOM   3674  C CG1  . VAL A 1 30  ? -11.242 10.958  4.070   1.00 0.89  ? 30   VAL A CG1  2  
ATOM   3675  C CG2  . VAL A 1 30  ? -9.884  12.030  2.299   1.00 0.76  ? 30   VAL A CG2  2  
ATOM   3676  H H    . VAL A 1 30  ? -12.110 13.013  2.297   1.00 0.76  ? 30   VAL A H    2  
ATOM   3677  H HA   . VAL A 1 30  ? -11.559 13.374  4.985   1.00 0.90  ? 30   VAL A HA   2  
ATOM   3678  H HB   . VAL A 1 30  ? -9.445  12.048  4.388   1.00 0.84  ? 30   VAL A HB   2  
ATOM   3679  H HG11 . VAL A 1 30  ? -12.068 10.971  3.370   1.00 1.41  ? 30   VAL A HG11 2  
ATOM   3680  H HG12 . VAL A 1 30  ? -11.618 11.051  5.076   1.00 1.34  ? 30   VAL A HG12 2  
ATOM   3681  H HG13 . VAL A 1 30  ? -10.701 10.030  3.968   1.00 1.34  ? 30   VAL A HG13 2  
ATOM   3682  H HG21 . VAL A 1 30  ? -8.911  12.485  2.185   1.00 1.12  ? 30   VAL A HG21 2  
ATOM   3683  H HG22 . VAL A 1 30  ? -10.600 12.560  1.681   1.00 1.29  ? 30   VAL A HG22 2  
ATOM   3684  H HG23 . VAL A 1 30  ? -9.838  10.995  1.996   1.00 1.35  ? 30   VAL A HG23 2  
ATOM   3685  N N    . GLU A 1 31  ? -9.095  14.658  3.185   1.00 0.78  ? 31   GLU A N    2  
ATOM   3686  C CA   . GLU A 1 31  ? -8.084  15.703  3.156   1.00 0.83  ? 31   GLU A CA   2  
ATOM   3687  C C    . GLU A 1 31  ? -8.692  16.947  2.543   1.00 0.88  ? 31   GLU A C    2  
ATOM   3688  O O    . GLU A 1 31  ? -8.088  18.020  2.514   1.00 0.98  ? 31   GLU A O    2  
ATOM   3689  C CB   . GLU A 1 31  ? -6.873  15.255  2.334   1.00 0.93  ? 31   GLU A CB   2  
ATOM   3690  C CG   . GLU A 1 31  ? -6.403  13.840  2.638   1.00 1.05  ? 31   GLU A CG   2  
ATOM   3691  C CD   . GLU A 1 31  ? -6.117  13.616  4.106   1.00 2.05  ? 31   GLU A CD   2  
ATOM   3692  O OE1  . GLU A 1 31  ? -5.088  14.131  4.594   1.00 2.46  ? 31   GLU A OE1  2  
ATOM   3693  O OE2  . GLU A 1 31  ? -6.922  12.930  4.771   1.00 2.74  ? 31   GLU A OE2  2  
ATOM   3694  H H    . GLU A 1 31  ? -9.081  13.968  2.496   1.00 0.75  ? 31   GLU A H    2  
ATOM   3695  H HA   . GLU A 1 31  ? -7.778  15.912  4.170   1.00 0.84  ? 31   GLU A HA   2  
ATOM   3696  H HB2  . GLU A 1 31  ? -7.125  15.308  1.286   1.00 1.51  ? 31   GLU A HB2  2  
ATOM   3697  H HB3  . GLU A 1 31  ? -6.053  15.931  2.530   1.00 1.30  ? 31   GLU A HB3  2  
ATOM   3698  H HG2  . GLU A 1 31  ? -7.171  13.147  2.329   1.00 1.41  ? 31   GLU A HG2  2  
ATOM   3699  H HG3  . GLU A 1 31  ? -5.500  13.647  2.078   1.00 1.38  ? 31   GLU A HG3  2  
ATOM   3700  N N    . GLU A 1 32  ? -9.900  16.766  2.036   1.00 0.87  ? 32   GLU A N    2  
ATOM   3701  C CA   . GLU A 1 32  ? -10.664 17.841  1.450   1.00 0.98  ? 32   GLU A CA   2  
ATOM   3702  C C    . GLU A 1 32  ? -11.043 18.865  2.509   1.00 1.09  ? 32   GLU A C    2  
ATOM   3703  O O    . GLU A 1 32  ? -10.918 20.071  2.300   1.00 1.24  ? 32   GLU A O    2  
ATOM   3704  C CB   . GLU A 1 32  ? -11.924 17.281  0.786   1.00 0.98  ? 32   GLU A CB   2  
ATOM   3705  C CG   . GLU A 1 32  ? -12.892 18.363  0.333   1.00 1.12  ? 32   GLU A CG   2  
ATOM   3706  C CD   . GLU A 1 32  ? -14.005 17.844  -0.546  1.00 1.20  ? 32   GLU A CD   2  
ATOM   3707  O OE1  . GLU A 1 32  ? -13.768 17.646  -1.756  1.00 1.45  ? 32   GLU A OE1  2  
ATOM   3708  O OE2  . GLU A 1 32  ? -15.113 17.605  -0.026  1.00 1.17  ? 32   GLU A OE2  2  
ATOM   3709  H H    . GLU A 1 32  ? -10.289 15.871  2.064   1.00 0.81  ? 32   GLU A H    2  
ATOM   3710  H HA   . GLU A 1 32  ? -10.053 18.312  0.701   1.00 1.06  ? 32   GLU A HA   2  
ATOM   3711  H HB2  . GLU A 1 32  ? -11.638 16.692  -0.074  1.00 0.98  ? 32   GLU A HB2  2  
ATOM   3712  H HB3  . GLU A 1 32  ? -12.435 16.637  1.496   1.00 0.94  ? 32   GLU A HB3  2  
ATOM   3713  H HG2  . GLU A 1 32  ? -13.337 18.811  1.212   1.00 1.13  ? 32   GLU A HG2  2  
ATOM   3714  H HG3  . GLU A 1 32  ? -12.341 19.115  -0.211  1.00 1.25  ? 32   GLU A HG3  2  
ATOM   3715  N N    . ASN A 1 33  ? -11.500 18.376  3.649   1.00 1.09  ? 33   ASN A N    2  
ATOM   3716  C CA   . ASN A 1 33  ? -11.985 19.245  4.704   1.00 1.27  ? 33   ASN A CA   2  
ATOM   3717  C C    . ASN A 1 33  ? -10.969 19.396  5.828   1.00 1.32  ? 33   ASN A C    2  
ATOM   3718  O O    . ASN A 1 33  ? -10.661 20.513  6.238   1.00 1.68  ? 33   ASN A O    2  
ATOM   3719  C CB   . ASN A 1 33  ? -13.305 18.714  5.248   1.00 1.36  ? 33   ASN A CB   2  
ATOM   3720  C CG   . ASN A 1 33  ? -14.445 18.903  4.271   1.00 1.48  ? 33   ASN A CG   2  
ATOM   3721  O OD1  . ASN A 1 33  ? -15.108 19.941  4.264   1.00 1.87  ? 33   ASN A OD1  2  
ATOM   3722  N ND2  . ASN A 1 33  ? -14.687 17.898  3.448   1.00 1.35  ? 33   ASN A ND2  2  
ATOM   3723  H H    . ASN A 1 33  ? -11.519 17.403  3.782   1.00 1.02  ? 33   ASN A H    2  
ATOM   3724  H HA   . ASN A 1 33  ? -12.159 20.217  4.268   1.00 1.40  ? 33   ASN A HA   2  
ATOM   3725  H HB2  . ASN A 1 33  ? -13.203 17.658  5.449   1.00 1.36  ? 33   ASN A HB2  2  
ATOM   3726  H HB3  . ASN A 1 33  ? -13.545 19.231  6.160   1.00 1.57  ? 33   ASN A HB3  2  
ATOM   3727  H HD21 . ASN A 1 33  ? -14.125 17.096  3.520   1.00 1.19  ? 33   ASN A HD21 2  
ATOM   3728  H HD22 . ASN A 1 33  ? -15.419 17.992  2.797   1.00 1.55  ? 33   ASN A HD22 2  
ATOM   3729  N N    . ARG A 1 34  ? -10.444 18.286  6.324   1.00 1.22  ? 34   ARG A N    2  
ATOM   3730  C CA   . ARG A 1 34  ? -9.496  18.340  7.431   1.00 1.29  ? 34   ARG A CA   2  
ATOM   3731  C C    . ARG A 1 34  ? -8.064  18.337  6.915   1.00 1.17  ? 34   ARG A C    2  
ATOM   3732  O O    . ARG A 1 34  ? -7.790  17.866  5.809   1.00 1.24  ? 34   ARG A O    2  
ATOM   3733  C CB   . ARG A 1 34  ? -9.697  17.171  8.399   1.00 1.50  ? 34   ARG A CB   2  
ATOM   3734  C CG   . ARG A 1 34  ? -9.406  15.812  7.787   1.00 1.52  ? 34   ARG A CG   2  
ATOM   3735  C CD   . ARG A 1 34  ? -9.341  14.721  8.839   1.00 1.91  ? 34   ARG A CD   2  
ATOM   3736  N NE   . ARG A 1 34  ? -10.562 14.641  9.635   1.00 2.18  ? 34   ARG A NE   2  
ATOM   3737  C CZ   . ARG A 1 34  ? -10.599 14.158  10.876  1.00 2.65  ? 34   ARG A CZ   2  
ATOM   3738  N NH1  . ARG A 1 34  ? -9.491  13.703  11.448  1.00 2.89  ? 34   ARG A NH1  2  
ATOM   3739  N NH2  . ARG A 1 34  ? -11.744 14.131  11.545  1.00 3.39  ? 34   ARG A NH2  2  
ATOM   3740  H H    . ARG A 1 34  ? -10.679 17.417  5.931   1.00 1.29  ? 34   ARG A H    2  
ATOM   3741  H HA   . ARG A 1 34  ? -9.669  19.266  7.960   1.00 1.52  ? 34   ARG A HA   2  
ATOM   3742  H HB2  . ARG A 1 34  ? -9.044  17.305  9.249   1.00 1.67  ? 34   ARG A HB2  2  
ATOM   3743  H HB3  . ARG A 1 34  ? -10.722 17.174  8.742   1.00 1.85  ? 34   ARG A HB3  2  
ATOM   3744  H HG2  . ARG A 1 34  ? -10.189 15.571  7.084   1.00 1.71  ? 34   ARG A HG2  2  
ATOM   3745  H HG3  . ARG A 1 34  ? -8.458  15.859  7.270   1.00 1.50  ? 34   ARG A HG3  2  
ATOM   3746  H HD2  . ARG A 1 34  ? -9.185  13.774  8.344   1.00 2.31  ? 34   ARG A HD2  2  
ATOM   3747  H HD3  . ARG A 1 34  ? -8.507  14.924  9.494   1.00 2.37  ? 34   ARG A HD3  2  
ATOM   3748  H HE   . ARG A 1 34  ? -11.396 14.967  9.221   1.00 2.49  ? 34   ARG A HE   2  
ATOM   3749  H HH11 . ARG A 1 34  ? -8.613  13.718  10.943  1.00 2.91  ? 34   ARG A HH11 2  
ATOM   3750  H HH12 . ARG A 1 34  ? -9.512  13.354  12.389  1.00 3.40  ? 34   ARG A HH12 2  
ATOM   3751  H HH21 . ARG A 1 34  ? -12.588 14.481  11.121  1.00 3.75  ? 34   ARG A HH21 2  
ATOM   3752  H HH22 . ARG A 1 34  ? -11.776 13.754  12.479  1.00 3.82  ? 34   ARG A HH22 2  
ATOM   3753  N N    . THR A 1 35  ? -7.159  18.876  7.714   1.00 1.31  ? 35   THR A N    2  
ATOM   3754  C CA   . THR A 1 35  ? -5.747  18.871  7.381   1.00 1.39  ? 35   THR A CA   2  
ATOM   3755  C C    . THR A 1 35  ? -4.939  18.249  8.510   1.00 1.34  ? 35   THR A C    2  
ATOM   3756  O O    . THR A 1 35  ? -4.912  18.760  9.635   1.00 1.55  ? 35   THR A O    2  
ATOM   3757  C CB   . THR A 1 35  ? -5.229  20.293  7.092   1.00 1.82  ? 35   THR A CB   2  
ATOM   3758  O OG1  . THR A 1 35  ? -5.587  21.176  8.163   1.00 2.05  ? 35   THR A OG1  2  
ATOM   3759  C CG2  . THR A 1 35  ? -5.789  20.825  5.781   1.00 2.25  ? 35   THR A CG2  2  
ATOM   3760  H H    . THR A 1 35  ? -7.452  19.295  8.553   1.00 1.51  ? 35   THR A H    2  
ATOM   3761  H HA   . THR A 1 35  ? -5.619  18.269  6.494   1.00 1.50  ? 35   THR A HA   2  
ATOM   3762  H HB   . THR A 1 35  ? -4.152  20.252  7.013   1.00 1.91  ? 35   THR A HB   2  
ATOM   3763  H HG1  . THR A 1 35  ? -6.551  21.194  8.254   1.00 2.37  ? 35   THR A HG1  2  
ATOM   3764  H HG21 . THR A 1 35  ? -5.428  21.829  5.617   1.00 2.57  ? 35   THR A HG21 2  
ATOM   3765  H HG22 . THR A 1 35  ? -6.868  20.833  5.827   1.00 2.67  ? 35   THR A HG22 2  
ATOM   3766  H HG23 . THR A 1 35  ? -5.468  20.189  4.969   1.00 2.39  ? 35   THR A HG23 2  
ATOM   3767  N N    . GLU A 1 36  ? -4.324  17.120  8.216   1.00 1.44  ? 36   GLU A N    2  
ATOM   3768  C CA   . GLU A 1 36  ? -3.546  16.391  9.201   1.00 1.68  ? 36   GLU A CA   2  
ATOM   3769  C C    . GLU A 1 36  ? -2.248  15.896  8.591   1.00 1.43  ? 36   GLU A C    2  
ATOM   3770  O O    . GLU A 1 36  ? -1.166  16.381  8.922   1.00 1.46  ? 36   GLU A O    2  
ATOM   3771  C CB   . GLU A 1 36  ? -4.348  15.203  9.725   1.00 2.17  ? 36   GLU A CB   2  
ATOM   3772  C CG   . GLU A 1 36  ? -5.651  15.603  10.386  1.00 2.49  ? 36   GLU A CG   2  
ATOM   3773  C CD   . GLU A 1 36  ? -6.311  14.459  11.121  1.00 2.96  ? 36   GLU A CD   2  
ATOM   3774  O OE1  . GLU A 1 36  ? -6.969  13.628  10.460  1.00 3.34  ? 36   GLU A OE1  2  
ATOM   3775  O OE2  . GLU A 1 36  ? -6.177  14.380  12.356  1.00 3.30  ? 36   GLU A OE2  2  
ATOM   3776  H H    . GLU A 1 36  ? -4.386  16.765  7.298   1.00 1.59  ? 36   GLU A H    2  
ATOM   3777  H HA   . GLU A 1 36  ? -3.324  17.059  10.018  1.00 1.91  ? 36   GLU A HA   2  
ATOM   3778  H HB2  . GLU A 1 36  ? -4.576  14.549  8.896   1.00 2.46  ? 36   GLU A HB2  2  
ATOM   3779  H HB3  . GLU A 1 36  ? -3.748  14.665  10.440  1.00 2.51  ? 36   GLU A HB3  2  
ATOM   3780  H HG2  . GLU A 1 36  ? -5.452  16.395  11.094  1.00 2.59  ? 36   GLU A HG2  2  
ATOM   3781  H HG3  . GLU A 1 36  ? -6.327  15.966  9.622   1.00 2.88  ? 36   GLU A HG3  2  
ATOM   3782  N N    . ALA A 1 37  ? -2.378  14.937  7.690   1.00 1.50  ? 37   ALA A N    2  
ATOM   3783  C CA   . ALA A 1 37  ? -1.234  14.343  7.020   1.00 1.39  ? 37   ALA A CA   2  
ATOM   3784  C C    . ALA A 1 37  ? -0.436  15.377  6.236   1.00 1.27  ? 37   ALA A C    2  
ATOM   3785  O O    . ALA A 1 37  ? -0.999  16.202  5.511   1.00 1.58  ? 37   ALA A O    2  
ATOM   3786  C CB   . ALA A 1 37  ? -1.679  13.227  6.094   1.00 1.92  ? 37   ALA A CB   2  
ATOM   3787  H H    . ALA A 1 37  ? -3.277  14.614  7.472   1.00 1.80  ? 37   ALA A H    2  
ATOM   3788  H HA   . ALA A 1 37  ? -0.595  13.912  7.776   1.00 1.33  ? 37   ALA A HA   2  
ATOM   3789  H HB1  . ALA A 1 37  ? -2.273  13.638  5.293   1.00 2.29  ? 37   ALA A HB1  2  
ATOM   3790  H HB2  . ALA A 1 37  ? -2.265  12.510  6.649   1.00 2.44  ? 37   ALA A HB2  2  
ATOM   3791  H HB3  . ALA A 1 37  ? -0.807  12.738  5.682   1.00 2.11  ? 37   ALA A HB3  2  
ATOM   3792  N N    . PRO A 1 38  ? 0.890   15.341  6.400   1.00 1.10  ? 38   PRO A N    2  
ATOM   3793  C CA   . PRO A 1 38  ? 1.830   16.200  5.674   1.00 1.43  ? 38   PRO A CA   2  
ATOM   3794  C C    . PRO A 1 38  ? 1.890   15.854  4.185   1.00 1.79  ? 38   PRO A C    2  
ATOM   3795  O O    . PRO A 1 38  ? 1.086   15.066  3.684   1.00 1.87  ? 38   PRO A O    2  
ATOM   3796  C CB   . PRO A 1 38  ? 3.185   15.914  6.362   1.00 1.34  ? 38   PRO A CB   2  
ATOM   3797  C CG   . PRO A 1 38  ? 2.835   15.208  7.623   1.00 1.26  ? 38   PRO A CG   2  
ATOM   3798  C CD   . PRO A 1 38  ? 1.582   14.456  7.337   1.00 1.01  ? 38   PRO A CD   2  
ATOM   3799  H HA   . PRO A 1 38  ? 1.578   17.244  5.788   1.00 1.71  ? 38   PRO A HA   2  
ATOM   3800  H HB2  . PRO A 1 38  ? 3.810   15.293  5.727   1.00 1.29  ? 38   PRO A HB2  2  
ATOM   3801  H HB3  . PRO A 1 38  ? 3.689   16.846  6.565   1.00 1.71  ? 38   PRO A HB3  2  
ATOM   3802  H HG2  . PRO A 1 38  ? 3.621   14.519  7.880   1.00 1.41  ? 38   PRO A HG2  2  
ATOM   3803  H HG3  . PRO A 1 38  ? 2.677   15.920  8.418   1.00 1.71  ? 38   PRO A HG3  2  
ATOM   3804  H HD2  . PRO A 1 38  ? 1.809   13.505  6.879   1.00 1.08  ? 38   PRO A HD2  2  
ATOM   3805  H HD3  . PRO A 1 38  ? 1.005   14.319  8.239   1.00 1.25  ? 38   PRO A HD3  2  
ATOM   3806  N N    . GLU A 1 39  ? 2.834   16.454  3.473   1.00 2.28  ? 39   GLU A N    2  
ATOM   3807  C CA   . GLU A 1 39  ? 3.019   16.169  2.056   1.00 2.76  ? 39   GLU A CA   2  
ATOM   3808  C C    . GLU A 1 39  ? 4.011   15.028  1.869   1.00 2.66  ? 39   GLU A C    2  
ATOM   3809  O O    . GLU A 1 39  ? 4.504   14.778  0.768   1.00 3.08  ? 39   GLU A O    2  
ATOM   3810  C CB   . GLU A 1 39  ? 3.511   17.412  1.321   1.00 3.38  ? 39   GLU A CB   2  
ATOM   3811  C CG   . GLU A 1 39  ? 4.857   17.916  1.805   1.00 3.52  ? 39   GLU A CG   2  
ATOM   3812  C CD   . GLU A 1 39  ? 5.285   19.174  1.084   1.00 4.22  ? 39   GLU A CD   2  
ATOM   3813  O OE1  . GLU A 1 39  ? 4.901   20.276  1.524   1.00 4.44  ? 39   GLU A OE1  2  
ATOM   3814  O OE2  . GLU A 1 39  ? 5.993   19.067  0.062   1.00 4.64  ? 39   GLU A OE2  2  
ATOM   3815  H H    . GLU A 1 39  ? 3.416   17.119  3.909   1.00 2.42  ? 39   GLU A H    2  
ATOM   3816  H HA   . GLU A 1 39  ? 2.066   15.873  1.655   1.00 2.84  ? 39   GLU A HA   2  
ATOM   3817  H HB2  . GLU A 1 39  ? 3.594   17.183  0.269   1.00 3.74  ? 39   GLU A HB2  2  
ATOM   3818  H HB3  . GLU A 1 39  ? 2.785   18.201  1.452   1.00 3.48  ? 39   GLU A HB3  2  
ATOM   3819  H HG2  . GLU A 1 39  ? 4.791   18.127  2.863   1.00 3.29  ? 39   GLU A HG2  2  
ATOM   3820  H HG3  . GLU A 1 39  ? 5.597   17.148  1.636   1.00 3.47  ? 39   GLU A HG3  2  
ATOM   3821  N N    . GLY A 1 40  ? 4.300   14.347  2.960   1.00 2.15  ? 40   GLY A N    2  
ATOM   3822  C CA   . GLY A 1 40  ? 5.241   13.255  2.930   1.00 2.04  ? 40   GLY A CA   2  
ATOM   3823  C C    . GLY A 1 40  ? 6.208   13.337  4.081   1.00 1.57  ? 40   GLY A C    2  
ATOM   3824  O O    . GLY A 1 40  ? 7.398   13.556  3.876   1.00 1.75  ? 40   GLY A O    2  
ATOM   3825  H H    . GLY A 1 40  ? 3.861   14.587  3.798   1.00 1.90  ? 40   GLY A H    2  
ATOM   3826  H HA2  . GLY A 1 40  ? 4.699   12.321  2.984   1.00 2.04  ? 40   GLY A HA2  2  
ATOM   3827  H HA3  . GLY A 1 40  ? 5.793   13.290  2.002   1.00 2.40  ? 40   GLY A HA3  2  
ATOM   3828  N N    . THR A 1 41  ? 5.702   13.172  5.299   1.00 1.12  ? 41   THR A N    2  
ATOM   3829  C CA   . THR A 1 41  ? 6.534   13.342  6.479   1.00 0.86  ? 41   THR A CA   2  
ATOM   3830  C C    . THR A 1 41  ? 7.574   12.211  6.580   1.00 0.75  ? 41   THR A C    2  
ATOM   3831  O O    . THR A 1 41  ? 8.749   12.410  6.268   1.00 0.85  ? 41   THR A O    2  
ATOM   3832  C CB   . THR A 1 41  ? 5.659   13.397  7.757   1.00 0.80  ? 41   THR A CB   2  
ATOM   3833  O OG1  . THR A 1 41  ? 6.460   13.253  8.932   1.00 0.95  ? 41   THR A OG1  2  
ATOM   3834  C CG2  . THR A 1 41  ? 4.569   12.333  7.742   1.00 0.91  ? 41   THR A CG2  2  
ATOM   3835  H H    . THR A 1 41  ? 4.756   12.923  5.402   1.00 1.17  ? 41   THR A H    2  
ATOM   3836  H HA   . THR A 1 41  ? 7.039   14.290  6.379   1.00 1.14  ? 41   THR A HA   2  
ATOM   3837  H HB   . THR A 1 41  ? 5.180   14.366  7.789   1.00 0.93  ? 41   THR A HB   2  
ATOM   3838  H HG1  . THR A 1 41  ? 5.956   13.578  9.697   1.00 1.29  ? 41   THR A HG1  2  
ATOM   3839  H HG21 . THR A 1 41  ? 5.019   11.357  7.648   1.00 1.35  ? 41   THR A HG21 2  
ATOM   3840  H HG22 . THR A 1 41  ? 3.908   12.509  6.906   1.00 1.45  ? 41   THR A HG22 2  
ATOM   3841  H HG23 . THR A 1 41  ? 4.005   12.383  8.662   1.00 1.31  ? 41   THR A HG23 2  
ATOM   3842  N N    . GLU A 1 42  ? 7.140   11.033  7.010   1.00 0.69  ? 42   GLU A N    2  
ATOM   3843  C CA   . GLU A 1 42  ? 7.938   9.817   6.900   1.00 0.66  ? 42   GLU A CA   2  
ATOM   3844  C C    . GLU A 1 42  ? 7.532   9.080   5.640   1.00 0.54  ? 42   GLU A C    2  
ATOM   3845  O O    . GLU A 1 42  ? 8.296   8.332   5.036   1.00 0.56  ? 42   GLU A O    2  
ATOM   3846  C CB   . GLU A 1 42  ? 7.703   8.921   8.112   1.00 0.74  ? 42   GLU A CB   2  
ATOM   3847  C CG   . GLU A 1 42  ? 6.312   8.304   8.172   1.00 0.65  ? 42   GLU A CG   2  
ATOM   3848  C CD   . GLU A 1 42  ? 6.088   7.501   9.435   1.00 1.20  ? 42   GLU A CD   2  
ATOM   3849  O OE1  . GLU A 1 42  ? 6.768   6.472   9.625   1.00 2.02  ? 42   GLU A OE1  2  
ATOM   3850  O OE2  . GLU A 1 42  ? 5.241   7.907   10.251  1.00 1.17  ? 42   GLU A OE2  2  
ATOM   3851  H H    . GLU A 1 42  ? 6.260   10.981  7.431   1.00 0.76  ? 42   GLU A H    2  
ATOM   3852  H HA   . GLU A 1 42  ? 8.981   10.090  6.842   1.00 0.71  ? 42   GLU A HA   2  
ATOM   3853  H HB2  . GLU A 1 42  ? 8.420   8.120   8.087   1.00 0.79  ? 42   GLU A HB2  2  
ATOM   3854  H HB3  . GLU A 1 42  ? 7.853   9.503   9.006   1.00 0.86  ? 42   GLU A HB3  2  
ATOM   3855  H HG2  . GLU A 1 42  ? 5.576   9.095   8.131   1.00 0.88  ? 42   GLU A HG2  2  
ATOM   3856  H HG3  . GLU A 1 42  ? 6.183   7.648   7.320   1.00 0.91  ? 42   GLU A HG3  2  
ATOM   3857  N N    . SER A 1 43  ? 6.294   9.342   5.283   1.00 0.48  ? 43   SER A N    2  
ATOM   3858  C CA   . SER A 1 43  ? 5.553   8.628   4.261   1.00 0.43  ? 43   SER A CA   2  
ATOM   3859  C C    . SER A 1 43  ? 6.227   8.592   2.903   1.00 0.43  ? 43   SER A C    2  
ATOM   3860  O O    . SER A 1 43  ? 6.169   7.570   2.240   1.00 0.49  ? 43   SER A O    2  
ATOM   3861  C CB   . SER A 1 43  ? 4.207   9.301   4.122   1.00 0.50  ? 43   SER A CB   2  
ATOM   3862  O OG   . SER A 1 43  ? 4.349   10.684  4.376   1.00 1.25  ? 43   SER A OG   2  
ATOM   3863  H H    . SER A 1 43  ? 5.839   10.065  5.752   1.00 0.54  ? 43   SER A H    2  
ATOM   3864  H HA   . SER A 1 43  ? 5.397   7.619   4.603   1.00 0.49  ? 43   SER A HA   2  
ATOM   3865  H HB2  . SER A 1 43  ? 3.837   9.158   3.112   1.00 0.71  ? 43   SER A HB2  2  
ATOM   3866  H HB3  . SER A 1 43  ? 3.514   8.881   4.831   1.00 0.91  ? 43   SER A HB3  2  
ATOM   3867  H HG   . SER A 1 43  ? 3.476   11.077  4.567   1.00 1.24  ? 43   SER A HG   2  
ATOM   3868  N N    . GLU A 1 44  ? 6.840   9.701   2.503   1.00 0.46  ? 44   GLU A N    2  
ATOM   3869  C CA   . GLU A 1 44  ? 7.340   9.884   1.131   1.00 0.52  ? 44   GLU A CA   2  
ATOM   3870  C C    . GLU A 1 44  ? 7.977   8.614   0.557   1.00 0.51  ? 44   GLU A C    2  
ATOM   3871  O O    . GLU A 1 44  ? 7.580   8.143   -0.507  1.00 0.58  ? 44   GLU A O    2  
ATOM   3872  C CB   . GLU A 1 44  ? 8.342   11.037  1.090   1.00 0.61  ? 44   GLU A CB   2  
ATOM   3873  C CG   . GLU A 1 44  ? 8.797   11.403  -0.312  1.00 0.72  ? 44   GLU A CG   2  
ATOM   3874  C CD   . GLU A 1 44  ? 7.684   12.003  -1.144  1.00 1.17  ? 44   GLU A CD   2  
ATOM   3875  O OE1  . GLU A 1 44  ? 6.933   11.240  -1.786  1.00 1.91  ? 44   GLU A OE1  2  
ATOM   3876  O OE2  . GLU A 1 44  ? 7.550   13.245  -1.152  1.00 1.29  ? 44   GLU A OE2  2  
ATOM   3877  H H    . GLU A 1 44  ? 6.961   10.426  3.149   1.00 0.47  ? 44   GLU A H    2  
ATOM   3878  H HA   . GLU A 1 44  ? 6.493   10.146  0.514   1.00 0.54  ? 44   GLU A HA   2  
ATOM   3879  H HB2  . GLU A 1 44  ? 7.881   11.906  1.531   1.00 0.63  ? 44   GLU A HB2  2  
ATOM   3880  H HB3  . GLU A 1 44  ? 9.210   10.764  1.670   1.00 0.61  ? 44   GLU A HB3  2  
ATOM   3881  H HG2  . GLU A 1 44  ? 9.600   12.121  -0.241  1.00 1.13  ? 44   GLU A HG2  2  
ATOM   3882  H HG3  . GLU A 1 44  ? 9.156   10.511  -0.806  1.00 1.04  ? 44   GLU A HG3  2  
ATOM   3883  N N    . ALA A 1 45  ? 8.937   8.046   1.270   1.00 0.48  ? 45   ALA A N    2  
ATOM   3884  C CA   . ALA A 1 45  ? 9.606   6.838   0.803   1.00 0.48  ? 45   ALA A CA   2  
ATOM   3885  C C    . ALA A 1 45  ? 8.738   5.597   0.990   1.00 0.41  ? 45   ALA A C    2  
ATOM   3886  O O    . ALA A 1 45  ? 8.750   4.699   0.148   1.00 0.41  ? 45   ALA A O    2  
ATOM   3887  C CB   . ALA A 1 45  ? 10.939  6.665   1.512   1.00 0.52  ? 45   ALA A CB   2  
ATOM   3888  H H    . ALA A 1 45  ? 9.213   8.455   2.123   1.00 0.49  ? 45   ALA A H    2  
ATOM   3889  H HA   . ALA A 1 45  ? 9.801   6.956   -0.254  1.00 0.52  ? 45   ALA A HA   2  
ATOM   3890  H HB1  . ALA A 1 45  ? 10.770  6.524   2.569   1.00 1.14  ? 45   ALA A HB1  2  
ATOM   3891  H HB2  . ALA A 1 45  ? 11.545  7.547   1.360   1.00 1.18  ? 45   ALA A HB2  2  
ATOM   3892  H HB3  . ALA A 1 45  ? 11.452  5.804   1.110   1.00 1.13  ? 45   ALA A HB3  2  
ATOM   3893  N N    . VAL A 1 46  ? 7.975   5.546   2.076   1.00 0.37  ? 46   VAL A N    2  
ATOM   3894  C CA   . VAL A 1 46  ? 7.165   4.367   2.372   1.00 0.34  ? 46   VAL A CA   2  
ATOM   3895  C C    . VAL A 1 46  ? 6.003   4.239   1.380   1.00 0.34  ? 46   VAL A C    2  
ATOM   3896  O O    . VAL A 1 46  ? 5.754   3.157   0.858   1.00 0.39  ? 46   VAL A O    2  
ATOM   3897  C CB   . VAL A 1 46  ? 6.647   4.347   3.843   1.00 0.49  ? 46   VAL A CB   2  
ATOM   3898  C CG1  . VAL A 1 46  ? 7.119   5.556   4.616   1.00 1.41  ? 46   VAL A CG1  2  
ATOM   3899  C CG2  . VAL A 1 46  ? 5.135   4.243   3.934   1.00 1.13  ? 46   VAL A CG2  2  
ATOM   3900  H H    . VAL A 1 46  ? 7.948   6.316   2.682   1.00 0.38  ? 46   VAL A H    2  
ATOM   3901  H HA   . VAL A 1 46  ? 7.815   3.507   2.247   1.00 0.36  ? 46   VAL A HA   2  
ATOM   3902  H HB   . VAL A 1 46  ? 7.066   3.472   4.322   1.00 1.47  ? 46   VAL A HB   2  
ATOM   3903  H HG11 . VAL A 1 46  ? 6.688   5.531   5.609   1.00 2.01  ? 46   VAL A HG11 2  
ATOM   3904  H HG12 . VAL A 1 46  ? 6.800   6.453   4.108   1.00 1.93  ? 46   VAL A HG12 2  
ATOM   3905  H HG13 . VAL A 1 46  ? 8.196   5.541   4.688   1.00 2.01  ? 46   VAL A HG13 2  
ATOM   3906  H HG21 . VAL A 1 46  ? 4.684   5.087   3.430   1.00 1.65  ? 46   VAL A HG21 2  
ATOM   3907  H HG22 . VAL A 1 46  ? 4.844   4.247   4.978   1.00 1.69  ? 46   VAL A HG22 2  
ATOM   3908  H HG23 . VAL A 1 46  ? 4.807   3.324   3.470   1.00 1.88  ? 46   VAL A HG23 2  
ATOM   3909  N N    . LYS A 1 47  ? 5.313   5.348   1.102   1.00 0.34  ? 47   LYS A N    2  
ATOM   3910  C CA   . LYS A 1 47  ? 4.210   5.345   0.143   1.00 0.36  ? 47   LYS A CA   2  
ATOM   3911  C C    . LYS A 1 47  ? 4.744   5.009   -1.241  1.00 0.39  ? 47   LYS A C    2  
ATOM   3912  O O    . LYS A 1 47  ? 4.140   4.240   -1.991  1.00 0.43  ? 47   LYS A O    2  
ATOM   3913  C CB   . LYS A 1 47  ? 3.498   6.710   0.117   1.00 0.38  ? 47   LYS A CB   2  
ATOM   3914  C CG   . LYS A 1 47  ? 4.451   7.878   -0.083  1.00 0.49  ? 47   LYS A CG   2  
ATOM   3915  C CD   . LYS A 1 47  ? 3.744   9.184   -0.383  1.00 0.47  ? 47   LYS A CD   2  
ATOM   3916  C CE   . LYS A 1 47  ? 2.890   9.641   0.776   1.00 0.47  ? 47   LYS A CE   2  
ATOM   3917  N NZ   . LYS A 1 47  ? 2.378   11.023  0.565   1.00 0.67  ? 47   LYS A NZ   2  
ATOM   3918  H H    . LYS A 1 47  ? 5.562   6.191   1.546   1.00 0.36  ? 47   LYS A H    2  
ATOM   3919  H HA   . LYS A 1 47  ? 3.508   4.580   0.445   1.00 0.36  ? 47   LYS A HA   2  
ATOM   3920  H HB2  . LYS A 1 47  ? 2.780   6.714   -0.690  1.00 0.47  ? 47   LYS A HB2  2  
ATOM   3921  H HB3  . LYS A 1 47  ? 2.979   6.850   1.052   1.00 0.38  ? 47   LYS A HB3  2  
ATOM   3922  H HG2  . LYS A 1 47  ? 5.031   8.005   0.818   1.00 0.64  ? 47   LYS A HG2  2  
ATOM   3923  H HG3  . LYS A 1 47  ? 5.112   7.648   -0.895  1.00 0.78  ? 47   LYS A HG3  2  
ATOM   3924  H HD2  . LYS A 1 47  ? 4.490   9.942   -0.583  1.00 0.84  ? 47   LYS A HD2  2  
ATOM   3925  H HD3  . LYS A 1 47  ? 3.118   9.053   -1.254  1.00 0.74  ? 47   LYS A HD3  2  
ATOM   3926  H HE2  . LYS A 1 47  ? 2.060   8.958   0.881   1.00 0.52  ? 47   LYS A HE2  2  
ATOM   3927  H HE3  . LYS A 1 47  ? 3.483   9.617   1.674   1.00 0.75  ? 47   LYS A HE3  2  
ATOM   3928  H HZ1  . LYS A 1 47  ? 3.140   11.634  0.200   1.00 1.13  ? 47   LYS A HZ1  2  
ATOM   3929  H HZ2  . LYS A 1 47  ? 2.041   11.427  1.467   1.00 1.14  ? 47   LYS A HZ2  2  
ATOM   3930  H HZ3  . LYS A 1 47  ? 1.591   11.023  -0.123  1.00 1.38  ? 47   LYS A HZ3  2  
ATOM   3931  N N    . GLN A 1 48  ? 5.897   5.585   -1.561  1.00 0.40  ? 48   GLN A N    2  
ATOM   3932  C CA   . GLN A 1 48  ? 6.599   5.270   -2.798  1.00 0.46  ? 48   GLN A CA   2  
ATOM   3933  C C    . GLN A 1 48  ? 6.897   3.782   -2.908  1.00 0.45  ? 48   GLN A C    2  
ATOM   3934  O O    . GLN A 1 48  ? 6.868   3.227   -4.000  1.00 0.50  ? 48   GLN A O    2  
ATOM   3935  C CB   . GLN A 1 48  ? 7.897   6.069   -2.905  1.00 0.52  ? 48   GLN A CB   2  
ATOM   3936  C CG   . GLN A 1 48  ? 7.743   7.401   -3.613  1.00 0.58  ? 48   GLN A CG   2  
ATOM   3937  C CD   . GLN A 1 48  ? 7.510   7.281   -5.112  1.00 0.67  ? 48   GLN A CD   2  
ATOM   3938  O OE1  . GLN A 1 48  ? 7.884   8.175   -5.869  1.00 0.99  ? 48   GLN A OE1  2  
ATOM   3939  N NE2  . GLN A 1 48  ? 6.917   6.186   -5.561  1.00 0.63  ? 48   GLN A NE2  2  
ATOM   3940  H H    . GLN A 1 48  ? 6.268   6.269   -0.954  1.00 0.39  ? 48   GLN A H    2  
ATOM   3941  H HA   . GLN A 1 48  ? 5.952   5.550   -3.616  1.00 0.48  ? 48   GLN A HA   2  
ATOM   3942  H HB2  . GLN A 1 48  ? 8.269   6.260   -1.910  1.00 0.49  ? 48   GLN A HB2  2  
ATOM   3943  H HB3  . GLN A 1 48  ? 8.626   5.487   -3.442  1.00 0.58  ? 48   GLN A HB3  2  
ATOM   3944  H HG2  . GLN A 1 48  ? 6.911   7.929   -3.181  1.00 0.58  ? 48   GLN A HG2  2  
ATOM   3945  H HG3  . GLN A 1 48  ? 8.646   7.966   -3.458  1.00 0.65  ? 48   GLN A HG3  2  
ATOM   3946  H HE21 . GLN A 1 48  ? 6.652   5.498   -4.915  1.00 0.74  ? 48   GLN A HE21 2  
ATOM   3947  H HE22 . GLN A 1 48  ? 6.771   6.106   -6.533  1.00 0.66  ? 48   GLN A HE22 2  
ATOM   3948  N N    . ALA A 1 49  ? 7.180   3.143   -1.783  1.00 0.42  ? 49   ALA A N    2  
ATOM   3949  C CA   . ALA A 1 49  ? 7.457   1.711   -1.771  1.00 0.41  ? 49   ALA A CA   2  
ATOM   3950  C C    . ALA A 1 49  ? 6.160   0.916   -1.852  1.00 0.39  ? 49   ALA A C    2  
ATOM   3951  O O    . ALA A 1 49  ? 6.102   -0.151  -2.465  1.00 0.42  ? 49   ALA A O    2  
ATOM   3952  C CB   . ALA A 1 49  ? 8.235   1.329   -0.522  1.00 0.42  ? 49   ALA A CB   2  
ATOM   3953  H H    . ALA A 1 49  ? 7.201   3.647   -0.938  1.00 0.42  ? 49   ALA A H    2  
ATOM   3954  H HA   . ALA A 1 49  ? 8.066   1.482   -2.633  1.00 0.45  ? 49   ALA A HA   2  
ATOM   3955  H HB1  . ALA A 1 49  ? 7.613   1.470   0.349   1.00 1.14  ? 49   ALA A HB1  2  
ATOM   3956  H HB2  . ALA A 1 49  ? 9.113   1.951   -0.442  1.00 1.06  ? 49   ALA A HB2  2  
ATOM   3957  H HB3  . ALA A 1 49  ? 8.538   0.291   -0.587  1.00 1.08  ? 49   ALA A HB3  2  
ATOM   3958  N N    . LEU A 1 50  ? 5.116   1.464   -1.245  1.00 0.38  ? 50   LEU A N    2  
ATOM   3959  C CA   . LEU A 1 50  ? 3.819   0.807   -1.176  1.00 0.40  ? 50   LEU A CA   2  
ATOM   3960  C C    . LEU A 1 50  ? 3.198   0.609   -2.551  1.00 0.41  ? 50   LEU A C    2  
ATOM   3961  O O    . LEU A 1 50  ? 2.530   -0.394  -2.793  1.00 0.43  ? 50   LEU A O    2  
ATOM   3962  C CB   . LEU A 1 50  ? 2.858   1.615   -0.304  1.00 0.45  ? 50   LEU A CB   2  
ATOM   3963  C CG   . LEU A 1 50  ? 3.168   1.627   1.185   1.00 0.69  ? 50   LEU A CG   2  
ATOM   3964  C CD1  . LEU A 1 50  ? 1.955   2.067   1.980   1.00 1.33  ? 50   LEU A CD1  2  
ATOM   3965  C CD2  . LEU A 1 50  ? 3.627   0.264   1.629   1.00 1.20  ? 50   LEU A CD2  2  
ATOM   3966  H H    . LEU A 1 50  ? 5.227   2.339   -0.812  1.00 0.39  ? 50   LEU A H    2  
ATOM   3967  H HA   . LEU A 1 50  ? 3.966   -0.161  -0.722  1.00 0.43  ? 50   LEU A HA   2  
ATOM   3968  H HB2  . LEU A 1 50  ? 2.886   2.629   -0.648  1.00 0.74  ? 50   LEU A HB2  2  
ATOM   3969  H HB3  . LEU A 1 50  ? 1.861   1.229   -0.442  1.00 0.48  ? 50   LEU A HB3  2  
ATOM   3970  H HG   . LEU A 1 50  ? 3.967   2.330   1.376   1.00 1.64  ? 50   LEU A HG   2  
ATOM   3971  H HD11 . LEU A 1 50  ? 1.627   3.036   1.636   1.00 1.95  ? 50   LEU A HD11 2  
ATOM   3972  H HD12 . LEU A 1 50  ? 2.213   2.124   3.028   1.00 1.77  ? 50   LEU A HD12 2  
ATOM   3973  H HD13 . LEU A 1 50  ? 1.161   1.345   1.845   1.00 1.93  ? 50   LEU A HD13 2  
ATOM   3974  H HD21 . LEU A 1 50  ? 3.873   0.292   2.679   1.00 1.81  ? 50   LEU A HD21 2  
ATOM   3975  H HD22 . LEU A 1 50  ? 4.497   -0.014  1.058   1.00 1.85  ? 50   LEU A HD22 2  
ATOM   3976  H HD23 . LEU A 1 50  ? 2.839   -0.450  1.458   1.00 1.62  ? 50   LEU A HD23 2  
ATOM   3977  N N    . ARG A 1 51  ? 3.438   1.537   -3.464  1.00 0.44  ? 51   ARG A N    2  
ATOM   3978  C CA   . ARG A 1 51  ? 2.781   1.485   -4.760  1.00 0.50  ? 51   ARG A CA   2  
ATOM   3979  C C    . ARG A 1 51  ? 3.492   0.477   -5.638  1.00 0.52  ? 51   ARG A C    2  
ATOM   3980  O O    . ARG A 1 51  ? 2.894   -0.158  -6.503  1.00 0.59  ? 51   ARG A O    2  
ATOM   3981  C CB   . ARG A 1 51  ? 2.777   2.866   -5.408  1.00 0.53  ? 51   ARG A CB   2  
ATOM   3982  C CG   . ARG A 1 51  ? 4.110   3.581   -5.300  1.00 0.52  ? 51   ARG A CG   2  
ATOM   3983  C CD   . ARG A 1 51  ? 4.129   4.844   -6.126  1.00 0.73  ? 51   ARG A CD   2  
ATOM   3984  N NE   . ARG A 1 51  ? 3.083   5.786   -5.727  1.00 1.21  ? 51   ARG A NE   2  
ATOM   3985  C CZ   . ARG A 1 51  ? 2.416   6.571   -6.573  1.00 1.63  ? 51   ARG A CZ   2  
ATOM   3986  N NH1  . ARG A 1 51  ? 2.665   6.516   -7.877  1.00 1.96  ? 51   ARG A NH1  2  
ATOM   3987  N NH2  . ARG A 1 51  ? 1.502   7.413   -6.114  1.00 2.17  ? 51   ARG A NH2  2  
ATOM   3988  H H    . ARG A 1 51  ? 4.109   2.240   -3.288  1.00 0.43  ? 51   ARG A H    2  
ATOM   3989  H HA   . ARG A 1 51  ? 1.763   1.160   -4.605  1.00 0.55  ? 51   ARG A HA   2  
ATOM   3990  H HB2  . ARG A 1 51  ? 2.530   2.762   -6.454  1.00 0.59  ? 51   ARG A HB2  2  
ATOM   3991  H HB3  . ARG A 1 51  ? 2.026   3.476   -4.927  1.00 0.58  ? 51   ARG A HB3  2  
ATOM   3992  H HG2  . ARG A 1 51  ? 4.287   3.838   -4.266  1.00 0.67  ? 51   ARG A HG2  2  
ATOM   3993  H HG3  . ARG A 1 51  ? 4.891   2.921   -5.648  1.00 0.66  ? 51   ARG A HG3  2  
ATOM   3994  H HD2  . ARG A 1 51  ? 5.091   5.320   -6.007  1.00 0.90  ? 51   ARG A HD2  2  
ATOM   3995  H HD3  . ARG A 1 51  ? 3.990   4.572   -7.156  1.00 1.12  ? 51   ARG A HD3  2  
ATOM   3996  H HE   . ARG A 1 51  ? 2.878   5.850   -4.763  1.00 1.60  ? 51   ARG A HE   2  
ATOM   3997  H HH11 . ARG A 1 51  ? 3.359   5.881   -8.237  1.00 1.99  ? 51   ARG A HH11 2  
ATOM   3998  H HH12 . ARG A 1 51  ? 2.159   7.111   -8.515  1.00 2.46  ? 51   ARG A HH12 2  
ATOM   3999  H HH21 . ARG A 1 51  ? 1.304   7.460   -5.120  1.00 2.45  ? 51   ARG A HH21 2  
ATOM   4000  H HH22 . ARG A 1 51  ? 1.002   8.018   -6.749  1.00 2.51  ? 51   ARG A HH22 2  
ATOM   4001  N N    . GLU A 1 52  ? 4.775   0.336   -5.372  1.00 0.49  ? 52   GLU A N    2  
ATOM   4002  C CA   . GLU A 1 52  ? 5.624   -0.626  -6.045  1.00 0.54  ? 52   GLU A CA   2  
ATOM   4003  C C    . GLU A 1 52  ? 5.269   -2.045  -5.621  1.00 0.53  ? 52   GLU A C    2  
ATOM   4004  O O    . GLU A 1 52  ? 5.194   -2.957  -6.450  1.00 0.58  ? 52   GLU A O    2  
ATOM   4005  C CB   . GLU A 1 52  ? 7.065   -0.312  -5.689  1.00 0.59  ? 52   GLU A CB   2  
ATOM   4006  C CG   . GLU A 1 52  ? 7.423   1.131   -5.977  1.00 0.63  ? 52   GLU A CG   2  
ATOM   4007  C CD   . GLU A 1 52  ? 7.694   1.366   -7.448  1.00 0.87  ? 52   GLU A CD   2  
ATOM   4008  O OE1  . GLU A 1 52  ? 8.741   0.905   -7.949  1.00 1.10  ? 52   GLU A OE1  2  
ATOM   4009  O OE2  . GLU A 1 52  ? 6.866   2.014   -8.112  1.00 1.07  ? 52   GLU A OE2  2  
ATOM   4010  H H    . GLU A 1 52  ? 5.175   0.918   -4.694  1.00 0.46  ? 52   GLU A H    2  
ATOM   4011  H HA   . GLU A 1 52  ? 5.487   -0.521  -7.109  1.00 0.59  ? 52   GLU A HA   2  
ATOM   4012  H HB2  . GLU A 1 52  ? 7.220   -0.505  -4.638  1.00 0.56  ? 52   GLU A HB2  2  
ATOM   4013  H HB3  . GLU A 1 52  ? 7.717   -0.947  -6.269  1.00 0.67  ? 52   GLU A HB3  2  
ATOM   4014  H HG2  . GLU A 1 52  ? 6.596   1.762   -5.671  1.00 0.66  ? 52   GLU A HG2  2  
ATOM   4015  H HG3  . GLU A 1 52  ? 8.289   1.401   -5.404  1.00 0.69  ? 52   GLU A HG3  2  
ATOM   4016  N N    . ALA A 1 53  ? 5.064   -2.226  -4.323  1.00 0.49  ? 53   ALA A N    2  
ATOM   4017  C CA   . ALA A 1 53  ? 4.654   -3.513  -3.783  1.00 0.48  ? 53   ALA A CA   2  
ATOM   4018  C C    . ALA A 1 53  ? 3.220   -3.827  -4.183  1.00 0.49  ? 53   ALA A C    2  
ATOM   4019  O O    . ALA A 1 53  ? 2.909   -4.949  -4.587  1.00 0.53  ? 53   ALA A O    2  
ATOM   4020  C CB   . ALA A 1 53  ? 4.799   -3.521  -2.269  1.00 0.45  ? 53   ALA A CB   2  
ATOM   4021  H H    . ALA A 1 53  ? 5.205   -1.472  -3.708  1.00 0.48  ? 53   ALA A H    2  
ATOM   4022  H HA   . ALA A 1 53  ? 5.307   -4.271  -4.191  1.00 0.51  ? 53   ALA A HA   2  
ATOM   4023  H HB1  . ALA A 1 53  ? 5.821   -3.297  -2.005  1.00 1.04  ? 53   ALA A HB1  2  
ATOM   4024  H HB2  . ALA A 1 53  ? 4.534   -4.496  -1.888  1.00 1.03  ? 53   ALA A HB2  2  
ATOM   4025  H HB3  . ALA A 1 53  ? 4.143   -2.776  -1.839  1.00 1.01  ? 53   ALA A HB3  2  
ATOM   4026  N N    . GLY A 1 54  ? 2.355   -2.821  -4.079  1.00 0.49  ? 54   GLY A N    2  
ATOM   4027  C CA   . GLY A 1 54  ? 0.967   -2.984  -4.470  1.00 0.53  ? 54   GLY A CA   2  
ATOM   4028  C C    . GLY A 1 54  ? 0.834   -3.343  -5.930  1.00 0.60  ? 54   GLY A C    2  
ATOM   4029  O O    . GLY A 1 54  ? 0.010   -4.174  -6.297  1.00 0.70  ? 54   GLY A O    2  
ATOM   4030  H H    . GLY A 1 54  ? 2.660   -1.958  -3.721  1.00 0.49  ? 54   GLY A H    2  
ATOM   4031  H HA2  . GLY A 1 54  ? 0.524   -3.768  -3.872  1.00 0.53  ? 54   GLY A HA2  2  
ATOM   4032  H HA3  . GLY A 1 54  ? 0.439   -2.060  -4.286  1.00 0.56  ? 54   GLY A HA3  2  
ATOM   4033  N N    . ASP A 1 55  ? 1.671   -2.724  -6.756  1.00 0.61  ? 55   ASP A N    2  
ATOM   4034  C CA   . ASP A 1 55  ? 1.695   -2.992  -8.191  1.00 0.69  ? 55   ASP A CA   2  
ATOM   4035  C C    . ASP A 1 55  ? 1.859   -4.487  -8.452  1.00 0.70  ? 55   ASP A C    2  
ATOM   4036  O O    . ASP A 1 55  ? 1.171   -5.064  -9.298  1.00 0.79  ? 55   ASP A O    2  
ATOM   4037  C CB   . ASP A 1 55  ? 2.842   -2.213  -8.840  1.00 0.73  ? 55   ASP A CB   2  
ATOM   4038  C CG   . ASP A 1 55  ? 2.904   -2.380  -10.343 1.00 0.85  ? 55   ASP A CG   2  
ATOM   4039  O OD1  . ASP A 1 55  ? 3.473   -3.385  -10.812 1.00 0.82  ? 55   ASP A OD1  2  
ATOM   4040  O OD2  . ASP A 1 55  ? 2.404   -1.493  -11.063 1.00 1.04  ? 55   ASP A OD2  2  
ATOM   4041  H H    . ASP A 1 55  ? 2.292   -2.058  -6.389  1.00 0.59  ? 55   ASP A H    2  
ATOM   4042  H HA   . ASP A 1 55  ? 0.756   -2.661  -8.610  1.00 0.77  ? 55   ASP A HA   2  
ATOM   4043  H HB2  . ASP A 1 55  ? 2.721   -1.162  -8.622  1.00 0.77  ? 55   ASP A HB2  2  
ATOM   4044  H HB3  . ASP A 1 55  ? 3.779   -2.553  -8.421  1.00 0.69  ? 55   ASP A HB3  2  
ATOM   4045  N N    . GLU A 1 56  ? 2.759   -5.111  -7.702  1.00 0.66  ? 56   GLU A N    2  
ATOM   4046  C CA   . GLU A 1 56  ? 2.978   -6.543  -7.812  1.00 0.74  ? 56   GLU A CA   2  
ATOM   4047  C C    . GLU A 1 56  ? 1.797   -7.324  -7.266  1.00 0.77  ? 56   GLU A C    2  
ATOM   4048  O O    . GLU A 1 56  ? 1.412   -8.348  -7.817  1.00 0.88  ? 56   GLU A O    2  
ATOM   4049  C CB   . GLU A 1 56  ? 4.239   -6.966  -7.064  1.00 0.79  ? 56   GLU A CB   2  
ATOM   4050  C CG   . GLU A 1 56  ? 5.529   -6.577  -7.756  1.00 1.24  ? 56   GLU A CG   2  
ATOM   4051  C CD   . GLU A 1 56  ? 6.727   -7.228  -7.105  1.00 1.52  ? 56   GLU A CD   2  
ATOM   4052  O OE1  . GLU A 1 56  ? 6.834   -8.470  -7.144  1.00 1.43  ? 56   GLU A OE1  2  
ATOM   4053  O OE2  . GLU A 1 56  ? 7.579   -6.496  -6.557  1.00 2.29  ? 56   GLU A OE2  2  
ATOM   4054  H H    . GLU A 1 56  ? 3.286   -4.593  -7.059  1.00 0.63  ? 56   GLU A H    2  
ATOM   4055  H HA   . GLU A 1 56  ? 3.093   -6.778  -8.854  1.00 0.78  ? 56   GLU A HA   2  
ATOM   4056  H HB2  . GLU A 1 56  ? 4.231   -6.508  -6.087  1.00 0.99  ? 56   GLU A HB2  2  
ATOM   4057  H HB3  . GLU A 1 56  ? 4.228   -8.040  -6.947  1.00 1.14  ? 56   GLU A HB3  2  
ATOM   4058  H HG2  . GLU A 1 56  ? 5.480   -6.888  -8.789  1.00 1.86  ? 56   GLU A HG2  2  
ATOM   4059  H HG3  . GLU A 1 56  ? 5.645   -5.505  -7.704  1.00 1.73  ? 56   GLU A HG3  2  
ATOM   4060  N N    . PHE A 1 57  ? 1.222   -6.836  -6.187  1.00 0.71  ? 57   PHE A N    2  
ATOM   4061  C CA   . PHE A 1 57  ? 0.157   -7.557  -5.510  1.00 0.75  ? 57   PHE A CA   2  
ATOM   4062  C C    . PHE A 1 57  ? -1.076  -7.664  -6.402  1.00 0.78  ? 57   PHE A C    2  
ATOM   4063  O O    . PHE A 1 57  ? -1.792  -8.665  -6.368  1.00 0.91  ? 57   PHE A O    2  
ATOM   4064  C CB   . PHE A 1 57  ? -0.197  -6.885  -4.183  1.00 0.76  ? 57   PHE A CB   2  
ATOM   4065  C CG   . PHE A 1 57  ? -0.761  -7.854  -3.185  1.00 1.09  ? 57   PHE A CG   2  
ATOM   4066  C CD1  . PHE A 1 57  ? 0.071   -8.615  -2.385  1.00 1.37  ? 57   PHE A CD1  2  
ATOM   4067  C CD2  . PHE A 1 57  ? -2.132  -7.985  -3.034  1.00 1.71  ? 57   PHE A CD2  2  
ATOM   4068  C CE1  . PHE A 1 57  ? -0.452  -9.491  -1.455  1.00 1.79  ? 57   PHE A CE1  2  
ATOM   4069  C CE2  . PHE A 1 57  ? -2.661  -8.858  -2.105  1.00 2.29  ? 57   PHE A CE2  2  
ATOM   4070  C CZ   . PHE A 1 57  ? -1.788  -9.683  -1.365  1.00 2.20  ? 57   PHE A CZ   2  
ATOM   4071  H H    . PHE A 1 57  ? 1.519   -5.969  -5.837  1.00 0.67  ? 57   PHE A H    2  
ATOM   4072  H HA   . PHE A 1 57  ? 0.519   -8.554  -5.308  1.00 0.80  ? 57   PHE A HA   2  
ATOM   4073  H HB2  . PHE A 1 57  ? 0.690   -6.440  -3.763  1.00 0.99  ? 57   PHE A HB2  2  
ATOM   4074  H HB3  . PHE A 1 57  ? -0.932  -6.112  -4.353  1.00 0.73  ? 57   PHE A HB3  2  
ATOM   4075  H HD1  . PHE A 1 57  ? 1.141   -8.521  -2.493  1.00 1.61  ? 57   PHE A HD1  2  
ATOM   4076  H HD2  . PHE A 1 57  ? -2.792  -7.397  -3.654  1.00 1.95  ? 57   PHE A HD2  2  
ATOM   4077  H HE1  . PHE A 1 57  ? 0.208   -10.081 -0.837  1.00 2.07  ? 57   PHE A HE1  2  
ATOM   4078  H HE2  . PHE A 1 57  ? -3.732  -8.951  -1.997  1.00 2.93  ? 57   PHE A HE2  2  
ATOM   4079  H HZ   . PHE A 1 57  ? -2.190  -10.394 -0.658  1.00 2.67  ? 57   PHE A HZ   2  
ATOM   4080  N N    . GLU A 1 58  ? -1.296  -6.644  -7.220  1.00 0.73  ? 58   GLU A N    2  
ATOM   4081  C CA   . GLU A 1 58  ? -2.433  -6.620  -8.132  1.00 0.82  ? 58   GLU A CA   2  
ATOM   4082  C C    . GLU A 1 58  ? -2.309  -7.716  -9.178  1.00 0.82  ? 58   GLU A C    2  
ATOM   4083  O O    . GLU A 1 58  ? -3.259  -8.452  -9.434  1.00 0.89  ? 58   GLU A O    2  
ATOM   4084  C CB   . GLU A 1 58  ? -2.528  -5.267  -8.828  1.00 0.86  ? 58   GLU A CB   2  
ATOM   4085  C CG   . GLU A 1 58  ? -2.558  -4.098  -7.870  1.00 0.91  ? 58   GLU A CG   2  
ATOM   4086  C CD   . GLU A 1 58  ? -2.532  -2.770  -8.588  1.00 0.93  ? 58   GLU A CD   2  
ATOM   4087  O OE1  . GLU A 1 58  ? -1.431  -2.278  -8.909  1.00 1.24  ? 58   GLU A OE1  2  
ATOM   4088  O OE2  . GLU A 1 58  ? -3.618  -2.205  -8.837  1.00 1.30  ? 58   GLU A OE2  2  
ATOM   4089  H H    . GLU A 1 58  ? -0.678  -5.879  -7.204  1.00 0.69  ? 58   GLU A H    2  
ATOM   4090  H HA   . GLU A 1 58  ? -3.330  -6.784  -7.555  1.00 0.95  ? 58   GLU A HA   2  
ATOM   4091  H HB2  . GLU A 1 58  ? -1.675  -5.148  -9.481  1.00 0.80  ? 58   GLU A HB2  2  
ATOM   4092  H HB3  . GLU A 1 58  ? -3.430  -5.242  -9.421  1.00 0.98  ? 58   GLU A HB3  2  
ATOM   4093  H HG2  . GLU A 1 58  ? -3.459  -4.154  -7.276  1.00 1.09  ? 58   GLU A HG2  2  
ATOM   4094  H HG3  . GLU A 1 58  ? -1.690  -4.163  -7.220  1.00 1.00  ? 58   GLU A HG3  2  
ATOM   4095  N N    . LEU A 1 59  ? -1.128  -7.827  -9.776  1.00 0.81  ? 59   LEU A N    2  
ATOM   4096  C CA   . LEU A 1 59  ? -0.894  -8.832  -10.808 1.00 0.87  ? 59   LEU A CA   2  
ATOM   4097  C C    . LEU A 1 59  ? -0.907  -10.232 -10.207 1.00 0.85  ? 59   LEU A C    2  
ATOM   4098  O O    . LEU A 1 59  ? -1.310  -11.194 -10.859 1.00 0.96  ? 59   LEU A O    2  
ATOM   4099  C CB   . LEU A 1 59  ? 0.424   -8.558  -11.554 1.00 0.96  ? 59   LEU A CB   2  
ATOM   4100  C CG   . LEU A 1 59  ? 1.706   -8.600  -10.716 1.00 1.06  ? 59   LEU A CG   2  
ATOM   4101  C CD1  . LEU A 1 59  ? 2.259   -10.013 -10.613 1.00 1.54  ? 59   LEU A CD1  2  
ATOM   4102  C CD2  . LEU A 1 59  ? 2.748   -7.669  -11.300 1.00 1.46  ? 59   LEU A CD2  2  
ATOM   4103  H H    . LEU A 1 59  ? -0.401  -7.218  -9.519  1.00 0.83  ? 59   LEU A H    2  
ATOM   4104  H HA   . LEU A 1 59  ? -1.711  -8.761  -11.513 1.00 0.94  ? 59   LEU A HA   2  
ATOM   4105  H HB2  . LEU A 1 59  ? 0.518   -9.290  -12.343 1.00 1.04  ? 59   LEU A HB2  2  
ATOM   4106  H HB3  . LEU A 1 59  ? 0.354   -7.581  -12.007 1.00 1.06  ? 59   LEU A HB3  2  
ATOM   4107  H HG   . LEU A 1 59  ? 1.480   -8.258  -9.717  1.00 1.87  ? 59   LEU A HG   2  
ATOM   4108  H HD11 . LEU A 1 59  ? 2.485   -10.385 -11.602 1.00 2.19  ? 59   LEU A HD11 2  
ATOM   4109  H HD12 . LEU A 1 59  ? 1.525   -10.654 -10.145 1.00 1.96  ? 59   LEU A HD12 2  
ATOM   4110  H HD13 . LEU A 1 59  ? 3.160   -10.003 -10.017 1.00 2.00  ? 59   LEU A HD13 2  
ATOM   4111  H HD21 . LEU A 1 59  ? 2.978   -7.976  -12.307 1.00 1.91  ? 59   LEU A HD21 2  
ATOM   4112  H HD22 . LEU A 1 59  ? 3.642   -7.713  -10.696 1.00 1.97  ? 59   LEU A HD22 2  
ATOM   4113  H HD23 . LEU A 1 59  ? 2.365   -6.661  -11.304 1.00 2.00  ? 59   LEU A HD23 2  
ATOM   4114  N N    . ARG A 1 60  ? -0.481  -10.335 -8.954  1.00 0.83  ? 60   ARG A N    2  
ATOM   4115  C CA   . ARG A 1 60  ? -0.476  -11.612 -8.253  1.00 0.90  ? 60   ARG A CA   2  
ATOM   4116  C C    . ARG A 1 60  ? -1.904  -12.068 -7.981  1.00 0.98  ? 60   ARG A C    2  
ATOM   4117  O O    . ARG A 1 60  ? -2.220  -13.257 -8.022  1.00 1.15  ? 60   ARG A O    2  
ATOM   4118  C CB   . ARG A 1 60  ? 0.283   -11.493 -6.930  1.00 1.03  ? 60   ARG A CB   2  
ATOM   4119  C CG   . ARG A 1 60  ? 1.767   -11.219 -7.087  1.00 1.00  ? 60   ARG A CG   2  
ATOM   4120  C CD   . ARG A 1 60  ? 2.426   -10.917 -5.747  1.00 1.07  ? 60   ARG A CD   2  
ATOM   4121  N NE   . ARG A 1 60  ? 3.807   -10.459 -5.919  1.00 1.41  ? 60   ARG A NE   2  
ATOM   4122  C CZ   . ARG A 1 60  ? 4.845   -10.911 -5.217  1.00 1.94  ? 60   ARG A CZ   2  
ATOM   4123  N NH1  . ARG A 1 60  ? 4.690   -11.913 -4.365  1.00 2.43  ? 60   ARG A NH1  2  
ATOM   4124  N NH2  . ARG A 1 60  ? 6.047   -10.377 -5.393  1.00 2.58  ? 60   ARG A NH2  2  
ATOM   4125  H H    . ARG A 1 60  ? -0.156  -9.532  -8.491  1.00 0.86  ? 60   ARG A H    2  
ATOM   4126  H HA   . ARG A 1 60  ? 0.020   -12.332 -8.886  1.00 0.94  ? 60   ARG A HA   2  
ATOM   4127  H HB2  . ARG A 1 60  ? -0.148  -10.687 -6.354  1.00 1.31  ? 60   ARG A HB2  2  
ATOM   4128  H HB3  . ARG A 1 60  ? 0.167   -12.416 -6.381  1.00 1.36  ? 60   ARG A HB3  2  
ATOM   4129  H HG2  . ARG A 1 60  ? 2.240   -12.088 -7.520  1.00 1.39  ? 60   ARG A HG2  2  
ATOM   4130  H HG3  . ARG A 1 60  ? 1.899   -10.371 -7.743  1.00 1.32  ? 60   ARG A HG3  2  
ATOM   4131  H HD2  . ARG A 1 60  ? 1.860   -10.139 -5.256  1.00 1.41  ? 60   ARG A HD2  2  
ATOM   4132  H HD3  . ARG A 1 60  ? 2.416   -11.812 -5.130  1.00 1.40  ? 60   ARG A HD3  2  
ATOM   4133  H HE   . ARG A 1 60  ? 3.962   -9.753  -6.585  1.00 1.85  ? 60   ARG A HE   2  
ATOM   4134  H HH11 . ARG A 1 60  ? 3.794   -12.340 -4.244  1.00 2.42  ? 60   ARG A HH11 2  
ATOM   4135  H HH12 . ARG A 1 60  ? 5.478   -12.253 -3.833  1.00 3.14  ? 60   ARG A HH12 2  
ATOM   4136  H HH21 . ARG A 1 60  ? 6.184   -9.631  -6.062  1.00 2.82  ? 60   ARG A HH21 2  
ATOM   4137  H HH22 . ARG A 1 60  ? 6.830   -10.704 -4.851  1.00 3.11  ? 60   ARG A HH22 2  
ATOM   4138  N N    . TYR A 1 61  ? -2.757  -11.094 -7.698  1.00 1.04  ? 61   TYR A N    2  
ATOM   4139  C CA   . TYR A 1 61  ? -4.151  -11.338 -7.363  1.00 1.26  ? 61   TYR A CA   2  
ATOM   4140  C C    . TYR A 1 61  ? -5.050  -11.303 -8.592  1.00 1.32  ? 61   TYR A C    2  
ATOM   4141  O O    . TYR A 1 61  ? -6.264  -11.457 -8.467  1.00 1.59  ? 61   TYR A O    2  
ATOM   4142  C CB   . TYR A 1 61  ? -4.635  -10.325 -6.332  1.00 1.52  ? 61   TYR A CB   2  
ATOM   4143  C CG   . TYR A 1 61  ? -5.145  -10.987 -5.083  1.00 2.19  ? 61   TYR A CG   2  
ATOM   4144  C CD1  . TYR A 1 61  ? -4.286  -11.296 -4.038  1.00 2.70  ? 61   TYR A CD1  2  
ATOM   4145  C CD2  . TYR A 1 61  ? -6.492  -11.280 -4.937  1.00 2.84  ? 61   TYR A CD2  2  
ATOM   4146  C CE1  . TYR A 1 61  ? -4.756  -11.883 -2.882  1.00 3.67  ? 61   TYR A CE1  2  
ATOM   4147  C CE2  . TYR A 1 61  ? -6.970  -11.861 -3.785  1.00 3.86  ? 61   TYR A CE2  2  
ATOM   4148  C CZ   . TYR A 1 61  ? -6.072  -12.256 -2.802  1.00 4.23  ? 61   TYR A CZ   2  
ATOM   4149  O OH   . TYR A 1 61  ? -6.576  -12.733 -1.613  1.00 5.32  ? 61   TYR A OH   2  
ATOM   4150  H H    . TYR A 1 61  ? -2.432  -10.167 -7.707  1.00 1.06  ? 61   TYR A H    2  
ATOM   4151  H HA   . TYR A 1 61  ? -4.211  -12.323 -6.926  1.00 1.33  ? 61   TYR A HA   2  
ATOM   4152  H HB2  . TYR A 1 61  ? -3.817  -9.673  -6.058  1.00 1.78  ? 61   TYR A HB2  2  
ATOM   4153  H HB3  . TYR A 1 61  ? -5.437  -9.739  -6.754  1.00 1.83  ? 61   TYR A HB3  2  
ATOM   4154  H HD1  . TYR A 1 61  ? -3.233  -11.074 -4.140  1.00 2.59  ? 61   TYR A HD1  2  
ATOM   4155  H HD2  . TYR A 1 61  ? -7.172  -11.044 -5.744  1.00 2.77  ? 61   TYR A HD2  2  
ATOM   4156  H HE1  . TYR A 1 61  ? -4.074  -12.118 -2.079  1.00 4.15  ? 61   TYR A HE1  2  
ATOM   4157  H HE2  . TYR A 1 61  ? -8.023  -12.082 -3.689  1.00 4.50  ? 61   TYR A HE2  2  
ATOM   4158  H HH   . TYR A 1 61  ? -7.201  -13.425 -1.846  1.00 5.59  ? 61   TYR A HH   2  
ATOM   4159  N N    . ARG A 1 62  ? -4.441  -11.062 -9.754  1.00 1.28  ? 62   ARG A N    2  
ATOM   4160  C CA   . ARG A 1 62  ? -5.146  -10.838 -11.027 1.00 1.39  ? 62   ARG A CA   2  
ATOM   4161  C C    . ARG A 1 62  ? -6.420  -11.678 -11.195 1.00 1.07  ? 62   ARG A C    2  
ATOM   4162  O O    . ARG A 1 62  ? -7.421  -11.189 -11.724 1.00 1.30  ? 62   ARG A O    2  
ATOM   4163  C CB   . ARG A 1 62  ? -4.210  -11.137 -12.200 1.00 1.72  ? 62   ARG A CB   2  
ATOM   4164  C CG   . ARG A 1 62  ? -4.739  -10.636 -13.534 1.00 2.15  ? 62   ARG A CG   2  
ATOM   4165  C CD   . ARG A 1 62  ? -4.380  -9.177  -13.762 1.00 2.51  ? 62   ARG A CD   2  
ATOM   4166  N NE   . ARG A 1 62  ? -2.979  -9.029  -14.154 1.00 3.10  ? 62   ARG A NE   2  
ATOM   4167  C CZ   . ARG A 1 62  ? -2.280  -7.899  -14.065 1.00 3.59  ? 62   ARG A CZ   2  
ATOM   4168  N NH1  . ARG A 1 62  ? -2.808  -6.812  -13.517 1.00 3.59  ? 62   ARG A NH1  2  
ATOM   4169  N NH2  . ARG A 1 62  ? -1.034  -7.872  -14.514 1.00 4.48  ? 62   ARG A NH2  2  
ATOM   4170  H H    . ARG A 1 62  ? -3.461  -11.026 -9.758  1.00 1.33  ? 62   ARG A H    2  
ATOM   4171  H HA   . ARG A 1 62  ? -5.418  -9.795  -11.068 1.00 1.73  ? 62   ARG A HA   2  
ATOM   4172  H HB2  . ARG A 1 62  ? -3.255  -10.666 -12.014 1.00 1.93  ? 62   ARG A HB2  2  
ATOM   4173  H HB3  . ARG A 1 62  ? -4.067  -12.205 -12.271 1.00 1.76  ? 62   ARG A HB3  2  
ATOM   4174  H HG2  . ARG A 1 62  ? -4.310  -11.230 -14.328 1.00 2.42  ? 62   ARG A HG2  2  
ATOM   4175  H HG3  . ARG A 1 62  ? -5.814  -10.739 -13.545 1.00 2.45  ? 62   ARG A HG3  2  
ATOM   4176  H HD2  . ARG A 1 62  ? -5.010  -8.780  -14.543 1.00 2.64  ? 62   ARG A HD2  2  
ATOM   4177  H HD3  . ARG A 1 62  ? -4.549  -8.629  -12.846 1.00 2.92  ? 62   ARG A HD3  2  
ATOM   4178  H HE   . ARG A 1 62  ? -2.535  -9.824  -14.536 1.00 3.50  ? 62   ARG A HE   2  
ATOM   4179  H HH11 . ARG A 1 62  ? -3.746  -6.825  -13.159 1.00 3.34  ? 62   ARG A HH11 2  
ATOM   4180  H HH12 . ARG A 1 62  ? -2.270  -5.960  -13.457 1.00 4.14  ? 62   ARG A HH12 2  
ATOM   4181  H HH21 . ARG A 1 62  ? -0.629  -8.701  -14.916 1.00 4.87  ? 62   ARG A HH21 2  
ATOM   4182  H HH22 . ARG A 1 62  ? -0.489  -7.023  -14.464 1.00 4.93  ? 62   ARG A HH22 2  
ATOM   4183  N N    . ARG A 1 63  ? -6.390  -12.930 -10.765 1.00 0.98  ? 63   ARG A N    2  
ATOM   4184  C CA   . ARG A 1 63  ? -7.519  -13.826 -10.977 1.00 1.19  ? 63   ARG A CA   2  
ATOM   4185  C C    . ARG A 1 63  ? -8.676  -13.513 -10.026 1.00 1.20  ? 63   ARG A C    2  
ATOM   4186  O O    . ARG A 1 63  ? -9.838  -13.512 -10.432 1.00 1.45  ? 63   ARG A O    2  
ATOM   4187  C CB   . ARG A 1 63  ? -7.086  -15.277 -10.795 1.00 1.61  ? 63   ARG A CB   2  
ATOM   4188  C CG   . ARG A 1 63  ? -8.088  -16.281 -11.338 1.00 2.18  ? 63   ARG A CG   2  
ATOM   4189  C CD   . ARG A 1 63  ? -7.672  -17.702 -11.019 1.00 2.52  ? 63   ARG A CD   2  
ATOM   4190  N NE   . ARG A 1 63  ? -6.281  -17.956 -11.381 1.00 3.12  ? 63   ARG A NE   2  
ATOM   4191  C CZ   . ARG A 1 63  ? -5.388  -18.480 -10.546 1.00 3.84  ? 63   ARG A CZ   2  
ATOM   4192  N NH1  . ARG A 1 63  ? -5.745  -18.786 -9.306  1.00 4.07  ? 63   ARG A NH1  2  
ATOM   4193  N NH2  . ARG A 1 63  ? -4.138  -18.676 -10.944 1.00 4.72  ? 63   ARG A NH2  2  
ATOM   4194  H H    . ARG A 1 63  ? -5.592  -13.260 -10.292 1.00 1.11  ? 63   ARG A H    2  
ATOM   4195  H HA   . ARG A 1 63  ? -7.861  -13.690 -11.992 1.00 1.34  ? 63   ARG A HA   2  
ATOM   4196  H HB2  . ARG A 1 63  ? -6.146  -15.426 -11.305 1.00 1.92  ? 63   ARG A HB2  2  
ATOM   4197  H HB3  . ARG A 1 63  ? -6.950  -15.471 -9.741  1.00 2.09  ? 63   ARG A HB3  2  
ATOM   4198  H HG2  . ARG A 1 63  ? -9.053  -16.089 -10.894 1.00 2.77  ? 63   ARG A HG2  2  
ATOM   4199  H HG3  . ARG A 1 63  ? -8.153  -16.165 -12.410 1.00 2.59  ? 63   ARG A HG3  2  
ATOM   4200  H HD2  . ARG A 1 63  ? -7.795  -17.872 -9.959  1.00 3.00  ? 63   ARG A HD2  2  
ATOM   4201  H HD3  . ARG A 1 63  ? -8.308  -18.383 -11.568 1.00 2.63  ? 63   ARG A HD3  2  
ATOM   4202  H HE   . ARG A 1 63  ? -5.999  -17.716 -12.300 1.00 3.38  ? 63   ARG A HE   2  
ATOM   4203  H HH11 . ARG A 1 63  ? -6.688  -18.620 -8.996  1.00 3.81  ? 63   ARG A HH11 2  
ATOM   4204  H HH12 . ARG A 1 63  ? -5.072  -19.178 -8.662  1.00 4.78  ? 63   ARG A HH12 2  
ATOM   4205  H HH21 . ARG A 1 63  ? -3.857  -18.427 -11.879 1.00 4.96  ? 63   ARG A HH21 2  
ATOM   4206  H HH22 . ARG A 1 63  ? -3.460  -19.072 -10.310 1.00 5.35  ? 63   ARG A HH22 2  
ATOM   4207  N N    . ALA A 1 64  ? -8.359  -13.261 -8.763  1.00 1.07  ? 64   ALA A N    2  
ATOM   4208  C CA   . ALA A 1 64  ? -9.390  -13.063 -7.751  1.00 1.09  ? 64   ALA A CA   2  
ATOM   4209  C C    . ALA A 1 64  ? -9.780  -11.593 -7.582  1.00 1.08  ? 64   ALA A C    2  
ATOM   4210  O O    . ALA A 1 64  ? -10.958 -11.284 -7.471  1.00 1.05  ? 64   ALA A O    2  
ATOM   4211  C CB   . ALA A 1 64  ? -8.951  -13.648 -6.409  1.00 1.17  ? 64   ALA A CB   2  
ATOM   4212  H H    . ALA A 1 64  ? -7.415  -13.190 -8.511  1.00 1.05  ? 64   ALA A H    2  
ATOM   4213  H HA   . ALA A 1 64  ? -10.264 -13.610 -8.073  1.00 1.12  ? 64   ALA A HA   2  
ATOM   4214  H HB1  . ALA A 1 64  ? -8.057  -13.145 -6.071  1.00 1.70  ? 64   ALA A HB1  2  
ATOM   4215  H HB2  . ALA A 1 64  ? -8.750  -14.707 -6.517  1.00 1.43  ? 64   ALA A HB2  2  
ATOM   4216  H HB3  . ALA A 1 64  ? -9.743  -13.503 -5.677  1.00 1.55  ? 64   ALA A HB3  2  
ATOM   4217  N N    . PHE A 1 65  ? -8.794  -10.694 -7.599  1.00 1.14  ? 65   PHE A N    2  
ATOM   4218  C CA   . PHE A 1 65  ? -8.980  -9.315  -7.114  1.00 1.22  ? 65   PHE A CA   2  
ATOM   4219  C C    . PHE A 1 65  ? -10.226 -8.624  -7.692  1.00 1.19  ? 65   PHE A C    2  
ATOM   4220  O O    . PHE A 1 65  ? -10.941 -7.931  -6.970  1.00 1.22  ? 65   PHE A O    2  
ATOM   4221  C CB   . PHE A 1 65  ? -7.723  -8.465  -7.376  1.00 1.47  ? 65   PHE A CB   2  
ATOM   4222  C CG   . PHE A 1 65  ? -7.653  -7.833  -8.742  1.00 1.41  ? 65   PHE A CG   2  
ATOM   4223  C CD1  . PHE A 1 65  ? -7.330  -8.584  -9.857  1.00 1.98  ? 65   PHE A CD1  2  
ATOM   4224  C CD2  . PHE A 1 65  ? -7.911  -6.481  -8.902  1.00 1.67  ? 65   PHE A CD2  2  
ATOM   4225  C CE1  . PHE A 1 65  ? -7.267  -8.001  -11.109 1.00 2.59  ? 65   PHE A CE1  2  
ATOM   4226  C CE2  . PHE A 1 65  ? -7.850  -5.892  -10.148 1.00 2.44  ? 65   PHE A CE2  2  
ATOM   4227  C CZ   . PHE A 1 65  ? -7.527  -6.654  -11.255 1.00 2.81  ? 65   PHE A CZ   2  
ATOM   4228  H H    . PHE A 1 65  ? -7.913  -10.961 -7.949  1.00 1.17  ? 65   PHE A H    2  
ATOM   4229  H HA   . PHE A 1 65  ? -9.115  -9.381  -6.044  1.00 1.22  ? 65   PHE A HA   2  
ATOM   4230  H HB2  . PHE A 1 65  ? -7.683  -7.670  -6.648  1.00 1.77  ? 65   PHE A HB2  2  
ATOM   4231  H HB3  . PHE A 1 65  ? -6.850  -9.091  -7.256  1.00 2.14  ? 65   PHE A HB3  2  
ATOM   4232  H HD1  . PHE A 1 65  ? -7.128  -9.640  -9.745  1.00 2.28  ? 65   PHE A HD1  2  
ATOM   4233  H HD2  . PHE A 1 65  ? -8.163  -5.885  -8.037  1.00 1.72  ? 65   PHE A HD2  2  
ATOM   4234  H HE1  . PHE A 1 65  ? -7.013  -8.599  -11.971 1.00 3.15  ? 65   PHE A HE1  2  
ATOM   4235  H HE2  . PHE A 1 65  ? -8.054  -4.838  -10.259 1.00 2.98  ? 65   PHE A HE2  2  
ATOM   4236  H HZ   . PHE A 1 65  ? -7.478  -6.196  -12.232 1.00 3.52  ? 65   PHE A HZ   2  
ATOM   4237  N N    . SER A 1 66  ? -10.498 -8.820  -8.975  1.00 1.20  ? 66   SER A N    2  
ATOM   4238  C CA   . SER A 1 66  ? -11.623 -8.153  -9.617  1.00 1.24  ? 66   SER A CA   2  
ATOM   4239  C C    . SER A 1 66  ? -12.876 -9.018  -9.526  1.00 1.13  ? 66   SER A C    2  
ATOM   4240  O O    . SER A 1 66  ? -13.965 -8.525  -9.236  1.00 1.16  ? 66   SER A O    2  
ATOM   4241  C CB   . SER A 1 66  ? -11.295 -7.834  -11.078 1.00 1.45  ? 66   SER A CB   2  
ATOM   4242  O OG   . SER A 1 66  ? -12.331 -7.083  -11.690 1.00 2.19  ? 66   SER A OG   2  
ATOM   4243  H H    . SER A 1 66  ? -9.945  -9.444  -9.498  1.00 1.21  ? 66   SER A H    2  
ATOM   4244  H HA   . SER A 1 66  ? -11.803 -7.229  -9.088  1.00 1.29  ? 66   SER A HA   2  
ATOM   4245  H HB2  . SER A 1 66  ? -10.381 -7.262  -11.121 1.00 1.81  ? 66   SER A HB2  2  
ATOM   4246  H HB3  . SER A 1 66  ? -11.165 -8.757  -11.624 1.00 1.57  ? 66   SER A HB3  2  
ATOM   4247  H HG   . SER A 1 66  ? -12.861 -6.642  -11.000 1.00 2.59  ? 66   SER A HG   2  
ATOM   4248  N N    . ASP A 1 67  ? -12.703 -10.315 -9.756  1.00 1.09  ? 67   ASP A N    2  
ATOM   4249  C CA   . ASP A 1 67  ? -13.802 -11.282 -9.687  1.00 1.08  ? 67   ASP A CA   2  
ATOM   4250  C C    . ASP A 1 67  ? -14.442 -11.284 -8.299  1.00 0.97  ? 67   ASP A C    2  
ATOM   4251  O O    . ASP A 1 67  ? -15.634 -11.556 -8.137  1.00 1.01  ? 67   ASP A O    2  
ATOM   4252  C CB   . ASP A 1 67  ? -13.267 -12.675 -10.027 1.00 1.18  ? 67   ASP A CB   2  
ATOM   4253  C CG   . ASP A 1 67  ? -14.282 -13.776 -9.799  1.00 1.86  ? 67   ASP A CG   2  
ATOM   4254  O OD1  . ASP A 1 67  ? -15.214 -13.913 -10.617 1.00 2.06  ? 67   ASP A OD1  2  
ATOM   4255  O OD2  . ASP A 1 67  ? -14.138 -14.526 -8.810  1.00 2.72  ? 67   ASP A OD2  2  
ATOM   4256  H H    . ASP A 1 67  ? -11.801 -10.638 -9.981  1.00 1.12  ? 67   ASP A H    2  
ATOM   4257  H HA   . ASP A 1 67  ? -14.544 -10.999 -10.418 1.00 1.16  ? 67   ASP A HA   2  
ATOM   4258  H HB2  . ASP A 1 67  ? -12.974 -12.694 -11.065 1.00 1.30  ? 67   ASP A HB2  2  
ATOM   4259  H HB3  . ASP A 1 67  ? -12.402 -12.878 -9.412  1.00 1.39  ? 67   ASP A HB3  2  
ATOM   4260  N N    . LEU A 1 68  ? -13.632 -10.949 -7.309  1.00 0.89  ? 68   LEU A N    2  
ATOM   4261  C CA   . LEU A 1 68  ? -14.046 -10.912 -5.916  1.00 0.85  ? 68   LEU A CA   2  
ATOM   4262  C C    . LEU A 1 68  ? -15.146 -9.894  -5.642  1.00 0.76  ? 68   LEU A C    2  
ATOM   4263  O O    . LEU A 1 68  ? -15.797 -9.972  -4.607  1.00 0.77  ? 68   LEU A O    2  
ATOM   4264  C CB   . LEU A 1 68  ? -12.836 -10.622 -5.028  1.00 0.91  ? 68   LEU A CB   2  
ATOM   4265  C CG   . LEU A 1 68  ? -12.212 -11.846 -4.358  1.00 1.06  ? 68   LEU A CG   2  
ATOM   4266  C CD1  . LEU A 1 68  ? -12.163 -13.022 -5.314  1.00 1.54  ? 68   LEU A CD1  2  
ATOM   4267  C CD2  . LEU A 1 68  ? -10.829 -11.517 -3.835  1.00 1.56  ? 68   LEU A CD2  2  
ATOM   4268  H H    . LEU A 1 68  ? -12.695 -10.735 -7.522  1.00 0.92  ? 68   LEU A H    2  
ATOM   4269  H HA   . LEU A 1 68  ? -14.421 -11.892 -5.666  1.00 0.96  ? 68   LEU A HA   2  
ATOM   4270  H HB2  . LEU A 1 68  ? -12.079 -10.146 -5.636  1.00 1.15  ? 68   LEU A HB2  2  
ATOM   4271  H HB3  . LEU A 1 68  ? -13.140 -9.932  -4.257  1.00 1.11  ? 68   LEU A HB3  2  
ATOM   4272  H HG   . LEU A 1 68  ? -12.820 -12.137 -3.524  1.00 1.87  ? 68   LEU A HG   2  
ATOM   4273  H HD11 . LEU A 1 68  ? -13.173 -13.320 -5.557  1.00 2.00  ? 68   LEU A HD11 2  
ATOM   4274  H HD12 . LEU A 1 68  ? -11.645 -13.845 -4.848  1.00 2.00  ? 68   LEU A HD12 2  
ATOM   4275  H HD13 . LEU A 1 68  ? -11.646 -12.732 -6.216  1.00 2.16  ? 68   LEU A HD13 2  
ATOM   4276  H HD21 . LEU A 1 68  ? -10.901 -10.715 -3.115  1.00 1.93  ? 68   LEU A HD21 2  
ATOM   4277  H HD22 . LEU A 1 68  ? -10.198 -11.210 -4.655  1.00 2.25  ? 68   LEU A HD22 2  
ATOM   4278  H HD23 . LEU A 1 68  ? -10.407 -12.389 -3.360  1.00 1.99  ? 68   LEU A HD23 2  
ATOM   4279  N N    . THR A 1 69  ? -15.365 -8.944  -6.542  1.00 0.70  ? 69   THR A N    2  
ATOM   4280  C CA   . THR A 1 69  ? -16.338 -7.882  -6.290  1.00 0.62  ? 69   THR A CA   2  
ATOM   4281  C C    . THR A 1 69  ? -17.752 -8.427  -6.133  1.00 0.63  ? 69   THR A C    2  
ATOM   4282  O O    . THR A 1 69  ? -18.601 -7.792  -5.511  1.00 0.60  ? 69   THR A O    2  
ATOM   4283  C CB   . THR A 1 69  ? -16.326 -6.810  -7.386  1.00 0.62  ? 69   THR A CB   2  
ATOM   4284  O OG1  . THR A 1 69  ? -16.301 -7.423  -8.681  1.00 0.69  ? 69   THR A OG1  2  
ATOM   4285  C CG2  . THR A 1 69  ? -15.133 -5.895  -7.211  1.00 0.63  ? 69   THR A CG2  2  
ATOM   4286  H H    . THR A 1 69  ? -14.878 -8.961  -7.396  1.00 0.73  ? 69   THR A H    2  
ATOM   4287  H HA   . THR A 1 69  ? -16.058 -7.406  -5.361  1.00 0.59  ? 69   THR A HA   2  
ATOM   4288  H HB   . THR A 1 69  ? -17.226 -6.220  -7.295  1.00 0.61  ? 69   THR A HB   2  
ATOM   4289  H HG1  . THR A 1 69  ? -15.390 -7.444  -9.014  1.00 0.77  ? 69   THR A HG1  2  
ATOM   4290  H HG21 . THR A 1 69  ? -14.243 -6.484  -7.048  1.00 1.26  ? 69   THR A HG21 2  
ATOM   4291  H HG22 . THR A 1 69  ? -15.301 -5.242  -6.362  1.00 1.12  ? 69   THR A HG22 2  
ATOM   4292  H HG23 . THR A 1 69  ? -15.008 -5.295  -8.102  1.00 1.21  ? 69   THR A HG23 2  
ATOM   4293  N N    . SER A 1 70  ? -17.995 -9.606  -6.683  1.00 0.72  ? 70   SER A N    2  
ATOM   4294  C CA   . SER A 1 70  ? -19.267 -10.276 -6.498  1.00 0.80  ? 70   SER A CA   2  
ATOM   4295  C C    . SER A 1 70  ? -19.312 -10.877 -5.102  1.00 0.76  ? 70   SER A C    2  
ATOM   4296  O O    . SER A 1 70  ? -20.352 -10.902 -4.446  1.00 0.76  ? 70   SER A O    2  
ATOM   4297  C CB   . SER A 1 70  ? -19.443 -11.377 -7.537  1.00 0.96  ? 70   SER A CB   2  
ATOM   4298  O OG   . SER A 1 70  ? -20.785 -11.834 -7.577  1.00 1.34  ? 70   SER A OG   2  
ATOM   4299  H H    . SER A 1 70  ? -17.303 -10.030 -7.237  1.00 0.77  ? 70   SER A H    2  
ATOM   4300  H HA   . SER A 1 70  ? -20.056 -9.546  -6.601  1.00 0.83  ? 70   SER A HA   2  
ATOM   4301  H HB2  . SER A 1 70  ? -19.171 -10.996 -8.511  1.00 1.16  ? 70   SER A HB2  2  
ATOM   4302  H HB3  . SER A 1 70  ? -18.797 -12.207 -7.282  1.00 1.25  ? 70   SER A HB3  2  
ATOM   4303  H HG   . SER A 1 70  ? -20.797 -12.795 -7.697  1.00 1.80  ? 70   SER A HG   2  
ATOM   4304  N N    . GLN A 1 71  ? -18.152 -11.337 -4.657  1.00 0.77  ? 71   GLN A N    2  
ATOM   4305  C CA   . GLN A 1 71  ? -18.003 -11.938 -3.344  1.00 0.77  ? 71   GLN A CA   2  
ATOM   4306  C C    . GLN A 1 71  ? -18.167 -10.874 -2.269  1.00 0.67  ? 71   GLN A C    2  
ATOM   4307  O O    . GLN A 1 71  ? -18.896 -11.061 -1.296  1.00 0.74  ? 71   GLN A O    2  
ATOM   4308  C CB   . GLN A 1 71  ? -16.624 -12.587 -3.225  1.00 0.81  ? 71   GLN A CB   2  
ATOM   4309  C CG   . GLN A 1 71  ? -16.248 -13.439 -4.414  1.00 0.99  ? 71   GLN A CG   2  
ATOM   4310  C CD   . GLN A 1 71  ? -15.081 -14.354 -4.118  1.00 1.09  ? 71   GLN A CD   2  
ATOM   4311  O OE1  . GLN A 1 71  ? -14.951 -15.423 -4.707  1.00 1.31  ? 71   GLN A OE1  2  
ATOM   4312  N NE2  . GLN A 1 71  ? -14.229 -13.948 -3.186  1.00 1.42  ? 71   GLN A NE2  2  
ATOM   4313  H H    . GLN A 1 71  ? -17.364 -11.263 -5.234  1.00 0.83  ? 71   GLN A H    2  
ATOM   4314  H HA   . GLN A 1 71  ? -18.767 -12.689 -3.224  1.00 0.86  ? 71   GLN A HA   2  
ATOM   4315  H HB2  . GLN A 1 71  ? -15.877 -11.809 -3.136  1.00 0.73  ? 71   GLN A HB2  2  
ATOM   4316  H HB3  . GLN A 1 71  ? -16.599 -13.206 -2.344  1.00 0.90  ? 71   GLN A HB3  2  
ATOM   4317  H HG2  . GLN A 1 71  ? -17.098 -14.038 -4.704  1.00 1.41  ? 71   GLN A HG2  2  
ATOM   4318  H HG3  . GLN A 1 71  ? -15.971 -12.779 -5.227  1.00 1.35  ? 71   GLN A HG3  2  
ATOM   4319  H HE21 . GLN A 1 71  ? -14.402 -13.088 -2.739  1.00 1.32  ? 71   GLN A HE21 2  
ATOM   4320  H HE22 . GLN A 1 71  ? -13.452 -14.512 -2.997  1.00 1.89  ? 71   GLN A HE22 2  
ATOM   4321  N N    . LEU A 1 72  ? -17.482 -9.753  -2.462  1.00 0.59  ? 72   LEU A N    2  
ATOM   4322  C CA   . LEU A 1 72  ? -17.587 -8.627  -1.548  1.00 0.55  ? 72   LEU A CA   2  
ATOM   4323  C C    . LEU A 1 72  ? -18.953 -7.970  -1.682  1.00 0.47  ? 72   LEU A C    2  
ATOM   4324  O O    . LEU A 1 72  ? -19.510 -7.476  -0.707  1.00 0.48  ? 72   LEU A O    2  
ATOM   4325  C CB   . LEU A 1 72  ? -16.504 -7.582  -1.847  1.00 0.59  ? 72   LEU A CB   2  
ATOM   4326  C CG   . LEU A 1 72  ? -15.056 -8.059  -1.722  1.00 0.76  ? 72   LEU A CG   2  
ATOM   4327  C CD1  . LEU A 1 72  ? -14.328 -7.909  -3.049  1.00 1.37  ? 72   LEU A CD1  2  
ATOM   4328  C CD2  . LEU A 1 72  ? -14.332 -7.282  -0.635  1.00 1.35  ? 72   LEU A CD2  2  
ATOM   4329  H H    . LEU A 1 72  ? -16.885 -9.686  -3.241  1.00 0.60  ? 72   LEU A H    2  
ATOM   4330  H HA   . LEU A 1 72  ? -17.463 -8.992  -0.542  1.00 0.62  ? 72   LEU A HA   2  
ATOM   4331  H HB2  . LEU A 1 72  ? -16.652 -7.227  -2.858  1.00 0.55  ? 72   LEU A HB2  2  
ATOM   4332  H HB3  . LEU A 1 72  ? -16.644 -6.751  -1.172  1.00 0.70  ? 72   LEU A HB3  2  
ATOM   4333  H HG   . LEU A 1 72  ? -15.047 -9.104  -1.450  1.00 1.69  ? 72   LEU A HG   2  
ATOM   4334  H HD11 . LEU A 1 72  ? -14.466 -6.904  -3.427  1.00 1.90  ? 72   LEU A HD11 2  
ATOM   4335  H HD12 . LEU A 1 72  ? -14.727 -8.624  -3.760  1.00 1.96  ? 72   LEU A HD12 2  
ATOM   4336  H HD13 . LEU A 1 72  ? -13.275 -8.096  -2.905  1.00 1.98  ? 72   LEU A HD13 2  
ATOM   4337  H HD21 . LEU A 1 72  ? -14.321 -6.232  -0.892  1.00 1.79  ? 72   LEU A HD21 2  
ATOM   4338  H HD22 . LEU A 1 72  ? -13.318 -7.642  -0.551  1.00 1.93  ? 72   LEU A HD22 2  
ATOM   4339  H HD23 . LEU A 1 72  ? -14.842 -7.417  0.306   1.00 1.96  ? 72   LEU A HD23 2  
ATOM   4340  N N    . HIS A 1 73  ? -19.498 -8.011  -2.893  1.00 0.48  ? 73   HIS A N    2  
ATOM   4341  C CA   . HIS A 1 73  ? -20.723 -7.289  -3.222  1.00 0.48  ? 73   HIS A CA   2  
ATOM   4342  C C    . HIS A 1 73  ? -20.487 -5.798  -3.014  1.00 0.43  ? 73   HIS A C    2  
ATOM   4343  O O    . HIS A 1 73  ? -21.066 -5.163  -2.134  1.00 0.52  ? 73   HIS A O    2  
ATOM   4344  C CB   . HIS A 1 73  ? -21.914 -7.795  -2.398  1.00 0.55  ? 73   HIS A CB   2  
ATOM   4345  C CG   . HIS A 1 73  ? -23.231 -7.194  -2.790  1.00 1.20  ? 73   HIS A CG   2  
ATOM   4346  N ND1  . HIS A 1 73  ? -23.840 -6.187  -2.076  1.00 2.06  ? 73   HIS A ND1  2  
ATOM   4347  C CD2  . HIS A 1 73  ? -24.059 -7.470  -3.826  1.00 1.97  ? 73   HIS A CD2  2  
ATOM   4348  C CE1  . HIS A 1 73  ? -24.982 -5.869  -2.652  1.00 2.72  ? 73   HIS A CE1  2  
ATOM   4349  N NE2  . HIS A 1 73  ? -25.141 -6.631  -3.717  1.00 2.62  ? 73   HIS A NE2  2  
ATOM   4350  H H    . HIS A 1 73  ? -19.055 -8.533  -3.594  1.00 0.53  ? 73   HIS A H    2  
ATOM   4351  H HA   . HIS A 1 73  ? -20.921 -7.456  -4.272  1.00 0.56  ? 73   HIS A HA   2  
ATOM   4352  H HB2  . HIS A 1 73  ? -21.992 -8.864  -2.512  1.00 1.05  ? 73   HIS A HB2  2  
ATOM   4353  H HB3  . HIS A 1 73  ? -21.739 -7.561  -1.357  1.00 0.86  ? 73   HIS A HB3  2  
ATOM   4354  H HD1  . HIS A 1 73  ? -23.483 -5.768  -1.252  1.00 2.50  ? 73   HIS A HD1  2  
ATOM   4355  H HD2  . HIS A 1 73  ? -23.898 -8.213  -4.594  1.00 2.48  ? 73   HIS A HD2  2  
ATOM   4356  H HE1  . HIS A 1 73  ? -25.671 -5.109  -2.310  1.00 3.54  ? 73   HIS A HE1  2  
ATOM   4357  H HE2  . HIS A 1 73  ? -25.994 -6.744  -4.204  1.00 3.26  ? 73   HIS A HE2  2  
ATOM   4358  N N    . ILE A 1 74  ? -19.576 -5.281  -3.818  1.00 0.45  ? 74   ILE A N    2  
ATOM   4359  C CA   . ILE A 1 74  ? -19.175 -3.886  -3.773  1.00 0.41  ? 74   ILE A CA   2  
ATOM   4360  C C    . ILE A 1 74  ? -20.351 -2.961  -4.055  1.00 0.49  ? 74   ILE A C    2  
ATOM   4361  O O    . ILE A 1 74  ? -20.913 -2.955  -5.152  1.00 0.91  ? 74   ILE A O    2  
ATOM   4362  C CB   . ILE A 1 74  ? -18.047 -3.654  -4.788  1.00 0.38  ? 74   ILE A CB   2  
ATOM   4363  C CG1  . ILE A 1 74  ? -16.870 -4.560  -4.437  1.00 0.36  ? 74   ILE A CG1  2  
ATOM   4364  C CG2  . ILE A 1 74  ? -17.615 -2.201  -4.804  1.00 0.44  ? 74   ILE A CG2  2  
ATOM   4365  C CD1  . ILE A 1 74  ? -16.171 -4.171  -3.155  1.00 0.39  ? 74   ILE A CD1  2  
ATOM   4366  H H    . ILE A 1 74  ? -19.148 -5.869  -4.471  1.00 0.57  ? 74   ILE A H    2  
ATOM   4367  H HA   . ILE A 1 74  ? -18.792 -3.678  -2.786  1.00 0.40  ? 74   ILE A HA   2  
ATOM   4368  H HB   . ILE A 1 74  ? -18.412 -3.912  -5.770  1.00 0.44  ? 74   ILE A HB   2  
ATOM   4369  H HG12 . ILE A 1 74  ? -17.228 -5.566  -4.320  1.00 0.38  ? 74   ILE A HG12 2  
ATOM   4370  H HG13 . ILE A 1 74  ? -16.152 -4.538  -5.235  1.00 0.36  ? 74   ILE A HG13 2  
ATOM   4371  H HG21 . ILE A 1 74  ? -18.446 -1.580  -5.097  1.00 0.98  ? 74   ILE A HG21 2  
ATOM   4372  H HG22 . ILE A 1 74  ? -16.804 -2.081  -5.512  1.00 1.15  ? 74   ILE A HG22 2  
ATOM   4373  H HG23 . ILE A 1 74  ? -17.277 -1.916  -3.818  1.00 1.08  ? 74   ILE A HG23 2  
ATOM   4374  H HD11 . ILE A 1 74  ? -15.437 -4.920  -2.902  1.00 1.10  ? 74   ILE A HD11 2  
ATOM   4375  H HD12 . ILE A 1 74  ? -16.900 -4.092  -2.355  1.00 1.13  ? 74   ILE A HD12 2  
ATOM   4376  H HD13 . ILE A 1 74  ? -15.680 -3.216  -3.292  1.00 1.05  ? 74   ILE A HD13 2  
ATOM   4377  N N    . THR A 1 75  ? -20.710 -2.187  -3.048  1.00 0.38  ? 75   THR A N    2  
ATOM   4378  C CA   . THR A 1 75  ? -21.911 -1.380  -3.073  1.00 0.40  ? 75   THR A CA   2  
ATOM   4379  C C    . THR A 1 75  ? -21.712 -0.196  -2.092  1.00 0.37  ? 75   THR A C    2  
ATOM   4380  O O    . THR A 1 75  ? -20.577 0.019   -1.660  1.00 0.34  ? 75   THR A O    2  
ATOM   4381  C CB   . THR A 1 75  ? -23.112 -2.301  -2.693  1.00 0.46  ? 75   THR A CB   2  
ATOM   4382  O OG1  . THR A 1 75  ? -24.316 -1.901  -3.364  1.00 0.51  ? 75   THR A OG1  2  
ATOM   4383  C CG2  . THR A 1 75  ? -23.345 -2.335  -1.187  1.00 0.46  ? 75   THR A CG2  2  
ATOM   4384  H H    . THR A 1 75  ? -20.139 -2.150  -2.252  1.00 0.63  ? 75   THR A H    2  
ATOM   4385  H HA   . THR A 1 75  ? -22.055 -1.002  -4.075  1.00 0.42  ? 75   THR A HA   2  
ATOM   4386  H HB   . THR A 1 75  ? -22.869 -3.305  -3.012  1.00 0.48  ? 75   THR A HB   2  
ATOM   4387  H HG1  . THR A 1 75  ? -24.091 -1.480  -4.210  1.00 0.93  ? 75   THR A HG1  2  
ATOM   4388  H HG21 . THR A 1 75  ? -23.559 -1.334  -0.837  1.00 1.10  ? 75   THR A HG21 2  
ATOM   4389  H HG22 . THR A 1 75  ? -22.459 -2.707  -0.695  1.00 1.12  ? 75   THR A HG22 2  
ATOM   4390  H HG23 . THR A 1 75  ? -24.180 -2.982  -0.965  1.00 1.04  ? 75   THR A HG23 2  
ATOM   4391  N N    . PRO A 1 76  ? -22.753 0.635   -1.802  1.00 0.38  ? 76   PRO A N    2  
ATOM   4392  C CA   . PRO A 1 76  ? -22.784 1.593   -0.683  1.00 0.37  ? 76   PRO A CA   2  
ATOM   4393  C C    . PRO A 1 76  ? -21.988 1.168   0.561   1.00 0.35  ? 76   PRO A C    2  
ATOM   4394  O O    . PRO A 1 76  ? -21.565 0.023   0.677   1.00 0.35  ? 76   PRO A O    2  
ATOM   4395  C CB   . PRO A 1 76  ? -24.280 1.688   -0.353  1.00 0.42  ? 76   PRO A CB   2  
ATOM   4396  C CG   . PRO A 1 76  ? -25.009 1.079   -1.514  1.00 0.47  ? 76   PRO A CG   2  
ATOM   4397  C CD   . PRO A 1 76  ? -23.984 0.782   -2.575  1.00 0.44  ? 76   PRO A CD   2  
ATOM   4398  H HA   . PRO A 1 76  ? -22.431 2.564   -0.996  1.00 0.37  ? 76   PRO A HA   2  
ATOM   4399  H HB2  . PRO A 1 76  ? -24.478 1.145   0.558   1.00 0.42  ? 76   PRO A HB2  2  
ATOM   4400  H HB3  . PRO A 1 76  ? -24.551 2.725   -0.221  1.00 0.45  ? 76   PRO A HB3  2  
ATOM   4401  H HG2  . PRO A 1 76  ? -25.493 0.167   -1.202  1.00 0.52  ? 76   PRO A HG2  2  
ATOM   4402  H HG3  . PRO A 1 76  ? -25.741 1.778   -1.890  1.00 0.53  ? 76   PRO A HG3  2  
ATOM   4403  H HD2  . PRO A 1 76  ? -24.228 -0.132  -3.093  1.00 0.46  ? 76   PRO A HD2  2  
ATOM   4404  H HD3  . PRO A 1 76  ? -23.909 1.604   -3.265  1.00 0.44  ? 76   PRO A HD3  2  
ATOM   4405  N N    . GLY A 1 77  ? -21.796 2.141   1.465   1.00 0.36  ? 77   GLY A N    2  
ATOM   4406  C CA   . GLY A 1 77  ? -20.964 2.019   2.678   1.00 0.37  ? 77   GLY A CA   2  
ATOM   4407  C C    . GLY A 1 77  ? -20.846 0.637   3.311   1.00 0.38  ? 77   GLY A C    2  
ATOM   4408  O O    . GLY A 1 77  ? -19.848 0.348   3.973   1.00 0.40  ? 77   GLY A O    2  
ATOM   4409  H H    . GLY A 1 77  ? -22.251 2.998   1.309   1.00 0.38  ? 77   GLY A H    2  
ATOM   4410  H HA2  . GLY A 1 77  ? -19.970 2.356   2.438   1.00 0.35  ? 77   GLY A HA2  2  
ATOM   4411  H HA3  . GLY A 1 77  ? -21.375 2.688   3.421   1.00 0.41  ? 77   GLY A HA3  2  
ATOM   4412  N N    . THR A 1 78  ? -21.840 -0.210  3.133   1.00 0.40  ? 78   THR A N    2  
ATOM   4413  C CA   . THR A 1 78  ? -21.797 -1.557  3.658   1.00 0.42  ? 78   THR A CA   2  
ATOM   4414  C C    . THR A 1 78  ? -20.747 -2.418  2.942   1.00 0.38  ? 78   THR A C    2  
ATOM   4415  O O    . THR A 1 78  ? -20.546 -3.580  3.289   1.00 0.40  ? 78   THR A O    2  
ATOM   4416  C CB   . THR A 1 78  ? -23.183 -2.203  3.570   1.00 0.49  ? 78   THR A CB   2  
ATOM   4417  O OG1  . THR A 1 78  ? -23.710 -2.046  2.244   1.00 0.50  ? 78   THR A OG1  2  
ATOM   4418  C CG2  . THR A 1 78  ? -24.114 -1.547  4.573   1.00 0.56  ? 78   THR A CG2  2  
ATOM   4419  H H    . THR A 1 78  ? -22.617 0.071   2.606   1.00 0.41  ? 78   THR A H    2  
ATOM   4420  H HA   . THR A 1 78  ? -21.529 -1.488  4.703   1.00 0.46  ? 78   THR A HA   2  
ATOM   4421  H HB   . THR A 1 78  ? -23.099 -3.254  3.803   1.00 0.49  ? 78   THR A HB   2  
ATOM   4422  H HG1  . THR A 1 78  ? -24.287 -2.794  2.032   1.00 0.80  ? 78   THR A HG1  2  
ATOM   4423  H HG21 . THR A 1 78  ? -24.129 -0.478  4.398   1.00 1.12  ? 78   THR A HG21 2  
ATOM   4424  H HG22 . THR A 1 78  ? -23.757 -1.742  5.572   1.00 1.22  ? 78   THR A HG22 2  
ATOM   4425  H HG23 . THR A 1 78  ? -25.111 -1.946  4.458   1.00 1.14  ? 78   THR A HG23 2  
ATOM   4426  N N    . ALA A 1 79  ? -20.053 -1.826  1.967   1.00 0.34  ? 79   ALA A N    2  
ATOM   4427  C CA   . ALA A 1 79  ? -18.899 -2.465  1.347   1.00 0.31  ? 79   ALA A CA   2  
ATOM   4428  C C    . ALA A 1 79  ? -17.745 -2.505  2.336   1.00 0.30  ? 79   ALA A C    2  
ATOM   4429  O O    . ALA A 1 79  ? -16.767 -3.222  2.146   1.00 0.31  ? 79   ALA A O    2  
ATOM   4430  C CB   . ALA A 1 79  ? -18.484 -1.736  0.075   1.00 0.32  ? 79   ALA A CB   2  
ATOM   4431  H H    . ALA A 1 79  ? -20.340 -0.940  1.645   1.00 0.36  ? 79   ALA A H    2  
ATOM   4432  H HA   . ALA A 1 79  ? -19.174 -3.478  1.085   1.00 0.33  ? 79   ALA A HA   2  
ATOM   4433  H HB1  . ALA A 1 79  ? -17.993 -0.809  0.338   1.00 1.07  ? 79   ALA A HB1  2  
ATOM   4434  H HB2  . ALA A 1 79  ? -19.361 -1.523  -0.517  1.00 1.03  ? 79   ALA A HB2  2  
ATOM   4435  H HB3  . ALA A 1 79  ? -17.802 -2.359  -0.496  1.00 1.05  ? 79   ALA A HB3  2  
ATOM   4436  N N    . TYR A 1 80  ? -17.874 -1.721  3.399   1.00 0.33  ? 80   TYR A N    2  
ATOM   4437  C CA   . TYR A 1 80  ? -16.922 -1.750  4.496   1.00 0.36  ? 80   TYR A CA   2  
ATOM   4438  C C    . TYR A 1 80  ? -17.120 -3.013  5.305   1.00 0.36  ? 80   TYR A C    2  
ATOM   4439  O O    . TYR A 1 80  ? -16.199 -3.507  5.935   1.00 0.38  ? 80   TYR A O    2  
ATOM   4440  C CB   . TYR A 1 80  ? -17.100 -0.513  5.382   1.00 0.44  ? 80   TYR A CB   2  
ATOM   4441  C CG   . TYR A 1 80  ? -16.533 -0.666  6.777   1.00 1.15  ? 80   TYR A CG   2  
ATOM   4442  C CD1  . TYR A 1 80  ? -15.162 -0.617  6.992   1.00 1.69  ? 80   TYR A CD1  2  
ATOM   4443  C CD2  . TYR A 1 80  ? -17.362 -0.848  7.875   1.00 2.21  ? 80   TYR A CD2  2  
ATOM   4444  C CE1  . TYR A 1 80  ? -14.635 -0.748  8.260   1.00 2.52  ? 80   TYR A CE1  2  
ATOM   4445  C CE2  . TYR A 1 80  ? -16.841 -0.978  9.147   1.00 3.13  ? 80   TYR A CE2  2  
ATOM   4446  C CZ   . TYR A 1 80  ? -15.507 -0.964  9.340   1.00 3.12  ? 80   TYR A CZ   2  
ATOM   4447  O OH   . TYR A 1 80  ? -14.954 -1.057  10.597  1.00 4.13  ? 80   TYR A OH   2  
ATOM   4448  H H    . TYR A 1 80  ? -18.644 -1.109  3.450   1.00 0.35  ? 80   TYR A H    2  
ATOM   4449  H HA   . TYR A 1 80  ? -15.924 -1.760  4.080   1.00 0.36  ? 80   TYR A HA   2  
ATOM   4450  H HB2  . TYR A 1 80  ? -16.607 0.325   4.917   1.00 1.09  ? 80   TYR A HB2  2  
ATOM   4451  H HB3  . TYR A 1 80  ? -18.154 -0.296  5.475   1.00 0.85  ? 80   TYR A HB3  2  
ATOM   4452  H HD1  . TYR A 1 80  ? -14.503 -0.475  6.148   1.00 1.99  ? 80   TYR A HD1  2  
ATOM   4453  H HD2  . TYR A 1 80  ? -18.430 -0.889  7.724   1.00 2.57  ? 80   TYR A HD2  2  
ATOM   4454  H HE1  . TYR A 1 80  ? -13.566 -0.709  8.407   1.00 3.04  ? 80   TYR A HE1  2  
ATOM   4455  H HE2  . TYR A 1 80  ? -17.503 -1.120  9.989   1.00 4.05  ? 80   TYR A HE2  2  
ATOM   4456  H HH   . TYR A 1 80  ? -14.230 -0.415  10.711  1.00 4.31  ? 80   TYR A HH   2  
ATOM   4457  N N    . GLN A 1 81  ? -18.330 -3.537  5.262   1.00 0.37  ? 81   GLN A N    2  
ATOM   4458  C CA   . GLN A 1 81  ? -18.644 -4.778  5.946   1.00 0.41  ? 81   GLN A CA   2  
ATOM   4459  C C    . GLN A 1 81  ? -18.177 -5.943  5.098   1.00 0.41  ? 81   GLN A C    2  
ATOM   4460  O O    . GLN A 1 81  ? -17.778 -6.995  5.600   1.00 0.46  ? 81   GLN A O    2  
ATOM   4461  C CB   . GLN A 1 81  ? -20.143 -4.860  6.221   1.00 0.45  ? 81   GLN A CB   2  
ATOM   4462  C CG   . GLN A 1 81  ? -20.631 -3.753  7.141   1.00 0.58  ? 81   GLN A CG   2  
ATOM   4463  C CD   . GLN A 1 81  ? -22.127 -3.784  7.383   1.00 0.68  ? 81   GLN A CD   2  
ATOM   4464  O OE1  . GLN A 1 81  ? -22.753 -4.845  7.379   1.00 1.03  ? 81   GLN A OE1  2  
ATOM   4465  N NE2  . GLN A 1 81  ? -22.709 -2.616  7.594   1.00 0.79  ? 81   GLN A NE2  2  
ATOM   4466  H H    . GLN A 1 81  ? -19.029 -3.081  4.744   1.00 0.36  ? 81   GLN A H    2  
ATOM   4467  H HA   . GLN A 1 81  ? -18.105 -4.787  6.875   1.00 0.44  ? 81   GLN A HA   2  
ATOM   4468  H HB2  . GLN A 1 81  ? -20.676 -4.784  5.285   1.00 0.45  ? 81   GLN A HB2  2  
ATOM   4469  H HB3  . GLN A 1 81  ? -20.363 -5.810  6.676   1.00 0.47  ? 81   GLN A HB3  2  
ATOM   4470  H HG2  . GLN A 1 81  ? -20.129 -3.850  8.093   1.00 0.67  ? 81   GLN A HG2  2  
ATOM   4471  H HG3  . GLN A 1 81  ? -20.375 -2.801  6.700   1.00 0.63  ? 81   GLN A HG3  2  
ATOM   4472  H HE21 . GLN A 1 81  ? -22.148 -1.808  7.576   1.00 1.01  ? 81   GLN A HE21 2  
ATOM   4473  H HE22 . GLN A 1 81  ? -23.677 -2.603  7.770   1.00 0.89  ? 81   GLN A HE22 2  
ATOM   4474  N N    . SER A 1 82  ? -18.236 -5.721  3.808   1.00 0.39  ? 82   SER A N    2  
ATOM   4475  C CA   . SER A 1 82  ? -17.650 -6.609  2.824   1.00 0.41  ? 82   SER A CA   2  
ATOM   4476  C C    . SER A 1 82  ? -16.135 -6.655  2.999   1.00 0.41  ? 82   SER A C    2  
ATOM   4477  O O    . SER A 1 82  ? -15.541 -7.719  3.157   1.00 0.48  ? 82   SER A O    2  
ATOM   4478  C CB   . SER A 1 82  ? -17.991 -6.084  1.434   1.00 0.41  ? 82   SER A CB   2  
ATOM   4479  O OG   . SER A 1 82  ? -19.371 -5.782  1.336   1.00 0.43  ? 82   SER A OG   2  
ATOM   4480  H H    . SER A 1 82  ? -18.720 -4.933  3.499   1.00 0.39  ? 82   SER A H    2  
ATOM   4481  H HA   . SER A 1 82  ? -18.064 -7.598  2.954   1.00 0.44  ? 82   SER A HA   2  
ATOM   4482  H HB2  . SER A 1 82  ? -17.424 -5.184  1.243   1.00 0.41  ? 82   SER A HB2  2  
ATOM   4483  H HB3  . SER A 1 82  ? -17.742 -6.826  0.694   1.00 0.42  ? 82   SER A HB3  2  
ATOM   4484  H HG   . SER A 1 82  ? -19.742 -6.236  0.566   1.00 0.43  ? 82   SER A HG   2  
ATOM   4485  N N    . PHE A 1 83  ? -15.524 -5.475  2.983   1.00 0.38  ? 83   PHE A N    2  
ATOM   4486  C CA   . PHE A 1 83  ? -14.085 -5.346  3.142   1.00 0.37  ? 83   PHE A CA   2  
ATOM   4487  C C    . PHE A 1 83  ? -13.668 -5.675  4.574   1.00 0.38  ? 83   PHE A C    2  
ATOM   4488  O O    . PHE A 1 83  ? -12.504 -5.959  4.851   1.00 0.39  ? 83   PHE A O    2  
ATOM   4489  C CB   . PHE A 1 83  ? -13.633 -3.939  2.739   1.00 0.36  ? 83   PHE A CB   2  
ATOM   4490  C CG   . PHE A 1 83  ? -12.142 -3.748  2.783   1.00 0.56  ? 83   PHE A CG   2  
ATOM   4491  C CD1  . PHE A 1 83  ? -11.336 -4.206  1.754   1.00 0.79  ? 83   PHE A CD1  2  
ATOM   4492  C CD2  . PHE A 1 83  ? -11.548 -3.099  3.853   1.00 0.75  ? 83   PHE A CD2  2  
ATOM   4493  C CE1  . PHE A 1 83  ? -9.968  -4.022  1.793   1.00 1.07  ? 83   PHE A CE1  2  
ATOM   4494  C CE2  . PHE A 1 83  ? -10.180 -2.914  3.897   1.00 1.05  ? 83   PHE A CE2  2  
ATOM   4495  C CZ   . PHE A 1 83  ? -9.384  -3.412  2.860   1.00 1.18  ? 83   PHE A CZ   2  
ATOM   4496  H H    . PHE A 1 83  ? -16.062 -4.662  2.847   1.00 0.37  ? 83   PHE A H    2  
ATOM   4497  H HA   . PHE A 1 83  ? -13.623 -6.058  2.480   1.00 0.40  ? 83   PHE A HA   2  
ATOM   4498  H HB2  . PHE A 1 83  ? -13.961 -3.752  1.732   1.00 0.49  ? 83   PHE A HB2  2  
ATOM   4499  H HB3  . PHE A 1 83  ? -14.087 -3.212  3.393   1.00 0.41  ? 83   PHE A HB3  2  
ATOM   4500  H HD1  . PHE A 1 83  ? -11.787 -4.713  0.914   1.00 0.86  ? 83   PHE A HD1  2  
ATOM   4501  H HD2  . PHE A 1 83  ? -12.166 -2.737  4.662   1.00 0.78  ? 83   PHE A HD2  2  
ATOM   4502  H HE1  . PHE A 1 83  ? -9.350  -4.385  0.984   1.00 1.29  ? 83   PHE A HE1  2  
ATOM   4503  H HE2  . PHE A 1 83  ? -9.731  -2.407  4.738   1.00 1.26  ? 83   PHE A HE2  2  
ATOM   4504  H HZ   . PHE A 1 83  ? -8.312  -3.281  2.890   1.00 1.44  ? 83   PHE A HZ   2  
ATOM   4505  N N    . GLU A 1 84  ? -14.632 -5.635  5.474   1.00 0.41  ? 84   GLU A N    2  
ATOM   4506  C CA   . GLU A 1 84  ? -14.407 -5.997  6.868   1.00 0.48  ? 84   GLU A CA   2  
ATOM   4507  C C    . GLU A 1 84  ? -13.914 -7.424  6.971   1.00 0.52  ? 84   GLU A C    2  
ATOM   4508  O O    . GLU A 1 84  ? -12.927 -7.707  7.644   1.00 0.55  ? 84   GLU A O    2  
ATOM   4509  C CB   . GLU A 1 84  ? -15.696 -5.877  7.667   1.00 0.55  ? 84   GLU A CB   2  
ATOM   4510  C CG   . GLU A 1 84  ? -15.562 -6.353  9.094   1.00 0.62  ? 84   GLU A CG   2  
ATOM   4511  C CD   . GLU A 1 84  ? -16.837 -6.190  9.890   1.00 0.71  ? 84   GLU A CD   2  
ATOM   4512  O OE1  . GLU A 1 84  ? -17.852 -6.812  9.522   1.00 0.78  ? 84   GLU A OE1  2  
ATOM   4513  O OE2  . GLU A 1 84  ? -16.829 -5.445  10.892  1.00 0.80  ? 84   GLU A OE2  2  
ATOM   4514  H H    . GLU A 1 84  ? -15.525 -5.349  5.192   1.00 0.40  ? 84   GLU A H    2  
ATOM   4515  H HA   . GLU A 1 84  ? -13.664 -5.326  7.275   1.00 0.48  ? 84   GLU A HA   2  
ATOM   4516  H HB2  . GLU A 1 84  ? -16.004 -4.852  7.677   1.00 0.56  ? 84   GLU A HB2  2  
ATOM   4517  H HB3  . GLU A 1 84  ? -16.457 -6.468  7.185   1.00 0.57  ? 84   GLU A HB3  2  
ATOM   4518  H HG2  . GLU A 1 84  ? -15.292 -7.399  9.087   1.00 0.64  ? 84   GLU A HG2  2  
ATOM   4519  H HG3  . GLU A 1 84  ? -14.779 -5.787  9.566   1.00 0.63  ? 84   GLU A HG3  2  
ATOM   4520  N N    . GLN A 1 85  ? -14.642 -8.308  6.306   1.00 0.57  ? 85   GLN A N    2  
ATOM   4521  C CA   . GLN A 1 85  ? -14.287 -9.721  6.201   1.00 0.65  ? 85   GLN A CA   2  
ATOM   4522  C C    . GLN A 1 85  ? -12.828 -9.882  5.822   1.00 0.64  ? 85   GLN A C    2  
ATOM   4523  O O    . GLN A 1 85  ? -12.154 -10.818 6.240   1.00 0.71  ? 85   GLN A O    2  
ATOM   4524  C CB   . GLN A 1 85  ? -15.164 -10.372 5.137   1.00 0.69  ? 85   GLN A CB   2  
ATOM   4525  C CG   . GLN A 1 85  ? -16.632 -10.126 5.379   1.00 0.79  ? 85   GLN A CG   2  
ATOM   4526  C CD   . GLN A 1 85  ? -17.545 -10.728 4.331   1.00 1.13  ? 85   GLN A CD   2  
ATOM   4527  O OE1  . GLN A 1 85  ? -17.196 -10.824 3.157   1.00 1.44  ? 85   GLN A OE1  2  
ATOM   4528  N NE2  . GLN A 1 85  ? -18.727 -11.143 4.755   1.00 1.62  ? 85   GLN A NE2  2  
ATOM   4529  H H    . GLN A 1 85  ? -15.471 -8.000  5.882   1.00 0.56  ? 85   GLN A H    2  
ATOM   4530  H HA   . GLN A 1 85  ? -14.465 -10.190 7.152   1.00 0.72  ? 85   GLN A HA   2  
ATOM   4531  H HB2  . GLN A 1 85  ? -14.904 -9.958  4.172   1.00 0.74  ? 85   GLN A HB2  2  
ATOM   4532  H HB3  . GLN A 1 85  ? -14.985 -11.435 5.129   1.00 0.91  ? 85   GLN A HB3  2  
ATOM   4533  H HG2  . GLN A 1 85  ? -16.892 -10.528 6.338   1.00 1.13  ? 85   GLN A HG2  2  
ATOM   4534  H HG3  . GLN A 1 85  ? -16.785 -9.065  5.391   1.00 1.03  ? 85   GLN A HG3  2  
ATOM   4535  H HE21 . GLN A 1 85  ? -18.936 -11.043 5.713   1.00 1.78  ? 85   GLN A HE21 2  
ATOM   4536  H HE22 . GLN A 1 85  ? -19.348 -11.530 4.100   1.00 1.99  ? 85   GLN A HE22 2  
ATOM   4537  N N    . VAL A 1 86  ? -12.358 -8.933  5.048   1.00 0.58  ? 86   VAL A N    2  
ATOM   4538  C CA   . VAL A 1 86  ? -11.015 -8.956  4.529   1.00 0.62  ? 86   VAL A CA   2  
ATOM   4539  C C    . VAL A 1 86  ? -10.034 -8.387  5.540   1.00 0.55  ? 86   VAL A C    2  
ATOM   4540  O O    . VAL A 1 86  ? -9.048  -9.033  5.896   1.00 0.59  ? 86   VAL A O    2  
ATOM   4541  C CB   . VAL A 1 86  ? -10.909 -8.124  3.254   1.00 0.70  ? 86   VAL A CB   2  
ATOM   4542  C CG1  . VAL A 1 86  ? -9.782  -8.664  2.422   1.00 1.13  ? 86   VAL A CG1  2  
ATOM   4543  C CG2  . VAL A 1 86  ? -12.214 -8.134  2.478   1.00 1.30  ? 86   VAL A CG2  2  
ATOM   4544  H H    . VAL A 1 86  ? -12.940 -8.182  4.825   1.00 0.55  ? 86   VAL A H    2  
ATOM   4545  H HA   . VAL A 1 86  ? -10.750 -9.976  4.299   1.00 0.70  ? 86   VAL A HA   2  
ATOM   4546  H HB   . VAL A 1 86  ? -10.676 -7.104  3.526   1.00 1.43  ? 86   VAL A HB   2  
ATOM   4547  H HG11 . VAL A 1 86  ? -9.626  -8.032  1.564   1.00 1.61  ? 86   VAL A HG11 2  
ATOM   4548  H HG12 . VAL A 1 86  ? -10.048 -9.670  2.094   1.00 1.74  ? 86   VAL A HG12 2  
ATOM   4549  H HG13 . VAL A 1 86  ? -8.878  -8.706  3.021   1.00 1.76  ? 86   VAL A HG13 2  
ATOM   4550  H HG21 . VAL A 1 86  ? -13.042 -8.274  3.168   1.00 1.79  ? 86   VAL A HG21 2  
ATOM   4551  H HG22 . VAL A 1 86  ? -12.198 -8.931  1.759   1.00 1.90  ? 86   VAL A HG22 2  
ATOM   4552  H HG23 . VAL A 1 86  ? -12.334 -7.190  1.966   1.00 1.83  ? 86   VAL A HG23 2  
ATOM   4553  N N    . VAL A 1 87  ? -10.310 -7.167  5.992   1.00 0.51  ? 87   VAL A N    2  
ATOM   4554  C CA   . VAL A 1 87  ? -9.423  -6.470  6.912   1.00 0.51  ? 87   VAL A CA   2  
ATOM   4555  C C    . VAL A 1 87  ? -9.282  -7.266  8.203   1.00 0.56  ? 87   VAL A C    2  
ATOM   4556  O O    . VAL A 1 87  ? -8.245  -7.236  8.863   1.00 0.60  ? 87   VAL A O    2  
ATOM   4557  C CB   . VAL A 1 87  ? -9.925  -5.037  7.219   1.00 0.54  ? 87   VAL A CB   2  
ATOM   4558  C CG1  . VAL A 1 87  ? -11.194 -5.048  8.063   1.00 0.75  ? 87   VAL A CG1  2  
ATOM   4559  C CG2  . VAL A 1 87  ? -8.832  -4.223  7.890   1.00 0.85  ? 87   VAL A CG2  2  
ATOM   4560  H H    . VAL A 1 87  ? -11.145 -6.726  5.706   1.00 0.50  ? 87   VAL A H    2  
ATOM   4561  H HA   . VAL A 1 87  ? -8.451  -6.397  6.441   1.00 0.53  ? 87   VAL A HA   2  
ATOM   4562  H HB   . VAL A 1 87  ? -10.167 -4.565  6.280   1.00 0.77  ? 87   VAL A HB   2  
ATOM   4563  H HG11 . VAL A 1 87  ? -10.997 -5.547  9.001   1.00 1.28  ? 87   VAL A HG11 2  
ATOM   4564  H HG12 . VAL A 1 87  ? -11.976 -5.572  7.533   1.00 1.30  ? 87   VAL A HG12 2  
ATOM   4565  H HG13 . VAL A 1 87  ? -11.507 -4.032  8.255   1.00 1.40  ? 87   VAL A HG13 2  
ATOM   4566  H HG21 . VAL A 1 87  ? -9.201  -3.229  8.101   1.00 1.36  ? 87   VAL A HG21 2  
ATOM   4567  H HG22 . VAL A 1 87  ? -7.975  -4.158  7.233   1.00 1.39  ? 87   VAL A HG22 2  
ATOM   4568  H HG23 . VAL A 1 87  ? -8.542  -4.702  8.813   1.00 1.43  ? 87   VAL A HG23 2  
ATOM   4569  N N    . ASN A 1 88  ? -10.339 -7.997  8.522   1.00 0.61  ? 88   ASN A N    2  
ATOM   4570  C CA   . ASN A 1 88  ? -10.366 -8.889  9.666   1.00 0.71  ? 88   ASN A CA   2  
ATOM   4571  C C    . ASN A 1 88  ? -9.258  -9.926  9.565   1.00 0.78  ? 88   ASN A C    2  
ATOM   4572  O O    . ASN A 1 88  ? -8.476  -10.103 10.497  1.00 0.91  ? 88   ASN A O    2  
ATOM   4573  C CB   . ASN A 1 88  ? -11.725 -9.571  9.739   1.00 0.73  ? 88   ASN A CB   2  
ATOM   4574  C CG   . ASN A 1 88  ? -12.570 -9.062  10.890  1.00 0.78  ? 88   ASN A CG   2  
ATOM   4575  O OD1  . ASN A 1 88  ? -12.543 -9.616  11.989  1.00 0.87  ? 88   ASN A OD1  2  
ATOM   4576  N ND2  . ASN A 1 88  ? -13.332 -8.008  10.646  1.00 0.73  ? 88   ASN A ND2  2  
ATOM   4577  H H    . ASN A 1 88  ? -11.143 -7.926  7.960   1.00 0.61  ? 88   ASN A H    2  
ATOM   4578  H HA   . ASN A 1 88  ? -10.221 -8.299  10.557  1.00 0.76  ? 88   ASN A HA   2  
ATOM   4579  H HB2  . ASN A 1 88  ? -12.252 -9.379  8.817   1.00 0.68  ? 88   ASN A HB2  2  
ATOM   4580  H HB3  . ASN A 1 88  ? -11.589 -10.632 9.850   1.00 0.79  ? 88   ASN A HB3  2  
ATOM   4581  H HD21 . ASN A 1 88  ? -13.316 -7.619  9.744   1.00 0.66  ? 88   ASN A HD21 2  
ATOM   4582  H HD22 . ASN A 1 88  ? -13.879 -7.648  11.384  1.00 0.78  ? 88   ASN A HD22 2  
ATOM   4583  N N    . GLU A 1 89  ? -9.170  -10.581 8.412   1.00 0.75  ? 89   GLU A N    2  
ATOM   4584  C CA   . GLU A 1 89  ? -8.162  -11.593 8.173   1.00 0.84  ? 89   GLU A CA   2  
ATOM   4585  C C    . GLU A 1 89  ? -6.804  -10.961 8.210   1.00 0.82  ? 89   GLU A C    2  
ATOM   4586  O O    . GLU A 1 89  ? -5.853  -11.477 8.799   1.00 0.98  ? 89   GLU A O    2  
ATOM   4587  C CB   . GLU A 1 89  ? -8.333  -12.177 6.782   1.00 0.87  ? 89   GLU A CB   2  
ATOM   4588  C CG   . GLU A 1 89  ? -9.690  -12.749 6.502   1.00 1.25  ? 89   GLU A CG   2  
ATOM   4589  C CD   . GLU A 1 89  ? -10.183 -13.669 7.602   1.00 2.21  ? 89   GLU A CD   2  
ATOM   4590  O OE1  . GLU A 1 89  ? -9.567  -14.736 7.821   1.00 2.58  ? 89   GLU A OE1  2  
ATOM   4591  O OE2  . GLU A 1 89  ? -11.181 -13.321 8.269   1.00 2.87  ? 89   GLU A OE2  2  
ATOM   4592  H H    . GLU A 1 89  ? -9.782  -10.356 7.681   1.00 0.71  ? 89   GLU A H    2  
ATOM   4593  H HA   . GLU A 1 89  ? -8.242  -12.369 8.917   1.00 0.91  ? 89   GLU A HA   2  
ATOM   4594  H HB2  . GLU A 1 89  ? -8.152  -11.394 6.062   1.00 1.01  ? 89   GLU A HB2  2  
ATOM   4595  H HB3  . GLU A 1 89  ? -7.602  -12.953 6.635   1.00 1.09  ? 89   GLU A HB3  2  
ATOM   4596  H HG2  . GLU A 1 89  ? -10.384 -11.938 6.386   1.00 1.39  ? 89   GLU A HG2  2  
ATOM   4597  H HG3  . GLU A 1 89  ? -9.626  -13.299 5.584   1.00 1.35  ? 89   GLU A HG3  2  
ATOM   4598  N N    . LEU A 1 90  ? -6.763  -9.813  7.578   1.00 0.69  ? 90   LEU A N    2  
ATOM   4599  C CA   . LEU A 1 90  ? -5.541  -9.158  7.218   1.00 0.64  ? 90   LEU A CA   2  
ATOM   4600  C C    . LEU A 1 90  ? -4.646  -8.865  8.426   1.00 0.70  ? 90   LEU A C    2  
ATOM   4601  O O    . LEU A 1 90  ? -3.426  -8.774  8.289   1.00 0.80  ? 90   LEU A O    2  
ATOM   4602  C CB   . LEU A 1 90  ? -5.895  -7.869  6.487   1.00 0.56  ? 90   LEU A CB   2  
ATOM   4603  C CG   . LEU A 1 90  ? -5.254  -7.673  5.116   1.00 0.67  ? 90   LEU A CG   2  
ATOM   4604  C CD1  . LEU A 1 90  ? -4.927  -8.984  4.445   1.00 1.25  ? 90   LEU A CD1  2  
ATOM   4605  C CD2  . LEU A 1 90  ? -6.185  -6.884  4.229   1.00 1.28  ? 90   LEU A CD2  2  
ATOM   4606  H H    . LEU A 1 90  ? -7.616  -9.384  7.326   1.00 0.65  ? 90   LEU A H    2  
ATOM   4607  H HA   . LEU A 1 90  ? -5.030  -9.816  6.532   1.00 0.66  ? 90   LEU A HA   2  
ATOM   4608  H HB2  . LEU A 1 90  ? -6.967  -7.840  6.362   1.00 0.73  ? 90   LEU A HB2  2  
ATOM   4609  H HB3  . LEU A 1 90  ? -5.605  -7.039  7.114   1.00 0.77  ? 90   LEU A HB3  2  
ATOM   4610  H HG   . LEU A 1 90  ? -4.345  -7.129  5.226   1.00 1.55  ? 90   LEU A HG   2  
ATOM   4611  H HD11 . LEU A 1 90  ? -4.257  -9.546  5.072   1.00 1.79  ? 90   LEU A HD11 2  
ATOM   4612  H HD12 . LEU A 1 90  ? -4.452  -8.783  3.494   1.00 1.83  ? 90   LEU A HD12 2  
ATOM   4613  H HD13 . LEU A 1 90  ? -5.838  -9.538  4.286   1.00 1.78  ? 90   LEU A HD13 2  
ATOM   4614  H HD21 . LEU A 1 90  ? -5.746  -6.783  3.248   1.00 1.76  ? 90   LEU A HD21 2  
ATOM   4615  H HD22 . LEU A 1 90  ? -6.352  -5.907  4.658   1.00 1.82  ? 90   LEU A HD22 2  
ATOM   4616  H HD23 . LEU A 1 90  ? -7.125  -7.413  4.153   1.00 1.92  ? 90   LEU A HD23 2  
ATOM   4617  N N    . PHE A 1 91  ? -5.244  -8.740  9.610   1.00 0.73  ? 91   PHE A N    2  
ATOM   4618  C CA   . PHE A 1 91  ? -4.480  -8.345  10.792  1.00 0.82  ? 91   PHE A CA   2  
ATOM   4619  C C    . PHE A 1 91  ? -4.251  -9.513  11.742  1.00 0.91  ? 91   PHE A C    2  
ATOM   4620  O O    . PHE A 1 91  ? -3.330  -9.495  12.556  1.00 1.06  ? 91   PHE A O    2  
ATOM   4621  C CB   . PHE A 1 91  ? -5.167  -7.183  11.528  1.00 0.88  ? 91   PHE A CB   2  
ATOM   4622  C CG   . PHE A 1 91  ? -6.416  -7.539  12.302  1.00 1.04  ? 91   PHE A CG   2  
ATOM   4623  C CD1  . PHE A 1 91  ? -6.336  -8.130  13.555  1.00 1.26  ? 91   PHE A CD1  2  
ATOM   4624  C CD2  . PHE A 1 91  ? -7.669  -7.261  11.782  1.00 1.70  ? 91   PHE A CD2  2  
ATOM   4625  C CE1  . PHE A 1 91  ? -7.479  -8.442  14.265  1.00 1.75  ? 91   PHE A CE1  2  
ATOM   4626  C CE2  . PHE A 1 91  ? -8.816  -7.568  12.489  1.00 2.30  ? 91   PHE A CE2  2  
ATOM   4627  C CZ   . PHE A 1 91  ? -8.721  -8.161  13.731  1.00 2.23  ? 91   PHE A CZ   2  
ATOM   4628  H H    . PHE A 1 91  ? -6.205  -8.924  9.688   1.00 0.72  ? 91   PHE A H    2  
ATOM   4629  H HA   . PHE A 1 91  ? -3.519  -8.007  10.447  1.00 0.82  ? 91   PHE A HA   2  
ATOM   4630  H HB2  . PHE A 1 91  ? -4.468  -6.744  12.221  1.00 1.16  ? 91   PHE A HB2  2  
ATOM   4631  H HB3  . PHE A 1 91  ? -5.442  -6.446  10.795  1.00 1.18  ? 91   PHE A HB3  2  
ATOM   4632  H HD1  . PHE A 1 91  ? -5.366  -8.351  13.974  1.00 1.47  ? 91   PHE A HD1  2  
ATOM   4633  H HD2  . PHE A 1 91  ? -7.746  -6.802  10.808  1.00 1.96  ? 91   PHE A HD2  2  
ATOM   4634  H HE1  . PHE A 1 91  ? -7.401  -8.906  15.238  1.00 2.04  ? 91   PHE A HE1  2  
ATOM   4635  H HE2  . PHE A 1 91  ? -9.785  -7.345  12.070  1.00 2.97  ? 91   PHE A HE2  2  
ATOM   4636  H HZ   . PHE A 1 91  ? -9.616  -8.403  14.286  1.00 2.76  ? 91   PHE A HZ   2  
ATOM   4637  N N    . ARG A 1 92  ? -5.085  -10.520 11.646  1.00 0.96  ? 92   ARG A N    2  
ATOM   4638  C CA   . ARG A 1 92  ? -5.009  -11.641 12.574  1.00 1.11  ? 92   ARG A CA   2  
ATOM   4639  C C    . ARG A 1 92  ? -4.163  -12.773 12.006  1.00 0.83  ? 92   ARG A C    2  
ATOM   4640  O O    . ARG A 1 92  ? -3.532  -13.529 12.742  1.00 0.90  ? 92   ARG A O    2  
ATOM   4641  C CB   . ARG A 1 92  ? -6.411  -12.159 12.876  1.00 1.53  ? 92   ARG A CB   2  
ATOM   4642  C CG   . ARG A 1 92  ? -6.922  -13.149 11.847  1.00 1.62  ? 92   ARG A CG   2  
ATOM   4643  C CD   . ARG A 1 92  ? -8.341  -12.844 11.439  1.00 2.21  ? 92   ARG A CD   2  
ATOM   4644  N NE   . ARG A 1 92  ? -9.310  -13.200 12.470  1.00 3.27  ? 92   ARG A NE   2  
ATOM   4645  C CZ   . ARG A 1 92  ? -10.627 -13.121 12.308  1.00 4.05  ? 92   ARG A CZ   2  
ATOM   4646  N NH1  . ARG A 1 92  ? -11.133 -12.784 11.131  1.00 3.96  ? 92   ARG A NH1  2  
ATOM   4647  N NH2  . ARG A 1 92  ? -11.438 -13.410 13.316  1.00 5.06  ? 92   ARG A NH2  2  
ATOM   4648  H H    . ARG A 1 92  ? -5.776  -10.502 10.950  1.00 0.99  ? 92   ARG A H    2  
ATOM   4649  H HA   . ARG A 1 92  ? -4.560  -11.286 13.486  1.00 1.30  ? 92   ARG A HA   2  
ATOM   4650  H HB2  . ARG A 1 92  ? -6.412  -12.637 13.843  1.00 1.76  ? 92   ARG A HB2  2  
ATOM   4651  H HB3  . ARG A 1 92  ? -7.084  -11.320 12.894  1.00 1.84  ? 92   ARG A HB3  2  
ATOM   4652  H HG2  . ARG A 1 92  ? -6.290  -13.102 10.973  1.00 1.69  ? 92   ARG A HG2  2  
ATOM   4653  H HG3  . ARG A 1 92  ? -6.884  -14.144 12.267  1.00 1.81  ? 92   ARG A HG3  2  
ATOM   4654  H HD2  . ARG A 1 92  ? -8.418  -11.783 11.247  1.00 2.25  ? 92   ARG A HD2  2  
ATOM   4655  H HD3  . ARG A 1 92  ? -8.559  -13.380 10.535  1.00 2.27  ? 92   ARG A HD3  2  
ATOM   4656  H HE   . ARG A 1 92  ? -8.955  -13.498 13.347  1.00 3.54  ? 92   ARG A HE   2  
ATOM   4657  H HH11 . ARG A 1 92  ? -10.528 -12.591 10.358  1.00 3.34  ? 92   ARG A HH11 2  
ATOM   4658  H HH12 . ARG A 1 92  ? -12.130 -12.720 11.005  1.00 4.64  ? 92   ARG A HH12 2  
ATOM   4659  H HH21 . ARG A 1 92  ? -11.059 -13.694 14.205  1.00 5.28  ? 92   ARG A HH21 2  
ATOM   4660  H HH22 . ARG A 1 92  ? -12.437 -13.338 13.202  1.00 5.67  ? 92   ARG A HH22 2  
ATOM   4661  N N    . ASP A 1 93  ? -4.159  -12.878 10.693  1.00 0.84  ? 93   ASP A N    2  
ATOM   4662  C CA   . ASP A 1 93  ? -3.599  -14.039 10.018  1.00 1.10  ? 93   ASP A CA   2  
ATOM   4663  C C    . ASP A 1 93  ? -2.116  -13.872 9.691   1.00 1.31  ? 93   ASP A C    2  
ATOM   4664  O O    . ASP A 1 93  ? -1.528  -14.722 9.025   1.00 1.88  ? 93   ASP A O    2  
ATOM   4665  C CB   . ASP A 1 93  ? -4.406  -14.318 8.741   1.00 1.65  ? 93   ASP A CB   2  
ATOM   4666  C CG   . ASP A 1 93  ? -3.929  -15.541 7.979   1.00 2.40  ? 93   ASP A CG   2  
ATOM   4667  O OD1  . ASP A 1 93  ? -4.043  -16.662 8.516   1.00 2.58  ? 93   ASP A OD1  2  
ATOM   4668  O OD2  . ASP A 1 93  ? -3.446  -15.387 6.836   1.00 3.12  ? 93   ASP A OD2  2  
ATOM   4669  H H    . ASP A 1 93  ? -4.566  -12.163 10.158  1.00 0.93  ? 93   ASP A H    2  
ATOM   4670  H HA   . ASP A 1 93  ? -3.709  -14.883 10.681  1.00 1.08  ? 93   ASP A HA   2  
ATOM   4671  H HB2  . ASP A 1 93  ? -5.441  -14.470 9.007   1.00 1.91  ? 93   ASP A HB2  2  
ATOM   4672  H HB3  . ASP A 1 93  ? -4.333  -13.460 8.087   1.00 1.73  ? 93   ASP A HB3  2  
ATOM   4673  N N    . GLY A 1 94  ? -1.471  -12.815 10.163  1.00 1.11  ? 94   GLY A N    2  
ATOM   4674  C CA   . GLY A 1 94  ? -0.084  -12.669 9.789   1.00 1.69  ? 94   GLY A CA   2  
ATOM   4675  C C    . GLY A 1 94  ? 0.273   -11.308 9.241   1.00 1.62  ? 94   GLY A C    2  
ATOM   4676  O O    . GLY A 1 94  ? 0.489   -11.179 8.040   1.00 2.31  ? 94   GLY A O    2  
ATOM   4677  H H    . GLY A 1 94  ? -1.916  -12.167 10.749  1.00 0.79  ? 94   GLY A H    2  
ATOM   4678  H HA2  . GLY A 1 94  ? 0.529   -12.864 10.655  1.00 1.93  ? 94   GLY A HA2  2  
ATOM   4679  H HA3  . GLY A 1 94  ? 0.134   -13.410 9.039   1.00 2.14  ? 94   GLY A HA3  2  
ATOM   4680  N N    . VAL A 1 95  ? 0.293   -10.280 10.075  1.00 0.85  ? 95   VAL A N    2  
ATOM   4681  C CA   . VAL A 1 95  ? 0.622   -8.947  9.580   1.00 0.67  ? 95   VAL A CA   2  
ATOM   4682  C C    . VAL A 1 95  ? 2.096   -8.836  9.232   1.00 0.62  ? 95   VAL A C    2  
ATOM   4683  O O    . VAL A 1 95  ? 2.970   -8.736  10.091  1.00 0.61  ? 95   VAL A O    2  
ATOM   4684  C CB   . VAL A 1 95  ? 0.277   -7.829  10.585  1.00 0.59  ? 95   VAL A CB   2  
ATOM   4685  C CG1  . VAL A 1 95  ? 0.580   -6.459  9.989   1.00 0.84  ? 95   VAL A CG1  2  
ATOM   4686  C CG2  . VAL A 1 95  ? -1.168  -7.917  11.022  1.00 1.06  ? 95   VAL A CG2  2  
ATOM   4687  H H    . VAL A 1 95  ? 0.075   -10.413 11.027  1.00 0.60  ? 95   VAL A H    2  
ATOM   4688  H HA   . VAL A 1 95  ? 0.060   -8.800  8.677   1.00 0.79  ? 95   VAL A HA   2  
ATOM   4689  H HB   . VAL A 1 95  ? 0.902   -7.957  11.458  1.00 0.99  ? 95   VAL A HB   2  
ATOM   4690  H HG11 . VAL A 1 95  ? 1.604   -6.437  9.646   1.00 1.32  ? 95   VAL A HG11 2  
ATOM   4691  H HG12 . VAL A 1 95  ? 0.436   -5.695  10.741  1.00 1.50  ? 95   VAL A HG12 2  
ATOM   4692  H HG13 . VAL A 1 95  ? -0.082  -6.273  9.155   1.00 1.39  ? 95   VAL A HG13 2  
ATOM   4693  H HG21 . VAL A 1 95  ? -1.339  -8.870  11.501  1.00 1.40  ? 95   VAL A HG21 2  
ATOM   4694  H HG22 . VAL A 1 95  ? -1.813  -7.825  10.160  1.00 1.68  ? 95   VAL A HG22 2  
ATOM   4695  H HG23 . VAL A 1 95  ? -1.382  -7.121  11.719  1.00 1.61  ? 95   VAL A HG23 2  
ATOM   4696  N N    . ASN A 1 96  ? 2.344   -8.920  7.941   1.00 0.76  ? 96   ASN A N    2  
ATOM   4697  C CA   . ASN A 1 96  ? 3.675   -8.795  7.380   1.00 0.86  ? 96   ASN A CA   2  
ATOM   4698  C C    . ASN A 1 96  ? 3.740   -7.500  6.592   1.00 0.72  ? 96   ASN A C    2  
ATOM   4699  O O    . ASN A 1 96  ? 2.742   -6.780  6.505   1.00 0.62  ? 96   ASN A O    2  
ATOM   4700  C CB   . ASN A 1 96  ? 3.983   -9.982  6.453   1.00 1.17  ? 96   ASN A CB   2  
ATOM   4701  C CG   . ASN A 1 96  ? 3.362   -11.289 6.925   1.00 1.47  ? 96   ASN A CG   2  
ATOM   4702  O OD1  . ASN A 1 96  ? 3.020   -12.153 6.116   1.00 2.12  ? 96   ASN A OD1  2  
ATOM   4703  N ND2  . ASN A 1 96  ? 3.207   -11.442 8.231   1.00 1.67  ? 96   ASN A ND2  2  
ATOM   4704  H H    . ASN A 1 96  ? 1.595   -9.074  7.338   1.00 0.86  ? 96   ASN A H    2  
ATOM   4705  H HA   . ASN A 1 96  ? 4.390   -8.765  8.189   1.00 0.91  ? 96   ASN A HA   2  
ATOM   4706  H HB2  . ASN A 1 96  ? 3.603   -9.765  5.467   1.00 1.53  ? 96   ASN A HB2  2  
ATOM   4707  H HB3  . ASN A 1 96  ? 5.055   -10.115 6.398   1.00 1.33  ? 96   ASN A HB3  2  
ATOM   4708  H HD21 . ASN A 1 96  ? 3.512   -10.717 8.823   1.00 1.78  ? 96   ASN A HD21 2  
ATOM   4709  H HD22 . ASN A 1 96  ? 2.736   -12.232 8.552   1.00 2.08  ? 96   ASN A HD22 2  
ATOM   4710  N N    . TRP A 1 97  ? 4.886   -7.210  5.998   1.00 0.77  ? 97   TRP A N    2  
ATOM   4711  C CA   . TRP A 1 97  ? 5.024   -6.021  5.170   1.00 0.72  ? 97   TRP A CA   2  
ATOM   4712  C C    . TRP A 1 97  ? 4.062   -6.065  3.984   1.00 0.63  ? 97   TRP A C    2  
ATOM   4713  O O    . TRP A 1 97  ? 3.279   -5.138  3.772   1.00 0.59  ? 97   TRP A O    2  
ATOM   4714  C CB   . TRP A 1 97  ? 6.464   -5.863  4.683   1.00 0.86  ? 97   TRP A CB   2  
ATOM   4715  C CG   . TRP A 1 97  ? 7.409   -5.394  5.751   1.00 0.68  ? 97   TRP A CG   2  
ATOM   4716  C CD1  . TRP A 1 97  ? 8.660   -5.876  6.010   1.00 0.83  ? 97   TRP A CD1  2  
ATOM   4717  C CD2  . TRP A 1 97  ? 7.173   -4.351  6.704   1.00 1.43  ? 97   TRP A CD2  2  
ATOM   4718  N NE1  . TRP A 1 97  ? 9.220   -5.189  7.061   1.00 0.99  ? 97   TRP A NE1  2  
ATOM   4719  C CE2  . TRP A 1 97  ? 8.324   -4.251  7.508   1.00 1.60  ? 97   TRP A CE2  2  
ATOM   4720  C CE3  . TRP A 1 97  ? 6.100   -3.490  6.958   1.00 2.29  ? 97   TRP A CE3  2  
ATOM   4721  C CZ2  . TRP A 1 97  ? 8.431   -3.327  8.543   1.00 2.54  ? 97   TRP A CZ2  2  
ATOM   4722  C CZ3  . TRP A 1 97  ? 6.207   -2.574  7.986   1.00 3.24  ? 97   TRP A CZ3  2  
ATOM   4723  C CH2  . TRP A 1 97  ? 7.365   -2.499  8.766   1.00 3.34  ? 97   TRP A CH2  2  
ATOM   4724  H H    . TRP A 1 97  ? 5.663   -7.808  6.123   1.00 0.88  ? 97   TRP A H    2  
ATOM   4725  H HA   . TRP A 1 97  ? 4.770   -5.168  5.783   1.00 0.72  ? 97   TRP A HA   2  
ATOM   4726  H HB2  . TRP A 1 97  ? 6.820   -6.815  4.318   1.00 1.09  ? 97   TRP A HB2  2  
ATOM   4727  H HB3  . TRP A 1 97  ? 6.487   -5.144  3.878   1.00 1.26  ? 97   TRP A HB3  2  
ATOM   4728  H HD1  . TRP A 1 97  ? 9.131   -6.674  5.456   1.00 1.43  ? 97   TRP A HD1  2  
ATOM   4729  H HE1  . TRP A 1 97  ? 10.118  -5.349  7.436   1.00 1.14  ? 97   TRP A HE1  2  
ATOM   4730  H HE3  . TRP A 1 97  ? 5.197   -3.533  6.365   1.00 2.29  ? 97   TRP A HE3  2  
ATOM   4731  H HZ2  . TRP A 1 97  ? 9.316   -3.255  9.157   1.00 2.71  ? 97   TRP A HZ2  2  
ATOM   4732  H HZ3  . TRP A 1 97  ? 5.388   -1.903  8.195   1.00 3.95  ? 97   TRP A HZ3  2  
ATOM   4733  H HH2  . TRP A 1 97  ? 7.404   -1.767  9.561   1.00 4.12  ? 97   TRP A HH2  2  
ATOM   4734  N N    . GLY A 1 98  ? 4.101   -7.162  3.237   1.00 0.69  ? 98   GLY A N    2  
ATOM   4735  C CA   . GLY A 1 98  ? 3.238   -7.307  2.079   1.00 0.69  ? 98   GLY A CA   2  
ATOM   4736  C C    . GLY A 1 98  ? 1.777   -7.479  2.455   1.00 0.62  ? 98   GLY A C    2  
ATOM   4737  O O    . GLY A 1 98  ? 0.888   -7.244  1.639   1.00 0.61  ? 98   GLY A O    2  
ATOM   4738  H H    . GLY A 1 98  ? 4.731   -7.885  3.470   1.00 0.78  ? 98   GLY A H    2  
ATOM   4739  H HA2  . GLY A 1 98  ? 3.338   -6.429  1.458   1.00 0.69  ? 98   GLY A HA2  2  
ATOM   4740  H HA3  . GLY A 1 98  ? 3.556   -8.171  1.513   1.00 0.80  ? 98   GLY A HA3  2  
ATOM   4741  N N    . ARG A 1 99  ? 1.533   -7.881  3.696   1.00 0.65  ? 99   ARG A N    2  
ATOM   4742  C CA   . ARG A 1 99  ? 0.172   -8.075  4.189   1.00 0.67  ? 99   ARG A CA   2  
ATOM   4743  C C    . ARG A 1 99  ? -0.548  -6.736  4.272   1.00 0.53  ? 99   ARG A C    2  
ATOM   4744  O O    . ARG A 1 99  ? -1.726  -6.620  3.938   1.00 0.55  ? 99   ARG A O    2  
ATOM   4745  C CB   . ARG A 1 99  ? 0.199   -8.716  5.574   1.00 0.82  ? 99   ARG A CB   2  
ATOM   4746  C CG   . ARG A 1 99  ? -1.157  -9.197  6.059   1.00 1.04  ? 99   ARG A CG   2  
ATOM   4747  C CD   . ARG A 1 99  ? -1.629  -10.408 5.276   1.00 1.50  ? 99   ARG A CD   2  
ATOM   4748  N NE   . ARG A 1 99  ? -0.733  -11.556 5.448   1.00 2.48  ? 99   ARG A NE   2  
ATOM   4749  C CZ   . ARG A 1 99  ? -1.133  -12.774 5.817   1.00 3.32  ? 99   ARG A CZ   2  
ATOM   4750  N NH1  . ARG A 1 99  ? -2.412  -13.003 6.088   1.00 3.44  ? 99   ARG A NH1  2  
ATOM   4751  N NH2  . ARG A 1 99  ? -0.247  -13.756 5.934   1.00 4.24  ? 99   ARG A NH2  2  
ATOM   4752  H H    . ARG A 1 99  ? 2.288   -8.042  4.299   1.00 0.70  ? 99   ARG A H    2  
ATOM   4753  H HA   . ARG A 1 99  ? -0.352  -8.722  3.503   1.00 0.74  ? 99   ARG A HA   2  
ATOM   4754  H HB2  . ARG A 1 99  ? 0.872   -9.559  5.557   1.00 1.58  ? 99   ARG A HB2  2  
ATOM   4755  H HB3  . ARG A 1 99  ? 0.568   -7.986  6.279   1.00 1.33  ? 99   ARG A HB3  2  
ATOM   4756  H HG2  . ARG A 1 99  ? -1.083  -9.463  7.104   1.00 1.48  ? 99   ARG A HG2  2  
ATOM   4757  H HG3  . ARG A 1 99  ? -1.876  -8.399  5.939   1.00 1.63  ? 99   ARG A HG3  2  
ATOM   4758  H HD2  . ARG A 1 99  ? -2.620  -10.677 5.610   1.00 1.65  ? 99   ARG A HD2  2  
ATOM   4759  H HD3  . ARG A 1 99  ? -1.660  -10.146 4.232   1.00 1.57  ? 99   ARG A HD3  2  
ATOM   4760  H HE   . ARG A 1 99  ? 0.223   -11.407 5.279   1.00 2.71  ? 99   ARG A HE   2  
ATOM   4761  H HH11 . ARG A 1 99  ? -3.080  -12.264 6.017   1.00 2.93  ? 99   ARG A HH11 2  
ATOM   4762  H HH12 . ARG A 1 99  ? -2.719  -13.931 6.363   1.00 4.20  ? 99   ARG A HH12 2  
ATOM   4763  H HH21 . ARG A 1 99  ? 0.723   -13.585 5.748   1.00 4.35  ? 99   ARG A HH21 2  
ATOM   4764  H HH22 . ARG A 1 99  ? -0.544  -14.678 6.207   1.00 4.91  ? 99   ARG A HH22 2  
ATOM   4765  N N    . ILE A 1 100 ? 0.178   -5.729  4.725   1.00 0.44  ? 100  ILE A N    2  
ATOM   4766  C CA   . ILE A 1 100 ? -0.367  -4.391  4.847   1.00 0.36  ? 100  ILE A CA   2  
ATOM   4767  C C    . ILE A 1 100 ? -0.545  -3.769  3.466   1.00 0.33  ? 100  ILE A C    2  
ATOM   4768  O O    . ILE A 1 100 ? -1.534  -3.088  3.202   1.00 0.34  ? 100  ILE A O    2  
ATOM   4769  C CB   . ILE A 1 100 ? 0.543   -3.514  5.723   1.00 0.32  ? 100  ILE A CB   2  
ATOM   4770  C CG1  . ILE A 1 100 ? 0.685   -4.151  7.106   1.00 0.33  ? 100  ILE A CG1  2  
ATOM   4771  C CG2  . ILE A 1 100 ? -0.022  -2.110  5.836   1.00 0.34  ? 100  ILE A CG2  2  
ATOM   4772  C CD1  . ILE A 1 100 ? 1.617   -3.405  8.028   1.00 0.34  ? 100  ILE A CD1  2  
ATOM   4773  H H    . ILE A 1 100 ? 1.110   -5.891  4.985   1.00 0.47  ? 100  ILE A H    2  
ATOM   4774  H HA   . ILE A 1 100 ? -1.332  -4.466  5.327   1.00 0.43  ? 100  ILE A HA   2  
ATOM   4775  H HB   . ILE A 1 100 ? 1.514   -3.454  5.257   1.00 0.34  ? 100  ILE A HB   2  
ATOM   4776  H HG12 . ILE A 1 100 ? -0.286  -4.188  7.578   1.00 0.37  ? 100  ILE A HG12 2  
ATOM   4777  H HG13 . ILE A 1 100 ? 1.062   -5.155  6.991   1.00 0.35  ? 100  ILE A HG13 2  
ATOM   4778  H HG21 . ILE A 1 100 ? -1.016  -2.154  6.254   1.00 0.97  ? 100  ILE A HG21 2  
ATOM   4779  H HG22 . ILE A 1 100 ? -0.062  -1.661  4.854   1.00 1.06  ? 100  ILE A HG22 2  
ATOM   4780  H HG23 . ILE A 1 100 ? 0.614   -1.518  6.477   1.00 1.06  ? 100  ILE A HG23 2  
ATOM   4781  H HD11 . ILE A 1 100 ? 1.639   -3.893  8.991   1.00 1.05  ? 100  ILE A HD11 2  
ATOM   4782  H HD12 . ILE A 1 100 ? 1.267   -2.391  8.146   1.00 1.11  ? 100  ILE A HD12 2  
ATOM   4783  H HD13 . ILE A 1 100 ? 2.611   -3.396  7.605   1.00 1.07  ? 100  ILE A HD13 2  
ATOM   4784  N N    . VAL A 1 101 ? 0.421   -4.020  2.589   1.00 0.33  ? 101  VAL A N    2  
ATOM   4785  C CA   . VAL A 1 101 ? 0.312   -3.634  1.184   1.00 0.35  ? 101  VAL A CA   2  
ATOM   4786  C C    . VAL A 1 101 ? -0.975  -4.176  0.589   1.00 0.37  ? 101  VAL A C    2  
ATOM   4787  O O    . VAL A 1 101 ? -1.697  -3.469  -0.108  1.00 0.45  ? 101  VAL A O    2  
ATOM   4788  C CB   . VAL A 1 101 ? 1.487   -4.179  0.362   1.00 0.46  ? 101  VAL A CB   2  
ATOM   4789  C CG1  . VAL A 1 101 ? 1.390   -3.730  -1.087  1.00 1.35  ? 101  VAL A CG1  2  
ATOM   4790  C CG2  . VAL A 1 101 ? 2.797   -3.750  0.982   1.00 1.32  ? 101  VAL A CG2  2  
ATOM   4791  H H    . VAL A 1 101 ? 1.237   -4.465  2.899   1.00 0.36  ? 101  VAL A H    2  
ATOM   4792  H HA   . VAL A 1 101 ? 0.312   -2.556  1.121   1.00 0.36  ? 101  VAL A HA   2  
ATOM   4793  H HB   . VAL A 1 101 ? 1.443   -5.258  0.383   1.00 1.36  ? 101  VAL A HB   2  
ATOM   4794  H HG11 . VAL A 1 101 ? 2.270   -4.052  -1.622  1.00 1.85  ? 101  VAL A HG11 2  
ATOM   4795  H HG12 . VAL A 1 101 ? 1.319   -2.653  -1.125  1.00 1.99  ? 101  VAL A HG12 2  
ATOM   4796  H HG13 . VAL A 1 101 ? 0.511   -4.167  -1.544  1.00 1.94  ? 101  VAL A HG13 2  
ATOM   4797  H HG21 . VAL A 1 101 ? 2.831   -2.671  1.042   1.00 1.92  ? 101  VAL A HG21 2  
ATOM   4798  H HG22 . VAL A 1 101 ? 3.615   -4.107  0.376   1.00 1.70  ? 101  VAL A HG22 2  
ATOM   4799  H HG23 . VAL A 1 101 ? 2.869   -4.171  1.972   1.00 2.03  ? 101  VAL A HG23 2  
ATOM   4800  N N    . ALA A 1 102 ? -1.226  -5.450  0.854   1.00 0.37  ? 102  ALA A N    2  
ATOM   4801  C CA   . ALA A 1 102 ? -2.475  -6.096  0.455   1.00 0.39  ? 102  ALA A CA   2  
ATOM   4802  C C    . ALA A 1 102 ? -3.672  -5.260  0.867   1.00 0.35  ? 102  ALA A C    2  
ATOM   4803  O O    . ALA A 1 102 ? -4.540  -4.952  0.052   1.00 0.34  ? 102  ALA A O    2  
ATOM   4804  C CB   . ALA A 1 102 ? -2.581  -7.469  1.086   1.00 0.44  ? 102  ALA A CB   2  
ATOM   4805  H H    . ALA A 1 102 ? -0.536  -5.977  1.323   1.00 0.42  ? 102  ALA A H    2  
ATOM   4806  H HA   . ALA A 1 102 ? -2.471  -6.212  -0.618  1.00 0.41  ? 102  ALA A HA   2  
ATOM   4807  H HB1  . ALA A 1 102 ? -3.408  -8.004  0.644   1.00 1.06  ? 102  ALA A HB1  2  
ATOM   4808  H HB2  . ALA A 1 102 ? -2.748  -7.364  2.150   1.00 1.03  ? 102  ALA A HB2  2  
ATOM   4809  H HB3  . ALA A 1 102 ? -1.665  -8.009  0.916   1.00 1.04  ? 102  ALA A HB3  2  
ATOM   4810  N N    . PHE A 1 103 ? -3.693  -4.892  2.138   1.00 0.35  ? 103  PHE A N    2  
ATOM   4811  C CA   . PHE A 1 103 ? -4.746  -4.061  2.698   1.00 0.34  ? 103  PHE A CA   2  
ATOM   4812  C C    . PHE A 1 103 ? -4.900  -2.761  1.902   1.00 0.31  ? 103  PHE A C    2  
ATOM   4813  O O    . PHE A 1 103 ? -6.016  -2.361  1.572   1.00 0.32  ? 103  PHE A O    2  
ATOM   4814  C CB   . PHE A 1 103 ? -4.432  -3.794  4.174   1.00 0.36  ? 103  PHE A CB   2  
ATOM   4815  C CG   . PHE A 1 103 ? -5.275  -2.731  4.818   1.00 0.62  ? 103  PHE A CG   2  
ATOM   4816  C CD1  . PHE A 1 103 ? -6.590  -2.980  5.165   1.00 0.67  ? 103  PHE A CD1  2  
ATOM   4817  C CD2  . PHE A 1 103 ? -4.739  -1.482  5.086   1.00 1.03  ? 103  PHE A CD2  2  
ATOM   4818  C CE1  . PHE A 1 103 ? -7.357  -2.002  5.768   1.00 1.09  ? 103  PHE A CE1  2  
ATOM   4819  C CE2  . PHE A 1 103 ? -5.502  -0.501  5.687   1.00 1.48  ? 103  PHE A CE2  2  
ATOM   4820  C CZ   . PHE A 1 103 ? -6.813  -0.763  6.029   1.00 1.49  ? 103  PHE A CZ   2  
ATOM   4821  H H    . PHE A 1 103 ? -2.968  -5.195  2.728   1.00 0.38  ? 103  PHE A H    2  
ATOM   4822  H HA   . PHE A 1 103 ? -5.669  -4.616  2.633   1.00 0.38  ? 103  PHE A HA   2  
ATOM   4823  H HB2  . PHE A 1 103 ? -4.584  -4.714  4.729   1.00 0.52  ? 103  PHE A HB2  2  
ATOM   4824  H HB3  . PHE A 1 103 ? -3.396  -3.497  4.263   1.00 0.60  ? 103  PHE A HB3  2  
ATOM   4825  H HD1  . PHE A 1 103 ? -7.019  -3.950  4.960   1.00 0.52  ? 103  PHE A HD1  2  
ATOM   4826  H HD2  . PHE A 1 103 ? -3.712  -1.277  4.819   1.00 1.05  ? 103  PHE A HD2  2  
ATOM   4827  H HE1  . PHE A 1 103 ? -8.384  -2.209  6.034   1.00 1.14  ? 103  PHE A HE1  2  
ATOM   4828  H HE2  . PHE A 1 103 ? -5.073  0.469   5.890   1.00 1.84  ? 103  PHE A HE2  2  
ATOM   4829  H HZ   . PHE A 1 103 ? -7.413  0.002   6.500   1.00 1.84  ? 103  PHE A HZ   2  
ATOM   4830  N N    . PHE A 1 104 ? -3.782  -2.123  1.568   1.00 0.33  ? 104  PHE A N    2  
ATOM   4831  C CA   . PHE A 1 104 ? -3.811  -0.922  0.737   1.00 0.40  ? 104  PHE A CA   2  
ATOM   4832  C C    . PHE A 1 104 ? -4.325  -1.234  -0.661  1.00 0.39  ? 104  PHE A C    2  
ATOM   4833  O O    . PHE A 1 104 ? -5.133  -0.491  -1.211  1.00 0.47  ? 104  PHE A O    2  
ATOM   4834  C CB   . PHE A 1 104 ? -2.424  -0.292  0.630   1.00 0.56  ? 104  PHE A CB   2  
ATOM   4835  C CG   . PHE A 1 104 ? -1.958  0.359   1.893   1.00 0.97  ? 104  PHE A CG   2  
ATOM   4836  C CD1  . PHE A 1 104 ? -2.598  1.479   2.387   1.00 1.79  ? 104  PHE A CD1  2  
ATOM   4837  C CD2  . PHE A 1 104 ? -0.884  -0.160  2.591   1.00 1.47  ? 104  PHE A CD2  2  
ATOM   4838  C CE1  . PHE A 1 104 ? -2.172  2.074   3.555   1.00 2.90  ? 104  PHE A CE1  2  
ATOM   4839  C CE2  . PHE A 1 104 ? -0.455  0.428   3.761   1.00 2.61  ? 104  PHE A CE2  2  
ATOM   4840  C CZ   . PHE A 1 104 ? -1.092  1.580   4.223   1.00 3.29  ? 104  PHE A CZ   2  
ATOM   4841  H H    . PHE A 1 104 ? -2.919  -2.464  1.892   1.00 0.34  ? 104  PHE A H    2  
ATOM   4842  H HA   . PHE A 1 104 ? -4.481  -0.215  1.205   1.00 0.42  ? 104  PHE A HA   2  
ATOM   4843  H HB2  . PHE A 1 104 ? -1.709  -1.057  0.369   1.00 1.36  ? 104  PHE A HB2  2  
ATOM   4844  H HB3  . PHE A 1 104 ? -2.438  0.459   -0.146  1.00 1.38  ? 104  PHE A HB3  2  
ATOM   4845  H HD1  . PHE A 1 104 ? -3.437  1.892   1.848   1.00 1.71  ? 104  PHE A HD1  2  
ATOM   4846  H HD2  . PHE A 1 104 ? -0.378  -1.036  2.211   1.00 1.21  ? 104  PHE A HD2  2  
ATOM   4847  H HE1  . PHE A 1 104 ? -2.678  2.950   3.932   1.00 3.55  ? 104  PHE A HE1  2  
ATOM   4848  H HE2  . PHE A 1 104 ? 0.386   0.014   4.299   1.00 3.05  ? 104  PHE A HE2  2  
ATOM   4849  H HZ   . PHE A 1 104 ? -0.753  2.057   5.131   1.00 4.21  ? 104  PHE A HZ   2  
ATOM   4850  N N    . SER A 1 105 ? -3.855  -2.338  -1.224  1.00 0.37  ? 105  SER A N    2  
ATOM   4851  C CA   . SER A 1 105 ? -4.222  -2.731  -2.576  1.00 0.44  ? 105  SER A CA   2  
ATOM   4852  C C    . SER A 1 105 ? -5.726  -2.955  -2.687  1.00 0.40  ? 105  SER A C    2  
ATOM   4853  O O    . SER A 1 105 ? -6.379  -2.405  -3.573  1.00 0.45  ? 105  SER A O    2  
ATOM   4854  C CB   . SER A 1 105 ? -3.460  -3.997  -2.981  1.00 0.50  ? 105  SER A CB   2  
ATOM   4855  O OG   . SER A 1 105 ? -2.061  -3.811  -2.847  1.00 1.19  ? 105  SER A OG   2  
ATOM   4856  H H    . SER A 1 105 ? -3.239  -2.908  -0.711  1.00 0.36  ? 105  SER A H    2  
ATOM   4857  H HA   . SER A 1 105 ? -3.942  -1.928  -3.241  1.00 0.52  ? 105  SER A HA   2  
ATOM   4858  H HB2  . SER A 1 105 ? -3.765  -4.817  -2.349  1.00 1.07  ? 105  SER A HB2  2  
ATOM   4859  H HB3  . SER A 1 105 ? -3.683  -4.234  -4.012  1.00 0.98  ? 105  SER A HB3  2  
ATOM   4860  H HG   . SER A 1 105 ? -1.852  -3.610  -1.928  1.00 1.55  ? 105  SER A HG   2  
ATOM   4861  N N    . PHE A 1 106 ? -6.275  -3.738  -1.768  1.00 0.35  ? 106  PHE A N    2  
ATOM   4862  C CA   . PHE A 1 106 ? -7.698  -4.042  -1.783  1.00 0.37  ? 106  PHE A CA   2  
ATOM   4863  C C    . PHE A 1 106 ? -8.516  -2.829  -1.365  1.00 0.31  ? 106  PHE A C    2  
ATOM   4864  O O    . PHE A 1 106 ? -9.617  -2.627  -1.857  1.00 0.30  ? 106  PHE A O    2  
ATOM   4865  C CB   . PHE A 1 106 ? -8.015  -5.229  -0.874  1.00 0.46  ? 106  PHE A CB   2  
ATOM   4866  C CG   . PHE A 1 106 ? -7.298  -6.487  -1.266  1.00 0.99  ? 106  PHE A CG   2  
ATOM   4867  C CD1  . PHE A 1 106 ? -7.391  -6.975  -2.559  1.00 1.56  ? 106  PHE A CD1  2  
ATOM   4868  C CD2  . PHE A 1 106 ? -6.524  -7.173  -0.348  1.00 1.64  ? 106  PHE A CD2  2  
ATOM   4869  C CE1  . PHE A 1 106 ? -6.725  -8.126  -2.927  1.00 2.46  ? 106  PHE A CE1  2  
ATOM   4870  C CE2  . PHE A 1 106 ? -5.853  -8.323  -0.710  1.00 2.53  ? 106  PHE A CE2  2  
ATOM   4871  C CZ   . PHE A 1 106 ? -5.955  -8.799  -2.001  1.00 2.89  ? 106  PHE A CZ   2  
ATOM   4872  H H    . PHE A 1 106 ? -5.709  -4.121  -1.062  1.00 0.35  ? 106  PHE A H    2  
ATOM   4873  H HA   . PHE A 1 106 ? -7.965  -4.301  -2.797  1.00 0.42  ? 106  PHE A HA   2  
ATOM   4874  H HB2  . PHE A 1 106 ? -7.731  -4.986  0.139   1.00 1.15  ? 106  PHE A HB2  2  
ATOM   4875  H HB3  . PHE A 1 106 ? -9.077  -5.423  -0.909  1.00 0.85  ? 106  PHE A HB3  2  
ATOM   4876  H HD1  . PHE A 1 106 ? -7.994  -6.447  -3.283  1.00 1.56  ? 106  PHE A HD1  2  
ATOM   4877  H HD2  . PHE A 1 106 ? -6.445  -6.801  0.664   1.00 1.67  ? 106  PHE A HD2  2  
ATOM   4878  H HE1  . PHE A 1 106 ? -6.805  -8.498  -3.938  1.00 2.96  ? 106  PHE A HE1  2  
ATOM   4879  H HE2  . PHE A 1 106 ? -5.251  -8.851  0.015   1.00 3.09  ? 106  PHE A HE2  2  
ATOM   4880  H HZ   . PHE A 1 106 ? -5.431  -9.700  -2.288  1.00 3.64  ? 106  PHE A HZ   2  
ATOM   4881  N N    . GLY A 1 107 ? -7.973  -2.024  -0.460  1.00 0.30  ? 107  GLY A N    2  
ATOM   4882  C CA   . GLY A 1 107 ? -8.655  -0.814  -0.046  1.00 0.28  ? 107  GLY A CA   2  
ATOM   4883  C C    . GLY A 1 107 ? -8.695  0.217   -1.152  1.00 0.24  ? 107  GLY A C    2  
ATOM   4884  O O    . GLY A 1 107 ? -9.714  0.874   -1.371  1.00 0.27  ? 107  GLY A O    2  
ATOM   4885  H H    . GLY A 1 107 ? -7.104  -2.255  -0.064  1.00 0.32  ? 107  GLY A H    2  
ATOM   4886  H HA2  . GLY A 1 107 ? -9.667  -1.060  0.241   1.00 0.28  ? 107  GLY A HA2  2  
ATOM   4887  H HA3  . GLY A 1 107 ? -8.142  -0.394  0.806   1.00 0.29  ? 107  GLY A HA3  2  
ATOM   4888  N N    . GLY A 1 108 ? -7.582  0.356   -1.858  1.00 0.23  ? 108  GLY A N    2  
ATOM   4889  C CA   . GLY A 1 108 ? -7.530  1.259   -2.986  1.00 0.22  ? 108  GLY A CA   2  
ATOM   4890  C C    . GLY A 1 108 ? -8.406  0.777   -4.123  1.00 0.22  ? 108  GLY A C    2  
ATOM   4891  O O    . GLY A 1 108 ? -9.053  1.570   -4.807  1.00 0.23  ? 108  GLY A O    2  
ATOM   4892  H H    . GLY A 1 108 ? -6.781  -0.159  -1.606  1.00 0.24  ? 108  GLY A H    2  
ATOM   4893  H HA2  . GLY A 1 108 ? -7.865  2.235   -2.663  1.00 0.22  ? 108  GLY A HA2  2  
ATOM   4894  H HA3  . GLY A 1 108 ? -6.510  1.332   -3.333  1.00 0.24  ? 108  GLY A HA3  2  
ATOM   4895  N N    . ALA A 1 109 ? -8.430  -0.537  -4.315  1.00 0.24  ? 109  ALA A N    2  
ATOM   4896  C CA   . ALA A 1 109 ? -9.287  -1.157  -5.315  1.00 0.26  ? 109  ALA A CA   2  
ATOM   4897  C C    . ALA A 1 109 ? -10.747 -1.086  -4.884  1.00 0.27  ? 109  ALA A C    2  
ATOM   4898  O O    . ALA A 1 109 ? -11.645 -1.034  -5.717  1.00 0.31  ? 109  ALA A O    2  
ATOM   4899  C CB   . ALA A 1 109 ? -8.870  -2.602  -5.546  1.00 0.29  ? 109  ALA A CB   2  
ATOM   4900  H H    . ALA A 1 109 ? -7.843  -1.110  -3.771  1.00 0.24  ? 109  ALA A H    2  
ATOM   4901  H HA   . ALA A 1 109 ? -9.166  -0.613  -6.244  1.00 0.29  ? 109  ALA A HA   2  
ATOM   4902  H HB1  . ALA A 1 109 ? -9.509  -3.046  -6.295  1.00 0.96  ? 109  ALA A HB1  2  
ATOM   4903  H HB2  . ALA A 1 109 ? -8.962  -3.156  -4.621  1.00 1.05  ? 109  ALA A HB2  2  
ATOM   4904  H HB3  . ALA A 1 109 ? -7.845  -2.632  -5.882  1.00 1.04  ? 109  ALA A HB3  2  
ATOM   4905  N N    . LEU A 1 110 ? -10.967 -1.066  -3.575  1.00 0.25  ? 110  LEU A N    2  
ATOM   4906  C CA   . LEU A 1 110 ? -12.311 -0.984  -3.012  1.00 0.28  ? 110  LEU A CA   2  
ATOM   4907  C C    . LEU A 1 110 ? -12.914 0.345   -3.418  1.00 0.24  ? 110  LEU A C    2  
ATOM   4908  O O    . LEU A 1 110 ? -14.078 0.439   -3.815  1.00 0.24  ? 110  LEU A O    2  
ATOM   4909  C CB   . LEU A 1 110 ? -12.240 -1.083  -1.485  1.00 0.32  ? 110  LEU A CB   2  
ATOM   4910  C CG   . LEU A 1 110 ? -13.257 -2.016  -0.818  1.00 0.45  ? 110  LEU A CG   2  
ATOM   4911  C CD1  . LEU A 1 110 ? -14.682 -1.553  -1.059  1.00 1.11  ? 110  LEU A CD1  2  
ATOM   4912  C CD2  . LEU A 1 110 ? -13.071 -3.444  -1.310  1.00 1.12  ? 110  LEU A CD2  2  
ATOM   4913  H H    . LEU A 1 110 ? -10.197 -1.088  -2.963  1.00 0.23  ? 110  LEU A H    2  
ATOM   4914  H HA   . LEU A 1 110 ? -12.906 -1.793  -3.405  1.00 0.34  ? 110  LEU A HA   2  
ATOM   4915  H HB2  . LEU A 1 110 ? -11.251 -1.425  -1.219  1.00 0.36  ? 110  LEU A HB2  2  
ATOM   4916  H HB3  . LEU A 1 110 ? -12.376 -0.091  -1.080  1.00 0.29  ? 110  LEU A HB3  2  
ATOM   4917  H HG   . LEU A 1 110 ? -13.090 -2.009  0.246   1.00 1.32  ? 110  LEU A HG   2  
ATOM   4918  H HD11 . LEU A 1 110 ? -15.357 -2.165  -0.475  1.00 1.67  ? 110  LEU A HD11 2  
ATOM   4919  H HD12 . LEU A 1 110 ? -14.920 -1.649  -2.110  1.00 1.63  ? 110  LEU A HD12 2  
ATOM   4920  H HD13 . LEU A 1 110 ? -14.781 -0.521  -0.757  1.00 1.78  ? 110  LEU A HD13 2  
ATOM   4921  H HD21 . LEU A 1 110 ? -13.783 -4.089  -0.817  1.00 1.67  ? 110  LEU A HD21 2  
ATOM   4922  H HD22 . LEU A 1 110 ? -12.068 -3.774  -1.083  1.00 1.70  ? 110  LEU A HD22 2  
ATOM   4923  H HD23 . LEU A 1 110 ? -13.230 -3.480  -2.376  1.00 1.78  ? 110  LEU A HD23 2  
ATOM   4924  N N    . CYS A 1 111 ? -12.079 1.366   -3.313  1.00 0.21  ? 111  CYS A N    2  
ATOM   4925  C CA   . CYS A 1 111 ? -12.396 2.701   -3.778  1.00 0.19  ? 111  CYS A CA   2  
ATOM   4926  C C    . CYS A 1 111 ? -12.840 2.668   -5.234  1.00 0.20  ? 111  CYS A C    2  
ATOM   4927  O O    . CYS A 1 111 ? -13.933 3.123   -5.570  1.00 0.26  ? 111  CYS A O    2  
ATOM   4928  C CB   . CYS A 1 111 ? -11.155 3.574   -3.625  1.00 0.20  ? 111  CYS A CB   2  
ATOM   4929  S SG   . CYS A 1 111 ? -11.280 5.201   -4.378  1.00 0.22  ? 111  CYS A SG   2  
ATOM   4930  H H    . CYS A 1 111 ? -11.204 1.211   -2.895  1.00 0.22  ? 111  CYS A H    2  
ATOM   4931  H HA   . CYS A 1 111 ? -13.193 3.104   -3.166  1.00 0.19  ? 111  CYS A HA   2  
ATOM   4932  H HB2  . CYS A 1 111 ? -10.958 3.717   -2.575  1.00 0.21  ? 111  CYS A HB2  2  
ATOM   4933  H HB3  . CYS A 1 111 ? -10.314 3.070   -4.077  1.00 0.22  ? 111  CYS A HB3  2  
ATOM   4934  H HG   . CYS A 1 111 ? -10.125 5.467   -4.971  1.00 0.90  ? 111  CYS A HG   2  
ATOM   4935  N N    . VAL A 1 112 ? -11.999 2.098   -6.089  1.00 0.20  ? 112  VAL A N    2  
ATOM   4936  C CA   . VAL A 1 112 ? -12.291 2.033   -7.511  1.00 0.22  ? 112  VAL A CA   2  
ATOM   4937  C C    . VAL A 1 112 ? -13.533 1.199   -7.791  1.00 0.22  ? 112  VAL A C    2  
ATOM   4938  O O    . VAL A 1 112 ? -14.348 1.574   -8.621  1.00 0.26  ? 112  VAL A O    2  
ATOM   4939  C CB   . VAL A 1 112 ? -11.114 1.469   -8.322  1.00 0.26  ? 112  VAL A CB   2  
ATOM   4940  C CG1  . VAL A 1 112 ? -11.518 1.264   -9.767  1.00 0.35  ? 112  VAL A CG1  2  
ATOM   4941  C CG2  . VAL A 1 112 ? -9.926  2.402   -8.252  1.00 0.27  ? 112  VAL A CG2  2  
ATOM   4942  H H    . VAL A 1 112 ? -11.163 1.711   -5.752  1.00 0.21  ? 112  VAL A H    2  
ATOM   4943  H HA   . VAL A 1 112 ? -12.473 3.046   -7.850  1.00 0.25  ? 112  VAL A HA   2  
ATOM   4944  H HB   . VAL A 1 112 ? -10.829 0.515   -7.904  1.00 0.27  ? 112  VAL A HB   2  
ATOM   4945  H HG11 . VAL A 1 112 ? -12.444 0.712   -9.809  1.00 1.07  ? 112  VAL A HG11 2  
ATOM   4946  H HG12 . VAL A 1 112 ? -10.745 0.709   -10.279 1.00 1.20  ? 112  VAL A HG12 2  
ATOM   4947  H HG13 . VAL A 1 112 ? -11.646 2.229   -10.249 1.00 0.97  ? 112  VAL A HG13 2  
ATOM   4948  H HG21 . VAL A 1 112 ? -10.254 3.417   -8.464  1.00 1.02  ? 112  VAL A HG21 2  
ATOM   4949  H HG22 . VAL A 1 112 ? -9.194  2.101   -8.991  1.00 1.02  ? 112  VAL A HG22 2  
ATOM   4950  H HG23 . VAL A 1 112 ? -9.489  2.357   -7.264  1.00 1.08  ? 112  VAL A HG23 2  
ATOM   4951  N N    . GLU A 1 113 ? -13.689 0.076   -7.099  1.00 0.23  ? 113  GLU A N    2  
ATOM   4952  C CA   . GLU A 1 113 ? -14.862 -0.760  -7.296  1.00 0.28  ? 113  GLU A CA   2  
ATOM   4953  C C    . GLU A 1 113 ? -16.129 -0.032  -6.895  1.00 0.23  ? 113  GLU A C    2  
ATOM   4954  O O    . GLU A 1 113 ? -17.218 -0.353  -7.361  1.00 0.29  ? 113  GLU A O    2  
ATOM   4955  C CB   . GLU A 1 113 ? -14.718 -2.084  -6.579  1.00 0.40  ? 113  GLU A CB   2  
ATOM   4956  C CG   . GLU A 1 113 ? -13.767 -2.984  -7.328  1.00 0.53  ? 113  GLU A CG   2  
ATOM   4957  C CD   . GLU A 1 113 ? -14.066 -3.005  -8.820  1.00 1.86  ? 113  GLU A CD   2  
ATOM   4958  O OE1  . GLU A 1 113 ? -15.127 -3.543  -9.212  1.00 2.34  ? 113  GLU A OE1  2  
ATOM   4959  O OE2  . GLU A 1 113 ? -13.254 -2.483  -9.609  1.00 2.51  ? 113  GLU A OE2  2  
ATOM   4960  H H    . GLU A 1 113 ? -13.000 -0.201  -6.451  1.00 0.23  ? 113  GLU A H    2  
ATOM   4961  H HA   . GLU A 1 113 ? -14.919 -0.980  -8.348  1.00 0.34  ? 113  GLU A HA   2  
ATOM   4962  H HB2  . GLU A 1 113 ? -14.351 -1.926  -5.573  1.00 0.39  ? 113  GLU A HB2  2  
ATOM   4963  H HB3  . GLU A 1 113 ? -15.680 -2.571  -6.535  1.00 0.45  ? 113  GLU A HB3  2  
ATOM   4964  H HG2  . GLU A 1 113 ? -12.755 -2.640  -7.174  1.00 0.87  ? 113  GLU A HG2  2  
ATOM   4965  H HG3  . GLU A 1 113 ? -13.876 -3.975  -6.946  1.00 1.02  ? 113  GLU A HG3  2  
ATOM   4966  N N    . SER A 1 114 ? -15.981 0.975   -6.056  1.00 0.18  ? 114  SER A N    2  
ATOM   4967  C CA   . SER A 1 114 ? -17.090 1.839   -5.725  1.00 0.19  ? 114  SER A CA   2  
ATOM   4968  C C    . SER A 1 114 ? -17.331 2.787   -6.889  1.00 0.22  ? 114  SER A C    2  
ATOM   4969  O O    . SER A 1 114 ? -18.456 3.001   -7.313  1.00 0.28  ? 114  SER A O    2  
ATOM   4970  C CB   . SER A 1 114 ? -16.789 2.611   -4.444  1.00 0.18  ? 114  SER A CB   2  
ATOM   4971  O OG   . SER A 1 114 ? -16.494 1.722   -3.379  1.00 0.20  ? 114  SER A OG   2  
ATOM   4972  H H    . SER A 1 114 ? -15.098 1.154   -5.665  1.00 0.20  ? 114  SER A H    2  
ATOM   4973  H HA   . SER A 1 114 ? -17.967 1.226   -5.581  1.00 0.20  ? 114  SER A HA   2  
ATOM   4974  H HB2  . SER A 1 114 ? -15.938 3.256   -4.606  1.00 0.18  ? 114  SER A HB2  2  
ATOM   4975  H HB3  . SER A 1 114 ? -17.647 3.207   -4.172  1.00 0.19  ? 114  SER A HB3  2  
ATOM   4976  H HG   . SER A 1 114 ? -15.699 1.214   -3.591  1.00 0.17  ? 114  SER A HG   2  
ATOM   4977  N N    . VAL A 1 115 ? -16.242 3.273   -7.456  1.00 0.21  ? 115  VAL A N    2  
ATOM   4978  C CA   . VAL A 1 115 ? -16.281 4.216   -8.565  1.00 0.27  ? 115  VAL A CA   2  
ATOM   4979  C C    . VAL A 1 115 ? -16.858 3.536   -9.792  1.00 0.28  ? 115  VAL A C    2  
ATOM   4980  O O    . VAL A 1 115 ? -17.605 4.126   -10.574 1.00 0.31  ? 115  VAL A O    2  
ATOM   4981  C CB   . VAL A 1 115 ? -14.858 4.700   -8.886  1.00 0.34  ? 115  VAL A CB   2  
ATOM   4982  C CG1  . VAL A 1 115 ? -14.848 5.667   -10.049 1.00 1.23  ? 115  VAL A CG1  2  
ATOM   4983  C CG2  . VAL A 1 115 ? -14.229 5.325   -7.661  1.00 1.10  ? 115  VAL A CG2  2  
ATOM   4984  H H    . VAL A 1 115 ? -15.369 2.949   -7.147  1.00 0.21  ? 115  VAL A H    2  
ATOM   4985  H HA   . VAL A 1 115 ? -16.891 5.063   -8.289  1.00 0.31  ? 115  VAL A HA   2  
ATOM   4986  H HB   . VAL A 1 115 ? -14.266 3.840   -9.162  1.00 1.10  ? 115  VAL A HB   2  
ATOM   4987  H HG11 . VAL A 1 115 ? -15.451 6.529   -9.808  1.00 1.83  ? 115  VAL A HG11 2  
ATOM   4988  H HG12 . VAL A 1 115 ? -15.250 5.177   -10.925 1.00 1.82  ? 115  VAL A HG12 2  
ATOM   4989  H HG13 . VAL A 1 115 ? -13.831 5.978   -10.244 1.00 1.79  ? 115  VAL A HG13 2  
ATOM   4990  H HG21 . VAL A 1 115 ? -14.171 4.584   -6.874  1.00 1.68  ? 115  VAL A HG21 2  
ATOM   4991  H HG22 . VAL A 1 115 ? -14.837 6.156   -7.326  1.00 1.73  ? 115  VAL A HG22 2  
ATOM   4992  H HG23 . VAL A 1 115 ? -13.234 5.671   -7.907  1.00 1.69  ? 115  VAL A HG23 2  
ATOM   4993  N N    . ASP A 1 116 ? -16.487 2.283   -9.916  1.00 0.28  ? 116  ASP A N    2  
ATOM   4994  C CA   . ASP A 1 116 ? -16.893 1.415   -10.999 1.00 0.34  ? 116  ASP A CA   2  
ATOM   4995  C C    . ASP A 1 116 ? -18.409 1.403   -11.163 1.00 0.35  ? 116  ASP A C    2  
ATOM   4996  O O    . ASP A 1 116 ? -18.928 1.608   -12.259 1.00 0.41  ? 116  ASP A O    2  
ATOM   4997  C CB   . ASP A 1 116 ? -16.386 0.017   -10.676 1.00 0.37  ? 116  ASP A CB   2  
ATOM   4998  C CG   . ASP A 1 116 ? -16.505 -0.951  -11.837 1.00 0.48  ? 116  ASP A CG   2  
ATOM   4999  O OD1  . ASP A 1 116 ? -17.567 -1.587  -11.975 1.00 0.60  ? 116  ASP A OD1  2  
ATOM   5000  O OD2  . ASP A 1 116 ? -15.551 -1.057  -12.631 1.00 0.60  ? 116  ASP A OD2  2  
ATOM   5001  H H    . ASP A 1 116 ? -15.880 1.912   -9.232  1.00 0.26  ? 116  ASP A H    2  
ATOM   5002  H HA   . ASP A 1 116 ? -16.431 1.762   -11.909 1.00 0.39  ? 116  ASP A HA   2  
ATOM   5003  H HB2  . ASP A 1 116 ? -15.346 0.086   -10.391 1.00 0.37  ? 116  ASP A HB2  2  
ATOM   5004  H HB3  . ASP A 1 116 ? -16.957 -0.368  -9.834  1.00 0.34  ? 116  ASP A HB3  2  
ATOM   5005  N N    . LYS A 1 117 ? -19.115 1.185   -10.059 1.00 0.32  ? 117  LYS A N    2  
ATOM   5006  C CA   . LYS A 1 117 ? -20.573 1.121   -10.081 1.00 0.35  ? 117  LYS A CA   2  
ATOM   5007  C C    . LYS A 1 117 ? -21.175 2.507   -9.834  1.00 0.34  ? 117  LYS A C    2  
ATOM   5008  O O    . LYS A 1 117 ? -22.367 2.632   -9.546  1.00 0.37  ? 117  LYS A O    2  
ATOM   5009  C CB   . LYS A 1 117 ? -21.093 0.138   -9.019  1.00 0.37  ? 117  LYS A CB   2  
ATOM   5010  C CG   . LYS A 1 117 ? -20.052 -0.837  -8.480  1.00 0.36  ? 117  LYS A CG   2  
ATOM   5011  C CD   . LYS A 1 117 ? -19.477 -1.746  -9.552  1.00 0.45  ? 117  LYS A CD   2  
ATOM   5012  C CE   . LYS A 1 117 ? -18.406 -2.659  -8.977  1.00 0.61  ? 117  LYS A CE   2  
ATOM   5013  N NZ   . LYS A 1 117 ? -17.685 -3.419  -10.032 1.00 1.62  ? 117  LYS A NZ   2  
ATOM   5014  H H    . LYS A 1 117 ? -18.645 1.046   -9.210  1.00 0.29  ? 117  LYS A H    2  
ATOM   5015  H HA   . LYS A 1 117 ? -20.876 0.777   -11.057 1.00 0.40  ? 117  LYS A HA   2  
ATOM   5016  H HB2  . LYS A 1 117 ? -21.481 0.706   -8.186  1.00 0.35  ? 117  LYS A HB2  2  
ATOM   5017  H HB3  . LYS A 1 117 ? -21.900 -0.437  -9.451  1.00 0.43  ? 117  LYS A HB3  2  
ATOM   5018  H HG2  . LYS A 1 117 ? -19.244 -0.273  -8.040  1.00 0.30  ? 117  LYS A HG2  2  
ATOM   5019  H HG3  . LYS A 1 117 ? -20.513 -1.447  -7.718  1.00 0.39  ? 117  LYS A HG3  2  
ATOM   5020  H HD2  . LYS A 1 117 ? -20.268 -2.343  -9.969  1.00 0.52  ? 117  LYS A HD2  2  
ATOM   5021  H HD3  . LYS A 1 117 ? -19.036 -1.136  -10.325 1.00 0.41  ? 117  LYS A HD3  2  
ATOM   5022  H HE2  . LYS A 1 117 ? -17.696 -2.054  -8.436  1.00 1.09  ? 117  LYS A HE2  2  
ATOM   5023  H HE3  . LYS A 1 117 ? -18.874 -3.356  -8.297  1.00 0.69  ? 117  LYS A HE3  2  
ATOM   5024  H HZ1  . LYS A 1 117 ? -16.743 -3.714  -9.681  1.00 2.16  ? 117  LYS A HZ1  2  
ATOM   5025  H HZ2  . LYS A 1 117 ? -17.558 -2.823  -10.881 1.00 2.12  ? 117  LYS A HZ2  2  
ATOM   5026  H HZ3  . LYS A 1 117 ? -18.228 -4.270  -10.295 1.00 2.13  ? 117  LYS A HZ3  2  
ATOM   5027  N N    . GLU A 1 118 ? -20.335 3.541   -9.956  1.00 0.31  ? 118  GLU A N    2  
ATOM   5028  C CA   . GLU A 1 118 ? -20.742 4.934   -9.740  1.00 0.33  ? 118  GLU A CA   2  
ATOM   5029  C C    . GLU A 1 118 ? -21.179 5.160   -8.297  1.00 0.31  ? 118  GLU A C    2  
ATOM   5030  O O    . GLU A 1 118 ? -22.270 5.657   -8.020  1.00 0.38  ? 118  GLU A O    2  
ATOM   5031  C CB   . GLU A 1 118 ? -21.850 5.341   -10.710 1.00 0.40  ? 118  GLU A CB   2  
ATOM   5032  C CG   . GLU A 1 118 ? -21.441 5.232   -12.166 1.00 0.49  ? 118  GLU A CG   2  
ATOM   5033  C CD   . GLU A 1 118 ? -22.519 5.720   -13.102 1.00 1.12  ? 118  GLU A CD   2  
ATOM   5034  O OE1  . GLU A 1 118 ? -23.393 4.911   -13.475 1.00 1.88  ? 118  GLU A OE1  2  
ATOM   5035  O OE2  . GLU A 1 118 ? -22.494 6.916   -13.472 1.00 1.07  ? 118  GLU A OE2  2  
ATOM   5036  H H    . GLU A 1 118 ? -19.403 3.358   -10.205 1.00 0.31  ? 118  GLU A H    2  
ATOM   5037  H HA   . GLU A 1 118 ? -19.873 5.554   -9.928  1.00 0.33  ? 118  GLU A HA   2  
ATOM   5038  H HB2  . GLU A 1 118 ? -22.707 4.706   -10.549 1.00 0.42  ? 118  GLU A HB2  2  
ATOM   5039  H HB3  . GLU A 1 118 ? -22.128 6.365   -10.512 1.00 0.40  ? 118  GLU A HB3  2  
ATOM   5040  H HG2  . GLU A 1 118 ? -20.553 5.826   -12.323 1.00 0.66  ? 118  GLU A HG2  2  
ATOM   5041  H HG3  . GLU A 1 118 ? -21.227 4.198   -12.392 1.00 0.78  ? 118  GLU A HG3  2  
ATOM   5042  N N    . MET A 1 119 ? -20.303 4.778   -7.387  1.00 0.26  ? 119  MET A N    2  
ATOM   5043  C CA   . MET A 1 119 ? -20.521 4.943   -5.959  1.00 0.26  ? 119  MET A CA   2  
ATOM   5044  C C    . MET A 1 119 ? -19.285 5.603   -5.366  1.00 0.25  ? 119  MET A C    2  
ATOM   5045  O O    . MET A 1 119 ? -18.780 5.208   -4.320  1.00 0.23  ? 119  MET A O    2  
ATOM   5046  C CB   . MET A 1 119 ? -20.760 3.581   -5.307  1.00 0.25  ? 119  MET A CB   2  
ATOM   5047  C CG   . MET A 1 119 ? -21.865 2.773   -5.965  1.00 0.28  ? 119  MET A CG   2  
ATOM   5048  S SD   . MET A 1 119 ? -21.957 1.091   -5.333  1.00 0.31  ? 119  MET A SD   2  
ATOM   5049  C CE   . MET A 1 119 ? -20.239 0.601   -5.461  1.00 0.29  ? 119  MET A CE   2  
ATOM   5050  H H    . MET A 1 119 ? -19.463 4.353   -7.687  1.00 0.26  ? 119  MET A H    2  
ATOM   5051  H HA   . MET A 1 119 ? -21.380 5.581   -5.811  1.00 0.29  ? 119  MET A HA   2  
ATOM   5052  H HB2  . MET A 1 119 ? -19.845 3.007   -5.360  1.00 0.23  ? 119  MET A HB2  2  
ATOM   5053  H HB3  . MET A 1 119 ? -21.019 3.728   -4.269  1.00 0.27  ? 119  MET A HB3  2  
ATOM   5054  H HG2  . MET A 1 119 ? -22.811 3.263   -5.782  1.00 0.30  ? 119  MET A HG2  2  
ATOM   5055  H HG3  . MET A 1 119 ? -21.680 2.733   -7.030  1.00 0.28  ? 119  MET A HG3  2  
ATOM   5056  H HE1  . MET A 1 119 ? -19.628 1.295   -4.902  1.00 1.08  ? 119  MET A HE1  2  
ATOM   5057  H HE2  . MET A 1 119 ? -19.934 0.608   -6.502  1.00 1.01  ? 119  MET A HE2  2  
ATOM   5058  H HE3  . MET A 1 119 ? -20.118 -0.393  -5.058  1.00 1.08  ? 119  MET A HE3  2  
ATOM   5059  N N    . GLN A 1 120 ? -18.808 6.617   -6.067  1.00 0.31  ? 120  GLN A N    2  
ATOM   5060  C CA   . GLN A 1 120 ? -17.574 7.310   -5.743  1.00 0.31  ? 120  GLN A CA   2  
ATOM   5061  C C    . GLN A 1 120 ? -17.601 7.969   -4.361  1.00 0.32  ? 120  GLN A C    2  
ATOM   5062  O O    . GLN A 1 120 ? -16.586 8.472   -3.890  1.00 0.33  ? 120  GLN A O    2  
ATOM   5063  C CB   . GLN A 1 120 ? -17.321 8.336   -6.836  1.00 0.36  ? 120  GLN A CB   2  
ATOM   5064  C CG   . GLN A 1 120 ? -17.351 7.707   -8.219  1.00 0.36  ? 120  GLN A CG   2  
ATOM   5065  C CD   . GLN A 1 120 ? -18.163 8.499   -9.226  1.00 0.58  ? 120  GLN A CD   2  
ATOM   5066  O OE1  . GLN A 1 120 ? -18.301 9.715   -9.116  1.00 1.15  ? 120  GLN A OE1  2  
ATOM   5067  N NE2  . GLN A 1 120 ? -18.692 7.810   -10.227 1.00 0.55  ? 120  GLN A NE2  2  
ATOM   5068  H H    . GLN A 1 120 ? -19.306 6.917   -6.859  1.00 0.39  ? 120  GLN A H    2  
ATOM   5069  H HA   . GLN A 1 120 ? -16.777 6.585   -5.761  1.00 0.29  ? 120  GLN A HA   2  
ATOM   5070  H HB2  . GLN A 1 120 ? -18.084 9.100   -6.788  1.00 0.41  ? 120  GLN A HB2  2  
ATOM   5071  H HB3  . GLN A 1 120 ? -16.352 8.787   -6.686  1.00 0.39  ? 120  GLN A HB3  2  
ATOM   5072  H HG2  . GLN A 1 120 ? -16.350 7.620   -8.580  1.00 0.52  ? 120  GLN A HG2  2  
ATOM   5073  H HG3  . GLN A 1 120 ? -17.780 6.721   -8.131  1.00 0.47  ? 120  GLN A HG3  2  
ATOM   5074  H HE21 . GLN A 1 120 ? -18.530 6.847   -10.263 1.00 0.74  ? 120  GLN A HE21 2  
ATOM   5075  H HE22 . GLN A 1 120 ? -19.232 8.295   -10.894 1.00 0.71  ? 120  GLN A HE22 2  
ATOM   5076  N N    . VAL A 1 121 ? -18.755 7.968   -3.712  1.00 0.32  ? 121  VAL A N    2  
ATOM   5077  C CA   . VAL A 1 121 ? -18.859 8.492   -2.357  1.00 0.35  ? 121  VAL A CA   2  
ATOM   5078  C C    . VAL A 1 121 ? -18.049 7.641   -1.373  1.00 0.31  ? 121  VAL A C    2  
ATOM   5079  O O    . VAL A 1 121 ? -17.593 8.136   -0.340  1.00 0.36  ? 121  VAL A O    2  
ATOM   5080  C CB   . VAL A 1 121 ? -20.324 8.560   -1.883  1.00 0.39  ? 121  VAL A CB   2  
ATOM   5081  C CG1  . VAL A 1 121 ? -21.128 9.497   -2.769  1.00 0.46  ? 121  VAL A CG1  2  
ATOM   5082  C CG2  . VAL A 1 121 ? -20.947 7.174   -1.863  1.00 0.38  ? 121  VAL A CG2  2  
ATOM   5083  H H    . VAL A 1 121 ? -19.552 7.613   -4.154  1.00 0.32  ? 121  VAL A H    2  
ATOM   5084  H HA   . VAL A 1 121 ? -18.458 9.494   -2.360  1.00 0.39  ? 121  VAL A HA   2  
ATOM   5085  H HB   . VAL A 1 121 ? -20.338 8.952   -0.876  1.00 0.42  ? 121  VAL A HB   2  
ATOM   5086  H HG11 . VAL A 1 121 ? -21.109 9.134   -3.785  1.00 1.05  ? 121  VAL A HG11 2  
ATOM   5087  H HG12 . VAL A 1 121 ? -20.697 10.486  -2.730  1.00 1.09  ? 121  VAL A HG12 2  
ATOM   5088  H HG13 . VAL A 1 121 ? -22.149 9.534   -2.419  1.00 1.19  ? 121  VAL A HG13 2  
ATOM   5089  H HG21 . VAL A 1 121 ? -21.953 7.236   -1.476  1.00 1.03  ? 121  VAL A HG21 2  
ATOM   5090  H HG22 . VAL A 1 121 ? -20.354 6.525   -1.235  1.00 1.06  ? 121  VAL A HG22 2  
ATOM   5091  H HG23 . VAL A 1 121 ? -20.970 6.777   -2.868  1.00 1.07  ? 121  VAL A HG23 2  
ATOM   5092  N N    . LEU A 1 122 ? -17.854 6.365   -1.711  1.00 0.24  ? 122  LEU A N    2  
ATOM   5093  C CA   . LEU A 1 122 ? -17.105 5.447   -0.857  1.00 0.21  ? 122  LEU A CA   2  
ATOM   5094  C C    . LEU A 1 122 ? -15.628 5.769   -0.899  1.00 0.19  ? 122  LEU A C    2  
ATOM   5095  O O    . LEU A 1 122 ? -14.910 5.505   0.059   1.00 0.19  ? 122  LEU A O    2  
ATOM   5096  C CB   . LEU A 1 122 ? -17.302 3.984   -1.278  1.00 0.18  ? 122  LEU A CB   2  
ATOM   5097  C CG   . LEU A 1 122 ? -18.653 3.351   -0.937  1.00 0.22  ? 122  LEU A CG   2  
ATOM   5098  C CD1  . LEU A 1 122 ? -19.008 3.609   0.512   1.00 0.26  ? 122  LEU A CD1  2  
ATOM   5099  C CD2  . LEU A 1 122 ? -19.743 3.859   -1.863  1.00 0.22  ? 122  LEU A CD2  2  
ATOM   5100  H H    . LEU A 1 122 ? -18.219 6.036   -2.562  1.00 0.23  ? 122  LEU A H    2  
ATOM   5101  H HA   . LEU A 1 122 ? -17.455 5.574   0.158   1.00 0.24  ? 122  LEU A HA   2  
ATOM   5102  H HB2  . LEU A 1 122 ? -17.167 3.924   -2.348  1.00 0.17  ? 122  LEU A HB2  2  
ATOM   5103  H HB3  . LEU A 1 122 ? -16.529 3.394   -0.807  1.00 0.18  ? 122  LEU A HB3  2  
ATOM   5104  H HG   . LEU A 1 122 ? -18.579 2.281   -1.070  1.00 0.24  ? 122  LEU A HG   2  
ATOM   5105  H HD11 . LEU A 1 122 ? -18.275 3.136   1.151   1.00 1.06  ? 122  LEU A HD11 2  
ATOM   5106  H HD12 . LEU A 1 122 ? -19.989 3.199   0.719   1.00 0.97  ? 122  LEU A HD12 2  
ATOM   5107  H HD13 . LEU A 1 122 ? -19.014 4.674   0.698   1.00 1.03  ? 122  LEU A HD13 2  
ATOM   5108  H HD21 . LEU A 1 122 ? -20.678 3.374   -1.623  1.00 1.00  ? 122  LEU A HD21 2  
ATOM   5109  H HD22 . LEU A 1 122 ? -19.472 3.639   -2.888  1.00 1.01  ? 122  LEU A HD22 2  
ATOM   5110  H HD23 . LEU A 1 122 ? -19.846 4.927   -1.743  1.00 1.00  ? 122  LEU A HD23 2  
ATOM   5111  N N    . VAL A 1 123 ? -15.194 6.338   -2.016  1.00 0.19  ? 123  VAL A N    2  
ATOM   5112  C CA   . VAL A 1 123 ? -13.797 6.709   -2.218  1.00 0.20  ? 123  VAL A CA   2  
ATOM   5113  C C    . VAL A 1 123 ? -13.200 7.383   -0.981  1.00 0.22  ? 123  VAL A C    2  
ATOM   5114  O O    . VAL A 1 123 ? -12.165 6.956   -0.467  1.00 0.25  ? 123  VAL A O    2  
ATOM   5115  C CB   . VAL A 1 123 ? -13.678 7.642   -3.439  1.00 0.22  ? 123  VAL A CB   2  
ATOM   5116  C CG1  . VAL A 1 123 ? -12.276 8.220   -3.569  1.00 0.23  ? 123  VAL A CG1  2  
ATOM   5117  C CG2  . VAL A 1 123 ? -14.073 6.883   -4.697  1.00 0.23  ? 123  VAL A CG2  2  
ATOM   5118  H H    . VAL A 1 123 ? -15.837 6.509   -2.743  1.00 0.21  ? 123  VAL A H    2  
ATOM   5119  H HA   . VAL A 1 123 ? -13.243 5.808   -2.426  1.00 0.19  ? 123  VAL A HA   2  
ATOM   5120  H HB   . VAL A 1 123 ? -14.370 8.461   -3.310  1.00 0.24  ? 123  VAL A HB   2  
ATOM   5121  H HG11 . VAL A 1 123 ? -12.039 8.790   -2.683  1.00 0.99  ? 123  VAL A HG11 2  
ATOM   5122  H HG12 . VAL A 1 123 ? -12.236 8.866   -4.435  1.00 1.00  ? 123  VAL A HG12 2  
ATOM   5123  H HG13 . VAL A 1 123 ? -11.564 7.415   -3.684  1.00 0.91  ? 123  VAL A HG13 2  
ATOM   5124  H HG21 . VAL A 1 123 ? -13.514 5.956   -4.749  1.00 0.99  ? 123  VAL A HG21 2  
ATOM   5125  H HG22 . VAL A 1 123 ? -13.853 7.485   -5.566  1.00 0.98  ? 123  VAL A HG22 2  
ATOM   5126  H HG23 . VAL A 1 123 ? -15.134 6.663   -4.669  1.00 0.93  ? 123  VAL A HG23 2  
ATOM   5127  N N    . SER A 1 124 ? -13.863 8.419   -0.493  1.00 0.24  ? 124  SER A N    2  
ATOM   5128  C CA   . SER A 1 124 ? -13.379 9.140   0.674   1.00 0.28  ? 124  SER A CA   2  
ATOM   5129  C C    . SER A 1 124 ? -13.560 8.308   1.944   1.00 0.27  ? 124  SER A C    2  
ATOM   5130  O O    . SER A 1 124 ? -12.683 8.279   2.808   1.00 0.33  ? 124  SER A O    2  
ATOM   5131  C CB   . SER A 1 124 ? -14.121 10.467  0.815   1.00 0.36  ? 124  SER A CB   2  
ATOM   5132  O OG   . SER A 1 124 ? -13.490 11.306  1.766   1.00 1.35  ? 124  SER A OG   2  
ATOM   5133  H H    . SER A 1 124 ? -14.694 8.705   -0.931  1.00 0.23  ? 124  SER A H    2  
ATOM   5134  H HA   . SER A 1 124 ? -12.323 9.337   0.534   1.00 0.30  ? 124  SER A HA   2  
ATOM   5135  H HB2  . SER A 1 124 ? -14.141 10.970  -0.138  1.00 0.96  ? 124  SER A HB2  2  
ATOM   5136  H HB3  . SER A 1 124 ? -15.133 10.275  1.140   1.00 0.82  ? 124  SER A HB3  2  
ATOM   5137  H HG   . SER A 1 124 ? -13.964 11.237  2.613   1.00 1.66  ? 124  SER A HG   2  
ATOM   5138  N N    . ARG A 1 125 ? -14.699 7.625   2.041   1.00 0.23  ? 125  ARG A N    2  
ATOM   5139  C CA   . ARG A 1 125 ? -15.035 6.845   3.228   1.00 0.23  ? 125  ARG A CA   2  
ATOM   5140  C C    . ARG A 1 125 ? -13.997 5.770   3.470   1.00 0.21  ? 125  ARG A C    2  
ATOM   5141  O O    . ARG A 1 125 ? -13.431 5.672   4.554   1.00 0.25  ? 125  ARG A O    2  
ATOM   5142  C CB   . ARG A 1 125 ? -16.402 6.183   3.069   1.00 0.28  ? 125  ARG A CB   2  
ATOM   5143  C CG   . ARG A 1 125 ? -17.509 7.129   2.653   1.00 0.55  ? 125  ARG A CG   2  
ATOM   5144  C CD   . ARG A 1 125 ? -18.846 6.427   2.651   1.00 0.55  ? 125  ARG A CD   2  
ATOM   5145  N NE   . ARG A 1 125 ? -19.938 7.304   2.235   1.00 1.44  ? 125  ARG A NE   2  
ATOM   5146  C CZ   . ARG A 1 125 ? -21.222 6.947   2.252   1.00 1.65  ? 125  ARG A CZ   2  
ATOM   5147  N NH1  . ARG A 1 125 ? -21.580 5.771   2.756   1.00 1.06  ? 125  ARG A NH1  2  
ATOM   5148  N NH2  . ARG A 1 125 ? -22.149 7.782   1.799   1.00 2.67  ? 125  ARG A NH2  2  
ATOM   5149  H H    . ARG A 1 125 ? -15.321 7.633   1.288   1.00 0.24  ? 125  ARG A H    2  
ATOM   5150  H HA   . ARG A 1 125 ? -15.055 7.508   4.080   1.00 0.27  ? 125  ARG A HA   2  
ATOM   5151  H HB2  . ARG A 1 125 ? -16.325 5.407   2.323   1.00 0.57  ? 125  ARG A HB2  2  
ATOM   5152  H HB3  . ARG A 1 125 ? -16.678 5.735   4.010   1.00 0.56  ? 125  ARG A HB3  2  
ATOM   5153  H HG2  . ARG A 1 125 ? -17.546 7.956   3.339   1.00 0.83  ? 125  ARG A HG2  2  
ATOM   5154  H HG3  . ARG A 1 125 ? -17.307 7.487   1.661   1.00 0.83  ? 125  ARG A HG3  2  
ATOM   5155  H HD2  . ARG A 1 125 ? -18.794 5.589   1.970   1.00 0.92  ? 125  ARG A HD2  2  
ATOM   5156  H HD3  . ARG A 1 125 ? -19.040 6.066   3.644   1.00 0.90  ? 125  ARG A HD3  2  
ATOM   5157  H HE   . ARG A 1 125 ? -19.694 8.206   1.904   1.00 2.07  ? 125  ARG A HE   2  
ATOM   5158  H HH11 . ARG A 1 125 ? -20.885 5.148   3.134   1.00 0.84  ? 125  ARG A HH11 2  
ATOM   5159  H HH12 . ARG A 1 125 ? -22.548 5.493   2.755   1.00 1.32  ? 125  ARG A HH12 2  
ATOM   5160  H HH21 . ARG A 1 125 ? -21.887 8.691   1.444   1.00 3.30  ? 125  ARG A HH21 2  
ATOM   5161  H HH22 . ARG A 1 125 ? -23.121 7.515   1.806   1.00 2.85  ? 125  ARG A HH22 2  
ATOM   5162  N N    . ILE A 1 126 ? -13.761 4.969   2.444   1.00 0.19  ? 126  ILE A N    2  
ATOM   5163  C CA   . ILE A 1 126 ? -12.812 3.874   2.518   1.00 0.19  ? 126  ILE A CA   2  
ATOM   5164  C C    . ILE A 1 126 ? -11.459 4.358   3.021   1.00 0.20  ? 126  ILE A C    2  
ATOM   5165  O O    . ILE A 1 126 ? -10.900 3.786   3.951   1.00 0.23  ? 126  ILE A O    2  
ATOM   5166  C CB   . ILE A 1 126 ? -12.664 3.190   1.141   1.00 0.19  ? 126  ILE A CB   2  
ATOM   5167  C CG1  . ILE A 1 126 ? -14.031 2.647   0.704   1.00 0.18  ? 126  ILE A CG1  2  
ATOM   5168  C CG2  . ILE A 1 126 ? -11.633 2.075   1.207   1.00 0.22  ? 126  ILE A CG2  2  
ATOM   5169  C CD1  . ILE A 1 126 ? -14.073 2.103   -0.700  1.00 0.18  ? 126  ILE A CD1  2  
ATOM   5170  H H    . ILE A 1 126 ? -14.248 5.122   1.600   1.00 0.20  ? 126  ILE A H    2  
ATOM   5171  H HA   . ILE A 1 126 ? -13.201 3.145   3.215   1.00 0.22  ? 126  ILE A HA   2  
ATOM   5172  H HB   . ILE A 1 126 ? -12.322 3.925   0.426   1.00 0.18  ? 126  ILE A HB   2  
ATOM   5173  H HG12 . ILE A 1 126 ? -14.315 1.849   1.366   1.00 0.21  ? 126  ILE A HG12 2  
ATOM   5174  H HG13 . ILE A 1 126 ? -14.761 3.441   0.774   1.00 0.19  ? 126  ILE A HG13 2  
ATOM   5175  H HG21 . ILE A 1 126 ? -10.674 2.492   1.476   1.00 0.98  ? 126  ILE A HG21 2  
ATOM   5176  H HG22 . ILE A 1 126 ? -11.560 1.593   0.243   1.00 1.02  ? 126  ILE A HG22 2  
ATOM   5177  H HG23 . ILE A 1 126 ? -11.933 1.352   1.950   1.00 1.04  ? 126  ILE A HG23 2  
ATOM   5178  H HD11 . ILE A 1 126 ? -13.340 1.318   -0.805  1.00 1.04  ? 126  ILE A HD11 2  
ATOM   5179  H HD12 . ILE A 1 126 ? -13.860 2.894   -1.403  1.00 1.00  ? 126  ILE A HD12 2  
ATOM   5180  H HD13 . ILE A 1 126 ? -15.058 1.700   -0.897  1.00 1.06  ? 126  ILE A HD13 2  
ATOM   5181  N N    . ALA A 1 127 ? -10.968 5.441   2.436   1.00 0.21  ? 127  ALA A N    2  
ATOM   5182  C CA   . ALA A 1 127 ? -9.663  5.988   2.797   1.00 0.24  ? 127  ALA A CA   2  
ATOM   5183  C C    . ALA A 1 127 ? -9.595  6.393   4.271   1.00 0.24  ? 127  ALA A C    2  
ATOM   5184  O O    . ALA A 1 127 ? -8.521  6.375   4.875   1.00 0.29  ? 127  ALA A O    2  
ATOM   5185  C CB   . ALA A 1 127 ? -9.343  7.179   1.921   1.00 0.27  ? 127  ALA A CB   2  
ATOM   5186  H H    . ALA A 1 127 ? -11.500 5.892   1.743   1.00 0.22  ? 127  ALA A H    2  
ATOM   5187  H HA   . ALA A 1 127 ? -8.920  5.227   2.611   1.00 0.25  ? 127  ALA A HA   2  
ATOM   5188  H HB1  . ALA A 1 127 ? -10.094 7.940   2.069   1.00 1.10  ? 127  ALA A HB1  2  
ATOM   5189  H HB2  . ALA A 1 127 ? -9.332  6.870   0.886   1.00 1.00  ? 127  ALA A HB2  2  
ATOM   5190  H HB3  . ALA A 1 127 ? -8.374  7.570   2.191   1.00 1.00  ? 127  ALA A HB3  2  
ATOM   5191  N N    . ALA A 1 128 ? -10.740 6.739   4.842   1.00 0.21  ? 128  ALA A N    2  
ATOM   5192  C CA   . ALA A 1 128 ? -10.808 7.188   6.222   1.00 0.22  ? 128  ALA A CA   2  
ATOM   5193  C C    . ALA A 1 128 ? -10.433 6.066   7.158   1.00 0.23  ? 128  ALA A C    2  
ATOM   5194  O O    . ALA A 1 128 ? -9.447  6.143   7.892   1.00 0.28  ? 128  ALA A O    2  
ATOM   5195  C CB   . ALA A 1 128 ? -12.213 7.678   6.544   1.00 0.23  ? 128  ALA A CB   2  
ATOM   5196  H H    . ALA A 1 128 ? -11.572 6.665   4.327   1.00 0.23  ? 128  ALA A H    2  
ATOM   5197  H HA   . ALA A 1 128 ? -10.114 8.002   6.358   1.00 0.26  ? 128  ALA A HA   2  
ATOM   5198  H HB1  . ALA A 1 128 ? -12.471 8.495   5.888   1.00 1.12  ? 128  ALA A HB1  2  
ATOM   5199  H HB2  . ALA A 1 128 ? -12.254 8.010   7.570   1.00 0.96  ? 128  ALA A HB2  2  
ATOM   5200  H HB3  . ALA A 1 128 ? -12.918 6.861   6.399   1.00 1.02  ? 128  ALA A HB3  2  
ATOM   5201  N N    . TRP A 1 129 ? -11.214 5.010   7.106   1.00 0.25  ? 129  TRP A N    2  
ATOM   5202  C CA   . TRP A 1 129 ? -11.014 3.897   8.002   1.00 0.35  ? 129  TRP A CA   2  
ATOM   5203  C C    . TRP A 1 129 ? -9.889  2.989   7.532   1.00 0.25  ? 129  TRP A C    2  
ATOM   5204  O O    . TRP A 1 129 ? -9.362  2.208   8.315   1.00 0.27  ? 129  TRP A O    2  
ATOM   5205  C CB   . TRP A 1 129 ? -12.320 3.144   8.228   1.00 0.56  ? 129  TRP A CB   2  
ATOM   5206  C CG   . TRP A 1 129 ? -13.136 2.915   7.001   1.00 0.60  ? 129  TRP A CG   2  
ATOM   5207  C CD1  . TRP A 1 129 ? -14.193 3.667   6.593   1.00 0.49  ? 129  TRP A CD1  2  
ATOM   5208  C CD2  . TRP A 1 129 ? -12.989 1.867   6.040   1.00 1.73  ? 129  TRP A CD2  2  
ATOM   5209  N NE1  . TRP A 1 129 ? -14.713 3.162   5.435   1.00 1.14  ? 129  TRP A NE1  2  
ATOM   5210  C CE2  . TRP A 1 129 ? -13.992 2.053   5.071   1.00 1.99  ? 129  TRP A CE2  2  
ATOM   5211  C CE3  . TRP A 1 129 ? -12.109 0.792   5.901   1.00 2.63  ? 129  TRP A CE3  2  
ATOM   5212  C CZ2  . TRP A 1 129 ? -14.139 1.201   3.979   1.00 3.08  ? 129  TRP A CZ2  2  
ATOM   5213  C CZ3  . TRP A 1 129 ? -12.254 -0.049  4.816   1.00 3.70  ? 129  TRP A CZ3  2  
ATOM   5214  C CH2  . TRP A 1 129 ? -13.262 0.158   3.867   1.00 3.91  ? 129  TRP A CH2  2  
ATOM   5215  H H    . TRP A 1 129 ? -11.943 4.980   6.442   1.00 0.26  ? 129  TRP A H    2  
ATOM   5216  H HA   . TRP A 1 129 ? -10.711 4.321   8.948   1.00 0.47  ? 129  TRP A HA   2  
ATOM   5217  H HB2  . TRP A 1 129 ? -12.106 2.188   8.669   1.00 1.10  ? 129  TRP A HB2  2  
ATOM   5218  H HB3  . TRP A 1 129 ? -12.921 3.723   8.908   1.00 0.98  ? 129  TRP A HB3  2  
ATOM   5219  H HD1  . TRP A 1 129 ? -14.557 4.539   7.117   1.00 1.00  ? 129  TRP A HD1  2  
ATOM   5220  H HE1  . TRP A 1 129 ? -15.477 3.540   4.946   1.00 1.24  ? 129  TRP A HE1  2  
ATOM   5221  H HE3  . TRP A 1 129 ? -11.324 0.615   6.622   1.00 2.55  ? 129  TRP A HE3  2  
ATOM   5222  H HZ2  . TRP A 1 129 ? -14.911 1.349   3.237   1.00 3.31  ? 129  TRP A HZ2  2  
ATOM   5223  H HZ3  . TRP A 1 129 ? -11.582 -0.885  4.693   1.00 4.42  ? 129  TRP A HZ3  2  
ATOM   5224  H HH2  . TRP A 1 129 ? -13.338 -0.527  3.035   1.00 4.77  ? 129  TRP A HH2  2  
ATOM   5225  N N    . MET A 1 130 ? -9.513  3.091   6.260   1.00 0.24  ? 130  MET A N    2  
ATOM   5226  C CA   . MET A 1 130 ? -8.296  2.440   5.785   1.00 0.26  ? 130  MET A CA   2  
ATOM   5227  C C    . MET A 1 130 ? -7.106  2.945   6.586   1.00 0.25  ? 130  MET A C    2  
ATOM   5228  O O    . MET A 1 130 ? -6.357  2.168   7.183   1.00 0.29  ? 130  MET A O    2  
ATOM   5229  C CB   . MET A 1 130 ? -8.071  2.722   4.300   1.00 0.31  ? 130  MET A CB   2  
ATOM   5230  C CG   . MET A 1 130 ? -8.778  1.751   3.375   1.00 0.29  ? 130  MET A CG   2  
ATOM   5231  S SD   . MET A 1 130 ? -7.745  0.350   2.923   1.00 1.08  ? 130  MET A SD   2  
ATOM   5232  C CE   . MET A 1 130 ? -6.500  1.176   1.935   1.00 0.31  ? 130  MET A CE   2  
ATOM   5233  H H    . MET A 1 130 ? -10.067 3.609   5.628   1.00 0.26  ? 130  MET A H    2  
ATOM   5234  H HA   . MET A 1 130 ? -8.398  1.376   5.936   1.00 0.28  ? 130  MET A HA   2  
ATOM   5235  H HB2  . MET A 1 130 ? -8.427  3.717   4.078   1.00 0.40  ? 130  MET A HB2  2  
ATOM   5236  H HB3  . MET A 1 130 ? -7.012  2.675   4.094   1.00 0.40  ? 130  MET A HB3  2  
ATOM   5237  H HG2  . MET A 1 130 ? -9.660  1.383   3.874   1.00 0.69  ? 130  MET A HG2  2  
ATOM   5238  H HG3  . MET A 1 130 ? -9.065  2.276   2.477   1.00 0.67  ? 130  MET A HG3  2  
ATOM   5239  H HE1  . MET A 1 130 ? -5.725  0.472   1.672   1.00 1.03  ? 130  MET A HE1  2  
ATOM   5240  H HE2  . MET A 1 130 ? -6.073  1.991   2.504   1.00 1.09  ? 130  MET A HE2  2  
ATOM   5241  H HE3  . MET A 1 130 ? -6.955  1.564   1.032   1.00 1.02  ? 130  MET A HE3  2  
ATOM   5242  N N    . ALA A 1 131 ? -6.954  4.261   6.617   1.00 0.24  ? 131  ALA A N    2  
ATOM   5243  C CA   . ALA A 1 131 ? -5.883  4.884   7.374   1.00 0.24  ? 131  ALA A CA   2  
ATOM   5244  C C    . ALA A 1 131 ? -6.054  4.632   8.862   1.00 0.24  ? 131  ALA A C    2  
ATOM   5245  O O    . ALA A 1 131 ? -5.080  4.364   9.568   1.00 0.25  ? 131  ALA A O    2  
ATOM   5246  C CB   . ALA A 1 131 ? -5.830  6.372   7.093   1.00 0.25  ? 131  ALA A CB   2  
ATOM   5247  H H    . ALA A 1 131 ? -7.574  4.825   6.104   1.00 0.25  ? 131  ALA A H    2  
ATOM   5248  H HA   . ALA A 1 131 ? -4.948  4.447   7.049   1.00 0.25  ? 131  ALA A HA   2  
ATOM   5249  H HB1  . ALA A 1 131 ? -4.977  6.800   7.596   1.00 1.04  ? 131  ALA A HB1  2  
ATOM   5250  H HB2  . ALA A 1 131 ? -6.734  6.838   7.456   1.00 1.01  ? 131  ALA A HB2  2  
ATOM   5251  H HB3  . ALA A 1 131 ? -5.740  6.533   6.026   1.00 1.05  ? 131  ALA A HB3  2  
ATOM   5252  N N    . THR A 1 132 ? -7.290  4.728   9.340   1.00 0.26  ? 132  THR A N    2  
ATOM   5253  C CA   . THR A 1 132 ? -7.580  4.434   10.737  1.00 0.29  ? 132  THR A CA   2  
ATOM   5254  C C    . THR A 1 132 ? -7.165  3.013   11.121  1.00 0.30  ? 132  THR A C    2  
ATOM   5255  O O    . THR A 1 132 ? -6.498  2.808   12.133  1.00 0.32  ? 132  THR A O    2  
ATOM   5256  C CB   . THR A 1 132 ? -9.072  4.597   11.062  1.00 0.32  ? 132  THR A CB   2  
ATOM   5257  O OG1  . THR A 1 132 ? -9.479  5.959   10.877  1.00 0.35  ? 132  THR A OG1  2  
ATOM   5258  C CG2  . THR A 1 132 ? -9.338  4.159   12.494  1.00 0.40  ? 132  THR A CG2  2  
ATOM   5259  H H    . THR A 1 132 ? -8.020  5.033   8.745   1.00 0.28  ? 132  THR A H    2  
ATOM   5260  H HA   . THR A 1 132 ? -7.023  5.138   11.341  1.00 0.31  ? 132  THR A HA   2  
ATOM   5261  H HB   . THR A 1 132 ? -9.642  3.965   10.397  1.00 0.33  ? 132  THR A HB   2  
ATOM   5262  H HG1  . THR A 1 132 ? -10.415 5.982   10.623  1.00 1.04  ? 132  THR A HG1  2  
ATOM   5263  H HG21 . THR A 1 132 ? -8.767  4.779   13.172  1.00 1.11  ? 132  THR A HG21 2  
ATOM   5264  H HG22 . THR A 1 132 ? -9.029  3.127   12.613  1.00 1.07  ? 132  THR A HG22 2  
ATOM   5265  H HG23 . THR A 1 132 ? -10.390 4.249   12.713  1.00 1.13  ? 132  THR A HG23 2  
ATOM   5266  N N    . TYR A 1 133 ? -7.582  2.030   10.332  1.00 0.30  ? 133  TYR A N    2  
ATOM   5267  C CA   . TYR A 1 133 ? -7.274  0.639   10.631  1.00 0.32  ? 133  TYR A CA   2  
ATOM   5268  C C    . TYR A 1 133 ? -5.773  0.408   10.685  1.00 0.32  ? 133  TYR A C    2  
ATOM   5269  O O    . TYR A 1 133 ? -5.297  -0.391  11.488  1.00 0.37  ? 133  TYR A O    2  
ATOM   5270  C CB   . TYR A 1 133 ? -7.931  -0.296  9.621   1.00 0.33  ? 133  TYR A CB   2  
ATOM   5271  C CG   . TYR A 1 133 ? -9.244  -0.863  10.111  1.00 0.93  ? 133  TYR A CG   2  
ATOM   5272  C CD1  . TYR A 1 133 ? -10.420 -0.132  9.996   1.00 1.29  ? 133  TYR A CD1  2  
ATOM   5273  C CD2  . TYR A 1 133 ? -9.313  -2.129  10.675  1.00 1.72  ? 133  TYR A CD2  2  
ATOM   5274  C CE1  . TYR A 1 133 ? -11.626 -0.646  10.432  1.00 1.93  ? 133  TYR A CE1  2  
ATOM   5275  C CE2  . TYR A 1 133 ? -10.515 -2.651  11.110  1.00 2.40  ? 133  TYR A CE2  2  
ATOM   5276  C CZ   . TYR A 1 133 ? -11.650 -1.904  11.036  1.00 2.40  ? 133  TYR A CZ   2  
ATOM   5277  O OH   . TYR A 1 133 ? -12.866 -2.423  11.417  1.00 3.13  ? 133  TYR A OH   2  
ATOM   5278  H H    . TYR A 1 133 ? -8.112  2.245   9.529   1.00 0.30  ? 133  TYR A H    2  
ATOM   5279  H HA   . TYR A 1 133 ? -7.682  0.425   11.608  1.00 0.34  ? 133  TYR A HA   2  
ATOM   5280  H HB2  . TYR A 1 133 ? -8.125  0.253   8.712   1.00 0.63  ? 133  TYR A HB2  2  
ATOM   5281  H HB3  . TYR A 1 133 ? -7.265  -1.119  9.411   1.00 0.67  ? 133  TYR A HB3  2  
ATOM   5282  H HD1  . TYR A 1 133 ? -10.385 0.856   9.559   1.00 1.45  ? 133  TYR A HD1  2  
ATOM   5283  H HD2  . TYR A 1 133 ? -8.408  -2.710  10.771  1.00 1.99  ? 133  TYR A HD2  2  
ATOM   5284  H HE1  . TYR A 1 133 ? -12.529 -0.063  10.335  1.00 2.31  ? 133  TYR A HE1  2  
ATOM   5285  H HE2  . TYR A 1 133 ? -10.548 -3.638  11.546  1.00 3.06  ? 133  TYR A HE2  2  
ATOM   5286  H HH   . TYR A 1 133 ? -12.714 -2.962  12.208  1.00 3.35  ? 133  TYR A HH   2  
ATOM   5287  N N    . LEU A 1 134 ? -5.026  1.113   9.847   1.00 0.29  ? 134  LEU A N    2  
ATOM   5288  C CA   . LEU A 1 134 ? -3.578  1.105   9.965   1.00 0.30  ? 134  LEU A CA   2  
ATOM   5289  C C    . LEU A 1 134 ? -3.208  1.683   11.324  1.00 0.32  ? 134  LEU A C    2  
ATOM   5290  O O    . LEU A 1 134 ? -2.549  1.032   12.128  1.00 0.35  ? 134  LEU A O    2  
ATOM   5291  C CB   . LEU A 1 134 ? -2.924  1.934   8.849   1.00 0.29  ? 134  LEU A CB   2  
ATOM   5292  C CG   . LEU A 1 134 ? -1.451  1.605   8.568   1.00 0.48  ? 134  LEU A CG   2  
ATOM   5293  C CD1  . LEU A 1 134 ? -0.958  2.362   7.356   1.00 0.95  ? 134  LEU A CD1  2  
ATOM   5294  C CD2  . LEU A 1 134 ? -0.580  1.948   9.760   1.00 0.88  ? 134  LEU A CD2  2  
ATOM   5295  H H    . LEU A 1 134 ? -5.455  1.638   9.135   1.00 0.28  ? 134  LEU A H    2  
ATOM   5296  H HA   . LEU A 1 134 ? -3.236  0.079   9.905   1.00 0.31  ? 134  LEU A HA   2  
ATOM   5297  H HB2  . LEU A 1 134 ? -3.486  1.795   7.940   1.00 0.33  ? 134  LEU A HB2  2  
ATOM   5298  H HB3  . LEU A 1 134 ? -2.984  2.976   9.127   1.00 0.42  ? 134  LEU A HB3  2  
ATOM   5299  H HG   . LEU A 1 134 ? -1.352  0.547   8.371   1.00 1.16  ? 134  LEU A HG   2  
ATOM   5300  H HD11 . LEU A 1 134 ? -0.685  3.364   7.649   1.00 1.59  ? 134  LEU A HD11 2  
ATOM   5301  H HD12 . LEU A 1 134 ? -1.742  2.404   6.615   1.00 1.54  ? 134  LEU A HD12 2  
ATOM   5302  H HD13 . LEU A 1 134 ? -0.096  1.859   6.945   1.00 1.45  ? 134  LEU A HD13 2  
ATOM   5303  H HD21 . LEU A 1 134 ? -0.894  1.370   10.615  1.00 1.30  ? 134  LEU A HD21 2  
ATOM   5304  H HD22 . LEU A 1 134 ? -0.678  3.005   9.981   1.00 1.49  ? 134  LEU A HD22 2  
ATOM   5305  H HD23 . LEU A 1 134 ? 0.451   1.722   9.530   1.00 1.46  ? 134  LEU A HD23 2  
ATOM   5306  N N    . ASN A 1 135 ? -3.684  2.894   11.568  1.00 0.31  ? 135  ASN A N    2  
ATOM   5307  C CA   . ASN A 1 135 ? -3.415  3.629   12.801  1.00 0.35  ? 135  ASN A CA   2  
ATOM   5308  C C    . ASN A 1 135 ? -3.617  2.774   14.050  1.00 0.38  ? 135  ASN A C    2  
ATOM   5309  O O    . ASN A 1 135 ? -2.738  2.701   14.906  1.00 0.43  ? 135  ASN A O    2  
ATOM   5310  C CB   . ASN A 1 135 ? -4.330  4.853   12.873  1.00 0.36  ? 135  ASN A CB   2  
ATOM   5311  C CG   . ASN A 1 135 ? -3.688  6.110   12.335  1.00 0.38  ? 135  ASN A CG   2  
ATOM   5312  O OD1  . ASN A 1 135 ? -3.079  6.871   13.079  1.00 0.46  ? 135  ASN A OD1  2  
ATOM   5313  N ND2  . ASN A 1 135 ? -3.829  6.340   11.041  1.00 0.34  ? 135  ASN A ND2  2  
ATOM   5314  H H    . ASN A 1 135 ? -4.250  3.318   10.884  1.00 0.30  ? 135  ASN A H    2  
ATOM   5315  H HA   . ASN A 1 135 ? -2.391  3.963   12.771  1.00 0.37  ? 135  ASN A HA   2  
ATOM   5316  H HB2  . ASN A 1 135 ? -5.212  4.656   12.288  1.00 0.34  ? 135  ASN A HB2  2  
ATOM   5317  H HB3  . ASN A 1 135 ? -4.616  5.023   13.896  1.00 0.40  ? 135  ASN A HB3  2  
ATOM   5318  H HD21 . ASN A 1 135 ? -4.333  5.686   10.506  1.00 0.30  ? 135  ASN A HD21 2  
ATOM   5319  H HD22 . ASN A 1 135 ? -3.434  7.156   10.673  1.00 0.37  ? 135  ASN A HD22 2  
ATOM   5320  N N    . ASP A 1 136 ? -4.769  2.126   14.151  1.00 0.38  ? 136  ASP A N    2  
ATOM   5321  C CA   . ASP A 1 136 ? -5.108  1.392   15.364  1.00 0.42  ? 136  ASP A CA   2  
ATOM   5322  C C    . ASP A 1 136 ? -4.526  -0.019  15.366  1.00 0.40  ? 136  ASP A C    2  
ATOM   5323  O O    . ASP A 1 136 ? -3.954  -0.463  16.360  1.00 0.43  ? 136  ASP A O    2  
ATOM   5324  C CB   . ASP A 1 136 ? -6.626  1.318   15.534  1.00 0.45  ? 136  ASP A CB   2  
ATOM   5325  C CG   . ASP A 1 136 ? -7.020  0.670   16.843  1.00 0.53  ? 136  ASP A CG   2  
ATOM   5326  O OD1  . ASP A 1 136 ? -6.921  1.342   17.893  1.00 0.59  ? 136  ASP A OD1  2  
ATOM   5327  O OD2  . ASP A 1 136 ? -7.434  -0.510  16.832  1.00 0.58  ? 136  ASP A OD2  2  
ATOM   5328  H H    . ASP A 1 136 ? -5.411  2.151   13.400  1.00 0.37  ? 136  ASP A H    2  
ATOM   5329  H HA   . ASP A 1 136 ? -4.694  1.934   16.200  1.00 0.46  ? 136  ASP A HA   2  
ATOM   5330  H HB2  . ASP A 1 136 ? -7.034  2.318   15.510  1.00 0.48  ? 136  ASP A HB2  2  
ATOM   5331  H HB3  . ASP A 1 136 ? -7.046  0.742   14.723  1.00 0.44  ? 136  ASP A HB3  2  
ATOM   5332  N N    . HIS A 1 137 ? -4.670  -0.717  14.252  1.00 0.38  ? 137  HIS A N    2  
ATOM   5333  C CA   . HIS A 1 137 ? -4.331  -2.133  14.190  1.00 0.38  ? 137  HIS A CA   2  
ATOM   5334  C C    . HIS A 1 137 ? -2.888  -2.375  13.764  1.00 0.35  ? 137  HIS A C    2  
ATOM   5335  O O    . HIS A 1 137 ? -2.156  -3.119  14.414  1.00 0.37  ? 137  HIS A O    2  
ATOM   5336  C CB   . HIS A 1 137 ? -5.274  -2.845  13.220  1.00 0.40  ? 137  HIS A CB   2  
ATOM   5337  C CG   . HIS A 1 137 ? -6.505  -3.401  13.870  1.00 0.63  ? 137  HIS A CG   2  
ATOM   5338  N ND1  . HIS A 1 137 ? -6.513  -4.572  14.598  1.00 1.18  ? 137  HIS A ND1  2  
ATOM   5339  C CD2  . HIS A 1 137 ? -7.777  -2.940  13.894  1.00 1.45  ? 137  HIS A CD2  2  
ATOM   5340  C CE1  . HIS A 1 137 ? -7.735  -4.806  15.039  1.00 1.13  ? 137  HIS A CE1  2  
ATOM   5341  N NE2  . HIS A 1 137 ? -8.519  -3.831  14.627  1.00 1.34  ? 137  HIS A NE2  2  
ATOM   5342  H H    . HIS A 1 137 ? -4.997  -0.270  13.442  1.00 0.37  ? 137  HIS A H    2  
ATOM   5343  H HA   . HIS A 1 137 ? -4.473  -2.547  15.176  1.00 0.42  ? 137  HIS A HA   2  
ATOM   5344  H HB2  . HIS A 1 137 ? -5.596  -2.130  12.474  1.00 0.51  ? 137  HIS A HB2  2  
ATOM   5345  H HB3  . HIS A 1 137 ? -4.747  -3.653  12.731  1.00 0.41  ? 137  HIS A HB3  2  
ATOM   5346  H HD1  . HIS A 1 137 ? -5.727  -5.148  14.781  1.00 1.96  ? 137  HIS A HD1  2  
ATOM   5347  H HD2  . HIS A 1 137 ? -8.140  -2.036  13.424  1.00 2.34  ? 137  HIS A HD2  2  
ATOM   5348  H HE1  . HIS A 1 137 ? -8.039  -5.651  15.639  1.00 1.61  ? 137  HIS A HE1  2  
ATOM   5349  H HE2  . HIS A 1 137 ? -9.470  -3.716  14.886  1.00 1.90  ? 137  HIS A HE2  2  
ATOM   5350  N N    . LEU A 1 138 ? -2.486  -1.740  12.680  1.00 0.32  ? 138  LEU A N    2  
ATOM   5351  C CA   . LEU A 1 138 ? -1.256  -2.108  11.999  1.00 0.29  ? 138  LEU A CA   2  
ATOM   5352  C C    . LEU A 1 138 ? -0.053  -1.333  12.500  1.00 0.27  ? 138  LEU A C    2  
ATOM   5353  O O    . LEU A 1 138 ? 1.038   -1.884  12.589  1.00 0.27  ? 138  LEU A O    2  
ATOM   5354  C CB   . LEU A 1 138 ? -1.437  -1.878  10.509  1.00 0.30  ? 138  LEU A CB   2  
ATOM   5355  C CG   . LEU A 1 138 ? -2.692  -2.522  9.940   1.00 0.59  ? 138  LEU A CG   2  
ATOM   5356  C CD1  . LEU A 1 138 ? -2.855  -2.173  8.481   1.00 1.20  ? 138  LEU A CD1  2  
ATOM   5357  C CD2  . LEU A 1 138 ? -2.641  -4.022  10.140  1.00 1.20  ? 138  LEU A CD2  2  
ATOM   5358  H H    . LEU A 1 138 ? -3.028  -1.003  12.322  1.00 0.33  ? 138  LEU A H    2  
ATOM   5359  H HA   . LEU A 1 138 ? -1.087  -3.160  12.168  1.00 0.32  ? 138  LEU A HA   2  
ATOM   5360  H HB2  . LEU A 1 138 ? -1.481  -0.812  10.329  1.00 0.58  ? 138  LEU A HB2  2  
ATOM   5361  H HB3  . LEU A 1 138 ? -0.581  -2.284  9.992   1.00 0.58  ? 138  LEU A HB3  2  
ATOM   5362  H HG   . LEU A 1 138 ? -3.554  -2.143  10.471  1.00 1.51  ? 138  LEU A HG   2  
ATOM   5363  H HD11 . LEU A 1 138 ? -3.731  -2.669  8.093   1.00 1.82  ? 138  LEU A HD11 2  
ATOM   5364  H HD12 . LEU A 1 138 ? -1.980  -2.495  7.935   1.00 1.75  ? 138  LEU A HD12 2  
ATOM   5365  H HD13 . LEU A 1 138 ? -2.969  -1.105  8.384   1.00 1.75  ? 138  LEU A HD13 2  
ATOM   5366  H HD21 . LEU A 1 138 ? -1.754  -4.417  9.668   1.00 1.73  ? 138  LEU A HD21 2  
ATOM   5367  H HD22 . LEU A 1 138 ? -3.518  -4.473  9.704   1.00 1.90  ? 138  LEU A HD22 2  
ATOM   5368  H HD23 . LEU A 1 138 ? -2.611  -4.237  11.199  1.00 1.66  ? 138  LEU A HD23 2  
ATOM   5369  N N    . GLU A 1 139 ? -0.261  -0.065  12.822  1.00 0.30  ? 139  GLU A N    2  
ATOM   5370  C CA   . GLU A 1 139 ? 0.828   0.836   13.195  1.00 0.31  ? 139  GLU A CA   2  
ATOM   5371  C C    . GLU A 1 139 ? 1.743   0.229   14.267  1.00 0.30  ? 139  GLU A C    2  
ATOM   5372  O O    . GLU A 1 139 ? 2.959   0.209   14.081  1.00 0.30  ? 139  GLU A O    2  
ATOM   5373  C CB   . GLU A 1 139 ? 0.279   2.183   13.657  1.00 0.38  ? 139  GLU A CB   2  
ATOM   5374  C CG   . GLU A 1 139 ? 1.339   3.261   13.770  1.00 0.40  ? 139  GLU A CG   2  
ATOM   5375  C CD   . GLU A 1 139 ? 0.778   4.547   14.328  1.00 0.49  ? 139  GLU A CD   2  
ATOM   5376  O OE1  . GLU A 1 139 ? 0.324   5.398   13.534  1.00 0.75  ? 139  GLU A OE1  2  
ATOM   5377  O OE2  . GLU A 1 139 ? 0.798   4.721   15.556  1.00 0.61  ? 139  GLU A OE2  2  
ATOM   5378  H H    . GLU A 1 139 ? -1.181  0.283   12.802  1.00 0.34  ? 139  GLU A H    2  
ATOM   5379  H HA   . GLU A 1 139 ? 1.420   1.000   12.308  1.00 0.30  ? 139  GLU A HA   2  
ATOM   5380  H HB2  . GLU A 1 139 ? -0.468  2.514   12.953  1.00 0.44  ? 139  GLU A HB2  2  
ATOM   5381  H HB3  . GLU A 1 139 ? -0.181  2.063   14.624  1.00 0.42  ? 139  GLU A HB3  2  
ATOM   5382  H HG2  . GLU A 1 139 ? 2.131   2.913   14.418  1.00 0.40  ? 139  GLU A HG2  2  
ATOM   5383  H HG3  . GLU A 1 139 ? 1.739   3.457   12.786  1.00 0.42  ? 139  GLU A HG3  2  
ATOM   5384  N N    . PRO A 1 140 ? 1.196   -0.289  15.393  1.00 0.32  ? 140  PRO A N    2  
ATOM   5385  C CA   . PRO A 1 140 ? 2.016   -0.950  16.411  1.00 0.34  ? 140  PRO A CA   2  
ATOM   5386  C C    . PRO A 1 140 ? 2.805   -2.115  15.823  1.00 0.32  ? 140  PRO A C    2  
ATOM   5387  O O    . PRO A 1 140 ? 4.018   -2.209  15.995  1.00 0.34  ? 140  PRO A O    2  
ATOM   5388  C CB   . PRO A 1 140 ? 0.997   -1.465  17.432  1.00 0.40  ? 140  PRO A CB   2  
ATOM   5389  C CG   . PRO A 1 140 ? -0.217  -0.632  17.228  1.00 0.56  ? 140  PRO A CG   2  
ATOM   5390  C CD   . PRO A 1 140 ? -0.234  -0.273  15.773  1.00 0.36  ? 140  PRO A CD   2  
ATOM   5391  H HA   . PRO A 1 140 ? 2.695   -0.258  16.886  1.00 0.37  ? 140  PRO A HA   2  
ATOM   5392  H HB2  . PRO A 1 140 ? 0.793   -2.508  17.242  1.00 0.48  ? 140  PRO A HB2  2  
ATOM   5393  H HB3  . PRO A 1 140 ? 1.393   -1.346  18.430  1.00 0.52  ? 140  PRO A HB3  2  
ATOM   5394  H HG2  . PRO A 1 140 ? -1.098  -1.202  17.483  1.00 0.82  ? 140  PRO A HG2  2  
ATOM   5395  H HG3  . PRO A 1 140 ? -0.157  0.260   17.834  1.00 0.87  ? 140  PRO A HG3  2  
ATOM   5396  H HD2  . PRO A 1 140 ? -0.789  -1.008  15.210  1.00 0.42  ? 140  PRO A HD2  2  
ATOM   5397  H HD3  . PRO A 1 140 ? -0.660  0.707   15.636  1.00 0.46  ? 140  PRO A HD3  2  
ATOM   5398  N N    . TRP A 1 141 ? 2.098   -2.977  15.098  1.00 0.31  ? 141  TRP A N    2  
ATOM   5399  C CA   . TRP A 1 141 ? 2.691   -4.160  14.482  1.00 0.32  ? 141  TRP A CA   2  
ATOM   5400  C C    . TRP A 1 141 ? 3.831   -3.761  13.547  1.00 0.31  ? 141  TRP A C    2  
ATOM   5401  O O    . TRP A 1 141 ? 4.921   -4.314  13.619  1.00 0.36  ? 141  TRP A O    2  
ATOM   5402  C CB   . TRP A 1 141 ? 1.615   -4.930  13.719  1.00 0.35  ? 141  TRP A CB   2  
ATOM   5403  C CG   . TRP A 1 141 ? 1.891   -6.393  13.620  1.00 0.36  ? 141  TRP A CG   2  
ATOM   5404  C CD1  . TRP A 1 141 ? 2.776   -7.004  12.786  1.00 0.43  ? 141  TRP A CD1  2  
ATOM   5405  C CD2  . TRP A 1 141 ? 1.271   -7.435  14.383  1.00 0.63  ? 141  TRP A CD2  2  
ATOM   5406  N NE1  . TRP A 1 141 ? 2.745   -8.360  12.981  1.00 0.60  ? 141  TRP A NE1  2  
ATOM   5407  C CE2  . TRP A 1 141 ? 1.830   -8.652  13.956  1.00 0.70  ? 141  TRP A CE2  2  
ATOM   5408  C CE3  . TRP A 1 141 ? 0.298   -7.456  15.386  1.00 0.91  ? 141  TRP A CE3  2  
ATOM   5409  C CZ2  . TRP A 1 141 ? 1.450   -9.878  14.496  1.00 0.98  ? 141  TRP A CZ2  2  
ATOM   5410  C CZ3  . TRP A 1 141 ? -0.079  -8.674  15.921  1.00 1.19  ? 141  TRP A CZ3  2  
ATOM   5411  C CH2  . TRP A 1 141 ? 0.496   -9.870  15.476  1.00 1.20  ? 141  TRP A CH2  2  
ATOM   5412  H H    . TRP A 1 141 ? 1.142   -2.807  14.970  1.00 0.32  ? 141  TRP A H    2  
ATOM   5413  H HA   . TRP A 1 141 ? 3.089   -4.790  15.263  1.00 0.36  ? 141  TRP A HA   2  
ATOM   5414  H HB2  . TRP A 1 141 ? 0.666   -4.803  14.221  1.00 0.48  ? 141  TRP A HB2  2  
ATOM   5415  H HB3  . TRP A 1 141 ? 1.541   -4.533  12.716  1.00 0.41  ? 141  TRP A HB3  2  
ATOM   5416  H HD1  . TRP A 1 141 ? 3.403   -6.483  12.078  1.00 0.54  ? 141  TRP A HD1  2  
ATOM   5417  H HE1  . TRP A 1 141 ? 3.291   -9.014  12.495  1.00 0.74  ? 141  TRP A HE1  2  
ATOM   5418  H HE3  . TRP A 1 141 ? -0.157  -6.544  15.741  1.00 0.97  ? 141  TRP A HE3  2  
ATOM   5419  H HZ2  . TRP A 1 141 ? 1.885   -10.809 14.163  1.00 1.08  ? 141  TRP A HZ2  2  
ATOM   5420  H HZ3  . TRP A 1 141 ? -0.830  -8.710  16.697  1.00 1.43  ? 141  TRP A HZ3  2  
ATOM   5421  H HH2  . TRP A 1 141 ? 0.170   -10.798 15.922  1.00 1.43  ? 141  TRP A HH2  2  
ATOM   5422  N N    . ILE A 1 142 ? 3.566   -2.798  12.677  1.00 0.26  ? 142  ILE A N    2  
ATOM   5423  C CA   . ILE A 1 142 ? 4.585   -2.207  11.809  1.00 0.26  ? 142  ILE A CA   2  
ATOM   5424  C C    . ILE A 1 142 ? 5.866   -1.891  12.578  1.00 0.29  ? 142  ILE A C    2  
ATOM   5425  O O    . ILE A 1 142 ? 6.957   -2.313  12.189  1.00 0.32  ? 142  ILE A O    2  
ATOM   5426  C CB   . ILE A 1 142 ? 4.030   -0.912  11.186  1.00 0.25  ? 142  ILE A CB   2  
ATOM   5427  C CG1  . ILE A 1 142 ? 2.947   -1.260  10.174  1.00 0.28  ? 142  ILE A CG1  2  
ATOM   5428  C CG2  . ILE A 1 142 ? 5.134   -0.082  10.548  1.00 0.28  ? 142  ILE A CG2  2  
ATOM   5429  C CD1  . ILE A 1 142 ? 1.987   -0.132  9.904   1.00 0.26  ? 142  ILE A CD1  2  
ATOM   5430  H H    . ILE A 1 142 ? 2.634   -2.474  12.600  1.00 0.25  ? 142  ILE A H    2  
ATOM   5431  H HA   . ILE A 1 142 ? 4.809   -2.907  11.015  1.00 0.28  ? 142  ILE A HA   2  
ATOM   5432  H HB   . ILE A 1 142 ? 3.589   -0.325  11.978  1.00 0.26  ? 142  ILE A HB   2  
ATOM   5433  H HG12 . ILE A 1 142 ? 3.413   -1.530  9.237   1.00 0.40  ? 142  ILE A HG12 2  
ATOM   5434  H HG13 . ILE A 1 142 ? 2.377   -2.101  10.541  1.00 0.41  ? 142  ILE A HG13 2  
ATOM   5435  H HG21 . ILE A 1 142 ? 5.635   -0.668  9.791   1.00 1.13  ? 142  ILE A HG21 2  
ATOM   5436  H HG22 . ILE A 1 142 ? 5.844   0.210   11.309  1.00 1.06  ? 142  ILE A HG22 2  
ATOM   5437  H HG23 . ILE A 1 142 ? 4.705   0.801   10.098  1.00 0.97  ? 142  ILE A HG23 2  
ATOM   5438  H HD11 . ILE A 1 142 ? 1.573   0.215   10.839  1.00 1.01  ? 142  ILE A HD11 2  
ATOM   5439  H HD12 . ILE A 1 142 ? 1.187   -0.486  9.265   1.00 1.00  ? 142  ILE A HD12 2  
ATOM   5440  H HD13 . ILE A 1 142 ? 2.507   0.680   9.417   1.00 1.07  ? 142  ILE A HD13 2  
ATOM   5441  N N    . GLN A 1 143 ? 5.720   -1.150  13.666  1.00 0.30  ? 143  GLN A N    2  
ATOM   5442  C CA   . GLN A 1 143 ? 6.853   -0.745  14.488  1.00 0.35  ? 143  GLN A CA   2  
ATOM   5443  C C    . GLN A 1 143 ? 7.614   -1.959  15.034  1.00 0.39  ? 143  GLN A C    2  
ATOM   5444  O O    . GLN A 1 143 ? 8.833   -1.913  15.194  1.00 0.43  ? 143  GLN A O    2  
ATOM   5445  C CB   . GLN A 1 143 ? 6.369   0.131   15.639  1.00 0.41  ? 143  GLN A CB   2  
ATOM   5446  C CG   . GLN A 1 143 ? 5.523   1.310   15.184  1.00 0.43  ? 143  GLN A CG   2  
ATOM   5447  C CD   . GLN A 1 143 ? 6.279   2.294   14.310  1.00 0.48  ? 143  GLN A CD   2  
ATOM   5448  O OE1  . GLN A 1 143 ? 7.490   2.471   14.450  1.00 0.57  ? 143  GLN A OE1  2  
ATOM   5449  N NE2  . GLN A 1 143 ? 5.563   2.937   13.398  1.00 0.52  ? 143  GLN A NE2  2  
ATOM   5450  H H    . GLN A 1 143 ? 4.817   -0.858  13.921  1.00 0.29  ? 143  GLN A H    2  
ATOM   5451  H HA   . GLN A 1 143 ? 7.518   -0.165  13.868  1.00 0.36  ? 143  GLN A HA   2  
ATOM   5452  H HB2  . GLN A 1 143 ? 5.777   -0.475  16.309  1.00 0.42  ? 143  GLN A HB2  2  
ATOM   5453  H HB3  . GLN A 1 143 ? 7.226   0.513   16.170  1.00 0.45  ? 143  GLN A HB3  2  
ATOM   5454  H HG2  . GLN A 1 143 ? 4.685   0.932   14.615  1.00 0.38  ? 143  GLN A HG2  2  
ATOM   5455  H HG3  . GLN A 1 143 ? 5.158   1.832   16.056  1.00 0.50  ? 143  GLN A HG3  2  
ATOM   5456  H HE21 . GLN A 1 143 ? 4.603   2.743   13.342  1.00 0.56  ? 143  GLN A HE21 2  
ATOM   5457  H HE22 . GLN A 1 143 ? 6.019   3.584   12.817  1.00 0.58  ? 143  GLN A HE22 2  
ATOM   5458  N N    . GLU A 1 144 ? 6.889   -3.050  15.294  1.00 0.40  ? 144  GLU A N    2  
ATOM   5459  C CA   . GLU A 1 144 ? 7.491   -4.287  15.796  1.00 0.47  ? 144  GLU A CA   2  
ATOM   5460  C C    . GLU A 1 144 ? 8.407   -4.911  14.748  1.00 0.48  ? 144  GLU A C    2  
ATOM   5461  O O    . GLU A 1 144 ? 9.265   -5.735  15.060  1.00 0.55  ? 144  GLU A O    2  
ATOM   5462  C CB   . GLU A 1 144 ? 6.387   -5.285  16.143  1.00 0.51  ? 144  GLU A CB   2  
ATOM   5463  C CG   . GLU A 1 144 ? 5.317   -4.723  17.053  1.00 0.52  ? 144  GLU A CG   2  
ATOM   5464  C CD   . GLU A 1 144 ? 5.718   -4.705  18.514  1.00 0.61  ? 144  GLU A CD   2  
ATOM   5465  O OE1  . GLU A 1 144 ? 5.629   -5.760  19.172  1.00 0.78  ? 144  GLU A OE1  2  
ATOM   5466  O OE2  . GLU A 1 144 ? 6.117   -3.632  19.017  1.00 0.67  ? 144  GLU A OE2  2  
ATOM   5467  H H    . GLU A 1 144 ? 5.916   -3.026  15.154  1.00 0.38  ? 144  GLU A H    2  
ATOM   5468  H HA   . GLU A 1 144 ? 8.058   -4.057  16.680  1.00 0.51  ? 144  GLU A HA   2  
ATOM   5469  H HB2  . GLU A 1 144 ? 5.907   -5.608  15.230  1.00 0.50  ? 144  GLU A HB2  2  
ATOM   5470  H HB3  . GLU A 1 144 ? 6.831   -6.141  16.630  1.00 0.57  ? 144  GLU A HB3  2  
ATOM   5471  H HG2  . GLU A 1 144 ? 5.109   -3.708  16.746  1.00 0.47  ? 144  GLU A HG2  2  
ATOM   5472  H HG3  . GLU A 1 144 ? 4.428   -5.318  16.936  1.00 0.55  ? 144  GLU A HG3  2  
ATOM   5473  N N    . ASN A 1 145 ? 8.206   -4.509  13.506  1.00 0.44  ? 145  ASN A N    2  
ATOM   5474  C CA   . ASN A 1 145 ? 8.903   -5.094  12.371  1.00 0.48  ? 145  ASN A CA   2  
ATOM   5475  C C    . ASN A 1 145 ? 9.903   -4.111  11.790  1.00 0.47  ? 145  ASN A C    2  
ATOM   5476  O O    . ASN A 1 145 ? 10.562  -4.392  10.787  1.00 0.57  ? 145  ASN A O    2  
ATOM   5477  C CB   . ASN A 1 145 ? 7.881   -5.516  11.317  1.00 0.49  ? 145  ASN A CB   2  
ATOM   5478  C CG   . ASN A 1 145 ? 7.055   -6.690  11.790  1.00 0.58  ? 145  ASN A CG   2  
ATOM   5479  O OD1  . ASN A 1 145 ? 7.325   -7.840  11.442  1.00 0.93  ? 145  ASN A OD1  2  
ATOM   5480  N ND2  . ASN A 1 145 ? 6.063   -6.407  12.616  1.00 0.54  ? 145  ASN A ND2  2  
ATOM   5481  H H    . ASN A 1 145 ? 7.564   -3.788  13.344  1.00 0.39  ? 145  ASN A H    2  
ATOM   5482  H HA   . ASN A 1 145 ? 9.431   -5.968  12.719  1.00 0.55  ? 145  ASN A HA   2  
ATOM   5483  H HB2  . ASN A 1 145 ? 7.217   -4.688  11.115  1.00 0.44  ? 145  ASN A HB2  2  
ATOM   5484  H HB3  . ASN A 1 145 ? 8.391   -5.793  10.410  1.00 0.52  ? 145  ASN A HB3  2  
ATOM   5485  H HD21 . ASN A 1 145 ? 5.919   -5.465  12.864  1.00 0.69  ? 145  ASN A HD21 2  
ATOM   5486  H HD22 . ASN A 1 145 ? 5.529   -7.136  12.972  1.00 0.56  ? 145  ASN A HD22 2  
ATOM   5487  N N    . GLY A 1 146 ? 10.004  -2.954  12.424  1.00 0.42  ? 146  GLY A N    2  
ATOM   5488  C CA   . GLY A 1 146 ? 10.994  -1.981  12.035  1.00 0.45  ? 146  GLY A CA   2  
ATOM   5489  C C    . GLY A 1 146 ? 10.407  -0.614  11.764  1.00 0.44  ? 146  GLY A C    2  
ATOM   5490  O O    . GLY A 1 146 ? 10.908  0.394   12.263  1.00 0.56  ? 146  GLY A O    2  
ATOM   5491  H H    . GLY A 1 146 ? 9.400   -2.762  13.171  1.00 0.44  ? 146  GLY A H    2  
ATOM   5492  H HA2  . GLY A 1 146 ? 11.711  -1.898  12.830  1.00 0.49  ? 146  GLY A HA2  2  
ATOM   5493  H HA3  . GLY A 1 146 ? 11.496  -2.331  11.146  1.00 0.47  ? 146  GLY A HA3  2  
ATOM   5494  N N    . GLY A 1 147 ? 9.344   -0.576  10.982  1.00 0.36  ? 147  GLY A N    2  
ATOM   5495  C CA   . GLY A 1 147 ? 8.741   0.686   10.610  1.00 0.36  ? 147  GLY A CA   2  
ATOM   5496  C C    . GLY A 1 147 ? 8.614   0.817   9.109   1.00 0.38  ? 147  GLY A C    2  
ATOM   5497  O O    . GLY A 1 147 ? 9.133   -0.021  8.367   1.00 0.49  ? 147  GLY A O    2  
ATOM   5498  H H    . GLY A 1 147 ? 8.966   -1.414  10.645  1.00 0.37  ? 147  GLY A H    2  
ATOM   5499  H HA2  . GLY A 1 147 ? 7.758   0.754   11.055  1.00 0.35  ? 147  GLY A HA2  2  
ATOM   5500  H HA3  . GLY A 1 147 ? 9.353   1.494   10.982  1.00 0.39  ? 147  GLY A HA3  2  
ATOM   5501  N N    . TRP A 1 148 ? 7.942   1.862   8.654   1.00 0.35  ? 148  TRP A N    2  
ATOM   5502  C CA   . TRP A 1 148 ? 7.701   2.053   7.234   1.00 0.37  ? 148  TRP A CA   2  
ATOM   5503  C C    . TRP A 1 148 ? 9.000   2.283   6.470   1.00 0.38  ? 148  TRP A C    2  
ATOM   5504  O O    . TRP A 1 148 ? 9.153   1.804   5.346   1.00 0.40  ? 148  TRP A O    2  
ATOM   5505  C CB   . TRP A 1 148 ? 6.735   3.211   7.003   1.00 0.39  ? 148  TRP A CB   2  
ATOM   5506  C CG   . TRP A 1 148 ? 5.314   2.864   7.308   1.00 0.46  ? 148  TRP A CG   2  
ATOM   5507  C CD1  . TRP A 1 148 ? 4.520   3.404   8.278   1.00 0.79  ? 148  TRP A CD1  2  
ATOM   5508  C CD2  . TRP A 1 148 ? 4.519   1.891   6.630   1.00 1.45  ? 148  TRP A CD2  2  
ATOM   5509  N NE1  . TRP A 1 148 ? 3.273   2.830   8.234   1.00 0.52  ? 148  TRP A NE1  2  
ATOM   5510  C CE2  . TRP A 1 148 ? 3.250   1.896   7.231   1.00 1.25  ? 148  TRP A CE2  2  
ATOM   5511  C CE3  . TRP A 1 148 ? 4.760   1.015   5.567   1.00 2.64  ? 148  TRP A CE3  2  
ATOM   5512  C CZ2  . TRP A 1 148 ? 2.224   1.060   6.804   1.00 2.17  ? 148  TRP A CZ2  2  
ATOM   5513  C CZ3  . TRP A 1 148 ? 3.741   0.187   5.145   1.00 3.57  ? 148  TRP A CZ3  2  
ATOM   5514  C CH2  . TRP A 1 148 ? 2.487   0.215   5.763   1.00 3.32  ? 148  TRP A CH2  2  
ATOM   5515  H H    . TRP A 1 148 ? 7.598   2.533   9.294   1.00 0.36  ? 148  TRP A H    2  
ATOM   5516  H HA   . TRP A 1 148 ? 7.246   1.150   6.859   1.00 0.40  ? 148  TRP A HA   2  
ATOM   5517  H HB2  . TRP A 1 148 ? 7.015   4.041   7.628   1.00 0.42  ? 148  TRP A HB2  2  
ATOM   5518  H HB3  . TRP A 1 148 ? 6.789   3.511   5.969   1.00 0.46  ? 148  TRP A HB3  2  
ATOM   5519  H HD1  . TRP A 1 148 ? 4.837   4.174   8.967   1.00 1.69  ? 148  TRP A HD1  2  
ATOM   5520  H HE1  . TRP A 1 148 ? 2.522   3.056   8.826   1.00 0.78  ? 148  TRP A HE1  2  
ATOM   5521  H HE3  . TRP A 1 148 ? 5.722   0.982   5.078   1.00 2.86  ? 148  TRP A HE3  2  
ATOM   5522  H HZ2  . TRP A 1 148 ? 1.250   1.067   7.270   1.00 2.01  ? 148  TRP A HZ2  2  
ATOM   5523  H HZ3  . TRP A 1 148 ? 3.907   -0.495  4.326   1.00 4.52  ? 148  TRP A HZ3  2  
ATOM   5524  H HH2  . TRP A 1 148 ? 1.718   -0.453  5.401   1.00 4.08  ? 148  TRP A HH2  2  
ATOM   5525  N N    . ASP A 1 149 ? 9.941   2.990   7.089   1.00 0.42  ? 149  ASP A N    2  
ATOM   5526  C CA   . ASP A 1 149 ? 11.246  3.236   6.475   1.00 0.47  ? 149  ASP A CA   2  
ATOM   5527  C C    . ASP A 1 149 ? 11.960  1.924   6.190   1.00 0.47  ? 149  ASP A C    2  
ATOM   5528  O O    . ASP A 1 149 ? 12.695  1.806   5.211   1.00 0.52  ? 149  ASP A O    2  
ATOM   5529  C CB   . ASP A 1 149 ? 12.126  4.107   7.373   1.00 0.56  ? 149  ASP A CB   2  
ATOM   5530  C CG   . ASP A 1 149 ? 12.445  3.465   8.708   1.00 1.23  ? 149  ASP A CG   2  
ATOM   5531  O OD1  . ASP A 1 149 ? 11.618  3.570   9.636   1.00 1.96  ? 149  ASP A OD1  2  
ATOM   5532  O OD2  . ASP A 1 149 ? 13.520  2.842   8.836   1.00 1.72  ? 149  ASP A OD2  2  
ATOM   5533  H H    . ASP A 1 149 ? 9.752   3.361   7.978   1.00 0.44  ? 149  ASP A H    2  
ATOM   5534  H HA   . ASP A 1 149 ? 11.081  3.749   5.536   1.00 0.50  ? 149  ASP A HA   2  
ATOM   5535  H HB2  . ASP A 1 149 ? 13.057  4.292   6.863   1.00 1.33  ? 149  ASP A HB2  2  
ATOM   5536  H HB3  . ASP A 1 149 ? 11.624  5.044   7.554   1.00 1.06  ? 149  ASP A HB3  2  
ATOM   5537  N N    . THR A 1 150 ? 11.732  0.942   7.044   1.00 0.47  ? 150  THR A N    2  
ATOM   5538  C CA   . THR A 1 150 ? 12.325  -0.367  6.861   1.00 0.51  ? 150  THR A CA   2  
ATOM   5539  C C    . THR A 1 150 ? 11.740  -1.064  5.637   1.00 0.50  ? 150  THR A C    2  
ATOM   5540  O O    . THR A 1 150 ? 12.465  -1.694  4.871   1.00 0.56  ? 150  THR A O    2  
ATOM   5541  C CB   . THR A 1 150 ? 12.129  -1.258  8.099   1.00 0.56  ? 150  THR A CB   2  
ATOM   5542  O OG1  . THR A 1 150 ? 12.697  -0.625  9.252   1.00 0.62  ? 150  THR A OG1  2  
ATOM   5543  C CG2  . THR A 1 150 ? 12.778  -2.617  7.886   1.00 0.67  ? 150  THR A CG2  2  
ATOM   5544  H H    . THR A 1 150 ? 11.162  1.110   7.823   1.00 0.47  ? 150  THR A H    2  
ATOM   5545  H HA   . THR A 1 150 ? 13.386  -0.225  6.709   1.00 0.56  ? 150  THR A HA   2  
ATOM   5546  H HB   . THR A 1 150 ? 11.071  -1.402  8.259   1.00 0.52  ? 150  THR A HB   2  
ATOM   5547  H HG1  . THR A 1 150 ? 13.457  -0.087  8.981   1.00 0.91  ? 150  THR A HG1  2  
ATOM   5548  H HG21 . THR A 1 150 ? 13.746  -2.481  7.415   1.00 1.10  ? 150  THR A HG21 2  
ATOM   5549  H HG22 . THR A 1 150 ? 12.148  -3.220  7.247   1.00 1.24  ? 150  THR A HG22 2  
ATOM   5550  H HG23 . THR A 1 150 ? 12.906  -3.110  8.838   1.00 1.22  ? 150  THR A HG23 2  
ATOM   5551  N N    . PHE A 1 151 ? 10.433  -0.926  5.434   1.00 0.45  ? 151  PHE A N    2  
ATOM   5552  C CA   . PHE A 1 151 ? 9.783   -1.540  4.283   1.00 0.47  ? 151  PHE A CA   2  
ATOM   5553  C C    . PHE A 1 151 ? 10.380  -0.961  3.013   1.00 0.48  ? 151  PHE A C    2  
ATOM   5554  O O    . PHE A 1 151 ? 10.510  -1.636  1.998   1.00 0.55  ? 151  PHE A O    2  
ATOM   5555  C CB   . PHE A 1 151 ? 8.271   -1.307  4.313   1.00 0.47  ? 151  PHE A CB   2  
ATOM   5556  C CG   . PHE A 1 151 ? 7.568   -1.835  3.094   1.00 1.18  ? 151  PHE A CG   2  
ATOM   5557  C CD1  . PHE A 1 151 ? 7.374   -3.195  2.929   1.00 1.80  ? 151  PHE A CD1  2  
ATOM   5558  C CD2  . PHE A 1 151 ? 7.120   -0.974  2.105   1.00 1.75  ? 151  PHE A CD2  2  
ATOM   5559  C CE1  . PHE A 1 151 ? 6.741   -3.689  1.806   1.00 2.65  ? 151  PHE A CE1  2  
ATOM   5560  C CE2  . PHE A 1 151 ? 6.489   -1.464  0.978   1.00 2.61  ? 151  PHE A CE2  2  
ATOM   5561  C CZ   . PHE A 1 151 ? 6.300   -2.823  0.829   1.00 3.00  ? 151  PHE A CZ   2  
ATOM   5562  H H    . PHE A 1 151 ? 9.904   -0.374  6.050   1.00 0.43  ? 151  PHE A H    2  
ATOM   5563  H HA   . PHE A 1 151 ? 9.984   -2.602  4.314   1.00 0.52  ? 151  PHE A HA   2  
ATOM   5564  H HB2  . PHE A 1 151 ? 7.853   -1.802  5.178   1.00 0.93  ? 151  PHE A HB2  2  
ATOM   5565  H HB3  . PHE A 1 151 ? 8.076   -0.247  4.379   1.00 0.79  ? 151  PHE A HB3  2  
ATOM   5566  H HD1  . PHE A 1 151 ? 7.718   -3.876  3.693   1.00 1.84  ? 151  PHE A HD1  2  
ATOM   5567  H HD2  . PHE A 1 151 ? 7.266   0.089   2.221   1.00 1.77  ? 151  PHE A HD2  2  
ATOM   5568  H HE1  . PHE A 1 151 ? 6.594   -4.753  1.693   1.00 3.20  ? 151  PHE A HE1  2  
ATOM   5569  H HE2  . PHE A 1 151 ? 6.143   -0.784  0.213   1.00 3.13  ? 151  PHE A HE2  2  
ATOM   5570  H HZ   . PHE A 1 151 ? 5.807   -3.207  -0.052  1.00 3.72  ? 151  PHE A HZ   2  
ATOM   5571  N N    . VAL A 1 152 ? 10.753  0.298   3.108   1.00 0.45  ? 152  VAL A N    2  
ATOM   5572  C CA   . VAL A 1 152 ? 11.453  0.996   2.053   1.00 0.49  ? 152  VAL A CA   2  
ATOM   5573  C C    . VAL A 1 152 ? 12.810  0.358   1.791   1.00 0.57  ? 152  VAL A C    2  
ATOM   5574  O O    . VAL A 1 152 ? 13.138  -0.003  0.666   1.00 0.64  ? 152  VAL A O    2  
ATOM   5575  C CB   . VAL A 1 152 ? 11.670  2.448   2.480   1.00 0.60  ? 152  VAL A CB   2  
ATOM   5576  C CG1  . VAL A 1 152 ? 12.430  3.216   1.428   1.00 1.15  ? 152  VAL A CG1  2  
ATOM   5577  C CG2  . VAL A 1 152 ? 10.351  3.100   2.815   1.00 0.91  ? 152  VAL A CG2  2  
ATOM   5578  H H    . VAL A 1 152 ? 10.545  0.787   3.932   1.00 0.43  ? 152  VAL A H    2  
ATOM   5579  H HA   . VAL A 1 152 ? 10.852  0.974   1.156   1.00 0.51  ? 152  VAL A HA   2  
ATOM   5580  H HB   . VAL A 1 152 ? 12.264  2.443   3.377   1.00 1.21  ? 152  VAL A HB   2  
ATOM   5581  H HG11 . VAL A 1 152 ? 13.412  2.779   1.322   1.00 1.86  ? 152  VAL A HG11 2  
ATOM   5582  H HG12 . VAL A 1 152 ? 12.520  4.246   1.733   1.00 1.51  ? 152  VAL A HG12 2  
ATOM   5583  H HG13 . VAL A 1 152 ? 11.904  3.157   0.488   1.00 1.68  ? 152  VAL A HG13 2  
ATOM   5584  H HG21 . VAL A 1 152 ? 9.704   3.079   1.951   1.00 1.44  ? 152  VAL A HG21 2  
ATOM   5585  H HG22 . VAL A 1 152 ? 10.525  4.122   3.117   1.00 1.54  ? 152  VAL A HG22 2  
ATOM   5586  H HG23 . VAL A 1 152 ? 9.887   2.555   3.631   1.00 1.45  ? 152  VAL A HG23 2  
ATOM   5587  N N    . GLU A 1 153 ? 13.604  0.264   2.839   1.00 0.59  ? 153  GLU A N    2  
ATOM   5588  C CA   . GLU A 1 153 ? 14.913  -0.365  2.777   1.00 0.69  ? 153  GLU A CA   2  
ATOM   5589  C C    . GLU A 1 153 ? 14.852  -1.721  2.069   1.00 0.70  ? 153  GLU A C    2  
ATOM   5590  O O    . GLU A 1 153 ? 15.667  -2.019  1.196   1.00 0.80  ? 153  GLU A O    2  
ATOM   5591  C CB   . GLU A 1 153 ? 15.450  -0.518  4.196   1.00 0.76  ? 153  GLU A CB   2  
ATOM   5592  C CG   . GLU A 1 153 ? 15.613  0.821   4.888   1.00 0.80  ? 153  GLU A CG   2  
ATOM   5593  C CD   . GLU A 1 153 ? 16.777  1.624   4.342   1.00 1.31  ? 153  GLU A CD   2  
ATOM   5594  O OE1  . GLU A 1 153 ? 16.590  2.339   3.335   1.00 1.67  ? 153  GLU A OE1  2  
ATOM   5595  O OE2  . GLU A 1 153 ? 17.882  1.549   4.916   1.00 1.58  ? 153  GLU A OE2  2  
ATOM   5596  H H    . GLU A 1 153 ? 13.305  0.649   3.691   1.00 0.57  ? 153  GLU A H    2  
ATOM   5597  H HA   . GLU A 1 153 ? 15.568  0.291   2.228   1.00 0.73  ? 153  GLU A HA   2  
ATOM   5598  H HB2  . GLU A 1 153 ? 14.756  -1.122  4.776   1.00 0.71  ? 153  GLU A HB2  2  
ATOM   5599  H HB3  . GLU A 1 153 ? 16.410  -1.008  4.162   1.00 0.86  ? 153  GLU A HB3  2  
ATOM   5600  H HG2  . GLU A 1 153 ? 14.704  1.396   4.732   1.00 0.86  ? 153  GLU A HG2  2  
ATOM   5601  H HG3  . GLU A 1 153 ? 15.764  0.656   5.945   1.00 0.92  ? 153  GLU A HG3  2  
ATOM   5602  N N    . LEU A 1 154 ? 13.873  -2.525  2.453   1.00 0.67  ? 154  LEU A N    2  
ATOM   5603  C CA   . LEU A 1 154 ? 13.668  -3.838  1.876   1.00 0.72  ? 154  LEU A CA   2  
ATOM   5604  C C    . LEU A 1 154 ? 13.038  -3.793  0.478   1.00 0.74  ? 154  LEU A C    2  
ATOM   5605  O O    . LEU A 1 154 ? 13.638  -4.242  -0.498  1.00 0.83  ? 154  LEU A O    2  
ATOM   5606  C CB   . LEU A 1 154 ? 12.763  -4.637  2.813   1.00 0.72  ? 154  LEU A CB   2  
ATOM   5607  C CG   . LEU A 1 154 ? 13.444  -5.225  4.049   1.00 0.83  ? 154  LEU A CG   2  
ATOM   5608  C CD1  . LEU A 1 154 ? 14.168  -4.171  4.868   1.00 1.30  ? 154  LEU A CD1  2  
ATOM   5609  C CD2  . LEU A 1 154 ? 12.426  -5.949  4.908   1.00 1.14  ? 154  LEU A CD2  2  
ATOM   5610  H H    . LEU A 1 154 ? 13.295  -2.253  3.194   1.00 0.67  ? 154  LEU A H    2  
ATOM   5611  H HA   . LEU A 1 154 ? 14.625  -4.331  1.819   1.00 0.79  ? 154  LEU A HA   2  
ATOM   5612  H HB2  . LEU A 1 154 ? 11.965  -3.988  3.145   1.00 0.83  ? 154  LEU A HB2  2  
ATOM   5613  H HB3  . LEU A 1 154 ? 12.329  -5.449  2.250   1.00 0.78  ? 154  LEU A HB3  2  
ATOM   5614  H HG   . LEU A 1 154 ? 14.172  -5.931  3.721   1.00 1.45  ? 154  LEU A HG   2  
ATOM   5615  H HD11 . LEU A 1 154 ? 14.666  -4.642  5.702   1.00 1.82  ? 154  LEU A HD11 2  
ATOM   5616  H HD12 . LEU A 1 154 ? 13.453  -3.449  5.236   1.00 1.62  ? 154  LEU A HD12 2  
ATOM   5617  H HD13 . LEU A 1 154 ? 14.896  -3.672  4.245   1.00 1.96  ? 154  LEU A HD13 2  
ATOM   5618  H HD21 . LEU A 1 154 ? 11.669  -5.248  5.231   1.00 1.60  ? 154  LEU A HD21 2  
ATOM   5619  H HD22 . LEU A 1 154 ? 12.918  -6.371  5.771   1.00 1.52  ? 154  LEU A HD22 2  
ATOM   5620  H HD23 . LEU A 1 154 ? 11.965  -6.737  4.332   1.00 1.78  ? 154  LEU A HD23 2  
ATOM   5621  N N    . TYR A 1 155 ? 11.834  -3.243  0.389   1.00 0.69  ? 155  TYR A N    2  
ATOM   5622  C CA   . TYR A 1 155 ? 11.004  -3.391  -0.805  1.00 0.78  ? 155  TYR A CA   2  
ATOM   5623  C C    . TYR A 1 155 ? 10.657  -2.037  -1.428  1.00 0.77  ? 155  TYR A C    2  
ATOM   5624  O O    . TYR A 1 155 ? 9.696   -1.924  -2.192  1.00 1.15  ? 155  TYR A O    2  
ATOM   5625  C CB   . TYR A 1 155 ? 9.721   -4.117  -0.407  1.00 0.86  ? 155  TYR A CB   2  
ATOM   5626  C CG   . TYR A 1 155 ? 9.223   -5.108  -1.434  1.00 1.40  ? 155  TYR A CG   2  
ATOM   5627  C CD1  . TYR A 1 155 ? 9.805   -6.361  -1.564  1.00 1.83  ? 155  TYR A CD1  2  
ATOM   5628  C CD2  . TYR A 1 155 ? 8.173   -4.780  -2.281  1.00 2.24  ? 155  TYR A CD2  2  
ATOM   5629  C CE1  . TYR A 1 155 ? 9.353   -7.261  -2.508  1.00 2.65  ? 155  TYR A CE1  2  
ATOM   5630  C CE2  . TYR A 1 155 ? 7.715   -5.674  -3.227  1.00 3.16  ? 155  TYR A CE2  2  
ATOM   5631  C CZ   . TYR A 1 155 ? 8.309   -6.944  -3.307  1.00 3.24  ? 155  TYR A CZ   2  
ATOM   5632  O OH   . TYR A 1 155 ? 7.854   -7.805  -4.280  1.00 4.24  ? 155  TYR A OH   2  
ATOM   5633  H H    . TYR A 1 155 ? 11.487  -2.717  1.149   1.00 0.63  ? 155  TYR A H    2  
ATOM   5634  H HA   . TYR A 1 155 ? 11.540  -3.989  -1.523  1.00 0.86  ? 155  TYR A HA   2  
ATOM   5635  H HB2  . TYR A 1 155 ? 9.893   -4.655  0.513   1.00 1.32  ? 155  TYR A HB2  2  
ATOM   5636  H HB3  . TYR A 1 155 ? 8.945   -3.383  -0.247  1.00 1.12  ? 155  TYR A HB3  2  
ATOM   5637  H HD1  . TYR A 1 155 ? 10.623  -6.630  -0.912  1.00 1.93  ? 155  TYR A HD1  2  
ATOM   5638  H HD2  . TYR A 1 155 ? 7.709   -3.808  -2.192  1.00 2.42  ? 155  TYR A HD2  2  
ATOM   5639  H HE1  . TYR A 1 155 ? 9.816   -8.233  -2.594  1.00 3.07  ? 155  TYR A HE1  2  
ATOM   5640  H HE2  . TYR A 1 155 ? 6.896   -5.402  -3.877  1.00 3.94  ? 155  TYR A HE2  2  
ATOM   5641  H HH   . TYR A 1 155 ? 7.766   -8.684  -3.872  1.00 4.39  ? 155  TYR A HH   2  
ATOM   5642  N N    . GLY A 1 156 ? 11.456  -1.031  -1.113  1.00 0.66  ? 156  GLY A N    2  
ATOM   5643  C CA   . GLY A 1 156 ? 11.154  0.335   -1.493  1.00 0.64  ? 156  GLY A CA   2  
ATOM   5644  C C    . GLY A 1 156 ? 11.201  0.629   -2.972  1.00 0.78  ? 156  GLY A C    2  
ATOM   5645  O O    . GLY A 1 156 ? 11.504  -0.229  -3.807  1.00 1.10  ? 156  GLY A O    2  
ATOM   5646  H H    . GLY A 1 156 ? 12.265  -1.211  -0.593  1.00 0.85  ? 156  GLY A H    2  
ATOM   5647  H HA2  . GLY A 1 156 ? 10.163  0.581   -1.143  1.00 0.61  ? 156  GLY A HA2  2  
ATOM   5648  H HA3  . GLY A 1 156 ? 11.858  0.988   -0.996  1.00 0.66  ? 156  GLY A HA3  2  
ATOM   5649  N N    . ASN A 1 157 ? 10.900  1.879   -3.263  1.00 0.70  ? 157  ASN A N    2  
ATOM   5650  C CA   . ASN A 1 157 ? 10.813  2.400   -4.604  1.00 0.80  ? 157  ASN A CA   2  
ATOM   5651  C C    . ASN A 1 157 ? 12.199  2.548   -5.214  1.00 1.14  ? 157  ASN A C    2  
ATOM   5652  O O    . ASN A 1 157 ? 12.969  3.424   -4.818  1.00 1.29  ? 157  ASN A O    2  
ATOM   5653  C CB   . ASN A 1 157 ? 10.117  3.751   -4.522  1.00 0.70  ? 157  ASN A CB   2  
ATOM   5654  C CG   . ASN A 1 157 ? 9.972   4.448   -5.854  1.00 0.77  ? 157  ASN A CG   2  
ATOM   5655  O OD1  . ASN A 1 157 ? 10.877  5.150   -6.303  1.00 0.88  ? 157  ASN A OD1  2  
ATOM   5656  N ND2  . ASN A 1 157 ? 8.820   4.291   -6.478  1.00 0.76  ? 157  ASN A ND2  2  
ATOM   5657  H H    . ASN A 1 157 ? 10.735  2.499   -2.522  1.00 0.75  ? 157  ASN A H    2  
ATOM   5658  H HA   . ASN A 1 157 ? 10.223  1.726   -5.195  1.00 0.86  ? 157  ASN A HA   2  
ATOM   5659  H HB2  . ASN A 1 157 ? 9.131   3.604   -4.108  1.00 0.60  ? 157  ASN A HB2  2  
ATOM   5660  H HB3  . ASN A 1 157 ? 10.682  4.391   -3.860  1.00 0.83  ? 157  ASN A HB3  2  
ATOM   5661  H HD21 . ASN A 1 157 ? 8.130   3.731   -6.054  1.00 0.72  ? 157  ASN A HD21 2  
ATOM   5662  H HD22 . ASN A 1 157 ? 8.691   4.755   -7.329  1.00 0.83  ? 157  ASN A HD22 2  
ATOM   5663  N N    . ASN A 1 158 ? 12.514  1.705   -6.184  1.00 1.40  ? 158  ASN A N    2  
ATOM   5664  C CA   . ASN A 1 158 ? 13.860  1.670   -6.738  1.00 1.79  ? 158  ASN A CA   2  
ATOM   5665  C C    . ASN A 1 158 ? 14.097  2.763   -7.767  1.00 1.93  ? 158  ASN A C    2  
ATOM   5666  O O    . ASN A 1 158 ? 15.229  2.964   -8.210  1.00 2.18  ? 158  ASN A O    2  
ATOM   5667  C CB   . ASN A 1 158 ? 14.190  0.297   -7.319  1.00 2.11  ? 158  ASN A CB   2  
ATOM   5668  C CG   . ASN A 1 158 ? 14.636  -0.676  -6.246  1.00 2.55  ? 158  ASN A CG   2  
ATOM   5669  O OD1  . ASN A 1 158 ? 14.136  -0.659  -5.122  1.00 2.99  ? 158  ASN A OD1  2  
ATOM   5670  N ND2  . ASN A 1 158 ? 15.611  -1.503  -6.572  1.00 2.94  ? 158  ASN A ND2  2  
ATOM   5671  H H    . ASN A 1 158 ? 11.832  1.092   -6.532  1.00 1.40  ? 158  ASN A H    2  
ATOM   5672  H HA   . ASN A 1 158 ? 14.536  1.850   -5.914  1.00 1.90  ? 158  ASN A HA   2  
ATOM   5673  H HB2  . ASN A 1 158 ? 13.311  -0.104  -7.805  1.00 2.60  ? 158  ASN A HB2  2  
ATOM   5674  H HB3  . ASN A 1 158 ? 14.984  0.399   -8.044  1.00 2.06  ? 158  ASN A HB3  2  
ATOM   5675  H HD21 . ASN A 1 158 ? 15.981  -1.444  -7.474  1.00 2.95  ? 158  ASN A HD21 2  
ATOM   5676  H HD22 . ASN A 1 158 ? 15.929  -2.142  -5.892  1.00 3.44  ? 158  ASN A HD22 2  
ATOM   5677  N N    . ALA A 1 159 ? 13.045  3.480   -8.139  1.00 1.86  ? 159  ALA A N    2  
ATOM   5678  C CA   . ALA A 1 159 ? 13.198  4.662   -8.976  1.00 2.10  ? 159  ALA A CA   2  
ATOM   5679  C C    . ALA A 1 159 ? 14.085  5.673   -8.262  1.00 2.25  ? 159  ALA A C    2  
ATOM   5680  O O    . ALA A 1 159 ? 14.890  6.366   -8.881  1.00 2.52  ? 159  ALA A O    2  
ATOM   5681  C CB   . ALA A 1 159 ? 11.845  5.271   -9.309  1.00 2.14  ? 159  ALA A CB   2  
ATOM   5682  H H    . ALA A 1 159 ? 12.145  3.199   -7.863  1.00 1.72  ? 159  ALA A H    2  
ATOM   5683  H HA   . ALA A 1 159 ? 13.678  4.362   -9.898  1.00 2.27  ? 159  ALA A HA   2  
ATOM   5684  H HB1  . ALA A 1 159 ? 11.239  4.542   -9.825  1.00 2.67  ? 159  ALA A HB1  2  
ATOM   5685  H HB2  . ALA A 1 159 ? 11.985  6.135   -9.941  1.00 2.16  ? 159  ALA A HB2  2  
ATOM   5686  H HB3  . ALA A 1 159 ? 11.351  5.571   -8.397  1.00 2.26  ? 159  ALA A HB3  2  
ATOM   5687  N N    . ALA A 1 160 ? 13.937  5.735   -6.945  1.00 2.17  ? 160  ALA A N    2  
ATOM   5688  C CA   . ALA A 1 160 ? 14.792  6.568   -6.120  1.00 2.44  ? 160  ALA A CA   2  
ATOM   5689  C C    . ALA A 1 160 ? 15.884  5.731   -5.454  1.00 2.55  ? 160  ALA A C    2  
ATOM   5690  O O    . ALA A 1 160 ? 17.021  6.181   -5.312  1.00 2.87  ? 160  ALA A O    2  
ATOM   5691  C CB   . ALA A 1 160 ? 13.970  7.296   -5.072  1.00 2.45  ? 160  ALA A CB   2  
ATOM   5692  H H    . ALA A 1 160 ? 13.225  5.209   -6.519  1.00 1.99  ? 160  ALA A H    2  
ATOM   5693  H HA   . ALA A 1 160 ? 15.255  7.306   -6.757  1.00 2.68  ? 160  ALA A HA   2  
ATOM   5694  H HB1  . ALA A 1 160 ? 13.528  6.577   -4.399  1.00 2.39  ? 160  ALA A HB1  2  
ATOM   5695  H HB2  . ALA A 1 160 ? 13.190  7.864   -5.557  1.00 2.74  ? 160  ALA A HB2  2  
ATOM   5696  H HB3  . ALA A 1 160 ? 14.610  7.964   -4.515  1.00 2.79  ? 160  ALA A HB3  2  
ATOM   5697  N N    . ALA A 1 161 ? 15.529  4.505   -5.061  1.00 2.37  ? 161  ALA A N    2  
ATOM   5698  C CA   . ALA A 1 161 ? 16.459  3.604   -4.374  1.00 2.60  ? 161  ALA A CA   2  
ATOM   5699  C C    . ALA A 1 161 ? 17.737  3.393   -5.172  1.00 2.85  ? 161  ALA A C    2  
ATOM   5700  O O    . ALA A 1 161 ? 18.836  3.564   -4.648  1.00 3.20  ? 161  ALA A O    2  
ATOM   5701  C CB   . ALA A 1 161 ? 15.804  2.258   -4.090  1.00 2.50  ? 161  ALA A CB   2  
ATOM   5702  H H    . ALA A 1 161 ? 14.607  4.204   -5.218  1.00 2.16  ? 161  ALA A H    2  
ATOM   5703  H HA   . ALA A 1 161 ? 16.713  4.056   -3.427  1.00 2.77  ? 161  ALA A HA   2  
ATOM   5704  H HB1  . ALA A 1 161 ? 15.657  1.720   -5.020  1.00 2.69  ? 161  ALA A HB1  2  
ATOM   5705  H HB2  . ALA A 1 161 ? 14.848  2.416   -3.613  1.00 2.61  ? 161  ALA A HB2  2  
ATOM   5706  H HB3  . ALA A 1 161 ? 16.440  1.678   -3.437  1.00 2.76  ? 161  ALA A HB3  2  
ATOM   5707  N N    . GLU A 1 162 ? 17.595  3.035   -6.444  1.00 2.76  ? 162  GLU A N    2  
ATOM   5708  C CA   . GLU A 1 162 ? 18.750  2.743   -7.282  1.00 3.08  ? 162  GLU A CA   2  
ATOM   5709  C C    . GLU A 1 162 ? 19.495  4.019   -7.640  1.00 3.31  ? 162  GLU A C    2  
ATOM   5710  O O    . GLU A 1 162 ? 20.705  4.001   -7.859  1.00 3.67  ? 162  GLU A O    2  
ATOM   5711  C CB   . GLU A 1 162 ? 18.324  2.000   -8.544  1.00 3.06  ? 162  GLU A CB   2  
ATOM   5712  C CG   . GLU A 1 162 ? 17.666  0.664   -8.252  1.00 3.25  ? 162  GLU A CG   2  
ATOM   5713  C CD   . GLU A 1 162 ? 17.342  -0.112  -9.504  1.00 3.48  ? 162  GLU A CD   2  
ATOM   5714  O OE1  . GLU A 1 162 ? 16.251  0.082   -10.067 1.00 3.72  ? 162  GLU A OE1  2  
ATOM   5715  O OE2  . GLU A 1 162 ? 18.183  -0.928  -9.932  1.00 3.71  ? 162  GLU A OE2  2  
ATOM   5716  H H    . GLU A 1 162 ? 16.693  2.971   -6.828  1.00 2.53  ? 162  GLU A H    2  
ATOM   5717  H HA   . GLU A 1 162 ? 19.413  2.108   -6.713  1.00 3.27  ? 162  GLU A HA   2  
ATOM   5718  H HB2  . GLU A 1 162 ? 17.623  2.612   -9.090  1.00 3.33  ? 162  GLU A HB2  2  
ATOM   5719  H HB3  . GLU A 1 162 ? 19.194  1.823   -9.159  1.00 3.04  ? 162  GLU A HB3  2  
ATOM   5720  H HG2  . GLU A 1 162 ? 18.335  0.073   -7.644  1.00 3.26  ? 162  GLU A HG2  2  
ATOM   5721  H HG3  . GLU A 1 162 ? 16.750  0.842   -7.708  1.00 3.57  ? 162  GLU A HG3  2  
ATOM   5722  N N    . SER A 1 163 ? 18.773  5.127   -7.671  1.00 3.19  ? 163  SER A N    2  
ATOM   5723  C CA   . SER A 1 163 ? 19.382  6.423   -7.908  1.00 3.52  ? 163  SER A CA   2  
ATOM   5724  C C    . SER A 1 163 ? 20.315  6.789   -6.753  1.00 3.81  ? 163  SER A C    2  
ATOM   5725  O O    . SER A 1 163 ? 21.312  7.484   -6.937  1.00 4.18  ? 163  SER A O    2  
ATOM   5726  C CB   . SER A 1 163 ? 18.291  7.481   -8.088  1.00 3.44  ? 163  SER A CB   2  
ATOM   5727  O OG   . SER A 1 163 ? 17.459  7.161   -9.193  1.00 3.87  ? 163  SER A OG   2  
ATOM   5728  H H    . SER A 1 163 ? 17.805  5.073   -7.537  1.00 2.92  ? 163  SER A H    2  
ATOM   5729  H HA   . SER A 1 163 ? 19.961  6.356   -8.817  1.00 3.71  ? 163  SER A HA   2  
ATOM   5730  H HB2  . SER A 1 163 ? 17.683  7.526   -7.194  1.00 3.31  ? 163  SER A HB2  2  
ATOM   5731  H HB3  . SER A 1 163 ? 18.749  8.443   -8.263  1.00 3.45  ? 163  SER A HB3  2  
ATOM   5732  H HG   . SER A 1 163 ? 16.529  7.196   -8.922  1.00 4.20  ? 163  SER A HG   2  
ATOM   5733  N N    . ARG A 1 164 ? 19.981  6.310   -5.559  1.00 3.70  ? 164  ARG A N    2  
ATOM   5734  C CA   . ARG A 1 164 ? 20.826  6.503   -4.388  1.00 4.07  ? 164  ARG A CA   2  
ATOM   5735  C C    . ARG A 1 164 ? 21.808  5.346   -4.217  1.00 4.24  ? 164  ARG A C    2  
ATOM   5736  O O    . ARG A 1 164 ? 22.750  5.419   -3.427  1.00 4.61  ? 164  ARG A O    2  
ATOM   5737  C CB   . ARG A 1 164 ? 19.965  6.650   -3.137  1.00 4.05  ? 164  ARG A CB   2  
ATOM   5738  C CG   . ARG A 1 164 ? 19.187  7.948   -3.108  1.00 4.12  ? 164  ARG A CG   2  
ATOM   5739  C CD   . ARG A 1 164 ? 20.108  9.144   -2.943  1.00 4.41  ? 164  ARG A CD   2  
ATOM   5740  N NE   . ARG A 1 164 ? 19.367  10.401  -2.888  1.00 4.73  ? 164  ARG A NE   2  
ATOM   5741  C CZ   . ARG A 1 164 ? 19.928  11.584  -2.644  1.00 5.32  ? 164  ARG A CZ   2  
ATOM   5742  N NH1  . ARG A 1 164 ? 21.245  11.678  -2.482  1.00 5.65  ? 164  ARG A NH1  2  
ATOM   5743  N NH2  . ARG A 1 164 ? 19.174  12.672  -2.579  1.00 5.82  ? 164  ARG A NH2  2  
ATOM   5744  H H    . ARG A 1 164 ? 19.137  5.818   -5.462  1.00 3.42  ? 164  ARG A H    2  
ATOM   5745  H HA   . ARG A 1 164 ? 21.379  7.413   -4.536  1.00 4.33  ? 164  ARG A HA   2  
ATOM   5746  H HB2  . ARG A 1 164 ? 19.263  5.830   -3.096  1.00 3.79  ? 164  ARG A HB2  2  
ATOM   5747  H HB3  . ARG A 1 164 ? 20.602  6.616   -2.266  1.00 4.41  ? 164  ARG A HB3  2  
ATOM   5748  H HG2  . ARG A 1 164 ? 18.658  8.048   -4.040  1.00 4.04  ? 164  ARG A HG2  2  
ATOM   5749  H HG3  . ARG A 1 164 ? 18.485  7.923   -2.287  1.00 4.42  ? 164  ARG A HG3  2  
ATOM   5750  H HD2  . ARG A 1 164 ? 20.669  9.028   -2.028  1.00 4.55  ? 164  ARG A HD2  2  
ATOM   5751  H HD3  . ARG A 1 164 ? 20.788  9.177   -3.781  1.00 4.64  ? 164  ARG A HD3  2  
ATOM   5752  H HE   . ARG A 1 164 ? 18.389  10.354  -3.031  1.00 4.71  ? 164  ARG A HE   2  
ATOM   5753  H HH11 . ARG A 1 164 ? 21.820  10.860  -2.540  1.00 5.49  ? 164  ARG A HH11 2  
ATOM   5754  H HH12 . ARG A 1 164 ? 21.674  12.576  -2.311  1.00 6.23  ? 164  ARG A HH12 2  
ATOM   5755  H HH21 . ARG A 1 164 ? 18.176  12.608  -2.714  1.00 5.80  ? 164  ARG A HH21 2  
ATOM   5756  H HH22 . ARG A 1 164 ? 19.589  13.571  -2.384  1.00 6.37  ? 164  ARG A HH22 2  
ATOM   5757  N N    . LYS A 1 165 ? 21.584  4.287   -4.973  1.00 4.03  ? 165  LYS A N    2  
ATOM   5758  C CA   . LYS A 1 165 ? 22.372  3.068   -4.845  1.00 4.26  ? 165  LYS A CA   2  
ATOM   5759  C C    . LYS A 1 165 ? 23.657  3.163   -5.652  1.00 4.49  ? 165  LYS A C    2  
ATOM   5760  O O    . LYS A 1 165 ? 24.651  2.520   -5.324  1.00 4.77  ? 165  LYS A O    2  
ATOM   5761  C CB   . LYS A 1 165 ? 21.557  1.864   -5.319  1.00 4.10  ? 165  LYS A CB   2  
ATOM   5762  C CG   . LYS A 1 165 ? 22.271  0.532   -5.152  1.00 4.47  ? 165  LYS A CG   2  
ATOM   5763  C CD   . LYS A 1 165 ? 21.477  -0.612  -5.756  1.00 4.47  ? 165  LYS A CD   2  
ATOM   5764  C CE   . LYS A 1 165 ? 20.090  -0.713  -5.141  1.00 4.43  ? 165  LYS A CE   2  
ATOM   5765  N NZ   . LYS A 1 165 ? 19.364  -1.934  -5.581  1.00 4.72  ? 165  LYS A NZ   2  
ATOM   5766  H H    . LYS A 1 165 ? 20.871  4.325   -5.641  1.00 3.77  ? 165  LYS A H    2  
ATOM   5767  H HA   . LYS A 1 165 ? 22.621  2.937   -3.802  1.00 4.47  ? 165  LYS A HA   2  
ATOM   5768  H HB2  . LYS A 1 165 ? 20.635  1.825   -4.757  1.00 3.95  ? 165  LYS A HB2  2  
ATOM   5769  H HB3  . LYS A 1 165 ? 21.323  1.992   -6.365  1.00 3.94  ? 165  LYS A HB3  2  
ATOM   5770  H HG2  . LYS A 1 165 ? 23.229  0.584   -5.644  1.00 4.66  ? 165  LYS A HG2  2  
ATOM   5771  H HG3  . LYS A 1 165 ? 22.414  0.343   -4.099  1.00 4.64  ? 165  LYS A HG3  2  
ATOM   5772  H HD2  . LYS A 1 165 ? 21.380  -0.440  -6.819  1.00 4.54  ? 165  LYS A HD2  2  
ATOM   5773  H HD3  . LYS A 1 165 ? 22.009  -1.535  -5.585  1.00 4.70  ? 165  LYS A HD3  2  
ATOM   5774  H HE2  . LYS A 1 165 ? 20.188  -0.733  -4.067  1.00 4.54  ? 165  LYS A HE2  2  
ATOM   5775  H HE3  . LYS A 1 165 ? 19.519  0.157   -5.432  1.00 4.38  ? 165  LYS A HE3  2  
ATOM   5776  H HZ1  . LYS A 1 165 ? 18.404  -1.947  -5.171  1.00 4.85  ? 165  LYS A HZ1  2  
ATOM   5777  H HZ2  . LYS A 1 165 ? 19.872  -2.787  -5.261  1.00 4.87  ? 165  LYS A HZ2  2  
ATOM   5778  H HZ3  . LYS A 1 165 ? 19.286  -1.961  -6.619  1.00 5.01  ? 165  LYS A HZ3  2  
ATOM   5779  N N    . GLY A 1 166 ? 23.634  3.983   -6.696  1.00 4.45  ? 166  GLY A N    2  
ATOM   5780  C CA   . GLY A 1 166 ? 24.760  4.071   -7.606  1.00 4.72  ? 166  GLY A CA   2  
ATOM   5781  C C    . GLY A 1 166 ? 26.071  4.395   -6.912  1.00 4.91  ? 166  GLY A C    2  
ATOM   5782  O O    . GLY A 1 166 ? 27.096  3.772   -7.187  1.00 5.10  ? 166  GLY A O    2  
ATOM   5783  H H    . GLY A 1 166 ? 22.840  4.535   -6.852  1.00 4.27  ? 166  GLY A H    2  
ATOM   5784  H HA2  . GLY A 1 166 ? 24.863  3.123   -8.115  1.00 4.83  ? 166  GLY A HA2  2  
ATOM   5785  H HA3  . GLY A 1 166 ? 24.554  4.837   -8.339  1.00 4.76  ? 166  GLY A HA3  2  
ATOM   5786  N N    . GLN A 1 167 ? 26.049  5.363   -6.006  1.00 4.92  ? 167  GLN A N    2  
ATOM   5787  C CA   . GLN A 1 167 ? 27.259  5.751   -5.295  1.00 5.16  ? 167  GLN A CA   2  
ATOM   5788  C C    . GLN A 1 167 ? 27.556  4.792   -4.156  1.00 5.19  ? 167  GLN A C    2  
ATOM   5789  O O    . GLN A 1 167 ? 28.705  4.641   -3.741  1.00 5.45  ? 167  GLN A O    2  
ATOM   5790  C CB   . GLN A 1 167 ? 27.152  7.182   -4.777  1.00 5.30  ? 167  GLN A CB   2  
ATOM   5791  C CG   . GLN A 1 167 ? 26.009  7.418   -3.805  1.00 5.16  ? 167  GLN A CG   2  
ATOM   5792  C CD   . GLN A 1 167 ? 25.905  8.872   -3.394  1.00 5.42  ? 167  GLN A CD   2  
ATOM   5793  O OE1  . GLN A 1 167 ? 26.903  9.591   -3.362  1.00 5.60  ? 167  GLN A OE1  2  
ATOM   5794  N NE2  . GLN A 1 167 ? 24.705  9.316   -3.066  1.00 5.72  ? 167  GLN A NE2  2  
ATOM   5795  H H    . GLN A 1 167 ? 25.203  5.839   -5.827  1.00 4.80  ? 167  GLN A H    2  
ATOM   5796  H HA   . GLN A 1 167 ? 28.072  5.696   -5.997  1.00 5.34  ? 167  GLN A HA   2  
ATOM   5797  H HB2  . GLN A 1 167 ? 28.073  7.439   -4.279  1.00 5.51  ? 167  GLN A HB2  2  
ATOM   5798  H HB3  . GLN A 1 167 ? 27.017  7.839   -5.621  1.00 5.38  ? 167  GLN A HB3  2  
ATOM   5799  H HG2  . GLN A 1 167 ? 25.084  7.125   -4.279  1.00 4.96  ? 167  GLN A HG2  2  
ATOM   5800  H HG3  . GLN A 1 167 ? 26.170  6.817   -2.923  1.00 5.16  ? 167  GLN A HG3  2  
ATOM   5801  H HE21 . GLN A 1 167 ? 23.949  8.685   -3.097  1.00 5.86  ? 167  GLN A HE21 2  
ATOM   5802  H HE22 . GLN A 1 167 ? 24.613  10.265  -2.814  1.00 5.94  ? 167  GLN A HE22 2  
ATOM   5803  N N    . GLU A 1 168 ? 26.527  4.117   -3.676  1.00 5.02  ? 168  GLU A N    2  
ATOM   5804  C CA   . GLU A 1 168 ? 26.689  3.148   -2.609  1.00 5.17  ? 168  GLU A CA   2  
ATOM   5805  C C    . GLU A 1 168 ? 27.178  1.829   -3.200  1.00 5.30  ? 168  GLU A C    2  
ATOM   5806  O O    . GLU A 1 168 ? 27.503  0.880   -2.484  1.00 5.55  ? 168  GLU A O    2  
ATOM   5807  C CB   . GLU A 1 168 ? 25.365  2.965   -1.864  1.00 5.10  ? 168  GLU A CB   2  
ATOM   5808  C CG   . GLU A 1 168 ? 25.502  2.290   -0.508  1.00 5.39  ? 168  GLU A CG   2  
ATOM   5809  C CD   . GLU A 1 168 ? 26.437  3.037   0.422   1.00 5.63  ? 168  GLU A CD   2  
ATOM   5810  O OE1  . GLU A 1 168 ? 26.146  4.204   0.752   1.00 5.81  ? 168  GLU A OE1  2  
ATOM   5811  O OE2  . GLU A 1 168 ? 27.464  2.458   0.841   1.00 5.88  ? 168  GLU A OE2  2  
ATOM   5812  H H    . GLU A 1 168 ? 25.635  4.268   -4.056  1.00 4.84  ? 168  GLU A H    2  
ATOM   5813  H HA   . GLU A 1 168 ? 27.437  3.525   -1.929  1.00 5.35  ? 168  GLU A HA   2  
ATOM   5814  H HB2  . GLU A 1 168 ? 24.919  3.936   -1.710  1.00 4.92  ? 168  GLU A HB2  2  
ATOM   5815  H HB3  . GLU A 1 168 ? 24.704  2.368   -2.473  1.00 5.27  ? 168  GLU A HB3  2  
ATOM   5816  H HG2  . GLU A 1 168 ? 24.528  2.235   -0.047  1.00 5.77  ? 168  GLU A HG2  2  
ATOM   5817  H HG3  . GLU A 1 168 ? 25.887  1.290   -0.655  1.00 5.44  ? 168  GLU A HG3  2  
ATOM   5818  N N    . ARG A 1 169 ? 27.243  1.796   -4.524  1.00 5.23  ? 169  ARG A N    2  
ATOM   5819  C CA   . ARG A 1 169 ? 27.734  0.635   -5.243  1.00 5.45  ? 169  ARG A CA   2  
ATOM   5820  C C    . ARG A 1 169 ? 29.240  0.773   -5.429  1.00 5.78  ? 169  ARG A C    2  
ATOM   5821  O O    . ARG A 1 169 ? 29.974  -0.213  -5.482  1.00 6.09  ? 169  ARG A O    2  
ATOM   5822  C CB   . ARG A 1 169 ? 27.012  0.519   -6.593  1.00 5.37  ? 169  ARG A CB   2  
ATOM   5823  C CG   . ARG A 1 169 ? 27.059  -0.868  -7.225  1.00 5.66  ? 169  ARG A CG   2  
ATOM   5824  C CD   . ARG A 1 169 ? 28.409  -1.169  -7.851  1.00 6.08  ? 169  ARG A CD   2  
ATOM   5825  N NE   . ARG A 1 169 ? 28.706  -0.299  -8.988  1.00 6.39  ? 169  ARG A NE   2  
ATOM   5826  C CZ   . ARG A 1 169 ? 29.905  -0.213  -9.558  1.00 6.90  ? 169  ARG A CZ   2  
ATOM   5827  N NH1  . ARG A 1 169 ? 30.922  -0.920  -9.079  1.00 7.13  ? 169  ARG A NH1  2  
ATOM   5828  N NH2  . ARG A 1 169 ? 30.093  0.592   -10.597 1.00 7.34  ? 169  ARG A NH2  2  
ATOM   5829  H H    . ARG A 1 169 ? 26.950  2.587   -5.035  1.00 5.10  ? 169  ARG A H    2  
ATOM   5830  H HA   . ARG A 1 169 ? 27.527  -0.243  -4.647  1.00 5.55  ? 169  ARG A HA   2  
ATOM   5831  H HB2  . ARG A 1 169 ? 25.977  0.789   -6.455  1.00 5.16  ? 169  ARG A HB2  2  
ATOM   5832  H HB3  . ARG A 1 169 ? 27.462  1.217   -7.285  1.00 5.44  ? 169  ARG A HB3  2  
ATOM   5833  H HG2  . ARG A 1 169 ? 26.860  -1.604  -6.461  1.00 5.71  ? 169  ARG A HG2  2  
ATOM   5834  H HG3  . ARG A 1 169 ? 26.297  -0.928  -7.988  1.00 5.72  ? 169  ARG A HG3  2  
ATOM   5835  H HD2  . ARG A 1 169 ? 29.174  -1.025  -7.103  1.00 6.24  ? 169  ARG A HD2  2  
ATOM   5836  H HD3  . ARG A 1 169 ? 28.418  -2.197  -8.183  1.00 6.23  ? 169  ARG A HD3  2  
ATOM   5837  H HE   . ARG A 1 169 ? 27.961  0.246   -9.349  1.00 6.35  ? 169  ARG A HE   2  
ATOM   5838  H HH11 . ARG A 1 169 ? 30.789  -1.523  -8.282  1.00 6.96  ? 169  ARG A HH11 2  
ATOM   5839  H HH12 . ARG A 1 169 ? 31.830  -0.860  -9.513  1.00 7.60  ? 169  ARG A HH12 2  
ATOM   5840  H HH21 . ARG A 1 169 ? 29.329  1.145   -10.955 1.00 7.32  ? 169  ARG A HH21 2  
ATOM   5841  H HH22 . ARG A 1 169 ? 30.994  0.651   -11.036 1.00 7.80  ? 169  ARG A HH22 2  
ATOM   5842  N N    . LEU A 1 170 ? 29.696  2.018   -5.499  1.00 5.79  ? 170  LEU A N    2  
ATOM   5843  C CA   . LEU A 1 170 ? 31.107  2.306   -5.660  1.00 6.19  ? 170  LEU A CA   2  
ATOM   5844  C C    . LEU A 1 170 ? 31.798  2.287   -4.309  1.00 6.32  ? 170  LEU A C    2  
ATOM   5845  O O    . LEU A 1 170 ? 32.985  1.962   -4.215  1.00 6.79  ? 170  LEU A O    2  
ATOM   5846  C CB   . LEU A 1 170 ? 31.292  3.656   -6.342  1.00 6.33  ? 170  LEU A CB   2  
ATOM   5847  C CG   . LEU A 1 170 ? 31.300  3.627   -7.875  1.00 6.61  ? 170  LEU A CG   2  
ATOM   5848  C CD1  . LEU A 1 170 ? 32.420  2.735   -8.386  1.00 6.97  ? 170  LEU A CD1  2  
ATOM   5849  C CD2  . LEU A 1 170 ? 29.960  3.156   -8.416  1.00 6.43  ? 170  LEU A CD2  2  
ATOM   5850  H H    . LEU A 1 170 ? 29.069  2.765   -5.425  1.00 5.59  ? 170  LEU A H    2  
ATOM   5851  H HA   . LEU A 1 170 ? 31.532  1.539   -6.283  1.00 6.42  ? 170  LEU A HA   2  
ATOM   5852  H HB2  . LEU A 1 170 ? 30.489  4.297   -6.023  1.00 6.17  ? 170  LEU A HB2  2  
ATOM   5853  H HB3  . LEU A 1 170 ? 32.219  4.077   -6.004  1.00 6.57  ? 170  LEU A HB3  2  
ATOM   5854  H HG   . LEU A 1 170 ? 31.478  4.626   -8.243  1.00 6.85  ? 170  LEU A HG   2  
ATOM   5855  H HD11 . LEU A 1 170 ? 33.369  3.111   -8.031  1.00 7.12  ? 170  LEU A HD11 2  
ATOM   5856  H HD12 . LEU A 1 170 ? 32.415  2.732   -9.465  1.00 7.02  ? 170  LEU A HD12 2  
ATOM   5857  H HD13 . LEU A 1 170 ? 32.274  1.729   -8.022  1.00 7.29  ? 170  LEU A HD13 2  
ATOM   5858  H HD21 . LEU A 1 170 ? 29.989  3.152   -9.495  1.00 6.56  ? 170  LEU A HD21 2  
ATOM   5859  H HD22 . LEU A 1 170 ? 29.180  3.824   -8.079  1.00 6.26  ? 170  LEU A HD22 2  
ATOM   5860  H HD23 . LEU A 1 170 ? 29.757  2.154   -8.057  1.00 6.64  ? 170  LEU A HD23 2  
ATOM   5861  N N    . GLU A 1 171 ? 31.031  2.650   -3.278  1.00 6.03  ? 171  GLU A N    2  
ATOM   5862  C CA   . GLU A 1 171 ? 31.454  2.540   -1.883  1.00 6.27  ? 171  GLU A CA   2  
ATOM   5863  C C    . GLU A 1 171 ? 32.495  3.593   -1.515  1.00 6.70  ? 171  GLU A C    2  
ATOM   5864  O O    . GLU A 1 171 ? 33.328  3.986   -2.336  1.00 6.90  ? 171  GLU A O    2  
ATOM   5865  C CB   . GLU A 1 171 ? 31.996  1.134   -1.598  1.00 6.34  ? 171  GLU A CB   2  
ATOM   5866  C CG   . GLU A 1 171 ? 31.010  0.027   -1.933  1.00 6.31  ? 171  GLU A CG   2  
ATOM   5867  C CD   . GLU A 1 171 ? 31.618  -1.352  -1.817  1.00 6.67  ? 171  GLU A CD   2  
ATOM   5868  O OE1  . GLU A 1 171 ? 31.626  -1.914  -0.698  1.00 6.97  ? 171  GLU A OE1  2  
ATOM   5869  O OE2  . GLU A 1 171 ? 32.098  -1.881  -2.841  1.00 6.91  ? 171  GLU A OE2  2  
ATOM   5870  H H    . GLU A 1 171 ? 30.143  3.021   -3.466  1.00 5.72  ? 171  GLU A H    2  
ATOM   5871  H HA   . GLU A 1 171 ? 30.580  2.699   -1.269  1.00 6.42  ? 171  GLU A HA   2  
ATOM   5872  H HB2  . GLU A 1 171 ? 32.890  0.980   -2.183  1.00 6.52  ? 171  GLU A HB2  2  
ATOM   5873  H HB3  . GLU A 1 171 ? 32.246  1.061   -0.549  1.00 6.61  ? 171  GLU A HB3  2  
ATOM   5874  H HG2  . GLU A 1 171 ? 30.172  0.091   -1.254  1.00 6.37  ? 171  GLU A HG2  2  
ATOM   5875  H HG3  . GLU A 1 171 ? 30.662  0.166   -2.945  1.00 6.37  ? 171  GLU A HG3  2  
ATOM   5876  N N    . HIS A 1 172 ? 32.423  4.069   -0.283  1.00 7.18  ? 172  HIS A N    2  
ATOM   5877  C CA   . HIS A 1 172 ? 33.415  4.996   0.237   1.00 7.91  ? 172  HIS A CA   2  
ATOM   5878  C C    . HIS A 1 172 ? 34.618  4.212   0.736   1.00 8.34  ? 172  HIS A C    2  
ATOM   5879  O O    . HIS A 1 172 ? 34.477  3.312   1.563   1.00 8.55  ? 172  HIS A O    2  
ATOM   5880  C CB   . HIS A 1 172 ? 32.824  5.846   1.367   1.00 8.43  ? 172  HIS A CB   2  
ATOM   5881  C CG   . HIS A 1 172 ? 33.784  6.850   1.930   1.00 8.65  ? 172  HIS A CG   2  
ATOM   5882  N ND1  . HIS A 1 172 ? 34.301  6.768   3.203   1.00 8.91  ? 172  HIS A ND1  2  
ATOM   5883  C CD2  . HIS A 1 172 ? 34.319  7.966   1.382   1.00 8.94  ? 172  HIS A CD2  2  
ATOM   5884  C CE1  . HIS A 1 172 ? 35.111  7.789   3.414   1.00 9.32  ? 172  HIS A CE1  2  
ATOM   5885  N NE2  . HIS A 1 172 ? 35.139  8.529   2.324   1.00 9.35  ? 172  HIS A NE2  2  
ATOM   5886  H H    . HIS A 1 172 ? 31.681  3.783   0.297   1.00 7.23  ? 172  HIS A H    2  
ATOM   5887  H HA   . HIS A 1 172 ? 33.727  5.643   -0.572  1.00 8.05  ? 172  HIS A HA   2  
ATOM   5888  H HB2  . HIS A 1 172 ? 31.966  6.382   0.991   1.00 8.63  ? 172  HIS A HB2  2  
ATOM   5889  H HB3  . HIS A 1 172 ? 32.513  5.194   2.170   1.00 8.77  ? 172  HIS A HB3  2  
ATOM   5890  H HD1  . HIS A 1 172 ? 34.102  6.060   3.866   1.00 8.98  ? 172  HIS A HD1  2  
ATOM   5891  H HD2  . HIS A 1 172 ? 34.132  8.344   0.387   1.00 9.04  ? 172  HIS A HD2  2  
ATOM   5892  H HE1  . HIS A 1 172 ? 35.659  7.982   4.323   1.00 9.74  ? 172  HIS A HE1  2  
ATOM   5893  H HE2  . HIS A 1 172 ? 35.541  9.432   2.261   1.00 9.81  ? 172  HIS A HE2  2  
ATOM   5894  N N    . HIS A 1 173 ? 35.795  4.547   0.238   1.00 8.71  ? 173  HIS A N    2  
ATOM   5895  C CA   . HIS A 1 173 ? 36.985  3.769   0.541   1.00 9.35  ? 173  HIS A CA   2  
ATOM   5896  C C    . HIS A 1 173 ? 37.952  4.549   1.418   1.00 9.73  ? 173  HIS A C    2  
ATOM   5897  O O    . HIS A 1 173 ? 37.867  5.772   1.524   1.00 10.12 ? 173  HIS A O    2  
ATOM   5898  C CB   . HIS A 1 173 ? 37.686  3.326   -0.746  1.00 9.85  ? 173  HIS A CB   2  
ATOM   5899  C CG   . HIS A 1 173 ? 36.841  2.443   -1.609  1.00 10.34 ? 173  HIS A CG   2  
ATOM   5900  N ND1  . HIS A 1 173 ? 36.654  1.100   -1.362  1.00 10.84 ? 173  HIS A ND1  2  
ATOM   5901  C CD2  . HIS A 1 173 ? 36.113  2.722   -2.714  1.00 10.66 ? 173  HIS A CD2  2  
ATOM   5902  C CE1  . HIS A 1 173 ? 35.852  0.595   -2.276  1.00 11.40 ? 173  HIS A CE1  2  
ATOM   5903  N NE2  . HIS A 1 173 ? 35.506  1.557   -3.109  1.00 11.31 ? 173  HIS A NE2  2  
ATOM   5904  H H    . HIS A 1 173 ? 35.871  5.349   -0.333  1.00 8.72  ? 173  HIS A H    2  
ATOM   5905  H HA   . HIS A 1 173 ? 36.669  2.890   1.081   1.00 9.44  ? 173  HIS A HA   2  
ATOM   5906  H HB2  . HIS A 1 173 ? 37.952  4.199   -1.322  1.00 9.81  ? 173  HIS A HB2  2  
ATOM   5907  H HB3  . HIS A 1 173 ? 38.583  2.782   -0.489  1.00 10.14 ? 173  HIS A HB3  2  
ATOM   5908  H HD1  . HIS A 1 173 ? 37.058  0.586   -0.621  1.00 10.92 ? 173  HIS A HD1  2  
ATOM   5909  H HD2  . HIS A 1 173 ? 36.028  3.684   -3.199  1.00 10.59 ? 173  HIS A HD2  2  
ATOM   5910  H HE1  . HIS A 1 173 ? 35.528  -0.435  -2.332  1.00 11.99 ? 173  HIS A HE1  2  
ATOM   5911  H HE2  . HIS A 1 173 ? 34.764  1.498   -3.756  1.00 11.79 ? 173  HIS A HE2  2  
ATOM   5912  N N    . HIS A 1 174 ? 38.867  3.822   2.046   1.00 9.86  ? 174  HIS A N    2  
ATOM   5913  C CA   . HIS A 1 174 ? 39.869  4.422   2.915   1.00 10.40 ? 174  HIS A CA   2  
ATOM   5914  C C    . HIS A 1 174 ? 40.923  5.149   2.097   1.00 11.06 ? 174  HIS A C    2  
ATOM   5915  O O    . HIS A 1 174 ? 41.332  4.681   1.031   1.00 11.27 ? 174  HIS A O    2  
ATOM   5916  C CB   . HIS A 1 174 ? 40.549  3.354   3.781   1.00 10.58 ? 174  HIS A CB   2  
ATOM   5917  C CG   . HIS A 1 174 ? 39.633  2.680   4.754   1.00 10.83 ? 174  HIS A CG   2  
ATOM   5918  N ND1  . HIS A 1 174 ? 39.258  1.361   4.643   1.00 11.12 ? 174  HIS A ND1  2  
ATOM   5919  C CD2  . HIS A 1 174 ? 39.021  3.150   5.867   1.00 11.10 ? 174  HIS A CD2  2  
ATOM   5920  C CE1  . HIS A 1 174 ? 38.454  1.048   5.642   1.00 11.52 ? 174  HIS A CE1  2  
ATOM   5921  N NE2  . HIS A 1 174 ? 38.293  2.117   6.400   1.00 11.52 ? 174  HIS A NE2  2  
ATOM   5922  H H    . HIS A 1 174 ? 38.865  2.849   1.920   1.00 9.73  ? 174  HIS A H    2  
ATOM   5923  H HA   . HIS A 1 174 ? 39.371  5.132   3.558   1.00 10.44 ? 174  HIS A HA   2  
ATOM   5924  H HB2  . HIS A 1 174 ? 40.962  2.592   3.138   1.00 10.52 ? 174  HIS A HB2  2  
ATOM   5925  H HB3  . HIS A 1 174 ? 41.349  3.815   4.342   1.00 10.82 ? 174  HIS A HB3  2  
ATOM   5926  H HD1  . HIS A 1 174 ? 39.536  0.740   3.926   1.00 11.17 ? 174  HIS A HD1  2  
ATOM   5927  H HD2  . HIS A 1 174 ? 39.092  4.154   6.261   1.00 11.16 ? 174  HIS A HD2  2  
ATOM   5928  H HE1  . HIS A 1 174 ? 38.005  0.081   5.812   1.00 11.95 ? 174  HIS A HE1  2  
ATOM   5929  H HE2  . HIS A 1 174 ? 37.593  2.217   7.090   1.00 11.89 ? 174  HIS A HE2  2  
ATOM   5930  N N    . HIS A 1 175 ? 41.355  6.295   2.597   1.00 11.59 ? 175  HIS A N    2  
ATOM   5931  C CA   . HIS A 1 175 ? 42.436  7.038   1.968   1.00 12.41 ? 175  HIS A CA   2  
ATOM   5932  C C    . HIS A 1 175 ? 43.771  6.503   2.457   1.00 12.84 ? 175  HIS A C    2  
ATOM   5933  O O    . HIS A 1 175 ? 44.790  6.627   1.782   1.00 13.21 ? 175  HIS A O    2  
ATOM   5934  C CB   . HIS A 1 175 ? 42.320  8.535   2.271   1.00 12.99 ? 175  HIS A CB   2  
ATOM   5935  C CG   . HIS A 1 175 ? 41.175  9.205   1.576   1.00 13.51 ? 175  HIS A CG   2  
ATOM   5936  N ND1  . HIS A 1 175 ? 39.880  9.175   2.045   1.00 13.89 ? 175  HIS A ND1  2  
ATOM   5937  C CD2  . HIS A 1 175 ? 41.140  9.931   0.436   1.00 13.89 ? 175  HIS A CD2  2  
ATOM   5938  C CE1  . HIS A 1 175 ? 39.101  9.852   1.223   1.00 14.46 ? 175  HIS A CE1  2  
ATOM   5939  N NE2  . HIS A 1 175 ? 39.841  10.321  0.239   1.00 14.48 ? 175  HIS A NE2  2  
ATOM   5940  H H    . HIS A 1 175 ? 40.940  6.649   3.415   1.00 11.55 ? 175  HIS A H    2  
ATOM   5941  H HA   . HIS A 1 175 ? 42.367  6.887   0.900   1.00 12.49 ? 175  HIS A HA   2  
ATOM   5942  H HB2  . HIS A 1 175 ? 42.186  8.669   3.334   1.00 12.92 ? 175  HIS A HB2  2  
ATOM   5943  H HB3  . HIS A 1 175 ? 43.231  9.027   1.964   1.00 13.31 ? 175  HIS A HB3  2  
ATOM   5944  H HD1  . HIS A 1 175 ? 39.569  8.712   2.863   1.00 13.86 ? 175  HIS A HD1  2  
ATOM   5945  H HD2  . HIS A 1 175 ? 41.982  10.161  -0.204  1.00 13.88 ? 175  HIS A HD2  2  
ATOM   5946  H HE1  . HIS A 1 175 ? 38.037  9.999   1.337   1.00 14.94 ? 175  HIS A HE1  2  
ATOM   5947  H HE2  . HIS A 1 175 ? 39.491  10.742  -0.584  1.00 14.95 ? 175  HIS A HE2  2  
ATOM   5948  N N    . HIS A 1 176 ? 43.753  5.907   3.638   1.00 12.98 ? 176  HIS A N    2  
ATOM   5949  C CA   . HIS A 1 176 ? 44.936  5.273   4.198   1.00 13.55 ? 176  HIS A CA   2  
ATOM   5950  C C    . HIS A 1 176 ? 44.621  3.826   4.543   1.00 13.90 ? 176  HIS A C    2  
ATOM   5951  O O    . HIS A 1 176 ? 43.859  3.548   5.467   1.00 14.09 ? 176  HIS A O    2  
ATOM   5952  C CB   . HIS A 1 176 ? 45.417  6.023   5.444   1.00 13.99 ? 176  HIS A CB   2  
ATOM   5953  C CG   . HIS A 1 176 ? 45.875  7.422   5.164   1.00 14.45 ? 176  HIS A CG   2  
ATOM   5954  N ND1  . HIS A 1 176 ? 45.061  8.524   5.302   1.00 14.88 ? 176  HIS A ND1  2  
ATOM   5955  C CD2  . HIS A 1 176 ? 47.074  7.896   4.753   1.00 14.71 ? 176  HIS A CD2  2  
ATOM   5956  C CE1  . HIS A 1 176 ? 45.737  9.611   4.988   1.00 15.37 ? 176  HIS A CE1  2  
ATOM   5957  N NE2  . HIS A 1 176 ? 46.962  9.261   4.653   1.00 15.28 ? 176  HIS A NE2  2  
ATOM   5958  H H    . HIS A 1 176 ? 42.913  5.891   4.156   1.00 12.81 ? 176  HIS A H    2  
ATOM   5959  H HA   . HIS A 1 176 ? 45.712  5.293   3.448   1.00 13.61 ? 176  HIS A HA   2  
ATOM   5960  H HB2  . HIS A 1 176 ? 44.609  6.074   6.157   1.00 14.08 ? 176  HIS A HB2  2  
ATOM   5961  H HB3  . HIS A 1 176 ? 46.244  5.482   5.883   1.00 14.07 ? 176  HIS A HB3  2  
ATOM   5962  H HD1  . HIS A 1 176 ? 44.114  8.513   5.592   1.00 14.94 ? 176  HIS A HD1  2  
ATOM   5963  H HD2  . HIS A 1 176 ? 47.958  7.309   4.546   1.00 14.62 ? 176  HIS A HD2  2  
ATOM   5964  H HE1  . HIS A 1 176 ? 45.352  10.621  5.005   1.00 15.88 ? 176  HIS A HE1  2  
ATOM   5965  H HE2  . HIS A 1 176 ? 47.726  9.888   4.584   1.00 15.66 ? 176  HIS A HE2  2  
ATOM   5966  N N    . HIS A 1 177 ? 45.191  2.906   3.784   1.00 14.14 ? 177  HIS A N    2  
ATOM   5967  C CA   . HIS A 1 177 ? 44.902  1.490   3.957   1.00 14.65 ? 177  HIS A CA   2  
ATOM   5968  C C    . HIS A 1 177 ? 46.177  0.656   3.848   1.00 15.60 ? 177  HIS A C    2  
ATOM   5969  O O    . HIS A 1 177 ? 46.290  -0.393  4.482   1.00 16.02 ? 177  HIS A O    2  
ATOM   5970  C CB   . HIS A 1 177 ? 43.868  1.040   2.912   1.00 14.60 ? 177  HIS A CB   2  
ATOM   5971  C CG   . HIS A 1 177 ? 43.507  -0.415  2.979   1.00 14.47 ? 177  HIS A CG   2  
ATOM   5972  N ND1  . HIS A 1 177 ? 43.565  -1.254  1.884   1.00 14.51 ? 177  HIS A ND1  2  
ATOM   5973  C CD2  . HIS A 1 177 ? 43.063  -1.176  4.008   1.00 14.51 ? 177  HIS A CD2  2  
ATOM   5974  C CE1  . HIS A 1 177 ? 43.176  -2.463  2.240   1.00 14.56 ? 177  HIS A CE1  2  
ATOM   5975  N NE2  . HIS A 1 177 ? 42.867  -2.442  3.520   1.00 14.56 ? 177  HIS A NE2  2  
ATOM   5976  H H    . HIS A 1 177 ? 45.833  3.188   3.089   1.00 14.09 ? 177  HIS A H    2  
ATOM   5977  H HA   . HIS A 1 177 ? 44.483  1.355   4.943   1.00 14.57 ? 177  HIS A HA   2  
ATOM   5978  H HB2  . HIS A 1 177 ? 42.961  1.608   3.053   1.00 14.44 ? 177  HIS A HB2  2  
ATOM   5979  H HB3  . HIS A 1 177 ? 44.258  1.240   1.925   1.00 14.99 ? 177  HIS A HB3  2  
ATOM   5980  H HD1  . HIS A 1 177 ? 43.847  -0.996  0.967   1.00 14.60 ? 177  HIS A HD1  2  
ATOM   5981  H HD2  . HIS A 1 177 ? 42.896  -0.847  5.025   1.00 14.61 ? 177  HIS A HD2  2  
ATOM   5982  H HE1  . HIS A 1 177 ? 43.120  -3.325  1.590   1.00 14.72 ? 177  HIS A HE1  2  
ATOM   5983  H HE2  . HIS A 1 177 ? 42.569  -3.225  4.046   1.00 14.72 ? 177  HIS A HE2  2  
ATOM   5984  N N    . LEU A 1 178 ? 47.122  1.130   3.030   1.00 16.06 ? 178  LEU A N    2  
ATOM   5985  C CA   . LEU A 1 178 ? 48.405  0.448   2.808   1.00 17.08 ? 178  LEU A CA   2  
ATOM   5986  C C    . LEU A 1 178 ? 48.215  -0.876  2.068   1.00 17.58 ? 178  LEU A C    2  
ATOM   5987  O O    . LEU A 1 178 ? 49.180  -1.595  1.810   1.00 17.74 ? 178  LEU A O    2  
ATOM   5988  C CB   . LEU A 1 178 ? 49.144  0.214   4.133   1.00 17.47 ? 178  LEU A CB   2  
ATOM   5989  C CG   . LEU A 1 178 ? 49.540  1.482   4.893   1.00 17.56 ? 178  LEU A CG   2  
ATOM   5990  C CD1  . LEU A 1 178 ? 50.193  1.125   6.219   1.00 17.99 ? 178  LEU A CD1  2  
ATOM   5991  C CD2  . LEU A 1 178 ? 50.475  2.336   4.051   1.00 17.68 ? 178  LEU A CD2  2  
ATOM   5992  H H    . LEU A 1 178 ? 46.955  1.977   2.556   1.00 15.79 ? 178  LEU A H    2  
ATOM   5993  H HA   . LEU A 1 178 ? 49.008  1.097   2.189   1.00 17.35 ? 178  LEU A HA   2  
ATOM   5994  H HB2  . LEU A 1 178 ? 48.509  -0.380  4.774   1.00 17.43 ? 178  LEU A HB2  2  
ATOM   5995  H HB3  . LEU A 1 178 ? 50.042  -0.349  3.925   1.00 17.90 ? 178  LEU A HB3  2  
ATOM   5996  H HG   . LEU A 1 178 ? 48.652  2.061   5.102   1.00 17.40 ? 178  LEU A HG   2  
ATOM   5997  H HD11 . LEU A 1 178 ? 50.465  2.030   6.741   1.00 18.20 ? 178  LEU A HD11 2  
ATOM   5998  H HD12 . LEU A 1 178 ? 51.079  0.536   6.035   1.00 18.21 ? 178  LEU A HD12 2  
ATOM   5999  H HD13 . LEU A 1 178 ? 49.500  0.556   6.820   1.00 17.98 ? 178  LEU A HD13 2  
ATOM   6000  H HD21 . LEU A 1 178 ? 51.372  1.777   3.831   1.00 17.91 ? 178  LEU A HD21 2  
ATOM   6001  H HD22 . LEU A 1 178 ? 50.733  3.232   4.595   1.00 17.74 ? 178  LEU A HD22 2  
ATOM   6002  H HD23 . LEU A 1 178 ? 49.982  2.604   3.127   1.00 17.62 ? 178  LEU A HD23 2  
ATOM   6003  N N    . GLU A 1 179 ? 46.964  -1.163  1.709   1.00 17.95 ? 179  GLU A N    2  
ATOM   6004  C CA   . GLU A 1 179 ? 46.588  -2.392  1.012   1.00 18.57 ? 179  GLU A CA   2  
ATOM   6005  C C    . GLU A 1 179 ? 46.938  -3.636  1.820   1.00 19.13 ? 179  GLU A C    2  
ATOM   6006  O O    . GLU A 1 179 ? 46.127  -4.122  2.609   1.00 19.11 ? 179  GLU A O    2  
ATOM   6007  C CB   . GLU A 1 179 ? 47.228  -2.451  -0.375  1.00 18.91 ? 179  GLU A CB   2  
ATOM   6008  C CG   . GLU A 1 179 ? 46.773  -1.325  -1.282  1.00 18.77 ? 179  GLU A CG   2  
ATOM   6009  C CD   . GLU A 1 179 ? 45.267  -1.258  -1.394  1.00 18.94 ? 179  GLU A CD   2  
ATOM   6010  O OE1  . GLU A 1 179 ? 44.632  -0.605  -0.541  1.00 19.19 ? 179  GLU A OE1  2  
ATOM   6011  O OE2  . GLU A 1 179 ? 44.707  -1.854  -2.342  1.00 18.93 ? 179  GLU A OE2  2  
ATOM   6012  H H    . GLU A 1 179 ? 46.265  -0.514  1.918   1.00 17.89 ? 179  GLU A H    2  
ATOM   6013  H HA   . GLU A 1 179 ? 45.515  -2.367  0.888   1.00 18.54 ? 179  GLU A HA   2  
ATOM   6014  H HB2  . GLU A 1 179 ? 48.300  -2.393  -0.269  1.00 19.08 ? 179  GLU A HB2  2  
ATOM   6015  H HB3  . GLU A 1 179 ? 46.969  -3.390  -0.842  1.00 19.22 ? 179  GLU A HB3  2  
ATOM   6016  H HG2  . GLU A 1 179 ? 47.133  -0.389  -0.883  1.00 18.73 ? 179  GLU A HG2  2  
ATOM   6017  H HG3  . GLU A 1 179 ? 47.187  -1.483  -2.267  1.00 18.73 ? 179  GLU A HG3  2  
ATOM   6018  N N    . HIS A 1 180 ? 48.145  -4.137  1.636   1.00 19.74 ? 180  HIS A N    2  
ATOM   6019  C CA   . HIS A 1 180 ? 48.579  -5.341  2.323   1.00 20.41 ? 180  HIS A CA   2  
ATOM   6020  C C    . HIS A 1 180 ? 49.841  -5.051  3.119   1.00 20.84 ? 180  HIS A C    2  
ATOM   6021  O O    . HIS A 1 180 ? 50.707  -4.298  2.669   1.00 21.13 ? 180  HIS A O    2  
ATOM   6022  C CB   . HIS A 1 180 ? 48.823  -6.479  1.328   1.00 21.03 ? 180  HIS A CB   2  
ATOM   6023  C CG   . HIS A 1 180 ? 47.618  -6.851  0.515   1.00 21.37 ? 180  HIS A CG   2  
ATOM   6024  N ND1  . HIS A 1 180 ? 46.540  -7.537  1.031   1.00 21.96 ? 180  HIS A ND1  2  
ATOM   6025  C CD2  . HIS A 1 180 ? 47.324  -6.622  -0.787  1.00 21.34 ? 180  HIS A CD2  2  
ATOM   6026  C CE1  . HIS A 1 180 ? 45.639  -7.717  0.083   1.00 22.26 ? 180  HIS A CE1  2  
ATOM   6027  N NE2  . HIS A 1 180 ? 46.089  -7.171  -1.028  1.00 21.90 ? 180  HIS A NE2  2  
ATOM   6028  H H    . HIS A 1 180 ? 48.774  -3.671  1.045   1.00 19.81 ? 180  HIS A H    2  
ATOM   6029  H HA   . HIS A 1 180 ? 47.796  -5.631  3.008   1.00 20.26 ? 180  HIS A HA   2  
ATOM   6030  H HB2  . HIS A 1 180 ? 49.604  -6.188  0.644   1.00 21.05 ? 180  HIS A HB2  2  
ATOM   6031  H HB3  . HIS A 1 180 ? 49.138  -7.359  1.871   1.00 21.34 ? 180  HIS A HB3  2  
ATOM   6032  H HD1  . HIS A 1 180 ? 46.441  -7.839  1.968   1.00 22.20 ? 180  HIS A HD1  2  
ATOM   6033  H HD2  . HIS A 1 180 ? 47.945  -6.104  -1.504  1.00 21.02 ? 180  HIS A HD2  2  
ATOM   6034  H HE1  . HIS A 1 180 ? 44.692  -8.224  0.200   1.00 22.80 ? 180  HIS A HE1  2  
ATOM   6035  H HE2  . HIS A 1 180 ? 45.571  -7.078  -1.864  1.00 22.10 ? 180  HIS A HE2  2  
ATOM   6036  N N    . HIS A 1 181 ? 49.933  -5.629  4.307   1.00 20.99 ? 181  HIS A N    2  
ATOM   6037  C CA   . HIS A 1 181 ? 51.073  -5.391  5.184   1.00 21.54 ? 181  HIS A CA   2  
ATOM   6038  C C    . HIS A 1 181 ? 52.210  -6.354  4.867   1.00 22.31 ? 181  HIS A C    2  
ATOM   6039  O O    . HIS A 1 181 ? 53.378  -5.965  4.852   1.00 22.51 ? 181  HIS A O    2  
ATOM   6040  C CB   . HIS A 1 181 ? 50.666  -5.529  6.652   1.00 21.37 ? 181  HIS A CB   2  
ATOM   6041  C CG   . HIS A 1 181 ? 49.617  -4.549  7.087   1.00 21.01 ? 181  HIS A CG   2  
ATOM   6042  N ND1  . HIS A 1 181 ? 48.529  -4.906  7.853   1.00 20.83 ? 181  HIS A ND1  2  
ATOM   6043  C CD2  . HIS A 1 181 ? 49.501  -3.216  6.872   1.00 20.92 ? 181  HIS A CD2  2  
ATOM   6044  C CE1  . HIS A 1 181 ? 47.789  -3.838  8.087   1.00 20.64 ? 181  HIS A CE1  2  
ATOM   6045  N NE2  . HIS A 1 181 ? 48.355  -2.800  7.504   1.00 20.70 ? 181  HIS A NE2  2  
ATOM   6046  H H    . HIS A 1 181 ? 49.214  -6.228  4.604   1.00 20.81 ? 181  HIS A H    2  
ATOM   6047  H HA   . HIS A 1 181 ? 51.416  -4.381  5.009   1.00 21.64 ? 181  HIS A HA   2  
ATOM   6048  H HB2  . HIS A 1 181 ? 50.277  -6.523  6.818   1.00 21.28 ? 181  HIS A HB2  2  
ATOM   6049  H HB3  . HIS A 1 181 ? 51.537  -5.382  7.275   1.00 21.73 ? 181  HIS A HB3  2  
ATOM   6050  H HD1  . HIS A 1 181 ? 48.326  -5.815  8.180   1.00 20.90 ? 181  HIS A HD1  2  
ATOM   6051  H HD2  . HIS A 1 181 ? 50.184  -2.597  6.307   1.00 21.08 ? 181  HIS A HD2  2  
ATOM   6052  H HE1  . HIS A 1 181 ? 46.876  -3.817  8.664   1.00 20.55 ? 181  HIS A HE1  2  
ATOM   6053  H HE2  . HIS A 1 181 ? 47.922  -1.919  7.378   1.00 20.67 ? 181  HIS A HE2  2  
ATOM   6054  N N    . HIS A 1 182 ? 51.867  -7.611  4.626   1.00 22.83 ? 182  HIS A N    2  
ATOM   6055  C CA   . HIS A 1 182 ? 52.860  -8.624  4.280   1.00 23.69 ? 182  HIS A CA   2  
ATOM   6056  C C    . HIS A 1 182 ? 52.237  -9.692  3.386   1.00 24.16 ? 182  HIS A C    2  
ATOM   6057  O O    . HIS A 1 182 ? 52.743  -10.806 3.277   1.00 24.40 ? 182  HIS A O    2  
ATOM   6058  C CB   . HIS A 1 182 ? 53.458  -9.257  5.548   1.00 24.01 ? 182  HIS A CB   2  
ATOM   6059  C CG   . HIS A 1 182 ? 52.499  -10.093 6.343   1.00 24.24 ? 182  HIS A CG   2  
ATOM   6060  N ND1  . HIS A 1 182 ? 52.551  -11.469 6.371   1.00 24.67 ? 182  HIS A ND1  2  
ATOM   6061  C CD2  . HIS A 1 182 ? 51.470  -9.743  7.151   1.00 24.22 ? 182  HIS A CD2  2  
ATOM   6062  C CE1  . HIS A 1 182 ? 51.598  -11.928 7.155   1.00 24.89 ? 182  HIS A CE1  2  
ATOM   6063  N NE2  . HIS A 1 182 ? 50.928  -10.904 7.643   1.00 24.63 ? 182  HIS A NE2  2  
ATOM   6064  H H    . HIS A 1 182 ? 50.916  -7.870  4.681   1.00 22.69 ? 182  HIS A H    2  
ATOM   6065  H HA   . HIS A 1 182 ? 53.649  -8.131  3.730   1.00 23.87 ? 182  HIS A HA   2  
ATOM   6066  H HB2  . HIS A 1 182 ? 54.286  -9.889  5.265   1.00 23.75 ? 182  HIS A HB2  2  
ATOM   6067  H HB3  . HIS A 1 182 ? 53.822  -8.469  6.191   1.00 24.46 ? 182  HIS A HB3  2  
ATOM   6068  H HD1  . HIS A 1 182 ? 53.207  -12.032 5.887   1.00 24.84 ? 182  HIS A HD1  2  
ATOM   6069  H HD2  . HIS A 1 182 ? 51.136  -8.738  7.366   1.00 24.00 ? 182  HIS A HD2  2  
ATOM   6070  H HE1  . HIS A 1 182 ? 51.400  -12.970 7.364   1.00 25.30 ? 182  HIS A HE1  2  
ATOM   6071  H HE2  . HIS A 1 182 ? 50.262  -10.960 8.371   1.00 24.80 ? 182  HIS A HE2  2  
ATOM   6072  N N    . HIS A 1 183 ? 51.143  -9.332  2.736   1.00 24.38 ? 183  HIS A N    2  
ATOM   6073  C CA   . HIS A 1 183 ? 50.442  -10.250 1.851   1.00 24.93 ? 183  HIS A CA   2  
ATOM   6074  C C    . HIS A 1 183 ? 50.776  -9.927  0.400   1.00 25.44 ? 183  HIS A C    2  
ATOM   6075  O O    . HIS A 1 183 ? 50.457  -8.845  -0.095  1.00 25.58 ? 183  HIS A O    2  
ATOM   6076  C CB   . HIS A 1 183 ? 48.926  -10.165 2.088   1.00 25.08 ? 183  HIS A CB   2  
ATOM   6077  C CG   . HIS A 1 183 ? 48.118  -11.165 1.308   1.00 25.22 ? 183  HIS A CG   2  
ATOM   6078  N ND1  . HIS A 1 183 ? 47.578  -12.304 1.869   1.00 25.36 ? 183  HIS A ND1  2  
ATOM   6079  C CD2  . HIS A 1 183 ? 47.745  -11.180 0.007   1.00 25.35 ? 183  HIS A CD2  2  
ATOM   6080  C CE1  . HIS A 1 183 ? 46.911  -12.972 0.947   1.00 25.56 ? 183  HIS A CE1  2  
ATOM   6081  N NE2  . HIS A 1 183 ? 46.996  -12.310 -0.190  1.00 25.56 ? 183  HIS A NE2  2  
ATOM   6082  H H    . HIS A 1 183 ? 50.812  -8.415  2.834   1.00 24.25 ? 183  HIS A H    2  
ATOM   6083  H HA   . HIS A 1 183 ? 50.781  -11.251 2.075   1.00 24.97 ? 183  HIS A HA   2  
ATOM   6084  H HB2  . HIS A 1 183 ? 48.725  -10.329 3.136   1.00 24.96 ? 183  HIS A HB2  2  
ATOM   6085  H HB3  . HIS A 1 183 ? 48.584  -9.177  1.814   1.00 25.31 ? 183  HIS A HB3  2  
ATOM   6086  H HD1  . HIS A 1 183 ? 47.663  -12.583 2.813   1.00 25.37 ? 183  HIS A HD1  2  
ATOM   6087  H HD2  . HIS A 1 183 ? 47.990  -10.436 -0.738  1.00 25.36 ? 183  HIS A HD2  2  
ATOM   6088  H HE1  . HIS A 1 183 ? 46.384  -13.902 1.098   1.00 25.77 ? 183  HIS A HE1  2  
ATOM   6089  H HE2  . HIS A 1 183 ? 46.684  -12.642 -1.067  1.00 25.74 ? 183  HIS A HE2  2  
ATOM   6090  N N    . HIS A 1 184 ? 51.431  -10.860 -0.267  1.00 25.80 ? 184  HIS A N    2  
ATOM   6091  C CA   . HIS A 1 184 ? 51.794  -10.693 -1.666  1.00 26.40 ? 184  HIS A CA   2  
ATOM   6092  C C    . HIS A 1 184 ? 51.616  -12.011 -2.406  1.00 26.96 ? 184  HIS A C    2  
ATOM   6093  O O    . HIS A 1 184 ? 52.091  -13.053 -1.955  1.00 27.37 ? 184  HIS A O    2  
ATOM   6094  C CB   . HIS A 1 184 ? 53.241  -10.200 -1.790  1.00 26.76 ? 184  HIS A CB   2  
ATOM   6095  C CG   . HIS A 1 184 ? 53.698  -9.993  -3.206  1.00 26.84 ? 184  HIS A CG   2  
ATOM   6096  N ND1  . HIS A 1 184 ? 54.539  -10.866 -3.861  1.00 26.92 ? 184  HIS A ND1  2  
ATOM   6097  C CD2  . HIS A 1 184 ? 53.431  -9.002  -4.090  1.00 26.96 ? 184  HIS A CD2  2  
ATOM   6098  C CE1  . HIS A 1 184 ? 54.768  -10.424 -5.083  1.00 27.09 ? 184  HIS A CE1  2  
ATOM   6099  N NE2  . HIS A 1 184 ? 54.107  -9.295  -5.248  1.00 27.11 ? 184  HIS A NE2  2  
ATOM   6100  H H    . HIS A 1 184 ? 51.676  -11.697 0.194   1.00 25.73 ? 184  HIS A H    2  
ATOM   6101  H HA   . HIS A 1 184 ? 51.131  -9.958  -2.098  1.00 26.29 ? 184  HIS A HA   2  
ATOM   6102  H HB2  . HIS A 1 184 ? 53.337  -9.257  -1.271  1.00 26.84 ? 184  HIS A HB2  2  
ATOM   6103  H HB3  . HIS A 1 184 ? 53.900  -10.924 -1.332  1.00 26.98 ? 184  HIS A HB3  2  
ATOM   6104  H HD1  . HIS A 1 184 ? 54.923  -11.692 -3.477  1.00 26.92 ? 184  HIS A HD1  2  
ATOM   6105  H HD2  . HIS A 1 184 ? 52.800  -8.141  -3.916  1.00 27.01 ? 184  HIS A HD2  2  
ATOM   6106  H HE1  . HIS A 1 184 ? 55.389  -10.907 -5.823  1.00 27.25 ? 184  HIS A HE1  2  
ATOM   6107  H HE2  . HIS A 1 184 ? 53.988  -8.830  -6.111  1.00 27.29 ? 184  HIS A HE2  2  
ATOM   6108  N N    . HIS A 1 185 ? 50.923  -11.964 -3.530  1.00 27.04 ? 185  HIS A N    2  
ATOM   6109  C CA   . HIS A 1 185 ? 50.674  -13.156 -4.321  1.00 27.63 ? 185  HIS A CA   2  
ATOM   6110  C C    . HIS A 1 185 ? 51.349  -13.037 -5.680  1.00 27.78 ? 185  HIS A C    2  
ATOM   6111  O O    . HIS A 1 185 ? 50.819  -12.309 -6.544  1.00 27.59 ? 185  HIS A O    2  
ATOM   6112  C CB   . HIS A 1 185 ? 49.167  -13.385 -4.481  1.00 28.05 ? 185  HIS A CB   2  
ATOM   6113  C CG   . HIS A 1 185 ? 48.816  -14.568 -5.336  1.00 28.32 ? 185  HIS A CG   2  
ATOM   6114  N ND1  . HIS A 1 185 ? 48.942  -15.874 -4.911  1.00 28.85 ? 185  HIS A ND1  2  
ATOM   6115  C CD2  . HIS A 1 185 ? 48.340  -14.631 -6.601  1.00 28.21 ? 185  HIS A CD2  2  
ATOM   6116  C CE1  . HIS A 1 185 ? 48.562  -16.687 -5.881  1.00 29.06 ? 185  HIS A CE1  2  
ATOM   6117  N NE2  . HIS A 1 185 ? 48.192  -15.957 -6.915  1.00 28.68 ? 185  HIS A NE2  2  
ATOM   6118  O OXT  . HIS A 1 185 ? 52.405  -13.672 -5.877  1.00 28.16 ? 185  HIS A OXT  2  
ATOM   6119  H H    . HIS A 1 185 ? 50.575  -11.102 -3.843  1.00 26.76 ? 185  HIS A H    2  
ATOM   6120  H HA   . HIS A 1 185 ? 51.104  -13.996 -3.794  1.00 27.76 ? 185  HIS A HA   2  
ATOM   6121  H HB2  . HIS A 1 185 ? 48.730  -13.542 -3.506  1.00 28.24 ? 185  HIS A HB2  2  
ATOM   6122  H HB3  . HIS A 1 185 ? 48.724  -12.508 -4.929  1.00 28.07 ? 185  HIS A HB3  2  
ATOM   6123  H HD1  . HIS A 1 185 ? 49.265  -16.169 -4.023  1.00 29.11 ? 185  HIS A HD1  2  
ATOM   6124  H HD2  . HIS A 1 185 ? 48.118  -13.791 -7.244  1.00 27.89 ? 185  HIS A HD2  2  
ATOM   6125  H HE1  . HIS A 1 185 ? 48.556  -17.765 -5.834  1.00 29.52 ? 185  HIS A HE1  2  
ATOM   6126  H HE2  . HIS A 1 185 ? 47.999  -16.310 -7.818  1.00 28.82 ? 185  HIS A HE2  2  
HETATM 6127  C C    . ACE B 2 1   ? -17.961 -17.755 3.291   1.00 3.23  ? 1001 ACE B C    2  
HETATM 6128  O O    . ACE B 2 1   ? -18.257 -16.972 2.385   1.00 3.56  ? 1001 ACE B O    2  
HETATM 6129  C CH3  . ACE B 2 1   ? -18.100 -17.319 4.737   1.00 4.05  ? 1001 ACE B CH3  2  
HETATM 6130  H H1   . ACE B 2 1   ? -18.943 -17.830 5.178   1.00 4.41  ? 1001 ACE B H1   2  
HETATM 6131  H H2   . ACE B 2 1   ? -18.259 -16.251 4.768   1.00 4.42  ? 1001 ACE B H2   2  
HETATM 6132  H H3   . ACE B 2 1   ? -17.195 -17.572 5.270   1.00 4.33  ? 1001 ACE B H3   2  
ATOM   6133  N N    . GLY B 2 2   ? -17.524 -18.983 3.037   1.00 2.68  ? 1002 GLY B N    2  
ATOM   6134  C CA   . GLY B 2 2   ? -17.360 -19.454 1.676   1.00 2.37  ? 1002 GLY B CA   2  
ATOM   6135  C C    . GLY B 2 2   ? -16.094 -18.928 1.033   1.00 2.24  ? 1002 GLY B C    2  
ATOM   6136  O O    . GLY B 2 2   ? -15.131 -19.668 0.831   1.00 2.97  ? 1002 GLY B O    2  
ATOM   6137  H H    . GLY B 2 2   ? -17.321 -19.584 3.786   1.00 2.99  ? 1002 GLY B H    2  
ATOM   6138  H HA2  . GLY B 2 2   ? -17.325 -20.533 1.682   1.00 2.60  ? 1002 GLY B HA2  2  
ATOM   6139  H HA3  . GLY B 2 2   ? -18.208 -19.134 1.090   1.00 2.58  ? 1002 GLY B HA3  2  
ATOM   6140  N N    . CYS B 2 3   ? -16.093 -17.644 0.721   1.00 1.72  ? 1003 CYS B N    2  
ATOM   6141  C CA   . CYS B 2 3   ? -14.948 -17.010 0.094   1.00 1.60  ? 1003 CYS B CA   2  
ATOM   6142  C C    . CYS B 2 3   ? -14.422 -15.905 0.985   1.00 1.42  ? 1003 CYS B C    2  
ATOM   6143  O O    . CYS B 2 3   ? -14.628 -15.948 2.192   1.00 1.55  ? 1003 CYS B O    2  
ATOM   6144  C CB   . CYS B 2 3   ? -15.340 -16.430 -1.254  1.00 1.63  ? 1003 CYS B CB   2  
ATOM   6145  S SG   . CYS B 2 3   ? -16.359 -17.558 -2.261  1.00 1.94  ? 1003 CYS B SG   2  
ATOM   6146  H H    . CYS B 2 3   ? -16.887 -17.101 0.930   1.00 1.84  ? 1003 CYS B H    2  
ATOM   6147  H HA   . CYS B 2 3   ? -14.179 -17.755 -0.044  1.00 1.76  ? 1003 CYS B HA   2  
ATOM   6148  H HB2  . CYS B 2 3   ? -15.885 -15.506 -1.095  1.00 1.60  ? 1003 CYS B HB2  2  
ATOM   6149  H HB3  . CYS B 2 3   ? -14.441 -16.215 -1.815  1.00 1.65  ? 1003 CYS B HB3  2  
ATOM   6150  N N    . VAL B 2 4   ? -13.734 -14.937 0.366   1.00 1.37  ? 1004 VAL B N    2  
ATOM   6151  C CA   . VAL B 2 4   ? -13.184 -13.751 1.033   1.00 1.19  ? 1004 VAL B CA   2  
ATOM   6152  C C    . VAL B 2 4   ? -12.434 -14.088 2.329   1.00 1.19  ? 1004 VAL B C    2  
ATOM   6153  O O    . VAL B 2 4   ? -11.219 -14.180 2.292   1.00 1.63  ? 1004 VAL B O    2  
ATOM   6154  C CB   . VAL B 2 4   ? -14.240 -12.643 1.222   1.00 1.15  ? 1004 VAL B CB   2  
ATOM   6155  C CG1  . VAL B 2 4   ? -14.770 -12.217 -0.132  1.00 1.41  ? 1004 VAL B CG1  2  
ATOM   6156  C CG2  . VAL B 2 4   ? -15.395 -13.050 2.124   1.00 1.42  ? 1004 VAL B CG2  2  
ATOM   6157  H H    . VAL B 2 4   ? -13.587 -15.022 -0.595  1.00 1.62  ? 1004 VAL B H    2  
ATOM   6158  H HA   . VAL B 2 4   ? -12.446 -13.354 0.348   1.00 1.20  ? 1004 VAL B HA   2  
ATOM   6159  H HB   . VAL B 2 4   ? -13.743 -11.803 1.659   1.00 0.94  ? 1004 VAL B HB   2  
ATOM   6160  H HG11 . VAL B 2 4   ? -15.496 -11.431 -0.006  1.00 1.79  ? 1004 VAL B HG11 2  
ATOM   6161  H HG12 . VAL B 2 4   ? -15.236 -13.064 -0.616  1.00 1.93  ? 1004 VAL B HG12 2  
ATOM   6162  H HG13 . VAL B 2 4   ? -13.953 -11.863 -0.741  1.00 1.62  ? 1004 VAL B HG13 2  
ATOM   6163  H HG21 . VAL B 2 4   ? -15.901 -13.903 1.697   1.00 1.73  ? 1004 VAL B HG21 2  
ATOM   6164  H HG22 . VAL B 2 4   ? -16.088 -12.226 2.213   1.00 1.78  ? 1004 VAL B HG22 2  
ATOM   6165  H HG23 . VAL B 2 4   ? -15.015 -13.308 3.101   1.00 1.94  ? 1004 VAL B HG23 2  
ATOM   6166  N N    . GLY B 2 5   ? -13.122 -14.217 3.465   1.00 1.02  ? 1005 GLY B N    2  
ATOM   6167  C CA   . GLY B 2 5   ? -12.548 -14.901 4.615   1.00 1.07  ? 1005 GLY B CA   2  
ATOM   6168  C C    . GLY B 2 5   ? -11.692 -16.110 4.220   1.00 1.05  ? 1005 GLY B C    2  
ATOM   6169  O O    . GLY B 2 5   ? -10.664 -16.382 4.840   1.00 1.20  ? 1005 GLY B O    2  
ATOM   6170  H H    . GLY B 2 5   ? -13.996 -13.779 3.553   1.00 1.09  ? 1005 GLY B H    2  
ATOM   6171  H HA2  . GLY B 2 5   ? -11.946 -14.203 5.162   1.00 1.07  ? 1005 GLY B HA2  2  
ATOM   6172  H HA3  . GLY B 2 5   ? -13.350 -15.240 5.252   1.00 1.26  ? 1005 GLY B HA3  2  
ATOM   6173  N N    . ARG B 2 6   ? -12.142 -16.849 3.199   1.00 1.08  ? 1006 ARG B N    2  
ATOM   6174  C CA   . ARG B 2 6   ? -11.378 -17.923 2.592   1.00 1.08  ? 1006 ARG B CA   2  
ATOM   6175  C C    . ARG B 2 6   ? -10.025 -17.439 2.097   1.00 1.04  ? 1006 ARG B C    2  
ATOM   6176  O O    . ARG B 2 6   ? -8.981  -18.013 2.404   1.00 1.10  ? 1006 ARG B O    2  
ATOM   6177  C CB   . ARG B 2 6   ? -12.156 -18.432 1.392   1.00 1.14  ? 1006 ARG B CB   2  
ATOM   6178  C CG   . ARG B 2 6   ? -11.707 -19.770 0.876   1.00 1.24  ? 1006 ARG B CG   2  
ATOM   6179  C CD   . ARG B 2 6   ? -11.740 -20.823 1.966   1.00 1.55  ? 1006 ARG B CD   2  
ATOM   6180  N NE   . ARG B 2 6   ? -10.575 -20.746 2.855   1.00 1.88  ? 1006 ARG B NE   2  
ATOM   6181  C CZ   . ARG B 2 6   ? -10.642 -20.796 4.187   1.00 2.43  ? 1006 ARG B CZ   2  
ATOM   6182  N NH1  . ARG B 2 6   ? -11.808 -20.987 4.792   1.00 2.88  ? 1006 ARG B NH1  2  
ATOM   6183  N NH2  . ARG B 2 6   ? -9.537  -20.671 4.914   1.00 2.87  ? 1006 ARG B NH2  2  
ATOM   6184  H H    . ARG B 2 6   ? -13.045 -16.686 2.852   1.00 1.23  ? 1006 ARG B H    2  
ATOM   6185  H HA   . ARG B 2 6   ? -11.252 -18.720 3.307   1.00 1.16  ? 1006 ARG B HA   2  
ATOM   6186  H HB2  . ARG B 2 6   ? -13.197 -18.502 1.651   1.00 1.38  ? 1006 ARG B HB2  2  
ATOM   6187  H HB3  . ARG B 2 6   ? -12.050 -17.715 0.591   1.00 1.34  ? 1006 ARG B HB3  2  
ATOM   6188  H HG2  . ARG B 2 6   ? -12.380 -20.057 0.095   1.00 1.62  ? 1006 ARG B HG2  2  
ATOM   6189  H HG3  . ARG B 2 6   ? -10.703 -19.687 0.489   1.00 1.60  ? 1006 ARG B HG3  2  
ATOM   6190  H HD2  . ARG B 2 6   ? -12.633 -20.664 2.550   1.00 1.88  ? 1006 ARG B HD2  2  
ATOM   6191  H HD3  . ARG B 2 6   ? -11.773 -21.795 1.505   1.00 1.96  ? 1006 ARG B HD3  2  
ATOM   6192  H HE   . ARG B 2 6   ? -9.695  -20.637 2.431   1.00 2.02  ? 1006 ARG B HE   2  
ATOM   6193  H HH11 . ARG B 2 6   ? -12.644 -21.102 4.253   1.00 2.84  ? 1006 ARG B HH11 2  
ATOM   6194  H HH12 . ARG B 2 6   ? -11.860 -21.012 5.801   1.00 3.45  ? 1006 ARG B HH12 2  
ATOM   6195  H HH21 . ARG B 2 6   ? -8.643  -20.542 4.467   1.00 2.94  ? 1006 ARG B HH21 2  
ATOM   6196  H HH22 . ARG B 2 6   ? -9.588  -20.696 5.922   1.00 3.33  ? 1006 ARG B HH22 2  
ATOM   6197  N N    . ALA B 2 7   ? -10.075 -16.384 1.311   1.00 1.02  ? 1007 ALA B N    2  
ATOM   6198  C CA   . ALA B 2 7   ? -8.918  -15.867 0.620   1.00 1.05  ? 1007 ALA B CA   2  
ATOM   6199  C C    . ALA B 2 7   ? -8.352  -14.678 1.371   1.00 1.02  ? 1007 ALA B C    2  
ATOM   6200  O O    . ALA B 2 7   ? -8.519  -14.580 2.583   1.00 1.31  ? 1007 ALA B O    2  
ATOM   6201  C CB   . ALA B 2 7   ? -9.325  -15.465 -0.787  1.00 1.10  ? 1007 ALA B CB   2  
ATOM   6202  H H    . ALA B 2 7   ? -10.923 -15.904 1.228   1.00 1.04  ? 1007 ALA B H    2  
ATOM   6203  H HA   . ALA B 2 7   ? -8.174  -16.647 0.556   1.00 1.14  ? 1007 ALA B HA   2  
ATOM   6204  H HB1  . ALA B 2 7   ? -10.133 -14.752 -0.738  1.00 1.51  ? 1007 ALA B HB1  2  
ATOM   6205  H HB2  . ALA B 2 7   ? -9.651  -16.341 -1.330  1.00 1.54  ? 1007 ALA B HB2  2  
ATOM   6206  H HB3  . ALA B 2 7   ? -8.481  -15.022 -1.294  1.00 1.46  ? 1007 ALA B HB3  2  
ATOM   6207  N N    . LEU B 2 8   ? -7.680  -13.791 0.638   1.00 0.84  ? 1008 LEU B N    2  
ATOM   6208  C CA   . LEU B 2 8   ? -7.171  -12.530 1.174   1.00 0.83  ? 1008 LEU B CA   2  
ATOM   6209  C C    . LEU B 2 8   ? -6.107  -12.768 2.239   1.00 0.78  ? 1008 LEU B C    2  
ATOM   6210  O O    . LEU B 2 8   ? -4.926  -12.560 1.982   1.00 0.79  ? 1008 LEU B O    2  
ATOM   6211  C CB   . LEU B 2 8   ? -8.315  -11.658 1.704   1.00 0.90  ? 1008 LEU B CB   2  
ATOM   6212  C CG   . LEU B 2 8   ? -9.279  -11.110 0.634   1.00 0.88  ? 1008 LEU B CG   2  
ATOM   6213  C CD1  . LEU B 2 8   ? -8.512  -10.590 -0.565  1.00 1.13  ? 1008 LEU B CD1  2  
ATOM   6214  C CD2  . LEU B 2 8   ? -10.292 -12.150 0.200   1.00 1.33  ? 1008 LEU B CD2  2  
ATOM   6215  H H    . LEU B 2 8   ? -7.518  -13.992 -0.311  1.00 0.85  ? 1008 LEU B H    2  
ATOM   6216  H HA   . LEU B 2 8   ? -6.702  -12.007 0.353   1.00 0.87  ? 1008 LEU B HA   2  
ATOM   6217  H HB2  . LEU B 2 8   ? -8.889  -12.245 2.407   1.00 0.95  ? 1008 LEU B HB2  2  
ATOM   6218  H HB3  . LEU B 2 8   ? -7.886  -10.819 2.231   1.00 1.05  ? 1008 LEU B HB3  2  
ATOM   6219  H HG   . LEU B 2 8   ? -9.825  -10.278 1.056   1.00 1.38  ? 1008 LEU B HG   2  
ATOM   6220  H HD11 . LEU B 2 8   ? -7.848  -9.798  -0.253  1.00 1.77  ? 1008 LEU B HD11 2  
ATOM   6221  H HD12 . LEU B 2 8   ? -9.206  -10.212 -1.301  1.00 1.55  ? 1008 LEU B HD12 2  
ATOM   6222  H HD13 . LEU B 2 8   ? -7.934  -11.396 -0.996  1.00 1.60  ? 1008 LEU B HD13 2  
ATOM   6223  H HD21 . LEU B 2 8   ? -10.965 -11.717 -0.525  1.00 1.85  ? 1008 LEU B HD21 2  
ATOM   6224  H HD22 . LEU B 2 8   ? -10.854 -12.486 1.060   1.00 1.90  ? 1008 LEU B HD22 2  
ATOM   6225  H HD23 . LEU B 2 8   ? -9.777  -12.988 -0.242  1.00 1.64  ? 1008 LEU B HD23 2  
ATOM   6226  N N    . ALA B 2 9   ? -6.531  -13.180 3.425   1.00 0.78  ? 1009 ALA B N    2  
ATOM   6227  C CA   . ALA B 2 9   ? -5.626  -13.663 4.451   1.00 0.78  ? 1009 ALA B CA   2  
ATOM   6228  C C    . ALA B 2 9   ? -4.615  -14.645 3.857   1.00 0.80  ? 1009 ALA B C    2  
ATOM   6229  O O    . ALA B 2 9   ? -3.413  -14.383 3.807   1.00 0.76  ? 1009 ALA B O    2  
ATOM   6230  C CB   . ALA B 2 9   ? -6.398  -14.371 5.541   1.00 0.88  ? 1009 ALA B CB   2  
ATOM   6231  H H    . ALA B 2 9   ? -7.486  -13.138 3.621   1.00 0.82  ? 1009 ALA B H    2  
ATOM   6232  H HA   . ALA B 2 9   ? -5.137  -12.809 4.889   1.00 0.73  ? 1009 ALA B HA   2  
ATOM   6233  H HB1  . ALA B 2 9   ? -6.922  -15.215 5.119   1.00 1.23  ? 1009 ALA B HB1  2  
ATOM   6234  H HB2  . ALA B 2 9   ? -7.107  -13.689 5.981   1.00 1.37  ? 1009 ALA B HB2  2  
ATOM   6235  H HB3  . ALA B 2 9   ? -5.709  -14.717 6.298   1.00 1.45  ? 1009 ALA B HB3  2  
ATOM   6236  N N    . ALA B 2 10  ? -5.150  -15.772 3.377   1.00 0.89  ? 1010 ALA B N    2  
ATOM   6237  C CA   . ALA B 2 10  ? -4.361  -16.865 2.803   1.00 0.94  ? 1010 ALA B CA   2  
ATOM   6238  C C    . ALA B 2 10  ? -3.418  -16.389 1.718   1.00 0.92  ? 1010 ALA B C    2  
ATOM   6239  O O    . ALA B 2 10  ? -2.278  -16.841 1.625   1.00 0.92  ? 1010 ALA B O    2  
ATOM   6240  C CB   . ALA B 2 10  ? -5.292  -17.921 2.221   1.00 1.03  ? 1010 ALA B CB   2  
ATOM   6241  H H    . ALA B 2 10  ? -6.127  -15.877 3.425   1.00 0.96  ? 1010 ALA B H    2  
ATOM   6242  H HA   . ALA B 2 10  ? -3.782  -17.322 3.592   1.00 0.94  ? 1010 ALA B HA   2  
ATOM   6243  H HB1  . ALA B 2 10  ? -5.838  -17.500 1.383   1.00 1.35  ? 1010 ALA B HB1  2  
ATOM   6244  H HB2  . ALA B 2 10  ? -5.991  -18.245 2.977   1.00 1.44  ? 1010 ALA B HB2  2  
ATOM   6245  H HB3  . ALA B 2 10  ? -4.712  -18.765 1.881   1.00 1.51  ? 1010 ALA B HB3  2  
ATOM   6246  N N    . PHE B 2 11  ? -3.891  -15.477 0.897   1.00 0.93  ? 1011 PHE B N    2  
ATOM   6247  C CA   . PHE B 2 11  ? -3.137  -15.064 -0.264  1.00 0.93  ? 1011 PHE B CA   2  
ATOM   6248  C C    . PHE B 2 11  ? -2.390  -13.769 -0.004  1.00 0.85  ? 1011 PHE B C    2  
ATOM   6249  O O    . PHE B 2 11  ? -1.792  -13.195 -0.908  1.00 0.89  ? 1011 PHE B O    2  
ATOM   6250  C CB   . PHE B 2 11  ? -4.051  -14.932 -1.463  1.00 0.97  ? 1011 PHE B CB   2  
ATOM   6251  C CG   . PHE B 2 11  ? -4.809  -16.189 -1.769  1.00 1.12  ? 1011 PHE B CG   2  
ATOM   6252  C CD1  . PHE B 2 11  ? -4.200  -17.251 -2.419  1.00 1.50  ? 1011 PHE B CD1  2  
ATOM   6253  C CD2  . PHE B 2 11  ? -6.140  -16.300 -1.422  1.00 1.18  ? 1011 PHE B CD2  2  
ATOM   6254  C CE1  . PHE B 2 11  ? -4.911  -18.398 -2.715  1.00 1.67  ? 1011 PHE B CE1  2  
ATOM   6255  C CE2  . PHE B 2 11  ? -6.856  -17.438 -1.719  1.00 1.32  ? 1011 PHE B CE2  2  
ATOM   6256  C CZ   . PHE B 2 11  ? -6.244  -18.488 -2.365  1.00 1.46  ? 1011 PHE B CZ   2  
ATOM   6257  H H    . PHE B 2 11  ? -4.763  -15.068 1.079   1.00 0.95  ? 1011 PHE B H    2  
ATOM   6258  H HA   . PHE B 2 11  ? -2.412  -15.839 -0.469  1.00 0.99  ? 1011 PHE B HA   2  
ATOM   6259  H HB2  . PHE B 2 11  ? -4.770  -14.147 -1.276  1.00 0.92  ? 1011 PHE B HB2  2  
ATOM   6260  H HB3  . PHE B 2 11  ? -3.462  -14.677 -2.331  1.00 1.00  ? 1011 PHE B HB3  2  
ATOM   6261  H HD1  . PHE B 2 11  ? -3.159  -17.179 -2.692  1.00 1.78  ? 1011 PHE B HD1  2  
ATOM   6262  H HD2  . PHE B 2 11  ? -6.625  -15.478 -0.918  1.00 1.34  ? 1011 PHE B HD2  2  
ATOM   6263  H HE1  . PHE B 2 11  ? -4.428  -19.220 -3.222  1.00 2.07  ? 1011 PHE B HE1  2  
ATOM   6264  H HE2  . PHE B 2 11  ? -7.898  -17.503 -1.441  1.00 1.50  ? 1011 PHE B HE2  2  
ATOM   6265  H HZ   . PHE B 2 11  ? -6.810  -19.372 -2.608  1.00 1.60  ? 1011 PHE B HZ   2  
ATOM   6266  N N    . GLY B 2 12  ? -2.419  -13.311 1.238   1.00 0.78  ? 1012 GLY B N    2  
ATOM   6267  C CA   . GLY B 2 12  ? -1.507  -12.266 1.642   1.00 0.72  ? 1012 GLY B CA   2  
ATOM   6268  C C    . GLY B 2 12  ? -0.132  -12.853 1.780   1.00 0.73  ? 1012 GLY B C    2  
ATOM   6269  O O    . GLY B 2 12  ? 0.881   -12.154 1.795   1.00 0.78  ? 1012 GLY B O    2  
ATOM   6270  H H    . GLY B 2 12  ? -3.065  -13.677 1.880   1.00 0.80  ? 1012 GLY B H    2  
ATOM   6271  H HA2  . GLY B 2 12  ? -1.493  -11.501 0.886   1.00 0.74  ? 1012 GLY B HA2  2  
ATOM   6272  H HA3  . GLY B 2 12  ? -1.818  -11.849 2.586   1.00 0.72  ? 1012 GLY B HA3  2  
ATOM   6273  N N    . ASP B 2 13  ? -0.131  -14.172 1.860   1.00 0.78  ? 1013 ASP B N    2  
ATOM   6274  C CA   . ASP B 2 13  ? 1.076   -14.975 1.823   1.00 0.86  ? 1013 ASP B CA   2  
ATOM   6275  C C    . ASP B 2 13  ? 1.670   -15.008 0.401   1.00 0.93  ? 1013 ASP B C    2  
ATOM   6276  O O    . ASP B 2 13  ? 2.744   -15.562 0.179   1.00 1.06  ? 1013 ASP B O    2  
ATOM   6277  C CB   . ASP B 2 13  ? 0.728   -16.384 2.328   1.00 0.98  ? 1013 ASP B CB   2  
ATOM   6278  C CG   . ASP B 2 13  ? 1.856   -17.384 2.192   1.00 1.18  ? 1013 ASP B CG   2  
ATOM   6279  O OD1  . ASP B 2 13  ? 2.745   -17.401 3.067   1.00 1.48  ? 1013 ASP B OD1  2  
ATOM   6280  O OD2  . ASP B 2 13  ? 1.839   -18.177 1.226   1.00 1.90  ? 1013 ASP B OD2  2  
ATOM   6281  H H    . ASP B 2 13  ? -0.996  -14.632 1.964   1.00 0.80  ? 1013 ASP B H    2  
ATOM   6282  H HA   . ASP B 2 13  ? 1.795   -14.529 2.493   1.00 0.88  ? 1013 ASP B HA   2  
ATOM   6283  H HB2  . ASP B 2 13  ? 0.468   -16.320 3.373   1.00 1.08  ? 1013 ASP B HB2  2  
ATOM   6284  H HB3  . ASP B 2 13  ? -0.129  -16.755 1.779   1.00 1.09  ? 1013 ASP B HB3  2  
ATOM   6285  N N    . CYS B 2 14  ? 0.980   -14.371 -0.555  1.00 0.93  ? 1014 CYS B N    2  
ATOM   6286  C CA   . CYS B 2 14  ? 1.448   -14.292 -1.934  1.00 1.06  ? 1014 CYS B CA   2  
ATOM   6287  C C    . CYS B 2 14  ? 2.805   -13.606 -1.986  1.00 1.08  ? 1014 CYS B C    2  
ATOM   6288  O O    . CYS B 2 14  ? 3.675   -13.969 -2.775  1.00 1.44  ? 1014 CYS B O    2  
ATOM   6289  C CB   . CYS B 2 14  ? 0.465   -13.488 -2.778  1.00 1.12  ? 1014 CYS B CB   2  
ATOM   6290  S SG   . CYS B 2 14  ? 0.746   -13.643 -4.563  1.00 1.34  ? 1014 CYS B SG   2  
ATOM   6291  H H    . CYS B 2 14  ? 0.140   -13.928 -0.326  1.00 0.89  ? 1014 CYS B H    2  
ATOM   6292  H HA   . CYS B 2 14  ? 1.529   -15.293 -2.339  1.00 1.22  ? 1014 CYS B HA   2  
ATOM   6293  H HB2  . CYS B 2 14  ? -0.543  -13.832 -2.572  1.00 1.12  ? 1014 CYS B HB2  2  
ATOM   6294  H HB3  . CYS B 2 14  ? 0.551   -12.440 -2.519  1.00 1.42  ? 1014 CYS B HB3  2  
ATOM   6295  N N    . ILE B 2 15  ? 2.967   -12.601 -1.131  1.00 1.14  ? 1015 ILE B N    2  
ATOM   6296  C CA   . ILE B 2 15  ? 4.189   -11.815 -1.075  1.00 1.23  ? 1015 ILE B CA   2  
ATOM   6297  C C    . ILE B 2 15  ? 4.871   -12.023 0.284   1.00 1.67  ? 1015 ILE B C    2  
ATOM   6298  O O    . ILE B 2 15  ? 5.295   -11.084 0.962   1.00 2.20  ? 1015 ILE B O    2  
ATOM   6299  C CB   . ILE B 2 15  ? 3.887   -10.315 -1.349  1.00 1.32  ? 1015 ILE B CB   2  
ATOM   6300  C CG1  . ILE B 2 15  ? 5.178   -9.489  -1.432  1.00 2.19  ? 1015 ILE B CG1  2  
ATOM   6301  C CG2  . ILE B 2 15  ? 2.943   -9.749  -0.294  1.00 1.41  ? 1015 ILE B CG2  2  
ATOM   6302  C CD1  . ILE B 2 15  ? 4.948   -8.030  -1.768  1.00 2.91  ? 1015 ILE B CD1  2  
ATOM   6303  H H    . ILE B 2 15  ? 2.242   -12.390 -0.503  1.00 1.40  ? 1015 ILE B H    2  
ATOM   6304  H HA   . ILE B 2 15  ? 4.847   -12.177 -1.853  1.00 1.28  ? 1015 ILE B HA   2  
ATOM   6305  H HB   . ILE B 2 15  ? 3.378   -10.255 -2.300  1.00 1.55  ? 1015 ILE B HB   2  
ATOM   6306  H HG12 . ILE B 2 15  ? 5.687   -9.532  -0.481  1.00 2.59  ? 1015 ILE B HG12 2  
ATOM   6307  H HG13 . ILE B 2 15  ? 5.816   -9.909  -2.196  1.00 2.56  ? 1015 ILE B HG13 2  
ATOM   6308  H HG21 . ILE B 2 15  ? 2.756   -8.704  -0.501  1.00 1.41  ? 1015 ILE B HG21 2  
ATOM   6309  H HG22 . ILE B 2 15  ? 3.395   -9.846  0.682   1.00 1.83  ? 1015 ILE B HG22 2  
ATOM   6310  H HG23 . ILE B 2 15  ? 2.011   -10.293 -0.315  1.00 2.10  ? 1015 ILE B HG23 2  
ATOM   6311  H HD11 . ILE B 2 15  ? 4.474   -7.954  -2.737  1.00 3.43  ? 1015 ILE B HD11 2  
ATOM   6312  H HD12 . ILE B 2 15  ? 5.895   -7.511  -1.787  1.00 3.20  ? 1015 ILE B HD12 2  
ATOM   6313  H HD13 . ILE B 2 15  ? 4.308   -7.584  -1.020  1.00 3.23  ? 1015 ILE B HD13 2  
ATOM   6314  N N    . ASN B 2 16  ? 4.977   -13.288 0.666   1.00 2.03  ? 1016 ASN B N    2  
ATOM   6315  C CA   . ASN B 2 16  ? 5.600   -13.665 1.928   1.00 2.59  ? 1016 ASN B CA   2  
ATOM   6316  C C    . ASN B 2 16  ? 7.114   -13.540 1.813   1.00 2.83  ? 1016 ASN B C    2  
ATOM   6317  O O    . ASN B 2 16  ? 7.755   -12.833 2.592   1.00 3.29  ? 1016 ASN B O    2  
ATOM   6318  C CB   . ASN B 2 16  ? 5.212   -15.106 2.289   1.00 3.32  ? 1016 ASN B CB   2  
ATOM   6319  C CG   . ASN B 2 16  ? 5.695   -15.550 3.664   1.00 3.73  ? 1016 ASN B CG   2  
ATOM   6320  O OD1  . ASN B 2 16  ? 6.719   -15.094 4.171   1.00 4.03  ? 1016 ASN B OD1  2  
ATOM   6321  N ND2  . ASN B 2 16  ? 4.954   -16.460 4.273   1.00 4.29  ? 1016 ASN B ND2  2  
ATOM   6322  H H    . ASN B 2 16  ? 4.632   -13.994 0.078   1.00 2.26  ? 1016 ASN B H    2  
ATOM   6323  H HA   . ASN B 2 16  ? 5.245   -12.993 2.696   1.00 2.85  ? 1016 ASN B HA   2  
ATOM   6324  H HB2  . ASN B 2 16  ? 4.137   -15.192 2.269   1.00 3.88  ? 1016 ASN B HB2  2  
ATOM   6325  H HB3  . ASN B 2 16  ? 5.632   -15.774 1.551   1.00 3.60  ? 1016 ASN B HB3  2  
ATOM   6326  H HD21 . ASN B 2 16  ? 4.145   -16.789 3.808   1.00 4.45  ? 1016 ASN B HD21 2  
ATOM   6327  H HD22 . ASN B 2 16  ? 5.241   -16.782 5.156   1.00 4.79  ? 1016 ASN B HD22 2  
ATOM   6328  N N    . ARG B 2 17  ? 7.678   -14.217 0.824   1.00 3.18  ? 1017 ARG B N    2  
ATOM   6329  C CA   . ARG B 2 17  ? 9.116   -14.225 0.636   1.00 3.90  ? 1017 ARG B CA   2  
ATOM   6330  C C    . ARG B 2 17  ? 9.457   -14.328 -0.844  1.00 4.54  ? 1017 ARG B C    2  
ATOM   6331  O O    . ARG B 2 17  ? 9.862   -13.349 -1.467  1.00 5.06  ? 1017 ARG B O    2  
ATOM   6332  C CB   . ARG B 2 17  ? 9.746   -15.385 1.414   1.00 4.55  ? 1017 ARG B CB   2  
ATOM   6333  C CG   . ARG B 2 17  ? 11.262  -15.319 1.492   1.00 5.10  ? 1017 ARG B CG   2  
ATOM   6334  C CD   . ARG B 2 17  ? 11.725  -13.998 2.085   1.00 5.97  ? 1017 ARG B CD   2  
ATOM   6335  N NE   . ARG B 2 17  ? 11.141  -13.747 3.404   1.00 6.51  ? 1017 ARG B NE   2  
ATOM   6336  C CZ   . ARG B 2 17  ? 11.120  -12.551 3.991   1.00 7.49  ? 1017 ARG B CZ   2  
ATOM   6337  N NH1  . ARG B 2 17  ? 11.615  -11.490 3.365   1.00 8.03  ? 1017 ARG B NH1  2  
ATOM   6338  N NH2  . ARG B 2 17  ? 10.587  -12.414 5.202   1.00 8.17  ? 1017 ARG B NH2  2  
ATOM   6339  H H    . ARG B 2 17  ? 7.105   -14.718 0.196   1.00 3.33  ? 1017 ARG B H    2  
ATOM   6340  H HA   . ARG B 2 17  ? 9.505   -13.293 1.019   1.00 4.04  ? 1017 ARG B HA   2  
ATOM   6341  H HB2  . ARG B 2 17  ? 9.356   -15.380 2.422   1.00 4.75  ? 1017 ARG B HB2  2  
ATOM   6342  H HB3  . ARG B 2 17  ? 9.471   -16.316 0.938   1.00 4.95  ? 1017 ARG B HB3  2  
ATOM   6343  H HG2  . ARG B 2 17  ? 11.619  -16.128 2.113   1.00 5.26  ? 1017 ARG B HG2  2  
ATOM   6344  H HG3  . ARG B 2 17  ? 11.669  -15.420 0.495   1.00 5.16  ? 1017 ARG B HG3  2  
ATOM   6345  H HD2  . ARG B 2 17  ? 12.800  -14.017 2.178   1.00 6.32  ? 1017 ARG B HD2  2  
ATOM   6346  H HD3  . ARG B 2 17  ? 11.437  -13.199 1.417   1.00 6.23  ? 1017 ARG B HD3  2  
ATOM   6347  H HE   . ARG B 2 17  ? 10.745  -14.519 3.877   1.00 6.33  ? 1017 ARG B HE   2  
ATOM   6348  H HH11 . ARG B 2 17  ? 12.008  -11.581 2.440   1.00 7.76  ? 1017 ARG B HH11 2  
ATOM   6349  H HH12 . ARG B 2 17  ? 11.601  -10.585 3.811   1.00 8.86  ? 1017 ARG B HH12 2  
ATOM   6350  H HH21 . ARG B 2 17  ? 10.198  -13.210 5.678   1.00 8.01  ? 1017 ARG B HH21 2  
ATOM   6351  H HH22 . ARG B 2 17  ? 10.572  -11.513 5.653   1.00 8.98  ? 1017 ARG B HH22 2  
HETATM 6352  N N    . NH2 B 2 18  ? 9.286   -15.511 -1.410  1.00 4.96  ? 1018 NH2 B N    2  
HETATM 6353  H HN1  . NH2 B 2 18  ? 8.954   -16.247 -0.854  1.00 4.86  ? 1018 NH2 B HN1  2  
HETATM 6354  H HN2  . NH2 B 2 18  ? 9.502   -15.605 -2.361  1.00 5.57  ? 1018 NH2 B HN2  2  
HETATM 6355  C C1   . 33B C 3 .   ? -15.241 -18.985 -2.361  1.00 1.93  ? 1100 33B B C1   2  
HETATM 6356  C C2   . 33B C 3 .   ? -13.920 -18.597 -3.029  1.00 1.78  ? 1100 33B B C2   2  
HETATM 6357  O O2   . 33B C 3 .   ? -13.876 -17.682 -3.849  1.00 2.16  ? 1100 33B B O2   2  
HETATM 6358  N N3   . 33B C 3 .   ? -12.849 -19.297 -2.655  1.00 1.51  ? 1100 33B B N3   2  
HETATM 6359  C C4   . 33B C 3 .   ? -11.667 -18.925 -3.137  1.00 1.44  ? 1100 33B B C4   2  
HETATM 6360  C C5   . 33B C 3 .   ? -11.046 -17.793 -2.631  1.00 1.42  ? 1100 33B B C5   2  
HETATM 6361  C C6   . 33B C 3 .   ? -11.100 -19.609 -4.207  1.00 1.47  ? 1100 33B B C6   2  
HETATM 6362  S S6   . 33B C 3 .   ? -11.880 -21.037 -4.836  1.00 1.71  ? 1100 33B B S6   2  
HETATM 6363  C C7   . 33B C 3 .   ? -9.860  -17.333 -3.212  1.00 1.43  ? 1100 33B B C7   2  
HETATM 6364  C C8   . 33B C 3 .   ? -9.918  -19.156 -4.782  1.00 1.42  ? 1100 33B B C8   2  
HETATM 6365  C C9   . 33B C 3 .   ? -9.299  -18.017 -4.292  1.00 1.39  ? 1100 33B B C9   2  
HETATM 6366  N N10  . 33B C 3 .   ? -8.110  -17.651 -4.777  1.00 1.40  ? 1100 33B B N10  2  
HETATM 6367  N N11  . 33B C 3 .   ? -7.574  -16.613 -4.394  1.00 1.51  ? 1100 33B B N11  2  
HETATM 6368  C C12  . 33B C 3 .   ? -6.357  -16.276 -4.830  1.00 1.54  ? 1100 33B B C12  2  
HETATM 6369  C C13  . 33B C 3 .   ? -5.757  -15.120 -4.351  1.00 1.75  ? 1100 33B B C13  2  
HETATM 6370  C C14  . 33B C 3 .   ? -5.656  -17.116 -5.692  1.00 1.42  ? 1100 33B B C14  2  
HETATM 6371  C C15  . 33B C 3 .   ? -4.448  -14.811 -4.709  1.00 1.78  ? 1100 33B B C15  2  
HETATM 6372  C C16  . 33B C 3 .   ? -4.340  -16.806 -6.045  1.00 1.45  ? 1100 33B B C16  2  
HETATM 6373  C C17  . 33B C 3 .   ? -3.736  -15.659 -5.548  1.00 1.60  ? 1100 33B B C17  2  
HETATM 6374  S S17  . 33B C 3 .   ? -3.415  -17.874 -7.073  1.00 1.38  ? 1100 33B B S17  2  
HETATM 6375  N N18  . 33B C 3 .   ? -2.442  -15.438 -5.800  1.00 1.62  ? 1100 33B B N18  2  
HETATM 6376  C C19  . 33B C 3 .   ? -1.705  -14.842 -4.856  1.00 1.65  ? 1100 33B B C19  2  
HETATM 6377  O O19  . 33B C 3 .   ? -2.162  -14.095 -3.991  1.00 1.92  ? 1100 33B B O19  2  
HETATM 6378  C C20  . 33B C 3 .   ? -0.201  -15.135 -4.919  1.00 1.43  ? 1100 33B B C20  2  
HETATM 6379  O O61  . 33B C 3 .   ? -12.367 -20.771 -6.230  1.00 2.13  ? 1100 33B B O61  2  
HETATM 6380  O O62  . 33B C 3 .   ? -13.053 -21.396 -3.970  1.00 2.30  ? 1100 33B B O62  2  
HETATM 6381  O O63  . 33B C 3 .   ? -10.903 -22.181 -4.864  1.00 2.30  ? 1100 33B B O63  2  
HETATM 6382  O O71  . 33B C 3 .   ? -4.242  -19.064 -7.467  1.00 2.03  ? 1100 33B B O71  2  
HETATM 6383  O O72  . 33B C 3 .   ? -2.191  -18.338 -6.337  1.00 1.73  ? 1100 33B B O72  2  
HETATM 6384  O O73  . 33B C 3 .   ? -2.990  -17.132 -8.308  1.00 2.14  ? 1100 33B B O73  2  
HETATM 6385  H HN3  . 33B C 3 .   ? -12.884 -19.966 -1.940  1.00 1.56  ? 1100 33B B HN3  2  
HETATM 6386  H H5   . 33B C 3 .   ? -11.477 -17.280 -1.773  1.00 1.48  ? 1100 33B B H5   2  
HETATM 6387  H H7   . 33B C 3 .   ? -9.380  -16.444 -2.828  1.00 1.52  ? 1100 33B B H7   2  
HETATM 6388  H H8   . 33B C 3 .   ? -9.481  -19.691 -5.610  1.00 1.47  ? 1100 33B B H8   2  
HETATM 6389  H H1   . 33B C 3 .   ? -15.040 -19.349 -1.363  1.00 1.83  ? 1100 33B B H1   2  
HETATM 6390  H H13  . 33B C 3 .   ? -6.305  -14.462 -3.693  1.00 1.91  ? 1100 33B B H13  2  
HETATM 6391  H H14  . 33B C 3 .   ? -6.119  -18.018 -6.064  1.00 1.37  ? 1100 33B B H14  2  
HETATM 6392  H H15  . 33B C 3 .   ? -3.981  -13.918 -4.322  1.00 1.97  ? 1100 33B B H15  2  
HETATM 6393  H HN18 . 33B C 3 .   ? -2.045  -15.697 -6.657  1.00 1.61  ? 1100 33B B HN18 2  
HETATM 6394  H H20  . 33B C 3 .   ? 0.059   -15.496 -5.896  1.00 1.84  ? 1100 33B B H20  2  
HETATM 6395  H H1A  . 33B C 3 .   ? -15.715 -19.767 -2.936  1.00 2.26  ? 1100 33B B H1A  2  
HETATM 6396  H H20A . 33B C 3 .   ? 0.043   -15.891 -4.186  1.00 1.72  ? 1100 33B B H20A 2  
ATOM   6397  N N    . MET A 1 1   ? 4.768   10.679  11.403  1.00 4.13  ? 1    MET A N    3  
ATOM   6398  C CA   . MET A 1 1   ? 4.607   10.721  12.872  1.00 3.61  ? 1    MET A CA   3  
ATOM   6399  C C    . MET A 1 1   ? 3.507   9.760   13.302  1.00 2.48  ? 1    MET A C    3  
ATOM   6400  O O    . MET A 1 1   ? 3.784   8.669   13.797  1.00 2.89  ? 1    MET A O    3  
ATOM   6401  C CB   . MET A 1 1   ? 4.264   12.143  13.328  1.00 4.18  ? 1    MET A CB   3  
ATOM   6402  C CG   . MET A 1 1   ? 5.236   13.198  12.831  1.00 4.89  ? 1    MET A CG   3  
ATOM   6403  S SD   . MET A 1 1   ? 4.710   14.873  13.237  1.00 5.86  ? 1    MET A SD   3  
ATOM   6404  C CE   . MET A 1 1   ? 5.932   15.831  12.345  1.00 6.21  ? 1    MET A CE   3  
ATOM   6405  H H1   . MET A 1 1   ? 5.581   11.264  11.110  1.00 4.36  ? 1    MET A H1   3  
ATOM   6406  H H2   . MET A 1 1   ? 3.911   11.041  10.935  1.00 4.50  ? 1    MET A H2   3  
ATOM   6407  H H3   . MET A 1 1   ? 4.934   9.695   11.086  1.00 4.37  ? 1    MET A H3   3  
ATOM   6408  H HA   . MET A 1 1   ? 5.539   10.416  13.327  1.00 4.14  ? 1    MET A HA   3  
ATOM   6409  H HB2  . MET A 1 1   ? 3.278   12.396  12.968  1.00 4.47  ? 1    MET A HB2  3  
ATOM   6410  H HB3  . MET A 1 1   ? 4.260   12.170  14.409  1.00 4.35  ? 1    MET A HB3  3  
ATOM   6411  H HG2  . MET A 1 1   ? 6.202   13.021  13.282  1.00 5.14  ? 1    MET A HG2  3  
ATOM   6412  H HG3  . MET A 1 1   ? 5.320   13.113  11.757  1.00 5.02  ? 1    MET A HG3  3  
ATOM   6413  H HE1  . MET A 1 1   ? 5.737   16.883  12.486  1.00 6.39  ? 1    MET A HE1  3  
ATOM   6414  H HE2  . MET A 1 1   ? 5.878   15.592  11.293  1.00 6.45  ? 1    MET A HE2  3  
ATOM   6415  H HE3  . MET A 1 1   ? 6.917   15.593  12.719  1.00 6.36  ? 1    MET A HE3  3  
ATOM   6416  N N    . SER A 1 2   ? 2.259   10.159  13.094  1.00 1.64  ? 2    SER A N    3  
ATOM   6417  C CA   . SER A 1 2   ? 1.127   9.309   13.427  1.00 0.95  ? 2    SER A CA   3  
ATOM   6418  C C    . SER A 1 2   ? 0.071   9.349   12.322  1.00 0.84  ? 2    SER A C    3  
ATOM   6419  O O    . SER A 1 2   ? -0.389  8.311   11.853  1.00 1.03  ? 2    SER A O    3  
ATOM   6420  C CB   . SER A 1 2   ? 0.535   9.740   14.770  1.00 1.55  ? 2    SER A CB   3  
ATOM   6421  O OG   . SER A 1 2   ? 0.486   11.154  14.879  1.00 1.87  ? 2    SER A OG   3  
ATOM   6422  H H    . SER A 1 2   ? 2.093   11.054  12.728  1.00 2.17  ? 2    SER A H    3  
ATOM   6423  H HA   . SER A 1 2   ? 1.493   8.297   13.517  1.00 1.52  ? 2    SER A HA   3  
ATOM   6424  H HB2  . SER A 1 2   ? -0.468  9.351   14.861  1.00 2.02  ? 2    SER A HB2  3  
ATOM   6425  H HB3  . SER A 1 2   ? 1.145   9.350   15.572  1.00 2.26  ? 2    SER A HB3  3  
ATOM   6426  H HG   . SER A 1 2   ? -0.281  11.492  14.394  1.00 2.17  ? 2    SER A HG   3  
ATOM   6427  N N    . GLN A 1 3   ? -0.283  10.550  11.882  1.00 0.73  ? 3    GLN A N    3  
ATOM   6428  C CA   . GLN A 1 3   ? -1.298  10.717  10.846  1.00 0.73  ? 3    GLN A CA   3  
ATOM   6429  C C    . GLN A 1 3   ? -0.719  10.463  9.459   1.00 0.61  ? 3    GLN A C    3  
ATOM   6430  O O    . GLN A 1 3   ? -1.418  10.571  8.455   1.00 0.64  ? 3    GLN A O    3  
ATOM   6431  C CB   . GLN A 1 3   ? -1.916  12.118  10.902  1.00 0.83  ? 3    GLN A CB   3  
ATOM   6432  C CG   . GLN A 1 3   ? -3.010  12.268  11.950  1.00 1.13  ? 3    GLN A CG   3  
ATOM   6433  C CD   . GLN A 1 3   ? -2.497  12.180  13.374  1.00 1.76  ? 3    GLN A CD   3  
ATOM   6434  O OE1  . GLN A 1 3   ? -1.371  12.577  13.668  1.00 2.42  ? 3    GLN A OE1  3  
ATOM   6435  N NE2  . GLN A 1 3   ? -3.318  11.648  14.263  1.00 2.22  ? 3    GLN A NE2  3  
ATOM   6436  H H    . GLN A 1 3   ? 0.149   11.350  12.262  1.00 0.80  ? 3    GLN A H    3  
ATOM   6437  H HA   . GLN A 1 3   ? -2.074  9.989   11.032  1.00 0.87  ? 3    GLN A HA   3  
ATOM   6438  H HB2  . GLN A 1 3   ? -1.137  12.832  11.123  1.00 1.10  ? 3    GLN A HB2  3  
ATOM   6439  H HB3  . GLN A 1 3   ? -2.340  12.350  9.937   1.00 1.10  ? 3    GLN A HB3  3  
ATOM   6440  H HG2  . GLN A 1 3   ? -3.484  13.228  11.817  1.00 1.52  ? 3    GLN A HG2  3  
ATOM   6441  H HG3  . GLN A 1 3   ? -3.741  11.486  11.799  1.00 1.61  ? 3    GLN A HG3  3  
ATOM   6442  H HE21 . GLN A 1 3   ? -4.201  11.341  13.954  1.00 2.34  ? 3    GLN A HE21 3  
ATOM   6443  H HE22 . GLN A 1 3   ? -3.017  11.582  15.198  1.00 2.76  ? 3    GLN A HE22 3  
ATOM   6444  N N    . SER A 1 4   ? 0.557   10.114  9.411   1.00 0.55  ? 4    SER A N    3  
ATOM   6445  C CA   . SER A 1 4   ? 1.242   9.854   8.153   1.00 0.52  ? 4    SER A CA   3  
ATOM   6446  C C    . SER A 1 4   ? 0.676   8.619   7.453   1.00 0.45  ? 4    SER A C    3  
ATOM   6447  O O    . SER A 1 4   ? 0.823   8.459   6.239   1.00 0.46  ? 4    SER A O    3  
ATOM   6448  C CB   . SER A 1 4   ? 2.734   9.683   8.427   1.00 0.61  ? 4    SER A CB   3  
ATOM   6449  O OG   . SER A 1 4   ? 2.939   9.170   9.735   1.00 1.25  ? 4    SER A OG   3  
ATOM   6450  H H    . SER A 1 4   ? 1.056   10.017  10.247  1.00 0.59  ? 4    SER A H    3  
ATOM   6451  H HA   . SER A 1 4   ? 1.100   10.712  7.512   1.00 0.57  ? 4    SER A HA   3  
ATOM   6452  H HB2  . SER A 1 4   ? 3.156   8.993   7.710   1.00 1.02  ? 4    SER A HB2  3  
ATOM   6453  H HB3  . SER A 1 4   ? 3.229   10.639  8.345   1.00 1.08  ? 4    SER A HB3  3  
ATOM   6454  H HG   . SER A 1 4   ? 3.755   8.642   9.754   1.00 1.54  ? 4    SER A HG   3  
ATOM   6455  N N    . ASN A 1 5   ? 0.010   7.761   8.222   1.00 0.43  ? 5    ASN A N    3  
ATOM   6456  C CA   . ASN A 1 5   ? -0.614  6.559   7.676   1.00 0.39  ? 5    ASN A CA   3  
ATOM   6457  C C    . ASN A 1 5   ? -1.731  6.930   6.713   1.00 0.35  ? 5    ASN A C    3  
ATOM   6458  O O    . ASN A 1 5   ? -2.116  6.134   5.856   1.00 0.35  ? 5    ASN A O    3  
ATOM   6459  C CB   . ASN A 1 5   ? -1.183  5.685   8.791   1.00 0.40  ? 5    ASN A CB   3  
ATOM   6460  C CG   . ASN A 1 5   ? -0.157  5.281   9.826   1.00 0.80  ? 5    ASN A CG   3  
ATOM   6461  O OD1  . ASN A 1 5   ? 1.017   5.078   9.518   1.00 1.78  ? 5    ASN A OD1  3  
ATOM   6462  N ND2  . ASN A 1 5   ? -0.600  5.172   11.067  1.00 0.53  ? 5    ASN A ND2  3  
ATOM   6463  H H    . ASN A 1 5   ? -0.056  7.938   9.185   1.00 0.46  ? 5    ASN A H    3  
ATOM   6464  H HA   . ASN A 1 5   ? 0.141   6.004   7.141   1.00 0.42  ? 5    ASN A HA   3  
ATOM   6465  H HB2  . ASN A 1 5   ? -1.965  6.210   9.284   1.00 0.91  ? 5    ASN A HB2  3  
ATOM   6466  H HB3  . ASN A 1 5   ? -1.596  4.792   8.356   1.00 0.85  ? 5    ASN A HB3  3  
ATOM   6467  H HD21 . ASN A 1 5   ? -1.545  5.361   11.239  1.00 0.61  ? 5    ASN A HD21 3  
ATOM   6468  H HD22 . ASN A 1 5   ? 0.033   4.904   11.767  1.00 1.03  ? 5    ASN A HD22 3  
ATOM   6469  N N    . ARG A 1 6   ? -2.253  8.144   6.871   1.00 0.35  ? 6    ARG A N    3  
ATOM   6470  C CA   . ARG A 1 6   ? -3.277  8.668   5.983   1.00 0.34  ? 6    ARG A CA   3  
ATOM   6471  C C    . ARG A 1 6   ? -2.811  8.606   4.543   1.00 0.31  ? 6    ARG A C    3  
ATOM   6472  O O    . ARG A 1 6   ? -3.494  8.057   3.680   1.00 0.30  ? 6    ARG A O    3  
ATOM   6473  C CB   . ARG A 1 6   ? -3.602  10.119  6.341   1.00 0.41  ? 6    ARG A CB   3  
ATOM   6474  C CG   . ARG A 1 6   ? -4.593  10.762  5.390   1.00 0.59  ? 6    ARG A CG   3  
ATOM   6475  C CD   . ARG A 1 6   ? -5.915  10.025  5.416   1.00 0.41  ? 6    ARG A CD   3  
ATOM   6476  N NE   . ARG A 1 6   ? -6.670  10.315  6.635   1.00 0.68  ? 6    ARG A NE   3  
ATOM   6477  C CZ   . ARG A 1 6   ? -7.698  9.594   7.076   1.00 0.69  ? 6    ARG A CZ   3  
ATOM   6478  N NH1  . ARG A 1 6   ? -8.095  8.519   6.412   1.00 1.40  ? 6    ARG A NH1  3  
ATOM   6479  N NH2  . ARG A 1 6   ? -8.332  9.951   8.185   1.00 0.93  ? 6    ARG A NH2  3  
ATOM   6480  H H    . ARG A 1 6   ? -1.937  8.705   7.613   1.00 0.37  ? 6    ARG A H    3  
ATOM   6481  H HA   . ARG A 1 6   ? -4.166  8.066   6.092   1.00 0.35  ? 6    ARG A HA   3  
ATOM   6482  H HB2  . ARG A 1 6   ? -4.018  10.149  7.338   1.00 0.72  ? 6    ARG A HB2  3  
ATOM   6483  H HB3  . ARG A 1 6   ? -2.688  10.696  6.322   1.00 0.62  ? 6    ARG A HB3  3  
ATOM   6484  H HG2  . ARG A 1 6   ? -4.753  11.788  5.687   1.00 1.01  ? 6    ARG A HG2  3  
ATOM   6485  H HG3  . ARG A 1 6   ? -4.191  10.731  4.387   1.00 1.02  ? 6    ARG A HG3  3  
ATOM   6486  H HD2  . ARG A 1 6   ? -6.496  10.321  4.555   1.00 0.55  ? 6    ARG A HD2  3  
ATOM   6487  H HD3  . ARG A 1 6   ? -5.710  8.960   5.366   1.00 0.42  ? 6    ARG A HD3  3  
ATOM   6488  H HE   . ARG A 1 6   ? -6.390  11.111  7.161   1.00 1.36  ? 6    ARG A HE   3  
ATOM   6489  H HH11 . ARG A 1 6   ? -7.625  8.241   5.575   1.00 1.68  ? 6    ARG A HH11 3  
ATOM   6490  H HH12 . ARG A 1 6   ? -8.862  7.972   6.753   1.00 1.90  ? 6    ARG A HH12 3  
ATOM   6491  H HH21 . ARG A 1 6   ? -8.040  10.768  8.696   1.00 1.42  ? 6    ARG A HH21 3  
ATOM   6492  H HH22 . ARG A 1 6   ? -9.107  9.404   8.525   1.00 1.07  ? 6    ARG A HH22 3  
ATOM   6493  N N    . GLU A 1 7   ? -1.641  9.167   4.305   1.00 0.30  ? 7    GLU A N    3  
ATOM   6494  C CA   . GLU A 1 7   ? -1.070  9.244   2.972   1.00 0.29  ? 7    GLU A CA   3  
ATOM   6495  C C    . GLU A 1 7   ? -0.918  7.864   2.369   1.00 0.25  ? 7    GLU A C    3  
ATOM   6496  O O    . GLU A 1 7   ? -1.252  7.639   1.213   1.00 0.26  ? 7    GLU A O    3  
ATOM   6497  C CB   . GLU A 1 7   ? 0.297   9.899   3.021   1.00 0.31  ? 7    GLU A CB   3  
ATOM   6498  C CG   . GLU A 1 7   ? 0.282   11.318  3.529   1.00 0.40  ? 7    GLU A CG   3  
ATOM   6499  C CD   . GLU A 1 7   ? 1.658   11.934  3.471   1.00 0.51  ? 7    GLU A CD   3  
ATOM   6500  O OE1  . GLU A 1 7   ? 2.193   12.113  2.356   1.00 0.68  ? 7    GLU A OE1  3  
ATOM   6501  O OE2  . GLU A 1 7   ? 2.186   12.287  4.545   1.00 0.53  ? 7    GLU A OE2  3  
ATOM   6502  H H    . GLU A 1 7   ? -1.138  9.537   5.059   1.00 0.33  ? 7    GLU A H    3  
ATOM   6503  H HA   . GLU A 1 7   ? -1.731  9.837   2.357   1.00 0.32  ? 7    GLU A HA   3  
ATOM   6504  H HB2  . GLU A 1 7   ? 0.937   9.318   3.668   1.00 0.33  ? 7    GLU A HB2  3  
ATOM   6505  H HB3  . GLU A 1 7   ? 0.716   9.901   2.026   1.00 0.33  ? 7    GLU A HB3  3  
ATOM   6506  H HG2  . GLU A 1 7   ? -0.388  11.898  2.915   1.00 0.46  ? 7    GLU A HG2  3  
ATOM   6507  H HG3  . GLU A 1 7   ? -0.065  11.322  4.550   1.00 0.40  ? 7    GLU A HG3  3  
ATOM   6508  N N    . LEU A 1 8   ? -0.381  6.958   3.170   1.00 0.26  ? 8    LEU A N    3  
ATOM   6509  C CA   . LEU A 1 8   ? -0.166  5.580   2.785   1.00 0.27  ? 8    LEU A CA   3  
ATOM   6510  C C    . LEU A 1 8   ? -1.448  4.950   2.249   1.00 0.28  ? 8    LEU A C    3  
ATOM   6511  O O    . LEU A 1 8   ? -1.408  4.099   1.362   1.00 0.40  ? 8    LEU A O    3  
ATOM   6512  C CB   . LEU A 1 8   ? 0.348   4.825   4.008   1.00 0.34  ? 8    LEU A CB   3  
ATOM   6513  C CG   . LEU A 1 8   ? 1.797   5.131   4.432   1.00 0.41  ? 8    LEU A CG   3  
ATOM   6514  C CD1  . LEU A 1 8   ? 2.281   6.509   3.986   1.00 1.00  ? 8    LEU A CD1  3  
ATOM   6515  C CD2  . LEU A 1 8   ? 1.942   4.990   5.941   1.00 1.16  ? 8    LEU A CD2  3  
ATOM   6516  H H    . LEU A 1 8   ? -0.079  7.229   4.062   1.00 0.31  ? 8    LEU A H    3  
ATOM   6517  H HA   . LEU A 1 8   ? 0.589   5.559   2.014   1.00 0.30  ? 8    LEU A HA   3  
ATOM   6518  H HB2  . LEU A 1 8   ? -0.302  5.055   4.840   1.00 0.48  ? 8    LEU A HB2  3  
ATOM   6519  H HB3  . LEU A 1 8   ? 0.276   3.768   3.803   1.00 0.55  ? 8    LEU A HB3  3  
ATOM   6520  H HG   . LEU A 1 8   ? 2.435   4.414   3.975   1.00 1.15  ? 8    LEU A HG   3  
ATOM   6521  H HD11 . LEU A 1 8   ? 1.617   7.270   4.372   1.00 1.57  ? 8    LEU A HD11 3  
ATOM   6522  H HD12 . LEU A 1 8   ? 2.292   6.558   2.902   1.00 1.63  ? 8    LEU A HD12 3  
ATOM   6523  H HD13 . LEU A 1 8   ? 3.283   6.677   4.361   1.00 1.61  ? 8    LEU A HD13 3  
ATOM   6524  H HD21 . LEU A 1 8   ? 1.779   3.961   6.224   1.00 1.72  ? 8    LEU A HD21 3  
ATOM   6525  H HD22 . LEU A 1 8   ? 1.208   5.618   6.436   1.00 1.80  ? 8    LEU A HD22 3  
ATOM   6526  H HD23 . LEU A 1 8   ? 2.936   5.294   6.237   1.00 1.65  ? 8    LEU A HD23 3  
ATOM   6527  N N    . VAL A 1 9   ? -2.580  5.384   2.784   1.00 0.23  ? 9    VAL A N    3  
ATOM   6528  C CA   . VAL A 1 9   ? -3.870  4.958   2.279   1.00 0.23  ? 9    VAL A CA   3  
ATOM   6529  C C    . VAL A 1 9   ? -4.226  5.758   1.033   1.00 0.23  ? 9    VAL A C    3  
ATOM   6530  O O    . VAL A 1 9   ? -4.381  5.209   -0.056  1.00 0.24  ? 9    VAL A O    3  
ATOM   6531  C CB   . VAL A 1 9   ? -4.958  5.164   3.348   1.00 0.25  ? 9    VAL A CB   3  
ATOM   6532  C CG1  . VAL A 1 9   ? -6.343  4.921   2.779   1.00 0.26  ? 9    VAL A CG1  3  
ATOM   6533  C CG2  . VAL A 1 9   ? -4.704  4.258   4.536   1.00 0.27  ? 9    VAL A CG2  3  
ATOM   6534  H H    . VAL A 1 9   ? -2.549  6.020   3.538   1.00 0.26  ? 9    VAL A H    3  
ATOM   6535  H HA   . VAL A 1 9   ? -3.815  3.910   2.035   1.00 0.25  ? 9    VAL A HA   3  
ATOM   6536  H HB   . VAL A 1 9   ? -4.909  6.187   3.690   1.00 0.26  ? 9    VAL A HB   3  
ATOM   6537  H HG11 . VAL A 1 9   ? -6.395  3.925   2.357   1.00 1.05  ? 9    VAL A HG11 3  
ATOM   6538  H HG12 . VAL A 1 9   ? -6.547  5.648   2.004   1.00 1.03  ? 9    VAL A HG12 3  
ATOM   6539  H HG13 . VAL A 1 9   ? -7.075  5.018   3.566   1.00 0.93  ? 9    VAL A HG13 3  
ATOM   6540  H HG21 . VAL A 1 9   ? -3.763  4.525   4.997   1.00 1.00  ? 9    VAL A HG21 3  
ATOM   6541  H HG22 . VAL A 1 9   ? -4.667  3.230   4.204   1.00 1.04  ? 9    VAL A HG22 3  
ATOM   6542  H HG23 . VAL A 1 9   ? -5.503  4.375   5.254   1.00 1.07  ? 9    VAL A HG23 3  
ATOM   6543  N N    . VAL A 1 10  ? -4.329  7.064   1.222   1.00 0.23  ? 10   VAL A N    3  
ATOM   6544  C CA   . VAL A 1 10  ? -4.756  7.991   0.181   1.00 0.25  ? 10   VAL A CA   3  
ATOM   6545  C C    . VAL A 1 10  ? -3.990  7.799   -1.120  1.00 0.25  ? 10   VAL A C    3  
ATOM   6546  O O    . VAL A 1 10  ? -4.603  7.598   -2.169  1.00 0.27  ? 10   VAL A O    3  
ATOM   6547  C CB   . VAL A 1 10  ? -4.587  9.436   0.670   1.00 0.28  ? 10   VAL A CB   3  
ATOM   6548  C CG1  . VAL A 1 10  ? -4.981  10.431  -0.405  1.00 0.33  ? 10   VAL A CG1  3  
ATOM   6549  C CG2  . VAL A 1 10  ? -5.414  9.641   1.917   1.00 0.32  ? 10   VAL A CG2  3  
ATOM   6550  H H    . VAL A 1 10  ? -4.095  7.427   2.107   1.00 0.24  ? 10   VAL A H    3  
ATOM   6551  H HA   . VAL A 1 10  ? -5.806  7.821   -0.004  1.00 0.27  ? 10   VAL A HA   3  
ATOM   6552  H HB   . VAL A 1 10  ? -3.549  9.597   0.920   1.00 0.28  ? 10   VAL A HB   3  
ATOM   6553  H HG11 . VAL A 1 10  ? -6.025  10.294  -0.653  1.00 1.13  ? 10   VAL A HG11 3  
ATOM   6554  H HG12 . VAL A 1 10  ? -4.376  10.268  -1.283  1.00 1.03  ? 10   VAL A HG12 3  
ATOM   6555  H HG13 . VAL A 1 10  ? -4.827  11.434  -0.037  1.00 1.05  ? 10   VAL A HG13 3  
ATOM   6556  H HG21 . VAL A 1 10  ? -5.030  9.007   2.702   1.00 1.06  ? 10   VAL A HG21 3  
ATOM   6557  H HG22 . VAL A 1 10  ? -6.440  9.374   1.710   1.00 1.04  ? 10   VAL A HG22 3  
ATOM   6558  H HG23 . VAL A 1 10  ? -5.359  10.673  2.225   1.00 1.04  ? 10   VAL A HG23 3  
ATOM   6559  N N    . ASP A 1 11  ? -2.660  7.857   -1.045  1.00 0.26  ? 11   ASP A N    3  
ATOM   6560  C CA   . ASP A 1 11  ? -1.806  7.714   -2.221  1.00 0.28  ? 11   ASP A CA   3  
ATOM   6561  C C    . ASP A 1 11  ? -2.209  6.491   -3.028  1.00 0.31  ? 11   ASP A C    3  
ATOM   6562  O O    . ASP A 1 11  ? -2.319  6.551   -4.254  1.00 0.35  ? 11   ASP A O    3  
ATOM   6563  C CB   . ASP A 1 11  ? -0.337  7.582   -1.805  1.00 0.32  ? 11   ASP A CB   3  
ATOM   6564  C CG   . ASP A 1 11  ? 0.625   7.691   -2.976  1.00 0.39  ? 11   ASP A CG   3  
ATOM   6565  O OD1  . ASP A 1 11  ? 0.649   6.788   -3.834  1.00 0.49  ? 11   ASP A OD1  3  
ATOM   6566  O OD2  . ASP A 1 11  ? 1.368   8.693   -3.043  1.00 0.59  ? 11   ASP A OD2  3  
ATOM   6567  H H    . ASP A 1 11  ? -2.237  7.997   -0.165  1.00 0.26  ? 11   ASP A H    3  
ATOM   6568  H HA   . ASP A 1 11  ? -1.925  8.597   -2.832  1.00 0.31  ? 11   ASP A HA   3  
ATOM   6569  H HB2  . ASP A 1 11  ? -0.099  8.363   -1.100  1.00 0.36  ? 11   ASP A HB2  3  
ATOM   6570  H HB3  . ASP A 1 11  ? -0.191  6.622   -1.333  1.00 0.36  ? 11   ASP A HB3  3  
ATOM   6571  N N    . PHE A 1 12  ? -2.471  5.395   -2.327  1.00 0.32  ? 12   PHE A N    3  
ATOM   6572  C CA   . PHE A 1 12  ? -2.774  4.140   -2.980  1.00 0.38  ? 12   PHE A CA   3  
ATOM   6573  C C    . PHE A 1 12  ? -4.163  4.170   -3.608  1.00 0.34  ? 12   PHE A C    3  
ATOM   6574  O O    . PHE A 1 12  ? -4.340  3.703   -4.732  1.00 0.39  ? 12   PHE A O    3  
ATOM   6575  C CB   . PHE A 1 12  ? -2.663  2.975   -2.002  1.00 0.46  ? 12   PHE A CB   3  
ATOM   6576  C CG   . PHE A 1 12  ? -2.181  1.709   -2.652  1.00 0.76  ? 12   PHE A CG   3  
ATOM   6577  C CD1  . PHE A 1 12  ? -2.995  1.020   -3.536  1.00 0.98  ? 12   PHE A CD1  3  
ATOM   6578  C CD2  . PHE A 1 12  ? -0.926  1.200   -2.367  1.00 1.24  ? 12   PHE A CD2  3  
ATOM   6579  C CE1  . PHE A 1 12  ? -2.564  -0.152  -4.124  1.00 1.38  ? 12   PHE A CE1  3  
ATOM   6580  C CE2  . PHE A 1 12  ? -0.491  0.029   -2.954  1.00 1.61  ? 12   PHE A CE2  3  
ATOM   6581  C CZ   . PHE A 1 12  ? -1.271  -0.611  -3.875  1.00 1.61  ? 12   PHE A CZ   3  
ATOM   6582  H H    . PHE A 1 12  ? -2.464  5.438   -1.348  1.00 0.31  ? 12   PHE A H    3  
ATOM   6583  H HA   . PHE A 1 12  ? -2.048  4.001   -3.767  1.00 0.45  ? 12   PHE A HA   3  
ATOM   6584  H HB2  . PHE A 1 12  ? -1.968  3.233   -1.217  1.00 0.57  ? 12   PHE A HB2  3  
ATOM   6585  H HB3  . PHE A 1 12  ? -3.635  2.782   -1.572  1.00 0.57  ? 12   PHE A HB3  3  
ATOM   6586  H HD1  . PHE A 1 12  ? -3.976  1.408   -3.767  1.00 1.09  ? 12   PHE A HD1  3  
ATOM   6587  H HD2  . PHE A 1 12  ? -0.284  1.727   -1.679  1.00 1.46  ? 12   PHE A HD2  3  
ATOM   6588  H HE1  . PHE A 1 12  ? -3.208  -0.680  -4.812  1.00 1.67  ? 12   PHE A HE1  3  
ATOM   6589  H HE2  . PHE A 1 12  ? 0.490   -0.357  -2.723  1.00 2.02  ? 12   PHE A HE2  3  
ATOM   6590  H HZ   . PHE A 1 12  ? -0.918  -1.514  -4.351  1.00 1.95  ? 12   PHE A HZ   3  
ATOM   6591  N N    . LEU A 1 13  ? -5.152  4.722   -2.901  1.00 0.28  ? 13   LEU A N    3  
ATOM   6592  C CA   . LEU A 1 13  ? -6.488  4.839   -3.473  1.00 0.28  ? 13   LEU A CA   3  
ATOM   6593  C C    . LEU A 1 13  ? -6.457  5.742   -4.703  1.00 0.30  ? 13   LEU A C    3  
ATOM   6594  O O    . LEU A 1 13  ? -7.084  5.444   -5.720  1.00 0.34  ? 13   LEU A O    3  
ATOM   6595  C CB   . LEU A 1 13  ? -7.506  5.358   -2.449  1.00 0.25  ? 13   LEU A CB   3  
ATOM   6596  C CG   . LEU A 1 13  ? -8.085  4.297   -1.505  1.00 0.26  ? 13   LEU A CG   3  
ATOM   6597  C CD1  . LEU A 1 13  ? -7.163  4.019   -0.348  1.00 0.26  ? 13   LEU A CD1  3  
ATOM   6598  C CD2  . LEU A 1 13  ? -9.457  4.703   -0.996  1.00 0.27  ? 13   LEU A CD2  3  
ATOM   6599  H H    . LEU A 1 13  ? -4.980  5.055   -1.984  1.00 0.26  ? 13   LEU A H    3  
ATOM   6600  H HA   . LEU A 1 13  ? -6.790  3.850   -3.789  1.00 0.31  ? 13   LEU A HA   3  
ATOM   6601  H HB2  . LEU A 1 13  ? -7.026  6.118   -1.850  1.00 0.23  ? 13   LEU A HB2  3  
ATOM   6602  H HB3  . LEU A 1 13  ? -8.324  5.813   -2.986  1.00 0.27  ? 13   LEU A HB3  3  
ATOM   6603  H HG   . LEU A 1 13  ? -8.194  3.377   -2.046  1.00 0.29  ? 13   LEU A HG   3  
ATOM   6604  H HD11 . LEU A 1 13  ? -7.614  3.276   0.295   1.00 0.91  ? 13   LEU A HD11 3  
ATOM   6605  H HD12 . LEU A 1 13  ? -7.005  4.931   0.212   1.00 0.87  ? 13   LEU A HD12 3  
ATOM   6606  H HD13 . LEU A 1 13  ? -6.218  3.652   -0.719  1.00 0.89  ? 13   LEU A HD13 3  
ATOM   6607  H HD21 . LEU A 1 13  ? -9.879  3.893   -0.416  1.00 1.06  ? 13   LEU A HD21 3  
ATOM   6608  H HD22 . LEU A 1 13  ? -10.102 4.920   -1.834  1.00 1.03  ? 13   LEU A HD22 3  
ATOM   6609  H HD23 . LEU A 1 13  ? -9.366  5.581   -0.373  1.00 1.05  ? 13   LEU A HD23 3  
ATOM   6610  N N    . SER A 1 14  ? -5.689  6.824   -4.617  1.00 0.29  ? 14   SER A N    3  
ATOM   6611  C CA   . SER A 1 14  ? -5.507  7.729   -5.749  1.00 0.33  ? 14   SER A CA   3  
ATOM   6612  C C    . SER A 1 14  ? -4.836  6.990   -6.903  1.00 0.37  ? 14   SER A C    3  
ATOM   6613  O O    . SER A 1 14  ? -5.190  7.161   -8.071  1.00 0.42  ? 14   SER A O    3  
ATOM   6614  C CB   . SER A 1 14  ? -4.641  8.919   -5.335  1.00 0.33  ? 14   SER A CB   3  
ATOM   6615  O OG   . SER A 1 14  ? -5.105  9.496   -4.129  1.00 1.05  ? 14   SER A OG   3  
ATOM   6616  H H    . SER A 1 14  ? -5.226  7.016   -3.767  1.00 0.27  ? 14   SER A H    3  
ATOM   6617  H HA   . SER A 1 14  ? -6.476  8.082   -6.064  1.00 0.36  ? 14   SER A HA   3  
ATOM   6618  H HB2  . SER A 1 14  ? -3.625  8.586   -5.191  1.00 0.91  ? 14   SER A HB2  3  
ATOM   6619  H HB3  . SER A 1 14  ? -4.668  9.667   -6.114  1.00 0.81  ? 14   SER A HB3  3  
ATOM   6620  H HG   . SER A 1 14  ? -5.972  9.134   -3.913  1.00 1.60  ? 14   SER A HG   3  
ATOM   6621  N N    . TYR A 1 15  ? -3.883  6.139   -6.539  1.00 0.37  ? 15   TYR A N    3  
ATOM   6622  C CA   . TYR A 1 15  ? -3.110  5.351   -7.488  1.00 0.45  ? 15   TYR A CA   3  
ATOM   6623  C C    . TYR A 1 15  ? -4.009  4.371   -8.250  1.00 0.43  ? 15   TYR A C    3  
ATOM   6624  O O    . TYR A 1 15  ? -3.644  3.879   -9.320  1.00 0.55  ? 15   TYR A O    3  
ATOM   6625  C CB   . TYR A 1 15  ? -2.012  4.605   -6.710  1.00 0.52  ? 15   TYR A CB   3  
ATOM   6626  C CG   . TYR A 1 15  ? -1.009  3.855   -7.555  1.00 0.67  ? 15   TYR A CG   3  
ATOM   6627  C CD1  . TYR A 1 15  ? -0.438  4.434   -8.679  1.00 0.72  ? 15   TYR A CD1  3  
ATOM   6628  C CD2  . TYR A 1 15  ? -0.623  2.563   -7.215  1.00 0.89  ? 15   TYR A CD2  3  
ATOM   6629  C CE1  . TYR A 1 15  ? 0.484   3.747   -9.442  1.00 0.89  ? 15   TYR A CE1  3  
ATOM   6630  C CE2  . TYR A 1 15  ? 0.301   1.871   -7.972  1.00 1.06  ? 15   TYR A CE2  3  
ATOM   6631  C CZ   . TYR A 1 15  ? 0.852   2.467   -9.086  1.00 1.03  ? 15   TYR A CZ   3  
ATOM   6632  O OH   . TYR A 1 15  ? 1.768   1.779   -9.851  1.00 1.22  ? 15   TYR A OH   3  
ATOM   6633  H H    . TYR A 1 15  ? -3.683  6.045   -5.580  1.00 0.36  ? 15   TYR A H    3  
ATOM   6634  H HA   . TYR A 1 15  ? -2.648  6.027   -8.190  1.00 0.50  ? 15   TYR A HA   3  
ATOM   6635  H HB2  . TYR A 1 15  ? -1.463  5.319   -6.117  1.00 0.53  ? 15   TYR A HB2  3  
ATOM   6636  H HB3  . TYR A 1 15  ? -2.482  3.892   -6.049  1.00 0.52  ? 15   TYR A HB3  3  
ATOM   6637  H HD1  . TYR A 1 15  ? -0.726  5.438   -8.957  1.00 0.72  ? 15   TYR A HD1  3  
ATOM   6638  H HD2  . TYR A 1 15  ? -1.059  2.099   -6.341  1.00 0.98  ? 15   TYR A HD2  3  
ATOM   6639  H HE1  . TYR A 1 15  ? 0.916   4.214   -10.315 1.00 0.98  ? 15   TYR A HE1  3  
ATOM   6640  H HE2  . TYR A 1 15  ? 0.586   0.868   -7.690  1.00 1.26  ? 15   TYR A HE2  3  
ATOM   6641  H HH   . TYR A 1 15  ? 1.473   0.862   -9.954  1.00 1.49  ? 15   TYR A HH   3  
ATOM   6642  N N    . LYS A 1 16  ? -5.193  4.104   -7.704  1.00 0.33  ? 16   LYS A N    3  
ATOM   6643  C CA   . LYS A 1 16  ? -6.134  3.176   -8.322  1.00 0.33  ? 16   LYS A CA   3  
ATOM   6644  C C    . LYS A 1 16  ? -7.056  3.921   -9.261  1.00 0.33  ? 16   LYS A C    3  
ATOM   6645  O O    . LYS A 1 16  ? -7.203  3.565   -10.426 1.00 0.42  ? 16   LYS A O    3  
ATOM   6646  C CB   . LYS A 1 16  ? -6.957  2.456   -7.255  1.00 0.34  ? 16   LYS A CB   3  
ATOM   6647  C CG   . LYS A 1 16  ? -6.139  1.676   -6.234  1.00 0.61  ? 16   LYS A CG   3  
ATOM   6648  C CD   . LYS A 1 16  ? -5.311  0.571   -6.872  1.00 0.57  ? 16   LYS A CD   3  
ATOM   6649  C CE   . LYS A 1 16  ? -3.996  1.104   -7.415  1.00 1.18  ? 16   LYS A CE   3  
ATOM   6650  N NZ   . LYS A 1 16  ? -3.143  0.033   -7.970  1.00 1.41  ? 16   LYS A NZ   3  
ATOM   6651  H H    . LYS A 1 16  ? -5.450  4.558   -6.867  1.00 0.32  ? 16   LYS A H    3  
ATOM   6652  H HA   . LYS A 1 16  ? -5.579  2.453   -8.892  1.00 0.38  ? 16   LYS A HA   3  
ATOM   6653  H HB2  . LYS A 1 16  ? -7.548  3.193   -6.721  1.00 0.62  ? 16   LYS A HB2  3  
ATOM   6654  H HB3  . LYS A 1 16  ? -7.624  1.766   -7.746  1.00 0.63  ? 16   LYS A HB3  3  
ATOM   6655  H HG2  . LYS A 1 16  ? -5.472  2.359   -5.732  1.00 0.97  ? 16   LYS A HG2  3  
ATOM   6656  H HG3  . LYS A 1 16  ? -6.812  1.236   -5.512  1.00 0.99  ? 16   LYS A HG3  3  
ATOM   6657  H HD2  . LYS A 1 16  ? -5.104  -0.186  -6.131  1.00 0.75  ? 16   LYS A HD2  3  
ATOM   6658  H HD3  . LYS A 1 16  ? -5.875  0.137   -7.685  1.00 0.97  ? 16   LYS A HD3  3  
ATOM   6659  H HE2  . LYS A 1 16  ? -4.201  1.813   -8.193  1.00 1.56  ? 16   LYS A HE2  3  
ATOM   6660  H HE3  . LYS A 1 16  ? -3.477  1.603   -6.616  1.00 1.44  ? 16   LYS A HE3  3  
ATOM   6661  H HZ1  . LYS A 1 16  ? -3.664  -0.499  -8.699  1.00 1.70  ? 16   LYS A HZ1  3  
ATOM   6662  H HZ2  . LYS A 1 16  ? -2.855  -0.635  -7.218  1.00 1.51  ? 16   LYS A HZ2  3  
ATOM   6663  H HZ3  . LYS A 1 16  ? -2.288  0.441   -8.406  1.00 1.84  ? 16   LYS A HZ3  3  
ATOM   6664  N N    . LEU A 1 17  ? -7.666  4.954   -8.726  1.00 0.33  ? 17   LEU A N    3  
ATOM   6665  C CA   . LEU A 1 17  ? -8.560  5.824   -9.475  1.00 0.32  ? 17   LEU A CA   3  
ATOM   6666  C C    . LEU A 1 17  ? -7.873  6.397   -10.713 1.00 0.35  ? 17   LEU A C    3  
ATOM   6667  O O    . LEU A 1 17  ? -8.514  6.632   -11.738 1.00 0.36  ? 17   LEU A O    3  
ATOM   6668  C CB   . LEU A 1 17  ? -9.014  6.931   -8.543  1.00 0.35  ? 17   LEU A CB   3  
ATOM   6669  C CG   . LEU A 1 17  ? -9.649  6.396   -7.270  1.00 0.53  ? 17   LEU A CG   3  
ATOM   6670  C CD1  . LEU A 1 17  ? -9.601  7.415   -6.159  1.00 1.35  ? 17   LEU A CD1  3  
ATOM   6671  C CD2  . LEU A 1 17  ? -11.070 5.956   -7.546  1.00 1.15  ? 17   LEU A CD2  3  
ATOM   6672  H H    . LEU A 1 17  ? -7.525  5.135   -7.770  1.00 0.38  ? 17   LEU A H    3  
ATOM   6673  H HA   . LEU A 1 17  ? -9.425  5.245   -9.777  1.00 0.31  ? 17   LEU A HA   3  
ATOM   6674  H HB2  . LEU A 1 17  ? -8.158  7.538   -8.282  1.00 0.33  ? 17   LEU A HB2  3  
ATOM   6675  H HB3  . LEU A 1 17  ? -9.738  7.545   -9.057  1.00 0.43  ? 17   LEU A HB3  3  
ATOM   6676  H HG   . LEU A 1 17  ? -9.095  5.529   -6.943  1.00 1.53  ? 17   LEU A HG   3  
ATOM   6677  H HD11 . LEU A 1 17  ? -8.567  7.576   -5.876  1.00 1.98  ? 17   LEU A HD11 3  
ATOM   6678  H HD12 . LEU A 1 17  ? -10.155 7.037   -5.309  1.00 1.90  ? 17   LEU A HD12 3  
ATOM   6679  H HD13 . LEU A 1 17  ? -10.035 8.343   -6.496  1.00 1.88  ? 17   LEU A HD13 3  
ATOM   6680  H HD21 . LEU A 1 17  ? -11.514 5.585   -6.633  1.00 1.75  ? 17   LEU A HD21 3  
ATOM   6681  H HD22 . LEU A 1 17  ? -11.056 5.170   -8.286  1.00 1.77  ? 17   LEU A HD22 3  
ATOM   6682  H HD23 . LEU A 1 17  ? -11.643 6.793   -7.914  1.00 1.74  ? 17   LEU A HD23 3  
ATOM   6683  N N    . SER A 1 18  ? -6.565  6.598   -10.611 1.00 0.41  ? 18   SER A N    3  
ATOM   6684  C CA   . SER A 1 18  ? -5.761  7.099   -11.720 1.00 0.48  ? 18   SER A CA   3  
ATOM   6685  C C    . SER A 1 18  ? -5.817  6.155   -12.932 1.00 0.51  ? 18   SER A C    3  
ATOM   6686  O O    . SER A 1 18  ? -5.756  6.603   -14.079 1.00 0.58  ? 18   SER A O    3  
ATOM   6687  C CB   . SER A 1 18  ? -4.311  7.297   -11.256 1.00 0.57  ? 18   SER A CB   3  
ATOM   6688  O OG   . SER A 1 18  ? -3.513  7.885   -12.268 1.00 0.94  ? 18   SER A OG   3  
ATOM   6689  H H    . SER A 1 18  ? -6.126  6.424   -9.748  1.00 0.41  ? 18   SER A H    3  
ATOM   6690  H HA   . SER A 1 18  ? -6.166  8.057   -12.012 1.00 0.51  ? 18   SER A HA   3  
ATOM   6691  H HB2  . SER A 1 18  ? -4.300  7.943   -10.392 1.00 0.86  ? 18   SER A HB2  3  
ATOM   6692  H HB3  . SER A 1 18  ? -3.889  6.340   -10.992 1.00 0.69  ? 18   SER A HB3  3  
ATOM   6693  H HG   . SER A 1 18  ? -3.153  8.726   -11.945 1.00 1.38  ? 18   SER A HG   3  
ATOM   6694  N N    . GLN A 1 19  ? -5.970  4.854   -12.680 1.00 0.52  ? 19   GLN A N    3  
ATOM   6695  C CA   . GLN A 1 19  ? -5.994  3.856   -13.756 1.00 0.57  ? 19   GLN A CA   3  
ATOM   6696  C C    . GLN A 1 19  ? -7.320  3.892   -14.480 1.00 0.51  ? 19   GLN A C    3  
ATOM   6697  O O    . GLN A 1 19  ? -7.450  3.441   -15.617 1.00 0.59  ? 19   GLN A O    3  
ATOM   6698  C CB   . GLN A 1 19  ? -5.798  2.450   -13.202 1.00 0.68  ? 19   GLN A CB   3  
ATOM   6699  C CG   . GLN A 1 19  ? -4.854  2.377   -12.027 1.00 0.84  ? 19   GLN A CG   3  
ATOM   6700  C CD   . GLN A 1 19  ? -4.708  0.964   -11.505 1.00 0.97  ? 19   GLN A CD   3  
ATOM   6701  O OE1  . GLN A 1 19  ? -3.814  0.223   -11.915 1.00 1.37  ? 19   GLN A OE1  3  
ATOM   6702  N NE2  . GLN A 1 19  ? -5.608  0.569   -10.620 1.00 1.19  ? 19   GLN A NE2  3  
ATOM   6703  H H    . GLN A 1 19  ? -6.077  4.556   -11.751 1.00 0.53  ? 19   GLN A H    3  
ATOM   6704  H HA   . GLN A 1 19  ? -5.210  4.084   -14.447 1.00 0.66  ? 19   GLN A HA   3  
ATOM   6705  H HB2  . GLN A 1 19  ? -6.755  2.063   -12.889 1.00 0.89  ? 19   GLN A HB2  3  
ATOM   6706  H HB3  . GLN A 1 19  ? -5.406  1.821   -13.986 1.00 0.96  ? 19   GLN A HB3  3  
ATOM   6707  H HG2  . GLN A 1 19  ? -3.890  2.744   -12.335 1.00 1.09  ? 19   GLN A HG2  3  
ATOM   6708  H HG3  . GLN A 1 19  ? -5.240  3.001   -11.234 1.00 1.03  ? 19   GLN A HG3  3  
ATOM   6709  H HE21 . GLN A 1 19  ? -6.312  1.202   -10.358 1.00 1.51  ? 19   GLN A HE21 3  
ATOM   6710  H HE22 . GLN A 1 19  ? -5.540  -0.345  -10.265 1.00 1.29  ? 19   GLN A HE22 3  
ATOM   6711  N N    . LYS A 1 20  ? -8.296  4.426   -13.788 1.00 0.45  ? 20   LYS A N    3  
ATOM   6712  C CA   . LYS A 1 20  ? -9.660  4.451   -14.251 1.00 0.49  ? 20   LYS A CA   3  
ATOM   6713  C C    . LYS A 1 20  ? -9.925  5.789   -14.904 1.00 0.48  ? 20   LYS A C    3  
ATOM   6714  O O    . LYS A 1 20  ? -10.790 5.936   -15.765 1.00 0.53  ? 20   LYS A O    3  
ATOM   6715  C CB   . LYS A 1 20  ? -10.591 4.262   -13.063 1.00 0.57  ? 20   LYS A CB   3  
ATOM   6716  C CG   . LYS A 1 20  ? -9.980  3.478   -11.911 1.00 0.49  ? 20   LYS A CG   3  
ATOM   6717  C CD   . LYS A 1 20  ? -9.679  2.030   -12.277 1.00 1.20  ? 20   LYS A CD   3  
ATOM   6718  C CE   . LYS A 1 20  ? -10.916 1.318   -12.803 1.00 1.75  ? 20   LYS A CE   3  
ATOM   6719  N NZ   . LYS A 1 20  ? -10.722 -0.152  -12.900 1.00 2.20  ? 20   LYS A NZ   3  
ATOM   6720  H H    . LYS A 1 20  ? -8.085  4.837   -12.933 1.00 0.45  ? 20   LYS A H    3  
ATOM   6721  H HA   . LYS A 1 20  ? -9.805  3.656   -14.966 1.00 0.54  ? 20   LYS A HA   3  
ATOM   6722  H HB2  . LYS A 1 20  ? -10.890 5.231   -12.692 1.00 0.67  ? 20   LYS A HB2  3  
ATOM   6723  H HB3  . LYS A 1 20  ? -11.457 3.737   -13.396 1.00 0.70  ? 20   LYS A HB3  3  
ATOM   6724  H HG2  . LYS A 1 20  ? -9.058  3.956   -11.620 1.00 1.16  ? 20   LYS A HG2  3  
ATOM   6725  H HG3  . LYS A 1 20  ? -10.664 3.495   -11.080 1.00 1.06  ? 20   LYS A HG3  3  
ATOM   6726  H HD2  . LYS A 1 20  ? -8.911  2.013   -13.038 1.00 1.65  ? 20   LYS A HD2  3  
ATOM   6727  H HD3  . LYS A 1 20  ? -9.326  1.516   -11.391 1.00 1.68  ? 20   LYS A HD3  3  
ATOM   6728  H HE2  . LYS A 1 20  ? -11.740 1.520   -12.134 1.00 2.01  ? 20   LYS A HE2  3  
ATOM   6729  H HE3  . LYS A 1 20  ? -11.146 1.710   -13.782 1.00 1.68  ? 20   LYS A HE3  3  
ATOM   6730  H HZ1  . LYS A 1 20  ? -11.606 -0.611  -13.213 1.00 2.49  ? 20   LYS A HZ1  3  
ATOM   6731  H HZ2  . LYS A 1 20  ? -10.457 -0.543  -11.968 1.00 2.36  ? 20   LYS A HZ2  3  
ATOM   6732  H HZ3  . LYS A 1 20  ? -9.970  -0.374  -13.585 1.00 2.65  ? 20   LYS A HZ3  3  
ATOM   6733  N N    . GLY A 1 21  ? -9.163  6.760   -14.450 1.00 0.45  ? 21   GLY A N    3  
ATOM   6734  C CA   . GLY A 1 21  ? -9.223  8.087   -14.997 1.00 0.49  ? 21   GLY A CA   3  
ATOM   6735  C C    . GLY A 1 21  ? -10.028 9.023   -14.124 1.00 0.47  ? 21   GLY A C    3  
ATOM   6736  O O    . GLY A 1 21  ? -10.491 10.070  -14.578 1.00 0.53  ? 21   GLY A O    3  
ATOM   6737  H H    . GLY A 1 21  ? -8.551  6.568   -13.708 1.00 0.44  ? 21   GLY A H    3  
ATOM   6738  H HA2  . GLY A 1 21  ? -8.216  8.461   -15.078 1.00 0.52  ? 21   GLY A HA2  3  
ATOM   6739  H HA3  . GLY A 1 21  ? -9.669  8.047   -15.980 1.00 0.54  ? 21   GLY A HA3  3  
ATOM   6740  N N    . TYR A 1 22  ? -10.198 8.638   -12.868 1.00 0.40  ? 22   TYR A N    3  
ATOM   6741  C CA   . TYR A 1 22  ? -10.912 9.462   -11.906 1.00 0.37  ? 22   TYR A CA   3  
ATOM   6742  C C    . TYR A 1 22  ? -9.933  10.223  -11.035 1.00 0.36  ? 22   TYR A C    3  
ATOM   6743  O O    . TYR A 1 22  ? -8.792  9.799   -10.852 1.00 0.38  ? 22   TYR A O    3  
ATOM   6744  C CB   . TYR A 1 22  ? -11.809 8.618   -11.002 1.00 0.34  ? 22   TYR A CB   3  
ATOM   6745  C CG   . TYR A 1 22  ? -13.001 7.994   -11.697 1.00 0.38  ? 22   TYR A CG   3  
ATOM   6746  C CD1  . TYR A 1 22  ? -12.832 6.942   -12.589 1.00 0.50  ? 22   TYR A CD1  3  
ATOM   6747  C CD2  . TYR A 1 22  ? -14.290 8.464   -11.476 1.00 0.50  ? 22   TYR A CD2  3  
ATOM   6748  C CE1  . TYR A 1 22  ? -13.911 6.376   -13.238 1.00 0.60  ? 22   TYR A CE1  3  
ATOM   6749  C CE2  . TYR A 1 22  ? -15.374 7.904   -12.122 1.00 0.62  ? 22   TYR A CE2  3  
ATOM   6750  C CZ   . TYR A 1 22  ? -15.198 6.837   -12.948 1.00 0.62  ? 22   TYR A CZ   3  
ATOM   6751  O OH   . TYR A 1 22  ? -16.256 6.305   -13.653 1.00 0.76  ? 22   TYR A OH   3  
ATOM   6752  H H    . TYR A 1 22  ? -9.820  7.782   -12.575 1.00 0.40  ? 22   TYR A H    3  
ATOM   6753  H HA   . TYR A 1 22  ? -11.521 10.165  -12.452 1.00 0.42  ? 22   TYR A HA   3  
ATOM   6754  H HB2  . TYR A 1 22  ? -11.224 7.815   -10.569 1.00 0.37  ? 22   TYR A HB2  3  
ATOM   6755  H HB3  . TYR A 1 22  ? -12.179 9.254   -10.207 1.00 0.32  ? 22   TYR A HB3  3  
ATOM   6756  H HD1  . TYR A 1 22  ? -11.837 6.565   -12.773 1.00 0.61  ? 22   TYR A HD1  3  
ATOM   6757  H HD2  . TYR A 1 22  ? -14.439 9.282   -10.786 1.00 0.60  ? 22   TYR A HD2  3  
ATOM   6758  H HE1  . TYR A 1 22  ? -13.759 5.558   -13.926 1.00 0.74  ? 22   TYR A HE1  3  
ATOM   6759  H HE2  . TYR A 1 22  ? -16.367 8.283   -11.938 1.00 0.78  ? 22   TYR A HE2  3  
ATOM   6760  H HH   . TYR A 1 22  ? -16.127 5.347   -13.726 1.00 1.12  ? 22   TYR A HH   3  
ATOM   6761  N N    . SER A 1 23  ? -10.382 11.342  -10.503 1.00 0.37  ? 23   SER A N    3  
ATOM   6762  C CA   . SER A 1 23  ? -9.586  12.112  -9.577  1.00 0.39  ? 23   SER A CA   3  
ATOM   6763  C C    . SER A 1 23  ? -9.900  11.682  -8.158  1.00 0.35  ? 23   SER A C    3  
ATOM   6764  O O    . SER A 1 23  ? -11.050 11.389  -7.833  1.00 0.34  ? 23   SER A O    3  
ATOM   6765  C CB   . SER A 1 23  ? -9.905  13.590  -9.729  1.00 0.45  ? 23   SER A CB   3  
ATOM   6766  O OG   . SER A 1 23  ? -8.839  14.406  -9.274  1.00 0.52  ? 23   SER A OG   3  
ATOM   6767  H H    . SER A 1 23  ? -11.278 11.667  -10.744 1.00 0.39  ? 23   SER A H    3  
ATOM   6768  H HA   . SER A 1 23  ? -8.542  11.941  -9.788  1.00 0.43  ? 23   SER A HA   3  
ATOM   6769  H HB2  . SER A 1 23  ? -10.104 13.803  -10.761 1.00 0.48  ? 23   SER A HB2  3  
ATOM   6770  H HB3  . SER A 1 23  ? -10.782 13.817  -9.144  1.00 0.45  ? 23   SER A HB3  3  
ATOM   6771  H HG   . SER A 1 23  ? -8.040  14.213  -9.798  1.00 0.75  ? 23   SER A HG   3  
ATOM   6772  N N    . TRP A 1 24  ? -8.887  11.652  -7.320  1.00 0.37  ? 24   TRP A N    3  
ATOM   6773  C CA   . TRP A 1 24  ? -9.085  11.338  -5.921  1.00 0.36  ? 24   TRP A CA   3  
ATOM   6774  C C    . TRP A 1 24  ? -9.717  12.526  -5.216  1.00 0.35  ? 24   TRP A C    3  
ATOM   6775  O O    . TRP A 1 24  ? -10.721 12.382  -4.524  1.00 0.34  ? 24   TRP A O    3  
ATOM   6776  C CB   . TRP A 1 24  ? -7.761  10.967  -5.254  1.00 0.45  ? 24   TRP A CB   3  
ATOM   6777  C CG   . TRP A 1 24  ? -7.821  11.018  -3.758  1.00 0.43  ? 24   TRP A CG   3  
ATOM   6778  C CD1  . TRP A 1 24  ? -7.382  12.029  -2.953  1.00 0.96  ? 24   TRP A CD1  3  
ATOM   6779  C CD2  . TRP A 1 24  ? -8.361  10.021  -2.892  1.00 1.27  ? 24   TRP A CD2  3  
ATOM   6780  N NE1  . TRP A 1 24  ? -7.624  11.720  -1.639  1.00 0.61  ? 24   TRP A NE1  3  
ATOM   6781  C CE2  . TRP A 1 24  ? -8.222  10.492  -1.576  1.00 1.10  ? 24   TRP A CE2  3  
ATOM   6782  C CE3  . TRP A 1 24  ? -8.950  8.777   -3.102  1.00 2.43  ? 24   TRP A CE3  3  
ATOM   6783  C CZ2  . TRP A 1 24  ? -8.654  9.760   -0.478  1.00 2.00  ? 24   TRP A CZ2  3  
ATOM   6784  C CZ3  . TRP A 1 24  ? -9.377  8.054   -2.010  1.00 3.36  ? 24   TRP A CZ3  3  
ATOM   6785  C CH2  . TRP A 1 24  ? -9.228  8.546   -0.715  1.00 3.13  ? 24   TRP A CH2  3  
ATOM   6786  H H    . TRP A 1 24  ? -7.986  11.862  -7.645  1.00 0.43  ? 24   TRP A H    3  
ATOM   6787  H HA   . TRP A 1 24  ? -9.761  10.497  -5.863  1.00 0.34  ? 24   TRP A HA   3  
ATOM   6788  H HB2  . TRP A 1 24  ? -7.489  9.963   -5.542  1.00 0.57  ? 24   TRP A HB2  3  
ATOM   6789  H HB3  . TRP A 1 24  ? -6.995  11.650  -5.584  1.00 0.57  ? 24   TRP A HB3  3  
ATOM   6790  H HD1  . TRP A 1 24  ? -6.917  12.934  -3.312  1.00 1.86  ? 24   TRP A HD1  3  
ATOM   6791  H HE1  . TRP A 1 24  ? -7.398  12.286  -0.870  1.00 0.92  ? 24   TRP A HE1  3  
ATOM   6792  H HE3  . TRP A 1 24  ? -9.075  8.379   -4.099  1.00 2.64  ? 24   TRP A HE3  3  
ATOM   6793  H HZ2  . TRP A 1 24  ? -8.547  10.127  0.532   1.00 1.86  ? 24   TRP A HZ2  3  
ATOM   6794  H HZ3  . TRP A 1 24  ? -9.834  7.087   -2.153  1.00 4.29  ? 24   TRP A HZ3  3  
ATOM   6795  H HH2  . TRP A 1 24  ? -9.576  7.943   0.110   1.00 3.88  ? 24   TRP A HH2  3  
ATOM   6796  N N    . SER A 1 25  ? -9.134  13.699  -5.427  1.00 0.39  ? 25   SER A N    3  
ATOM   6797  C CA   . SER A 1 25  ? -9.576  14.913  -4.756  1.00 0.44  ? 25   SER A CA   3  
ATOM   6798  C C    . SER A 1 25  ? -11.040 15.224  -5.057  1.00 0.43  ? 25   SER A C    3  
ATOM   6799  O O    . SER A 1 25  ? -11.766 15.690  -4.181  1.00 0.49  ? 25   SER A O    3  
ATOM   6800  C CB   . SER A 1 25  ? -8.690  16.087  -5.159  1.00 0.53  ? 25   SER A CB   3  
ATOM   6801  O OG   . SER A 1 25  ? -7.334  15.848  -4.811  1.00 1.37  ? 25   SER A OG   3  
ATOM   6802  H H    . SER A 1 25  ? -8.375  13.750  -6.051  1.00 0.42  ? 25   SER A H    3  
ATOM   6803  H HA   . SER A 1 25  ? -9.473  14.751  -3.693  1.00 0.46  ? 25   SER A HA   3  
ATOM   6804  H HB2  . SER A 1 25  ? -8.754  16.235  -6.227  1.00 1.05  ? 25   SER A HB2  3  
ATOM   6805  H HB3  . SER A 1 25  ? -9.027  16.979  -4.651  1.00 1.16  ? 25   SER A HB3  3  
ATOM   6806  H HG   . SER A 1 25  ? -7.092  16.424  -4.064  1.00 1.86  ? 25   SER A HG   3  
ATOM   6807  N N    . GLN A 1 26  ? -11.483 14.939  -6.281  1.00 0.40  ? 26   GLN A N    3  
ATOM   6808  C CA   . GLN A 1 26  ? -12.862 15.224  -6.672  1.00 0.42  ? 26   GLN A CA   3  
ATOM   6809  C C    . GLN A 1 26  ? -13.868 14.450  -5.823  1.00 0.38  ? 26   GLN A C    3  
ATOM   6810  O O    . GLN A 1 26  ? -15.016 14.864  -5.670  1.00 0.41  ? 26   GLN A O    3  
ATOM   6811  C CB   . GLN A 1 26  ? -13.082 14.900  -8.144  1.00 0.47  ? 26   GLN A CB   3  
ATOM   6812  C CG   . GLN A 1 26  ? -12.346 15.839  -9.073  1.00 0.59  ? 26   GLN A CG   3  
ATOM   6813  C CD   . GLN A 1 26  ? -12.689 15.612  -10.531 1.00 0.73  ? 26   GLN A CD   3  
ATOM   6814  O OE1  . GLN A 1 26  ? -13.036 14.502  -10.934 1.00 1.11  ? 26   GLN A OE1  3  
ATOM   6815  N NE2  . GLN A 1 26  ? -12.585 16.657  -11.333 1.00 1.10  ? 26   GLN A NE2  3  
ATOM   6816  H H    . GLN A 1 26  ? -10.870 14.535  -6.935  1.00 0.39  ? 26   GLN A H    3  
ATOM   6817  H HA   . GLN A 1 26  ? -13.024 16.280  -6.528  1.00 0.50  ? 26   GLN A HA   3  
ATOM   6818  H HB2  . GLN A 1 26  ? -12.736 13.896  -8.334  1.00 0.43  ? 26   GLN A HB2  3  
ATOM   6819  H HB3  . GLN A 1 26  ? -14.135 14.957  -8.361  1.00 0.53  ? 26   GLN A HB3  3  
ATOM   6820  H HG2  . GLN A 1 26  ? -12.601 16.855  -8.814  1.00 0.70  ? 26   GLN A HG2  3  
ATOM   6821  H HG3  . GLN A 1 26  ? -11.287 15.689  -8.939  1.00 0.53  ? 26   GLN A HG3  3  
ATOM   6822  H HE21 . GLN A 1 26  ? -12.295 17.517  -10.943 1.00 1.52  ? 26   GLN A HE21 3  
ATOM   6823  H HE22 . GLN A 1 26  ? -12.794 16.536  -12.287 1.00 1.17  ? 26   GLN A HE22 3  
ATOM   6824  N N    . PHE A 1 27  ? -13.437 13.319  -5.286  1.00 0.35  ? 27   PHE A N    3  
ATOM   6825  C CA   . PHE A 1 27  ? -14.307 12.474  -4.486  1.00 0.38  ? 27   PHE A CA   3  
ATOM   6826  C C    . PHE A 1 27  ? -13.755 12.305  -3.075  1.00 0.43  ? 27   PHE A C    3  
ATOM   6827  O O    . PHE A 1 27  ? -14.143 11.385  -2.357  1.00 0.67  ? 27   PHE A O    3  
ATOM   6828  C CB   . PHE A 1 27  ? -14.441 11.101  -5.145  1.00 0.43  ? 27   PHE A CB   3  
ATOM   6829  C CG   . PHE A 1 27  ? -14.855 11.161  -6.584  1.00 0.67  ? 27   PHE A CG   3  
ATOM   6830  C CD1  . PHE A 1 27  ? -16.087 11.677  -6.946  1.00 0.85  ? 27   PHE A CD1  3  
ATOM   6831  C CD2  . PHE A 1 27  ? -14.003 10.712  -7.578  1.00 0.94  ? 27   PHE A CD2  3  
ATOM   6832  C CE1  . PHE A 1 27  ? -16.462 11.741  -8.273  1.00 1.16  ? 27   PHE A CE1  3  
ATOM   6833  C CE2  . PHE A 1 27  ? -14.371 10.774  -8.906  1.00 1.20  ? 27   PHE A CE2  3  
ATOM   6834  C CZ   . PHE A 1 27  ? -15.603 11.288  -9.255  1.00 1.28  ? 27   PHE A CZ   3  
ATOM   6835  H H    . PHE A 1 27  ? -12.512 13.040  -5.439  1.00 0.34  ? 27   PHE A H    3  
ATOM   6836  H HA   . PHE A 1 27  ? -15.279 12.939  -4.434  1.00 0.42  ? 27   PHE A HA   3  
ATOM   6837  H HB2  . PHE A 1 27  ? -13.490 10.591  -5.095  1.00 0.52  ? 27   PHE A HB2  3  
ATOM   6838  H HB3  . PHE A 1 27  ? -15.176 10.526  -4.610  1.00 0.39  ? 27   PHE A HB3  3  
ATOM   6839  H HD1  . PHE A 1 27  ? -16.761 12.032  -6.178  1.00 0.88  ? 27   PHE A HD1  3  
ATOM   6840  H HD2  . PHE A 1 27  ? -13.040 10.307  -7.306  1.00 1.05  ? 27   PHE A HD2  3  
ATOM   6841  H HE1  . PHE A 1 27  ? -17.427 12.145  -8.544  1.00 1.39  ? 27   PHE A HE1  3  
ATOM   6842  H HE2  . PHE A 1 27  ? -13.697 10.419  -9.671  1.00 1.44  ? 27   PHE A HE2  3  
ATOM   6843  H HZ   . PHE A 1 27  ? -15.894 11.338  -10.293 1.00 1.53  ? 27   PHE A HZ   3  
ATOM   6844  N N    . SER A 1 28  ? -12.866 13.200  -2.670  1.00 0.39  ? 28   SER A N    3  
ATOM   6845  C CA   . SER A 1 28  ? -12.158 13.031  -1.413  1.00 0.42  ? 28   SER A CA   3  
ATOM   6846  C C    . SER A 1 28  ? -12.758 13.877  -0.300  1.00 0.58  ? 28   SER A C    3  
ATOM   6847  O O    . SER A 1 28  ? -13.756 14.570  -0.484  1.00 1.01  ? 28   SER A O    3  
ATOM   6848  C CB   . SER A 1 28  ? -10.673 13.357  -1.572  1.00 0.62  ? 28   SER A CB   3  
ATOM   6849  O OG   . SER A 1 28  ? -10.447 14.758  -1.621  1.00 1.81  ? 28   SER A OG   3  
ATOM   6850  H H    . SER A 1 28  ? -12.689 13.991  -3.223  1.00 0.51  ? 28   SER A H    3  
ATOM   6851  H HA   . SER A 1 28  ? -12.251 11.994  -1.126  1.00 0.57  ? 28   SER A HA   3  
ATOM   6852  H HB2  . SER A 1 28  ? -10.126 12.940  -0.735  1.00 0.85  ? 28   SER A HB2  3  
ATOM   6853  H HB3  . SER A 1 28  ? -10.309 12.917  -2.491  1.00 1.08  ? 28   SER A HB3  3  
ATOM   6854  H HG   . SER A 1 28  ? -11.206 15.199  -2.031  1.00 2.04  ? 28   SER A HG   3  
ATOM   6855  N N    . ASP A 1 29  ? -12.133 13.776  0.860   1.00 0.63  ? 29   ASP A N    3  
ATOM   6856  C CA   . ASP A 1 29  ? -12.557 14.481  2.060   1.00 0.84  ? 29   ASP A CA   3  
ATOM   6857  C C    . ASP A 1 29  ? -11.396 14.513  3.051   1.00 0.88  ? 29   ASP A C    3  
ATOM   6858  O O    . ASP A 1 29  ? -11.287 15.415  3.880   1.00 1.03  ? 29   ASP A O    3  
ATOM   6859  C CB   . ASP A 1 29  ? -13.774 13.772  2.662   1.00 1.04  ? 29   ASP A CB   3  
ATOM   6860  C CG   . ASP A 1 29  ? -14.179 14.296  4.028   1.00 1.69  ? 29   ASP A CG   3  
ATOM   6861  O OD1  . ASP A 1 29  ? -13.609 13.845  5.042   1.00 2.31  ? 29   ASP A OD1  3  
ATOM   6862  O OD2  . ASP A 1 29  ? -15.089 15.146  4.100   1.00 1.85  ? 29   ASP A OD2  3  
ATOM   6863  H H    . ASP A 1 29  ? -11.349 13.203  0.913   1.00 0.79  ? 29   ASP A H    3  
ATOM   6864  H HA   . ASP A 1 29  ? -12.824 15.492  1.787   1.00 0.91  ? 29   ASP A HA   3  
ATOM   6865  H HB2  . ASP A 1 29  ? -14.609 13.900  1.991   1.00 1.07  ? 29   ASP A HB2  3  
ATOM   6866  H HB3  . ASP A 1 29  ? -13.553 12.718  2.749   1.00 1.38  ? 29   ASP A HB3  3  
ATOM   6867  N N    . VAL A 1 30  ? -10.503 13.539  2.880   1.00 0.80  ? 30   VAL A N    3  
ATOM   6868  C CA   . VAL A 1 30  ? -9.358  13.307  3.759   1.00 0.82  ? 30   VAL A CA   3  
ATOM   6869  C C    . VAL A 1 30  ? -8.487  14.555  3.943   1.00 0.82  ? 30   VAL A C    3  
ATOM   6870  O O    . VAL A 1 30  ? -8.502  15.178  5.002   1.00 0.92  ? 30   VAL A O    3  
ATOM   6871  C CB   . VAL A 1 30  ? -8.497  12.151  3.184   1.00 0.81  ? 30   VAL A CB   3  
ATOM   6872  C CG1  . VAL A 1 30  ? -9.140  10.811  3.475   1.00 0.89  ? 30   VAL A CG1  3  
ATOM   6873  C CG2  . VAL A 1 30  ? -8.324  12.305  1.678   1.00 0.76  ? 30   VAL A CG2  3  
ATOM   6874  H H    . VAL A 1 30  ? -10.626 12.938  2.126   1.00 0.76  ? 30   VAL A H    3  
ATOM   6875  H HA   . VAL A 1 30  ? -9.733  12.997  4.721   1.00 0.90  ? 30   VAL A HA   3  
ATOM   6876  H HB   . VAL A 1 30  ? -7.523  12.177  3.647   1.00 0.84  ? 30   VAL A HB   3  
ATOM   6877  H HG11 . VAL A 1 30  ? -10.092 10.759  2.966   1.00 1.41  ? 30   VAL A HG11 3  
ATOM   6878  H HG12 . VAL A 1 30  ? -9.290  10.704  4.538   1.00 1.34  ? 30   VAL A HG12 3  
ATOM   6879  H HG13 . VAL A 1 30  ? -8.498  10.020  3.117   1.00 1.34  ? 30   VAL A HG13 3  
ATOM   6880  H HG21 . VAL A 1 30  ? -8.015  11.361  1.254   1.00 1.12  ? 30   VAL A HG21 3  
ATOM   6881  H HG22 . VAL A 1 30  ? -7.573  13.050  1.474   1.00 1.29  ? 30   VAL A HG22 3  
ATOM   6882  H HG23 . VAL A 1 30  ? -9.265  12.609  1.238   1.00 1.35  ? 30   VAL A HG23 3  
ATOM   6883  N N    . GLU A 1 31  ? -7.746  14.918  2.908   1.00 0.78  ? 31   GLU A N    3  
ATOM   6884  C CA   . GLU A 1 31  ? -6.895  16.094  2.942   1.00 0.83  ? 31   GLU A CA   3  
ATOM   6885  C C    . GLU A 1 31  ? -7.697  17.285  2.465   1.00 0.88  ? 31   GLU A C    3  
ATOM   6886  O O    . GLU A 1 31  ? -7.230  18.422  2.471   1.00 0.98  ? 31   GLU A O    3  
ATOM   6887  C CB   . GLU A 1 31  ? -5.682  15.892  2.035   1.00 0.93  ? 31   GLU A CB   3  
ATOM   6888  C CG   . GLU A 1 31  ? -4.862  14.658  2.365   1.00 1.05  ? 31   GLU A CG   3  
ATOM   6889  C CD   . GLU A 1 31  ? -3.792  14.389  1.328   1.00 2.05  ? 31   GLU A CD   3  
ATOM   6890  O OE1  . GLU A 1 31  ? -2.716  15.016  1.406   1.00 2.46  ? 31   GLU A OE1  3  
ATOM   6891  O OE2  . GLU A 1 31  ? -4.015  13.533  0.446   1.00 2.74  ? 31   GLU A OE2  3  
ATOM   6892  H H    . GLU A 1 31  ? -7.771  14.383  2.095   1.00 0.75  ? 31   GLU A H    3  
ATOM   6893  H HA   . GLU A 1 31  ? -6.570  16.259  3.959   1.00 0.84  ? 31   GLU A HA   3  
ATOM   6894  H HB2  . GLU A 1 31  ? -6.023  15.807  1.013   1.00 1.51  ? 31   GLU A HB2  3  
ATOM   6895  H HB3  . GLU A 1 31  ? -5.038  16.757  2.117   1.00 1.30  ? 31   GLU A HB3  3  
ATOM   6896  H HG2  . GLU A 1 31  ? -4.387  14.801  3.324   1.00 1.41  ? 31   GLU A HG2  3  
ATOM   6897  H HG3  . GLU A 1 31  ? -5.521  13.804  2.412   1.00 1.38  ? 31   GLU A HG3  3  
ATOM   6898  N N    . GLU A 1 32  ? -8.919  16.992  2.051   1.00 0.87  ? 32   GLU A N    3  
ATOM   6899  C CA   . GLU A 1 32  ? -9.797  17.984  1.479   1.00 0.98  ? 32   GLU A CA   3  
ATOM   6900  C C    . GLU A 1 32  ? -10.310 18.944  2.542   1.00 1.09  ? 32   GLU A C    3  
ATOM   6901  O O    . GLU A 1 32  ? -10.187 20.158  2.405   1.00 1.24  ? 32   GLU A O    3  
ATOM   6902  C CB   . GLU A 1 32  ? -10.962 17.300  0.762   1.00 0.98  ? 32   GLU A CB   3  
ATOM   6903  C CG   . GLU A 1 32  ? -12.013 18.273  0.255   1.00 1.12  ? 32   GLU A CG   3  
ATOM   6904  C CD   . GLU A 1 32  ? -12.938 17.660  -0.770  1.00 1.20  ? 32   GLU A CD   3  
ATOM   6905  O OE1  . GLU A 1 32  ? -12.436 17.065  -1.746  1.00 1.45  ? 32   GLU A OE1  3  
ATOM   6906  O OE2  . GLU A 1 32  ? -14.169 17.748  -0.591  1.00 1.17  ? 32   GLU A OE2  3  
ATOM   6907  H H    . GLU A 1 32  ? -9.239  16.074  2.142   1.00 0.81  ? 32   GLU A H    3  
ATOM   6908  H HA   . GLU A 1 32  ? -9.227  18.538  0.755   1.00 1.06  ? 32   GLU A HA   3  
ATOM   6909  H HB2  . GLU A 1 32  ? -10.576 16.750  -0.083  1.00 0.98  ? 32   GLU A HB2  3  
ATOM   6910  H HB3  . GLU A 1 32  ? -11.437 16.604  1.446   1.00 0.94  ? 32   GLU A HB3  3  
ATOM   6911  H HG2  . GLU A 1 32  ? -12.606 18.606  1.094   1.00 1.13  ? 32   GLU A HG2  3  
ATOM   6912  H HG3  . GLU A 1 32  ? -11.514 19.122  -0.191  1.00 1.25  ? 32   GLU A HG3  3  
ATOM   6913  N N    . ASN A 1 33  ? -10.866 18.399  3.612   1.00 1.09  ? 33   ASN A N    3  
ATOM   6914  C CA   . ASN A 1 33  ? -11.502 19.221  4.630   1.00 1.27  ? 33   ASN A CA   3  
ATOM   6915  C C    . ASN A 1 33  ? -10.573 19.493  5.805   1.00 1.32  ? 33   ASN A C    3  
ATOM   6916  O O    . ASN A 1 33  ? -10.617 20.568  6.401   1.00 1.68  ? 33   ASN A O    3  
ATOM   6917  C CB   . ASN A 1 33  ? -12.791 18.558  5.104   1.00 1.36  ? 33   ASN A CB   3  
ATOM   6918  C CG   . ASN A 1 33  ? -13.888 18.634  4.062   1.00 1.48  ? 33   ASN A CG   3  
ATOM   6919  O OD1  . ASN A 1 33  ? -14.678 19.579  4.034   1.00 1.87  ? 33   ASN A OD1  3  
ATOM   6920  N ND2  . ASN A 1 33  ? -13.949 17.637  3.197   1.00 1.35  ? 33   ASN A ND2  3  
ATOM   6921  H H    . ASN A 1 33  ? -10.853 17.424  3.722   1.00 1.02  ? 33   ASN A H    3  
ATOM   6922  H HA   . ASN A 1 33  ? -11.752 20.165  4.171   1.00 1.40  ? 33   ASN A HA   3  
ATOM   6923  H HB2  . ASN A 1 33  ? -12.595 17.517  5.316   1.00 1.36  ? 33   ASN A HB2  3  
ATOM   6924  H HB3  . ASN A 1 33  ? -13.133 19.048  6.000   1.00 1.57  ? 33   ASN A HB3  3  
ATOM   6925  H HD21 . ASN A 1 33  ? -13.297 16.912  3.279   1.00 1.19  ? 33   ASN A HD21 3  
ATOM   6926  H HD22 . ASN A 1 33  ? -14.644 17.668  2.499   1.00 1.55  ? 33   ASN A HD22 3  
ATOM   6927  N N    . ARG A 1 34  ? -9.727  18.530  6.142   1.00 1.22  ? 34   ARG A N    3  
ATOM   6928  C CA   . ARG A 1 34  ? -8.780  18.718  7.233   1.00 1.29  ? 34   ARG A CA   3  
ATOM   6929  C C    . ARG A 1 34  ? -7.360  18.491  6.746   1.00 1.17  ? 34   ARG A C    3  
ATOM   6930  O O    . ARG A 1 34  ? -7.139  17.846  5.720   1.00 1.24  ? 34   ARG A O    3  
ATOM   6931  C CB   . ARG A 1 34  ? -9.086  17.775  8.402   1.00 1.50  ? 34   ARG A CB   3  
ATOM   6932  C CG   . ARG A 1 34  ? -8.833  16.309  8.097   1.00 1.52  ? 34   ARG A CG   3  
ATOM   6933  C CD   . ARG A 1 34  ? -9.114  15.430  9.305   1.00 1.91  ? 34   ARG A CD   3  
ATOM   6934  N NE   . ARG A 1 34  ? -8.237  15.732  10.438  1.00 2.18  ? 34   ARG A NE   3  
ATOM   6935  C CZ   . ARG A 1 34  ? -8.489  15.360  11.693  1.00 2.65  ? 34   ARG A CZ   3  
ATOM   6936  N NH1  . ARG A 1 34  ? -9.578  14.656  11.980  1.00 2.89  ? 34   ARG A NH1  3  
ATOM   6937  N NH2  . ARG A 1 34  ? -7.644  15.686  12.660  1.00 3.39  ? 34   ARG A NH2  3  
ATOM   6938  H H    . ARG A 1 34  ? -9.734  17.684  5.648   1.00 1.29  ? 34   ARG A H    3  
ATOM   6939  H HA   . ARG A 1 34  ? -8.870  19.739  7.573   1.00 1.52  ? 34   ARG A HA   3  
ATOM   6940  H HB2  . ARG A 1 34  ? -8.469  18.055  9.244   1.00 1.67  ? 34   ARG A HB2  3  
ATOM   6941  H HB3  . ARG A 1 34  ? -10.124 17.889  8.677   1.00 1.85  ? 34   ARG A HB3  3  
ATOM   6942  H HG2  . ARG A 1 34  ? -9.476  16.004  7.285   1.00 1.71  ? 34   ARG A HG2  3  
ATOM   6943  H HG3  . ARG A 1 34  ? -7.799  16.186  7.806   1.00 1.50  ? 34   ARG A HG3  3  
ATOM   6944  H HD2  . ARG A 1 34  ? -10.138 15.582  9.610   1.00 2.31  ? 34   ARG A HD2  3  
ATOM   6945  H HD3  . ARG A 1 34  ? -8.976  14.397  9.020   1.00 2.37  ? 34   ARG A HD3  3  
ATOM   6946  H HE   . ARG A 1 34  ? -7.415  16.243  10.252  1.00 2.49  ? 34   ARG A HE   3  
ATOM   6947  H HH11 . ARG A 1 34  ? -10.220 14.395  11.249  1.00 2.91  ? 34   ARG A HH11 3  
ATOM   6948  H HH12 . ARG A 1 34  ? -9.774  14.388  12.931  1.00 3.40  ? 34   ARG A HH12 3  
ATOM   6949  H HH21 . ARG A 1 34  ? -6.810  16.212  12.443  1.00 3.75  ? 34   ARG A HH21 3  
ATOM   6950  H HH22 . ARG A 1 34  ? -7.833  15.415  13.614  1.00 3.82  ? 34   ARG A HH22 3  
ATOM   6951  N N    . THR A 1 35  ? -6.403  19.028  7.478   1.00 1.31  ? 35   THR A N    3  
ATOM   6952  C CA   . THR A 1 35  ? -5.005  18.829  7.164   1.00 1.39  ? 35   THR A CA   3  
ATOM   6953  C C    . THR A 1 35  ? -4.285  18.167  8.328   1.00 1.34  ? 35   THR A C    3  
ATOM   6954  O O    . THR A 1 35  ? -4.005  18.793  9.350   1.00 1.55  ? 35   THR A O    3  
ATOM   6955  C CB   . THR A 1 35  ? -4.303  20.147  6.819   1.00 1.82  ? 35   THR A CB   3  
ATOM   6956  O OG1  . THR A 1 35  ? -4.635  21.161  7.782   1.00 2.05  ? 35   THR A OG1  3  
ATOM   6957  C CG2  . THR A 1 35  ? -4.677  20.618  5.422   1.00 2.25  ? 35   THR A CG2  3  
ATOM   6958  H H    . THR A 1 35  ? -6.644  19.578  8.258   1.00 1.51  ? 35   THR A H    3  
ATOM   6959  H HA   . THR A 1 35  ? -4.947  18.178  6.304   1.00 1.50  ? 35   THR A HA   3  
ATOM   6960  H HB   . THR A 1 35  ? -3.240  19.964  6.846   1.00 1.91  ? 35   THR A HB   3  
ATOM   6961  H HG1  . THR A 1 35  ? -3.971  21.155  8.490   1.00 2.37  ? 35   THR A HG1  3  
ATOM   6962  H HG21 . THR A 1 35  ? -4.376  19.875  4.700   1.00 2.57  ? 35   THR A HG21 3  
ATOM   6963  H HG22 . THR A 1 35  ? -4.173  21.550  5.211   1.00 2.67  ? 35   THR A HG22 3  
ATOM   6964  H HG23 . THR A 1 35  ? -5.745  20.764  5.366   1.00 2.39  ? 35   THR A HG23 3  
ATOM   6965  N N    . GLU A 1 36  ? -4.025  16.888  8.175   1.00 1.44  ? 36   GLU A N    3  
ATOM   6966  C CA   . GLU A 1 36  ? -3.364  16.114  9.201   1.00 1.68  ? 36   GLU A CA   3  
ATOM   6967  C C    . GLU A 1 36  ? -1.889  15.914  8.880   1.00 1.43  ? 36   GLU A C    3  
ATOM   6968  O O    . GLU A 1 36  ? -1.032  16.703  9.282   1.00 1.46  ? 36   GLU A O    3  
ATOM   6969  C CB   . GLU A 1 36  ? -4.088  14.775  9.373   1.00 2.17  ? 36   GLU A CB   3  
ATOM   6970  C CG   . GLU A 1 36  ? -4.319  13.979  8.093   1.00 2.49  ? 36   GLU A CG   3  
ATOM   6971  C CD   . GLU A 1 36  ? -5.145  12.732  8.335   1.00 2.96  ? 36   GLU A CD   3  
ATOM   6972  O OE1  . GLU A 1 36  ? -4.611  11.766  8.918   1.00 3.30  ? 36   GLU A OE1  3  
ATOM   6973  O OE2  . GLU A 1 36  ? -6.328  12.709  7.948   1.00 3.34  ? 36   GLU A OE2  3  
ATOM   6974  H H    . GLU A 1 36  ? -4.290  16.451  7.351   1.00 1.59  ? 36   GLU A H    3  
ATOM   6975  H HA   . GLU A 1 36  ? -3.440  16.668  10.125  1.00 1.91  ? 36   GLU A HA   3  
ATOM   6976  H HB2  . GLU A 1 36  ? -3.529  14.156  10.057  1.00 2.46  ? 36   GLU A HB2  3  
ATOM   6977  H HB3  . GLU A 1 36  ? -5.036  14.980  9.790   1.00 2.51  ? 36   GLU A HB3  3  
ATOM   6978  H HG2  . GLU A 1 36  ? -4.837  14.605  7.381   1.00 2.59  ? 36   GLU A HG2  3  
ATOM   6979  H HG3  . GLU A 1 36  ? -3.361  13.687  7.686   1.00 2.88  ? 36   GLU A HG3  3  
ATOM   6980  N N    . ALA A 1 37  ? -1.614  14.862  8.151   1.00 1.50  ? 37   ALA A N    3  
ATOM   6981  C CA   . ALA A 1 37  ? -0.263  14.539  7.725   1.00 1.39  ? 37   ALA A CA   3  
ATOM   6982  C C    . ALA A 1 37  ? 0.245   15.527  6.681   1.00 1.27  ? 37   ALA A C    3  
ATOM   6983  O O    . ALA A 1 37  ? -0.538  16.093  5.916   1.00 1.58  ? 37   ALA A O    3  
ATOM   6984  C CB   . ALA A 1 37  ? -0.212  13.127  7.166   1.00 1.92  ? 37   ALA A CB   3  
ATOM   6985  H H    . ALA A 1 37  ? -2.357  14.265  7.905   1.00 1.80  ? 37   ALA A H    3  
ATOM   6986  H HA   . ALA A 1 37  ? 0.381   14.582  8.591   1.00 1.33  ? 37   ALA A HA   3  
ATOM   6987  H HB1  . ALA A 1 37  ? -0.827  13.068  6.281   1.00 2.29  ? 37   ALA A HB1  3  
ATOM   6988  H HB2  . ALA A 1 37  ? -0.582  12.433  7.907   1.00 2.44  ? 37   ALA A HB2  3  
ATOM   6989  H HB3  . ALA A 1 37  ? 0.808   12.876  6.915   1.00 2.11  ? 37   ALA A HB3  3  
ATOM   6990  N N    . PRO A 1 38  ? 1.565   15.778  6.683   1.00 1.10  ? 38   PRO A N    3  
ATOM   6991  C CA   . PRO A 1 38  ? 2.252   16.526  5.617   1.00 1.43  ? 38   PRO A CA   3  
ATOM   6992  C C    . PRO A 1 38  ? 2.019   15.916  4.228   1.00 1.79  ? 38   PRO A C    3  
ATOM   6993  O O    . PRO A 1 38  ? 1.226   14.990  4.065   1.00 1.87  ? 38   PRO A O    3  
ATOM   6994  C CB   . PRO A 1 38  ? 3.732   16.412  6.020   1.00 1.34  ? 38   PRO A CB   3  
ATOM   6995  C CG   . PRO A 1 38  ? 3.698   16.239  7.492   1.00 1.26  ? 38   PRO A CG   3  
ATOM   6996  C CD   . PRO A 1 38  ? 2.490   15.396  7.763   1.00 1.01  ? 38   PRO A CD   3  
ATOM   6997  H HA   . PRO A 1 38  ? 1.956   17.565  5.607   1.00 1.71  ? 38   PRO A HA   3  
ATOM   6998  H HB2  . PRO A 1 38  ? 4.192   15.556  5.537   1.00 1.29  ? 38   PRO A HB2  3  
ATOM   6999  H HB3  . PRO A 1 38  ? 4.257   17.309  5.744   1.00 1.71  ? 38   PRO A HB3  3  
ATOM   7000  H HG2  . PRO A 1 38  ? 4.590   15.727  7.818   1.00 1.41  ? 38   PRO A HG2  3  
ATOM   7001  H HG3  . PRO A 1 38  ? 3.607   17.198  7.978   1.00 1.71  ? 38   PRO A HG3  3  
ATOM   7002  H HD2  . PRO A 1 38  ? 2.744   14.349  7.703   1.00 1.08  ? 38   PRO A HD2  3  
ATOM   7003  H HD3  . PRO A 1 38  ? 2.073   15.631  8.731   1.00 1.25  ? 38   PRO A HD3  3  
ATOM   7004  N N    . GLU A 1 39  ? 2.709   16.440  3.225   1.00 2.28  ? 39   GLU A N    3  
ATOM   7005  C CA   . GLU A 1 39  ? 2.593   15.909  1.872   1.00 2.76  ? 39   GLU A CA   3  
ATOM   7006  C C    . GLU A 1 39  ? 3.588   14.772  1.662   1.00 2.66  ? 39   GLU A C    3  
ATOM   7007  O O    . GLU A 1 39  ? 3.866   14.364  0.533   1.00 3.08  ? 39   GLU A O    3  
ATOM   7008  C CB   . GLU A 1 39  ? 2.828   17.009  0.841   1.00 3.38  ? 39   GLU A CB   3  
ATOM   7009  C CG   . GLU A 1 39  ? 4.214   17.617  0.905   1.00 3.52  ? 39   GLU A CG   3  
ATOM   7010  C CD   . GLU A 1 39  ? 4.407   18.696  -0.134  1.00 4.22  ? 39   GLU A CD   3  
ATOM   7011  O OE1  . GLU A 1 39  ? 4.035   19.857  0.128   1.00 4.44  ? 39   GLU A OE1  3  
ATOM   7012  O OE2  . GLU A 1 39  ? 4.942   18.389  -1.218  1.00 4.64  ? 39   GLU A OE2  3  
ATOM   7013  H H    . GLU A 1 39  ? 3.300   17.205  3.393   1.00 2.42  ? 39   GLU A H    3  
ATOM   7014  H HA   . GLU A 1 39  ? 1.595   15.525  1.755   1.00 2.84  ? 39   GLU A HA   3  
ATOM   7015  H HB2  . GLU A 1 39  ? 2.685   16.596  -0.146  1.00 3.74  ? 39   GLU A HB2  3  
ATOM   7016  H HB3  . GLU A 1 39  ? 2.106   17.796  1.001   1.00 3.48  ? 39   GLU A HB3  3  
ATOM   7017  H HG2  . GLU A 1 39  ? 4.362   18.045  1.885   1.00 3.29  ? 39   GLU A HG2  3  
ATOM   7018  H HG3  . GLU A 1 39  ? 4.942   16.836  0.738   1.00 3.47  ? 39   GLU A HG3  3  
ATOM   7019  N N    . GLY A 1 40  ? 4.120   14.271  2.759   1.00 2.15  ? 40   GLY A N    3  
ATOM   7020  C CA   . GLY A 1 40  ? 5.053   13.173  2.698   1.00 2.04  ? 40   GLY A CA   3  
ATOM   7021  C C    . GLY A 1 40  ? 6.167   13.331  3.700   1.00 1.57  ? 40   GLY A C    3  
ATOM   7022  O O    . GLY A 1 40  ? 7.331   13.440  3.324   1.00 1.75  ? 40   GLY A O    3  
ATOM   7023  H H    . GLY A 1 40  ? 3.871   14.652  3.623   1.00 1.90  ? 40   GLY A H    3  
ATOM   7024  H HA2  . GLY A 1 40  ? 4.526   12.252  2.899   1.00 2.04  ? 40   GLY A HA2  3  
ATOM   7025  H HA3  . GLY A 1 40  ? 5.478   13.128  1.707   1.00 2.40  ? 40   GLY A HA3  3  
ATOM   7026  N N    . THR A 1 41  ? 5.818   13.344  4.979   1.00 1.12  ? 41   THR A N    3  
ATOM   7027  C CA   . THR A 1 41  ? 6.810   13.552  6.020   1.00 0.86  ? 41   THR A CA   3  
ATOM   7028  C C    . THR A 1 41  ? 7.757   12.341  6.114   1.00 0.75  ? 41   THR A C    3  
ATOM   7029  O O    . THR A 1 41  ? 8.899   12.403  5.658   1.00 0.85  ? 41   THR A O    3  
ATOM   7030  C CB   . THR A 1 41  ? 6.128   13.833  7.380   1.00 0.80  ? 41   THR A CB   3  
ATOM   7031  O OG1  . THR A 1 41  ? 7.065   13.715  8.453   1.00 0.95  ? 41   THR A OG1  3  
ATOM   7032  C CG2  . THR A 1 41  ? 4.941   12.909  7.617   1.00 0.91  ? 41   THR A CG2  3  
ATOM   7033  H H    . THR A 1 41  ? 4.878   13.201  5.226   1.00 1.17  ? 41   THR A H    3  
ATOM   7034  H HA   . THR A 1 41  ? 7.380   14.427  5.746   1.00 1.14  ? 41   THR A HA   3  
ATOM   7035  H HB   . THR A 1 41  ? 5.760   14.850  7.363   1.00 0.93  ? 41   THR A HB   3  
ATOM   7036  H HG1  . THR A 1 41  ? 7.352   14.603  8.726   1.00 1.29  ? 41   THR A HG1  3  
ATOM   7037  H HG21 . THR A 1 41  ? 4.204   13.070  6.843   1.00 1.35  ? 41   THR A HG21 3  
ATOM   7038  H HG22 . THR A 1 41  ? 4.504   13.124  8.581   1.00 1.45  ? 41   THR A HG22 3  
ATOM   7039  H HG23 . THR A 1 41  ? 5.272   11.881  7.592   1.00 1.31  ? 41   THR A HG23 3  
ATOM   7040  N N    . GLU A 1 42  ? 7.278   11.241  6.687   1.00 0.69  ? 42   GLU A N    3  
ATOM   7041  C CA   . GLU A 1 42  ? 7.981   9.964   6.617   1.00 0.66  ? 42   GLU A CA   3  
ATOM   7042  C C    . GLU A 1 42  ? 7.452   9.194   5.424   1.00 0.54  ? 42   GLU A C    3  
ATOM   7043  O O    . GLU A 1 42  ? 8.158   8.425   4.773   1.00 0.56  ? 42   GLU A O    3  
ATOM   7044  C CB   . GLU A 1 42  ? 7.750   9.146   7.892   1.00 0.74  ? 42   GLU A CB   3  
ATOM   7045  C CG   . GLU A 1 42  ? 6.330   8.602   8.035   1.00 0.65  ? 42   GLU A CG   3  
ATOM   7046  C CD   . GLU A 1 42  ? 6.103   7.895   9.352   1.00 1.20  ? 42   GLU A CD   3  
ATOM   7047  O OE1  . GLU A 1 42  ? 6.645   6.791   9.546   1.00 2.02  ? 42   GLU A OE1  3  
ATOM   7048  O OE2  . GLU A 1 42  ? 5.380   8.444   10.206  1.00 1.17  ? 42   GLU A OE2  3  
ATOM   7049  H H    . GLU A 1 42  ? 6.436   11.292  7.182   1.00 0.76  ? 42   GLU A H    3  
ATOM   7050  H HA   . GLU A 1 42  ? 9.037   10.156  6.489   1.00 0.71  ? 42   GLU A HA   3  
ATOM   7051  H HB2  . GLU A 1 42  ? 8.427   8.310   7.887   1.00 0.79  ? 42   GLU A HB2  3  
ATOM   7052  H HB3  . GLU A 1 42  ? 7.963   9.767   8.748   1.00 0.86  ? 42   GLU A HB3  3  
ATOM   7053  H HG2  . GLU A 1 42  ? 5.634   9.425   7.963   1.00 0.88  ? 42   GLU A HG2  3  
ATOM   7054  H HG3  . GLU A 1 42  ? 6.141   7.900   7.226   1.00 0.91  ? 42   GLU A HG3  3  
ATOM   7055  N N    . SER A 1 43  ? 6.186   9.460   5.166   1.00 0.48  ? 43   SER A N    3  
ATOM   7056  C CA   . SER A 1 43  ? 5.367   8.744   4.214   1.00 0.43  ? 43   SER A CA   3  
ATOM   7057  C C    . SER A 1 43  ? 5.944   8.730   2.814   1.00 0.43  ? 43   SER A C    3  
ATOM   7058  O O    . SER A 1 43  ? 5.797   7.742   2.109   1.00 0.49  ? 43   SER A O    3  
ATOM   7059  C CB   . SER A 1 43  ? 4.016   9.415   4.195   1.00 0.50  ? 43   SER A CB   3  
ATOM   7060  O OG   . SER A 1 43  ? 4.017   10.529  5.078   1.00 1.25  ? 43   SER A OG   3  
ATOM   7061  H H    . SER A 1 43  ? 5.764   10.187  5.667   1.00 0.54  ? 43   SER A H    3  
ATOM   7062  H HA   . SER A 1 43  ? 5.244   7.736   4.556   1.00 0.49  ? 43   SER A HA   3  
ATOM   7063  H HB2  . SER A 1 43  ? 3.805   9.749   3.194   1.00 0.71  ? 43   SER A HB2  3  
ATOM   7064  H HB3  . SER A 1 43  ? 3.262   8.717   4.510   1.00 0.91  ? 43   SER A HB3  3  
ATOM   7065  H HG   . SER A 1 43  ? 3.288   11.136  4.838   1.00 1.24  ? 43   SER A HG   3  
ATOM   7066  N N    . GLU A 1 44  ? 6.584   9.825   2.430   1.00 0.46  ? 44   GLU A N    3  
ATOM   7067  C CA   . GLU A 1 44  ? 7.068   10.014  1.063   1.00 0.52  ? 44   GLU A CA   3  
ATOM   7068  C C    . GLU A 1 44  ? 7.772   8.762   0.533   1.00 0.51  ? 44   GLU A C    3  
ATOM   7069  O O    . GLU A 1 44  ? 7.403   8.236   -0.515  1.00 0.58  ? 44   GLU A O    3  
ATOM   7070  C CB   . GLU A 1 44  ? 8.009   11.220  1.007   1.00 0.61  ? 44   GLU A CB   3  
ATOM   7071  C CG   . GLU A 1 44  ? 8.513   11.548  -0.388  1.00 0.72  ? 44   GLU A CG   3  
ATOM   7072  C CD   . GLU A 1 44  ? 9.331   12.823  -0.425  1.00 1.17  ? 44   GLU A CD   3  
ATOM   7073  O OE1  . GLU A 1 44  ? 8.737   13.905  -0.605  1.00 1.29  ? 44   GLU A OE1  3  
ATOM   7074  O OE2  . GLU A 1 44  ? 10.569  12.751  -0.273  1.00 1.91  ? 44   GLU A OE2  3  
ATOM   7075  H H    . GLU A 1 44  ? 6.735   10.532  3.088   1.00 0.47  ? 44   GLU A H    3  
ATOM   7076  H HA   . GLU A 1 44  ? 6.204   10.215  0.442   1.00 0.54  ? 44   GLU A HA   3  
ATOM   7077  H HB2  . GLU A 1 44  ? 7.489   12.085  1.389   1.00 0.63  ? 44   GLU A HB2  3  
ATOM   7078  H HB3  . GLU A 1 44  ? 8.864   11.021  1.635   1.00 0.61  ? 44   GLU A HB3  3  
ATOM   7079  H HG2  . GLU A 1 44  ? 9.131   10.733  -0.735  1.00 1.13  ? 44   GLU A HG2  3  
ATOM   7080  H HG3  . GLU A 1 44  ? 7.665   11.662  -1.045  1.00 1.04  ? 44   GLU A HG3  3  
ATOM   7081  N N    . ALA A 1 45  ? 8.753   8.272   1.279   1.00 0.48  ? 45   ALA A N    3  
ATOM   7082  C CA   . ALA A 1 45  ? 9.503   7.088   0.871   1.00 0.48  ? 45   ALA A CA   3  
ATOM   7083  C C    . ALA A 1 45  ? 8.671   5.816   1.006   1.00 0.41  ? 45   ALA A C    3  
ATOM   7084  O O    . ALA A 1 45  ? 8.741   4.934   0.149   1.00 0.41  ? 45   ALA A O    3  
ATOM   7085  C CB   . ALA A 1 45  ? 10.782  6.968   1.682   1.00 0.52  ? 45   ALA A CB   3  
ATOM   7086  H H    . ALA A 1 45  ? 8.981   8.718   2.123   1.00 0.49  ? 45   ALA A H    3  
ATOM   7087  H HA   . ALA A 1 45  ? 9.779   7.207   -0.167  1.00 0.52  ? 45   ALA A HA   3  
ATOM   7088  H HB1  . ALA A 1 45  ? 11.360  7.875   1.579   1.00 1.14  ? 45   ALA A HB1  3  
ATOM   7089  H HB2  . ALA A 1 45  ? 11.359  6.131   1.320   1.00 1.18  ? 45   ALA A HB2  3  
ATOM   7090  H HB3  . ALA A 1 45  ? 10.536  6.815   2.722   1.00 1.13  ? 45   ALA A HB3  3  
ATOM   7091  N N    . VAL A 1 46  ? 7.874   5.721   2.067   1.00 0.37  ? 46   VAL A N    3  
ATOM   7092  C CA   . VAL A 1 46  ? 7.123   4.497   2.335   1.00 0.34  ? 46   VAL A CA   3  
ATOM   7093  C C    . VAL A 1 46  ? 5.985   4.321   1.330   1.00 0.34  ? 46   VAL A C    3  
ATOM   7094  O O    . VAL A 1 46  ? 5.776   3.230   0.823   1.00 0.39  ? 46   VAL A O    3  
ATOM   7095  C CB   . VAL A 1 46  ? 6.606   4.416   3.805   1.00 0.49  ? 46   VAL A CB   3  
ATOM   7096  C CG1  . VAL A 1 46  ? 7.086   5.589   4.633   1.00 1.41  ? 46   VAL A CG1  3  
ATOM   7097  C CG2  . VAL A 1 46  ? 5.097   4.313   3.897   1.00 1.13  ? 46   VAL A CG2  3  
ATOM   7098  H H    . VAL A 1 46  ? 7.790   6.485   2.677   1.00 0.38  ? 46   VAL A H    3  
ATOM   7099  H HA   . VAL A 1 46  ? 7.810   3.676   2.191   1.00 0.36  ? 46   VAL A HA   3  
ATOM   7100  H HB   . VAL A 1 46  ? 7.019   3.516   4.242   1.00 1.47  ? 46   VAL A HB   3  
ATOM   7101  H HG11 . VAL A 1 46  ? 6.695   5.500   5.637   1.00 2.01  ? 46   VAL A HG11 3  
ATOM   7102  H HG12 . VAL A 1 46  ? 6.730   6.509   4.191   1.00 1.93  ? 46   VAL A HG12 3  
ATOM   7103  H HG13 . VAL A 1 46  ? 8.165   5.594   4.663   1.00 2.01  ? 46   VAL A HG13 3  
ATOM   7104  H HG21 . VAL A 1 46  ? 4.809   4.306   4.943   1.00 1.65  ? 46   VAL A HG21 3  
ATOM   7105  H HG22 . VAL A 1 46  ? 4.767   3.400   3.422   1.00 1.69  ? 46   VAL A HG22 3  
ATOM   7106  H HG23 . VAL A 1 46  ? 4.646   5.163   3.406   1.00 1.88  ? 46   VAL A HG23 3  
ATOM   7107  N N    . LYS A 1 47  ? 5.284   5.405   1.010   1.00 0.34  ? 47   LYS A N    3  
ATOM   7108  C CA   . LYS A 1 47  ? 4.194   5.352   0.040   1.00 0.36  ? 47   LYS A CA   3  
ATOM   7109  C C    . LYS A 1 47  ? 4.774   5.166   -1.362  1.00 0.39  ? 47   LYS A C    3  
ATOM   7110  O O    . LYS A 1 47  ? 4.153   4.549   -2.225  1.00 0.43  ? 47   LYS A O    3  
ATOM   7111  C CB   . LYS A 1 47  ? 3.347   6.629   0.125   1.00 0.38  ? 47   LYS A CB   3  
ATOM   7112  C CG   . LYS A 1 47  ? 3.998   7.844   -0.507  1.00 0.49  ? 47   LYS A CG   3  
ATOM   7113  C CD   . LYS A 1 47  ? 3.688   9.111   0.231   1.00 0.47  ? 47   LYS A CD   3  
ATOM   7114  C CE   . LYS A 1 47  ? 2.213   9.352   0.337   1.00 0.47  ? 47   LYS A CE   3  
ATOM   7115  N NZ   . LYS A 1 47  ? 1.670   10.090  -0.832  1.00 0.67  ? 47   LYS A NZ   3  
ATOM   7116  H H    . LYS A 1 47  ? 5.508   6.264   1.436   1.00 0.36  ? 47   LYS A H    3  
ATOM   7117  H HA   . LYS A 1 47  ? 3.573   4.491   0.274   1.00 0.36  ? 47   LYS A HA   3  
ATOM   7118  H HB2  . LYS A 1 47  ? 2.407   6.461   -0.374  1.00 0.47  ? 47   LYS A HB2  3  
ATOM   7119  H HB3  . LYS A 1 47  ? 3.157   6.852   1.165   1.00 0.38  ? 47   LYS A HB3  3  
ATOM   7120  H HG2  . LYS A 1 47  ? 5.055   7.715   -0.501  1.00 0.64  ? 47   LYS A HG2  3  
ATOM   7121  H HG3  . LYS A 1 47  ? 3.644   7.936   -1.517  1.00 0.78  ? 47   LYS A HG3  3  
ATOM   7122  H HD2  . LYS A 1 47  ? 4.105   9.051   1.223   1.00 0.84  ? 47   LYS A HD2  3  
ATOM   7123  H HD3  . LYS A 1 47  ? 4.138   9.929   -0.300  1.00 0.74  ? 47   LYS A HD3  3  
ATOM   7124  H HE2  . LYS A 1 47  ? 1.711   8.401   0.426   1.00 0.52  ? 47   LYS A HE2  3  
ATOM   7125  H HE3  . LYS A 1 47  ? 2.053   9.920   1.219   1.00 0.75  ? 47   LYS A HE3  3  
ATOM   7126  H HZ1  . LYS A 1 47  ? 2.193   10.983  -0.969  1.00 1.13  ? 47   LYS A HZ1  3  
ATOM   7127  H HZ2  . LYS A 1 47  ? 0.662   10.317  -0.680  1.00 1.14  ? 47   LYS A HZ2  3  
ATOM   7128  H HZ3  . LYS A 1 47  ? 1.754   9.515   -1.699  1.00 1.38  ? 47   LYS A HZ3  3  
ATOM   7129  N N    . GLN A 1 48  ? 5.981   5.688   -1.571  1.00 0.40  ? 48   GLN A N    3  
ATOM   7130  C CA   . GLN A 1 48  ? 6.712   5.439   -2.805  1.00 0.46  ? 48   GLN A CA   3  
ATOM   7131  C C    . GLN A 1 48  ? 7.056   3.966   -2.924  1.00 0.45  ? 48   GLN A C    3  
ATOM   7132  O O    . GLN A 1 48  ? 7.070   3.414   -4.017  1.00 0.50  ? 48   GLN A O    3  
ATOM   7133  C CB   . GLN A 1 48  ? 7.998   6.262   -2.871  1.00 0.52  ? 48   GLN A CB   3  
ATOM   7134  C CG   . GLN A 1 48  ? 7.857   7.586   -3.603  1.00 0.58  ? 48   GLN A CG   3  
ATOM   7135  C CD   . GLN A 1 48  ? 7.214   7.453   -4.972  1.00 0.67  ? 48   GLN A CD   3  
ATOM   7136  O OE1  . GLN A 1 48  ? 6.596   8.393   -5.470  1.00 0.99  ? 48   GLN A OE1  3  
ATOM   7137  N NE2  . GLN A 1 48  ? 7.326   6.283   -5.582  1.00 0.63  ? 48   GLN A NE2  3  
ATOM   7138  H H    . GLN A 1 48  ? 6.382   6.264   -0.883  1.00 0.39  ? 48   GLN A H    3  
ATOM   7139  H HA   . GLN A 1 48  ? 6.074   5.718   -3.631  1.00 0.48  ? 48   GLN A HA   3  
ATOM   7140  H HB2  . GLN A 1 48  ? 8.324   6.472   -1.863  1.00 0.49  ? 48   GLN A HB2  3  
ATOM   7141  H HB3  . GLN A 1 48  ? 8.759   5.681   -3.368  1.00 0.58  ? 48   GLN A HB3  3  
ATOM   7142  H HG2  . GLN A 1 48  ? 7.256   8.251   -3.004  1.00 0.58  ? 48   GLN A HG2  3  
ATOM   7143  H HG3  . GLN A 1 48  ? 8.842   8.010   -3.732  1.00 0.65  ? 48   GLN A HG3  3  
ATOM   7144  H HE21 . GLN A 1 48  ? 7.804   5.561   -5.123  1.00 0.74  ? 48   GLN A HE21 3  
ATOM   7145  H HE22 . GLN A 1 48  ? 6.939   6.194   -6.486  1.00 0.66  ? 48   GLN A HE22 3  
ATOM   7146  N N    . ALA A 1 49  ? 7.350   3.344   -1.795  1.00 0.42  ? 49   ALA A N    3  
ATOM   7147  C CA   . ALA A 1 49  ? 7.625   1.918   -1.754  1.00 0.41  ? 49   ALA A CA   3  
ATOM   7148  C C    . ALA A 1 49  ? 6.333   1.119   -1.878  1.00 0.39  ? 49   ALA A C    3  
ATOM   7149  O O    . ALA A 1 49  ? 6.302   0.051   -2.489  1.00 0.42  ? 49   ALA A O    3  
ATOM   7150  C CB   . ALA A 1 49  ? 8.345   1.560   -0.466  1.00 0.42  ? 49   ALA A CB   3  
ATOM   7151  H H    . ALA A 1 49  ? 7.392   3.863   -0.961  1.00 0.42  ? 49   ALA A H    3  
ATOM   7152  H HA   . ALA A 1 49  ? 8.275   1.677   -2.579  1.00 0.45  ? 49   ALA A HA   3  
ATOM   7153  H HB1  . ALA A 1 49  ? 7.705   1.778   0.375   1.00 1.14  ? 49   ALA A HB1  3  
ATOM   7154  H HB2  . ALA A 1 49  ? 9.253   2.139   -0.390  1.00 1.06  ? 49   ALA A HB2  3  
ATOM   7155  H HB3  . ALA A 1 49  ? 8.588   0.508   -0.472  1.00 1.08  ? 49   ALA A HB3  3  
ATOM   7156  N N    . LEU A 1 50  ? 5.264   1.669   -1.314  1.00 0.38  ? 50   LEU A N    3  
ATOM   7157  C CA   . LEU A 1 50  ? 3.982   1.026   -1.270  1.00 0.40  ? 50   LEU A CA   3  
ATOM   7158  C C    . LEU A 1 50  ? 3.390   0.817   -2.659  1.00 0.41  ? 50   LEU A C    3  
ATOM   7159  O O    . LEU A 1 50  ? 2.640   -0.131  -2.877  1.00 0.43  ? 50   LEU A O    3  
ATOM   7160  C CB   . LEU A 1 50  ? 3.051   1.881   -0.418  1.00 0.45  ? 50   LEU A CB   3  
ATOM   7161  C CG   . LEU A 1 50  ? 3.273   1.807   1.093   1.00 0.69  ? 50   LEU A CG   3  
ATOM   7162  C CD1  . LEU A 1 50  ? 2.088   2.393   1.833   1.00 1.33  ? 50   LEU A CD1  3  
ATOM   7163  C CD2  . LEU A 1 50  ? 3.501   0.380   1.533   1.00 1.20  ? 50   LEU A CD2  3  
ATOM   7164  H H    . LEU A 1 50  ? 5.339   2.546   -0.894  1.00 0.39  ? 50   LEU A H    3  
ATOM   7165  H HA   . LEU A 1 50  ? 4.104   0.067   -0.793  1.00 0.43  ? 50   LEU A HA   3  
ATOM   7166  H HB2  . LEU A 1 50  ? 3.175   2.911   -0.721  1.00 0.74  ? 50   LEU A HB2  3  
ATOM   7167  H HB3  . LEU A 1 50  ? 2.060   1.595   -0.624  1.00 0.48  ? 50   LEU A HB3  3  
ATOM   7168  H HG   . LEU A 1 50  ? 4.149   2.383   1.351   1.00 1.64  ? 50   LEU A HG   3  
ATOM   7169  H HD11 . LEU A 1 50  ? 1.915   3.404   1.498   1.00 1.95  ? 50   LEU A HD11 3  
ATOM   7170  H HD12 . LEU A 1 50  ? 2.292   2.391   2.894   1.00 1.77  ? 50   LEU A HD12 3  
ATOM   7171  H HD13 . LEU A 1 50  ? 1.211   1.788   1.637   1.00 1.93  ? 50   LEU A HD13 3  
ATOM   7172  H HD21 . LEU A 1 50  ? 3.679   0.359   2.598   1.00 1.81  ? 50   LEU A HD21 3  
ATOM   7173  H HD22 . LEU A 1 50  ? 4.358   -0.024  1.014   1.00 1.85  ? 50   LEU A HD22 3  
ATOM   7174  H HD23 . LEU A 1 50  ? 2.626   -0.208  1.300   1.00 1.62  ? 50   LEU A HD23 3  
ATOM   7175  N N    . ARG A 1 51  ? 3.745   1.673   -3.609  1.00 0.44  ? 51   ARG A N    3  
ATOM   7176  C CA   . ARG A 1 51  ? 3.167   1.583   -4.943  1.00 0.50  ? 51   ARG A CA   3  
ATOM   7177  C C    . ARG A 1 51  ? 3.896   0.505   -5.726  1.00 0.52  ? 51   ARG A C    3  
ATOM   7178  O O    . ARG A 1 51  ? 3.327   -0.175  -6.580  1.00 0.59  ? 51   ARG A O    3  
ATOM   7179  C CB   . ARG A 1 51  ? 3.282   2.926   -5.662  1.00 0.53  ? 51   ARG A CB   3  
ATOM   7180  C CG   . ARG A 1 51  ? 4.716   3.297   -5.981  1.00 0.52  ? 51   ARG A CG   3  
ATOM   7181  C CD   . ARG A 1 51  ? 4.844   4.683   -6.570  1.00 0.73  ? 51   ARG A CD   3  
ATOM   7182  N NE   . ARG A 1 51  ? 3.927   4.917   -7.684  1.00 1.21  ? 51   ARG A NE   3  
ATOM   7183  C CZ   . ARG A 1 51  ? 4.175   4.585   -8.952  1.00 1.63  ? 51   ARG A CZ   3  
ATOM   7184  N NH1  . ARG A 1 51  ? 5.237   3.844   -9.267  1.00 1.96  ? 51   ARG A NH1  3  
ATOM   7185  N NH2  . ARG A 1 51  ? 3.337   4.974   -9.905  1.00 2.17  ? 51   ARG A NH2  3  
ATOM   7186  H H    . ARG A 1 51  ? 4.433   2.354   -3.423  1.00 0.43  ? 51   ARG A H    3  
ATOM   7187  H HA   . ARG A 1 51  ? 2.127   1.313   -4.845  1.00 0.55  ? 51   ARG A HA   3  
ATOM   7188  H HB2  . ARG A 1 51  ? 2.727   2.877   -6.588  1.00 0.59  ? 51   ARG A HB2  3  
ATOM   7189  H HB3  . ARG A 1 51  ? 2.860   3.699   -5.036  1.00 0.58  ? 51   ARG A HB3  3  
ATOM   7190  H HG2  . ARG A 1 51  ? 5.291   3.257   -5.069  1.00 0.67  ? 51   ARG A HG2  3  
ATOM   7191  H HG3  . ARG A 1 51  ? 5.112   2.581   -6.684  1.00 0.66  ? 51   ARG A HG3  3  
ATOM   7192  H HD2  . ARG A 1 51  ? 4.647   5.407   -5.796  1.00 0.90  ? 51   ARG A HD2  3  
ATOM   7193  H HD3  . ARG A 1 51  ? 5.856   4.805   -6.919  1.00 1.12  ? 51   ARG A HD3  3  
ATOM   7194  H HE   . ARG A 1 51  ? 3.089   5.399   -7.475  1.00 1.60  ? 51   ARG A HE   3  
ATOM   7195  H HH11 . ARG A 1 51  ? 5.868   3.526   -8.548  1.00 1.99  ? 51   ARG A HH11 3  
ATOM   7196  H HH12 . ARG A 1 51  ? 5.410   3.586   -10.227 1.00 2.46  ? 51   ARG A HH12 3  
ATOM   7197  H HH21 . ARG A 1 51  ? 2.521   5.518   -9.668  1.00 2.45  ? 51   ARG A HH21 3  
ATOM   7198  H HH22 . ARG A 1 51  ? 3.517   4.737   -10.868 1.00 2.51  ? 51   ARG A HH22 3  
ATOM   7199  N N    . GLU A 1 52  ? 5.164   0.355   -5.388  1.00 0.49  ? 52   GLU A N    3  
ATOM   7200  C CA   . GLU A 1 52  ? 6.048   -0.594  -6.030  1.00 0.54  ? 52   GLU A CA   3  
ATOM   7201  C C    . GLU A 1 52  ? 5.725   -2.002  -5.554  1.00 0.53  ? 52   GLU A C    3  
ATOM   7202  O O    . GLU A 1 52  ? 5.534   -2.916  -6.358  1.00 0.58  ? 52   GLU A O    3  
ATOM   7203  C CB   . GLU A 1 52  ? 7.484   -0.221  -5.676  1.00 0.59  ? 52   GLU A CB   3  
ATOM   7204  C CG   . GLU A 1 52  ? 7.784   1.259   -5.882  1.00 0.63  ? 52   GLU A CG   3  
ATOM   7205  C CD   . GLU A 1 52  ? 8.051   1.603   -7.330  1.00 0.87  ? 52   GLU A CD   3  
ATOM   7206  O OE1  . GLU A 1 52  ? 9.116   1.204   -7.846  1.00 1.10  ? 52   GLU A OE1  3  
ATOM   7207  O OE2  . GLU A 1 52  ? 7.203   2.269   -7.960  1.00 1.07  ? 52   GLU A OE2  3  
ATOM   7208  H H    . GLU A 1 52  ? 5.523   0.913   -4.668  1.00 0.46  ? 52   GLU A H    3  
ATOM   7209  H HA   . GLU A 1 52  ? 5.906   -0.534  -7.101  1.00 0.59  ? 52   GLU A HA   3  
ATOM   7210  H HB2  . GLU A 1 52  ? 7.665   -0.466  -4.639  1.00 0.56  ? 52   GLU A HB2  3  
ATOM   7211  H HB3  . GLU A 1 52  ? 8.158   -0.793  -6.297  1.00 0.67  ? 52   GLU A HB3  3  
ATOM   7212  H HG2  . GLU A 1 52  ? 6.932   1.838   -5.546  1.00 0.66  ? 52   GLU A HG2  3  
ATOM   7213  H HG3  . GLU A 1 52  ? 8.639   1.533   -5.291  1.00 0.69  ? 52   GLU A HG3  3  
ATOM   7214  N N    . ALA A 1 53  ? 5.643   -2.161  -4.238  1.00 0.49  ? 53   ALA A N    3  
ATOM   7215  C CA   . ALA A 1 53  ? 5.252   -3.430  -3.645  1.00 0.48  ? 53   ALA A CA   3  
ATOM   7216  C C    . ALA A 1 53  ? 3.813   -3.748  -4.009  1.00 0.49  ? 53   ALA A C    3  
ATOM   7217  O O    . ALA A 1 53  ? 3.445   -4.909  -4.187  1.00 0.53  ? 53   ALA A O    3  
ATOM   7218  C CB   . ALA A 1 53  ? 5.414   -3.387  -2.135  1.00 0.45  ? 53   ALA A CB   3  
ATOM   7219  H H    . ALA A 1 53  ? 5.853   -1.400  -3.651  1.00 0.48  ? 53   ALA A H    3  
ATOM   7220  H HA   . ALA A 1 53  ? 5.899   -4.200  -4.038  1.00 0.51  ? 53   ALA A HA   3  
ATOM   7221  H HB1  . ALA A 1 53  ? 4.711   -2.678  -1.717  1.00 1.04  ? 53   ALA A HB1  3  
ATOM   7222  H HB2  . ALA A 1 53  ? 6.420   -3.087  -1.887  1.00 1.03  ? 53   ALA A HB2  3  
ATOM   7223  H HB3  . ALA A 1 53  ? 5.219   -4.367  -1.724  1.00 1.01  ? 53   ALA A HB3  3  
ATOM   7224  N N    . GLY A 1 54  ? 3.008   -2.696  -4.110  1.00 0.49  ? 54   GLY A N    3  
ATOM   7225  C CA   . GLY A 1 54  ? 1.626   -2.845  -4.495  1.00 0.53  ? 54   GLY A CA   3  
ATOM   7226  C C    . GLY A 1 54  ? 1.490   -3.497  -5.845  1.00 0.60  ? 54   GLY A C    3  
ATOM   7227  O O    . GLY A 1 54  ? 0.882   -4.553  -5.960  1.00 0.70  ? 54   GLY A O    3  
ATOM   7228  H H    . GLY A 1 54  ? 3.362   -1.802  -3.914  1.00 0.49  ? 54   GLY A H    3  
ATOM   7229  H HA2  . GLY A 1 54  ? 1.120   -3.452  -3.758  1.00 0.53  ? 54   GLY A HA2  3  
ATOM   7230  H HA3  . GLY A 1 54  ? 1.163   -1.870  -4.527  1.00 0.56  ? 54   GLY A HA3  3  
ATOM   7231  N N    . ASP A 1 55  ? 2.101   -2.891  -6.856  1.00 0.61  ? 55   ASP A N    3  
ATOM   7232  C CA   . ASP A 1 55  ? 2.001   -3.385  -8.229  1.00 0.69  ? 55   ASP A CA   3  
ATOM   7233  C C    . ASP A 1 55  ? 2.430   -4.846  -8.324  1.00 0.70  ? 55   ASP A C    3  
ATOM   7234  O O    . ASP A 1 55  ? 1.772   -5.656  -8.981  1.00 0.79  ? 55   ASP A O    3  
ATOM   7235  C CB   . ASP A 1 55  ? 2.855   -2.529  -9.163  1.00 0.73  ? 55   ASP A CB   3  
ATOM   7236  C CG   . ASP A 1 55  ? 2.793   -3.014  -10.599 1.00 0.85  ? 55   ASP A CG   3  
ATOM   7237  O OD1  . ASP A 1 55  ? 1.712   -2.909  -11.223 1.00 1.04  ? 55   ASP A OD1  3  
ATOM   7238  O OD2  . ASP A 1 55  ? 3.821   -3.507  -11.111 1.00 0.82  ? 55   ASP A OD2  3  
ATOM   7239  H H    . ASP A 1 55  ? 2.644   -2.091  -6.674  1.00 0.59  ? 55   ASP A H    3  
ATOM   7240  H HA   . ASP A 1 55  ? 0.967   -3.308  -8.531  1.00 0.77  ? 55   ASP A HA   3  
ATOM   7241  H HB2  . ASP A 1 55  ? 2.501   -1.511  -9.131  1.00 0.77  ? 55   ASP A HB2  3  
ATOM   7242  H HB3  . ASP A 1 55  ? 3.886   -2.557  -8.833  1.00 0.69  ? 55   ASP A HB3  3  
ATOM   7243  N N    . GLU A 1 56  ? 3.521   -5.172  -7.644  1.00 0.66  ? 56   GLU A N    3  
ATOM   7244  C CA   . GLU A 1 56  ? 4.033   -6.539  -7.592  1.00 0.74  ? 56   GLU A CA   3  
ATOM   7245  C C    . GLU A 1 56  ? 3.005   -7.498  -7.003  1.00 0.77  ? 56   GLU A C    3  
ATOM   7246  O O    . GLU A 1 56  ? 2.927   -8.663  -7.389  1.00 0.88  ? 56   GLU A O    3  
ATOM   7247  C CB   . GLU A 1 56  ? 5.313   -6.582  -6.759  1.00 0.79  ? 56   GLU A CB   3  
ATOM   7248  C CG   . GLU A 1 56  ? 6.513   -5.944  -7.439  1.00 1.24  ? 56   GLU A CG   3  
ATOM   7249  C CD   . GLU A 1 56  ? 7.028   -6.775  -8.594  1.00 1.52  ? 56   GLU A CD   3  
ATOM   7250  O OE1  . GLU A 1 56  ? 7.714   -7.789  -8.353  1.00 1.43  ? 56   GLU A OE1  3  
ATOM   7251  O OE2  . GLU A 1 56  ? 6.752   -6.412  -9.759  1.00 2.29  ? 56   GLU A OE2  3  
ATOM   7252  H H    . GLU A 1 56  ? 4.006   -4.466  -7.163  1.00 0.63  ? 56   GLU A H    3  
ATOM   7253  H HA   . GLU A 1 56  ? 4.254   -6.850  -8.597  1.00 0.78  ? 56   GLU A HA   3  
ATOM   7254  H HB2  . GLU A 1 56  ? 5.138   -6.065  -5.827  1.00 0.99  ? 56   GLU A HB2  3  
ATOM   7255  H HB3  . GLU A 1 56  ? 5.555   -7.613  -6.547  1.00 1.14  ? 56   GLU A HB3  3  
ATOM   7256  H HG2  . GLU A 1 56  ? 6.226   -4.973  -7.814  1.00 1.86  ? 56   GLU A HG2  3  
ATOM   7257  H HG3  . GLU A 1 56  ? 7.306   -5.830  -6.714  1.00 1.73  ? 56   GLU A HG3  3  
ATOM   7258  N N    . PHE A 1 57  ? 2.232   -7.004  -6.060  1.00 0.71  ? 57   PHE A N    3  
ATOM   7259  C CA   . PHE A 1 57  ? 1.219   -7.812  -5.406  1.00 0.75  ? 57   PHE A CA   3  
ATOM   7260  C C    . PHE A 1 57  ? -0.057  -7.895  -6.249  1.00 0.78  ? 57   PHE A C    3  
ATOM   7261  O O    . PHE A 1 57  ? -0.674  -8.957  -6.356  1.00 0.91  ? 57   PHE A O    3  
ATOM   7262  C CB   . PHE A 1 57  ? 0.898   -7.250  -4.018  1.00 0.76  ? 57   PHE A CB   3  
ATOM   7263  C CG   . PHE A 1 57  ? -0.017  -8.140  -3.230  1.00 1.09  ? 57   PHE A CG   3  
ATOM   7264  C CD1  . PHE A 1 57  ? 0.484   -9.245  -2.564  1.00 1.37  ? 57   PHE A CD1  3  
ATOM   7265  C CD2  . PHE A 1 57  ? -1.376  -7.887  -3.174  1.00 1.71  ? 57   PHE A CD2  3  
ATOM   7266  C CE1  . PHE A 1 57  ? -0.352  -10.077 -1.853  1.00 1.79  ? 57   PHE A CE1  3  
ATOM   7267  C CE2  . PHE A 1 57  ? -2.219  -8.720  -2.468  1.00 2.29  ? 57   PHE A CE2  3  
ATOM   7268  C CZ   . PHE A 1 57  ? -1.708  -9.816  -1.806  1.00 2.20  ? 57   PHE A CZ   3  
ATOM   7269  H H    . PHE A 1 57  ? 2.342   -6.064  -5.802  1.00 0.67  ? 57   PHE A H    3  
ATOM   7270  H HA   . PHE A 1 57  ? 1.620   -8.808  -5.293  1.00 0.80  ? 57   PHE A HA   3  
ATOM   7271  H HB2  . PHE A 1 57  ? 1.815   -7.132  -3.458  1.00 0.99  ? 57   PHE A HB2  3  
ATOM   7272  H HB3  . PHE A 1 57  ? 0.418   -6.286  -4.123  1.00 0.73  ? 57   PHE A HB3  3  
ATOM   7273  H HD1  . PHE A 1 57  ? 1.545   -9.449  -2.599  1.00 1.61  ? 57   PHE A HD1  3  
ATOM   7274  H HD2  . PHE A 1 57  ? -1.778  -7.029  -3.692  1.00 1.95  ? 57   PHE A HD2  3  
ATOM   7275  H HE1  . PHE A 1 57  ? 0.050   -10.936 -1.336  1.00 2.07  ? 57   PHE A HE1  3  
ATOM   7276  H HE2  . PHE A 1 57  ? -3.278  -8.512  -2.432  1.00 2.93  ? 57   PHE A HE2  3  
ATOM   7277  H HZ   . PHE A 1 57  ? -2.365  -10.469 -1.253  1.00 2.67  ? 57   PHE A HZ   3  
ATOM   7278  N N    . GLU A 1 58  ? -0.438  -6.775  -6.852  1.00 0.73  ? 58   GLU A N    3  
ATOM   7279  C CA   . GLU A 1 58  ? -1.707  -6.672  -7.573  1.00 0.82  ? 58   GLU A CA   3  
ATOM   7280  C C    . GLU A 1 58  ? -1.758  -7.615  -8.756  1.00 0.82  ? 58   GLU A C    3  
ATOM   7281  O O    . GLU A 1 58  ? -2.773  -8.265  -8.991  1.00 0.89  ? 58   GLU A O    3  
ATOM   7282  C CB   . GLU A 1 58  ? -1.936  -5.245  -8.054  1.00 0.86  ? 58   GLU A CB   3  
ATOM   7283  C CG   . GLU A 1 58  ? -1.795  -4.229  -6.949  1.00 0.91  ? 58   GLU A CG   3  
ATOM   7284  C CD   . GLU A 1 58  ? -2.078  -2.820  -7.397  1.00 0.93  ? 58   GLU A CD   3  
ATOM   7285  O OE1  . GLU A 1 58  ? -1.639  -2.459  -8.507  1.00 1.30  ? 58   GLU A OE1  3  
ATOM   7286  O OE2  . GLU A 1 58  ? -2.733  -2.060  -6.642  1.00 1.24  ? 58   GLU A OE2  3  
ATOM   7287  H H    . GLU A 1 58  ? 0.150   -5.985  -6.805  1.00 0.69  ? 58   GLU A H    3  
ATOM   7288  H HA   . GLU A 1 58  ? -2.496  -6.938  -6.886  1.00 0.95  ? 58   GLU A HA   3  
ATOM   7289  H HB2  . GLU A 1 58  ? -1.217  -5.015  -8.825  1.00 0.80  ? 58   GLU A HB2  3  
ATOM   7290  H HB3  . GLU A 1 58  ? -2.933  -5.168  -8.464  1.00 0.98  ? 58   GLU A HB3  3  
ATOM   7291  H HG2  . GLU A 1 58  ? -2.482  -4.482  -6.156  1.00 1.09  ? 58   GLU A HG2  3  
ATOM   7292  H HG3  . GLU A 1 58  ? -0.783  -4.276  -6.574  1.00 1.00  ? 58   GLU A HG3  3  
ATOM   7293  N N    . LEU A 1 59  ? -0.655  -7.697  -9.488  1.00 0.81  ? 59   LEU A N    3  
ATOM   7294  C CA   . LEU A 1 59  ? -0.580  -8.554  -10.666 1.00 0.87  ? 59   LEU A CA   3  
ATOM   7295  C C    . LEU A 1 59  ? -0.832  -10.014 -10.312 1.00 0.85  ? 59   LEU A C    3  
ATOM   7296  O O    . LEU A 1 59  ? -1.152  -10.829 -11.175 1.00 0.96  ? 59   LEU A O    3  
ATOM   7297  C CB   . LEU A 1 59  ? 0.780   -8.395  -11.351 1.00 0.96  ? 59   LEU A CB   3  
ATOM   7298  C CG   . LEU A 1 59  ? 2.011   -8.604  -10.462 1.00 1.06  ? 59   LEU A CG   3  
ATOM   7299  C CD1  . LEU A 1 59  ? 2.358   -10.077 -10.319 1.00 1.54  ? 59   LEU A CD1  3  
ATOM   7300  C CD2  . LEU A 1 59  ? 3.192   -7.841  -11.019 1.00 1.46  ? 59   LEU A CD2  3  
ATOM   7301  H H    . LEU A 1 59  ? 0.129   -7.157  -9.233  1.00 0.83  ? 59   LEU A H    3  
ATOM   7302  H HA   . LEU A 1 59  ? -1.351  -8.232  -11.351 1.00 0.94  ? 59   LEU A HA   3  
ATOM   7303  H HB2  . LEU A 1 59  ? 0.829   -9.105  -12.162 1.00 1.04  ? 59   LEU A HB2  3  
ATOM   7304  H HB3  . LEU A 1 59  ? 0.830   -7.401  -11.765 1.00 1.06  ? 59   LEU A HB3  3  
ATOM   7305  H HG   . LEU A 1 59  ? 1.802   -8.215  -9.477  1.00 1.87  ? 59   LEU A HG   3  
ATOM   7306  H HD11 . LEU A 1 59  ? 3.221   -10.180 -9.678  1.00 2.19  ? 59   LEU A HD11 3  
ATOM   7307  H HD12 . LEU A 1 59  ? 2.581   -10.492 -11.291 1.00 1.96  ? 59   LEU A HD12 3  
ATOM   7308  H HD13 . LEU A 1 59  ? 1.522   -10.604 -9.885  1.00 2.00  ? 59   LEU A HD13 3  
ATOM   7309  H HD21 . LEU A 1 59  ? 2.959   -6.787  -11.042 1.00 1.91  ? 59   LEU A HD21 3  
ATOM   7310  H HD22 . LEU A 1 59  ? 3.401   -8.188  -12.019 1.00 1.97  ? 59   LEU A HD22 3  
ATOM   7311  H HD23 . LEU A 1 59  ? 4.053   -8.006  -10.391 1.00 2.00  ? 59   LEU A HD23 3  
ATOM   7312  N N    . ARG A 1 60  ? -0.683  -10.338 -9.037  1.00 0.83  ? 60   ARG A N    3  
ATOM   7313  C CA   . ARG A 1 60  ? -0.880  -11.700 -8.578  1.00 0.90  ? 60   ARG A CA   3  
ATOM   7314  C C    . ARG A 1 60  ? -2.371  -12.013 -8.415  1.00 0.98  ? 60   ARG A C    3  
ATOM   7315  O O    . ARG A 1 60  ? -2.872  -12.992 -8.965  1.00 1.15  ? 60   ARG A O    3  
ATOM   7316  C CB   . ARG A 1 60  ? -0.157  -11.939 -7.247  1.00 1.03  ? 60   ARG A CB   3  
ATOM   7317  C CG   . ARG A 1 60  ? 1.304   -11.516 -7.249  1.00 1.00  ? 60   ARG A CG   3  
ATOM   7318  C CD   . ARG A 1 60  ? 2.019   -11.956 -5.980  1.00 1.07  ? 60   ARG A CD   3  
ATOM   7319  N NE   . ARG A 1 60  ? 2.174   -13.408 -5.926  1.00 1.41  ? 60   ARG A NE   3  
ATOM   7320  C CZ   . ARG A 1 60  ? 1.600   -14.187 -5.013  1.00 1.94  ? 60   ARG A CZ   3  
ATOM   7321  N NH1  . ARG A 1 60  ? 0.882   -13.650 -4.032  1.00 2.43  ? 60   ARG A NH1  3  
ATOM   7322  N NH2  . ARG A 1 60  ? 1.760   -15.501 -5.070  1.00 2.58  ? 60   ARG A NH2  3  
ATOM   7323  H H    . ARG A 1 60  ? -0.429  -9.643  -8.396  1.00 0.86  ? 60   ARG A H    3  
ATOM   7324  H HA   . ARG A 1 60  ? -0.462  -12.357 -9.326  1.00 0.94  ? 60   ARG A HA   3  
ATOM   7325  H HB2  . ARG A 1 60  ? -0.666  -11.387 -6.472  1.00 1.31  ? 60   ARG A HB2  3  
ATOM   7326  H HB3  . ARG A 1 60  ? -0.203  -12.993 -7.012  1.00 1.36  ? 60   ARG A HB3  3  
ATOM   7327  H HG2  . ARG A 1 60  ? 1.796   -11.961 -8.100  1.00 1.39  ? 60   ARG A HG2  3  
ATOM   7328  H HG3  . ARG A 1 60  ? 1.356   -10.439 -7.324  1.00 1.32  ? 60   ARG A HG3  3  
ATOM   7329  H HD2  . ARG A 1 60  ? 2.996   -11.497 -5.953  1.00 1.41  ? 60   ARG A HD2  3  
ATOM   7330  H HD3  . ARG A 1 60  ? 1.445   -11.635 -5.121  1.00 1.40  ? 60   ARG A HD3  3  
ATOM   7331  H HE   . ARG A 1 60  ? 2.737   -13.828 -6.628  1.00 1.85  ? 60   ARG A HE   3  
ATOM   7332  H HH11 . ARG A 1 60  ? 0.771   -12.657 -3.974  1.00 2.42  ? 60   ARG A HH11 3  
ATOM   7333  H HH12 . ARG A 1 60  ? 0.455   -14.236 -3.340  1.00 3.14  ? 60   ARG A HH12 3  
ATOM   7334  H HH21 . ARG A 1 60  ? 2.318   -15.912 -5.797  1.00 2.82  ? 60   ARG A HH21 3  
ATOM   7335  H HH22 . ARG A 1 60  ? 1.307   -16.101 -4.392  1.00 3.11  ? 60   ARG A HH22 3  
ATOM   7336  N N    . TYR A 1 61  ? -3.075  -11.178 -7.651  1.00 1.04  ? 61   TYR A N    3  
ATOM   7337  C CA   . TYR A 1 61  ? -4.468  -11.458 -7.294  1.00 1.26  ? 61   TYR A CA   3  
ATOM   7338  C C    . TYR A 1 61  ? -5.465  -10.836 -8.275  1.00 1.32  ? 61   TYR A C    3  
ATOM   7339  O O    . TYR A 1 61  ? -6.670  -11.071 -8.158  1.00 1.59  ? 61   TYR A O    3  
ATOM   7340  C CB   . TYR A 1 61  ? -4.771  -10.958 -5.872  1.00 1.52  ? 61   TYR A CB   3  
ATOM   7341  C CG   . TYR A 1 61  ? -5.018  -9.461  -5.766  1.00 2.19  ? 61   TYR A CG   3  
ATOM   7342  C CD1  . TYR A 1 61  ? -6.283  -8.924  -5.953  1.00 2.84  ? 61   TYR A CD1  3  
ATOM   7343  C CD2  . TYR A 1 61  ? -3.972  -8.586  -5.485  1.00 2.70  ? 61   TYR A CD2  3  
ATOM   7344  C CE1  . TYR A 1 61  ? -6.500  -7.560  -5.865  1.00 3.86  ? 61   TYR A CE1  3  
ATOM   7345  C CE2  . TYR A 1 61  ? -4.181  -7.227  -5.392  1.00 3.67  ? 61   TYR A CE2  3  
ATOM   7346  C CZ   . TYR A 1 61  ? -5.496  -6.727  -5.555  1.00 4.23  ? 61   TYR A CZ   3  
ATOM   7347  O OH   . TYR A 1 61  ? -5.648  -5.361  -5.498  1.00 5.32  ? 61   TYR A OH   3  
ATOM   7348  H H    . TYR A 1 61  ? -2.653  -10.355 -7.325  1.00 1.06  ? 61   TYR A H    3  
ATOM   7349  H HA   . TYR A 1 61  ? -4.595  -12.529 -7.313  1.00 1.33  ? 61   TYR A HA   3  
ATOM   7350  H HB2  . TYR A 1 61  ? -5.652  -11.461 -5.505  1.00 1.78  ? 61   TYR A HB2  3  
ATOM   7351  H HB3  . TYR A 1 61  ? -3.935  -11.201 -5.231  1.00 1.83  ? 61   TYR A HB3  3  
ATOM   7352  H HD1  . TYR A 1 61  ? -7.108  -9.586  -6.171  1.00 2.77  ? 61   TYR A HD1  3  
ATOM   7353  H HD2  . TYR A 1 61  ? -2.980  -8.986  -5.335  1.00 2.59  ? 61   TYR A HD2  3  
ATOM   7354  H HE1  . TYR A 1 61  ? -7.492  -7.159  -6.015  1.00 4.50  ? 61   TYR A HE1  3  
ATOM   7355  H HE2  . TYR A 1 61  ? -3.355  -6.566  -5.173  1.00 4.15  ? 61   TYR A HE2  3  
ATOM   7356  H HH   . TYR A 1 61  ? -6.588  -5.181  -5.366  1.00 5.59  ? 61   TYR A HH   3  
ATOM   7357  N N    . ARG A 1 62  ? -4.965  -10.046 -9.226  1.00 1.28  ? 62   ARG A N    3  
ATOM   7358  C CA   . ARG A 1 62  ? -5.822  -9.228  -10.093 1.00 1.39  ? 62   ARG A CA   3  
ATOM   7359  C C    . ARG A 1 62  ? -6.943  -10.044 -10.736 1.00 1.07  ? 62   ARG A C    3  
ATOM   7360  O O    . ARG A 1 62  ? -8.073  -9.570  -10.855 1.00 1.30  ? 62   ARG A O    3  
ATOM   7361  C CB   . ARG A 1 62  ? -4.989  -8.530  -11.174 1.00 1.72  ? 62   ARG A CB   3  
ATOM   7362  C CG   . ARG A 1 62  ? -5.787  -7.539  -12.006 1.00 2.15  ? 62   ARG A CG   3  
ATOM   7363  C CD   . ARG A 1 62  ? -4.894  -6.706  -12.908 1.00 2.51  ? 62   ARG A CD   3  
ATOM   7364  N NE   . ARG A 1 62  ? -5.654  -5.697  -13.646 1.00 3.10  ? 62   ARG A NE   3  
ATOM   7365  C CZ   . ARG A 1 62  ? -5.145  -4.547  -14.086 1.00 3.59  ? 62   ARG A CZ   3  
ATOM   7366  N NH1  . ARG A 1 62  ? -3.881  -4.234  -13.829 1.00 3.59  ? 62   ARG A NH1  3  
ATOM   7367  N NH2  . ARG A 1 62  ? -5.904  -3.708  -14.781 1.00 4.48  ? 62   ARG A NH2  3  
ATOM   7368  H H    . ARG A 1 62  ? -3.993  -10.009 -9.348  1.00 1.33  ? 62   ARG A H    3  
ATOM   7369  H HA   . ARG A 1 62  ? -6.275  -8.470  -9.471  1.00 1.73  ? 62   ARG A HA   3  
ATOM   7370  H HB2  . ARG A 1 62  ? -4.177  -7.999  -10.700 1.00 1.93  ? 62   ARG A HB2  3  
ATOM   7371  H HB3  . ARG A 1 62  ? -4.580  -9.279  -11.837 1.00 1.76  ? 62   ARG A HB3  3  
ATOM   7372  H HG2  . ARG A 1 62  ? -6.489  -8.082  -12.620 1.00 2.42  ? 62   ARG A HG2  3  
ATOM   7373  H HG3  . ARG A 1 62  ? -6.325  -6.880  -11.341 1.00 2.45  ? 62   ARG A HG3  3  
ATOM   7374  H HD2  . ARG A 1 62  ? -4.151  -6.210  -12.299 1.00 2.64  ? 62   ARG A HD2  3  
ATOM   7375  H HD3  . ARG A 1 62  ? -4.402  -7.360  -13.613 1.00 2.92  ? 62   ARG A HD3  3  
ATOM   7376  H HE   . ARG A 1 62  ? -6.604  -5.896  -13.834 1.00 3.50  ? 62   ARG A HE   3  
ATOM   7377  H HH11 . ARG A 1 62  ? -3.300  -4.866  -13.295 1.00 3.34  ? 62   ARG A HH11 3  
ATOM   7378  H HH12 . ARG A 1 62  ? -3.491  -3.369  -14.166 1.00 4.14  ? 62   ARG A HH12 3  
ATOM   7379  H HH21 . ARG A 1 62  ? -6.864  -3.939  -14.978 1.00 4.87  ? 62   ARG A HH21 3  
ATOM   7380  H HH22 . ARG A 1 62  ? -5.523  -2.839  -15.120 1.00 4.93  ? 62   ARG A HH22 3  
ATOM   7381  N N    . ARG A 1 63  ? -6.629  -11.268 -11.125 1.00 0.98  ? 63   ARG A N    3  
ATOM   7382  C CA   . ARG A 1 63  ? -7.598  -12.162 -11.751 1.00 1.19  ? 63   ARG A CA   3  
ATOM   7383  C C    . ARG A 1 63  ? -8.875  -12.306 -10.912 1.00 1.20  ? 63   ARG A C    3  
ATOM   7384  O O    . ARG A 1 63  ? -9.980  -12.350 -11.454 1.00 1.45  ? 63   ARG A O    3  
ATOM   7385  C CB   . ARG A 1 63  ? -6.962  -13.536 -11.951 1.00 1.61  ? 63   ARG A CB   3  
ATOM   7386  C CG   . ARG A 1 63  ? -7.857  -14.538 -12.658 1.00 2.18  ? 63   ARG A CG   3  
ATOM   7387  C CD   . ARG A 1 63  ? -7.294  -15.943 -12.546 1.00 2.52  ? 63   ARG A CD   3  
ATOM   7388  N NE   . ARG A 1 63  ? -7.205  -16.378 -11.151 1.00 3.12  ? 63   ARG A NE   3  
ATOM   7389  C CZ   . ARG A 1 63  ? -6.116  -16.920 -10.603 1.00 3.84  ? 63   ARG A CZ   3  
ATOM   7390  N NH1  . ARG A 1 63  ? -5.012  -17.077 -11.321 1.00 4.07  ? 63   ARG A NH1  3  
ATOM   7391  N NH2  . ARG A 1 63  ? -6.132  -17.287 -9.329  1.00 4.72  ? 63   ARG A NH2  3  
ATOM   7392  H H    . ARG A 1 63  ? -5.704  -11.580 -11.004 1.00 1.11  ? 63   ARG A H    3  
ATOM   7393  H HA   . ARG A 1 63  ? -7.857  -11.752 -12.714 1.00 1.34  ? 63   ARG A HA   3  
ATOM   7394  H HB2  . ARG A 1 63  ? -6.061  -13.420 -12.536 1.00 1.92  ? 63   ARG A HB2  3  
ATOM   7395  H HB3  . ARG A 1 63  ? -6.701  -13.942 -10.985 1.00 2.09  ? 63   ARG A HB3  3  
ATOM   7396  H HG2  . ARG A 1 63  ? -8.837  -14.513 -12.206 1.00 2.77  ? 63   ARG A HG2  3  
ATOM   7397  H HG3  . ARG A 1 63  ? -7.932  -14.269 -13.702 1.00 2.59  ? 63   ARG A HG3  3  
ATOM   7398  H HD2  . ARG A 1 63  ? -7.938  -16.622 -13.087 1.00 3.00  ? 63   ARG A HD2  3  
ATOM   7399  H HD3  . ARG A 1 63  ? -6.306  -15.958 -12.983 1.00 2.63  ? 63   ARG A HD3  3  
ATOM   7400  H HE   . ARG A 1 63  ? -8.011  -16.257 -10.590 1.00 3.38  ? 63   ARG A HE   3  
ATOM   7401  H HH11 . ARG A 1 63  ? -4.987  -16.788 -12.289 1.00 3.81  ? 63   ARG A HH11 3  
ATOM   7402  H HH12 . ARG A 1 63  ? -4.184  -17.472 -10.902 1.00 4.78  ? 63   ARG A HH12 3  
ATOM   7403  H HH21 . ARG A 1 63  ? -6.966  -17.152 -8.775  1.00 4.96  ? 63   ARG A HH21 3  
ATOM   7404  H HH22 . ARG A 1 63  ? -5.317  -17.706 -8.908  1.00 5.35  ? 63   ARG A HH22 3  
ATOM   7405  N N    . ALA A 1 64  ? -8.723  -12.350 -9.592  1.00 1.07  ? 64   ALA A N    3  
ATOM   7406  C CA   . ALA A 1 64  ? -9.844  -12.655 -8.709  1.00 1.09  ? 64   ALA A CA   3  
ATOM   7407  C C    . ALA A 1 64  ? -10.711 -11.439 -8.410  1.00 1.08  ? 64   ALA A C    3  
ATOM   7408  O O    . ALA A 1 64  ? -11.923 -11.515 -8.536  1.00 1.05  ? 64   ALA A O    3  
ATOM   7409  C CB   . ALA A 1 64  ? -9.354  -13.268 -7.400  1.00 1.17  ? 64   ALA A CB   3  
ATOM   7410  H H    . ALA A 1 64  ? -7.839  -12.166 -9.203  1.00 1.05  ? 64   ALA A H    3  
ATOM   7411  H HA   . ALA A 1 64  ? -10.460 -13.394 -9.204  1.00 1.12  ? 64   ALA A HA   3  
ATOM   7412  H HB1  . ALA A 1 64  ? -8.664  -12.590 -6.922  1.00 1.70  ? 64   ALA A HB1  3  
ATOM   7413  H HB2  . ALA A 1 64  ? -8.860  -14.207 -7.600  1.00 1.43  ? 64   ALA A HB2  3  
ATOM   7414  H HB3  . ALA A 1 64  ? -10.205 -13.436 -6.741  1.00 1.55  ? 64   ALA A HB3  3  
ATOM   7415  N N    . PHE A 1 65  ? -10.104 -10.317 -8.028  1.00 1.14  ? 65   PHE A N    3  
ATOM   7416  C CA   . PHE A 1 65  ? -10.869 -9.204  -7.449  1.00 1.22  ? 65   PHE A CA   3  
ATOM   7417  C C    . PHE A 1 65  ? -11.935 -8.663  -8.409  1.00 1.19  ? 65   PHE A C    3  
ATOM   7418  O O    . PHE A 1 65  ? -12.961 -8.146  -7.969  1.00 1.22  ? 65   PHE A O    3  
ATOM   7419  C CB   . PHE A 1 65  ? -9.944  -8.075  -6.957  1.00 1.47  ? 65   PHE A CB   3  
ATOM   7420  C CG   . PHE A 1 65  ? -9.557  -7.055  -7.994  1.00 1.41  ? 65   PHE A CG   3  
ATOM   7421  C CD1  . PHE A 1 65  ? -8.487  -7.277  -8.841  1.00 1.98  ? 65   PHE A CD1  3  
ATOM   7422  C CD2  . PHE A 1 65  ? -10.257 -5.862  -8.104  1.00 1.67  ? 65   PHE A CD2  3  
ATOM   7423  C CE1  . PHE A 1 65  ? -8.122  -6.331  -9.779  1.00 2.59  ? 65   PHE A CE1  3  
ATOM   7424  C CE2  . PHE A 1 65  ? -9.898  -4.915  -9.043  1.00 2.44  ? 65   PHE A CE2  3  
ATOM   7425  C CZ   . PHE A 1 65  ? -8.829  -5.151  -9.881  1.00 2.81  ? 65   PHE A CZ   3  
ATOM   7426  H H    . PHE A 1 65  ? -9.133  -10.233 -8.133  1.00 1.17  ? 65   PHE A H    3  
ATOM   7427  H HA   . PHE A 1 65  ? -11.385 -9.606  -6.588  1.00 1.22  ? 65   PHE A HA   3  
ATOM   7428  H HB2  . PHE A 1 65  ? -10.437 -7.549  -6.154  1.00 1.77  ? 65   PHE A HB2  3  
ATOM   7429  H HB3  . PHE A 1 65  ? -9.034  -8.518  -6.576  1.00 2.14  ? 65   PHE A HB3  3  
ATOM   7430  H HD1  . PHE A 1 65  ? -7.934  -8.200  -8.765  1.00 2.28  ? 65   PHE A HD1  3  
ATOM   7431  H HD2  . PHE A 1 65  ? -11.095 -5.677  -7.448  1.00 1.72  ? 65   PHE A HD2  3  
ATOM   7432  H HE1  . PHE A 1 65  ? -7.284  -6.516  -10.434 1.00 3.15  ? 65   PHE A HE1  3  
ATOM   7433  H HE2  . PHE A 1 65  ? -10.453 -3.992  -9.119  1.00 2.98  ? 65   PHE A HE2  3  
ATOM   7434  H HZ   . PHE A 1 65  ? -8.544  -4.410  -10.615 1.00 3.52  ? 65   PHE A HZ   3  
ATOM   7435  N N    . SER A 1 66  ? -11.711 -8.810  -9.712  1.00 1.20  ? 66   SER A N    3  
ATOM   7436  C CA   . SER A 1 66  ? -12.690 -8.372  -10.702 1.00 1.24  ? 66   SER A CA   3  
ATOM   7437  C C    . SER A 1 66  ? -13.943 -9.249  -10.627 1.00 1.13  ? 66   SER A C    3  
ATOM   7438  O O    . SER A 1 66  ? -15.059 -8.785  -10.855 1.00 1.16  ? 66   SER A O    3  
ATOM   7439  C CB   . SER A 1 66  ? -12.084 -8.419  -12.110 1.00 1.45  ? 66   SER A CB   3  
ATOM   7440  O OG   . SER A 1 66  ? -12.927 -7.780  -13.057 1.00 2.19  ? 66   SER A OG   3  
ATOM   7441  H H    . SER A 1 66  ? -10.873 -9.219  -10.013 1.00 1.21  ? 66   SER A H    3  
ATOM   7442  H HA   . SER A 1 66  ? -12.964 -7.353  -10.469 1.00 1.29  ? 66   SER A HA   3  
ATOM   7443  H HB2  . SER A 1 66  ? -11.128 -7.917  -12.104 1.00 1.81  ? 66   SER A HB2  3  
ATOM   7444  H HB3  . SER A 1 66  ? -11.948 -9.448  -12.405 1.00 1.57  ? 66   SER A HB3  3  
ATOM   7445  H HG   . SER A 1 66  ? -13.478 -7.119  -12.602 1.00 2.59  ? 66   SER A HG   3  
ATOM   7446  N N    . ASP A 1 67  ? -13.743 -10.515 -10.288 1.00 1.09  ? 67   ASP A N    3  
ATOM   7447  C CA   . ASP A 1 67  ? -14.841 -11.462 -10.128 1.00 1.08  ? 67   ASP A CA   3  
ATOM   7448  C C    . ASP A 1 67  ? -15.341 -11.456 -8.692  1.00 0.97  ? 67   ASP A C    3  
ATOM   7449  O O    . ASP A 1 67  ? -16.495 -11.783 -8.409  1.00 1.01  ? 67   ASP A O    3  
ATOM   7450  C CB   . ASP A 1 67  ? -14.376 -12.873 -10.499 1.00 1.18  ? 67   ASP A CB   3  
ATOM   7451  C CG   . ASP A 1 67  ? -14.251 -13.071 -11.993 1.00 1.86  ? 67   ASP A CG   3  
ATOM   7452  O OD1  . ASP A 1 67  ? -15.266 -13.390 -12.642 1.00 2.06  ? 67   ASP A OD1  3  
ATOM   7453  O OD2  . ASP A 1 67  ? -13.136 -12.917 -12.529 1.00 2.72  ? 67   ASP A OD2  3  
ATOM   7454  H H    . ASP A 1 67  ? -12.824 -10.826 -10.135 1.00 1.12  ? 67   ASP A H    3  
ATOM   7455  H HA   . ASP A 1 67  ? -15.643 -11.166 -10.786 1.00 1.16  ? 67   ASP A HA   3  
ATOM   7456  H HB2  . ASP A 1 67  ? -13.409 -13.054 -10.051 1.00 1.30  ? 67   ASP A HB2  3  
ATOM   7457  H HB3  . ASP A 1 67  ? -15.081 -13.591 -10.114 1.00 1.39  ? 67   ASP A HB3  3  
ATOM   7458  N N    . LEU A 1 68  ? -14.454 -11.082 -7.787  1.00 0.89  ? 68   LEU A N    3  
ATOM   7459  C CA   . LEU A 1 68  ? -14.739 -11.099 -6.366  1.00 0.85  ? 68   LEU A CA   3  
ATOM   7460  C C    . LEU A 1 68  ? -15.640 -9.952  -5.942  1.00 0.76  ? 68   LEU A C    3  
ATOM   7461  O O    . LEU A 1 68  ? -16.239 -10.018 -4.879  1.00 0.77  ? 68   LEU A O    3  
ATOM   7462  C CB   . LEU A 1 68  ? -13.433 -11.083 -5.564  1.00 0.91  ? 68   LEU A CB   3  
ATOM   7463  C CG   . LEU A 1 68  ? -12.861 -12.462 -5.211  1.00 1.06  ? 68   LEU A CG   3  
ATOM   7464  C CD1  . LEU A 1 68  ? -13.073 -13.452 -6.339  1.00 1.54  ? 68   LEU A CD1  3  
ATOM   7465  C CD2  . LEU A 1 68  ? -11.389 -12.354 -4.860  1.00 1.56  ? 68   LEU A CD2  3  
ATOM   7466  H H    . LEU A 1 68  ? -13.560 -10.809 -8.086  1.00 0.92  ? 68   LEU A H    3  
ATOM   7467  H HA   . LEU A 1 68  ? -15.253 -12.024 -6.154  1.00 0.96  ? 68   LEU A HA   3  
ATOM   7468  H HB2  . LEU A 1 68  ? -12.691 -10.546 -6.133  1.00 1.15  ? 68   LEU A HB2  3  
ATOM   7469  H HB3  . LEU A 1 68  ? -13.611 -10.547 -4.643  1.00 1.11  ? 68   LEU A HB3  3  
ATOM   7470  H HG   . LEU A 1 68  ? -13.374 -12.842 -4.351  1.00 1.87  ? 68   LEU A HG   3  
ATOM   7471  H HD11 . LEU A 1 68  ? -12.595 -14.388 -6.093  1.00 2.00  ? 68   LEU A HD11 3  
ATOM   7472  H HD12 . LEU A 1 68  ? -12.652 -13.058 -7.252  1.00 2.00  ? 68   LEU A HD12 3  
ATOM   7473  H HD13 . LEU A 1 68  ? -14.137 -13.613 -6.467  1.00 2.16  ? 68   LEU A HD13 3  
ATOM   7474  H HD21 . LEU A 1 68  ? -10.847 -11.946 -5.698  1.00 1.93  ? 68   LEU A HD21 3  
ATOM   7475  H HD22 . LEU A 1 68  ? -11.002 -13.336 -4.623  1.00 2.25  ? 68   LEU A HD22 3  
ATOM   7476  H HD23 . LEU A 1 68  ? -11.274 -11.707 -4.003  1.00 1.99  ? 68   LEU A HD23 3  
ATOM   7477  N N    . THR A 1 69  ? -15.756 -8.910  -6.760  1.00 0.70  ? 69   THR A N    3  
ATOM   7478  C CA   . THR A 1 69  ? -16.609 -7.773  -6.413  1.00 0.62  ? 69   THR A CA   3  
ATOM   7479  C C    . THR A 1 69  ? -18.044 -8.221  -6.166  1.00 0.63  ? 69   THR A C    3  
ATOM   7480  O O    . THR A 1 69  ? -18.736 -7.680  -5.303  1.00 0.60  ? 69   THR A O    3  
ATOM   7481  C CB   . THR A 1 69  ? -16.580 -6.688  -7.499  1.00 0.62  ? 69   THR A CB   3  
ATOM   7482  O OG1  . THR A 1 69  ? -16.468 -7.289  -8.796  1.00 0.69  ? 69   THR A OG1  3  
ATOM   7483  C CG2  . THR A 1 69  ? -15.426 -5.734  -7.265  1.00 0.63  ? 69   THR A CG2  3  
ATOM   7484  H H    . THR A 1 69  ? -15.266 -8.903  -7.609  1.00 0.73  ? 69   THR A H    3  
ATOM   7485  H HA   . THR A 1 69  ? -16.223 -7.344  -5.499  1.00 0.59  ? 69   THR A HA   3  
ATOM   7486  H HB   . THR A 1 69  ? -17.504 -6.126  -7.448  1.00 0.61  ? 69   THR A HB   3  
ATOM   7487  H HG1  . THR A 1 69  ? -15.669 -6.966  -9.230  1.00 0.77  ? 69   THR A HG1  3  
ATOM   7488  H HG21 . THR A 1 69  ? -15.349 -5.050  -8.097  1.00 1.26  ? 69   THR A HG21 3  
ATOM   7489  H HG22 . THR A 1 69  ? -14.507 -6.293  -7.170  1.00 1.12  ? 69   THR A HG22 3  
ATOM   7490  H HG23 . THR A 1 69  ? -15.603 -5.173  -6.356  1.00 1.21  ? 69   THR A HG23 3  
ATOM   7491  N N    . SER A 1 70  ? -18.472 -9.229  -6.914  1.00 0.72  ? 70   SER A N    3  
ATOM   7492  C CA   . SER A 1 70  ? -19.763 -9.856  -6.693  1.00 0.80  ? 70   SER A CA   3  
ATOM   7493  C C    . SER A 1 70  ? -19.790 -10.521 -5.319  1.00 0.76  ? 70   SER A C    3  
ATOM   7494  O O    . SER A 1 70  ? -20.767 -10.420 -4.577  1.00 0.76  ? 70   SER A O    3  
ATOM   7495  C CB   . SER A 1 70  ? -20.012 -10.903 -7.778  1.00 0.96  ? 70   SER A CB   3  
ATOM   7496  O OG   . SER A 1 70  ? -21.270 -11.534 -7.613  1.00 1.34  ? 70   SER A OG   3  
ATOM   7497  H H    . SER A 1 70  ? -17.905 -9.552  -7.647  1.00 0.77  ? 70   SER A H    3  
ATOM   7498  H HA   . SER A 1 70  ? -20.526 -9.094  -6.740  1.00 0.83  ? 70   SER A HA   3  
ATOM   7499  H HB2  . SER A 1 70  ? -19.985 -10.427 -8.747  1.00 1.16  ? 70   SER A HB2  3  
ATOM   7500  H HB3  . SER A 1 70  ? -19.236 -11.654 -7.723  1.00 1.25  ? 70   SER A HB3  3  
ATOM   7501  H HG   . SER A 1 70  ? -21.897 -11.179 -8.264  1.00 1.80  ? 70   SER A HG   3  
ATOM   7502  N N    . GLN A 1 71  ? -18.685 -11.173 -4.988  1.00 0.77  ? 71   GLN A N    3  
ATOM   7503  C CA   . GLN A 1 71  ? -18.545 -11.899 -3.734  1.00 0.77  ? 71   GLN A CA   3  
ATOM   7504  C C    . GLN A 1 71  ? -18.550 -10.938 -2.554  1.00 0.67  ? 71   GLN A C    3  
ATOM   7505  O O    . GLN A 1 71  ? -19.117 -11.225 -1.501  1.00 0.74  ? 71   GLN A O    3  
ATOM   7506  C CB   . GLN A 1 71  ? -17.241 -12.696 -3.744  1.00 0.81  ? 71   GLN A CB   3  
ATOM   7507  C CG   . GLN A 1 71  ? -17.022 -13.491 -5.007  1.00 0.99  ? 71   GLN A CG   3  
ATOM   7508  C CD   . GLN A 1 71  ? -15.976 -14.561 -4.818  1.00 1.09  ? 71   GLN A CD   3  
ATOM   7509  O OE1  . GLN A 1 71  ? -15.990 -15.592 -5.489  1.00 1.31  ? 71   GLN A OE1  3  
ATOM   7510  N NE2  . GLN A 1 71  ? -15.071 -14.335 -3.878  1.00 1.42  ? 71   GLN A NE2  3  
ATOM   7511  H H    . GLN A 1 71  ? -17.928 -11.157 -5.609  1.00 0.83  ? 71   GLN A H    3  
ATOM   7512  H HA   . GLN A 1 71  ? -19.379 -12.579 -3.643  1.00 0.86  ? 71   GLN A HA   3  
ATOM   7513  H HB2  . GLN A 1 71  ? -16.407 -12.012 -3.645  1.00 0.73  ? 71   GLN A HB2  3  
ATOM   7514  H HB3  . GLN A 1 71  ? -17.237 -13.378 -2.910  1.00 0.90  ? 71   GLN A HB3  3  
ATOM   7515  H HG2  . GLN A 1 71  ? -17.952 -13.954 -5.302  1.00 1.41  ? 71   GLN A HG2  3  
ATOM   7516  H HG3  . GLN A 1 71  ? -16.687 -12.810 -5.780  1.00 1.35  ? 71   GLN A HG3  3  
ATOM   7517  H HE21 . GLN A 1 71  ? -15.127 -13.495 -3.364  1.00 1.32  ? 71   GLN A HE21 3  
ATOM   7518  H HE22 . GLN A 1 71  ? -14.391 -15.019 -3.725  1.00 1.89  ? 71   GLN A HE22 3  
ATOM   7519  N N    . LEU A 1 72  ? -17.899 -9.801  -2.741  1.00 0.59  ? 72   LEU A N    3  
ATOM   7520  C CA   . LEU A 1 72  ? -17.843 -8.770  -1.720  1.00 0.55  ? 72   LEU A CA   3  
ATOM   7521  C C    . LEU A 1 72  ? -19.164 -8.012  -1.657  1.00 0.47  ? 72   LEU A C    3  
ATOM   7522  O O    . LEU A 1 72  ? -19.569 -7.542  -0.598  1.00 0.48  ? 72   LEU A O    3  
ATOM   7523  C CB   . LEU A 1 72  ? -16.693 -7.800  -2.010  1.00 0.59  ? 72   LEU A CB   3  
ATOM   7524  C CG   . LEU A 1 72  ? -15.290 -8.414  -1.952  1.00 0.76  ? 72   LEU A CG   3  
ATOM   7525  C CD1  . LEU A 1 72  ? -14.570 -8.249  -3.279  1.00 1.37  ? 72   LEU A CD1  3  
ATOM   7526  C CD2  . LEU A 1 72  ? -14.478 -7.785  -0.836  1.00 1.35  ? 72   LEU A CD2  3  
ATOM   7527  H H    . LEU A 1 72  ? -17.432 -9.655  -3.594  1.00 0.60  ? 72   LEU A H    3  
ATOM   7528  H HA   . LEU A 1 72  ? -17.670 -9.248  -0.770  1.00 0.62  ? 72   LEU A HA   3  
ATOM   7529  H HB2  . LEU A 1 72  ? -16.840 -7.387  -2.997  1.00 0.55  ? 72   LEU A HB2  3  
ATOM   7530  H HB3  . LEU A 1 72  ? -16.738 -6.995  -1.292  1.00 0.70  ? 72   LEU A HB3  3  
ATOM   7531  H HG   . LEU A 1 72  ? -15.375 -9.472  -1.748  1.00 1.69  ? 72   LEU A HG   3  
ATOM   7532  H HD11 . LEU A 1 72  ? -13.538 -8.547  -3.169  1.00 1.90  ? 72   LEU A HD11 3  
ATOM   7533  H HD12 . LEU A 1 72  ? -14.617 -7.216  -3.594  1.00 1.96  ? 72   LEU A HD12 3  
ATOM   7534  H HD13 . LEU A 1 72  ? -15.045 -8.879  -4.026  1.00 1.98  ? 72   LEU A HD13 3  
ATOM   7535  H HD21 . LEU A 1 72  ? -14.414 -6.719  -0.996  1.00 1.79  ? 72   LEU A HD21 3  
ATOM   7536  H HD22 . LEU A 1 72  ? -13.485 -8.209  -0.836  1.00 1.93  ? 72   LEU A HD22 3  
ATOM   7537  H HD23 . LEU A 1 72  ? -14.956 -7.981  0.111   1.00 1.96  ? 72   LEU A HD23 3  
ATOM   7538  N N    . HIS A 1 73  ? -19.837 -7.925  -2.802  1.00 0.48  ? 73   HIS A N    3  
ATOM   7539  C CA   . HIS A 1 73  ? -21.084 -7.172  -2.932  1.00 0.48  ? 73   HIS A CA   3  
ATOM   7540  C C    . HIS A 1 73  ? -20.799 -5.686  -2.796  1.00 0.43  ? 73   HIS A C    3  
ATOM   7541  O O    . HIS A 1 73  ? -21.427 -4.981  -2.005  1.00 0.52  ? 73   HIS A O    3  
ATOM   7542  C CB   . HIS A 1 73  ? -22.142 -7.613  -1.905  1.00 0.55  ? 73   HIS A CB   3  
ATOM   7543  C CG   . HIS A 1 73  ? -22.542 -9.053  -2.017  1.00 1.20  ? 73   HIS A CG   3  
ATOM   7544  N ND1  . HIS A 1 73  ? -23.563 -9.491  -2.831  1.00 2.06  ? 73   HIS A ND1  3  
ATOM   7545  C CD2  . HIS A 1 73  ? -22.046 -10.159 -1.416  1.00 1.97  ? 73   HIS A CD2  3  
ATOM   7546  C CE1  . HIS A 1 73  ? -23.675 -10.801 -2.727  1.00 2.72  ? 73   HIS A CE1  3  
ATOM   7547  N NE2  . HIS A 1 73  ? -22.764 -11.233 -1.876  1.00 2.62  ? 73   HIS A NE2  3  
ATOM   7548  H H    . HIS A 1 73  ? -19.472 -8.372  -3.598  1.00 0.53  ? 73   HIS A H    3  
ATOM   7549  H HA   . HIS A 1 73  ? -21.463 -7.351  -3.927  1.00 0.56  ? 73   HIS A HA   3  
ATOM   7550  H HB2  . HIS A 1 73  ? -21.752 -7.457  -0.911  1.00 1.05  ? 73   HIS A HB2  3  
ATOM   7551  H HB3  . HIS A 1 73  ? -23.029 -7.010  -2.034  1.00 0.86  ? 73   HIS A HB3  3  
ATOM   7552  H HD1  . HIS A 1 73  ? -24.131 -8.918  -3.407  1.00 2.50  ? 73   HIS A HD1  3  
ATOM   7553  H HD2  . HIS A 1 73  ? -21.231 -10.190 -0.706  1.00 2.48  ? 73   HIS A HD2  3  
ATOM   7554  H HE1  . HIS A 1 73  ? -24.390 -11.418 -3.252  1.00 3.54  ? 73   HIS A HE1  3  
ATOM   7555  H HE2  . HIS A 1 73  ? -22.509 -12.181 -1.753  1.00 3.26  ? 73   HIS A HE2  3  
ATOM   7556  N N    . ILE A 1 74  ? -19.822 -5.238  -3.572  1.00 0.45  ? 74   ILE A N    3  
ATOM   7557  C CA   . ILE A 1 74  ? -19.408 -3.844  -3.608  1.00 0.41  ? 74   ILE A CA   3  
ATOM   7558  C C    . ILE A 1 74  ? -20.582 -2.922  -3.925  1.00 0.49  ? 74   ILE A C    3  
ATOM   7559  O O    . ILE A 1 74  ? -21.166 -2.976  -5.010  1.00 0.91  ? 74   ILE A O    3  
ATOM   7560  C CB   . ILE A 1 74  ? -18.296 -3.669  -4.650  1.00 0.38  ? 74   ILE A CB   3  
ATOM   7561  C CG1  . ILE A 1 74  ? -17.109 -4.554  -4.277  1.00 0.36  ? 74   ILE A CG1  3  
ATOM   7562  C CG2  . ILE A 1 74  ? -17.867 -2.218  -4.742  1.00 0.44  ? 74   ILE A CG2  3  
ATOM   7563  C CD1  . ILE A 1 74  ? -16.364 -4.073  -3.052  1.00 0.39  ? 74   ILE A CD1  3  
ATOM   7564  H H    . ILE A 1 74  ? -19.352 -5.877  -4.148  1.00 0.57  ? 74   ILE A H    3  
ATOM   7565  H HA   . ILE A 1 74  ? -19.008 -3.586  -2.638  1.00 0.40  ? 74   ILE A HA   3  
ATOM   7566  H HB   . ILE A 1 74  ? -18.677 -3.972  -5.613  1.00 0.44  ? 74   ILE A HB   3  
ATOM   7567  H HG12 . ILE A 1 74  ? -17.465 -5.548  -4.074  1.00 0.38  ? 74   ILE A HG12 3  
ATOM   7568  H HG13 . ILE A 1 74  ? -16.419 -4.591  -5.101  1.00 0.36  ? 74   ILE A HG13 3  
ATOM   7569  H HG21 . ILE A 1 74  ? -17.069 -2.129  -5.472  1.00 0.98  ? 74   ILE A HG21 3  
ATOM   7570  H HG22 . ILE A 1 74  ? -17.514 -1.885  -3.776  1.00 1.15  ? 74   ILE A HG22 3  
ATOM   7571  H HG23 . ILE A 1 74  ? -18.705 -1.611  -5.050  1.00 1.08  ? 74   ILE A HG23 3  
ATOM   7572  H HD11 . ILE A 1 74  ? -17.069 -3.893  -2.249  1.00 1.10  ? 74   ILE A HD11 3  
ATOM   7573  H HD12 . ILE A 1 74  ? -15.843 -3.156  -3.289  1.00 1.13  ? 74   ILE A HD12 3  
ATOM   7574  H HD13 . ILE A 1 74  ? -15.653 -4.823  -2.748  1.00 1.05  ? 74   ILE A HD13 3  
ATOM   7575  N N    . THR A 1 75  ? -20.921 -2.093  -2.954  1.00 0.38  ? 75   THR A N    3  
ATOM   7576  C CA   . THR A 1 75  ? -22.114 -1.274  -3.005  1.00 0.40  ? 75   THR A CA   3  
ATOM   7577  C C    . THR A 1 75  ? -21.934 -0.124  -1.983  1.00 0.37  ? 75   THR A C    3  
ATOM   7578  O O    . THR A 1 75  ? -20.809 0.084   -1.524  1.00 0.34  ? 75   THR A O    3  
ATOM   7579  C CB   . THR A 1 75  ? -23.335 -2.190  -2.686  1.00 0.46  ? 75   THR A CB   3  
ATOM   7580  O OG1  . THR A 1 75  ? -24.521 -1.761  -3.370  1.00 0.51  ? 75   THR A OG1  3  
ATOM   7581  C CG2  . THR A 1 75  ? -23.603 -2.258  -1.192  1.00 0.46  ? 75   THR A CG2  3  
ATOM   7582  H H    . THR A 1 75  ? -20.339 -2.020  -2.169  1.00 0.63  ? 75   THR A H    3  
ATOM   7583  H HA   . THR A 1 75  ? -22.218 -0.869  -4.002  1.00 0.42  ? 75   THR A HA   3  
ATOM   7584  H HB   . THR A 1 75  ? -23.094 -3.189  -3.025  1.00 0.48  ? 75   THR A HB   3  
ATOM   7585  H HG1  . THR A 1 75  ? -25.291 -2.214  -2.985  1.00 0.93  ? 75   THR A HG1  3  
ATOM   7586  H HG21 . THR A 1 75  ? -22.727 -2.631  -0.685  1.00 1.10  ? 75   THR A HG21 3  
ATOM   7587  H HG22 . THR A 1 75  ? -24.437 -2.919  -1.005  1.00 1.12  ? 75   THR A HG22 3  
ATOM   7588  H HG23 . THR A 1 75  ? -23.838 -1.269  -0.827  1.00 1.04  ? 75   THR A HG23 3  
ATOM   7589  N N    . PRO A 1 76  ? -22.987 0.681   -1.681  1.00 0.38  ? 76   PRO A N    3  
ATOM   7590  C CA   . PRO A 1 76  ? -23.076 1.553   -0.502  1.00 0.37  ? 76   PRO A CA   3  
ATOM   7591  C C    . PRO A 1 76  ? -22.305 1.066   0.736   1.00 0.35  ? 76   PRO A C    3  
ATOM   7592  O O    . PRO A 1 76  ? -21.859 -0.077  0.798   1.00 0.35  ? 76   PRO A O    3  
ATOM   7593  C CB   . PRO A 1 76  ? -24.581 1.567   -0.217  1.00 0.42  ? 76   PRO A CB   3  
ATOM   7594  C CG   . PRO A 1 76  ? -25.253 1.173   -1.499  1.00 0.47  ? 76   PRO A CG   3  
ATOM   7595  C CD   . PRO A 1 76  ? -24.169 0.896   -2.509  1.00 0.44  ? 76   PRO A CD   3  
ATOM   7596  H HA   . PRO A 1 76  ? -22.752 2.556   -0.736  1.00 0.37  ? 76   PRO A HA   3  
ATOM   7597  H HB2  . PRO A 1 76  ? -24.801 0.862   0.569   1.00 0.42  ? 76   PRO A HB2  3  
ATOM   7598  H HB3  . PRO A 1 76  ? -24.879 2.558   0.092   1.00 0.45  ? 76   PRO A HB3  3  
ATOM   7599  H HG2  . PRO A 1 76  ? -25.845 0.284   -1.341  1.00 0.52  ? 76   PRO A HG2  3  
ATOM   7600  H HG3  . PRO A 1 76  ? -25.882 1.981   -1.841  1.00 0.53  ? 76   PRO A HG3  3  
ATOM   7601  H HD2  . PRO A 1 76  ? -24.403 0.015   -3.085  1.00 0.46  ? 76   PRO A HD2  3  
ATOM   7602  H HD3  . PRO A 1 76  ? -24.035 1.746   -3.155  1.00 0.44  ? 76   PRO A HD3  3  
ATOM   7603  N N    . GLY A 1 77  ? -22.174 1.985   1.703   1.00 0.36  ? 77   GLY A N    3  
ATOM   7604  C CA   . GLY A 1 77  ? -21.367 1.827   2.927   1.00 0.37  ? 77   GLY A CA   3  
ATOM   7605  C C    . GLY A 1 77  ? -21.170 0.414   3.474   1.00 0.38  ? 77   GLY A C    3  
ATOM   7606  O O    . GLY A 1 77  ? -20.164 0.151   4.127   1.00 0.40  ? 77   GLY A O    3  
ATOM   7607  H H    . GLY A 1 77  ? -22.655 2.835   1.580   1.00 0.38  ? 77   GLY A H    3  
ATOM   7608  H HA2  . GLY A 1 77  ? -20.394 2.247   2.743   1.00 0.35  ? 77   GLY A HA2  3  
ATOM   7609  H HA3  . GLY A 1 77  ? -21.842 2.415   3.702   1.00 0.41  ? 77   GLY A HA3  3  
ATOM   7610  N N    . THR A 1 78  ? -22.091 -0.499  3.231   1.00 0.40  ? 78   THR A N    3  
ATOM   7611  C CA   . THR A 1 78  ? -21.934 -1.871  3.689   1.00 0.42  ? 78   THR A CA   3  
ATOM   7612  C C    . THR A 1 78  ? -20.765 -2.575  2.999   1.00 0.38  ? 78   THR A C    3  
ATOM   7613  O O    . THR A 1 78  ? -20.491 -3.748  3.262   1.00 0.40  ? 78   THR A O    3  
ATOM   7614  C CB   . THR A 1 78  ? -23.222 -2.674  3.482   1.00 0.49  ? 78   THR A CB   3  
ATOM   7615  O OG1  . THR A 1 78  ? -23.652 -2.588  2.115   1.00 0.50  ? 78   THR A OG1  3  
ATOM   7616  C CG2  . THR A 1 78  ? -24.297 -2.137  4.399   1.00 0.56  ? 78   THR A CG2  3  
ATOM   7617  H H    . THR A 1 78  ? -22.888 -0.253  2.717   1.00 0.41  ? 78   THR A H    3  
ATOM   7618  H HA   . THR A 1 78  ? -21.732 -1.837  4.749   1.00 0.46  ? 78   THR A HA   3  
ATOM   7619  H HB   . THR A 1 78  ? -23.035 -3.707  3.735   1.00 0.49  ? 78   THR A HB   3  
ATOM   7620  H HG1  . THR A 1 78  ? -22.957 -2.942  1.538   1.00 0.80  ? 78   THR A HG1  3  
ATOM   7621  H HG21 . THR A 1 78  ? -24.028 -2.352  5.422   1.00 1.12  ? 78   THR A HG21 3  
ATOM   7622  H HG22 . THR A 1 78  ? -25.243 -2.600  4.163   1.00 1.22  ? 78   THR A HG22 3  
ATOM   7623  H HG23 . THR A 1 78  ? -24.370 -1.063  4.265   1.00 1.14  ? 78   THR A HG23 3  
ATOM   7624  N N    . ALA A 1 79  ? -20.056 -1.847  2.138   1.00 0.34  ? 79   ALA A N    3  
ATOM   7625  C CA   . ALA A 1 79  ? -18.859 -2.367  1.510   1.00 0.31  ? 79   ALA A CA   3  
ATOM   7626  C C    . ALA A 1 79  ? -17.717 -2.424  2.517   1.00 0.30  ? 79   ALA A C    3  
ATOM   7627  O O    . ALA A 1 79  ? -16.688 -3.044  2.262   1.00 0.31  ? 79   ALA A O    3  
ATOM   7628  C CB   . ALA A 1 79  ? -18.469 -1.526  0.308   1.00 0.32  ? 79   ALA A CB   3  
ATOM   7629  H H    . ALA A 1 79  ? -20.359 -0.935  1.914   1.00 0.36  ? 79   ALA A H    3  
ATOM   7630  H HA   . ALA A 1 79  ? -19.071 -3.369  1.167   1.00 0.33  ? 79   ALA A HA   3  
ATOM   7631  H HB1  . ALA A 1 79  ? -18.015 -0.608  0.648   1.00 1.07  ? 79   ALA A HB1  3  
ATOM   7632  H HB2  . ALA A 1 79  ? -19.354 -1.298  -0.268  1.00 1.03  ? 79   ALA A HB2  3  
ATOM   7633  H HB3  . ALA A 1 79  ? -17.766 -2.076  -0.311  1.00 1.05  ? 79   ALA A HB3  3  
ATOM   7634  N N    . TYR A 1 80  ? -17.903 -1.783  3.674   1.00 0.33  ? 80   TYR A N    3  
ATOM   7635  C CA   . TYR A 1 80  ? -16.914 -1.875  4.746   1.00 0.36  ? 80   TYR A CA   3  
ATOM   7636  C C    . TYR A 1 80  ? -17.009 -3.247  5.375   1.00 0.36  ? 80   TYR A C    3  
ATOM   7637  O O    . TYR A 1 80  ? -16.067 -3.725  5.991   1.00 0.38  ? 80   TYR A O    3  
ATOM   7638  C CB   . TYR A 1 80  ? -17.127 -0.828  5.846   1.00 0.44  ? 80   TYR A CB   3  
ATOM   7639  C CG   . TYR A 1 80  ? -17.462 0.565   5.371   1.00 1.15  ? 80   TYR A CG   3  
ATOM   7640  C CD1  . TYR A 1 80  ? -16.933 1.087   4.197   1.00 1.69  ? 80   TYR A CD1  3  
ATOM   7641  C CD2  . TYR A 1 80  ? -18.332 1.355   6.110   1.00 2.21  ? 80   TYR A CD2  3  
ATOM   7642  C CE1  . TYR A 1 80  ? -17.266 2.359   3.775   1.00 2.52  ? 80   TYR A CE1  3  
ATOM   7643  C CE2  . TYR A 1 80  ? -18.671 2.622   5.694   1.00 3.13  ? 80   TYR A CE2  3  
ATOM   7644  C CZ   . TYR A 1 80  ? -18.136 3.118   4.530   1.00 3.12  ? 80   TYR A CZ   3  
ATOM   7645  O OH   . TYR A 1 80  ? -18.483 4.377   4.116   1.00 4.13  ? 80   TYR A OH   3  
ATOM   7646  H H    . TYR A 1 80  ? -18.716 -1.243  3.806   1.00 0.35  ? 80   TYR A H    3  
ATOM   7647  H HA   . TYR A 1 80  ? -15.931 -1.755  4.312   1.00 0.36  ? 80   TYR A HA   3  
ATOM   7648  H HB2  . TYR A 1 80  ? -17.936 -1.153  6.481   1.00 1.09  ? 80   TYR A HB2  3  
ATOM   7649  H HB3  . TYR A 1 80  ? -16.227 -0.764  6.435   1.00 0.85  ? 80   TYR A HB3  3  
ATOM   7650  H HD1  . TYR A 1 80  ? -16.254 0.485   3.612   1.00 1.99  ? 80   TYR A HD1  3  
ATOM   7651  H HD2  . TYR A 1 80  ? -18.750 0.960   7.024   1.00 2.57  ? 80   TYR A HD2  3  
ATOM   7652  H HE1  . TYR A 1 80  ? -16.848 2.753   2.861   1.00 3.04  ? 80   TYR A HE1  3  
ATOM   7653  H HE2  . TYR A 1 80  ? -19.350 3.221   6.283   1.00 4.05  ? 80   TYR A HE2  3  
ATOM   7654  H HH   . TYR A 1 80  ? -18.348 5.001   4.847   1.00 4.31  ? 80   TYR A HH   3  
ATOM   7655  N N    . GLN A 1 81  ? -18.171 -3.867  5.215   1.00 0.37  ? 81   GLN A N    3  
ATOM   7656  C CA   . GLN A 1 81  ? -18.396 -5.219  5.698   1.00 0.41  ? 81   GLN A CA   3  
ATOM   7657  C C    . GLN A 1 81  ? -17.842 -6.218  4.700   1.00 0.41  ? 81   GLN A C    3  
ATOM   7658  O O    . GLN A 1 81  ? -17.467 -7.337  5.051   1.00 0.46  ? 81   GLN A O    3  
ATOM   7659  C CB   . GLN A 1 81  ? -19.886 -5.458  5.939   1.00 0.45  ? 81   GLN A CB   3  
ATOM   7660  C CG   . GLN A 1 81  ? -20.365 -4.948  7.285   1.00 0.58  ? 81   GLN A CG   3  
ATOM   7661  C CD   . GLN A 1 81  ? -21.875 -4.898  7.394   1.00 0.68  ? 81   GLN A CD   3  
ATOM   7662  O OE1  . GLN A 1 81  ? -22.518 -5.882  7.762   1.00 1.03  ? 81   GLN A OE1  3  
ATOM   7663  N NE2  . GLN A 1 81  ? -22.447 -3.746  7.085   1.00 0.79  ? 81   GLN A NE2  3  
ATOM   7664  H H    . GLN A 1 81  ? -18.897 -3.399  4.748   1.00 0.36  ? 81   GLN A H    3  
ATOM   7665  H HA   . GLN A 1 81  ? -17.863 -5.327  6.625   1.00 0.44  ? 81   GLN A HA   3  
ATOM   7666  H HB2  . GLN A 1 81  ? -20.453 -4.954  5.166   1.00 0.45  ? 81   GLN A HB2  3  
ATOM   7667  H HB3  . GLN A 1 81  ? -20.083 -6.517  5.886   1.00 0.47  ? 81   GLN A HB3  3  
ATOM   7668  H HG2  . GLN A 1 81  ? -19.988 -5.601  8.058   1.00 0.67  ? 81   GLN A HG2  3  
ATOM   7669  H HG3  . GLN A 1 81  ? -19.975 -3.951  7.435   1.00 0.63  ? 81   GLN A HG3  3  
ATOM   7670  H HE21 . GLN A 1 81  ? -21.868 -3.001  6.804   1.00 1.01  ? 81   GLN A HE21 3  
ATOM   7671  H HE22 . GLN A 1 81  ? -23.428 -3.675  7.162   1.00 0.89  ? 81   GLN A HE22 3  
ATOM   7672  N N    . SER A 1 82  ? -17.790 -5.783  3.461   1.00 0.39  ? 82   SER A N    3  
ATOM   7673  C CA   . SER A 1 82  ? -17.155 -6.536  2.396   1.00 0.41  ? 82   SER A CA   3  
ATOM   7674  C C    . SER A 1 82  ? -15.644 -6.461  2.567   1.00 0.41  ? 82   SER A C    3  
ATOM   7675  O O    . SER A 1 82  ? -14.953 -7.478  2.601   1.00 0.48  ? 82   SER A O    3  
ATOM   7676  C CB   . SER A 1 82  ? -17.560 -5.940  1.050   1.00 0.41  ? 82   SER A CB   3  
ATOM   7677  O OG   . SER A 1 82  ? -18.943 -5.622  1.038   1.00 0.43  ? 82   SER A OG   3  
ATOM   7678  H H    . SER A 1 82  ? -18.202 -4.925  3.253   1.00 0.39  ? 82   SER A H    3  
ATOM   7679  H HA   . SER A 1 82  ? -17.476 -7.565  2.455   1.00 0.44  ? 82   SER A HA   3  
ATOM   7680  H HB2  . SER A 1 82  ? -16.993 -5.038  0.871   1.00 0.41  ? 82   SER A HB2  3  
ATOM   7681  H HB3  . SER A 1 82  ? -17.360 -6.655  0.266   1.00 0.42  ? 82   SER A HB3  3  
ATOM   7682  H HG   . SER A 1 82  ? -19.430 -6.351  0.623   1.00 0.43  ? 82   SER A HG   3  
ATOM   7683  N N    . PHE A 1 83  ? -15.153 -5.236  2.706   1.00 0.38  ? 83   PHE A N    3  
ATOM   7684  C CA   . PHE A 1 83  ? -13.746 -4.981  2.956   1.00 0.37  ? 83   PHE A CA   3  
ATOM   7685  C C    . PHE A 1 83  ? -13.355 -5.484  4.347   1.00 0.38  ? 83   PHE A C    3  
ATOM   7686  O O    . PHE A 1 83  ? -12.178 -5.683  4.644   1.00 0.39  ? 83   PHE A O    3  
ATOM   7687  C CB   . PHE A 1 83  ? -13.451 -3.484  2.790   1.00 0.36  ? 83   PHE A CB   3  
ATOM   7688  C CG   . PHE A 1 83  ? -12.034 -3.096  3.106   1.00 0.56  ? 83   PHE A CG   3  
ATOM   7689  C CD1  . PHE A 1 83  ? -10.991 -3.521  2.300   1.00 0.79  ? 83   PHE A CD1  3  
ATOM   7690  C CD2  . PHE A 1 83  ? -11.748 -2.303  4.205   1.00 0.75  ? 83   PHE A CD2  3  
ATOM   7691  C CE1  . PHE A 1 83  ? -9.689  -3.163  2.584   1.00 1.07  ? 83   PHE A CE1  3  
ATOM   7692  C CE2  . PHE A 1 83  ? -10.448 -1.942  4.493   1.00 1.05  ? 83   PHE A CE2  3  
ATOM   7693  C CZ   . PHE A 1 83  ? -9.416  -2.372  3.682   1.00 1.18  ? 83   PHE A CZ   3  
ATOM   7694  H H    . PHE A 1 83  ? -15.765 -4.468  2.628   1.00 0.37  ? 83   PHE A H    3  
ATOM   7695  H HA   . PHE A 1 83  ? -13.180 -5.529  2.222   1.00 0.40  ? 83   PHE A HA   3  
ATOM   7696  H HB2  . PHE A 1 83  ? -13.643 -3.207  1.765   1.00 0.49  ? 83   PHE A HB2  3  
ATOM   7697  H HB3  . PHE A 1 83  ? -14.107 -2.919  3.433   1.00 0.41  ? 83   PHE A HB3  3  
ATOM   7698  H HD1  . PHE A 1 83  ? -11.204 -4.140  1.440   1.00 0.86  ? 83   PHE A HD1  3  
ATOM   7699  H HD2  . PHE A 1 83  ? -12.554 -1.966  4.839   1.00 0.78  ? 83   PHE A HD2  3  
ATOM   7700  H HE1  . PHE A 1 83  ? -8.884  -3.501  1.948   1.00 1.29  ? 83   PHE A HE1  3  
ATOM   7701  H HE2  . PHE A 1 83  ? -10.237 -1.323  5.354   1.00 1.26  ? 83   PHE A HE2  3  
ATOM   7702  H HZ   . PHE A 1 83  ? -8.399  -2.090  3.908   1.00 1.44  ? 83   PHE A HZ   3  
ATOM   7703  N N    . GLU A 1 84  ? -14.357 -5.698  5.189   1.00 0.41  ? 84   GLU A N    3  
ATOM   7704  C CA   . GLU A 1 84  ? -14.145 -6.226  6.531   1.00 0.48  ? 84   GLU A CA   3  
ATOM   7705  C C    . GLU A 1 84  ? -13.527 -7.600  6.464   1.00 0.52  ? 84   GLU A C    3  
ATOM   7706  O O    . GLU A 1 84  ? -12.530 -7.874  7.121   1.00 0.55  ? 84   GLU A O    3  
ATOM   7707  C CB   . GLU A 1 84  ? -15.465 -6.336  7.273   1.00 0.55  ? 84   GLU A CB   3  
ATOM   7708  C CG   . GLU A 1 84  ? -15.319 -6.866  8.680   1.00 0.62  ? 84   GLU A CG   3  
ATOM   7709  C CD   . GLU A 1 84  ? -16.602 -6.784  9.473   1.00 0.71  ? 84   GLU A CD   3  
ATOM   7710  O OE1  . GLU A 1 84  ? -17.472 -7.661  9.297   1.00 0.78  ? 84   GLU A OE1  3  
ATOM   7711  O OE2  . GLU A 1 84  ? -16.750 -5.837  10.277  1.00 0.80  ? 84   GLU A OE2  3  
ATOM   7712  H H    . GLU A 1 84  ? -15.268 -5.499  4.897   1.00 0.40  ? 84   GLU A H    3  
ATOM   7713  H HA   . GLU A 1 84  ? -13.484 -5.556  7.062   1.00 0.48  ? 84   GLU A HA   3  
ATOM   7714  H HB2  . GLU A 1 84  ? -15.930 -5.369  7.311   1.00 0.56  ? 84   GLU A HB2  3  
ATOM   7715  H HB3  . GLU A 1 84  ? -16.102 -7.008  6.728   1.00 0.57  ? 84   GLU A HB3  3  
ATOM   7716  H HG2  . GLU A 1 84  ? -15.014 -7.901  8.628   1.00 0.64  ? 84   GLU A HG2  3  
ATOM   7717  H HG3  . GLU A 1 84  ? -14.558 -6.295  9.179   1.00 0.63  ? 84   GLU A HG3  3  
ATOM   7718  N N    . GLN A 1 85  ? -14.149 -8.453  5.659   1.00 0.57  ? 85   GLN A N    3  
ATOM   7719  C CA   . GLN A 1 85  ? -13.673 -9.813  5.416   1.00 0.65  ? 85   GLN A CA   3  
ATOM   7720  C C    . GLN A 1 85  ? -12.188 -9.805  5.119   1.00 0.64  ? 85   GLN A C    3  
ATOM   7721  O O    . GLN A 1 85  ? -11.449 -10.715 5.492   1.00 0.71  ? 85   GLN A O    3  
ATOM   7722  C CB   . GLN A 1 85  ? -14.410 -10.399 4.215   1.00 0.69  ? 85   GLN A CB   3  
ATOM   7723  C CG   . GLN A 1 85  ? -15.916 -10.300 4.316   1.00 0.79  ? 85   GLN A CG   3  
ATOM   7724  C CD   . GLN A 1 85  ? -16.622 -10.937 3.133   1.00 1.13  ? 85   GLN A CD   3  
ATOM   7725  O OE1  . GLN A 1 85  ? -16.090 -10.981 2.024   1.00 1.44  ? 85   GLN A OE1  3  
ATOM   7726  N NE2  . GLN A 1 85  ? -17.827 -11.434 3.359   1.00 1.62  ? 85   GLN A NE2  3  
ATOM   7727  H H    . GLN A 1 85  ? -14.967 -8.156  5.213   1.00 0.56  ? 85   GLN A H    3  
ATOM   7728  H HA   . GLN A 1 85  ? -13.869 -10.410 6.289   1.00 0.72  ? 85   GLN A HA   3  
ATOM   7729  H HB2  . GLN A 1 85  ? -14.105 -9.859  3.330   1.00 0.74  ? 85   GLN A HB2  3  
ATOM   7730  H HB3  . GLN A 1 85  ? -14.140 -11.438 4.109   1.00 0.91  ? 85   GLN A HB3  3  
ATOM   7731  H HG2  . GLN A 1 85  ? -16.236 -10.786 5.221   1.00 1.13  ? 85   GLN A HG2  3  
ATOM   7732  H HG3  . GLN A 1 85  ? -16.181 -9.256  4.354   1.00 1.03  ? 85   GLN A HG3  3  
ATOM   7733  H HE21 . GLN A 1 85  ? -18.195 -11.367 4.270   1.00 1.78  ? 85   GLN A HE21 3  
ATOM   7734  H HE22 . GLN A 1 85  ? -18.308 -11.844 2.605   1.00 1.99  ? 85   GLN A HE22 3  
ATOM   7735  N N    . VAL A 1 86  ? -11.777 -8.735  4.476   1.00 0.58  ? 86   VAL A N    3  
ATOM   7736  C CA   . VAL A 1 86  ? -10.427 -8.578  4.002   1.00 0.62  ? 86   VAL A CA   3  
ATOM   7737  C C    . VAL A 1 86  ? -9.539  -8.014  5.083   1.00 0.55  ? 86   VAL A C    3  
ATOM   7738  O O    . VAL A 1 86  ? -8.526  -8.589  5.437   1.00 0.59  ? 86   VAL A O    3  
ATOM   7739  C CB   . VAL A 1 86  ? -10.368 -7.623  2.816   1.00 0.70  ? 86   VAL A CB   3  
ATOM   7740  C CG1  . VAL A 1 86  ? -9.213  -8.016  1.938   1.00 1.13  ? 86   VAL A CG1  3  
ATOM   7741  C CG2  . VAL A 1 86  ? -11.688 -7.597  2.061   1.00 1.30  ? 86   VAL A CG2  3  
ATOM   7742  H H    . VAL A 1 86  ? -12.413 -8.011  4.331   1.00 0.55  ? 86   VAL A H    3  
ATOM   7743  H HA   . VAL A 1 86  ? -10.054 -9.542  3.690   1.00 0.70  ? 86   VAL A HA   3  
ATOM   7744  H HB   . VAL A 1 86  ? -10.175 -6.629  3.194   1.00 1.43  ? 86   VAL A HB   3  
ATOM   7745  H HG11 . VAL A 1 86  ? -9.238  -7.448  1.022   1.00 1.61  ? 86   VAL A HG11 3  
ATOM   7746  H HG12 . VAL A 1 86  ? -9.285  -9.077  1.717   1.00 1.74  ? 86   VAL A HG12 3  
ATOM   7747  H HG13 . VAL A 1 86  ? -8.290  -7.824  2.462   1.00 1.76  ? 86   VAL A HG13 3  
ATOM   7748  H HG21 . VAL A 1 86  ? -12.274 -6.753  2.397   1.00 1.79  ? 86   VAL A HG21 3  
ATOM   7749  H HG22 . VAL A 1 86  ? -12.234 -8.505  2.268   1.00 1.90  ? 86   VAL A HG22 3  
ATOM   7750  H HG23 . VAL A 1 86  ? -11.502 -7.510  1.002   1.00 1.83  ? 86   VAL A HG23 3  
ATOM   7751  N N    . VAL A 1 87  ? -9.939  -6.882  5.619   1.00 0.51  ? 87   VAL A N    3  
ATOM   7752  C CA   . VAL A 1 87  ? -9.138  -6.204  6.613   1.00 0.51  ? 87   VAL A CA   3  
ATOM   7753  C C    . VAL A 1 87  ? -8.996  -7.080  7.853   1.00 0.56  ? 87   VAL A C    3  
ATOM   7754  O O    . VAL A 1 87  ? -8.110  -6.895  8.686   1.00 0.60  ? 87   VAL A O    3  
ATOM   7755  C CB   . VAL A 1 87  ? -9.761  -4.847  6.977   1.00 0.54  ? 87   VAL A CB   3  
ATOM   7756  C CG1  . VAL A 1 87  ? -10.968 -5.006  7.897   1.00 0.75  ? 87   VAL A CG1  3  
ATOM   7757  C CG2  . VAL A 1 87  ? -8.709  -3.950  7.584   1.00 0.85  ? 87   VAL A CG2  3  
ATOM   7758  H H    . VAL A 1 87  ? -10.801 -6.496  5.347   1.00 0.50  ? 87   VAL A H    3  
ATOM   7759  H HA   . VAL A 1 87  ? -8.155  -6.031  6.189   1.00 0.53  ? 87   VAL A HA   3  
ATOM   7760  H HB   . VAL A 1 87  ? -10.108 -4.389  6.066   1.00 0.77  ? 87   VAL A HB   3  
ATOM   7761  H HG11 . VAL A 1 87  ? -11.742 -5.570  7.387   1.00 1.28  ? 87   VAL A HG11 3  
ATOM   7762  H HG12 . VAL A 1 87  ? -11.351 -4.032  8.162   1.00 1.30  ? 87   VAL A HG12 3  
ATOM   7763  H HG13 . VAL A 1 87  ? -10.672 -5.532  8.792   1.00 1.40  ? 87   VAL A HG13 3  
ATOM   7764  H HG21 . VAL A 1 87  ? -7.871  -3.870  6.901   1.00 1.36  ? 87   VAL A HG21 3  
ATOM   7765  H HG22 . VAL A 1 87  ? -8.374  -4.378  8.517   1.00 1.39  ? 87   VAL A HG22 3  
ATOM   7766  H HG23 . VAL A 1 87  ? -9.127  -2.972  7.762   1.00 1.43  ? 87   VAL A HG23 3  
ATOM   7767  N N    . ASN A 1 88  ? -9.887  -8.046  7.935   1.00 0.61  ? 88   ASN A N    3  
ATOM   7768  C CA   . ASN A 1 88  ? -9.885  -9.043  8.985   1.00 0.71  ? 88   ASN A CA   3  
ATOM   7769  C C    . ASN A 1 88  ? -8.980  -10.223 8.652   1.00 0.78  ? 88   ASN A C    3  
ATOM   7770  O O    . ASN A 1 88  ? -8.344  -10.787 9.545   1.00 0.91  ? 88   ASN A O    3  
ATOM   7771  C CB   . ASN A 1 88  ? -11.296 -9.527  9.225   1.00 0.73  ? 88   ASN A CB   3  
ATOM   7772  C CG   . ASN A 1 88  ? -11.939 -8.815  10.394  1.00 0.78  ? 88   ASN A CG   3  
ATOM   7773  O OD1  . ASN A 1 88  ? -11.832 -9.250  11.540  1.00 0.87  ? 88   ASN A OD1  3  
ATOM   7774  N ND2  . ASN A 1 88  ? -12.600 -7.706  10.116  1.00 0.73  ? 88   ASN A ND2  3  
ATOM   7775  H H    . ASN A 1 88  ? -10.598 -8.070  7.262   1.00 0.61  ? 88   ASN A H    3  
ATOM   7776  H HA   . ASN A 1 88  ? -9.530  -8.570  9.885   1.00 0.76  ? 88   ASN A HA   3  
ATOM   7777  H HB2  . ASN A 1 88  ? -11.875 -9.328  8.337   1.00 0.68  ? 88   ASN A HB2  3  
ATOM   7778  H HB3  . ASN A 1 88  ? -11.285 -10.584 9.413   1.00 0.79  ? 88   ASN A HB3  3  
ATOM   7779  H HD21 . ASN A 1 88  ? -12.641 -7.413  9.180   1.00 0.66  ? 88   ASN A HD21 3  
ATOM   7780  H HD22 . ASN A 1 88  ? -13.010 -7.218  10.856  1.00 0.78  ? 88   ASN A HD22 3  
ATOM   7781  N N    . GLU A 1 89  ? -8.911  -10.609 7.378   1.00 0.75  ? 89   GLU A N    3  
ATOM   7782  C CA   . GLU A 1 89  ? -8.022  -11.691 6.986   1.00 0.84  ? 89   GLU A CA   3  
ATOM   7783  C C    . GLU A 1 89  ? -6.608  -11.175 6.995   1.00 0.82  ? 89   GLU A C    3  
ATOM   7784  O O    . GLU A 1 89  ? -5.663  -11.859 7.396   1.00 0.98  ? 89   GLU A O    3  
ATOM   7785  C CB   . GLU A 1 89  ? -8.373  -12.291 5.602   1.00 0.87  ? 89   GLU A CB   3  
ATOM   7786  C CG   . GLU A 1 89  ? -8.478  -11.314 4.431   1.00 1.25  ? 89   GLU A CG   3  
ATOM   7787  C CD   . GLU A 1 89  ? -7.165  -10.867 3.833   1.00 2.21  ? 89   GLU A CD   3  
ATOM   7788  O OE1  . GLU A 1 89  ? -6.104  -11.296 4.309   1.00 2.58  ? 89   GLU A OE1  3  
ATOM   7789  O OE2  . GLU A 1 89  ? -7.205  -10.084 2.871   1.00 2.87  ? 89   GLU A OE2  3  
ATOM   7790  H H    . GLU A 1 89  ? -9.433  -10.141 6.694   1.00 0.71  ? 89   GLU A H    3  
ATOM   7791  H HA   . GLU A 1 89  ? -8.106  -12.463 7.733   1.00 0.91  ? 89   GLU A HA   3  
ATOM   7792  H HB2  . GLU A 1 89  ? -7.619  -13.021 5.359   1.00 1.01  ? 89   GLU A HB2  3  
ATOM   7793  H HB3  . GLU A 1 89  ? -9.315  -12.795 5.678   1.00 1.09  ? 89   GLU A HB3  3  
ATOM   7794  H HG2  . GLU A 1 89  ? -9.049  -11.772 3.649   1.00 1.39  ? 89   GLU A HG2  3  
ATOM   7795  H HG3  . GLU A 1 89  ? -8.999  -10.448 4.770   1.00 1.35  ? 89   GLU A HG3  3  
ATOM   7796  N N    . LEU A 1 90  ? -6.503  -9.927  6.608   1.00 0.69  ? 90   LEU A N    3  
ATOM   7797  C CA   . LEU A 1 90  ? -5.237  -9.323  6.302   1.00 0.64  ? 90   LEU A CA   3  
ATOM   7798  C C    . LEU A 1 90  ? -4.379  -9.193  7.557   1.00 0.70  ? 90   LEU A C    3  
ATOM   7799  O O    . LEU A 1 90  ? -3.160  -9.320  7.509   1.00 0.80  ? 90   LEU A O    3  
ATOM   7800  C CB   . LEU A 1 90  ? -5.503  -7.953  5.685   1.00 0.56  ? 90   LEU A CB   3  
ATOM   7801  C CG   . LEU A 1 90  ? -4.865  -7.655  4.322   1.00 0.67  ? 90   LEU A CG   3  
ATOM   7802  C CD1  . LEU A 1 90  ? -4.523  -8.897  3.530   1.00 1.25  ? 90   LEU A CD1  3  
ATOM   7803  C CD2  . LEU A 1 90  ? -5.819  -6.821  3.511   1.00 1.28  ? 90   LEU A CD2  3  
ATOM   7804  H H    . LEU A 1 90  ? -7.328  -9.395  6.489   1.00 0.65  ? 90   LEU A H    3  
ATOM   7805  H HA   . LEU A 1 90  ? -4.747  -9.958  5.572   1.00 0.66  ? 90   LEU A HA   3  
ATOM   7806  H HB2  . LEU A 1 90  ? -6.571  -7.842  5.579   1.00 0.73  ? 90   LEU A HB2  3  
ATOM   7807  H HB3  . LEU A 1 90  ? -5.157  -7.205  6.383   1.00 0.77  ? 90   LEU A HB3  3  
ATOM   7808  H HG   . LEU A 1 90  ? -3.966  -7.100  4.465   1.00 1.55  ? 90   LEU A HG   3  
ATOM   7809  H HD11 . LEU A 1 90  ? -5.439  -9.369  3.179   1.00 1.79  ? 90   LEU A HD11 3  
ATOM   7810  H HD12 . LEU A 1 90  ? -3.977  -9.579  4.154   1.00 1.83  ? 90   LEU A HD12 3  
ATOM   7811  H HD13 . LEU A 1 90  ? -3.917  -8.617  2.681   1.00 1.78  ? 90   LEU A HD13 3  
ATOM   7812  H HD21 . LEU A 1 90  ? -6.721  -7.394  3.344   1.00 1.76  ? 90   LEU A HD21 3  
ATOM   7813  H HD22 . LEU A 1 90  ? -5.363  -6.577  2.562   1.00 1.82  ? 90   LEU A HD22 3  
ATOM   7814  H HD23 . LEU A 1 90  ? -6.060  -5.915  4.049   1.00 1.92  ? 90   LEU A HD23 3  
ATOM   7815  N N    . PHE A 1 91  ? -5.025  -8.966  8.695   1.00 0.73  ? 91   PHE A N    3  
ATOM   7816  C CA   . PHE A 1 91  ? -4.296  -8.698  9.923   1.00 0.82  ? 91   PHE A CA   3  
ATOM   7817  C C    . PHE A 1 91  ? -4.181  -9.953  10.777  1.00 0.91  ? 91   PHE A C    3  
ATOM   7818  O O    . PHE A 1 91  ? -3.350  -10.027 11.681  1.00 1.06  ? 91   PHE A O    3  
ATOM   7819  C CB   . PHE A 1 91  ? -4.964  -7.560  10.707  1.00 0.88  ? 91   PHE A CB   3  
ATOM   7820  C CG   . PHE A 1 91  ? -6.034  -7.991  11.677  1.00 1.04  ? 91   PHE A CG   3  
ATOM   7821  C CD1  . PHE A 1 91  ? -7.274  -8.414  11.231  1.00 1.70  ? 91   PHE A CD1  3  
ATOM   7822  C CD2  . PHE A 1 91  ? -5.797  -7.958  13.041  1.00 1.26  ? 91   PHE A CD2  3  
ATOM   7823  C CE1  . PHE A 1 91  ? -8.256  -8.795  12.124  1.00 2.30  ? 91   PHE A CE1  3  
ATOM   7824  C CE2  . PHE A 1 91  ? -6.775  -8.341  13.939  1.00 1.75  ? 91   PHE A CE2  3  
ATOM   7825  C CZ   . PHE A 1 91  ? -8.007  -8.759  13.480  1.00 2.23  ? 91   PHE A CZ   3  
ATOM   7826  H H    . PHE A 1 91  ? -6.004  -8.985  8.708   1.00 0.72  ? 91   PHE A H    3  
ATOM   7827  H HA   . PHE A 1 91  ? -3.303  -8.387  9.645   1.00 0.82  ? 91   PHE A HA   3  
ATOM   7828  H HB2  . PHE A 1 91  ? -4.211  -7.030  11.268  1.00 1.16  ? 91   PHE A HB2  3  
ATOM   7829  H HB3  . PHE A 1 91  ? -5.418  -6.883  10.001  1.00 1.18  ? 91   PHE A HB3  3  
ATOM   7830  H HD1  . PHE A 1 91  ? -7.471  -8.445  10.168  1.00 1.96  ? 91   PHE A HD1  3  
ATOM   7831  H HD2  . PHE A 1 91  ? -4.834  -7.630  13.403  1.00 1.47  ? 91   PHE A HD2  3  
ATOM   7832  H HE1  . PHE A 1 91  ? -9.219  -9.121  11.761  1.00 2.97  ? 91   PHE A HE1  3  
ATOM   7833  H HE2  . PHE A 1 91  ? -6.575  -8.312  15.001  1.00 2.04  ? 91   PHE A HE2  3  
ATOM   7834  H HZ   . PHE A 1 91  ? -8.773  -9.058  14.180  1.00 2.76  ? 91   PHE A HZ   3  
ATOM   7835  N N    . ARG A 1 92  ? -5.002  -10.944 10.482  1.00 0.96  ? 92   ARG A N    3  
ATOM   7836  C CA   . ARG A 1 92  ? -5.006  -12.160 11.284  1.00 1.11  ? 92   ARG A CA   3  
ATOM   7837  C C    . ARG A 1 92  ? -4.000  -13.171 10.753  1.00 0.83  ? 92   ARG A C    3  
ATOM   7838  O O    . ARG A 1 92  ? -3.438  -13.956 11.513  1.00 0.90  ? 92   ARG A O    3  
ATOM   7839  C CB   . ARG A 1 92  ? -6.409  -12.797 11.346  1.00 1.53  ? 92   ARG A CB   3  
ATOM   7840  C CG   . ARG A 1 92  ? -6.558  -14.098 10.553  1.00 1.62  ? 92   ARG A CG   3  
ATOM   7841  C CD   . ARG A 1 92  ? -7.118  -13.863 9.171   1.00 2.21  ? 92   ARG A CD   3  
ATOM   7842  N NE   . ARG A 1 92  ? -7.158  -15.089 8.373   1.00 3.27  ? 92   ARG A NE   3  
ATOM   7843  C CZ   . ARG A 1 92  ? -8.210  -15.472 7.645   1.00 4.05  ? 92   ARG A CZ   3  
ATOM   7844  N NH1  . ARG A 1 92  ? -9.349  -14.798 7.706   1.00 3.96  ? 92   ARG A NH1  3  
ATOM   7845  N NH2  . ARG A 1 92  ? -8.133  -16.542 6.867   1.00 5.06  ? 92   ARG A NH2  3  
ATOM   7846  H H    . ARG A 1 92  ? -5.612  -10.854 9.720   1.00 0.99  ? 92   ARG A H    3  
ATOM   7847  H HA   . ARG A 1 92  ? -4.713  -11.878 12.280  1.00 1.30  ? 92   ARG A HA   3  
ATOM   7848  H HB2  . ARG A 1 92  ? -6.645  -13.007 12.378  1.00 1.76  ? 92   ARG A HB2  3  
ATOM   7849  H HB3  . ARG A 1 92  ? -7.126  -12.086 10.964  1.00 1.84  ? 92   ARG A HB3  3  
ATOM   7850  H HG2  . ARG A 1 92  ? -5.590  -14.557 10.448  1.00 1.69  ? 92   ARG A HG2  3  
ATOM   7851  H HG3  . ARG A 1 92  ? -7.219  -14.762 11.088  1.00 1.81  ? 92   ARG A HG3  3  
ATOM   7852  H HD2  . ARG A 1 92  ? -8.117  -13.473 9.265   1.00 2.25  ? 92   ARG A HD2  3  
ATOM   7853  H HD3  . ARG A 1 92  ? -6.494  -13.139 8.666   1.00 2.27  ? 92   ARG A HD3  3  
ATOM   7854  H HE   . ARG A 1 92  ? -6.340  -15.642 8.354   1.00 3.54  ? 92   ARG A HE   3  
ATOM   7855  H HH11 . ARG A 1 92  ? -9.436  -13.994 8.304   1.00 3.34  ? 92   ARG A HH11 3  
ATOM   7856  H HH12 . ARG A 1 92  ? -10.134 -15.091 7.149   1.00 4.64  ? 92   ARG A HH12 3  
ATOM   7857  H HH21 . ARG A 1 92  ? -7.276  -17.075 6.815   1.00 5.28  ? 92   ARG A HH21 3  
ATOM   7858  H HH22 . ARG A 1 92  ? -8.931  -16.828 6.325   1.00 5.67  ? 92   ARG A HH22 3  
ATOM   7859  N N    . ASP A 1 93  ? -3.766  -13.139 9.451   1.00 0.84  ? 93   ASP A N    3  
ATOM   7860  C CA   . ASP A 1 93  ? -3.030  -14.209 8.791   1.00 1.10  ? 93   ASP A CA   3  
ATOM   7861  C C    . ASP A 1 93  ? -1.531  -13.929 8.710   1.00 1.31  ? 93   ASP A C    3  
ATOM   7862  O O    . ASP A 1 93  ? -0.779  -14.741 8.171   1.00 1.88  ? 93   ASP A O    3  
ATOM   7863  C CB   . ASP A 1 93  ? -3.601  -14.437 7.387   1.00 1.65  ? 93   ASP A CB   3  
ATOM   7864  C CG   . ASP A 1 93  ? -3.040  -15.674 6.711   1.00 2.40  ? 93   ASP A CG   3  
ATOM   7865  O OD1  . ASP A 1 93  ? -3.481  -16.790 7.054   1.00 2.58  ? 93   ASP A OD1  3  
ATOM   7866  O OD2  . ASP A 1 93  ? -2.167  -15.539 5.827   1.00 3.12  ? 93   ASP A OD2  3  
ATOM   7867  H H    . ASP A 1 93  ? -4.103  -12.388 8.915   1.00 0.93  ? 93   ASP A H    3  
ATOM   7868  H HA   . ASP A 1 93  ? -3.177  -15.106 9.370   1.00 1.08  ? 93   ASP A HA   3  
ATOM   7869  H HB2  . ASP A 1 93  ? -4.674  -14.547 7.457   1.00 1.91  ? 93   ASP A HB2  3  
ATOM   7870  H HB3  . ASP A 1 93  ? -3.376  -13.578 6.773   1.00 1.73  ? 93   ASP A HB3  3  
ATOM   7871  N N    . GLY A 1 94  ? -1.060  -12.823 9.268   1.00 1.11  ? 94   GLY A N    3  
ATOM   7872  C CA   . GLY A 1 94  ? 0.342   -12.527 9.075   1.00 1.69  ? 94   GLY A CA   3  
ATOM   7873  C C    . GLY A 1 94  ? 0.641   -11.109 8.635   1.00 1.62  ? 94   GLY A C    3  
ATOM   7874  O O    . GLY A 1 94  ? 0.979   -10.887 7.472   1.00 2.31  ? 94   GLY A O    3  
ATOM   7875  H H    . GLY A 1 94  ? -1.642  -12.237 9.794   1.00 0.79  ? 94   GLY A H    3  
ATOM   7876  H HA2  . GLY A 1 94  ? 0.862   -12.712 10.003  1.00 1.93  ? 94   GLY A HA2  3  
ATOM   7877  H HA3  . GLY A 1 94  ? 0.726   -13.205 8.329   1.00 2.14  ? 94   GLY A HA3  3  
ATOM   7878  N N    . VAL A 1 95  ? 0.487   -10.132 9.522   1.00 0.85  ? 95   VAL A N    3  
ATOM   7879  C CA   . VAL A 1 95  ? 0.786   -8.756  9.151   1.00 0.67  ? 95   VAL A CA   3  
ATOM   7880  C C    . VAL A 1 95  ? 2.284   -8.566  8.974   1.00 0.62  ? 95   VAL A C    3  
ATOM   7881  O O    . VAL A 1 95  ? 3.039   -8.442  9.932   1.00 0.61  ? 95   VAL A O    3  
ATOM   7882  C CB   . VAL A 1 95  ? 0.296   -7.737  10.194  1.00 0.59  ? 95   VAL A CB   3  
ATOM   7883  C CG1  . VAL A 1 95  ? 0.582   -6.317  9.720   1.00 0.84  ? 95   VAL A CG1  3  
ATOM   7884  C CG2  . VAL A 1 95  ? -1.179  -7.920  10.482  1.00 1.06  ? 95   VAL A CG2  3  
ATOM   7885  H H    . VAL A 1 95  ? 0.180   -10.336 10.430  1.00 0.60  ? 95   VAL A H    3  
ATOM   7886  H HA   . VAL A 1 95  ? 0.301   -8.558  8.211   1.00 0.79  ? 95   VAL A HA   3  
ATOM   7887  H HB   . VAL A 1 95  ? 0.843   -7.900  11.112  1.00 0.99  ? 95   VAL A HB   3  
ATOM   7888  H HG11 . VAL A 1 95  ? 0.369   -5.617  10.516  1.00 1.32  ? 95   VAL A HG11 3  
ATOM   7889  H HG12 . VAL A 1 95  ? -0.038  -6.091  8.866   1.00 1.50  ? 95   VAL A HG12 3  
ATOM   7890  H HG13 . VAL A 1 95  ? 1.623   -6.238  9.437   1.00 1.39  ? 95   VAL A HG13 3  
ATOM   7891  H HG21 . VAL A 1 95  ? -1.497  -7.190  11.211  1.00 1.40  ? 95   VAL A HG21 3  
ATOM   7892  H HG22 . VAL A 1 95  ? -1.346  -8.914  10.871  1.00 1.68  ? 95   VAL A HG22 3  
ATOM   7893  H HG23 . VAL A 1 95  ? -1.743  -7.789  9.571   1.00 1.61  ? 95   VAL A HG23 3  
ATOM   7894  N N    . ASN A 1 96  ? 2.693   -8.615  7.722   1.00 0.76  ? 96   ASN A N    3  
ATOM   7895  C CA   . ASN A 1 96  ? 4.080   -8.417  7.333   1.00 0.86  ? 96   ASN A CA   3  
ATOM   7896  C C    . ASN A 1 96  ? 4.207   -7.077  6.628   1.00 0.72  ? 96   ASN A C    3  
ATOM   7897  O O    . ASN A 1 96  ? 3.213   -6.366  6.468   1.00 0.62  ? 96   ASN A O    3  
ATOM   7898  C CB   . ASN A 1 96  ? 4.554   -9.530  6.381   1.00 1.17  ? 96   ASN A CB   3  
ATOM   7899  C CG   . ASN A 1 96  ? 4.581   -10.917 7.007   1.00 1.47  ? 96   ASN A CG   3  
ATOM   7900  O OD1  . ASN A 1 96  ? 5.383   -11.765 6.621   1.00 2.12  ? 96   ASN A OD1  3  
ATOM   7901  N ND2  . ASN A 1 96  ? 3.706   -11.158 7.965   1.00 1.67  ? 96   ASN A ND2  3  
ATOM   7902  H H    . ASN A 1 96  ? 2.031   -8.781  7.029   1.00 0.86  ? 96   ASN A H    3  
ATOM   7903  H HA   . ASN A 1 96  ? 4.690   -8.416  8.223   1.00 0.91  ? 96   ASN A HA   3  
ATOM   7904  H HB2  . ASN A 1 96  ? 3.893   -9.564  5.528   1.00 1.53  ? 96   ASN A HB2  3  
ATOM   7905  H HB3  . ASN A 1 96  ? 5.552   -9.293  6.041   1.00 1.33  ? 96   ASN A HB3  3  
ATOM   7906  H HD21 . ASN A 1 96  ? 3.097   -10.436 8.222   1.00 1.78  ? 96   ASN A HD21 3  
ATOM   7907  H HD22 . ASN A 1 96  ? 3.681   -12.051 8.365   1.00 2.08  ? 96   ASN A HD22 3  
ATOM   7908  N N    . TRP A 1 97  ? 5.418   -6.752  6.189   1.00 0.77  ? 97   TRP A N    3  
ATOM   7909  C CA   . TRP A 1 97  ? 5.664   -5.527  5.430   1.00 0.72  ? 97   TRP A CA   3  
ATOM   7910  C C    . TRP A 1 97  ? 4.694   -5.407  4.252   1.00 0.63  ? 97   TRP A C    3  
ATOM   7911  O O    . TRP A 1 97  ? 3.999   -4.404  4.098   1.00 0.59  ? 97   TRP A O    3  
ATOM   7912  C CB   . TRP A 1 97  ? 7.101   -5.512  4.895   1.00 0.86  ? 97   TRP A CB   3  
ATOM   7913  C CG   . TRP A 1 97  ? 8.161   -5.576  5.952   1.00 0.68  ? 97   TRP A CG   3  
ATOM   7914  C CD1  . TRP A 1 97  ? 8.649   -4.537  6.694   1.00 0.83  ? 97   TRP A CD1  3  
ATOM   7915  C CD2  . TRP A 1 97  ? 8.887   -6.740  6.365   1.00 1.43  ? 97   TRP A CD2  3  
ATOM   7916  N NE1  . TRP A 1 97  ? 9.631   -4.987  7.544   1.00 0.99  ? 97   TRP A NE1  3  
ATOM   7917  C CE2  . TRP A 1 97  ? 9.792   -6.335  7.364   1.00 1.60  ? 97   TRP A CE2  3  
ATOM   7918  C CE3  . TRP A 1 97  ? 8.856   -8.087  5.989   1.00 2.29  ? 97   TRP A CE3  3  
ATOM   7919  C CZ2  . TRP A 1 97  ? 10.657  -7.228  7.990   1.00 2.54  ? 97   TRP A CZ2  3  
ATOM   7920  C CZ3  . TRP A 1 97  ? 9.715   -8.971  6.613   1.00 3.24  ? 97   TRP A CZ3  3  
ATOM   7921  C CH2  . TRP A 1 97  ? 10.605  -8.538  7.603   1.00 3.34  ? 97   TRP A CH2  3  
ATOM   7922  H H    . TRP A 1 97  ? 6.174   -7.344  6.399   1.00 0.88  ? 97   TRP A H    3  
ATOM   7923  H HA   . TRP A 1 97  ? 5.524   -4.686  6.091   1.00 0.72  ? 97   TRP A HA   3  
ATOM   7924  H HB2  . TRP A 1 97  ? 7.239   -6.359  4.242   1.00 1.09  ? 97   TRP A HB2  3  
ATOM   7925  H HB3  . TRP A 1 97  ? 7.252   -4.604  4.328   1.00 1.26  ? 97   TRP A HB3  3  
ATOM   7926  H HD1  . TRP A 1 97  ? 8.306   -3.517  6.611   1.00 1.43  ? 97   TRP A HD1  3  
ATOM   7927  H HE1  . TRP A 1 97  ? 10.136  -4.433  8.177   1.00 1.14  ? 97   TRP A HE1  3  
ATOM   7928  H HE3  . TRP A 1 97  ? 8.175   -8.439  5.228   1.00 2.29  ? 97   TRP A HE3  3  
ATOM   7929  H HZ2  . TRP A 1 97  ? 11.349  -6.910  8.757   1.00 2.71  ? 97   TRP A HZ2  3  
ATOM   7930  H HZ3  . TRP A 1 97  ? 9.706   -10.015 6.336   1.00 3.95  ? 97   TRP A HZ3  3  
ATOM   7931  H HH2  . TRP A 1 97  ? 11.259  -9.265  8.062   1.00 4.12  ? 97   TRP A HH2  3  
ATOM   7932  N N    . GLY A 1 98  ? 4.640   -6.457  3.439   1.00 0.69  ? 98   GLY A N    3  
ATOM   7933  C CA   . GLY A 1 98  ? 3.836   -6.430  2.229   1.00 0.69  ? 98   GLY A CA   3  
ATOM   7934  C C    . GLY A 1 98  ? 2.363   -6.713  2.470   1.00 0.62  ? 98   GLY A C    3  
ATOM   7935  O O    . GLY A 1 98  ? 1.530   -6.474  1.597   1.00 0.61  ? 98   GLY A O    3  
ATOM   7936  H H    . GLY A 1 98  ? 5.158   -7.257  3.660   1.00 0.78  ? 98   GLY A H    3  
ATOM   7937  H HA2  . GLY A 1 98  ? 3.931   -5.458  1.775   1.00 0.69  ? 98   GLY A HA2  3  
ATOM   7938  H HA3  . GLY A 1 98  ? 4.222   -7.170  1.544   1.00 0.80  ? 98   GLY A HA3  3  
ATOM   7939  N N    . ARG A 1 99  ? 2.038   -7.224  3.648   1.00 0.65  ? 99   ARG A N    3  
ATOM   7940  C CA   . ARG A 1 99  ? 0.654   -7.541  3.988   1.00 0.67  ? 99   ARG A CA   3  
ATOM   7941  C C    . ARG A 1 99  ? -0.195  -6.277  4.000   1.00 0.53  ? 99   ARG A C    3  
ATOM   7942  O O    . ARG A 1 99  ? -1.319  -6.259  3.506   1.00 0.55  ? 99   ARG A O    3  
ATOM   7943  C CB   . ARG A 1 99  ? 0.596   -8.208  5.356   1.00 0.82  ? 99   ARG A CB   3  
ATOM   7944  C CG   . ARG A 1 99  ? -0.811  -8.535  5.818   1.00 1.04  ? 99   ARG A CG   3  
ATOM   7945  C CD   . ARG A 1 99  ? -1.445  -9.625  4.973   1.00 1.50  ? 99   ARG A CD   3  
ATOM   7946  N NE   . ARG A 1 99  ? -0.851  -10.936 5.222   1.00 2.48  ? 99   ARG A NE   3  
ATOM   7947  C CZ   . ARG A 1 99  ? -1.520  -12.079 5.111   1.00 3.32  ? 99   ARG A CZ   3  
ATOM   7948  N NH1  . ARG A 1 99  ? -2.803  -12.071 4.777   1.00 3.44  ? 99   ARG A NH1  3  
ATOM   7949  N NH2  . ARG A 1 99  ? -0.909  -13.230 5.352   1.00 4.24  ? 99   ARG A NH2  3  
ATOM   7950  H H    . ARG A 1 99  ? 2.742   -7.382  4.308   1.00 0.70  ? 99   ARG A H    3  
ATOM   7951  H HA   . ARG A 1 99  ? 0.266   -8.220  3.244   1.00 0.74  ? 99   ARG A HA   3  
ATOM   7952  H HB2  . ARG A 1 99  ? 1.164   -9.125  5.323   1.00 1.58  ? 99   ARG A HB2  3  
ATOM   7953  H HB3  . ARG A 1 99  ? 1.042   -7.542  6.081   1.00 1.33  ? 99   ARG A HB3  3  
ATOM   7954  H HG2  . ARG A 1 99  ? -0.773  -8.869  6.844   1.00 1.48  ? 99   ARG A HG2  3  
ATOM   7955  H HG3  . ARG A 1 99  ? -1.416  -7.643  5.751   1.00 1.63  ? 99   ARG A HG3  3  
ATOM   7956  H HD2  . ARG A 1 99  ? -2.497  -9.672  5.207   1.00 1.65  ? 99   ARG A HD2  3  
ATOM   7957  H HD3  . ARG A 1 99  ? -1.321  -9.375  3.931   1.00 1.57  ? 99   ARG A HD3  3  
ATOM   7958  H HE   . ARG A 1 99  ? 0.096   -10.963 5.488   1.00 2.71  ? 99   ARG A HE   3  
ATOM   7959  H HH11 . ARG A 1 99  ? -3.283  -11.206 4.608   1.00 2.93  ? 99   ARG A HH11 3  
ATOM   7960  H HH12 . ARG A 1 99  ? -3.300  -12.936 4.675   1.00 4.20  ? 99   ARG A HH12 3  
ATOM   7961  H HH21 . ARG A 1 99  ? 0.065   -13.244 5.619   1.00 4.35  ? 99   ARG A HH21 3  
ATOM   7962  H HH22 . ARG A 1 99  ? -1.417  -14.104 5.275   1.00 4.91  ? 99   ARG A HH22 3  
ATOM   7963  N N    . ILE A 1 100 ? 0.359   -5.219  4.567   1.00 0.44  ? 100  ILE A N    3  
ATOM   7964  C CA   . ILE A 1 100 ? -0.344  -3.952  4.658   1.00 0.36  ? 100  ILE A CA   3  
ATOM   7965  C C    . ILE A 1 100 ? -0.414  -3.282  3.289   1.00 0.33  ? 100  ILE A C    3  
ATOM   7966  O O    . ILE A 1 100 ? -1.390  -2.610  2.963   1.00 0.34  ? 100  ILE A O    3  
ATOM   7967  C CB   . ILE A 1 100 ? 0.333   -3.039  5.689   1.00 0.32  ? 100  ILE A CB   3  
ATOM   7968  C CG1  . ILE A 1 100 ? 0.276   -3.711  7.062   1.00 0.33  ? 100  ILE A CG1  3  
ATOM   7969  C CG2  . ILE A 1 100 ? -0.342  -1.680  5.724   1.00 0.34  ? 100  ILE A CG2  3  
ATOM   7970  C CD1  . ILE A 1 100 ? 1.034   -2.978  8.135   1.00 0.34  ? 100  ILE A CD1  3  
ATOM   7971  H H    . ILE A 1 100 ? 1.265   -5.293  4.935   1.00 0.47  ? 100  ILE A H    3  
ATOM   7972  H HA   . ILE A 1 100 ? -1.348  -4.156  4.997   1.00 0.43  ? 100  ILE A HA   3  
ATOM   7973  H HB   . ILE A 1 100 ? 1.364   -2.900  5.404   1.00 0.34  ? 100  ILE A HB   3  
ATOM   7974  H HG12 . ILE A 1 100 ? -0.755  -3.780  7.377   1.00 0.37  ? 100  ILE A HG12 3  
ATOM   7975  H HG13 . ILE A 1 100 ? 0.687   -4.705  6.983   1.00 0.35  ? 100  ILE A HG13 3  
ATOM   7976  H HG21 . ILE A 1 100 ? 0.137   -1.060  6.467   1.00 0.97  ? 100  ILE A HG21 3  
ATOM   7977  H HG22 . ILE A 1 100 ? -1.386  -1.801  5.972   1.00 1.06  ? 100  ILE A HG22 3  
ATOM   7978  H HG23 . ILE A 1 100 ? -0.251  -1.212  4.752   1.00 1.06  ? 100  ILE A HG23 3  
ATOM   7979  H HD11 . ILE A 1 100 ? 0.896   -3.483  9.083   1.00 1.05  ? 100  ILE A HD11 3  
ATOM   7980  H HD12 . ILE A 1 100 ? 0.664   -1.967  8.210   1.00 1.11  ? 100  ILE A HD12 3  
ATOM   7981  H HD13 . ILE A 1 100 ? 2.084   -2.960  7.887   1.00 1.07  ? 100  ILE A HD13 3  
ATOM   7982  N N    . VAL A 1 101 ? 0.629   -3.484  2.494   1.00 0.33  ? 101  VAL A N    3  
ATOM   7983  C CA   . VAL A 1 101 ? 0.617   -3.120  1.078   1.00 0.35  ? 101  VAL A CA   3  
ATOM   7984  C C    . VAL A 1 101 ? -0.644  -3.656  0.419   1.00 0.37  ? 101  VAL A C    3  
ATOM   7985  O O    . VAL A 1 101 ? -1.402  -2.917  -0.210  1.00 0.45  ? 101  VAL A O    3  
ATOM   7986  C CB   . VAL A 1 101 ? 1.832   -3.723  0.358   1.00 0.46  ? 101  VAL A CB   3  
ATOM   7987  C CG1  . VAL A 1 101 ? 1.828   -3.369  -1.116  1.00 1.35  ? 101  VAL A CG1  3  
ATOM   7988  C CG2  . VAL A 1 101 ? 3.105   -3.260  1.026   1.00 1.32  ? 101  VAL A CG2  3  
ATOM   7989  H H    . VAL A 1 101 ? 1.437   -3.879  2.873   1.00 0.36  ? 101  VAL A H    3  
ATOM   7990  H HA   . VAL A 1 101 ? 0.655   -2.045  0.986   1.00 0.36  ? 101  VAL A HA   3  
ATOM   7991  H HB   . VAL A 1 101 ? 1.778   -4.798  0.447   1.00 1.36  ? 101  VAL A HB   3  
ATOM   7992  H HG11 . VAL A 1 101 ? 1.828   -2.295  -1.230  1.00 1.85  ? 101  VAL A HG11 3  
ATOM   7993  H HG12 . VAL A 1 101 ? 0.945   -3.783  -1.583  1.00 1.99  ? 101  VAL A HG12 3  
ATOM   7994  H HG13 . VAL A 1 101 ? 2.708   -3.782  -1.587  1.00 1.94  ? 101  VAL A HG13 3  
ATOM   7995  H HG21 . VAL A 1 101 ? 3.153   -2.181  1.005   1.00 1.92  ? 101  VAL A HG21 3  
ATOM   7996  H HG22 . VAL A 1 101 ? 3.955   -3.672  0.503   1.00 1.70  ? 101  VAL A HG22 3  
ATOM   7997  H HG23 . VAL A 1 101 ? 3.110   -3.602  2.050   1.00 2.03  ? 101  VAL A HG23 3  
ATOM   7998  N N    . ALA A 1 102 ? -0.842  -4.957  0.570   1.00 0.37  ? 102  ALA A N    3  
ATOM   7999  C CA   . ALA A 1 102 ? -2.044  -5.627  0.083   1.00 0.39  ? 102  ALA A CA   3  
ATOM   8000  C C    . ALA A 1 102 ? -3.300  -4.934  0.587   1.00 0.35  ? 102  ALA A C    3  
ATOM   8001  O O    . ALA A 1 102 ? -4.223  -4.669  -0.177  1.00 0.34  ? 102  ALA A O    3  
ATOM   8002  C CB   . ALA A 1 102 ? -2.051  -7.074  0.529   1.00 0.44  ? 102  ALA A CB   3  
ATOM   8003  H H    . ALA A 1 102 ? -0.143  -5.489  1.020   1.00 0.42  ? 102  ALA A H    3  
ATOM   8004  H HA   . ALA A 1 102 ? -2.031  -5.603  -0.996  1.00 0.41  ? 102  ALA A HA   3  
ATOM   8005  H HB1  . ALA A 1 102 ? -2.176  -7.117  1.603   1.00 1.06  ? 102  ALA A HB1  3  
ATOM   8006  H HB2  . ALA A 1 102 ? -1.116  -7.535  0.255   1.00 1.03  ? 102  ALA A HB2  3  
ATOM   8007  H HB3  . ALA A 1 102 ? -2.869  -7.593  0.050   1.00 1.04  ? 102  ALA A HB3  3  
ATOM   8008  N N    . PHE A 1 103 ? -3.315  -4.647  1.879   1.00 0.35  ? 103  PHE A N    3  
ATOM   8009  C CA   . PHE A 1 103 ? -4.427  -3.954  2.515   1.00 0.34  ? 103  PHE A CA   3  
ATOM   8010  C C    . PHE A 1 103 ? -4.720  -2.617  1.826   1.00 0.31  ? 103  PHE A C    3  
ATOM   8011  O O    . PHE A 1 103 ? -5.882  -2.254  1.634   1.00 0.32  ? 103  PHE A O    3  
ATOM   8012  C CB   . PHE A 1 103 ? -4.118  -3.781  4.010   1.00 0.36  ? 103  PHE A CB   3  
ATOM   8013  C CG   . PHE A 1 103 ? -4.862  -2.663  4.690   1.00 0.62  ? 103  PHE A CG   3  
ATOM   8014  C CD1  . PHE A 1 103 ? -6.163  -2.837  5.125   1.00 0.67  ? 103  PHE A CD1  3  
ATOM   8015  C CD2  . PHE A 1 103 ? -4.244  -1.441  4.907   1.00 1.03  ? 103  PHE A CD2  3  
ATOM   8016  C CE1  . PHE A 1 103 ? -6.836  -1.811  5.761   1.00 1.09  ? 103  PHE A CE1  3  
ATOM   8017  C CE2  . PHE A 1 103 ? -4.912  -0.413  5.539   1.00 1.48  ? 103  PHE A CE2  3  
ATOM   8018  C CZ   . PHE A 1 103 ? -6.211  -0.598  5.967   1.00 1.49  ? 103  PHE A CZ   3  
ATOM   8019  H H    . PHE A 1 103 ? -2.550  -4.919  2.431   1.00 0.38  ? 103  PHE A H    3  
ATOM   8020  H HA   . PHE A 1 103 ? -5.298  -4.584  2.416   1.00 0.38  ? 103  PHE A HA   3  
ATOM   8021  H HB2  . PHE A 1 103 ? -4.374  -4.704  4.522   1.00 0.52  ? 103  PHE A HB2  3  
ATOM   8022  H HB3  . PHE A 1 103 ? -3.060  -3.597  4.128   1.00 0.60  ? 103  PHE A HB3  3  
ATOM   8023  H HD1  . PHE A 1 103 ? -6.655  -3.786  4.963   1.00 0.52  ? 103  PHE A HD1  3  
ATOM   8024  H HD2  . PHE A 1 103 ? -3.227  -1.295  4.572   1.00 1.05  ? 103  PHE A HD2  3  
ATOM   8025  H HE1  . PHE A 1 103 ? -7.853  -1.958  6.095   1.00 1.14  ? 103  PHE A HE1  3  
ATOM   8026  H HE2  . PHE A 1 103 ? -4.420  0.536   5.699   1.00 1.84  ? 103  PHE A HE2  3  
ATOM   8027  H HZ   . PHE A 1 103 ? -6.737  0.204   6.465   1.00 1.84  ? 103  PHE A HZ   3  
ATOM   8028  N N    . PHE A 1 104 ? -3.672  -1.899  1.434   1.00 0.33  ? 104  PHE A N    3  
ATOM   8029  C CA   . PHE A 1 104 ? -3.843  -0.664  0.679   1.00 0.40  ? 104  PHE A CA   3  
ATOM   8030  C C    . PHE A 1 104 ? -4.345  -0.954  -0.730  1.00 0.39  ? 104  PHE A C    3  
ATOM   8031  O O    . PHE A 1 104 ? -5.104  -0.174  -1.296  1.00 0.47  ? 104  PHE A O    3  
ATOM   8032  C CB   . PHE A 1 104 ? -2.535  0.120   0.598   1.00 0.56  ? 104  PHE A CB   3  
ATOM   8033  C CG   . PHE A 1 104 ? -2.040  0.610   1.922   1.00 0.97  ? 104  PHE A CG   3  
ATOM   8034  C CD1  . PHE A 1 104 ? -2.875  1.320   2.764   1.00 1.79  ? 104  PHE A CD1  3  
ATOM   8035  C CD2  . PHE A 1 104 ? -0.742  0.354   2.328   1.00 1.47  ? 104  PHE A CD2  3  
ATOM   8036  C CE1  . PHE A 1 104 ? -2.424  1.767   3.988   1.00 2.90  ? 104  PHE A CE1  3  
ATOM   8037  C CE2  . PHE A 1 104 ? -0.287  0.799   3.552   1.00 2.61  ? 104  PHE A CE2  3  
ATOM   8038  C CZ   . PHE A 1 104 ? -1.117  1.530   4.369   1.00 3.29  ? 104  PHE A CZ   3  
ATOM   8039  H H    . PHE A 1 104 ? -2.763  -2.197  1.669   1.00 0.34  ? 104  PHE A H    3  
ATOM   8040  H HA   . PHE A 1 104 ? -4.581  -0.063  1.192   1.00 0.42  ? 104  PHE A HA   3  
ATOM   8041  H HB2  . PHE A 1 104 ? -1.771  -0.515  0.175   1.00 1.36  ? 104  PHE A HB2  3  
ATOM   8042  H HB3  . PHE A 1 104 ? -2.677  0.978   -0.044  1.00 1.38  ? 104  PHE A HB3  3  
ATOM   8043  H HD1  . PHE A 1 104 ? -3.891  1.524   2.457   1.00 1.71  ? 104  PHE A HD1  3  
ATOM   8044  H HD2  . PHE A 1 104 ? -0.082  -0.200  1.677   1.00 1.21  ? 104  PHE A HD2  3  
ATOM   8045  H HE1  . PHE A 1 104 ? -3.086  2.322   4.637   1.00 3.55  ? 104  PHE A HE1  3  
ATOM   8046  H HE2  . PHE A 1 104 ? 0.727   0.592   3.859   1.00 3.05  ? 104  PHE A HE2  3  
ATOM   8047  H HZ   . PHE A 1 104 ? -0.757  1.888   5.321   1.00 4.21  ? 104  PHE A HZ   3  
ATOM   8048  N N    . SER A 1 105 ? -3.918  -2.076  -1.290  1.00 0.37  ? 105  SER A N    3  
ATOM   8049  C CA   . SER A 1 105 ? -4.312  -2.455  -2.638  1.00 0.44  ? 105  SER A CA   3  
ATOM   8050  C C    . SER A 1 105 ? -5.798  -2.806  -2.687  1.00 0.40  ? 105  SER A C    3  
ATOM   8051  O O    . SER A 1 105 ? -6.546  -2.231  -3.476  1.00 0.45  ? 105  SER A O    3  
ATOM   8052  C CB   . SER A 1 105 ? -3.459  -3.628  -3.135  1.00 0.50  ? 105  SER A CB   3  
ATOM   8053  O OG   . SER A 1 105 ? -3.678  -3.879  -4.513  1.00 1.19  ? 105  SER A OG   3  
ATOM   8054  H H    . SER A 1 105 ? -3.315  -2.664  -0.785  1.00 0.36  ? 105  SER A H    3  
ATOM   8055  H HA   . SER A 1 105 ? -4.139  -1.603  -3.279  1.00 0.52  ? 105  SER A HA   3  
ATOM   8056  H HB2  . SER A 1 105 ? -2.414  -3.397  -2.989  1.00 1.07  ? 105  SER A HB2  3  
ATOM   8057  H HB3  . SER A 1 105 ? -3.712  -4.516  -2.575  1.00 0.98  ? 105  SER A HB3  3  
ATOM   8058  H HG   . SER A 1 105 ? -3.320  -3.147  -5.039  1.00 1.55  ? 105  SER A HG   3  
ATOM   8059  N N    . PHE A 1 106 ? -6.230  -3.725  -1.825  1.00 0.35  ? 106  PHE A N    3  
ATOM   8060  C CA   . PHE A 1 106 ? -7.634  -4.127  -1.782  1.00 0.37  ? 106  PHE A CA   3  
ATOM   8061  C C    . PHE A 1 106 ? -8.514  -2.955  -1.368  1.00 0.31  ? 106  PHE A C    3  
ATOM   8062  O O    . PHE A 1 106 ? -9.611  -2.786  -1.887  1.00 0.30  ? 106  PHE A O    3  
ATOM   8063  C CB   . PHE A 1 106 ? -7.865  -5.293  -0.817  1.00 0.46  ? 106  PHE A CB   3  
ATOM   8064  C CG   . PHE A 1 106 ? -6.996  -6.491  -1.064  1.00 0.99  ? 106  PHE A CG   3  
ATOM   8065  C CD1  . PHE A 1 106 ? -7.015  -7.145  -2.282  1.00 1.56  ? 106  PHE A CD1  3  
ATOM   8066  C CD2  . PHE A 1 106 ? -6.157  -6.961  -0.068  1.00 1.64  ? 106  PHE A CD2  3  
ATOM   8067  C CE1  . PHE A 1 106 ? -6.214  -8.247  -2.502  1.00 2.46  ? 106  PHE A CE1  3  
ATOM   8068  C CE2  . PHE A 1 106 ? -5.354  -8.062  -0.284  1.00 2.53  ? 106  PHE A CE2  3  
ATOM   8069  C CZ   . PHE A 1 106 ? -5.382  -8.705  -1.503  1.00 2.89  ? 106  PHE A CZ   3  
ATOM   8070  H H    . PHE A 1 106 ? -5.592  -4.144  -1.211  1.00 0.35  ? 106  PHE A H    3  
ATOM   8071  H HA   . PHE A 1 106 ? -7.916  -4.439  -2.778  1.00 0.42  ? 106  PHE A HA   3  
ATOM   8072  H HB2  . PHE A 1 106 ? -7.683  -4.962  0.191   1.00 1.15  ? 106  PHE A HB2  3  
ATOM   8073  H HB3  . PHE A 1 106 ? -8.894  -5.609  -0.904  1.00 0.85  ? 106  PHE A HB3  3  
ATOM   8074  H HD1  . PHE A 1 106 ? -7.667  -6.787  -3.065  1.00 1.56  ? 106  PHE A HD1  3  
ATOM   8075  H HD2  . PHE A 1 106 ? -6.134  -6.457  0.887   1.00 1.67  ? 106  PHE A HD2  3  
ATOM   8076  H HE1  . PHE A 1 106 ? -6.237  -8.749  -3.458  1.00 2.96  ? 106  PHE A HE1  3  
ATOM   8077  H HE2  . PHE A 1 106 ? -4.703  -8.418  0.502   1.00 3.09  ? 106  PHE A HE2  3  
ATOM   8078  H HZ   . PHE A 1 106 ? -4.754  -9.567  -1.674  1.00 3.64  ? 106  PHE A HZ   3  
ATOM   8079  N N    . GLY A 1 107 ? -8.026  -2.151  -0.428  1.00 0.30  ? 107  GLY A N    3  
ATOM   8080  C CA   . GLY A 1 107 ? -8.769  -0.979  0.002   1.00 0.28  ? 107  GLY A CA   3  
ATOM   8081  C C    . GLY A 1 107 ? -8.810  0.085   -1.072  1.00 0.24  ? 107  GLY A C    3  
ATOM   8082  O O    . GLY A 1 107 ? -9.832  0.740   -1.277  1.00 0.27  ? 107  GLY A O    3  
ATOM   8083  H H    . GLY A 1 107 ? -7.156  -2.355  -0.021  1.00 0.32  ? 107  GLY A H    3  
ATOM   8084  H HA2  . GLY A 1 107 ? -9.779  -1.272  0.244   1.00 0.28  ? 107  GLY A HA2  3  
ATOM   8085  H HA3  . GLY A 1 107 ? -8.303  -0.566  0.884   1.00 0.29  ? 107  GLY A HA3  3  
ATOM   8086  N N    . GLY A 1 108 ? -7.694  0.251   -1.766  1.00 0.23  ? 108  GLY A N    3  
ATOM   8087  C CA   . GLY A 1 108 ? -7.640  1.181   -2.869  1.00 0.22  ? 108  GLY A CA   3  
ATOM   8088  C C    . GLY A 1 108 ? -8.532  0.735   -4.009  1.00 0.22  ? 108  GLY A C    3  
ATOM   8089  O O    . GLY A 1 108 ? -9.147  1.553   -4.692  1.00 0.23  ? 108  GLY A O    3  
ATOM   8090  H H    . GLY A 1 108 ? -6.891  -0.260  -1.520  1.00 0.24  ? 108  GLY A H    3  
ATOM   8091  H HA2  . GLY A 1 108 ? -7.961  2.152   -2.521  1.00 0.22  ? 108  GLY A HA2  3  
ATOM   8092  H HA3  . GLY A 1 108 ? -6.623  1.249   -3.224  1.00 0.24  ? 108  GLY A HA3  3  
ATOM   8093  N N    . ALA A 1 109 ? -8.595  -0.573  -4.215  1.00 0.24  ? 109  ALA A N    3  
ATOM   8094  C CA   . ALA A 1 109 ? -9.483  -1.148  -5.209  1.00 0.26  ? 109  ALA A CA   3  
ATOM   8095  C C    . ALA A 1 109 ? -10.923 -1.088  -4.725  1.00 0.27  ? 109  ALA A C    3  
ATOM   8096  O O    . ALA A 1 109 ? -11.846 -0.977  -5.522  1.00 0.31  ? 109  ALA A O    3  
ATOM   8097  C CB   . ALA A 1 109 ? -9.085  -2.582  -5.514  1.00 0.29  ? 109  ALA A CB   3  
ATOM   8098  H H    . ALA A 1 109 ? -8.014  -1.169  -3.689  1.00 0.24  ? 109  ALA A H    3  
ATOM   8099  H HA   . ALA A 1 109 ? -9.392  -0.568  -6.118  1.00 0.29  ? 109  ALA A HA   3  
ATOM   8100  H HB1  . ALA A 1 109 ? -9.740  -2.976  -6.279  1.00 0.96  ? 109  ALA A HB1  3  
ATOM   8101  H HB2  . ALA A 1 109 ? -9.170  -3.182  -4.615  1.00 1.05  ? 109  ALA A HB2  3  
ATOM   8102  H HB3  . ALA A 1 109 ? -8.065  -2.605  -5.868  1.00 1.04  ? 109  ALA A HB3  3  
ATOM   8103  N N    . LEU A 1 110 ? -11.099 -1.132  -3.408  1.00 0.25  ? 110  LEU A N    3  
ATOM   8104  C CA   . LEU A 1 110 ? -12.420 -1.044  -2.796  1.00 0.28  ? 110  LEU A CA   3  
ATOM   8105  C C    . LEU A 1 110 ? -13.015 0.297   -3.174  1.00 0.24  ? 110  LEU A C    3  
ATOM   8106  O O    . LEU A 1 110 ? -14.203 0.421   -3.485  1.00 0.24  ? 110  LEU A O    3  
ATOM   8107  C CB   . LEU A 1 110 ? -12.301 -1.150  -1.273  1.00 0.32  ? 110  LEU A CB   3  
ATOM   8108  C CG   . LEU A 1 110 ? -13.366 -1.997  -0.565  1.00 0.45  ? 110  LEU A CG   3  
ATOM   8109  C CD1  . LEU A 1 110 ? -14.768 -1.490  -0.853  1.00 1.11  ? 110  LEU A CD1  3  
ATOM   8110  C CD2  . LEU A 1 110 ? -13.233 -3.461  -0.958  1.00 1.12  ? 110  LEU A CD2  3  
ATOM   8111  H H    . LEU A 1 110 ? -10.309 -1.203  -2.828  1.00 0.23  ? 110  LEU A H    3  
ATOM   8112  H HA   . LEU A 1 110 ? -13.039 -1.843  -3.174  1.00 0.34  ? 110  LEU A HA   3  
ATOM   8113  H HB2  . LEU A 1 110 ? -11.334 -1.570  -1.043  1.00 0.36  ? 110  LEU A HB2  3  
ATOM   8114  H HB3  . LEU A 1 110 ? -12.343 -0.148  -0.867  1.00 0.29  ? 110  LEU A HB3  3  
ATOM   8115  H HG   . LEU A 1 110 ? -13.210 -1.929  0.497   1.00 1.32  ? 110  LEU A HG   3  
ATOM   8116  H HD11 . LEU A 1 110 ? -14.841 -0.452  -0.563  1.00 1.67  ? 110  LEU A HD11 3  
ATOM   8117  H HD12 . LEU A 1 110 ? -15.480 -2.072  -0.286  1.00 1.63  ? 110  LEU A HD12 3  
ATOM   8118  H HD13 . LEU A 1 110 ? -14.978 -1.588  -1.908  1.00 1.78  ? 110  LEU A HD13 3  
ATOM   8119  H HD21 . LEU A 1 110 ? -13.408 -3.567  -2.019  1.00 1.67  ? 110  LEU A HD21 3  
ATOM   8120  H HD22 . LEU A 1 110 ? -13.959 -4.046  -0.412  1.00 1.70  ? 110  LEU A HD22 3  
ATOM   8121  H HD23 . LEU A 1 110 ? -12.239 -3.809  -0.720  1.00 1.78  ? 110  LEU A HD23 3  
ATOM   8122  N N    . CYS A 1 111 ? -12.143 1.293   -3.139  1.00 0.21  ? 111  CYS A N    3  
ATOM   8123  C CA   . CYS A 1 111 ? -12.444 2.626   -3.607  1.00 0.19  ? 111  CYS A CA   3  
ATOM   8124  C C    . CYS A 1 111 ? -13.014 2.571   -5.014  1.00 0.20  ? 111  CYS A C    3  
ATOM   8125  O O    . CYS A 1 111 ? -14.180 2.895   -5.223  1.00 0.26  ? 111  CYS A O    3  
ATOM   8126  C CB   . CYS A 1 111 ? -11.167 3.461   -3.575  1.00 0.20  ? 111  CYS A CB   3  
ATOM   8127  S SG   . CYS A 1 111 ? -11.320 5.117   -4.246  1.00 0.22  ? 111  CYS A SG   3  
ATOM   8128  H H    . CYS A 1 111 ? -11.248 1.116   -2.776  1.00 0.22  ? 111  CYS A H    3  
ATOM   8129  H HA   . CYS A 1 111 ? -13.176 3.070   -2.948  1.00 0.19  ? 111  CYS A HA   3  
ATOM   8130  H HB2  . CYS A 1 111 ? -10.843 3.557   -2.552  1.00 0.21  ? 111  CYS A HB2  3  
ATOM   8131  H HB3  . CYS A 1 111 ? -10.400 2.954   -4.142  1.00 0.22  ? 111  CYS A HB3  3  
ATOM   8132  H HG   . CYS A 1 111 ? -11.061 5.977   -3.271  1.00 0.90  ? 111  CYS A HG   3  
ATOM   8133  N N    . VAL A 1 112 ? -12.207 2.106   -5.962  1.00 0.20  ? 112  VAL A N    3  
ATOM   8134  C CA   . VAL A 1 112 ? -12.603 2.113   -7.364  1.00 0.22  ? 112  VAL A CA   3  
ATOM   8135  C C    . VAL A 1 112 ? -13.801 1.215   -7.627  1.00 0.22  ? 112  VAL A C    3  
ATOM   8136  O O    . VAL A 1 112 ? -14.662 1.569   -8.422  1.00 0.26  ? 112  VAL A O    3  
ATOM   8137  C CB   . VAL A 1 112 ? -11.476 1.684   -8.306  1.00 0.26  ? 112  VAL A CB   3  
ATOM   8138  C CG1  . VAL A 1 112 ? -11.959 1.822   -9.735  1.00 0.35  ? 112  VAL A CG1  3  
ATOM   8139  C CG2  . VAL A 1 112 ? -10.226 2.512   -8.085  1.00 0.27  ? 112  VAL A CG2  3  
ATOM   8140  H H    . VAL A 1 112 ? -11.328 1.747   -5.711  1.00 0.21  ? 112  VAL A H    3  
ATOM   8141  H HA   . VAL A 1 112 ? -12.886 3.137   -7.624  1.00 0.25  ? 112  VAL A HA   3  
ATOM   8142  H HB   . VAL A 1 112 ? -11.240 0.640   -8.115  1.00 0.27  ? 112  VAL A HB   3  
ATOM   8143  H HG11 . VAL A 1 112 ? -11.133 1.668   -10.412 1.00 1.07  ? 112  VAL A HG11 3  
ATOM   8144  H HG12 . VAL A 1 112 ? -12.371 2.815   -9.880  1.00 1.20  ? 112  VAL A HG12 3  
ATOM   8145  H HG13 . VAL A 1 112 ? -12.725 1.086   -9.927  1.00 0.97  ? 112  VAL A HG13 3  
ATOM   8146  H HG21 . VAL A 1 112 ? -10.472 3.564   -8.149  1.00 1.02  ? 112  VAL A HG21 3  
ATOM   8147  H HG22 . VAL A 1 112 ? -9.496  2.268   -8.847  1.00 1.02  ? 112  VAL A HG22 3  
ATOM   8148  H HG23 . VAL A 1 112 ? -9.817  2.294   -7.107  1.00 1.08  ? 112  VAL A HG23 3  
ATOM   8149  N N    . GLU A 1 113 ? -13.874 0.067   -6.966  1.00 0.23  ? 113  GLU A N    3  
ATOM   8150  C CA   . GLU A 1 113 ? -15.007 -0.828  -7.159  1.00 0.28  ? 113  GLU A CA   3  
ATOM   8151  C C    . GLU A 1 113 ? -16.309 -0.135  -6.795  1.00 0.23  ? 113  GLU A C    3  
ATOM   8152  O O    . GLU A 1 113 ? -17.387 -0.550  -7.209  1.00 0.29  ? 113  GLU A O    3  
ATOM   8153  C CB   . GLU A 1 113 ? -14.835 -2.123  -6.386  1.00 0.40  ? 113  GLU A CB   3  
ATOM   8154  C CG   . GLU A 1 113 ? -13.717 -2.972  -6.950  1.00 0.53  ? 113  GLU A CG   3  
ATOM   8155  C CD   . GLU A 1 113 ? -13.578 -2.832  -8.459  1.00 1.86  ? 113  GLU A CD   3  
ATOM   8156  O OE1  . GLU A 1 113 ? -14.486 -3.289  -9.188  1.00 2.34  ? 113  GLU A OE1  3  
ATOM   8157  O OE2  . GLU A 1 113 ? -12.561 -2.274  -8.925  1.00 2.51  ? 113  GLU A OE2  3  
ATOM   8158  H H    . GLU A 1 113 ? -13.152 -0.190  -6.346  1.00 0.23  ? 113  GLU A H    3  
ATOM   8159  H HA   . GLU A 1 113 ? -15.037 -1.083  -8.204  1.00 0.34  ? 113  GLU A HA   3  
ATOM   8160  H HB2  . GLU A 1 113 ? -14.621 -1.904  -5.348  1.00 0.39  ? 113  GLU A HB2  3  
ATOM   8161  H HB3  . GLU A 1 113 ? -15.752 -2.689  -6.445  1.00 0.45  ? 113  GLU A HB3  3  
ATOM   8162  H HG2  . GLU A 1 113 ? -12.787 -2.694  -6.484  1.00 0.87  ? 113  GLU A HG2  3  
ATOM   8163  H HG3  . GLU A 1 113 ? -13.938 -3.993  -6.729  1.00 1.02  ? 113  GLU A HG3  3  
ATOM   8164  N N    . SER A 1 114 ? -16.195 0.962   -6.065  1.00 0.18  ? 114  SER A N    3  
ATOM   8165  C CA   . SER A 1 114 ? -17.339 1.759   -5.715  1.00 0.19  ? 114  SER A CA   3  
ATOM   8166  C C    . SER A 1 114 ? -17.608 2.714   -6.853  1.00 0.22  ? 114  SER A C    3  
ATOM   8167  O O    . SER A 1 114 ? -18.714 2.808   -7.365  1.00 0.28  ? 114  SER A O    3  
ATOM   8168  C CB   . SER A 1 114 ? -17.060 2.521   -4.422  1.00 0.18  ? 114  SER A CB   3  
ATOM   8169  O OG   . SER A 1 114 ? -16.817 1.624   -3.350  1.00 0.20  ? 114  SER A OG   3  
ATOM   8170  H H    . SER A 1 114 ? -15.302 1.276   -5.800  1.00 0.20  ? 114  SER A H    3  
ATOM   8171  H HA   . SER A 1 114 ? -18.192 1.112   -5.583  1.00 0.20  ? 114  SER A HA   3  
ATOM   8172  H HB2  . SER A 1 114 ? -16.188 3.141   -4.559  1.00 0.18  ? 114  SER A HB2  3  
ATOM   8173  H HB3  . SER A 1 114 ? -17.906 3.145   -4.176  1.00 0.19  ? 114  SER A HB3  3  
ATOM   8174  H HG   . SER A 1 114 ? -15.974 1.172   -3.491  1.00 0.17  ? 114  SER A HG   3  
ATOM   8175  N N    . VAL A 1 115 ? -16.546 3.344   -7.307  1.00 0.21  ? 115  VAL A N    3  
ATOM   8176  C CA   . VAL A 1 115 ? -16.626 4.369   -8.315  1.00 0.27  ? 115  VAL A CA   3  
ATOM   8177  C C    . VAL A 1 115 ? -17.083 3.766   -9.629  1.00 0.28  ? 115  VAL A C    3  
ATOM   8178  O O    . VAL A 1 115 ? -17.794 4.387   -10.418 1.00 0.31  ? 115  VAL A O    3  
ATOM   8179  C CB   . VAL A 1 115 ? -15.270 5.067   -8.479  1.00 0.34  ? 115  VAL A CB   3  
ATOM   8180  C CG1  . VAL A 1 115 ? -14.330 4.728   -7.377  1.00 1.23  ? 115  VAL A CG1  3  
ATOM   8181  C CG2  . VAL A 1 115 ? -14.664 4.843   -9.833  1.00 1.10  ? 115  VAL A CG2  3  
ATOM   8182  H H    . VAL A 1 115 ? -15.666 3.083   -6.978  1.00 0.21  ? 115  VAL A H    3  
ATOM   8183  H HA   . VAL A 1 115 ? -17.338 5.094   -7.993  1.00 0.31  ? 115  VAL A HA   3  
ATOM   8184  H HB   . VAL A 1 115 ? -15.442 6.074   -8.378  1.00 1.10  ? 115  VAL A HB   3  
ATOM   8185  H HG11 . VAL A 1 115 ? -14.306 3.660   -7.250  1.00 1.83  ? 115  VAL A HG11 3  
ATOM   8186  H HG12 . VAL A 1 115 ? -14.683 5.193   -6.467  1.00 1.82  ? 115  VAL A HG12 3  
ATOM   8187  H HG13 . VAL A 1 115 ? -13.339 5.091   -7.619  1.00 1.79  ? 115  VAL A HG13 3  
ATOM   8188  H HG21 . VAL A 1 115 ? -15.369 5.177   -10.575 1.00 1.68  ? 115  VAL A HG21 3  
ATOM   8189  H HG22 . VAL A 1 115 ? -14.462 3.793   -9.967  1.00 1.73  ? 115  VAL A HG22 3  
ATOM   8190  H HG23 . VAL A 1 115 ? -13.754 5.409   -9.915  1.00 1.69  ? 115  VAL A HG23 3  
ATOM   8191  N N    . ASP A 1 116 ? -16.642 2.546   -9.815  1.00 0.28  ? 116  ASP A N    3  
ATOM   8192  C CA   . ASP A 1 116 ? -17.000 1.703   -10.941 1.00 0.34  ? 116  ASP A CA   3  
ATOM   8193  C C    . ASP A 1 116 ? -18.511 1.653   -11.132 1.00 0.35  ? 116  ASP A C    3  
ATOM   8194  O O    . ASP A 1 116 ? -19.022 1.908   -12.221 1.00 0.41  ? 116  ASP A O    3  
ATOM   8195  C CB   . ASP A 1 116 ? -16.472 0.303   -10.657 1.00 0.37  ? 116  ASP A CB   3  
ATOM   8196  C CG   . ASP A 1 116 ? -16.539 -0.618  -11.857 1.00 0.48  ? 116  ASP A CG   3  
ATOM   8197  O OD1  . ASP A 1 116 ? -15.563 -0.657  -12.636 1.00 0.60  ? 116  ASP A OD1  3  
ATOM   8198  O OD2  . ASP A 1 116 ? -17.548 -1.331  -12.012 1.00 0.60  ? 116  ASP A OD2  3  
ATOM   8199  H H    . ASP A 1 116 ? -16.000 2.197   -9.158  1.00 0.26  ? 116  ASP A H    3  
ATOM   8200  H HA   . ASP A 1 116 ? -16.532 2.092   -11.831 1.00 0.39  ? 116  ASP A HA   3  
ATOM   8201  H HB2  . ASP A 1 116 ? -15.440 0.378   -10.340 1.00 0.37  ? 116  ASP A HB2  3  
ATOM   8202  H HB3  . ASP A 1 116 ? -17.059 -0.128  -9.847  1.00 0.34  ? 116  ASP A HB3  3  
ATOM   8203  N N    . LYS A 1 117 ? -19.221 1.351   -10.050 1.00 0.32  ? 117  LYS A N    3  
ATOM   8204  C CA   . LYS A 1 117 ? -20.675 1.275   -10.079 1.00 0.35  ? 117  LYS A CA   3  
ATOM   8205  C C    . LYS A 1 117 ? -21.278 2.660   -9.851  1.00 0.34  ? 117  LYS A C    3  
ATOM   8206  O O    . LYS A 1 117 ? -22.468 2.792   -9.551  1.00 0.37  ? 117  LYS A O    3  
ATOM   8207  C CB   . LYS A 1 117 ? -21.181 0.309   -8.999  1.00 0.37  ? 117  LYS A CB   3  
ATOM   8208  C CG   . LYS A 1 117 ? -20.158 -0.733  -8.553  1.00 0.36  ? 117  LYS A CG   3  
ATOM   8209  C CD   . LYS A 1 117 ? -19.685 -1.610  -9.696  1.00 0.45  ? 117  LYS A CD   3  
ATOM   8210  C CE   . LYS A 1 117 ? -18.621 -2.590  -9.233  1.00 0.61  ? 117  LYS A CE   3  
ATOM   8211  N NZ   . LYS A 1 117 ? -18.073 -3.380  -10.366 1.00 1.62  ? 117  LYS A NZ   3  
ATOM   8212  H H    . LYS A 1 117 ? -18.753 1.150   -9.213  1.00 0.29  ? 117  LYS A H    3  
ATOM   8213  H HA   . LYS A 1 117 ? -20.975 0.913   -11.050 1.00 0.40  ? 117  LYS A HA   3  
ATOM   8214  H HB2  . LYS A 1 117 ? -21.474 0.882   -8.132  1.00 0.35  ? 117  LYS A HB2  3  
ATOM   8215  H HB3  . LYS A 1 117 ? -22.047 -0.211  -9.381  1.00 0.43  ? 117  LYS A HB3  3  
ATOM   8216  H HG2  . LYS A 1 117 ? -19.304 -0.223  -8.135  1.00 0.30  ? 117  LYS A HG2  3  
ATOM   8217  H HG3  . LYS A 1 117 ? -20.606 -1.358  -7.796  1.00 0.39  ? 117  LYS A HG3  3  
ATOM   8218  H HD2  . LYS A 1 117 ? -20.523 -2.156  -10.089 1.00 0.52  ? 117  LYS A HD2  3  
ATOM   8219  H HD3  . LYS A 1 117 ? -19.269 -0.981  -10.468 1.00 0.41  ? 117  LYS A HD3  3  
ATOM   8220  H HE2  . LYS A 1 117 ? -17.818 -2.033  -8.773  1.00 1.09  ? 117  LYS A HE2  3  
ATOM   8221  H HE3  . LYS A 1 117 ? -19.055 -3.262  -8.509  1.00 0.69  ? 117  LYS A HE3  3  
ATOM   8222  H HZ1  . LYS A 1 117 ? -18.784 -4.065  -10.702 1.00 2.16  ? 117  LYS A HZ1  3  
ATOM   8223  H HZ2  . LYS A 1 117 ? -17.221 -3.895  -10.069 1.00 2.12  ? 117  LYS A HZ2  3  
ATOM   8224  H HZ3  . LYS A 1 117 ? -17.822 -2.742  -11.157 1.00 2.13  ? 117  LYS A HZ3  3  
ATOM   8225  N N    . GLU A 1 118 ? -20.430 3.681   -9.996  1.00 0.31  ? 118  GLU A N    3  
ATOM   8226  C CA   . GLU A 1 118 ? -20.817 5.078   -9.813  1.00 0.33  ? 118  GLU A CA   3  
ATOM   8227  C C    . GLU A 1 118 ? -21.189 5.333   -8.362  1.00 0.31  ? 118  GLU A C    3  
ATOM   8228  O O    . GLU A 1 118 ? -22.227 5.910   -8.047  1.00 0.38  ? 118  GLU A O    3  
ATOM   8229  C CB   . GLU A 1 118 ? -21.954 5.464   -10.760 1.00 0.40  ? 118  GLU A CB   3  
ATOM   8230  C CG   . GLU A 1 118 ? -21.614 5.211   -12.218 1.00 0.49  ? 118  GLU A CG   3  
ATOM   8231  C CD   . GLU A 1 118 ? -22.634 5.788   -13.168 1.00 1.12  ? 118  GLU A CD   3  
ATOM   8232  O OE1  . GLU A 1 118 ? -23.758 5.248   -13.232 1.00 1.88  ? 118  GLU A OE1  3  
ATOM   8233  O OE2  . GLU A 1 118 ? -22.320 6.784   -13.852 1.00 1.07  ? 118  GLU A OE2  3  
ATOM   8234  H H    . GLU A 1 118 ? -19.498 3.482   -10.232 1.00 0.31  ? 118  GLU A H    3  
ATOM   8235  H HA   . GLU A 1 118 ? -19.948 5.685   -10.046 1.00 0.33  ? 118  GLU A HA   3  
ATOM   8236  H HB2  . GLU A 1 118 ? -22.833 4.888   -10.507 1.00 0.42  ? 118  GLU A HB2  3  
ATOM   8237  H HB3  . GLU A 1 118 ? -22.171 6.514   -10.639 1.00 0.40  ? 118  GLU A HB3  3  
ATOM   8238  H HG2  . GLU A 1 118 ? -20.655 5.658   -12.431 1.00 0.66  ? 118  GLU A HG2  3  
ATOM   8239  H HG3  . GLU A 1 118 ? -21.555 4.144   -12.379 1.00 0.78  ? 118  GLU A HG3  3  
ATOM   8240  N N    . MET A 1 119 ? -20.306 4.890   -7.489  1.00 0.26  ? 119  MET A N    3  
ATOM   8241  C CA   . MET A 1 119 ? -20.468 5.041   -6.055  1.00 0.26  ? 119  MET A CA   3  
ATOM   8242  C C    . MET A 1 119 ? -19.186 5.635   -5.501  1.00 0.25  ? 119  MET A C    3  
ATOM   8243  O O    . MET A 1 119 ? -18.728 5.281   -4.419  1.00 0.23  ? 119  MET A O    3  
ATOM   8244  C CB   . MET A 1 119 ? -20.752 3.681   -5.403  1.00 0.25  ? 119  MET A CB   3  
ATOM   8245  C CG   . MET A 1 119 ? -21.911 2.926   -6.035  1.00 0.28  ? 119  MET A CG   3  
ATOM   8246  S SD   . MET A 1 119 ? -22.112 1.265   -5.360  1.00 0.31  ? 119  MET A SD   3  
ATOM   8247  C CE   . MET A 1 119 ? -20.438 0.645   -5.494  1.00 0.29  ? 119  MET A CE   3  
ATOM   8248  H H    . MET A 1 119 ? -19.494 4.440   -7.825  1.00 0.26  ? 119  MET A H    3  
ATOM   8249  H HA   . MET A 1 119 ? -21.292 5.716   -5.870  1.00 0.29  ? 119  MET A HA   3  
ATOM   8250  H HB2  . MET A 1 119 ? -19.866 3.068   -5.485  1.00 0.23  ? 119  MET A HB2  3  
ATOM   8251  H HB3  . MET A 1 119 ? -20.975 3.831   -4.358  1.00 0.27  ? 119  MET A HB3  3  
ATOM   8252  H HG2  . MET A 1 119 ? -22.821 3.481   -5.861  1.00 0.30  ? 119  MET A HG2  3  
ATOM   8253  H HG3  . MET A 1 119 ? -21.735 2.849   -7.098  1.00 0.28  ? 119  MET A HG3  3  
ATOM   8254  H HE1  . MET A 1 119 ? -20.390 -0.357  -5.096  1.00 1.08  ? 119  MET A HE1  3  
ATOM   8255  H HE2  . MET A 1 119 ? -19.773 1.289   -4.935  1.00 1.01  ? 119  MET A HE2  3  
ATOM   8256  H HE3  . MET A 1 119 ? -20.134 0.635   -6.536  1.00 1.08  ? 119  MET A HE3  3  
ATOM   8257  N N    . GLN A 1 120 ? -18.604 6.541   -6.283  1.00 0.31  ? 120  GLN A N    3  
ATOM   8258  C CA   . GLN A 1 120 ? -17.367 7.226   -5.938  1.00 0.31  ? 120  GLN A CA   3  
ATOM   8259  C C    . GLN A 1 120 ? -17.438 7.926   -4.569  1.00 0.32  ? 120  GLN A C    3  
ATOM   8260  O O    . GLN A 1 120 ? -16.440 8.431   -4.073  1.00 0.33  ? 120  GLN A O    3  
ATOM   8261  C CB   . GLN A 1 120 ? -17.044 8.246   -7.030  1.00 0.36  ? 120  GLN A CB   3  
ATOM   8262  C CG   . GLN A 1 120 ? -17.227 7.693   -8.432  1.00 0.36  ? 120  GLN A CG   3  
ATOM   8263  C CD   . GLN A 1 120 ? -18.327 8.373   -9.218  1.00 0.58  ? 120  GLN A CD   3  
ATOM   8264  O OE1  . GLN A 1 120 ? -18.649 9.539   -8.991  1.00 1.15  ? 120  GLN A OE1  3  
ATOM   8265  N NE2  . GLN A 1 120 ? -18.892 7.651   -10.171 1.00 0.55  ? 120  GLN A NE2  3  
ATOM   8266  H H    . GLN A 1 120 ? -19.012 6.743   -7.152  1.00 0.39  ? 120  GLN A H    3  
ATOM   8267  H HA   . GLN A 1 120 ? -16.581 6.484   -5.913  1.00 0.29  ? 120  GLN A HA   3  
ATOM   8268  H HB2  . GLN A 1 120 ? -17.689 9.104   -6.915  1.00 0.41  ? 120  GLN A HB2  3  
ATOM   8269  H HB3  . GLN A 1 120 ? -16.015 8.558   -6.923  1.00 0.39  ? 120  GLN A HB3  3  
ATOM   8270  H HG2  . GLN A 1 120 ? -16.311 7.793   -8.973  1.00 0.52  ? 120  GLN A HG2  3  
ATOM   8271  H HG3  . GLN A 1 120 ? -17.468 6.648   -8.348  1.00 0.47  ? 120  GLN A HG3  3  
ATOM   8272  H HE21 . GLN A 1 120 ? -18.569 6.734   -10.311 1.00 0.74  ? 120  GLN A HE21 3  
ATOM   8273  H HE22 . GLN A 1 120 ? -19.608 8.064   -10.710 1.00 0.71  ? 120  GLN A HE22 3  
ATOM   8274  N N    . VAL A 1 121 ? -18.618 7.965   -3.970  1.00 0.32  ? 121  VAL A N    3  
ATOM   8275  C CA   . VAL A 1 121 ? -18.784 8.538   -2.641  1.00 0.35  ? 121  VAL A CA   3  
ATOM   8276  C C    . VAL A 1 121 ? -18.098 7.688   -1.562  1.00 0.31  ? 121  VAL A C    3  
ATOM   8277  O O    . VAL A 1 121 ? -17.756 8.193   -0.495  1.00 0.36  ? 121  VAL A O    3  
ATOM   8278  C CB   . VAL A 1 121 ? -20.273 8.709   -2.287  1.00 0.39  ? 121  VAL A CB   3  
ATOM   8279  C CG1  . VAL A 1 121 ? -20.931 9.708   -3.224  1.00 0.46  ? 121  VAL A CG1  3  
ATOM   8280  C CG2  . VAL A 1 121 ? -20.990 7.369   -2.342  1.00 0.38  ? 121  VAL A CG2  3  
ATOM   8281  H H    . VAL A 1 121 ? -19.401 7.602   -4.435  1.00 0.32  ? 121  VAL A H    3  
ATOM   8282  H HA   . VAL A 1 121 ? -18.328 9.519   -2.648  1.00 0.39  ? 121  VAL A HA   3  
ATOM   8283  H HB   . VAL A 1 121 ? -20.344 9.091   -1.279  1.00 0.42  ? 121  VAL A HB   3  
ATOM   8284  H HG11 . VAL A 1 121 ? -20.428 10.660  -3.144  1.00 1.05  ? 121  VAL A HG11 3  
ATOM   8285  H HG12 . VAL A 1 121 ? -21.970 9.825   -2.954  1.00 1.09  ? 121  VAL A HG12 3  
ATOM   8286  H HG13 . VAL A 1 121 ? -20.862 9.348   -4.240  1.00 1.19  ? 121  VAL A HG13 3  
ATOM   8287  H HG21 . VAL A 1 121 ? -20.959 6.987   -3.351  1.00 1.03  ? 121  VAL A HG21 3  
ATOM   8288  H HG22 . VAL A 1 121 ? -22.017 7.495   -2.033  1.00 1.06  ? 121  VAL A HG22 3  
ATOM   8289  H HG23 . VAL A 1 121 ? -20.496 6.673   -1.681  1.00 1.07  ? 121  VAL A HG23 3  
ATOM   8290  N N    . LEU A 1 122 ? -17.879 6.405   -1.851  1.00 0.24  ? 122  LEU A N    3  
ATOM   8291  C CA   . LEU A 1 122 ? -17.208 5.502   -0.910  1.00 0.21  ? 122  LEU A CA   3  
ATOM   8292  C C    . LEU A 1 122 ? -15.724 5.783   -0.888  1.00 0.19  ? 122  LEU A C    3  
ATOM   8293  O O    . LEU A 1 122 ? -15.043 5.502   0.093   1.00 0.19  ? 122  LEU A O    3  
ATOM   8294  C CB   . LEU A 1 122 ? -17.416 4.027   -1.282  1.00 0.18  ? 122  LEU A CB   3  
ATOM   8295  C CG   . LEU A 1 122 ? -18.791 3.431   -0.983  1.00 0.22  ? 122  LEU A CG   3  
ATOM   8296  C CD1  . LEU A 1 122 ? -19.175 3.683   0.466   1.00 0.26  ? 122  LEU A CD1  3  
ATOM   8297  C CD2  . LEU A 1 122 ? -19.837 3.981   -1.938  1.00 0.22  ? 122  LEU A CD2  3  
ATOM   8298  H H    . LEU A 1 122 ? -18.168 6.056   -2.719  1.00 0.23  ? 122  LEU A H    3  
ATOM   8299  H HA   . LEU A 1 122 ? -17.611 5.680   0.076   1.00 0.24  ? 122  LEU A HA   3  
ATOM   8300  H HB2  . LEU A 1 122 ? -17.233 3.924   -2.341  1.00 0.17  ? 122  LEU A HB2  3  
ATOM   8301  H HB3  . LEU A 1 122 ? -16.677 3.443   -0.755  1.00 0.18  ? 122  LEU A HB3  3  
ATOM   8302  H HG   . LEU A 1 122 ? -18.743 2.360   -1.125  1.00 0.24  ? 122  LEU A HG   3  
ATOM   8303  H HD11 . LEU A 1 122 ? -18.470 3.182   1.116   1.00 1.06  ? 122  LEU A HD11 3  
ATOM   8304  H HD12 . LEU A 1 122 ? -20.170 3.301   0.650   1.00 0.97  ? 122  LEU A HD12 3  
ATOM   8305  H HD13 . LEU A 1 122 ? -19.148 4.748   0.663   1.00 1.03  ? 122  LEU A HD13 3  
ATOM   8306  H HD21 . LEU A 1 122 ? -19.541 3.761   -2.957  1.00 1.00  ? 122  LEU A HD21 3  
ATOM   8307  H HD22 . LEU A 1 122 ? -19.911 5.052   -1.811  1.00 1.01  ? 122  LEU A HD22 3  
ATOM   8308  H HD23 . LEU A 1 122 ? -20.793 3.524   -1.732  1.00 1.00  ? 122  LEU A HD23 3  
ATOM   8309  N N    . VAL A 1 123 ? -15.248 6.338   -1.987  1.00 0.19  ? 123  VAL A N    3  
ATOM   8310  C CA   . VAL A 1 123 ? -13.836 6.624   -2.193  1.00 0.20  ? 123  VAL A CA   3  
ATOM   8311  C C    . VAL A 1 123 ? -13.191 7.274   -0.971  1.00 0.22  ? 123  VAL A C    3  
ATOM   8312  O O    . VAL A 1 123 ? -12.174 6.799   -0.464  1.00 0.25  ? 123  VAL A O    3  
ATOM   8313  C CB   . VAL A 1 123 ? -13.678 7.530   -3.429  1.00 0.22  ? 123  VAL A CB   3  
ATOM   8314  C CG1  . VAL A 1 123 ? -12.276 8.103   -3.535  1.00 0.23  ? 123  VAL A CG1  3  
ATOM   8315  C CG2  . VAL A 1 123 ? -14.033 6.739   -4.677  1.00 0.23  ? 123  VAL A CG2  3  
ATOM   8316  H H    . VAL A 1 123 ? -15.881 6.575   -2.700  1.00 0.21  ? 123  VAL A H    3  
ATOM   8317  H HA   . VAL A 1 123 ? -13.336 5.689   -2.396  1.00 0.19  ? 123  VAL A HA   3  
ATOM   8318  H HB   . VAL A 1 123 ? -14.373 8.351   -3.340  1.00 0.24  ? 123  VAL A HB   3  
ATOM   8319  H HG11 . VAL A 1 123 ? -12.187 8.674   -4.448  1.00 0.99  ? 123  VAL A HG11 3  
ATOM   8320  H HG12 . VAL A 1 123 ? -11.556 7.294   -3.542  1.00 1.00  ? 123  VAL A HG12 3  
ATOM   8321  H HG13 . VAL A 1 123 ? -12.085 8.747   -2.687  1.00 0.91  ? 123  VAL A HG13 3  
ATOM   8322  H HG21 . VAL A 1 123 ? -15.083 6.463   -4.646  1.00 0.99  ? 123  VAL A HG21 3  
ATOM   8323  H HG22 . VAL A 1 123 ? -13.429 5.840   -4.714  1.00 0.98  ? 123  VAL A HG22 3  
ATOM   8324  H HG23 . VAL A 1 123 ? -13.841 7.338   -5.554  1.00 0.93  ? 123  VAL A HG23 3  
ATOM   8325  N N    . SER A 1 124 ? -13.794 8.343   -0.493  1.00 0.24  ? 124  SER A N    3  
ATOM   8326  C CA   . SER A 1 124 ? -13.277 9.075   0.636   1.00 0.28  ? 124  SER A CA   3  
ATOM   8327  C C    . SER A 1 124 ? -13.540 8.331   1.944   1.00 0.27  ? 124  SER A C    3  
ATOM   8328  O O    . SER A 1 124 ? -12.731 8.375   2.875   1.00 0.33  ? 124  SER A O    3  
ATOM   8329  C CB   . SER A 1 124 ? -13.956 10.431  0.642   1.00 0.36  ? 124  SER A CB   3  
ATOM   8330  O OG   . SER A 1 124 ? -15.175 10.377  -0.083  1.00 1.35  ? 124  SER A OG   3  
ATOM   8331  H H    . SER A 1 124 ? -14.628 8.656   -0.904  1.00 0.23  ? 124  SER A H    3  
ATOM   8332  H HA   . SER A 1 124 ? -12.208 9.206   0.506   1.00 0.30  ? 124  SER A HA   3  
ATOM   8333  H HB2  . SER A 1 124 ? -14.172 10.711  1.652   1.00 0.96  ? 124  SER A HB2  3  
ATOM   8334  H HB3  . SER A 1 124 ? -13.310 11.163  0.185   1.00 0.82  ? 124  SER A HB3  3  
ATOM   8335  H HG   . SER A 1 124 ? -15.086 10.903  -0.893  1.00 1.66  ? 124  SER A HG   3  
ATOM   8336  N N    . ARG A 1 125 ? -14.668 7.634   1.992   1.00 0.23  ? 125  ARG A N    3  
ATOM   8337  C CA   . ARG A 1 125 ? -15.093 6.925   3.191   1.00 0.23  ? 125  ARG A CA   3  
ATOM   8338  C C    . ARG A 1 125 ? -14.135 5.783   3.511   1.00 0.21  ? 125  ARG A C    3  
ATOM   8339  O O    . ARG A 1 125 ? -13.639 5.671   4.630   1.00 0.25  ? 125  ARG A O    3  
ATOM   8340  C CB   . ARG A 1 125 ? -16.503 6.364   3.004   1.00 0.28  ? 125  ARG A CB   3  
ATOM   8341  C CG   . ARG A 1 125 ? -17.509 7.363   2.459   1.00 0.55  ? 125  ARG A CG   3  
ATOM   8342  C CD   . ARG A 1 125 ? -18.912 6.796   2.485   1.00 0.55  ? 125  ARG A CD   3  
ATOM   8343  N NE   . ARG A 1 125 ? -19.906 7.721   1.942   1.00 1.44  ? 125  ARG A NE   3  
ATOM   8344  C CZ   . ARG A 1 125 ? -21.100 7.338   1.492   1.00 1.65  ? 125  ARG A CZ   3  
ATOM   8345  N NH1  . ARG A 1 125 ? -21.444 6.057   1.550   1.00 1.06  ? 125  ARG A NH1  3  
ATOM   8346  N NH2  . ARG A 1 125 ? -21.947 8.230   0.993   1.00 2.67  ? 125  ARG A NH2  3  
ATOM   8347  H H    . ARG A 1 125 ? -15.230 7.592   1.192   1.00 0.24  ? 125  ARG A H    3  
ATOM   8348  H HA   . ARG A 1 125 ? -15.094 7.623   4.014   1.00 0.27  ? 125  ARG A HA   3  
ATOM   8349  H HB2  . ARG A 1 125 ? -16.457 5.530   2.320   1.00 0.57  ? 125  ARG A HB2  3  
ATOM   8350  H HB3  . ARG A 1 125 ? -16.863 6.012   3.958   1.00 0.56  ? 125  ARG A HB3  3  
ATOM   8351  H HG2  . ARG A 1 125 ? -17.480 8.261   3.052   1.00 0.83  ? 125  ARG A HG2  3  
ATOM   8352  H HG3  . ARG A 1 125 ? -17.253 7.591   1.441   1.00 0.83  ? 125  ARG A HG3  3  
ATOM   8353  H HD2  . ARG A 1 125 ? -18.929 5.888   1.901   1.00 0.92  ? 125  ARG A HD2  3  
ATOM   8354  H HD3  . ARG A 1 125 ? -19.165 6.567   3.504   1.00 0.90  ? 125  ARG A HD3  3  
ATOM   8355  H HE   . ARG A 1 125 ? -19.667 8.680   1.916   1.00 2.07  ? 125  ARG A HE   3  
ATOM   8356  H HH11 . ARG A 1 125 ? -20.808 5.385   1.930   1.00 0.84  ? 125  ARG A HH11 3  
ATOM   8357  H HH12 . ARG A 1 125 ? -22.347 5.754   1.221   1.00 1.32  ? 125  ARG A HH12 3  
ATOM   8358  H HH21 . ARG A 1 125 ? -21.694 9.206   0.952   1.00 3.30  ? 125  ARG A HH21 3  
ATOM   8359  H HH22 . ARG A 1 125 ? -22.850 7.937   0.653   1.00 2.85  ? 125  ARG A HH22 3  
ATOM   8360  N N    . ILE A 1 126 ? -13.894 4.937   2.518   1.00 0.19  ? 126  ILE A N    3  
ATOM   8361  C CA   . ILE A 1 126 ? -12.993 3.797   2.664   1.00 0.19  ? 126  ILE A CA   3  
ATOM   8362  C C    . ILE A 1 126 ? -11.626 4.233   3.179   1.00 0.20  ? 126  ILE A C    3  
ATOM   8363  O O    . ILE A 1 126 ? -11.117 3.672   4.152   1.00 0.23  ? 126  ILE A O    3  
ATOM   8364  C CB   . ILE A 1 126 ? -12.830 3.060   1.320   1.00 0.19  ? 126  ILE A CB   3  
ATOM   8365  C CG1  . ILE A 1 126 ? -14.208 2.629   0.812   1.00 0.18  ? 126  ILE A CG1  3  
ATOM   8366  C CG2  . ILE A 1 126 ? -11.910 1.856   1.476   1.00 0.22  ? 126  ILE A CG2  3  
ATOM   8367  C CD1  . ILE A 1 126 ? -14.215 2.135   -0.613  1.00 0.18  ? 126  ILE A CD1  3  
ATOM   8368  H H    . ILE A 1 126 ? -14.349 5.076   1.654   1.00 0.20  ? 126  ILE A H    3  
ATOM   8369  H HA   . ILE A 1 126 ? -13.433 3.112   3.374   1.00 0.22  ? 126  ILE A HA   3  
ATOM   8370  H HB   . ILE A 1 126 ? -12.377 3.738   0.608   1.00 0.18  ? 126  ILE A HB   3  
ATOM   8371  H HG12 . ILE A 1 126 ? -14.577 1.831   1.436   1.00 0.21  ? 126  ILE A HG12 3  
ATOM   8372  H HG13 . ILE A 1 126 ? -14.885 3.469   0.876   1.00 0.19  ? 126  ILE A HG13 3  
ATOM   8373  H HG21 . ILE A 1 126 ? -12.310 1.190   2.226   1.00 0.98  ? 126  ILE A HG21 3  
ATOM   8374  H HG22 . ILE A 1 126 ? -10.927 2.190   1.776   1.00 1.02  ? 126  ILE A HG22 3  
ATOM   8375  H HG23 . ILE A 1 126 ? -11.837 1.333   0.533   1.00 1.04  ? 126  ILE A HG23 3  
ATOM   8376  H HD11 . ILE A 1 126 ? -13.576 1.268   -0.698  1.00 1.04  ? 126  ILE A HD11 3  
ATOM   8377  H HD12 . ILE A 1 126 ? -13.855 2.916   -1.266  1.00 1.00  ? 126  ILE A HD12 3  
ATOM   8378  H HD13 . ILE A 1 126 ? -15.224 1.868   -0.894  1.00 1.06  ? 126  ILE A HD13 3  
ATOM   8379  N N    . ALA A 1 127 ? -11.045 5.245   2.543   1.00 0.21  ? 127  ALA A N    3  
ATOM   8380  C CA   . ALA A 1 127 ? -9.718  5.720   2.917   1.00 0.24  ? 127  ALA A CA   3  
ATOM   8381  C C    . ALA A 1 127 ? -9.670  6.158   4.376   1.00 0.24  ? 127  ALA A C    3  
ATOM   8382  O O    . ALA A 1 127 ? -8.636  6.029   5.036   1.00 0.29  ? 127  ALA A O    3  
ATOM   8383  C CB   . ALA A 1 127 ? -9.289  6.859   2.019   1.00 0.27  ? 127  ALA A CB   3  
ATOM   8384  H H    . ALA A 1 127 ? -11.524 5.688   1.805   1.00 0.22  ? 127  ALA A H    3  
ATOM   8385  H HA   . ALA A 1 127 ? -9.023  4.904   2.776   1.00 0.25  ? 127  ALA A HA   3  
ATOM   8386  H HB1  . ALA A 1 127 ? -8.298  7.183   2.300   1.00 1.10  ? 127  ALA A HB1  3  
ATOM   8387  H HB2  . ALA A 1 127 ? -9.981  7.681   2.124   1.00 1.00  ? 127  ALA A HB2  3  
ATOM   8388  H HB3  . ALA A 1 127 ? -9.281  6.524   0.992   1.00 1.00  ? 127  ALA A HB3  3  
ATOM   8389  N N    . ALA A 1 128 ? -10.785 6.683   4.867   1.00 0.21  ? 128  ALA A N    3  
ATOM   8390  C CA   . ALA A 1 128 ? -10.901 7.078   6.264   1.00 0.22  ? 128  ALA A CA   3  
ATOM   8391  C C    . ALA A 1 128 ? -10.649 5.889   7.171   1.00 0.23  ? 128  ALA A C    3  
ATOM   8392  O O    . ALA A 1 128 ? -9.693  5.871   7.950   1.00 0.28  ? 128  ALA A O    3  
ATOM   8393  C CB   . ALA A 1 128 ? -12.285 7.639   6.542   1.00 0.23  ? 128  ALA A CB   3  
ATOM   8394  H H    . ALA A 1 128 ? -11.558 6.802   4.273   1.00 0.23  ? 128  ALA A H    3  
ATOM   8395  H HA   . ALA A 1 128 ? -10.168 7.844   6.469   1.00 0.26  ? 128  ALA A HA   3  
ATOM   8396  H HB1  . ALA A 1 128 ? -12.312 8.054   7.537   1.00 1.12  ? 128  ALA A HB1  3  
ATOM   8397  H HB2  . ALA A 1 128 ? -13.011 6.836   6.468   1.00 0.96  ? 128  ALA A HB2  3  
ATOM   8398  H HB3  . ALA A 1 128 ? -12.519 8.407   5.819   1.00 1.02  ? 128  ALA A HB3  3  
ATOM   8399  N N    . TRP A 1 129 ? -11.502 4.891   7.028   1.00 0.25  ? 129  TRP A N    3  
ATOM   8400  C CA   . TRP A 1 129 ? -11.455 3.702   7.857   1.00 0.35  ? 129  TRP A CA   3  
ATOM   8401  C C    . TRP A 1 129 ? -10.137 2.953   7.674   1.00 0.25  ? 129  TRP A C    3  
ATOM   8402  O O    . TRP A 1 129 ? -9.598  2.397   8.627   1.00 0.27  ? 129  TRP A O    3  
ATOM   8403  C CB   . TRP A 1 129 ? -12.641 2.802   7.516   1.00 0.56  ? 129  TRP A CB   3  
ATOM   8404  C CG   . TRP A 1 129 ? -13.971 3.457   7.748   1.00 0.60  ? 129  TRP A CG   3  
ATOM   8405  C CD1  . TRP A 1 129 ? -14.828 3.924   6.795   1.00 0.49  ? 129  TRP A CD1  3  
ATOM   8406  C CD2  . TRP A 1 129 ? -14.591 3.723   9.011   1.00 1.73  ? 129  TRP A CD2  3  
ATOM   8407  N NE1  . TRP A 1 129 ? -15.941 4.468   7.386   1.00 1.14  ? 129  TRP A NE1  3  
ATOM   8408  C CE2  . TRP A 1 129 ? -15.820 4.354   8.746   1.00 1.99  ? 129  TRP A CE2  3  
ATOM   8409  C CE3  . TRP A 1 129 ? -14.226 3.488   10.340  1.00 2.63  ? 129  TRP A CE3  3  
ATOM   8410  C CZ2  . TRP A 1 129 ? -16.686 4.752   9.760   1.00 3.08  ? 129  TRP A CZ2  3  
ATOM   8411  C CZ3  . TRP A 1 129 ? -15.087 3.885   11.346  1.00 3.70  ? 129  TRP A CZ3  3  
ATOM   8412  C CH2  . TRP A 1 129 ? -16.304 4.511   11.051  1.00 3.91  ? 129  TRP A CH2  3  
ATOM   8413  H H    . TRP A 1 129 ? -12.192 4.956   6.332   1.00 0.26  ? 129  TRP A H    3  
ATOM   8414  H HA   . TRP A 1 129 ? -11.538 4.014   8.887   1.00 0.47  ? 129  TRP A HA   3  
ATOM   8415  H HB2  . TRP A 1 129 ? -12.586 2.532   6.474   1.00 1.10  ? 129  TRP A HB2  3  
ATOM   8416  H HB3  . TRP A 1 129 ? -12.596 1.914   8.121   1.00 0.98  ? 129  TRP A HB3  3  
ATOM   8417  H HD1  . TRP A 1 129 ? -14.643 3.871   5.732   1.00 1.00  ? 129  TRP A HD1  3  
ATOM   8418  H HE1  . TRP A 1 129 ? -16.704 4.875   6.908   1.00 1.24  ? 129  TRP A HE1  3  
ATOM   8419  H HE3  . TRP A 1 129 ? -13.291 3.007   10.586  1.00 2.55  ? 129  TRP A HE3  3  
ATOM   8420  H HZ2  . TRP A 1 129 ? -17.630 5.236   9.549   1.00 3.31  ? 129  TRP A HZ2  3  
ATOM   8421  H HZ3  . TRP A 1 129 ? -14.822 3.713   12.378  1.00 4.42  ? 129  TRP A HZ3  3  
ATOM   8422  H HH2  . TRP A 1 129 ? -16.945 4.805   11.869  1.00 4.77  ? 129  TRP A HH2  3  
ATOM   8423  N N    . MET A 1 130 ? -9.616  2.958   6.449   1.00 0.24  ? 130  MET A N    3  
ATOM   8424  C CA   . MET A 1 130 ? -8.344  2.299   6.148   1.00 0.26  ? 130  MET A CA   3  
ATOM   8425  C C    . MET A 1 130 ? -7.202  2.900   6.954   1.00 0.25  ? 130  MET A C    3  
ATOM   8426  O O    . MET A 1 130 ? -6.479  2.187   7.651   1.00 0.29  ? 130  MET A O    3  
ATOM   8427  C CB   . MET A 1 130 ? -8.021  2.404   4.661   1.00 0.31  ? 130  MET A CB   3  
ATOM   8428  C CG   . MET A 1 130 ? -8.909  1.549   3.783   1.00 0.29  ? 130  MET A CG   3  
ATOM   8429  S SD   . MET A 1 130 ? -8.568  1.782   2.031   1.00 1.08  ? 130  MET A SD   3  
ATOM   8430  C CE   . MET A 1 130 ? -6.854  1.285   1.958   1.00 0.31  ? 130  MET A CE   3  
ATOM   8431  H H    . MET A 1 130 ? -10.103 3.413   5.724   1.00 0.26  ? 130  MET A H    3  
ATOM   8432  H HA   . MET A 1 130 ? -8.442  1.256   6.406   1.00 0.28  ? 130  MET A HA   3  
ATOM   8433  H HB2  . MET A 1 130 ? -8.131  3.433   4.353   1.00 0.40  ? 130  MET A HB2  3  
ATOM   8434  H HB3  . MET A 1 130 ? -6.996  2.101   4.505   1.00 0.40  ? 130  MET A HB3  3  
ATOM   8435  H HG2  . MET A 1 130 ? -8.745  0.512   4.032   1.00 0.69  ? 130  MET A HG2  3  
ATOM   8436  H HG3  . MET A 1 130 ? -9.937  1.810   3.974   1.00 0.67  ? 130  MET A HG3  3  
ATOM   8437  H HE1  . MET A 1 130 ? -6.769  0.248   2.243   1.00 1.03  ? 130  MET A HE1  3  
ATOM   8438  H HE2  . MET A 1 130 ? -6.277  1.895   2.641   1.00 1.09  ? 130  MET A HE2  3  
ATOM   8439  H HE3  . MET A 1 130 ? -6.485  1.416   0.950   1.00 1.02  ? 130  MET A HE3  3  
ATOM   8440  N N    . ALA A 1 131 ? -7.038  4.212   6.851   1.00 0.24  ? 131  ALA A N    3  
ATOM   8441  C CA   . ALA A 1 131 ? -5.957  4.896   7.546   1.00 0.24  ? 131  ALA A CA   3  
ATOM   8442  C C    . ALA A 1 131 ? -6.097  4.747   9.050   1.00 0.24  ? 131  ALA A C    3  
ATOM   8443  O O    . ALA A 1 131 ? -5.113  4.493   9.746   1.00 0.25  ? 131  ALA A O    3  
ATOM   8444  C CB   . ALA A 1 131 ? -5.908  6.361   7.160   1.00 0.25  ? 131  ALA A CB   3  
ATOM   8445  H H    . ALA A 1 131 ? -7.656  4.730   6.289   1.00 0.25  ? 131  ALA A H    3  
ATOM   8446  H HA   . ALA A 1 131 ? -5.027  4.438   7.238   1.00 0.25  ? 131  ALA A HA   3  
ATOM   8447  H HB1  . ALA A 1 131 ? -6.812  6.850   7.489   1.00 1.04  ? 131  ALA A HB1  3  
ATOM   8448  H HB2  . ALA A 1 131 ? -5.820  6.447   6.084   1.00 1.01  ? 131  ALA A HB2  3  
ATOM   8449  H HB3  . ALA A 1 131 ? -5.053  6.828   7.630   1.00 1.05  ? 131  ALA A HB3  3  
ATOM   8450  N N    . THR A 1 132 ? -7.315  4.895   9.552   1.00 0.26  ? 132  THR A N    3  
ATOM   8451  C CA   . THR A 1 132 ? -7.563  4.709   10.970  1.00 0.29  ? 132  THR A CA   3  
ATOM   8452  C C    . THR A 1 132 ? -7.224  3.284   11.394  1.00 0.30  ? 132  THR A C    3  
ATOM   8453  O O    . THR A 1 132 ? -6.590  3.073   12.426  1.00 0.32  ? 132  THR A O    3  
ATOM   8454  C CB   . THR A 1 132 ? -9.021  5.007   11.348  1.00 0.32  ? 132  THR A CB   3  
ATOM   8455  O OG1  . THR A 1 132 ? -9.349  6.371   11.037  1.00 0.35  ? 132  THR A OG1  3  
ATOM   8456  C CG2  . THR A 1 132 ? -9.233  4.742   12.831  1.00 0.40  ? 132  THR A CG2  3  
ATOM   8457  H H    . THR A 1 132 ? -8.061  5.144   8.959   1.00 0.28  ? 132  THR A H    3  
ATOM   8458  H HA   . THR A 1 132 ? -6.925  5.397   11.508  1.00 0.31  ? 132  THR A HA   3  
ATOM   8459  H HB   . THR A 1 132 ? -9.667  4.350   10.785  1.00 0.33  ? 132  THR A HB   3  
ATOM   8460  H HG1  . THR A 1 132 ? -9.588  6.839   11.852  1.00 1.04  ? 132  THR A HG1  3  
ATOM   8461  H HG21 . THR A 1 132 ? -8.951  3.719   13.051  1.00 1.11  ? 132  THR A HG21 3  
ATOM   8462  H HG22 . THR A 1 132 ? -10.270 4.897   13.084  1.00 1.07  ? 132  THR A HG22 3  
ATOM   8463  H HG23 . THR A 1 132 ? -8.612  5.414   13.408  1.00 1.13  ? 132  THR A HG23 3  
ATOM   8464  N N    . TYR A 1 133 ? -7.644  2.309   10.596  1.00 0.30  ? 133  TYR A N    3  
ATOM   8465  C CA   . TYR A 1 133 ? -7.350  0.912   10.884  1.00 0.32  ? 133  TYR A CA   3  
ATOM   8466  C C    . TYR A 1 133 ? -5.845  0.706   11.003  1.00 0.32  ? 133  TYR A C    3  
ATOM   8467  O O    . TYR A 1 133 ? -5.378  -0.027  11.872  1.00 0.37  ? 133  TYR A O    3  
ATOM   8468  C CB   . TYR A 1 133 ? -7.924  -0.010  9.807   1.00 0.33  ? 133  TYR A CB   3  
ATOM   8469  C CG   . TYR A 1 133 ? -7.976  -1.460  10.233  1.00 0.93  ? 133  TYR A CG   3  
ATOM   8470  C CD1  . TYR A 1 133 ? -6.859  -2.273  10.105  1.00 1.72  ? 133  TYR A CD1  3  
ATOM   8471  C CD2  . TYR A 1 133 ? -9.141  -2.020  10.744  1.00 1.29  ? 133  TYR A CD2  3  
ATOM   8472  C CE1  . TYR A 1 133 ? -6.899  -3.602  10.474  1.00 2.40  ? 133  TYR A CE1  3  
ATOM   8473  C CE2  . TYR A 1 133 ? -9.188  -3.348  11.118  1.00 1.93  ? 133  TYR A CE2  3  
ATOM   8474  C CZ   . TYR A 1 133 ? -8.078  -4.112  11.054  1.00 2.40  ? 133  TYR A CZ   3  
ATOM   8475  O OH   . TYR A 1 133 ? -8.112  -5.459  11.339  1.00 3.13  ? 133  TYR A OH   3  
ATOM   8476  H H    . TYR A 1 133 ? -8.178  2.534   9.803   1.00 0.30  ? 133  TYR A H    3  
ATOM   8477  H HA   . TYR A 1 133 ? -7.806  0.670   11.833  1.00 0.34  ? 133  TYR A HA   3  
ATOM   8478  H HB2  . TYR A 1 133 ? -8.930  0.305   9.572   1.00 0.63  ? 133  TYR A HB2  3  
ATOM   8479  H HB3  . TYR A 1 133 ? -7.312  0.056   8.919   1.00 0.67  ? 133  TYR A HB3  3  
ATOM   8480  H HD1  . TYR A 1 133 ? -5.949  -1.852  9.708   1.00 1.99  ? 133  TYR A HD1  3  
ATOM   8481  H HD2  . TYR A 1 133 ? -10.020 -1.399  10.850  1.00 1.45  ? 133  TYR A HD2  3  
ATOM   8482  H HE1  . TYR A 1 133 ? -6.018  -4.218  10.367  1.00 3.06  ? 133  TYR A HE1  3  
ATOM   8483  H HE2  . TYR A 1 133 ? -10.101 -3.765  11.516  1.00 2.31  ? 133  TYR A HE2  3  
ATOM   8484  H HH   . TYR A 1 133 ? -7.415  -5.642  11.976  1.00 3.35  ? 133  TYR A HH   3  
ATOM   8485  N N    . LEU A 1 134 ? -5.086  1.360   10.133  1.00 0.29  ? 134  LEU A N    3  
ATOM   8486  C CA   . LEU A 1 134 ? -3.636  1.335   10.238  1.00 0.30  ? 134  LEU A CA   3  
ATOM   8487  C C    . LEU A 1 134 ? -3.230  1.950   11.572  1.00 0.32  ? 134  LEU A C    3  
ATOM   8488  O O    . LEU A 1 134 ? -2.541  1.326   12.373  1.00 0.35  ? 134  LEU A O    3  
ATOM   8489  C CB   . LEU A 1 134 ? -2.983  2.110   9.081   1.00 0.29  ? 134  LEU A CB   3  
ATOM   8490  C CG   . LEU A 1 134 ? -1.524  1.739   8.780   1.00 0.48  ? 134  LEU A CG   3  
ATOM   8491  C CD1  . LEU A 1 134 ? -1.031  2.467   7.549   1.00 0.95  ? 134  LEU A CD1  3  
ATOM   8492  C CD2  . LEU A 1 134 ? -0.625  2.078   9.951   1.00 0.88  ? 134  LEU A CD2  3  
ATOM   8493  H H    . LEU A 1 134 ? -5.512  1.866   9.404   1.00 0.28  ? 134  LEU A H    3  
ATOM   8494  H HA   . LEU A 1 134 ? -3.312  0.305   10.208  1.00 0.31  ? 134  LEU A HA   3  
ATOM   8495  H HB2  . LEU A 1 134 ? -3.567  1.949   8.188   1.00 0.33  ? 134  LEU A HB2  3  
ATOM   8496  H HB3  . LEU A 1 134 ? -3.017  3.163   9.322   1.00 0.42  ? 134  LEU A HB3  3  
ATOM   8497  H HG   . LEU A 1 134 ? -1.455  0.677   8.596   1.00 1.16  ? 134  LEU A HG   3  
ATOM   8498  H HD11 . LEU A 1 134 ? -0.201  1.925   7.121   1.00 1.59  ? 134  LEU A HD11 3  
ATOM   8499  H HD12 . LEU A 1 134 ? -0.700  3.456   7.833   1.00 1.54  ? 134  LEU A HD12 3  
ATOM   8500  H HD13 . LEU A 1 134 ? -1.829  2.544   6.826   1.00 1.45  ? 134  LEU A HD13 3  
ATOM   8501  H HD21 . LEU A 1 134 ? -0.945  1.526   10.822  1.00 1.30  ? 134  LEU A HD21 3  
ATOM   8502  H HD22 . LEU A 1 134 ? -0.689  3.141   10.153  1.00 1.49  ? 134  LEU A HD22 3  
ATOM   8503  H HD23 . LEU A 1 134 ? 0.395   1.817   9.711   1.00 1.46  ? 134  LEU A HD23 3  
ATOM   8504  N N    . ASN A 1 135 ? -3.697  3.166   11.796  1.00 0.31  ? 135  ASN A N    3  
ATOM   8505  C CA   . ASN A 1 135 ? -3.396  3.927   13.005  1.00 0.35  ? 135  ASN A CA   3  
ATOM   8506  C C    . ASN A 1 135 ? -3.682  3.132   14.282  1.00 0.38  ? 135  ASN A C    3  
ATOM   8507  O O    . ASN A 1 135 ? -2.878  3.136   15.216  1.00 0.43  ? 135  ASN A O    3  
ATOM   8508  C CB   . ASN A 1 135 ? -4.220  5.219   13.002  1.00 0.36  ? 135  ASN A CB   3  
ATOM   8509  C CG   . ASN A 1 135 ? -3.540  6.371   12.288  1.00 0.38  ? 135  ASN A CG   3  
ATOM   8510  O OD1  . ASN A 1 135 ? -2.825  7.158   12.900  1.00 0.46  ? 135  ASN A OD1  3  
ATOM   8511  N ND2  . ASN A 1 135 ? -3.767  6.485   10.990  1.00 0.34  ? 135  ASN A ND2  3  
ATOM   8512  H H    . ASN A 1 135 ? -4.277  3.575   11.116  1.00 0.30  ? 135  ASN A H    3  
ATOM   8513  H HA   . ASN A 1 135 ? -2.349  4.180   12.982  1.00 0.37  ? 135  ASN A HA   3  
ATOM   8514  H HB2  . ASN A 1 135 ? -5.152  5.026   12.500  1.00 0.34  ? 135  ASN A HB2  3  
ATOM   8515  H HB3  . ASN A 1 135 ? -4.425  5.516   14.017  1.00 0.40  ? 135  ASN A HB3  3  
ATOM   8516  H HD21 . ASN A 1 135 ? -4.353  5.822   10.560  1.00 0.30  ? 135  ASN A HD21 3  
ATOM   8517  H HD22 . ASN A 1 135 ? -3.362  7.243   10.511  1.00 0.37  ? 135  ASN A HD22 3  
ATOM   8518  N N    . ASP A 1 136 ? -4.819  2.452   14.315  1.00 0.38  ? 136  ASP A N    3  
ATOM   8519  C CA   . ASP A 1 136 ? -5.246  1.727   15.505  1.00 0.42  ? 136  ASP A CA   3  
ATOM   8520  C C    . ASP A 1 136 ? -4.629  0.331   15.574  1.00 0.40  ? 136  ASP A C    3  
ATOM   8521  O O    . ASP A 1 136 ? -4.025  -0.050  16.575  1.00 0.43  ? 136  ASP A O    3  
ATOM   8522  C CB   . ASP A 1 136 ? -6.774  1.623   15.514  1.00 0.45  ? 136  ASP A CB   3  
ATOM   8523  C CG   . ASP A 1 136 ? -7.317  0.867   16.709  1.00 0.53  ? 136  ASP A CG   3  
ATOM   8524  O OD1  . ASP A 1 136 ? -7.457  1.474   17.793  1.00 0.59  ? 136  ASP A OD1  3  
ATOM   8525  O OD2  . ASP A 1 136 ? -7.583  -0.345  16.578  1.00 0.58  ? 136  ASP A OD2  3  
ATOM   8526  H H    . ASP A 1 136 ? -5.403  2.449   13.515  1.00 0.37  ? 136  ASP A H    3  
ATOM   8527  H HA   . ASP A 1 136 ? -4.931  2.291   16.369  1.00 0.46  ? 136  ASP A HA   3  
ATOM   8528  H HB2  . ASP A 1 136 ? -7.193  2.618   15.526  1.00 0.48  ? 136  ASP A HB2  3  
ATOM   8529  H HB3  . ASP A 1 136 ? -7.095  1.116   14.615  1.00 0.44  ? 136  ASP A HB3  3  
ATOM   8530  N N    . HIS A 1 137 ? -4.789  -0.422  14.503  1.00 0.38  ? 137  HIS A N    3  
ATOM   8531  C CA   . HIS A 1 137 ? -4.418  -1.835  14.482  1.00 0.38  ? 137  HIS A CA   3  
ATOM   8532  C C    . HIS A 1 137 ? -2.988  -2.072  14.006  1.00 0.35  ? 137  HIS A C    3  
ATOM   8533  O O    . HIS A 1 137 ? -2.204  -2.747  14.670  1.00 0.37  ? 137  HIS A O    3  
ATOM   8534  C CB   . HIS A 1 137 ? -5.374  -2.580  13.558  1.00 0.40  ? 137  HIS A CB   3  
ATOM   8535  C CG   . HIS A 1 137 ? -6.567  -3.168  14.244  1.00 0.63  ? 137  HIS A CG   3  
ATOM   8536  N ND1  . HIS A 1 137 ? -7.753  -2.487  14.406  1.00 1.18  ? 137  HIS A ND1  3  
ATOM   8537  C CD2  . HIS A 1 137 ? -6.760  -4.390  14.792  1.00 1.45  ? 137  HIS A CD2  3  
ATOM   8538  C CE1  . HIS A 1 137 ? -8.623  -3.264  15.021  1.00 1.13  ? 137  HIS A CE1  3  
ATOM   8539  N NE2  . HIS A 1 137 ? -8.046  -4.422  15.265  1.00 1.34  ? 137  HIS A NE2  3  
ATOM   8540  H H    . HIS A 1 137 ? -5.168  -0.019  13.688  1.00 0.37  ? 137  HIS A H    3  
ATOM   8541  H HA   . HIS A 1 137 ? -4.526  -2.224  15.482  1.00 0.42  ? 137  HIS A HA   3  
ATOM   8542  H HB2  . HIS A 1 137 ? -5.738  -1.882  12.815  1.00 0.51  ? 137  HIS A HB2  3  
ATOM   8543  H HB3  . HIS A 1 137 ? -4.840  -3.378  13.060  1.00 0.41  ? 137  HIS A HB3  3  
ATOM   8544  H HD1  . HIS A 1 137 ? -7.934  -1.559  14.114  1.00 1.96  ? 137  HIS A HD1  3  
ATOM   8545  H HD2  . HIS A 1 137 ? -6.036  -5.191  14.843  1.00 2.34  ? 137  HIS A HD2  3  
ATOM   8546  H HE1  . HIS A 1 137 ? -9.637  -2.997  15.281  1.00 1.61  ? 137  HIS A HE1  3  
ATOM   8547  H HE2  . HIS A 1 137 ? -8.504  -5.219  15.625  1.00 1.90  ? 137  HIS A HE2  3  
ATOM   8548  N N    . LEU A 1 138 ? -2.663  -1.503  12.860  1.00 0.32  ? 138  LEU A N    3  
ATOM   8549  C CA   . LEU A 1 138 ? -1.478  -1.873  12.115  1.00 0.29  ? 138  LEU A CA   3  
ATOM   8550  C C    . LEU A 1 138 ? -0.200  -1.233  12.629  1.00 0.27  ? 138  LEU A C    3  
ATOM   8551  O O    . LEU A 1 138 ? 0.822   -1.903  12.746  1.00 0.27  ? 138  LEU A O    3  
ATOM   8552  C CB   . LEU A 1 138 ? -1.705  -1.475  10.674  1.00 0.30  ? 138  LEU A CB   3  
ATOM   8553  C CG   . LEU A 1 138 ? -1.991  -2.622  9.727   1.00 0.59  ? 138  LEU A CG   3  
ATOM   8554  C CD1  . LEU A 1 138 ? -2.709  -3.770  10.423  1.00 1.20  ? 138  LEU A CD1  3  
ATOM   8555  C CD2  . LEU A 1 138 ? -2.803  -2.128  8.548   1.00 1.20  ? 138  LEU A CD2  3  
ATOM   8556  H H    . LEU A 1 138 ? -3.245  -0.811  12.484  1.00 0.33  ? 138  LEU A H    3  
ATOM   8557  H HA   . LEU A 1 138 ? -1.376  -2.945  12.161  1.00 0.32  ? 138  LEU A HA   3  
ATOM   8558  H HB2  . LEU A 1 138 ? -2.542  -0.791  10.640  1.00 0.58  ? 138  LEU A HB2  3  
ATOM   8559  H HB3  . LEU A 1 138 ? -0.825  -0.958  10.322  1.00 0.58  ? 138  LEU A HB3  3  
ATOM   8560  H HG   . LEU A 1 138 ? -1.059  -2.984  9.366   1.00 1.51  ? 138  LEU A HG   3  
ATOM   8561  H HD11 . LEU A 1 138 ? -2.093  -4.142  11.230  1.00 1.82  ? 138  LEU A HD11 3  
ATOM   8562  H HD12 . LEU A 1 138 ? -2.886  -4.565  9.713   1.00 1.75  ? 138  LEU A HD12 3  
ATOM   8563  H HD13 . LEU A 1 138 ? -3.651  -3.421  10.819  1.00 1.75  ? 138  LEU A HD13 3  
ATOM   8564  H HD21 . LEU A 1 138 ? -2.265  -1.333  8.052   1.00 1.73  ? 138  LEU A HD21 3  
ATOM   8565  H HD22 . LEU A 1 138 ? -3.755  -1.757  8.902   1.00 1.90  ? 138  LEU A HD22 3  
ATOM   8566  H HD23 . LEU A 1 138 ? -2.966  -2.941  7.857   1.00 1.66  ? 138  LEU A HD23 3  
ATOM   8567  N N    . GLU A 1 139 ? -0.264  0.059   12.899  1.00 0.30  ? 139  GLU A N    3  
ATOM   8568  C CA   . GLU A 1 139 ? 0.908   0.845   13.299  1.00 0.31  ? 139  GLU A CA   3  
ATOM   8569  C C    . GLU A 1 139 ? 1.769   0.131   14.357  1.00 0.30  ? 139  GLU A C    3  
ATOM   8570  O O    . GLU A 1 139 ? 2.983   0.021   14.171  1.00 0.30  ? 139  GLU A O    3  
ATOM   8571  C CB   . GLU A 1 139 ? 0.488   2.230   13.792  1.00 0.38  ? 139  GLU A CB   3  
ATOM   8572  C CG   . GLU A 1 139 ? 1.642   3.214   13.881  1.00 0.40  ? 139  GLU A CG   3  
ATOM   8573  C CD   . GLU A 1 139 ? 1.223   4.535   14.481  1.00 0.49  ? 139  GLU A CD   3  
ATOM   8574  O OE1  . GLU A 1 139 ? 0.706   5.389   13.739  1.00 0.75  ? 139  GLU A OE1  3  
ATOM   8575  O OE2  . GLU A 1 139 ? 1.398   4.715   15.706  1.00 0.61  ? 139  GLU A OE2  3  
ATOM   8576  H H    . GLU A 1 139 ? -1.130  0.511   12.802  1.00 0.34  ? 139  GLU A H    3  
ATOM   8577  H HA   . GLU A 1 139 ? 1.514   0.976   12.416  1.00 0.30  ? 139  GLU A HA   3  
ATOM   8578  H HB2  . GLU A 1 139 ? -0.250  2.633   13.113  1.00 0.44  ? 139  GLU A HB2  3  
ATOM   8579  H HB3  . GLU A 1 139 ? 0.049   2.136   14.772  1.00 0.42  ? 139  GLU A HB3  3  
ATOM   8580  H HG2  . GLU A 1 139 ? 2.422   2.787   14.493  1.00 0.40  ? 139  GLU A HG2  3  
ATOM   8581  H HG3  . GLU A 1 139 ? 2.023   3.392   12.886  1.00 0.42  ? 139  GLU A HG3  3  
ATOM   8582  N N    . PRO A 1 140 ? 1.181   -0.374  15.471  1.00 0.32  ? 140  PRO A N    3  
ATOM   8583  C CA   . PRO A 1 140 ? 1.940   -1.136  16.470  1.00 0.34  ? 140  PRO A CA   3  
ATOM   8584  C C    . PRO A 1 140 ? 2.685   -2.310  15.843  1.00 0.32  ? 140  PRO A C    3  
ATOM   8585  O O    . PRO A 1 140 ? 3.890   -2.470  16.038  1.00 0.34  ? 140  PRO A O    3  
ATOM   8586  C CB   . PRO A 1 140 ? 0.867   -1.652  17.431  1.00 0.40  ? 140  PRO A CB   3  
ATOM   8587  C CG   . PRO A 1 140 ? -0.269  -0.707  17.283  1.00 0.56  ? 140  PRO A CG   3  
ATOM   8588  C CD   . PRO A 1 140 ? -0.241  -0.240  15.858  1.00 0.36  ? 140  PRO A CD   3  
ATOM   8589  H HA   . PRO A 1 140 ? 2.640   -0.509  17.003  1.00 0.37  ? 140  PRO A HA   3  
ATOM   8590  H HB2  . PRO A 1 140 ? 0.583   -2.656  17.148  1.00 0.48  ? 140  PRO A HB2  3  
ATOM   8591  H HB3  . PRO A 1 140 ? 1.253   -1.652  18.439  1.00 0.52  ? 140  PRO A HB3  3  
ATOM   8592  H HG2  . PRO A 1 140 ? -1.196  -1.219  17.489  1.00 0.82  ? 140  PRO A HG2  3  
ATOM   8593  H HG3  . PRO A 1 140 ? -0.142  0.129   17.956  1.00 0.87  ? 140  PRO A HG3  3  
ATOM   8594  H HD2  . PRO A 1 140 ? -0.866  -0.872  15.245  1.00 0.42  ? 140  PRO A HD2  3  
ATOM   8595  H HD3  . PRO A 1 140 ? -0.563  0.788   15.794  1.00 0.46  ? 140  PRO A HD3  3  
ATOM   8596  N N    . TRP A 1 141 ? 1.952   -3.108  15.072  1.00 0.31  ? 141  TRP A N    3  
ATOM   8597  C CA   . TRP A 1 141 ? 2.501   -4.285  14.405  1.00 0.32  ? 141  TRP A CA   3  
ATOM   8598  C C    . TRP A 1 141 ? 3.660   -3.886  13.495  1.00 0.31  ? 141  TRP A C    3  
ATOM   8599  O O    . TRP A 1 141 ? 4.734   -4.474  13.554  1.00 0.36  ? 141  TRP A O    3  
ATOM   8600  C CB   . TRP A 1 141 ? 1.404   -4.966  13.587  1.00 0.35  ? 141  TRP A CB   3  
ATOM   8601  C CG   . TRP A 1 141 ? 1.564   -6.448  13.469  1.00 0.36  ? 141  TRP A CG   3  
ATOM   8602  C CD1  . TRP A 1 141 ? 2.585   -7.126  12.870  1.00 0.43  ? 141  TRP A CD1  3  
ATOM   8603  C CD2  . TRP A 1 141 ? 0.655   -7.441  13.956  1.00 0.63  ? 141  TRP A CD2  3  
ATOM   8604  N NE1  . TRP A 1 141 ? 2.367   -8.479  12.960  1.00 0.60  ? 141  TRP A NE1  3  
ATOM   8605  C CE2  . TRP A 1 141 ? 1.189   -8.697  13.622  1.00 0.70  ? 141  TRP A CE2  3  
ATOM   8606  C CE3  . TRP A 1 141 ? -0.561  -7.387  14.644  1.00 0.91  ? 141  TRP A CE3  3  
ATOM   8607  C CZ2  . TRP A 1 141 ? 0.551   -9.889  13.953  1.00 0.98  ? 141  TRP A CZ2  3  
ATOM   8608  C CZ3  . TRP A 1 141 ? -1.193  -8.571  14.971  1.00 1.19  ? 141  TRP A CZ3  3  
ATOM   8609  C CH2  . TRP A 1 141 ? -0.635  -9.807  14.626  1.00 1.20  ? 141  TRP A CH2  3  
ATOM   8610  H H    . TRP A 1 141 ? 1.004   -2.891  14.942  1.00 0.32  ? 141  TRP A H    3  
ATOM   8611  H HA   . TRP A 1 141 ? 2.863   -4.969  15.157  1.00 0.36  ? 141  TRP A HA   3  
ATOM   8612  H HB2  . TRP A 1 141 ? 0.449   -4.771  14.051  1.00 0.48  ? 141  TRP A HB2  3  
ATOM   8613  H HB3  . TRP A 1 141 ? 1.402   -4.549  12.588  1.00 0.41  ? 141  TRP A HB3  3  
ATOM   8614  H HD1  . TRP A 1 141 ? 3.434   -6.654  12.400  1.00 0.54  ? 141  TRP A HD1  3  
ATOM   8615  H HE1  . TRP A 1 141 ? 2.960   -9.180  12.603  1.00 0.74  ? 141  TRP A HE1  3  
ATOM   8616  H HE3  . TRP A 1 141 ? -1.006  -6.443  14.920  1.00 0.97  ? 141  TRP A HE3  3  
ATOM   8617  H HZ2  . TRP A 1 141 ? 0.968   -10.852 13.693  1.00 1.08  ? 141  TRP A HZ2  3  
ATOM   8618  H HZ3  . TRP A 1 141 ? -2.132  -8.549  15.503  1.00 1.43  ? 141  TRP A HZ3  3  
ATOM   8619  H HH2  . TRP A 1 141 ? -1.165  -10.707 14.901  1.00 1.43  ? 141  TRP A HH2  3  
ATOM   8620  N N    . ILE A 1 142 ? 3.427   -2.875  12.669  1.00 0.26  ? 142  ILE A N    3  
ATOM   8621  C CA   . ILE A 1 142 ? 4.453   -2.313  11.794  1.00 0.26  ? 142  ILE A CA   3  
ATOM   8622  C C    . ILE A 1 142 ? 5.761   -2.073  12.541  1.00 0.29  ? 142  ILE A C    3  
ATOM   8623  O O    . ILE A 1 142 ? 6.823   -2.539  12.124  1.00 0.32  ? 142  ILE A O    3  
ATOM   8624  C CB   . ILE A 1 142 ? 3.952   -0.982  11.213  1.00 0.25  ? 142  ILE A CB   3  
ATOM   8625  C CG1  . ILE A 1 142 ? 2.809   -1.250  10.247  1.00 0.28  ? 142  ILE A CG1  3  
ATOM   8626  C CG2  . ILE A 1 142 ? 5.078   -0.222  10.532  1.00 0.28  ? 142  ILE A CG2  3  
ATOM   8627  C CD1  . ILE A 1 142 ? 1.946   -0.046  9.987   1.00 0.26  ? 142  ILE A CD1  3  
ATOM   8628  H H    . ILE A 1 142 ? 2.518   -2.490  12.637  1.00 0.25  ? 142  ILE A H    3  
ATOM   8629  H HA   . ILE A 1 142 ? 4.623   -3.002  10.980  1.00 0.28  ? 142  ILE A HA   3  
ATOM   8630  H HB   . ILE A 1 142 ? 3.586   -0.376  12.028  1.00 0.26  ? 142  ILE A HB   3  
ATOM   8631  H HG12 . ILE A 1 142 ? 3.214   -1.576  9.301   1.00 0.40  ? 142  ILE A HG12 3  
ATOM   8632  H HG13 . ILE A 1 142 ? 2.179   -2.029  10.652  1.00 0.41  ? 142  ILE A HG13 3  
ATOM   8633  H HG21 . ILE A 1 142 ? 5.503   -0.831  9.748   1.00 1.13  ? 142  ILE A HG21 3  
ATOM   8634  H HG22 . ILE A 1 142 ? 5.841   0.009   11.263  1.00 1.06  ? 142  ILE A HG22 3  
ATOM   8635  H HG23 . ILE A 1 142 ? 4.694   0.694   10.111  1.00 0.97  ? 142  ILE A HG23 3  
ATOM   8636  H HD11 . ILE A 1 142 ? 2.535   0.730   9.524   1.00 1.01  ? 142  ILE A HD11 3  
ATOM   8637  H HD12 . ILE A 1 142 ? 1.548   0.314   10.923  1.00 1.00  ? 142  ILE A HD12 3  
ATOM   8638  H HD13 . ILE A 1 142 ? 1.129   -0.323  9.332   1.00 1.07  ? 142  ILE A HD13 3  
ATOM   8639  N N    . GLN A 1 143 ? 5.672   -1.341  13.639  1.00 0.30  ? 143  GLN A N    3  
ATOM   8640  C CA   . GLN A 1 143 ? 6.840   -1.001  14.440  1.00 0.35  ? 143  GLN A CA   3  
ATOM   8641  C C    . GLN A 1 143 ? 7.546   -2.250  14.971  1.00 0.39  ? 143  GLN A C    3  
ATOM   8642  O O    . GLN A 1 143 ? 8.763   -2.252  15.154  1.00 0.43  ? 143  GLN A O    3  
ATOM   8643  C CB   . GLN A 1 143 ? 6.431   -0.100  15.596  1.00 0.41  ? 143  GLN A CB   3  
ATOM   8644  C CG   . GLN A 1 143 ? 5.679   1.143   15.152  1.00 0.43  ? 143  GLN A CG   3  
ATOM   8645  C CD   . GLN A 1 143 ? 6.464   1.992   14.172  1.00 0.48  ? 143  GLN A CD   3  
ATOM   8646  O OE1  . GLN A 1 143 ? 7.695   2.008   14.184  1.00 0.57  ? 143  GLN A OE1  3  
ATOM   8647  N NE2  . GLN A 1 143 ? 5.751   2.708   13.319  1.00 0.52  ? 143  GLN A NE2  3  
ATOM   8648  H H    . GLN A 1 143 ? 4.790   -1.008  13.915  1.00 0.29  ? 143  GLN A H    3  
ATOM   8649  H HA   . GLN A 1 143 ? 7.522   -0.458  13.806  1.00 0.36  ? 143  GLN A HA   3  
ATOM   8650  H HB2  . GLN A 1 143 ? 5.799   -0.664  16.265  1.00 0.42  ? 143  GLN A HB2  3  
ATOM   8651  H HB3  . GLN A 1 143 ? 7.317   0.211   16.126  1.00 0.45  ? 143  GLN A HB3  3  
ATOM   8652  H HG2  . GLN A 1 143 ? 4.761   0.834   14.671  1.00 0.38  ? 143  GLN A HG2  3  
ATOM   8653  H HG3  . GLN A 1 143 ? 5.447   1.739   16.021  1.00 0.50  ? 143  GLN A HG3  3  
ATOM   8654  H HE21 . GLN A 1 143 ? 4.774   2.652   13.369  1.00 0.56  ? 143  GLN A HE21 3  
ATOM   8655  H HE22 . GLN A 1 143 ? 6.229   3.267   12.670  1.00 0.58  ? 143  GLN A HE22 3  
ATOM   8656  N N    . GLU A 1 144 ? 6.782   -3.313  15.214  1.00 0.40  ? 144  GLU A N    3  
ATOM   8657  C CA   . GLU A 1 144 ? 7.341   -4.582  15.664  1.00 0.47  ? 144  GLU A CA   3  
ATOM   8658  C C    . GLU A 1 144 ? 8.169   -5.229  14.560  1.00 0.48  ? 144  GLU A C    3  
ATOM   8659  O O    . GLU A 1 144 ? 9.048   -6.051  14.817  1.00 0.55  ? 144  GLU A O    3  
ATOM   8660  C CB   . GLU A 1 144 ? 6.211   -5.531  16.051  1.00 0.51  ? 144  GLU A CB   3  
ATOM   8661  C CG   . GLU A 1 144 ? 5.242   -4.945  17.053  1.00 0.52  ? 144  GLU A CG   3  
ATOM   8662  C CD   . GLU A 1 144 ? 5.748   -5.011  18.477  1.00 0.61  ? 144  GLU A CD   3  
ATOM   8663  O OE1  . GLU A 1 144 ? 5.515   -6.041  19.144  1.00 0.78  ? 144  GLU A OE1  3  
ATOM   8664  O OE2  . GLU A 1 144 ? 6.376   -4.034  18.937  1.00 0.67  ? 144  GLU A OE2  3  
ATOM   8665  H H    . GLU A 1 144 ? 5.805   -3.241  15.101  1.00 0.38  ? 144  GLU A H    3  
ATOM   8666  H HA   . GLU A 1 144 ? 7.966   -4.397  16.520  1.00 0.51  ? 144  GLU A HA   3  
ATOM   8667  H HB2  . GLU A 1 144 ? 5.654   -5.791  15.162  1.00 0.50  ? 144  GLU A HB2  3  
ATOM   8668  H HB3  . GLU A 1 144 ? 6.637   -6.428  16.475  1.00 0.57  ? 144  GLU A HB3  3  
ATOM   8669  H HG2  . GLU A 1 144 ? 5.072   -3.910  16.800  1.00 0.47  ? 144  GLU A HG2  3  
ATOM   8670  H HG3  . GLU A 1 144 ? 4.314   -5.485  16.980  1.00 0.55  ? 144  GLU A HG3  3  
ATOM   8671  N N    . ASN A 1 145 ? 7.874   -4.844  13.329  1.00 0.44  ? 145  ASN A N    3  
ATOM   8672  C CA   . ASN A 1 145 ? 8.471   -5.477  12.157  1.00 0.48  ? 145  ASN A CA   3  
ATOM   8673  C C    . ASN A 1 145 ? 9.619   -4.631  11.633  1.00 0.47  ? 145  ASN A C    3  
ATOM   8674  O O    . ASN A 1 145 ? 10.493  -5.118  10.912  1.00 0.57  ? 145  ASN A O    3  
ATOM   8675  C CB   . ASN A 1 145 ? 7.422   -5.683  11.050  1.00 0.49  ? 145  ASN A CB   3  
ATOM   8676  C CG   . ASN A 1 145 ? 6.320   -6.665  11.430  1.00 0.58  ? 145  ASN A CG   3  
ATOM   8677  O OD1  . ASN A 1 145 ? 5.773   -7.359  10.577  1.00 0.93  ? 145  ASN A OD1  3  
ATOM   8678  N ND2  . ASN A 1 145 ? 5.987   -6.727  12.710  1.00 0.54  ? 145  ASN A ND2  3  
ATOM   8679  H H    . ASN A 1 145 ? 7.249   -4.097  13.204  1.00 0.39  ? 145  ASN A H    3  
ATOM   8680  H HA   . ASN A 1 145 ? 8.856   -6.438  12.459  1.00 0.55  ? 145  ASN A HA   3  
ATOM   8681  H HB2  . ASN A 1 145 ? 6.962   -4.734  10.822  1.00 0.44  ? 145  ASN A HB2  3  
ATOM   8682  H HB3  . ASN A 1 145 ? 7.918   -6.055  10.165  1.00 0.52  ? 145  ASN A HB3  3  
ATOM   8683  H HD21 . ASN A 1 145 ? 6.464   -6.147  13.336  1.00 0.69  ? 145  ASN A HD21 3  
ATOM   8684  H HD22 . ASN A 1 145 ? 5.266   -7.327  12.979  1.00 0.56  ? 145  ASN A HD22 3  
ATOM   8685  N N    . GLY A 1 146 ? 9.605   -3.357  11.996  1.00 0.42  ? 146  GLY A N    3  
ATOM   8686  C CA   . GLY A 1 146 ? 10.689  -2.474  11.636  1.00 0.45  ? 146  GLY A CA   3  
ATOM   8687  C C    . GLY A 1 146 ? 10.227  -1.054  11.386  1.00 0.44  ? 146  GLY A C    3  
ATOM   8688  O O    . GLY A 1 146 ? 10.944  -0.102  11.679  1.00 0.56  ? 146  GLY A O    3  
ATOM   8689  H H    . GLY A 1 146 ? 8.848   -3.013  12.517  1.00 0.44  ? 146  GLY A H    3  
ATOM   8690  H HA2  . GLY A 1 146 ? 11.404  -2.470  12.441  1.00 0.49  ? 146  GLY A HA2  3  
ATOM   8691  H HA3  . GLY A 1 146 ? 11.167  -2.851  10.744  1.00 0.47  ? 146  GLY A HA3  3  
ATOM   8692  N N    . GLY A 1 147 ? 9.024   -0.909  10.855  1.00 0.36  ? 147  GLY A N    3  
ATOM   8693  C CA   . GLY A 1 147 ? 8.517   0.408   10.528  1.00 0.36  ? 147  GLY A CA   3  
ATOM   8694  C C    . GLY A 1 147 ? 8.431   0.623   9.032   1.00 0.38  ? 147  GLY A C    3  
ATOM   8695  O O    . GLY A 1 147 ? 8.945   -0.189  8.257   1.00 0.49  ? 147  GLY A O    3  
ATOM   8696  H H    . GLY A 1 147 ? 8.475   -1.700  10.681  1.00 0.37  ? 147  GLY A H    3  
ATOM   8697  H HA2  . GLY A 1 147 ? 7.533   0.522   10.958  1.00 0.35  ? 147  GLY A HA2  3  
ATOM   8698  H HA3  . GLY A 1 147 ? 9.174   1.152   10.953  1.00 0.39  ? 147  GLY A HA3  3  
ATOM   8699  N N    . TRP A 1 148 ? 7.790   1.710   8.621   1.00 0.35  ? 148  TRP A N    3  
ATOM   8700  C CA   . TRP A 1 148 ? 7.616   2.001   7.207   1.00 0.37  ? 148  TRP A CA   3  
ATOM   8701  C C    . TRP A 1 148 ? 8.940   2.335   6.538   1.00 0.38  ? 148  TRP A C    3  
ATOM   8702  O O    . TRP A 1 148 ? 9.153   1.992   5.378   1.00 0.40  ? 148  TRP A O    3  
ATOM   8703  C CB   . TRP A 1 148 ? 6.623   3.142   7.003   1.00 0.39  ? 148  TRP A CB   3  
ATOM   8704  C CG   . TRP A 1 148 ? 5.206   2.749   7.260   1.00 0.46  ? 148  TRP A CG   3  
ATOM   8705  C CD1  . TRP A 1 148 ? 4.368   3.258   8.207   1.00 0.79  ? 148  TRP A CD1  3  
ATOM   8706  C CD2  . TRP A 1 148 ? 4.465   1.754   6.555   1.00 1.45  ? 148  TRP A CD2  3  
ATOM   8707  N NE1  . TRP A 1 148 ? 3.142   2.645   8.125   1.00 0.52  ? 148  TRP A NE1  3  
ATOM   8708  C CE2  . TRP A 1 148 ? 3.178   1.714   7.118   1.00 1.25  ? 148  TRP A CE2  3  
ATOM   8709  C CE3  . TRP A 1 148 ? 4.767   0.893   5.496   1.00 2.64  ? 148  TRP A CE3  3  
ATOM   8710  C CZ2  . TRP A 1 148 ? 2.194   0.847   6.656   1.00 2.17  ? 148  TRP A CZ2  3  
ATOM   8711  C CZ3  . TRP A 1 148 ? 3.791   0.032   5.040   1.00 3.57  ? 148  TRP A CZ3  3  
ATOM   8712  C CH2  . TRP A 1 148 ? 2.518   0.016   5.618   1.00 3.32  ? 148  TRP A CH2  3  
ATOM   8713  H H    . TRP A 1 148 ? 7.422   2.337   9.287   1.00 0.36  ? 148  TRP A H    3  
ATOM   8714  H HA   . TRP A 1 148 ? 7.216   1.113   6.741   1.00 0.40  ? 148  TRP A HA   3  
ATOM   8715  H HB2  . TRP A 1 148 ? 6.870   3.955   7.664   1.00 0.42  ? 148  TRP A HB2  3  
ATOM   8716  H HB3  . TRP A 1 148 ? 6.693   3.486   5.982   1.00 0.46  ? 148  TRP A HB3  3  
ATOM   8717  H HD1  . TRP A 1 148 ? 4.642   4.034   8.908   1.00 1.69  ? 148  TRP A HD1  3  
ATOM   8718  H HE1  . TRP A 1 148 ? 2.368   2.842   8.696   1.00 0.78  ? 148  TRP A HE1  3  
ATOM   8719  H HE3  . TRP A 1 148 ? 5.745   0.892   5.037   1.00 2.86  ? 148  TRP A HE3  3  
ATOM   8720  H HZ2  . TRP A 1 148 ? 1.205   0.821   7.089   1.00 2.01  ? 148  TRP A HZ2  3  
ATOM   8721  H HZ3  . TRP A 1 148 ? 4.006   -0.641  4.224   1.00 4.52  ? 148  TRP A HZ3  3  
ATOM   8722  H HH2  . TRP A 1 148 ? 1.784   -0.676  5.230   1.00 4.08  ? 148  TRP A HH2  3  
ATOM   8723  N N    . ASP A 1 149 ? 9.831   2.989   7.276   1.00 0.42  ? 149  ASP A N    3  
ATOM   8724  C CA   . ASP A 1 149 ? 11.139  3.361   6.739   1.00 0.47  ? 149  ASP A CA   3  
ATOM   8725  C C    . ASP A 1 149 ? 11.888  2.122   6.272   1.00 0.47  ? 149  ASP A C    3  
ATOM   8726  O O    . ASP A 1 149 ? 12.430  2.086   5.167   1.00 0.52  ? 149  ASP A O    3  
ATOM   8727  C CB   . ASP A 1 149 ? 11.979  4.088   7.788   1.00 0.56  ? 149  ASP A CB   3  
ATOM   8728  C CG   . ASP A 1 149 ? 11.304  5.328   8.333   1.00 1.23  ? 149  ASP A CG   3  
ATOM   8729  O OD1  . ASP A 1 149 ? 11.304  6.363   7.632   1.00 1.72  ? 149  ASP A OD1  3  
ATOM   8730  O OD2  . ASP A 1 149 ? 10.757  5.272   9.455   1.00 1.96  ? 149  ASP A OD2  3  
ATOM   8731  H H    . ASP A 1 149 ? 9.605   3.231   8.200   1.00 0.44  ? 149  ASP A H    3  
ATOM   8732  H HA   . ASP A 1 149 ? 10.980  4.016   5.895   1.00 0.50  ? 149  ASP A HA   3  
ATOM   8733  H HB2  . ASP A 1 149 ? 12.171  3.418   8.611   1.00 1.33  ? 149  ASP A HB2  3  
ATOM   8734  H HB3  . ASP A 1 149 ? 12.919  4.379   7.342   1.00 1.06  ? 149  ASP A HB3  3  
ATOM   8735  N N    . THR A 1 150 ? 11.894  1.101   7.121   1.00 0.47  ? 150  THR A N    3  
ATOM   8736  C CA   . THR A 1 150 ? 12.543  -0.159  6.802   1.00 0.51  ? 150  THR A CA   3  
ATOM   8737  C C    . THR A 1 150 ? 11.918  -0.804  5.571   1.00 0.50  ? 150  THR A C    3  
ATOM   8738  O O    . THR A 1 150 ? 12.612  -1.412  4.764   1.00 0.56  ? 150  THR A O    3  
ATOM   8739  C CB   . THR A 1 150 ? 12.461  -1.134  7.990   1.00 0.56  ? 150  THR A CB   3  
ATOM   8740  O OG1  . THR A 1 150 ? 13.114  -0.565  9.131   1.00 0.62  ? 150  THR A OG1  3  
ATOM   8741  C CG2  . THR A 1 150 ? 13.098  -2.468  7.638   1.00 0.67  ? 150  THR A CG2  3  
ATOM   8742  H H    . THR A 1 150 ? 11.454  1.202   7.990   1.00 0.47  ? 150  THR A H    3  
ATOM   8743  H HA   . THR A 1 150 ? 13.584  0.043   6.600   1.00 0.56  ? 150  THR A HA   3  
ATOM   8744  H HB   . THR A 1 150 ? 11.420  -1.301  8.228   1.00 0.52  ? 150  THR A HB   3  
ATOM   8745  H HG1  . THR A 1 150 ? 13.750  -1.205  9.490   1.00 0.91  ? 150  THR A HG1  3  
ATOM   8746  H HG21 . THR A 1 150 ? 13.116  -3.101  8.512   1.00 1.10  ? 150  THR A HG21 3  
ATOM   8747  H HG22 . THR A 1 150 ? 14.106  -2.304  7.284   1.00 1.24  ? 150  THR A HG22 3  
ATOM   8748  H HG23 . THR A 1 150 ? 12.518  -2.943  6.860   1.00 1.22  ? 150  THR A HG23 3  
ATOM   8749  N N    . PHE A 1 151 ? 10.610  -0.648  5.415   1.00 0.45  ? 151  PHE A N    3  
ATOM   8750  C CA   . PHE A 1 151 ? 9.909   -1.242  4.288   1.00 0.47  ? 151  PHE A CA   3  
ATOM   8751  C C    . PHE A 1 151 ? 10.472  -0.723  2.970   1.00 0.48  ? 151  PHE A C    3  
ATOM   8752  O O    . PHE A 1 151 ? 10.658  -1.485  2.022   1.00 0.55  ? 151  PHE A O    3  
ATOM   8753  C CB   . PHE A 1 151 ? 8.408   -0.963  4.363   1.00 0.47  ? 151  PHE A CB   3  
ATOM   8754  C CG   . PHE A 1 151 ? 7.670   -1.461  3.158   1.00 1.18  ? 151  PHE A CG   3  
ATOM   8755  C CD1  . PHE A 1 151 ? 7.437   -2.813  2.981   1.00 1.80  ? 151  PHE A CD1  3  
ATOM   8756  C CD2  . PHE A 1 151 ? 7.189   -0.572  2.213   1.00 1.75  ? 151  PHE A CD2  3  
ATOM   8757  C CE1  . PHE A 1 151 ? 6.742   -3.269  1.881   1.00 2.65  ? 151  PHE A CE1  3  
ATOM   8758  C CE2  . PHE A 1 151 ? 6.490   -1.022  1.112   1.00 2.61  ? 151  PHE A CE2  3  
ATOM   8759  C CZ   . PHE A 1 151 ? 6.340   -2.391  0.911   1.00 3.00  ? 151  PHE A CZ   3  
ATOM   8760  H H    . PHE A 1 151 ? 10.111  -0.112  6.066   1.00 0.43  ? 151  PHE A H    3  
ATOM   8761  H HA   . PHE A 1 151 ? 10.067  -2.309  4.331   1.00 0.52  ? 151  PHE A HA   3  
ATOM   8762  H HB2  . PHE A 1 151 ? 7.998   -1.452  5.235   1.00 0.93  ? 151  PHE A HB2  3  
ATOM   8763  H HB3  . PHE A 1 151 ? 8.246   0.103   4.441   1.00 0.79  ? 151  PHE A HB3  3  
ATOM   8764  H HD1  . PHE A 1 151 ? 7.810   -3.515  3.713   1.00 1.84  ? 151  PHE A HD1  3  
ATOM   8765  H HD2  . PHE A 1 151 ? 7.365   0.486   2.342   1.00 1.77  ? 151  PHE A HD2  3  
ATOM   8766  H HE1  . PHE A 1 151 ? 6.567   -4.327  1.753   1.00 3.20  ? 151  PHE A HE1  3  
ATOM   8767  H HE2  . PHE A 1 151 ? 6.119   -0.318  0.382   1.00 3.13  ? 151  PHE A HE2  3  
ATOM   8768  H HZ   . PHE A 1 151 ? 5.821   -2.753  0.035   1.00 3.72  ? 151  PHE A HZ   3  
ATOM   8769  N N    . VAL A 1 152 ? 10.764  0.568   2.919   1.00 0.45  ? 152  VAL A N    3  
ATOM   8770  C CA   . VAL A 1 152 ? 11.336  1.165   1.722   1.00 0.49  ? 152  VAL A CA   3  
ATOM   8771  C C    . VAL A 1 152 ? 12.804  0.755   1.580   1.00 0.57  ? 152  VAL A C    3  
ATOM   8772  O O    . VAL A 1 152 ? 13.361  0.744   0.485   1.00 0.64  ? 152  VAL A O    3  
ATOM   8773  C CB   . VAL A 1 152 ? 11.164  2.710   1.673   1.00 0.60  ? 152  VAL A CB   3  
ATOM   8774  C CG1  . VAL A 1 152 ? 10.222  3.181   2.763   1.00 1.15  ? 152  VAL A CG1  3  
ATOM   8775  C CG2  . VAL A 1 152 ? 12.490  3.451   1.746   1.00 0.91  ? 152  VAL A CG2  3  
ATOM   8776  H H    . VAL A 1 152 ? 10.591  1.132   3.705   1.00 0.43  ? 152  VAL A H    3  
ATOM   8777  H HA   . VAL A 1 152 ? 10.797  0.747   0.878   1.00 0.51  ? 152  VAL A HA   3  
ATOM   8778  H HB   . VAL A 1 152 ? 10.705  2.954   0.724   1.00 1.21  ? 152  VAL A HB   3  
ATOM   8779  H HG11 . VAL A 1 152 ? 9.234   2.783   2.576   1.00 1.86  ? 152  VAL A HG11 3  
ATOM   8780  H HG12 . VAL A 1 152 ? 10.182  4.260   2.761   1.00 1.51  ? 152  VAL A HG12 3  
ATOM   8781  H HG13 . VAL A 1 152 ? 10.575  2.832   3.725   1.00 1.68  ? 152  VAL A HG13 3  
ATOM   8782  H HG21 . VAL A 1 152 ? 13.109  3.149   0.913   1.00 1.44  ? 152  VAL A HG21 3  
ATOM   8783  H HG22 . VAL A 1 152 ? 12.989  3.212   2.672   1.00 1.54  ? 152  VAL A HG22 3  
ATOM   8784  H HG23 . VAL A 1 152 ? 12.309  4.515   1.693   1.00 1.45  ? 152  VAL A HG23 3  
ATOM   8785  N N    . GLU A 1 153 ? 13.438  0.422   2.692   1.00 0.59  ? 153  GLU A N    3  
ATOM   8786  C CA   . GLU A 1 153 ? 14.789  -0.116  2.645   1.00 0.69  ? 153  GLU A CA   3  
ATOM   8787  C C    . GLU A 1 153 ? 14.780  -1.491  1.976   1.00 0.70  ? 153  GLU A C    3  
ATOM   8788  O O    . GLU A 1 153 ? 15.798  -1.952  1.456   1.00 0.80  ? 153  GLU A O    3  
ATOM   8789  C CB   . GLU A 1 153 ? 15.382  -0.196  4.049   1.00 0.76  ? 153  GLU A CB   3  
ATOM   8790  C CG   . GLU A 1 153 ? 15.519  1.166   4.698   1.00 0.80  ? 153  GLU A CG   3  
ATOM   8791  C CD   . GLU A 1 153 ? 16.562  2.036   4.025   1.00 1.31  ? 153  GLU A CD   3  
ATOM   8792  O OE1  . GLU A 1 153 ? 16.225  2.703   3.024   1.00 1.67  ? 153  GLU A OE1  3  
ATOM   8793  O OE2  . GLU A 1 153 ? 17.722  2.055   4.488   1.00 1.58  ? 153  GLU A OE2  3  
ATOM   8794  H H    . GLU A 1 153 ? 12.993  0.536   3.558   1.00 0.57  ? 153  GLU A H    3  
ATOM   8795  H HA   . GLU A 1 153 ? 15.386  0.560   2.055   1.00 0.73  ? 153  GLU A HA   3  
ATOM   8796  H HB2  . GLU A 1 153 ? 14.741  -0.811  4.670   1.00 0.71  ? 153  GLU A HB2  3  
ATOM   8797  H HB3  . GLU A 1 153 ? 16.361  -0.648  3.994   1.00 0.86  ? 153  GLU A HB3  3  
ATOM   8798  H HG2  . GLU A 1 153 ? 14.568  1.667   4.629   1.00 0.86  ? 153  GLU A HG2  3  
ATOM   8799  H HG3  . GLU A 1 153 ? 15.787  1.035   5.736   1.00 0.92  ? 153  GLU A HG3  3  
ATOM   8800  N N    . LEU A 1 154 ? 13.616  -2.138  1.991   1.00 0.67  ? 154  LEU A N    3  
ATOM   8801  C CA   . LEU A 1 154 ? 13.443  -3.436  1.347   1.00 0.72  ? 154  LEU A CA   3  
ATOM   8802  C C    . LEU A 1 154 ? 12.897  -3.269  -0.074  1.00 0.74  ? 154  LEU A C    3  
ATOM   8803  O O    . LEU A 1 154 ? 13.513  -3.705  -1.047  1.00 0.83  ? 154  LEU A O    3  
ATOM   8804  C CB   . LEU A 1 154 ? 12.470  -4.320  2.141   1.00 0.72  ? 154  LEU A CB   3  
ATOM   8805  C CG   . LEU A 1 154 ? 12.529  -4.200  3.667   1.00 0.83  ? 154  LEU A CG   3  
ATOM   8806  C CD1  . LEU A 1 154 ? 11.604  -5.217  4.314   1.00 1.30  ? 154  LEU A CD1  3  
ATOM   8807  C CD2  . LEU A 1 154 ? 13.947  -4.370  4.181   1.00 1.14  ? 154  LEU A CD2  3  
ATOM   8808  H H    . LEU A 1 154 ? 12.859  -1.741  2.471   1.00 0.67  ? 154  LEU A H    3  
ATOM   8809  H HA   . LEU A 1 154 ? 14.406  -3.921  1.301   1.00 0.79  ? 154  LEU A HA   3  
ATOM   8810  H HB2  . LEU A 1 154 ? 11.466  -4.076  1.826   1.00 0.83  ? 154  LEU A HB2  3  
ATOM   8811  H HB3  . LEU A 1 154 ? 12.665  -5.349  1.879   1.00 0.78  ? 154  LEU A HB3  3  
ATOM   8812  H HG   . LEU A 1 154 ? 12.186  -3.217  3.953   1.00 1.45  ? 154  LEU A HG   3  
ATOM   8813  H HD11 . LEU A 1 154 ? 10.592  -5.047  3.978   1.00 1.82  ? 154  LEU A HD11 3  
ATOM   8814  H HD12 . LEU A 1 154 ? 11.650  -5.113  5.388   1.00 1.62  ? 154  LEU A HD12 3  
ATOM   8815  H HD13 . LEU A 1 154 ? 11.913  -6.214  4.035   1.00 1.96  ? 154  LEU A HD13 3  
ATOM   8816  H HD21 . LEU A 1 154 ? 14.342  -5.319  3.852   1.00 1.60  ? 154  LEU A HD21 3  
ATOM   8817  H HD22 . LEU A 1 154 ? 13.943  -4.334  5.261   1.00 1.52  ? 154  LEU A HD22 3  
ATOM   8818  H HD23 . LEU A 1 154 ? 14.563  -3.567  3.797   1.00 1.78  ? 154  LEU A HD23 3  
ATOM   8819  N N    . TYR A 1 155 ? 11.733  -2.634  -0.180  1.00 0.69  ? 155  TYR A N    3  
ATOM   8820  C CA   . TYR A 1 155 ? 11.010  -2.523  -1.444  1.00 0.78  ? 155  TYR A CA   3  
ATOM   8821  C C    . TYR A 1 155 ? 10.787  -1.069  -1.836  1.00 0.77  ? 155  TYR A C    3  
ATOM   8822  O O    . TYR A 1 155 ? 9.828   -0.744  -2.534  1.00 1.15  ? 155  TYR A O    3  
ATOM   8823  C CB   . TYR A 1 155 ? 9.658   -3.226  -1.339  1.00 0.86  ? 155  TYR A CB   3  
ATOM   8824  C CG   . TYR A 1 155 ? 9.718   -4.715  -1.591  1.00 1.40  ? 155  TYR A CG   3  
ATOM   8825  C CD1  . TYR A 1 155 ? 9.643   -5.216  -2.884  1.00 2.24  ? 155  TYR A CD1  3  
ATOM   8826  C CD2  . TYR A 1 155 ? 9.844   -5.618  -0.543  1.00 1.83  ? 155  TYR A CD2  3  
ATOM   8827  C CE1  . TYR A 1 155 ? 9.693   -6.574  -3.127  1.00 3.16  ? 155  TYR A CE1  3  
ATOM   8828  C CE2  . TYR A 1 155 ? 9.896   -6.979  -0.778  1.00 2.65  ? 155  TYR A CE2  3  
ATOM   8829  C CZ   . TYR A 1 155 ? 9.820   -7.452  -2.072  1.00 3.24  ? 155  TYR A CZ   3  
ATOM   8830  O OH   . TYR A 1 155 ? 9.868   -8.807  -2.312  1.00 4.24  ? 155  TYR A OH   3  
ATOM   8831  H H    . TYR A 1 155 ? 11.349  -2.206  0.620   1.00 0.63  ? 155  TYR A H    3  
ATOM   8832  H HA   . TYR A 1 155 ? 11.598  -3.006  -2.209  1.00 0.86  ? 155  TYR A HA   3  
ATOM   8833  H HB2  . TYR A 1 155 ? 9.262   -3.077  -0.345  1.00 1.32  ? 155  TYR A HB2  3  
ATOM   8834  H HB3  . TYR A 1 155 ? 8.983   -2.789  -2.056  1.00 1.12  ? 155  TYR A HB3  3  
ATOM   8835  H HD1  . TYR A 1 155 ? 9.544   -4.526  -3.710  1.00 2.42  ? 155  TYR A HD1  3  
ATOM   8836  H HD2  . TYR A 1 155 ? 9.904   -5.244  0.469   1.00 1.93  ? 155  TYR A HD2  3  
ATOM   8837  H HE1  . TYR A 1 155 ? 9.633   -6.945  -4.140  1.00 3.94  ? 155  TYR A HE1  3  
ATOM   8838  H HE2  . TYR A 1 155 ? 9.997   -7.667  0.049   1.00 3.07  ? 155  TYR A HE2  3  
ATOM   8839  H HH   . TYR A 1 155 ? 9.230   -9.255  -1.732  1.00 4.39  ? 155  TYR A HH   3  
ATOM   8840  N N    . GLY A 1 156 ? 11.677  -0.203  -1.391  1.00 0.66  ? 156  GLY A N    3  
ATOM   8841  C CA   . GLY A 1 156 ? 11.544  1.210   -1.674  1.00 0.64  ? 156  GLY A CA   3  
ATOM   8842  C C    . GLY A 1 156 ? 11.683  1.532   -3.129  1.00 0.78  ? 156  GLY A C    3  
ATOM   8843  O O    . GLY A 1 156 ? 12.183  0.730   -3.920  1.00 1.10  ? 156  GLY A O    3  
ATOM   8844  H H    . GLY A 1 156 ? 12.436  -0.525  -0.863  1.00 0.85  ? 156  GLY A H    3  
ATOM   8845  H HA2  . GLY A 1 156 ? 10.576  1.549   -1.338  1.00 0.61  ? 156  GLY A HA2  3  
ATOM   8846  H HA3  . GLY A 1 156 ? 12.299  1.756   -1.136  1.00 0.66  ? 156  GLY A HA3  3  
ATOM   8847  N N    . ASN A 1 157 ? 11.238  2.716   -3.461  1.00 0.70  ? 157  ASN A N    3  
ATOM   8848  C CA   . ASN A 1 157 ? 11.303  3.230   -4.802  1.00 0.80  ? 157  ASN A CA   3  
ATOM   8849  C C    . ASN A 1 157 ? 12.750  3.387   -5.248  1.00 1.14  ? 157  ASN A C    3  
ATOM   8850  O O    . ASN A 1 157 ? 13.465  4.271   -4.772  1.00 1.29  ? 157  ASN A O    3  
ATOM   8851  C CB   . ASN A 1 157 ? 10.600  4.571   -4.804  1.00 0.70  ? 157  ASN A CB   3  
ATOM   8852  C CG   . ASN A 1 157 ? 10.477  5.187   -6.182  1.00 0.77  ? 157  ASN A CG   3  
ATOM   8853  O OD1  . ASN A 1 157 ? 11.365  5.907   -6.640  1.00 0.88  ? 157  ASN A OD1  3  
ATOM   8854  N ND2  . ASN A 1 157 ? 9.367   4.915   -6.851  1.00 0.76  ? 157  ASN A ND2  3  
ATOM   8855  H H    . ASN A 1 157 ? 10.844  3.277   -2.768  1.00 0.75  ? 157  ASN A H    3  
ATOM   8856  H HA   . ASN A 1 157 ? 10.788  2.550   -5.457  1.00 0.86  ? 157  ASN A HA   3  
ATOM   8857  H HB2  . ASN A 1 157 ? 9.610   4.438   -4.396  1.00 0.60  ? 157  ASN A HB2  3  
ATOM   8858  H HB3  . ASN A 1 157 ? 11.154  5.244   -4.167  1.00 0.83  ? 157  ASN A HB3  3  
ATOM   8859  H HD21 . ASN A 1 157 ? 8.699   4.332   -6.433  1.00 0.72  ? 157  ASN A HD21 3  
ATOM   8860  H HD22 . ASN A 1 157 ? 9.245   5.331   -7.726  1.00 0.83  ? 157  ASN A HD22 3  
ATOM   8861  N N    . ASN A 1 158 ? 13.179  2.530   -6.158  1.00 1.40  ? 158  ASN A N    3  
ATOM   8862  C CA   . ASN A 1 158 ? 14.557  2.552   -6.624  1.00 1.79  ? 158  ASN A CA   3  
ATOM   8863  C C    . ASN A 1 158 ? 14.763  3.607   -7.693  1.00 1.93  ? 158  ASN A C    3  
ATOM   8864  O O    . ASN A 1 158 ? 15.874  4.093   -7.866  1.00 2.18  ? 158  ASN A O    3  
ATOM   8865  C CB   . ASN A 1 158 ? 14.990  1.180   -7.144  1.00 2.11  ? 158  ASN A CB   3  
ATOM   8866  C CG   . ASN A 1 158 ? 15.507  0.283   -6.037  1.00 2.55  ? 158  ASN A CG   3  
ATOM   8867  O OD1  . ASN A 1 158 ? 14.751  -0.469  -5.422  1.00 2.99  ? 158  ASN A OD1  3  
ATOM   8868  N ND2  . ASN A 1 158 ? 16.801  0.359   -5.771  1.00 2.94  ? 158  ASN A ND2  3  
ATOM   8869  H H    . ASN A 1 158 ? 12.557  1.859   -6.522  1.00 1.40  ? 158  ASN A H    3  
ATOM   8870  H HA   . ASN A 1 158 ? 15.175  2.807   -5.777  1.00 1.90  ? 158  ASN A HA   3  
ATOM   8871  H HB2  . ASN A 1 158 ? 14.147  0.695   -7.612  1.00 2.60  ? 158  ASN A HB2  3  
ATOM   8872  H HB3  . ASN A 1 158 ? 15.777  1.310   -7.873  1.00 2.06  ? 158  ASN A HB3  3  
ATOM   8873  H HD21 . ASN A 1 158 ? 17.348  0.979   -6.299  1.00 2.95  ? 158  ASN A HD21 3  
ATOM   8874  H HD22 . ASN A 1 158 ? 17.162  -0.208  -5.052  1.00 3.44  ? 158  ASN A HD22 3  
ATOM   8875  N N    . ALA A 1 159 ? 13.689  3.980   -8.386  1.00 1.86  ? 159  ALA A N    3  
ATOM   8876  C CA   . ALA A 1 159 ? 13.767  4.985   -9.447  1.00 2.10  ? 159  ALA A CA   3  
ATOM   8877  C C    . ALA A 1 159 ? 14.409  6.271   -8.939  1.00 2.25  ? 159  ALA A C    3  
ATOM   8878  O O    . ALA A 1 159 ? 15.278  6.843   -9.596  1.00 2.52  ? 159  ALA A O    3  
ATOM   8879  C CB   . ALA A 1 159 ? 12.385  5.272   -10.013 1.00 2.14  ? 159  ALA A CB   3  
ATOM   8880  H H    . ALA A 1 159 ? 12.818  3.565   -8.182  1.00 1.72  ? 159  ALA A H    3  
ATOM   8881  H HA   . ALA A 1 159 ? 14.378  4.581   -10.241 1.00 2.27  ? 159  ALA A HA   3  
ATOM   8882  H HB1  . ALA A 1 159 ? 12.471  5.969   -10.835 1.00 2.67  ? 159  ALA A HB1  3  
ATOM   8883  H HB2  . ALA A 1 159 ? 11.762  5.700   -9.243  1.00 2.16  ? 159  ALA A HB2  3  
ATOM   8884  H HB3  . ALA A 1 159 ? 11.942  4.354   -10.365 1.00 2.26  ? 159  ALA A HB3  3  
ATOM   8885  N N    . ALA A 1 160 ? 13.985  6.713   -7.763  1.00 2.17  ? 160  ALA A N    3  
ATOM   8886  C CA   . ALA A 1 160 ? 14.565  7.895   -7.143  1.00 2.44  ? 160  ALA A CA   3  
ATOM   8887  C C    . ALA A 1 160 ? 15.854  7.538   -6.412  1.00 2.55  ? 160  ALA A C    3  
ATOM   8888  O O    . ALA A 1 160 ? 16.805  8.321   -6.395  1.00 2.87  ? 160  ALA A O    3  
ATOM   8889  C CB   . ALA A 1 160 ? 13.573  8.534   -6.187  1.00 2.45  ? 160  ALA A CB   3  
ATOM   8890  H H    . ALA A 1 160 ? 13.259  6.238   -7.305  1.00 1.99  ? 160  ALA A H    3  
ATOM   8891  H HA   . ALA A 1 160 ? 14.790  8.607   -7.924  1.00 2.68  ? 160  ALA A HA   3  
ATOM   8892  H HB1  . ALA A 1 160 ? 13.355  7.845   -5.384  1.00 2.39  ? 160  ALA A HB1  3  
ATOM   8893  H HB2  . ALA A 1 160 ? 12.664  8.772   -6.718  1.00 2.74  ? 160  ALA A HB2  3  
ATOM   8894  H HB3  . ALA A 1 160 ? 14.001  9.440   -5.780  1.00 2.79  ? 160  ALA A HB3  3  
ATOM   8895  N N    . ALA A 1 161 ? 15.875  6.344   -5.821  1.00 2.37  ? 161  ALA A N    3  
ATOM   8896  C CA   . ALA A 1 161 ? 17.034  5.867   -5.071  1.00 2.60  ? 161  ALA A CA   3  
ATOM   8897  C C    . ALA A 1 161 ? 18.298  5.906   -5.922  1.00 2.85  ? 161  ALA A C    3  
ATOM   8898  O O    . ALA A 1 161 ? 19.246  6.619   -5.598  1.00 3.20  ? 161  ALA A O    3  
ATOM   8899  C CB   . ALA A 1 161 ? 16.790  4.458   -4.548  1.00 2.50  ? 161  ALA A CB   3  
ATOM   8900  H H    . ALA A 1 161 ? 15.085  5.768   -5.889  1.00 2.16  ? 161  ALA A H    3  
ATOM   8901  H HA   . ALA A 1 161 ? 17.169  6.521   -4.221  1.00 2.77  ? 161  ALA A HA   3  
ATOM   8902  H HB1  . ALA A 1 161 ? 16.677  3.778   -5.380  1.00 2.69  ? 161  ALA A HB1  3  
ATOM   8903  H HB2  . ALA A 1 161 ? 15.889  4.446   -3.950  1.00 2.61  ? 161  ALA A HB2  3  
ATOM   8904  H HB3  . ALA A 1 161 ? 17.628  4.147   -3.941  1.00 2.76  ? 161  ALA A HB3  3  
ATOM   8905  N N    . GLU A 1 162 ? 18.298  5.162   -7.025  1.00 2.76  ? 162  GLU A N    3  
ATOM   8906  C CA   . GLU A 1 162 ? 19.455  5.101   -7.911  1.00 3.08  ? 162  GLU A CA   3  
ATOM   8907  C C    . GLU A 1 162 ? 19.718  6.441   -8.578  1.00 3.31  ? 162  GLU A C    3  
ATOM   8908  O O    . GLU A 1 162 ? 20.858  6.764   -8.896  1.00 3.67  ? 162  GLU A O    3  
ATOM   8909  C CB   . GLU A 1 162 ? 19.278  4.032   -8.988  1.00 3.06  ? 162  GLU A CB   3  
ATOM   8910  C CG   . GLU A 1 162 ? 18.020  4.194   -9.820  1.00 3.25  ? 162  GLU A CG   3  
ATOM   8911  C CD   . GLU A 1 162 ? 17.902  3.150   -10.904 1.00 3.48  ? 162  GLU A CD   3  
ATOM   8912  O OE1  . GLU A 1 162 ? 17.445  2.027   -10.603 1.00 3.72  ? 162  GLU A OE1  3  
ATOM   8913  O OE2  . GLU A 1 162 ? 18.266  3.439   -12.061 1.00 3.71  ? 162  GLU A OE2  3  
ATOM   8914  H H    . GLU A 1 162 ? 17.497  4.636   -7.247  1.00 2.53  ? 162  GLU A H    3  
ATOM   8915  H HA   . GLU A 1 162 ? 20.314  4.845   -7.308  1.00 3.27  ? 162  GLU A HA   3  
ATOM   8916  H HB2  . GLU A 1 162 ? 20.125  4.082   -9.656  1.00 3.33  ? 162  GLU A HB2  3  
ATOM   8917  H HB3  . GLU A 1 162 ? 19.255  3.061   -8.519  1.00 3.04  ? 162  GLU A HB3  3  
ATOM   8918  H HG2  . GLU A 1 162 ? 17.161  4.114   -9.170  1.00 3.26  ? 162  GLU A HG2  3  
ATOM   8919  H HG3  . GLU A 1 162 ? 18.033  5.171   -10.280 1.00 3.57  ? 162  GLU A HG3  3  
ATOM   8920  N N    . SER A 1 163 ? 18.670  7.222   -8.782  1.00 3.19  ? 163  SER A N    3  
ATOM   8921  C CA   . SER A 1 163 ? 18.810  8.509   -9.439  1.00 3.52  ? 163  SER A CA   3  
ATOM   8922  C C    . SER A 1 163 ? 19.660  9.447   -8.583  1.00 3.81  ? 163  SER A C    3  
ATOM   8923  O O    . SER A 1 163 ? 20.509  10.179  -9.092  1.00 4.18  ? 163  SER A O    3  
ATOM   8924  C CB   . SER A 1 163 ? 17.433  9.126   -9.708  1.00 3.44  ? 163  SER A CB   3  
ATOM   8925  O OG   . SER A 1 163 ? 17.542  10.363  -10.392 1.00 3.87  ? 163  SER A OG   3  
ATOM   8926  H H    . SER A 1 163 ? 17.783  6.924   -8.488  1.00 2.92  ? 163  SER A H    3  
ATOM   8927  H HA   . SER A 1 163 ? 19.312  8.335   -10.378 1.00 3.71  ? 163  SER A HA   3  
ATOM   8928  H HB2  . SER A 1 163 ? 16.850  8.448   -10.312 1.00 3.31  ? 163  SER A HB2  3  
ATOM   8929  H HB3  . SER A 1 163 ? 16.927  9.294   -8.767  1.00 3.45  ? 163  SER A HB3  3  
ATOM   8930  H HG   . SER A 1 163 ? 16.841  10.962  -10.083 1.00 4.20  ? 163  SER A HG   3  
ATOM   8931  N N    . ARG A 1 164 ? 19.439  9.401   -7.276  1.00 3.70  ? 164  ARG A N    3  
ATOM   8932  C CA   . ARG A 1 164 ? 20.197  10.223  -6.344  1.00 4.07  ? 164  ARG A CA   3  
ATOM   8933  C C    . ARG A 1 164 ? 21.441  9.476   -5.866  1.00 4.24  ? 164  ARG A C    3  
ATOM   8934  O O    . ARG A 1 164 ? 22.228  9.994   -5.077  1.00 4.61  ? 164  ARG A O    3  
ATOM   8935  C CB   . ARG A 1 164 ? 19.314  10.617  -5.162  1.00 4.05  ? 164  ARG A CB   3  
ATOM   8936  C CG   . ARG A 1 164 ? 18.092  11.405  -5.592  1.00 4.12  ? 164  ARG A CG   3  
ATOM   8937  C CD   . ARG A 1 164 ? 18.438  12.838  -5.961  1.00 4.41  ? 164  ARG A CD   3  
ATOM   8938  N NE   . ARG A 1 164 ? 18.722  13.656  -4.782  1.00 4.73  ? 164  ARG A NE   3  
ATOM   8939  C CZ   . ARG A 1 164 ? 19.053  14.945  -4.832  1.00 5.32  ? 164  ARG A CZ   3  
ATOM   8940  N NH1  . ARG A 1 164 ? 19.205  15.556  -6.000  1.00 5.65  ? 164  ARG A NH1  3  
ATOM   8941  N NH2  . ARG A 1 164 ? 19.236  15.621  -3.705  1.00 5.82  ? 164  ARG A NH2  3  
ATOM   8942  H H    . ARG A 1 164 ? 18.745  8.798   -6.928  1.00 3.42  ? 164  ARG A H    3  
ATOM   8943  H HA   . ARG A 1 164 ? 20.497  11.116  -6.867  1.00 4.33  ? 164  ARG A HA   3  
ATOM   8944  H HB2  . ARG A 1 164 ? 18.985  9.722   -4.654  1.00 3.79  ? 164  ARG A HB2  3  
ATOM   8945  H HB3  . ARG A 1 164 ? 19.889  11.224  -4.479  1.00 4.41  ? 164  ARG A HB3  3  
ATOM   8946  H HG2  . ARG A 1 164 ? 17.671  10.923  -6.459  1.00 4.04  ? 164  ARG A HG2  3  
ATOM   8947  H HG3  . ARG A 1 164 ? 17.371  11.408  -4.789  1.00 4.42  ? 164  ARG A HG3  3  
ATOM   8948  H HD2  . ARG A 1 164 ? 19.308  12.832  -6.600  1.00 4.55  ? 164  ARG A HD2  3  
ATOM   8949  H HD3  . ARG A 1 164 ? 17.605  13.270  -6.494  1.00 4.64  ? 164  ARG A HD3  3  
ATOM   8950  H HE   . ARG A 1 164 ? 18.636  13.223  -3.901  1.00 4.71  ? 164  ARG A HE   3  
ATOM   8951  H HH11 . ARG A 1 164 ? 19.069  15.050  -6.861  1.00 5.49  ? 164  ARG A HH11 3  
ATOM   8952  H HH12 . ARG A 1 164 ? 19.464  16.532  -6.036  1.00 6.23  ? 164  ARG A HH12 3  
ATOM   8953  H HH21 . ARG A 1 164 ? 19.128  15.161  -2.819  1.00 5.80  ? 164  ARG A HH21 3  
ATOM   8954  H HH22 . ARG A 1 164 ? 19.470  16.604  -3.731  1.00 6.37  ? 164  ARG A HH22 3  
ATOM   8955  N N    . LYS A 1 165 ? 21.599  8.254   -6.358  1.00 4.03  ? 165  LYS A N    3  
ATOM   8956  C CA   . LYS A 1 165 ? 22.707  7.392   -5.970  1.00 4.26  ? 165  LYS A CA   3  
ATOM   8957  C C    . LYS A 1 165 ? 23.809  7.403   -7.020  1.00 4.49  ? 165  LYS A C    3  
ATOM   8958  O O    . LYS A 1 165 ? 24.961  7.712   -6.729  1.00 4.77  ? 165  LYS A O    3  
ATOM   8959  C CB   . LYS A 1 165 ? 22.214  5.961   -5.792  1.00 4.10  ? 165  LYS A CB   3  
ATOM   8960  C CG   . LYS A 1 165 ? 23.285  5.015   -5.327  1.00 4.47  ? 165  LYS A CG   3  
ATOM   8961  C CD   . LYS A 1 165 ? 22.853  3.567   -5.449  1.00 4.47  ? 165  LYS A CD   3  
ATOM   8962  C CE   . LYS A 1 165 ? 22.608  3.176   -6.897  1.00 4.43  ? 165  LYS A CE   3  
ATOM   8963  N NZ   . LYS A 1 165 ? 22.095  1.789   -7.016  1.00 4.72  ? 165  LYS A NZ   3  
ATOM   8964  H H    . LYS A 1 165 ? 20.948  7.920   -7.007  1.00 3.77  ? 165  LYS A H    3  
ATOM   8965  H HA   . LYS A 1 165 ? 23.107  7.744   -5.034  1.00 4.47  ? 165  LYS A HA   3  
ATOM   8966  H HB2  . LYS A 1 165 ? 21.420  5.947   -5.072  1.00 3.95  ? 165  LYS A HB2  3  
ATOM   8967  H HB3  . LYS A 1 165 ? 21.837  5.603   -6.735  1.00 3.94  ? 165  LYS A HB3  3  
ATOM   8968  H HG2  . LYS A 1 165 ? 24.155  5.178   -5.923  1.00 4.66  ? 165  LYS A HG2  3  
ATOM   8969  H HG3  . LYS A 1 165 ? 23.510  5.228   -4.300  1.00 4.64  ? 165  LYS A HG3  3  
ATOM   8970  H HD2  . LYS A 1 165 ? 23.630  2.938   -5.044  1.00 4.54  ? 165  LYS A HD2  3  
ATOM   8971  H HD3  . LYS A 1 165 ? 21.943  3.426   -4.887  1.00 4.70  ? 165  LYS A HD3  3  
ATOM   8972  H HE2  . LYS A 1 165 ? 21.883  3.853   -7.323  1.00 4.54  ? 165  LYS A HE2  3  
ATOM   8973  H HE3  . LYS A 1 165 ? 23.537  3.255   -7.440  1.00 4.38  ? 165  LYS A HE3  3  
ATOM   8974  H HZ1  . LYS A 1 165 ? 21.186  1.699   -6.513  1.00 4.85  ? 165  LYS A HZ1  3  
ATOM   8975  H HZ2  . LYS A 1 165 ? 22.773  1.115   -6.608  1.00 4.87  ? 165  LYS A HZ2  3  
ATOM   8976  H HZ3  . LYS A 1 165 ? 21.944  1.543   -8.020  1.00 5.01  ? 165  LYS A HZ3  3  
ATOM   8977  N N    . GLY A 1 166 ? 23.434  7.067   -8.248  1.00 4.45  ? 166  GLY A N    3  
ATOM   8978  C CA   . GLY A 1 166 ? 24.396  6.885   -9.315  1.00 4.72  ? 166  GLY A CA   3  
ATOM   8979  C C    . GLY A 1 166 ? 25.118  8.161   -9.702  1.00 4.91  ? 166  GLY A C    3  
ATOM   8980  O O    . GLY A 1 166 ? 26.101  8.122   -10.442 1.00 5.10  ? 166  GLY A O    3  
ATOM   8981  H H    . GLY A 1 166 ? 22.478  6.935   -8.435  1.00 4.27  ? 166  GLY A H    3  
ATOM   8982  H HA2  . GLY A 1 166 ? 25.127  6.157   -8.993  1.00 4.83  ? 166  GLY A HA2  3  
ATOM   8983  H HA3  . GLY A 1 166 ? 23.881  6.498   -10.181 1.00 4.76  ? 166  GLY A HA3  3  
ATOM   8984  N N    . GLN A 1 167 ? 24.632  9.297   -9.219  1.00 4.92  ? 167  GLN A N    3  
ATOM   8985  C CA   . GLN A 1 167 ? 25.301  10.569  -9.462  1.00 5.16  ? 167  GLN A CA   3  
ATOM   8986  C C    . GLN A 1 167 ? 26.625  10.624  -8.710  1.00 5.19  ? 167  GLN A C    3  
ATOM   8987  O O    . GLN A 1 167 ? 27.528  11.371  -9.083  1.00 5.45  ? 167  GLN A O    3  
ATOM   8988  C CB   . GLN A 1 167 ? 24.404  11.747  -9.069  1.00 5.30  ? 167  GLN A CB   3  
ATOM   8989  C CG   . GLN A 1 167 ? 23.815  11.644  -7.671  1.00 5.16  ? 167  GLN A CG   3  
ATOM   8990  C CD   . GLN A 1 167 ? 22.930  12.828  -7.318  1.00 5.42  ? 167  GLN A CD   3  
ATOM   8991  O OE1  . GLN A 1 167 ? 22.794  13.191  -6.150  1.00 5.60  ? 167  GLN A OE1  3  
ATOM   8992  N NE2  . GLN A 1 167 ? 22.329  13.443  -8.325  1.00 5.72  ? 167  GLN A NE2  3  
ATOM   8993  H H    . GLN A 1 167 ? 23.809  9.278   -8.690  1.00 4.80  ? 167  GLN A H    3  
ATOM   8994  H HA   . GLN A 1 167 ? 25.510  10.627  -10.519 1.00 5.34  ? 167  GLN A HA   3  
ATOM   8995  H HB2  . GLN A 1 167 ? 24.984  12.657  -9.123  1.00 5.51  ? 167  GLN A HB2  3  
ATOM   8996  H HB3  . GLN A 1 167 ? 23.590  11.810  -9.774  1.00 5.38  ? 167  GLN A HB3  3  
ATOM   8997  H HG2  . GLN A 1 167 ? 23.224  10.742  -7.612  1.00 4.96  ? 167  GLN A HG2  3  
ATOM   8998  H HG3  . GLN A 1 167 ? 24.624  11.591  -6.957  1.00 5.16  ? 167  GLN A HG3  3  
ATOM   8999  H HE21 . GLN A 1 167 ? 22.486  13.107  -9.236  1.00 5.86  ? 167  GLN A HE21 3  
ATOM   9000  H HE22 . GLN A 1 167 ? 21.758  14.211  -8.123  1.00 5.94  ? 167  GLN A HE22 3  
ATOM   9001  N N    . GLU A 1 168 ? 26.742  9.797   -7.675  1.00 5.02  ? 168  GLU A N    3  
ATOM   9002  C CA   . GLU A 1 168 ? 27.973  9.689   -6.900  1.00 5.17  ? 168  GLU A CA   3  
ATOM   9003  C C    . GLU A 1 168 ? 29.021  8.887   -7.667  1.00 5.30  ? 168  GLU A C    3  
ATOM   9004  O O    . GLU A 1 168 ? 30.165  8.760   -7.232  1.00 5.55  ? 168  GLU A O    3  
ATOM   9005  C CB   . GLU A 1 168 ? 27.696  9.012   -5.554  1.00 5.10  ? 168  GLU A CB   3  
ATOM   9006  C CG   . GLU A 1 168 ? 26.780  9.802   -4.632  1.00 5.39  ? 168  GLU A CG   3  
ATOM   9007  C CD   . GLU A 1 168 ? 27.430  11.062  -4.103  1.00 5.63  ? 168  GLU A CD   3  
ATOM   9008  O OE1  . GLU A 1 168 ? 28.650  11.044  -3.841  1.00 5.88  ? 168  GLU A OE1  3  
ATOM   9009  O OE2  . GLU A 1 168 ? 26.728  12.084  -3.969  1.00 5.81  ? 168  GLU A OE2  3  
ATOM   9010  H H    . GLU A 1 168 ? 25.975  9.237   -7.423  1.00 4.84  ? 168  GLU A H    3  
ATOM   9011  H HA   . GLU A 1 168 ? 28.350  10.684  -6.729  1.00 5.35  ? 168  GLU A HA   3  
ATOM   9012  H HB2  . GLU A 1 168 ? 27.237  8.052   -5.738  1.00 4.92  ? 168  GLU A HB2  3  
ATOM   9013  H HB3  . GLU A 1 168 ? 28.636  8.857   -5.044  1.00 5.27  ? 168  GLU A HB3  3  
ATOM   9014  H HG2  . GLU A 1 168 ? 25.891  10.078  -5.180  1.00 5.77  ? 168  GLU A HG2  3  
ATOM   9015  H HG3  . GLU A 1 168 ? 26.506  9.177   -3.796  1.00 5.44  ? 168  GLU A HG3  3  
ATOM   9016  N N    . ARG A 1 169 ? 28.620  8.336   -8.805  1.00 5.23  ? 169  ARG A N    3  
ATOM   9017  C CA   . ARG A 1 169 ? 29.525  7.547   -9.626  1.00 5.45  ? 169  ARG A CA   3  
ATOM   9018  C C    . ARG A 1 169 ? 30.305  8.475   -10.550 1.00 5.78  ? 169  ARG A C    3  
ATOM   9019  O O    . ARG A 1 169 ? 31.444  8.193   -10.923 1.00 6.09  ? 169  ARG A O    3  
ATOM   9020  C CB   . ARG A 1 169 ? 28.732  6.503   -10.428 1.00 5.37  ? 169  ARG A CB   3  
ATOM   9021  C CG   . ARG A 1 169 ? 29.573  5.385   -11.035 1.00 5.66  ? 169  ARG A CG   3  
ATOM   9022  C CD   . ARG A 1 169 ? 30.293  5.824   -12.299 1.00 6.08  ? 169  ARG A CD   3  
ATOM   9023  N NE   . ARG A 1 169 ? 31.156  4.774   -12.834 1.00 6.39  ? 169  ARG A NE   3  
ATOM   9024  C CZ   . ARG A 1 169 ? 32.340  4.999   -13.399 1.00 6.90  ? 169  ARG A CZ   3  
ATOM   9025  N NH1  . ARG A 1 169 ? 32.813  6.234   -13.491 1.00 7.13  ? 169  ARG A NH1  3  
ATOM   9026  N NH2  . ARG A 1 169 ? 33.049  3.984   -13.870 1.00 7.34  ? 169  ARG A NH2  3  
ATOM   9027  H H    . ARG A 1 169 ? 27.691  8.470   -9.102  1.00 5.10  ? 169  ARG A H    3  
ATOM   9028  H HA   . ARG A 1 169 ? 30.217  7.040   -8.971  1.00 5.55  ? 169  ARG A HA   3  
ATOM   9029  H HB2  . ARG A 1 169 ? 27.999  6.053   -9.776  1.00 5.16  ? 169  ARG A HB2  3  
ATOM   9030  H HB3  . ARG A 1 169 ? 28.216  7.008   -11.233 1.00 5.44  ? 169  ARG A HB3  3  
ATOM   9031  H HG2  . ARG A 1 169 ? 30.310  5.071   -10.311 1.00 5.71  ? 169  ARG A HG2  3  
ATOM   9032  H HG3  . ARG A 1 169 ? 28.927  4.553   -11.272 1.00 5.72  ? 169  ARG A HG3  3  
ATOM   9033  H HD2  . ARG A 1 169 ? 29.557  6.085   -13.045 1.00 6.24  ? 169  ARG A HD2  3  
ATOM   9034  H HD3  . ARG A 1 169 ? 30.895  6.691   -12.071 1.00 6.23  ? 169  ARG A HD3  3  
ATOM   9035  H HE   . ARG A 1 169 ? 30.829  3.847   -12.773 1.00 6.35  ? 169  ARG A HE   3  
ATOM   9036  H HH11 . ARG A 1 169 ? 32.286  7.006   -13.130 1.00 6.96  ? 169  ARG A HH11 3  
ATOM   9037  H HH12 . ARG A 1 169 ? 33.704  6.403   -13.931 1.00 7.60  ? 169  ARG A HH12 3  
ATOM   9038  H HH21 . ARG A 1 169 ? 32.692  3.046   -13.803 1.00 7.32  ? 169  ARG A HH21 3  
ATOM   9039  H HH22 . ARG A 1 169 ? 33.950  4.144   -14.292 1.00 7.80  ? 169  ARG A HH22 3  
ATOM   9040  N N    . LEU A 1 170 ? 29.691  9.596   -10.897 1.00 5.79  ? 170  LEU A N    3  
ATOM   9041  C CA   . LEU A 1 170 ? 30.315  10.560  -11.790 1.00 6.19  ? 170  LEU A CA   3  
ATOM   9042  C C    . LEU A 1 170 ? 30.912  11.704  -10.989 1.00 6.32  ? 170  LEU A C    3  
ATOM   9043  O O    . LEU A 1 170 ? 32.129  11.905  -10.978 1.00 6.79  ? 170  LEU A O    3  
ATOM   9044  C CB   . LEU A 1 170 ? 29.311  11.097  -12.809 1.00 6.33  ? 170  LEU A CB   3  
ATOM   9045  C CG   . LEU A 1 170 ? 28.950  10.154  -13.967 1.00 6.61  ? 170  LEU A CG   3  
ATOM   9046  C CD1  . LEU A 1 170 ? 30.204  9.653   -14.666 1.00 6.97  ? 170  LEU A CD1  3  
ATOM   9047  C CD2  . LEU A 1 170 ? 28.101  8.988   -13.484 1.00 6.43  ? 170  LEU A CD2  3  
ATOM   9048  H H    . LEU A 1 170 ? 28.805  9.793   -10.524 1.00 5.59  ? 170  LEU A H    3  
ATOM   9049  H HA   . LEU A 1 170 ? 31.100  10.058  -12.317 1.00 6.42  ? 170  LEU A HA   3  
ATOM   9050  H HB2  . LEU A 1 170 ? 28.412  11.331  -12.278 1.00 6.17  ? 170  LEU A HB2  3  
ATOM   9051  H HB3  . LEU A 1 170 ? 29.708  12.008  -13.228 1.00 6.57  ? 170  LEU A HB3  3  
ATOM   9052  H HG   . LEU A 1 170 ? 28.372  10.706  -14.694 1.00 6.85  ? 170  LEU A HG   3  
ATOM   9053  H HD11 . LEU A 1 170 ? 30.761  10.493  -15.051 1.00 7.12  ? 170  LEU A HD11 3  
ATOM   9054  H HD12 . LEU A 1 170 ? 29.926  9.000   -15.480 1.00 7.02  ? 170  LEU A HD12 3  
ATOM   9055  H HD13 . LEU A 1 170 ? 30.815  9.108   -13.961 1.00 7.29  ? 170  LEU A HD13 3  
ATOM   9056  H HD21 . LEU A 1 170 ? 27.875  8.336   -14.316 1.00 6.56  ? 170  LEU A HD21 3  
ATOM   9057  H HD22 . LEU A 1 170 ? 27.180  9.363   -13.062 1.00 6.26  ? 170  LEU A HD22 3  
ATOM   9058  H HD23 . LEU A 1 170 ? 28.644  8.436   -12.731 1.00 6.64  ? 170  LEU A HD23 3  
ATOM   9059  N N    . GLU A 1 171 ? 30.050  12.438  -10.308 1.00 6.03  ? 171  GLU A N    3  
ATOM   9060  C CA   . GLU A 1 171 ? 30.473  13.524  -9.443  1.00 6.27  ? 171  GLU A CA   3  
ATOM   9061  C C    . GLU A 1 171 ? 30.152  13.164  -7.999  1.00 6.70  ? 171  GLU A C    3  
ATOM   9062  O O    . GLU A 1 171 ? 30.009  11.987  -7.674  1.00 6.90  ? 171  GLU A O    3  
ATOM   9063  C CB   . GLU A 1 171 ? 29.783  14.827  -9.855  1.00 6.34  ? 171  GLU A CB   3  
ATOM   9064  C CG   . GLU A 1 171 ? 30.193  15.309  -11.239 1.00 6.31  ? 171  GLU A CG   3  
ATOM   9065  C CD   . GLU A 1 171 ? 29.530  16.610  -11.634 1.00 6.67  ? 171  GLU A CD   3  
ATOM   9066  O OE1  . GLU A 1 171 ? 29.991  17.678  -11.181 1.00 6.97  ? 171  GLU A OE1  3  
ATOM   9067  O OE2  . GLU A 1 171 ? 28.539  16.572  -12.394 1.00 6.91  ? 171  GLU A OE2  3  
ATOM   9068  H H    . GLU A 1 171 ? 29.092  12.234  -10.375 1.00 5.72  ? 171  GLU A H    3  
ATOM   9069  H HA   . GLU A 1 171 ? 31.542  13.637  -9.547  1.00 6.42  ? 171  GLU A HA   3  
ATOM   9070  H HB2  . GLU A 1 171 ? 28.714  14.673  -9.851  1.00 6.52  ? 171  GLU A HB2  3  
ATOM   9071  H HB3  . GLU A 1 171 ? 30.032  15.596  -9.140  1.00 6.61  ? 171  GLU A HB3  3  
ATOM   9072  H HG2  . GLU A 1 171 ? 31.263  15.453  -11.251 1.00 6.37  ? 171  GLU A HG2  3  
ATOM   9073  H HG3  . GLU A 1 171 ? 29.926  14.551  -11.962 1.00 6.37  ? 171  GLU A HG3  3  
ATOM   9074  N N    . HIS A 1 172 ? 30.056  14.152  -7.128  1.00 7.18  ? 172  HIS A N    3  
ATOM   9075  C CA   . HIS A 1 172 ? 29.736  13.888  -5.734  1.00 7.91  ? 172  HIS A CA   3  
ATOM   9076  C C    . HIS A 1 172 ? 28.775  14.929  -5.195  1.00 8.34  ? 172  HIS A C    3  
ATOM   9077  O O    . HIS A 1 172 ? 29.102  16.113  -5.113  1.00 8.55  ? 172  HIS A O    3  
ATOM   9078  C CB   . HIS A 1 172 ? 31.006  13.845  -4.883  1.00 8.43  ? 172  HIS A CB   3  
ATOM   9079  C CG   . HIS A 1 172 ? 31.853  12.639  -5.138  1.00 8.65  ? 172  HIS A CG   3  
ATOM   9080  N ND1  . HIS A 1 172 ? 33.011  12.676  -5.880  1.00 8.91  ? 172  HIS A ND1  3  
ATOM   9081  C CD2  . HIS A 1 172 ? 31.702  11.354  -4.746  1.00 8.94  ? 172  HIS A CD2  3  
ATOM   9082  C CE1  . HIS A 1 172 ? 33.538  11.468  -5.932  1.00 9.32  ? 172  HIS A CE1  3  
ATOM   9083  N NE2  . HIS A 1 172 ? 32.761  10.647  -5.251  1.00 9.35  ? 172  HIS A NE2  3  
ATOM   9084  H H    . HIS A 1 172 ? 30.194  15.081  -7.424  1.00 7.23  ? 172  HIS A H    3  
ATOM   9085  H HA   . HIS A 1 172 ? 29.256  12.923  -5.689  1.00 8.05  ? 172  HIS A HA   3  
ATOM   9086  H HB2  . HIS A 1 172 ? 31.603  14.720  -5.092  1.00 8.63  ? 172  HIS A HB2  3  
ATOM   9087  H HB3  . HIS A 1 172 ? 30.731  13.844  -3.837  1.00 8.77  ? 172  HIS A HB3  3  
ATOM   9088  H HD1  . HIS A 1 172 ? 33.389  13.480  -6.320  1.00 8.98  ? 172  HIS A HD1  3  
ATOM   9089  H HD2  . HIS A 1 172 ? 30.895  10.958  -4.146  1.00 9.04  ? 172  HIS A HD2  3  
ATOM   9090  H HE1  . HIS A 1 172 ? 34.447  11.196  -6.445  1.00 9.74  ? 172  HIS A HE1  3  
ATOM   9091  H HE2  . HIS A 1 172 ? 32.988  9.715   -5.018  1.00 9.81  ? 172  HIS A HE2  3  
ATOM   9092  N N    . HIS A 1 173 ? 27.587  14.479  -4.830  1.00 8.71  ? 173  HIS A N    3  
ATOM   9093  C CA   . HIS A 1 173 ? 26.563  15.361  -4.305  1.00 9.35  ? 173  HIS A CA   3  
ATOM   9094  C C    . HIS A 1 173 ? 26.784  15.571  -2.815  1.00 9.73  ? 173  HIS A C    3  
ATOM   9095  O O    . HIS A 1 173 ? 26.560  16.663  -2.289  1.00 10.12 ? 173  HIS A O    3  
ATOM   9096  C CB   . HIS A 1 173 ? 25.174  14.768  -4.567  1.00 9.85  ? 173  HIS A CB   3  
ATOM   9097  C CG   . HIS A 1 173 ? 24.041  15.632  -4.107  1.00 10.34 ? 173  HIS A CG   3  
ATOM   9098  N ND1  . HIS A 1 173 ? 23.336  16.455  -4.951  1.00 10.84 ? 173  HIS A ND1  3  
ATOM   9099  C CD2  . HIS A 1 173 ? 23.489  15.793  -2.881  1.00 10.66 ? 173  HIS A CD2  3  
ATOM   9100  C CE1  . HIS A 1 173 ? 22.403  17.087  -4.270  1.00 11.40 ? 173  HIS A CE1  3  
ATOM   9101  N NE2  . HIS A 1 173 ? 22.474  16.701  -3.011  1.00 11.31 ? 173  HIS A NE2  3  
ATOM   9102  H H    . HIS A 1 173 ? 27.394  13.513  -4.902  1.00 8.72  ? 173  HIS A H    3  
ATOM   9103  H HA   . HIS A 1 173 ? 26.645  16.312  -4.811  1.00 9.44  ? 173  HIS A HA   3  
ATOM   9104  H HB2  . HIS A 1 173 ? 25.055  14.608  -5.628  1.00 9.81  ? 173  HIS A HB2  3  
ATOM   9105  H HB3  . HIS A 1 173 ? 25.096  13.819  -4.057  1.00 10.14 ? 173  HIS A HB3  3  
ATOM   9106  H HD1  . HIS A 1 173 ? 23.494  16.557  -5.925  1.00 10.92 ? 173  HIS A HD1  3  
ATOM   9107  H HD2  . HIS A 1 173 ? 23.793  15.296  -1.971  1.00 10.59 ? 173  HIS A HD2  3  
ATOM   9108  H HE1  . HIS A 1 173 ? 21.697  17.798  -4.674  1.00 11.99 ? 173  HIS A HE1  3  
ATOM   9109  H HE2  . HIS A 1 173 ? 21.803  16.909  -2.314  1.00 11.79 ? 173  HIS A HE2  3  
ATOM   9110  N N    . HIS A 1 174 ? 27.230  14.519  -2.146  1.00 9.86  ? 174  HIS A N    3  
ATOM   9111  C CA   . HIS A 1 174 ? 27.498  14.577  -0.717  1.00 10.40 ? 174  HIS A CA   3  
ATOM   9112  C C    . HIS A 1 174 ? 28.817  15.299  -0.456  1.00 11.06 ? 174  HIS A C    3  
ATOM   9113  O O    . HIS A 1 174 ? 28.895  16.194  0.386   1.00 11.27 ? 174  HIS A O    3  
ATOM   9114  C CB   . HIS A 1 174 ? 27.531  13.162  -0.128  1.00 10.58 ? 174  HIS A CB   3  
ATOM   9115  C CG   . HIS A 1 174 ? 27.677  13.126  1.362   1.00 10.83 ? 174  HIS A CG   3  
ATOM   9116  N ND1  . HIS A 1 174 ? 28.632  12.373  2.007   1.00 11.12 ? 174  HIS A ND1  3  
ATOM   9117  C CD2  . HIS A 1 174 ? 26.966  13.739  2.337   1.00 11.10 ? 174  HIS A CD2  3  
ATOM   9118  C CE1  . HIS A 1 174 ? 28.505  12.525  3.310   1.00 11.52 ? 174  HIS A CE1  3  
ATOM   9119  N NE2  . HIS A 1 174 ? 27.500  13.349  3.539   1.00 11.52 ? 174  HIS A NE2  3  
ATOM   9120  H H    . HIS A 1 174 ? 27.380  13.674  -2.630  1.00 9.73  ? 174  HIS A H    3  
ATOM   9121  H HA   . HIS A 1 174 ? 26.698  15.134  -0.252  1.00 10.44 ? 174  HIS A HA   3  
ATOM   9122  H HB2  . HIS A 1 174 ? 26.613  12.655  -0.383  1.00 10.52 ? 174  HIS A HB2  3  
ATOM   9123  H HB3  . HIS A 1 174 ? 28.363  12.624  -0.557  1.00 10.82 ? 174  HIS A HB3  3  
ATOM   9124  H HD1  . HIS A 1 174 ? 29.307  11.792  1.567   1.00 11.17 ? 174  HIS A HD1  3  
ATOM   9125  H HD2  . HIS A 1 174 ? 26.131  14.412  2.194   1.00 11.16 ? 174  HIS A HD2  3  
ATOM   9126  H HE1  . HIS A 1 174 ? 29.119  12.054  4.063   1.00 11.95 ? 174  HIS A HE1  3  
ATOM   9127  H HE2  . HIS A 1 174 ? 27.071  13.484  4.418   1.00 11.89 ? 174  HIS A HE2  3  
ATOM   9128  N N    . HIS A 1 175 ? 29.848  14.903  -1.182  1.00 11.59 ? 175  HIS A N    3  
ATOM   9129  C CA   . HIS A 1 175 ? 31.154  15.534  -1.074  1.00 12.41 ? 175  HIS A CA   3  
ATOM   9130  C C    . HIS A 1 175 ? 31.223  16.771  -1.961  1.00 12.84 ? 175  HIS A C    3  
ATOM   9131  O O    . HIS A 1 175 ? 31.316  16.662  -3.181  1.00 13.21 ? 175  HIS A O    3  
ATOM   9132  C CB   . HIS A 1 175 ? 32.255  14.540  -1.462  1.00 12.99 ? 175  HIS A CB   3  
ATOM   9133  C CG   . HIS A 1 175 ? 33.643  15.105  -1.409  1.00 13.51 ? 175  HIS A CG   3  
ATOM   9134  N ND1  . HIS A 1 175 ? 34.428  15.057  -0.281  1.00 13.89 ? 175  HIS A ND1  3  
ATOM   9135  C CD2  . HIS A 1 175 ? 34.384  15.729  -2.354  1.00 13.89 ? 175  HIS A CD2  3  
ATOM   9136  C CE1  . HIS A 1 175 ? 35.591  15.628  -0.532  1.00 14.46 ? 175  HIS A CE1  3  
ATOM   9137  N NE2  . HIS A 1 175 ? 35.589  16.044  -1.784  1.00 14.48 ? 175  HIS A NE2  3  
ATOM   9138  H H    . HIS A 1 175 ? 29.733  14.147  -1.805  1.00 11.55 ? 175  HIS A H    3  
ATOM   9139  H HA   . HIS A 1 175 ? 31.295  15.833  -0.045  1.00 12.49 ? 175  HIS A HA   3  
ATOM   9140  H HB2  . HIS A 1 175 ? 32.218  13.695  -0.790  1.00 12.92 ? 175  HIS A HB2  3  
ATOM   9141  H HB3  . HIS A 1 175 ? 32.075  14.196  -2.471  1.00 13.31 ? 175  HIS A HB3  3  
ATOM   9142  H HD1  . HIS A 1 175 ? 34.167  14.656  0.587   1.00 13.86 ? 175  HIS A HD1  3  
ATOM   9143  H HD2  . HIS A 1 175 ? 34.082  15.938  -3.371  1.00 13.88 ? 175  HIS A HD2  3  
ATOM   9144  H HE1  . HIS A 1 175 ? 36.406  15.734  0.168   1.00 14.94 ? 175  HIS A HE1  3  
ATOM   9145  H HE2  . HIS A 1 175 ? 36.265  16.651  -2.177  1.00 14.95 ? 175  HIS A HE2  3  
ATOM   9146  N N    . HIS A 1 176 ? 31.176  17.942  -1.343  1.00 12.98 ? 176  HIS A N    3  
ATOM   9147  C CA   . HIS A 1 176 ? 31.282  19.199  -2.072  1.00 13.55 ? 176  HIS A CA   3  
ATOM   9148  C C    . HIS A 1 176 ? 32.745  19.552  -2.301  1.00 13.90 ? 176  HIS A C    3  
ATOM   9149  O O    . HIS A 1 176 ? 33.472  19.862  -1.357  1.00 14.09 ? 176  HIS A O    3  
ATOM   9150  C CB   . HIS A 1 176 ? 30.581  20.331  -1.312  1.00 13.99 ? 176  HIS A CB   3  
ATOM   9151  C CG   . HIS A 1 176 ? 29.086  20.225  -1.306  1.00 14.45 ? 176  HIS A CG   3  
ATOM   9152  N ND1  . HIS A 1 176 ? 28.271  21.108  -1.979  1.00 14.88 ? 176  HIS A ND1  3  
ATOM   9153  C CD2  . HIS A 1 176 ? 28.258  19.340  -0.703  1.00 14.71 ? 176  HIS A CD2  3  
ATOM   9154  C CE1  . HIS A 1 176 ? 27.011  20.774  -1.788  1.00 15.37 ? 176  HIS A CE1  3  
ATOM   9155  N NE2  . HIS A 1 176 ? 26.974  19.704  -1.019  1.00 15.28 ? 176  HIS A NE2  3  
ATOM   9156  H H    . HIS A 1 176 ? 31.074  17.963  -0.363  1.00 12.81 ? 176  HIS A H    3  
ATOM   9157  H HA   . HIS A 1 176 ? 30.801  19.068  -3.030  1.00 13.61 ? 176  HIS A HA   3  
ATOM   9158  H HB2  . HIS A 1 176 ? 30.916  20.324  -0.285  1.00 14.08 ? 176  HIS A HB2  3  
ATOM   9159  H HB3  . HIS A 1 176 ? 30.847  21.274  -1.765  1.00 14.07 ? 176  HIS A HB3  3  
ATOM   9160  H HD1  . HIS A 1 176 ? 28.576  21.877  -2.517  1.00 14.94 ? 176  HIS A HD1  3  
ATOM   9161  H HD2  . HIS A 1 176 ? 28.554  18.503  -0.085  1.00 14.62 ? 176  HIS A HD2  3  
ATOM   9162  H HE1  . HIS A 1 176 ? 26.152  21.288  -2.196  1.00 15.88 ? 176  HIS A HE1  3  
ATOM   9163  H HE2  . HIS A 1 176 ? 26.157  19.340  -0.597  1.00 15.66 ? 176  HIS A HE2  3  
ATOM   9164  N N    . HIS A 1 177 ? 33.168  19.485  -3.557  1.00 14.14 ? 177  HIS A N    3  
ATOM   9165  C CA   . HIS A 1 177 ? 34.554  19.761  -3.925  1.00 14.65 ? 177  HIS A CA   3  
ATOM   9166  C C    . HIS A 1 177 ? 34.895  21.232  -3.713  1.00 15.60 ? 177  HIS A C    3  
ATOM   9167  O O    . HIS A 1 177 ? 36.002  21.556  -3.273  1.00 16.02 ? 177  HIS A O    3  
ATOM   9168  C CB   . HIS A 1 177 ? 34.796  19.373  -5.390  1.00 14.60 ? 177  HIS A CB   3  
ATOM   9169  C CG   . HIS A 1 177 ? 36.189  19.655  -5.872  1.00 14.47 ? 177  HIS A CG   3  
ATOM   9170  N ND1  . HIS A 1 177 ? 36.472  20.551  -6.883  1.00 14.51 ? 177  HIS A ND1  3  
ATOM   9171  C CD2  . HIS A 1 177 ? 37.381  19.150  -5.479  1.00 14.51 ? 177  HIS A CD2  3  
ATOM   9172  C CE1  . HIS A 1 177 ? 37.776  20.584  -7.085  1.00 14.56 ? 177  HIS A CE1  3  
ATOM   9173  N NE2  . HIS A 1 177 ? 38.349  19.743  -6.247  1.00 14.56 ? 177  HIS A NE2  3  
ATOM   9174  H H    . HIS A 1 177 ? 32.528  19.235  -4.264  1.00 14.09 ? 177  HIS A H    3  
ATOM   9175  H HA   . HIS A 1 177 ? 35.191  19.162  -3.294  1.00 14.57 ? 177  HIS A HA   3  
ATOM   9176  H HB2  . HIS A 1 177 ? 34.613  18.317  -5.510  1.00 14.44 ? 177  HIS A HB2  3  
ATOM   9177  H HB3  . HIS A 1 177 ? 34.110  19.925  -6.017  1.00 14.99 ? 177  HIS A HB3  3  
ATOM   9178  H HD1  . HIS A 1 177 ? 35.807  21.088  -7.386  1.00 14.60 ? 177  HIS A HD1  3  
ATOM   9179  H HD2  . HIS A 1 177 ? 37.541  18.416  -4.702  1.00 14.61 ? 177  HIS A HD2  3  
ATOM   9180  H HE1  . HIS A 1 177 ? 38.287  21.195  -7.816  1.00 14.72 ? 177  HIS A HE1  3  
ATOM   9181  H HE2  . HIS A 1 177 ? 39.308  19.504  -6.245  1.00 14.72 ? 177  HIS A HE2  3  
ATOM   9182  N N    . LEU A 1 178 ? 33.933  22.103  -4.023  1.00 16.06 ? 178  LEU A N    3  
ATOM   9183  C CA   . LEU A 1 178 ? 34.118  23.551  -3.950  1.00 17.08 ? 178  LEU A CA   3  
ATOM   9184  C C    . LEU A 1 178 ? 35.157  24.007  -4.971  1.00 17.58 ? 178  LEU A C    3  
ATOM   9185  O O    . LEU A 1 178 ? 36.353  23.775  -4.808  1.00 17.74 ? 178  LEU A O    3  
ATOM   9186  C CB   . LEU A 1 178 ? 34.528  23.983  -2.537  1.00 17.47 ? 178  LEU A CB   3  
ATOM   9187  C CG   . LEU A 1 178 ? 34.606  25.494  -2.314  1.00 17.56 ? 178  LEU A CG   3  
ATOM   9188  C CD1  . LEU A 1 178 ? 33.226  26.121  -2.436  1.00 17.99 ? 178  LEU A CD1  3  
ATOM   9189  C CD2  . LEU A 1 178 ? 35.214  25.798  -0.957  1.00 17.68 ? 178  LEU A CD2  3  
ATOM   9190  H H    . LEU A 1 178 ? 33.063  21.755  -4.317  1.00 15.79 ? 178  LEU A H    3  
ATOM   9191  H HA   . LEU A 1 178 ? 33.171  24.011  -4.195  1.00 17.35 ? 178  LEU A HA   3  
ATOM   9192  H HB2  . LEU A 1 178 ? 33.813  23.574  -1.836  1.00 17.43 ? 178  LEU A HB2  3  
ATOM   9193  H HB3  . LEU A 1 178 ? 35.498  23.561  -2.322  1.00 17.90 ? 178  LEU A HB3  3  
ATOM   9194  H HG   . LEU A 1 178 ? 35.240  25.932  -3.073  1.00 17.40 ? 178  LEU A HG   3  
ATOM   9195  H HD11 . LEU A 1 178 ? 33.300  27.188  -2.280  1.00 18.20 ? 178  LEU A HD11 3  
ATOM   9196  H HD12 . LEU A 1 178 ? 32.569  25.693  -1.694  1.00 18.21 ? 178  LEU A HD12 3  
ATOM   9197  H HD13 . LEU A 1 178 ? 32.829  25.929  -3.423  1.00 17.98 ? 178  LEU A HD13 3  
ATOM   9198  H HD21 . LEU A 1 178 ? 36.223  25.412  -0.920  1.00 17.91 ? 178  LEU A HD21 3  
ATOM   9199  H HD22 . LEU A 1 178 ? 34.622  25.330  -0.185  1.00 17.74 ? 178  LEU A HD22 3  
ATOM   9200  H HD23 . LEU A 1 178 ? 35.230  26.866  -0.800  1.00 17.62 ? 178  LEU A HD23 3  
ATOM   9201  N N    . GLU A 1 179 ? 34.694  24.651  -6.031  1.00 17.95 ? 179  GLU A N    3  
ATOM   9202  C CA   . GLU A 1 179 ? 35.579  25.082  -7.103  1.00 18.57 ? 179  GLU A CA   3  
ATOM   9203  C C    . GLU A 1 179 ? 36.393  26.300  -6.683  1.00 19.13 ? 179  GLU A C    3  
ATOM   9204  O O    . GLU A 1 179 ? 36.134  26.904  -5.640  1.00 19.11 ? 179  GLU A O    3  
ATOM   9205  C CB   . GLU A 1 179 ? 34.781  25.388  -8.369  1.00 18.91 ? 179  GLU A CB   3  
ATOM   9206  C CG   . GLU A 1 179 ? 34.053  24.177  -8.929  1.00 18.77 ? 179  GLU A CG   3  
ATOM   9207  C CD   . GLU A 1 179 ? 34.966  22.980  -9.094  1.00 18.94 ? 179  GLU A CD   3  
ATOM   9208  O OE1  . GLU A 1 179 ? 35.867  23.030  -9.959  1.00 19.19 ? 179  GLU A OE1  3  
ATOM   9209  O OE2  . GLU A 1 179 ? 34.789  21.980  -8.365  1.00 18.93 ? 179  GLU A OE2  3  
ATOM   9210  H H    . GLU A 1 179 ? 33.731  24.853  -6.089  1.00 17.89 ? 179  GLU A H    3  
ATOM   9211  H HA   . GLU A 1 179 ? 36.259  24.270  -7.310  1.00 18.54 ? 179  GLU A HA   3  
ATOM   9212  H HB2  . GLU A 1 179 ? 34.050  26.151  -8.145  1.00 19.08 ? 179  GLU A HB2  3  
ATOM   9213  H HB3  . GLU A 1 179 ? 35.456  25.759  -9.126  1.00 19.22 ? 179  GLU A HB3  3  
ATOM   9214  H HG2  . GLU A 1 179 ? 33.252  23.912  -8.256  1.00 18.73 ? 179  GLU A HG2  3  
ATOM   9215  H HG3  . GLU A 1 179 ? 33.642  24.435  -9.893  1.00 18.73 ? 179  GLU A HG3  3  
ATOM   9216  N N    . HIS A 1 180 ? 37.373  26.654  -7.504  1.00 19.74 ? 180  HIS A N    3  
ATOM   9217  C CA   . HIS A 1 180 ? 38.270  27.760  -7.193  1.00 20.41 ? 180  HIS A CA   3  
ATOM   9218  C C    . HIS A 1 180 ? 37.533  29.094  -7.266  1.00 20.84 ? 180  HIS A C    3  
ATOM   9219  O O    . HIS A 1 180 ? 36.979  29.451  -8.305  1.00 21.13 ? 180  HIS A O    3  
ATOM   9220  C CB   . HIS A 1 180 ? 39.468  27.768  -8.147  1.00 21.03 ? 180  HIS A CB   3  
ATOM   9221  C CG   . HIS A 1 180 ? 40.411  28.909  -7.909  1.00 21.37 ? 180  HIS A CG   3  
ATOM   9222  N ND1  . HIS A 1 180 ? 40.600  29.930  -8.812  1.00 21.96 ? 180  HIS A ND1  3  
ATOM   9223  C CD2  . HIS A 1 180 ? 41.205  29.194  -6.852  1.00 21.34 ? 180  HIS A CD2  3  
ATOM   9224  C CE1  . HIS A 1 180 ? 41.464  30.794  -8.320  1.00 22.26 ? 180  HIS A CE1  3  
ATOM   9225  N NE2  . HIS A 1 180 ? 41.847  30.372  -7.131  1.00 21.90 ? 180  HIS A NE2  3  
ATOM   9226  H H    . HIS A 1 180 ? 37.490  26.166  -8.350  1.00 19.81 ? 180  HIS A H    3  
ATOM   9227  H HA   . HIS A 1 180 ? 38.628  27.619  -6.183  1.00 20.26 ? 180  HIS A HA   3  
ATOM   9228  H HB2  . HIS A 1 180 ? 40.022  26.849  -8.028  1.00 21.05 ? 180  HIS A HB2  3  
ATOM   9229  H HB3  . HIS A 1 180 ? 39.111  27.838  -9.164  1.00 21.34 ? 180  HIS A HB3  3  
ATOM   9230  H HD1  . HIS A 1 180 ? 40.177  29.998  -9.702  1.00 22.20 ? 180  HIS A HD1  3  
ATOM   9231  H HD2  . HIS A 1 180 ? 41.311  28.603  -5.953  1.00 21.02 ? 180  HIS A HD2  3  
ATOM   9232  H HE1  . HIS A 1 180 ? 41.801  31.695  -8.808  1.00 22.80 ? 180  HIS A HE1  3  
ATOM   9233  H HE2  . HIS A 1 180 ? 42.329  30.924  -6.467  1.00 22.10 ? 180  HIS A HE2  3  
ATOM   9234  N N    . HIS A 1 181 ? 37.533  29.818  -6.158  1.00 20.99 ? 181  HIS A N    3  
ATOM   9235  C CA   . HIS A 1 181 ? 36.886  31.118  -6.097  1.00 21.54 ? 181  HIS A CA   3  
ATOM   9236  C C    . HIS A 1 181 ? 37.681  32.157  -6.873  1.00 22.31 ? 181  HIS A C    3  
ATOM   9237  O O    . HIS A 1 181 ? 38.876  32.348  -6.640  1.00 22.51 ? 181  HIS A O    3  
ATOM   9238  C CB   . HIS A 1 181 ? 36.713  31.569  -4.645  1.00 21.37 ? 181  HIS A CB   3  
ATOM   9239  C CG   . HIS A 1 181 ? 35.711  30.762  -3.879  1.00 21.01 ? 181  HIS A CG   3  
ATOM   9240  N ND1  . HIS A 1 181 ? 36.052  29.912  -2.848  1.00 20.83 ? 181  HIS A ND1  3  
ATOM   9241  C CD2  . HIS A 1 181 ? 34.365  30.693  -3.990  1.00 20.92 ? 181  HIS A CD2  3  
ATOM   9242  C CE1  . HIS A 1 181 ? 34.959  29.358  -2.360  1.00 20.64 ? 181  HIS A CE1  3  
ATOM   9243  N NE2  . HIS A 1 181 ? 33.923  29.814  -3.035  1.00 20.70 ? 181  HIS A NE2  3  
ATOM   9244  H H    . HIS A 1 181 ? 37.981  29.466  -5.355  1.00 20.81 ? 181  HIS A H    3  
ATOM   9245  H HA   . HIS A 1 181 ? 35.911  31.020  -6.551  1.00 21.64 ? 181  HIS A HA   3  
ATOM   9246  H HB2  . HIS A 1 181 ? 37.661  31.488  -4.135  1.00 21.28 ? 181  HIS A HB2  3  
ATOM   9247  H HB3  . HIS A 1 181 ? 36.389  32.600  -4.632  1.00 21.73 ? 181  HIS A HB3  3  
ATOM   9248  H HD1  . HIS A 1 181 ? 36.966  29.726  -2.529  1.00 20.90 ? 181  HIS A HD1  3  
ATOM   9249  H HD2  . HIS A 1 181 ? 33.752  31.230  -4.701  1.00 21.08 ? 181  HIS A HD2  3  
ATOM   9250  H HE1  . HIS A 1 181 ? 34.919  28.650  -1.544  1.00 20.55 ? 181  HIS A HE1  3  
ATOM   9251  H HE2  . HIS A 1 181 ? 32.977  29.642  -2.809  1.00 20.67 ? 181  HIS A HE2  3  
ATOM   9252  N N    . HIS A 1 182 ? 37.012  32.822  -7.800  1.00 22.83 ? 182  HIS A N    3  
ATOM   9253  C CA   . HIS A 1 182 ? 37.636  33.884  -8.576  1.00 23.69 ? 182  HIS A CA   3  
ATOM   9254  C C    . HIS A 1 182 ? 37.638  35.185  -7.784  1.00 24.16 ? 182  HIS A C    3  
ATOM   9255  O O    . HIS A 1 182 ? 36.794  35.382  -6.909  1.00 24.40 ? 182  HIS A O    3  
ATOM   9256  C CB   . HIS A 1 182 ? 36.940  34.070  -9.938  1.00 24.01 ? 182  HIS A CB   3  
ATOM   9257  C CG   . HIS A 1 182 ? 35.439  34.088  -9.892  1.00 24.24 ? 182  HIS A CG   3  
ATOM   9258  N ND1  . HIS A 1 182 ? 34.668  33.153  -10.543 1.00 24.67 ? 182  HIS A ND1  3  
ATOM   9259  C CD2  . HIS A 1 182 ? 34.569  34.938  -9.298  1.00 24.22 ? 182  HIS A CD2  3  
ATOM   9260  C CE1  . HIS A 1 182 ? 33.393  33.424  -10.354 1.00 24.89 ? 182  HIS A CE1  3  
ATOM   9261  N NE2  . HIS A 1 182 ? 33.302  34.503  -9.601  1.00 24.63 ? 182  HIS A NE2  3  
ATOM   9262  H H    . HIS A 1 182 ? 36.064  32.602  -7.955  1.00 22.69 ? 182  HIS A H    3  
ATOM   9263  H HA   . HIS A 1 182 ? 38.662  33.593  -8.749  1.00 23.87 ? 182  HIS A HA   3  
ATOM   9264  H HB2  . HIS A 1 182 ? 37.263  35.007  -10.367 1.00 23.75 ? 182  HIS A HB2  3  
ATOM   9265  H HB3  . HIS A 1 182 ? 37.241  33.265  -10.593 1.00 24.46 ? 182  HIS A HB3  3  
ATOM   9266  H HD1  . HIS A 1 182 ? 35.010  32.392  -11.078 1.00 24.84 ? 182  HIS A HD1  3  
ATOM   9267  H HD2  . HIS A 1 182 ? 34.824  35.799  -8.693  1.00 24.00 ? 182  HIS A HD2  3  
ATOM   9268  H HE1  . HIS A 1 182 ? 32.562  32.857  -10.748 1.00 25.30 ? 182  HIS A HE1  3  
ATOM   9269  H HE2  . HIS A 1 182 ? 32.477  35.019  -9.464  1.00 24.80 ? 182  HIS A HE2  3  
ATOM   9270  N N    . HIS A 1 183 ? 38.602  36.055  -8.086  1.00 24.38 ? 183  HIS A N    3  
ATOM   9271  C CA   . HIS A 1 183 ? 38.763  37.334  -7.386  1.00 24.93 ? 183  HIS A CA   3  
ATOM   9272  C C    . HIS A 1 183 ? 39.168  37.112  -5.934  1.00 25.44 ? 183  HIS A C    3  
ATOM   9273  O O    . HIS A 1 183 ? 38.824  37.899  -5.050  1.00 25.58 ? 183  HIS A O    3  
ATOM   9274  C CB   . HIS A 1 183 ? 37.480  38.177  -7.451  1.00 25.08 ? 183  HIS A CB   3  
ATOM   9275  C CG   . HIS A 1 183 ? 37.159  38.687  -8.822  1.00 25.22 ? 183  HIS A CG   3  
ATOM   9276  N ND1  . HIS A 1 183 ? 37.485  39.955  -9.249  1.00 25.36 ? 183  HIS A ND1  3  
ATOM   9277  C CD2  . HIS A 1 183 ? 36.538  38.091  -9.866  1.00 25.35 ? 183  HIS A CD2  3  
ATOM   9278  C CE1  . HIS A 1 183 ? 37.081  40.115  -10.493 1.00 25.56 ? 183  HIS A CE1  3  
ATOM   9279  N NE2  . HIS A 1 183 ? 36.503  38.999  -10.892 1.00 25.56 ? 183  HIS A NE2  3  
ATOM   9280  H H    . HIS A 1 183 ? 39.236  35.828  -8.804  1.00 24.25 ? 183  HIS A H    3  
ATOM   9281  H HA   . HIS A 1 183 ? 39.557  37.875  -7.880  1.00 24.97 ? 183  HIS A HA   3  
ATOM   9282  H HB2  . HIS A 1 183 ? 36.646  37.578  -7.118  1.00 24.96 ? 183  HIS A HB2  3  
ATOM   9283  H HB3  . HIS A 1 183 ? 37.586  39.031  -6.796  1.00 25.31 ? 183  HIS A HB3  3  
ATOM   9284  H HD1  . HIS A 1 183 ? 37.944  40.644  -8.713  1.00 25.37 ? 183  HIS A HD1  3  
ATOM   9285  H HD2  . HIS A 1 183 ? 36.144  37.085  -9.887  1.00 25.36 ? 183  HIS A HD2  3  
ATOM   9286  H HE1  . HIS A 1 183 ? 37.202  41.010  -11.086 1.00 25.77 ? 183  HIS A HE1  3  
ATOM   9287  H HE2  . HIS A 1 183 ? 35.983  38.901  -11.725 1.00 25.74 ? 183  HIS A HE2  3  
ATOM   9288  N N    . HIS A 1 184 ? 39.917  36.044  -5.690  1.00 25.80 ? 184  HIS A N    3  
ATOM   9289  C CA   . HIS A 1 184 ? 40.390  35.745  -4.346  1.00 26.40 ? 184  HIS A CA   3  
ATOM   9290  C C    . HIS A 1 184 ? 41.916  35.688  -4.315  1.00 26.96 ? 184  HIS A C    3  
ATOM   9291  O O    . HIS A 1 184 ? 42.508  34.609  -4.310  1.00 27.37 ? 184  HIS A O    3  
ATOM   9292  C CB   . HIS A 1 184 ? 39.791  34.426  -3.843  1.00 26.76 ? 184  HIS A CB   3  
ATOM   9293  C CG   . HIS A 1 184 ? 40.044  34.164  -2.387  1.00 26.84 ? 184  HIS A CG   3  
ATOM   9294  N ND1  . HIS A 1 184 ? 40.768  33.088  -1.925  1.00 26.92 ? 184  HIS A ND1  3  
ATOM   9295  C CD2  . HIS A 1 184 ? 39.652  34.848  -1.288  1.00 26.96 ? 184  HIS A CD2  3  
ATOM   9296  C CE1  . HIS A 1 184 ? 40.811  33.122  -0.607  1.00 27.09 ? 184  HIS A CE1  3  
ATOM   9297  N NE2  . HIS A 1 184 ? 40.142  34.181  -0.195  1.00 27.11 ? 184  HIS A NE2  3  
ATOM   9298  H H    . HIS A 1 184 ? 40.159  35.447  -6.428  1.00 25.73 ? 184  HIS A H    3  
ATOM   9299  H HA   . HIS A 1 184 ? 40.062  36.547  -3.700  1.00 26.29 ? 184  HIS A HA   3  
ATOM   9300  H HB2  . HIS A 1 184 ? 38.722  34.442  -3.995  1.00 26.84 ? 184  HIS A HB2  3  
ATOM   9301  H HB3  . HIS A 1 184 ? 40.217  33.609  -4.407  1.00 26.98 ? 184  HIS A HB3  3  
ATOM   9302  H HD1  . HIS A 1 184 ? 41.197  32.396  -2.484  1.00 26.92 ? 184  HIS A HD1  3  
ATOM   9303  H HD2  . HIS A 1 184 ? 39.066  35.757  -1.274  1.00 27.01 ? 184  HIS A HD2  3  
ATOM   9304  H HE1  . HIS A 1 184 ? 41.312  32.404  0.026   1.00 27.25 ? 184  HIS A HE1  3  
ATOM   9305  H HE2  . HIS A 1 184 ? 40.178  34.546  0.720   1.00 27.29 ? 184  HIS A HE2  3  
ATOM   9306  N N    . HIS A 1 185 ? 42.544  36.856  -4.353  1.00 27.04 ? 185  HIS A N    3  
ATOM   9307  C CA   . HIS A 1 185 ? 43.994  36.957  -4.238  1.00 27.63 ? 185  HIS A CA   3  
ATOM   9308  C C    . HIS A 1 185 ? 44.365  38.189  -3.423  1.00 27.78 ? 185  HIS A C    3  
ATOM   9309  O O    . HIS A 1 185 ? 44.413  38.082  -2.183  1.00 27.59 ? 185  HIS A O    3  
ATOM   9310  C CB   . HIS A 1 185 ? 44.662  37.024  -5.617  1.00 28.05 ? 185  HIS A CB   3  
ATOM   9311  C CG   . HIS A 1 185 ? 44.602  35.738  -6.384  1.00 28.32 ? 185  HIS A CG   3  
ATOM   9312  N ND1  . HIS A 1 185 ? 43.757  35.540  -7.450  1.00 28.85 ? 185  HIS A ND1  3  
ATOM   9313  C CD2  . HIS A 1 185 ? 45.297  34.584  -6.238  1.00 28.21 ? 185  HIS A CD2  3  
ATOM   9314  C CE1  . HIS A 1 185 ? 43.929  34.321  -7.927  1.00 29.06 ? 185  HIS A CE1  3  
ATOM   9315  N NE2  . HIS A 1 185 ? 44.858  33.720  -7.211  1.00 28.68 ? 185  HIS A NE2  3  
ATOM   9316  O OXT  . HIS A 1 185 ? 44.593  39.261  -4.020  1.00 28.16 ? 185  HIS A OXT  3  
ATOM   9317  H H    . HIS A 1 185 ? 42.018  37.682  -4.467  1.00 26.76 ? 185  HIS A H    3  
ATOM   9318  H HA   . HIS A 1 185 ? 44.346  36.080  -3.718  1.00 27.76 ? 185  HIS A HA   3  
ATOM   9319  H HB2  . HIS A 1 185 ? 44.174  37.784  -6.207  1.00 28.24 ? 185  HIS A HB2  3  
ATOM   9320  H HB3  . HIS A 1 185 ? 45.703  37.288  -5.491  1.00 28.07 ? 185  HIS A HB3  3  
ATOM   9321  H HD1  . HIS A 1 185 ? 43.112  36.198  -7.804  1.00 29.11 ? 185  HIS A HD1  3  
ATOM   9322  H HD2  . HIS A 1 185 ? 46.053  34.381  -5.492  1.00 27.89 ? 185  HIS A HD2  3  
ATOM   9323  H HE1  . HIS A 1 185 ? 43.400  33.890  -8.764  1.00 29.52 ? 185  HIS A HE1  3  
ATOM   9324  H HE2  . HIS A 1 185 ? 45.056  32.750  -7.244  1.00 28.82 ? 185  HIS A HE2  3  
HETATM 9325  C C    . ACE B 2 1   ? -15.473 -18.201 1.144   1.00 3.23  ? 1001 ACE B C    3  
HETATM 9326  O O    . ACE B 2 1   ? -14.513 -18.746 1.691   1.00 3.56  ? 1001 ACE B O    3  
HETATM 9327  C CH3  . ACE B 2 1   ? -16.463 -17.412 1.977   1.00 4.05  ? 1001 ACE B CH3  3  
HETATM 9328  H H1   . ACE B 2 1   ? -16.335 -17.674 3.018   1.00 4.41  ? 1001 ACE B H1   3  
HETATM 9329  H H2   . ACE B 2 1   ? -17.464 -17.655 1.657   1.00 4.42  ? 1001 ACE B H2   3  
HETATM 9330  H H3   . ACE B 2 1   ? -16.279 -16.357 1.839   1.00 4.33  ? 1001 ACE B H3   3  
ATOM   9331  N N    . GLY B 2 2   ? -15.667 -18.283 -0.166  1.00 2.68  ? 1002 GLY B N    3  
ATOM   9332  C CA   . GLY B 2 2   ? -14.770 -19.052 -1.005  1.00 2.37  ? 1002 GLY B CA   3  
ATOM   9333  C C    . GLY B 2 2   ? -13.431 -18.371 -1.203  1.00 2.24  ? 1002 GLY B C    3  
ATOM   9334  O O    . GLY B 2 2   ? -12.386 -19.021 -1.174  1.00 2.97  ? 1002 GLY B O    3  
ATOM   9335  H H    . GLY B 2 2   ? -16.434 -17.816 -0.570  1.00 2.99  ? 1002 GLY B H    3  
ATOM   9336  H HA2  . GLY B 2 2   ? -14.605 -20.016 -0.547  1.00 2.60  ? 1002 GLY B HA2  3  
ATOM   9337  H HA3  . GLY B 2 2   ? -15.234 -19.198 -1.969  1.00 2.58  ? 1002 GLY B HA3  3  
ATOM   9338  N N    . CYS B 2 3   ? -13.448 -17.061 -1.396  1.00 1.72  ? 1003 CYS B N    3  
ATOM   9339  C CA   . CYS B 2 3   ? -12.225 -16.325 -1.675  1.00 1.60  ? 1003 CYS B CA   3  
ATOM   9340  C C    . CYS B 2 3   ? -12.021 -15.228 -0.652  1.00 1.42  ? 1003 CYS B C    3  
ATOM   9341  O O    . CYS B 2 3   ? -12.435 -15.374 0.493   1.00 1.55  ? 1003 CYS B O    3  
ATOM   9342  C CB   . CYS B 2 3   ? -12.276 -15.708 -3.066  1.00 1.63  ? 1003 CYS B CB   3  
ATOM   9343  S SG   . CYS B 2 3   ? -12.969 -16.798 -4.350  1.00 1.94  ? 1003 CYS B SG   3  
ATOM   9344  H H    . CYS B 2 3   ? -14.302 -16.572 -1.325  1.00 1.84  ? 1003 CYS B H    3  
ATOM   9345  H HA   . CYS B 2 3   ? -11.396 -17.012 -1.624  1.00 1.76  ? 1003 CYS B HA   3  
ATOM   9346  H HB2  . CYS B 2 3   ? -12.874 -14.804 -3.026  1.00 1.60  ? 1003 CYS B HB2  3  
ATOM   9347  H HB3  . CYS B 2 3   ? -11.271 -15.449 -3.369  1.00 1.65  ? 1003 CYS B HB3  3  
ATOM   9348  N N    . VAL B 2 4   ? -11.356 -14.145 -1.089  1.00 1.37  ? 1004 VAL B N    3  
ATOM   9349  C CA   . VAL B 2 4   ? -11.128 -12.936 -0.291  1.00 1.19  ? 1004 VAL B CA   3  
ATOM   9350  C C    . VAL B 2 4   ? -10.736 -13.242 1.165   1.00 1.19  ? 1004 VAL B C    3  
ATOM   9351  O O    . VAL B 2 4   ? -9.546  -13.389 1.435   1.00 1.63  ? 1004 VAL B O    3  
ATOM   9352  C CB   . VAL B 2 4   ? -12.302 -11.950 -0.403  1.00 1.15  ? 1004 VAL B CB   3  
ATOM   9353  C CG1  . VAL B 2 4   ? -12.313 -11.294 -1.771  1.00 1.41  ? 1004 VAL B CG1  3  
ATOM   9354  C CG2  . VAL B 2 4   ? -13.603 -12.636 -0.181  1.00 1.42  ? 1004 VAL B CG2  3  
ATOM   9355  H H    . VAL B 2 4   ? -11.000 -14.160 -1.998  1.00 1.62  ? 1004 VAL B H    3  
ATOM   9356  H HA   . VAL B 2 4   ? -10.292 -12.453 -0.740  1.00 1.20  ? 1004 VAL B HA   3  
ATOM   9357  H HB   . VAL B 2 4   ? -12.183 -11.197 0.336   1.00 0.94  ? 1004 VAL B HB   3  
ATOM   9358  H HG11 . VAL B 2 4   ? -12.456 -12.052 -2.529  1.00 1.79  ? 1004 VAL B HG11 3  
ATOM   9359  H HG12 . VAL B 2 4   ? -11.373 -10.793 -1.941  1.00 1.93  ? 1004 VAL B HG12 3  
ATOM   9360  H HG13 . VAL B 2 4   ? -13.118 -10.578 -1.823  1.00 1.62  ? 1004 VAL B HG13 3  
ATOM   9361  H HG21 . VAL B 2 4   ? -13.625 -13.017 0.822   1.00 1.73  ? 1004 VAL B HG21 3  
ATOM   9362  H HG22 . VAL B 2 4   ? -13.676 -13.447 -0.884  1.00 1.78  ? 1004 VAL B HG22 3  
ATOM   9363  H HG23 . VAL B 2 4   ? -14.406 -11.942 -0.333  1.00 1.94  ? 1004 VAL B HG23 3  
ATOM   9364  N N    . GLY B 2 5   ? -11.710 -13.309 2.087   1.00 1.02  ? 1005 GLY B N    3  
ATOM   9365  C CA   . GLY B 2 5   ? -11.487 -13.911 3.405   1.00 1.07  ? 1005 GLY B CA   3  
ATOM   9366  C C    . GLY B 2 5   ? -10.467 -15.050 3.396   1.00 1.05  ? 1005 GLY B C    3  
ATOM   9367  O O    . GLY B 2 5   ? -9.629  -15.151 4.289   1.00 1.20  ? 1005 GLY B O    3  
ATOM   9368  H H    . GLY B 2 5   ? -12.578 -12.894 1.896   1.00 1.09  ? 1005 GLY B H    3  
ATOM   9369  H HA2  . GLY B 2 5   ? -11.163 -13.153 4.094   1.00 1.07  ? 1005 GLY B HA2  3  
ATOM   9370  H HA3  . GLY B 2 5   ? -12.429 -14.304 3.758   1.00 1.26  ? 1005 GLY B HA3  3  
ATOM   9371  N N    . ARG B 2 6   ? -10.551 -15.916 2.386   1.00 1.08  ? 1006 ARG B N    3  
ATOM   9372  C CA   . ARG B 2 6   ? -9.597  -17.009 2.223   1.00 1.08  ? 1006 ARG B CA   3  
ATOM   9373  C C    . ARG B 2 6   ? -8.448  -16.629 1.290   1.00 1.04  ? 1006 ARG B C    3  
ATOM   9374  O O    . ARG B 2 6   ? -7.297  -16.958 1.549   1.00 1.10  ? 1006 ARG B O    3  
ATOM   9375  C CB   . ARG B 2 6   ? -10.294 -18.249 1.656   1.00 1.14  ? 1006 ARG B CB   3  
ATOM   9376  C CG   . ARG B 2 6   ? -10.965 -19.122 2.700   1.00 1.24  ? 1006 ARG B CG   3  
ATOM   9377  C CD   . ARG B 2 6   ? -11.973 -18.345 3.523   1.00 1.55  ? 1006 ARG B CD   3  
ATOM   9378  N NE   . ARG B 2 6   ? -12.583 -19.164 4.568   1.00 1.88  ? 1006 ARG B NE   3  
ATOM   9379  C CZ   . ARG B 2 6   ? -13.640 -18.786 5.291   1.00 2.43  ? 1006 ARG B CZ   3  
ATOM   9380  N NH1  . ARG B 2 6   ? -14.230 -17.618 5.056   1.00 2.88  ? 1006 ARG B NH1  3  
ATOM   9381  N NH2  . ARG B 2 6   ? -14.109 -19.580 6.244   1.00 2.87  ? 1006 ARG B NH2  3  
ATOM   9382  H H    . ARG B 2 6   ? -11.287 -15.823 1.742   1.00 1.23  ? 1006 ARG B H    3  
ATOM   9383  H HA   . ARG B 2 6   ? -9.199  -17.250 3.195   1.00 1.16  ? 1006 ARG B HA   3  
ATOM   9384  H HB2  . ARG B 2 6   ? -11.048 -17.931 0.950   1.00 1.38  ? 1006 ARG B HB2  3  
ATOM   9385  H HB3  . ARG B 2 6   ? -9.562  -18.849 1.136   1.00 1.34  ? 1006 ARG B HB3  3  
ATOM   9386  H HG2  . ARG B 2 6   ? -11.474 -19.928 2.198   1.00 1.62  ? 1006 ARG B HG2  3  
ATOM   9387  H HG3  . ARG B 2 6   ? -10.209 -19.523 3.358   1.00 1.60  ? 1006 ARG B HG3  3  
ATOM   9388  H HD2  . ARG B 2 6   ? -11.465 -17.511 3.980   1.00 1.88  ? 1006 ARG B HD2  3  
ATOM   9389  H HD3  . ARG B 2 6   ? -12.745 -17.975 2.866   1.00 1.96  ? 1006 ARG B HD3  3  
ATOM   9390  H HE   . ARG B 2 6   ? -12.172 -20.041 4.751   1.00 2.02  ? 1006 ARG B HE   3  
ATOM   9391  H HH11 . ARG B 2 6   ? -13.884 -17.013 4.339   1.00 2.84  ? 1006 ARG B HH11 3  
ATOM   9392  H HH12 . ARG B 2 6   ? -15.036 -17.340 5.596   1.00 3.45  ? 1006 ARG B HH12 3  
ATOM   9393  H HH21 . ARG B 2 6   ? -13.673 -20.472 6.422   1.00 2.94  ? 1006 ARG B HH21 3  
ATOM   9394  H HH22 . ARG B 2 6   ? -14.897 -19.292 6.804   1.00 3.33  ? 1006 ARG B HH22 3  
ATOM   9395  N N    . ALA B 2 7   ? -8.769  -15.924 0.212   1.00 1.02  ? 1007 ALA B N    3  
ATOM   9396  C CA   . ALA B 2 7   ? -7.826  -15.731 -0.889  1.00 1.05  ? 1007 ALA B CA   3  
ATOM   9397  C C    . ALA B 2 7   ? -6.779  -14.666 -0.599  1.00 1.02  ? 1007 ALA B C    3  
ATOM   9398  O O    . ALA B 2 7   ? -5.593  -14.892 -0.806  1.00 1.31  ? 1007 ALA B O    3  
ATOM   9399  C CB   . ALA B 2 7   ? -8.569  -15.377 -2.164  1.00 1.10  ? 1007 ALA B CB   3  
ATOM   9400  H H    . ALA B 2 7   ? -9.651  -15.506 0.166   1.00 1.04  ? 1007 ALA B H    3  
ATOM   9401  H HA   . ALA B 2 7   ? -7.322  -16.672 -1.056  1.00 1.14  ? 1007 ALA B HA   3  
ATOM   9402  H HB1  . ALA B 2 7   ? -9.053  -14.418 -2.042  1.00 1.51  ? 1007 ALA B HB1  3  
ATOM   9403  H HB2  . ALA B 2 7   ? -9.313  -16.132 -2.370  1.00 1.54  ? 1007 ALA B HB2  3  
ATOM   9404  H HB3  . ALA B 2 7   ? -7.869  -15.325 -2.985  1.00 1.46  ? 1007 ALA B HB3  3  
ATOM   9405  N N    . LEU B 2 8   ? -7.214  -13.514 -0.122  1.00 0.84  ? 1008 LEU B N    3  
ATOM   9406  C CA   . LEU B 2 8   ? -6.327  -12.365 0.021   1.00 0.83  ? 1008 LEU B CA   3  
ATOM   9407  C C    . LEU B 2 8   ? -5.422  -12.577 1.220   1.00 0.78  ? 1008 LEU B C    3  
ATOM   9408  O O    . LEU B 2 8   ? -4.242  -12.230 1.196   1.00 0.79  ? 1008 LEU B O    3  
ATOM   9409  C CB   . LEU B 2 8   ? -7.163  -11.092 0.144   1.00 0.90  ? 1008 LEU B CB   3  
ATOM   9410  C CG   . LEU B 2 8   ? -8.399  -11.129 -0.745  1.00 0.88  ? 1008 LEU B CG   3  
ATOM   9411  C CD1  . LEU B 2 8   ? -9.306  -9.939  -0.560  1.00 1.13  ? 1008 LEU B CD1  3  
ATOM   9412  C CD2  . LEU B 2 8   ? -8.013  -11.264 -2.208  1.00 1.33  ? 1008 LEU B CD2  3  
ATOM   9413  H H    . LEU B 2 8   ? -8.148  -13.434 0.170   1.00 0.85  ? 1008 LEU B H    3  
ATOM   9414  H HA   . LEU B 2 8   ? -5.721  -12.300 -0.869  1.00 0.87  ? 1008 LEU B HA   3  
ATOM   9415  H HB2  . LEU B 2 8   ? -7.472  -10.977 1.174   1.00 0.95  ? 1008 LEU B HB2  3  
ATOM   9416  H HB3  . LEU B 2 8   ? -6.558  -10.246 -0.140  1.00 1.05  ? 1008 LEU B HB3  3  
ATOM   9417  H HG   . LEU B 2 8   ? -8.952  -11.989 -0.463  1.00 1.38  ? 1008 LEU B HG   3  
ATOM   9418  H HD11 . LEU B 2 8   ? -10.208 -10.090 -1.140  1.00 1.77  ? 1008 LEU B HD11 3  
ATOM   9419  H HD12 . LEU B 2 8   ? -8.806  -9.048  -0.898  1.00 1.55  ? 1008 LEU B HD12 3  
ATOM   9420  H HD13 . LEU B 2 8   ? -9.567  -9.846  0.480   1.00 1.60  ? 1008 LEU B HD13 3  
ATOM   9421  H HD21 . LEU B 2 8   ? -7.401  -12.145 -2.339  1.00 1.85  ? 1008 LEU B HD21 3  
ATOM   9422  H HD22 . LEU B 2 8   ? -7.457  -10.388 -2.513  1.00 1.90  ? 1008 LEU B HD22 3  
ATOM   9423  H HD23 . LEU B 2 8   ? -8.905  -11.351 -2.809  1.00 1.64  ? 1008 LEU B HD23 3  
ATOM   9424  N N    . ALA B 2 9   ? -5.995  -13.174 2.256   1.00 0.78  ? 1009 ALA B N    3  
ATOM   9425  C CA   . ALA B 2 9   ? -5.239  -13.662 3.389   1.00 0.78  ? 1009 ALA B CA   3  
ATOM   9426  C C    . ALA B 2 9   ? -4.113  -14.574 2.916   1.00 0.80  ? 1009 ALA B C    3  
ATOM   9427  O O    . ALA B 2 9   ? -2.952  -14.421 3.288   1.00 0.76  ? 1009 ALA B O    3  
ATOM   9428  C CB   . ALA B 2 9   ? -6.144  -14.437 4.327   1.00 0.88  ? 1009 ALA B CB   3  
ATOM   9429  H H    . ALA B 2 9   ? -6.960  -13.225 2.287   1.00 0.82  ? 1009 ALA B H    3  
ATOM   9430  H HA   . ALA B 2 9   ? -4.858  -12.794 3.930   1.00 0.73  ? 1009 ALA B HA   3  
ATOM   9431  H HB1  . ALA B 2 9   ? -6.566  -15.281 3.802   1.00 1.23  ? 1009 ALA B HB1  3  
ATOM   9432  H HB2  . ALA B 2 9   ? -6.938  -13.792 4.673   1.00 1.37  ? 1009 ALA B HB2  3  
ATOM   9433  H HB3  . ALA B 2 9   ? -5.569  -14.788 5.170   1.00 1.45  ? 1009 ALA B HB3  3  
ATOM   9434  N N    . ALA B 2 10  ? -4.497  -15.521 2.068   1.00 0.89  ? 1010 ALA B N    3  
ATOM   9435  C CA   . ALA B 2 10  ? -3.601  -16.546 1.559   1.00 0.94  ? 1010 ALA B CA   3  
ATOM   9436  C C    . ALA B 2 10  ? -2.541  -15.966 0.627   1.00 0.92  ? 1010 ALA B C    3  
ATOM   9437  O O    . ALA B 2 10  ? -1.348  -16.236 0.777   1.00 0.92  ? 1010 ALA B O    3  
ATOM   9438  C CB   . ALA B 2 10  ? -4.417  -17.597 0.827   1.00 1.03  ? 1010 ALA B CB   3  
ATOM   9439  H H    . ALA B 2 10  ? -5.432  -15.528 1.773   1.00 0.96  ? 1010 ALA B H    3  
ATOM   9440  H HA   . ALA B 2 10  ? -3.116  -17.021 2.399   1.00 0.94  ? 1010 ALA B HA   3  
ATOM   9441  H HB1  . ALA B 2 10  ? -3.752  -18.289 0.324   1.00 1.35  ? 1010 ALA B HB1  3  
ATOM   9442  H HB2  . ALA B 2 10  ? -5.051  -17.117 0.093   1.00 1.44  ? 1010 ALA B HB2  3  
ATOM   9443  H HB3  . ALA B 2 10  ? -5.033  -18.137 1.531   1.00 1.51  ? 1010 ALA B HB3  3  
ATOM   9444  N N    . PHE B 2 11  ? -2.983  -15.181 -0.341  1.00 0.93  ? 1011 PHE B N    3  
ATOM   9445  C CA   . PHE B 2 11  ? -2.084  -14.607 -1.333  1.00 0.93  ? 1011 PHE B CA   3  
ATOM   9446  C C    . PHE B 2 11  ? -1.237  -13.491 -0.738  1.00 0.85  ? 1011 PHE B C    3  
ATOM   9447  O O    . PHE B 2 11  ? -0.154  -13.194 -1.244  1.00 0.89  ? 1011 PHE B O    3  
ATOM   9448  C CB   . PHE B 2 11  ? -2.874  -14.082 -2.535  1.00 0.97  ? 1011 PHE B CB   3  
ATOM   9449  C CG   . PHE B 2 11  ? -3.256  -15.148 -3.525  1.00 1.12  ? 1011 PHE B CG   3  
ATOM   9450  C CD1  . PHE B 2 11  ? -2.320  -15.704 -4.389  1.00 1.50  ? 1011 PHE B CD1  3  
ATOM   9451  C CD2  . PHE B 2 11  ? -4.560  -15.606 -3.583  1.00 1.18  ? 1011 PHE B CD2  3  
ATOM   9452  C CE1  . PHE B 2 11  ? -2.678  -16.687 -5.281  1.00 1.67  ? 1011 PHE B CE1  3  
ATOM   9453  C CE2  . PHE B 2 11  ? -4.924  -16.593 -4.474  1.00 1.32  ? 1011 PHE B CE2  3  
ATOM   9454  C CZ   . PHE B 2 11  ? -3.941  -17.095 -5.383  1.00 1.46  ? 1011 PHE B CZ   3  
ATOM   9455  H H    . PHE B 2 11  ? -3.946  -14.980 -0.393  1.00 0.95  ? 1011 PHE B H    3  
ATOM   9456  H HA   . PHE B 2 11  ? -1.427  -15.395 -1.670  1.00 0.99  ? 1011 PHE B HA   3  
ATOM   9457  H HB2  . PHE B 2 11  ? -3.783  -13.616 -2.182  1.00 0.92  ? 1011 PHE B HB2  3  
ATOM   9458  H HB3  . PHE B 2 11  ? -2.277  -13.346 -3.052  1.00 1.00  ? 1011 PHE B HB3  3  
ATOM   9459  H HD1  . PHE B 2 11  ? -1.302  -15.358 -4.368  1.00 1.78  ? 1011 PHE B HD1  3  
ATOM   9460  H HD2  . PHE B 2 11  ? -5.299  -15.182 -2.918  1.00 1.34  ? 1011 PHE B HD2  3  
ATOM   9461  H HE1  . PHE B 2 11  ? -1.936  -17.108 -5.947  1.00 2.07  ? 1011 PHE B HE1  3  
ATOM   9462  H HE2  . PHE B 2 11  ? -5.949  -16.933 -4.510  1.00 1.50  ? 1011 PHE B HE2  3  
ATOM   9463  H HZ   . PHE B 2 11  ? -4.208  -17.850 -6.108  1.00 1.60  ? 1011 PHE B HZ   3  
ATOM   9464  N N    . GLY B 2 12  ? -1.722  -12.893 0.344   1.00 0.78  ? 1012 GLY B N    3  
ATOM   9465  C CA   . GLY B 2 12  ? -1.026  -11.778 0.957   1.00 0.72  ? 1012 GLY B CA   3  
ATOM   9466  C C    . GLY B 2 12  ? 0.202   -12.200 1.726   1.00 0.73  ? 1012 GLY B C    3  
ATOM   9467  O O    . GLY B 2 12  ? 0.998   -11.363 2.151   1.00 0.78  ? 1012 GLY B O    3  
ATOM   9468  H H    . GLY B 2 12  ? -2.570  -13.205 0.730   1.00 0.80  ? 1012 GLY B H    3  
ATOM   9469  H HA2  . GLY B 2 12  ? -0.724  -11.097 0.179   1.00 0.74  ? 1012 GLY B HA2  3  
ATOM   9470  H HA3  . GLY B 2 12  ? -1.703  -11.268 1.627   1.00 0.72  ? 1012 GLY B HA3  3  
ATOM   9471  N N    . ASP B 2 13  ? 0.352   -13.501 1.909   1.00 0.78  ? 1013 ASP B N    3  
ATOM   9472  C CA   . ASP B 2 13  ? 1.528   -14.048 2.566   1.00 0.86  ? 1013 ASP B CA   3  
ATOM   9473  C C    . ASP B 2 13  ? 2.743   -13.999 1.639   1.00 0.93  ? 1013 ASP B C    3  
ATOM   9474  O O    . ASP B 2 13  ? 3.889   -14.017 2.091   1.00 1.06  ? 1013 ASP B O    3  
ATOM   9475  C CB   . ASP B 2 13  ? 1.255   -15.489 3.001   1.00 0.98  ? 1013 ASP B CB   3  
ATOM   9476  C CG   . ASP B 2 13  ? 2.412   -16.095 3.764   1.00 1.18  ? 1013 ASP B CG   3  
ATOM   9477  O OD1  . ASP B 2 13  ? 2.567   -15.793 4.964   1.00 1.90  ? 1013 ASP B OD1  3  
ATOM   9478  O OD2  . ASP B 2 13  ? 3.187   -16.872 3.162   1.00 1.48  ? 1013 ASP B OD2  3  
ATOM   9479  H H    . ASP B 2 13  ? -0.359  -14.109 1.611   1.00 0.80  ? 1013 ASP B H    3  
ATOM   9480  H HA   . ASP B 2 13  ? 1.730   -13.447 3.440   1.00 0.88  ? 1013 ASP B HA   3  
ATOM   9481  H HB2  . ASP B 2 13  ? 0.382   -15.508 3.636   1.00 1.08  ? 1013 ASP B HB2  3  
ATOM   9482  H HB3  . ASP B 2 13  ? 1.070   -16.092 2.124   1.00 1.09  ? 1013 ASP B HB3  3  
ATOM   9483  N N    . CYS B 2 14  ? 2.491   -13.906 0.337   1.00 0.93  ? 1014 CYS B N    3  
ATOM   9484  C CA   . CYS B 2 14  ? 3.562   -13.958 -0.643  1.00 1.06  ? 1014 CYS B CA   3  
ATOM   9485  C C    . CYS B 2 14  ? 3.965   -12.556 -1.082  1.00 1.08  ? 1014 CYS B C    3  
ATOM   9486  O O    . CYS B 2 14  ? 3.370   -11.987 -1.998  1.00 1.44  ? 1014 CYS B O    3  
ATOM   9487  C CB   . CYS B 2 14  ? 3.128   -14.763 -1.863  1.00 1.12  ? 1014 CYS B CB   3  
ATOM   9488  S SG   . CYS B 2 14  ? 1.859   -16.025 -1.522  1.00 1.34  ? 1014 CYS B SG   3  
ATOM   9489  H H    . CYS B 2 14  ? 1.566   -13.782 0.030   1.00 0.89  ? 1014 CYS B H    3  
ATOM   9490  H HA   . CYS B 2 14  ? 4.412   -14.441 -0.184  1.00 1.22  ? 1014 CYS B HA   3  
ATOM   9491  H HB2  . CYS B 2 14  ? 2.721   -14.084 -2.603  1.00 1.12  ? 1014 CYS B HB2  3  
ATOM   9492  H HB3  . CYS B 2 14  ? 3.994   -15.269 -2.275  1.00 1.42  ? 1014 CYS B HB3  3  
ATOM   9493  N N    . ILE B 2 15  ? 4.965   -11.999 -0.419  1.00 1.14  ? 1015 ILE B N    3  
ATOM   9494  C CA   . ILE B 2 15  ? 5.464   -10.672 -0.756  1.00 1.23  ? 1015 ILE B CA   3  
ATOM   9495  C C    . ILE B 2 15  ? 6.898   -10.751 -1.261  1.00 1.67  ? 1015 ILE B C    3  
ATOM   9496  O O    . ILE B 2 15  ? 7.724   -9.876  -0.997  1.00 2.20  ? 1015 ILE B O    3  
ATOM   9497  C CB   . ILE B 2 15  ? 5.390   -9.719  0.452   1.00 1.32  ? 1015 ILE B CB   3  
ATOM   9498  C CG1  . ILE B 2 15  ? 6.026   -10.373 1.688   1.00 2.19  ? 1015 ILE B CG1  3  
ATOM   9499  C CG2  . ILE B 2 15  ? 3.943   -9.331  0.718   1.00 1.41  ? 1015 ILE B CG2  3  
ATOM   9500  C CD1  . ILE B 2 15  ? 6.083   -9.470  2.900   1.00 2.91  ? 1015 ILE B CD1  3  
ATOM   9501  H H    . ILE B 2 15  ? 5.378   -12.491 0.322   1.00 1.40  ? 1015 ILE B H    3  
ATOM   9502  H HA   . ILE B 2 15  ? 4.840   -10.271 -1.542  1.00 1.28  ? 1015 ILE B HA   3  
ATOM   9503  H HB   . ILE B 2 15  ? 5.937   -8.820  0.208   1.00 1.55  ? 1015 ILE B HB   3  
ATOM   9504  H HG12 . ILE B 2 15  ? 5.453   -11.249 1.956   1.00 2.59  ? 1015 ILE B HG12 3  
ATOM   9505  H HG13 . ILE B 2 15  ? 7.036   -10.671 1.447   1.00 2.56  ? 1015 ILE B HG13 3  
ATOM   9506  H HG21 . ILE B 2 15  ? 3.541   -8.826  -0.149  1.00 1.41  ? 1015 ILE B HG21 3  
ATOM   9507  H HG22 . ILE B 2 15  ? 3.899   -8.667  1.570   1.00 1.83  ? 1015 ILE B HG22 3  
ATOM   9508  H HG23 . ILE B 2 15  ? 3.362   -10.218 0.920   1.00 2.10  ? 1015 ILE B HG23 3  
ATOM   9509  H HD11 . ILE B 2 15  ? 6.672   -8.594  2.668   1.00 3.43  ? 1015 ILE B HD11 3  
ATOM   9510  H HD12 . ILE B 2 15  ? 6.536   -10.002 3.723   1.00 3.20  ? 1015 ILE B HD12 3  
ATOM   9511  H HD13 . ILE B 2 15  ? 5.082   -9.169  3.172   1.00 3.23  ? 1015 ILE B HD13 3  
ATOM   9512  N N    . ASN B 2 16  ? 7.173   -11.798 -2.017  1.00 2.03  ? 1016 ASN B N    3  
ATOM   9513  C CA   . ASN B 2 16  ? 8.512   -12.063 -2.523  1.00 2.59  ? 1016 ASN B CA   3  
ATOM   9514  C C    . ASN B 2 16  ? 8.433   -12.907 -3.789  1.00 2.83  ? 1016 ASN B C    3  
ATOM   9515  O O    . ASN B 2 16  ? 9.355   -13.664 -4.104  1.00 3.29  ? 1016 ASN B O    3  
ATOM   9516  C CB   . ASN B 2 16  ? 9.346   -12.776 -1.448  1.00 3.32  ? 1016 ASN B CB   3  
ATOM   9517  C CG   . ASN B 2 16  ? 8.646   -13.992 -0.862  1.00 3.73  ? 1016 ASN B CG   3  
ATOM   9518  O OD1  . ASN B 2 16  ? 7.908   -14.701 -1.548  1.00 4.03  ? 1016 ASN B OD1  3  
ATOM   9519  N ND2  . ASN B 2 16  ? 8.855   -14.235 0.423   1.00 4.29  ? 1016 ASN B ND2  3  
ATOM   9520  H H    . ASN B 2 16  ? 6.450   -12.418 -2.247  1.00 2.26  ? 1016 ASN B H    3  
ATOM   9521  H HA   . ASN B 2 16  ? 8.974   -11.117 -2.761  1.00 2.85  ? 1016 ASN B HA   3  
ATOM   9522  H HB2  . ASN B 2 16  ? 10.280  -13.098 -1.883  1.00 3.88  ? 1016 ASN B HB2  3  
ATOM   9523  H HB3  . ASN B 2 16  ? 9.551   -12.082 -0.645  1.00 3.60  ? 1016 ASN B HB3  3  
ATOM   9524  H HD21 . ASN B 2 16  ? 9.448   -13.624 0.923   1.00 4.45  ? 1016 ASN B HD21 3  
ATOM   9525  H HD22 . ASN B 2 16  ? 8.402   -15.010 0.832   1.00 4.79  ? 1016 ASN B HD22 3  
ATOM   9526  N N    . ARG B 2 17  ? 7.334   -12.732 -4.525  1.00 3.18  ? 1017 ARG B N    3  
ATOM   9527  C CA   . ARG B 2 17  ? 7.035   -13.539 -5.707  1.00 3.90  ? 1017 ARG B CA   3  
ATOM   9528  C C    . ARG B 2 17  ? 6.893   -15.009 -5.332  1.00 4.54  ? 1017 ARG B C    3  
ATOM   9529  O O    . ARG B 2 17  ? 7.817   -15.804 -5.510  1.00 5.06  ? 1017 ARG B O    3  
ATOM   9530  C CB   . ARG B 2 17  ? 8.109   -13.361 -6.790  1.00 4.55  ? 1017 ARG B CB   3  
ATOM   9531  C CG   . ARG B 2 17  ? 8.101   -11.987 -7.441  1.00 5.10  ? 1017 ARG B CG   3  
ATOM   9532  C CD   . ARG B 2 17  ? 6.800   -11.735 -8.184  1.00 5.97  ? 1017 ARG B CD   3  
ATOM   9533  N NE   . ARG B 2 17  ? 6.796   -10.446 -8.872  1.00 6.51  ? 1017 ARG B NE   3  
ATOM   9534  C CZ   . ARG B 2 17  ? 6.243   -10.241 -10.066 1.00 7.49  ? 1017 ARG B CZ   3  
ATOM   9535  N NH1  . ARG B 2 17  ? 5.636   -11.228 -10.708 1.00 8.03  ? 1017 ARG B NH1  3  
ATOM   9536  N NH2  . ARG B 2 17  ? 6.282   -9.038  -10.614 1.00 8.17  ? 1017 ARG B NH2  3  
ATOM   9537  H H    . ARG B 2 17  ? 6.702   -12.019 -4.270  1.00 3.33  ? 1017 ARG B H    3  
ATOM   9538  H HA   . ARG B 2 17  ? 6.088   -13.196 -6.100  1.00 4.04  ? 1017 ARG B HA   3  
ATOM   9539  H HB2  . ARG B 2 17  ? 9.081   -13.519 -6.346  1.00 4.75  ? 1017 ARG B HB2  3  
ATOM   9540  H HB3  . ARG B 2 17  ? 7.950   -14.101 -7.560  1.00 4.95  ? 1017 ARG B HB3  3  
ATOM   9541  H HG2  . ARG B 2 17  ? 8.218   -11.234 -6.675  1.00 5.26  ? 1017 ARG B HG2  3  
ATOM   9542  H HG3  . ARG B 2 17  ? 8.923   -11.925 -8.139  1.00 5.16  ? 1017 ARG B HG3  3  
ATOM   9543  H HD2  . ARG B 2 17  ? 6.660   -12.519 -8.914  1.00 6.32  ? 1017 ARG B HD2  3  
ATOM   9544  H HD3  . ARG B 2 17  ? 5.986   -11.757 -7.474  1.00 6.23  ? 1017 ARG B HD3  3  
ATOM   9545  H HE   . ARG B 2 17  ? 7.232   -9.686  -8.414  1.00 6.33  ? 1017 ARG B HE   3  
ATOM   9546  H HH11 . ARG B 2 17  ? 5.584   -12.146 -10.299 1.00 7.76  ? 1017 ARG B HH11 3  
ATOM   9547  H HH12 . ARG B 2 17  ? 5.223   -11.061 -11.614 1.00 8.86  ? 1017 ARG B HH12 3  
ATOM   9548  H HH21 . ARG B 2 17  ? 6.728   -8.273  -10.131 1.00 8.01  ? 1017 ARG B HH21 3  
ATOM   9549  H HH22 . ARG B 2 17  ? 5.866   -8.881  -11.515 1.00 8.98  ? 1017 ARG B HH22 3  
HETATM 9550  N N    . NH2 B 2 18  ? 5.733   -15.371 -4.806  1.00 4.96  ? 1018 NH2 B N    3  
HETATM 9551  H HN1  . NH2 B 2 18  ? 5.046   -14.684 -4.692  1.00 4.86  ? 1018 NH2 B HN1  3  
HETATM 9552  H HN2  . NH2 B 2 18  ? 5.611   -16.311 -4.550  1.00 5.57  ? 1018 NH2 B HN2  3  
HETATM 9553  C C1   . 33B C 3 .   ? -12.093 -18.348 -4.003  1.00 1.93  ? 1100 33B B C1   3  
HETATM 9554  C C2   . 33B C 3 .   ? -10.628 -18.110 -3.622  1.00 1.78  ? 1100 33B B C2   3  
HETATM 9555  O O2   . 33B C 3 .   ? -10.030 -17.102 -3.995  1.00 2.16  ? 1100 33B B O2   3  
HETATM 9556  N N3   . 33B C 3 .   ? -10.084 -19.055 -2.855  1.00 1.51  ? 1100 33B B N3   3  
HETATM 9557  C C4   . 33B C 3 .   ? -8.757  -19.097 -2.698  1.00 1.44  ? 1100 33B B C4   3  
HETATM 9558  C C5   . 33B C 3 .   ? -8.216  -19.344 -1.428  1.00 1.42  ? 1100 33B B C5   3  
HETATM 9559  C C6   . 33B C 3 .   ? -7.893  -18.869 -3.781  1.00 1.47  ? 1100 33B B C6   3  
HETATM 9560  S S6   . 33B C 3 .   ? -8.487  -18.663 -5.420  1.00 1.71  ? 1100 33B B S6   3  
HETATM 9561  C C7   . 33B C 3 .   ? -6.834  -19.368 -1.250  1.00 1.43  ? 1100 33B B C7   3  
HETATM 9562  C C8   . 33B C 3 .   ? -6.525  -18.885 -3.581  1.00 1.42  ? 1100 33B B C8   3  
HETATM 9563  C C9   . 33B C 3 .   ? -5.996  -19.141 -2.333  1.00 1.39  ? 1100 33B B C9   3  
HETATM 9564  N N10  . 33B C 3 .   ? -4.678  -19.164 -2.203  1.00 1.40  ? 1100 33B B N10  3  
HETATM 9565  N N11  . 33B C 3 .   ? -4.122  -19.408 -1.137  1.00 1.51  ? 1100 33B B N11  3  
HETATM 9566  C C12  . 33B C 3 .   ? -2.797  -19.377 -1.125  1.00 1.54  ? 1100 33B B C12  3  
HETATM 9567  C C13  . 33B C 3 .   ? -2.076  -19.558 0.052   1.00 1.75  ? 1100 33B B C13  3  
HETATM 9568  C C14  . 33B C 3 .   ? -2.143  -19.077 -2.301  1.00 1.42  ? 1100 33B B C14  3  
HETATM 9569  C C15  . 33B C 3 .   ? -0.691  -19.415 0.039   1.00 1.78  ? 1100 33B B C15  3  
HETATM 9570  C C16  . 33B C 3 .   ? -0.769  -18.936 -2.318  1.00 1.45  ? 1100 33B B C16  3  
HETATM 9571  C C17  . 33B C 3 .   ? -0.041  -19.097 -1.153  1.00 1.60  ? 1100 33B B C17  3  
HETATM 9572  S S17  . 33B C 3 .   ? 0.044   -18.533 -3.810  1.00 1.38  ? 1100 33B B S17  3  
HETATM 9573  N N18  . 33B C 3 .   ? 1.267   -18.869 -1.177  1.00 1.62  ? 1100 33B B N18  3  
HETATM 9574  C C19  . 33B C 3 .   ? 1.838   -18.348 -0.092  1.00 1.65  ? 1100 33B B C19  3  
HETATM 9575  O O19  . 33B C 3 .   ? 1.686   -18.779 1.053   1.00 1.92  ? 1100 33B B O19  3  
HETATM 9576  C C20  . 33B C 3 .   ? 2.715   -17.132 -0.377  1.00 1.43  ? 1100 33B B C20  3  
HETATM 9577  O O61  . 33B C 3 .   ? -8.491  -17.204 -5.775  1.00 2.13  ? 1100 33B B O61  3  
HETATM 9578  O O62  . 33B C 3 .   ? -9.880  -19.209 -5.562  1.00 2.30  ? 1100 33B B O62  3  
HETATM 9579  O O63  . 33B C 3 .   ? -7.580  -19.388 -6.378  1.00 2.30  ? 1100 33B B O63  3  
HETATM 9580  O O71  . 33B C 3 .   ? -0.886  -18.723 -4.970  1.00 1.73  ? 1100 33B B O71  3  
HETATM 9581  O O72  . 33B C 3 .   ? 0.500   -17.102 -3.762  1.00 2.03  ? 1100 33B B O72  3  
HETATM 9582  O O73  . 33B C 3 .   ? 1.244   -19.411 -4.000  1.00 2.14  ? 1100 33B B O73  3  
HETATM 9583  H HN3  . 33B C 3 .   ? -10.633 -19.738 -2.413  1.00 1.56  ? 1100 33B B HN3  3  
HETATM 9584  H H5   . 33B C 3 .   ? -8.867  -19.509 -0.581  1.00 1.48  ? 1100 33B B H5   3  
HETATM 9585  H H7   . 33B C 3 .   ? -6.417  -19.568 -0.275  1.00 1.52  ? 1100 33B B H7   3  
HETATM 9586  H H8   . 33B C 3 .   ? -5.859  -18.691 -4.411  1.00 1.47  ? 1100 33B B H8   3  
HETATM 9587  H H1   . 33B C 3 .   ? -12.589 -18.857 -3.190  1.00 1.83  ? 1100 33B B H1   3  
HETATM 9588  H H13  . 33B C 3 .   ? -2.589  -19.804 0.971   1.00 1.91  ? 1100 33B B H13  3  
HETATM 9589  H H14  . 33B C 3 .   ? -2.712  -18.934 -3.202  1.00 1.37  ? 1100 33B B H14  3  
HETATM 9590  H H15  . 33B C 3 .   ? -0.123  -19.539 0.950   1.00 1.97  ? 1100 33B B H15  3  
HETATM 9591  H HN18 . 33B C 3 .   ? 1.771   -18.959 -2.014  1.00 1.61  ? 1100 33B B HN18 3  
HETATM 9592  H H20  . 33B C 3 .   ? 3.647   -17.454 -0.819  1.00 1.84  ? 1100 33B B H20  3  
HETATM 9593  H H1A  . 33B C 3 .   ? -12.127 -18.974 -4.883  1.00 2.26  ? 1100 33B B H1A  3  
HETATM 9594  H H20A . 33B C 3 .   ? 2.917   -16.609 0.546   1.00 1.72  ? 1100 33B B H20A 3  
ATOM   9595  N N    . MET A 1 1   ? -0.708  6.874   16.924  1.00 4.13  ? 1    MET A N    4  
ATOM   9596  C CA   . MET A 1 1   ? -1.557  7.066   15.729  1.00 3.61  ? 1    MET A CA   4  
ATOM   9597  C C    . MET A 1 1   ? -1.017  8.209   14.873  1.00 2.48  ? 1    MET A C    4  
ATOM   9598  O O    . MET A 1 1   ? -1.191  9.390   15.185  1.00 2.89  ? 1    MET A O    4  
ATOM   9599  C CB   . MET A 1 1   ? -3.018  7.318   16.129  1.00 4.18  ? 1    MET A CB   4  
ATOM   9600  C CG   . MET A 1 1   ? -3.215  8.472   17.097  1.00 4.89  ? 1    MET A CG   4  
ATOM   9601  S SD   . MET A 1 1   ? -4.954  8.814   17.423  1.00 5.86  ? 1    MET A SD   4  
ATOM   9602  C CE   . MET A 1 1   ? -4.804  10.173  18.579  1.00 6.21  ? 1    MET A CE   4  
ATOM   9603  H H1   . MET A 1 1   ? 0.260   6.624   16.632  1.00 4.36  ? 1    MET A H1   4  
ATOM   9604  H H2   . MET A 1 1   ? -1.086  6.110   17.521  1.00 4.50  ? 1    MET A H2   4  
ATOM   9605  H H3   . MET A 1 1   ? -0.669  7.753   17.486  1.00 4.37  ? 1    MET A H3   4  
ATOM   9606  H HA   . MET A 1 1   ? -1.509  6.159   15.144  1.00 4.14  ? 1    MET A HA   4  
ATOM   9607  H HB2  . MET A 1 1   ? -3.588  7.531   15.237  1.00 4.47  ? 1    MET A HB2  4  
ATOM   9608  H HB3  . MET A 1 1   ? -3.410  6.423   16.587  1.00 4.35  ? 1    MET A HB3  4  
ATOM   9609  H HG2  . MET A 1 1   ? -2.729  8.227   18.031  1.00 5.14  ? 1    MET A HG2  4  
ATOM   9610  H HG3  . MET A 1 1   ? -2.760  9.357   16.679  1.00 5.02  ? 1    MET A HG3  4  
ATOM   9611  H HE1  . MET A 1 1   ? -4.281  10.991  18.106  1.00 6.39  ? 1    MET A HE1  4  
ATOM   9612  H HE2  . MET A 1 1   ? -4.253  9.847   19.449  1.00 6.45  ? 1    MET A HE2  4  
ATOM   9613  H HE3  . MET A 1 1   ? -5.789  10.500  18.878  1.00 6.36  ? 1    MET A HE3  4  
ATOM   9614  N N    . SER A 1 2   ? -0.339  7.844   13.800  1.00 1.64  ? 2    SER A N    4  
ATOM   9615  C CA   . SER A 1 2   ? 0.288   8.806   12.919  1.00 0.95  ? 2    SER A CA   4  
ATOM   9616  C C    . SER A 1 2   ? -0.691  9.287   11.855  1.00 0.84  ? 2    SER A C    4  
ATOM   9617  O O    . SER A 1 2   ? -1.274  8.484   11.122  1.00 1.03  ? 2    SER A O    4  
ATOM   9618  C CB   . SER A 1 2   ? 1.508   8.167   12.253  1.00 1.55  ? 2    SER A CB   4  
ATOM   9619  O OG   . SER A 1 2   ? 2.248   7.397   13.190  1.00 1.87  ? 2    SER A OG   4  
ATOM   9620  H H    . SER A 1 2   ? -0.248  6.881   13.597  1.00 2.17  ? 2    SER A H    4  
ATOM   9621  H HA   . SER A 1 2   ? 0.609   9.649   13.513  1.00 1.52  ? 2    SER A HA   4  
ATOM   9622  H HB2  . SER A 1 2   ? 1.182   7.522   11.450  1.00 2.02  ? 2    SER A HB2  4  
ATOM   9623  H HB3  . SER A 1 2   ? 2.148   8.942   11.857  1.00 2.26  ? 2    SER A HB3  4  
ATOM   9624  H HG   . SER A 1 2   ? 1.768   6.569   13.367  1.00 2.17  ? 2    SER A HG   4  
ATOM   9625  N N    . GLN A 1 3   ? -0.866  10.599  11.765  1.00 0.73  ? 3    GLN A N    4  
ATOM   9626  C CA   . GLN A 1 3   ? -1.724  11.182  10.742  1.00 0.73  ? 3    GLN A CA   4  
ATOM   9627  C C    . GLN A 1 3   ? -1.157  10.899  9.360   1.00 0.61  ? 3    GLN A C    4  
ATOM   9628  O O    . GLN A 1 3   ? -1.890  10.830  8.375   1.00 0.64  ? 3    GLN A O    4  
ATOM   9629  C CB   . GLN A 1 3   ? -1.868  12.688  10.954  1.00 0.83  ? 3    GLN A CB   4  
ATOM   9630  C CG   . GLN A 1 3   ? -2.775  13.050  12.117  1.00 1.13  ? 3    GLN A CG   4  
ATOM   9631  C CD   . GLN A 1 3   ? -4.232  12.726  11.847  1.00 1.76  ? 3    GLN A CD   4  
ATOM   9632  O OE1  . GLN A 1 3   ? -4.679  12.726  10.700  1.00 2.42  ? 3    GLN A OE1  4  
ATOM   9633  N NE2  . GLN A 1 3   ? -4.989  12.467  12.902  1.00 2.22  ? 3    GLN A NE2  4  
ATOM   9634  H H    . GLN A 1 3   ? -0.399  11.192  12.399  1.00 0.80  ? 3    GLN A H    4  
ATOM   9635  H HA   . GLN A 1 3   ? -2.694  10.722  10.828  1.00 0.87  ? 3    GLN A HA   4  
ATOM   9636  H HB2  . GLN A 1 3   ? -0.892  13.110  11.140  1.00 1.10  ? 3    GLN A HB2  4  
ATOM   9637  H HB3  . GLN A 1 3   ? -2.277  13.128  10.056  1.00 1.10  ? 3    GLN A HB3  4  
ATOM   9638  H HG2  . GLN A 1 3   ? -2.457  12.487  12.982  1.00 1.52  ? 3    GLN A HG2  4  
ATOM   9639  H HG3  . GLN A 1 3   ? -2.683  14.107  12.318  1.00 1.61  ? 3    GLN A HG3  4  
ATOM   9640  H HE21 . GLN A 1 3   ? -4.574  12.497  13.793  1.00 2.34  ? 3    GLN A HE21 4  
ATOM   9641  H HE22 . GLN A 1 3   ? -5.937  12.257  12.753  1.00 2.76  ? 3    GLN A HE22 4  
ATOM   9642  N N    . SER A 1 4   ? 0.153   10.694  9.312   1.00 0.55  ? 4    SER A N    4  
ATOM   9643  C CA   . SER A 1 4   ? 0.870   10.462  8.067   1.00 0.52  ? 4    SER A CA   4  
ATOM   9644  C C    . SER A 1 4   ? 0.455   9.155   7.388   1.00 0.45  ? 4    SER A C    4  
ATOM   9645  O O    . SER A 1 4   ? 0.687   8.975   6.191   1.00 0.46  ? 4    SER A O    4  
ATOM   9646  C CB   . SER A 1 4   ? 2.375   10.471  8.340   1.00 0.61  ? 4    SER A CB   4  
ATOM   9647  O OG   . SER A 1 4   ? 2.649   10.085  9.680   1.00 1.25  ? 4    SER A OG   4  
ATOM   9648  H H    . SER A 1 4   ? 0.660   10.694  10.150  1.00 0.59  ? 4    SER A H    4  
ATOM   9649  H HA   . SER A 1 4   ? 0.639   11.281  7.402   1.00 0.57  ? 4    SER A HA   4  
ATOM   9650  H HB2  . SER A 1 4   ? 2.865   9.778   7.671   1.00 1.02  ? 4    SER A HB2  4  
ATOM   9651  H HB3  . SER A 1 4   ? 2.764   11.465  8.176   1.00 1.08  ? 4    SER A HB3  4  
ATOM   9652  H HG   . SER A 1 4   ? 3.501   9.611   9.713   1.00 1.54  ? 4    SER A HG   4  
ATOM   9653  N N    . ASN A 1 5   ? -0.183  8.249   8.132   1.00 0.43  ? 5    ASN A N    4  
ATOM   9654  C CA   . ASN A 1 5   ? -0.634  6.989   7.543   1.00 0.39  ? 5    ASN A CA   4  
ATOM   9655  C C    . ASN A 1 5   ? -1.754  7.252   6.544   1.00 0.35  ? 5    ASN A C    4  
ATOM   9656  O O    . ASN A 1 5   ? -2.098  6.386   5.738   1.00 0.35  ? 5    ASN A O    4  
ATOM   9657  C CB   . ASN A 1 5   ? -1.134  5.988   8.588   1.00 0.40  ? 5    ASN A CB   4  
ATOM   9658  C CG   . ASN A 1 5   ? -0.190  5.780   9.753   1.00 0.80  ? 5    ASN A CG   4  
ATOM   9659  O OD1  . ASN A 1 5   ? 1.013   5.980   9.638   1.00 1.78  ? 5    ASN A OD1  4  
ATOM   9660  N ND2  . ASN A 1 5   ? -0.741  5.356   10.882  1.00 0.53  ? 5    ASN A ND2  4  
ATOM   9661  H H    . ASN A 1 5   ? -0.340  8.427   9.084   1.00 0.46  ? 5    ASN A H    4  
ATOM   9662  H HA   . ASN A 1 5   ? 0.203   6.556   7.014   1.00 0.42  ? 5    ASN A HA   4  
ATOM   9663  H HB2  . ASN A 1 5   ? -2.076  6.316   8.970   1.00 0.91  ? 5    ASN A HB2  4  
ATOM   9664  H HB3  . ASN A 1 5   ? -1.274  5.038   8.105   1.00 0.85  ? 5    ASN A HB3  4  
ATOM   9665  H HD21 . ASN A 1 5   ? -1.709  5.217   10.899  1.00 0.61  ? 5    ASN A HD21 4  
ATOM   9666  H HD22 . ASN A 1 5   ? -0.154  5.165   11.644  1.00 1.03  ? 5    ASN A HD22 4  
ATOM   9667  N N    . ARG A 1 6   ? -2.331  8.448   6.619   1.00 0.35  ? 6    ARG A N    4  
ATOM   9668  C CA   . ARG A 1 6   ? -3.333  8.880   5.656   1.00 0.34  ? 6    ARG A CA   4  
ATOM   9669  C C    . ARG A 1 6   ? -2.761  8.808   4.255   1.00 0.31  ? 6    ARG A C    4  
ATOM   9670  O O    . ARG A 1 6   ? -3.368  8.240   3.353   1.00 0.30  ? 6    ARG A O    4  
ATOM   9671  C CB   . ARG A 1 6   ? -3.781  10.314  5.950   1.00 0.41  ? 6    ARG A CB   4  
ATOM   9672  C CG   . ARG A 1 6   ? -4.758  10.849  4.919   1.00 0.59  ? 6    ARG A CG   4  
ATOM   9673  C CD   . ARG A 1 6   ? -6.041  10.045  4.926   1.00 0.41  ? 6    ARG A CD   4  
ATOM   9674  N NE   . ARG A 1 6   ? -6.971  10.544  5.937   1.00 0.68  ? 6    ARG A NE   4  
ATOM   9675  C CZ   . ARG A 1 6   ? -7.838  9.801   6.620   1.00 0.69  ? 6    ARG A CZ   4  
ATOM   9676  N NH1  . ARG A 1 6   ? -7.971  8.505   6.369   1.00 1.40  ? 6    ARG A NH1  4  
ATOM   9677  N NH2  . ARG A 1 6   ? -8.594  10.368  7.546   1.00 0.93  ? 6    ARG A NH2  4  
ATOM   9678  H H    . ARG A 1 6   ? -2.063  9.064   7.337   1.00 0.37  ? 6    ARG A H    4  
ATOM   9679  H HA   . ARG A 1 6   ? -4.184  8.219   5.724   1.00 0.35  ? 6    ARG A HA   4  
ATOM   9680  H HB2  . ARG A 1 6   ? -4.258  10.342  6.919   1.00 0.72  ? 6    ARG A HB2  4  
ATOM   9681  H HB3  . ARG A 1 6   ? -2.914  10.958  5.963   1.00 0.62  ? 6    ARG A HB3  4  
ATOM   9682  H HG2  . ARG A 1 6   ? -4.986  11.879  5.150   1.00 1.01  ? 6    ARG A HG2  4  
ATOM   9683  H HG3  . ARG A 1 6   ? -4.306  10.785  3.941   1.00 1.02  ? 6    ARG A HG3  4  
ATOM   9684  H HD2  . ARG A 1 6   ? -6.498  10.109  3.951   1.00 0.55  ? 6    ARG A HD2  4  
ATOM   9685  H HD3  . ARG A 1 6   ? -5.792  9.012   5.143   1.00 0.42  ? 6    ARG A HD3  4  
ATOM   9686  H HE   . ARG A 1 6   ? -6.941  11.523  6.127   1.00 1.36  ? 6    ARG A HE   4  
ATOM   9687  H HH11 . ARG A 1 6   ? -7.424  8.069   5.654   1.00 1.68  ? 6    ARG A HH11 4  
ATOM   9688  H HH12 . ARG A 1 6   ? -8.623  7.956   6.900   1.00 1.90  ? 6    ARG A HH12 4  
ATOM   9689  H HH21 . ARG A 1 6   ? -8.517  11.362  7.729   1.00 1.42  ? 6    ARG A HH21 4  
ATOM   9690  H HH22 . ARG A 1 6   ? -9.245  9.813   8.079   1.00 1.07  ? 6    ARG A HH22 4  
ATOM   9691  N N    . GLU A 1 7   ? -1.575  9.371   4.112   1.00 0.30  ? 7    GLU A N    4  
ATOM   9692  C CA   . GLU A 1 7   ? -0.874  9.437   2.837   1.00 0.29  ? 7    GLU A CA   4  
ATOM   9693  C C    . GLU A 1 7   ? -0.749  8.059   2.209   1.00 0.25  ? 7    GLU A C    4  
ATOM   9694  O O    . GLU A 1 7   ? -1.072  7.862   1.042   1.00 0.26  ? 7    GLU A O    4  
ATOM   9695  C CB   . GLU A 1 7   ? 0.527   9.984   3.054   1.00 0.31  ? 7    GLU A CB   4  
ATOM   9696  C CG   . GLU A 1 7   ? 0.576   11.307  3.781   1.00 0.40  ? 7    GLU A CG   4  
ATOM   9697  C CD   . GLU A 1 7   ? 1.997   11.697  4.118   1.00 0.51  ? 7    GLU A CD   4  
ATOM   9698  O OE1  . GLU A 1 7   ? 2.781   11.986  3.194   1.00 0.68  ? 7    GLU A OE1  4  
ATOM   9699  O OE2  . GLU A 1 7   ? 2.318   11.773  5.319   1.00 0.53  ? 7    GLU A OE2  4  
ATOM   9700  H H    . GLU A 1 7   ? -1.151  9.760   4.902   1.00 0.33  ? 7    GLU A H    4  
ATOM   9701  H HA   . GLU A 1 7   ? -1.423  10.095  2.181   1.00 0.32  ? 7    GLU A HA   4  
ATOM   9702  H HB2  . GLU A 1 7   ? 1.094   9.265   3.627   1.00 0.33  ? 7    GLU A HB2  4  
ATOM   9703  H HB3  . GLU A 1 7   ? 1.002   10.112  2.091   1.00 0.33  ? 7    GLU A HB3  4  
ATOM   9704  H HG2  . GLU A 1 7   ? 0.142   12.065  3.148   1.00 0.46  ? 7    GLU A HG2  4  
ATOM   9705  H HG3  . GLU A 1 7   ? 0.006   11.225  4.694   1.00 0.40  ? 7    GLU A HG3  4  
ATOM   9706  N N    . LEU A 1 8   ? -0.239  7.127   3.005   1.00 0.26  ? 8    LEU A N    4  
ATOM   9707  C CA   . LEU A 1 8   ? -0.051  5.741   2.613   1.00 0.27  ? 8    LEU A CA   4  
ATOM   9708  C C    . LEU A 1 8   ? -1.313  5.163   1.979   1.00 0.28  ? 8    LEU A C    4  
ATOM   9709  O O    . LEU A 1 8   ? -1.244  4.351   1.058   1.00 0.40  ? 8    LEU A O    4  
ATOM   9710  C CB   . LEU A 1 8   ? 0.344   4.947   3.860   1.00 0.34  ? 8    LEU A CB   4  
ATOM   9711  C CG   . LEU A 1 8   ? 1.792   5.143   4.350   1.00 0.41  ? 8    LEU A CG   4  
ATOM   9712  C CD1  . LEU A 1 8   ? 2.296   6.566   4.161   1.00 1.00  ? 8    LEU A CD1  4  
ATOM   9713  C CD2  . LEU A 1 8   ? 1.922   4.749   5.814   1.00 1.16  ? 8    LEU A CD2  4  
ATOM   9714  H H    . LEU A 1 8   ? 0.058   7.384   3.902   1.00 0.31  ? 8    LEU A H    4  
ATOM   9715  H HA   . LEU A 1 8   ? 0.755   5.700   1.897   1.00 0.30  ? 8    LEU A HA   4  
ATOM   9716  H HB2  . LEU A 1 8   ? -0.323  5.227   4.662   1.00 0.48  ? 8    LEU A HB2  4  
ATOM   9717  H HB3  . LEU A 1 8   ? 0.203   3.898   3.649   1.00 0.55  ? 8    LEU A HB3  4  
ATOM   9718  H HG   . LEU A 1 8   ? 2.428   4.506   3.779   1.00 1.15  ? 8    LEU A HG   4  
ATOM   9719  H HD11 . LEU A 1 8   ? 1.654   7.254   4.689   1.00 1.57  ? 8    LEU A HD11 4  
ATOM   9720  H HD12 . LEU A 1 8   ? 2.299   6.813   3.105   1.00 1.63  ? 8    LEU A HD12 4  
ATOM   9721  H HD13 . LEU A 1 8   ? 3.309   6.645   4.549   1.00 1.61  ? 8    LEU A HD13 4  
ATOM   9722  H HD21 . LEU A 1 8   ? 1.211   5.315   6.409   1.00 1.72  ? 8    LEU A HD21 4  
ATOM   9723  H HD22 . LEU A 1 8   ? 2.931   4.963   6.153   1.00 1.80  ? 8    LEU A HD22 4  
ATOM   9724  H HD23 . LEU A 1 8   ? 1.722   3.693   5.923   1.00 1.65  ? 8    LEU A HD23 4  
ATOM   9725  N N    . VAL A 1 9   ? -2.458  5.595   2.478   1.00 0.23  ? 9    VAL A N    4  
ATOM   9726  C CA   . VAL A 1 9   ? -3.735  5.203   1.918   1.00 0.23  ? 9    VAL A CA   4  
ATOM   9727  C C    . VAL A 1 9   ? -4.053  6.040   0.685   1.00 0.23  ? 9    VAL A C    4  
ATOM   9728  O O    . VAL A 1 9   ? -4.226  5.518   -0.415  1.00 0.24  ? 9    VAL A O    4  
ATOM   9729  C CB   . VAL A 1 9   ? -4.841  5.393   2.969   1.00 0.25  ? 9    VAL A CB   4  
ATOM   9730  C CG1  . VAL A 1 9   ? -6.215  5.154   2.377   1.00 0.26  ? 9    VAL A CG1  4  
ATOM   9731  C CG2  . VAL A 1 9   ? -4.599  4.476   4.150   1.00 0.27  ? 9    VAL A CG2  4  
ATOM   9732  H H    . VAL A 1 9   ? -2.447  6.216   3.242   1.00 0.26  ? 9    VAL A H    4  
ATOM   9733  H HA   . VAL A 1 9   ? -3.688  4.158   1.646   1.00 0.25  ? 9    VAL A HA   4  
ATOM   9734  H HB   . VAL A 1 9   ? -4.799  6.413   3.322   1.00 0.26  ? 9    VAL A HB   4  
ATOM   9735  H HG11 . VAL A 1 9   ? -6.416  5.906   1.623   1.00 1.05  ? 9    VAL A HG11 4  
ATOM   9736  H HG12 . VAL A 1 9   ? -6.957  5.220   3.159   1.00 1.03  ? 9    VAL A HG12 4  
ATOM   9737  H HG13 . VAL A 1 9   ? -6.250  4.174   1.923   1.00 0.93  ? 9    VAL A HG13 4  
ATOM   9738  H HG21 . VAL A 1 9   ? -4.596  3.450   3.816   1.00 1.00  ? 9    VAL A HG21 4  
ATOM   9739  H HG22 . VAL A 1 9   ? -5.383  4.615   4.879   1.00 1.04  ? 9    VAL A HG22 4  
ATOM   9740  H HG23 . VAL A 1 9   ? -3.645  4.712   4.599   1.00 1.07  ? 9    VAL A HG23 4  
ATOM   9741  N N    . VAL A 1 10  ? -4.120  7.343   0.900   1.00 0.23  ? 10   VAL A N    4  
ATOM   9742  C CA   . VAL A 1 10  ? -4.493  8.303   -0.134  1.00 0.25  ? 10   VAL A CA   4  
ATOM   9743  C C    . VAL A 1 10  ? -3.677  8.152   -1.410  1.00 0.25  ? 10   VAL A C    4  
ATOM   9744  O O    . VAL A 1 10  ? -4.246  7.988   -2.490  1.00 0.27  ? 10   VAL A O    4  
ATOM   9745  C CB   . VAL A 1 10  ? -4.330  9.731   0.391   1.00 0.28  ? 10   VAL A CB   4  
ATOM   9746  C CG1  . VAL A 1 10  ? -4.651  10.745  -0.684  1.00 0.33  ? 10   VAL A CG1  4  
ATOM   9747  C CG2  . VAL A 1 10  ? -5.213  9.924   1.599   1.00 0.32  ? 10   VAL A CG2  4  
ATOM   9748  H H    . VAL A 1 10  ? -3.908  7.681   1.803   1.00 0.24  ? 10   VAL A H    4  
ATOM   9749  H HA   . VAL A 1 10  ? -5.536  8.151   -0.367  1.00 0.27  ? 10   VAL A HA   4  
ATOM   9750  H HB   . VAL A 1 10  ? -3.303  9.871   0.694   1.00 0.28  ? 10   VAL A HB   4  
ATOM   9751  H HG11 . VAL A 1 10  ? -5.685  10.639  -0.980  1.00 1.13  ? 10   VAL A HG11 4  
ATOM   9752  H HG12 . VAL A 1 10  ? -4.012  10.575  -1.540  1.00 1.03  ? 10   VAL A HG12 4  
ATOM   9753  H HG13 . VAL A 1 10  ? -4.485  11.739  -0.300  1.00 1.05  ? 10   VAL A HG13 4  
ATOM   9754  H HG21 . VAL A 1 10  ? -5.352  10.979  1.781   1.00 1.06  ? 10   VAL A HG21 4  
ATOM   9755  H HG22 . VAL A 1 10  ? -4.735  9.470   2.458   1.00 1.04  ? 10   VAL A HG22 4  
ATOM   9756  H HG23 . VAL A 1 10  ? -6.170  9.450   1.424   1.00 1.04  ? 10   VAL A HG23 4  
ATOM   9757  N N    . ASP A 1 11  ? -2.355  8.218   -1.287  1.00 0.26  ? 11   ASP A N    4  
ATOM   9758  C CA   . ASP A 1 11  ? -1.470  8.153   -2.448  1.00 0.28  ? 11   ASP A CA   4  
ATOM   9759  C C    . ASP A 1 11  ? -1.749  6.897   -3.261  1.00 0.31  ? 11   ASP A C    4  
ATOM   9760  O O    . ASP A 1 11  ? -1.616  6.892   -4.488  1.00 0.35  ? 11   ASP A O    4  
ATOM   9761  C CB   . ASP A 1 11  ? -0.001  8.178   -2.012  1.00 0.32  ? 11   ASP A CB   4  
ATOM   9762  C CG   . ASP A 1 11  ? 0.951   8.339   -3.186  1.00 0.39  ? 11   ASP A CG   4  
ATOM   9763  O OD1  . ASP A 1 11  ? 1.201   9.494   -3.602  1.00 0.59  ? 11   ASP A OD1  4  
ATOM   9764  O OD2  . ASP A 1 11  ? 1.454   7.322   -3.701  1.00 0.49  ? 11   ASP A OD2  4  
ATOM   9765  H H    . ASP A 1 11  ? -1.959  8.302   -0.389  1.00 0.26  ? 11   ASP A H    4  
ATOM   9766  H HA   . ASP A 1 11  ? -1.670  9.018   -3.064  1.00 0.31  ? 11   ASP A HA   4  
ATOM   9767  H HB2  . ASP A 1 11  ? 0.153   9.003   -1.334  1.00 0.36  ? 11   ASP A HB2  4  
ATOM   9768  H HB3  . ASP A 1 11  ? 0.234   7.253   -1.507  1.00 0.36  ? 11   ASP A HB3  4  
ATOM   9769  N N    . PHE A 1 12  ? -2.175  5.845   -2.574  1.00 0.32  ? 12   PHE A N    4  
ATOM   9770  C CA   . PHE A 1 12  ? -2.474  4.592   -3.231  1.00 0.38  ? 12   PHE A CA   4  
ATOM   9771  C C    . PHE A 1 12  ? -3.847  4.651   -3.899  1.00 0.34  ? 12   PHE A C    4  
ATOM   9772  O O    . PHE A 1 12  ? -3.966  4.353   -5.087  1.00 0.39  ? 12   PHE A O    4  
ATOM   9773  C CB   . PHE A 1 12  ? -2.405  3.425   -2.245  1.00 0.46  ? 12   PHE A CB   4  
ATOM   9774  C CG   . PHE A 1 12  ? -2.051  2.121   -2.902  1.00 0.76  ? 12   PHE A CG   4  
ATOM   9775  C CD1  . PHE A 1 12  ? -3.010  1.402   -3.596  1.00 0.98  ? 12   PHE A CD1  4  
ATOM   9776  C CD2  . PHE A 1 12  ? -0.768  1.606   -2.816  1.00 1.24  ? 12   PHE A CD2  4  
ATOM   9777  C CE1  . PHE A 1 12  ? -2.697  0.196   -4.193  1.00 1.38  ? 12   PHE A CE1  4  
ATOM   9778  C CE2  . PHE A 1 12  ? -0.450  0.401   -3.412  1.00 1.61  ? 12   PHE A CE2  4  
ATOM   9779  C CZ   . PHE A 1 12  ? -1.376  -0.275  -4.137  1.00 1.61  ? 12   PHE A CZ   4  
ATOM   9780  H H    . PHE A 1 12  ? -2.294  5.919   -1.604  1.00 0.31  ? 12   PHE A H    4  
ATOM   9781  H HA   . PHE A 1 12  ? -1.729  4.445   -3.997  1.00 0.45  ? 12   PHE A HA   4  
ATOM   9782  H HB2  . PHE A 1 12  ? -1.655  3.637   -1.498  1.00 0.57  ? 12   PHE A HB2  4  
ATOM   9783  H HB3  . PHE A 1 12  ? -3.365  3.308   -1.764  1.00 0.57  ? 12   PHE A HB3  4  
ATOM   9784  H HD1  . PHE A 1 12  ? -4.014  1.793   -3.670  1.00 1.09  ? 12   PHE A HD1  4  
ATOM   9785  H HD2  . PHE A 1 12  ? -0.011  2.155   -2.277  1.00 1.46  ? 12   PHE A HD2  4  
ATOM   9786  H HE1  . PHE A 1 12  ? -3.454  -0.353  -4.731  1.00 1.67  ? 12   PHE A HE1  4  
ATOM   9787  H HE2  . PHE A 1 12  ? 0.555   0.011   -3.338  1.00 2.02  ? 12   PHE A HE2  4  
ATOM   9788  H HZ   . PHE A 1 12  ? -1.115  -1.208  -4.616  1.00 1.95  ? 12   PHE A HZ   4  
ATOM   9789  N N    . LEU A 1 13  ? -4.882  5.054   -3.151  1.00 0.28  ? 13   LEU A N    4  
ATOM   9790  C CA   . LEU A 1 13  ? -6.227  5.157   -3.718  1.00 0.28  ? 13   LEU A CA   4  
ATOM   9791  C C    . LEU A 1 13  ? -6.248  6.124   -4.895  1.00 0.30  ? 13   LEU A C    4  
ATOM   9792  O O    . LEU A 1 13  ? -6.845  5.835   -5.931  1.00 0.34  ? 13   LEU A O    4  
ATOM   9793  C CB   . LEU A 1 13  ? -7.261  5.593   -2.671  1.00 0.25  ? 13   LEU A CB   4  
ATOM   9794  C CG   . LEU A 1 13  ? -7.866  4.455   -1.846  1.00 0.26  ? 13   LEU A CG   4  
ATOM   9795  C CD1  . LEU A 1 13  ? -6.990  4.095   -0.677  1.00 0.26  ? 13   LEU A CD1  4  
ATOM   9796  C CD2  . LEU A 1 13  ? -9.263  4.805   -1.369  1.00 0.27  ? 13   LEU A CD2  4  
ATOM   9797  H H    . LEU A 1 13  ? -4.738  5.289   -2.201  1.00 0.26  ? 13   LEU A H    4  
ATOM   9798  H HA   . LEU A 1 13  ? -6.497  4.176   -4.082  1.00 0.31  ? 13   LEU A HA   4  
ATOM   9799  H HB2  . LEU A 1 13  ? -6.786  6.288   -1.994  1.00 0.23  ? 13   LEU A HB2  4  
ATOM   9800  H HB3  . LEU A 1 13  ? -8.063  6.103   -3.180  1.00 0.27  ? 13   LEU A HB3  4  
ATOM   9801  H HG   . LEU A 1 13  ? -7.938  3.582   -2.468  1.00 0.29  ? 13   LEU A HG   4  
ATOM   9802  H HD11 . LEU A 1 13  ? -7.446  3.278   -0.132  1.00 0.91  ? 13   LEU A HD11 4  
ATOM   9803  H HD12 . LEU A 1 13  ? -6.892  4.953   -0.027  1.00 0.87  ? 13   LEU A HD12 4  
ATOM   9804  H HD13 . LEU A 1 13  ? -6.017  3.795   -1.033  1.00 0.89  ? 13   LEU A HD13 4  
ATOM   9805  H HD21 . LEU A 1 13  ? -9.685  3.957   -0.848  1.00 1.06  ? 13   LEU A HD21 4  
ATOM   9806  H HD22 . LEU A 1 13  ? -9.883  5.049   -2.219  1.00 1.03  ? 13   LEU A HD22 4  
ATOM   9807  H HD23 . LEU A 1 13  ? -9.215  5.652   -0.701  1.00 1.05  ? 13   LEU A HD23 4  
ATOM   9808  N N    . SER A 1 14  ? -5.570  7.253   -4.738  1.00 0.29  ? 14   SER A N    4  
ATOM   9809  C CA   . SER A 1 14  ? -5.474  8.252   -5.799  1.00 0.33  ? 14   SER A CA   4  
ATOM   9810  C C    . SER A 1 14  ? -4.856  7.640   -7.052  1.00 0.37  ? 14   SER A C    4  
ATOM   9811  O O    . SER A 1 14  ? -5.307  7.885   -8.174  1.00 0.42  ? 14   SER A O    4  
ATOM   9812  C CB   . SER A 1 14  ? -4.635  9.444   -5.323  1.00 0.33  ? 14   SER A CB   4  
ATOM   9813  O OG   . SER A 1 14  ? -4.554  10.458  -6.314  1.00 1.05  ? 14   SER A OG   4  
ATOM   9814  H H    . SER A 1 14  ? -5.117  7.423   -3.878  1.00 0.27  ? 14   SER A H    4  
ATOM   9815  H HA   . SER A 1 14  ? -6.472  8.591   -6.030  1.00 0.36  ? 14   SER A HA   4  
ATOM   9816  H HB2  . SER A 1 14  ? -5.085  9.865   -4.437  1.00 0.91  ? 14   SER A HB2  4  
ATOM   9817  H HB3  . SER A 1 14  ? -3.639  9.105   -5.093  1.00 0.81  ? 14   SER A HB3  4  
ATOM   9818  H HG   . SER A 1 14  ? -3.642  10.788  -6.353  1.00 1.60  ? 14   SER A HG   4  
ATOM   9819  N N    . TYR A 1 15  ? -3.845  6.809   -6.849  1.00 0.37  ? 15   TYR A N    4  
ATOM   9820  C CA   . TYR A 1 15  ? -3.148  6.169   -7.949  1.00 0.45  ? 15   TYR A CA   4  
ATOM   9821  C C    . TYR A 1 15  ? -4.036  5.101   -8.590  1.00 0.43  ? 15   TYR A C    4  
ATOM   9822  O O    . TYR A 1 15  ? -3.865  4.756   -9.760  1.00 0.55  ? 15   TYR A O    4  
ATOM   9823  C CB   . TYR A 1 15  ? -1.840  5.555   -7.442  1.00 0.52  ? 15   TYR A CB   4  
ATOM   9824  C CG   . TYR A 1 15  ? -0.857  5.188   -8.532  1.00 0.67  ? 15   TYR A CG   4  
ATOM   9825  C CD1  . TYR A 1 15  ? -0.223  6.171   -9.281  1.00 0.72  ? 15   TYR A CD1  4  
ATOM   9826  C CD2  . TYR A 1 15  ? -0.558  3.861   -8.805  1.00 0.89  ? 15   TYR A CD2  4  
ATOM   9827  C CE1  . TYR A 1 15  ? 0.681   5.839   -10.273 1.00 0.89  ? 15   TYR A CE1  4  
ATOM   9828  C CE2  . TYR A 1 15  ? 0.346   3.522   -9.792  1.00 1.06  ? 15   TYR A CE2  4  
ATOM   9829  C CZ   . TYR A 1 15  ? 0.963   4.514   -10.524 1.00 1.03  ? 15   TYR A CZ   4  
ATOM   9830  O OH   . TYR A 1 15  ? 1.867   4.178   -11.505 1.00 1.22  ? 15   TYR A OH   4  
ATOM   9831  H H    . TYR A 1 15  ? -3.558  6.622   -5.929  1.00 0.36  ? 15   TYR A H    4  
ATOM   9832  H HA   . TYR A 1 15  ? -2.922  6.925   -8.686  1.00 0.50  ? 15   TYR A HA   4  
ATOM   9833  H HB2  . TYR A 1 15  ? -1.351  6.262   -6.788  1.00 0.53  ? 15   TYR A HB2  4  
ATOM   9834  H HB3  . TYR A 1 15  ? -2.066  4.657   -6.885  1.00 0.52  ? 15   TYR A HB3  4  
ATOM   9835  H HD1  . TYR A 1 15  ? -0.445  7.208   -9.083  1.00 0.72  ? 15   TYR A HD1  4  
ATOM   9836  H HD2  . TYR A 1 15  ? -1.043  3.084   -8.232  1.00 0.98  ? 15   TYR A HD2  4  
ATOM   9837  H HE1  . TYR A 1 15  ? 1.164   6.618   -10.846 1.00 0.98  ? 15   TYR A HE1  4  
ATOM   9838  H HE2  . TYR A 1 15  ? 0.565   2.483   -9.989  1.00 1.26  ? 15   TYR A HE2  4  
ATOM   9839  H HH   . TYR A 1 15  ? 2.657   4.737   -11.418 1.00 1.49  ? 15   TYR A HH   4  
ATOM   9840  N N    . LYS A 1 16  ? -4.997  4.590   -7.823  1.00 0.33  ? 16   LYS A N    4  
ATOM   9841  C CA   . LYS A 1 16  ? -5.912  3.567   -8.323  1.00 0.33  ? 16   LYS A CA   4  
ATOM   9842  C C    . LYS A 1 16  ? -7.085  4.199   -9.057  1.00 0.33  ? 16   LYS A C    4  
ATOM   9843  O O    . LYS A 1 16  ? -7.645  3.598   -9.961  1.00 0.42  ? 16   LYS A O    4  
ATOM   9844  C CB   . LYS A 1 16  ? -6.419  2.670   -7.191  1.00 0.34  ? 16   LYS A CB   4  
ATOM   9845  C CG   . LYS A 1 16  ? -5.324  1.979   -6.378  1.00 0.61  ? 16   LYS A CG   4  
ATOM   9846  C CD   . LYS A 1 16  ? -4.452  1.039   -7.209  1.00 0.57  ? 16   LYS A CD   4  
ATOM   9847  C CE   . LYS A 1 16  ? -3.349  1.784   -7.949  1.00 1.18  ? 16   LYS A CE   4  
ATOM   9848  N NZ   . LYS A 1 16  ? -2.337  0.866   -8.530  1.00 1.41  ? 16   LYS A NZ   4  
ATOM   9849  H H    . LYS A 1 16  ? -5.090  4.907   -6.897  1.00 0.32  ? 16   LYS A H    4  
ATOM   9850  H HA   . LYS A 1 16  ? -5.369  2.960   -9.026  1.00 0.38  ? 16   LYS A HA   4  
ATOM   9851  H HB2  . LYS A 1 16  ? -7.008  3.270   -6.513  1.00 0.62  ? 16   LYS A HB2  4  
ATOM   9852  H HB3  . LYS A 1 16  ? -7.052  1.906   -7.617  1.00 0.63  ? 16   LYS A HB3  4  
ATOM   9853  H HG2  . LYS A 1 16  ? -4.691  2.737   -5.945  1.00 0.97  ? 16   LYS A HG2  4  
ATOM   9854  H HG3  . LYS A 1 16  ? -5.791  1.411   -5.586  1.00 0.99  ? 16   LYS A HG3  4  
ATOM   9855  H HD2  . LYS A 1 16  ? -3.999  0.313   -6.551  1.00 0.75  ? 16   LYS A HD2  4  
ATOM   9856  H HD3  . LYS A 1 16  ? -5.076  0.531   -7.930  1.00 0.97  ? 16   LYS A HD3  4  
ATOM   9857  H HE2  . LYS A 1 16  ? -3.788  2.354   -8.747  1.00 1.56  ? 16   LYS A HE2  4  
ATOM   9858  H HE3  . LYS A 1 16  ? -2.862  2.456   -7.259  1.00 1.44  ? 16   LYS A HE3  4  
ATOM   9859  H HZ1  . LYS A 1 16  ? -2.798  -0.004  -8.881  1.00 1.70  ? 16   LYS A HZ1  4  
ATOM   9860  H HZ2  . LYS A 1 16  ? -1.624  0.605   -7.816  1.00 1.51  ? 16   LYS A HZ2  4  
ATOM   9861  H HZ3  . LYS A 1 16  ? -1.855  1.328   -9.332  1.00 1.84  ? 16   LYS A HZ3  4  
ATOM   9862  N N    . LEU A 1 17  ? -7.459  5.410   -8.680  1.00 0.33  ? 17   LEU A N    4  
ATOM   9863  C CA   . LEU A 1 17  ? -8.472  6.135   -9.445  1.00 0.32  ? 17   LEU A CA   4  
ATOM   9864  C C    . LEU A 1 17  ? -7.870  6.605   -10.764 1.00 0.35  ? 17   LEU A C    4  
ATOM   9865  O O    . LEU A 1 17  ? -8.573  6.773   -11.761 1.00 0.36  ? 17   LEU A O    4  
ATOM   9866  C CB   . LEU A 1 17  ? -9.038  7.336   -8.672  1.00 0.35  ? 17   LEU A CB   4  
ATOM   9867  C CG   . LEU A 1 17  ? -10.124 7.027   -7.629  1.00 0.53  ? 17   LEU A CG   4  
ATOM   9868  C CD1  . LEU A 1 17  ? -10.625 5.599   -7.742  1.00 1.35  ? 17   LEU A CD1  4  
ATOM   9869  C CD2  . LEU A 1 17  ? -9.613  7.315   -6.231  1.00 1.15  ? 17   LEU A CD2  4  
ATOM   9870  H H    . LEU A 1 17  ? -7.060  5.816   -7.878  1.00 0.38  ? 17   LEU A H    4  
ATOM   9871  H HA   . LEU A 1 17  ? -9.278  5.444   -9.659  1.00 0.31  ? 17   LEU A HA   4  
ATOM   9872  H HB2  . LEU A 1 17  ? -8.218  7.822   -8.164  1.00 0.33  ? 17   LEU A HB2  4  
ATOM   9873  H HB3  . LEU A 1 17  ? -9.451  8.029   -9.386  1.00 0.43  ? 17   LEU A HB3  4  
ATOM   9874  H HG   . LEU A 1 17  ? -10.969 7.673   -7.808  1.00 1.53  ? 17   LEU A HG   4  
ATOM   9875  H HD11 . LEU A 1 17  ? -11.051 5.444   -8.724  1.00 1.98  ? 17   LEU A HD11 4  
ATOM   9876  H HD12 . LEU A 1 17  ? -11.381 5.422   -6.990  1.00 1.90  ? 17   LEU A HD12 4  
ATOM   9877  H HD13 . LEU A 1 17  ? -9.802  4.916   -7.595  1.00 1.88  ? 17   LEU A HD13 4  
ATOM   9878  H HD21 . LEU A 1 17  ? -9.344  8.358   -6.155  1.00 1.75  ? 17   LEU A HD21 4  
ATOM   9879  H HD22 . LEU A 1 17  ? -8.745  6.703   -6.034  1.00 1.77  ? 17   LEU A HD22 4  
ATOM   9880  H HD23 . LEU A 1 17  ? -10.388 7.088   -5.512  1.00 1.74  ? 17   LEU A HD23 4  
ATOM   9881  N N    . SER A 1 18  ? -6.556  6.788   -10.761 1.00 0.41  ? 18   SER A N    4  
ATOM   9882  C CA   . SER A 1 18  ? -5.831  7.274   -11.929 1.00 0.48  ? 18   SER A CA   4  
ATOM   9883  C C    . SER A 1 18  ? -5.891  6.273   -13.093 1.00 0.51  ? 18   SER A C    4  
ATOM   9884  O O    . SER A 1 18  ? -5.940  6.671   -14.258 1.00 0.58  ? 18   SER A O    4  
ATOM   9885  C CB   . SER A 1 18  ? -4.376  7.562   -11.549 1.00 0.57  ? 18   SER A CB   4  
ATOM   9886  O OG   . SER A 1 18  ? -3.733  8.363   -12.525 1.00 0.94  ? 18   SER A OG   4  
ATOM   9887  H H    . SER A 1 18  ? -6.058  6.609   -9.935  1.00 0.41  ? 18   SER A H    4  
ATOM   9888  H HA   . SER A 1 18  ? -6.296  8.196   -12.243 1.00 0.51  ? 18   SER A HA   4  
ATOM   9889  H HB2  . SER A 1 18  ? -4.350  8.083   -10.603 1.00 0.86  ? 18   SER A HB2  4  
ATOM   9890  H HB3  . SER A 1 18  ? -3.840  6.629   -11.458 1.00 0.69  ? 18   SER A HB3  4  
ATOM   9891  H HG   . SER A 1 18  ? -3.724  9.285   -12.219 1.00 1.38  ? 18   SER A HG   4  
ATOM   9892  N N    . GLN A 1 19  ? -5.908  4.977   -12.782 1.00 0.52  ? 19   GLN A N    4  
ATOM   9893  C CA   . GLN A 1 19  ? -5.971  3.944   -13.821 1.00 0.57  ? 19   GLN A CA   4  
ATOM   9894  C C    . GLN A 1 19  ? -7.378  3.832   -14.396 1.00 0.51  ? 19   GLN A C    4  
ATOM   9895  O O    . GLN A 1 19  ? -7.620  3.107   -15.361 1.00 0.59  ? 19   GLN A O    4  
ATOM   9896  C CB   . GLN A 1 19  ? -5.518  2.592   -13.270 1.00 0.68  ? 19   GLN A CB   4  
ATOM   9897  C CG   . GLN A 1 19  ? -6.265  2.183   -12.023 1.00 0.84  ? 19   GLN A CG   4  
ATOM   9898  C CD   . GLN A 1 19  ? -5.833  0.843   -11.474 1.00 0.97  ? 19   GLN A CD   4  
ATOM   9899  O OE1  . GLN A 1 19  ? -4.905  0.755   -10.672 1.00 1.37  ? 19   GLN A OE1  4  
ATOM   9900  N NE2  . GLN A 1 19  ? -6.517  -0.211  -11.886 1.00 1.19  ? 19   GLN A NE2  4  
ATOM   9901  H H    . GLN A 1 19  ? -5.874  4.706   -11.841 1.00 0.53  ? 19   GLN A H    4  
ATOM   9902  H HA   . GLN A 1 19  ? -5.309  4.236   -14.606 1.00 0.66  ? 19   GLN A HA   4  
ATOM   9903  H HB2  . GLN A 1 19  ? -5.675  1.837   -14.025 1.00 0.89  ? 19   GLN A HB2  4  
ATOM   9904  H HB3  . GLN A 1 19  ? -4.465  2.645   -13.034 1.00 0.96  ? 19   GLN A HB3  4  
ATOM   9905  H HG2  . GLN A 1 19  ? -6.098  2.936   -11.272 1.00 1.09  ? 19   GLN A HG2  4  
ATOM   9906  H HG3  . GLN A 1 19  ? -7.321  2.138   -12.254 1.00 1.03  ? 19   GLN A HG3  4  
ATOM   9907  H HE21 . GLN A 1 19  ? -7.259  -0.066  -12.521 1.00 1.51  ? 19   GLN A HE21 4  
ATOM   9908  H HE22 . GLN A 1 19  ? -6.259  -1.094  -11.542 1.00 1.29  ? 19   GLN A HE22 4  
ATOM   9909  N N    . LYS A 1 20  ? -8.293  4.565   -13.795 1.00 0.45  ? 20   LYS A N    4  
ATOM   9910  C CA   . LYS A 1 20  ? -9.688  4.556   -14.205 1.00 0.49  ? 20   LYS A CA   4  
ATOM   9911  C C    . LYS A 1 20  ? -10.010 5.873   -14.868 1.00 0.48  ? 20   LYS A C    4  
ATOM   9912  O O    . LYS A 1 20  ? -10.888 5.974   -15.721 1.00 0.53  ? 20   LYS A O    4  
ATOM   9913  C CB   . LYS A 1 20  ? -10.580 4.354   -12.984 1.00 0.57  ? 20   LYS A CB   4  
ATOM   9914  C CG   . LYS A 1 20  ? -9.977  3.420   -11.962 1.00 0.49  ? 20   LYS A CG   4  
ATOM   9915  C CD   . LYS A 1 20  ? -9.783  2.027   -12.523 1.00 1.20  ? 20   LYS A CD   4  
ATOM   9916  C CE   . LYS A 1 20  ? -11.090 1.461   -13.051 1.00 1.75  ? 20   LYS A CE   4  
ATOM   9917  N NZ   . LYS A 1 20  ? -10.908 0.109   -13.637 1.00 2.20  ? 20   LYS A NZ   4  
ATOM   9918  H H    . LYS A 1 20  ? -8.020  5.142   -13.053 1.00 0.45  ? 20   LYS A H    4  
ATOM   9919  H HA   . LYS A 1 20  ? -9.837  3.752   -14.905 1.00 0.54  ? 20   LYS A HA   4  
ATOM   9920  H HB2  . LYS A 1 20  ? -10.759 5.302   -12.507 1.00 0.67  ? 20   LYS A HB2  4  
ATOM   9921  H HB3  . LYS A 1 20  ? -11.522 3.938   -13.305 1.00 0.70  ? 20   LYS A HB3  4  
ATOM   9922  H HG2  . LYS A 1 20  ? -9.017  3.810   -11.663 1.00 1.16  ? 20   LYS A HG2  4  
ATOM   9923  H HG3  . LYS A 1 20  ? -10.624 3.372   -11.110 1.00 1.06  ? 20   LYS A HG3  4  
ATOM   9924  H HD2  . LYS A 1 20  ? -9.060  2.071   -13.329 1.00 1.65  ? 20   LYS A HD2  4  
ATOM   9925  H HD3  . LYS A 1 20  ? -9.411  1.385   -11.735 1.00 1.68  ? 20   LYS A HD3  4  
ATOM   9926  H HE2  . LYS A 1 20  ? -11.796 1.406   -12.230 1.00 2.01  ? 20   LYS A HE2  4  
ATOM   9927  H HE3  . LYS A 1 20  ? -11.474 2.130   -13.808 1.00 1.68  ? 20   LYS A HE3  4  
ATOM   9928  H HZ1  . LYS A 1 20  ? -10.240 0.153   -14.435 1.00 2.49  ? 20   LYS A HZ1  4  
ATOM   9929  H HZ2  . LYS A 1 20  ? -11.817 -0.265  -13.983 1.00 2.36  ? 20   LYS A HZ2  4  
ATOM   9930  H HZ3  . LYS A 1 20  ? -10.529 -0.547  -12.920 1.00 2.65  ? 20   LYS A HZ3  4  
ATOM   9931  N N    . GLY A 1 21  ? -9.272  6.876   -14.450 1.00 0.45  ? 21   GLY A N    4  
ATOM   9932  C CA   . GLY A 1 21  ? -9.407  8.195   -15.014 1.00 0.49  ? 21   GLY A CA   4  
ATOM   9933  C C    . GLY A 1 21  ? -10.210 9.097   -14.117 1.00 0.47  ? 21   GLY A C    4  
ATOM   9934  O O    . GLY A 1 21  ? -10.800 10.078  -14.567 1.00 0.53  ? 21   GLY A O    4  
ATOM   9935  H H    . GLY A 1 21  ? -8.639  6.718   -13.717 1.00 0.44  ? 21   GLY A H    4  
ATOM   9936  H HA2  . GLY A 1 21  ? -8.423  8.615   -15.150 1.00 0.52  ? 21   GLY A HA2  4  
ATOM   9937  H HA3  . GLY A 1 21  ? -9.897  8.122   -15.973 1.00 0.54  ? 21   GLY A HA3  4  
ATOM   9938  N N    . TYR A 1 22  ? -10.238 8.752   -12.842 1.00 0.40  ? 22   TYR A N    4  
ATOM   9939  C CA   . TYR A 1 22  ? -10.961 9.529   -11.855 1.00 0.37  ? 22   TYR A CA   4  
ATOM   9940  C C    . TYR A 1 22  ? -10.004 10.232  -10.908 1.00 0.36  ? 22   TYR A C    4  
ATOM   9941  O O    . TYR A 1 22  ? -8.822  9.886   -10.825 1.00 0.38  ? 22   TYR A O    4  
ATOM   9942  C CB   . TYR A 1 22  ? -11.912 8.633   -11.065 1.00 0.34  ? 22   TYR A CB   4  
ATOM   9943  C CG   . TYR A 1 22  ? -13.082 8.135   -11.885 1.00 0.38  ? 22   TYR A CG   4  
ATOM   9944  C CD1  . TYR A 1 22  ? -12.969 6.991   -12.663 1.00 0.50  ? 22   TYR A CD1  4  
ATOM   9945  C CD2  . TYR A 1 22  ? -14.298 8.806   -11.878 1.00 0.50  ? 22   TYR A CD2  4  
ATOM   9946  C CE1  . TYR A 1 22  ? -14.032 6.529   -13.413 1.00 0.60  ? 22   TYR A CE1  4  
ATOM   9947  C CE2  . TYR A 1 22  ? -15.366 8.350   -12.624 1.00 0.62  ? 22   TYR A CE2  4  
ATOM   9948  C CZ   . TYR A 1 22  ? -15.231 7.228   -13.394 1.00 0.62  ? 22   TYR A CZ   4  
ATOM   9949  O OH   . TYR A 1 22  ? -16.290 6.761   -14.136 1.00 0.76  ? 22   TYR A OH   4  
ATOM   9950  H H    . TYR A 1 22  ? -9.749  7.950   -12.553 1.00 0.40  ? 22   TYR A H    4  
ATOM   9951  H HA   . TYR A 1 22  ? -11.539 10.274  -12.381 1.00 0.42  ? 22   TYR A HA   4  
ATOM   9952  H HB2  . TYR A 1 22  ? -11.370 7.768   -10.694 1.00 0.37  ? 22   TYR A HB2  4  
ATOM   9953  H HB3  . TYR A 1 22  ? -12.303 9.197   -10.228 1.00 0.32  ? 22   TYR A HB3  4  
ATOM   9954  H HD1  . TYR A 1 22  ? -12.030 6.457   -12.680 1.00 0.61  ? 22   TYR A HD1  4  
ATOM   9955  H HD2  . TYR A 1 22  ? -14.403 9.697   -11.278 1.00 0.60  ? 22   TYR A HD2  4  
ATOM   9956  H HE1  . TYR A 1 22  ? -13.925 5.638   -14.012 1.00 0.74  ? 22   TYR A HE1  4  
ATOM   9957  H HE2  . TYR A 1 22  ? -16.305 8.884   -12.606 1.00 0.78  ? 22   TYR A HE2  4  
ATOM   9958  H HH   . TYR A 1 22  ? -16.684 7.507   -14.611 1.00 1.12  ? 22   TYR A HH   4  
ATOM   9959  N N    . SER A 1 23  ? -10.520 11.217  -10.195 1.00 0.37  ? 23   SER A N    4  
ATOM   9960  C CA   . SER A 1 23  ? -9.720  11.974  -9.258  1.00 0.39  ? 23   SER A CA   4  
ATOM   9961  C C    . SER A 1 23  ? -9.984  11.501  -7.845  1.00 0.35  ? 23   SER A C    4  
ATOM   9962  O O    . SER A 1 23  ? -11.107 11.137  -7.503  1.00 0.34  ? 23   SER A O    4  
ATOM   9963  C CB   . SER A 1 23  ? -10.054 13.456  -9.356  1.00 0.45  ? 23   SER A CB   4  
ATOM   9964  O OG   . SER A 1 23  ? -8.999  14.254  -8.854  1.00 0.52  ? 23   SER A OG   4  
ATOM   9965  H H    . SER A 1 23  ? -11.466 11.444  -10.304 1.00 0.39  ? 23   SER A H    4  
ATOM   9966  H HA   . SER A 1 23  ? -8.678  11.825  -9.499  1.00 0.43  ? 23   SER A HA   4  
ATOM   9967  H HB2  . SER A 1 23  ? -10.242 13.715  -10.380 1.00 0.48  ? 23   SER A HB2  4  
ATOM   9968  H HB3  . SER A 1 23  ? -10.939 13.653  -8.771  1.00 0.45  ? 23   SER A HB3  4  
ATOM   9969  H HG   . SER A 1 23  ? -8.532  14.671  -9.595  1.00 0.75  ? 23   SER A HG   4  
ATOM   9970  N N    . TRP A 1 24  ? -8.954  11.524  -7.026  1.00 0.37  ? 24   TRP A N    4  
ATOM   9971  C CA   . TRP A 1 24  ? -9.089  11.167  -5.629  1.00 0.36  ? 24   TRP A CA   4  
ATOM   9972  C C    . TRP A 1 24  ? -9.889  12.228  -4.875  1.00 0.35  ? 24   TRP A C    4  
ATOM   9973  O O    . TRP A 1 24  ? -10.830 11.909  -4.148  1.00 0.34  ? 24   TRP A O    4  
ATOM   9974  C CB   . TRP A 1 24  ? -7.699  10.977  -5.003  1.00 0.45  ? 24   TRP A CB   4  
ATOM   9975  C CG   . TRP A 1 24  ? -7.602  11.431  -3.578  1.00 0.43  ? 24   TRP A CG   4  
ATOM   9976  C CD1  . TRP A 1 24  ? -8.019  10.760  -2.466  1.00 0.96  ? 24   TRP A CD1  4  
ATOM   9977  C CD2  . TRP A 1 24  ? -7.051  12.669  -3.120  1.00 1.27  ? 24   TRP A CD2  4  
ATOM   9978  N NE1  . TRP A 1 24  ? -7.781  11.518  -1.344  1.00 0.61  ? 24   TRP A NE1  4  
ATOM   9979  C CE2  . TRP A 1 24  ? -7.181  12.692  -1.722  1.00 1.10  ? 24   TRP A CE2  4  
ATOM   9980  C CE3  . TRP A 1 24  ? -6.463  13.764  -3.761  1.00 2.43  ? 24   TRP A CE3  4  
ATOM   9981  C CZ2  . TRP A 1 24  ? -6.747  13.765  -0.954  1.00 2.00  ? 24   TRP A CZ2  4  
ATOM   9982  C CZ3  . TRP A 1 24  ? -6.031  14.829  -2.996  1.00 3.36  ? 24   TRP A CZ3  4  
ATOM   9983  C CH2  . TRP A 1 24  ? -6.174  14.822  -1.605  1.00 3.13  ? 24   TRP A CH2  4  
ATOM   9984  H H    . TRP A 1 24  ? -8.071  11.791  -7.373  1.00 0.43  ? 24   TRP A H    4  
ATOM   9985  H HA   . TRP A 1 24  ? -9.626  10.230  -5.578  1.00 0.34  ? 24   TRP A HA   4  
ATOM   9986  H HB2  . TRP A 1 24  ? -7.440  9.930   -5.035  1.00 0.57  ? 24   TRP A HB2  4  
ATOM   9987  H HB3  . TRP A 1 24  ? -6.977  11.537  -5.581  1.00 0.57  ? 24   TRP A HB3  4  
ATOM   9988  H HD1  . TRP A 1 24  ? -8.484  9.784   -2.480  1.00 1.86  ? 24   TRP A HD1  4  
ATOM   9989  H HE1  . TRP A 1 24  ? -7.997  11.259  -0.424  1.00 0.92  ? 24   TRP A HE1  4  
ATOM   9990  H HE3  . TRP A 1 24  ? -6.344  13.785  -4.834  1.00 2.64  ? 24   TRP A HE3  4  
ATOM   9991  H HZ2  . TRP A 1 24  ? -6.851  13.777  0.121   1.00 1.86  ? 24   TRP A HZ2  4  
ATOM   9992  H HZ3  . TRP A 1 24  ? -5.574  15.683  -3.473  1.00 4.29  ? 24   TRP A HZ3  4  
ATOM   9993  H HH2  . TRP A 1 24  ? -5.823  15.677  -1.046  1.00 3.88  ? 24   TRP A HH2  4  
ATOM   9994  N N    . SER A 1 25  ? -9.536  13.491  -5.081  1.00 0.39  ? 25   SER A N    4  
ATOM   9995  C CA   . SER A 1 25  ? -10.082 14.569  -4.271  1.00 0.44  ? 25   SER A CA   4  
ATOM   9996  C C    . SER A 1 25  ? -11.517 14.895  -4.665  1.00 0.43  ? 25   SER A C    4  
ATOM   9997  O O    . SER A 1 25  ? -12.269 15.430  -3.861  1.00 0.49  ? 25   SER A O    4  
ATOM   9998  C CB   . SER A 1 25  ? -9.202  15.811  -4.380  1.00 0.53  ? 25   SER A CB   4  
ATOM   9999  O OG   . SER A 1 25  ? -9.412  16.695  -3.291  1.00 1.37  ? 25   SER A OG   4  
ATOM   10000 H H    . SER A 1 25  ? -8.889  13.701  -5.789  1.00 0.42  ? 25   SER A H    4  
ATOM   10001 H HA   . SER A 1 25  ? -10.079 14.234  -3.245  1.00 0.46  ? 25   SER A HA   4  
ATOM   10002 H HB2  . SER A 1 25  ? -8.165  15.509  -4.381  1.00 1.05  ? 25   SER A HB2  4  
ATOM   10003 H HB3  . SER A 1 25  ? -9.428  16.329  -5.298  1.00 1.16  ? 25   SER A HB3  4  
ATOM   10004 H HG   . SER A 1 25  ? -10.368 16.846  -3.171  1.00 1.86  ? 25   SER A HG   4  
ATOM   10005 N N    . GLN A 1 26  ? -11.911 14.566  -5.892  1.00 0.40  ? 26   GLN A N    4  
ATOM   10006 C CA   . GLN A 1 26  ? -13.293 14.783  -6.306  1.00 0.42  ? 26   GLN A CA   4  
ATOM   10007 C C    . GLN A 1 26  ? -14.257 13.977  -5.445  1.00 0.38  ? 26   GLN A C    4  
ATOM   10008 O O    . GLN A 1 26  ? -15.429 14.330  -5.296  1.00 0.41  ? 26   GLN A O    4  
ATOM   10009 C CB   . GLN A 1 26  ? -13.493 14.413  -7.770  1.00 0.47  ? 26   GLN A CB   4  
ATOM   10010 C CG   . GLN A 1 26  ? -12.909 15.425  -8.730  1.00 0.59  ? 26   GLN A CG   4  
ATOM   10011 C CD   . GLN A 1 26  ? -13.239 15.110  -10.172 1.00 0.73  ? 26   GLN A CD   4  
ATOM   10012 O OE1  . GLN A 1 26  ? -13.394 13.947  -10.550 1.00 1.11  ? 26   GLN A OE1  4  
ATOM   10013 N NE2  . GLN A 1 26  ? -13.352 16.143  -10.988 1.00 1.10  ? 26   GLN A NE2  4  
ATOM   10014 H H    . GLN A 1 26  ? -11.265 14.186  -6.529  1.00 0.39  ? 26   GLN A H    4  
ATOM   10015 H HA   . GLN A 1 26  ? -13.509 15.833  -6.182  1.00 0.50  ? 26   GLN A HA   4  
ATOM   10016 H HB2  . GLN A 1 26  ? -13.023 13.460  -7.956  1.00 0.43  ? 26   GLN A HB2  4  
ATOM   10017 H HB3  . GLN A 1 26  ? -14.551 14.329  -7.967  1.00 0.53  ? 26   GLN A HB3  4  
ATOM   10018 H HG2  . GLN A 1 26  ? -13.305 16.399  -8.491  1.00 0.70  ? 26   GLN A HG2  4  
ATOM   10019 H HG3  . GLN A 1 26  ? -11.836 15.432  -8.612  1.00 0.53  ? 26   GLN A HG3  4  
ATOM   10020 H HE21 . GLN A 1 26  ? -13.210 17.046  -10.618 1.00 1.52  ? 26   GLN A HE21 4  
ATOM   10021 H HE22 . GLN A 1 26  ? -13.584 15.973  -11.925 1.00 1.17  ? 26   GLN A HE22 4  
ATOM   10022 N N    . PHE A 1 27  ? -13.759 12.886  -4.882  1.00 0.35  ? 27   PHE A N    4  
ATOM   10023 C CA   . PHE A 1 27  ? -14.589 11.996  -4.095  1.00 0.38  ? 27   PHE A CA   4  
ATOM   10024 C C    . PHE A 1 27  ? -14.178 12.015  -2.626  1.00 0.43  ? 27   PHE A C    4  
ATOM   10025 O O    . PHE A 1 27  ? -14.964 11.662  -1.751  1.00 0.67  ? 27   PHE A O    4  
ATOM   10026 C CB   . PHE A 1 27  ? -14.485 10.576  -4.648  1.00 0.43  ? 27   PHE A CB   4  
ATOM   10027 C CG   . PHE A 1 27  ? -14.587 10.501  -6.147  1.00 0.67  ? 27   PHE A CG   4  
ATOM   10028 C CD1  . PHE A 1 27  ? -15.523 11.259  -6.836  1.00 0.85  ? 27   PHE A CD1  4  
ATOM   10029 C CD2  . PHE A 1 27  ? -13.735 9.683   -6.867  1.00 0.94  ? 27   PHE A CD2  4  
ATOM   10030 C CE1  . PHE A 1 27  ? -15.605 11.199  -8.212  1.00 1.16  ? 27   PHE A CE1  4  
ATOM   10031 C CE2  . PHE A 1 27  ? -13.813 9.620   -8.244  1.00 1.20  ? 27   PHE A CE2  4  
ATOM   10032 C CZ   . PHE A 1 27  ? -14.749 10.380  -8.917  1.00 1.28  ? 27   PHE A CZ   4  
ATOM   10033 H H    . PHE A 1 27  ? -12.814 12.669  -5.008  1.00 0.34  ? 27   PHE A H    4  
ATOM   10034 H HA   . PHE A 1 27  ? -15.611 12.332  -4.178  1.00 0.42  ? 27   PHE A HA   4  
ATOM   10035 H HB2  . PHE A 1 27  ? -13.533 10.155  -4.360  1.00 0.52  ? 27   PHE A HB2  4  
ATOM   10036 H HB3  . PHE A 1 27  ? -15.278 9.979   -4.229  1.00 0.39  ? 27   PHE A HB3  4  
ATOM   10037 H HD1  . PHE A 1 27  ? -16.194 11.901  -6.285  1.00 0.88  ? 27   PHE A HD1  4  
ATOM   10038 H HD2  . PHE A 1 27  ? -13.003 9.087   -6.342  1.00 1.05  ? 27   PHE A HD2  4  
ATOM   10039 H HE1  . PHE A 1 27  ? -16.339 11.794  -8.736  1.00 1.39  ? 27   PHE A HE1  4  
ATOM   10040 H HE2  . PHE A 1 27  ? -13.141 8.977   -8.795  1.00 1.44  ? 27   PHE A HE2  4  
ATOM   10041 H HZ   . PHE A 1 27  ? -14.811 10.331  -9.995  1.00 1.53  ? 27   PHE A HZ   4  
ATOM   10042 N N    . SER A 1 28  ? -12.940 12.416  -2.363  1.00 0.39  ? 28   SER A N    4  
ATOM   10043 C CA   . SER A 1 28  ? -12.424 12.449  -1.003  1.00 0.42  ? 28   SER A CA   4  
ATOM   10044 C C    . SER A 1 28  ? -12.430 13.842  -0.426  1.00 0.58  ? 28   SER A C    4  
ATOM   10045 O O    . SER A 1 28  ? -12.178 14.832  -1.102  1.00 1.01  ? 28   SER A O    4  
ATOM   10046 C CB   . SER A 1 28  ? -11.016 11.882  -0.943  1.00 0.62  ? 28   SER A CB   4  
ATOM   10047 O OG   . SER A 1 28  ? -10.963 10.589  -1.522  1.00 1.81  ? 28   SER A OG   4  
ATOM   10048 H H    . SER A 1 28  ? -12.362 12.700  -3.099  1.00 0.51  ? 28   SER A H    4  
ATOM   10049 H HA   . SER A 1 28  ? -13.067 11.845  -0.383  1.00 0.57  ? 28   SER A HA   4  
ATOM   10050 H HB2  . SER A 1 28  ? -10.352 12.537  -1.480  1.00 0.85  ? 28   SER A HB2  4  
ATOM   10051 H HB3  . SER A 1 28  ? -10.698 11.818  0.090   1.00 1.08  ? 28   SER A HB3  4  
ATOM   10052 H HG   . SER A 1 28  ? -11.127 10.659  -2.469  1.00 2.04  ? 28   SER A HG   4  
ATOM   10053 N N    . ASP A 1 29  ? -12.692 13.872  0.854   1.00 0.63  ? 29   ASP A N    4  
ATOM   10054 C CA   . ASP A 1 29  ? -12.799 15.096  1.611   1.00 0.84  ? 29   ASP A CA   4  
ATOM   10055 C C    . ASP A 1 29  ? -11.730 15.120  2.691   1.00 0.88  ? 29   ASP A C    4  
ATOM   10056 O O    . ASP A 1 29  ? -11.531 16.128  3.371   1.00 1.03  ? 29   ASP A O    4  
ATOM   10057 C CB   . ASP A 1 29  ? -14.168 15.141  2.273   1.00 1.04  ? 29   ASP A CB   4  
ATOM   10058 C CG   . ASP A 1 29  ? -15.317 15.357  1.311   1.00 1.69  ? 29   ASP A CG   4  
ATOM   10059 O OD1  . ASP A 1 29  ? -15.865 14.354  0.801   1.00 2.31  ? 29   ASP A OD1  4  
ATOM   10060 O OD2  . ASP A 1 29  ? -15.710 16.521  1.091   1.00 1.85  ? 29   ASP A OD2  4  
ATOM   10061 H H    . ASP A 1 29  ? -12.829 13.021  1.316   1.00 0.79  ? 29   ASP A H    4  
ATOM   10062 H HA   . ASP A 1 29  ? -12.681 15.934  0.948   1.00 0.91  ? 29   ASP A HA   4  
ATOM   10063 H HB2  . ASP A 1 29  ? -14.325 14.187  2.758   1.00 1.07  ? 29   ASP A HB2  4  
ATOM   10064 H HB3  . ASP A 1 29  ? -14.178 15.928  3.010   1.00 1.38  ? 29   ASP A HB3  4  
ATOM   10065 N N    . VAL A 1 30  ? -11.021 13.999  2.779   1.00 0.80  ? 30   VAL A N    4  
ATOM   10066 C CA   . VAL A 1 30  ? -10.158 13.667  3.911   1.00 0.82  ? 30   VAL A CA   4  
ATOM   10067 C C    . VAL A 1 30  ? -9.138  14.759  4.233   1.00 0.82  ? 30   VAL A C    4  
ATOM   10068 O O    . VAL A 1 30  ? -9.294  15.486  5.207   1.00 0.92  ? 30   VAL A O    4  
ATOM   10069 C CB   . VAL A 1 30  ? -9.445  12.323  3.632   1.00 0.81  ? 30   VAL A CB   4  
ATOM   10070 C CG1  . VAL A 1 30  ? -10.403 11.168  3.863   1.00 0.89  ? 30   VAL A CG1  4  
ATOM   10071 C CG2  . VAL A 1 30  ? -8.908  12.277  2.204   1.00 0.76  ? 30   VAL A CG2  4  
ATOM   10072 H H    . VAL A 1 30  ? -11.071 13.368  2.039   1.00 0.76  ? 30   VAL A H    4  
ATOM   10073 H HA   . VAL A 1 30  ? -10.793 13.528  4.773   1.00 0.90  ? 30   VAL A HA   4  
ATOM   10074 H HB   . VAL A 1 30  ? -8.614  12.223  4.311   1.00 0.84  ? 30   VAL A HB   4  
ATOM   10075 H HG11 . VAL A 1 30  ? -9.911  10.237  3.627   1.00 1.41  ? 30   VAL A HG11 4  
ATOM   10076 H HG12 . VAL A 1 30  ? -11.269 11.290  3.226   1.00 1.34  ? 30   VAL A HG12 4  
ATOM   10077 H HG13 . VAL A 1 30  ? -10.716 11.160  4.896   1.00 1.34  ? 30   VAL A HG13 4  
ATOM   10078 H HG21 . VAL A 1 30  ? -9.668  12.638  1.524   1.00 1.12  ? 30   VAL A HG21 4  
ATOM   10079 H HG22 . VAL A 1 30  ? -8.650  11.261  1.949   1.00 1.29  ? 30   VAL A HG22 4  
ATOM   10080 H HG23 . VAL A 1 30  ? -8.030  12.901  2.127   1.00 1.35  ? 30   VAL A HG23 4  
ATOM   10081 N N    . GLU A 1 31  ? -8.120  14.898  3.405   1.00 0.78  ? 31   GLU A N    4  
ATOM   10082 C CA   . GLU A 1 31  ? -7.127  15.937  3.597   1.00 0.83  ? 31   GLU A CA   4  
ATOM   10083 C C    . GLU A 1 31  ? -7.475  17.126  2.719   1.00 0.88  ? 31   GLU A C    4  
ATOM   10084 O O    . GLU A 1 31  ? -6.746  18.117  2.660   1.00 0.98  ? 31   GLU A O    4  
ATOM   10085 C CB   . GLU A 1 31  ? -5.721  15.417  3.293   1.00 0.93  ? 31   GLU A CB   4  
ATOM   10086 C CG   . GLU A 1 31  ? -5.584  14.799  1.916   1.00 1.05  ? 31   GLU A CG   4  
ATOM   10087 C CD   . GLU A 1 31  ? -4.183  14.304  1.636   1.00 2.05  ? 31   GLU A CD   4  
ATOM   10088 O OE1  . GLU A 1 31  ? -3.355  15.097  1.154   1.00 2.46  ? 31   GLU A OE1  4  
ATOM   10089 O OE2  . GLU A 1 31  ? -3.907  13.112  1.903   1.00 2.74  ? 31   GLU A OE2  4  
ATOM   10090 H H    . GLU A 1 31  ? -8.028  14.286  2.652   1.00 0.75  ? 31   GLU A H    4  
ATOM   10091 H HA   . GLU A 1 31  ? -7.174  16.245  4.631   1.00 0.84  ? 31   GLU A HA   4  
ATOM   10092 H HB2  . GLU A 1 31  ? -5.021  16.237  3.366   1.00 1.51  ? 31   GLU A HB2  4  
ATOM   10093 H HB3  . GLU A 1 31  ? -5.461  14.669  4.027   1.00 1.30  ? 31   GLU A HB3  4  
ATOM   10094 H HG2  . GLU A 1 31  ? -6.265  13.964  1.840   1.00 1.41  ? 31   GLU A HG2  4  
ATOM   10095 H HG3  . GLU A 1 31  ? -5.843  15.541  1.176   1.00 1.38  ? 31   GLU A HG3  4  
ATOM   10096 N N    . GLU A 1 32  ? -8.596  16.992  2.020   1.00 0.87  ? 32   GLU A N    4  
ATOM   10097 C CA   . GLU A 1 32  ? -9.085  18.032  1.138   1.00 0.98  ? 32   GLU A CA   4  
ATOM   10098 C C    . GLU A 1 32  ? -9.610  19.219  1.939   1.00 1.09  ? 32   GLU A C    4  
ATOM   10099 O O    . GLU A 1 32  ? -9.148  20.350  1.778   1.00 1.24  ? 32   GLU A O    4  
ATOM   10100 C CB   . GLU A 1 32  ? -10.203 17.492  0.239   1.00 0.98  ? 32   GLU A CB   4  
ATOM   10101 C CG   . GLU A 1 32  ? -10.925 18.597  -0.518  1.00 1.12  ? 32   GLU A CG   4  
ATOM   10102 C CD   . GLU A 1 32  ? -11.991 18.097  -1.465  1.00 1.20  ? 32   GLU A CD   4  
ATOM   10103 O OE1  . GLU A 1 32  ? -13.159 17.982  -1.043  1.00 1.17  ? 32   GLU A OE1  4  
ATOM   10104 O OE2  . GLU A 1 32  ? -11.674 17.861  -2.646  1.00 1.45  ? 32   GLU A OE2  4  
ATOM   10105 H H    . GLU A 1 32  ? -9.115  16.169  2.117   1.00 0.81  ? 32   GLU A H    4  
ATOM   10106 H HA   . GLU A 1 32  ? -8.265  18.354  0.521   1.00 1.06  ? 32   GLU A HA   4  
ATOM   10107 H HB2  . GLU A 1 32  ? -9.777  16.802  -0.478  1.00 0.98  ? 32   GLU A HB2  4  
ATOM   10108 H HB3  . GLU A 1 32  ? -10.923 16.966  0.853   1.00 0.94  ? 32   GLU A HB3  4  
ATOM   10109 H HG2  . GLU A 1 32  ? -11.397 19.248  0.203   1.00 1.13  ? 32   GLU A HG2  4  
ATOM   10110 H HG3  . GLU A 1 32  ? -10.197 19.161  -1.083  1.00 1.25  ? 32   GLU A HG3  4  
ATOM   10111 N N    . ASN A 1 33  ? -10.579 18.949  2.801   1.00 1.09  ? 33   ASN A N    4  
ATOM   10112 C CA   . ASN A 1 33  ? -11.250 20.003  3.546   1.00 1.27  ? 33   ASN A CA   4  
ATOM   10113 C C    . ASN A 1 33  ? -10.534 20.278  4.856   1.00 1.32  ? 33   ASN A C    4  
ATOM   10114 O O    . ASN A 1 33  ? -10.149 21.415  5.133   1.00 1.68  ? 33   ASN A O    4  
ATOM   10115 C CB   . ASN A 1 33  ? -12.708 19.625  3.791   1.00 1.36  ? 33   ASN A CB   4  
ATOM   10116 C CG   . ASN A 1 33  ? -13.522 19.643  2.513   1.00 1.48  ? 33   ASN A CG   4  
ATOM   10117 O OD1  . ASN A 1 33  ? -14.076 20.671  2.128   1.00 1.87  ? 33   ASN A OD1  4  
ATOM   10118 N ND2  . ASN A 1 33  ? -13.600 18.503  1.847   1.00 1.35  ? 33   ASN A ND2  4  
ATOM   10119 H H    . ASN A 1 33  ? -10.846 18.016  2.947   1.00 1.02  ? 33   ASN A H    4  
ATOM   10120 H HA   . ASN A 1 33  ? -11.219 20.899  2.944   1.00 1.40  ? 33   ASN A HA   4  
ATOM   10121 H HB2  . ASN A 1 33  ? -12.746 18.627  4.203   1.00 1.36  ? 33   ASN A HB2  4  
ATOM   10122 H HB3  . ASN A 1 33  ? -13.144 20.322  4.490   1.00 1.57  ? 33   ASN A HB3  4  
ATOM   10123 H HD21 . ASN A 1 33  ? -13.138 17.721  2.211   1.00 1.19  ? 33   ASN A HD21 4  
ATOM   10124 H HD22 . ASN A 1 33  ? -14.115 18.487  1.010   1.00 1.55  ? 33   ASN A HD22 4  
ATOM   10125 N N    . ARG A 1 34  ? -10.353 19.242  5.659   1.00 1.22  ? 34   ARG A N    4  
ATOM   10126 C CA   . ARG A 1 34  ? -9.573  19.367  6.879   1.00 1.29  ? 34   ARG A CA   4  
ATOM   10127 C C    . ARG A 1 34  ? -8.122  19.022  6.581   1.00 1.17  ? 34   ARG A C    4  
ATOM   10128 O O    . ARG A 1 34  ? -7.830  18.323  5.612   1.00 1.24  ? 34   ARG A O    4  
ATOM   10129 C CB   . ARG A 1 34  ? -10.117 18.463  7.993   1.00 1.50  ? 34   ARG A CB   4  
ATOM   10130 C CG   . ARG A 1 34  ? -10.090 16.984  7.651   1.00 1.52  ? 34   ARG A CG   4  
ATOM   10131 C CD   . ARG A 1 34  ? -10.504 16.123  8.832   1.00 1.91  ? 34   ARG A CD   4  
ATOM   10132 N NE   . ARG A 1 34  ? -9.544  16.190  9.935   1.00 2.18  ? 34   ARG A NE   4  
ATOM   10133 C CZ   . ARG A 1 34  ? -9.404  15.237  10.859  1.00 2.65  ? 34   ARG A CZ   4  
ATOM   10134 N NH1  . ARG A 1 34  ? -10.133 14.131  10.789  1.00 2.89  ? 34   ARG A NH1  4  
ATOM   10135 N NH2  . ARG A 1 34  ? -8.524  15.388  11.842  1.00 3.39  ? 34   ARG A NH2  4  
ATOM   10136 H H    . ARG A 1 34  ? -10.737 18.373  5.421   1.00 1.29  ? 34   ARG A H    4  
ATOM   10137 H HA   . ARG A 1 34  ? -9.627  20.397  7.201   1.00 1.52  ? 34   ARG A HA   4  
ATOM   10138 H HB2  . ARG A 1 34  ? -9.525  18.614  8.883   1.00 1.67  ? 34   ARG A HB2  4  
ATOM   10139 H HB3  . ARG A 1 34  ? -11.139 18.743  8.200   1.00 1.85  ? 34   ARG A HB3  4  
ATOM   10140 H HG2  . ARG A 1 34  ? -10.769 16.802  6.832   1.00 1.71  ? 34   ARG A HG2  4  
ATOM   10141 H HG3  . ARG A 1 34  ? -9.087  16.714  7.355   1.00 1.50  ? 34   ARG A HG3  4  
ATOM   10142 H HD2  . ARG A 1 34  ? -11.465 16.462  9.187   1.00 2.31  ? 34   ARG A HD2  4  
ATOM   10143 H HD3  . ARG A 1 34  ? -10.585 15.098  8.500   1.00 2.37  ? 34   ARG A HD3  4  
ATOM   10144 H HE   . ARG A 1 34  ? -8.973  16.998  9.994   1.00 2.49  ? 34   ARG A HE   4  
ATOM   10145 H HH11 . ARG A 1 34  ? -10.785 14.007  10.040  1.00 2.91  ? 34   ARG A HH11 4  
ATOM   10146 H HH12 . ARG A 1 34  ? -10.034 13.411  11.487  1.00 3.40  ? 34   ARG A HH12 4  
ATOM   10147 H HH21 . ARG A 1 34  ? -7.962  16.218  11.893  1.00 3.75  ? 34   ARG A HH21 4  
ATOM   10148 H HH22 . ARG A 1 34  ? -8.419  14.672  12.547  1.00 3.82  ? 34   ARG A HH22 4  
ATOM   10149 N N    . THR A 1 35  ? -7.217  19.511  7.401   1.00 1.31  ? 35   THR A N    4  
ATOM   10150 C CA   . THR A 1 35  ? -5.803  19.270  7.186   1.00 1.39  ? 35   THR A CA   4  
ATOM   10151 C C    . THR A 1 35  ? -5.282  18.214  8.148   1.00 1.34  ? 35   THR A C    4  
ATOM   10152 O O    . THR A 1 35  ? -5.163  18.445  9.353   1.00 1.55  ? 35   THR A O    4  
ATOM   10153 C CB   . THR A 1 35  ? -4.981  20.560  7.322   1.00 1.82  ? 35   THR A CB   4  
ATOM   10154 O OG1  . THR A 1 35  ? -5.364  21.289  8.500   1.00 2.05  ? 35   THR A OG1  4  
ATOM   10155 C CG2  . THR A 1 35  ? -5.157  21.440  6.096   1.00 2.25  ? 35   THR A CG2  4  
ATOM   10156 H H    . THR A 1 35  ? -7.508  20.034  8.182   1.00 1.51  ? 35   THR A H    4  
ATOM   10157 H HA   . THR A 1 35  ? -5.685  18.901  6.177   1.00 1.50  ? 35   THR A HA   4  
ATOM   10158 H HB   . THR A 1 35  ? -3.939  20.285  7.398   1.00 1.91  ? 35   THR A HB   4  
ATOM   10159 H HG1  . THR A 1 35  ? -6.255  21.016  8.776   1.00 2.37  ? 35   THR A HG1  4  
ATOM   10160 H HG21 . THR A 1 35  ? -4.809  20.911  5.221   1.00 2.57  ? 35   THR A HG21 4  
ATOM   10161 H HG22 . THR A 1 35  ? -4.586  22.348  6.219   1.00 2.67  ? 35   THR A HG22 4  
ATOM   10162 H HG23 . THR A 1 35  ? -6.202  21.684  5.976   1.00 2.39  ? 35   THR A HG23 4  
ATOM   10163 N N    . GLU A 1 36  ? -5.005  17.044  7.605   1.00 1.44  ? 36   GLU A N    4  
ATOM   10164 C CA   . GLU A 1 36  ? -4.573  15.909  8.404   1.00 1.68  ? 36   GLU A CA   4  
ATOM   10165 C C    . GLU A 1 36  ? -3.072  15.689  8.255   1.00 1.43  ? 36   GLU A C    4  
ATOM   10166 O O    . GLU A 1 36  ? -2.277  16.161  9.069   1.00 1.46  ? 36   GLU A O    4  
ATOM   10167 C CB   . GLU A 1 36  ? -5.323  14.643  7.982   1.00 2.17  ? 36   GLU A CB   4  
ATOM   10168 C CG   . GLU A 1 36  ? -6.834  14.801  7.944   1.00 2.49  ? 36   GLU A CG   4  
ATOM   10169 C CD   . GLU A 1 36  ? -7.525  13.559  7.425   1.00 2.96  ? 36   GLU A CD   4  
ATOM   10170 O OE1  . GLU A 1 36  ? -7.220  13.126  6.291   1.00 3.34  ? 36   GLU A OE1  4  
ATOM   10171 O OE2  . GLU A 1 36  ? -8.396  13.022  8.135   1.00 3.30  ? 36   GLU A OE2  4  
ATOM   10172 H H    . GLU A 1 36  ? -5.078  16.949  6.634   1.00 1.59  ? 36   GLU A H    4  
ATOM   10173 H HA   . GLU A 1 36  ? -4.796  16.125  9.438   1.00 1.91  ? 36   GLU A HA   4  
ATOM   10174 H HB2  . GLU A 1 36  ? -4.989  14.354  6.996   1.00 2.46  ? 36   GLU A HB2  4  
ATOM   10175 H HB3  . GLU A 1 36  ? -5.084  13.852  8.677   1.00 2.51  ? 36   GLU A HB3  4  
ATOM   10176 H HG2  . GLU A 1 36  ? -7.189  15.002  8.943   1.00 2.59  ? 36   GLU A HG2  4  
ATOM   10177 H HG3  . GLU A 1 36  ? -7.082  15.631  7.298   1.00 2.88  ? 36   GLU A HG3  4  
ATOM   10178 N N    . ALA A 1 37  ? -2.691  14.977  7.206   1.00 1.50  ? 37   ALA A N    4  
ATOM   10179 C CA   . ALA A 1 37  ? -1.292  14.680  6.946   1.00 1.39  ? 37   ALA A CA   4  
ATOM   10180 C C    . ALA A 1 37  ? -0.729  15.589  5.864   1.00 1.27  ? 37   ALA A C    4  
ATOM   10181 O O    . ALA A 1 37  ? -1.471  16.080  5.011   1.00 1.58  ? 37   ALA A O    4  
ATOM   10182 C CB   . ALA A 1 37  ? -1.138  13.224  6.535   1.00 1.92  ? 37   ALA A CB   4  
ATOM   10183 H H    . ALA A 1 37  ? -3.371  14.645  6.583   1.00 1.80  ? 37   ALA A H    4  
ATOM   10184 H HA   . ALA A 1 37  ? -0.740  14.833  7.861   1.00 1.33  ? 37   ALA A HA   4  
ATOM   10185 H HB1  . ALA A 1 37  ? -0.094  13.001  6.382   1.00 2.29  ? 37   ALA A HB1  4  
ATOM   10186 H HB2  . ALA A 1 37  ? -1.681  13.050  5.617   1.00 2.44  ? 37   ALA A HB2  4  
ATOM   10187 H HB3  . ALA A 1 37  ? -1.533  12.586  7.312   1.00 2.11  ? 37   ALA A HB3  4  
ATOM   10188 N N    . PRO A 1 38  ? 0.585   15.859  5.910   1.00 1.10  ? 38   PRO A N    4  
ATOM   10189 C CA   . PRO A 1 38  ? 1.304   16.510  4.809   1.00 1.43  ? 38   PRO A CA   4  
ATOM   10190 C C    . PRO A 1 38  ? 1.240   15.663  3.540   1.00 1.79  ? 38   PRO A C    4  
ATOM   10191 O O    . PRO A 1 38  ? 0.810   14.511  3.581   1.00 1.87  ? 38   PRO A O    4  
ATOM   10192 C CB   . PRO A 1 38  ? 2.749   16.611  5.335   1.00 1.34  ? 38   PRO A CB   4  
ATOM   10193 C CG   . PRO A 1 38  ? 2.616   16.516  6.812   1.00 1.26  ? 38   PRO A CG   4  
ATOM   10194 C CD   . PRO A 1 38  ? 1.467   15.587  7.053   1.00 1.01  ? 38   PRO A CD   4  
ATOM   10195 H HA   . PRO A 1 38  ? 0.915   17.496  4.607   1.00 1.71  ? 38   PRO A HA   4  
ATOM   10196 H HB2  . PRO A 1 38  ? 3.355   15.800  4.943   1.00 1.29  ? 38   PRO A HB2  4  
ATOM   10197 H HB3  . PRO A 1 38  ? 3.176   17.555  5.041   1.00 1.71  ? 38   PRO A HB3  4  
ATOM   10198 H HG2  . PRO A 1 38  ? 3.521   16.104  7.232   1.00 1.41  ? 38   PRO A HG2  4  
ATOM   10199 H HG3  . PRO A 1 38  ? 2.410   17.489  7.231   1.00 1.71  ? 38   PRO A HG3  4  
ATOM   10200 H HD2  . PRO A 1 38  ? 1.805   14.563  7.047   1.00 1.08  ? 38   PRO A HD2  4  
ATOM   10201 H HD3  . PRO A 1 38  ? 0.976   15.821  7.985   1.00 1.25  ? 38   PRO A HD3  4  
ATOM   10202 N N    . GLU A 1 39  ? 1.661   16.217  2.412   1.00 2.28  ? 39   GLU A N    4  
ATOM   10203 C CA   . GLU A 1 39  ? 1.609   15.480  1.155   1.00 2.76  ? 39   GLU A CA   4  
ATOM   10204 C C    . GLU A 1 39  ? 2.802   14.535  1.030   1.00 2.66  ? 39   GLU A C    4  
ATOM   10205 O O    . GLU A 1 39  ? 2.930   13.789  0.057   1.00 3.08  ? 39   GLU A O    4  
ATOM   10206 C CB   . GLU A 1 39  ? 1.550   16.436  -0.035  1.00 3.38  ? 39   GLU A CB   4  
ATOM   10207 C CG   . GLU A 1 39  ? 2.728   17.385  -0.131  1.00 3.52  ? 39   GLU A CG   4  
ATOM   10208 C CD   . GLU A 1 39  ? 2.632   18.283  -1.344  1.00 4.22  ? 39   GLU A CD   4  
ATOM   10209 O OE1  . GLU A 1 39  ? 2.975   17.830  -2.456  1.00 4.64  ? 39   GLU A OE1  4  
ATOM   10210 O OE2  . GLU A 1 39  ? 2.235   19.455  -1.188  1.00 4.44  ? 39   GLU A OE2  4  
ATOM   10211 H H    . GLU A 1 39  ? 2.006   17.136  2.421   1.00 2.42  ? 39   GLU A H    4  
ATOM   10212 H HA   . GLU A 1 39  ? 0.708   14.890  1.170   1.00 2.84  ? 39   GLU A HA   4  
ATOM   10213 H HB2  . GLU A 1 39  ? 1.512   15.854  -0.944  1.00 3.74  ? 39   GLU A HB2  4  
ATOM   10214 H HB3  . GLU A 1 39  ? 0.648   17.025  0.039   1.00 3.48  ? 39   GLU A HB3  4  
ATOM   10215 H HG2  . GLU A 1 39  ? 2.755   18.000  0.756   1.00 3.29  ? 39   GLU A HG2  4  
ATOM   10216 H HG3  . GLU A 1 39  ? 3.638   16.806  -0.198  1.00 3.47  ? 39   GLU A HG3  4  
ATOM   10217 N N    . GLY A 1 40  ? 3.668   14.572  2.028   1.00 2.15  ? 40   GLY A N    4  
ATOM   10218 C CA   . GLY A 1 40  ? 4.803   13.678  2.067   1.00 2.04  ? 40   GLY A CA   4  
ATOM   10219 C C    . GLY A 1 40  ? 5.770   14.050  3.158   1.00 1.57  ? 40   GLY A C    4  
ATOM   10220 O O    . GLY A 1 40  ? 6.883   14.496  2.883   1.00 1.75  ? 40   GLY A O    4  
ATOM   10221 H H    . GLY A 1 40  ? 3.534   15.216  2.752   1.00 1.90  ? 40   GLY A H    4  
ATOM   10222 H HA2  . GLY A 1 40  ? 4.449   12.673  2.244   1.00 2.04  ? 40   GLY A HA2  4  
ATOM   10223 H HA3  . GLY A 1 40  ? 5.314   13.712  1.116   1.00 2.40  ? 40   GLY A HA3  4  
ATOM   10224 N N    . THR A 1 41  ? 5.355   13.875  4.408   1.00 1.12  ? 41   THR A N    4  
ATOM   10225 C CA   . THR A 1 41  ? 6.201   14.260  5.522   1.00 0.86  ? 41   THR A CA   4  
ATOM   10226 C C    . THR A 1 41  ? 7.264   13.175  5.795   1.00 0.75  ? 41   THR A C    4  
ATOM   10227 O O    . THR A 1 41  ? 8.428   13.345  5.433   1.00 0.85  ? 41   THR A O    4  
ATOM   10228 C CB   . THR A 1 41  ? 5.351   14.561  6.784   1.00 0.80  ? 41   THR A CB   4  
ATOM   10229 O OG1  . THR A 1 41  ? 6.188   14.790  7.926   1.00 0.95  ? 41   THR A OG1  4  
ATOM   10230 C CG2  . THR A 1 41  ? 4.356   13.446  7.074   1.00 0.91  ? 41   THR A CG2  4  
ATOM   10231 H H    . THR A 1 41  ? 4.471   13.477  4.578   1.00 1.17  ? 41   THR A H    4  
ATOM   10232 H HA   . THR A 1 41  ? 6.698   15.174  5.235   1.00 1.14  ? 41   THR A HA   4  
ATOM   10233 H HB   . THR A 1 41  ? 4.789   15.465  6.595   1.00 0.93  ? 41   THR A HB   4  
ATOM   10234 H HG1  . THR A 1 41  ? 6.325   13.958  8.410   1.00 1.29  ? 41   THR A HG1  4  
ATOM   10235 H HG21 . THR A 1 41  ? 3.752   13.716  7.926   1.00 1.35  ? 41   THR A HG21 4  
ATOM   10236 H HG22 . THR A 1 41  ? 4.890   12.532  7.283   1.00 1.45  ? 41   THR A HG22 4  
ATOM   10237 H HG23 . THR A 1 41  ? 3.721   13.305  6.212   1.00 1.31  ? 41   THR A HG23 4  
ATOM   10238 N N    . GLU A 1 42  ? 6.863   12.060  6.402   1.00 0.69  ? 42   GLU A N    4  
ATOM   10239 C CA   . GLU A 1 42  ? 7.738   10.899  6.549   1.00 0.66  ? 42   GLU A CA   4  
ATOM   10240 C C    . GLU A 1 42  ? 7.498   9.928   5.410   1.00 0.54  ? 42   GLU A C    4  
ATOM   10241 O O    . GLU A 1 42  ? 8.393   9.222   4.946   1.00 0.56  ? 42   GLU A O    4  
ATOM   10242 C CB   . GLU A 1 42  ? 7.463   10.181  7.872   1.00 0.74  ? 42   GLU A CB   4  
ATOM   10243 C CG   . GLU A 1 42  ? 6.116   9.463   7.935   1.00 0.65  ? 42   GLU A CG   4  
ATOM   10244 C CD   . GLU A 1 42  ? 5.928   8.707   9.234   1.00 1.20  ? 42   GLU A CD   4  
ATOM   10245 O OE1  . GLU A 1 42  ? 6.579   7.656   9.414   1.00 2.02  ? 42   GLU A OE1  4  
ATOM   10246 O OE2  . GLU A 1 42  ? 5.115   9.150   10.071  1.00 1.17  ? 42   GLU A OE2  4  
ATOM   10247 H H    . GLU A 1 42  ? 5.960   12.021  6.777   1.00 0.76  ? 42   GLU A H    4  
ATOM   10248 H HA   . GLU A 1 42  ? 8.763   11.235  6.525   1.00 0.71  ? 42   GLU A HA   4  
ATOM   10249 H HB2  . GLU A 1 42  ? 8.237   9.450   8.031   1.00 0.79  ? 42   GLU A HB2  4  
ATOM   10250 H HB3  . GLU A 1 42  ? 7.495   10.907  8.669   1.00 0.86  ? 42   GLU A HB3  4  
ATOM   10251 H HG2  . GLU A 1 42  ? 5.326   10.194  7.845   1.00 0.88  ? 42   GLU A HG2  4  
ATOM   10252 H HG3  . GLU A 1 42  ? 6.049   8.757   7.109   1.00 0.91  ? 42   GLU A HG3  4  
ATOM   10253 N N    . SER A 1 43  ? 6.256   9.927   4.984   1.00 0.48  ? 43   SER A N    4  
ATOM   10254 C CA   . SER A 1 43  ? 5.706   8.901   4.129   1.00 0.43  ? 43   SER A CA   4  
ATOM   10255 C C    . SER A 1 43  ? 6.356   8.793   2.769   1.00 0.43  ? 43   SER A C    4  
ATOM   10256 O O    . SER A 1 43  ? 6.275   7.739   2.166   1.00 0.49  ? 43   SER A O    4  
ATOM   10257 C CB   . SER A 1 43  ? 4.240   9.174   3.927   1.00 0.50  ? 43   SER A CB   4  
ATOM   10258 O OG   . SER A 1 43  ? 3.545   9.171   5.160   1.00 1.25  ? 43   SER A OG   4  
ATOM   10259 H H    . SER A 1 43  ? 5.665   10.638  5.295   1.00 0.54  ? 43   SER A H    4  
ATOM   10260 H HA   . SER A 1 43  ? 5.806   7.958   4.638   1.00 0.49  ? 43   SER A HA   4  
ATOM   10261 H HB2  . SER A 1 43  ? 4.127   10.135  3.470   1.00 0.71  ? 43   SER A HB2  4  
ATOM   10262 H HB3  . SER A 1 43  ? 3.830   8.420   3.274   1.00 0.91  ? 43   SER A HB3  4  
ATOM   10263 H HG   . SER A 1 43  ? 3.042   9.997   5.253   1.00 1.24  ? 43   SER A HG   4  
ATOM   10264 N N    . GLU A 1 44  ? 6.962   9.869   2.285   1.00 0.46  ? 44   GLU A N    4  
ATOM   10265 C CA   . GLU A 1 44  ? 7.475   9.922   0.909   1.00 0.52  ? 44   GLU A CA   4  
ATOM   10266 C C    . GLU A 1 44  ? 8.119   8.601   0.479   1.00 0.51  ? 44   GLU A C    4  
ATOM   10267 O O    . GLU A 1 44  ? 7.698   8.006   -0.507  1.00 0.58  ? 44   GLU A O    4  
ATOM   10268 C CB   . GLU A 1 44  ? 8.463   11.075  0.726   1.00 0.61  ? 44   GLU A CB   4  
ATOM   10269 C CG   . GLU A 1 44  ? 9.066   11.124  -0.671  1.00 0.72  ? 44   GLU A CG   4  
ATOM   10270 C CD   . GLU A 1 44  ? 9.858   12.385  -0.934  1.00 1.17  ? 44   GLU A CD   4  
ATOM   10271 O OE1  . GLU A 1 44  ? 10.877  12.606  -0.247  1.00 1.91  ? 44   GLU A OE1  4  
ATOM   10272 O OE2  . GLU A 1 44  ? 9.469   13.166  -1.825  1.00 1.29  ? 44   GLU A OE2  4  
ATOM   10273 H H    . GLU A 1 44  ? 7.059   10.650  2.863   1.00 0.47  ? 44   GLU A H    4  
ATOM   10274 H HA   . GLU A 1 44  ? 6.625   10.100  0.265   1.00 0.54  ? 44   GLU A HA   4  
ATOM   10275 H HB2  . GLU A 1 44  ? 7.948   12.006  0.907   1.00 0.63  ? 44   GLU A HB2  4  
ATOM   10276 H HB3  . GLU A 1 44  ? 9.266   10.968  1.439   1.00 0.61  ? 44   GLU A HB3  4  
ATOM   10277 H HG2  . GLU A 1 44  ? 9.723   10.276  -0.793  1.00 1.13  ? 44   GLU A HG2  4  
ATOM   10278 H HG3  . GLU A 1 44  ? 8.266   11.062  -1.395  1.00 1.04  ? 44   GLU A HG3  4  
ATOM   10279 N N    . ALA A 1 45  ? 9.096   8.121   1.234   1.00 0.48  ? 45   ALA A N    4  
ATOM   10280 C CA   . ALA A 1 45  ? 9.751   6.860   0.904   1.00 0.48  ? 45   ALA A CA   4  
ATOM   10281 C C    . ALA A 1 45  ? 8.828   5.662   1.138   1.00 0.41  ? 45   ALA A C    4  
ATOM   10282 O O    . ALA A 1 45  ? 8.803   4.732   0.332   1.00 0.41  ? 45   ALA A O    4  
ATOM   10283 C CB   . ALA A 1 45  ? 11.035  6.706   1.704   1.00 0.52  ? 45   ALA A CB   4  
ATOM   10284 H H    . ALA A 1 45  ? 9.391   8.629   2.023   1.00 0.49  ? 45   ALA A H    4  
ATOM   10285 H HA   . ALA A 1 45  ? 10.014  6.887   -0.147  1.00 0.52  ? 45   ALA A HA   4  
ATOM   10286 H HB1  . ALA A 1 45  ? 11.677  7.554   1.520   1.00 1.14  ? 45   ALA A HB1  4  
ATOM   10287 H HB2  . ALA A 1 45  ? 11.539  5.798   1.403   1.00 1.18  ? 45   ALA A HB2  4  
ATOM   10288 H HB3  . ALA A 1 45  ? 10.799  6.654   2.757   1.00 1.13  ? 45   ALA A HB3  4  
ATOM   10289 N N    . VAL A 1 46  ? 8.058   5.691   2.225   1.00 0.37  ? 46   VAL A N    4  
ATOM   10290 C CA   . VAL A 1 46  ? 7.198   4.559   2.577   1.00 0.34  ? 46   VAL A CA   4  
ATOM   10291 C C    . VAL A 1 46  ? 6.059   4.389   1.559   1.00 0.34  ? 46   VAL A C    4  
ATOM   10292 O O    . VAL A 1 46  ? 5.781   3.274   1.119   1.00 0.39  ? 46   VAL A O    4  
ATOM   10293 C CB   . VAL A 1 46  ? 6.633   4.654   4.030   1.00 0.49  ? 46   VAL A CB   4  
ATOM   10294 C CG1  . VAL A 1 46  ? 7.261   5.775   4.824   1.00 1.41  ? 46   VAL A CG1  4  
ATOM   10295 C CG2  . VAL A 1 46  ? 5.134   4.817   4.069   1.00 1.13  ? 46   VAL A CG2  4  
ATOM   10296 H H    . VAL A 1 46  ? 8.065   6.486   2.797   1.00 0.38  ? 46   VAL A H    4  
ATOM   10297 H HA   . VAL A 1 46  ? 7.813   3.674   2.528   1.00 0.36  ? 46   VAL A HA   4  
ATOM   10298 H HB   . VAL A 1 46  ? 6.872   3.729   4.533   1.00 1.47  ? 46   VAL A HB   4  
ATOM   10299 H HG11 . VAL A 1 46  ? 8.265   5.501   5.108   1.00 2.01  ? 46   VAL A HG11 4  
ATOM   10300 H HG12 . VAL A 1 46  ? 6.660   5.949   5.711   1.00 1.93  ? 46   VAL A HG12 4  
ATOM   10301 H HG13 . VAL A 1 46  ? 7.282   6.671   4.224   1.00 2.01  ? 46   VAL A HG13 4  
ATOM   10302 H HG21 . VAL A 1 46  ? 4.874   5.827   3.761   1.00 1.65  ? 46   VAL A HG21 4  
ATOM   10303 H HG22 . VAL A 1 46  ? 4.787   4.646   5.079   1.00 1.69  ? 46   VAL A HG22 4  
ATOM   10304 H HG23 . VAL A 1 46  ? 4.680   4.103   3.399   1.00 1.88  ? 46   VAL A HG23 4  
ATOM   10305 N N    . LYS A 1 47  ? 5.421   5.491   1.168   1.00 0.34  ? 47   LYS A N    4  
ATOM   10306 C CA   . LYS A 1 47  ? 4.340   5.443   0.190   1.00 0.36  ? 47   LYS A CA   4  
ATOM   10307 C C    . LYS A 1 47  ? 4.908   5.102   -1.180  1.00 0.39  ? 47   LYS A C    4  
ATOM   10308 O O    . LYS A 1 47  ? 4.315   4.337   -1.940  1.00 0.43  ? 47   LYS A O    4  
ATOM   10309 C CB   . LYS A 1 47  ? 3.589   6.779   0.133   1.00 0.38  ? 47   LYS A CB   4  
ATOM   10310 C CG   . LYS A 1 47  ? 4.496   7.959   -0.154  1.00 0.49  ? 47   LYS A CG   4  
ATOM   10311 C CD   . LYS A 1 47  ? 3.735   9.239   -0.415  1.00 0.47  ? 47   LYS A CD   4  
ATOM   10312 C CE   . LYS A 1 47  ? 2.981   9.688   0.808   1.00 0.47  ? 47   LYS A CE   4  
ATOM   10313 N NZ   . LYS A 1 47  ? 2.479   11.082  0.672   1.00 0.67  ? 47   LYS A NZ   4  
ATOM   10314 H H    . LYS A 1 47  ? 5.691   6.359   1.545   1.00 0.36  ? 47   LYS A H    4  
ATOM   10315 H HA   . LYS A 1 47  ? 3.654   4.665   0.491   1.00 0.36  ? 47   LYS A HA   4  
ATOM   10316 H HB2  . LYS A 1 47  ? 2.840   6.727   -0.644  1.00 0.47  ? 47   LYS A HB2  4  
ATOM   10317 H HB3  . LYS A 1 47  ? 3.103   6.947   1.082   1.00 0.38  ? 47   LYS A HB3  4  
ATOM   10318 H HG2  . LYS A 1 47  ? 5.140   8.114   0.696   1.00 0.64  ? 47   LYS A HG2  4  
ATOM   10319 H HG3  . LYS A 1 47  ? 5.093   7.731   -1.012  1.00 0.78  ? 47   LYS A HG3  4  
ATOM   10320 H HD2  . LYS A 1 47  ? 4.435   10.006  -0.684  1.00 0.84  ? 47   LYS A HD2  4  
ATOM   10321 H HD3  . LYS A 1 47  ? 3.037   9.079   -1.222  1.00 0.74  ? 47   LYS A HD3  4  
ATOM   10322 H HE2  . LYS A 1 47  ? 2.146   9.022   0.958   1.00 0.52  ? 47   LYS A HE2  4  
ATOM   10323 H HE3  . LYS A 1 47  ? 3.645   9.628   1.655   1.00 0.75  ? 47   LYS A HE3  4  
ATOM   10324 H HZ1  . LYS A 1 47  ? 2.174   11.446  1.603   1.00 1.13  ? 47   LYS A HZ1  4  
ATOM   10325 H HZ2  . LYS A 1 47  ? 1.667   11.112  0.015   1.00 1.14  ? 47   LYS A HZ2  4  
ATOM   10326 H HZ3  . LYS A 1 47  ? 3.227   11.702  0.300   1.00 1.38  ? 47   LYS A HZ3  4  
ATOM   10327 N N    . GLN A 1 48  ? 6.073   5.673   -1.481  1.00 0.40  ? 48   GLN A N    4  
ATOM   10328 C CA   . GLN A 1 48  ? 6.793   5.345   -2.707  1.00 0.46  ? 48   GLN A CA   4  
ATOM   10329 C C    . GLN A 1 48  ? 7.125   3.862   -2.769  1.00 0.45  ? 48   GLN A C    4  
ATOM   10330 O O    . GLN A 1 48  ? 7.157   3.283   -3.842  1.00 0.50  ? 48   GLN A O    4  
ATOM   10331 C CB   . GLN A 1 48  ? 8.085   6.153   -2.834  1.00 0.52  ? 48   GLN A CB   4  
ATOM   10332 C CG   . GLN A 1 48  ? 7.908   7.514   -3.483  1.00 0.58  ? 48   GLN A CG   4  
ATOM   10333 C CD   . GLN A 1 48  ? 7.221   7.465   -4.840  1.00 0.67  ? 48   GLN A CD   4  
ATOM   10334 O OE1  . GLN A 1 48  ? 6.560   8.424   -5.239  1.00 0.99  ? 48   GLN A OE1  4  
ATOM   10335 N NE2  . GLN A 1 48  ? 7.348   6.351   -5.554  1.00 0.63  ? 48   GLN A NE2  4  
ATOM   10336 H H    . GLN A 1 48  ? 6.443   6.351   -0.867  1.00 0.39  ? 48   GLN A H    4  
ATOM   10337 H HA   . GLN A 1 48  ? 6.150   5.589   -3.538  1.00 0.48  ? 48   GLN A HA   4  
ATOM   10338 H HB2  . GLN A 1 48  ? 8.493   6.306   -1.846  1.00 0.49  ? 48   GLN A HB2  4  
ATOM   10339 H HB3  . GLN A 1 48  ? 8.796   5.590   -3.417  1.00 0.58  ? 48   GLN A HB3  4  
ATOM   10340 H HG2  . GLN A 1 48  ? 7.320   8.133   -2.825  1.00 0.58  ? 48   GLN A HG2  4  
ATOM   10341 H HG3  . GLN A 1 48  ? 8.885   7.955   -3.611  1.00 0.65  ? 48   GLN A HG3  4  
ATOM   10342 H HE21 . GLN A 1 48  ? 7.866   5.605   -5.176  1.00 0.74  ? 48   GLN A HE21 4  
ATOM   10343 H HE22 . GLN A 1 48  ? 6.932   6.325   -6.444  1.00 0.66  ? 48   GLN A HE22 4  
ATOM   10344 N N    . ALA A 1 49  ? 7.386   3.260   -1.620  1.00 0.42  ? 49   ALA A N    4  
ATOM   10345 C CA   . ALA A 1 49  ? 7.669   1.834   -1.552  1.00 0.41  ? 49   ALA A CA   4  
ATOM   10346 C C    . ALA A 1 49  ? 6.385   1.023   -1.678  1.00 0.39  ? 49   ALA A C    4  
ATOM   10347 O O    . ALA A 1 49  ? 6.341   -0.009  -2.350  1.00 0.42  ? 49   ALA A O    4  
ATOM   10348 C CB   . ALA A 1 49  ? 8.369   1.505   -0.247  1.00 0.42  ? 49   ALA A CB   4  
ATOM   10349 H H    . ALA A 1 49  ? 7.398   3.791   -0.792  1.00 0.42  ? 49   ALA A H    4  
ATOM   10350 H HA   . ALA A 1 49  ? 8.332   1.582   -2.365  1.00 0.45  ? 49   ALA A HA   4  
ATOM   10351 H HB1  . ALA A 1 49  ? 8.621   0.455   -0.228  1.00 1.14  ? 49   ALA A HB1  4  
ATOM   10352 H HB2  . ALA A 1 49  ? 7.713   1.737   0.581   1.00 1.06  ? 49   ALA A HB2  4  
ATOM   10353 H HB3  . ALA A 1 49  ? 9.272   2.092   -0.166  1.00 1.08  ? 49   ALA A HB3  4  
ATOM   10354 N N    . LEU A 1 50  ? 5.337   1.523   -1.046  1.00 0.38  ? 50   LEU A N    4  
ATOM   10355 C CA   . LEU A 1 50  ? 4.060   0.826   -0.962  1.00 0.40  ? 50   LEU A CA   4  
ATOM   10356 C C    . LEU A 1 50  ? 3.384   0.679   -2.320  1.00 0.41  ? 50   LEU A C    4  
ATOM   10357 O O    . LEU A 1 50  ? 2.620   -0.259  -2.534  1.00 0.43  ? 50   LEU A O    4  
ATOM   10358 C CB   . LEU A 1 50  ? 3.134   1.571   -0.006  1.00 0.45  ? 50   LEU A CB   4  
ATOM   10359 C CG   . LEU A 1 50  ? 2.758   0.810   1.265   1.00 0.69  ? 50   LEU A CG   4  
ATOM   10360 C CD1  . LEU A 1 50  ? 4.001   0.311   1.980   1.00 1.33  ? 50   LEU A CD1  4  
ATOM   10361 C CD2  . LEU A 1 50  ? 1.947   1.701   2.184   1.00 1.20  ? 50   LEU A CD2  4  
ATOM   10362 H H    . LEU A 1 50  ? 5.426   2.395   -0.601  1.00 0.39  ? 50   LEU A H    4  
ATOM   10363 H HA   . LEU A 1 50  ? 4.249   -0.158  -0.562  1.00 0.43  ? 50   LEU A HA   4  
ATOM   10364 H HB2  . LEU A 1 50  ? 3.618   2.492   0.283   1.00 0.74  ? 50   LEU A HB2  4  
ATOM   10365 H HB3  . LEU A 1 50  ? 2.224   1.812   -0.535  1.00 0.48  ? 50   LEU A HB3  4  
ATOM   10366 H HG   . LEU A 1 50  ? 2.153   -0.045  1.004   1.00 1.64  ? 50   LEU A HG   4  
ATOM   10367 H HD11 . LEU A 1 50  ? 4.534   -0.378  1.337   1.00 1.95  ? 50   LEU A HD11 4  
ATOM   10368 H HD12 . LEU A 1 50  ? 3.714   -0.195  2.890   1.00 1.77  ? 50   LEU A HD12 4  
ATOM   10369 H HD13 . LEU A 1 50  ? 4.639   1.148   2.218   1.00 1.93  ? 50   LEU A HD13 4  
ATOM   10370 H HD21 . LEU A 1 50  ? 1.693   1.154   3.080   1.00 1.81  ? 50   LEU A HD21 4  
ATOM   10371 H HD22 . LEU A 1 50  ? 1.043   2.008   1.680   1.00 1.85  ? 50   LEU A HD22 4  
ATOM   10372 H HD23 . LEU A 1 50  ? 2.527   2.573   2.446   1.00 1.62  ? 50   LEU A HD23 4  
ATOM   10373 N N    . ARG A 1 51  ? 3.683   1.576   -3.247  1.00 0.44  ? 51   ARG A N    4  
ATOM   10374 C CA   . ARG A 1 51  ? 3.002   1.572   -4.533  1.00 0.50  ? 51   ARG A CA   4  
ATOM   10375 C C    . ARG A 1 51  ? 3.669   0.570   -5.450  1.00 0.52  ? 51   ARG A C    4  
ATOM   10376 O O    . ARG A 1 51  ? 3.049   -0.001  -6.348  1.00 0.59  ? 51   ARG A O    4  
ATOM   10377 C CB   . ARG A 1 51  ? 3.047   2.961   -5.157  1.00 0.53  ? 51   ARG A CB   4  
ATOM   10378 C CG   . ARG A 1 51  ? 4.430   3.570   -5.094  1.00 0.52  ? 51   ARG A CG   4  
ATOM   10379 C CD   . ARG A 1 51  ? 4.570   4.763   -6.005  1.00 0.73  ? 51   ARG A CD   4  
ATOM   10380 N NE   . ARG A 1 51  ? 3.638   5.839   -5.678  1.00 1.21  ? 51   ARG A NE   4  
ATOM   10381 C CZ   . ARG A 1 51  ? 3.563   6.983   -6.357  1.00 1.63  ? 51   ARG A CZ   4  
ATOM   10382 N NH1  . ARG A 1 51  ? 4.340   7.187   -7.415  1.00 1.96  ? 51   ARG A NH1  4  
ATOM   10383 N NH2  . ARG A 1 51  ? 2.711   7.921   -5.973  1.00 2.17  ? 51   ARG A NH2  4  
ATOM   10384 H H    . ARG A 1 51  ? 4.408   2.228   -3.085  1.00 0.43  ? 51   ARG A H    4  
ATOM   10385 H HA   . ARG A 1 51  ? 1.974   1.282   -4.372  1.00 0.55  ? 51   ARG A HA   4  
ATOM   10386 H HB2  . ARG A 1 51  ? 2.747   2.893   -6.192  1.00 0.59  ? 51   ARG A HB2  4  
ATOM   10387 H HB3  . ARG A 1 51  ? 2.364   3.609   -4.630  1.00 0.58  ? 51   ARG A HB3  4  
ATOM   10388 H HG2  . ARG A 1 51  ? 4.624   3.883   -4.080  1.00 0.67  ? 51   ARG A HG2  4  
ATOM   10389 H HG3  . ARG A 1 51  ? 5.152   2.820   -5.384  1.00 0.66  ? 51   ARG A HG3  4  
ATOM   10390 H HD2  . ARG A 1 51  ? 5.577   5.139   -5.920  1.00 0.90  ? 51   ARG A HD2  4  
ATOM   10391 H HD3  . ARG A 1 51  ? 4.398   4.438   -7.016  1.00 1.12  ? 51   ARG A HD3  4  
ATOM   10392 H HE   . ARG A 1 51  ? 3.047   5.709   -4.900  1.00 1.60  ? 51   ARG A HE   4  
ATOM   10393 H HH11 . ARG A 1 51  ? 4.989   6.477   -7.714  1.00 1.99  ? 51   ARG A HH11 4  
ATOM   10394 H HH12 . ARG A 1 51  ? 4.294   8.062   -7.913  1.00 2.46  ? 51   ARG A HH12 4  
ATOM   10395 H HH21 . ARG A 1 51  ? 2.120   7.768   -5.162  1.00 2.45  ? 51   ARG A HH21 4  
ATOM   10396 H HH22 . ARG A 1 51  ? 2.643   8.781   -6.483  1.00 2.51  ? 51   ARG A HH22 4  
ATOM   10397 N N    . GLU A 1 52  ? 4.944   0.363   -5.188  1.00 0.49  ? 52   GLU A N    4  
ATOM   10398 C CA   . GLU A 1 52  ? 5.766   -0.544  -5.956  1.00 0.54  ? 52   GLU A CA   4  
ATOM   10399 C C    . GLU A 1 52  ? 5.516   -1.975  -5.500  1.00 0.53  ? 52   GLU A C    4  
ATOM   10400 O O    . GLU A 1 52  ? 5.445   -2.898  -6.309  1.00 0.58  ? 52   GLU A O    4  
ATOM   10401 C CB   . GLU A 1 52  ? 7.223   -0.151  -5.755  1.00 0.59  ? 52   GLU A CB   4  
ATOM   10402 C CG   . GLU A 1 52  ? 7.449   1.347   -5.902  1.00 0.63  ? 52   GLU A CG   4  
ATOM   10403 C CD   . GLU A 1 52  ? 7.325   1.825   -7.336  1.00 0.87  ? 52   GLU A CD   4  
ATOM   10404 O OE1  . GLU A 1 52  ? 6.190   1.909   -7.839  1.00 1.07  ? 52   GLU A OE1  4  
ATOM   10405 O OE2  . GLU A 1 52  ? 8.364   2.115   -7.965  1.00 1.10  ? 52   GLU A OE2  4  
ATOM   10406 H H    . GLU A 1 52  ? 5.353   0.849   -4.443  1.00 0.46  ? 52   GLU A H    4  
ATOM   10407 H HA   . GLU A 1 52  ? 5.506   -0.446  -6.999  1.00 0.59  ? 52   GLU A HA   4  
ATOM   10408 H HB2  . GLU A 1 52  ? 7.533   -0.449  -4.764  1.00 0.56  ? 52   GLU A HB2  4  
ATOM   10409 H HB3  . GLU A 1 52  ? 7.831   -0.661  -6.487  1.00 0.67  ? 52   GLU A HB3  4  
ATOM   10410 H HG2  . GLU A 1 52  ? 6.716   1.877   -5.304  1.00 0.66  ? 52   GLU A HG2  4  
ATOM   10411 H HG3  . GLU A 1 52  ? 8.424   1.588   -5.533  1.00 0.69  ? 52   GLU A HG3  4  
ATOM   10412 N N    . ALA A 1 53  ? 5.375   -2.143  -4.191  1.00 0.49  ? 53   ALA A N    4  
ATOM   10413 C CA   . ALA A 1 53  ? 4.976   -3.423  -3.624  1.00 0.48  ? 53   ALA A CA   4  
ATOM   10414 C C    . ALA A 1 53  ? 3.526   -3.713  -3.975  1.00 0.49  ? 53   ALA A C    4  
ATOM   10415 O O    . ALA A 1 53  ? 3.168   -4.838  -4.326  1.00 0.53  ? 53   ALA A O    4  
ATOM   10416 C CB   . ALA A 1 53  ? 5.163   -3.420  -2.115  1.00 0.45  ? 53   ALA A CB   4  
ATOM   10417 H H    . ALA A 1 53  ? 5.559   -1.387  -3.589  1.00 0.48  ? 53   ALA A H    4  
ATOM   10418 H HA   . ALA A 1 53  ? 5.604   -4.195  -4.048  1.00 0.51  ? 53   ALA A HA   4  
ATOM   10419 H HB1  . ALA A 1 53  ? 4.856   -4.373  -1.711  1.00 1.04  ? 53   ALA A HB1  4  
ATOM   10420 H HB2  . ALA A 1 53  ? 4.560   -2.634  -1.678  1.00 1.03  ? 53   ALA A HB2  4  
ATOM   10421 H HB3  . ALA A 1 53  ? 6.202   -3.247  -1.881  1.00 1.01  ? 53   ALA A HB3  4  
ATOM   10422 N N    . GLY A 1 54  ? 2.697   -2.677  -3.888  1.00 0.49  ? 54   GLY A N    4  
ATOM   10423 C CA   . GLY A 1 54  ? 1.302   -2.800  -4.255  1.00 0.53  ? 54   GLY A CA   4  
ATOM   10424 C C    . GLY A 1 54  ? 1.142   -3.205  -5.699  1.00 0.60  ? 54   GLY A C    4  
ATOM   10425 O O    . GLY A 1 54  ? 0.209   -3.914  -6.046  1.00 0.70  ? 54   GLY A O    4  
ATOM   10426 H H    . GLY A 1 54  ? 3.036   -1.817  -3.555  1.00 0.49  ? 54   GLY A H    4  
ATOM   10427 H HA2  . GLY A 1 54  ? 0.837   -3.546  -3.626  1.00 0.53  ? 54   GLY A HA2  4  
ATOM   10428 H HA3  . GLY A 1 54  ? 0.812   -1.851  -4.100  1.00 0.56  ? 54   GLY A HA3  4  
ATOM   10429 N N    . ASP A 1 55  ? 2.080   -2.766  -6.531  1.00 0.61  ? 55   ASP A N    4  
ATOM   10430 C CA   . ASP A 1 55  ? 2.101   -3.117  -7.949  1.00 0.69  ? 55   ASP A CA   4  
ATOM   10431 C C    . ASP A 1 55  ? 2.066   -4.630  -8.139  1.00 0.70  ? 55   ASP A C    4  
ATOM   10432 O O    . ASP A 1 55  ? 1.395   -5.136  -9.033  1.00 0.79  ? 55   ASP A O    4  
ATOM   10433 C CB   . ASP A 1 55  ? 3.362   -2.548  -8.597  1.00 0.73  ? 55   ASP A CB   4  
ATOM   10434 C CG   . ASP A 1 55  ? 3.441   -2.820  -10.083 1.00 0.85  ? 55   ASP A CG   4  
ATOM   10435 O OD1  . ASP A 1 55  ? 2.727   -2.142  -10.852 1.00 1.04  ? 55   ASP A OD1  4  
ATOM   10436 O OD2  . ASP A 1 55  ? 4.200   -3.724  -10.487 1.00 0.82  ? 55   ASP A OD2  4  
ATOM   10437 H H    . ASP A 1 55  ? 2.783   -2.181  -6.180  1.00 0.59  ? 55   ASP A H    4  
ATOM   10438 H HA   . ASP A 1 55  ? 1.233   -2.681  -8.419  1.00 0.77  ? 55   ASP A HA   4  
ATOM   10439 H HB2  . ASP A 1 55  ? 3.388   -1.482  -8.443  1.00 0.77  ? 55   ASP A HB2  4  
ATOM   10440 H HB3  . ASP A 1 55  ? 4.225   -2.996  -8.126  1.00 0.69  ? 55   ASP A HB3  4  
ATOM   10441 N N    . GLU A 1 56  ? 2.785   -5.336  -7.275  1.00 0.66  ? 56   GLU A N    4  
ATOM   10442 C CA   . GLU A 1 56  ? 2.854   -6.782  -7.302  1.00 0.74  ? 56   GLU A CA   4  
ATOM   10443 C C    . GLU A 1 56  ? 1.610   -7.393  -6.647  1.00 0.77  ? 56   GLU A C    4  
ATOM   10444 O O    . GLU A 1 56  ? 1.212   -8.518  -6.942  1.00 0.88  ? 56   GLU A O    4  
ATOM   10445 C CB   . GLU A 1 56  ? 4.139   -7.234  -6.604  1.00 0.79  ? 56   GLU A CB   4  
ATOM   10446 C CG   . GLU A 1 56  ? 3.992   -8.549  -5.887  1.00 1.24  ? 56   GLU A CG   4  
ATOM   10447 C CD   . GLU A 1 56  ? 5.291   -9.081  -5.323  1.00 1.52  ? 56   GLU A CD   4  
ATOM   10448 O OE1  . GLU A 1 56  ? 6.079   -9.673  -6.085  1.00 1.43  ? 56   GLU A OE1  4  
ATOM   10449 O OE2  . GLU A 1 56  ? 5.540   -8.876  -4.116  1.00 2.29  ? 56   GLU A OE2  4  
ATOM   10450 H H    . GLU A 1 56  ? 3.285   -4.867  -6.577  1.00 0.63  ? 56   GLU A H    4  
ATOM   10451 H HA   . GLU A 1 56  ? 2.887   -7.097  -8.334  1.00 0.78  ? 56   GLU A HA   4  
ATOM   10452 H HB2  . GLU A 1 56  ? 4.923   -7.334  -7.342  1.00 0.99  ? 56   GLU A HB2  4  
ATOM   10453 H HB3  . GLU A 1 56  ? 4.430   -6.482  -5.882  1.00 1.14  ? 56   GLU A HB3  4  
ATOM   10454 H HG2  . GLU A 1 56  ? 3.299   -8.397  -5.079  1.00 1.86  ? 56   GLU A HG2  4  
ATOM   10455 H HG3  . GLU A 1 56  ? 3.587   -9.277  -6.576  1.00 1.73  ? 56   GLU A HG3  4  
ATOM   10456 N N    . PHE A 1 57  ? 1.010   -6.652  -5.744  1.00 0.71  ? 57   PHE A N    4  
ATOM   10457 C CA   . PHE A 1 57  ? -0.191  -7.104  -5.064  1.00 0.75  ? 57   PHE A CA   4  
ATOM   10458 C C    . PHE A 1 57  ? -1.452  -6.891  -5.909  1.00 0.78  ? 57   PHE A C    4  
ATOM   10459 O O    . PHE A 1 57  ? -2.480  -7.524  -5.657  1.00 0.91  ? 57   PHE A O    4  
ATOM   10460 C CB   . PHE A 1 57  ? -0.310  -6.419  -3.703  1.00 0.76  ? 57   PHE A CB   4  
ATOM   10461 C CG   . PHE A 1 57  ? 0.357   -7.201  -2.611  1.00 1.09  ? 57   PHE A CG   4  
ATOM   10462 C CD1  . PHE A 1 57  ? -0.277  -8.277  -2.018  1.00 1.37  ? 57   PHE A CD1  4  
ATOM   10463 C CD2  . PHE A 1 57  ? 1.620   -6.844  -2.172  1.00 1.71  ? 57   PHE A CD2  4  
ATOM   10464 C CE1  . PHE A 1 57  ? 0.338   -8.987  -1.008  1.00 1.79  ? 57   PHE A CE1  4  
ATOM   10465 C CE2  . PHE A 1 57  ? 2.240   -7.548  -1.161  1.00 2.29  ? 57   PHE A CE2  4  
ATOM   10466 C CZ   . PHE A 1 57  ? 1.583   -8.671  -0.604  1.00 2.20  ? 57   PHE A CZ   4  
ATOM   10467 H H    . PHE A 1 57  ? 1.379   -5.769  -5.532  1.00 0.67  ? 57   PHE A H    4  
ATOM   10468 H HA   . PHE A 1 57  ? -0.078  -8.165  -4.899  1.00 0.80  ? 57   PHE A HA   4  
ATOM   10469 H HB2  . PHE A 1 57  ? 0.161   -5.449  -3.752  1.00 0.99  ? 57   PHE A HB2  4  
ATOM   10470 H HB3  . PHE A 1 57  ? -1.348  -6.297  -3.443  1.00 0.73  ? 57   PHE A HB3  4  
ATOM   10471 H HD1  . PHE A 1 57  ? -1.263  -8.563  -2.355  1.00 1.61  ? 57   PHE A HD1  4  
ATOM   10472 H HD2  . PHE A 1 57  ? 2.123   -6.004  -2.630  1.00 1.95  ? 57   PHE A HD2  4  
ATOM   10473 H HE1  . PHE A 1 57  ? -0.166  -9.826  -0.553  1.00 2.07  ? 57   PHE A HE1  4  
ATOM   10474 H HE2  . PHE A 1 57  ? 3.226   -7.259  -0.826  1.00 2.93  ? 57   PHE A HE2  4  
ATOM   10475 H HZ   . PHE A 1 57  ? 2.063   -9.242  0.177   1.00 2.67  ? 57   PHE A HZ   4  
ATOM   10476 N N    . GLU A 1 58  ? -1.369  -6.024  -6.917  1.00 0.73  ? 58   GLU A N    4  
ATOM   10477 C CA   . GLU A 1 58  ? -2.529  -5.702  -7.748  1.00 0.82  ? 58   GLU A CA   4  
ATOM   10478 C C    . GLU A 1 58  ? -2.958  -6.901  -8.566  1.00 0.82  ? 58   GLU A C    4  
ATOM   10479 O O    . GLU A 1 58  ? -4.020  -7.468  -8.333  1.00 0.89  ? 58   GLU A O    4  
ATOM   10480 C CB   . GLU A 1 58  ? -2.227  -4.541  -8.691  1.00 0.86  ? 58   GLU A CB   4  
ATOM   10481 C CG   . GLU A 1 58  ? -1.899  -3.252  -7.979  1.00 0.91  ? 58   GLU A CG   4  
ATOM   10482 C CD   . GLU A 1 58  ? -1.819  -2.081  -8.927  1.00 0.93  ? 58   GLU A CD   4  
ATOM   10483 O OE1  . GLU A 1 58  ? -2.880  -1.609  -9.383  1.00 1.30  ? 58   GLU A OE1  4  
ATOM   10484 O OE2  . GLU A 1 58  ? -0.699  -1.615  -9.217  1.00 1.24  ? 58   GLU A OE2  4  
ATOM   10485 H H    . GLU A 1 58  ? -0.505  -5.598  -7.113  1.00 0.69  ? 58   GLU A H    4  
ATOM   10486 H HA   . GLU A 1 58  ? -3.338  -5.420  -7.091  1.00 0.95  ? 58   GLU A HA   4  
ATOM   10487 H HB2  . GLU A 1 58  ? -1.387  -4.807  -9.314  1.00 0.80  ? 58   GLU A HB2  4  
ATOM   10488 H HB3  . GLU A 1 58  ? -3.089  -4.371  -9.319  1.00 0.98  ? 58   GLU A HB3  4  
ATOM   10489 H HG2  . GLU A 1 58  ? -2.660  -3.056  -7.242  1.00 1.09  ? 58   GLU A HG2  4  
ATOM   10490 H HG3  . GLU A 1 58  ? -0.943  -3.367  -7.490  1.00 1.00  ? 58   GLU A HG3  4  
ATOM   10491 N N    . LEU A 1 59  ? -2.115  -7.272  -9.524  1.00 0.81  ? 59   LEU A N    4  
ATOM   10492 C CA   . LEU A 1 59  ? -2.352  -8.428  -10.393 1.00 0.87  ? 59   LEU A CA   4  
ATOM   10493 C C    . LEU A 1 59  ? -2.752  -9.653  -9.584  1.00 0.85  ? 59   LEU A C    4  
ATOM   10494 O O    . LEU A 1 59  ? -3.625  -10.418 -9.999  1.00 0.96  ? 59   LEU A O    4  
ATOM   10495 C CB   . LEU A 1 59  ? -1.093  -8.768  -11.201 1.00 0.96  ? 59   LEU A CB   4  
ATOM   10496 C CG   . LEU A 1 59  ? 0.118   -9.161  -10.352 1.00 1.06  ? 59   LEU A CG   4  
ATOM   10497 C CD1  . LEU A 1 59  ? 1.163   -9.876  -11.162 1.00 1.54  ? 59   LEU A CD1  4  
ATOM   10498 C CD2  . LEU A 1 59  ? 0.733   -7.950  -9.712  1.00 1.46  ? 59   LEU A CD2  4  
ATOM   10499 H H    . LEU A 1 59  ? -1.298  -6.745  -9.657  1.00 0.83  ? 59   LEU A H    4  
ATOM   10500 H HA   . LEU A 1 59  ? -3.152  -8.178  -11.073 1.00 0.94  ? 59   LEU A HA   4  
ATOM   10501 H HB2  . LEU A 1 59  ? -1.326  -9.589  -11.865 1.00 1.04  ? 59   LEU A HB2  4  
ATOM   10502 H HB3  . LEU A 1 59  ? -0.825  -7.908  -11.796 1.00 1.06  ? 59   LEU A HB3  4  
ATOM   10503 H HG   . LEU A 1 59  ? -0.205  -9.822  -9.564  1.00 1.87  ? 59   LEU A HG   4  
ATOM   10504 H HD11 . LEU A 1 59  ? 2.069   -9.943  -10.576 1.00 2.19  ? 59   LEU A HD11 4  
ATOM   10505 H HD12 . LEU A 1 59  ? 1.356   -9.322  -12.068 1.00 1.96  ? 59   LEU A HD12 4  
ATOM   10506 H HD13 . LEU A 1 59  ? 0.812   -10.865 -11.403 1.00 2.00  ? 59   LEU A HD13 4  
ATOM   10507 H HD21 . LEU A 1 59  ? 1.649   -8.232  -9.219  1.00 1.91  ? 59   LEU A HD21 4  
ATOM   10508 H HD22 . LEU A 1 59  ? 0.042   -7.552  -8.981  1.00 1.97  ? 59   LEU A HD22 4  
ATOM   10509 H HD23 . LEU A 1 59  ? 0.938   -7.203  -10.463 1.00 2.00  ? 59   LEU A HD23 4  
ATOM   10510 N N    . ARG A 1 60  ? -2.117  -9.821  -8.423  1.00 0.83  ? 60   ARG A N    4  
ATOM   10511 C CA   . ARG A 1 60  ? -2.365  -10.975 -7.583  1.00 0.90  ? 60   ARG A CA   4  
ATOM   10512 C C    . ARG A 1 60  ? -3.851  -11.113 -7.267  1.00 0.98  ? 60   ARG A C    4  
ATOM   10513 O O    . ARG A 1 60  ? -4.458  -12.158 -7.507  1.00 1.15  ? 60   ARG A O    4  
ATOM   10514 C CB   . ARG A 1 60  ? -1.575  -10.890 -6.278  1.00 1.03  ? 60   ARG A CB   4  
ATOM   10515 C CG   . ARG A 1 60  ? -0.132  -11.342 -6.399  1.00 1.00  ? 60   ARG A CG   4  
ATOM   10516 C CD   . ARG A 1 60  ? 0.564   -11.307 -5.051  1.00 1.07  ? 60   ARG A CD   4  
ATOM   10517 N NE   . ARG A 1 60  ? 1.897   -11.900 -5.107  1.00 1.41  ? 60   ARG A NE   4  
ATOM   10518 C CZ   . ARG A 1 60  ? 2.942   -11.452 -4.418  1.00 1.94  ? 60   ARG A CZ   4  
ATOM   10519 N NH1  . ARG A 1 60  ? 2.801   -10.437 -3.572  1.00 2.43  ? 60   ARG A NH1  4  
ATOM   10520 N NH2  . ARG A 1 60  ? 4.131   -12.024 -4.565  1.00 2.58  ? 60   ARG A NH2  4  
ATOM   10521 H H    . ARG A 1 60  ? -1.465  -9.152  -8.132  1.00 0.86  ? 60   ARG A H    4  
ATOM   10522 H HA   . ARG A 1 60  ? -2.030  -11.837 -8.138  1.00 0.94  ? 60   ARG A HA   4  
ATOM   10523 H HB2  . ARG A 1 60  ? -1.579  -9.866  -5.935  1.00 1.31  ? 60   ARG A HB2  4  
ATOM   10524 H HB3  . ARG A 1 60  ? -2.061  -11.509 -5.537  1.00 1.36  ? 60   ARG A HB3  4  
ATOM   10525 H HG2  . ARG A 1 60  ? -0.110  -12.352 -6.781  1.00 1.39  ? 60   ARG A HG2  4  
ATOM   10526 H HG3  . ARG A 1 60  ? 0.387   -10.684 -7.081  1.00 1.32  ? 60   ARG A HG3  4  
ATOM   10527 H HD2  . ARG A 1 60  ? 0.652   -10.279 -4.733  1.00 1.41  ? 60   ARG A HD2  4  
ATOM   10528 H HD3  . ARG A 1 60  ? -0.035  -11.853 -4.341  1.00 1.40  ? 60   ARG A HD3  4  
ATOM   10529 H HE   . ARG A 1 60  ? 2.022   -12.674 -5.713  1.00 1.85  ? 60   ARG A HE   4  
ATOM   10530 H HH11 . ARG A 1 60  ? 1.907   -10.008 -3.446  1.00 2.42  ? 60   ARG A HH11 4  
ATOM   10531 H HH12 . ARG A 1 60  ? 3.596   -10.084 -3.070  1.00 3.14  ? 60   ARG A HH12 4  
ATOM   10532 H HH21 . ARG A 1 60  ? 4.245   -12.800 -5.197  1.00 2.82  ? 60   ARG A HH21 4  
ATOM   10533 H HH22 . ARG A 1 60  ? 4.925   -11.677 -4.058  1.00 3.11  ? 60   ARG A HH22 4  
ATOM   10534 N N    . TYR A 1 61  ? -4.436  -10.043 -6.744  1.00 1.04  ? 61   TYR A N    4  
ATOM   10535 C CA   . TYR A 1 61  ? -5.843  -10.050 -6.372  1.00 1.26  ? 61   TYR A CA   4  
ATOM   10536 C C    . TYR A 1 61  ? -6.717  -9.718  -7.571  1.00 1.32  ? 61   TYR A C    4  
ATOM   10537 O O    . TYR A 1 61  ? -7.899  -10.055 -7.596  1.00 1.59  ? 61   TYR A O    4  
ATOM   10538 C CB   . TYR A 1 61  ? -6.105  -9.059  -5.237  1.00 1.52  ? 61   TYR A CB   4  
ATOM   10539 C CG   . TYR A 1 61  ? -5.310  -9.352  -3.984  1.00 2.19  ? 61   TYR A CG   4  
ATOM   10540 C CD1  . TYR A 1 61  ? -5.020  -10.660 -3.610  1.00 2.84  ? 61   TYR A CD1  4  
ATOM   10541 C CD2  . TYR A 1 61  ? -4.854  -8.321  -3.173  1.00 2.70  ? 61   TYR A CD2  4  
ATOM   10542 C CE1  . TYR A 1 61  ? -4.298  -10.929 -2.465  1.00 3.86  ? 61   TYR A CE1  4  
ATOM   10543 C CE2  . TYR A 1 61  ? -4.132  -8.584  -2.027  1.00 3.67  ? 61   TYR A CE2  4  
ATOM   10544 C CZ   . TYR A 1 61  ? -3.856  -9.889  -1.678  1.00 4.23  ? 61   TYR A CZ   4  
ATOM   10545 O OH   . TYR A 1 61  ? -3.140  -10.156 -0.538  1.00 5.32  ? 61   TYR A OH   4  
ATOM   10546 H H    . TYR A 1 61  ? -3.907  -9.226  -6.606  1.00 1.06  ? 61   TYR A H    4  
ATOM   10547 H HA   . TYR A 1 61  ? -6.088  -11.045 -6.031  1.00 1.33  ? 61   TYR A HA   4  
ATOM   10548 H HB2  . TYR A 1 61  ? -5.846  -8.065  -5.569  1.00 1.78  ? 61   TYR A HB2  4  
ATOM   10549 H HB3  . TYR A 1 61  ? -7.154  -9.087  -4.980  1.00 1.83  ? 61   TYR A HB3  4  
ATOM   10550 H HD1  . TYR A 1 61  ? -5.368  -11.473 -4.229  1.00 2.77  ? 61   TYR A HD1  4  
ATOM   10551 H HD2  . TYR A 1 61  ? -5.072  -7.299  -3.448  1.00 2.59  ? 61   TYR A HD2  4  
ATOM   10552 H HE1  . TYR A 1 61  ? -4.082  -11.952 -2.191  1.00 4.50  ? 61   TYR A HE1  4  
ATOM   10553 H HE2  . TYR A 1 61  ? -3.783  -7.769  -1.409  1.00 4.15  ? 61   TYR A HE2  4  
ATOM   10554 H HH   . TYR A 1 61  ? -3.632  -9.847  0.231   1.00 5.59  ? 61   TYR A HH   4  
ATOM   10555 N N    . ARG A 1 62  ? -6.121  -9.071  -8.569  1.00 1.28  ? 62   ARG A N    4  
ATOM   10556 C CA   . ARG A 1 62  ? -6.822  -8.694  -9.794  1.00 1.39  ? 62   ARG A CA   4  
ATOM   10557 C C    . ARG A 1 62  ? -7.447  -9.913  -10.459 1.00 1.07  ? 62   ARG A C    4  
ATOM   10558 O O    . ARG A 1 62  ? -8.463  -9.810  -11.145 1.00 1.30  ? 62   ARG A O    4  
ATOM   10559 C CB   . ARG A 1 62  ? -5.863  -7.996  -10.762 1.00 1.72  ? 62   ARG A CB   4  
ATOM   10560 C CG   . ARG A 1 62  ? -6.507  -7.558  -12.067 1.00 2.15  ? 62   ARG A CG   4  
ATOM   10561 C CD   . ARG A 1 62  ? -5.522  -6.802  -12.942 1.00 2.51  ? 62   ARG A CD   4  
ATOM   10562 N NE   . ARG A 1 62  ? -5.103  -5.539  -12.333 1.00 3.10  ? 62   ARG A NE   4  
ATOM   10563 C CZ   . ARG A 1 62  ? -3.850  -5.081  -12.350 1.00 3.59  ? 62   ARG A CZ   4  
ATOM   10564 N NH1  . ARG A 1 62  ? -2.886  -5.786  -12.928 1.00 3.59  ? 62   ARG A NH1  4  
ATOM   10565 N NH2  . ARG A 1 62  ? -3.560  -3.914  -11.790 1.00 4.48  ? 62   ARG A NH2  4  
ATOM   10566 H H    . ARG A 1 62  ? -5.173  -8.824  -8.472  1.00 1.33  ? 62   ARG A H    4  
ATOM   10567 H HA   . ARG A 1 62  ? -7.608  -8.006  -9.526  1.00 1.73  ? 62   ARG A HA   4  
ATOM   10568 H HB2  . ARG A 1 62  ? -5.457  -7.120  -10.277 1.00 1.93  ? 62   ARG A HB2  4  
ATOM   10569 H HB3  . ARG A 1 62  ? -5.053  -8.671  -10.996 1.00 1.76  ? 62   ARG A HB3  4  
ATOM   10570 H HG2  . ARG A 1 62  ? -6.848  -8.432  -12.601 1.00 2.42  ? 62   ARG A HG2  4  
ATOM   10571 H HG3  . ARG A 1 62  ? -7.347  -6.917  -11.846 1.00 2.45  ? 62   ARG A HG3  4  
ATOM   10572 H HD2  . ARG A 1 62  ? -4.651  -7.420  -13.100 1.00 2.64  ? 62   ARG A HD2  4  
ATOM   10573 H HD3  . ARG A 1 62  ? -5.991  -6.593  -13.893 1.00 2.92  ? 62   ARG A HD3  4  
ATOM   10574 H HE   . ARG A 1 62  ? -5.800  -4.997  -11.898 1.00 3.50  ? 62   ARG A HE   4  
ATOM   10575 H HH11 . ARG A 1 62  ? -3.093  -6.667  -13.362 1.00 3.34  ? 62   ARG A HH11 4  
ATOM   10576 H HH12 . ARG A 1 62  ? -1.938  -5.444  -12.925 1.00 4.14  ? 62   ARG A HH12 4  
ATOM   10577 H HH21 . ARG A 1 62  ? -4.283  -3.369  -11.343 1.00 4.87  ? 62   ARG A HH21 4  
ATOM   10578 H HH22 . ARG A 1 62  ? -2.622  -3.560  -11.822 1.00 4.93  ? 62   ARG A HH22 4  
ATOM   10579 N N    . ARG A 1 63  ? -6.832  -11.065 -10.243 1.00 0.98  ? 63   ARG A N    4  
ATOM   10580 C CA   . ARG A 1 63  ? -7.351  -12.322 -10.750 1.00 1.19  ? 63   ARG A CA   4  
ATOM   10581 C C    . ARG A 1 63  ? -8.768  -12.579 -10.248 1.00 1.20  ? 63   ARG A C    4  
ATOM   10582 O O    . ARG A 1 63  ? -9.688  -12.784 -11.035 1.00 1.45  ? 63   ARG A O    4  
ATOM   10583 C CB   . ARG A 1 63  ? -6.442  -13.475 -10.324 1.00 1.61  ? 63   ARG A CB   4  
ATOM   10584 C CG   . ARG A 1 63  ? -5.089  -13.473 -11.008 1.00 2.18  ? 63   ARG A CG   4  
ATOM   10585 C CD   . ARG A 1 63  ? -5.234  -13.637 -12.510 1.00 2.52  ? 63   ARG A CD   4  
ATOM   10586 N NE   . ARG A 1 63  ? -3.953  -13.888 -13.159 1.00 3.12  ? 63   ARG A NE   4  
ATOM   10587 C CZ   . ARG A 1 63  ? -3.738  -14.896 -14.000 1.00 3.84  ? 63   ARG A CZ   4  
ATOM   10588 N NH1  . ARG A 1 63  ? -4.724  -15.736 -14.299 1.00 4.07  ? 63   ARG A NH1  4  
ATOM   10589 N NH2  . ARG A 1 63  ? -2.541  -15.068 -14.545 1.00 4.72  ? 63   ARG A NH2  4  
ATOM   10590 H H    . ARG A 1 63  ? -5.996  -11.066 -9.727  1.00 1.11  ? 63   ARG A H    4  
ATOM   10591 H HA   . ARG A 1 63  ? -7.366  -12.267 -11.827 1.00 1.34  ? 63   ARG A HA   4  
ATOM   10592 H HB2  . ARG A 1 63  ? -6.282  -13.415 -9.258  1.00 1.92  ? 63   ARG A HB2  4  
ATOM   10593 H HB3  . ARG A 1 63  ? -6.936  -14.409 -10.553 1.00 2.09  ? 63   ARG A HB3  4  
ATOM   10594 H HG2  . ARG A 1 63  ? -4.591  -12.537 -10.802 1.00 2.77  ? 63   ARG A HG2  4  
ATOM   10595 H HG3  . ARG A 1 63  ? -4.498  -14.290 -10.621 1.00 2.59  ? 63   ARG A HG3  4  
ATOM   10596 H HD2  . ARG A 1 63  ? -5.894  -14.469 -12.706 1.00 3.00  ? 63   ARG A HD2  4  
ATOM   10597 H HD3  . ARG A 1 63  ? -5.664  -12.733 -12.917 1.00 2.63  ? 63   ARG A HD3  4  
ATOM   10598 H HE   . ARG A 1 63  ? -3.209  -13.271 -12.948 1.00 3.38  ? 63   ARG A HE   4  
ATOM   10599 H HH11 . ARG A 1 63  ? -5.636  -15.614 -13.891 1.00 3.81  ? 63   ARG A HH11 4  
ATOM   10600 H HH12 . ARG A 1 63  ? -4.568  -16.493 -14.942 1.00 4.78  ? 63   ARG A HH12 4  
ATOM   10601 H HH21 . ARG A 1 63  ? -1.787  -14.431 -14.325 1.00 4.96  ? 63   ARG A HH21 4  
ATOM   10602 H HH22 . ARG A 1 63  ? -2.374  -15.839 -15.170 1.00 5.35  ? 63   ARG A HH22 4  
ATOM   10603 N N    . ALA A 1 64  ? -8.935  -12.563 -8.933  1.00 1.07  ? 64   ALA A N    4  
ATOM   10604 C CA   . ALA A 1 64  ? -10.207 -12.920 -8.322  1.00 1.09  ? 64   ALA A CA   4  
ATOM   10605 C C    . ALA A 1 64  ? -11.120 -11.717 -8.099  1.00 1.08  ? 64   ALA A C    4  
ATOM   10606 O O    . ALA A 1 64  ? -12.333 -11.845 -8.192  1.00 1.05  ? 64   ALA A O    4  
ATOM   10607 C CB   . ALA A 1 64  ? -9.966  -13.636 -7.003  1.00 1.17  ? 64   ALA A CB   4  
ATOM   10608 H H    . ALA A 1 64  ? -8.186  -12.301 -8.359  1.00 1.05  ? 64   ALA A H    4  
ATOM   10609 H HA   . ALA A 1 64  ? -10.706 -13.612 -8.984  1.00 1.12  ? 64   ALA A HA   4  
ATOM   10610 H HB1  . ALA A 1 64  ? -9.472  -14.579 -7.188  1.00 1.70  ? 64   ALA A HB1  4  
ATOM   10611 H HB2  . ALA A 1 64  ? -10.914 -13.811 -6.507  1.00 1.43  ? 64   ALA A HB2  4  
ATOM   10612 H HB3  . ALA A 1 64  ? -9.342  -13.022 -6.373  1.00 1.55  ? 64   ALA A HB3  4  
ATOM   10613 N N    . PHE A 1 65  ? -10.542 -10.549 -7.820  1.00 1.14  ? 65   PHE A N    4  
ATOM   10614 C CA   . PHE A 1 65  ? -11.315 -9.409  -7.307  1.00 1.22  ? 65   PHE A CA   4  
ATOM   10615 C C    . PHE A 1 65  ? -12.406 -8.945  -8.279  1.00 1.19  ? 65   PHE A C    4  
ATOM   10616 O O    . PHE A 1 65  ? -13.410 -8.379  -7.854  1.00 1.22  ? 65   PHE A O    4  
ATOM   10617 C CB   . PHE A 1 65  ? -10.383 -8.247  -6.917  1.00 1.47  ? 65   PHE A CB   4  
ATOM   10618 C CG   . PHE A 1 65  ? -10.208 -7.171  -7.957  1.00 1.41  ? 65   PHE A CG   4  
ATOM   10619 C CD1  . PHE A 1 65  ? -9.645  -7.448  -9.190  1.00 1.98  ? 65   PHE A CD1  4  
ATOM   10620 C CD2  . PHE A 1 65  ? -10.597 -5.869  -7.684  1.00 1.67  ? 65   PHE A CD2  4  
ATOM   10621 C CE1  . PHE A 1 65  ? -9.474  -6.450  -10.131 1.00 2.59  ? 65   PHE A CE1  4  
ATOM   10622 C CE2  . PHE A 1 65  ? -10.429 -4.870  -8.621  1.00 2.44  ? 65   PHE A CE2  4  
ATOM   10623 C CZ   . PHE A 1 65  ? -9.867  -5.160  -9.846  1.00 2.81  ? 65   PHE A CZ   4  
ATOM   10624 H H    . PHE A 1 65  ? -9.572  -10.448 -7.953  1.00 1.17  ? 65   PHE A H    4  
ATOM   10625 H HA   . PHE A 1 65  ? -11.809 -9.753  -6.409  1.00 1.22  ? 65   PHE A HA   4  
ATOM   10626 H HB2  . PHE A 1 65  ? -10.773 -7.775  -6.028  1.00 1.77  ? 65   PHE A HB2  4  
ATOM   10627 H HB3  . PHE A 1 65  ? -9.405  -8.651  -6.693  1.00 2.14  ? 65   PHE A HB3  4  
ATOM   10628 H HD1  . PHE A 1 65  ? -9.339  -8.458  -9.416  1.00 2.28  ? 65   PHE A HD1  4  
ATOM   10629 H HD2  . PHE A 1 65  ? -11.036 -5.639  -6.725  1.00 1.72  ? 65   PHE A HD2  4  
ATOM   10630 H HE1  . PHE A 1 65  ? -9.033  -6.682  -11.090 1.00 3.15  ? 65   PHE A HE1  4  
ATOM   10631 H HE2  . PHE A 1 65  ? -10.739 -3.860  -8.394  1.00 2.98  ? 65   PHE A HE2  4  
ATOM   10632 H HZ   . PHE A 1 65  ? -9.735  -4.378  -10.580 1.00 3.52  ? 65   PHE A HZ   4  
ATOM   10633 N N    . SER A 1 66  ? -12.222 -9.202  -9.571  1.00 1.20  ? 66   SER A N    4  
ATOM   10634 C CA   . SER A 1 66  ? -13.232 -8.857  -10.564 1.00 1.24  ? 66   SER A CA   4  
ATOM   10635 C C    . SER A 1 66  ? -14.514 -9.647  -10.317 1.00 1.13  ? 66   SER A C    4  
ATOM   10636 O O    . SER A 1 66  ? -15.620 -9.147  -10.513 1.00 1.16  ? 66   SER A O    4  
ATOM   10637 C CB   . SER A 1 66  ? -12.709 -9.132  -11.957 1.00 1.45  ? 66   SER A CB   4  
ATOM   10638 O OG   . SER A 1 66  ? -11.444 -8.523  -12.161 1.00 2.19  ? 66   SER A OG   4  
ATOM   10639 H H    . SER A 1 66  ? -11.391 -9.634  -9.862  1.00 1.21  ? 66   SER A H    4  
ATOM   10640 H HA   . SER A 1 66  ? -13.441 -7.818  -10.480 1.00 1.29  ? 66   SER A HA   4  
ATOM   10641 H HB2  . SER A 1 66  ? -12.612 -10.183 -12.076 1.00 1.81  ? 66   SER A HB2  4  
ATOM   10642 H HB3  . SER A 1 66  ? -13.407 -8.746  -12.686 1.00 1.57  ? 66   SER A HB3  4  
ATOM   10643 H HG   . SER A 1 66  ? -11.436 -7.660  -11.729 1.00 2.59  ? 66   SER A HG   4  
ATOM   10644 N N    . ASP A 1 67  ? -14.345 -10.886 -9.883  1.00 1.09  ? 67   ASP A N    4  
ATOM   10645 C CA   . ASP A 1 67  ? -15.465 -11.750 -9.536  1.00 1.08  ? 67   ASP A CA   4  
ATOM   10646 C C    . ASP A 1 67  ? -15.809 -11.587 -8.060  1.00 0.97  ? 67   ASP A C    4  
ATOM   10647 O O    . ASP A 1 67  ? -16.969 -11.675 -7.660  1.00 1.01  ? 67   ASP A O    4  
ATOM   10648 C CB   . ASP A 1 67  ? -15.101 -13.205 -9.843  1.00 1.18  ? 67   ASP A CB   4  
ATOM   10649 C CG   . ASP A 1 67  ? -16.201 -14.185 -9.489  1.00 1.86  ? 67   ASP A CG   4  
ATOM   10650 O OD1  . ASP A 1 67  ? -17.194 -14.270 -10.243 1.00 2.06  ? 67   ASP A OD1  4  
ATOM   10651 O OD2  . ASP A 1 67  ? -16.061 -14.898 -8.474  1.00 2.72  ? 67   ASP A OD2  4  
ATOM   10652 H H    . ASP A 1 67  ? -13.433 -11.236 -9.791  1.00 1.12  ? 67   ASP A H    4  
ATOM   10653 H HA   . ASP A 1 67  ? -16.314 -11.459 -10.135 1.00 1.16  ? 67   ASP A HA   4  
ATOM   10654 H HB2  . ASP A 1 67  ? -14.892 -13.301 -10.898 1.00 1.30  ? 67   ASP A HB2  4  
ATOM   10655 H HB3  . ASP A 1 67  ? -14.216 -13.471 -9.283  1.00 1.39  ? 67   ASP A HB3  4  
ATOM   10656 N N    . LEU A 1 68  ? -14.784 -11.320 -7.258  1.00 0.89  ? 68   LEU A N    4  
ATOM   10657 C CA   . LEU A 1 68  ? -14.941 -11.168 -5.820  1.00 0.85  ? 68   LEU A CA   4  
ATOM   10658 C C    . LEU A 1 68  ? -15.797 -9.967  -5.453  1.00 0.76  ? 68   LEU A C    4  
ATOM   10659 O O    . LEU A 1 68  ? -16.392 -9.952  -4.385  1.00 0.77  ? 68   LEU A O    4  
ATOM   10660 C CB   . LEU A 1 68  ? -13.579 -11.065 -5.135  1.00 0.91  ? 68   LEU A CB   4  
ATOM   10661 C CG   . LEU A 1 68  ? -13.025 -12.383 -4.583  1.00 1.06  ? 68   LEU A CG   4  
ATOM   10662 C CD1  . LEU A 1 68  ? -13.220 -13.519 -5.569  1.00 1.54  ? 68   LEU A CD1  4  
ATOM   10663 C CD2  . LEU A 1 68  ? -11.560 -12.225 -4.223  1.00 1.56  ? 68   LEU A CD2  4  
ATOM   10664 H H    . LEU A 1 68  ? -13.883 -11.243 -7.646  1.00 0.92  ? 68   LEU A H    4  
ATOM   10665 H HA   . LEU A 1 68  ? -15.437 -12.056 -5.458  1.00 0.96  ? 68   LEU A HA   4  
ATOM   10666 H HB2  . LEU A 1 68  ? -12.870 -10.668 -5.845  1.00 1.15  ? 68   LEU A HB2  4  
ATOM   10667 H HB3  . LEU A 1 68  ? -13.667 -10.369 -4.314  1.00 1.11  ? 68   LEU A HB3  4  
ATOM   10668 H HG   . LEU A 1 68  ? -13.556 -12.639 -3.686  1.00 1.87  ? 68   LEU A HG   4  
ATOM   10669 H HD11 . LEU A 1 68  ? -12.746 -14.411 -5.191  1.00 2.00  ? 68   LEU A HD11 4  
ATOM   10670 H HD12 . LEU A 1 68  ? -12.784 -13.252 -6.521  1.00 2.00  ? 68   LEU A HD12 4  
ATOM   10671 H HD13 . LEU A 1 68  ? -14.279 -13.699 -5.694  1.00 2.16  ? 68   LEU A HD13 4  
ATOM   10672 H HD21 . LEU A 1 68  ? -11.006 -11.923 -5.101  1.00 1.93  ? 68   LEU A HD21 4  
ATOM   10673 H HD22 . LEU A 1 68  ? -11.174 -13.166 -3.860  1.00 2.25  ? 68   LEU A HD22 4  
ATOM   10674 H HD23 . LEU A 1 68  ? -11.460 -11.473 -3.457  1.00 1.99  ? 68   LEU A HD23 4  
ATOM   10675 N N    . THR A 1 69  ? -15.872 -8.963  -6.316  1.00 0.70  ? 69   THR A N    4  
ATOM   10676 C CA   . THR A 1 69  ? -16.725 -7.811  -6.040  1.00 0.62  ? 69   THR A CA   4  
ATOM   10677 C C    . THR A 1 69  ? -18.182 -8.235  -5.924  1.00 0.63  ? 69   THR A C    4  
ATOM   10678 O O    . THR A 1 69  ? -18.975 -7.594  -5.234  1.00 0.60  ? 69   THR A O    4  
ATOM   10679 C CB   . THR A 1 69  ? -16.582 -6.720  -7.107  1.00 0.62  ? 69   THR A CB   4  
ATOM   10680 O OG1  . THR A 1 69  ? -16.461 -7.315  -8.401  1.00 0.69  ? 69   THR A OG1  4  
ATOM   10681 C CG2  . THR A 1 69  ? -15.378 -5.844  -6.817  1.00 0.63  ? 69   THR A CG2  4  
ATOM   10682 H H    . THR A 1 69  ? -15.348 -8.991  -7.148  1.00 0.73  ? 69   THR A H    4  
ATOM   10683 H HA   . THR A 1 69  ? -16.414 -7.396  -5.091  1.00 0.59  ? 69   THR A HA   4  
ATOM   10684 H HB   . THR A 1 69  ? -17.468 -6.103  -7.087  1.00 0.61  ? 69   THR A HB   4  
ATOM   10685 H HG1  . THR A 1 69  ? -16.181 -6.638  -9.038  1.00 0.77  ? 69   THR A HG1  4  
ATOM   10686 H HG21 . THR A 1 69  ? -15.573 -5.239  -5.939  1.00 1.26  ? 69   THR A HG21 4  
ATOM   10687 H HG22 . THR A 1 69  ? -15.190 -5.196  -7.660  1.00 1.12  ? 69   THR A HG22 4  
ATOM   10688 H HG23 . THR A 1 69  ? -14.512 -6.464  -6.640  1.00 1.21  ? 69   THR A HG23 4  
ATOM   10689 N N    . SER A 1 70  ? -18.516 -9.337  -6.581  1.00 0.72  ? 70   SER A N    4  
ATOM   10690 C CA   . SER A 1 70  ? -19.820 -9.949  -6.433  1.00 0.80  ? 70   SER A CA   4  
ATOM   10691 C C    . SER A 1 70  ? -19.913 -10.608 -5.062  1.00 0.76  ? 70   SER A C    4  
ATOM   10692 O O    . SER A 1 70  ? -20.942 -10.540 -4.392  1.00 0.76  ? 70   SER A O    4  
ATOM   10693 C CB   . SER A 1 70  ? -20.031 -10.993 -7.530  1.00 0.96  ? 70   SER A CB   4  
ATOM   10694 O OG   . SER A 1 70  ? -21.342 -11.533 -7.488  1.00 1.34  ? 70   SER A OG   4  
ATOM   10695 H H    . SER A 1 70  ? -17.861 -9.748  -7.189  1.00 0.77  ? 70   SER A H    4  
ATOM   10696 H HA   . SER A 1 70  ? -20.570 -9.178  -6.515  1.00 0.83  ? 70   SER A HA   4  
ATOM   10697 H HB2  . SER A 1 70  ? -19.872 -10.537 -8.495  1.00 1.16  ? 70   SER A HB2  4  
ATOM   10698 H HB3  . SER A 1 70  ? -19.319 -11.796 -7.387  1.00 1.25  ? 70   SER A HB3  4  
ATOM   10699 H HG   . SER A 1 70  ? -21.312 -12.399 -7.048  1.00 1.80  ? 70   SER A HG   4  
ATOM   10700 N N    . GLN A 1 71  ? -18.811 -11.229 -4.648  1.00 0.77  ? 71   GLN A N    4  
ATOM   10701 C CA   . GLN A 1 71  ? -18.723 -11.882 -3.349  1.00 0.77  ? 71   GLN A CA   4  
ATOM   10702 C C    . GLN A 1 71  ? -18.870 -10.857 -2.231  1.00 0.67  ? 71   GLN A C    4  
ATOM   10703 O O    . GLN A 1 71  ? -19.704 -11.003 -1.336  1.00 0.74  ? 71   GLN A O    4  
ATOM   10704 C CB   . GLN A 1 71  ? -17.375 -12.597 -3.199  1.00 0.81  ? 71   GLN A CB   4  
ATOM   10705 C CG   . GLN A 1 71  ? -17.042 -13.555 -4.318  1.00 0.99  ? 71   GLN A CG   4  
ATOM   10706 C CD   . GLN A 1 71  ? -16.050 -14.613 -3.877  1.00 1.09  ? 71   GLN A CD   4  
ATOM   10707 O OE1  . GLN A 1 71  ? -16.028 -15.725 -4.401  1.00 1.31  ? 71   GLN A OE1  4  
ATOM   10708 N NE2  . GLN A 1 71  ? -15.233 -14.279 -2.890  1.00 1.42  ? 71   GLN A NE2  4  
ATOM   10709 H H    . GLN A 1 71  ? -18.029 -11.241 -5.238  1.00 0.83  ? 71   GLN A H    4  
ATOM   10710 H HA   . GLN A 1 71  ? -19.522 -12.605 -3.276  1.00 0.86  ? 71   GLN A HA   4  
ATOM   10711 H HB2  . GLN A 1 71  ? -16.589 -11.854 -3.174  1.00 0.73  ? 71   GLN A HB2  4  
ATOM   10712 H HB3  . GLN A 1 71  ? -17.368 -13.146 -2.273  1.00 0.90  ? 71   GLN A HB3  4  
ATOM   10713 H HG2  . GLN A 1 71  ? -17.948 -14.037 -4.656  1.00 1.41  ? 71   GLN A HG2  4  
ATOM   10714 H HG3  . GLN A 1 71  ? -16.604 -12.985 -5.129  1.00 1.35  ? 71   GLN A HG3  4  
ATOM   10715 H HE21 . GLN A 1 71  ? -15.313 -13.380 -2.507  1.00 1.32  ? 71   GLN A HE21 4  
ATOM   10716 H HE22 . GLN A 1 71  ? -14.594 -14.952 -2.567  1.00 1.89  ? 71   GLN A HE22 4  
ATOM   10717 N N    . LEU A 1 72  ? -18.056 -9.811  -2.305  1.00 0.59  ? 72   LEU A N    4  
ATOM   10718 C CA   . LEU A 1 72  ? -18.069 -8.751  -1.311  1.00 0.55  ? 72   LEU A CA   4  
ATOM   10719 C C    . LEU A 1 72  ? -19.374 -7.968  -1.383  1.00 0.47  ? 72   LEU A C    4  
ATOM   10720 O O    . LEU A 1 72  ? -19.874 -7.489  -0.369  1.00 0.48  ? 72   LEU A O    4  
ATOM   10721 C CB   . LEU A 1 72  ? -16.886 -7.793  -1.529  1.00 0.59  ? 72   LEU A CB   4  
ATOM   10722 C CG   . LEU A 1 72  ? -15.488 -8.405  -1.375  1.00 0.76  ? 72   LEU A CG   4  
ATOM   10723 C CD1  . LEU A 1 72  ? -14.706 -8.290  -2.677  1.00 1.37  ? 72   LEU A CD1  4  
ATOM   10724 C CD2  . LEU A 1 72  ? -14.729 -7.728  -0.243  1.00 1.35  ? 72   LEU A CD2  4  
ATOM   10725 H H    . LEU A 1 72  ? -17.422 -9.753  -3.057  1.00 0.60  ? 72   LEU A H    4  
ATOM   10726 H HA   . LEU A 1 72  ? -17.982 -9.204  -0.337  1.00 0.62  ? 72   LEU A HA   4  
ATOM   10727 H HB2  . LEU A 1 72  ? -16.967 -7.384  -2.525  1.00 0.55  ? 72   LEU A HB2  4  
ATOM   10728 H HB3  . LEU A 1 72  ? -16.977 -6.982  -0.821  1.00 0.70  ? 72   LEU A HB3  4  
ATOM   10729 H HG   . LEU A 1 72  ? -15.585 -9.454  -1.135  1.00 1.69  ? 72   LEU A HG   4  
ATOM   10730 H HD11 . LEU A 1 72  ? -14.749 -7.271  -3.037  1.00 1.90  ? 72   LEU A HD11 4  
ATOM   10731 H HD12 . LEU A 1 72  ? -15.135 -8.956  -3.418  1.00 1.96  ? 72   LEU A HD12 4  
ATOM   10732 H HD13 . LEU A 1 72  ? -13.676 -8.564  -2.503  1.00 1.98  ? 72   LEU A HD13 4  
ATOM   10733 H HD21 . LEU A 1 72  ? -14.605 -6.680  -0.471  1.00 1.79  ? 72   LEU A HD21 4  
ATOM   10734 H HD22 . LEU A 1 72  ? -13.757 -8.190  -0.132  1.00 1.93  ? 72   LEU A HD22 4  
ATOM   10735 H HD23 . LEU A 1 72  ? -15.285 -7.832  0.677   1.00 1.96  ? 72   LEU A HD23 4  
ATOM   10736 N N    . HIS A 1 73  ? -19.932 -7.880  -2.587  1.00 0.48  ? 73   HIS A N    4  
ATOM   10737 C CA   . HIS A 1 73  ? -21.104 -7.047  -2.851  1.00 0.48  ? 73   HIS A CA   4  
ATOM   10738 C C    . HIS A 1 73  ? -20.748 -5.588  -2.629  1.00 0.43  ? 73   HIS A C    4  
ATOM   10739 O O    . HIS A 1 73  ? -21.214 -4.946  -1.684  1.00 0.52  ? 73   HIS A O    4  
ATOM   10740 C CB   . HIS A 1 73  ? -22.317 -7.436  -1.992  1.00 0.55  ? 73   HIS A CB   4  
ATOM   10741 C CG   . HIS A 1 73  ? -22.871 -8.798  -2.278  1.00 1.20  ? 73   HIS A CG   4  
ATOM   10742 N ND1  . HIS A 1 73  ? -23.706 -9.067  -3.341  1.00 2.06  ? 73   HIS A ND1  4  
ATOM   10743 C CD2  . HIS A 1 73  ? -22.716 -9.970  -1.621  1.00 1.97  ? 73   HIS A CD2  4  
ATOM   10744 C CE1  . HIS A 1 73  ? -24.041 -10.344 -3.323  1.00 2.72  ? 73   HIS A CE1  4  
ATOM   10745 N NE2  . HIS A 1 73  ? -23.452 -10.912 -2.290  1.00 2.62  ? 73   HIS A NE2  4  
ATOM   10746 H H    . HIS A 1 73  ? -19.529 -8.376  -3.333  1.00 0.53  ? 73   HIS A H    4  
ATOM   10747 H HA   . HIS A 1 73  ? -21.355 -7.174  -3.895  1.00 0.56  ? 73   HIS A HA   4  
ATOM   10748 H HB2  . HIS A 1 73  ? -22.028 -7.413  -0.952  1.00 1.05  ? 73   HIS A HB2  4  
ATOM   10749 H HB3  . HIS A 1 73  ? -23.106 -6.716  -2.154  1.00 0.86  ? 73   HIS A HB3  4  
ATOM   10750 H HD1  . HIS A 1 73  ? -24.012 -8.414  -4.018  1.00 2.50  ? 73   HIS A HD1  4  
ATOM   10751 H HD2  . HIS A 1 73  ? -22.119 -10.133 -0.735  1.00 2.48  ? 73   HIS A HD2  4  
ATOM   10752 H HE1  . HIS A 1 73  ? -24.688 -10.838 -4.033  1.00 3.54  ? 73   HIS A HE1  4  
ATOM   10753 H HE2  . HIS A 1 73  ? -23.621 -11.834 -1.976  1.00 3.26  ? 73   HIS A HE2  4  
ATOM   10754 N N    . ILE A 1 74  ? -19.867 -5.099  -3.485  1.00 0.45  ? 74   ILE A N    4  
ATOM   10755 C CA   . ILE A 1 74  ? -19.427 -3.719  -3.459  1.00 0.41  ? 74   ILE A CA   4  
ATOM   10756 C C    . ILE A 1 74  ? -20.601 -2.782  -3.710  1.00 0.49  ? 74   ILE A C    4  
ATOM   10757 O O    . ILE A 1 74  ? -21.234 -2.820  -4.766  1.00 0.91  ? 74   ILE A O    4  
ATOM   10758 C CB   . ILE A 1 74  ? -18.332 -3.517  -4.512  1.00 0.38  ? 74   ILE A CB   4  
ATOM   10759 C CG1  . ILE A 1 74  ? -17.184 -4.475  -4.217  1.00 0.36  ? 74   ILE A CG1  4  
ATOM   10760 C CG2  . ILE A 1 74  ? -17.838 -2.082  -4.522  1.00 0.44  ? 74   ILE A CG2  4  
ATOM   10761 C CD1  . ILE A 1 74  ? -16.402 -4.112  -2.976  1.00 0.39  ? 74   ILE A CD1  4  
ATOM   10762 H H    . ILE A 1 74  ? -19.491 -5.697  -4.165  1.00 0.57  ? 74   ILE A H    4  
ATOM   10763 H HA   . ILE A 1 74  ? -19.010 -3.514  -2.485  1.00 0.40  ? 74   ILE A HA   4  
ATOM   10764 H HB   . ILE A 1 74  ? -18.743 -3.743  -5.483  1.00 0.44  ? 74   ILE A HB   4  
ATOM   10765 H HG12 . ILE A 1 74  ? -17.582 -5.461  -4.074  1.00 0.38  ? 74   ILE A HG12 4  
ATOM   10766 H HG13 . ILE A 1 74  ? -16.510 -4.489  -5.050  1.00 0.36  ? 74   ILE A HG13 4  
ATOM   10767 H HG21 . ILE A 1 74  ? -18.642 -1.425  -4.816  1.00 0.98  ? 74   ILE A HG21 4  
ATOM   10768 H HG22 . ILE A 1 74  ? -17.019 -1.995  -5.228  1.00 1.15  ? 74   ILE A HG22 4  
ATOM   10769 H HG23 . ILE A 1 74  ? -17.492 -1.814  -3.533  1.00 1.08  ? 74   ILE A HG23 4  
ATOM   10770 H HD11 . ILE A 1 74  ? -15.707 -4.903  -2.743  1.00 1.10  ? 74   ILE A HD11 4  
ATOM   10771 H HD12 . ILE A 1 74  ? -17.088 -3.973  -2.147  1.00 1.13  ? 74   ILE A HD12 4  
ATOM   10772 H HD13 . ILE A 1 74  ? -15.858 -3.193  -3.151  1.00 1.05  ? 74   ILE A HD13 4  
ATOM   10773 N N    . THR A 1 75  ? -20.885 -1.962  -2.721  1.00 0.38  ? 75   THR A N    4  
ATOM   10774 C CA   . THR A 1 75  ? -22.092 -1.169  -2.700  1.00 0.40  ? 75   THR A CA   4  
ATOM   10775 C C    . THR A 1 75  ? -21.865 0.007   -1.725  1.00 0.37  ? 75   THR A C    4  
ATOM   10776 O O    . THR A 1 75  ? -20.719 0.227   -1.327  1.00 0.34  ? 75   THR A O    4  
ATOM   10777 C CB   . THR A 1 75  ? -23.271 -2.099  -2.274  1.00 0.46  ? 75   THR A CB   4  
ATOM   10778 O OG1  . THR A 1 75  ? -24.495 -1.719  -2.917  1.00 0.51  ? 75   THR A OG1  4  
ATOM   10779 C CG2  . THR A 1 75  ? -23.467 -2.118  -0.764  1.00 0.46  ? 75   THR A CG2  4  
ATOM   10780 H H    . THR A 1 75  ? -20.255 -1.876  -1.976  1.00 0.63  ? 75   THR A H    4  
ATOM   10781 H HA   . THR A 1 75  ? -22.277 -0.788  -3.694  1.00 0.42  ? 75   THR A HA   4  
ATOM   10782 H HB   . THR A 1 75  ? -23.025 -3.104  -2.589  1.00 0.48  ? 75   THR A HB   4  
ATOM   10783 H HG1  . THR A 1 75  ? -24.323 -1.548  -3.858  1.00 0.93  ? 75   THR A HG1  4  
ATOM   10784 H HG21 . THR A 1 75  ? -22.563 -2.469  -0.287  1.00 1.10  ? 75   THR A HG21 4  
ATOM   10785 H HG22 . THR A 1 75  ? -24.286 -2.776  -0.513  1.00 1.12  ? 75   THR A HG22 4  
ATOM   10786 H HG23 . THR A 1 75  ? -23.690 -1.116  -0.420  1.00 1.04  ? 75   THR A HG23 4  
ATOM   10787 N N    . PRO A 1 76  ? -22.904 0.823   -1.404  1.00 0.38  ? 76   PRO A N    4  
ATOM   10788 C CA   . PRO A 1 76  ? -22.925 1.750   -0.266  1.00 0.37  ? 76   PRO A CA   4  
ATOM   10789 C C    . PRO A 1 76  ? -22.086 1.311   0.945   1.00 0.35  ? 76   PRO A C    4  
ATOM   10790 O O    . PRO A 1 76  ? -21.660 0.164   1.033   1.00 0.35  ? 76   PRO A O    4  
ATOM   10791 C CB   . PRO A 1 76  ? -24.411 1.784   0.105   1.00 0.42  ? 76   PRO A CB   4  
ATOM   10792 C CG   . PRO A 1 76  ? -25.157 1.295   -1.101  1.00 0.47  ? 76   PRO A CG   4  
ATOM   10793 C CD   . PRO A 1 76  ? -24.138 0.989   -2.167  1.00 0.44  ? 76   PRO A CD   4  
ATOM   10794 H HA   . PRO A 1 76  ? -22.612 2.739   -0.564  1.00 0.37  ? 76   PRO A HA   4  
ATOM   10795 H HB2  . PRO A 1 76  ? -24.580 1.141   0.953   1.00 0.42  ? 76   PRO A HB2  4  
ATOM   10796 H HB3  . PRO A 1 76  ? -24.695 2.795   0.357   1.00 0.45  ? 76   PRO A HB3  4  
ATOM   10797 H HG2  . PRO A 1 76  ? -25.706 0.400   -0.849  1.00 0.52  ? 76   PRO A HG2  4  
ATOM   10798 H HG3  . PRO A 1 76  ? -25.835 2.063   -1.442  1.00 0.53  ? 76   PRO A HG3  4  
ATOM   10799 H HD2  . PRO A 1 76  ? -24.396 0.081   -2.690  1.00 0.46  ? 76   PRO A HD2  4  
ATOM   10800 H HD3  . PRO A 1 76  ? -24.058 1.814   -2.854  1.00 0.44  ? 76   PRO A HD3  4  
ATOM   10801 N N    . GLY A 1 77  ? -21.870 2.269   1.857   1.00 0.36  ? 77   GLY A N    4  
ATOM   10802 C CA   . GLY A 1 77  ? -21.011 2.120   3.047   1.00 0.37  ? 77   GLY A CA   4  
ATOM   10803 C C    . GLY A 1 77  ? -20.875 0.719   3.639   1.00 0.38  ? 77   GLY A C    4  
ATOM   10804 O O    . GLY A 1 77  ? -19.840 0.400   4.228   1.00 0.40  ? 77   GLY A O    4  
ATOM   10805 H H    . GLY A 1 77  ? -22.308 3.139   1.711   1.00 0.38  ? 77   GLY A H    4  
ATOM   10806 H HA2  . GLY A 1 77  ? -20.024 2.468   2.794   1.00 0.35  ? 77   GLY A HA2  4  
ATOM   10807 H HA3  . GLY A 1 77  ? -21.407 2.768   3.818   1.00 0.41  ? 77   GLY A HA3  4  
ATOM   10808 N N    . THR A 1 78  ? -21.890 -0.115  3.496   1.00 0.40  ? 78   THR A N    4  
ATOM   10809 C CA   . THR A 1 78  ? -21.846 -1.476  3.998   1.00 0.42  ? 78   THR A CA   4  
ATOM   10810 C C    . THR A 1 78  ? -20.834 -2.346  3.239   1.00 0.38  ? 78   THR A C    4  
ATOM   10811 O O    . THR A 1 78  ? -20.661 -3.527  3.542   1.00 0.40  ? 78   THR A O    4  
ATOM   10812 C CB   . THR A 1 78  ? -23.242 -2.109  3.956   1.00 0.49  ? 78   THR A CB   4  
ATOM   10813 O OG1  . THR A 1 78  ? -23.831 -1.922  2.659   1.00 0.50  ? 78   THR A OG1  4  
ATOM   10814 C CG2  . THR A 1 78  ? -24.120 -1.469  5.012   1.00 0.56  ? 78   THR A CG2  4  
ATOM   10815 H H    . THR A 1 78  ? -22.689 0.186   3.013   1.00 0.41  ? 78   THR A H    4  
ATOM   10816 H HA   . THR A 1 78  ? -21.540 -1.426  5.033   1.00 0.46  ? 78   THR A HA   4  
ATOM   10817 H HB   . THR A 1 78  ? -23.158 -3.166  4.164   1.00 0.49  ? 78   THR A HB   4  
ATOM   10818 H HG1  . THR A 1 78  ? -24.112 -2.780  2.307   1.00 0.80  ? 78   THR A HG1  4  
ATOM   10819 H HG21 . THR A 1 78  ? -24.136 -0.397  4.858   1.00 1.12  ? 78   THR A HG21 4  
ATOM   10820 H HG22 . THR A 1 78  ? -23.717 -1.687  5.990   1.00 1.22  ? 78   THR A HG22 4  
ATOM   10821 H HG23 . THR A 1 78  ? -25.122 -1.861  4.936   1.00 1.14  ? 78   THR A HG23 4  
ATOM   10822 N N    . ALA A 1 79  ? -20.140 -1.743  2.273   1.00 0.34  ? 79   ALA A N    4  
ATOM   10823 C CA   . ALA A 1 79  ? -19.024 -2.394  1.602   1.00 0.31  ? 79   ALA A CA   4  
ATOM   10824 C C    . ALA A 1 79  ? -17.826 -2.475  2.537   1.00 0.30  ? 79   ALA A C    4  
ATOM   10825 O O    . ALA A 1 79  ? -16.871 -3.202  2.282   1.00 0.31  ? 79   ALA A O    4  
ATOM   10826 C CB   . ALA A 1 79  ? -18.651 -1.651  0.329   1.00 0.32  ? 79   ALA A CB   4  
ATOM   10827 H H    . ALA A 1 79  ? -20.406 -0.839  1.992   1.00 0.36  ? 79   ALA A H    4  
ATOM   10828 H HA   . ALA A 1 79  ? -19.331 -3.396  1.334   1.00 0.33  ? 79   ALA A HA   4  
ATOM   10829 H HB1  . ALA A 1 79  ? -19.547 -1.418  -0.225  1.00 1.07  ? 79   ALA A HB1  4  
ATOM   10830 H HB2  . ALA A 1 79  ? -18.002 -2.275  -0.279  1.00 1.03  ? 79   ALA A HB2  4  
ATOM   10831 H HB3  . ALA A 1 79  ? -18.134 -0.736  0.586   1.00 1.05  ? 79   ALA A HB3  4  
ATOM   10832 N N    . TYR A 1 80  ? -17.890 -1.721  3.628   1.00 0.33  ? 80   TYR A N    4  
ATOM   10833 C CA   . TYR A 1 80  ? -16.856 -1.762  4.654   1.00 0.36  ? 80   TYR A CA   4  
ATOM   10834 C C    . TYR A 1 80  ? -17.003 -3.031  5.474   1.00 0.36  ? 80   TYR A C    4  
ATOM   10835 O O    . TYR A 1 80  ? -16.050 -3.503  6.081   1.00 0.38  ? 80   TYR A O    4  
ATOM   10836 C CB   . TYR A 1 80  ? -16.941 -0.517  5.548   1.00 0.44  ? 80   TYR A CB   4  
ATOM   10837 C CG   . TYR A 1 80  ? -16.026 -0.545  6.756   1.00 1.15  ? 80   TYR A CG   4  
ATOM   10838 C CD1  . TYR A 1 80  ? -14.645 -0.535  6.600   1.00 2.21  ? 80   TYR A CD1  4  
ATOM   10839 C CD2  . TYR A 1 80  ? -16.538 -0.578  8.048   1.00 1.69  ? 80   TYR A CD2  4  
ATOM   10840 C CE1  . TYR A 1 80  ? -13.801 -0.558  7.691   1.00 3.13  ? 80   TYR A CE1  4  
ATOM   10841 C CE2  . TYR A 1 80  ? -15.697 -0.600  9.147   1.00 2.52  ? 80   TYR A CE2  4  
ATOM   10842 C CZ   . TYR A 1 80  ? -14.361 -0.604  8.985   1.00 3.12  ? 80   TYR A CZ   4  
ATOM   10843 O OH   . TYR A 1 80  ? -13.488 -0.614  10.050  1.00 4.13  ? 80   TYR A OH   4  
ATOM   10844 H H    . TYR A 1 80  ? -18.662 -1.123  3.750   1.00 0.35  ? 80   TYR A H    4  
ATOM   10845 H HA   . TYR A 1 80  ? -15.894 -1.783  4.161   1.00 0.36  ? 80   TYR A HA   4  
ATOM   10846 H HB2  . TYR A 1 80  ? -16.684 0.351   4.962   1.00 1.09  ? 80   TYR A HB2  4  
ATOM   10847 H HB3  . TYR A 1 80  ? -17.957 -0.412  5.904   1.00 0.85  ? 80   TYR A HB3  4  
ATOM   10848 H HD1  . TYR A 1 80  ? -14.231 -0.510  5.602   1.00 2.57  ? 80   TYR A HD1  4  
ATOM   10849 H HD2  . TYR A 1 80  ? -17.607 -0.587  8.189   1.00 1.99  ? 80   TYR A HD2  4  
ATOM   10850 H HE1  . TYR A 1 80  ? -12.730 -0.548  7.546   1.00 4.05  ? 80   TYR A HE1  4  
ATOM   10851 H HE2  . TYR A 1 80  ? -16.112 -0.625  10.145  1.00 3.04  ? 80   TYR A HE2  4  
ATOM   10852 H HH   . TYR A 1 80  ? -13.819 -1.249  10.703  1.00 4.31  ? 80   TYR A HH   4  
ATOM   10853 N N    . GLN A 1 81  ? -18.201 -3.593  5.464   1.00 0.37  ? 81   GLN A N    4  
ATOM   10854 C CA   . GLN A 1 81  ? -18.444 -4.872  6.114   1.00 0.41  ? 81   GLN A CA   4  
ATOM   10855 C C    . GLN A 1 81  ? -18.029 -6.000  5.189   1.00 0.41  ? 81   GLN A C    4  
ATOM   10856 O O    . GLN A 1 81  ? -17.666 -7.093  5.623   1.00 0.46  ? 81   GLN A O    4  
ATOM   10857 C CB   . GLN A 1 81  ? -19.914 -5.013  6.503   1.00 0.45  ? 81   GLN A CB   4  
ATOM   10858 C CG   . GLN A 1 81  ? -20.286 -4.230  7.749   1.00 0.58  ? 81   GLN A CG   4  
ATOM   10859 C CD   . GLN A 1 81  ? -21.768 -4.282  8.046   1.00 0.68  ? 81   GLN A CD   4  
ATOM   10860 O OE1  . GLN A 1 81  ? -22.245 -5.178  8.742   1.00 1.03  ? 81   GLN A OE1  4  
ATOM   10861 N NE2  . GLN A 1 81  ? -22.503 -3.317  7.526   1.00 0.79  ? 81   GLN A NE2  4  
ATOM   10862 H H    . GLN A 1 81  ? -18.937 -3.139  4.997   1.00 0.36  ? 81   GLN A H    4  
ATOM   10863 H HA   . GLN A 1 81  ? -17.833 -4.910  6.998   1.00 0.44  ? 81   GLN A HA   4  
ATOM   10864 H HB2  . GLN A 1 81  ? -20.527 -4.657  5.687   1.00 0.45  ? 81   GLN A HB2  4  
ATOM   10865 H HB3  . GLN A 1 81  ? -20.129 -6.055  6.677   1.00 0.47  ? 81   GLN A HB3  4  
ATOM   10866 H HG2  . GLN A 1 81  ? -19.753 -4.644  8.591   1.00 0.67  ? 81   GLN A HG2  4  
ATOM   10867 H HG3  . GLN A 1 81  ? -19.995 -3.199  7.611   1.00 0.63  ? 81   GLN A HG3  4  
ATOM   10868 H HE21 . GLN A 1 81  ? -22.051 -2.633  6.989   1.00 1.01  ? 81   GLN A HE21 4  
ATOM   10869 H HE22 . GLN A 1 81  ? -23.474 -3.323  7.701   1.00 0.89  ? 81   GLN A HE22 4  
ATOM   10870 N N    . SER A 1 82  ? -18.097 -5.712  3.911   1.00 0.39  ? 82   SER A N    4  
ATOM   10871 C CA   . SER A 1 82  ? -17.587 -6.595  2.883   1.00 0.41  ? 82   SER A CA   4  
ATOM   10872 C C    . SER A 1 82  ? -16.069 -6.618  2.941   1.00 0.41  ? 82   SER A C    4  
ATOM   10873 O O    . SER A 1 82  ? -15.446 -7.674  3.027   1.00 0.48  ? 82   SER A O    4  
ATOM   10874 C CB   . SER A 1 82  ? -18.046 -6.080  1.525   1.00 0.41  ? 82   SER A CB   4  
ATOM   10875 O OG   . SER A 1 82  ? -19.427 -5.758  1.543   1.00 0.43  ? 82   SER A OG   4  
ATOM   10876 H H    . SER A 1 82  ? -18.521 -4.877  3.644   1.00 0.39  ? 82   SER A H    4  
ATOM   10877 H HA   . SER A 1 82  ? -17.970 -7.591  3.051   1.00 0.44  ? 82   SER A HA   4  
ATOM   10878 H HB2  . SER A 1 82  ? -17.487 -5.191  1.271   1.00 0.41  ? 82   SER A HB2  4  
ATOM   10879 H HB3  . SER A 1 82  ? -17.874 -6.835  0.778   1.00 0.42  ? 82   SER A HB3  4  
ATOM   10880 H HG   . SER A 1 82  ? -19.867 -6.215  0.812   1.00 0.43  ? 82   SER A HG   4  
ATOM   10881 N N    . PHE A 1 83  ? -15.487 -5.427  2.913   1.00 0.38  ? 83   PHE A N    4  
ATOM   10882 C CA   . PHE A 1 83  ? -14.049 -5.269  3.003   1.00 0.37  ? 83   PHE A CA   4  
ATOM   10883 C C    . PHE A 1 83  ? -13.559 -5.705  4.381   1.00 0.38  ? 83   PHE A C    4  
ATOM   10884 O O    . PHE A 1 83  ? -12.404 -6.086  4.540   1.00 0.39  ? 83   PHE A O    4  
ATOM   10885 C CB   . PHE A 1 83  ? -13.669 -3.811  2.718   1.00 0.36  ? 83   PHE A CB   4  
ATOM   10886 C CG   . PHE A 1 83  ? -12.191 -3.539  2.736   1.00 0.56  ? 83   PHE A CG   4  
ATOM   10887 C CD1  . PHE A 1 83  ? -11.347 -4.184  1.847   1.00 0.79  ? 83   PHE A CD1  4  
ATOM   10888 C CD2  . PHE A 1 83  ? -11.648 -2.645  3.643   1.00 0.75  ? 83   PHE A CD2  4  
ATOM   10889 C CE1  . PHE A 1 83  ? -9.989  -3.941  1.864   1.00 1.07  ? 83   PHE A CE1  4  
ATOM   10890 C CE2  . PHE A 1 83  ? -10.290 -2.396  3.664   1.00 1.05  ? 83   PHE A CE2  4  
ATOM   10891 C CZ   . PHE A 1 83  ? -9.463  -3.026  2.765   1.00 1.18  ? 83   PHE A CZ   4  
ATOM   10892 H H    . PHE A 1 83  ? -16.047 -4.625  2.818   1.00 0.37  ? 83   PHE A H    4  
ATOM   10893 H HA   . PHE A 1 83  ? -13.598 -5.902  2.256   1.00 0.40  ? 83   PHE A HA   4  
ATOM   10894 H HB2  . PHE A 1 83  ? -14.038 -3.538  1.741   1.00 0.49  ? 83   PHE A HB2  4  
ATOM   10895 H HB3  . PHE A 1 83  ? -14.132 -3.176  3.457   1.00 0.41  ? 83   PHE A HB3  4  
ATOM   10896 H HD1  . PHE A 1 83  ? -11.761 -4.884  1.135   1.00 0.86  ? 83   PHE A HD1  4  
ATOM   10897 H HD2  . PHE A 1 83  ? -12.298 -2.136  4.340   1.00 0.78  ? 83   PHE A HD2  4  
ATOM   10898 H HE1  . PHE A 1 83  ? -9.340  -4.449  1.166   1.00 1.29  ? 83   PHE A HE1  4  
ATOM   10899 H HE2  . PHE A 1 83  ? -9.879  -1.697  4.376   1.00 1.26  ? 83   PHE A HE2  4  
ATOM   10900 H HZ   . PHE A 1 83  ? -8.402  -2.827  2.777   1.00 1.44  ? 83   PHE A HZ   4  
ATOM   10901 N N    . GLU A 1 84  ? -14.460 -5.676  5.360   1.00 0.41  ? 84   GLU A N    4  
ATOM   10902 C CA   . GLU A 1 84  ? -14.145 -6.075  6.730   1.00 0.48  ? 84   GLU A CA   4  
ATOM   10903 C C    . GLU A 1 84  ? -13.580 -7.480  6.763   1.00 0.52  ? 84   GLU A C    4  
ATOM   10904 O O    . GLU A 1 84  ? -12.555 -7.739  7.391   1.00 0.55  ? 84   GLU A O    4  
ATOM   10905 C CB   . GLU A 1 84  ? -15.394 -6.028  7.599   1.00 0.55  ? 84   GLU A CB   4  
ATOM   10906 C CG   . GLU A 1 84  ? -15.128 -6.360  9.049   1.00 0.62  ? 84   GLU A CG   4  
ATOM   10907 C CD   . GLU A 1 84  ? -16.279 -5.998  9.959   1.00 0.71  ? 84   GLU A CD   4  
ATOM   10908 O OE1  . GLU A 1 84  ? -16.353 -4.832  10.396  1.00 0.80  ? 84   GLU A OE1  4  
ATOM   10909 O OE2  . GLU A 1 84  ? -17.112 -6.879  10.250  1.00 0.78  ? 84   GLU A OE2  4  
ATOM   10910 H H    . GLU A 1 84  ? -15.368 -5.374  5.155   1.00 0.40  ? 84   GLU A H    4  
ATOM   10911 H HA   . GLU A 1 84  ? -13.413 -5.384  7.121   1.00 0.48  ? 84   GLU A HA   4  
ATOM   10912 H HB2  . GLU A 1 84  ? -15.815 -5.047  7.546   1.00 0.56  ? 84   GLU A HB2  4  
ATOM   10913 H HB3  . GLU A 1 84  ? -16.108 -6.739  7.215   1.00 0.57  ? 84   GLU A HB3  4  
ATOM   10914 H HG2  . GLU A 1 84  ? -14.941 -7.421  9.134   1.00 0.64  ? 84   GLU A HG2  4  
ATOM   10915 H HG3  . GLU A 1 84  ? -14.254 -5.821  9.361   1.00 0.63  ? 84   GLU A HG3  4  
ATOM   10916 N N    . GLN A 1 85  ? -14.281 -8.370  6.080   1.00 0.57  ? 85   GLN A N    4  
ATOM   10917 C CA   . GLN A 1 85  ? -13.876 -9.759  5.910   1.00 0.65  ? 85   GLN A CA   4  
ATOM   10918 C C    . GLN A 1 85  ? -12.419 -9.874  5.506   1.00 0.64  ? 85   GLN A C    4  
ATOM   10919 O O    . GLN A 1 85  ? -11.736 -10.844 5.833   1.00 0.71  ? 85   GLN A O    4  
ATOM   10920 C CB   . GLN A 1 85  ? -14.732 -10.383 4.820   1.00 0.69  ? 85   GLN A CB   4  
ATOM   10921 C CG   . GLN A 1 85  ? -16.204 -10.282 5.108   1.00 0.79  ? 85   GLN A CG   4  
ATOM   10922 C CD   . GLN A 1 85  ? -17.072 -10.939 4.051   1.00 1.13  ? 85   GLN A CD   4  
ATOM   10923 O OE1  . GLN A 1 85  ? -16.741 -10.943 2.867   1.00 1.44  ? 85   GLN A OE1  4  
ATOM   10924 N NE2  . GLN A 1 85  ? -18.183 -11.513 4.476   1.00 1.62  ? 85   GLN A NE2  4  
ATOM   10925 H H    . GLN A 1 85  ? -15.129 -8.082  5.683   1.00 0.56  ? 85   GLN A H    4  
ATOM   10926 H HA   . GLN A 1 85  ? -14.037 -10.282 6.836   1.00 0.72  ? 85   GLN A HA   4  
ATOM   10927 H HB2  . GLN A 1 85  ? -14.538 -9.868  3.889   1.00 0.74  ? 85   GLN A HB2  4  
ATOM   10928 H HB3  . GLN A 1 85  ? -14.469 -11.423 4.716   1.00 0.91  ? 85   GLN A HB3  4  
ATOM   10929 H HG2  . GLN A 1 85  ? -16.403 -10.734 6.058   1.00 1.13  ? 85   GLN A HG2  4  
ATOM   10930 H HG3  . GLN A 1 85  ? -16.451 -9.240  5.152   1.00 1.03  ? 85   GLN A HG3  4  
ATOM   10931 H HE21 . GLN A 1 85  ? -18.384 -11.478 5.440   1.00 1.78  ? 85   GLN A HE21 4  
ATOM   10932 H HE22 . GLN A 1 85  ? -18.757 -11.958 3.818   1.00 1.99  ? 85   GLN A HE22 4  
ATOM   10933 N N    . VAL A 1 86  ? -11.953 -8.865  4.809   1.00 0.58  ? 86   VAL A N    4  
ATOM   10934 C CA   . VAL A 1 86  ? -10.637 -8.892  4.234   1.00 0.62  ? 86   VAL A CA   4  
ATOM   10935 C C    . VAL A 1 86  ? -9.629  -8.319  5.208   1.00 0.55  ? 86   VAL A C    4  
ATOM   10936 O O    . VAL A 1 86  ? -8.599  -8.912  5.472   1.00 0.59  ? 86   VAL A O    4  
ATOM   10937 C CB   . VAL A 1 86  ? -10.568 -8.077  2.948   1.00 0.70  ? 86   VAL A CB   4  
ATOM   10938 C CG1  . VAL A 1 86  ? -9.432  -8.611  2.122   1.00 1.13  ? 86   VAL A CG1  4  
ATOM   10939 C CG2  . VAL A 1 86  ? -11.886 -8.124  2.191   1.00 1.30  ? 86   VAL A CG2  4  
ATOM   10940 H H    . VAL A 1 86  ? -12.504 -8.062  4.707   1.00 0.55  ? 86   VAL A H    4  
ATOM   10941 H HA   . VAL A 1 86  ? -10.386 -9.923  4.010   1.00 0.70  ? 86   VAL A HA   4  
ATOM   10942 H HB   . VAL A 1 86  ? -10.352 -7.050  3.203   1.00 1.43  ? 86   VAL A HB   4  
ATOM   10943 H HG11 . VAL A 1 86  ? -8.521  -8.575  2.713   1.00 1.61  ? 86   VAL A HG11 4  
ATOM   10944 H HG12 . VAL A 1 86  ? -9.319  -8.014  1.232   1.00 1.74  ? 86   VAL A HG12 4  
ATOM   10945 H HG13 . VAL A 1 86  ? -9.650  -9.643  1.852   1.00 1.76  ? 86   VAL A HG13 4  
ATOM   10946 H HG21 . VAL A 1 86  ? -12.018 -7.202  1.645   1.00 1.79  ? 86   VAL A HG21 4  
ATOM   10947 H HG22 . VAL A 1 86  ? -12.704 -8.253  2.893   1.00 1.90  ? 86   VAL A HG22 4  
ATOM   10948 H HG23 . VAL A 1 86  ? -11.869 -8.947  1.500   1.00 1.83  ? 86   VAL A HG23 4  
ATOM   10949 N N    . VAL A 1 87  ? -9.932  -7.152  5.746   1.00 0.51  ? 87   VAL A N    4  
ATOM   10950 C CA   . VAL A 1 87  ? -9.063  -6.540  6.742   1.00 0.51  ? 87   VAL A CA   4  
ATOM   10951 C C    . VAL A 1 87  ? -8.800  -7.540  7.841   1.00 0.56  ? 87   VAL A C    4  
ATOM   10952 O O    . VAL A 1 87  ? -7.708  -7.644  8.397   1.00 0.60  ? 87   VAL A O    4  
ATOM   10953 C CB   . VAL A 1 87  ? -9.712  -5.341  7.430   1.00 0.54  ? 87   VAL A CB   4  
ATOM   10954 C CG1  . VAL A 1 87  ? -8.702  -4.240  7.640   1.00 0.75  ? 87   VAL A CG1  4  
ATOM   10955 C CG2  . VAL A 1 87  ? -10.940 -4.858  6.700   1.00 0.85  ? 87   VAL A CG2  4  
ATOM   10956 H H    . VAL A 1 87  ? -10.756 -6.696  5.471   1.00 0.50  ? 87   VAL A H    4  
ATOM   10957 H HA   . VAL A 1 87  ? -8.138  -6.240  6.271   1.00 0.53  ? 87   VAL A HA   4  
ATOM   10958 H HB   . VAL A 1 87  ? -10.032 -5.681  8.399   1.00 0.77  ? 87   VAL A HB   4  
ATOM   10959 H HG11 . VAL A 1 87  ? -7.938  -4.588  8.320   1.00 1.28  ? 87   VAL A HG11 4  
ATOM   10960 H HG12 . VAL A 1 87  ? -9.192  -3.374  8.058   1.00 1.30  ? 87   VAL A HG12 4  
ATOM   10961 H HG13 . VAL A 1 87  ? -8.249  -3.982  6.694   1.00 1.40  ? 87   VAL A HG13 4  
ATOM   10962 H HG21 . VAL A 1 87  ? -11.311 -3.962  7.172   1.00 1.36  ? 87   VAL A HG21 4  
ATOM   10963 H HG22 . VAL A 1 87  ? -11.700 -5.633  6.749   1.00 1.39  ? 87   VAL A HG22 4  
ATOM   10964 H HG23 . VAL A 1 87  ? -10.695 -4.655  5.669   1.00 1.43  ? 87   VAL A HG23 4  
ATOM   10965 N N    . ASN A 1 88  ? -9.858  -8.256  8.136   1.00 0.61  ? 88   ASN A N    4  
ATOM   10966 C CA   . ASN A 1 88  ? -9.875  -9.236  9.178   1.00 0.71  ? 88   ASN A CA   4  
ATOM   10967 C C    . ASN A 1 88  ? -8.893  -10.378 8.912   1.00 0.78  ? 88   ASN A C    4  
ATOM   10968 O O    . ASN A 1 88  ? -8.157  -10.765 9.814   1.00 0.91  ? 88   ASN A O    4  
ATOM   10969 C CB   . ASN A 1 88  ? -11.300 -9.732  9.357   1.00 0.73  ? 88   ASN A CB   4  
ATOM   10970 C CG   . ASN A 1 88  ? -12.005 -9.006  10.485  1.00 0.78  ? 88   ASN A CG   4  
ATOM   10971 O OD1  . ASN A 1 88  ? -11.987 -9.453  11.633  1.00 0.87  ? 88   ASN A OD1  4  
ATOM   10972 N ND2  . ASN A 1 88  ? -12.627 -7.878  10.171  1.00 0.73  ? 88   ASN A ND2  4  
ATOM   10973 H H    . ASN A 1 88  ? -10.679 -8.107  7.618   1.00 0.61  ? 88   ASN A H    4  
ATOM   10974 H HA   . ASN A 1 88  ? -9.578  -8.734  10.084  1.00 0.76  ? 88   ASN A HA   4  
ATOM   10975 H HB2  . ASN A 1 88  ? -11.842 -9.548  8.443   1.00 0.68  ? 88   ASN A HB2  4  
ATOM   10976 H HB3  . ASN A 1 88  ? -11.296 -10.777 9.561   1.00 0.79  ? 88   ASN A HB3  4  
ATOM   10977 H HD21 . ASN A 1 88  ? -12.610 -7.579  9.231   1.00 0.66  ? 88   ASN A HD21 4  
ATOM   10978 H HD22 . ASN A 1 88  ? -13.061 -7.370  10.893  1.00 0.78  ? 88   ASN A HD22 4  
ATOM   10979 N N    . GLU A 1