data_2LVM
# 
_entry.id   2LVM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LVM         
RCSB  RCSB102887   
BMRB  18579        
WWPDB D_1000102887 
# 
_pdbx_database_related.db_id          18579 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LVM 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-07 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cui, G.'     1 
'Botuyan, M.' 2 
'Mer, G.'     3 
# 
_citation.id                        primary 
_citation.title                     
'Acetylation limits 53BP1 association with damaged chromatin to promote homologous recombination.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            20 
_citation.page_first                317 
_citation.page_last                 325 
_citation.year                      2013 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23377543 
_citation.pdbx_database_id_DOI      10.1038/nsmb.2499 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tang, J.'        1 
primary 'Cho, N.W.'       2 
primary 'Cui, G.'         3 
primary 'Manion, E.M.'    4 
primary 'Shanbhag, N.M.'  5 
primary 'Botuyan, M.V.'   6 
primary 'Mer, G.'         7 
primary 'Greenberg, R.A.' 8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Tumor suppressor p53-binding protein 1' 13944.780 1 ? ? 'UNP residues 1484-1603' ? 
2 polymer man 'Histone H4'                             1724.044  1 ? ? 'UNP residues 15-28'     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        '53BP1, p53-binding protein 1, p53BP1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKG
HRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
;
;GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKG
HRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
;
A ? 
2 'polypeptide(L)' no yes 'GAKRHR(MLY)VLRDNIQ' GAKRHRKVLRDNIQ B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   ASN n 
1 5   SER n 
1 6   PHE n 
1 7   VAL n 
1 8   GLY n 
1 9   LEU n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LYS n 
1 15  TRP n 
1 16  SER n 
1 17  SER n 
1 18  ASN n 
1 19  GLY n 
1 20  TYR n 
1 21  PHE n 
1 22  TYR n 
1 23  SER n 
1 24  GLY n 
1 25  LYS n 
1 26  ILE n 
1 27  THR n 
1 28  ARG n 
1 29  ASP n 
1 30  VAL n 
1 31  GLY n 
1 32  ALA n 
1 33  GLY n 
1 34  LYS n 
1 35  TYR n 
1 36  LYS n 
1 37  LEU n 
1 38  LEU n 
1 39  PHE n 
1 40  ASP n 
1 41  ASP n 
1 42  GLY n 
1 43  TYR n 
1 44  GLU n 
1 45  CYS n 
1 46  ASP n 
1 47  VAL n 
1 48  LEU n 
1 49  GLY n 
1 50  LYS n 
1 51  ASP n 
1 52  ILE n 
1 53  LEU n 
1 54  LEU n 
1 55  CYS n 
1 56  ASP n 
1 57  PRO n 
1 58  ILE n 
1 59  PRO n 
1 60  LEU n 
1 61  ASP n 
1 62  THR n 
1 63  GLU n 
1 64  VAL n 
1 65  THR n 
1 66  ALA n 
1 67  LEU n 
1 68  SER n 
1 69  GLU n 
1 70  ASP n 
1 71  GLU n 
1 72  TYR n 
1 73  PHE n 
1 74  SER n 
1 75  ALA n 
1 76  GLY n 
1 77  VAL n 
1 78  VAL n 
1 79  LYS n 
1 80  GLY n 
1 81  HIS n 
1 82  ARG n 
1 83  LYS n 
1 84  GLU n 
1 85  SER n 
1 86  GLY n 
1 87  GLU n 
1 88  LEU n 
1 89  TYR n 
1 90  TYR n 
1 91  SER n 
1 92  ILE n 
1 93  GLU n 
1 94  LYS n 
1 95  GLU n 
1 96  GLY n 
1 97  GLN n 
1 98  ARG n 
1 99  LYS n 
1 100 TRP n 
1 101 TYR n 
1 102 LYS n 
1 103 ARG n 
1 104 MET n 
1 105 ALA n 
1 106 VAL n 
1 107 ILE n 
1 108 LEU n 
1 109 SER n 
1 110 LEU n 
1 111 GLU n 
1 112 GLN n 
1 113 GLY n 
1 114 ASN n 
1 115 ARG n 
1 116 LEU n 
1 117 ARG n 
1 118 GLU n 
1 119 GLN n 
1 120 TYR n 
1 121 GLY n 
1 122 LEU n 
1 123 GLY n 
2 1   GLY n 
2 2   ALA n 
2 3   LYS n 
2 4   ARG n 
2 5   HIS n 
2 6   ARG n 
2 7   MLY n 
2 8   VAL n 
2 9   LEU n 
2 10  ARG n 
2 11  ASP n 
2 12  ASN n 
2 13  ILE n 
2 14  GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human ? TP53BP1 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? pTEV ? ? ? ? ? 
2 1 sample ? ? ? human ? ?       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? pGB1 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TP53B_HUMAN Q12888 1 
;NSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPLDTEVTALSEDEYFSAGVVKGHRK
ESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQYGLG
;
1484 ? 
2 UNP H4_HUMAN    P62805 2 GAKRHRKVLRDNIQ 15   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LVM A 4 ? 123 ? Q12888 1484 ? 1603 ? 1484 1603 
2 2 2LVM B 1 ? 14  ? P62805 15   ? 28   ? 14   27   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LVM GLY A 1 ? UNP Q12888 ? ? 'EXPRESSION TAG' -3 1 
1 2LVM HIS A 2 ? UNP Q12888 ? ? 'EXPRESSION TAG' -2 2 
1 2LVM MET A 3 ? UNP Q12888 ? ? 'EXPRESSION TAG' -1 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
MLY 'L-peptide linking' n N-DIMETHYL-LYSINE ? 'C8 H18 N2 O2'   174.241 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'                        
1 2  1 '2D 1H-13C HSQC'                        
1 3  1 '2D 1H-13C HSQC aliphatic'              
1 4  1 '2D 1H-13C HSQC aromatic'               
1 5  1 '3D HNCA'                               
1 6  1 '3D HNCACB'                             
1 7  1 '3D CBCA(CO)NH'                         
1 8  1 '3D HNCO'                               
1 9  1 '3D HN(CA)CO'                           
1 10 1 '3D C(CO)NH'                            
1 11 1 '3D HCCH-TOCSY'                         
1 12 1 '3D HBHA(CO)NH'                         
1 13 1 '3D 1H-15N TOCSY'                       
1 14 1 '3D 1H-15N NOESY'                       
1 15 1 '3D 1H-13C NOESY aliphatic'             
1 16 1 '3D 1H-13C NOESY aromatic'              
1 17 2 '3D 13C/15N-filtered, 13C-edited NOESY' 
1 18 3 '2D 1H-15N HSQC'                        
1 19 3 '2D 1H-13C HSQC'                        
1 20 3 '3D HCCH-TOCSY'                         
1 21 4 '3D 13C/15N-filtered, 13C-edited NOESY' 
1 22 3 '3D 1H-15N NOESY'                       
1 23 3 '3D 1H-13C NOESY'                       
1 24 1 '2D (HB)CB(CGCD)HD'                     
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1.7 mM [U-100% 13C; U-100% 15N] protein_1, 8.5 mM protein_2, 25 mM sodium phosphate, 0.001 % DSS, 0.001 % NaN3, 90% H2O/10% D2O' 
1 '90% H2O/10% D2O' 
'1.7 mM [U-100% 13C; U-100% 15N] protein_1, 8.5 mM protein_2, 25 mM sodium phosphate, 0.001 % DSS, 0.001 % NaN3, 100% D2O'        
2 '100% D2O'        
'5 mM protein_1, 4 mM [U-100% 13C; U-100% 15N] protein_2, 25 mM sodium phosphate, 0.001 % DSS, 0.001 % NaN3, 90% H2O/10% D2O'     
3 '90% H2O/10% D2O' 
'5 mM protein_1, 4 mM [U-100% 13C; U-100% 15N] protein_2, 25 mM sodium phosphate, 0.001 % DSS, 0.001 % NaN3, 100% D2O'            
4 '100% D2O'        
# 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2LVM 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LVM 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LVM 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                                        collection                  xwinnmr ? 1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax'                     processing                  NMRPipe ? 2 
'Johnson, One Moon Scientific'                                          'data analysis'             NMRView ? 3 
'Duggan, Legge, Dyson & Wright'                                         'chemical shift assignment' SANE    ? 4 
'Guntert, Mumenthaler and Wuthrich'                                     'structure solution'        CYANA   ? 5 
'Case, Darden, Cheatham, III, Simmerling, Wang, Duke, Luo, and Kollman' refinement                  AMBER   ? 6 
'Cornilescu, Delaglio and Bax'                                          'data analysis'             TALOS   ? 7 
'Wishart, D.S.'                                                         'data analysis'             CSI     ? 8 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LVM 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LVM 
_struct.title                     
'Solution structure of human 53BP1 tandem Tudor domains in complex with a histone H4K20me2 peptide' 
_struct.pdbx_descriptor           'Tumor suppressor p53-binding protein 1, Histone H4' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LVM 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
_struct_keywords.text            'dimethylation, CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        109 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        121 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         1589 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         1601 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? B ARG 6 C ? ? ? 1_555 B MLY 7 N ? ? B ARG 19 B MLY 20 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale2 covale ? ? B MLY 7 C ? ? ? 1_555 B VAL 8 N ? ? B MLY 20 B VAL 21 1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 3 ? 
C ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 44  ? LEU A 48  ? GLU A 1524 LEU A 1528 
A 2 LYS A 34  ? PHE A 39  ? LYS A 1514 PHE A 1519 
A 3 PHE A 21  ? GLY A 31  ? PHE A 1501 GLY A 1511 
A 4 ARG A 10  ? LYS A 14  ? ARG A 1490 LYS A 1494 
A 5 ILE A 52  ? LEU A 53  ? ILE A 1532 LEU A 1533 
B 1 ARG A 82  ? GLU A 84  ? ARG A 1562 GLU A 1564 
B 2 GLU A 87  ? LYS A 94  ? GLU A 1567 LYS A 1574 
B 3 GLN A 97  ? LYS A 102 ? GLN A 1577 LYS A 1582 
C 1 ARG A 82  ? GLU A 84  ? ARG A 1562 GLU A 1564 
C 2 GLU A 87  ? LYS A 94  ? GLU A 1567 LYS A 1574 
C 3 PHE A 73  ? VAL A 78  ? PHE A 1553 VAL A 1558 
C 4 GLU A 63  ? LEU A 67  ? GLU A 1543 LEU A 1547 
C 5 VAL A 106 ? ILE A 107 ? VAL A 1586 ILE A 1587 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 47 ? O VAL A 1527 N TYR A 35  ? N TYR A 1515 
A 2 3 O LYS A 36 ? O LYS A 1516 N ARG A 28  ? N ARG A 1508 
A 3 4 O GLY A 24 ? O GLY A 1504 N VAL A 11  ? N VAL A 1491 
A 4 5 N VAL A 12 ? N VAL A 1492 O LEU A 53  ? O LEU A 1533 
B 1 2 N ARG A 82 ? N ARG A 1562 O TYR A 89  ? O TYR A 1569 
B 2 3 N ILE A 92 ? N ILE A 1572 O LYS A 99  ? O LYS A 1579 
C 1 2 N ARG A 82 ? N ARG A 1562 O TYR A 89  ? O TYR A 1569 
C 2 3 O GLU A 93 ? O GLU A 1573 N VAL A 77  ? N VAL A 1557 
C 3 4 O SER A 74 ? O SER A 1554 N ALA A 66  ? N ALA A 1546 
C 4 5 N THR A 65 ? N THR A 1545 O ILE A 107 ? O ILE A 1587 
# 
_atom_sites.entry_id                    2LVM 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . GLY A 1 1   ? 1.734   6.830   -9.405  1.00 0.00 ? -3   GLY A N    1  
ATOM   2     C CA   . GLY A 1 1   ? 0.289   6.699   -9.107  1.00 0.00 ? -3   GLY A CA   1  
ATOM   3     C C    . GLY A 1 1   ? -0.005  6.820   -7.611  1.00 0.00 ? -3   GLY A C    1  
ATOM   4     O O    . GLY A 1 1   ? 0.752   7.450   -6.865  1.00 0.00 ? -3   GLY A O    1  
ATOM   5     H H1   . GLY A 1 1   ? 1.894   6.765   -10.397 1.00 0.00 ? -3   GLY A H1   1  
ATOM   6     H H2   . GLY A 1 1   ? 2.072   7.719   -9.075  1.00 0.00 ? -3   GLY A H2   1  
ATOM   7     H H3   . GLY A 1 1   ? 2.250   6.099   -8.942  1.00 0.00 ? -3   GLY A H3   1  
ATOM   8     H HA2  . GLY A 1 1   ? -0.258  7.485   -9.630  1.00 0.00 ? -3   GLY A HA2  1  
ATOM   9     H HA3  . GLY A 1 1   ? -0.064  5.733   -9.463  1.00 0.00 ? -3   GLY A HA3  1  
ATOM   10    N N    . HIS A 1 2   ? -1.115  6.230   -7.159  1.00 0.00 ? -2   HIS A N    1  
ATOM   11    C CA   . HIS A 1 2   ? -1.551  6.226   -5.763  1.00 0.00 ? -2   HIS A CA   1  
ATOM   12    C C    . HIS A 1 2   ? -2.341  4.940   -5.505  1.00 0.00 ? -2   HIS A C    1  
ATOM   13    O O    . HIS A 1 2   ? -2.979  4.414   -6.422  1.00 0.00 ? -2   HIS A O    1  
ATOM   14    C CB   . HIS A 1 2   ? -2.421  7.461   -5.495  1.00 0.00 ? -2   HIS A CB   1  
ATOM   15    C CG   . HIS A 1 2   ? -2.905  7.542   -4.067  1.00 0.00 ? -2   HIS A CG   1  
ATOM   16    N ND1  . HIS A 1 2   ? -2.083  7.542   -2.934  1.00 0.00 ? -2   HIS A ND1  1  
ATOM   17    C CD2  . HIS A 1 2   ? -4.213  7.575   -3.672  1.00 0.00 ? -2   HIS A CD2  1  
ATOM   18    C CE1  . HIS A 1 2   ? -2.920  7.581   -1.880  1.00 0.00 ? -2   HIS A CE1  1  
ATOM   19    N NE2  . HIS A 1 2   ? -4.200  7.607   -2.294  1.00 0.00 ? -2   HIS A NE2  1  
ATOM   20    H H    . HIS A 1 2   ? -1.704  5.708   -7.803  1.00 0.00 ? -2   HIS A H    1  
ATOM   21    H HA   . HIS A 1 2   ? -0.682  6.247   -5.102  1.00 0.00 ? -2   HIS A HA   1  
ATOM   22    H HB2  . HIS A 1 2   ? -1.847  8.360   -5.713  1.00 0.00 ? -2   HIS A HB2  1  
ATOM   23    H HB3  . HIS A 1 2   ? -3.283  7.446   -6.163  1.00 0.00 ? -2   HIS A HB3  1  
ATOM   24    H HD2  . HIS A 1 2   ? -5.085  7.576   -4.316  1.00 0.00 ? -2   HIS A HD2  1  
ATOM   25    H HE1  . HIS A 1 2   ? -2.611  7.580   -0.839  1.00 0.00 ? -2   HIS A HE1  1  
ATOM   26    H HE2  . HIS A 1 2   ? -5.016  7.644   -1.688  1.00 0.00 ? -2   HIS A HE2  1  
ATOM   27    N N    . MET A 1 3   ? -2.308  4.440   -4.268  1.00 0.00 ? -1   MET A N    1  
ATOM   28    C CA   . MET A 1 3   ? -2.993  3.233   -3.813  1.00 0.00 ? -1   MET A CA   1  
ATOM   29    C C    . MET A 1 3   ? -3.347  3.400   -2.329  1.00 0.00 ? -1   MET A C    1  
ATOM   30    O O    . MET A 1 3   ? -2.829  4.292   -1.650  1.00 0.00 ? -1   MET A O    1  
ATOM   31    C CB   . MET A 1 3   ? -2.092  1.991   -3.988  1.00 0.00 ? -1   MET A CB   1  
ATOM   32    C CG   . MET A 1 3   ? -1.829  1.606   -5.452  1.00 0.00 ? -1   MET A CG   1  
ATOM   33    S SD   . MET A 1 3   ? -0.921  0.051   -5.696  1.00 0.00 ? -1   MET A SD   1  
ATOM   34    C CE   . MET A 1 3   ? -2.176  -1.169  -5.212  1.00 0.00 ? -1   MET A CE   1  
ATOM   35    H H    . MET A 1 3   ? -1.840  4.969   -3.541  1.00 0.00 ? -1   MET A H    1  
ATOM   36    H HA   . MET A 1 3   ? -3.914  3.096   -4.379  1.00 0.00 ? -1   MET A HA   1  
ATOM   37    H HB2  . MET A 1 3   ? -1.135  2.162   -3.491  1.00 0.00 ? -1   MET A HB2  1  
ATOM   38    H HB3  . MET A 1 3   ? -2.567  1.140   -3.498  1.00 0.00 ? -1   MET A HB3  1  
ATOM   39    H HG2  . MET A 1 3   ? -2.780  1.535   -5.983  1.00 0.00 ? -1   MET A HG2  1  
ATOM   40    H HG3  . MET A 1 3   ? -1.248  2.402   -5.914  1.00 0.00 ? -1   MET A HG3  1  
ATOM   41    H HE1  . MET A 1 3   ? -2.436  -1.051  -4.160  1.00 0.00 ? -1   MET A HE1  1  
ATOM   42    H HE2  . MET A 1 3   ? -3.069  -1.048  -5.825  1.00 0.00 ? -1   MET A HE2  1  
ATOM   43    H HE3  . MET A 1 3   ? -1.778  -2.172  -5.362  1.00 0.00 ? -1   MET A HE3  1  
ATOM   44    N N    . ASN A 1 4   ? -4.183  2.495   -1.811  1.00 0.00 ? 1484 ASN A N    1  
ATOM   45    C CA   . ASN A 1 4   ? -4.495  2.355   -0.389  1.00 0.00 ? 1484 ASN A CA   1  
ATOM   46    C C    . ASN A 1 4   ? -4.416  0.880   -0.034  1.00 0.00 ? 1484 ASN A C    1  
ATOM   47    O O    . ASN A 1 4   ? -4.689  0.030   -0.882  1.00 0.00 ? 1484 ASN A O    1  
ATOM   48    C CB   . ASN A 1 4   ? -5.909  2.873   -0.102  1.00 0.00 ? 1484 ASN A CB   1  
ATOM   49    C CG   . ASN A 1 4   ? -6.269  2.740   1.379   1.00 0.00 ? 1484 ASN A CG   1  
ATOM   50    O OD1  . ASN A 1 4   ? -5.533  3.201   2.248   1.00 0.00 ? 1484 ASN A OD1  1  
ATOM   51    N ND2  . ASN A 1 4   ? -7.388  2.118   1.699   1.00 0.00 ? 1484 ASN A ND2  1  
ATOM   52    H H    . ASN A 1 4   ? -4.541  1.763   -2.409  1.00 0.00 ? 1484 ASN A H    1  
ATOM   53    H HA   . ASN A 1 4   ? -3.771  2.899   0.220   1.00 0.00 ? 1484 ASN A HA   1  
ATOM   54    H HB2  . ASN A 1 4   ? -5.972  3.925   -0.384  1.00 0.00 ? 1484 ASN A HB2  1  
ATOM   55    H HB3  . ASN A 1 4   ? -6.618  2.307   -0.704  1.00 0.00 ? 1484 ASN A HB3  1  
ATOM   56    H HD21 . ASN A 1 4   ? -7.980  1.713   0.974   1.00 0.00 ? 1484 ASN A HD21 1  
ATOM   57    H HD22 . ASN A 1 4   ? -7.659  2.040   2.671   1.00 0.00 ? 1484 ASN A HD22 1  
ATOM   58    N N    . SER A 1 5   ? -4.062  0.579   1.212   1.00 0.00 ? 1485 SER A N    1  
ATOM   59    C CA   . SER A 1 5   ? -3.936  -0.771  1.725   1.00 0.00 ? 1485 SER A CA   1  
ATOM   60    C C    . SER A 1 5   ? -5.273  -1.502  1.652   1.00 0.00 ? 1485 SER A C    1  
ATOM   61    O O    . SER A 1 5   ? -6.138  -1.295  2.507   1.00 0.00 ? 1485 SER A O    1  
ATOM   62    C CB   . SER A 1 5   ? -3.428  -0.691  3.172   1.00 0.00 ? 1485 SER A CB   1  
ATOM   63    O OG   . SER A 1 5   ? -2.200  0.027   3.233   1.00 0.00 ? 1485 SER A OG   1  
ATOM   64    H H    . SER A 1 5   ? -3.840  1.326   1.858   1.00 0.00 ? 1485 SER A H    1  
ATOM   65    H HA   . SER A 1 5   ? -3.212  -1.311  1.110   1.00 0.00 ? 1485 SER A HA   1  
ATOM   66    H HB2  . SER A 1 5   ? -4.171  -0.171  3.783   1.00 0.00 ? 1485 SER A HB2  1  
ATOM   67    H HB3  . SER A 1 5   ? -3.306  -1.698  3.565   1.00 0.00 ? 1485 SER A HB3  1  
ATOM   68    H HG   . SER A 1 5   ? -1.886  0.041   4.164   1.00 0.00 ? 1485 SER A HG   1  
ATOM   69    N N    . PHE A 1 6   ? -5.413  -2.381  0.651   1.00 0.00 ? 1486 PHE A N    1  
ATOM   70    C CA   . PHE A 1 6   ? -6.528  -3.299  0.411   1.00 0.00 ? 1486 PHE A CA   1  
ATOM   71    C C    . PHE A 1 6   ? -7.851  -2.596  0.139   1.00 0.00 ? 1486 PHE A C    1  
ATOM   72    O O    . PHE A 1 6   ? -8.394  -2.738  -0.953  1.00 0.00 ? 1486 PHE A O    1  
ATOM   73    C CB   . PHE A 1 6   ? -6.606  -4.349  1.535   1.00 0.00 ? 1486 PHE A CB   1  
ATOM   74    C CG   . PHE A 1 6   ? -5.311  -5.104  1.697   1.00 0.00 ? 1486 PHE A CG   1  
ATOM   75    C CD1  . PHE A 1 6   ? -5.017  -6.156  0.815   1.00 0.00 ? 1486 PHE A CD1  1  
ATOM   76    C CD2  . PHE A 1 6   ? -4.397  -4.759  2.711   1.00 0.00 ? 1486 PHE A CD2  1  
ATOM   77    C CE1  . PHE A 1 6   ? -3.822  -6.874  0.958   1.00 0.00 ? 1486 PHE A CE1  1  
ATOM   78    C CE2  . PHE A 1 6   ? -3.201  -5.480  2.854   1.00 0.00 ? 1486 PHE A CE2  1  
ATOM   79    C CZ   . PHE A 1 6   ? -2.912  -6.542  1.975   1.00 0.00 ? 1486 PHE A CZ   1  
ATOM   80    H H    . PHE A 1 6   ? -4.665  -2.419  -0.033  1.00 0.00 ? 1486 PHE A H    1  
ATOM   81    H HA   . PHE A 1 6   ? -6.306  -3.851  -0.498  1.00 0.00 ? 1486 PHE A HA   1  
ATOM   82    H HB2  . PHE A 1 6   ? -6.866  -3.892  2.488   1.00 0.00 ? 1486 PHE A HB2  1  
ATOM   83    H HB3  . PHE A 1 6   ? -7.400  -5.066  1.322   1.00 0.00 ? 1486 PHE A HB3  1  
ATOM   84    H HD1  . PHE A 1 6   ? -5.710  -6.415  0.025   1.00 0.00 ? 1486 PHE A HD1  1  
ATOM   85    H HD2  . PHE A 1 6   ? -4.614  -3.937  3.381   1.00 0.00 ? 1486 PHE A HD2  1  
ATOM   86    H HE1  . PHE A 1 6   ? -3.614  -7.686  0.279   1.00 0.00 ? 1486 PHE A HE1  1  
ATOM   87    H HE2  . PHE A 1 6   ? -2.499  -5.219  3.639   1.00 0.00 ? 1486 PHE A HE2  1  
ATOM   88    H HZ   . PHE A 1 6   ? -1.994  -7.100  2.082   1.00 0.00 ? 1486 PHE A HZ   1  
ATOM   89    N N    . VAL A 1 7   ? -8.393  -1.860  1.100   1.00 0.00 ? 1487 VAL A N    1  
ATOM   90    C CA   . VAL A 1 7   ? -9.721  -1.284  1.013   1.00 0.00 ? 1487 VAL A CA   1  
ATOM   91    C C    . VAL A 1 7   ? -9.766  -0.297  -0.164  1.00 0.00 ? 1487 VAL A C    1  
ATOM   92    O O    . VAL A 1 7   ? -8.992  0.665   -0.203  1.00 0.00 ? 1487 VAL A O    1  
ATOM   93    C CB   . VAL A 1 7   ? -10.122 -0.692  2.384   1.00 0.00 ? 1487 VAL A CB   1  
ATOM   94    C CG1  . VAL A 1 7   ? -11.619 -0.386  2.346   1.00 0.00 ? 1487 VAL A CG1  1  
ATOM   95    C CG2  . VAL A 1 7   ? -9.896  -1.689  3.541   1.00 0.00 ? 1487 VAL A CG2  1  
ATOM   96    H H    . VAL A 1 7   ? -7.847  -1.684  1.937   1.00 0.00 ? 1487 VAL A H    1  
ATOM   97    H HA   . VAL A 1 7   ? -10.399 -2.102  0.781   1.00 0.00 ? 1487 VAL A HA   1  
ATOM   98    H HB   . VAL A 1 7   ? -9.555  0.218   2.589   1.00 0.00 ? 1487 VAL A HB   1  
ATOM   99    H HG11 . VAL A 1 7   ? -12.139 -1.290  2.017   1.00 0.00 ? 1487 VAL A HG11 1  
ATOM   100   H HG12 . VAL A 1 7   ? -11.986 -0.088  3.331   1.00 0.00 ? 1487 VAL A HG12 1  
ATOM   101   H HG13 . VAL A 1 7   ? -11.830 0.415   1.640   1.00 0.00 ? 1487 VAL A HG13 1  
ATOM   102   H HG21 . VAL A 1 7   ? -10.311 -1.289  4.472   1.00 0.00 ? 1487 VAL A HG21 1  
ATOM   103   H HG22 . VAL A 1 7   ? -10.373 -2.646  3.322   1.00 0.00 ? 1487 VAL A HG22 1  
ATOM   104   H HG23 . VAL A 1 7   ? -8.830  -1.852  3.711   1.00 0.00 ? 1487 VAL A HG23 1  
ATOM   105   N N    . GLY A 1 8   ? -10.647 -0.572  -1.127  1.00 0.00 ? 1488 GLY A N    1  
ATOM   106   C CA   . GLY A 1 8   ? -10.870 0.209   -2.339  1.00 0.00 ? 1488 GLY A CA   1  
ATOM   107   C C    . GLY A 1 8   ? -10.361 -0.502  -3.599  1.00 0.00 ? 1488 GLY A C    1  
ATOM   108   O O    . GLY A 1 8   ? -10.871 -0.233  -4.689  1.00 0.00 ? 1488 GLY A O    1  
ATOM   109   H H    . GLY A 1 8   ? -11.272 -1.361  -1.005  1.00 0.00 ? 1488 GLY A H    1  
ATOM   110   H HA2  . GLY A 1 8   ? -11.941 0.386   -2.447  1.00 0.00 ? 1488 GLY A HA2  1  
ATOM   111   H HA3  . GLY A 1 8   ? -10.372 1.174   -2.255  1.00 0.00 ? 1488 GLY A HA3  1  
ATOM   112   N N    . LEU A 1 9   ? -9.374  -1.403  -3.479  1.00 0.00 ? 1489 LEU A N    1  
ATOM   113   C CA   . LEU A 1 9   ? -8.713  -2.020  -4.631  1.00 0.00 ? 1489 LEU A CA   1  
ATOM   114   C C    . LEU A 1 9   ? -9.621  -3.014  -5.345  1.00 0.00 ? 1489 LEU A C    1  
ATOM   115   O O    . LEU A 1 9   ? -10.275 -3.832  -4.692  1.00 0.00 ? 1489 LEU A O    1  
ATOM   116   C CB   . LEU A 1 9   ? -7.406  -2.728  -4.216  1.00 0.00 ? 1489 LEU A CB   1  
ATOM   117   C CG   . LEU A 1 9   ? -6.387  -1.883  -3.423  1.00 0.00 ? 1489 LEU A CG   1  
ATOM   118   C CD1  . LEU A 1 9   ? -5.140  -2.717  -3.104  1.00 0.00 ? 1489 LEU A CD1  1  
ATOM   119   C CD2  . LEU A 1 9   ? -6.002  -0.608  -4.175  1.00 0.00 ? 1489 LEU A CD2  1  
ATOM   120   H H    . LEU A 1 9   ? -8.994  -1.609  -2.562  1.00 0.00 ? 1489 LEU A H    1  
ATOM   121   H HA   . LEU A 1 9   ? -8.457  -1.252  -5.346  1.00 0.00 ? 1489 LEU A HA   1  
ATOM   122   H HB2  . LEU A 1 9   ? -7.662  -3.601  -3.621  1.00 0.00 ? 1489 LEU A HB2  1  
ATOM   123   H HB3  . LEU A 1 9   ? -6.921  -3.095  -5.121  1.00 0.00 ? 1489 LEU A HB3  1  
ATOM   124   H HG   . LEU A 1 9   ? -6.828  -1.579  -2.478  1.00 0.00 ? 1489 LEU A HG   1  
ATOM   125   H HD11 . LEU A 1 9   ? -4.480  -2.154  -2.440  1.00 0.00 ? 1489 LEU A HD11 1  
ATOM   126   H HD12 . LEU A 1 9   ? -5.423  -3.642  -2.594  1.00 0.00 ? 1489 LEU A HD12 1  
ATOM   127   H HD13 . LEU A 1 9   ? -4.603  -2.966  -4.019  1.00 0.00 ? 1489 LEU A HD13 1  
ATOM   128   H HD21 . LEU A 1 9   ? -5.200  -0.096  -3.644  1.00 0.00 ? 1489 LEU A HD21 1  
ATOM   129   H HD22 . LEU A 1 9   ? -5.676  -0.839  -5.189  1.00 0.00 ? 1489 LEU A HD22 1  
ATOM   130   H HD23 . LEU A 1 9   ? -6.874  0.050   -4.210  1.00 0.00 ? 1489 LEU A HD23 1  
ATOM   131   N N    . ARG A 1 10  ? -9.643  -2.962  -6.687  1.00 0.00 ? 1490 ARG A N    1  
ATOM   132   C CA   . ARG A 1 10  ? -10.259 -4.016  -7.496  1.00 0.00 ? 1490 ARG A CA   1  
ATOM   133   C C    . ARG A 1 10  ? -9.256  -5.159  -7.523  1.00 0.00 ? 1490 ARG A C    1  
ATOM   134   O O    . ARG A 1 10  ? -8.072  -4.944  -7.792  1.00 0.00 ? 1490 ARG A O    1  
ATOM   135   C CB   . ARG A 1 10  ? -10.579 -3.582  -8.942  1.00 0.00 ? 1490 ARG A CB   1  
ATOM   136   C CG   . ARG A 1 10  ? -12.007 -3.046  -9.113  1.00 0.00 ? 1490 ARG A CG   1  
ATOM   137   C CD   . ARG A 1 10  ? -12.410 -3.014  -10.596 1.00 0.00 ? 1490 ARG A CD   1  
ATOM   138   N NE   . ARG A 1 10  ? -13.869 -2.861  -10.762 1.00 0.00 ? 1490 ARG A NE   1  
ATOM   139   C CZ   . ARG A 1 10  ? -14.543 -1.745  -11.084 1.00 0.00 ? 1490 ARG A CZ   1  
ATOM   140   N NH1  . ARG A 1 10  ? -13.910 -0.592  -11.295 1.00 0.00 ? 1490 ARG A NH1  1  
ATOM   141   N NH2  . ARG A 1 10  ? -15.864 -1.795  -11.194 1.00 0.00 ? 1490 ARG A NH2  1  
ATOM   142   H H    . ARG A 1 10  ? -9.073  -2.274  -7.164  1.00 0.00 ? 1490 ARG A H    1  
ATOM   143   H HA   . ARG A 1 10  ? -11.172 -4.357  -7.004  1.00 0.00 ? 1490 ARG A HA   1  
ATOM   144   H HB2  . ARG A 1 10  ? -9.854  -2.844  -9.285  1.00 0.00 ? 1490 ARG A HB2  1  
ATOM   145   H HB3  . ARG A 1 10  ? -10.477 -4.455  -9.591  1.00 0.00 ? 1490 ARG A HB3  1  
ATOM   146   H HG2  . ARG A 1 10  ? -12.684 -3.736  -8.606  1.00 0.00 ? 1490 ARG A HG2  1  
ATOM   147   H HG3  . ARG A 1 10  ? -12.100 -2.058  -8.665  1.00 0.00 ? 1490 ARG A HG3  1  
ATOM   148   H HD2  . ARG A 1 10  ? -11.862 -2.227  -11.117 1.00 0.00 ? 1490 ARG A HD2  1  
ATOM   149   H HD3  . ARG A 1 10  ? -12.132 -3.962  -11.058 1.00 0.00 ? 1490 ARG A HD3  1  
ATOM   150   H HE   . ARG A 1 10  ? -14.414 -3.721  -10.613 1.00 0.00 ? 1490 ARG A HE   1  
ATOM   151   H HH11 . ARG A 1 10  ? -12.905 -0.522  -11.209 1.00 0.00 ? 1490 ARG A HH11 1  
ATOM   152   H HH12 . ARG A 1 10  ? -14.406 0.257   -11.548 1.00 0.00 ? 1490 ARG A HH12 1  
ATOM   153   H HH21 . ARG A 1 10  ? -16.368 -2.671  -10.993 1.00 0.00 ? 1490 ARG A HH21 1  
ATOM   154   H HH22 . ARG A 1 10  ? -16.420 -0.997  -11.472 1.00 0.00 ? 1490 ARG A HH22 1  
ATOM   155   N N    . VAL A 1 11  ? -9.735  -6.364  -7.248  1.00 0.00 ? 1491 VAL A N    1  
ATOM   156   C CA   . VAL A 1 11  ? -8.960  -7.583  -7.086  1.00 0.00 ? 1491 VAL A CA   1  
ATOM   157   C C    . VAL A 1 11  ? -9.828  -8.730  -7.634  1.00 0.00 ? 1491 VAL A C    1  
ATOM   158   O O    . VAL A 1 11  ? -10.972 -8.502  -8.034  1.00 0.00 ? 1491 VAL A O    1  
ATOM   159   C CB   . VAL A 1 11  ? -8.566  -7.738  -5.591  1.00 0.00 ? 1491 VAL A CB   1  
ATOM   160   C CG1  . VAL A 1 11  ? -7.776  -6.538  -5.049  1.00 0.00 ? 1491 VAL A CG1  1  
ATOM   161   C CG2  . VAL A 1 11  ? -9.756  -7.929  -4.655  1.00 0.00 ? 1491 VAL A CG2  1  
ATOM   162   H H    . VAL A 1 11  ? -10.734 -6.477  -7.093  1.00 0.00 ? 1491 VAL A H    1  
ATOM   163   H HA   . VAL A 1 11  ? -8.044  -7.532  -7.675  1.00 0.00 ? 1491 VAL A HA   1  
ATOM   164   H HB   . VAL A 1 11  ? -7.941  -8.619  -5.488  1.00 0.00 ? 1491 VAL A HB   1  
ATOM   165   H HG11 . VAL A 1 11  ? -6.992  -6.249  -5.747  1.00 0.00 ? 1491 VAL A HG11 1  
ATOM   166   H HG12 . VAL A 1 11  ? -8.433  -5.683  -4.891  1.00 0.00 ? 1491 VAL A HG12 1  
ATOM   167   H HG13 . VAL A 1 11  ? -7.320  -6.789  -4.094  1.00 0.00 ? 1491 VAL A HG13 1  
ATOM   168   H HG21 . VAL A 1 11  ? -10.416 -7.060  -4.693  1.00 0.00 ? 1491 VAL A HG21 1  
ATOM   169   H HG22 . VAL A 1 11  ? -10.319 -8.822  -4.932  1.00 0.00 ? 1491 VAL A HG22 1  
ATOM   170   H HG23 . VAL A 1 11  ? -9.377  -8.057  -3.637  1.00 0.00 ? 1491 VAL A HG23 1  
ATOM   171   N N    . VAL A 1 12  ? -9.335  -9.964  -7.620  1.00 0.00 ? 1492 VAL A N    1  
ATOM   172   C CA   . VAL A 1 12  ? -10.138 -11.145 -7.912  1.00 0.00 ? 1492 VAL A CA   1  
ATOM   173   C C    . VAL A 1 12  ? -10.185 -11.927 -6.601  1.00 0.00 ? 1492 VAL A C    1  
ATOM   174   O O    . VAL A 1 12  ? -9.196  -11.965 -5.878  1.00 0.00 ? 1492 VAL A O    1  
ATOM   175   C CB   . VAL A 1 12  ? -9.552  -11.951 -9.094  1.00 0.00 ? 1492 VAL A CB   1  
ATOM   176   C CG1  . VAL A 1 12  ? -10.611 -12.893 -9.677  1.00 0.00 ? 1492 VAL A CG1  1  
ATOM   177   C CG2  . VAL A 1 12  ? -9.068  -11.072 -10.258 1.00 0.00 ? 1492 VAL A CG2  1  
ATOM   178   H H    . VAL A 1 12  ? -8.398  -10.128 -7.263  1.00 0.00 ? 1492 VAL A H    1  
ATOM   179   H HA   . VAL A 1 12  ? -11.152 -10.849 -8.168  1.00 0.00 ? 1492 VAL A HA   1  
ATOM   180   H HB   . VAL A 1 12  ? -8.712  -12.546 -8.734  1.00 0.00 ? 1492 VAL A HB   1  
ATOM   181   H HG11 . VAL A 1 12  ? -10.143 -13.619 -10.343 1.00 0.00 ? 1492 VAL A HG11 1  
ATOM   182   H HG12 . VAL A 1 12  ? -11.117 -13.418 -8.870  1.00 0.00 ? 1492 VAL A HG12 1  
ATOM   183   H HG13 . VAL A 1 12  ? -11.356 -12.321 -10.234 1.00 0.00 ? 1492 VAL A HG13 1  
ATOM   184   H HG21 . VAL A 1 12  ? -8.738  -11.718 -11.078 1.00 0.00 ? 1492 VAL A HG21 1  
ATOM   185   H HG22 . VAL A 1 12  ? -9.869  -10.417 -10.603 1.00 0.00 ? 1492 VAL A HG22 1  
ATOM   186   H HG23 . VAL A 1 12  ? -8.228  -10.461 -9.939  1.00 0.00 ? 1492 VAL A HG23 1  
ATOM   187   N N    . ALA A 1 13  ? -11.321 -12.516 -6.258  1.00 0.00 ? 1493 ALA A N    1  
ATOM   188   C CA   . ALA A 1 13  ? -11.588 -13.104 -4.961  1.00 0.00 ? 1493 ALA A CA   1  
ATOM   189   C C    . ALA A 1 13  ? -12.340 -14.404 -5.167  1.00 0.00 ? 1493 ALA A C    1  
ATOM   190   O O    . ALA A 1 13  ? -13.125 -14.497 -6.107  1.00 0.00 ? 1493 ALA A O    1  
ATOM   191   C CB   . ALA A 1 13  ? -12.472 -12.122 -4.188  1.00 0.00 ? 1493 ALA A CB   1  
ATOM   192   H H    . ALA A 1 13  ? -12.113 -12.478 -6.886  1.00 0.00 ? 1493 ALA A H    1  
ATOM   193   H HA   . ALA A 1 13  ? -10.663 -13.279 -4.417  1.00 0.00 ? 1493 ALA A HA   1  
ATOM   194   H HB1  . ALA A 1 13  ? -12.625 -12.489 -3.177  1.00 0.00 ? 1493 ALA A HB1  1  
ATOM   195   H HB2  . ALA A 1 13  ? -11.998 -11.141 -4.168  1.00 0.00 ? 1493 ALA A HB2  1  
ATOM   196   H HB3  . ALA A 1 13  ? -13.443 -12.024 -4.669  1.00 0.00 ? 1493 ALA A HB3  1  
ATOM   197   N N    . LYS A 1 14  ? -12.168 -15.383 -4.283  1.00 0.00 ? 1494 LYS A N    1  
ATOM   198   C CA   . LYS A 1 14  ? -12.901 -16.635 -4.407  1.00 0.00 ? 1494 LYS A CA   1  
ATOM   199   C C    . LYS A 1 14  ? -14.260 -16.420 -3.783  1.00 0.00 ? 1494 LYS A C    1  
ATOM   200   O O    . LYS A 1 14  ? -14.365 -15.871 -2.688  1.00 0.00 ? 1494 LYS A O    1  
ATOM   201   C CB   . LYS A 1 14  ? -12.196 -17.773 -3.661  1.00 0.00 ? 1494 LYS A CB   1  
ATOM   202   C CG   . LYS A 1 14  ? -12.991 -19.085 -3.746  1.00 0.00 ? 1494 LYS A CG   1  
ATOM   203   C CD   . LYS A 1 14  ? -12.126 -20.250 -3.232  1.00 0.00 ? 1494 LYS A CD   1  
ATOM   204   C CE   . LYS A 1 14  ? -12.798 -21.606 -3.490  1.00 0.00 ? 1494 LYS A CE   1  
ATOM   205   N NZ   . LYS A 1 14  ? -12.116 -22.727 -2.780  1.00 0.00 ? 1494 LYS A NZ   1  
ATOM   206   H H    . LYS A 1 14  ? -11.553 -15.243 -3.490  1.00 0.00 ? 1494 LYS A H    1  
ATOM   207   H HA   . LYS A 1 14  ? -13.003 -16.916 -5.459  1.00 0.00 ? 1494 LYS A HA   1  
ATOM   208   H HB2  . LYS A 1 14  ? -11.198 -17.908 -4.075  1.00 0.00 ? 1494 LYS A HB2  1  
ATOM   209   H HB3  . LYS A 1 14  ? -12.112 -17.508 -2.612  1.00 0.00 ? 1494 LYS A HB3  1  
ATOM   210   H HG2  . LYS A 1 14  ? -13.889 -18.992 -3.126  1.00 0.00 ? 1494 LYS A HG2  1  
ATOM   211   H HG3  . LYS A 1 14  ? -13.309 -19.260 -4.774  1.00 0.00 ? 1494 LYS A HG3  1  
ATOM   212   H HD2  . LYS A 1 14  ? -11.152 -20.238 -3.728  1.00 0.00 ? 1494 LYS A HD2  1  
ATOM   213   H HD3  . LYS A 1 14  ? -11.973 -20.107 -2.161  1.00 0.00 ? 1494 LYS A HD3  1  
ATOM   214   H HE2  . LYS A 1 14  ? -13.846 -21.538 -3.186  1.00 0.00 ? 1494 LYS A HE2  1  
ATOM   215   H HE3  . LYS A 1 14  ? -12.783 -21.803 -4.566  1.00 0.00 ? 1494 LYS A HE3  1  
ATOM   216   H HZ1  . LYS A 1 14  ? -12.588 -23.619 -2.948  1.00 0.00 ? 1494 LYS A HZ1  1  
ATOM   217   H HZ2  . LYS A 1 14  ? -11.154 -22.830 -3.088  1.00 0.00 ? 1494 LYS A HZ2  1  
ATOM   218   H HZ3  . LYS A 1 14  ? -12.092 -22.586 -1.776  1.00 0.00 ? 1494 LYS A HZ3  1  
ATOM   219   N N    . TRP A 1 15  ? -15.298 -16.878 -4.469  1.00 0.00 ? 1495 TRP A N    1  
ATOM   220   C CA   . TRP A 1 15  ? -16.626 -16.946 -3.898  1.00 0.00 ? 1495 TRP A CA   1  
ATOM   221   C C    . TRP A 1 15  ? -16.606 -18.114 -2.905  1.00 0.00 ? 1495 TRP A C    1  
ATOM   222   O O    . TRP A 1 15  ? -16.444 -19.273 -3.298  1.00 0.00 ? 1495 TRP A O    1  
ATOM   223   C CB   . TRP A 1 15  ? -17.607 -17.076 -5.052  1.00 0.00 ? 1495 TRP A CB   1  
ATOM   224   C CG   . TRP A 1 15  ? -18.975 -17.591 -4.757  1.00 0.00 ? 1495 TRP A CG   1  
ATOM   225   C CD1  . TRP A 1 15  ? -19.433 -18.785 -5.180  1.00 0.00 ? 1495 TRP A CD1  1  
ATOM   226   C CD2  . TRP A 1 15  ? -20.073 -16.988 -4.002  1.00 0.00 ? 1495 TRP A CD2  1  
ATOM   227   N NE1  . TRP A 1 15  ? -20.768 -18.918 -4.859  1.00 0.00 ? 1495 TRP A NE1  1  
ATOM   228   C CE2  . TRP A 1 15  ? -21.215 -17.840 -4.118  1.00 0.00 ? 1495 TRP A CE2  1  
ATOM   229   C CE3  . TRP A 1 15  ? -20.216 -15.803 -3.251  1.00 0.00 ? 1495 TRP A CE3  1  
ATOM   230   C CZ2  . TRP A 1 15  ? -22.461 -17.499 -3.566  1.00 0.00 ? 1495 TRP A CZ2  1  
ATOM   231   C CZ3  . TRP A 1 15  ? -21.464 -15.467 -2.691  1.00 0.00 ? 1495 TRP A CZ3  1  
ATOM   232   C CH2  . TRP A 1 15  ? -22.581 -16.290 -2.858  1.00 0.00 ? 1495 TRP A CH2  1  
ATOM   233   H H    . TRP A 1 15  ? -15.138 -17.331 -5.363  1.00 0.00 ? 1495 TRP A H    1  
ATOM   234   H HA   . TRP A 1 15  ? -16.836 -16.009 -3.375  1.00 0.00 ? 1495 TRP A HA   1  
ATOM   235   H HB2  . TRP A 1 15  ? -17.701 -16.087 -5.500  1.00 0.00 ? 1495 TRP A HB2  1  
ATOM   236   H HB3  . TRP A 1 15  ? -17.168 -17.730 -5.806  1.00 0.00 ? 1495 TRP A HB3  1  
ATOM   237   H HD1  . TRP A 1 15  ? -18.822 -19.511 -5.700  1.00 0.00 ? 1495 TRP A HD1  1  
ATOM   238   H HE1  . TRP A 1 15  ? -21.326 -19.718 -5.148  1.00 0.00 ? 1495 TRP A HE1  1  
ATOM   239   H HE3  . TRP A 1 15  ? -19.363 -15.148 -3.105  1.00 0.00 ? 1495 TRP A HE3  1  
ATOM   240   H HZ2  . TRP A 1 15  ? -23.316 -18.153 -3.683  1.00 0.00 ? 1495 TRP A HZ2  1  
ATOM   241   H HZ3  . TRP A 1 15  ? -21.602 -14.571 -2.117  1.00 0.00 ? 1495 TRP A HZ3  1  
ATOM   242   H HH2  . TRP A 1 15  ? -23.516 -15.961 -2.426  1.00 0.00 ? 1495 TRP A HH2  1  
ATOM   243   N N    . SER A 1 16  ? -16.707 -17.786 -1.619  1.00 0.00 ? 1496 SER A N    1  
ATOM   244   C CA   . SER A 1 16  ? -16.497 -18.665 -0.475  1.00 0.00 ? 1496 SER A CA   1  
ATOM   245   C C    . SER A 1 16  ? -17.348 -19.944 -0.421  1.00 0.00 ? 1496 SER A C    1  
ATOM   246   O O    . SER A 1 16  ? -16.972 -20.866 0.308   1.00 0.00 ? 1496 SER A O    1  
ATOM   247   C CB   . SER A 1 16  ? -16.705 -17.833 0.797   1.00 0.00 ? 1496 SER A CB   1  
ATOM   248   O OG   . SER A 1 16  ? -15.963 -16.627 0.706   1.00 0.00 ? 1496 SER A OG   1  
ATOM   249   H H    . SER A 1 16  ? -16.748 -16.806 -1.368  1.00 0.00 ? 1496 SER A H    1  
ATOM   250   H HA   . SER A 1 16  ? -15.452 -18.976 -0.503  1.00 0.00 ? 1496 SER A HA   1  
ATOM   251   H HB2  . SER A 1 16  ? -17.765 -17.600 0.879   1.00 0.00 ? 1496 SER A HB2  1  
ATOM   252   H HB3  . SER A 1 16  ? -16.389 -18.406 1.672   1.00 0.00 ? 1496 SER A HB3  1  
ATOM   253   H HG   . SER A 1 16  ? -16.192 -16.040 1.452   1.00 0.00 ? 1496 SER A HG   1  
ATOM   254   N N    . SER A 1 17  ? -18.428 -20.059 -1.197  1.00 0.00 ? 1497 SER A N    1  
ATOM   255   C CA   . SER A 1 17  ? -19.222 -21.288 -1.337  1.00 0.00 ? 1497 SER A CA   1  
ATOM   256   C C    . SER A 1 17  ? -18.498 -22.314 -2.244  1.00 0.00 ? 1497 SER A C    1  
ATOM   257   O O    . SER A 1 17  ? -19.070 -22.838 -3.200  1.00 0.00 ? 1497 SER A O    1  
ATOM   258   C CB   . SER A 1 17  ? -20.628 -20.924 -1.831  1.00 0.00 ? 1497 SER A CB   1  
ATOM   259   O OG   . SER A 1 17  ? -21.217 -19.928 -1.000  1.00 0.00 ? 1497 SER A OG   1  
ATOM   260   H H    . SER A 1 17  ? -18.719 -19.274 -1.761  1.00 0.00 ? 1497 SER A H    1  
ATOM   261   H HA   . SER A 1 17  ? -19.327 -21.744 -0.353  1.00 0.00 ? 1497 SER A HA   1  
ATOM   262   H HB2  . SER A 1 17  ? -20.569 -20.557 -2.854  1.00 0.00 ? 1497 SER A HB2  1  
ATOM   263   H HB3  . SER A 1 17  ? -21.251 -21.819 -1.826  1.00 0.00 ? 1497 SER A HB3  1  
ATOM   264   H HG   . SER A 1 17  ? -22.105 -19.719 -1.350  1.00 0.00 ? 1497 SER A HG   1  
ATOM   265   N N    . ASN A 1 18  ? -17.212 -22.561 -1.951  1.00 0.00 ? 1498 ASN A N    1  
ATOM   266   C CA   . ASN A 1 18  ? -16.234 -23.334 -2.718  1.00 0.00 ? 1498 ASN A CA   1  
ATOM   267   C C    . ASN A 1 18  ? -16.348 -23.143 -4.238  1.00 0.00 ? 1498 ASN A C    1  
ATOM   268   O O    . ASN A 1 18  ? -16.420 -24.117 -4.997  1.00 0.00 ? 1498 ASN A O    1  
ATOM   269   C CB   . ASN A 1 18  ? -16.220 -24.810 -2.286  1.00 0.00 ? 1498 ASN A CB   1  
ATOM   270   C CG   . ASN A 1 18  ? -14.994 -25.539 -2.849  1.00 0.00 ? 1498 ASN A CG   1  
ATOM   271   O OD1  . ASN A 1 18  ? -13.936 -24.936 -3.043  1.00 0.00 ? 1498 ASN A OD1  1  
ATOM   272   N ND2  . ASN A 1 18  ? -15.098 -26.833 -3.119  1.00 0.00 ? 1498 ASN A ND2  1  
ATOM   273   H H    . ASN A 1 18  ? -16.864 -22.119 -1.105  1.00 0.00 ? 1498 ASN A H    1  
ATOM   274   H HA   . ASN A 1 18  ? -15.265 -22.925 -2.436  1.00 0.00 ? 1498 ASN A HA   1  
ATOM   275   H HB2  . ASN A 1 18  ? -16.193 -24.879 -1.197  1.00 0.00 ? 1498 ASN A HB2  1  
ATOM   276   H HB3  . ASN A 1 18  ? -17.135 -25.296 -2.631  1.00 0.00 ? 1498 ASN A HB3  1  
ATOM   277   H HD21 . ASN A 1 18  ? -15.965 -27.326 -2.945  1.00 0.00 ? 1498 ASN A HD21 1  
ATOM   278   H HD22 . ASN A 1 18  ? -14.303 -27.340 -3.487  1.00 0.00 ? 1498 ASN A HD22 1  
ATOM   279   N N    . GLY A 1 19  ? -16.404 -21.884 -4.681  1.00 0.00 ? 1499 GLY A N    1  
ATOM   280   C CA   . GLY A 1 19  ? -16.562 -21.524 -6.084  1.00 0.00 ? 1499 GLY A CA   1  
ATOM   281   C C    . GLY A 1 19  ? -15.258 -21.058 -6.719  1.00 0.00 ? 1499 GLY A C    1  
ATOM   282   O O    . GLY A 1 19  ? -14.170 -21.284 -6.195  1.00 0.00 ? 1499 GLY A O    1  
ATOM   283   H H    . GLY A 1 19  ? -16.360 -21.116 -4.017  1.00 0.00 ? 1499 GLY A H    1  
ATOM   284   H HA2  . GLY A 1 19  ? -16.953 -22.362 -6.663  1.00 0.00 ? 1499 GLY A HA2  1  
ATOM   285   H HA3  . GLY A 1 19  ? -17.278 -20.714 -6.148  1.00 0.00 ? 1499 GLY A HA3  1  
ATOM   286   N N    . TYR A 1 20  ? -15.383 -20.425 -7.883  1.00 0.00 ? 1500 TYR A N    1  
ATOM   287   C CA   . TYR A 1 20  ? -14.282 -19.850 -8.647  1.00 0.00 ? 1500 TYR A CA   1  
ATOM   288   C C    . TYR A 1 20  ? -13.887 -18.469 -8.121  1.00 0.00 ? 1500 TYR A C    1  
ATOM   289   O O    . TYR A 1 20  ? -14.467 -17.967 -7.152  1.00 0.00 ? 1500 TYR A O    1  
ATOM   290   C CB   . TYR A 1 20  ? -14.732 -19.773 -10.110 1.00 0.00 ? 1500 TYR A CB   1  
ATOM   291   C CG   . TYR A 1 20  ? -14.897 -21.083 -10.854 1.00 0.00 ? 1500 TYR A CG   1  
ATOM   292   C CD1  . TYR A 1 20  ? -14.464 -22.326 -10.349 1.00 0.00 ? 1500 TYR A CD1  1  
ATOM   293   C CD2  . TYR A 1 20  ? -15.499 -21.024 -12.114 1.00 0.00 ? 1500 TYR A CD2  1  
ATOM   294   C CE1  . TYR A 1 20  ? -14.558 -23.478 -11.161 1.00 0.00 ? 1500 TYR A CE1  1  
ATOM   295   C CE2  . TYR A 1 20  ? -15.578 -22.151 -12.934 1.00 0.00 ? 1500 TYR A CE2  1  
ATOM   296   C CZ   . TYR A 1 20  ? -15.090 -23.389 -12.470 1.00 0.00 ? 1500 TYR A CZ   1  
ATOM   297   O OH   . TYR A 1 20  ? -15.149 -24.473 -13.295 1.00 0.00 ? 1500 TYR A OH   1  
ATOM   298   H H    . TYR A 1 20  ? -16.313 -20.298 -8.258  1.00 0.00 ? 1500 TYR A H    1  
ATOM   299   H HA   . TYR A 1 20  ? -13.395 -20.480 -8.575  1.00 0.00 ? 1500 TYR A HA   1  
ATOM   300   H HB2  . TYR A 1 20  ? -15.671 -19.225 -10.164 1.00 0.00 ? 1500 TYR A HB2  1  
ATOM   301   H HB3  . TYR A 1 20  ? -14.011 -19.195 -10.683 1.00 0.00 ? 1500 TYR A HB3  1  
ATOM   302   H HD1  . TYR A 1 20  ? -14.056 -22.405 -9.347  1.00 0.00 ? 1500 TYR A HD1  1  
ATOM   303   H HD2  . TYR A 1 20  ? -15.913 -20.099 -12.466 1.00 0.00 ? 1500 TYR A HD2  1  
ATOM   304   H HE1  . TYR A 1 20  ? -14.229 -24.437 -10.781 1.00 0.00 ? 1500 TYR A HE1  1  
ATOM   305   H HE2  . TYR A 1 20  ? -16.014 -22.044 -13.915 1.00 0.00 ? 1500 TYR A HE2  1  
ATOM   306   H HH   . TYR A 1 20  ? -14.777 -25.292 -12.918 1.00 0.00 ? 1500 TYR A HH   1  
ATOM   307   N N    . PHE A 1 21  ? -12.902 -17.852 -8.776  1.00 0.00 ? 1501 PHE A N    1  
ATOM   308   C CA   . PHE A 1 21  ? -12.435 -16.517 -8.477  1.00 0.00 ? 1501 PHE A CA   1  
ATOM   309   C C    . PHE A 1 21  ? -13.123 -15.528 -9.432  1.00 0.00 ? 1501 PHE A C    1  
ATOM   310   O O    . PHE A 1 21  ? -13.082 -15.724 -10.652 1.00 0.00 ? 1501 PHE A O    1  
ATOM   311   C CB   . PHE A 1 21  ? -10.907 -16.487 -8.624  1.00 0.00 ? 1501 PHE A CB   1  
ATOM   312   C CG   . PHE A 1 21  ? -10.148 -17.357 -7.640  1.00 0.00 ? 1501 PHE A CG   1  
ATOM   313   C CD1  . PHE A 1 21  ? -9.918  -18.714 -7.938  1.00 0.00 ? 1501 PHE A CD1  1  
ATOM   314   C CD2  . PHE A 1 21  ? -9.673  -16.818 -6.429  1.00 0.00 ? 1501 PHE A CD2  1  
ATOM   315   C CE1  . PHE A 1 21  ? -9.239  -19.530 -7.019  1.00 0.00 ? 1501 PHE A CE1  1  
ATOM   316   C CE2  . PHE A 1 21  ? -9.004  -17.639 -5.507  1.00 0.00 ? 1501 PHE A CE2  1  
ATOM   317   C CZ   . PHE A 1 21  ? -8.810  -19.000 -5.795  1.00 0.00 ? 1501 PHE A CZ   1  
ATOM   318   H H    . PHE A 1 21  ? -12.476 -18.296 -9.585  1.00 0.00 ? 1501 PHE A H    1  
ATOM   319   H HA   . PHE A 1 21  ? -12.683 -16.285 -7.452  1.00 0.00 ? 1501 PHE A HA   1  
ATOM   320   H HB2  . PHE A 1 21  ? -10.643 -16.795 -9.631  1.00 0.00 ? 1501 PHE A HB2  1  
ATOM   321   H HB3  . PHE A 1 21  ? -10.563 -15.470 -8.497  1.00 0.00 ? 1501 PHE A HB3  1  
ATOM   322   H HD1  . PHE A 1 21  ? -10.262 -19.133 -8.875  1.00 0.00 ? 1501 PHE A HD1  1  
ATOM   323   H HD2  . PHE A 1 21  ? -9.819  -15.771 -6.200  1.00 0.00 ? 1501 PHE A HD2  1  
ATOM   324   H HE1  . PHE A 1 21  ? -9.040  -20.567 -7.241  1.00 0.00 ? 1501 PHE A HE1  1  
ATOM   325   H HE2  . PHE A 1 21  ? -8.641  -17.223 -4.575  1.00 0.00 ? 1501 PHE A HE2  1  
ATOM   326   H HZ   . PHE A 1 21  ? -8.335  -19.653 -5.082  1.00 0.00 ? 1501 PHE A HZ   1  
ATOM   327   N N    . TYR A 1 22  ? -13.713 -14.461 -8.886  1.00 0.00 ? 1502 TYR A N    1  
ATOM   328   C CA   . TYR A 1 22  ? -14.466 -13.426 -9.605  1.00 0.00 ? 1502 TYR A CA   1  
ATOM   329   C C    . TYR A 1 22  ? -13.942 -12.055 -9.193  1.00 0.00 ? 1502 TYR A C    1  
ATOM   330   O O    . TYR A 1 22  ? -13.395 -11.906 -8.101  1.00 0.00 ? 1502 TYR A O    1  
ATOM   331   C CB   . TYR A 1 22  ? -15.961 -13.510 -9.249  1.00 0.00 ? 1502 TYR A CB   1  
ATOM   332   C CG   . TYR A 1 22  ? -16.623 -14.835 -9.550  1.00 0.00 ? 1502 TYR A CG   1  
ATOM   333   C CD1  . TYR A 1 22  ? -16.506 -15.879 -8.614  1.00 0.00 ? 1502 TYR A CD1  1  
ATOM   334   C CD2  . TYR A 1 22  ? -17.352 -15.021 -10.737 1.00 0.00 ? 1502 TYR A CD2  1  
ATOM   335   C CE1  . TYR A 1 22  ? -17.086 -17.132 -8.870  1.00 0.00 ? 1502 TYR A CE1  1  
ATOM   336   C CE2  . TYR A 1 22  ? -17.903 -16.285 -11.007 1.00 0.00 ? 1502 TYR A CE2  1  
ATOM   337   C CZ   . TYR A 1 22  ? -17.785 -17.342 -10.082 1.00 0.00 ? 1502 TYR A CZ   1  
ATOM   338   O OH   . TYR A 1 22  ? -18.347 -18.547 -10.370 1.00 0.00 ? 1502 TYR A OH   1  
ATOM   339   H H    . TYR A 1 22  ? -13.665 -14.350 -7.874  1.00 0.00 ? 1502 TYR A H    1  
ATOM   340   H HA   . TYR A 1 22  ? -14.346 -13.561 -10.681 1.00 0.00 ? 1502 TYR A HA   1  
ATOM   341   H HB2  . TYR A 1 22  ? -16.078 -13.332 -8.183  1.00 0.00 ? 1502 TYR A HB2  1  
ATOM   342   H HB3  . TYR A 1 22  ? -16.500 -12.721 -9.776  1.00 0.00 ? 1502 TYR A HB3  1  
ATOM   343   H HD1  . TYR A 1 22  ? -15.964 -15.715 -7.691  1.00 0.00 ? 1502 TYR A HD1  1  
ATOM   344   H HD2  . TYR A 1 22  ? -17.501 -14.209 -11.450 1.00 0.00 ? 1502 TYR A HD2  1  
ATOM   345   H HE1  . TYR A 1 22  ? -16.989 -17.922 -8.137  1.00 0.00 ? 1502 TYR A HE1  1  
ATOM   346   H HE2  . TYR A 1 22  ? -18.423 -16.450 -11.933 1.00 0.00 ? 1502 TYR A HE2  1  
ATOM   347   H HH   . TYR A 1 22  ? -18.348 -19.175 -9.631  1.00 0.00 ? 1502 TYR A HH   1  
ATOM   348   N N    . SER A 1 23  ? -14.110 -11.045 -10.045 1.00 0.00 ? 1503 SER A N    1  
ATOM   349   C CA   . SER A 1 23  ? -13.652 -9.690  -9.772  1.00 0.00 ? 1503 SER A CA   1  
ATOM   350   C C    . SER A 1 23  ? -14.470 -9.045  -8.653  1.00 0.00 ? 1503 SER A C    1  
ATOM   351   O O    . SER A 1 23  ? -15.694 -9.195  -8.618  1.00 0.00 ? 1503 SER A O    1  
ATOM   352   C CB   . SER A 1 23  ? -13.791 -8.867  -11.053 1.00 0.00 ? 1503 SER A CB   1  
ATOM   353   O OG   . SER A 1 23  ? -13.355 -9.612  -12.177 1.00 0.00 ? 1503 SER A OG   1  
ATOM   354   H H    . SER A 1 23  ? -14.519 -11.207 -10.955 1.00 0.00 ? 1503 SER A H    1  
ATOM   355   H HA   . SER A 1 23  ? -12.602 -9.722  -9.486  1.00 0.00 ? 1503 SER A HA   1  
ATOM   356   H HB2  . SER A 1 23  ? -14.836 -8.595  -11.207 1.00 0.00 ? 1503 SER A HB2  1  
ATOM   357   H HB3  . SER A 1 23  ? -13.197 -7.965  -10.956 1.00 0.00 ? 1503 SER A HB3  1  
ATOM   358   H HG   . SER A 1 23  ? -12.395 -9.793  -12.115 1.00 0.00 ? 1503 SER A HG   1  
ATOM   359   N N    . GLY A 1 24  ? -13.837 -8.255  -7.786  1.00 0.00 ? 1504 GLY A N    1  
ATOM   360   C CA   . GLY A 1 24  ? -14.554 -7.478  -6.787  1.00 0.00 ? 1504 GLY A CA   1  
ATOM   361   C C    . GLY A 1 24  ? -13.686 -6.383  -6.204  1.00 0.00 ? 1504 GLY A C    1  
ATOM   362   O O    . GLY A 1 24  ? -12.472 -6.368  -6.397  1.00 0.00 ? 1504 GLY A O    1  
ATOM   363   H H    . GLY A 1 24  ? -12.820 -8.146  -7.822  1.00 0.00 ? 1504 GLY A H    1  
ATOM   364   H HA2  . GLY A 1 24  ? -15.428 -7.016  -7.247  1.00 0.00 ? 1504 GLY A HA2  1  
ATOM   365   H HA3  . GLY A 1 24  ? -14.869 -8.138  -5.977  1.00 0.00 ? 1504 GLY A HA3  1  
ATOM   366   N N    . LYS A 1 25  ? -14.321 -5.453  -5.493  1.00 0.00 ? 1505 LYS A N    1  
ATOM   367   C CA   . LYS A 1 25  ? -13.661 -4.343  -4.818  1.00 0.00 ? 1505 LYS A CA   1  
ATOM   368   C C    . LYS A 1 25  ? -13.651 -4.673  -3.340  1.00 0.00 ? 1505 LYS A C    1  
ATOM   369   O O    . LYS A 1 25  ? -14.692 -5.059  -2.805  1.00 0.00 ? 1505 LYS A O    1  
ATOM   370   C CB   . LYS A 1 25  ? -14.463 -3.055  -5.051  1.00 0.00 ? 1505 LYS A CB   1  
ATOM   371   C CG   . LYS A 1 25  ? -14.527 -2.680  -6.546  1.00 0.00 ? 1505 LYS A CG   1  
ATOM   372   C CD   . LYS A 1 25  ? -15.877 -2.119  -7.012  1.00 0.00 ? 1505 LYS A CD   1  
ATOM   373   C CE   . LYS A 1 25  ? -16.978 -3.195  -7.068  1.00 0.00 ? 1505 LYS A CE   1  
ATOM   374   N NZ   . LYS A 1 25  ? -18.142 -2.755  -7.896  1.00 0.00 ? 1505 LYS A NZ   1  
ATOM   375   H H    . LYS A 1 25  ? -15.329 -5.524  -5.373  1.00 0.00 ? 1505 LYS A H    1  
ATOM   376   H HA   . LYS A 1 25  ? -12.640 -4.224  -5.182  1.00 0.00 ? 1505 LYS A HA   1  
ATOM   377   H HB2  . LYS A 1 25  ? -15.459 -3.186  -4.622  1.00 0.00 ? 1505 LYS A HB2  1  
ATOM   378   H HB3  . LYS A 1 25  ? -13.971 -2.251  -4.503  1.00 0.00 ? 1505 LYS A HB3  1  
ATOM   379   H HG2  . LYS A 1 25  ? -13.749 -1.940  -6.737  1.00 0.00 ? 1505 LYS A HG2  1  
ATOM   380   H HG3  . LYS A 1 25  ? -14.312 -3.547  -7.163  1.00 0.00 ? 1505 LYS A HG3  1  
ATOM   381   H HD2  . LYS A 1 25  ? -16.175 -1.316  -6.336  1.00 0.00 ? 1505 LYS A HD2  1  
ATOM   382   H HD3  . LYS A 1 25  ? -15.729 -1.709  -8.011  1.00 0.00 ? 1505 LYS A HD3  1  
ATOM   383   H HE2  . LYS A 1 25  ? -16.565 -4.114  -7.503  1.00 0.00 ? 1505 LYS A HE2  1  
ATOM   384   H HE3  . LYS A 1 25  ? -17.298 -3.420  -6.046  1.00 0.00 ? 1505 LYS A HE3  1  
ATOM   385   H HZ1  . LYS A 1 25  ? -18.393 -1.784  -7.730  1.00 0.00 ? 1505 LYS A HZ1  1  
ATOM   386   H HZ2  . LYS A 1 25  ? -17.922 -2.876  -8.890  1.00 0.00 ? 1505 LYS A HZ2  1  
ATOM   387   H HZ3  . LYS A 1 25  ? -18.964 -3.324  -7.715  1.00 0.00 ? 1505 LYS A HZ3  1  
ATOM   388   N N    . ILE A 1 26  ? -12.507 -4.554  -2.681  1.00 0.00 ? 1506 ILE A N    1  
ATOM   389   C CA   . ILE A 1 26  ? -12.432 -4.780  -1.240  1.00 0.00 ? 1506 ILE A CA   1  
ATOM   390   C C    . ILE A 1 26  ? -13.175 -3.621  -0.585  1.00 0.00 ? 1506 ILE A C    1  
ATOM   391   O O    . ILE A 1 26  ? -12.756 -2.474  -0.724  1.00 0.00 ? 1506 ILE A O    1  
ATOM   392   C CB   . ILE A 1 26  ? -10.962 -4.861  -0.803  1.00 0.00 ? 1506 ILE A CB   1  
ATOM   393   C CG1  . ILE A 1 26  ? -10.245 -6.075  -1.443  1.00 0.00 ? 1506 ILE A CG1  1  
ATOM   394   C CG2  . ILE A 1 26  ? -10.859 -4.954  0.730   1.00 0.00 ? 1506 ILE A CG2  1  
ATOM   395   C CD1  . ILE A 1 26  ? -8.744  -5.826  -1.631  1.00 0.00 ? 1506 ILE A CD1  1  
ATOM   396   H H    . ILE A 1 26  ? -11.672 -4.234  -3.169  1.00 0.00 ? 1506 ILE A H    1  
ATOM   397   H HA   . ILE A 1 26  ? -12.940 -5.712  -0.980  1.00 0.00 ? 1506 ILE A HA   1  
ATOM   398   H HB   . ILE A 1 26  ? -10.478 -3.945  -1.134  1.00 0.00 ? 1506 ILE A HB   1  
ATOM   399   H HG12 . ILE A 1 26  ? -10.401 -6.964  -0.827  1.00 0.00 ? 1506 ILE A HG12 1  
ATOM   400   H HG13 . ILE A 1 26  ? -10.658 -6.281  -2.428  1.00 0.00 ? 1506 ILE A HG13 1  
ATOM   401   H HG21 . ILE A 1 26  ? -9.814  -5.072  1.026   1.00 0.00 ? 1506 ILE A HG21 1  
ATOM   402   H HG22 . ILE A 1 26  ? -11.256 -4.049  1.201   1.00 0.00 ? 1506 ILE A HG22 1  
ATOM   403   H HG23 . ILE A 1 26  ? -11.444 -5.805  1.078   1.00 0.00 ? 1506 ILE A HG23 1  
ATOM   404   H HD11 . ILE A 1 26  ? -8.260  -6.730  -1.997  1.00 0.00 ? 1506 ILE A HD11 1  
ATOM   405   H HD12 . ILE A 1 26  ? -8.606  -5.018  -2.355  1.00 0.00 ? 1506 ILE A HD12 1  
ATOM   406   H HD13 . ILE A 1 26  ? -8.276  -5.552  -0.690  1.00 0.00 ? 1506 ILE A HD13 1  
ATOM   407   N N    . THR A 1 27  ? -14.260 -3.911  0.121   1.00 0.00 ? 1507 THR A N    1  
ATOM   408   C CA   . THR A 1 27  ? -15.077 -2.888  0.747   1.00 0.00 ? 1507 THR A CA   1  
ATOM   409   C C    . THR A 1 27  ? -14.473 -2.516  2.093   1.00 0.00 ? 1507 THR A C    1  
ATOM   410   O O    . THR A 1 27  ? -14.578 -1.365  2.520   1.00 0.00 ? 1507 THR A O    1  
ATOM   411   C CB   . THR A 1 27  ? -16.483 -3.438  0.952   1.00 0.00 ? 1507 THR A CB   1  
ATOM   412   O OG1  . THR A 1 27  ? -16.403 -4.640  1.688   1.00 0.00 ? 1507 THR A OG1  1  
ATOM   413   C CG2  . THR A 1 27  ? -17.113 -3.811  -0.374  1.00 0.00 ? 1507 THR A CG2  1  
ATOM   414   H H    . THR A 1 27  ? -14.562 -4.875  0.279   1.00 0.00 ? 1507 THR A H    1  
ATOM   415   H HA   . THR A 1 27  ? -15.134 -2.013  0.098   1.00 0.00 ? 1507 THR A HA   1  
ATOM   416   H HB   . THR A 1 27  ? -17.103 -2.709  1.471   1.00 0.00 ? 1507 THR A HB   1  
ATOM   417   H HG1  . THR A 1 27  ? -17.191 -4.693  2.268   1.00 0.00 ? 1507 THR A HG1  1  
ATOM   418   H HG21 . THR A 1 27  ? -16.492 -4.555  -0.872  1.00 0.00 ? 1507 THR A HG21 1  
ATOM   419   H HG22 . THR A 1 27  ? -18.101 -4.232  -0.178  1.00 0.00 ? 1507 THR A HG22 1  
ATOM   420   H HG23 . THR A 1 27  ? -17.204 -2.920  -0.998  1.00 0.00 ? 1507 THR A HG23 1  
ATOM   421   N N    . ARG A 1 28  ? -13.860 -3.501  2.777   1.00 0.00 ? 1508 ARG A N    1  
ATOM   422   C CA   . ARG A 1 28  ? -13.416 -3.359  4.158   1.00 0.00 ? 1508 ARG A CA   1  
ATOM   423   C C    . ARG A 1 28  ? -12.585 -4.560  4.596   1.00 0.00 ? 1508 ARG A C    1  
ATOM   424   O O    . ARG A 1 28  ? -12.910 -5.689  4.239   1.00 0.00 ? 1508 ARG A O    1  
ATOM   425   C CB   . ARG A 1 28  ? -14.695 -3.332  5.017   1.00 0.00 ? 1508 ARG A CB   1  
ATOM   426   C CG   . ARG A 1 28  ? -14.473 -2.778  6.427   1.00 0.00 ? 1508 ARG A CG   1  
ATOM   427   C CD   . ARG A 1 28  ? -15.306 -3.619  7.393   1.00 0.00 ? 1508 ARG A CD   1  
ATOM   428   N NE   . ARG A 1 28  ? -15.588 -2.918  8.662   1.00 0.00 ? 1508 ARG A NE   1  
ATOM   429   C CZ   . ARG A 1 28  ? -14.811 -2.816  9.753   1.00 0.00 ? 1508 ARG A CZ   1  
ATOM   430   N NH1  . ARG A 1 28  ? -13.606 -3.383  9.812   1.00 0.00 ? 1508 ARG A NH1  1  
ATOM   431   N NH2  . ARG A 1 28  ? -15.253 -2.128  10.804  1.00 0.00 ? 1508 ARG A NH2  1  
ATOM   432   H H    . ARG A 1 28  ? -13.896 -4.445  2.397   1.00 0.00 ? 1508 ARG A H    1  
ATOM   433   H HA   . ARG A 1 28  ? -12.861 -2.428  4.282   1.00 0.00 ? 1508 ARG A HA   1  
ATOM   434   H HB2  . ARG A 1 28  ? -15.468 -2.717  4.557   1.00 0.00 ? 1508 ARG A HB2  1  
ATOM   435   H HB3  . ARG A 1 28  ? -15.096 -4.350  5.053   1.00 0.00 ? 1508 ARG A HB3  1  
ATOM   436   H HG2  . ARG A 1 28  ? -13.427 -2.820  6.719   1.00 0.00 ? 1508 ARG A HG2  1  
ATOM   437   H HG3  . ARG A 1 28  ? -14.799 -1.736  6.447   1.00 0.00 ? 1508 ARG A HG3  1  
ATOM   438   H HD2  . ARG A 1 28  ? -16.255 -3.850  6.898   1.00 0.00 ? 1508 ARG A HD2  1  
ATOM   439   H HD3  . ARG A 1 28  ? -14.789 -4.563  7.556   1.00 0.00 ? 1508 ARG A HD3  1  
ATOM   440   H HE   . ARG A 1 28  ? -16.495 -2.459  8.690   1.00 0.00 ? 1508 ARG A HE   1  
ATOM   441   H HH11 . ARG A 1 28  ? -13.222 -3.924  9.036   1.00 0.00 ? 1508 ARG A HH11 1  
ATOM   442   H HH12 . ARG A 1 28  ? -13.018 -3.308  10.636  1.00 0.00 ? 1508 ARG A HH12 1  
ATOM   443   H HH21 . ARG A 1 28  ? -16.165 -1.682  10.798  1.00 0.00 ? 1508 ARG A HH21 1  
ATOM   444   H HH22 . ARG A 1 28  ? -14.702 -2.021  11.649  1.00 0.00 ? 1508 ARG A HH22 1  
ATOM   445   N N    . ASP A 1 29  ? -11.539 -4.345  5.386   1.00 0.00 ? 1509 ASP A N    1  
ATOM   446   C CA   . ASP A 1 29  ? -10.857 -5.441  6.075   1.00 0.00 ? 1509 ASP A CA   1  
ATOM   447   C C    . ASP A 1 29  ? -11.837 -5.812  7.183   1.00 0.00 ? 1509 ASP A C    1  
ATOM   448   O O    . ASP A 1 29  ? -12.168 -4.970  8.018   1.00 0.00 ? 1509 ASP A O    1  
ATOM   449   C CB   . ASP A 1 29  ? -9.515  -4.987  6.659   1.00 0.00 ? 1509 ASP A CB   1  
ATOM   450   C CG   . ASP A 1 29  ? -9.052  -5.896  7.814   1.00 0.00 ? 1509 ASP A CG   1  
ATOM   451   O OD1  . ASP A 1 29  ? -8.839  -7.108  7.587   1.00 0.00 ? 1509 ASP A OD1  1  
ATOM   452   O OD2  . ASP A 1 29  ? -8.899  -5.392  8.953   1.00 0.00 ? 1509 ASP A OD2  1  
ATOM   453   H H    . ASP A 1 29  ? -11.297 -3.403  5.660   1.00 0.00 ? 1509 ASP A H    1  
ATOM   454   H HA   . ASP A 1 29  ? -10.698 -6.298  5.418   1.00 0.00 ? 1509 ASP A HA   1  
ATOM   455   H HB2  . ASP A 1 29  ? -8.763  -4.987  5.869   1.00 0.00 ? 1509 ASP A HB2  1  
ATOM   456   H HB3  . ASP A 1 29  ? -9.607  -3.965  7.024   1.00 0.00 ? 1509 ASP A HB3  1  
ATOM   457   N N    . VAL A 1 30  ? -12.419 -7.006  7.113   1.00 0.00 ? 1510 VAL A N    1  
ATOM   458   C CA   . VAL A 1 30  ? -13.381 -7.477  8.101   1.00 0.00 ? 1510 VAL A CA   1  
ATOM   459   C C    . VAL A 1 30  ? -12.642 -7.624  9.438   1.00 0.00 ? 1510 VAL A C    1  
ATOM   460   O O    . VAL A 1 30  ? -13.062 -7.057  10.451  1.00 0.00 ? 1510 VAL A O    1  
ATOM   461   C CB   . VAL A 1 30  ? -14.003 -8.823  7.675   1.00 0.00 ? 1510 VAL A CB   1  
ATOM   462   C CG1  . VAL A 1 30  ? -15.257 -9.182  8.453   1.00 0.00 ? 1510 VAL A CG1  1  
ATOM   463   C CG2  . VAL A 1 30  ? -14.403 -8.880  6.207   1.00 0.00 ? 1510 VAL A CG2  1  
ATOM   464   H H    . VAL A 1 30  ? -12.081 -7.672  6.433   1.00 0.00 ? 1510 VAL A H    1  
ATOM   465   H HA   . VAL A 1 30  ? -14.169 -6.735  8.178   1.00 0.00 ? 1510 VAL A HA   1  
ATOM   466   H HB   . VAL A 1 30  ? -13.270 -9.597  7.844   1.00 0.00 ? 1510 VAL A HB   1  
ATOM   467   H HG11 . VAL A 1 30  ? -16.077 -8.525  8.151   1.00 0.00 ? 1510 VAL A HG11 1  
ATOM   468   H HG12 . VAL A 1 30  ? -15.511 -10.220 8.223   1.00 0.00 ? 1510 VAL A HG12 1  
ATOM   469   H HG13 . VAL A 1 30  ? -15.062 -9.090  9.521   1.00 0.00 ? 1510 VAL A HG13 1  
ATOM   470   H HG21 . VAL A 1 30  ? -14.964 -9.797  5.979   1.00 0.00 ? 1510 VAL A HG21 1  
ATOM   471   H HG22 . VAL A 1 30  ? -14.991 -7.994  5.975   1.00 0.00 ? 1510 VAL A HG22 1  
ATOM   472   H HG23 . VAL A 1 30  ? -13.498 -8.885  5.622   1.00 0.00 ? 1510 VAL A HG23 1  
ATOM   473   N N    . GLY A 1 31  ? -11.537 -8.374  9.424   1.00 0.00 ? 1511 GLY A N    1  
ATOM   474   C CA   . GLY A 1 31  ? -10.706 -8.652  10.578  1.00 0.00 ? 1511 GLY A CA   1  
ATOM   475   C C    . GLY A 1 31  ? -10.133 -10.052 10.436  1.00 0.00 ? 1511 GLY A C    1  
ATOM   476   O O    . GLY A 1 31  ? -10.623 -10.847 9.631   1.00 0.00 ? 1511 GLY A O    1  
ATOM   477   H H    . GLY A 1 31  ? -11.274 -8.865  8.569   1.00 0.00 ? 1511 GLY A H    1  
ATOM   478   H HA2  . GLY A 1 31  ? -9.898  -7.921  10.626  1.00 0.00 ? 1511 GLY A HA2  1  
ATOM   479   H HA3  . GLY A 1 31  ? -11.294 -8.604  11.495  1.00 0.00 ? 1511 GLY A HA3  1  
ATOM   480   N N    . ALA A 1 32  ? -9.104  -10.369 11.219  1.00 0.00 ? 1512 ALA A N    1  
ATOM   481   C CA   . ALA A 1 32  ? -8.465  -11.685 11.295  1.00 0.00 ? 1512 ALA A CA   1  
ATOM   482   C C    . ALA A 1 32  ? -7.943  -12.257 9.964   1.00 0.00 ? 1512 ALA A C    1  
ATOM   483   O O    . ALA A 1 32  ? -7.579  -13.432 9.898   1.00 0.00 ? 1512 ALA A O    1  
ATOM   484   C CB   . ALA A 1 32  ? -9.419  -12.642 12.017  1.00 0.00 ? 1512 ALA A CB   1  
ATOM   485   H H    . ALA A 1 32  ? -8.751  -9.660  11.851  1.00 0.00 ? 1512 ALA A H    1  
ATOM   486   H HA   . ALA A 1 32  ? -7.583  -11.564 11.919  1.00 0.00 ? 1512 ALA A HA   1  
ATOM   487   H HB1  . ALA A 1 32  ? -10.307 -12.786 11.406  1.00 0.00 ? 1512 ALA A HB1  1  
ATOM   488   H HB2  . ALA A 1 32  ? -8.928  -13.602 12.193  1.00 0.00 ? 1512 ALA A HB2  1  
ATOM   489   H HB3  . ALA A 1 32  ? -9.711  -12.212 12.974  1.00 0.00 ? 1512 ALA A HB3  1  
ATOM   490   N N    . GLY A 1 33  ? -7.911  -11.448 8.903   1.00 0.00 ? 1513 GLY A N    1  
ATOM   491   C CA   . GLY A 1 33  ? -7.455  -11.815 7.574   1.00 0.00 ? 1513 GLY A CA   1  
ATOM   492   C C    . GLY A 1 33  ? -8.619  -11.874 6.595   1.00 0.00 ? 1513 GLY A C    1  
ATOM   493   O O    . GLY A 1 33  ? -8.389  -12.019 5.402   1.00 0.00 ? 1513 GLY A O    1  
ATOM   494   H H    . GLY A 1 33  ? -8.316  -10.528 8.989   1.00 0.00 ? 1513 GLY A H    1  
ATOM   495   H HA2  . GLY A 1 33  ? -6.740  -11.069 7.226   1.00 0.00 ? 1513 GLY A HA2  1  
ATOM   496   H HA3  . GLY A 1 33  ? -6.964  -12.787 7.593   1.00 0.00 ? 1513 GLY A HA3  1  
ATOM   497   N N    . LYS A 1 34  ? -9.876  -11.815 7.046   1.00 0.00 ? 1514 LYS A N    1  
ATOM   498   C CA   . LYS A 1 34  ? -11.004 -11.668 6.142   1.00 0.00 ? 1514 LYS A CA   1  
ATOM   499   C C    . LYS A 1 34  ? -11.040 -10.233 5.651   1.00 0.00 ? 1514 LYS A C    1  
ATOM   500   O O    . LYS A 1 34  ? -10.937 -9.304  6.451   1.00 0.00 ? 1514 LYS A O    1  
ATOM   501   C CB   . LYS A 1 34  ? -12.333 -11.974 6.851   1.00 0.00 ? 1514 LYS A CB   1  
ATOM   502   C CG   . LYS A 1 34  ? -12.687 -13.453 6.967   1.00 0.00 ? 1514 LYS A CG   1  
ATOM   503   C CD   . LYS A 1 34  ? -12.151 -14.189 8.211   1.00 0.00 ? 1514 LYS A CD   1  
ATOM   504   C CE   . LYS A 1 34  ? -12.783 -13.662 9.511   1.00 0.00 ? 1514 LYS A CE   1  
ATOM   505   N NZ   . LYS A 1 34  ? -12.622 -14.615 10.648  1.00 0.00 ? 1514 LYS A NZ   1  
ATOM   506   H H    . LYS A 1 34  ? -10.056 -11.735 8.039   1.00 0.00 ? 1514 LYS A H    1  
ATOM   507   H HA   . LYS A 1 34  ? -10.879 -12.323 5.286   1.00 0.00 ? 1514 LYS A HA   1  
ATOM   508   H HB2  . LYS A 1 34  ? -12.385 -11.496 7.825   1.00 0.00 ? 1514 LYS A HB2  1  
ATOM   509   H HB3  . LYS A 1 34  ? -13.118 -11.526 6.245   1.00 0.00 ? 1514 LYS A HB3  1  
ATOM   510   H HG2  . LYS A 1 34  ? -13.777 -13.499 6.982   1.00 0.00 ? 1514 LYS A HG2  1  
ATOM   511   H HG3  . LYS A 1 34  ? -12.335 -13.959 6.069   1.00 0.00 ? 1514 LYS A HG3  1  
ATOM   512   H HD2  . LYS A 1 34  ? -12.397 -15.246 8.101   1.00 0.00 ? 1514 LYS A HD2  1  
ATOM   513   H HD3  . LYS A 1 34  ? -11.064 -14.098 8.263   1.00 0.00 ? 1514 LYS A HD3  1  
ATOM   514   H HE2  . LYS A 1 34  ? -12.330 -12.697 9.765   1.00 0.00 ? 1514 LYS A HE2  1  
ATOM   515   H HE3  . LYS A 1 34  ? -13.851 -13.496 9.346   1.00 0.00 ? 1514 LYS A HE3  1  
ATOM   516   H HZ1  . LYS A 1 34  ? -13.020 -14.231 11.498  1.00 0.00 ? 1514 LYS A HZ1  1  
ATOM   517   H HZ2  . LYS A 1 34  ? -13.105 -15.488 10.469  1.00 0.00 ? 1514 LYS A HZ2  1  
ATOM   518   H HZ3  . LYS A 1 34  ? -11.649 -14.835 10.834  1.00 0.00 ? 1514 LYS A HZ3  1  
ATOM   519   N N    . TYR A 1 35  ? -11.351 -10.060 4.373   1.00 0.00 ? 1515 TYR A N    1  
ATOM   520   C CA   . TYR A 1 35  ? -11.655 -8.790  3.741   1.00 0.00 ? 1515 TYR A CA   1  
ATOM   521   C C    . TYR A 1 35  ? -12.997 -8.999  3.043   1.00 0.00 ? 1515 TYR A C    1  
ATOM   522   O O    . TYR A 1 35  ? -13.218 -10.046 2.436   1.00 0.00 ? 1515 TYR A O    1  
ATOM   523   C CB   . TYR A 1 35  ? -10.561 -8.364  2.760   1.00 0.00 ? 1515 TYR A CB   1  
ATOM   524   C CG   . TYR A 1 35  ? -9.141  -8.333  3.301   1.00 0.00 ? 1515 TYR A CG   1  
ATOM   525   C CD1  . TYR A 1 35  ? -8.428  -9.532  3.493   1.00 0.00 ? 1515 TYR A CD1  1  
ATOM   526   C CD2  . TYR A 1 35  ? -8.528  -7.101  3.609   1.00 0.00 ? 1515 TYR A CD2  1  
ATOM   527   C CE1  . TYR A 1 35  ? -7.118  -9.516  4.001   1.00 0.00 ? 1515 TYR A CE1  1  
ATOM   528   C CE2  . TYR A 1 35  ? -7.216  -7.079  4.120   1.00 0.00 ? 1515 TYR A CE2  1  
ATOM   529   C CZ   . TYR A 1 35  ? -6.502  -8.283  4.319   1.00 0.00 ? 1515 TYR A CZ   1  
ATOM   530   O OH   . TYR A 1 35  ? -5.232  -8.240  4.818   1.00 0.00 ? 1515 TYR A OH   1  
ATOM   531   H H    . TYR A 1 35  ? -11.465 -10.885 3.791   1.00 0.00 ? 1515 TYR A H    1  
ATOM   532   H HA   . TYR A 1 35  ? -11.757 -8.010  4.492   1.00 0.00 ? 1515 TYR A HA   1  
ATOM   533   H HB2  . TYR A 1 35  ? -10.593 -9.017  1.891   1.00 0.00 ? 1515 TYR A HB2  1  
ATOM   534   H HB3  . TYR A 1 35  ? -10.831 -7.362  2.440   1.00 0.00 ? 1515 TYR A HB3  1  
ATOM   535   H HD1  . TYR A 1 35  ? -8.881  -10.480 3.251   1.00 0.00 ? 1515 TYR A HD1  1  
ATOM   536   H HD2  . TYR A 1 35  ? -9.058  -6.170  3.459   1.00 0.00 ? 1515 TYR A HD2  1  
ATOM   537   H HE1  . TYR A 1 35  ? -6.601  -10.455 4.145   1.00 0.00 ? 1515 TYR A HE1  1  
ATOM   538   H HE2  . TYR A 1 35  ? -6.745  -6.139  4.365   1.00 0.00 ? 1515 TYR A HE2  1  
ATOM   539   H HH   . TYR A 1 35  ? -4.820  -9.111  4.947   1.00 0.00 ? 1515 TYR A HH   1  
ATOM   540   N N    . LYS A 1 36  ? -13.945 -8.076  3.201   1.00 0.00 ? 1516 LYS A N    1  
ATOM   541   C CA   . LYS A 1 36  ? -15.223 -8.154  2.515   1.00 0.00 ? 1516 LYS A CA   1  
ATOM   542   C C    . LYS A 1 36  ? -15.058 -7.574  1.132   1.00 0.00 ? 1516 LYS A C    1  
ATOM   543   O O    . LYS A 1 36  ? -14.310 -6.614  0.934   1.00 0.00 ? 1516 LYS A O    1  
ATOM   544   C CB   . LYS A 1 36  ? -16.278 -7.478  3.386   1.00 0.00 ? 1516 LYS A CB   1  
ATOM   545   C CG   . LYS A 1 36  ? -17.696 -7.508  2.808   1.00 0.00 ? 1516 LYS A CG   1  
ATOM   546   C CD   . LYS A 1 36  ? -18.738 -7.436  3.929   1.00 0.00 ? 1516 LYS A CD   1  
ATOM   547   C CE   . LYS A 1 36  ? -18.552 -6.259  4.911   1.00 0.00 ? 1516 LYS A CE   1  
ATOM   548   N NZ   . LYS A 1 36  ? -19.715 -6.120  5.833   1.00 0.00 ? 1516 LYS A NZ   1  
ATOM   549   H H    . LYS A 1 36  ? -13.782 -7.257  3.783   1.00 0.00 ? 1516 LYS A H    1  
ATOM   550   H HA   . LYS A 1 36  ? -15.487 -9.203  2.394   1.00 0.00 ? 1516 LYS A HA   1  
ATOM   551   H HB2  . LYS A 1 36  ? -16.297 -8.051  4.305   1.00 0.00 ? 1516 LYS A HB2  1  
ATOM   552   H HB3  . LYS A 1 36  ? -15.985 -6.449  3.600   1.00 0.00 ? 1516 LYS A HB3  1  
ATOM   553   H HG2  . LYS A 1 36  ? -17.833 -6.678  2.116   1.00 0.00 ? 1516 LYS A HG2  1  
ATOM   554   H HG3  . LYS A 1 36  ? -17.851 -8.440  2.266   1.00 0.00 ? 1516 LYS A HG3  1  
ATOM   555   H HD2  . LYS A 1 36  ? -19.720 -7.373  3.453   1.00 0.00 ? 1516 LYS A HD2  1  
ATOM   556   H HD3  . LYS A 1 36  ? -18.667 -8.370  4.495   1.00 0.00 ? 1516 LYS A HD3  1  
ATOM   557   H HE2  . LYS A 1 36  ? -17.640 -6.420  5.507   1.00 0.00 ? 1516 LYS A HE2  1  
ATOM   558   H HE3  . LYS A 1 36  ? -18.430 -5.328  4.346   1.00 0.00 ? 1516 LYS A HE3  1  
ATOM   559   H HZ1  . LYS A 1 36  ? -19.587 -5.346  6.475   1.00 0.00 ? 1516 LYS A HZ1  1  
ATOM   560   H HZ2  . LYS A 1 36  ? -20.572 -5.933  5.321   1.00 0.00 ? 1516 LYS A HZ2  1  
ATOM   561   H HZ3  . LYS A 1 36  ? -19.856 -6.954  6.389   1.00 0.00 ? 1516 LYS A HZ3  1  
ATOM   562   N N    . LEU A 1 37  ? -15.729 -8.197  0.179   1.00 0.00 ? 1517 LEU A N    1  
ATOM   563   C CA   . LEU A 1 37  ? -15.562 -7.961  -1.233  1.00 0.00 ? 1517 LEU A CA   1  
ATOM   564   C C    . LEU A 1 37  ? -16.933 -7.725  -1.820  1.00 0.00 ? 1517 LEU A C    1  
ATOM   565   O O    . LEU A 1 37  ? -17.781 -8.613  -1.771  1.00 0.00 ? 1517 LEU A O    1  
ATOM   566   C CB   . LEU A 1 37  ? -14.960 -9.219  -1.900  1.00 0.00 ? 1517 LEU A CB   1  
ATOM   567   C CG   . LEU A 1 37  ? -13.436 -9.296  -2.028  1.00 0.00 ? 1517 LEU A CG   1  
ATOM   568   C CD1  . LEU A 1 37  ? -12.927 -8.300  -3.065  1.00 0.00 ? 1517 LEU A CD1  1  
ATOM   569   C CD2  . LEU A 1 37  ? -12.673 -9.093  -0.720  1.00 0.00 ? 1517 LEU A CD2  1  
ATOM   570   H H    . LEU A 1 37  ? -16.316 -8.986  0.433   1.00 0.00 ? 1517 LEU A H    1  
ATOM   571   H HA   . LEU A 1 37  ? -14.926 -7.095  -1.411  1.00 0.00 ? 1517 LEU A HA   1  
ATOM   572   H HB2  . LEU A 1 37  ? -15.322 -10.113 -1.386  1.00 0.00 ? 1517 LEU A HB2  1  
ATOM   573   H HB3  . LEU A 1 37  ? -15.360 -9.271  -2.913  1.00 0.00 ? 1517 LEU A HB3  1  
ATOM   574   H HG   . LEU A 1 37  ? -13.198 -10.295 -2.380  1.00 0.00 ? 1517 LEU A HG   1  
ATOM   575   H HD11 . LEU A 1 37  ? -13.355 -8.528  -4.043  1.00 0.00 ? 1517 LEU A HD11 1  
ATOM   576   H HD12 . LEU A 1 37  ? -13.193 -7.285  -2.783  1.00 0.00 ? 1517 LEU A HD12 1  
ATOM   577   H HD13 . LEU A 1 37  ? -11.844 -8.384  -3.131  1.00 0.00 ? 1517 LEU A HD13 1  
ATOM   578   H HD21 . LEU A 1 37  ? -11.612 -9.246  -0.886  1.00 0.00 ? 1517 LEU A HD21 1  
ATOM   579   H HD22 . LEU A 1 37  ? -12.819 -8.088  -0.331  1.00 0.00 ? 1517 LEU A HD22 1  
ATOM   580   H HD23 . LEU A 1 37  ? -13.024 -9.827  0.012   1.00 0.00 ? 1517 LEU A HD23 1  
ATOM   581   N N    . LEU A 1 38  ? -17.134 -6.530  -2.375  1.00 0.00 ? 1518 LEU A N    1  
ATOM   582   C CA   . LEU A 1 38  ? -18.270 -6.173  -3.201  1.00 0.00 ? 1518 LEU A CA   1  
ATOM   583   C C    . LEU A 1 38  ? -17.842 -6.654  -4.573  1.00 0.00 ? 1518 LEU A C    1  
ATOM   584   O O    . LEU A 1 38  ? -17.092 -5.961  -5.268  1.00 0.00 ? 1518 LEU A O    1  
ATOM   585   C CB   . LEU A 1 38  ? -18.539 -4.657  -3.159  1.00 0.00 ? 1518 LEU A CB   1  
ATOM   586   C CG   . LEU A 1 38  ? -19.525 -4.122  -4.222  1.00 0.00 ? 1518 LEU A CG   1  
ATOM   587   C CD1  . LEU A 1 38  ? -20.937 -4.696  -4.091  1.00 0.00 ? 1518 LEU A CD1  1  
ATOM   588   C CD2  . LEU A 1 38  ? -19.599 -2.594  -4.100  1.00 0.00 ? 1518 LEU A CD2  1  
ATOM   589   H H    . LEU A 1 38  ? -16.381 -5.857  -2.322  1.00 0.00 ? 1518 LEU A H    1  
ATOM   590   H HA   . LEU A 1 38  ? -19.157 -6.714  -2.879  1.00 0.00 ? 1518 LEU A HA   1  
ATOM   591   H HB2  . LEU A 1 38  ? -18.953 -4.420  -2.182  1.00 0.00 ? 1518 LEU A HB2  1  
ATOM   592   H HB3  . LEU A 1 38  ? -17.589 -4.123  -3.250  1.00 0.00 ? 1518 LEU A HB3  1  
ATOM   593   H HG   . LEU A 1 38  ? -19.152 -4.355  -5.215  1.00 0.00 ? 1518 LEU A HG   1  
ATOM   594   H HD11 . LEU A 1 38  ? -21.567 -4.317  -4.893  1.00 0.00 ? 1518 LEU A HD11 1  
ATOM   595   H HD12 . LEU A 1 38  ? -20.912 -5.781  -4.157  1.00 0.00 ? 1518 LEU A HD12 1  
ATOM   596   H HD13 . LEU A 1 38  ? -21.371 -4.405  -3.133  1.00 0.00 ? 1518 LEU A HD13 1  
ATOM   597   H HD21 . LEU A 1 38  ? -18.609 -2.154  -4.226  1.00 0.00 ? 1518 LEU A HD21 1  
ATOM   598   H HD22 . LEU A 1 38  ? -20.261 -2.184  -4.863  1.00 0.00 ? 1518 LEU A HD22 1  
ATOM   599   H HD23 . LEU A 1 38  ? -19.987 -2.310  -3.118  1.00 0.00 ? 1518 LEU A HD23 1  
ATOM   600   N N    . PHE A 1 39  ? -18.213 -7.883  -4.909  1.00 0.00 ? 1519 PHE A N    1  
ATOM   601   C CA   . PHE A 1 39  ? -17.997 -8.429  -6.235  1.00 0.00 ? 1519 PHE A CA   1  
ATOM   602   C C    . PHE A 1 39  ? -18.621 -7.476  -7.258  1.00 0.00 ? 1519 PHE A C    1  
ATOM   603   O O    . PHE A 1 39  ? -19.578 -6.756  -6.960  1.00 0.00 ? 1519 PHE A O    1  
ATOM   604   C CB   . PHE A 1 39  ? -18.587 -9.834  -6.316  1.00 0.00 ? 1519 PHE A CB   1  
ATOM   605   C CG   . PHE A 1 39  ? -17.800 -10.911 -5.593  1.00 0.00 ? 1519 PHE A CG   1  
ATOM   606   C CD1  . PHE A 1 39  ? -16.697 -11.512 -6.229  1.00 0.00 ? 1519 PHE A CD1  1  
ATOM   607   C CD2  . PHE A 1 39  ? -18.164 -11.328 -4.296  1.00 0.00 ? 1519 PHE A CD2  1  
ATOM   608   C CE1  . PHE A 1 39  ? -15.977 -12.532 -5.587  1.00 0.00 ? 1519 PHE A CE1  1  
ATOM   609   C CE2  . PHE A 1 39  ? -17.467 -12.380 -3.675  1.00 0.00 ? 1519 PHE A CE2  1  
ATOM   610   C CZ   . PHE A 1 39  ? -16.362 -12.973 -4.314  1.00 0.00 ? 1519 PHE A CZ   1  
ATOM   611   H H    . PHE A 1 39  ? -18.879 -8.359  -4.309  1.00 0.00 ? 1519 PHE A H    1  
ATOM   612   H HA   . PHE A 1 39  ? -16.931 -8.504  -6.427  1.00 0.00 ? 1519 PHE A HA   1  
ATOM   613   H HB2  . PHE A 1 39  ? -19.597 -9.809  -5.915  1.00 0.00 ? 1519 PHE A HB2  1  
ATOM   614   H HB3  . PHE A 1 39  ? -18.647 -10.123 -7.368  1.00 0.00 ? 1519 PHE A HB3  1  
ATOM   615   H HD1  . PHE A 1 39  ? -16.396 -11.197 -7.218  1.00 0.00 ? 1519 PHE A HD1  1  
ATOM   616   H HD2  . PHE A 1 39  ? -18.982 -10.842 -3.778  1.00 0.00 ? 1519 PHE A HD2  1  
ATOM   617   H HE1  . PHE A 1 39  ? -15.125 -12.978 -6.075  1.00 0.00 ? 1519 PHE A HE1  1  
ATOM   618   H HE2  . PHE A 1 39  ? -17.790 -12.726 -2.701  1.00 0.00 ? 1519 PHE A HE2  1  
ATOM   619   H HZ   . PHE A 1 39  ? -15.803 -13.769 -3.841  1.00 0.00 ? 1519 PHE A HZ   1  
ATOM   620   N N    . ASP A 1 40  ? -18.084 -7.444  -8.478  1.00 0.00 ? 1520 ASP A N    1  
ATOM   621   C CA   . ASP A 1 40  ? -18.581 -6.522  -9.506  1.00 0.00 ? 1520 ASP A CA   1  
ATOM   622   C C    . ASP A 1 40  ? -19.983 -6.919  -9.986  1.00 0.00 ? 1520 ASP A C    1  
ATOM   623   O O    . ASP A 1 40  ? -20.690 -6.104  -10.579 1.00 0.00 ? 1520 ASP A O    1  
ATOM   624   C CB   . ASP A 1 40  ? -17.594 -6.346  -10.673 1.00 0.00 ? 1520 ASP A CB   1  
ATOM   625   C CG   . ASP A 1 40  ? -16.638 -5.163  -10.441 1.00 0.00 ? 1520 ASP A CG   1  
ATOM   626   O OD1  . ASP A 1 40  ? -17.121 -4.040  -10.162 1.00 0.00 ? 1520 ASP A OD1  1  
ATOM   627   O OD2  . ASP A 1 40  ? -15.401 -5.330  -10.531 1.00 0.00 ? 1520 ASP A OD2  1  
ATOM   628   H H    . ASP A 1 40  ? -17.339 -8.097  -8.708  1.00 0.00 ? 1520 ASP A H    1  
ATOM   629   H HA   . ASP A 1 40  ? -18.700 -5.548  -9.036  1.00 0.00 ? 1520 ASP A HA   1  
ATOM   630   H HB2  . ASP A 1 40  ? -17.033 -7.268  -10.820 1.00 0.00 ? 1520 ASP A HB2  1  
ATOM   631   H HB3  . ASP A 1 40  ? -18.158 -6.155  -11.590 1.00 0.00 ? 1520 ASP A HB3  1  
ATOM   632   N N    . ASP A 1 41  ? -20.407 -8.150  -9.695  1.00 0.00 ? 1521 ASP A N    1  
ATOM   633   C CA   . ASP A 1 41  ? -21.784 -8.603  -9.877  1.00 0.00 ? 1521 ASP A CA   1  
ATOM   634   C C    . ASP A 1 41  ? -22.729 -8.066  -8.793  1.00 0.00 ? 1521 ASP A C    1  
ATOM   635   O O    . ASP A 1 41  ? -23.937 -8.256  -8.894  1.00 0.00 ? 1521 ASP A O    1  
ATOM   636   C CB   . ASP A 1 41  ? -21.867 -10.128 -9.987  1.00 0.00 ? 1521 ASP A CB   1  
ATOM   637   C CG   . ASP A 1 41  ? -21.415 -10.924 -8.779  1.00 0.00 ? 1521 ASP A CG   1  
ATOM   638   O OD1  . ASP A 1 41  ? -21.261 -10.335 -7.692  1.00 0.00 ? 1521 ASP A OD1  1  
ATOM   639   O OD2  . ASP A 1 41  ? -21.216 -12.148 -8.944  1.00 0.00 ? 1521 ASP A OD2  1  
ATOM   640   H H    . ASP A 1 41  ? -19.798 -8.757  -9.165  1.00 0.00 ? 1521 ASP A H    1  
ATOM   641   H HA   . ASP A 1 41  ? -22.157 -8.216  -10.814 1.00 0.00 ? 1521 ASP A HA   1  
ATOM   642   H HB2  . ASP A 1 41  ? -22.914 -10.378 -10.137 1.00 0.00 ? 1521 ASP A HB2  1  
ATOM   643   H HB3  . ASP A 1 41  ? -21.294 -10.449 -10.859 1.00 0.00 ? 1521 ASP A HB3  1  
ATOM   644   N N    . GLY A 1 42  ? -22.216 -7.368  -7.783  1.00 0.00 ? 1522 GLY A N    1  
ATOM   645   C CA   . GLY A 1 42  ? -23.011 -6.724  -6.751  1.00 0.00 ? 1522 GLY A CA   1  
ATOM   646   C C    . GLY A 1 42  ? -23.216 -7.605  -5.516  1.00 0.00 ? 1522 GLY A C    1  
ATOM   647   O O    . GLY A 1 42  ? -23.802 -7.125  -4.543  1.00 0.00 ? 1522 GLY A O    1  
ATOM   648   H H    . GLY A 1 42  ? -21.205 -7.279  -7.727  1.00 0.00 ? 1522 GLY A H    1  
ATOM   649   H HA2  . GLY A 1 42  ? -22.498 -5.813  -6.443  1.00 0.00 ? 1522 GLY A HA2  1  
ATOM   650   H HA3  . GLY A 1 42  ? -23.985 -6.442  -7.154  1.00 0.00 ? 1522 GLY A HA3  1  
ATOM   651   N N    . TYR A 1 43  ? -22.771 -8.870  -5.530  1.00 0.00 ? 1523 TYR A N    1  
ATOM   652   C CA   . TYR A 1 43  ? -22.741 -9.678  -4.316  1.00 0.00 ? 1523 TYR A CA   1  
ATOM   653   C C    . TYR A 1 43  ? -21.728 -9.047  -3.331  1.00 0.00 ? 1523 TYR A C    1  
ATOM   654   O O    . TYR A 1 43  ? -20.779 -8.391  -3.764  1.00 0.00 ? 1523 TYR A O    1  
ATOM   655   C CB   . TYR A 1 43  ? -22.363 -11.114 -4.675  1.00 0.00 ? 1523 TYR A CB   1  
ATOM   656   C CG   . TYR A 1 43  ? -23.485 -11.942 -5.286  1.00 0.00 ? 1523 TYR A CG   1  
ATOM   657   C CD1  . TYR A 1 43  ? -24.014 -11.685 -6.581  1.00 0.00 ? 1523 TYR A CD1  1  
ATOM   658   C CD2  . TYR A 1 43  ? -24.008 -13.011 -4.525  1.00 0.00 ? 1523 TYR A CD2  1  
ATOM   659   C CE1  . TYR A 1 43  ? -25.068 -12.477 -7.060  1.00 0.00 ? 1523 TYR A CE1  1  
ATOM   660   C CE2  . TYR A 1 43  ? -25.057 -13.798 -5.020  1.00 0.00 ? 1523 TYR A CE2  1  
ATOM   661   C CZ   . TYR A 1 43  ? -25.591 -13.547 -6.300  1.00 0.00 ? 1523 TYR A CZ   1  
ATOM   662   O OH   . TYR A 1 43  ? -26.591 -14.335 -6.784  1.00 0.00 ? 1523 TYR A OH   1  
ATOM   663   H H    . TYR A 1 43  ? -22.276 -9.232  -6.348  1.00 0.00 ? 1523 TYR A H    1  
ATOM   664   H HA   . TYR A 1 43  ? -23.738 -9.701  -3.874  1.00 0.00 ? 1523 TYR A HA   1  
ATOM   665   H HB2  . TYR A 1 43  ? -21.508 -11.100 -5.350  1.00 0.00 ? 1523 TYR A HB2  1  
ATOM   666   H HB3  . TYR A 1 43  ? -22.025 -11.608 -3.763  1.00 0.00 ? 1523 TYR A HB3  1  
ATOM   667   H HD1  . TYR A 1 43  ? -23.652 -10.903 -7.253  1.00 0.00 ? 1523 TYR A HD1  1  
ATOM   668   H HD2  . TYR A 1 43  ? -23.614 -13.257 -3.544  1.00 0.00 ? 1523 TYR A HD2  1  
ATOM   669   H HE1  . TYR A 1 43  ? -25.464 -12.247 -8.030  1.00 0.00 ? 1523 TYR A HE1  1  
ATOM   670   H HE2  . TYR A 1 43  ? -25.447 -14.597 -4.409  1.00 0.00 ? 1523 TYR A HE2  1  
ATOM   671   H HH   . TYR A 1 43  ? -26.866 -14.119 -7.694  1.00 0.00 ? 1523 TYR A HH   1  
ATOM   672   N N    . GLU A 1 44  ? -21.870 -9.266  -2.022  1.00 0.00 ? 1524 GLU A N    1  
ATOM   673   C CA   . GLU A 1 44  ? -20.974 -8.718  -0.995  1.00 0.00 ? 1524 GLU A CA   1  
ATOM   674   C C    . GLU A 1 44  ? -20.750 -9.801  0.055   1.00 0.00 ? 1524 GLU A C    1  
ATOM   675   O O    . GLU A 1 44  ? -21.712 -10.236 0.705   1.00 0.00 ? 1524 GLU A O    1  
ATOM   676   C CB   . GLU A 1 44  ? -21.540 -7.471  -0.298  1.00 0.00 ? 1524 GLU A CB   1  
ATOM   677   C CG   . GLU A 1 44  ? -21.395 -6.186  -1.091  1.00 0.00 ? 1524 GLU A CG   1  
ATOM   678   C CD   . GLU A 1 44  ? -22.076 -5.003  -0.376  1.00 0.00 ? 1524 GLU A CD   1  
ATOM   679   O OE1  . GLU A 1 44  ? -23.291 -4.776  -0.587  1.00 0.00 ? 1524 GLU A OE1  1  
ATOM   680   O OE2  . GLU A 1 44  ? -21.396 -4.293  0.407   1.00 0.00 ? 1524 GLU A OE2  1  
ATOM   681   H H    . GLU A 1 44  ? -22.546 -9.945  -1.703  1.00 0.00 ? 1524 GLU A H    1  
ATOM   682   H HA   . GLU A 1 44  ? -20.030 -8.451  -1.452  1.00 0.00 ? 1524 GLU A HA   1  
ATOM   683   H HB2  . GLU A 1 44  ? -22.592 -7.612  -0.074  1.00 0.00 ? 1524 GLU A HB2  1  
ATOM   684   H HB3  . GLU A 1 44  ? -20.964 -7.317  0.620   1.00 0.00 ? 1524 GLU A HB3  1  
ATOM   685   H HG2  . GLU A 1 44  ? -20.329 -5.984  -1.184  1.00 0.00 ? 1524 GLU A HG2  1  
ATOM   686   H HG3  . GLU A 1 44  ? -21.843 -6.332  -2.072  1.00 0.00 ? 1524 GLU A HG3  1  
ATOM   687   N N    . CYS A 1 45  ? -19.498 -10.245 0.213   1.00 0.00 ? 1525 CYS A N    1  
ATOM   688   C CA   . CYS A 1 45  ? -19.190 -11.421 1.023   1.00 0.00 ? 1525 CYS A CA   1  
ATOM   689   C C    . CYS A 1 45  ? -17.794 -11.272 1.625   1.00 0.00 ? 1525 CYS A C    1  
ATOM   690   O O    . CYS A 1 45  ? -16.913 -10.683 0.994   1.00 0.00 ? 1525 CYS A O    1  
ATOM   691   C CB   . CYS A 1 45  ? -19.173 -12.685 0.132   1.00 0.00 ? 1525 CYS A CB   1  
ATOM   692   S SG   . CYS A 1 45  ? -20.228 -12.547 -1.342  1.00 0.00 ? 1525 CYS A SG   1  
ATOM   693   H H    . CYS A 1 45  ? -18.751 -9.863  -0.361  1.00 0.00 ? 1525 CYS A H    1  
ATOM   694   H HA   . CYS A 1 45  ? -19.931 -11.535 1.817   1.00 0.00 ? 1525 CYS A HA   1  
ATOM   695   H HB2  . CYS A 1 45  ? -18.145 -12.889 -0.180  1.00 0.00 ? 1525 CYS A HB2  1  
ATOM   696   H HB3  . CYS A 1 45  ? -19.523 -13.547 0.709   1.00 0.00 ? 1525 CYS A HB3  1  
ATOM   697   H HG   . CYS A 1 45  ? -19.993 -13.790 -1.782  1.00 0.00 ? 1525 CYS A HG   1  
ATOM   698   N N    . ASP A 1 46  ? -17.577 -11.790 2.834   1.00 0.00 ? 1526 ASP A N    1  
ATOM   699   C CA   . ASP A 1 46  ? -16.242 -11.924 3.402   1.00 0.00 ? 1526 ASP A CA   1  
ATOM   700   C C    . ASP A 1 46  ? -15.497 -13.008 2.616   1.00 0.00 ? 1526 ASP A C    1  
ATOM   701   O O    . ASP A 1 46  ? -16.077 -14.031 2.241   1.00 0.00 ? 1526 ASP A O    1  
ATOM   702   C CB   . ASP A 1 46  ? -16.285 -12.268 4.896   1.00 0.00 ? 1526 ASP A CB   1  
ATOM   703   C CG   . ASP A 1 46  ? -16.694 -13.727 5.177   1.00 0.00 ? 1526 ASP A CG   1  
ATOM   704   O OD1  . ASP A 1 46  ? -17.913 -14.022 5.164   1.00 0.00 ? 1526 ASP A OD1  1  
ATOM   705   O OD2  . ASP A 1 46  ? -15.799 -14.571 5.419   1.00 0.00 ? 1526 ASP A OD2  1  
ATOM   706   H H    . ASP A 1 46  ? -18.319 -12.266 3.321   1.00 0.00 ? 1526 ASP A H    1  
ATOM   707   H HA   . ASP A 1 46  ? -15.713 -10.986 3.304   1.00 0.00 ? 1526 ASP A HA   1  
ATOM   708   H HB2  . ASP A 1 46  ? -15.289 -12.101 5.305   1.00 0.00 ? 1526 ASP A HB2  1  
ATOM   709   H HB3  . ASP A 1 46  ? -16.965 -11.585 5.406   1.00 0.00 ? 1526 ASP A HB3  1  
ATOM   710   N N    . VAL A 1 47  ? -14.208 -12.770 2.375   1.00 0.00 ? 1527 VAL A N    1  
ATOM   711   C CA   . VAL A 1 47  ? -13.288 -13.692 1.725   1.00 0.00 ? 1527 VAL A CA   1  
ATOM   712   C C    . VAL A 1 47  ? -11.978 -13.579 2.519   1.00 0.00 ? 1527 VAL A C    1  
ATOM   713   O O    . VAL A 1 47  ? -11.578 -12.477 2.901   1.00 0.00 ? 1527 VAL A O    1  
ATOM   714   C CB   . VAL A 1 47  ? -13.146 -13.320 0.226   1.00 0.00 ? 1527 VAL A CB   1  
ATOM   715   C CG1  . VAL A 1 47  ? -12.083 -14.159 -0.480  1.00 0.00 ? 1527 VAL A CG1  1  
ATOM   716   C CG2  . VAL A 1 47  ? -14.442 -13.528 -0.582  1.00 0.00 ? 1527 VAL A CG2  1  
ATOM   717   H H    . VAL A 1 47  ? -13.809 -11.872 2.635   1.00 0.00 ? 1527 VAL A H    1  
ATOM   718   H HA   . VAL A 1 47  ? -13.673 -14.712 1.803   1.00 0.00 ? 1527 VAL A HA   1  
ATOM   719   H HB   . VAL A 1 47  ? -12.853 -12.274 0.153   1.00 0.00 ? 1527 VAL A HB   1  
ATOM   720   H HG11 . VAL A 1 47  ? -11.158 -14.152 0.086   1.00 0.00 ? 1527 VAL A HG11 1  
ATOM   721   H HG12 . VAL A 1 47  ? -12.425 -15.186 -0.592  1.00 0.00 ? 1527 VAL A HG12 1  
ATOM   722   H HG13 . VAL A 1 47  ? -11.876 -13.729 -1.460  1.00 0.00 ? 1527 VAL A HG13 1  
ATOM   723   H HG21 . VAL A 1 47  ? -14.267 -13.356 -1.646  1.00 0.00 ? 1527 VAL A HG21 1  
ATOM   724   H HG22 . VAL A 1 47  ? -14.772 -14.561 -0.472  1.00 0.00 ? 1527 VAL A HG22 1  
ATOM   725   H HG23 . VAL A 1 47  ? -15.221 -12.856 -0.232  1.00 0.00 ? 1527 VAL A HG23 1  
ATOM   726   N N    . LEU A 1 48  ? -11.332 -14.705 2.838   1.00 0.00 ? 1528 LEU A N    1  
ATOM   727   C CA   . LEU A 1 48  ? -10.068 -14.708 3.582   1.00 0.00 ? 1528 LEU A CA   1  
ATOM   728   C C    . LEU A 1 48  ? -8.927  -14.236 2.675   1.00 0.00 ? 1528 LEU A C    1  
ATOM   729   O O    . LEU A 1 48  ? -8.978  -14.456 1.473   1.00 0.00 ? 1528 LEU A O    1  
ATOM   730   C CB   . LEU A 1 48  ? -9.788  -16.114 4.153   1.00 0.00 ? 1528 LEU A CB   1  
ATOM   731   C CG   . LEU A 1 48  ? -9.954  -16.215 5.683   1.00 0.00 ? 1528 LEU A CG   1  
ATOM   732   C CD1  . LEU A 1 48  ? -9.800  -17.668 6.135   1.00 0.00 ? 1528 LEU A CD1  1  
ATOM   733   C CD2  . LEU A 1 48  ? -8.945  -15.348 6.436   1.00 0.00 ? 1528 LEU A CD2  1  
ATOM   734   H H    . LEU A 1 48  ? -11.670 -15.591 2.480   1.00 0.00 ? 1528 LEU A H    1  
ATOM   735   H HA   . LEU A 1 48  ? -10.148 -13.992 4.393   1.00 0.00 ? 1528 LEU A HA   1  
ATOM   736   H HB2  . LEU A 1 48  ? -10.447 -16.840 3.674   1.00 0.00 ? 1528 LEU A HB2  1  
ATOM   737   H HB3  . LEU A 1 48  ? -8.772  -16.407 3.899   1.00 0.00 ? 1528 LEU A HB3  1  
ATOM   738   H HG   . LEU A 1 48  ? -10.947 -15.860 5.960   1.00 0.00 ? 1528 LEU A HG   1  
ATOM   739   H HD11 . LEU A 1 48  ? -10.530 -18.296 5.617   1.00 0.00 ? 1528 LEU A HD11 1  
ATOM   740   H HD12 . LEU A 1 48  ? -8.794  -18.024 5.910   1.00 0.00 ? 1528 LEU A HD12 1  
ATOM   741   H HD13 . LEU A 1 48  ? -9.979  -17.743 7.208   1.00 0.00 ? 1528 LEU A HD13 1  
ATOM   742   H HD21 . LEU A 1 48  ? -9.265  -14.314 6.360   1.00 0.00 ? 1528 LEU A HD21 1  
ATOM   743   H HD22 . LEU A 1 48  ? -8.939  -15.605 7.498   1.00 0.00 ? 1528 LEU A HD22 1  
ATOM   744   H HD23 . LEU A 1 48  ? -7.937  -15.466 6.034   1.00 0.00 ? 1528 LEU A HD23 1  
ATOM   745   N N    . GLY A 1 49  ? -7.868  -13.645 3.239   1.00 0.00 ? 1529 GLY A N    1  
ATOM   746   C CA   . GLY A 1 49  ? -6.761  -13.046 2.496   1.00 0.00 ? 1529 GLY A CA   1  
ATOM   747   C C    . GLY A 1 49  ? -6.099  -14.009 1.518   1.00 0.00 ? 1529 GLY A C    1  
ATOM   748   O O    . GLY A 1 49  ? -5.790  -13.641 0.384   1.00 0.00 ? 1529 GLY A O    1  
ATOM   749   H H    . GLY A 1 49  ? -7.904  -13.404 4.227   1.00 0.00 ? 1529 GLY A H    1  
ATOM   750   H HA2  . GLY A 1 49  ? -7.130  -12.171 1.961   1.00 0.00 ? 1529 GLY A HA2  1  
ATOM   751   H HA3  . GLY A 1 49  ? -6.006  -12.714 3.212   1.00 0.00 ? 1529 GLY A HA3  1  
ATOM   752   N N    . LYS A 1 50  ? -5.917  -15.272 1.920   1.00 0.00 ? 1530 LYS A N    1  
ATOM   753   C CA   . LYS A 1 50  ? -5.331  -16.266 1.007   1.00 0.00 ? 1530 LYS A CA   1  
ATOM   754   C C    . LYS A 1 50  ? -6.197  -16.503 -0.241  1.00 0.00 ? 1530 LYS A C    1  
ATOM   755   O O    . LYS A 1 50  ? -5.688  -16.982 -1.242  1.00 0.00 ? 1530 LYS A O    1  
ATOM   756   C CB   . LYS A 1 50  ? -4.906  -17.575 1.703   1.00 0.00 ? 1530 LYS A CB   1  
ATOM   757   C CG   . LYS A 1 50  ? -6.032  -18.478 2.247   1.00 0.00 ? 1530 LYS A CG   1  
ATOM   758   C CD   . LYS A 1 50  ? -6.426  -18.206 3.711   1.00 0.00 ? 1530 LYS A CD   1  
ATOM   759   C CE   . LYS A 1 50  ? -5.323  -18.468 4.750   1.00 0.00 ? 1530 LYS A CE   1  
ATOM   760   N NZ   . LYS A 1 50  ? -4.963  -19.910 4.889   1.00 0.00 ? 1530 LYS A NZ   1  
ATOM   761   H H    . LYS A 1 50  ? -6.179  -15.518 2.866   1.00 0.00 ? 1530 LYS A H    1  
ATOM   762   H HA   . LYS A 1 50  ? -4.409  -15.814 0.642   1.00 0.00 ? 1530 LYS A HA   1  
ATOM   763   H HB2  . LYS A 1 50  ? -4.361  -18.166 0.962   1.00 0.00 ? 1530 LYS A HB2  1  
ATOM   764   H HB3  . LYS A 1 50  ? -4.186  -17.342 2.490   1.00 0.00 ? 1530 LYS A HB3  1  
ATOM   765   H HG2  . LYS A 1 50  ? -6.918  -18.371 1.623   1.00 0.00 ? 1530 LYS A HG2  1  
ATOM   766   H HG3  . LYS A 1 50  ? -5.704  -19.513 2.168   1.00 0.00 ? 1530 LYS A HG3  1  
ATOM   767   H HD2  . LYS A 1 50  ? -6.719  -17.163 3.799   1.00 0.00 ? 1530 LYS A HD2  1  
ATOM   768   H HD3  . LYS A 1 50  ? -7.298  -18.817 3.954   1.00 0.00 ? 1530 LYS A HD3  1  
ATOM   769   H HE2  . LYS A 1 50  ? -4.441  -17.882 4.483   1.00 0.00 ? 1530 LYS A HE2  1  
ATOM   770   H HE3  . LYS A 1 50  ? -5.679  -18.096 5.713   1.00 0.00 ? 1530 LYS A HE3  1  
ATOM   771   H HZ1  . LYS A 1 50  ? -4.268  -20.030 5.617   1.00 0.00 ? 1530 LYS A HZ1  1  
ATOM   772   H HZ2  . LYS A 1 50  ? -5.765  -20.473 5.142   1.00 0.00 ? 1530 LYS A HZ2  1  
ATOM   773   H HZ3  . LYS A 1 50  ? -4.559  -20.290 4.039   1.00 0.00 ? 1530 LYS A HZ3  1  
ATOM   774   N N    . ASP A 1 51  ? -7.478  -16.148 -0.203  1.00 0.00 ? 1531 ASP A N    1  
ATOM   775   C CA   . ASP A 1 51  ? -8.450  -16.391 -1.268  1.00 0.00 ? 1531 ASP A CA   1  
ATOM   776   C C    . ASP A 1 51  ? -8.678  -15.139 -2.128  1.00 0.00 ? 1531 ASP A C    1  
ATOM   777   O O    . ASP A 1 51  ? -9.665  -15.073 -2.863  1.00 0.00 ? 1531 ASP A O    1  
ATOM   778   C CB   . ASP A 1 51  ? -9.760  -16.919 -0.656  1.00 0.00 ? 1531 ASP A CB   1  
ATOM   779   C CG   . ASP A 1 51  ? -9.662  -18.393 -0.235  1.00 0.00 ? 1531 ASP A CG   1  
ATOM   780   O OD1  . ASP A 1 51  ? -9.404  -19.260 -1.101  1.00 0.00 ? 1531 ASP A OD1  1  
ATOM   781   O OD2  . ASP A 1 51  ? -9.849  -18.691 0.969   1.00 0.00 ? 1531 ASP A OD2  1  
ATOM   782   H H    . ASP A 1 51  ? -7.841  -15.728 0.646   1.00 0.00 ? 1531 ASP A H    1  
ATOM   783   H HA   . ASP A 1 51  ? -8.070  -17.161 -1.936  1.00 0.00 ? 1531 ASP A HA   1  
ATOM   784   H HB2  . ASP A 1 51  ? -10.068 -16.299 0.185   1.00 0.00 ? 1531 ASP A HB2  1  
ATOM   785   H HB3  . ASP A 1 51  ? -10.546 -16.847 -1.392  1.00 0.00 ? 1531 ASP A HB3  1  
ATOM   786   N N    . ILE A 1 52  ? -7.801  -14.127 -2.071  1.00 0.00 ? 1532 ILE A N    1  
ATOM   787   C CA   . ILE A 1 52  ? -7.936  -12.888 -2.838  1.00 0.00 ? 1532 ILE A CA   1  
ATOM   788   C C    . ILE A 1 52  ? -6.595  -12.622 -3.522  1.00 0.00 ? 1532 ILE A C    1  
ATOM   789   O O    . ILE A 1 52  ? -5.536  -12.799 -2.926  1.00 0.00 ? 1532 ILE A O    1  
ATOM   790   C CB   . ILE A 1 52  ? -8.399  -11.683 -1.967  1.00 0.00 ? 1532 ILE A CB   1  
ATOM   791   C CG1  . ILE A 1 52  ? -8.877  -12.107 -0.562  1.00 0.00 ? 1532 ILE A CG1  1  
ATOM   792   C CG2  . ILE A 1 52  ? -9.486  -10.867 -2.675  1.00 0.00 ? 1532 ILE A CG2  1  
ATOM   793   C CD1  . ILE A 1 52  ? -9.577  -11.076 0.318   1.00 0.00 ? 1532 ILE A CD1  1  
ATOM   794   H H    . ILE A 1 52  ? -6.999  -14.181 -1.449  1.00 0.00 ? 1532 ILE A H    1  
ATOM   795   H HA   . ILE A 1 52  ? -8.677  -13.053 -3.621  1.00 0.00 ? 1532 ILE A HA   1  
ATOM   796   H HB   . ILE A 1 52  ? -7.559  -11.013 -1.841  1.00 0.00 ? 1532 ILE A HB   1  
ATOM   797   H HG12 . ILE A 1 52  ? -9.571  -12.933 -0.669  1.00 0.00 ? 1532 ILE A HG12 1  
ATOM   798   H HG13 . ILE A 1 52  ? -8.012  -12.462 -0.018  1.00 0.00 ? 1532 ILE A HG13 1  
ATOM   799   H HG21 . ILE A 1 52  ? -10.422 -11.417 -2.644  1.00 0.00 ? 1532 ILE A HG21 1  
ATOM   800   H HG22 . ILE A 1 52  ? -9.614  -9.906  -2.171  1.00 0.00 ? 1532 ILE A HG22 1  
ATOM   801   H HG23 . ILE A 1 52  ? -9.198  -10.672 -3.710  1.00 0.00 ? 1532 ILE A HG23 1  
ATOM   802   H HD11 . ILE A 1 52  ? -10.607 -10.963 -0.011  1.00 0.00 ? 1532 ILE A HD11 1  
ATOM   803   H HD12 . ILE A 1 52  ? -9.585  -11.449 1.342   1.00 0.00 ? 1532 ILE A HD12 1  
ATOM   804   H HD13 . ILE A 1 52  ? -9.066  -10.120 0.280   1.00 0.00 ? 1532 ILE A HD13 1  
ATOM   805   N N    . LEU A 1 53  ? -6.664  -12.192 -4.778  1.00 0.00 ? 1533 LEU A N    1  
ATOM   806   C CA   . LEU A 1 53  ? -5.588  -12.034 -5.744  1.00 0.00 ? 1533 LEU A CA   1  
ATOM   807   C C    . LEU A 1 53  ? -5.642  -10.563 -6.123  1.00 0.00 ? 1533 LEU A C    1  
ATOM   808   O O    . LEU A 1 53  ? -6.597  -10.159 -6.787  1.00 0.00 ? 1533 LEU A O    1  
ATOM   809   C CB   . LEU A 1 53  ? -5.857  -12.908 -6.990  1.00 0.00 ? 1533 LEU A CB   1  
ATOM   810   C CG   . LEU A 1 53  ? -6.084  -14.410 -6.743  1.00 0.00 ? 1533 LEU A CG   1  
ATOM   811   C CD1  . LEU A 1 53  ? -6.456  -15.136 -8.042  1.00 0.00 ? 1533 LEU A CD1  1  
ATOM   812   C CD2  . LEU A 1 53  ? -4.843  -15.065 -6.148  1.00 0.00 ? 1533 LEU A CD2  1  
ATOM   813   H H    . LEU A 1 53  ? -7.586  -12.014 -5.148  1.00 0.00 ? 1533 LEU A H    1  
ATOM   814   H HA   . LEU A 1 53  ? -4.634  -12.293 -5.296  1.00 0.00 ? 1533 LEU A HA   1  
ATOM   815   H HB2  . LEU A 1 53  ? -6.752  -12.531 -7.487  1.00 0.00 ? 1533 LEU A HB2  1  
ATOM   816   H HB3  . LEU A 1 53  ? -5.023  -12.779 -7.681  1.00 0.00 ? 1533 LEU A HB3  1  
ATOM   817   H HG   . LEU A 1 53  ? -6.908  -14.555 -6.047  1.00 0.00 ? 1533 LEU A HG   1  
ATOM   818   H HD11 . LEU A 1 53  ? -7.401  -14.738 -8.425  1.00 0.00 ? 1533 LEU A HD11 1  
ATOM   819   H HD12 . LEU A 1 53  ? -5.686  -14.983 -8.799  1.00 0.00 ? 1533 LEU A HD12 1  
ATOM   820   H HD13 . LEU A 1 53  ? -6.577  -16.203 -7.858  1.00 0.00 ? 1533 LEU A HD13 1  
ATOM   821   H HD21 . LEU A 1 53  ? -5.065  -16.119 -5.955  1.00 0.00 ? 1533 LEU A HD21 1  
ATOM   822   H HD22 . LEU A 1 53  ? -4.005  -14.988 -6.842  1.00 0.00 ? 1533 LEU A HD22 1  
ATOM   823   H HD23 . LEU A 1 53  ? -4.584  -14.591 -5.202  1.00 0.00 ? 1533 LEU A HD23 1  
ATOM   824   N N    . LEU A 1 54  ? -4.663  -9.747  -5.716  1.00 0.00 ? 1534 LEU A N    1  
ATOM   825   C CA   . LEU A 1 54  ? -4.798  -8.283  -5.846  1.00 0.00 ? 1534 LEU A CA   1  
ATOM   826   C C    . LEU A 1 54  ? -4.009  -7.614  -6.960  1.00 0.00 ? 1534 LEU A C    1  
ATOM   827   O O    . LEU A 1 54  ? -4.171  -6.413  -7.180  1.00 0.00 ? 1534 LEU A O    1  
ATOM   828   C CB   . LEU A 1 54  ? -4.571  -7.574  -4.506  1.00 0.00 ? 1534 LEU A CB   1  
ATOM   829   C CG   . LEU A 1 54  ? -3.219  -7.774  -3.805  1.00 0.00 ? 1534 LEU A CG   1  
ATOM   830   C CD1  . LEU A 1 54  ? -1.980  -7.416  -4.630  1.00 0.00 ? 1534 LEU A CD1  1  
ATOM   831   C CD2  . LEU A 1 54  ? -3.267  -6.908  -2.540  1.00 0.00 ? 1534 LEU A CD2  1  
ATOM   832   H H    . LEU A 1 54  ? -3.861  -10.138 -5.223  1.00 0.00 ? 1534 LEU A H    1  
ATOM   833   H HA   . LEU A 1 54  ? -5.830  -8.076  -6.109  1.00 0.00 ? 1534 LEU A HA   1  
ATOM   834   H HB2  . LEU A 1 54  ? -4.729  -6.500  -4.654  1.00 0.00 ? 1534 LEU A HB2  1  
ATOM   835   H HB3  . LEU A 1 54  ? -5.354  -7.915  -3.836  1.00 0.00 ? 1534 LEU A HB3  1  
ATOM   836   H HG   . LEU A 1 54  ? -3.129  -8.826  -3.522  1.00 0.00 ? 1534 LEU A HG   1  
ATOM   837   H HD11 . LEU A 1 54  ? -1.815  -8.163  -5.404  1.00 0.00 ? 1534 LEU A HD11 1  
ATOM   838   H HD12 . LEU A 1 54  ? -2.091  -6.432  -5.087  1.00 0.00 ? 1534 LEU A HD12 1  
ATOM   839   H HD13 . LEU A 1 54  ? -1.100  -7.424  -3.985  1.00 0.00 ? 1534 LEU A HD13 1  
ATOM   840   H HD21 . LEU A 1 54  ? -3.094  -5.863  -2.792  1.00 0.00 ? 1534 LEU A HD21 1  
ATOM   841   H HD22 . LEU A 1 54  ? -4.251  -6.985  -2.067  1.00 0.00 ? 1534 LEU A HD22 1  
ATOM   842   H HD23 . LEU A 1 54  ? -2.510  -7.261  -1.835  1.00 0.00 ? 1534 LEU A HD23 1  
ATOM   843   N N    . CYS A 1 55  ? -3.185  -8.364  -7.677  1.00 0.00 ? 1535 CYS A N    1  
ATOM   844   C CA   . CYS A 1 55  ? -2.349  -7.848  -8.752  1.00 0.00 ? 1535 CYS A CA   1  
ATOM   845   C C    . CYS A 1 55  ? -2.536  -8.825  -9.907  1.00 0.00 ? 1535 CYS A C    1  
ATOM   846   O O    . CYS A 1 55  ? -1.574  -9.383  -10.432 1.00 0.00 ? 1535 CYS A O    1  
ATOM   847   C CB   . CYS A 1 55  ? -0.920  -7.662  -8.208  1.00 0.00 ? 1535 CYS A CB   1  
ATOM   848   S SG   . CYS A 1 55  ? -0.218  -9.181  -7.513  1.00 0.00 ? 1535 CYS A SG   1  
ATOM   849   H H    . CYS A 1 55  ? -3.099  -9.352  -7.470  1.00 0.00 ? 1535 CYS A H    1  
ATOM   850   H HA   . CYS A 1 55  ? -2.717  -6.872  -9.082  1.00 0.00 ? 1535 CYS A HA   1  
ATOM   851   H HB2  . CYS A 1 55  ? -0.271  -7.284  -8.988  1.00 0.00 ? 1535 CYS A HB2  1  
ATOM   852   H HB3  . CYS A 1 55  ? -0.964  -6.925  -7.411  1.00 0.00 ? 1535 CYS A HB3  1  
ATOM   853   H HG   . CYS A 1 55  ? -0.244  -9.872  -8.667  1.00 0.00 ? 1535 CYS A HG   1  
ATOM   854   N N    . ASP A 1 56  ? -3.813  -9.051  -10.247 1.00 0.00 ? 1536 ASP A N    1  
ATOM   855   C CA   . ASP A 1 56  ? -4.231  -10.130 -11.139 1.00 0.00 ? 1536 ASP A CA   1  
ATOM   856   C C    . ASP A 1 56  ? -4.969  -9.720  -12.424 1.00 0.00 ? 1536 ASP A C    1  
ATOM   857   O O    . ASP A 1 56  ? -6.107  -10.154 -12.645 1.00 0.00 ? 1536 ASP A O    1  
ATOM   858   C CB   . ASP A 1 56  ? -5.026  -11.151 -10.322 1.00 0.00 ? 1536 ASP A CB   1  
ATOM   859   C CG   . ASP A 1 56  ? -5.330  -12.439 -11.117 1.00 0.00 ? 1536 ASP A CG   1  
ATOM   860   O OD1  . ASP A 1 56  ? -4.629  -12.747 -12.115 1.00 0.00 ? 1536 ASP A OD1  1  
ATOM   861   O OD2  . ASP A 1 56  ? -6.283  -13.144 -10.714 1.00 0.00 ? 1536 ASP A OD2  1  
ATOM   862   H H    . ASP A 1 56  ? -4.544  -8.499  -9.817  1.00 0.00 ? 1536 ASP A H    1  
ATOM   863   H HA   . ASP A 1 56  ? -3.336  -10.657 -11.469 1.00 0.00 ? 1536 ASP A HA   1  
ATOM   864   H HB2  . ASP A 1 56  ? -4.463  -11.399 -9.425  1.00 0.00 ? 1536 ASP A HB2  1  
ATOM   865   H HB3  . ASP A 1 56  ? -5.958  -10.693 -9.994  1.00 0.00 ? 1536 ASP A HB3  1  
ATOM   866   N N    . PRO A 1 57  ? -4.440  -8.787  -13.239 1.00 0.00 ? 1537 PRO A N    1  
ATOM   867   C CA   . PRO A 1 57  ? -4.979  -8.619  -14.580 1.00 0.00 ? 1537 PRO A CA   1  
ATOM   868   C C    . PRO A 1 57  ? -4.559  -9.943  -15.256 1.00 0.00 ? 1537 PRO A C    1  
ATOM   869   O O    . PRO A 1 57  ? -3.373  -10.289 -15.222 1.00 0.00 ? 1537 PRO A O    1  
ATOM   870   C CB   . PRO A 1 57  ? -4.309  -7.371  -15.160 1.00 0.00 ? 1537 PRO A CB   1  
ATOM   871   C CG   . PRO A 1 57  ? -2.978  -7.294  -14.398 1.00 0.00 ? 1537 PRO A CG   1  
ATOM   872   C CD   . PRO A 1 57  ? -3.256  -7.962  -13.051 1.00 0.00 ? 1537 PRO A CD   1  
ATOM   873   H HA   . PRO A 1 57  ? -6.059  -8.500  -14.560 1.00 0.00 ? 1537 PRO A HA   1  
ATOM   874   H HB2  . PRO A 1 57  ? -4.171  -7.449  -16.240 1.00 0.00 ? 1537 PRO A HB2  1  
ATOM   875   H HB3  . PRO A 1 57  ? -4.926  -6.497  -14.937 1.00 0.00 ? 1537 PRO A HB3  1  
ATOM   876   H HG2  . PRO A 1 57  ? -2.213  -7.873  -14.921 1.00 0.00 ? 1537 PRO A HG2  1  
ATOM   877   H HG3  . PRO A 1 57  ? -2.644  -6.263  -14.264 1.00 0.00 ? 1537 PRO A HG3  1  
ATOM   878   H HD2  . PRO A 1 57  ? -2.404  -8.575  -12.761 1.00 0.00 ? 1537 PRO A HD2  1  
ATOM   879   H HD3  . PRO A 1 57  ? -3.455  -7.204  -12.292 1.00 0.00 ? 1537 PRO A HD3  1  
ATOM   880   N N    . ILE A 1 58  ? -5.496  -10.702 -15.838 1.00 0.00 ? 1538 ILE A N    1  
ATOM   881   C CA   . ILE A 1 58  ? -5.208  -12.070 -16.274 1.00 0.00 ? 1538 ILE A CA   1  
ATOM   882   C C    . ILE A 1 58  ? -4.053  -12.064 -17.298 1.00 0.00 ? 1538 ILE A C    1  
ATOM   883   O O    . ILE A 1 58  ? -4.182  -11.408 -18.339 1.00 0.00 ? 1538 ILE A O    1  
ATOM   884   C CB   . ILE A 1 58  ? -6.429  -12.787 -16.899 1.00 0.00 ? 1538 ILE A CB   1  
ATOM   885   C CG1  . ILE A 1 58  ? -7.836  -12.503 -16.321 1.00 0.00 ? 1538 ILE A CG1  1  
ATOM   886   C CG2  . ILE A 1 58  ? -6.144  -14.302 -16.896 1.00 0.00 ? 1538 ILE A CG2  1  
ATOM   887   C CD1  . ILE A 1 58  ? -8.161  -13.134 -14.972 1.00 0.00 ? 1538 ILE A CD1  1  
ATOM   888   H H    . ILE A 1 58  ? -6.449  -10.365 -15.889 1.00 0.00 ? 1538 ILE A H    1  
ATOM   889   H HA   . ILE A 1 58  ? -4.924  -12.617 -15.375 1.00 0.00 ? 1538 ILE A HA   1  
ATOM   890   H HB   . ILE A 1 58  ? -6.471  -12.471 -17.942 1.00 0.00 ? 1538 ILE A HB   1  
ATOM   891   H HG12 . ILE A 1 58  ? -7.986  -11.439 -16.207 1.00 0.00 ? 1538 ILE A HG12 1  
ATOM   892   H HG13 . ILE A 1 58  ? -8.578  -12.838 -17.051 1.00 0.00 ? 1538 ILE A HG13 1  
ATOM   893   H HG21 . ILE A 1 58  ? -6.964  -14.834 -17.370 1.00 0.00 ? 1538 ILE A HG21 1  
ATOM   894   H HG22 . ILE A 1 58  ? -5.237  -14.501 -17.464 1.00 0.00 ? 1538 ILE A HG22 1  
ATOM   895   H HG23 . ILE A 1 58  ? -6.008  -14.674 -15.880 1.00 0.00 ? 1538 ILE A HG23 1  
ATOM   896   H HD11 . ILE A 1 58  ? -8.195  -14.214 -15.080 1.00 0.00 ? 1538 ILE A HD11 1  
ATOM   897   H HD12 . ILE A 1 58  ? -7.403  -12.844 -14.243 1.00 0.00 ? 1538 ILE A HD12 1  
ATOM   898   H HD13 . ILE A 1 58  ? -9.138  -12.793 -14.634 1.00 0.00 ? 1538 ILE A HD13 1  
ATOM   899   N N    . PRO A 1 59  ? -2.947  -12.791 -17.055 1.00 0.00 ? 1539 PRO A N    1  
ATOM   900   C CA   . PRO A 1 59  ? -1.899  -12.939 -18.046 1.00 0.00 ? 1539 PRO A CA   1  
ATOM   901   C C    . PRO A 1 59  ? -2.416  -13.711 -19.256 1.00 0.00 ? 1539 PRO A C    1  
ATOM   902   O O    . PRO A 1 59  ? -3.214  -14.649 -19.165 1.00 0.00 ? 1539 PRO A O    1  
ATOM   903   C CB   . PRO A 1 59  ? -0.719  -13.621 -17.342 1.00 0.00 ? 1539 PRO A CB   1  
ATOM   904   C CG   . PRO A 1 59  ? -1.290  -14.211 -16.045 1.00 0.00 ? 1539 PRO A CG   1  
ATOM   905   C CD   . PRO A 1 59  ? -2.624  -13.496 -15.824 1.00 0.00 ? 1539 PRO A CD   1  
ATOM   906   H HA   . PRO A 1 59  ? -1.600  -11.955 -18.417 1.00 0.00 ? 1539 PRO A HA   1  
ATOM   907   H HB2  . PRO A 1 59  ? -0.269  -14.398 -17.963 1.00 0.00 ? 1539 PRO A HB2  1  
ATOM   908   H HB3  . PRO A 1 59  ? 0.029   -12.868 -17.091 1.00 0.00 ? 1539 PRO A HB3  1  
ATOM   909   H HG2  . PRO A 1 59  ? -1.466  -15.283 -16.147 1.00 0.00 ? 1539 PRO A HG2  1  
ATOM   910   H HG3  . PRO A 1 59  ? -0.613  -14.033 -15.210 1.00 0.00 ? 1539 PRO A HG3  1  
ATOM   911   H HD2  . PRO A 1 59  ? -3.399  -14.223 -15.584 1.00 0.00 ? 1539 PRO A HD2  1  
ATOM   912   H HD3  . PRO A 1 59  ? -2.524  -12.771 -15.014 1.00 0.00 ? 1539 PRO A HD3  1  
ATOM   913   N N    . LEU A 1 60  ? -1.950  -13.290 -20.424 1.00 0.00 ? 1540 LEU A N    1  
ATOM   914   C CA   . LEU A 1 60  ? -2.314  -13.898 -21.679 1.00 0.00 ? 1540 LEU A CA   1  
ATOM   915   C C    . LEU A 1 60  ? -1.779  -15.339 -21.686 1.00 0.00 ? 1540 LEU A C    1  
ATOM   916   O O    . LEU A 1 60  ? -0.786  -15.634 -21.020 1.00 0.00 ? 1540 LEU A O    1  
ATOM   917   C CB   . LEU A 1 60  ? -1.776  -13.047 -22.836 1.00 0.00 ? 1540 LEU A CB   1  
ATOM   918   C CG   . LEU A 1 60  ? -2.352  -11.609 -22.923 1.00 0.00 ? 1540 LEU A CG   1  
ATOM   919   C CD1  . LEU A 1 60  ? -1.683  -10.610 -21.972 1.00 0.00 ? 1540 LEU A CD1  1  
ATOM   920   C CD2  . LEU A 1 60  ? -2.192  -11.120 -24.364 1.00 0.00 ? 1540 LEU A CD2  1  
ATOM   921   H H    . LEU A 1 60  ? -1.263  -12.548 -20.440 1.00 0.00 ? 1540 LEU A H    1  
ATOM   922   H HA   . LEU A 1 60  ? -3.398  -13.927 -21.750 1.00 0.00 ? 1540 LEU A HA   1  
ATOM   923   H HB2  . LEU A 1 60  ? -0.690  -12.994 -22.773 1.00 0.00 ? 1540 LEU A HB2  1  
ATOM   924   H HB3  . LEU A 1 60  ? -2.029  -13.584 -23.747 1.00 0.00 ? 1540 LEU A HB3  1  
ATOM   925   H HG   . LEU A 1 60  ? -3.408  -11.610 -22.668 1.00 0.00 ? 1540 LEU A HG   1  
ATOM   926   H HD11 . LEU A 1 60  ? -2.033  -10.770 -20.951 1.00 0.00 ? 1540 LEU A HD11 1  
ATOM   927   H HD12 . LEU A 1 60  ? -0.595  -10.691 -22.027 1.00 0.00 ? 1540 LEU A HD12 1  
ATOM   928   H HD13 . LEU A 1 60  ? -1.975  -9.595  -22.245 1.00 0.00 ? 1540 LEU A HD13 1  
ATOM   929   H HD21 . LEU A 1 60  ? -2.607  -10.118 -24.462 1.00 0.00 ? 1540 LEU A HD21 1  
ATOM   930   H HD22 . LEU A 1 60  ? -1.136  -11.104 -24.637 1.00 0.00 ? 1540 LEU A HD22 1  
ATOM   931   H HD23 . LEU A 1 60  ? -2.721  -11.794 -25.041 1.00 0.00 ? 1540 LEU A HD23 1  
ATOM   932   N N    . ASP A 1 61  ? -2.465  -16.229 -22.406 1.00 0.00 ? 1541 ASP A N    1  
ATOM   933   C CA   . ASP A 1 61  ? -2.263  -17.686 -22.432 1.00 0.00 ? 1541 ASP A CA   1  
ATOM   934   C C    . ASP A 1 61  ? -2.791  -18.404 -21.177 1.00 0.00 ? 1541 ASP A C    1  
ATOM   935   O O    . ASP A 1 61  ? -2.880  -19.632 -21.174 1.00 0.00 ? 1541 ASP A O    1  
ATOM   936   C CB   . ASP A 1 61  ? -0.817  -18.083 -22.788 1.00 0.00 ? 1541 ASP A CB   1  
ATOM   937   C CG   . ASP A 1 61  ? -0.715  -19.565 -23.195 1.00 0.00 ? 1541 ASP A CG   1  
ATOM   938   O OD1  . ASP A 1 61  ? -1.354  -19.963 -24.199 1.00 0.00 ? 1541 ASP A OD1  1  
ATOM   939   O OD2  . ASP A 1 61  ? 0.012   -20.333 -22.518 1.00 0.00 ? 1541 ASP A OD2  1  
ATOM   940   H H    . ASP A 1 61  ? -3.279  -15.908 -22.924 1.00 0.00 ? 1541 ASP A H    1  
ATOM   941   H HA   . ASP A 1 61  ? -2.867  -18.052 -23.255 1.00 0.00 ? 1541 ASP A HA   1  
ATOM   942   H HB2  . ASP A 1 61  ? -0.468  -17.467 -23.617 1.00 0.00 ? 1541 ASP A HB2  1  
ATOM   943   H HB3  . ASP A 1 61  ? -0.168  -17.907 -21.929 1.00 0.00 ? 1541 ASP A HB3  1  
ATOM   944   N N    . THR A 1 62  ? -3.224  -17.683 -20.133 1.00 0.00 ? 1542 THR A N    1  
ATOM   945   C CA   . THR A 1 62  ? -3.922  -18.297 -19.007 1.00 0.00 ? 1542 THR A CA   1  
ATOM   946   C C    . THR A 1 62  ? -5.287  -18.791 -19.486 1.00 0.00 ? 1542 THR A C    1  
ATOM   947   O O    . THR A 1 62  ? -5.986  -18.106 -20.246 1.00 0.00 ? 1542 THR A O    1  
ATOM   948   C CB   . THR A 1 62  ? -4.058  -17.305 -17.848 1.00 0.00 ? 1542 THR A CB   1  
ATOM   949   O OG1  . THR A 1 62  ? -2.793  -16.749 -17.588 1.00 0.00 ? 1542 THR A OG1  1  
ATOM   950   C CG2  . THR A 1 62  ? -4.540  -17.903 -16.526 1.00 0.00 ? 1542 THR A CG2  1  
ATOM   951   H H    . THR A 1 62  ? -3.160  -16.675 -20.135 1.00 0.00 ? 1542 THR A H    1  
ATOM   952   H HA   . THR A 1 62  ? -3.325  -19.144 -18.664 1.00 0.00 ? 1542 THR A HA   1  
ATOM   953   H HB   . THR A 1 62  ? -4.746  -16.512 -18.141 1.00 0.00 ? 1542 THR A HB   1  
ATOM   954   H HG1  . THR A 1 62  ? -2.726  -15.956 -18.147 1.00 0.00 ? 1542 THR A HG1  1  
ATOM   955   H HG21 . THR A 1 62  ? -5.589  -18.194 -16.607 1.00 0.00 ? 1542 THR A HG21 1  
ATOM   956   H HG22 . THR A 1 62  ? -3.932  -18.770 -16.264 1.00 0.00 ? 1542 THR A HG22 1  
ATOM   957   H HG23 . THR A 1 62  ? -4.441  -17.150 -15.740 1.00 0.00 ? 1542 THR A HG23 1  
ATOM   958   N N    . GLU A 1 63  ? -5.660  -19.984 -19.033 1.00 0.00 ? 1543 GLU A N    1  
ATOM   959   C CA   . GLU A 1 63  ? -6.962  -20.572 -19.281 1.00 0.00 ? 1543 GLU A CA   1  
ATOM   960   C C    . GLU A 1 63  ? -7.923  -20.009 -18.240 1.00 0.00 ? 1543 GLU A C    1  
ATOM   961   O O    . GLU A 1 63  ? -7.575  -19.875 -17.063 1.00 0.00 ? 1543 GLU A O    1  
ATOM   962   C CB   . GLU A 1 63  ? -6.843  -22.102 -19.229 1.00 0.00 ? 1543 GLU A CB   1  
ATOM   963   C CG   . GLU A 1 63  ? -8.141  -22.831 -19.599 1.00 0.00 ? 1543 GLU A CG   1  
ATOM   964   C CD   . GLU A 1 63  ? -7.920  -24.355 -19.644 1.00 0.00 ? 1543 GLU A CD   1  
ATOM   965   O OE1  . GLU A 1 63  ? -7.773  -24.982 -18.568 1.00 0.00 ? 1543 GLU A OE1  1  
ATOM   966   O OE2  . GLU A 1 63  ? -7.895  -24.929 -20.760 1.00 0.00 ? 1543 GLU A OE2  1  
ATOM   967   H H    . GLU A 1 63  ? -5.078  -20.437 -18.344 1.00 0.00 ? 1543 GLU A H    1  
ATOM   968   H HA   . GLU A 1 63  ? -7.298  -20.283 -20.273 1.00 0.00 ? 1543 GLU A HA   1  
ATOM   969   H HB2  . GLU A 1 63  ? -6.070  -22.412 -19.931 1.00 0.00 ? 1543 GLU A HB2  1  
ATOM   970   H HB3  . GLU A 1 63  ? -6.529  -22.404 -18.232 1.00 0.00 ? 1543 GLU A HB3  1  
ATOM   971   H HG2  . GLU A 1 63  ? -8.916  -22.590 -18.870 1.00 0.00 ? 1543 GLU A HG2  1  
ATOM   972   H HG3  . GLU A 1 63  ? -8.477  -22.482 -20.575 1.00 0.00 ? 1543 GLU A HG3  1  
ATOM   973   N N    . VAL A 1 64  ? -9.126  -19.663 -18.676 1.00 0.00 ? 1544 VAL A N    1  
ATOM   974   C CA   . VAL A 1 64  ? -10.138 -18.998 -17.868 1.00 0.00 ? 1544 VAL A CA   1  
ATOM   975   C C    . VAL A 1 64  ? -11.513 -19.471 -18.318 1.00 0.00 ? 1544 VAL A C    1  
ATOM   976   O O    . VAL A 1 64  ? -11.689 -19.938 -19.444 1.00 0.00 ? 1544 VAL A O    1  
ATOM   977   C CB   . VAL A 1 64  ? -10.037 -17.461 -18.010 1.00 0.00 ? 1544 VAL A CB   1  
ATOM   978   C CG1  . VAL A 1 64  ? -8.833  -16.859 -17.282 1.00 0.00 ? 1544 VAL A CG1  1  
ATOM   979   C CG2  . VAL A 1 64  ? -9.959  -16.984 -19.465 1.00 0.00 ? 1544 VAL A CG2  1  
ATOM   980   H H    . VAL A 1 64  ? -9.358  -19.820 -19.657 1.00 0.00 ? 1544 VAL A H    1  
ATOM   981   H HA   . VAL A 1 64  ? -10.003 -19.263 -16.817 1.00 0.00 ? 1544 VAL A HA   1  
ATOM   982   H HB   . VAL A 1 64  ? -10.928 -17.024 -17.558 1.00 0.00 ? 1544 VAL A HB   1  
ATOM   983   H HG11 . VAL A 1 64  ? -8.916  -15.771 -17.292 1.00 0.00 ? 1544 VAL A HG11 1  
ATOM   984   H HG12 . VAL A 1 64  ? -8.838  -17.192 -16.248 1.00 0.00 ? 1544 VAL A HG12 1  
ATOM   985   H HG13 . VAL A 1 64  ? -7.895  -17.159 -17.758 1.00 0.00 ? 1544 VAL A HG13 1  
ATOM   986   H HG21 . VAL A 1 64  ? -9.095  -17.407 -19.976 1.00 0.00 ? 1544 VAL A HG21 1  
ATOM   987   H HG22 . VAL A 1 64  ? -10.872 -17.254 -19.997 1.00 0.00 ? 1544 VAL A HG22 1  
ATOM   988   H HG23 . VAL A 1 64  ? -9.856  -15.902 -19.463 1.00 0.00 ? 1544 VAL A HG23 1  
ATOM   989   N N    . THR A 1 65  ? -12.492 -19.311 -17.444 1.00 0.00 ? 1545 THR A N    1  
ATOM   990   C CA   . THR A 1 65  ? -13.891 -19.490 -17.773 1.00 0.00 ? 1545 THR A CA   1  
ATOM   991   C C    . THR A 1 65  ? -14.408 -18.110 -18.214 1.00 0.00 ? 1545 THR A C    1  
ATOM   992   O O    . THR A 1 65  ? -13.887 -17.072 -17.796 1.00 0.00 ? 1545 THR A O    1  
ATOM   993   C CB   . THR A 1 65  ? -14.587 -20.092 -16.545 1.00 0.00 ? 1545 THR A CB   1  
ATOM   994   O OG1  . THR A 1 65  ? -14.124 -21.412 -16.327 1.00 0.00 ? 1545 THR A OG1  1  
ATOM   995   C CG2  . THR A 1 65  ? -16.110 -20.139 -16.661 1.00 0.00 ? 1545 THR A CG2  1  
ATOM   996   H H    . THR A 1 65  ? -12.308 -18.797 -16.586 1.00 0.00 ? 1545 THR A H    1  
ATOM   997   H HA   . THR A 1 65  ? -13.999 -20.194 -18.592 1.00 0.00 ? 1545 THR A HA   1  
ATOM   998   H HB   . THR A 1 65  ? -14.318 -19.506 -15.676 1.00 0.00 ? 1545 THR A HB   1  
ATOM   999   H HG1  . THR A 1 65  ? -13.237 -21.387 -15.916 1.00 0.00 ? 1545 THR A HG1  1  
ATOM   1000  H HG21 . THR A 1 65  ? -16.416 -20.684 -17.555 1.00 0.00 ? 1545 THR A HG21 1  
ATOM   1001  H HG22 . THR A 1 65  ? -16.520 -20.651 -15.793 1.00 0.00 ? 1545 THR A HG22 1  
ATOM   1002  H HG23 . THR A 1 65  ? -16.510 -19.122 -16.684 1.00 0.00 ? 1545 THR A HG23 1  
ATOM   1003  N N    . ALA A 1 66  ? -15.425 -18.083 -19.072 1.00 0.00 ? 1546 ALA A N    1  
ATOM   1004  C CA   . ALA A 1 66  ? -16.000 -16.887 -19.657 1.00 0.00 ? 1546 ALA A CA   1  
ATOM   1005  C C    . ALA A 1 66  ? -17.521 -17.003 -19.562 1.00 0.00 ? 1546 ALA A C    1  
ATOM   1006  O O    . ALA A 1 66  ? -18.057 -18.077 -19.849 1.00 0.00 ? 1546 ALA A O    1  
ATOM   1007  C CB   . ALA A 1 66  ? -15.544 -16.765 -21.112 1.00 0.00 ? 1546 ALA A CB   1  
ATOM   1008  H H    . ALA A 1 66  ? -15.849 -18.962 -19.356 1.00 0.00 ? 1546 ALA A H    1  
ATOM   1009  H HA   . ALA A 1 66  ? -15.642 -16.012 -19.127 1.00 0.00 ? 1546 ALA A HA   1  
ATOM   1010  H HB1  . ALA A 1 66  ? -14.456 -16.721 -21.163 1.00 0.00 ? 1546 ALA A HB1  1  
ATOM   1011  H HB2  . ALA A 1 66  ? -15.910 -17.613 -21.696 1.00 0.00 ? 1546 ALA A HB2  1  
ATOM   1012  H HB3  . ALA A 1 66  ? -15.949 -15.844 -21.520 1.00 0.00 ? 1546 ALA A HB3  1  
ATOM   1013  N N    . LEU A 1 67  ? -18.211 -15.924 -19.176 1.00 0.00 ? 1547 LEU A N    1  
ATOM   1014  C CA   . LEU A 1 67  ? -19.668 -15.898 -19.013 1.00 0.00 ? 1547 LEU A CA   1  
ATOM   1015  C C    . LEU A 1 67  ? -20.248 -14.767 -19.849 1.00 0.00 ? 1547 LEU A C    1  
ATOM   1016  O O    . LEU A 1 67  ? -19.970 -13.599 -19.583 1.00 0.00 ? 1547 LEU A O    1  
ATOM   1017  C CB   . LEU A 1 67  ? -20.094 -15.677 -17.544 1.00 0.00 ? 1547 LEU A CB   1  
ATOM   1018  C CG   . LEU A 1 67  ? -20.231 -16.911 -16.645 1.00 0.00 ? 1547 LEU A CG   1  
ATOM   1019  C CD1  . LEU A 1 67  ? -21.440 -17.772 -17.009 1.00 0.00 ? 1547 LEU A CD1  1  
ATOM   1020  C CD2  . LEU A 1 67  ? -18.984 -17.786 -16.591 1.00 0.00 ? 1547 LEU A CD2  1  
ATOM   1021  H H    . LEU A 1 67  ? -17.704 -15.076 -18.952 1.00 0.00 ? 1547 LEU A H    1  
ATOM   1022  H HA   . LEU A 1 67  ? -20.080 -16.841 -19.358 1.00 0.00 ? 1547 LEU A HA   1  
ATOM   1023  H HB2  . LEU A 1 67  ? -19.408 -14.967 -17.074 1.00 0.00 ? 1547 LEU A HB2  1  
ATOM   1024  H HB3  . LEU A 1 67  ? -21.087 -15.215 -17.537 1.00 0.00 ? 1547 LEU A HB3  1  
ATOM   1025  H HG   . LEU A 1 67  ? -20.416 -16.532 -15.646 1.00 0.00 ? 1547 LEU A HG   1  
ATOM   1026  H HD11 . LEU A 1 67  ? -21.351 -18.138 -18.028 1.00 0.00 ? 1547 LEU A HD11 1  
ATOM   1027  H HD12 . LEU A 1 67  ? -21.493 -18.621 -16.326 1.00 0.00 ? 1547 LEU A HD12 1  
ATOM   1028  H HD13 . LEU A 1 67  ? -22.352 -17.176 -16.919 1.00 0.00 ? 1547 LEU A HD13 1  
ATOM   1029  H HD21 . LEU A 1 67  ? -18.103 -17.156 -16.453 1.00 0.00 ? 1547 LEU A HD21 1  
ATOM   1030  H HD22 . LEU A 1 67  ? -19.069 -18.490 -15.761 1.00 0.00 ? 1547 LEU A HD22 1  
ATOM   1031  H HD23 . LEU A 1 67  ? -18.884 -18.355 -17.510 1.00 0.00 ? 1547 LEU A HD23 1  
ATOM   1032  N N    . SER A 1 68  ? -21.065 -15.097 -20.846 1.00 0.00 ? 1548 SER A N    1  
ATOM   1033  C CA   . SER A 1 68  ? -21.853 -14.110 -21.572 1.00 0.00 ? 1548 SER A CA   1  
ATOM   1034  C C    . SER A 1 68  ? -22.893 -13.487 -20.634 1.00 0.00 ? 1548 SER A C    1  
ATOM   1035  O O    . SER A 1 68  ? -23.313 -14.110 -19.658 1.00 0.00 ? 1548 SER A O    1  
ATOM   1036  C CB   . SER A 1 68  ? -22.491 -14.779 -22.793 1.00 0.00 ? 1548 SER A CB   1  
ATOM   1037  O OG   . SER A 1 68  ? -21.477 -15.414 -23.569 1.00 0.00 ? 1548 SER A OG   1  
ATOM   1038  H H    . SER A 1 68  ? -21.211 -16.076 -21.063 1.00 0.00 ? 1548 SER A H    1  
ATOM   1039  H HA   . SER A 1 68  ? -21.195 -13.313 -21.917 1.00 0.00 ? 1548 SER A HA   1  
ATOM   1040  H HB2  . SER A 1 68  ? -23.217 -15.524 -22.464 1.00 0.00 ? 1548 SER A HB2  1  
ATOM   1041  H HB3  . SER A 1 68  ? -23.001 -14.026 -23.392 1.00 0.00 ? 1548 SER A HB3  1  
ATOM   1042  H HG   . SER A 1 68  ? -21.885 -15.801 -24.369 1.00 0.00 ? 1548 SER A HG   1  
ATOM   1043  N N    . GLU A 1 69  ? -23.341 -12.267 -20.943 1.00 0.00 ? 1549 GLU A N    1  
ATOM   1044  C CA   . GLU A 1 69  ? -24.330 -11.559 -20.131 1.00 0.00 ? 1549 GLU A CA   1  
ATOM   1045  C C    . GLU A 1 69  ? -25.677 -12.297 -20.171 1.00 0.00 ? 1549 GLU A C    1  
ATOM   1046  O O    . GLU A 1 69  ? -26.409 -12.320 -19.183 1.00 0.00 ? 1549 GLU A O    1  
ATOM   1047  C CB   . GLU A 1 69  ? -24.455 -10.114 -20.645 1.00 0.00 ? 1549 GLU A CB   1  
ATOM   1048  C CG   . GLU A 1 69  ? -25.228 -9.181  -19.702 1.00 0.00 ? 1549 GLU A CG   1  
ATOM   1049  C CD   . GLU A 1 69  ? -24.490 -8.950  -18.369 1.00 0.00 ? 1549 GLU A CD   1  
ATOM   1050  O OE1  . GLU A 1 69  ? -23.568 -8.097  -18.334 1.00 0.00 ? 1549 GLU A OE1  1  
ATOM   1051  O OE2  . GLU A 1 69  ? -24.823 -9.611  -17.357 1.00 0.00 ? 1549 GLU A OE2  1  
ATOM   1052  H H    . GLU A 1 69  ? -22.960 -11.779 -21.747 1.00 0.00 ? 1549 GLU A H    1  
ATOM   1053  H HA   . GLU A 1 69  ? -23.974 -11.545 -19.102 1.00 0.00 ? 1549 GLU A HA   1  
ATOM   1054  H HB2  . GLU A 1 69  ? -23.457 -9.698  -20.776 1.00 0.00 ? 1549 GLU A HB2  1  
ATOM   1055  H HB3  . GLU A 1 69  ? -24.944 -10.120 -21.620 1.00 0.00 ? 1549 GLU A HB3  1  
ATOM   1056  H HG2  . GLU A 1 69  ? -25.364 -8.222  -20.206 1.00 0.00 ? 1549 GLU A HG2  1  
ATOM   1057  H HG3  . GLU A 1 69  ? -26.223 -9.591  -19.519 1.00 0.00 ? 1549 GLU A HG3  1  
ATOM   1058  N N    . ASP A 1 70  ? -25.967 -12.988 -21.283 1.00 0.00 ? 1550 ASP A N    1  
ATOM   1059  C CA   . ASP A 1 70  ? -27.125 -13.879 -21.444 1.00 0.00 ? 1550 ASP A CA   1  
ATOM   1060  C C    . ASP A 1 70  ? -26.890 -15.248 -20.772 1.00 0.00 ? 1550 ASP A C    1  
ATOM   1061  O O    . ASP A 1 70  ? -27.404 -16.284 -21.191 1.00 0.00 ? 1550 ASP A O    1  
ATOM   1062  C CB   . ASP A 1 70  ? -27.475 -14.017 -22.931 1.00 0.00 ? 1550 ASP A CB   1  
ATOM   1063  C CG   . ASP A 1 70  ? -28.893 -14.586 -23.157 1.00 0.00 ? 1550 ASP A CG   1  
ATOM   1064  O OD1  . ASP A 1 70  ? -29.847 -14.185 -22.444 1.00 0.00 ? 1550 ASP A OD1  1  
ATOM   1065  O OD2  . ASP A 1 70  ? -29.069 -15.437 -24.063 1.00 0.00 ? 1550 ASP A OD2  1  
ATOM   1066  H H    . ASP A 1 70  ? -25.334 -12.921 -22.068 1.00 0.00 ? 1550 ASP A H    1  
ATOM   1067  H HA   . ASP A 1 70  ? -27.970 -13.405 -20.946 1.00 0.00 ? 1550 ASP A HA   1  
ATOM   1068  H HB2  . ASP A 1 70  ? -27.428 -13.028 -23.392 1.00 0.00 ? 1550 ASP A HB2  1  
ATOM   1069  H HB3  . ASP A 1 70  ? -26.725 -14.652 -23.405 1.00 0.00 ? 1550 ASP A HB3  1  
ATOM   1070  N N    . GLU A 1 71  ? -26.041 -15.247 -19.744 1.00 0.00 ? 1551 GLU A N    1  
ATOM   1071  C CA   . GLU A 1 71  ? -25.638 -16.342 -18.879 1.00 0.00 ? 1551 GLU A CA   1  
ATOM   1072  C C    . GLU A 1 71  ? -25.385 -17.688 -19.577 1.00 0.00 ? 1551 GLU A C    1  
ATOM   1073  O O    . GLU A 1 71  ? -26.012 -18.705 -19.284 1.00 0.00 ? 1551 GLU A O    1  
ATOM   1074  C CB   . GLU A 1 71  ? -26.406 -16.378 -17.536 1.00 0.00 ? 1551 GLU A CB   1  
ATOM   1075  C CG   . GLU A 1 71  ? -27.841 -15.828 -17.460 1.00 0.00 ? 1551 GLU A CG   1  
ATOM   1076  C CD   . GLU A 1 71  ? -28.892 -16.726 -18.133 1.00 0.00 ? 1551 GLU A CD   1  
ATOM   1077  O OE1  . GLU A 1 71  ? -28.890 -17.961 -17.916 1.00 0.00 ? 1551 GLU A OE1  1  
ATOM   1078  O OE2  . GLU A 1 71  ? -29.745 -16.212 -18.895 1.00 0.00 ? 1551 GLU A OE2  1  
ATOM   1079  H H    . GLU A 1 71  ? -25.652 -14.342 -19.507 1.00 0.00 ? 1551 GLU A H    1  
ATOM   1080  H HA   . GLU A 1 71  ? -24.630 -16.051 -18.568 1.00 0.00 ? 1551 GLU A HA   1  
ATOM   1081  H HB2  . GLU A 1 71  ? -26.410 -17.391 -17.152 1.00 0.00 ? 1551 GLU A HB2  1  
ATOM   1082  H HB3  . GLU A 1 71  ? -25.811 -15.792 -16.834 1.00 0.00 ? 1551 GLU A HB3  1  
ATOM   1083  H HG2  . GLU A 1 71  ? -28.104 -15.737 -16.404 1.00 0.00 ? 1551 GLU A HG2  1  
ATOM   1084  H HG3  . GLU A 1 71  ? -27.869 -14.821 -17.877 1.00 0.00 ? 1551 GLU A HG3  1  
ATOM   1085  N N    . TYR A 1 72  ? -24.433 -17.685 -20.511 1.00 0.00 ? 1552 TYR A N    1  
ATOM   1086  C CA   . TYR A 1 72  ? -23.862 -18.889 -21.117 1.00 0.00 ? 1552 TYR A CA   1  
ATOM   1087  C C    . TYR A 1 72  ? -22.432 -19.002 -20.599 1.00 0.00 ? 1552 TYR A C    1  
ATOM   1088  O O    . TYR A 1 72  ? -21.754 -17.982 -20.497 1.00 0.00 ? 1552 TYR A O    1  
ATOM   1089  C CB   . TYR A 1 72  ? -23.885 -18.811 -22.649 1.00 0.00 ? 1552 TYR A CB   1  
ATOM   1090  C CG   . TYR A 1 72  ? -25.225 -19.210 -23.217 1.00 0.00 ? 1552 TYR A CG   1  
ATOM   1091  C CD1  . TYR A 1 72  ? -25.497 -20.570 -23.460 1.00 0.00 ? 1552 TYR A CD1  1  
ATOM   1092  C CD2  . TYR A 1 72  ? -26.197 -18.236 -23.495 1.00 0.00 ? 1552 TYR A CD2  1  
ATOM   1093  C CE1  . TYR A 1 72  ? -26.747 -20.962 -23.966 1.00 0.00 ? 1552 TYR A CE1  1  
ATOM   1094  C CE2  . TYR A 1 72  ? -27.446 -18.623 -24.000 1.00 0.00 ? 1552 TYR A CE2  1  
ATOM   1095  C CZ   . TYR A 1 72  ? -27.730 -19.986 -24.252 1.00 0.00 ? 1552 TYR A CZ   1  
ATOM   1096  O OH   . TYR A 1 72  ? -28.947 -20.339 -24.763 1.00 0.00 ? 1552 TYR A OH   1  
ATOM   1097  H H    . TYR A 1 72  ? -23.988 -16.808 -20.744 1.00 0.00 ? 1552 TYR A H    1  
ATOM   1098  H HA   . TYR A 1 72  ? -24.426 -19.762 -20.803 1.00 0.00 ? 1552 TYR A HA   1  
ATOM   1099  H HB2  . TYR A 1 72  ? -23.613 -17.807 -22.975 1.00 0.00 ? 1552 TYR A HB2  1  
ATOM   1100  H HB3  . TYR A 1 72  ? -23.132 -19.494 -23.050 1.00 0.00 ? 1552 TYR A HB3  1  
ATOM   1101  H HD1  . TYR A 1 72  ? -24.753 -21.325 -23.255 1.00 0.00 ? 1552 TYR A HD1  1  
ATOM   1102  H HD2  . TYR A 1 72  ? -25.995 -17.190 -23.323 1.00 0.00 ? 1552 TYR A HD2  1  
ATOM   1103  H HE1  . TYR A 1 72  ? -26.937 -22.016 -24.122 1.00 0.00 ? 1552 TYR A HE1  1  
ATOM   1104  H HE2  . TYR A 1 72  ? -28.188 -17.863 -24.192 1.00 0.00 ? 1552 TYR A HE2  1  
ATOM   1105  H HH   . TYR A 1 72  ? -29.050 -21.292 -24.935 1.00 0.00 ? 1552 TYR A HH   1  
ATOM   1106  N N    . PHE A 1 73  ? -21.987 -20.213 -20.264 1.00 0.00 ? 1553 PHE A N    1  
ATOM   1107  C CA   . PHE A 1 73  ? -20.699 -20.485 -19.624 1.00 0.00 ? 1553 PHE A CA   1  
ATOM   1108  C C    . PHE A 1 73  ? -19.861 -21.295 -20.616 1.00 0.00 ? 1553 PHE A C    1  
ATOM   1109  O O    . PHE A 1 73  ? -20.381 -22.191 -21.284 1.00 0.00 ? 1553 PHE A O    1  
ATOM   1110  C CB   . PHE A 1 73  ? -20.915 -21.174 -18.261 1.00 0.00 ? 1553 PHE A CB   1  
ATOM   1111  C CG   . PHE A 1 73  ? -20.438 -22.606 -18.137 1.00 0.00 ? 1553 PHE A CG   1  
ATOM   1112  C CD1  . PHE A 1 73  ? -21.258 -23.669 -18.559 1.00 0.00 ? 1553 PHE A CD1  1  
ATOM   1113  C CD2  . PHE A 1 73  ? -19.172 -22.876 -17.588 1.00 0.00 ? 1553 PHE A CD2  1  
ATOM   1114  C CE1  . PHE A 1 73  ? -20.776 -24.993 -18.489 1.00 0.00 ? 1553 PHE A CE1  1  
ATOM   1115  C CE2  . PHE A 1 73  ? -18.706 -24.197 -17.483 1.00 0.00 ? 1553 PHE A CE2  1  
ATOM   1116  C CZ   . PHE A 1 73  ? -19.498 -25.257 -17.961 1.00 0.00 ? 1553 PHE A CZ   1  
ATOM   1117  H H    . PHE A 1 73  ? -22.536 -21.025 -20.514 1.00 0.00 ? 1553 PHE A H    1  
ATOM   1118  H HA   . PHE A 1 73  ? -20.179 -19.558 -19.394 1.00 0.00 ? 1553 PHE A HA   1  
ATOM   1119  H HB2  . PHE A 1 73  ? -20.408 -20.579 -17.497 1.00 0.00 ? 1553 PHE A HB2  1  
ATOM   1120  H HB3  . PHE A 1 73  ? -21.974 -21.160 -18.017 1.00 0.00 ? 1553 PHE A HB3  1  
ATOM   1121  H HD1  . PHE A 1 73  ? -22.253 -23.464 -18.930 1.00 0.00 ? 1553 PHE A HD1  1  
ATOM   1122  H HD2  . PHE A 1 73  ? -18.548 -22.074 -17.229 1.00 0.00 ? 1553 PHE A HD2  1  
ATOM   1123  H HE1  . PHE A 1 73  ? -21.388 -25.809 -18.841 1.00 0.00 ? 1553 PHE A HE1  1  
ATOM   1124  H HE2  . PHE A 1 73  ? -17.745 -24.379 -17.014 1.00 0.00 ? 1553 PHE A HE2  1  
ATOM   1125  H HZ   . PHE A 1 73  ? -19.124 -26.272 -17.919 1.00 0.00 ? 1553 PHE A HZ   1  
ATOM   1126  N N    . SER A 1 74  ? -18.577 -20.971 -20.734 1.00 0.00 ? 1554 SER A N    1  
ATOM   1127  C CA   . SER A 1 74  ? -17.583 -21.757 -21.455 1.00 0.00 ? 1554 SER A CA   1  
ATOM   1128  C C    . SER A 1 74  ? -16.212 -21.527 -20.817 1.00 0.00 ? 1554 SER A C    1  
ATOM   1129  O O    . SER A 1 74  ? -16.084 -20.656 -19.959 1.00 0.00 ? 1554 SER A O    1  
ATOM   1130  C CB   . SER A 1 74  ? -17.521 -21.323 -22.927 1.00 0.00 ? 1554 SER A CB   1  
ATOM   1131  O OG   . SER A 1 74  ? -18.736 -21.490 -23.641 1.00 0.00 ? 1554 SER A OG   1  
ATOM   1132  H H    . SER A 1 74  ? -18.215 -20.174 -20.215 1.00 0.00 ? 1554 SER A H    1  
ATOM   1133  H HA   . SER A 1 74  ? -17.823 -22.822 -21.394 1.00 0.00 ? 1554 SER A HA   1  
ATOM   1134  H HB2  . SER A 1 74  ? -17.194 -20.285 -22.994 1.00 0.00 ? 1554 SER A HB2  1  
ATOM   1135  H HB3  . SER A 1 74  ? -16.761 -21.933 -23.407 1.00 0.00 ? 1554 SER A HB3  1  
ATOM   1136  H HG   . SER A 1 74  ? -19.404 -21.875 -23.038 1.00 0.00 ? 1554 SER A HG   1  
ATOM   1137  N N    . ALA A 1 75  ? -15.174 -22.220 -21.286 1.00 0.00 ? 1555 ALA A N    1  
ATOM   1138  C CA   . ALA A 1 75  ? -13.794 -21.936 -20.919 1.00 0.00 ? 1555 ALA A CA   1  
ATOM   1139  C C    . ALA A 1 75  ? -12.941 -21.862 -22.182 1.00 0.00 ? 1555 ALA A C    1  
ATOM   1140  O O    . ALA A 1 75  ? -13.261 -22.486 -23.195 1.00 0.00 ? 1555 ALA A O    1  
ATOM   1141  C CB   . ALA A 1 75  ? -13.292 -23.000 -19.945 1.00 0.00 ? 1555 ALA A CB   1  
ATOM   1142  H H    . ALA A 1 75  ? -15.310 -22.924 -22.003 1.00 0.00 ? 1555 ALA A H    1  
ATOM   1143  H HA   . ALA A 1 75  ? -13.742 -20.962 -20.440 1.00 0.00 ? 1555 ALA A HA   1  
ATOM   1144  H HB1  . ALA A 1 75  ? -13.355 -23.981 -20.415 1.00 0.00 ? 1555 ALA A HB1  1  
ATOM   1145  H HB2  . ALA A 1 75  ? -12.253 -22.796 -19.673 1.00 0.00 ? 1555 ALA A HB2  1  
ATOM   1146  H HB3  . ALA A 1 75  ? -13.906 -22.985 -19.041 1.00 0.00 ? 1555 ALA A HB3  1  
ATOM   1147  N N    . GLY A 1 76  ? -11.875 -21.075 -22.107 1.00 0.00 ? 1556 GLY A N    1  
ATOM   1148  C CA   . GLY A 1 76  ? -11.021 -20.685 -23.219 1.00 0.00 ? 1556 GLY A CA   1  
ATOM   1149  C C    . GLY A 1 76  ? -9.774  -20.020 -22.652 1.00 0.00 ? 1556 GLY A C    1  
ATOM   1150  O O    . GLY A 1 76  ? -9.473  -20.175 -21.468 1.00 0.00 ? 1556 GLY A O    1  
ATOM   1151  H H    . GLY A 1 76  ? -11.634 -20.666 -21.204 1.00 0.00 ? 1556 GLY A H    1  
ATOM   1152  H HA2  . GLY A 1 76  ? -10.734 -21.560 -23.803 1.00 0.00 ? 1556 GLY A HA2  1  
ATOM   1153  H HA3  . GLY A 1 76  ? -11.556 -19.986 -23.861 1.00 0.00 ? 1556 GLY A HA3  1  
ATOM   1154  N N    . VAL A 1 77  ? -9.040  -19.261 -23.460 1.00 0.00 ? 1557 VAL A N    1  
ATOM   1155  C CA   . VAL A 1 77  ? -7.741  -18.716 -23.059 1.00 0.00 ? 1557 VAL A CA   1  
ATOM   1156  C C    . VAL A 1 77  ? -7.674  -17.245 -23.423 1.00 0.00 ? 1557 VAL A C    1  
ATOM   1157  O O    . VAL A 1 77  ? -8.132  -16.839 -24.486 1.00 0.00 ? 1557 VAL A O    1  
ATOM   1158  C CB   . VAL A 1 77  ? -6.620  -19.554 -23.707 1.00 0.00 ? 1557 VAL A CB   1  
ATOM   1159  C CG1  . VAL A 1 77  ? -5.292  -18.803 -23.850 1.00 0.00 ? 1557 VAL A CG1  1  
ATOM   1160  C CG2  . VAL A 1 77  ? -6.324  -20.778 -22.836 1.00 0.00 ? 1557 VAL A CG2  1  
ATOM   1161  H H    . VAL A 1 77  ? -9.368  -19.077 -24.409 1.00 0.00 ? 1557 VAL A H    1  
ATOM   1162  H HA   . VAL A 1 77  ? -7.628  -18.780 -21.978 1.00 0.00 ? 1557 VAL A HA   1  
ATOM   1163  H HB   . VAL A 1 77  ? -6.933  -19.883 -24.699 1.00 0.00 ? 1557 VAL A HB   1  
ATOM   1164  H HG11 . VAL A 1 77  ? -5.023  -18.359 -22.894 1.00 0.00 ? 1557 VAL A HG11 1  
ATOM   1165  H HG12 . VAL A 1 77  ? -4.509  -19.489 -24.176 1.00 0.00 ? 1557 VAL A HG12 1  
ATOM   1166  H HG13 . VAL A 1 77  ? -5.385  -18.011 -24.592 1.00 0.00 ? 1557 VAL A HG13 1  
ATOM   1167  H HG21 . VAL A 1 77  ? -5.667  -21.463 -23.370 1.00 0.00 ? 1557 VAL A HG21 1  
ATOM   1168  H HG22 . VAL A 1 77  ? -5.814  -20.449 -21.931 1.00 0.00 ? 1557 VAL A HG22 1  
ATOM   1169  H HG23 . VAL A 1 77  ? -7.248  -21.293 -22.569 1.00 0.00 ? 1557 VAL A HG23 1  
ATOM   1170  N N    . VAL A 1 78  ? -7.079  -16.439 -22.549 1.00 0.00 ? 1558 VAL A N    1  
ATOM   1171  C CA   . VAL A 1 78  ? -6.822  -15.038 -22.833 1.00 0.00 ? 1558 VAL A CA   1  
ATOM   1172  C C    . VAL A 1 78  ? -5.827  -14.949 -23.992 1.00 0.00 ? 1558 VAL A C    1  
ATOM   1173  O O    . VAL A 1 78  ? -4.748  -15.532 -23.898 1.00 0.00 ? 1558 VAL A O    1  
ATOM   1174  C CB   . VAL A 1 78  ? -6.258  -14.366 -21.567 1.00 0.00 ? 1558 VAL A CB   1  
ATOM   1175  C CG1  . VAL A 1 78  ? -5.964  -12.880 -21.812 1.00 0.00 ? 1558 VAL A CG1  1  
ATOM   1176  C CG2  . VAL A 1 78  ? -7.222  -14.460 -20.381 1.00 0.00 ? 1558 VAL A CG2  1  
ATOM   1177  H H    . VAL A 1 78  ? -6.676  -16.837 -21.706 1.00 0.00 ? 1558 VAL A H    1  
ATOM   1178  H HA   . VAL A 1 78  ? -7.760  -14.567 -23.117 1.00 0.00 ? 1558 VAL A HA   1  
ATOM   1179  H HB   . VAL A 1 78  ? -5.335  -14.874 -21.279 1.00 0.00 ? 1558 VAL A HB   1  
ATOM   1180  H HG11 . VAL A 1 78  ? -6.881  -12.348 -22.068 1.00 0.00 ? 1558 VAL A HG11 1  
ATOM   1181  H HG12 . VAL A 1 78  ? -5.522  -12.435 -20.921 1.00 0.00 ? 1558 VAL A HG12 1  
ATOM   1182  H HG13 . VAL A 1 78  ? -5.261  -12.759 -22.630 1.00 0.00 ? 1558 VAL A HG13 1  
ATOM   1183  H HG21 . VAL A 1 78  ? -7.389  -15.502 -20.097 1.00 0.00 ? 1558 VAL A HG21 1  
ATOM   1184  H HG22 . VAL A 1 78  ? -6.784  -13.938 -19.534 1.00 0.00 ? 1558 VAL A HG22 1  
ATOM   1185  H HG23 . VAL A 1 78  ? -8.169  -13.979 -20.618 1.00 0.00 ? 1558 VAL A HG23 1  
ATOM   1186  N N    . LYS A 1 79  ? -6.119  -14.165 -25.034 1.00 0.00 ? 1559 LYS A N    1  
ATOM   1187  C CA   . LYS A 1 79  ? -5.171  -13.881 -26.118 1.00 0.00 ? 1559 LYS A CA   1  
ATOM   1188  C C    . LYS A 1 79  ? -5.080  -12.384 -26.432 1.00 0.00 ? 1559 LYS A C    1  
ATOM   1189  O O    . LYS A 1 79  ? -4.426  -12.005 -27.405 1.00 0.00 ? 1559 LYS A O    1  
ATOM   1190  C CB   . LYS A 1 79  ? -5.538  -14.715 -27.367 1.00 0.00 ? 1559 LYS A CB   1  
ATOM   1191  C CG   . LYS A 1 79  ? -5.244  -16.213 -27.235 1.00 0.00 ? 1559 LYS A CG   1  
ATOM   1192  C CD   . LYS A 1 79  ? -3.742  -16.556 -27.144 1.00 0.00 ? 1559 LYS A CD   1  
ATOM   1193  C CE   . LYS A 1 79  ? -3.462  -18.068 -27.202 1.00 0.00 ? 1559 LYS A CE   1  
ATOM   1194  N NZ   . LYS A 1 79  ? -3.687  -18.666 -28.547 1.00 0.00 ? 1559 LYS A NZ   1  
ATOM   1195  H H    . LYS A 1 79  ? -7.048  -13.758 -25.111 1.00 0.00 ? 1559 LYS A H    1  
ATOM   1196  H HA   . LYS A 1 79  ? -4.166  -14.160 -25.793 1.00 0.00 ? 1559 LYS A HA   1  
ATOM   1197  H HB2  . LYS A 1 79  ? -6.602  -14.577 -27.575 1.00 0.00 ? 1559 LYS A HB2  1  
ATOM   1198  H HB3  . LYS A 1 79  ? -4.987  -14.347 -28.232 1.00 0.00 ? 1559 LYS A HB3  1  
ATOM   1199  H HG2  . LYS A 1 79  ? -5.758  -16.593 -26.354 1.00 0.00 ? 1559 LYS A HG2  1  
ATOM   1200  H HG3  . LYS A 1 79  ? -5.652  -16.695 -28.113 1.00 0.00 ? 1559 LYS A HG3  1  
ATOM   1201  H HD2  . LYS A 1 79  ? -3.201  -16.052 -27.946 1.00 0.00 ? 1559 LYS A HD2  1  
ATOM   1202  H HD3  . LYS A 1 79  ? -3.353  -16.186 -26.193 1.00 0.00 ? 1559 LYS A HD3  1  
ATOM   1203  H HE2  . LYS A 1 79  ? -2.414  -18.224 -26.926 1.00 0.00 ? 1559 LYS A HE2  1  
ATOM   1204  H HE3  . LYS A 1 79  ? -4.074  -18.580 -26.457 1.00 0.00 ? 1559 LYS A HE3  1  
ATOM   1205  H HZ1  . LYS A 1 79  ? -3.371  -19.628 -28.568 1.00 0.00 ? 1559 LYS A HZ1  1  
ATOM   1206  H HZ2  . LYS A 1 79  ? -4.678  -18.685 -28.806 1.00 0.00 ? 1559 LYS A HZ2  1  
ATOM   1207  H HZ3  . LYS A 1 79  ? -3.179  -18.169 -29.267 1.00 0.00 ? 1559 LYS A HZ3  1  
ATOM   1208  N N    . GLY A 1 80  ? -5.664  -11.519 -25.603 1.00 0.00 ? 1560 GLY A N    1  
ATOM   1209  C CA   . GLY A 1 80  ? -5.505  -10.082 -25.738 1.00 0.00 ? 1560 GLY A CA   1  
ATOM   1210  C C    . GLY A 1 80  ? -6.308  -9.339  -24.683 1.00 0.00 ? 1560 GLY A C    1  
ATOM   1211  O O    . GLY A 1 80  ? -6.926  -9.948  -23.807 1.00 0.00 ? 1560 GLY A O    1  
ATOM   1212  H H    . GLY A 1 80  ? -6.233  -11.830 -24.828 1.00 0.00 ? 1560 GLY A H    1  
ATOM   1213  H HA2  . GLY A 1 80  ? -4.453  -9.825  -25.625 1.00 0.00 ? 1560 GLY A HA2  1  
ATOM   1214  H HA3  . GLY A 1 80  ? -5.825  -9.770  -26.730 1.00 0.00 ? 1560 GLY A HA3  1  
ATOM   1215  N N    . HIS A 1 81  ? -6.285  -8.014  -24.798 1.00 0.00 ? 1561 HIS A N    1  
ATOM   1216  C CA   . HIS A 1 81  ? -6.786  -7.046  -23.826 1.00 0.00 ? 1561 HIS A CA   1  
ATOM   1217  C C    . HIS A 1 81  ? -7.448  -5.880  -24.550 1.00 0.00 ? 1561 HIS A C    1  
ATOM   1218  O O    . HIS A 1 81  ? -7.066  -5.539  -25.674 1.00 0.00 ? 1561 HIS A O    1  
ATOM   1219  C CB   . HIS A 1 81  ? -5.622  -6.478  -22.997 1.00 0.00 ? 1561 HIS A CB   1  
ATOM   1220  C CG   . HIS A 1 81  ? -5.341  -7.246  -21.738 1.00 0.00 ? 1561 HIS A CG   1  
ATOM   1221  N ND1  . HIS A 1 81  ? -4.496  -8.353  -21.629 1.00 0.00 ? 1561 HIS A ND1  1  
ATOM   1222  C CD2  . HIS A 1 81  ? -5.828  -6.908  -20.512 1.00 0.00 ? 1561 HIS A CD2  1  
ATOM   1223  C CE1  . HIS A 1 81  ? -4.494  -8.668  -20.323 1.00 0.00 ? 1561 HIS A CE1  1  
ATOM   1224  N NE2  . HIS A 1 81  ? -5.276  -7.813  -19.629 1.00 0.00 ? 1561 HIS A NE2  1  
ATOM   1225  H H    . HIS A 1 81  ? -5.863  -7.632  -25.629 1.00 0.00 ? 1561 HIS A H    1  
ATOM   1226  H HA   . HIS A 1 81  ? -7.501  -7.525  -23.160 1.00 0.00 ? 1561 HIS A HA   1  
ATOM   1227  H HB2  . HIS A 1 81  ? -4.721  -6.424  -23.605 1.00 0.00 ? 1561 HIS A HB2  1  
ATOM   1228  H HB3  . HIS A 1 81  ? -5.862  -5.456  -22.695 1.00 0.00 ? 1561 HIS A HB3  1  
ATOM   1229  H HD2  . HIS A 1 81  ? -6.514  -6.086  -20.294 1.00 0.00 ? 1561 HIS A HD2  1  
ATOM   1230  H HE1  . HIS A 1 81  ? -3.940  -9.494  -19.891 1.00 0.00 ? 1561 HIS A HE1  1  
ATOM   1231  H HE2  . HIS A 1 81  ? -5.432  -7.836  -18.628 1.00 0.00 ? 1561 HIS A HE2  1  
ATOM   1232  N N    . ARG A 1 82  ? -8.388  -5.221  -23.870 1.00 0.00 ? 1562 ARG A N    1  
ATOM   1233  C CA   . ARG A 1 82  ? -9.013  -3.986  -24.320 1.00 0.00 ? 1562 ARG A CA   1  
ATOM   1234  C C    . ARG A 1 82  ? -9.334  -3.147  -23.088 1.00 0.00 ? 1562 ARG A C    1  
ATOM   1235  O O    . ARG A 1 82  ? -9.489  -3.677  -21.987 1.00 0.00 ? 1562 ARG A O    1  
ATOM   1236  C CB   . ARG A 1 82  ? -10.253 -4.352  -25.167 1.00 0.00 ? 1562 ARG A CB   1  
ATOM   1237  C CG   . ARG A 1 82  ? -11.277 -3.231  -25.410 1.00 0.00 ? 1562 ARG A CG   1  
ATOM   1238  C CD   . ARG A 1 82  ? -12.427 -3.752  -26.283 1.00 0.00 ? 1562 ARG A CD   1  
ATOM   1239  N NE   . ARG A 1 82  ? -13.297 -2.657  -26.741 1.00 0.00 ? 1562 ARG A NE   1  
ATOM   1240  C CZ   . ARG A 1 82  ? -13.163 -1.931  -27.859 1.00 0.00 ? 1562 ARG A CZ   1  
ATOM   1241  N NH1  . ARG A 1 82  ? -12.123 -2.083  -28.680 1.00 0.00 ? 1562 ARG A NH1  1  
ATOM   1242  N NH2  . ARG A 1 82  ? -14.102 -1.038  -28.139 1.00 0.00 ? 1562 ARG A NH2  1  
ATOM   1243  H H    . ARG A 1 82  ? -8.655  -5.547  -22.945 1.00 0.00 ? 1562 ARG A H    1  
ATOM   1244  H HA   . ARG A 1 82  ? -8.304  -3.431  -24.943 1.00 0.00 ? 1562 ARG A HA   1  
ATOM   1245  H HB2  . ARG A 1 82  ? -9.891  -4.691  -26.138 1.00 0.00 ? 1562 ARG A HB2  1  
ATOM   1246  H HB3  . ARG A 1 82  ? -10.760 -5.198  -24.705 1.00 0.00 ? 1562 ARG A HB3  1  
ATOM   1247  H HG2  . ARG A 1 82  ? -11.692 -2.887  -24.459 1.00 0.00 ? 1562 ARG A HG2  1  
ATOM   1248  H HG3  . ARG A 1 82  ? -10.782 -2.396  -25.908 1.00 0.00 ? 1562 ARG A HG3  1  
ATOM   1249  H HD2  . ARG A 1 82  ? -12.035 -4.294  -27.145 1.00 0.00 ? 1562 ARG A HD2  1  
ATOM   1250  H HD3  . ARG A 1 82  ? -13.025 -4.452  -25.697 1.00 0.00 ? 1562 ARG A HD3  1  
ATOM   1251  H HE   . ARG A 1 82  ? -14.092 -2.436  -26.137 1.00 0.00 ? 1562 ARG A HE   1  
ATOM   1252  H HH11 . ARG A 1 82  ? -11.397 -2.762  -28.488 1.00 0.00 ? 1562 ARG A HH11 1  
ATOM   1253  H HH12 . ARG A 1 82  ? -12.019 -1.527  -29.520 1.00 0.00 ? 1562 ARG A HH12 1  
ATOM   1254  H HH21 . ARG A 1 82  ? -14.918 -0.993  -27.514 1.00 0.00 ? 1562 ARG A HH21 1  
ATOM   1255  H HH22 . ARG A 1 82  ? -14.084 -0.448  -28.962 1.00 0.00 ? 1562 ARG A HH22 1  
ATOM   1256  N N    . LYS A 1 83  ? -9.501  -1.844  -23.290 1.00 0.00 ? 1563 LYS A N    1  
ATOM   1257  C CA   . LYS A 1 83  ? -10.018 -0.906  -22.305 1.00 0.00 ? 1563 LYS A CA   1  
ATOM   1258  C C    . LYS A 1 83  ? -11.142 -0.149  -23.002 1.00 0.00 ? 1563 LYS A C    1  
ATOM   1259  O O    . LYS A 1 83  ? -10.956 0.340   -24.119 1.00 0.00 ? 1563 LYS A O    1  
ATOM   1260  C CB   . LYS A 1 83  ? -8.883  0.040   -21.864 1.00 0.00 ? 1563 LYS A CB   1  
ATOM   1261  C CG   . LYS A 1 83  ? -8.121  -0.458  -20.624 1.00 0.00 ? 1563 LYS A CG   1  
ATOM   1262  C CD   . LYS A 1 83  ? -8.971  -0.281  -19.349 1.00 0.00 ? 1563 LYS A CD   1  
ATOM   1263  C CE   . LYS A 1 83  ? -8.128  -0.142  -18.064 1.00 0.00 ? 1563 LYS A CE   1  
ATOM   1264  N NZ   . LYS A 1 83  ? -7.454  1.183   -17.942 1.00 0.00 ? 1563 LYS A NZ   1  
ATOM   1265  H H    . LYS A 1 83  ? -9.364  -1.476  -24.223 1.00 0.00 ? 1563 LYS A H    1  
ATOM   1266  H HA   . LYS A 1 83  ? -10.424 -1.444  -21.447 1.00 0.00 ? 1563 LYS A HA   1  
ATOM   1267  H HB2  . LYS A 1 83  ? -8.177  0.174   -22.687 1.00 0.00 ? 1563 LYS A HB2  1  
ATOM   1268  H HB3  . LYS A 1 83  ? -9.300  1.024   -21.645 1.00 0.00 ? 1563 LYS A HB3  1  
ATOM   1269  H HG2  . LYS A 1 83  ? -7.834  -1.510  -20.741 1.00 0.00 ? 1563 LYS A HG2  1  
ATOM   1270  H HG3  . LYS A 1 83  ? -7.208  0.130   -20.542 1.00 0.00 ? 1563 LYS A HG3  1  
ATOM   1271  H HD2  . LYS A 1 83  ? -9.629  0.585   -19.441 1.00 0.00 ? 1563 LYS A HD2  1  
ATOM   1272  H HD3  . LYS A 1 83  ? -9.622  -1.153  -19.256 1.00 0.00 ? 1563 LYS A HD3  1  
ATOM   1273  H HE2  . LYS A 1 83  ? -8.786  -0.280  -17.199 1.00 0.00 ? 1563 LYS A HE2  1  
ATOM   1274  H HE3  . LYS A 1 83  ? -7.380  -0.938  -18.036 1.00 0.00 ? 1563 LYS A HE3  1  
ATOM   1275  H HZ1  . LYS A 1 83  ? -6.938  1.244   -17.071 1.00 0.00 ? 1563 LYS A HZ1  1  
ATOM   1276  H HZ2  . LYS A 1 83  ? -6.787  1.342   -18.689 1.00 0.00 ? 1563 LYS A HZ2  1  
ATOM   1277  H HZ3  . LYS A 1 83  ? -8.118  1.948   -17.942 1.00 0.00 ? 1563 LYS A HZ3  1  
ATOM   1278  N N    . GLU A 1 84  ? -12.311 -0.074  -22.371 1.00 0.00 ? 1564 GLU A N    1  
ATOM   1279  C CA   . GLU A 1 84  ? -13.503 0.564   -22.920 1.00 0.00 ? 1564 GLU A CA   1  
ATOM   1280  C C    . GLU A 1 84  ? -14.295 1.130   -21.748 1.00 0.00 ? 1564 GLU A C    1  
ATOM   1281  O O    . GLU A 1 84  ? -14.511 0.423   -20.768 1.00 0.00 ? 1564 GLU A O    1  
ATOM   1282  C CB   . GLU A 1 84  ? -14.322 -0.482  -23.700 1.00 0.00 ? 1564 GLU A CB   1  
ATOM   1283  C CG   . GLU A 1 84  ? -15.593 0.114   -24.322 1.00 0.00 ? 1564 GLU A CG   1  
ATOM   1284  C CD   . GLU A 1 84  ? -16.407 -0.945  -25.090 1.00 0.00 ? 1564 GLU A CD   1  
ATOM   1285  O OE1  . GLU A 1 84  ? -15.889 -1.470  -26.104 1.00 0.00 ? 1564 GLU A OE1  1  
ATOM   1286  O OE2  . GLU A 1 84  ? -17.558 -1.249  -24.692 1.00 0.00 ? 1564 GLU A OE2  1  
ATOM   1287  H H    . GLU A 1 84  ? -12.419 -0.504  -21.455 1.00 0.00 ? 1564 GLU A H    1  
ATOM   1288  H HA   . GLU A 1 84  ? -13.223 1.374   -23.591 1.00 0.00 ? 1564 GLU A HA   1  
ATOM   1289  H HB2  . GLU A 1 84  ? -13.697 -0.888  -24.492 1.00 0.00 ? 1564 GLU A HB2  1  
ATOM   1290  H HB3  . GLU A 1 84  ? -14.598 -1.299  -23.036 1.00 0.00 ? 1564 GLU A HB3  1  
ATOM   1291  H HG2  . GLU A 1 84  ? -16.214 0.543   -23.536 1.00 0.00 ? 1564 GLU A HG2  1  
ATOM   1292  H HG3  . GLU A 1 84  ? -15.310 0.917   -25.007 1.00 0.00 ? 1564 GLU A HG3  1  
ATOM   1293  N N    . SER A 1 85  ? -14.712 2.396   -21.851 1.00 0.00 ? 1565 SER A N    1  
ATOM   1294  C CA   . SER A 1 85  ? -15.538 3.083   -20.859 1.00 0.00 ? 1565 SER A CA   1  
ATOM   1295  C C    . SER A 1 85  ? -15.014 2.937   -19.416 1.00 0.00 ? 1565 SER A C    1  
ATOM   1296  O O    . SER A 1 85  ? -15.795 2.874   -18.462 1.00 0.00 ? 1565 SER A O    1  
ATOM   1297  C CB   . SER A 1 85  ? -17.000 2.640   -21.035 1.00 0.00 ? 1565 SER A CB   1  
ATOM   1298  O OG   . SER A 1 85  ? -17.439 2.878   -22.373 1.00 0.00 ? 1565 SER A OG   1  
ATOM   1299  H H    . SER A 1 85  ? -14.524 2.908   -22.703 1.00 0.00 ? 1565 SER A H    1  
ATOM   1300  H HA   . SER A 1 85  ? -15.497 4.150   -21.090 1.00 0.00 ? 1565 SER A HA   1  
ATOM   1301  H HB2  . SER A 1 85  ? -17.089 1.577   -20.800 1.00 0.00 ? 1565 SER A HB2  1  
ATOM   1302  H HB3  . SER A 1 85  ? -17.625 3.205   -20.342 1.00 0.00 ? 1565 SER A HB3  1  
ATOM   1303  H HG   . SER A 1 85  ? -18.389 2.645   -22.438 1.00 0.00 ? 1565 SER A HG   1  
ATOM   1304  N N    . GLY A 1 86  ? -13.685 2.881   -19.254 1.00 0.00 ? 1566 GLY A N    1  
ATOM   1305  C CA   . GLY A 1 86  ? -13.051 2.773   -17.948 1.00 0.00 ? 1566 GLY A CA   1  
ATOM   1306  C C    . GLY A 1 86  ? -13.224 1.384   -17.327 1.00 0.00 ? 1566 GLY A C    1  
ATOM   1307  O O    . GLY A 1 86  ? -13.232 1.264   -16.098 1.00 0.00 ? 1566 GLY A O    1  
ATOM   1308  H H    . GLY A 1 86  ? -13.088 2.946   -20.068 1.00 0.00 ? 1566 GLY A H    1  
ATOM   1309  H HA2  . GLY A 1 86  ? -11.984 2.973   -18.064 1.00 0.00 ? 1566 GLY A HA2  1  
ATOM   1310  H HA3  . GLY A 1 86  ? -13.473 3.523   -17.280 1.00 0.00 ? 1566 GLY A HA3  1  
ATOM   1311  N N    . GLU A 1 87  ? -13.358 0.332   -18.141 1.00 0.00 ? 1567 GLU A N    1  
ATOM   1312  C CA   . GLU A 1 87  ? -13.481 -1.049  -17.714 1.00 0.00 ? 1567 GLU A CA   1  
ATOM   1313  C C    . GLU A 1 87  ? -12.487 -1.862  -18.546 1.00 0.00 ? 1567 GLU A C    1  
ATOM   1314  O O    . GLU A 1 87  ? -12.124 -1.479  -19.666 1.00 0.00 ? 1567 GLU A O    1  
ATOM   1315  C CB   . GLU A 1 87  ? -14.946 -1.504  -17.866 1.00 0.00 ? 1567 GLU A CB   1  
ATOM   1316  C CG   . GLU A 1 87  ? -15.176 -2.979  -17.533 1.00 0.00 ? 1567 GLU A CG   1  
ATOM   1317  C CD   . GLU A 1 87  ? -14.876 -3.314  -16.060 1.00 0.00 ? 1567 GLU A CD   1  
ATOM   1318  O OE1  . GLU A 1 87  ? -13.680 -3.313  -15.681 1.00 0.00 ? 1567 GLU A OE1  1  
ATOM   1319  O OE2  . GLU A 1 87  ? -15.825 -3.577  -15.285 1.00 0.00 ? 1567 GLU A OE2  1  
ATOM   1320  H H    . GLU A 1 87  ? -13.360 0.435   -19.152 1.00 0.00 ? 1567 GLU A H    1  
ATOM   1321  H HA   . GLU A 1 87  ? -13.202 -1.124  -16.665 1.00 0.00 ? 1567 GLU A HA   1  
ATOM   1322  H HB2  . GLU A 1 87  ? -15.575 -0.889  -17.217 1.00 0.00 ? 1567 GLU A HB2  1  
ATOM   1323  H HB3  . GLU A 1 87  ? -15.266 -1.334  -18.894 1.00 0.00 ? 1567 GLU A HB3  1  
ATOM   1324  H HG2  . GLU A 1 87  ? -16.216 -3.216  -17.760 1.00 0.00 ? 1567 GLU A HG2  1  
ATOM   1325  H HG3  . GLU A 1 87  ? -14.550 -3.583  -18.189 1.00 0.00 ? 1567 GLU A HG3  1  
ATOM   1326  N N    . LEU A 1 88  ? -12.018 -2.966  -17.969 1.00 0.00 ? 1568 LEU A N    1  
ATOM   1327  C CA   . LEU A 1 88  ? -10.916 -3.772  -18.465 1.00 0.00 ? 1568 LEU A CA   1  
ATOM   1328  C C    . LEU A 1 88  ? -11.476 -5.074  -19.030 1.00 0.00 ? 1568 LEU A C    1  
ATOM   1329  O O    . LEU A 1 88  ? -12.288 -5.753  -18.393 1.00 0.00 ? 1568 LEU A O    1  
ATOM   1330  C CB   . LEU A 1 88  ? -9.942  -3.946  -17.281 1.00 0.00 ? 1568 LEU A CB   1  
ATOM   1331  C CG   . LEU A 1 88  ? -8.539  -4.530  -17.531 1.00 0.00 ? 1568 LEU A CG   1  
ATOM   1332  C CD1  . LEU A 1 88  ? -8.543  -6.051  -17.556 1.00 0.00 ? 1568 LEU A CD1  1  
ATOM   1333  C CD2  . LEU A 1 88  ? -7.874  -3.985  -18.793 1.00 0.00 ? 1568 LEU A CD2  1  
ATOM   1334  H H    . LEU A 1 88  ? -12.463 -3.271  -17.103 1.00 0.00 ? 1568 LEU A H    1  
ATOM   1335  H HA   . LEU A 1 88  ? -10.418 -3.228  -19.268 1.00 0.00 ? 1568 LEU A HA   1  
ATOM   1336  H HB2  . LEU A 1 88  ? -9.782  -2.954  -16.851 1.00 0.00 ? 1568 LEU A HB2  1  
ATOM   1337  H HB3  . LEU A 1 88  ? -10.438 -4.547  -16.519 1.00 0.00 ? 1568 LEU A HB3  1  
ATOM   1338  H HG   . LEU A 1 88  ? -7.926  -4.229  -16.681 1.00 0.00 ? 1568 LEU A HG   1  
ATOM   1339  H HD11 . LEU A 1 88  ? -9.100  -6.427  -16.697 1.00 0.00 ? 1568 LEU A HD11 1  
ATOM   1340  H HD12 . LEU A 1 88  ? -8.997  -6.425  -18.477 1.00 0.00 ? 1568 LEU A HD12 1  
ATOM   1341  H HD13 . LEU A 1 88  ? -7.513  -6.417  -17.480 1.00 0.00 ? 1568 LEU A HD13 1  
ATOM   1342  H HD21 . LEU A 1 88  ? -8.352  -4.376  -19.692 1.00 0.00 ? 1568 LEU A HD21 1  
ATOM   1343  H HD22 . LEU A 1 88  ? -7.929  -2.901  -18.801 1.00 0.00 ? 1568 LEU A HD22 1  
ATOM   1344  H HD23 . LEU A 1 88  ? -6.818  -4.272  -18.791 1.00 0.00 ? 1568 LEU A HD23 1  
ATOM   1345  N N    . TYR A 1 89  ? -11.047 -5.394  -20.247 1.00 0.00 ? 1569 TYR A N    1  
ATOM   1346  C CA   . TYR A 1 89  ? -11.580 -6.456  -21.085 1.00 0.00 ? 1569 TYR A CA   1  
ATOM   1347  C C    . TYR A 1 89  ? -10.455 -7.375  -21.531 1.00 0.00 ? 1569 TYR A C    1  
ATOM   1348  O O    . TYR A 1 89  ? -9.297  -6.960  -21.619 1.00 0.00 ? 1569 TYR A O    1  
ATOM   1349  C CB   . TYR A 1 89  ? -12.235 -5.833  -22.325 1.00 0.00 ? 1569 TYR A CB   1  
ATOM   1350  C CG   . TYR A 1 89  ? -13.640 -5.349  -22.103 1.00 0.00 ? 1569 TYR A CG   1  
ATOM   1351  C CD1  . TYR A 1 89  ? -13.870 -4.084  -21.533 1.00 0.00 ? 1569 TYR A CD1  1  
ATOM   1352  C CD2  . TYR A 1 89  ? -14.720 -6.170  -22.467 1.00 0.00 ? 1569 TYR A CD2  1  
ATOM   1353  C CE1  . TYR A 1 89  ? -15.182 -3.644  -21.317 1.00 0.00 ? 1569 TYR A CE1  1  
ATOM   1354  C CE2  . TYR A 1 89  ? -16.036 -5.743  -22.242 1.00 0.00 ? 1569 TYR A CE2  1  
ATOM   1355  C CZ   . TYR A 1 89  ? -16.278 -4.476  -21.661 1.00 0.00 ? 1569 TYR A CZ   1  
ATOM   1356  O OH   . TYR A 1 89  ? -17.562 -4.070  -21.440 1.00 0.00 ? 1569 TYR A OH   1  
ATOM   1357  H H    . TYR A 1 89  ? -10.344 -4.811  -20.693 1.00 0.00 ? 1569 TYR A H    1  
ATOM   1358  H HA   . TYR A 1 89  ? -12.334 -7.027  -20.543 1.00 0.00 ? 1569 TYR A HA   1  
ATOM   1359  H HB2  . TYR A 1 89  ? -11.630 -4.997  -22.669 1.00 0.00 ? 1569 TYR A HB2  1  
ATOM   1360  H HB3  . TYR A 1 89  ? -12.251 -6.574  -23.125 1.00 0.00 ? 1569 TYR A HB3  1  
ATOM   1361  H HD1  . TYR A 1 89  ? -13.042 -3.447  -21.257 1.00 0.00 ? 1569 TYR A HD1  1  
ATOM   1362  H HD2  . TYR A 1 89  ? -14.545 -7.135  -22.923 1.00 0.00 ? 1569 TYR A HD2  1  
ATOM   1363  H HE1  . TYR A 1 89  ? -15.333 -2.667  -20.888 1.00 0.00 ? 1569 TYR A HE1  1  
ATOM   1364  H HE2  . TYR A 1 89  ? -16.851 -6.397  -22.514 1.00 0.00 ? 1569 TYR A HE2  1  
ATOM   1365  H HH   . TYR A 1 89  ? -17.632 -3.181  -21.053 1.00 0.00 ? 1569 TYR A HH   1  
ATOM   1366  N N    . TYR A 1 90  ? -10.825 -8.600  -21.901 1.00 0.00 ? 1570 TYR A N    1  
ATOM   1367  C CA   . TYR A 1 90  ? -9.927  -9.633  -22.386 1.00 0.00 ? 1570 TYR A CA   1  
ATOM   1368  C C    . TYR A 1 90  ? -10.577 -10.258 -23.603 1.00 0.00 ? 1570 TYR A C    1  
ATOM   1369  O O    . TYR A 1 90  ? -11.775 -10.542 -23.583 1.00 0.00 ? 1570 TYR A O    1  
ATOM   1370  C CB   . TYR A 1 90  ? -9.725  -10.719 -21.318 1.00 0.00 ? 1570 TYR A CB   1  
ATOM   1371  C CG   . TYR A 1 90  ? -9.226  -10.233 -19.981 1.00 0.00 ? 1570 TYR A CG   1  
ATOM   1372  C CD1  . TYR A 1 90  ? -10.119 -9.662  -19.048 1.00 0.00 ? 1570 TYR A CD1  1  
ATOM   1373  C CD2  . TYR A 1 90  ? -7.865  -10.352 -19.668 1.00 0.00 ? 1570 TYR A CD2  1  
ATOM   1374  C CE1  . TYR A 1 90  ? -9.635  -9.193  -17.814 1.00 0.00 ? 1570 TYR A CE1  1  
ATOM   1375  C CE2  . TYR A 1 90  ? -7.383  -9.881  -18.440 1.00 0.00 ? 1570 TYR A CE2  1  
ATOM   1376  C CZ   . TYR A 1 90  ? -8.263  -9.304  -17.507 1.00 0.00 ? 1570 TYR A CZ   1  
ATOM   1377  O OH   . TYR A 1 90  ? -7.767  -8.869  -16.315 1.00 0.00 ? 1570 TYR A OH   1  
ATOM   1378  H H    . TYR A 1 90  ? -11.812 -8.848  -21.860 1.00 0.00 ? 1570 TYR A H    1  
ATOM   1379  H HA   . TYR A 1 90  ? -8.963  -9.202  -22.650 1.00 0.00 ? 1570 TYR A HA   1  
ATOM   1380  H HB2  . TYR A 1 90  ? -10.661 -11.244 -21.150 1.00 0.00 ? 1570 TYR A HB2  1  
ATOM   1381  H HB3  . TYR A 1 90  ? -9.027  -11.458 -21.711 1.00 0.00 ? 1570 TYR A HB3  1  
ATOM   1382  H HD1  . TYR A 1 90  ? -11.175 -9.580  -19.274 1.00 0.00 ? 1570 TYR A HD1  1  
ATOM   1383  H HD2  . TYR A 1 90  ? -7.180  -10.805 -20.365 1.00 0.00 ? 1570 TYR A HD2  1  
ATOM   1384  H HE1  . TYR A 1 90  ? -10.313 -8.747  -17.108 1.00 0.00 ? 1570 TYR A HE1  1  
ATOM   1385  H HE2  . TYR A 1 90  ? -6.331  -9.971  -18.223 1.00 0.00 ? 1570 TYR A HE2  1  
ATOM   1386  H HH   . TYR A 1 90  ? -8.434  -8.491  -15.710 1.00 0.00 ? 1570 TYR A HH   1  
ATOM   1387  N N    . SER A 1 91  ? -9.808  -10.498 -24.653 1.00 0.00 ? 1571 SER A N    1  
ATOM   1388  C CA   . SER A 1 91  ? -10.259 -11.282 -25.781 1.00 0.00 ? 1571 SER A CA   1  
ATOM   1389  C C    . SER A 1 91  ? -9.943  -12.728 -25.416 1.00 0.00 ? 1571 SER A C    1  
ATOM   1390  O O    . SER A 1 91  ? -8.780  -13.136 -25.389 1.00 0.00 ? 1571 SER A O    1  
ATOM   1391  C CB   . SER A 1 91  ? -9.615  -10.771 -27.075 1.00 0.00 ? 1571 SER A CB   1  
ATOM   1392  O OG   . SER A 1 91  ? -8.333  -10.206 -26.861 1.00 0.00 ? 1571 SER A OG   1  
ATOM   1393  H H    . SER A 1 91  ? -8.826  -10.228 -24.660 1.00 0.00 ? 1571 SER A H    1  
ATOM   1394  H HA   . SER A 1 91  ? -11.336 -11.187 -25.892 1.00 0.00 ? 1571 SER A HA   1  
ATOM   1395  H HB2  . SER A 1 91  ? -9.534  -11.584 -27.785 1.00 0.00 ? 1571 SER A HB2  1  
ATOM   1396  H HB3  . SER A 1 91  ? -10.266 -10.013 -27.509 1.00 0.00 ? 1571 SER A HB3  1  
ATOM   1397  H HG   . SER A 1 91  ? -8.059  -9.732  -27.670 1.00 0.00 ? 1571 SER A HG   1  
ATOM   1398  N N    . ILE A 1 92  ? -10.972 -13.486 -25.033 1.00 0.00 ? 1572 ILE A N    1  
ATOM   1399  C CA   . ILE A 1 92  ? -10.841 -14.898 -24.725 1.00 0.00 ? 1572 ILE A CA   1  
ATOM   1400  C C    . ILE A 1 92  ? -10.969 -15.611 -26.061 1.00 0.00 ? 1572 ILE A C    1  
ATOM   1401  O O    . ILE A 1 92  ? -12.007 -15.533 -26.715 1.00 0.00 ? 1572 ILE A O    1  
ATOM   1402  C CB   . ILE A 1 92  ? -11.899 -15.342 -23.687 1.00 0.00 ? 1572 ILE A CB   1  
ATOM   1403  C CG1  . ILE A 1 92  ? -11.936 -14.435 -22.435 1.00 0.00 ? 1572 ILE A CG1  1  
ATOM   1404  C CG2  . ILE A 1 92  ? -11.663 -16.799 -23.247 1.00 0.00 ? 1572 ILE A CG2  1  
ATOM   1405  C CD1  . ILE A 1 92  ? -10.566 -14.222 -21.793 1.00 0.00 ? 1572 ILE A CD1  1  
ATOM   1406  H H    . ILE A 1 92  ? -11.921 -13.114 -25.111 1.00 0.00 ? 1572 ILE A H    1  
ATOM   1407  H HA   . ILE A 1 92  ? -9.850  -15.081 -24.309 1.00 0.00 ? 1572 ILE A HA   1  
ATOM   1408  H HB   . ILE A 1 92  ? -12.880 -15.302 -24.161 1.00 0.00 ? 1572 ILE A HB   1  
ATOM   1409  H HG12 . ILE A 1 92  ? -12.342 -13.455 -22.693 1.00 0.00 ? 1572 ILE A HG12 1  
ATOM   1410  H HG13 . ILE A 1 92  ? -12.603 -14.876 -21.689 1.00 0.00 ? 1572 ILE A HG13 1  
ATOM   1411  H HG21 . ILE A 1 92  ? -10.653 -16.919 -22.846 1.00 0.00 ? 1572 ILE A HG21 1  
ATOM   1412  H HG22 . ILE A 1 92  ? -12.392 -17.083 -22.483 1.00 0.00 ? 1572 ILE A HG22 1  
ATOM   1413  H HG23 . ILE A 1 92  ? -11.794 -17.465 -24.104 1.00 0.00 ? 1572 ILE A HG23 1  
ATOM   1414  H HD11 . ILE A 1 92  ? -9.930  -13.629 -22.449 1.00 0.00 ? 1572 ILE A HD11 1  
ATOM   1415  H HD12 . ILE A 1 92  ? -10.689 -13.691 -20.853 1.00 0.00 ? 1572 ILE A HD12 1  
ATOM   1416  H HD13 . ILE A 1 92  ? -10.081 -15.175 -21.598 1.00 0.00 ? 1572 ILE A HD13 1  
ATOM   1417  N N    . GLU A 1 93  ? -9.899  -16.248 -26.521 1.00 0.00 ? 1573 GLU A N    1  
ATOM   1418  C CA   . GLU A 1 93  ? -9.972  -17.142 -27.657 1.00 0.00 ? 1573 GLU A CA   1  
ATOM   1419  C C    . GLU A 1 93  ? -10.685 -18.409 -27.195 1.00 0.00 ? 1573 GLU A C    1  
ATOM   1420  O O    . GLU A 1 93  ? -10.350 -18.976 -26.150 1.00 0.00 ? 1573 GLU A O    1  
ATOM   1421  C CB   . GLU A 1 93  ? -8.570  -17.427 -28.209 1.00 0.00 ? 1573 GLU A CB   1  
ATOM   1422  C CG   . GLU A 1 93  ? -8.611  -18.299 -29.472 1.00 0.00 ? 1573 GLU A CG   1  
ATOM   1423  C CD   . GLU A 1 93  ? -7.214  -18.463 -30.094 1.00 0.00 ? 1573 GLU A CD   1  
ATOM   1424  O OE1  . GLU A 1 93  ? -6.304  -18.995 -29.414 1.00 0.00 ? 1573 GLU A OE1  1  
ATOM   1425  O OE2  . GLU A 1 93  ? -7.015  -18.061 -31.263 1.00 0.00 ? 1573 GLU A OE2  1  
ATOM   1426  H H    . GLU A 1 93  ? -9.084  -16.323 -25.919 1.00 0.00 ? 1573 GLU A H    1  
ATOM   1427  H HA   . GLU A 1 93  ? -10.555 -16.661 -28.435 1.00 0.00 ? 1573 GLU A HA   1  
ATOM   1428  H HB2  . GLU A 1 93  ? -8.102  -16.479 -28.476 1.00 0.00 ? 1573 GLU A HB2  1  
ATOM   1429  H HB3  . GLU A 1 93  ? -7.966  -17.910 -27.442 1.00 0.00 ? 1573 GLU A HB3  1  
ATOM   1430  H HG2  . GLU A 1 93  ? -9.016  -19.283 -29.228 1.00 0.00 ? 1573 GLU A HG2  1  
ATOM   1431  H HG3  . GLU A 1 93  ? -9.283  -17.827 -30.190 1.00 0.00 ? 1573 GLU A HG3  1  
ATOM   1432  N N    . LYS A 1 94  ? -11.663 -18.850 -27.984 1.00 0.00 ? 1574 LYS A N    1  
ATOM   1433  C CA   . LYS A 1 94  ? -12.320 -20.140 -27.837 1.00 0.00 ? 1574 LYS A CA   1  
ATOM   1434  C C    . LYS A 1 94  ? -12.633 -20.621 -29.247 1.00 0.00 ? 1574 LYS A C    1  
ATOM   1435  O O    . LYS A 1 94  ? -12.949 -19.792 -30.096 1.00 0.00 ? 1574 LYS A O    1  
ATOM   1436  C CB   . LYS A 1 94  ? -13.592 -19.971 -26.981 1.00 0.00 ? 1574 LYS A CB   1  
ATOM   1437  C CG   . LYS A 1 94  ? -13.949 -21.308 -26.316 1.00 0.00 ? 1574 LYS A CG   1  
ATOM   1438  C CD   . LYS A 1 94  ? -15.360 -21.392 -25.728 1.00 0.00 ? 1574 LYS A CD   1  
ATOM   1439  C CE   . LYS A 1 94  ? -16.439 -21.294 -26.827 1.00 0.00 ? 1574 LYS A CE   1  
ATOM   1440  N NZ   . LYS A 1 94  ? -17.766 -21.831 -26.416 1.00 0.00 ? 1574 LYS A NZ   1  
ATOM   1441  H H    . LYS A 1 94  ? -11.910 -18.312 -28.816 1.00 0.00 ? 1574 LYS A H    1  
ATOM   1442  H HA   . LYS A 1 94  ? -11.623 -20.831 -27.349 1.00 0.00 ? 1574 LYS A HA   1  
ATOM   1443  H HB2  . LYS A 1 94  ? -13.410 -19.237 -26.190 1.00 0.00 ? 1574 LYS A HB2  1  
ATOM   1444  H HB3  . LYS A 1 94  ? -14.408 -19.599 -27.602 1.00 0.00 ? 1574 LYS A HB3  1  
ATOM   1445  H HG2  . LYS A 1 94  ? -13.831 -22.120 -27.029 1.00 0.00 ? 1574 LYS A HG2  1  
ATOM   1446  H HG3  . LYS A 1 94  ? -13.226 -21.460 -25.516 1.00 0.00 ? 1574 LYS A HG3  1  
ATOM   1447  H HD2  . LYS A 1 94  ? -15.437 -22.356 -25.213 1.00 0.00 ? 1574 LYS A HD2  1  
ATOM   1448  H HD3  . LYS A 1 94  ? -15.491 -20.591 -24.992 1.00 0.00 ? 1574 LYS A HD3  1  
ATOM   1449  H HE2  . LYS A 1 94  ? -16.544 -20.246 -27.123 1.00 0.00 ? 1574 LYS A HE2  1  
ATOM   1450  H HE3  . LYS A 1 94  ? -16.094 -21.855 -27.700 1.00 0.00 ? 1574 LYS A HE3  1  
ATOM   1451  H HZ1  . LYS A 1 94  ? -18.434 -21.730 -27.176 1.00 0.00 ? 1574 LYS A HZ1  1  
ATOM   1452  H HZ2  . LYS A 1 94  ? -17.718 -22.822 -26.208 1.00 0.00 ? 1574 LYS A HZ2  1  
ATOM   1453  H HZ3  . LYS A 1 94  ? -18.151 -21.354 -25.603 1.00 0.00 ? 1574 LYS A HZ3  1  
ATOM   1454  N N    . GLU A 1 95  ? -12.545 -21.921 -29.510 1.00 0.00 ? 1575 GLU A N    1  
ATOM   1455  C CA   . GLU A 1 95  ? -12.777 -22.513 -30.835 1.00 0.00 ? 1575 GLU A CA   1  
ATOM   1456  C C    . GLU A 1 95  ? -11.957 -21.813 -31.937 1.00 0.00 ? 1575 GLU A C    1  
ATOM   1457  O O    . GLU A 1 95  ? -12.393 -21.702 -33.086 1.00 0.00 ? 1575 GLU A O    1  
ATOM   1458  C CB   . GLU A 1 95  ? -14.291 -22.591 -31.124 1.00 0.00 ? 1575 GLU A CB   1  
ATOM   1459  C CG   . GLU A 1 95  ? -15.032 -23.504 -30.136 1.00 0.00 ? 1575 GLU A CG   1  
ATOM   1460  C CD   . GLU A 1 95  ? -16.542 -23.562 -30.432 1.00 0.00 ? 1575 GLU A CD   1  
ATOM   1461  O OE1  . GLU A 1 95  ? -16.952 -24.274 -31.383 1.00 0.00 ? 1575 GLU A OE1  1  
ATOM   1462  O OE2  . GLU A 1 95  ? -17.327 -22.897 -29.710 1.00 0.00 ? 1575 GLU A OE2  1  
ATOM   1463  H H    . GLU A 1 95  ? -12.276 -22.558 -28.769 1.00 0.00 ? 1575 GLU A H    1  
ATOM   1464  H HA   . GLU A 1 95  ? -12.395 -23.530 -30.793 1.00 0.00 ? 1575 GLU A HA   1  
ATOM   1465  H HB2  . GLU A 1 95  ? -14.726 -21.590 -31.082 1.00 0.00 ? 1575 GLU A HB2  1  
ATOM   1466  H HB3  . GLU A 1 95  ? -14.449 -22.994 -32.123 1.00 0.00 ? 1575 GLU A HB3  1  
ATOM   1467  H HG2  . GLU A 1 95  ? -14.611 -24.511 -30.199 1.00 0.00 ? 1575 GLU A HG2  1  
ATOM   1468  H HG3  . GLU A 1 95  ? -14.881 -23.143 -29.120 1.00 0.00 ? 1575 GLU A HG3  1  
ATOM   1469  N N    . GLY A 1 96  ? -10.753 -21.335 -31.592 1.00 0.00 ? 1576 GLY A N    1  
ATOM   1470  C CA   . GLY A 1 96  ? -9.830  -20.730 -32.547 1.00 0.00 ? 1576 GLY A CA   1  
ATOM   1471  C C    . GLY A 1 96  ? -10.276 -19.353 -33.050 1.00 0.00 ? 1576 GLY A C    1  
ATOM   1472  O O    . GLY A 1 96  ? -9.805  -18.920 -34.106 1.00 0.00 ? 1576 GLY A O    1  
ATOM   1473  H H    . GLY A 1 96  ? -10.429 -21.457 -30.639 1.00 0.00 ? 1576 GLY A H    1  
ATOM   1474  H HA2  . GLY A 1 96  ? -8.856  -20.619 -32.068 1.00 0.00 ? 1576 GLY A HA2  1  
ATOM   1475  H HA3  . GLY A 1 96  ? -9.712  -21.399 -33.400 1.00 0.00 ? 1576 GLY A HA3  1  
ATOM   1476  N N    . GLN A 1 97  ? -11.166 -18.665 -32.326 1.00 0.00 ? 1577 GLN A N    1  
ATOM   1477  C CA   . GLN A 1 97  ? -11.592 -17.299 -32.641 1.00 0.00 ? 1577 GLN A CA   1  
ATOM   1478  C C    . GLN A 1 97  ? -11.696 -16.488 -31.351 1.00 0.00 ? 1577 GLN A C    1  
ATOM   1479  O O    . GLN A 1 97  ? -11.935 -17.048 -30.281 1.00 0.00 ? 1577 GLN A O    1  
ATOM   1480  C CB   . GLN A 1 97  ? -12.883 -17.308 -33.486 1.00 0.00 ? 1577 GLN A CB   1  
ATOM   1481  C CG   . GLN A 1 97  ? -14.082 -18.091 -32.923 1.00 0.00 ? 1577 GLN A CG   1  
ATOM   1482  C CD   . GLN A 1 97  ? -14.906 -17.314 -31.893 1.00 0.00 ? 1577 GLN A CD   1  
ATOM   1483  O OE1  . GLN A 1 97  ? -15.609 -16.359 -32.224 1.00 0.00 ? 1577 GLN A OE1  1  
ATOM   1484  N NE2  . GLN A 1 97  ? -14.846 -17.703 -30.629 1.00 0.00 ? 1577 GLN A NE2  1  
ATOM   1485  H H    . GLN A 1 97  ? -11.535 -19.085 -31.477 1.00 0.00 ? 1577 GLN A H    1  
ATOM   1486  H HA   . GLN A 1 97  ? -10.817 -16.827 -33.245 1.00 0.00 ? 1577 GLN A HA   1  
ATOM   1487  H HB2  . GLN A 1 97  ? -13.192 -16.281 -33.685 1.00 0.00 ? 1577 GLN A HB2  1  
ATOM   1488  H HB3  . GLN A 1 97  ? -12.636 -17.753 -34.452 1.00 0.00 ? 1577 GLN A HB3  1  
ATOM   1489  H HG2  . GLN A 1 97  ? -14.747 -18.326 -33.758 1.00 0.00 ? 1577 GLN A HG2  1  
ATOM   1490  H HG3  . GLN A 1 97  ? -13.749 -19.040 -32.508 1.00 0.00 ? 1577 GLN A HG3  1  
ATOM   1491  H HE21 . GLN A 1 97  ? -14.196 -18.447 -30.371 1.00 0.00 ? 1577 GLN A HE21 1  
ATOM   1492  H HE22 . GLN A 1 97  ? -15.371 -17.218 -29.919 1.00 0.00 ? 1577 GLN A HE22 1  
ATOM   1493  N N    . ARG A 1 98  ? -11.456 -15.175 -31.418 1.00 0.00 ? 1578 ARG A N    1  
ATOM   1494  C CA   . ARG A 1 98  ? -11.456 -14.302 -30.234 1.00 0.00 ? 1578 ARG A CA   1  
ATOM   1495  C C    . ARG A 1 98  ? -12.887 -13.873 -29.918 1.00 0.00 ? 1578 ARG A C    1  
ATOM   1496  O O    . ARG A 1 98  ? -13.642 -13.522 -30.827 1.00 0.00 ? 1578 ARG A O    1  
ATOM   1497  C CB   . ARG A 1 98  ? -10.556 -13.074 -30.475 1.00 0.00 ? 1578 ARG A CB   1  
ATOM   1498  C CG   . ARG A 1 98  ? -9.065  -13.456 -30.555 1.00 0.00 ? 1578 ARG A CG   1  
ATOM   1499  C CD   . ARG A 1 98  ? -8.147  -12.240 -30.759 1.00 0.00 ? 1578 ARG A CD   1  
ATOM   1500  N NE   . ARG A 1 98  ? -8.325  -11.621 -32.089 1.00 0.00 ? 1578 ARG A NE   1  
ATOM   1501  C CZ   . ARG A 1 98  ? -7.705  -10.518 -32.532 1.00 0.00 ? 1578 ARG A CZ   1  
ATOM   1502  N NH1  . ARG A 1 98  ? -6.818  -9.882  -31.769 1.00 0.00 ? 1578 ARG A NH1  1  
ATOM   1503  N NH2  . ARG A 1 98  ? -7.976  -10.055 -33.751 1.00 0.00 ? 1578 ARG A NH2  1  
ATOM   1504  H H    . ARG A 1 98  ? -11.334 -14.739 -32.325 1.00 0.00 ? 1578 ARG A H    1  
ATOM   1505  H HA   . ARG A 1 98  ? -11.072 -14.852 -29.377 1.00 0.00 ? 1578 ARG A HA   1  
ATOM   1506  H HB2  . ARG A 1 98  ? -10.865 -12.572 -31.393 1.00 0.00 ? 1578 ARG A HB2  1  
ATOM   1507  H HB3  . ARG A 1 98  ? -10.694 -12.373 -29.649 1.00 0.00 ? 1578 ARG A HB3  1  
ATOM   1508  H HG2  . ARG A 1 98  ? -8.781  -13.941 -29.618 1.00 0.00 ? 1578 ARG A HG2  1  
ATOM   1509  H HG3  . ARG A 1 98  ? -8.905  -14.166 -31.367 1.00 0.00 ? 1578 ARG A HG3  1  
ATOM   1510  H HD2  . ARG A 1 98  ? -8.358  -11.503 -29.982 1.00 0.00 ? 1578 ARG A HD2  1  
ATOM   1511  H HD3  . ARG A 1 98  ? -7.112  -12.575 -30.660 1.00 0.00 ? 1578 ARG A HD3  1  
ATOM   1512  H HE   . ARG A 1 98  ? -8.978  -12.089 -32.710 1.00 0.00 ? 1578 ARG A HE   1  
ATOM   1513  H HH11 . ARG A 1 98  ? -6.585  -10.222 -30.842 1.00 0.00 ? 1578 ARG A HH11 1  
ATOM   1514  H HH12 . ARG A 1 98  ? -6.340  -9.047  -32.084 1.00 0.00 ? 1578 ARG A HH12 1  
ATOM   1515  H HH21 . ARG A 1 98  ? -8.654  -10.511 -34.351 1.00 0.00 ? 1578 ARG A HH21 1  
ATOM   1516  H HH22 . ARG A 1 98  ? -7.531  -9.223  -34.120 1.00 0.00 ? 1578 ARG A HH22 1  
ATOM   1517  N N    . LYS A 1 99  ? -13.222 -13.828 -28.626 1.00 0.00 ? 1579 LYS A N    1  
ATOM   1518  C CA   . LYS A 1 99  ? -14.505 -13.345 -28.111 1.00 0.00 ? 1579 LYS A CA   1  
ATOM   1519  C C    . LYS A 1 99  ? -14.183 -12.377 -26.979 1.00 0.00 ? 1579 LYS A C    1  
ATOM   1520  O O    . LYS A 1 99  ? -13.429 -12.730 -26.074 1.00 0.00 ? 1579 LYS A O    1  
ATOM   1521  C CB   . LYS A 1 99  ? -15.309 -14.567 -27.619 1.00 0.00 ? 1579 LYS A CB   1  
ATOM   1522  C CG   . LYS A 1 99  ? -16.837 -14.416 -27.621 1.00 0.00 ? 1579 LYS A CG   1  
ATOM   1523  C CD   . LYS A 1 99  ? -17.404 -13.191 -26.884 1.00 0.00 ? 1579 LYS A CD   1  
ATOM   1524  C CE   . LYS A 1 99  ? -18.923 -13.289 -26.650 1.00 0.00 ? 1579 LYS A CE   1  
ATOM   1525  N NZ   . LYS A 1 99  ? -19.724 -13.200 -27.905 1.00 0.00 ? 1579 LYS A NZ   1  
ATOM   1526  H H    . LYS A 1 99  ? -12.593 -14.247 -27.939 1.00 0.00 ? 1579 LYS A H    1  
ATOM   1527  H HA   . LYS A 1 99  ? -15.054 -12.837 -28.907 1.00 0.00 ? 1579 LYS A HA   1  
ATOM   1528  H HB2  . LYS A 1 99  ? -15.080 -15.418 -28.266 1.00 0.00 ? 1579 LYS A HB2  1  
ATOM   1529  H HB3  . LYS A 1 99  ? -14.964 -14.840 -26.621 1.00 0.00 ? 1579 LYS A HB3  1  
ATOM   1530  H HG2  . LYS A 1 99  ? -17.169 -14.391 -28.660 1.00 0.00 ? 1579 LYS A HG2  1  
ATOM   1531  H HG3  . LYS A 1 99  ? -17.241 -15.316 -27.155 1.00 0.00 ? 1579 LYS A HG3  1  
ATOM   1532  H HD2  . LYS A 1 99  ? -16.914 -13.108 -25.914 1.00 0.00 ? 1579 LYS A HD2  1  
ATOM   1533  H HD3  . LYS A 1 99  ? -17.191 -12.286 -27.452 1.00 0.00 ? 1579 LYS A HD3  1  
ATOM   1534  H HE2  . LYS A 1 99  ? -19.140 -14.227 -26.132 1.00 0.00 ? 1579 LYS A HE2  1  
ATOM   1535  H HE3  . LYS A 1 99  ? -19.217 -12.479 -25.979 1.00 0.00 ? 1579 LYS A HE3  1  
ATOM   1536  H HZ1  . LYS A 1 99  ? -19.552 -12.335 -28.401 1.00 0.00 ? 1579 LYS A HZ1  1  
ATOM   1537  H HZ2  . LYS A 1 99  ? -19.531 -13.970 -28.538 1.00 0.00 ? 1579 LYS A HZ2  1  
ATOM   1538  H HZ3  . LYS A 1 99  ? -20.718 -13.228 -27.697 1.00 0.00 ? 1579 LYS A HZ3  1  
ATOM   1539  N N    . TRP A 1 100 ? -14.719 -11.163 -27.007 1.00 0.00 ? 1580 TRP A N    1  
ATOM   1540  C CA   . TRP A 1 100 ? -14.441 -10.181 -25.962 1.00 0.00 ? 1580 TRP A CA   1  
ATOM   1541  C C    . TRP A 1 100 ? -15.295 -10.473 -24.733 1.00 0.00 ? 1580 TRP A C    1  
ATOM   1542  O O    . TRP A 1 100 ? -16.510 -10.636 -24.856 1.00 0.00 ? 1580 TRP A O    1  
ATOM   1543  C CB   . TRP A 1 100 ? -14.742 -8.775  -26.496 1.00 0.00 ? 1580 TRP A CB   1  
ATOM   1544  C CG   . TRP A 1 100 ? -13.715 -8.287  -27.465 1.00 0.00 ? 1580 TRP A CG   1  
ATOM   1545  C CD1  . TRP A 1 100 ? -13.873 -8.114  -28.794 1.00 0.00 ? 1580 TRP A CD1  1  
ATOM   1546  C CD2  . TRP A 1 100 ? -12.342 -7.910  -27.174 1.00 0.00 ? 1580 TRP A CD2  1  
ATOM   1547  N NE1  . TRP A 1 100 ? -12.683 -7.676  -29.347 1.00 0.00 ? 1580 TRP A NE1  1  
ATOM   1548  C CE2  . TRP A 1 100 ? -11.694 -7.558  -28.392 1.00 0.00 ? 1580 TRP A CE2  1  
ATOM   1549  C CE3  . TRP A 1 100 ? -11.580 -7.866  -25.988 1.00 0.00 ? 1580 TRP A CE3  1  
ATOM   1550  C CZ2  . TRP A 1 100 ? -10.340 -7.202  -28.437 1.00 0.00 ? 1580 TRP A CZ2  1  
ATOM   1551  C CZ3  . TRP A 1 100 ? -10.216 -7.530  -26.023 1.00 0.00 ? 1580 TRP A CZ3  1  
ATOM   1552  C CH2  . TRP A 1 100 ? -9.597  -7.195  -27.245 1.00 0.00 ? 1580 TRP A CH2  1  
ATOM   1553  H H    . TRP A 1 100 ? -15.337 -10.894 -27.759 1.00 0.00 ? 1580 TRP A H    1  
ATOM   1554  H HA   . TRP A 1 100 ? -13.380 -10.237 -25.694 1.00 0.00 ? 1580 TRP A HA   1  
ATOM   1555  H HB2  . TRP A 1 100 ? -15.730 -8.760  -26.959 1.00 0.00 ? 1580 TRP A HB2  1  
ATOM   1556  H HB3  . TRP A 1 100 ? -14.756 -8.077  -25.656 1.00 0.00 ? 1580 TRP A HB3  1  
ATOM   1557  H HD1  . TRP A 1 100 ? -14.790 -8.293  -29.344 1.00 0.00 ? 1580 TRP A HD1  1  
ATOM   1558  H HE1  . TRP A 1 100 ? -12.577 -7.475  -30.338 1.00 0.00 ? 1580 TRP A HE1  1  
ATOM   1559  H HE3  . TRP A 1 100 ? -12.062 -8.098  -25.050 1.00 0.00 ? 1580 TRP A HE3  1  
ATOM   1560  H HZ2  . TRP A 1 100 ? -9.869  -6.938  -29.375 1.00 0.00 ? 1580 TRP A HZ2  1  
ATOM   1561  H HZ3  . TRP A 1 100 ? -9.639  -7.526  -25.112 1.00 0.00 ? 1580 TRP A HZ3  1  
ATOM   1562  H HH2  . TRP A 1 100 ? -8.547  -6.934  -27.265 1.00 0.00 ? 1580 TRP A HH2  1  
ATOM   1563  N N    . TYR A 1 101 ? -14.668 -10.477 -23.555 1.00 0.00 ? 1581 TYR A N    1  
ATOM   1564  C CA   . TYR A 1 101 ? -15.333 -10.580 -22.258 1.00 0.00 ? 1581 TYR A CA   1  
ATOM   1565  C C    . TYR A 1 101 ? -14.725 -9.558  -21.297 1.00 0.00 ? 1581 TYR A C    1  
ATOM   1566  O O    . TYR A 1 101 ? -13.603 -9.092  -21.495 1.00 0.00 ? 1581 TYR A O    1  
ATOM   1567  C CB   . TYR A 1 101 ? -15.191 -12.010 -21.717 1.00 0.00 ? 1581 TYR A CB   1  
ATOM   1568  C CG   . TYR A 1 101 ? -16.067 -13.027 -22.417 1.00 0.00 ? 1581 TYR A CG   1  
ATOM   1569  C CD1  . TYR A 1 101 ? -17.443 -13.060 -22.140 1.00 0.00 ? 1581 TYR A CD1  1  
ATOM   1570  C CD2  . TYR A 1 101 ? -15.518 -13.937 -23.339 1.00 0.00 ? 1581 TYR A CD2  1  
ATOM   1571  C CE1  . TYR A 1 101 ? -18.260 -14.006 -22.775 1.00 0.00 ? 1581 TYR A CE1  1  
ATOM   1572  C CE2  . TYR A 1 101 ? -16.332 -14.908 -23.951 1.00 0.00 ? 1581 TYR A CE2  1  
ATOM   1573  C CZ   . TYR A 1 101 ? -17.718 -14.947 -23.675 1.00 0.00 ? 1581 TYR A CZ   1  
ATOM   1574  O OH   . TYR A 1 101 ? -18.519 -15.878 -24.269 1.00 0.00 ? 1581 TYR A OH   1  
ATOM   1575  H H    . TYR A 1 101 ? -13.649 -10.396 -23.537 1.00 0.00 ? 1581 TYR A H    1  
ATOM   1576  H HA   . TYR A 1 101 ? -16.401 -10.370 -22.369 1.00 0.00 ? 1581 TYR A HA   1  
ATOM   1577  H HB2  . TYR A 1 101 ? -14.148 -12.316 -21.785 1.00 0.00 ? 1581 TYR A HB2  1  
ATOM   1578  H HB3  . TYR A 1 101 ? -15.469 -12.021 -20.663 1.00 0.00 ? 1581 TYR A HB3  1  
ATOM   1579  H HD1  . TYR A 1 101 ? -17.881 -12.362 -21.438 1.00 0.00 ? 1581 TYR A HD1  1  
ATOM   1580  H HD2  . TYR A 1 101 ? -14.471 -13.894 -23.576 1.00 0.00 ? 1581 TYR A HD2  1  
ATOM   1581  H HE1  . TYR A 1 101 ? -19.312 -14.000 -22.561 1.00 0.00 ? 1581 TYR A HE1  1  
ATOM   1582  H HE2  . TYR A 1 101 ? -15.892 -15.624 -24.632 1.00 0.00 ? 1581 TYR A HE2  1  
ATOM   1583  H HH   . TYR A 1 101 ? -19.454 -15.819 -23.997 1.00 0.00 ? 1581 TYR A HH   1  
ATOM   1584  N N    . LYS A 1 102 ? -15.464 -9.201  -20.247 1.00 0.00 ? 1582 LYS A N    1  
ATOM   1585  C CA   . LYS A 1 102 ? -15.075 -8.172  -19.259 1.00 0.00 ? 1582 LYS A CA   1  
ATOM   1586  C C    . LYS A 1 102 ? -14.520 -8.837  -18.011 1.00 0.00 ? 1582 LYS A C    1  
ATOM   1587  O O    . LYS A 1 102 ? -14.875 -9.984  -17.769 1.00 0.00 ? 1582 LYS A O    1  
ATOM   1588  C CB   . LYS A 1 102 ? -16.276 -7.249  -18.954 1.00 0.00 ? 1582 LYS A CB   1  
ATOM   1589  C CG   . LYS A 1 102 ? -17.552 -7.939  -18.429 1.00 0.00 ? 1582 LYS A CG   1  
ATOM   1590  C CD   . LYS A 1 102 ? -18.709 -6.924  -18.318 1.00 0.00 ? 1582 LYS A CD   1  
ATOM   1591  C CE   . LYS A 1 102 ? -20.059 -7.594  -17.984 1.00 0.00 ? 1582 LYS A CE   1  
ATOM   1592  N NZ   . LYS A 1 102 ? -21.208 -6.674  -18.197 1.00 0.00 ? 1582 LYS A NZ   1  
ATOM   1593  H H    . LYS A 1 102 ? -16.331 -9.705  -20.108 1.00 0.00 ? 1582 LYS A H    1  
ATOM   1594  H HA   . LYS A 1 102 ? -14.289 -7.549  -19.690 1.00 0.00 ? 1582 LYS A HA   1  
ATOM   1595  H HB2  . LYS A 1 102 ? -15.963 -6.491  -18.233 1.00 0.00 ? 1582 LYS A HB2  1  
ATOM   1596  H HB3  . LYS A 1 102 ? -16.527 -6.730  -19.875 1.00 0.00 ? 1582 LYS A HB3  1  
ATOM   1597  H HG2  . LYS A 1 102 ? -17.853 -8.721  -19.129 1.00 0.00 ? 1582 LYS A HG2  1  
ATOM   1598  H HG3  . LYS A 1 102 ? -17.357 -8.390  -17.454 1.00 0.00 ? 1582 LYS A HG3  1  
ATOM   1599  H HD2  . LYS A 1 102 ? -18.463 -6.178  -17.555 1.00 0.00 ? 1582 LYS A HD2  1  
ATOM   1600  H HD3  . LYS A 1 102 ? -18.801 -6.423  -19.282 1.00 0.00 ? 1582 LYS A HD3  1  
ATOM   1601  H HE2  . LYS A 1 102 ? -20.182 -8.469  -18.628 1.00 0.00 ? 1582 LYS A HE2  1  
ATOM   1602  H HE3  . LYS A 1 102 ? -20.067 -7.940  -16.941 1.00 0.00 ? 1582 LYS A HE3  1  
ATOM   1603  H HZ1  . LYS A 1 102 ? -22.096 -7.179  -18.100 1.00 0.00 ? 1582 LYS A HZ1  1  
ATOM   1604  H HZ2  . LYS A 1 102 ? -21.211 -5.907  -17.534 1.00 0.00 ? 1582 LYS A HZ2  1  
ATOM   1605  H HZ3  . LYS A 1 102 ? -21.210 -6.283  -19.133 1.00 0.00 ? 1582 LYS A HZ3  1  
ATOM   1606  N N    . ARG A 1 103 ? -13.718 -8.150  -17.184 1.00 0.00 ? 1583 ARG A N    1  
ATOM   1607  C CA   . ARG A 1 103 ? -13.100 -8.763  -15.991 1.00 0.00 ? 1583 ARG A CA   1  
ATOM   1608  C C    . ARG A 1 103 ? -14.062 -9.641  -15.185 1.00 0.00 ? 1583 ARG A C    1  
ATOM   1609  O O    . ARG A 1 103 ? -13.761 -10.813 -14.991 1.00 0.00 ? 1583 ARG A O    1  
ATOM   1610  C CB   . ARG A 1 103 ? -12.364 -7.737  -15.091 1.00 0.00 ? 1583 ARG A CB   1  
ATOM   1611  C CG   . ARG A 1 103 ? -13.109 -6.420  -14.811 1.00 0.00 ? 1583 ARG A CG   1  
ATOM   1612  C CD   . ARG A 1 103 ? -12.660 -5.706  -13.524 1.00 0.00 ? 1583 ARG A CD   1  
ATOM   1613  N NE   . ARG A 1 103 ? -11.218 -5.370  -13.503 1.00 0.00 ? 1583 ARG A NE   1  
ATOM   1614  C CZ   . ARG A 1 103 ? -10.673 -4.164  -13.719 1.00 0.00 ? 1583 ARG A CZ   1  
ATOM   1615  N NH1  . ARG A 1 103 ? -11.404 -3.151  -14.167 1.00 0.00 ? 1583 ARG A NH1  1  
ATOM   1616  N NH2  . ARG A 1 103 ? -9.381  -3.979  -13.480 1.00 0.00 ? 1583 ARG A NH2  1  
ATOM   1617  H H    . ARG A 1 103 ? -13.399 -7.222  -17.470 1.00 0.00 ? 1583 ARG A H    1  
ATOM   1618  H HA   . ARG A 1 103 ? -12.346 -9.462  -16.359 1.00 0.00 ? 1583 ARG A HA   1  
ATOM   1619  H HB2  . ARG A 1 103 ? -12.132 -8.227  -14.142 1.00 0.00 ? 1583 ARG A HB2  1  
ATOM   1620  H HB3  . ARG A 1 103 ? -11.414 -7.478  -15.561 1.00 0.00 ? 1583 ARG A HB3  1  
ATOM   1621  H HG2  . ARG A 1 103 ? -12.949 -5.763  -15.661 1.00 0.00 ? 1583 ARG A HG2  1  
ATOM   1622  H HG3  . ARG A 1 103 ? -14.179 -6.612  -14.722 1.00 0.00 ? 1583 ARG A HG3  1  
ATOM   1623  H HD2  . ARG A 1 103 ? -13.257 -4.804  -13.387 1.00 0.00 ? 1583 ARG A HD2  1  
ATOM   1624  H HD3  . ARG A 1 103 ? -12.867 -6.344  -12.665 1.00 0.00 ? 1583 ARG A HD3  1  
ATOM   1625  H HE   . ARG A 1 103 ? -10.595 -6.150  -13.293 1.00 0.00 ? 1583 ARG A HE   1  
ATOM   1626  H HH11 . ARG A 1 103 ? -12.360 -3.299  -14.534 1.00 0.00 ? 1583 ARG A HH11 1  
ATOM   1627  H HH12 . ARG A 1 103 ? -11.027 -2.217  -14.284 1.00 0.00 ? 1583 ARG A HH12 1  
ATOM   1628  H HH21 . ARG A 1 103 ? -8.795  -4.722  -13.108 1.00 0.00 ? 1583 ARG A HH21 1  
ATOM   1629  H HH22 . ARG A 1 103 ? -8.924  -3.083  -13.617 1.00 0.00 ? 1583 ARG A HH22 1  
ATOM   1630  N N    . MET A 1 104 ? -15.249 -9.142  -14.815 1.00 0.00 ? 1584 MET A N    1  
ATOM   1631  C CA   . MET A 1 104 ? -16.171 -9.925  -13.977 1.00 0.00 ? 1584 MET A CA   1  
ATOM   1632  C C    . MET A 1 104 ? -16.705 -11.189 -14.673 1.00 0.00 ? 1584 MET A C    1  
ATOM   1633  O O    . MET A 1 104 ? -17.172 -12.102 -13.996 1.00 0.00 ? 1584 MET A O    1  
ATOM   1634  C CB   . MET A 1 104 ? -17.303 -9.040  -13.416 1.00 0.00 ? 1584 MET A CB   1  
ATOM   1635  C CG   . MET A 1 104 ? -18.291 -8.452  -14.438 1.00 0.00 ? 1584 MET A CG   1  
ATOM   1636  S SD   . MET A 1 104 ? -19.347 -9.642  -15.320 1.00 0.00 ? 1584 MET A SD   1  
ATOM   1637  C CE   . MET A 1 104 ? -20.612 -10.013 -14.079 1.00 0.00 ? 1584 MET A CE   1  
ATOM   1638  H H    . MET A 1 104 ? -15.461 -8.175  -15.015 1.00 0.00 ? 1584 MET A H    1  
ATOM   1639  H HA   . MET A 1 104 ? -15.595 -10.271 -13.116 1.00 0.00 ? 1584 MET A HA   1  
ATOM   1640  H HB2  . MET A 1 104 ? -17.860 -9.616  -12.678 1.00 0.00 ? 1584 MET A HB2  1  
ATOM   1641  H HB3  . MET A 1 104 ? -16.835 -8.206  -12.893 1.00 0.00 ? 1584 MET A HB3  1  
ATOM   1642  H HG2  . MET A 1 104 ? -18.940 -7.745  -13.917 1.00 0.00 ? 1584 MET A HG2  1  
ATOM   1643  H HG3  . MET A 1 104 ? -17.726 -7.886  -15.176 1.00 0.00 ? 1584 MET A HG3  1  
ATOM   1644  H HE1  . MET A 1 104 ? -21.206 -10.864 -14.418 1.00 0.00 ? 1584 MET A HE1  1  
ATOM   1645  H HE2  . MET A 1 104 ? -20.148 -10.247 -13.119 1.00 0.00 ? 1584 MET A HE2  1  
ATOM   1646  H HE3  . MET A 1 104 ? -21.260 -9.139  -13.976 1.00 0.00 ? 1584 MET A HE3  1  
ATOM   1647  N N    . ALA A 1 105 ? -16.657 -11.240 -16.010 1.00 0.00 ? 1585 ALA A N    1  
ATOM   1648  C CA   . ALA A 1 105 ? -17.091 -12.359 -16.826 1.00 0.00 ? 1585 ALA A CA   1  
ATOM   1649  C C    . ALA A 1 105 ? -15.931 -13.306 -17.114 1.00 0.00 ? 1585 ALA A C    1  
ATOM   1650  O O    . ALA A 1 105 ? -16.192 -14.446 -17.490 1.00 0.00 ? 1585 ALA A O    1  
ATOM   1651  C CB   . ALA A 1 105 ? -17.627 -11.823 -18.161 1.00 0.00 ? 1585 ALA A CB   1  
ATOM   1652  H H    . ALA A 1 105 ? -16.197 -10.491 -16.509 1.00 0.00 ? 1585 ALA A H    1  
ATOM   1653  H HA   . ALA A 1 105 ? -17.886 -12.913 -16.319 1.00 0.00 ? 1585 ALA A HA   1  
ATOM   1654  H HB1  . ALA A 1 105 ? -18.556 -11.277 -18.000 1.00 0.00 ? 1585 ALA A HB1  1  
ATOM   1655  H HB2  . ALA A 1 105 ? -16.896 -11.179 -18.644 1.00 0.00 ? 1585 ALA A HB2  1  
ATOM   1656  H HB3  . ALA A 1 105 ? -17.816 -12.664 -18.826 1.00 0.00 ? 1585 ALA A HB3  1  
ATOM   1657  N N    . VAL A 1 106 ? -14.681 -12.866 -16.971 1.00 0.00 ? 1586 VAL A N    1  
ATOM   1658  C CA   . VAL A 1 106 ? -13.501 -13.680 -17.178 1.00 0.00 ? 1586 VAL A CA   1  
ATOM   1659  C C    . VAL A 1 106 ? -13.134 -14.185 -15.792 1.00 0.00 ? 1586 VAL A C    1  
ATOM   1660  O O    . VAL A 1 106 ? -12.399 -13.549 -15.032 1.00 0.00 ? 1586 VAL A O    1  
ATOM   1661  C CB   . VAL A 1 106 ? -12.399 -12.849 -17.852 1.00 0.00 ? 1586 VAL A CB   1  
ATOM   1662  C CG1  . VAL A 1 106 ? -11.139 -13.695 -18.063 1.00 0.00 ? 1586 VAL A CG1  1  
ATOM   1663  C CG2  . VAL A 1 106 ? -12.883 -12.375 -19.225 1.00 0.00 ? 1586 VAL A CG2  1  
ATOM   1664  H H    . VAL A 1 106 ? -14.514 -11.941 -16.596 1.00 0.00 ? 1586 VAL A H    1  
ATOM   1665  H HA   . VAL A 1 106 ? -13.746 -14.527 -17.822 1.00 0.00 ? 1586 VAL A HA   1  
ATOM   1666  H HB   . VAL A 1 106 ? -12.157 -11.974 -17.250 1.00 0.00 ? 1586 VAL A HB   1  
ATOM   1667  H HG11 . VAL A 1 106 ? -11.407 -14.583 -18.639 1.00 0.00 ? 1586 VAL A HG11 1  
ATOM   1668  H HG12 . VAL A 1 106 ? -10.385 -13.111 -18.589 1.00 0.00 ? 1586 VAL A HG12 1  
ATOM   1669  H HG13 . VAL A 1 106 ? -10.729 -14.002 -17.099 1.00 0.00 ? 1586 VAL A HG13 1  
ATOM   1670  H HG21 . VAL A 1 106 ? -12.104 -11.791 -19.705 1.00 0.00 ? 1586 VAL A HG21 1  
ATOM   1671  H HG22 . VAL A 1 106 ? -13.138 -13.233 -19.850 1.00 0.00 ? 1586 VAL A HG22 1  
ATOM   1672  H HG23 . VAL A 1 106 ? -13.754 -11.730 -19.122 1.00 0.00 ? 1586 VAL A HG23 1  
ATOM   1673  N N    . ILE A 1 107 ? -13.691 -15.339 -15.454 1.00 0.00 ? 1587 ILE A N    1  
ATOM   1674  C CA   . ILE A 1 107 ? -13.629 -15.870 -14.110 1.00 0.00 ? 1587 ILE A CA   1  
ATOM   1675  C C    . ILE A 1 107 ? -12.552 -16.943 -14.137 1.00 0.00 ? 1587 ILE A C    1  
ATOM   1676  O O    . ILE A 1 107 ? -12.406 -17.681 -15.116 1.00 0.00 ? 1587 ILE A O    1  
ATOM   1677  C CB   . ILE A 1 107 ? -15.032 -16.305 -13.626 1.00 0.00 ? 1587 ILE A CB   1  
ATOM   1678  C CG1  . ILE A 1 107 ? -15.483 -17.633 -14.248 1.00 0.00 ? 1587 ILE A CG1  1  
ATOM   1679  C CG2  . ILE A 1 107 ? -16.056 -15.205 -13.960 1.00 0.00 ? 1587 ILE A CG2  1  
ATOM   1680  C CD1  . ILE A 1 107 ? -16.887 -18.074 -13.824 1.00 0.00 ? 1587 ILE A CD1  1  
ATOM   1681  H H    . ILE A 1 107 ? -14.178 -15.878 -16.159 1.00 0.00 ? 1587 ILE A H    1  
ATOM   1682  H HA   . ILE A 1 107 ? -13.298 -15.088 -13.434 1.00 0.00 ? 1587 ILE A HA   1  
ATOM   1683  H HB   . ILE A 1 107 ? -14.996 -16.430 -12.542 1.00 0.00 ? 1587 ILE A HB   1  
ATOM   1684  H HG12 . ILE A 1 107 ? -15.460 -17.536 -15.334 1.00 0.00 ? 1587 ILE A HG12 1  
ATOM   1685  H HG13 . ILE A 1 107 ? -14.786 -18.411 -13.938 1.00 0.00 ? 1587 ILE A HG13 1  
ATOM   1686  H HG21 . ILE A 1 107 ? -15.659 -14.229 -13.691 1.00 0.00 ? 1587 ILE A HG21 1  
ATOM   1687  H HG22 . ILE A 1 107 ? -16.293 -15.243 -15.024 1.00 0.00 ? 1587 ILE A HG22 1  
ATOM   1688  H HG23 . ILE A 1 107 ? -16.981 -15.361 -13.414 1.00 0.00 ? 1587 ILE A HG23 1  
ATOM   1689  H HD11 . ILE A 1 107 ? -17.101 -19.047 -14.251 1.00 0.00 ? 1587 ILE A HD11 1  
ATOM   1690  H HD12 . ILE A 1 107 ? -16.936 -18.149 -12.740 1.00 0.00 ? 1587 ILE A HD12 1  
ATOM   1691  H HD13 . ILE A 1 107 ? -17.640 -17.368 -14.165 1.00 0.00 ? 1587 ILE A HD13 1  
ATOM   1692  N N    . LEU A 1 108 ? -11.762 -17.024 -13.078 1.00 0.00 ? 1588 LEU A N    1  
ATOM   1693  C CA   . LEU A 1 108 ? -10.639 -17.941 -13.038 1.00 0.00 ? 1588 LEU A CA   1  
ATOM   1694  C C    . LEU A 1 108 ? -11.164 -19.152 -12.303 1.00 0.00 ? 1588 LEU A C    1  
ATOM   1695  O O    . LEU A 1 108 ? -11.504 -19.051 -11.121 1.00 0.00 ? 1588 LEU A O    1  
ATOM   1696  C CB   . LEU A 1 108 ? -9.442  -17.283 -12.333 1.00 0.00 ? 1588 LEU A CB   1  
ATOM   1697  C CG   . LEU A 1 108 ? -8.522  -16.529 -13.308 1.00 0.00 ? 1588 LEU A CG   1  
ATOM   1698  C CD1  . LEU A 1 108 ? -7.787  -15.427 -12.543 1.00 0.00 ? 1588 LEU A CD1  1  
ATOM   1699  C CD2  . LEU A 1 108 ? -7.483  -17.472 -13.935 1.00 0.00 ? 1588 LEU A CD2  1  
ATOM   1700  H H    . LEU A 1 108 ? -11.984 -16.490 -12.245 1.00 0.00 ? 1588 LEU A H    1  
ATOM   1701  H HA   . LEU A 1 108 ? -10.337 -18.234 -14.045 1.00 0.00 ? 1588 LEU A HA   1  
ATOM   1702  H HB2  . LEU A 1 108 ? -9.823  -16.576 -11.598 1.00 0.00 ? 1588 LEU A HB2  1  
ATOM   1703  H HB3  . LEU A 1 108 ? -8.865  -18.043 -11.803 1.00 0.00 ? 1588 LEU A HB3  1  
ATOM   1704  H HG   . LEU A 1 108 ? -9.115  -16.087 -14.115 1.00 0.00 ? 1588 LEU A HG   1  
ATOM   1705  H HD11 . LEU A 1 108 ? -7.006  -14.987 -13.163 1.00 0.00 ? 1588 LEU A HD11 1  
ATOM   1706  H HD12 . LEU A 1 108 ? -8.478  -14.635 -12.245 1.00 0.00 ? 1588 LEU A HD12 1  
ATOM   1707  H HD13 . LEU A 1 108 ? -7.317  -15.838 -11.647 1.00 0.00 ? 1588 LEU A HD13 1  
ATOM   1708  H HD21 . LEU A 1 108 ? -6.834  -17.899 -13.167 1.00 0.00 ? 1588 LEU A HD21 1  
ATOM   1709  H HD22 . LEU A 1 108 ? -7.973  -18.277 -14.479 1.00 0.00 ? 1588 LEU A HD22 1  
ATOM   1710  H HD23 . LEU A 1 108 ? -6.865  -16.916 -14.646 1.00 0.00 ? 1588 LEU A HD23 1  
ATOM   1711  N N    . SER A 1 109 ? -11.266 -20.277 -13.014 1.00 0.00 ? 1589 SER A N    1  
ATOM   1712  C CA   . SER A 1 109 ? -11.635 -21.565 -12.442 1.00 0.00 ? 1589 SER A CA   1  
ATOM   1713  C C    . SER A 1 109 ? -10.677 -21.837 -11.279 1.00 0.00 ? 1589 SER A C    1  
ATOM   1714  O O    . SER A 1 109 ? -9.523  -21.418 -11.341 1.00 0.00 ? 1589 SER A O    1  
ATOM   1715  C CB   . SER A 1 109 ? -11.650 -22.643 -13.547 1.00 0.00 ? 1589 SER A CB   1  
ATOM   1716  O OG   . SER A 1 109 ? -11.543 -22.072 -14.854 1.00 0.00 ? 1589 SER A OG   1  
ATOM   1717  H H    . SER A 1 109 ? -11.045 -20.289 -14.004 1.00 0.00 ? 1589 SER A H    1  
ATOM   1718  H HA   . SER A 1 109 ? -12.644 -21.467 -12.054 1.00 0.00 ? 1589 SER A HA   1  
ATOM   1719  H HB2  . SER A 1 109 ? -10.824 -23.339 -13.400 1.00 0.00 ? 1589 SER A HB2  1  
ATOM   1720  H HB3  . SER A 1 109 ? -12.580 -23.206 -13.483 1.00 0.00 ? 1589 SER A HB3  1  
ATOM   1721  H HG   . SER A 1 109 ? -11.751 -22.769 -15.514 1.00 0.00 ? 1589 SER A HG   1  
ATOM   1722  N N    . LEU A 1 110 ? -11.105 -22.526 -10.219 1.00 0.00 ? 1590 LEU A N    1  
ATOM   1723  C CA   . LEU A 1 110 ? -10.323 -22.601 -8.978  1.00 0.00 ? 1590 LEU A CA   1  
ATOM   1724  C C    . LEU A 1 110 ? -8.908  -23.159 -9.133  1.00 0.00 ? 1590 LEU A C    1  
ATOM   1725  O O    . LEU A 1 110 ? -8.002  -22.699 -8.446  1.00 0.00 ? 1590 LEU A O    1  
ATOM   1726  C CB   . LEU A 1 110 ? -11.131 -23.251 -7.834  1.00 0.00 ? 1590 LEU A CB   1  
ATOM   1727  C CG   . LEU A 1 110 ? -11.347 -24.766 -7.990  1.00 0.00 ? 1590 LEU A CG   1  
ATOM   1728  C CD1  . LEU A 1 110 ? -10.378 -25.579 -7.127  1.00 0.00 ? 1590 LEU A CD1  1  
ATOM   1729  C CD2  . LEU A 1 110 ? -12.796 -25.145 -7.669  1.00 0.00 ? 1590 LEU A CD2  1  
ATOM   1730  H H    . LEU A 1 110 ? -12.037 -22.925 -10.236 1.00 0.00 ? 1590 LEU A H    1  
ATOM   1731  H HA   . LEU A 1 110 ? -10.194 -21.569 -8.675  1.00 0.00 ? 1590 LEU A HA   1  
ATOM   1732  H HB2  . LEU A 1 110 ? -10.623 -23.053 -6.885  1.00 0.00 ? 1590 LEU A HB2  1  
ATOM   1733  H HB3  . LEU A 1 110 ? -12.095 -22.739 -7.775  1.00 0.00 ? 1590 LEU A HB3  1  
ATOM   1734  H HG   . LEU A 1 110 ? -11.154 -25.014 -9.026  1.00 0.00 ? 1590 LEU A HG   1  
ATOM   1735  H HD11 . LEU A 1 110 ? -10.541 -26.644 -7.295  1.00 0.00 ? 1590 LEU A HD11 1  
ATOM   1736  H HD12 . LEU A 1 110 ? -9.345  -25.349 -7.390  1.00 0.00 ? 1590 LEU A HD12 1  
ATOM   1737  H HD13 . LEU A 1 110 ? -10.544 -25.363 -6.073  1.00 0.00 ? 1590 LEU A HD13 1  
ATOM   1738  H HD21 . LEU A 1 110 ? -13.483 -24.628 -8.345  1.00 0.00 ? 1590 LEU A HD21 1  
ATOM   1739  H HD22 . LEU A 1 110 ? -12.941 -26.220 -7.805  1.00 0.00 ? 1590 LEU A HD22 1  
ATOM   1740  H HD23 . LEU A 1 110 ? -13.044 -24.871 -6.645  1.00 0.00 ? 1590 LEU A HD23 1  
ATOM   1741  N N    . GLU A 1 111 ? -8.664  -24.082 -10.062 1.00 0.00 ? 1591 GLU A N    1  
ATOM   1742  C CA   . GLU A 1 111 ? -7.319  -24.616 -10.275 1.00 0.00 ? 1591 GLU A CA   1  
ATOM   1743  C C    . GLU A 1 111 ? -6.470  -23.628 -11.091 1.00 0.00 ? 1591 GLU A C    1  
ATOM   1744  O O    . GLU A 1 111 ? -5.245  -23.629 -10.979 1.00 0.00 ? 1591 GLU A O    1  
ATOM   1745  C CB   . GLU A 1 111 ? -7.418  -25.975 -10.972 1.00 0.00 ? 1591 GLU A CB   1  
ATOM   1746  C CG   . GLU A 1 111 ? -6.238  -26.881 -10.599 1.00 0.00 ? 1591 GLU A CG   1  
ATOM   1747  C CD   . GLU A 1 111 ? -6.043  -28.017 -11.613 1.00 0.00 ? 1591 GLU A CD   1  
ATOM   1748  O OE1  . GLU A 1 111 ? -6.694  -29.082 -11.481 1.00 0.00 ? 1591 GLU A OE1  1  
ATOM   1749  O OE2  . GLU A 1 111 ? -5.223  -27.830 -12.546 1.00 0.00 ? 1591 GLU A OE2  1  
ATOM   1750  H H    . GLU A 1 111 ? -9.418  -24.446 -10.631 1.00 0.00 ? 1591 GLU A H    1  
ATOM   1751  H HA   . GLU A 1 111 ? -6.843  -24.768 -9.299  1.00 0.00 ? 1591 GLU A HA   1  
ATOM   1752  H HB2  . GLU A 1 111 ? -8.338  -26.484 -10.679 1.00 0.00 ? 1591 GLU A HB2  1  
ATOM   1753  H HB3  . GLU A 1 111 ? -7.440  -25.804 -12.048 1.00 0.00 ? 1591 GLU A HB3  1  
ATOM   1754  H HG2  . GLU A 1 111 ? -5.323  -26.288 -10.550 1.00 0.00 ? 1591 GLU A HG2  1  
ATOM   1755  H HG3  . GLU A 1 111 ? -6.408  -27.294 -9.602  1.00 0.00 ? 1591 GLU A HG3  1  
ATOM   1756  N N    . GLN A 1 112 ? -7.099  -22.756 -11.893 1.00 0.00 ? 1592 GLN A N    1  
ATOM   1757  C CA   . GLN A 1 112 ? -6.417  -21.659 -12.576 1.00 0.00 ? 1592 GLN A CA   1  
ATOM   1758  C C    . GLN A 1 112 ? -6.009  -20.641 -11.512 1.00 0.00 ? 1592 GLN A C    1  
ATOM   1759  O O    . GLN A 1 112 ? -4.834  -20.329 -11.383 1.00 0.00 ? 1592 GLN A O    1  
ATOM   1760  C CB   . GLN A 1 112 ? -7.311  -20.979 -13.647 1.00 0.00 ? 1592 GLN A CB   1  
ATOM   1761  C CG   . GLN A 1 112 ? -8.213  -21.891 -14.492 1.00 0.00 ? 1592 GLN A CG   1  
ATOM   1762  C CD   . GLN A 1 112 ? -7.509  -22.848 -15.451 1.00 0.00 ? 1592 GLN A CD   1  
ATOM   1763  O OE1  . GLN A 1 112 ? -6.284  -22.932 -15.530 1.00 0.00 ? 1592 GLN A OE1  1  
ATOM   1764  N NE2  . GLN A 1 112 ? -8.304  -23.595 -16.203 1.00 0.00 ? 1592 GLN A NE2  1  
ATOM   1765  H H    . GLN A 1 112 ? -8.112  -22.753 -11.906 1.00 0.00 ? 1592 GLN A H    1  
ATOM   1766  H HA   . GLN A 1 112 ? -5.524  -22.045 -13.066 1.00 0.00 ? 1592 GLN A HA   1  
ATOM   1767  H HB2  . GLN A 1 112 ? -7.976  -20.273 -13.155 1.00 0.00 ? 1592 GLN A HB2  1  
ATOM   1768  H HB3  . GLN A 1 112 ? -6.668  -20.404 -14.317 1.00 0.00 ? 1592 GLN A HB3  1  
ATOM   1769  H HG2  . GLN A 1 112 ? -8.852  -22.472 -13.833 1.00 0.00 ? 1592 GLN A HG2  1  
ATOM   1770  H HG3  . GLN A 1 112 ? -8.870  -21.251 -15.084 1.00 0.00 ? 1592 GLN A HG3  1  
ATOM   1771  H HE21 . GLN A 1 112 ? -9.309  -23.518 -16.118 1.00 0.00 ? 1592 GLN A HE21 1  
ATOM   1772  H HE22 . GLN A 1 112 ? -7.923  -24.192 -16.944 1.00 0.00 ? 1592 GLN A HE22 1  
ATOM   1773  N N    . GLY A 1 113 ? -6.969  -20.171 -10.703 1.00 0.00 ? 1593 GLY A N    1  
ATOM   1774  C CA   . GLY A 1 113 ? -6.744  -19.146 -9.680  1.00 0.00 ? 1593 GLY A CA   1  
ATOM   1775  C C    . GLY A 1 113 ? -5.678  -19.561 -8.680  1.00 0.00 ? 1593 GLY A C    1  
ATOM   1776  O O    . GLY A 1 113 ? -4.878  -18.730 -8.259  1.00 0.00 ? 1593 GLY A O    1  
ATOM   1777  H H    . GLY A 1 113 ? -7.922  -20.503 -10.833 1.00 0.00 ? 1593 GLY A H    1  
ATOM   1778  H HA2  . GLY A 1 113 ? -6.443  -18.218 -10.162 1.00 0.00 ? 1593 GLY A HA2  1  
ATOM   1779  H HA3  . GLY A 1 113 ? -7.670  -18.964 -9.146  1.00 0.00 ? 1593 GLY A HA3  1  
ATOM   1780  N N    . ASN A 1 114 ? -5.583  -20.860 -8.370  1.00 0.00 ? 1594 ASN A N    1  
ATOM   1781  C CA   . ASN A 1 114 ? -4.537  -21.389 -7.492  1.00 0.00 ? 1594 ASN A CA   1  
ATOM   1782  C C    . ASN A 1 114 ? -3.140  -21.012 -7.991  1.00 0.00 ? 1594 ASN A C    1  
ATOM   1783  O O    . ASN A 1 114 ? -2.320  -20.539 -7.208  1.00 0.00 ? 1594 ASN A O    1  
ATOM   1784  C CB   . ASN A 1 114 ? -4.655  -22.919 -7.354  1.00 0.00 ? 1594 ASN A CB   1  
ATOM   1785  C CG   . ASN A 1 114 ? -5.341  -23.289 -6.045  1.00 0.00 ? 1594 ASN A CG   1  
ATOM   1786  O OD1  . ASN A 1 114 ? -4.694  -23.405 -5.008  1.00 0.00 ? 1594 ASN A OD1  1  
ATOM   1787  N ND2  . ASN A 1 114 ? -6.651  -23.472 -6.063  1.00 0.00 ? 1594 ASN A ND2  1  
ATOM   1788  H H    . ASN A 1 114 ? -6.289  -21.499 -8.733  1.00 0.00 ? 1594 ASN A H    1  
ATOM   1789  H HA   . ASN A 1 114 ? -4.661  -20.938 -6.503  1.00 0.00 ? 1594 ASN A HA   1  
ATOM   1790  H HB2  . ASN A 1 114 ? -5.176  -23.347 -8.210  1.00 0.00 ? 1594 ASN A HB2  1  
ATOM   1791  H HB3  . ASN A 1 114 ? -3.652  -23.359 -7.354  1.00 0.00 ? 1594 ASN A HB3  1  
ATOM   1792  H HD21 . ASN A 1 114 ? -7.192  -23.302 -6.911  1.00 0.00 ? 1594 ASN A HD21 1  
ATOM   1793  H HD22 . ASN A 1 114 ? -7.132  -23.746 -5.218  1.00 0.00 ? 1594 ASN A HD22 1  
ATOM   1794  N N    . ARG A 1 115 ? -2.886  -21.133 -9.300  1.00 0.00 ? 1595 ARG A N    1  
ATOM   1795  C CA   . ARG A 1 115 ? -1.588  -20.786 -9.887  1.00 0.00 ? 1595 ARG A CA   1  
ATOM   1796  C C    . ARG A 1 115 ? -1.240  -19.310 -9.691  1.00 0.00 ? 1595 ARG A C    1  
ATOM   1797  O O    . ARG A 1 115 ? -0.060  -18.964 -9.732  1.00 0.00 ? 1595 ARG A O    1  
ATOM   1798  C CB   . ARG A 1 115 ? -1.573  -21.118 -11.383 1.00 0.00 ? 1595 ARG A CB   1  
ATOM   1799  C CG   . ARG A 1 115 ? -1.609  -22.629 -11.664 1.00 0.00 ? 1595 ARG A CG   1  
ATOM   1800  C CD   . ARG A 1 115 ? -2.439  -22.883 -12.921 1.00 0.00 ? 1595 ARG A CD   1  
ATOM   1801  N NE   . ARG A 1 115 ? -2.098  -24.178 -13.550 1.00 0.00 ? 1595 ARG A NE   1  
ATOM   1802  C CZ   . ARG A 1 115 ? -2.762  -25.337 -13.439 1.00 0.00 ? 1595 ARG A CZ   1  
ATOM   1803  N NH1  . ARG A 1 115 ? -3.835  -25.435 -12.668 1.00 0.00 ? 1595 ARG A NH1  1  
ATOM   1804  N NH2  . ARG A 1 115 ? -2.348  -26.410 -14.108 1.00 0.00 ? 1595 ARG A NH2  1  
ATOM   1805  H H    . ARG A 1 115 ? -3.632  -21.434 -9.922  1.00 0.00 ? 1595 ARG A H    1  
ATOM   1806  H HA   . ARG A 1 115 ? -0.808  -21.382 -9.404  1.00 0.00 ? 1595 ARG A HA   1  
ATOM   1807  H HB2  . ARG A 1 115 ? -2.412  -20.612 -11.859 1.00 0.00 ? 1595 ARG A HB2  1  
ATOM   1808  H HB3  . ARG A 1 115 ? -0.663  -20.711 -11.833 1.00 0.00 ? 1595 ARG A HB3  1  
ATOM   1809  H HG2  . ARG A 1 115 ? -0.590  -22.994 -11.801 1.00 0.00 ? 1595 ARG A HG2  1  
ATOM   1810  H HG3  . ARG A 1 115 ? -2.058  -23.174 -10.832 1.00 0.00 ? 1595 ARG A HG3  1  
ATOM   1811  H HD2  . ARG A 1 115 ? -3.492  -22.828 -12.644 1.00 0.00 ? 1595 ARG A HD2  1  
ATOM   1812  H HD3  . ARG A 1 115 ? -2.235  -22.087 -13.638 1.00 0.00 ? 1595 ARG A HD3  1  
ATOM   1813  H HE   . ARG A 1 115 ? -1.263  -24.156 -14.127 1.00 0.00 ? 1595 ARG A HE   1  
ATOM   1814  H HH11 . ARG A 1 115 ? -4.159  -24.656 -12.099 1.00 0.00 ? 1595 ARG A HH11 1  
ATOM   1815  H HH12 . ARG A 1 115 ? -4.355  -26.320 -12.610 1.00 0.00 ? 1595 ARG A HH12 1  
ATOM   1816  H HH21 . ARG A 1 115 ? -1.538  -26.376 -14.715 1.00 0.00 ? 1595 ARG A HH21 1  
ATOM   1817  H HH22 . ARG A 1 115 ? -2.829  -27.302 -14.036 1.00 0.00 ? 1595 ARG A HH22 1  
ATOM   1818  N N    . LEU A 1 116 ? -2.234  -18.438 -9.494  1.00 0.00 ? 1596 LEU A N    1  
ATOM   1819  C CA   . LEU A 1 116 ? -1.991  -17.042 -9.183  1.00 0.00 ? 1596 LEU A CA   1  
ATOM   1820  C C    . LEU A 1 116 ? -1.894  -16.821 -7.680  1.00 0.00 ? 1596 LEU A C    1  
ATOM   1821  O O    . LEU A 1 116 ? -1.219  -15.887 -7.262  1.00 0.00 ? 1596 LEU A O    1  
ATOM   1822  C CB   . LEU A 1 116 ? -3.105  -16.154 -9.755  1.00 0.00 ? 1596 LEU A CB   1  
ATOM   1823  C CG   . LEU A 1 116 ? -3.211  -16.043 -11.291 1.00 0.00 ? 1596 LEU A CG   1  
ATOM   1824  C CD1  . LEU A 1 116 ? -1.867  -16.135 -12.035 1.00 0.00 ? 1596 LEU A CD1  1  
ATOM   1825  C CD2  . LEU A 1 116 ? -4.173  -17.083 -11.866 1.00 0.00 ? 1596 LEU A CD2  1  
ATOM   1826  H H    . LEU A 1 116 ? -3.194  -18.761 -9.485  1.00 0.00 ? 1596 LEU A H    1  
ATOM   1827  H HA   . LEU A 1 116 ? -1.039  -16.742 -9.619  1.00 0.00 ? 1596 LEU A HA   1  
ATOM   1828  H HB2  . LEU A 1 116 ? -4.065  -16.475 -9.350  1.00 0.00 ? 1596 LEU A HB2  1  
ATOM   1829  H HB3  . LEU A 1 116 ? -2.931  -15.154 -9.367  1.00 0.00 ? 1596 LEU A HB3  1  
ATOM   1830  H HG   . LEU A 1 116 ? -3.634  -15.067 -11.507 1.00 0.00 ? 1596 LEU A HG   1  
ATOM   1831  H HD11 . LEU A 1 116 ? -1.158  -15.432 -11.607 1.00 0.00 ? 1596 LEU A HD11 1  
ATOM   1832  H HD12 . LEU A 1 116 ? -1.460  -17.146 -11.970 1.00 0.00 ? 1596 LEU A HD12 1  
ATOM   1833  H HD13 . LEU A 1 116 ? -2.014  -15.883 -13.087 1.00 0.00 ? 1596 LEU A HD13 1  
ATOM   1834  H HD21 . LEU A 1 116 ? -3.785  -18.088 -11.710 1.00 0.00 ? 1596 LEU A HD21 1  
ATOM   1835  H HD22 . LEU A 1 116 ? -5.141  -16.980 -11.381 1.00 0.00 ? 1596 LEU A HD22 1  
ATOM   1836  H HD23 . LEU A 1 116 ? -4.307  -16.915 -12.936 1.00 0.00 ? 1596 LEU A HD23 1  
ATOM   1837  N N    . ARG A 1 117 ? -2.545  -17.643 -6.850  1.00 0.00 ? 1597 ARG A N    1  
ATOM   1838  C CA   . ARG A 1 117 ? -2.565  -17.483 -5.393  1.00 0.00 ? 1597 ARG A CA   1  
ATOM   1839  C C    . ARG A 1 117 ? -1.164  -17.435 -4.813  1.00 0.00 ? 1597 ARG A C    1  
ATOM   1840  O O    . ARG A 1 117 ? -0.888  -16.609 -3.951  1.00 0.00 ? 1597 ARG A O    1  
ATOM   1841  C CB   . ARG A 1 117 ? -3.406  -18.611 -4.781  1.00 0.00 ? 1597 ARG A CB   1  
ATOM   1842  C CG   . ARG A 1 117 ? -3.631  -18.402 -3.278  1.00 0.00 ? 1597 ARG A CG   1  
ATOM   1843  C CD   . ARG A 1 117 ? -4.603  -19.442 -2.692  1.00 0.00 ? 1597 ARG A CD   1  
ATOM   1844  N NE   . ARG A 1 117 ? -4.209  -20.841 -2.965  1.00 0.00 ? 1597 ARG A NE   1  
ATOM   1845  C CZ   . ARG A 1 117 ? -3.244  -21.556 -2.371  1.00 0.00 ? 1597 ARG A CZ   1  
ATOM   1846  N NH1  . ARG A 1 117 ? -2.526  -21.050 -1.372  1.00 0.00 ? 1597 ARG A NH1  1  
ATOM   1847  N NH2  . ARG A 1 117 ? -3.005  -22.795 -2.794  1.00 0.00 ? 1597 ARG A NH2  1  
ATOM   1848  H H    . ARG A 1 117 ? -3.081  -18.412 -7.246  1.00 0.00 ? 1597 ARG A H    1  
ATOM   1849  H HA   . ARG A 1 117 ? -3.037  -16.532 -5.145  1.00 0.00 ? 1597 ARG A HA   1  
ATOM   1850  H HB2  . ARG A 1 117 ? -4.378  -18.644 -5.280  1.00 0.00 ? 1597 ARG A HB2  1  
ATOM   1851  H HB3  . ARG A 1 117 ? -2.894  -19.560 -4.938  1.00 0.00 ? 1597 ARG A HB3  1  
ATOM   1852  H HG2  . ARG A 1 117 ? -2.685  -18.457 -2.748  1.00 0.00 ? 1597 ARG A HG2  1  
ATOM   1853  H HG3  . ARG A 1 117 ? -4.053  -17.405 -3.131  1.00 0.00 ? 1597 ARG A HG3  1  
ATOM   1854  H HD2  . ARG A 1 117 ? -4.688  -19.287 -1.616  1.00 0.00 ? 1597 ARG A HD2  1  
ATOM   1855  H HD3  . ARG A 1 117 ? -5.591  -19.257 -3.127  1.00 0.00 ? 1597 ARG A HD3  1  
ATOM   1856  H HE   . ARG A 1 117 ? -4.751  -21.300 -3.691  1.00 0.00 ? 1597 ARG A HE   1  
ATOM   1857  H HH11 . ARG A 1 117 ? -2.705  -20.123 -1.017  1.00 0.00 ? 1597 ARG A HH11 1  
ATOM   1858  H HH12 . ARG A 1 117 ? -1.795  -21.582 -0.910  1.00 0.00 ? 1597 ARG A HH12 1  
ATOM   1859  H HH21 . ARG A 1 117 ? -3.543  -23.189 -3.569  1.00 0.00 ? 1597 ARG A HH21 1  
ATOM   1860  H HH22 . ARG A 1 117 ? -2.296  -23.388 -2.375  1.00 0.00 ? 1597 ARG A HH22 1  
ATOM   1861  N N    . GLU A 1 118 ? -0.276  -18.280 -5.320  1.00 0.00 ? 1598 GLU A N    1  
ATOM   1862  C CA   . GLU A 1 118 ? 1.106   -18.346 -4.868  1.00 0.00 ? 1598 GLU A CA   1  
ATOM   1863  C C    . GLU A 1 118 ? 1.886   -17.030 -5.079  1.00 0.00 ? 1598 GLU A C    1  
ATOM   1864  O O    . GLU A 1 118 ? 2.912   -16.845 -4.423  1.00 0.00 ? 1598 GLU A O    1  
ATOM   1865  C CB   . GLU A 1 118 ? 1.811   -19.541 -5.533  1.00 0.00 ? 1598 GLU A CB   1  
ATOM   1866  C CG   . GLU A 1 118 ? 1.714   -19.531 -7.063  1.00 0.00 ? 1598 GLU A CG   1  
ATOM   1867  C CD   . GLU A 1 118 ? 2.567   -20.652 -7.690  1.00 0.00 ? 1598 GLU A CD   1  
ATOM   1868  O OE1  . GLU A 1 118 ? 2.072   -21.799 -7.822  1.00 0.00 ? 1598 GLU A OE1  1  
ATOM   1869  O OE2  . GLU A 1 118 ? 3.740   -20.394 -8.060  1.00 0.00 ? 1598 GLU A OE2  1  
ATOM   1870  H H    . GLU A 1 118 ? -0.581  -18.950 -6.015  1.00 0.00 ? 1598 GLU A H    1  
ATOM   1871  H HA   . GLU A 1 118 ? 1.091   -18.532 -3.791  1.00 0.00 ? 1598 GLU A HA   1  
ATOM   1872  H HB2  . GLU A 1 118 ? 2.860   -19.547 -5.233  1.00 0.00 ? 1598 GLU A HB2  1  
ATOM   1873  H HB3  . GLU A 1 118 ? 1.356   -20.460 -5.163  1.00 0.00 ? 1598 GLU A HB3  1  
ATOM   1874  H HG2  . GLU A 1 118 ? 0.670   -19.676 -7.343  1.00 0.00 ? 1598 GLU A HG2  1  
ATOM   1875  H HG3  . GLU A 1 118 ? 2.039   -18.560 -7.442  1.00 0.00 ? 1598 GLU A HG3  1  
ATOM   1876  N N    . GLN A 1 119 ? 1.437   -16.126 -5.968  1.00 0.00 ? 1599 GLN A N    1  
ATOM   1877  C CA   . GLN A 1 119 ? 2.138   -14.883 -6.280  1.00 0.00 ? 1599 GLN A CA   1  
ATOM   1878  C C    . GLN A 1 119 ? 1.330   -13.658 -5.821  1.00 0.00 ? 1599 GLN A C    1  
ATOM   1879  O O    . GLN A 1 119 ? 1.886   -12.734 -5.222  1.00 0.00 ? 1599 GLN A O    1  
ATOM   1880  C CB   . GLN A 1 119 ? 2.457   -14.884 -7.788  1.00 0.00 ? 1599 GLN A CB   1  
ATOM   1881  C CG   . GLN A 1 119 ? 3.503   -13.829 -8.164  1.00 0.00 ? 1599 GLN A CG   1  
ATOM   1882  C CD   . GLN A 1 119 ? 4.166   -14.119 -9.517  1.00 0.00 ? 1599 GLN A CD   1  
ATOM   1883  O OE1  . GLN A 1 119 ? 5.378   -14.326 -9.596  1.00 0.00 ? 1599 GLN A OE1  1  
ATOM   1884  N NE2  . GLN A 1 119 ? 3.413   -14.148 -10.610 1.00 0.00 ? 1599 GLN A NE2  1  
ATOM   1885  H H    . GLN A 1 119 ? 0.567   -16.284 -6.464  1.00 0.00 ? 1599 GLN A H    1  
ATOM   1886  H HA   . GLN A 1 119 ? 3.090   -14.868 -5.746  1.00 0.00 ? 1599 GLN A HA   1  
ATOM   1887  H HB2  . GLN A 1 119 ? 2.862   -15.857 -8.058  1.00 0.00 ? 1599 GLN A HB2  1  
ATOM   1888  H HB3  . GLN A 1 119 ? 1.543   -14.729 -8.365  1.00 0.00 ? 1599 GLN A HB3  1  
ATOM   1889  H HG2  . GLN A 1 119 ? 3.040   -12.844 -8.175  1.00 0.00 ? 1599 GLN A HG2  1  
ATOM   1890  H HG3  . GLN A 1 119 ? 4.279   -13.827 -7.399  1.00 0.00 ? 1599 GLN A HG3  1  
ATOM   1891  H HE21 . GLN A 1 119 ? 2.416   -13.982 -10.559 1.00 0.00 ? 1599 GLN A HE21 1  
ATOM   1892  H HE22 . GLN A 1 119 ? 3.835   -14.334 -11.511 1.00 0.00 ? 1599 GLN A HE22 1  
ATOM   1893  N N    . TYR A 1 120 ? 0.019   -13.656 -6.084  1.00 0.00 ? 1600 TYR A N    1  
ATOM   1894  C CA   . TYR A 1 120 ? -0.881  -12.515 -5.928  1.00 0.00 ? 1600 TYR A CA   1  
ATOM   1895  C C    . TYR A 1 120 ? -1.756  -12.601 -4.675  1.00 0.00 ? 1600 TYR A C    1  
ATOM   1896  O O    . TYR A 1 120 ? -2.495  -11.656 -4.391  1.00 0.00 ? 1600 TYR A O    1  
ATOM   1897  C CB   . TYR A 1 120 ? -1.799  -12.482 -7.162  1.00 0.00 ? 1600 TYR A CB   1  
ATOM   1898  C CG   . TYR A 1 120 ? -1.146  -12.442 -8.529  1.00 0.00 ? 1600 TYR A CG   1  
ATOM   1899  C CD1  . TYR A 1 120 ? 0.212   -12.123 -8.698  1.00 0.00 ? 1600 TYR A CD1  1  
ATOM   1900  C CD2  . TYR A 1 120 ? -1.932  -12.733 -9.657  1.00 0.00 ? 1600 TYR A CD2  1  
ATOM   1901  C CE1  . TYR A 1 120 ? 0.788   -12.134 -9.978  1.00 0.00 ? 1600 TYR A CE1  1  
ATOM   1902  C CE2  . TYR A 1 120 ? -1.372  -12.739 -10.945 1.00 0.00 ? 1600 TYR A CE2  1  
ATOM   1903  C CZ   . TYR A 1 120 ? 0.000   -12.445 -11.112 1.00 0.00 ? 1600 TYR A CZ   1  
ATOM   1904  O OH   . TYR A 1 120 ? 0.581   -12.456 -12.346 1.00 0.00 ? 1600 TYR A OH   1  
ATOM   1905  H H    . TYR A 1 120 ? -0.356  -14.411 -6.641  1.00 0.00 ? 1600 TYR A H    1  
ATOM   1906  H HA   . TYR A 1 120 ? -0.303  -11.589 -5.882  1.00 0.00 ? 1600 TYR A HA   1  
ATOM   1907  H HB2  . TYR A 1 120 ? -2.428  -13.368 -7.132  1.00 0.00 ? 1600 TYR A HB2  1  
ATOM   1908  H HB3  . TYR A 1 120 ? -2.460  -11.630 -7.087  1.00 0.00 ? 1600 TYR A HB3  1  
ATOM   1909  H HD1  . TYR A 1 120 ? 0.825   -11.865 -7.848  1.00 0.00 ? 1600 TYR A HD1  1  
ATOM   1910  H HD2  . TYR A 1 120 ? -2.978  -12.956 -9.524  1.00 0.00 ? 1600 TYR A HD2  1  
ATOM   1911  H HE1  . TYR A 1 120 ? 1.837   -11.902 -10.094 1.00 0.00 ? 1600 TYR A HE1  1  
ATOM   1912  H HE2  . TYR A 1 120 ? -1.998  -12.968 -11.796 1.00 0.00 ? 1600 TYR A HE2  1  
ATOM   1913  H HH   . TYR A 1 120 ? -0.037  -12.650 -13.073 1.00 0.00 ? 1600 TYR A HH   1  
ATOM   1914  N N    . GLY A 1 121 ? -1.717  -13.736 -3.974  1.00 0.00 ? 1601 GLY A N    1  
ATOM   1915  C CA   . GLY A 1 121 ? -2.494  -13.969 -2.764  1.00 0.00 ? 1601 GLY A CA   1  
ATOM   1916  C C    . GLY A 1 121 ? -2.170  -12.906 -1.710  1.00 0.00 ? 1601 GLY A C    1  
ATOM   1917  O O    . GLY A 1 121 ? -0.988  -12.609 -1.505  1.00 0.00 ? 1601 GLY A O    1  
ATOM   1918  H H    . GLY A 1 121 ? -1.069  -14.459 -4.266  1.00 0.00 ? 1601 GLY A H    1  
ATOM   1919  H HA2  . GLY A 1 121 ? -3.548  -13.965 -3.015  1.00 0.00 ? 1601 GLY A HA2  1  
ATOM   1920  H HA3  . GLY A 1 121 ? -2.252  -14.949 -2.355  1.00 0.00 ? 1601 GLY A HA3  1  
ATOM   1921  N N    . LEU A 1 122 ? -3.181  -12.346 -1.030  1.00 0.00 ? 1602 LEU A N    1  
ATOM   1922  C CA   . LEU A 1 122 ? -2.923  -11.378 0.032   1.00 0.00 ? 1602 LEU A CA   1  
ATOM   1923  C C    . LEU A 1 122 ? -2.213  -12.046 1.208   1.00 0.00 ? 1602 LEU A C    1  
ATOM   1924  O O    . LEU A 1 122 ? -1.327  -11.446 1.826   1.00 0.00 ? 1602 LEU A O    1  
ATOM   1925  C CB   . LEU A 1 122 ? -4.186  -10.721 0.610   1.00 0.00 ? 1602 LEU A CB   1  
ATOM   1926  C CG   . LEU A 1 122 ? -5.358  -10.408 -0.311  1.00 0.00 ? 1602 LEU A CG   1  
ATOM   1927  C CD1  . LEU A 1 122 ? -6.353  -9.530  0.459   1.00 0.00 ? 1602 LEU A CD1  1  
ATOM   1928  C CD2  . LEU A 1 122 ? -4.937  -9.729  -1.600  1.00 0.00 ? 1602 LEU A CD2  1  
ATOM   1929  H H    . LEU A 1 122 ? -4.144  -12.519 -1.294  1.00 0.00 ? 1602 LEU A H    1  
ATOM   1930  H HA   . LEU A 1 122 ? -2.302  -10.589 -0.382  1.00 0.00 ? 1602 LEU A HA   1  
ATOM   1931  H HB2  . LEU A 1 122 ? -4.570  -11.329 1.426   1.00 0.00 ? 1602 LEU A HB2  1  
ATOM   1932  H HB3  . LEU A 1 122 ? -3.841  -9.785  1.035   1.00 0.00 ? 1602 LEU A HB3  1  
ATOM   1933  H HG   . LEU A 1 122 ? -5.829  -11.344 -0.575  1.00 0.00 ? 1602 LEU A HG   1  
ATOM   1934  H HD11 . LEU A 1 122 ? -6.796  -10.112 1.265   1.00 0.00 ? 1602 LEU A HD11 1  
ATOM   1935  H HD12 . LEU A 1 122 ? -5.860  -8.672  0.912   1.00 0.00 ? 1602 LEU A HD12 1  
ATOM   1936  H HD13 . LEU A 1 122 ? -7.138  -9.162  -0.199  1.00 0.00 ? 1602 LEU A HD13 1  
ATOM   1937  H HD21 . LEU A 1 122 ? -5.784  -9.232  -2.071  1.00 0.00 ? 1602 LEU A HD21 1  
ATOM   1938  H HD22 . LEU A 1 122 ? -4.154  -9.024  -1.360  1.00 0.00 ? 1602 LEU A HD22 1  
ATOM   1939  H HD23 . LEU A 1 122 ? -4.535  -10.463 -2.298  1.00 0.00 ? 1602 LEU A HD23 1  
ATOM   1940  N N    . GLY A 1 123 ? -2.687  -13.250 1.557   1.00 0.00 ? 1603 GLY A N    1  
ATOM   1941  C CA   . GLY A 1 123 ? -2.273  -13.959 2.754   1.00 0.00 ? 1603 GLY A CA   1  
ATOM   1942  C C    . GLY A 1 123 ? -0.780  -14.272 2.694   1.00 0.00 ? 1603 GLY A C    1  
ATOM   1943  O O    . GLY A 1 123 ? -0.070  -13.974 3.680   1.00 0.00 ? 1603 GLY A O    1  
ATOM   1944  O OXT  . GLY A 1 123 ? -0.332  -14.842 1.674   1.00 0.00 ? 1603 GLY A OXT  1  
ATOM   1945  H H    . GLY A 1 123 ? -3.417  -13.654 0.989   1.00 0.00 ? 1603 GLY A H    1  
ATOM   1946  H HA2  . GLY A 1 123 ? -2.490  -13.316 3.606   1.00 0.00 ? 1603 GLY A HA2  1  
ATOM   1947  H HA3  . GLY A 1 123 ? -2.845  -14.879 2.845   1.00 0.00 ? 1603 GLY A HA3  1  
ATOM   1948  N N    . GLY B 2 1   ? -27.279 -27.264 -24.817 1.00 0.00 ? 14   GLY B N    1  
ATOM   1949  C CA   . GLY B 2 1   ? -25.798 -27.288 -24.806 1.00 0.00 ? 14   GLY B CA   1  
ATOM   1950  C C    . GLY B 2 1   ? -25.229 -27.012 -23.418 1.00 0.00 ? 14   GLY B C    1  
ATOM   1951  O O    . GLY B 2 1   ? -24.946 -27.954 -22.671 1.00 0.00 ? 14   GLY B O    1  
ATOM   1952  H H1   . GLY B 2 1   ? -27.641 -27.974 -24.200 1.00 0.00 ? 14   GLY B H1   1  
ATOM   1953  H H2   . GLY B 2 1   ? -27.618 -27.442 -25.748 1.00 0.00 ? 14   GLY B H2   1  
ATOM   1954  H H3   . GLY B 2 1   ? -27.622 -26.366 -24.519 1.00 0.00 ? 14   GLY B H3   1  
ATOM   1955  H HA2  . GLY B 2 1   ? -25.455 -28.270 -25.134 1.00 0.00 ? 14   GLY B HA2  1  
ATOM   1956  H HA3  . GLY B 2 1   ? -25.415 -26.546 -25.508 1.00 0.00 ? 14   GLY B HA3  1  
ATOM   1957  N N    . ALA B 2 2   ? -25.044 -25.732 -23.065 1.00 0.00 ? 15   ALA B N    1  
ATOM   1958  C CA   . ALA B 2 2   ? -24.498 -25.286 -21.780 1.00 0.00 ? 15   ALA B CA   1  
ATOM   1959  C C    . ALA B 2 2   ? -25.218 -24.010 -21.338 1.00 0.00 ? 15   ALA B C    1  
ATOM   1960  O O    . ALA B 2 2   ? -25.885 -23.371 -22.149 1.00 0.00 ? 15   ALA B O    1  
ATOM   1961  C CB   . ALA B 2 2   ? -22.994 -25.025 -21.945 1.00 0.00 ? 15   ALA B CB   1  
ATOM   1962  H H    . ALA B 2 2   ? -25.322 -24.986 -23.696 1.00 0.00 ? 15   ALA B H    1  
ATOM   1963  H HA   . ALA B 2 2   ? -24.654 -26.051 -21.020 1.00 0.00 ? 15   ALA B HA   1  
ATOM   1964  H HB1  . ALA B 2 2   ? -22.566 -24.702 -20.997 1.00 0.00 ? 15   ALA B HB1  1  
ATOM   1965  H HB2  . ALA B 2 2   ? -22.492 -25.940 -22.255 1.00 0.00 ? 15   ALA B HB2  1  
ATOM   1966  H HB3  . ALA B 2 2   ? -22.830 -24.246 -22.690 1.00 0.00 ? 15   ALA B HB3  1  
ATOM   1967  N N    . LYS B 2 3   ? -25.066 -23.612 -20.072 1.00 0.00 ? 16   LYS B N    1  
ATOM   1968  C CA   . LYS B 2 3   ? -25.632 -22.382 -19.500 1.00 0.00 ? 16   LYS B CA   1  
ATOM   1969  C C    . LYS B 2 3   ? -24.882 -22.055 -18.208 1.00 0.00 ? 16   LYS B C    1  
ATOM   1970  O O    . LYS B 2 3   ? -24.182 -22.940 -17.723 1.00 0.00 ? 16   LYS B O    1  
ATOM   1971  C CB   . LYS B 2 3   ? -27.130 -22.619 -19.216 1.00 0.00 ? 16   LYS B CB   1  
ATOM   1972  C CG   . LYS B 2 3   ? -28.032 -21.389 -19.434 1.00 0.00 ? 16   LYS B CG   1  
ATOM   1973  C CD   . LYS B 2 3   ? -28.019 -20.910 -20.892 1.00 0.00 ? 16   LYS B CD   1  
ATOM   1974  C CE   . LYS B 2 3   ? -29.139 -19.897 -21.172 1.00 0.00 ? 16   LYS B CE   1  
ATOM   1975  N NZ   . LYS B 2 3   ? -28.852 -18.569 -20.590 1.00 0.00 ? 16   LYS B NZ   1  
ATOM   1976  H H    . LYS B 2 3   ? -24.517 -24.183 -19.434 1.00 0.00 ? 16   LYS B H    1  
ATOM   1977  H HA   . LYS B 2 3   ? -25.489 -21.580 -20.220 1.00 0.00 ? 16   LYS B HA   1  
ATOM   1978  H HB2  . LYS B 2 3   ? -27.502 -23.402 -19.873 1.00 0.00 ? 16   LYS B HB2  1  
ATOM   1979  H HB3  . LYS B 2 3   ? -27.233 -22.979 -18.192 1.00 0.00 ? 16   LYS B HB3  1  
ATOM   1980  H HG2  . LYS B 2 3   ? -29.055 -21.670 -19.177 1.00 0.00 ? 16   LYS B HG2  1  
ATOM   1981  H HG3  . LYS B 2 3   ? -27.720 -20.580 -18.779 1.00 0.00 ? 16   LYS B HG3  1  
ATOM   1982  H HD2  . LYS B 2 3   ? -27.056 -20.468 -21.133 1.00 0.00 ? 16   LYS B HD2  1  
ATOM   1983  H HD3  . LYS B 2 3   ? -28.170 -21.774 -21.542 1.00 0.00 ? 16   LYS B HD3  1  
ATOM   1984  H HE2  . LYS B 2 3   ? -29.256 -19.789 -22.253 1.00 0.00 ? 16   LYS B HE2  1  
ATOM   1985  H HE3  . LYS B 2 3   ? -30.078 -20.277 -20.766 1.00 0.00 ? 16   LYS B HE3  1  
ATOM   1986  H HZ1  . LYS B 2 3   ? -28.724 -18.613 -19.578 1.00 0.00 ? 16   LYS B HZ1  1  
ATOM   1987  H HZ2  . LYS B 2 3   ? -28.021 -18.141 -20.988 1.00 0.00 ? 16   LYS B HZ2  1  
ATOM   1988  H HZ3  . LYS B 2 3   ? -29.613 -17.922 -20.751 1.00 0.00 ? 16   LYS B HZ3  1  
ATOM   1989  N N    . ARG B 2 4   ? -24.995 -20.833 -17.660 1.00 0.00 ? 17   ARG B N    1  
ATOM   1990  C CA   . ARG B 2 4   ? -24.305 -20.427 -16.420 1.00 0.00 ? 17   ARG B CA   1  
ATOM   1991  C C    . ARG B 2 4   ? -24.326 -21.575 -15.407 1.00 0.00 ? 17   ARG B C    1  
ATOM   1992  O O    . ARG B 2 4   ? -25.390 -22.080 -15.043 1.00 0.00 ? 17   ARG B O    1  
ATOM   1993  C CB   . ARG B 2 4   ? -24.857 -19.126 -15.868 1.00 0.00 ? 17   ARG B CB   1  
ATOM   1994  C CG   . ARG B 2 4   ? -24.167 -18.799 -14.540 1.00 0.00 ? 17   ARG B CG   1  
ATOM   1995  C CD   . ARG B 2 4   ? -24.656 -17.466 -14.003 1.00 0.00 ? 17   ARG B CD   1  
ATOM   1996  N NE   . ARG B 2 4   ? -25.256 -17.654 -12.667 1.00 0.00 ? 17   ARG B NE   1  
ATOM   1997  C CZ   . ARG B 2 4   ? -26.473 -17.290 -12.231 1.00 0.00 ? 17   ARG B CZ   1  
ATOM   1998  N NH1  . ARG B 2 4   ? -27.316 -16.631 -13.023 1.00 0.00 ? 17   ARG B NH1  1  
ATOM   1999  N NH2  . ARG B 2 4   ? -26.857 -17.592 -10.994 1.00 0.00 ? 17   ARG B NH2  1  
ATOM   2000  H H    . ARG B 2 4   ? -25.606 -20.156 -18.110 1.00 0.00 ? 17   ARG B H    1  
ATOM   2001  H HA   . ARG B 2 4   ? -23.280 -20.160 -16.643 1.00 0.00 ? 17   ARG B HA   1  
ATOM   2002  H HB2  . ARG B 2 4   ? -24.599 -18.332 -16.571 1.00 0.00 ? 17   ARG B HB2  1  
ATOM   2003  H HB3  . ARG B 2 4   ? -25.935 -19.202 -15.721 1.00 0.00 ? 17   ARG B HB3  1  
ATOM   2004  H HG2  . ARG B 2 4   ? -24.379 -19.580 -13.813 1.00 0.00 ? 17   ARG B HG2  1  
ATOM   2005  H HG3  . ARG B 2 4   ? -23.087 -18.732 -14.691 1.00 0.00 ? 17   ARG B HG3  1  
ATOM   2006  H HD2  . ARG B 2 4   ? -23.784 -16.813 -13.947 1.00 0.00 ? 17   ARG B HD2  1  
ATOM   2007  H HD3  . ARG B 2 4   ? -25.353 -17.036 -14.715 1.00 0.00 ? 17   ARG B HD3  1  
ATOM   2008  H HE   . ARG B 2 4   ? -24.629 -18.138 -12.017 1.00 0.00 ? 17   ARG B HE   1  
ATOM   2009  H HH11 . ARG B 2 4   ? -27.087 -16.435 -13.984 1.00 0.00 ? 17   ARG B HH11 1  
ATOM   2010  H HH12 . ARG B 2 4   ? -28.240 -16.352 -12.706 1.00 0.00 ? 17   ARG B HH12 1  
ATOM   2011  H HH21 . ARG B 2 4   ? -26.302 -18.179 -10.383 1.00 0.00 ? 17   ARG B HH21 1  
ATOM   2012  H HH22 . ARG B 2 4   ? -27.769 -17.323 -10.639 1.00 0.00 ? 17   ARG B HH22 1  
ATOM   2013  N N    . HIS B 2 5   ? -23.129 -21.943 -14.955 1.00 0.00 ? 18   HIS B N    1  
ATOM   2014  C CA   . HIS B 2 5   ? -22.893 -23.149 -14.182 1.00 0.00 ? 18   HIS B CA   1  
ATOM   2015  C C    . HIS B 2 5   ? -22.681 -22.908 -12.680 1.00 0.00 ? 18   HIS B C    1  
ATOM   2016  O O    . HIS B 2 5   ? -22.806 -23.841 -11.887 1.00 0.00 ? 18   HIS B O    1  
ATOM   2017  C CB   . HIS B 2 5   ? -21.714 -23.846 -14.828 1.00 0.00 ? 18   HIS B CB   1  
ATOM   2018  C CG   . HIS B 2 5   ? -20.416 -23.161 -14.613 1.00 0.00 ? 18   HIS B CG   1  
ATOM   2019  N ND1  . HIS B 2 5   ? -20.188 -21.798 -14.438 1.00 0.00 ? 18   HIS B ND1  1  
ATOM   2020  C CD2  . HIS B 2 5   ? -19.249 -23.824 -14.673 1.00 0.00 ? 18   HIS B CD2  1  
ATOM   2021  C CE1  . HIS B 2 5   ? -18.854 -21.680 -14.374 1.00 0.00 ? 18   HIS B CE1  1  
ATOM   2022  N NE2  . HIS B 2 5   ? -18.263 -22.880 -14.539 1.00 0.00 ? 18   HIS B NE2  1  
ATOM   2023  H H    . HIS B 2 5   ? -22.293 -21.475 -15.282 1.00 0.00 ? 18   HIS B H    1  
ATOM   2024  H HA   . HIS B 2 5   ? -23.694 -23.849 -14.349 1.00 0.00 ? 18   HIS B HA   1  
ATOM   2025  H HB2  . HIS B 2 5   ? -21.636 -24.860 -14.439 1.00 0.00 ? 18   HIS B HB2  1  
ATOM   2026  H HB3  . HIS B 2 5   ? -21.878 -23.903 -15.906 1.00 0.00 ? 18   HIS B HB3  1  
ATOM   2027  H HD2  . HIS B 2 5   ? -19.164 -24.892 -14.812 1.00 0.00 ? 18   HIS B HD2  1  
ATOM   2028  H HE1  . HIS B 2 5   ? -18.334 -20.747 -14.251 1.00 0.00 ? 18   HIS B HE1  1  
ATOM   2029  H HE2  . HIS B 2 5   ? -17.262 -23.067 -14.570 1.00 0.00 ? 18   HIS B HE2  1  
ATOM   2030  N N    . ARG B 2 6   ? -22.372 -21.666 -12.288 1.00 0.00 ? 19   ARG B N    1  
ATOM   2031  C CA   . ARG B 2 6   ? -22.053 -21.231 -10.923 1.00 0.00 ? 19   ARG B CA   1  
ATOM   2032  C C    . ARG B 2 6   ? -22.683 -19.857 -10.721 1.00 0.00 ? 19   ARG B C    1  
ATOM   2033  O O    . ARG B 2 6   ? -23.117 -19.224 -11.683 1.00 0.00 ? 19   ARG B O    1  
ATOM   2034  C CB   . ARG B 2 6   ? -20.515 -21.186 -10.741 1.00 0.00 ? 19   ARG B CB   1  
ATOM   2035  C CG   . ARG B 2 6   ? -19.880 -22.588 -10.785 1.00 0.00 ? 19   ARG B CG   1  
ATOM   2036  C CD   . ARG B 2 6   ? -18.364 -22.597 -10.543 1.00 0.00 ? 19   ARG B CD   1  
ATOM   2037  N NE   . ARG B 2 6   ? -17.874 -23.954 -10.205 1.00 0.00 ? 19   ARG B NE   1  
ATOM   2038  C CZ   . ARG B 2 6   ? -17.707 -25.019 -11.009 1.00 0.00 ? 19   ARG B CZ   1  
ATOM   2039  N NH1  . ARG B 2 6   ? -18.028 -24.976 -12.304 1.00 0.00 ? 19   ARG B NH1  1  
ATOM   2040  N NH2  . ARG B 2 6   ? -17.211 -26.143 -10.502 1.00 0.00 ? 19   ARG B NH2  1  
ATOM   2041  H H    . ARG B 2 6   ? -22.308 -20.941 -12.993 1.00 0.00 ? 19   ARG B H    1  
ATOM   2042  H HA   . ARG B 2 6   ? -22.489 -21.904 -10.179 1.00 0.00 ? 19   ARG B HA   1  
ATOM   2043  H HB2  . ARG B 2 6   ? -20.071 -20.561 -11.520 1.00 0.00 ? 19   ARG B HB2  1  
ATOM   2044  H HB3  . ARG B 2 6   ? -20.290 -20.736 -9.770  1.00 0.00 ? 19   ARG B HB3  1  
ATOM   2045  H HG2  . ARG B 2 6   ? -20.356 -23.206 -10.026 1.00 0.00 ? 19   ARG B HG2  1  
ATOM   2046  H HG3  . ARG B 2 6   ? -20.053 -23.023 -11.763 1.00 0.00 ? 19   ARG B HG3  1  
ATOM   2047  H HD2  . ARG B 2 6   ? -17.842 -22.214 -11.419 1.00 0.00 ? 19   ARG B HD2  1  
ATOM   2048  H HD3  . ARG B 2 6   ? -18.139 -21.934 -9.707  1.00 0.00 ? 19   ARG B HD3  1  
ATOM   2049  H HE   . ARG B 2 6   ? -17.633 -24.068 -9.227  1.00 0.00 ? 19   ARG B HE   1  
ATOM   2050  H HH11 . ARG B 2 6   ? -18.459 -24.148 -12.690 1.00 0.00 ? 19   ARG B HH11 1  
ATOM   2051  H HH12 . ARG B 2 6   ? -17.857 -25.762 -12.924 1.00 0.00 ? 19   ARG B HH12 1  
ATOM   2052  H HH21 . ARG B 2 6   ? -16.965 -26.218 -9.520  1.00 0.00 ? 19   ARG B HH21 1  
ATOM   2053  H HH22 . ARG B 2 6   ? -17.080 -26.976 -11.063 1.00 0.00 ? 19   ARG B HH22 1  
HETATM 2054  N N    . MLY B 2 7   ? -22.758 -19.378 -9.484  1.00 0.00 ? 20   MLY B N    1  
HETATM 2055  C CA   . MLY B 2 7   ? -23.214 -18.030 -9.173  1.00 0.00 ? 20   MLY B CA   1  
HETATM 2056  C CB   . MLY B 2 7   ? -23.491 -17.924 -7.660  1.00 0.00 ? 20   MLY B CB   1  
HETATM 2057  C CG   . MLY B 2 7   ? -23.626 -16.505 -7.077  1.00 0.00 ? 20   MLY B CG   1  
HETATM 2058  C CD   . MLY B 2 7   ? -22.273 -15.903 -6.649  1.00 0.00 ? 20   MLY B CD   1  
HETATM 2059  C CE   . MLY B 2 7   ? -21.990 -14.579 -7.354  1.00 0.00 ? 20   MLY B CE   1  
HETATM 2060  N NZ   . MLY B 2 7   ? -20.609 -14.072 -7.155  1.00 0.00 ? 20   MLY B NZ   1  
HETATM 2061  C CH1  . MLY B 2 7   ? -20.248 -13.658 -5.777  1.00 0.00 ? 20   MLY B CH1  1  
HETATM 2062  C CH2  . MLY B 2 7   ? -19.511 -14.779 -7.867  1.00 0.00 ? 20   MLY B CH2  1  
HETATM 2063  C C    . MLY B 2 7   ? -22.182 -17.052 -9.708  1.00 0.00 ? 20   MLY B C    1  
HETATM 2064  O O    . MLY B 2 7   ? -21.008 -17.089 -9.355  1.00 0.00 ? 20   MLY B O    1  
HETATM 2065  H H    . MLY B 2 7   ? -22.380 -19.937 -8.731  1.00 0.00 ? 20   MLY B H    1  
HETATM 2066  H HA   . MLY B 2 7   ? -24.143 -17.828 -9.714  1.00 0.00 ? 20   MLY B HA   1  
HETATM 2067  H HB2  . MLY B 2 7   ? -22.716 -18.452 -7.101  1.00 0.00 ? 20   MLY B HB2  1  
HETATM 2068  H HB3  . MLY B 2 7   ? -24.425 -18.451 -7.471  1.00 0.00 ? 20   MLY B HB3  1  
HETATM 2069  H HG2  . MLY B 2 7   ? -24.247 -16.572 -6.182  1.00 0.00 ? 20   MLY B HG2  1  
HETATM 2070  H HG3  . MLY B 2 7   ? -24.161 -15.861 -7.778  1.00 0.00 ? 20   MLY B HG3  1  
HETATM 2071  H HD2  . MLY B 2 7   ? -21.462 -16.606 -6.829  1.00 0.00 ? 20   MLY B HD2  1  
HETATM 2072  H HD3  . MLY B 2 7   ? -22.312 -15.699 -5.583  1.00 0.00 ? 20   MLY B HD3  1  
HETATM 2073  H HE2  . MLY B 2 7   ? -22.696 -13.849 -6.980  1.00 0.00 ? 20   MLY B HE2  1  
HETATM 2074  H HE3  . MLY B 2 7   ? -22.197 -14.667 -8.413  1.00 0.00 ? 20   MLY B HE3  1  
HETATM 2075  H HH11 . MLY B 2 7   ? -19.509 -14.333 -5.350  1.00 0.00 ? 20   MLY B HH11 1  
HETATM 2076  H HH12 . MLY B 2 7   ? -19.821 -12.660 -5.813  1.00 0.00 ? 20   MLY B HH12 1  
HETATM 2077  H HH13 . MLY B 2 7   ? -21.117 -13.629 -5.120  1.00 0.00 ? 20   MLY B HH13 1  
HETATM 2078  H HH21 . MLY B 2 7   ? -18.581 -14.223 -7.745  1.00 0.00 ? 20   MLY B HH21 1  
HETATM 2079  H HH22 . MLY B 2 7   ? -19.373 -15.787 -7.475  1.00 0.00 ? 20   MLY B HH22 1  
HETATM 2080  H HH23 . MLY B 2 7   ? -19.711 -14.844 -8.939  1.00 0.00 ? 20   MLY B HH23 1  
HETATM 2081  H HZ   . MLY B 2 7   ? -20.681 -13.171 -7.680  1.00 0.00 ? 20   MLY B HZ   1  
ATOM   2082  N N    . VAL B 2 8   ? -22.690 -16.161 -10.556 1.00 0.00 ? 21   VAL B N    1  
ATOM   2083  C CA   . VAL B 2 8   ? -22.089 -14.957 -11.122 1.00 0.00 ? 21   VAL B CA   1  
ATOM   2084  C C    . VAL B 2 8   ? -23.279 -13.993 -11.315 1.00 0.00 ? 21   VAL B C    1  
ATOM   2085  O O    . VAL B 2 8   ? -24.419 -14.438 -11.156 1.00 0.00 ? 21   VAL B O    1  
ATOM   2086  C CB   . VAL B 2 8   ? -21.361 -15.249 -12.463 1.00 0.00 ? 21   VAL B CB   1  
ATOM   2087  C CG1  . VAL B 2 8   ? -20.184 -14.286 -12.655 1.00 0.00 ? 21   VAL B CG1  1  
ATOM   2088  C CG2  . VAL B 2 8   ? -20.978 -16.713 -12.698 1.00 0.00 ? 21   VAL B CG2  1  
ATOM   2089  H H    . VAL B 2 8   ? -23.688 -16.208 -10.746 1.00 0.00 ? 21   VAL B H    1  
ATOM   2090  H HA   . VAL B 2 8   ? -21.387 -14.531 -10.407 1.00 0.00 ? 21   VAL B HA   1  
ATOM   2091  H HB   . VAL B 2 8   ? -22.037 -15.038 -13.273 1.00 0.00 ? 21   VAL B HB   1  
ATOM   2092  H HG11 . VAL B 2 8   ? -19.517 -14.645 -13.436 1.00 0.00 ? 21   VAL B HG11 1  
ATOM   2093  H HG12 . VAL B 2 8   ? -20.551 -13.302 -12.952 1.00 0.00 ? 21   VAL B HG12 1  
ATOM   2094  H HG13 . VAL B 2 8   ? -19.643 -14.173 -11.718 1.00 0.00 ? 21   VAL B HG13 1  
ATOM   2095  H HG21 . VAL B 2 8   ? -20.315 -16.806 -13.552 1.00 0.00 ? 21   VAL B HG21 1  
ATOM   2096  H HG22 . VAL B 2 8   ? -20.496 -17.139 -11.828 1.00 0.00 ? 21   VAL B HG22 1  
ATOM   2097  H HG23 . VAL B 2 8   ? -21.888 -17.269 -12.916 1.00 0.00 ? 21   VAL B HG23 1  
ATOM   2098  N N    . LEU B 2 9   ? -22.999 -12.763 -11.775 1.00 0.00 ? 22   LEU B N    1  
ATOM   2099  C CA   . LEU B 2 9   ? -23.898 -11.682 -12.225 1.00 0.00 ? 22   LEU B CA   1  
ATOM   2100  C C    . LEU B 2 9   ? -25.117 -11.351 -11.327 1.00 0.00 ? 22   LEU B C    1  
ATOM   2101  O O    . LEU B 2 9   ? -25.482 -12.084 -10.412 1.00 0.00 ? 22   LEU B O    1  
ATOM   2102  C CB   . LEU B 2 9   ? -24.221 -11.731 -13.735 1.00 0.00 ? 22   LEU B CB   1  
ATOM   2103  C CG   . LEU B 2 9   ? -25.009 -12.919 -14.301 1.00 0.00 ? 22   LEU B CG   1  
ATOM   2104  C CD1  . LEU B 2 9   ? -24.118 -14.149 -14.501 1.00 0.00 ? 22   LEU B CD1  1  
ATOM   2105  C CD2  . LEU B 2 9   ? -26.304 -13.185 -13.527 1.00 0.00 ? 22   LEU B CD2  1  
ATOM   2106  H H    . LEU B 2 9   ? -22.020 -12.514 -11.772 1.00 0.00 ? 22   LEU B H    1  
ATOM   2107  H HA   . LEU B 2 9   ? -23.254 -10.814 -12.167 1.00 0.00 ? 22   LEU B HA   1  
ATOM   2108  H HB2  . LEU B 2 9   ? -24.781 -10.829 -13.992 1.00 0.00 ? 22   LEU B HB2  1  
ATOM   2109  H HB3  . LEU B 2 9   ? -23.287 -11.649 -14.292 1.00 0.00 ? 22   LEU B HB3  1  
ATOM   2110  H HG   . LEU B 2 9   ? -25.302 -12.657 -15.304 1.00 0.00 ? 22   LEU B HG   1  
ATOM   2111  H HD11 . LEU B 2 9   ? -23.086 -13.856 -14.737 1.00 0.00 ? 22   LEU B HD11 1  
ATOM   2112  H HD12 . LEU B 2 9   ? -24.132 -14.752 -13.605 1.00 0.00 ? 22   LEU B HD12 1  
ATOM   2113  H HD13 . LEU B 2 9   ? -24.496 -14.752 -15.323 1.00 0.00 ? 22   LEU B HD13 1  
ATOM   2114  H HD21 . LEU B 2 9   ? -26.096 -13.518 -12.509 1.00 0.00 ? 22   LEU B HD21 1  
ATOM   2115  H HD22 . LEU B 2 9   ? -26.884 -12.264 -13.458 1.00 0.00 ? 22   LEU B HD22 1  
ATOM   2116  H HD23 . LEU B 2 9   ? -26.897 -13.941 -14.037 1.00 0.00 ? 22   LEU B HD23 1  
ATOM   2117  N N    . ARG B 2 10  ? -25.767 -10.207 -11.569 1.00 0.00 ? 23   ARG B N    1  
ATOM   2118  C CA   . ARG B 2 10  ? -27.004 -9.777  -10.899 1.00 0.00 ? 23   ARG B CA   1  
ATOM   2119  C C    . ARG B 2 10  ? -27.584 -8.609  -11.708 1.00 0.00 ? 23   ARG B C    1  
ATOM   2120  O O    . ARG B 2 10  ? -27.044 -8.271  -12.765 1.00 0.00 ? 23   ARG B O    1  
ATOM   2121  C CB   . ARG B 2 10  ? -26.707 -9.393  -9.429  1.00 0.00 ? 23   ARG B CB   1  
ATOM   2122  C CG   . ARG B 2 10  ? -27.839 -9.718  -8.441  1.00 0.00 ? 23   ARG B CG   1  
ATOM   2123  C CD   . ARG B 2 10  ? -27.351 -9.514  -6.999  1.00 0.00 ? 23   ARG B CD   1  
ATOM   2124  N NE   . ARG B 2 10  ? -28.394 -9.872  -6.017  1.00 0.00 ? 23   ARG B NE   1  
ATOM   2125  C CZ   . ARG B 2 10  ? -28.235 -10.583 -4.890  1.00 0.00 ? 23   ARG B CZ   1  
ATOM   2126  N NH1  . ARG B 2 10  ? -27.044 -11.071 -4.546  1.00 0.00 ? 23   ARG B NH1  1  
ATOM   2127  N NH2  . ARG B 2 10  ? -29.284 -10.805 -4.103  1.00 0.00 ? 23   ARG B NH2  1  
ATOM   2128  H H    . ARG B 2 10  ? -25.472 -9.608  -12.330 1.00 0.00 ? 23   ARG B H    1  
ATOM   2129  H HA   . ARG B 2 10  ? -27.712 -10.611 -10.918 1.00 0.00 ? 23   ARG B HA   1  
ATOM   2130  H HB2  . ARG B 2 10  ? -25.837 -9.949  -9.082  1.00 0.00 ? 23   ARG B HB2  1  
ATOM   2131  H HB3  . ARG B 2 10  ? -26.464 -8.334  -9.378  1.00 0.00 ? 23   ARG B HB3  1  
ATOM   2132  H HG2  . ARG B 2 10  ? -28.699 -9.076  -8.629  1.00 0.00 ? 23   ARG B HG2  1  
ATOM   2133  H HG3  . ARG B 2 10  ? -28.135 -10.760 -8.567  1.00 0.00 ? 23   ARG B HG3  1  
ATOM   2134  H HD2  . ARG B 2 10  ? -26.462 -10.118 -6.847  1.00 0.00 ? 23   ARG B HD2  1  
ATOM   2135  H HD3  . ARG B 2 10  ? -27.085 -8.467  -6.850  1.00 0.00 ? 23   ARG B HD3  1  
ATOM   2136  H HE   . ARG B 2 10  ? -29.326 -9.532  -6.238  1.00 0.00 ? 23   ARG B HE   1  
ATOM   2137  H HH11 . ARG B 2 10  ? -26.237 -10.956 -5.147  1.00 0.00 ? 23   ARG B HH11 1  
ATOM   2138  H HH12 . ARG B 2 10  ? -26.912 -11.627 -3.707  1.00 0.00 ? 23   ARG B HH12 1  
ATOM   2139  H HH21 . ARG B 2 10  ? -30.201 -10.442 -4.329  1.00 0.00 ? 23   ARG B HH21 1  
ATOM   2140  H HH22 . ARG B 2 10  ? -29.211 -11.341 -3.246  1.00 0.00 ? 23   ARG B HH22 1  
ATOM   2141  N N    . ASP B 2 11  ? -28.659 -7.982  -11.228 1.00 0.00 ? 24   ASP B N    1  
ATOM   2142  C CA   . ASP B 2 11  ? -29.362 -6.894  -11.913 1.00 0.00 ? 24   ASP B CA   1  
ATOM   2143  C C    . ASP B 2 11  ? -29.971 -5.943  -10.880 1.00 0.00 ? 24   ASP B C    1  
ATOM   2144  O O    . ASP B 2 11  ? -30.280 -6.372  -9.766  1.00 0.00 ? 24   ASP B O    1  
ATOM   2145  C CB   . ASP B 2 11  ? -30.482 -7.499  -12.756 1.00 0.00 ? 24   ASP B CB   1  
ATOM   2146  C CG   . ASP B 2 11  ? -31.326 -6.424  -13.463 1.00 0.00 ? 24   ASP B CG   1  
ATOM   2147  O OD1  . ASP B 2 11  ? -30.747 -5.578  -14.183 1.00 0.00 ? 24   ASP B OD1  1  
ATOM   2148  O OD2  . ASP B 2 11  ? -32.570 -6.425  -13.300 1.00 0.00 ? 24   ASP B OD2  1  
ATOM   2149  H H    . ASP B 2 11  ? -29.060 -8.265  -10.343 1.00 0.00 ? 24   ASP B H    1  
ATOM   2150  H HA   . ASP B 2 11  ? -28.675 -6.348  -12.560 1.00 0.00 ? 24   ASP B HA   1  
ATOM   2151  H HB2  . ASP B 2 11  ? -30.045 -8.169  -13.498 1.00 0.00 ? 24   ASP B HB2  1  
ATOM   2152  H HB3  . ASP B 2 11  ? -31.111 -8.086  -12.087 1.00 0.00 ? 24   ASP B HB3  1  
ATOM   2153  N N    . ASN B 2 12  ? -30.150 -4.666  -11.249 1.00 0.00 ? 25   ASN B N    1  
ATOM   2154  C CA   . ASN B 2 12  ? -30.709 -3.595  -10.410 1.00 0.00 ? 25   ASN B CA   1  
ATOM   2155  C C    . ASN B 2 12  ? -29.797 -3.184  -9.260  1.00 0.00 ? 25   ASN B C    1  
ATOM   2156  O O    . ASN B 2 12  ? -30.259 -2.674  -8.234  1.00 0.00 ? 25   ASN B O    1  
ATOM   2157  C CB   . ASN B 2 12  ? -32.122 -3.957  -9.913  1.00 0.00 ? 25   ASN B CB   1  
ATOM   2158  C CG   . ASN B 2 12  ? -33.057 -2.751  -9.893  1.00 0.00 ? 25   ASN B CG   1  
ATOM   2159  O OD1  . ASN B 2 12  ? -33.969 -2.646  -10.712 1.00 0.00 ? 25   ASN B OD1  1  
ATOM   2160  N ND2  . ASN B 2 12  ? -32.863 -1.819  -8.972  1.00 0.00 ? 25   ASN B ND2  1  
ATOM   2161  H H    . ASN B 2 12  ? -29.917 -4.412  -12.203 1.00 0.00 ? 25   ASN B H    1  
ATOM   2162  H HA   . ASN B 2 12  ? -30.766 -2.715  -11.046 1.00 0.00 ? 25   ASN B HA   1  
ATOM   2163  H HB2  . ASN B 2 12  ? -32.519 -4.734  -10.552 1.00 0.00 ? 25   ASN B HB2  1  
ATOM   2164  H HB3  . ASN B 2 12  ? -32.069 -4.397  -8.913  1.00 0.00 ? 25   ASN B HB3  1  
ATOM   2165  H HD21 . ASN B 2 12  ? -32.069 -1.913  -8.342  1.00 0.00 ? 25   ASN B HD21 1  
ATOM   2166  H HD22 . ASN B 2 12  ? -33.460 -1.002  -8.923  1.00 0.00 ? 25   ASN B HD22 1  
ATOM   2167  N N    . ILE B 2 13  ? -28.493 -3.416  -9.421  1.00 0.00 ? 26   ILE B N    1  
ATOM   2168  C CA   . ILE B 2 13  ? -27.533 -3.269  -8.337  1.00 0.00 ? 26   ILE B CA   1  
ATOM   2169  C C    . ILE B 2 13  ? -26.834 -1.904  -8.379  1.00 0.00 ? 26   ILE B C    1  
ATOM   2170  O O    . ILE B 2 13  ? -25.821 -1.693  -7.705  1.00 0.00 ? 26   ILE B O    1  
ATOM   2171  C CB   . ILE B 2 13  ? -26.556 -4.461  -8.323  1.00 0.00 ? 26   ILE B CB   1  
ATOM   2172  C CG1  . ILE B 2 13  ? -25.549 -4.470  -9.494  1.00 0.00 ? 26   ILE B CG1  1  
ATOM   2173  C CG2  . ILE B 2 13  ? -27.360 -5.752  -8.248  1.00 0.00 ? 26   ILE B CG2  1  
ATOM   2174  C CD1  . ILE B 2 13  ? -25.946 -5.152  -10.814 1.00 0.00 ? 26   ILE B CD1  1  
ATOM   2175  H H    . ILE B 2 13  ? -28.159 -3.786  -10.299 1.00 0.00 ? 26   ILE B H    1  
ATOM   2176  H HA   . ILE B 2 13  ? -28.110 -3.317  -7.425  1.00 0.00 ? 26   ILE B HA   1  
ATOM   2177  H HB   . ILE B 2 13  ? -25.974 -4.385  -7.401  1.00 0.00 ? 26   ILE B HB   1  
ATOM   2178  H HG12 . ILE B 2 13  ? -25.344 -3.434  -9.715  1.00 0.00 ? 26   ILE B HG12 1  
ATOM   2179  H HG13 . ILE B 2 13  ? -24.629 -4.940  -9.147  1.00 0.00 ? 26   ILE B HG13 1  
ATOM   2180  H HG21 . ILE B 2 13  ? -28.105 -5.670  -7.457  1.00 0.00 ? 26   ILE B HG21 1  
ATOM   2181  H HG22 . ILE B 2 13  ? -27.876 -5.909  -9.193  1.00 0.00 ? 26   ILE B HG22 1  
ATOM   2182  H HG23 . ILE B 2 13  ? -26.680 -6.567  -8.049  1.00 0.00 ? 26   ILE B HG23 1  
ATOM   2183  H HD11 . ILE B 2 13  ? -26.058 -6.227  -10.667 1.00 0.00 ? 26   ILE B HD11 1  
ATOM   2184  H HD12 . ILE B 2 13  ? -26.875 -4.738  -11.202 1.00 0.00 ? 26   ILE B HD12 1  
ATOM   2185  H HD13 . ILE B 2 13  ? -25.158 -4.991  -11.550 1.00 0.00 ? 26   ILE B HD13 1  
ATOM   2186  N N    . GLN B 2 14  ? -27.362 -0.998  -9.206  1.00 0.00 ? 27   GLN B N    1  
ATOM   2187  C CA   . GLN B 2 14  ? -26.752 0.256   -9.578  1.00 0.00 ? 27   GLN B CA   1  
ATOM   2188  C C    . GLN B 2 14  ? -27.774 1.372   -9.365  1.00 0.00 ? 27   GLN B C    1  
ATOM   2189  O O    . GLN B 2 14  ? -27.415 2.399   -8.747  1.00 0.00 ? 27   GLN B O    1  
ATOM   2190  C CB   . GLN B 2 14  ? -26.329 0.160   -11.055 1.00 0.00 ? 27   GLN B CB   1  
ATOM   2191  C CG   . GLN B 2 14  ? -25.184 -0.830  -11.313 1.00 0.00 ? 27   GLN B CG   1  
ATOM   2192  C CD   . GLN B 2 14  ? -24.688 -0.745  -12.761 1.00 0.00 ? 27   GLN B CD   1  
ATOM   2193  O OE1  . GLN B 2 14  ? -25.117 -1.498  -13.633 1.00 0.00 ? 27   GLN B OE1  1  
ATOM   2194  N NE2  . GLN B 2 14  ? -23.775 0.170   -13.060 1.00 0.00 ? 27   GLN B NE2  1  
ATOM   2195  O OXT  . GLN B 2 14  ? -28.941 1.210   -9.795  1.00 0.00 ? 27   GLN B OXT  1  
ATOM   2196  H H    . GLN B 2 14  ? -28.266 -1.181  -9.612  1.00 0.00 ? 27   GLN B H    1  
ATOM   2197  H HA   . GLN B 2 14  ? -25.878 0.417   -8.950  1.00 0.00 ? 27   GLN B HA   1  
ATOM   2198  H HB2  . GLN B 2 14  ? -27.186 -0.180  -11.638 1.00 0.00 ? 27   GLN B HB2  1  
ATOM   2199  H HB3  . GLN B 2 14  ? -26.028 1.150   -11.397 1.00 0.00 ? 27   GLN B HB3  1  
ATOM   2200  H HG2  . GLN B 2 14  ? -24.354 -0.633  -10.631 1.00 0.00 ? 27   GLN B HG2  1  
ATOM   2201  H HG3  . GLN B 2 14  ? -25.549 -1.843  -11.135 1.00 0.00 ? 27   GLN B HG3  1  
ATOM   2202  H HE21 . GLN B 2 14  ? -23.424 0.793   -12.341 1.00 0.00 ? 27   GLN B HE21 1  
ATOM   2203  H HE22 . GLN B 2 14  ? -23.429 0.249   -14.010 1.00 0.00 ? 27   GLN B HE22 1  
ATOM   2204  N N    . GLY A 1 1   ? 3.163   4.667   -1.212  1.00 0.00 ? -3   GLY A N    2  
ATOM   2205  C CA   . GLY A 1 1   ? 2.156   3.774   -1.835  1.00 0.00 ? -3   GLY A CA   2  
ATOM   2206  C C    . GLY A 1 1   ? 1.208   4.546   -2.754  1.00 0.00 ? -3   GLY A C    2  
ATOM   2207  O O    . GLY A 1 1   ? 0.689   5.600   -2.377  1.00 0.00 ? -3   GLY A O    2  
ATOM   2208  H H1   . GLY A 1 1   ? 3.717   5.114   -1.927  1.00 0.00 ? -3   GLY A H1   2  
ATOM   2209  H H2   . GLY A 1 1   ? 2.699   5.381   -0.672  1.00 0.00 ? -3   GLY A H2   2  
ATOM   2210  H H3   . GLY A 1 1   ? 3.771   4.140   -0.607  1.00 0.00 ? -3   GLY A H3   2  
ATOM   2211  H HA2  . GLY A 1 1   ? 2.676   3.000   -2.407  1.00 0.00 ? -3   GLY A HA2  2  
ATOM   2212  H HA3  . GLY A 1 1   ? 1.566   3.293   -1.053  1.00 0.00 ? -3   GLY A HA3  2  
ATOM   2213  N N    . HIS A 1 2   ? 0.963   4.027   -3.966  1.00 0.00 ? -2   HIS A N    2  
ATOM   2214  C CA   . HIS A 1 2   ? 0.097   4.687   -4.954  1.00 0.00 ? -2   HIS A CA   2  
ATOM   2215  C C    . HIS A 1 2   ? -1.374  4.709   -4.515  1.00 0.00 ? -2   HIS A C    2  
ATOM   2216  O O    . HIS A 1 2   ? -2.125  5.613   -4.892  1.00 0.00 ? -2   HIS A O    2  
ATOM   2217  C CB   . HIS A 1 2   ? 0.235   3.982   -6.311  1.00 0.00 ? -2   HIS A CB   2  
ATOM   2218  C CG   . HIS A 1 2   ? -0.440  4.729   -7.440  1.00 0.00 ? -2   HIS A CG   2  
ATOM   2219  N ND1  . HIS A 1 2   ? -0.111  6.023   -7.868  1.00 0.00 ? -2   HIS A ND1  2  
ATOM   2220  C CD2  . HIS A 1 2   ? -1.463  4.251   -8.208  1.00 0.00 ? -2   HIS A CD2  2  
ATOM   2221  C CE1  . HIS A 1 2   ? -0.951  6.292   -8.884  1.00 0.00 ? -2   HIS A CE1  2  
ATOM   2222  N NE2  . HIS A 1 2   ? -1.769  5.248   -9.110  1.00 0.00 ? -2   HIS A NE2  2  
ATOM   2223  H H    . HIS A 1 2   ? 1.408   3.159   -4.239  1.00 0.00 ? -2   HIS A H    2  
ATOM   2224  H HA   . HIS A 1 2   ? 0.434   5.720   -5.074  1.00 0.00 ? -2   HIS A HA   2  
ATOM   2225  H HB2  . HIS A 1 2   ? 1.297   3.888   -6.552  1.00 0.00 ? -2   HIS A HB2  2  
ATOM   2226  H HB3  . HIS A 1 2   ? -0.190  2.977   -6.241  1.00 0.00 ? -2   HIS A HB3  2  
ATOM   2227  H HD2  . HIS A 1 2   ? -1.944  3.282   -8.130  1.00 0.00 ? -2   HIS A HD2  2  
ATOM   2228  H HE1  . HIS A 1 2   ? -0.973  7.217   -9.443  1.00 0.00 ? -2   HIS A HE1  2  
ATOM   2229  H HE2  . HIS A 1 2   ? -2.488  5.215   -9.826  1.00 0.00 ? -2   HIS A HE2  2  
ATOM   2230  N N    . MET A 1 3   ? -1.791  3.723   -3.712  1.00 0.00 ? -1   MET A N    2  
ATOM   2231  C CA   . MET A 1 3   ? -3.163  3.536   -3.244  1.00 0.00 ? -1   MET A CA   2  
ATOM   2232  C C    . MET A 1 3   ? -3.147  3.134   -1.766  1.00 0.00 ? -1   MET A C    2  
ATOM   2233  O O    . MET A 1 3   ? -2.105  2.754   -1.218  1.00 0.00 ? -1   MET A O    2  
ATOM   2234  C CB   . MET A 1 3   ? -3.858  2.452   -4.084  1.00 0.00 ? -1   MET A CB   2  
ATOM   2235  C CG   . MET A 1 3   ? -4.057  2.856   -5.551  1.00 0.00 ? -1   MET A CG   2  
ATOM   2236  S SD   . MET A 1 3   ? -4.791  1.569   -6.602  1.00 0.00 ? -1   MET A SD   2  
ATOM   2237  C CE   . MET A 1 3   ? -3.401  0.402   -6.700  1.00 0.00 ? -1   MET A CE   2  
ATOM   2238  H H    . MET A 1 3   ? -1.112  3.049   -3.381  1.00 0.00 ? -1   MET A H    2  
ATOM   2239  H HA   . MET A 1 3   ? -3.722  4.466   -3.341  1.00 0.00 ? -1   MET A HA   2  
ATOM   2240  H HB2  . MET A 1 3   ? -3.262  1.539   -4.039  1.00 0.00 ? -1   MET A HB2  2  
ATOM   2241  H HB3  . MET A 1 3   ? -4.842  2.238   -3.662  1.00 0.00 ? -1   MET A HB3  2  
ATOM   2242  H HG2  . MET A 1 3   ? -4.706  3.730   -5.581  1.00 0.00 ? -1   MET A HG2  2  
ATOM   2243  H HG3  . MET A 1 3   ? -3.099  3.140   -5.986  1.00 0.00 ? -1   MET A HG3  2  
ATOM   2244  H HE1  . MET A 1 3   ? -3.636  -0.394  -7.406  1.00 0.00 ? -1   MET A HE1  2  
ATOM   2245  H HE2  . MET A 1 3   ? -2.501  0.923   -7.035  1.00 0.00 ? -1   MET A HE2  2  
ATOM   2246  H HE3  . MET A 1 3   ? -3.211  -0.036  -5.717  1.00 0.00 ? -1   MET A HE3  2  
ATOM   2247  N N    . ASN A 1 4   ? -4.318  3.214   -1.127  1.00 0.00 ? 1484 ASN A N    2  
ATOM   2248  C CA   . ASN A 1 4   ? -4.535  2.753   0.243   1.00 0.00 ? 1484 ASN A CA   2  
ATOM   2249  C C    . ASN A 1 4   ? -4.308  1.249   0.357   1.00 0.00 ? 1484 ASN A C    2  
ATOM   2250  O O    . ASN A 1 4   ? -4.530  0.510   -0.599  1.00 0.00 ? 1484 ASN A O    2  
ATOM   2251  C CB   . ASN A 1 4   ? -5.971  3.104   0.669   1.00 0.00 ? 1484 ASN A CB   2  
ATOM   2252  C CG   . ASN A 1 4   ? -6.269  2.651   2.092   1.00 0.00 ? 1484 ASN A CG   2  
ATOM   2253  O OD1  . ASN A 1 4   ? -5.517  2.940   3.020   1.00 0.00 ? 1484 ASN A OD1  2  
ATOM   2254  N ND2  . ASN A 1 4   ? -7.359  1.934   2.294   1.00 0.00 ? 1484 ASN A ND2  2  
ATOM   2255  H H    . ASN A 1 4   ? -5.128  3.527   -1.646  1.00 0.00 ? 1484 ASN A H    2  
ATOM   2256  H HA   . ASN A 1 4   ? -3.835  3.252   0.909   1.00 0.00 ? 1484 ASN A HA   2  
ATOM   2257  H HB2  . ASN A 1 4   ? -6.123  4.182   0.610   1.00 0.00 ? 1484 ASN A HB2  2  
ATOM   2258  H HB3  . ASN A 1 4   ? -6.666  2.616   -0.018  1.00 0.00 ? 1484 ASN A HB3  2  
ATOM   2259  H HD21 . ASN A 1 4   ? -7.955  1.673   1.509   1.00 0.00 ? 1484 ASN A HD21 2  
ATOM   2260  H HD22 . ASN A 1 4   ? -7.588  1.629   3.232   1.00 0.00 ? 1484 ASN A HD22 2  
ATOM   2261  N N    . SER A 1 5   ? -3.904  0.774   1.532   1.00 0.00 ? 1485 SER A N    2  
ATOM   2262  C CA   . SER A 1 5   ? -3.748  -0.643  1.821   1.00 0.00 ? 1485 SER A CA   2  
ATOM   2263  C C    . SER A 1 5   ? -5.083  -1.372  1.667   1.00 0.00 ? 1485 SER A C    2  
ATOM   2264  O O    . SER A 1 5   ? -5.977  -1.172  2.490   1.00 0.00 ? 1485 SER A O    2  
ATOM   2265  C CB   . SER A 1 5   ? -3.220  -0.792  3.253   1.00 0.00 ? 1485 SER A CB   2  
ATOM   2266  O OG   . SER A 1 5   ? -1.984  -0.099  3.401   1.00 0.00 ? 1485 SER A OG   2  
ATOM   2267  H H    . SER A 1 5   ? -3.727  1.413   2.295   1.00 0.00 ? 1485 SER A H    2  
ATOM   2268  H HA   . SER A 1 5   ? -3.032  -1.072  1.114   1.00 0.00 ? 1485 SER A HA   2  
ATOM   2269  H HB2  . SER A 1 5   ? -3.952  -0.374  3.951   1.00 0.00 ? 1485 SER A HB2  2  
ATOM   2270  H HB3  . SER A 1 5   ? -3.094  -1.849  3.484   1.00 0.00 ? 1485 SER A HB3  2  
ATOM   2271  H HG   . SER A 1 5   ? -1.652  -0.228  4.314   1.00 0.00 ? 1485 SER A HG   2  
ATOM   2272  N N    . PHE A 1 6   ? -5.181  -2.250  0.660   1.00 0.00 ? 1486 PHE A N    2  
ATOM   2273  C CA   . PHE A 1 6   ? -6.283  -3.172  0.373   1.00 0.00 ? 1486 PHE A CA   2  
ATOM   2274  C C    . PHE A 1 6   ? -7.605  -2.479  0.073   1.00 0.00 ? 1486 PHE A C    2  
ATOM   2275  O O    . PHE A 1 6   ? -8.100  -2.554  -1.046  1.00 0.00 ? 1486 PHE A O    2  
ATOM   2276  C CB   . PHE A 1 6   ? -6.396  -4.213  1.497   1.00 0.00 ? 1486 PHE A CB   2  
ATOM   2277  C CG   . PHE A 1 6   ? -5.109  -4.977  1.677   1.00 0.00 ? 1486 PHE A CG   2  
ATOM   2278  C CD1  . PHE A 1 6   ? -4.794  -6.005  0.772   1.00 0.00 ? 1486 PHE A CD1  2  
ATOM   2279  C CD2  . PHE A 1 6   ? -4.230  -4.664  2.730   1.00 0.00 ? 1486 PHE A CD2  2  
ATOM   2280  C CE1  . PHE A 1 6   ? -3.614  -6.744  0.942   1.00 0.00 ? 1486 PHE A CE1  2  
ATOM   2281  C CE2  . PHE A 1 6   ? -3.042  -5.399  2.886   1.00 0.00 ? 1486 PHE A CE2  2  
ATOM   2282  C CZ   . PHE A 1 6   ? -2.735  -6.442  1.996   1.00 0.00 ? 1486 PHE A CZ   2  
ATOM   2283  H H    . PHE A 1 6   ? -4.399  -2.289  0.014   1.00 0.00 ? 1486 PHE A H    2  
ATOM   2284  H HA   . PHE A 1 6   ? -6.039  -3.731  -0.528  1.00 0.00 ? 1486 PHE A HA   2  
ATOM   2285  H HB2  . PHE A 1 6   ? -6.663  -3.743  2.440   1.00 0.00 ? 1486 PHE A HB2  2  
ATOM   2286  H HB3  . PHE A 1 6   ? -7.192  -4.922  1.272   1.00 0.00 ? 1486 PHE A HB3  2  
ATOM   2287  H HD1  . PHE A 1 6   ? -5.459  -6.222  -0.052  1.00 0.00 ? 1486 PHE A HD1  2  
ATOM   2288  H HD2  . PHE A 1 6   ? -4.464  -3.860  3.418   1.00 0.00 ? 1486 PHE A HD2  2  
ATOM   2289  H HE1  . PHE A 1 6   ? -3.397  -7.543  0.253   1.00 0.00 ? 1486 PHE A HE1  2  
ATOM   2290  H HE2  . PHE A 1 6   ? -2.361  -5.164  3.698   1.00 0.00 ? 1486 PHE A HE2  2  
ATOM   2291  H HZ   . PHE A 1 6   ? -1.822  -7.009  2.121   1.00 0.00 ? 1486 PHE A HZ   2  
ATOM   2292  N N    . VAL A 1 7   ? -8.189  -1.827  1.063   1.00 0.00 ? 1487 VAL A N    2  
ATOM   2293  C CA   . VAL A 1 7   ? -9.512  -1.247  1.029   1.00 0.00 ? 1487 VAL A CA   2  
ATOM   2294  C C    . VAL A 1 7   ? -9.562  -0.192  -0.083  1.00 0.00 ? 1487 VAL A C    2  
ATOM   2295  O O    . VAL A 1 7   ? -8.895  0.842   0.009   1.00 0.00 ? 1487 VAL A O    2  
ATOM   2296  C CB   . VAL A 1 7   ? -9.872  -0.729  2.440   1.00 0.00 ? 1487 VAL A CB   2  
ATOM   2297  C CG1  . VAL A 1 7   ? -11.369 -0.441  2.482   1.00 0.00 ? 1487 VAL A CG1  2  
ATOM   2298  C CG2  . VAL A 1 7   ? -9.574  -1.770  3.538   1.00 0.00 ? 1487 VAL A CG2  2  
ATOM   2299  H H    . VAL A 1 7   ? -7.647  -1.711  1.912   1.00 0.00 ? 1487 VAL A H    2  
ATOM   2300  H HA   . VAL A 1 7   ? -10.206 -2.043  0.772   1.00 0.00 ? 1487 VAL A HA   2  
ATOM   2301  H HB   . VAL A 1 7   ? -9.315  0.176   2.665   1.00 0.00 ? 1487 VAL A HB   2  
ATOM   2302  H HG11 . VAL A 1 7   ? -11.692 -0.159  3.488   1.00 0.00 ? 1487 VAL A HG11 2  
ATOM   2303  H HG12 . VAL A 1 7   ? -11.621 0.370   1.792   1.00 0.00 ? 1487 VAL A HG12 2  
ATOM   2304  H HG13 . VAL A 1 7   ? -11.899 -1.340  2.176   1.00 0.00 ? 1487 VAL A HG13 2  
ATOM   2305  H HG21 . VAL A 1 7   ? -10.037 -2.729  3.299   1.00 0.00 ? 1487 VAL A HG21 2  
ATOM   2306  H HG22 . VAL A 1 7   ? -8.499  -1.911  3.658   1.00 0.00 ? 1487 VAL A HG22 2  
ATOM   2307  H HG23 . VAL A 1 7   ? -9.947  -1.407  4.499   1.00 0.00 ? 1487 VAL A HG23 2  
ATOM   2308  N N    . GLY A 1 8   ? -10.330 -0.494  -1.138  1.00 0.00 ? 1488 GLY A N    2  
ATOM   2309  C CA   . GLY A 1 8   ? -10.543 0.340   -2.311  1.00 0.00 ? 1488 GLY A CA   2  
ATOM   2310  C C    . GLY A 1 8   ? -9.978  -0.287  -3.594  1.00 0.00 ? 1488 GLY A C    2  
ATOM   2311  O O    . GLY A 1 8   ? -10.395 0.101   -4.687  1.00 0.00 ? 1488 GLY A O    2  
ATOM   2312  H H    . GLY A 1 8   ? -10.883 -1.346  -1.101  1.00 0.00 ? 1488 GLY A H    2  
ATOM   2313  H HA2  . GLY A 1 8   ? -11.622 0.485   -2.429  1.00 0.00 ? 1488 GLY A HA2  2  
ATOM   2314  H HA3  . GLY A 1 8   ? -10.071 1.311   -2.156  1.00 0.00 ? 1488 GLY A HA3  2  
ATOM   2315  N N    . LEU A 1 9   ? -9.048  -1.251  -3.495  1.00 0.00 ? 1489 LEU A N    2  
ATOM   2316  C CA   . LEU A 1 9   ? -8.383  -1.844  -4.662  1.00 0.00 ? 1489 LEU A CA   2  
ATOM   2317  C C    . LEU A 1 9   ? -9.325  -2.783  -5.394  1.00 0.00 ? 1489 LEU A C    2  
ATOM   2318  O O    . LEU A 1 9   ? -10.028 -3.581  -4.771  1.00 0.00 ? 1489 LEU A O    2  
ATOM   2319  C CB   . LEU A 1 9   ? -7.106  -2.615  -4.262  1.00 0.00 ? 1489 LEU A CB   2  
ATOM   2320  C CG   . LEU A 1 9   ? -5.829  -1.783  -4.016  1.00 0.00 ? 1489 LEU A CG   2  
ATOM   2321  C CD1  . LEU A 1 9   ? -6.012  -0.588  -3.082  1.00 0.00 ? 1489 LEU A CD1  2  
ATOM   2322  C CD2  . LEU A 1 9   ? -4.739  -2.699  -3.439  1.00 0.00 ? 1489 LEU A CD2  2  
ATOM   2323  H H    . LEU A 1 9   ? -8.763  -1.577  -2.575  1.00 0.00 ? 1489 LEU A H    2  
ATOM   2324  H HA   . LEU A 1 9   ? -8.109  -1.072  -5.372  1.00 0.00 ? 1489 LEU A HA   2  
ATOM   2325  H HB2  . LEU A 1 9   ? -7.326  -3.221  -3.391  1.00 0.00 ? 1489 LEU A HB2  2  
ATOM   2326  H HB3  . LEU A 1 9   ? -6.866  -3.311  -5.070  1.00 0.00 ? 1489 LEU A HB3  2  
ATOM   2327  H HG   . LEU A 1 9   ? -5.483  -1.398  -4.973  1.00 0.00 ? 1489 LEU A HG   2  
ATOM   2328  H HD11 . LEU A 1 9   ? -6.360  -0.913  -2.103  1.00 0.00 ? 1489 LEU A HD11 2  
ATOM   2329  H HD12 . LEU A 1 9   ? -5.053  -0.084  -2.957  1.00 0.00 ? 1489 LEU A HD12 2  
ATOM   2330  H HD13 . LEU A 1 9   ? -6.713  0.130   -3.504  1.00 0.00 ? 1489 LEU A HD13 2  
ATOM   2331  H HD21 . LEU A 1 9   ? -3.820  -2.133  -3.281  1.00 0.00 ? 1489 LEU A HD21 2  
ATOM   2332  H HD22 . LEU A 1 9   ? -5.059  -3.124  -2.485  1.00 0.00 ? 1489 LEU A HD22 2  
ATOM   2333  H HD23 . LEU A 1 9   ? -4.539  -3.514  -4.133  1.00 0.00 ? 1489 LEU A HD23 2  
ATOM   2334  N N    . ARG A 1 10  ? -9.289  -2.711  -6.727  1.00 0.00 ? 1490 ARG A N    2  
ATOM   2335  C CA   . ARG A 1 10  ? -9.940  -3.689  -7.589  1.00 0.00 ? 1490 ARG A CA   2  
ATOM   2336  C C    . ARG A 1 10  ? -8.987  -4.879  -7.657  1.00 0.00 ? 1490 ARG A C    2  
ATOM   2337  O O    . ARG A 1 10  ? -7.802  -4.711  -7.947  1.00 0.00 ? 1490 ARG A O    2  
ATOM   2338  C CB   . ARG A 1 10  ? -10.188 -3.132  -8.998  1.00 0.00 ? 1490 ARG A CB   2  
ATOM   2339  C CG   . ARG A 1 10  ? -11.178 -1.952  -8.998  1.00 0.00 ? 1490 ARG A CG   2  
ATOM   2340  C CD   . ARG A 1 10  ? -11.619 -1.529  -10.407 1.00 0.00 ? 1490 ARG A CD   2  
ATOM   2341  N NE   . ARG A 1 10  ? -12.756 -2.328  -10.915 1.00 0.00 ? 1490 ARG A NE   2  
ATOM   2342  C CZ   . ARG A 1 10  ? -13.105 -2.479  -12.203 1.00 0.00 ? 1490 ARG A CZ   2  
ATOM   2343  N NH1  . ARG A 1 10  ? -12.338 -2.020  -13.185 1.00 0.00 ? 1490 ARG A NH1  2  
ATOM   2344  N NH2  . ARG A 1 10  ? -14.232 -3.097  -12.516 1.00 0.00 ? 1490 ARG A NH2  2  
ATOM   2345  H H    . ARG A 1 10  ? -8.647  -2.060  -7.163  1.00 0.00 ? 1490 ARG A H    2  
ATOM   2346  H HA   . ARG A 1 10  ? -10.893 -3.997  -7.143  1.00 0.00 ? 1490 ARG A HA   2  
ATOM   2347  H HB2  . ARG A 1 10  ? -9.244  -2.810  -9.443  1.00 0.00 ? 1490 ARG A HB2  2  
ATOM   2348  H HB3  . ARG A 1 10  ? -10.584 -3.946  -9.601  1.00 0.00 ? 1490 ARG A HB3  2  
ATOM   2349  H HG2  . ARG A 1 10  ? -12.058 -2.212  -8.416  1.00 0.00 ? 1490 ARG A HG2  2  
ATOM   2350  H HG3  . ARG A 1 10  ? -10.691 -1.100  -8.522  1.00 0.00 ? 1490 ARG A HG3  2  
ATOM   2351  H HD2  . ARG A 1 10  ? -11.946 -0.486  -10.359 1.00 0.00 ? 1490 ARG A HD2  2  
ATOM   2352  H HD3  . ARG A 1 10  ? -10.762 -1.596  -11.080 1.00 0.00 ? 1490 ARG A HD3  2  
ATOM   2353  H HE   . ARG A 1 10  ? -13.320 -2.799  -10.214 1.00 0.00 ? 1490 ARG A HE   2  
ATOM   2354  H HH11 . ARG A 1 10  ? -11.493 -1.495  -12.999 1.00 0.00 ? 1490 ARG A HH11 2  
ATOM   2355  H HH12 . ARG A 1 10  ? -12.564 -2.235  -14.164 1.00 0.00 ? 1490 ARG A HH12 2  
ATOM   2356  H HH21 . ARG A 1 10  ? -14.883 -3.444  -11.802 1.00 0.00 ? 1490 ARG A HH21 2  
ATOM   2357  H HH22 . ARG A 1 10  ? -14.539 -3.162  -13.498 1.00 0.00 ? 1490 ARG A HH22 2  
ATOM   2358  N N    . VAL A 1 11  ? -9.506  -6.057  -7.349  1.00 0.00 ? 1491 VAL A N    2  
ATOM   2359  C CA   . VAL A 1 11  ? -8.783  -7.314  -7.210  1.00 0.00 ? 1491 VAL A CA   2  
ATOM   2360  C C    . VAL A 1 11  ? -9.689  -8.422  -7.776  1.00 0.00 ? 1491 VAL A C    2  
ATOM   2361  O O    . VAL A 1 11  ? -10.736 -8.138  -8.368  1.00 0.00 ? 1491 VAL A O    2  
ATOM   2362  C CB   . VAL A 1 11  ? -8.380  -7.497  -5.728  1.00 0.00 ? 1491 VAL A CB   2  
ATOM   2363  C CG1  . VAL A 1 11  ? -7.466  -6.364  -5.234  1.00 0.00 ? 1491 VAL A CG1  2  
ATOM   2364  C CG2  . VAL A 1 11  ? -9.577  -7.577  -4.780  1.00 0.00 ? 1491 VAL A CG2  2  
ATOM   2365  H H    . VAL A 1 11  ? -10.491 -6.101  -7.112  1.00 0.00 ? 1491 VAL A H    2  
ATOM   2366  H HA   . VAL A 1 11  ? -7.861  -7.312  -7.788  1.00 0.00 ? 1491 VAL A HA   2  
ATOM   2367  H HB   . VAL A 1 11  ? -7.821  -8.423  -5.619  1.00 0.00 ? 1491 VAL A HB   2  
ATOM   2368  H HG11 . VAL A 1 11  ? -7.054  -6.623  -4.261  1.00 0.00 ? 1491 VAL A HG11 2  
ATOM   2369  H HG12 . VAL A 1 11  ? -6.647  -6.208  -5.937  1.00 0.00 ? 1491 VAL A HG12 2  
ATOM   2370  H HG13 . VAL A 1 11  ? -8.032  -5.436  -5.126  1.00 0.00 ? 1491 VAL A HG13 2  
ATOM   2371  H HG21 . VAL A 1 11  ? -10.238 -8.391  -5.083  1.00 0.00 ? 1491 VAL A HG21 2  
ATOM   2372  H HG22 . VAL A 1 11  ? -9.218  -7.778  -3.770  1.00 0.00 ? 1491 VAL A HG22 2  
ATOM   2373  H HG23 . VAL A 1 11  ? -10.139 -6.642  -4.790  1.00 0.00 ? 1491 VAL A HG23 2  
ATOM   2374  N N    . VAL A 1 12  ? -9.329  -9.685  -7.580  1.00 0.00 ? 1492 VAL A N    2  
ATOM   2375  C CA   . VAL A 1 12  ? -10.183 -10.834 -7.855  1.00 0.00 ? 1492 VAL A CA   2  
ATOM   2376  C C    . VAL A 1 12  ? -10.219 -11.621 -6.547  1.00 0.00 ? 1492 VAL A C    2  
ATOM   2377  O O    . VAL A 1 12  ? -9.277  -11.545 -5.762  1.00 0.00 ? 1492 VAL A O    2  
ATOM   2378  C CB   . VAL A 1 12  ? -9.639  -11.645 -9.051  1.00 0.00 ? 1492 VAL A CB   2  
ATOM   2379  C CG1  . VAL A 1 12  ? -10.573 -12.764 -9.528  1.00 0.00 ? 1492 VAL A CG1  2  
ATOM   2380  C CG2  . VAL A 1 12  ? -9.385  -10.775 -10.282 1.00 0.00 ? 1492 VAL A CG2  2  
ATOM   2381  H H    . VAL A 1 12  ? -8.450  -9.879  -7.107  1.00 0.00 ? 1492 VAL A H    2  
ATOM   2382  H HA   . VAL A 1 12  ? -11.191 -10.502 -8.083  1.00 0.00 ? 1492 VAL A HA   2  
ATOM   2383  H HB   . VAL A 1 12  ? -8.698  -12.099 -8.757  1.00 0.00 ? 1492 VAL A HB   2  
ATOM   2384  H HG11 . VAL A 1 12  ? -10.979 -13.302 -8.679  1.00 0.00 ? 1492 VAL A HG11 2  
ATOM   2385  H HG12 . VAL A 1 12  ? -11.393 -12.352 -10.117 1.00 0.00 ? 1492 VAL A HG12 2  
ATOM   2386  H HG13 . VAL A 1 12  ? -10.021 -13.464 -10.156 1.00 0.00 ? 1492 VAL A HG13 2  
ATOM   2387  H HG21 . VAL A 1 12  ? -8.693  -9.990  -10.005 1.00 0.00 ? 1492 VAL A HG21 2  
ATOM   2388  H HG22 . VAL A 1 12  ? -8.937  -11.381 -11.075 1.00 0.00 ? 1492 VAL A HG22 2  
ATOM   2389  H HG23 . VAL A 1 12  ? -10.309 -10.308 -10.632 1.00 0.00 ? 1492 VAL A HG23 2  
ATOM   2390  N N    . ALA A 1 13  ? -11.295 -12.345 -6.259  1.00 0.00 ? 1493 ALA A N    2  
ATOM   2391  C CA   . ALA A 1 13  ? -11.517 -12.972 -4.968  1.00 0.00 ? 1493 ALA A CA   2  
ATOM   2392  C C    . ALA A 1 13  ? -12.269 -14.273 -5.188  1.00 0.00 ? 1493 ALA A C    2  
ATOM   2393  O O    . ALA A 1 13  ? -13.081 -14.338 -6.112  1.00 0.00 ? 1493 ALA A O    2  
ATOM   2394  C CB   . ALA A 1 13  ? -12.346 -11.993 -4.138  1.00 0.00 ? 1493 ALA A CB   2  
ATOM   2395  H H    . ALA A 1 13  ? -12.071 -12.376 -6.910  1.00 0.00 ? 1493 ALA A H    2  
ATOM   2396  H HA   . ALA A 1 13  ? -10.569 -13.174 -4.477  1.00 0.00 ? 1493 ALA A HA   2  
ATOM   2397  H HB1  . ALA A 1 13  ? -13.334 -11.864 -4.573  1.00 0.00 ? 1493 ALA A HB1  2  
ATOM   2398  H HB2  . ALA A 1 13  ? -12.452 -12.358 -3.120  1.00 0.00 ? 1493 ALA A HB2  2  
ATOM   2399  H HB3  . ALA A 1 13  ? -11.854 -11.020 -4.138  1.00 0.00 ? 1493 ALA A HB3  2  
ATOM   2400  N N    . LYS A 1 14  ? -12.066 -15.290 -4.351  1.00 0.00 ? 1494 LYS A N    2  
ATOM   2401  C CA   . LYS A 1 14  ? -12.809 -16.539 -4.495  1.00 0.00 ? 1494 LYS A CA   2  
ATOM   2402  C C    . LYS A 1 14  ? -14.139 -16.330 -3.815  1.00 0.00 ? 1494 LYS A C    2  
ATOM   2403  O O    . LYS A 1 14  ? -14.208 -15.814 -2.704  1.00 0.00 ? 1494 LYS A O    2  
ATOM   2404  C CB   . LYS A 1 14  ? -12.101 -17.723 -3.820  1.00 0.00 ? 1494 LYS A CB   2  
ATOM   2405  C CG   . LYS A 1 14  ? -12.938 -19.010 -3.910  1.00 0.00 ? 1494 LYS A CG   2  
ATOM   2406  C CD   . LYS A 1 14  ? -12.092 -20.230 -3.505  1.00 0.00 ? 1494 LYS A CD   2  
ATOM   2407  C CE   . LYS A 1 14  ? -12.875 -21.534 -3.716  1.00 0.00 ? 1494 LYS A CE   2  
ATOM   2408  N NZ   . LYS A 1 14  ? -12.195 -22.723 -3.123  1.00 0.00 ? 1494 LYS A NZ   2  
ATOM   2409  H H    . LYS A 1 14  ? -11.444 -15.168 -3.560  1.00 0.00 ? 1494 LYS A H    2  
ATOM   2410  H HA   . LYS A 1 14  ? -12.960 -16.774 -5.551  1.00 0.00 ? 1494 LYS A HA   2  
ATOM   2411  H HB2  . LYS A 1 14  ? -11.135 -17.876 -4.294  1.00 0.00 ? 1494 LYS A HB2  2  
ATOM   2412  H HB3  . LYS A 1 14  ? -11.952 -17.502 -2.765  1.00 0.00 ? 1494 LYS A HB3  2  
ATOM   2413  H HG2  . LYS A 1 14  ? -13.801 -18.921 -3.239  1.00 0.00 ? 1494 LYS A HG2  2  
ATOM   2414  H HG3  . LYS A 1 14  ? -13.332 -19.132 -4.921  1.00 0.00 ? 1494 LYS A HG3  2  
ATOM   2415  H HD2  . LYS A 1 14  ? -11.180 -20.265 -4.110  1.00 0.00 ? 1494 LYS A HD2  2  
ATOM   2416  H HD3  . LYS A 1 14  ? -11.809 -20.122 -2.455  1.00 0.00 ? 1494 LYS A HD3  2  
ATOM   2417  H HE2  . LYS A 1 14  ? -13.863 -21.408 -3.266  1.00 0.00 ? 1494 LYS A HE2  2  
ATOM   2418  H HE3  . LYS A 1 14  ? -13.013 -21.688 -4.793  1.00 0.00 ? 1494 LYS A HE3  2  
ATOM   2419  H HZ1  . LYS A 1 14  ? -12.748 -23.570 -3.266  1.00 0.00 ? 1494 LYS A HZ1  2  
ATOM   2420  H HZ2  . LYS A 1 14  ? -11.283 -22.880 -3.536  1.00 0.00 ? 1494 LYS A HZ2  2  
ATOM   2421  H HZ3  . LYS A 1 14  ? -12.072 -22.625 -2.121  1.00 0.00 ? 1494 LYS A HZ3  2  
ATOM   2422  N N    . TRP A 1 15  ? -15.188 -16.770 -4.484  1.00 0.00 ? 1495 TRP A N    2  
ATOM   2423  C CA   . TRP A 1 15  ? -16.497 -16.854 -3.888  1.00 0.00 ? 1495 TRP A CA   2  
ATOM   2424  C C    . TRP A 1 15  ? -16.464 -18.010 -2.881  1.00 0.00 ? 1495 TRP A C    2  
ATOM   2425  O O    . TRP A 1 15  ? -16.322 -19.175 -3.266  1.00 0.00 ? 1495 TRP A O    2  
ATOM   2426  C CB   . TRP A 1 15  ? -17.459 -17.060 -5.039  1.00 0.00 ? 1495 TRP A CB   2  
ATOM   2427  C CG   . TRP A 1 15  ? -18.850 -17.441 -4.688  1.00 0.00 ? 1495 TRP A CG   2  
ATOM   2428  C CD1  . TRP A 1 15  ? -19.432 -18.587 -5.083  1.00 0.00 ? 1495 TRP A CD1  2  
ATOM   2429  C CD2  . TRP A 1 15  ? -19.841 -16.725 -3.904  1.00 0.00 ? 1495 TRP A CD2  2  
ATOM   2430  N NE1  . TRP A 1 15  ? -20.766 -18.583 -4.728  1.00 0.00 ? 1495 TRP A NE1  2  
ATOM   2431  C CE2  . TRP A 1 15  ? -21.055 -17.482 -3.928  1.00 0.00 ? 1495 TRP A CE2  2  
ATOM   2432  C CE3  . TRP A 1 15  ? -19.859 -15.467 -3.255  1.00 0.00 ? 1495 TRP A CE3  2  
ATOM   2433  C CZ2  . TRP A 1 15  ? -22.226 -16.994 -3.323  1.00 0.00 ? 1495 TRP A CZ2  2  
ATOM   2434  C CZ3  . TRP A 1 15  ? -21.038 -14.975 -2.670  1.00 0.00 ? 1495 TRP A CZ3  2  
ATOM   2435  C CH2  . TRP A 1 15  ? -22.209 -15.747 -2.672  1.00 0.00 ? 1495 TRP A CH2  2  
ATOM   2436  H H    . TRP A 1 15  ? -15.047 -17.194 -5.401  1.00 0.00 ? 1495 TRP A H    2  
ATOM   2437  H HA   . TRP A 1 15  ? -16.737 -15.912 -3.389  1.00 0.00 ? 1495 TRP A HA   2  
ATOM   2438  H HB2  . TRP A 1 15  ? -17.484 -16.121 -5.596  1.00 0.00 ? 1495 TRP A HB2  2  
ATOM   2439  H HB3  . TRP A 1 15  ? -17.051 -17.829 -5.693  1.00 0.00 ? 1495 TRP A HB3  2  
ATOM   2440  H HD1  . TRP A 1 15  ? -18.902 -19.368 -5.608  1.00 0.00 ? 1495 TRP A HD1  2  
ATOM   2441  H HE1  . TRP A 1 15  ? -21.408 -19.316 -5.047  1.00 0.00 ? 1495 TRP A HE1  2  
ATOM   2442  H HE3  . TRP A 1 15  ? -18.961 -14.866 -3.207  1.00 0.00 ? 1495 TRP A HE3  2  
ATOM   2443  H HZ2  . TRP A 1 15  ? -23.136 -17.570 -3.355  1.00 0.00 ? 1495 TRP A HZ2  2  
ATOM   2444  H HZ3  . TRP A 1 15  ? -21.050 -13.997 -2.215  1.00 0.00 ? 1495 TRP A HZ3  2  
ATOM   2445  H HH2  . TRP A 1 15  ? -23.089 -15.359 -2.173  1.00 0.00 ? 1495 TRP A HH2  2  
ATOM   2446  N N    . SER A 1 16  ? -16.542 -17.675 -1.596  1.00 0.00 ? 1496 SER A N    2  
ATOM   2447  C CA   . SER A 1 16  ? -16.319 -18.562 -0.458  1.00 0.00 ? 1496 SER A CA   2  
ATOM   2448  C C    . SER A 1 16  ? -17.229 -19.797 -0.401  1.00 0.00 ? 1496 SER A C    2  
ATOM   2449  O O    . SER A 1 16  ? -16.862 -20.769 0.262   1.00 0.00 ? 1496 SER A O    2  
ATOM   2450  C CB   . SER A 1 16  ? -16.469 -17.726 0.813   1.00 0.00 ? 1496 SER A CB   2  
ATOM   2451  O OG   . SER A 1 16  ? -15.679 -16.549 0.722   1.00 0.00 ? 1496 SER A OG   2  
ATOM   2452  H H    . SER A 1 16  ? -16.575 -16.693 -1.351  1.00 0.00 ? 1496 SER A H    2  
ATOM   2453  H HA   . SER A 1 16  ? -15.287 -18.913 -0.511  1.00 0.00 ? 1496 SER A HA   2  
ATOM   2454  H HB2  . SER A 1 16  ? -17.518 -17.453 0.913   1.00 0.00 ? 1496 SER A HB2  2  
ATOM   2455  H HB3  . SER A 1 16  ? -16.165 -18.312 1.680   1.00 0.00 ? 1496 SER A HB3  2  
ATOM   2456  H HG   . SER A 1 16  ? -15.955 -15.920 1.417   1.00 0.00 ? 1496 SER A HG   2  
ATOM   2457  N N    . SER A 1 17  ? -18.359 -19.820 -1.112  1.00 0.00 ? 1497 SER A N    2  
ATOM   2458  C CA   . SER A 1 17  ? -19.227 -20.995 -1.263  1.00 0.00 ? 1497 SER A CA   2  
ATOM   2459  C C    . SER A 1 17  ? -18.621 -22.018 -2.251  1.00 0.00 ? 1497 SER A C    2  
ATOM   2460  O O    . SER A 1 17  ? -19.295 -22.510 -3.159  1.00 0.00 ? 1497 SER A O    2  
ATOM   2461  C CB   . SER A 1 17  ? -20.629 -20.525 -1.667  1.00 0.00 ? 1497 SER A CB   2  
ATOM   2462  O OG   . SER A 1 17  ? -21.097 -19.525 -0.769  1.00 0.00 ? 1497 SER A OG   2  
ATOM   2463  H H    . SER A 1 17  ? -18.642 -18.990 -1.615  1.00 0.00 ? 1497 SER A H    2  
ATOM   2464  H HA   . SER A 1 17  ? -19.304 -21.489 -0.291  1.00 0.00 ? 1497 SER A HA   2  
ATOM   2465  H HB2  . SER A 1 17  ? -20.595 -20.128 -2.679  1.00 0.00 ? 1497 SER A HB2  2  
ATOM   2466  H HB3  . SER A 1 17  ? -21.311 -21.382 -1.652  1.00 0.00 ? 1497 SER A HB3  2  
ATOM   2467  H HG   . SER A 1 17  ? -21.983 -19.234 -1.066  1.00 0.00 ? 1497 SER A HG   2  
ATOM   2468  N N    . ASN A 1 18  ? -17.321 -22.303 -2.087  1.00 0.00 ? 1498 ASN A N    2  
ATOM   2469  C CA   . ASN A 1 18  ? -16.441 -23.106 -2.936  1.00 0.00 ? 1498 ASN A CA   2  
ATOM   2470  C C    . ASN A 1 18  ? -16.701 -22.932 -4.440  1.00 0.00 ? 1498 ASN A C    2  
ATOM   2471  O O    . ASN A 1 18  ? -16.931 -23.910 -5.156  1.00 0.00 ? 1498 ASN A O    2  
ATOM   2472  C CB   . ASN A 1 18  ? -16.416 -24.574 -2.482  1.00 0.00 ? 1498 ASN A CB   2  
ATOM   2473  C CG   . ASN A 1 18  ? -15.259 -25.334 -3.138  1.00 0.00 ? 1498 ASN A CG   2  
ATOM   2474  O OD1  . ASN A 1 18  ? -14.189 -24.775 -3.381  1.00 0.00 ? 1498 ASN A OD1  2  
ATOM   2475  N ND2  . ASN A 1 18  ? -15.438 -26.611 -3.436  1.00 0.00 ? 1498 ASN A ND2  2  
ATOM   2476  H H    . ASN A 1 18  ? -16.882 -21.890 -1.269  1.00 0.00 ? 1498 ASN A H    2  
ATOM   2477  H HA   . ASN A 1 18  ? -15.442 -22.709 -2.760  1.00 0.00 ? 1498 ASN A HA   2  
ATOM   2478  H HB2  . ASN A 1 18  ? -16.288 -24.625 -1.400  1.00 0.00 ? 1498 ASN A HB2  2  
ATOM   2479  H HB3  . ASN A 1 18  ? -17.372 -25.042 -2.733  1.00 0.00 ? 1498 ASN A HB3  2  
ATOM   2480  H HD21 . ASN A 1 18  ? -16.311 -27.076 -3.225  1.00 0.00 ? 1498 ASN A HD21 2  
ATOM   2481  H HD22 . ASN A 1 18  ? -14.689 -27.142 -3.859  1.00 0.00 ? 1498 ASN A HD22 2  
ATOM   2482  N N    . GLY A 1 19  ? -16.668 -21.681 -4.915  1.00 0.00 ? 1499 GLY A N    2  
ATOM   2483  C CA   . GLY A 1 19  ? -16.799 -21.347 -6.330  1.00 0.00 ? 1499 GLY A CA   2  
ATOM   2484  C C    . GLY A 1 19  ? -15.496 -20.806 -6.900  1.00 0.00 ? 1499 GLY A C    2  
ATOM   2485  O O    . GLY A 1 19  ? -14.416 -21.043 -6.362  1.00 0.00 ? 1499 GLY A O    2  
ATOM   2486  H H    . GLY A 1 19  ? -16.483 -20.914 -4.273  1.00 0.00 ? 1499 GLY A H    2  
ATOM   2487  H HA2  . GLY A 1 19  ? -17.099 -22.221 -6.907  1.00 0.00 ? 1499 GLY A HA2  2  
ATOM   2488  H HA3  . GLY A 1 19  ? -17.576 -20.598 -6.454  1.00 0.00 ? 1499 GLY A HA3  2  
ATOM   2489  N N    . TYR A 1 20  ? -15.601 -20.114 -8.031  1.00 0.00 ? 1500 TYR A N    2  
ATOM   2490  C CA   . TYR A 1 20  ? -14.471 -19.568 -8.771  1.00 0.00 ? 1500 TYR A CA   2  
ATOM   2491  C C    . TYR A 1 20  ? -14.009 -18.229 -8.201  1.00 0.00 ? 1500 TYR A C    2  
ATOM   2492  O O    . TYR A 1 20  ? -14.538 -17.740 -7.200  1.00 0.00 ? 1500 TYR A O    2  
ATOM   2493  C CB   . TYR A 1 20  ? -14.893 -19.463 -10.247 1.00 0.00 ? 1500 TYR A CB   2  
ATOM   2494  C CG   . TYR A 1 20  ? -15.104 -20.767 -10.993 1.00 0.00 ? 1500 TYR A CG   2  
ATOM   2495  C CD1  . TYR A 1 20  ? -14.498 -21.974 -10.590 1.00 0.00 ? 1500 TYR A CD1  2  
ATOM   2496  C CD2  . TYR A 1 20  ? -15.922 -20.761 -12.131 1.00 0.00 ? 1500 TYR A CD2  2  
ATOM   2497  C CE1  . TYR A 1 20  ? -14.593 -23.123 -11.401 1.00 0.00 ? 1500 TYR A CE1  2  
ATOM   2498  C CE2  . TYR A 1 20  ? -16.052 -21.908 -12.928 1.00 0.00 ? 1500 TYR A CE2  2  
ATOM   2499  C CZ   . TYR A 1 20  ? -15.344 -23.081 -12.594 1.00 0.00 ? 1500 TYR A CZ   2  
ATOM   2500  O OH   . TYR A 1 20  ? -15.391 -24.166 -13.419 1.00 0.00 ? 1500 TYR A OH   2  
ATOM   2501  H H    . TYR A 1 20  ? -16.524 -19.933 -8.408  1.00 0.00 ? 1500 TYR A H    2  
ATOM   2502  H HA   . TYR A 1 20  ? -13.616 -20.237 -8.683  1.00 0.00 ? 1500 TYR A HA   2  
ATOM   2503  H HB2  . TYR A 1 20  ? -15.802 -18.866 -10.307 1.00 0.00 ? 1500 TYR A HB2  2  
ATOM   2504  H HB3  . TYR A 1 20  ? -14.138 -18.917 -10.808 1.00 0.00 ? 1500 TYR A HB3  2  
ATOM   2505  H HD1  . TYR A 1 20  ? -13.952 -22.026 -9.661  1.00 0.00 ? 1500 TYR A HD1  2  
ATOM   2506  H HD2  . TYR A 1 20  ? -16.460 -19.869 -12.401 1.00 0.00 ? 1500 TYR A HD2  2  
ATOM   2507  H HE1  . TYR A 1 20  ? -14.094 -24.041 -11.116 1.00 0.00 ? 1500 TYR A HE1  2  
ATOM   2508  H HE2  . TYR A 1 20  ? -16.692 -21.869 -13.794 1.00 0.00 ? 1500 TYR A HE2  2  
ATOM   2509  H HH   . TYR A 1 20  ? -14.787 -24.894 -13.162 1.00 0.00 ? 1500 TYR A HH   2  
ATOM   2510  N N    . PHE A 1 21  ? -13.005 -17.645 -8.855  1.00 0.00 ? 1501 PHE A N    2  
ATOM   2511  C CA   . PHE A 1 21  ? -12.464 -16.342 -8.531  1.00 0.00 ? 1501 PHE A CA   2  
ATOM   2512  C C    . PHE A 1 21  ? -13.134 -15.309 -9.450  1.00 0.00 ? 1501 PHE A C    2  
ATOM   2513  O O    . PHE A 1 21  ? -13.072 -15.457 -10.674 1.00 0.00 ? 1501 PHE A O    2  
ATOM   2514  C CB   . PHE A 1 21  ? -10.939 -16.400 -8.715  1.00 0.00 ? 1501 PHE A CB   2  
ATOM   2515  C CG   . PHE A 1 21  ? -10.179 -17.283 -7.744  1.00 0.00 ? 1501 PHE A CG   2  
ATOM   2516  C CD1  . PHE A 1 21  ? -10.019 -18.653 -8.023  1.00 0.00 ? 1501 PHE A CD1  2  
ATOM   2517  C CD2  . PHE A 1 21  ? -9.625  -16.743 -6.569  1.00 0.00 ? 1501 PHE A CD2  2  
ATOM   2518  C CE1  . PHE A 1 21  ? -9.311  -19.475 -7.131  1.00 0.00 ? 1501 PHE A CE1  2  
ATOM   2519  C CE2  . PHE A 1 21  ? -8.919  -17.569 -5.675  1.00 0.00 ? 1501 PHE A CE2  2  
ATOM   2520  C CZ   . PHE A 1 21  ? -8.775  -18.939 -5.953  1.00 0.00 ? 1501 PHE A CZ   2  
ATOM   2521  H H    . PHE A 1 21  ? -12.632 -18.082 -9.692  1.00 0.00 ? 1501 PHE A H    2  
ATOM   2522  H HA   . PHE A 1 21  ? -12.679 -16.120 -7.498  1.00 0.00 ? 1501 PHE A HA   2  
ATOM   2523  H HB2  . PHE A 1 21  ? -10.736 -16.760 -9.715  1.00 0.00 ? 1501 PHE A HB2  2  
ATOM   2524  H HB3  . PHE A 1 21  ? -10.529 -15.402 -8.641  1.00 0.00 ? 1501 PHE A HB3  2  
ATOM   2525  H HD1  . PHE A 1 21  ? -10.437 -19.074 -8.925  1.00 0.00 ? 1501 PHE A HD1  2  
ATOM   2526  H HD2  . PHE A 1 21  ? -9.732  -15.692 -6.344  1.00 0.00 ? 1501 PHE A HD2  2  
ATOM   2527  H HE1  . PHE A 1 21  ? -9.172  -20.522 -7.349  1.00 0.00 ? 1501 PHE A HE1  2  
ATOM   2528  H HE2  . PHE A 1 21  ? -8.491  -17.148 -4.776  1.00 0.00 ? 1501 PHE A HE2  2  
ATOM   2529  H HZ   . PHE A 1 21  ? -8.257  -19.598 -5.272  1.00 0.00 ? 1501 PHE A HZ   2  
ATOM   2530  N N    . TYR A 1 22  ? -13.735 -14.263 -8.876  1.00 0.00 ? 1502 TYR A N    2  
ATOM   2531  C CA   . TYR A 1 22  ? -14.483 -13.216 -9.584  1.00 0.00 ? 1502 TYR A CA   2  
ATOM   2532  C C    . TYR A 1 22  ? -13.873 -11.865 -9.234  1.00 0.00 ? 1502 TYR A C    2  
ATOM   2533  O O    . TYR A 1 22  ? -13.319 -11.706 -8.148  1.00 0.00 ? 1502 TYR A O    2  
ATOM   2534  C CB   . TYR A 1 22  ? -15.964 -13.244 -9.162  1.00 0.00 ? 1502 TYR A CB   2  
ATOM   2535  C CG   . TYR A 1 22  ? -16.673 -14.553 -9.415  1.00 0.00 ? 1502 TYR A CG   2  
ATOM   2536  C CD1  . TYR A 1 22  ? -16.531 -15.599 -8.484  1.00 0.00 ? 1502 TYR A CD1  2  
ATOM   2537  C CD2  . TYR A 1 22  ? -17.466 -14.732 -10.562 1.00 0.00 ? 1502 TYR A CD2  2  
ATOM   2538  C CE1  . TYR A 1 22  ? -17.131 -16.846 -8.718  1.00 0.00 ? 1502 TYR A CE1  2  
ATOM   2539  C CE2  . TYR A 1 22  ? -18.041 -15.990 -10.811 1.00 0.00 ? 1502 TYR A CE2  2  
ATOM   2540  C CZ   . TYR A 1 22  ? -17.875 -17.053 -9.894  1.00 0.00 ? 1502 TYR A CZ   2  
ATOM   2541  O OH   . TYR A 1 22  ? -18.419 -18.278 -10.126 1.00 0.00 ? 1502 TYR A OH   2  
ATOM   2542  H H    . TYR A 1 22  ? -13.710 -14.181 -7.861  1.00 0.00 ? 1502 TYR A H    2  
ATOM   2543  H HA   . TYR A 1 22  ? -14.417 -13.385 -10.660 1.00 0.00 ? 1502 TYR A HA   2  
ATOM   2544  H HB2  . TYR A 1 22  ? -16.026 -13.061 -8.092  1.00 0.00 ? 1502 TYR A HB2  2  
ATOM   2545  H HB3  . TYR A 1 22  ? -16.503 -12.443 -9.674  1.00 0.00 ? 1502 TYR A HB3  2  
ATOM   2546  H HD1  . TYR A 1 22  ? -15.954 -15.442 -7.582  1.00 0.00 ? 1502 TYR A HD1  2  
ATOM   2547  H HD2  . TYR A 1 22  ? -17.639 -13.910 -11.257 1.00 0.00 ? 1502 TYR A HD2  2  
ATOM   2548  H HE1  . TYR A 1 22  ? -17.021 -17.647 -7.997  1.00 0.00 ? 1502 TYR A HE1  2  
ATOM   2549  H HE2  . TYR A 1 22  ? -18.612 -16.138 -11.712 1.00 0.00 ? 1502 TYR A HE2  2  
ATOM   2550  H HH   . TYR A 1 22  ? -18.958 -18.326 -10.929 1.00 0.00 ? 1502 TYR A HH   2  
ATOM   2551  N N    . SER A 1 23  ? -13.956 -10.890 -10.140 1.00 0.00 ? 1503 SER A N    2  
ATOM   2552  C CA   . SER A 1 23  ? -13.435 -9.547  -9.894  1.00 0.00 ? 1503 SER A CA   2  
ATOM   2553  C C    . SER A 1 23  ? -14.232 -8.858  -8.782  1.00 0.00 ? 1503 SER A C    2  
ATOM   2554  O O    . SER A 1 23  ? -15.447 -9.056  -8.682  1.00 0.00 ? 1503 SER A O    2  
ATOM   2555  C CB   . SER A 1 23  ? -13.506 -8.735  -11.182 1.00 0.00 ? 1503 SER A CB   2  
ATOM   2556  O OG   . SER A 1 23  ? -12.546 -9.206  -12.120 1.00 0.00 ? 1503 SER A OG   2  
ATOM   2557  H H    . SER A 1 23  ? -14.470 -11.048 -10.996 1.00 0.00 ? 1503 SER A H    2  
ATOM   2558  H HA   . SER A 1 23  ? -12.392 -9.618  -9.592  1.00 0.00 ? 1503 SER A HA   2  
ATOM   2559  H HB2  . SER A 1 23  ? -14.512 -8.772  -11.602 1.00 0.00 ? 1503 SER A HB2  2  
ATOM   2560  H HB3  . SER A 1 23  ? -13.273 -7.705  -10.945 1.00 0.00 ? 1503 SER A HB3  2  
ATOM   2561  H HG   . SER A 1 23  ? -12.786 -10.095 -12.466 1.00 0.00 ? 1503 SER A HG   2  
ATOM   2562  N N    . GLY A 1 24  ? -13.588 -8.013  -7.972  1.00 0.00 ? 1504 GLY A N    2  
ATOM   2563  C CA   . GLY A 1 24  ? -14.269 -7.256  -6.937  1.00 0.00 ? 1504 GLY A CA   2  
ATOM   2564  C C    . GLY A 1 24  ? -13.402 -6.171  -6.326  1.00 0.00 ? 1504 GLY A C    2  
ATOM   2565  O O    . GLY A 1 24  ? -12.193 -6.146  -6.523  1.00 0.00 ? 1504 GLY A O    2  
ATOM   2566  H H    . GLY A 1 24  ? -12.588 -7.844  -8.093  1.00 0.00 ? 1504 GLY A H    2  
ATOM   2567  H HA2  . GLY A 1 24  ? -15.150 -6.781  -7.369  1.00 0.00 ? 1504 GLY A HA2  2  
ATOM   2568  H HA3  . GLY A 1 24  ? -14.574 -7.935  -6.140  1.00 0.00 ? 1504 GLY A HA3  2  
ATOM   2569  N N    . LYS A 1 25  ? -14.030 -5.278  -5.567  1.00 0.00 ? 1505 LYS A N    2  
ATOM   2570  C CA   . LYS A 1 25  ? -13.393 -4.166  -4.873  1.00 0.00 ? 1505 LYS A CA   2  
ATOM   2571  C C    . LYS A 1 25  ? -13.382 -4.490  -3.392  1.00 0.00 ? 1505 LYS A C    2  
ATOM   2572  O O    . LYS A 1 25  ? -14.409 -4.902  -2.861  1.00 0.00 ? 1505 LYS A O    2  
ATOM   2573  C CB   . LYS A 1 25  ? -14.227 -2.903  -5.114  1.00 0.00 ? 1505 LYS A CB   2  
ATOM   2574  C CG   . LYS A 1 25  ? -14.229 -2.471  -6.591  1.00 0.00 ? 1505 LYS A CG   2  
ATOM   2575  C CD   . LYS A 1 25  ? -15.545 -1.828  -7.052  1.00 0.00 ? 1505 LYS A CD   2  
ATOM   2576  C CE   . LYS A 1 25  ? -16.614 -2.846  -7.502  1.00 0.00 ? 1505 LYS A CE   2  
ATOM   2577  N NZ   . LYS A 1 25  ? -17.778 -2.161  -8.143  1.00 0.00 ? 1505 LYS A NZ   2  
ATOM   2578  H H    . LYS A 1 25  ? -15.040 -5.345  -5.465  1.00 0.00 ? 1505 LYS A H    2  
ATOM   2579  H HA   . LYS A 1 25  ? -12.372 -4.022  -5.231  1.00 0.00 ? 1505 LYS A HA   2  
ATOM   2580  H HB2  . LYS A 1 25  ? -15.242 -3.084  -4.752  1.00 0.00 ? 1505 LYS A HB2  2  
ATOM   2581  H HB3  . LYS A 1 25  ? -13.806 -2.086  -4.525  1.00 0.00 ? 1505 LYS A HB3  2  
ATOM   2582  H HG2  . LYS A 1 25  ? -13.434 -1.731  -6.702  1.00 0.00 ? 1505 LYS A HG2  2  
ATOM   2583  H HG3  . LYS A 1 25  ? -13.999 -3.308  -7.251  1.00 0.00 ? 1505 LYS A HG3  2  
ATOM   2584  H HD2  . LYS A 1 25  ? -15.933 -1.205  -6.244  1.00 0.00 ? 1505 LYS A HD2  2  
ATOM   2585  H HD3  . LYS A 1 25  ? -15.308 -1.187  -7.900  1.00 0.00 ? 1505 LYS A HD3  2  
ATOM   2586  H HE2  . LYS A 1 25  ? -16.168 -3.538  -8.222  1.00 0.00 ? 1505 LYS A HE2  2  
ATOM   2587  H HE3  . LYS A 1 25  ? -16.956 -3.441  -6.647  1.00 0.00 ? 1505 LYS A HE3  2  
ATOM   2588  H HZ1  . LYS A 1 25  ? -18.190 -1.459  -7.538  1.00 0.00 ? 1505 LYS A HZ1  2  
ATOM   2589  H HZ2  . LYS A 1 25  ? -17.507 -1.701  -9.006  1.00 0.00 ? 1505 LYS A HZ2  2  
ATOM   2590  H HZ3  . LYS A 1 25  ? -18.508 -2.821  -8.389  1.00 0.00 ? 1505 LYS A HZ3  2  
ATOM   2591  N N    . ILE A 1 26  ? -12.252 -4.331  -2.715  1.00 0.00 ? 1506 ILE A N    2  
ATOM   2592  C CA   . ILE A 1 26  ? -12.171 -4.598  -1.279  1.00 0.00 ? 1506 ILE A CA   2  
ATOM   2593  C C    . ILE A 1 26  ? -12.913 -3.468  -0.569  1.00 0.00 ? 1506 ILE A C    2  
ATOM   2594  O O    . ILE A 1 26  ? -12.484 -2.320  -0.644  1.00 0.00 ? 1506 ILE A O    2  
ATOM   2595  C CB   . ILE A 1 26  ? -10.695 -4.701  -0.850  1.00 0.00 ? 1506 ILE A CB   2  
ATOM   2596  C CG1  . ILE A 1 26  ? -9.988  -5.890  -1.532  1.00 0.00 ? 1506 ILE A CG1  2  
ATOM   2597  C CG2  . ILE A 1 26  ? -10.600 -4.882  0.672   1.00 0.00 ? 1506 ILE A CG2  2  
ATOM   2598  C CD1  . ILE A 1 26  ? -8.488  -5.663  -1.731  1.00 0.00 ? 1506 ILE A CD1  2  
ATOM   2599  H H    . ILE A 1 26  ? -11.429 -3.979  -3.197  1.00 0.00 ? 1506 ILE A H    2  
ATOM   2600  H HA   . ILE A 1 26  ? -12.674 -5.539  -1.049  1.00 0.00 ? 1506 ILE A HA   2  
ATOM   2601  H HB   . ILE A 1 26  ? -10.198 -3.779  -1.135  1.00 0.00 ? 1506 ILE A HB   2  
ATOM   2602  H HG12 . ILE A 1 26  ? -10.139 -6.793  -0.936  1.00 0.00 ? 1506 ILE A HG12 2  
ATOM   2603  H HG13 . ILE A 1 26  ? -10.415 -6.051  -2.518  1.00 0.00 ? 1506 ILE A HG13 2  
ATOM   2604  H HG21 . ILE A 1 26  ? -11.195 -5.752  0.951   1.00 0.00 ? 1506 ILE A HG21 2  
ATOM   2605  H HG22 . ILE A 1 26  ? -9.556  -5.026  0.961   1.00 0.00 ? 1506 ILE A HG22 2  
ATOM   2606  H HG23 . ILE A 1 26  ? -11.001 -4.017  1.201   1.00 0.00 ? 1506 ILE A HG23 2  
ATOM   2607  H HD11 . ILE A 1 26  ? -8.029  -6.569  -2.124  1.00 0.00 ? 1506 ILE A HD11 2  
ATOM   2608  H HD12 . ILE A 1 26  ? -8.344  -4.850  -2.444  1.00 0.00 ? 1506 ILE A HD12 2  
ATOM   2609  H HD13 . ILE A 1 26  ? -8.011  -5.428  -0.788  1.00 0.00 ? 1506 ILE A HD13 2  
ATOM   2610  N N    . THR A 1 27  ? -14.008 -3.783  0.115   1.00 0.00 ? 1507 THR A N    2  
ATOM   2611  C CA   . THR A 1 27  ? -14.848 -2.778  0.748   1.00 0.00 ? 1507 THR A CA   2  
ATOM   2612  C C    . THR A 1 27  ? -14.300 -2.404  2.121   1.00 0.00 ? 1507 THR A C    2  
ATOM   2613  O O    . THR A 1 27  ? -14.365 -1.234  2.500   1.00 0.00 ? 1507 THR A O    2  
ATOM   2614  C CB   . THR A 1 27  ? -16.259 -3.336  0.907   1.00 0.00 ? 1507 THR A CB   2  
ATOM   2615  O OG1  . THR A 1 27  ? -16.195 -4.562  1.600   1.00 0.00 ? 1507 THR A OG1  2  
ATOM   2616  C CG2  . THR A 1 27  ? -16.870 -3.658  -0.438  1.00 0.00 ? 1507 THR A CG2  2  
ATOM   2617  H H    . THR A 1 27  ? -14.324 -4.751  0.178   1.00 0.00 ? 1507 THR A H    2  
ATOM   2618  H HA   . THR A 1 27  ? -14.885 -1.893  0.113   1.00 0.00 ? 1507 THR A HA   2  
ATOM   2619  H HB   . THR A 1 27  ? -16.885 -2.625  1.446   1.00 0.00 ? 1507 THR A HB   2  
ATOM   2620  H HG1  . THR A 1 27  ? -16.981 -4.620  2.177   1.00 0.00 ? 1507 THR A HG1  2  
ATOM   2621  H HG21 . THR A 1 27  ? -17.822 -4.173  -0.275  1.00 0.00 ? 1507 THR A HG21 2  
ATOM   2622  H HG22 . THR A 1 27  ? -17.041 -2.735  -0.998  1.00 0.00 ? 1507 THR A HG22 2  
ATOM   2623  H HG23 . THR A 1 27  ? -16.195 -4.304  -0.995  1.00 0.00 ? 1507 THR A HG23 2  
ATOM   2624  N N    . ARG A 1 28  ? -13.773 -3.397  2.859   1.00 0.00 ? 1508 ARG A N    2  
ATOM   2625  C CA   . ARG A 1 28  ? -13.315 -3.241  4.241   1.00 0.00 ? 1508 ARG A CA   2  
ATOM   2626  C C    . ARG A 1 28  ? -12.552 -4.489  4.681   1.00 0.00 ? 1508 ARG A C    2  
ATOM   2627  O O    . ARG A 1 28  ? -12.985 -5.603  4.403   1.00 0.00 ? 1508 ARG A O    2  
ATOM   2628  C CB   . ARG A 1 28  ? -14.572 -2.993  5.113   1.00 0.00 ? 1508 ARG A CB   2  
ATOM   2629  C CG   . ARG A 1 28  ? -14.299 -2.841  6.615   1.00 0.00 ? 1508 ARG A CG   2  
ATOM   2630  C CD   . ARG A 1 28  ? -14.821 -4.062  7.381   1.00 0.00 ? 1508 ARG A CD   2  
ATOM   2631  N NE   . ARG A 1 28  ? -14.328 -4.072  8.772   1.00 0.00 ? 1508 ARG A NE   2  
ATOM   2632  C CZ   . ARG A 1 28  ? -14.977 -3.702  9.886   1.00 0.00 ? 1508 ARG A CZ   2  
ATOM   2633  N NH1  . ARG A 1 28  ? -16.186 -3.150  9.826   1.00 0.00 ? 1508 ARG A NH1  2  
ATOM   2634  N NH2  . ARG A 1 28  ? -14.400 -3.889  11.070  1.00 0.00 ? 1508 ARG A NH2  2  
ATOM   2635  H H    . ARG A 1 28  ? -13.837 -4.347  2.490   1.00 0.00 ? 1508 ARG A H    2  
ATOM   2636  H HA   . ARG A 1 28  ? -12.659 -2.369  4.307   1.00 0.00 ? 1508 ARG A HA   2  
ATOM   2637  H HB2  . ARG A 1 28  ? -15.052 -2.069  4.794   1.00 0.00 ? 1508 ARG A HB2  2  
ATOM   2638  H HB3  . ARG A 1 28  ? -15.292 -3.792  4.935   1.00 0.00 ? 1508 ARG A HB3  2  
ATOM   2639  H HG2  . ARG A 1 28  ? -13.228 -2.707  6.785   1.00 0.00 ? 1508 ARG A HG2  2  
ATOM   2640  H HG3  . ARG A 1 28  ? -14.811 -1.953  6.978   1.00 0.00 ? 1508 ARG A HG3  2  
ATOM   2641  H HD2  . ARG A 1 28  ? -15.910 -4.079  7.350   1.00 0.00 ? 1508 ARG A HD2  2  
ATOM   2642  H HD3  . ARG A 1 28  ? -14.462 -4.961  6.875   1.00 0.00 ? 1508 ARG A HD3  2  
ATOM   2643  H HE   . ARG A 1 28  ? -13.366 -4.404  8.873   1.00 0.00 ? 1508 ARG A HE   2  
ATOM   2644  H HH11 . ARG A 1 28  ? -16.632 -2.973  8.935   1.00 0.00 ? 1508 ARG A HH11 2  
ATOM   2645  H HH12 . ARG A 1 28  ? -16.693 -2.861  10.655  1.00 0.00 ? 1508 ARG A HH12 2  
ATOM   2646  H HH21 . ARG A 1 28  ? -13.501 -4.347  11.150  1.00 0.00 ? 1508 ARG A HH21 2  
ATOM   2647  H HH22 . ARG A 1 28  ? -14.850 -3.614  11.936  1.00 0.00 ? 1508 ARG A HH22 2  
ATOM   2648  N N    . ASP A 1 29  ? -11.429 -4.318  5.378   1.00 0.00 ? 1509 ASP A N    2  
ATOM   2649  C CA   . ASP A 1 29  ? -10.723 -5.405  6.066   1.00 0.00 ? 1509 ASP A CA   2  
ATOM   2650  C C    . ASP A 1 29  ? -11.613 -5.826  7.230   1.00 0.00 ? 1509 ASP A C    2  
ATOM   2651  O O    . ASP A 1 29  ? -11.781 -5.059  8.177   1.00 0.00 ? 1509 ASP A O    2  
ATOM   2652  C CB   . ASP A 1 29  ? -9.352  -4.930  6.574   1.00 0.00 ? 1509 ASP A CB   2  
ATOM   2653  C CG   . ASP A 1 29  ? -8.774  -5.841  7.675   1.00 0.00 ? 1509 ASP A CG   2  
ATOM   2654  O OD1  . ASP A 1 29  ? -8.787  -7.083  7.515   1.00 0.00 ? 1509 ASP A OD1  2  
ATOM   2655  O OD2  . ASP A 1 29  ? -8.299  -5.307  8.706   1.00 0.00 ? 1509 ASP A OD2  2  
ATOM   2656  H H    . ASP A 1 29  ? -11.117 -3.377  5.580   1.00 0.00 ? 1509 ASP A H    2  
ATOM   2657  H HA   . ASP A 1 29  ? -10.579 -6.251  5.398   1.00 0.00 ? 1509 ASP A HA   2  
ATOM   2658  H HB2  . ASP A 1 29  ? -8.652  -4.874  5.737   1.00 0.00 ? 1509 ASP A HB2  2  
ATOM   2659  H HB3  . ASP A 1 29  ? -9.456  -3.924  6.978   1.00 0.00 ? 1509 ASP A HB3  2  
ATOM   2660  N N    . VAL A 1 30  ? -12.271 -6.979  7.108   1.00 0.00 ? 1510 VAL A N    2  
ATOM   2661  C CA   . VAL A 1 30  ? -13.226 -7.478  8.093   1.00 0.00 ? 1510 VAL A CA   2  
ATOM   2662  C C    . VAL A 1 30  ? -12.484 -7.663  9.422   1.00 0.00 ? 1510 VAL A C    2  
ATOM   2663  O O    . VAL A 1 30  ? -12.878 -7.095  10.443  1.00 0.00 ? 1510 VAL A O    2  
ATOM   2664  C CB   . VAL A 1 30  ? -13.858 -8.808  7.634   1.00 0.00 ? 1510 VAL A CB   2  
ATOM   2665  C CG1  . VAL A 1 30  ? -15.121 -9.171  8.386   1.00 0.00 ? 1510 VAL A CG1  2  
ATOM   2666  C CG2  . VAL A 1 30  ? -14.252 -8.843  6.161   1.00 0.00 ? 1510 VAL A CG2  2  
ATOM   2667  H H    . VAL A 1 30  ? -11.990 -7.603  6.366   1.00 0.00 ? 1510 VAL A H    2  
ATOM   2668  H HA   . VAL A 1 30  ? -14.015 -6.739  8.210   1.00 0.00 ? 1510 VAL A HA   2  
ATOM   2669  H HB   . VAL A 1 30  ? -13.136 -9.592  7.798   1.00 0.00 ? 1510 VAL A HB   2  
ATOM   2670  H HG11 . VAL A 1 30  ? -15.368 -10.210 8.151   1.00 0.00 ? 1510 VAL A HG11 2  
ATOM   2671  H HG12 . VAL A 1 30  ? -14.942 -9.090  9.458   1.00 0.00 ? 1510 VAL A HG12 2  
ATOM   2672  H HG13 . VAL A 1 30  ? -15.938 -8.508  8.075   1.00 0.00 ? 1510 VAL A HG13 2  
ATOM   2673  H HG21 . VAL A 1 30  ? -14.868 -7.974  5.929   1.00 0.00 ? 1510 VAL A HG21 2  
ATOM   2674  H HG22 . VAL A 1 30  ? -13.349 -8.829  5.575   1.00 0.00 ? 1510 VAL A HG22 2  
ATOM   2675  H HG23 . VAL A 1 30  ? -14.791 -9.768  5.916   1.00 0.00 ? 1510 VAL A HG23 2  
ATOM   2676  N N    . GLY A 1 31  ? -11.392 -8.429  9.386   1.00 0.00 ? 1511 GLY A N    2  
ATOM   2677  C CA   . GLY A 1 31  ? -10.551 -8.740  10.527  1.00 0.00 ? 1511 GLY A CA   2  
ATOM   2678  C C    . GLY A 1 31  ? -9.970  -10.130 10.333  1.00 0.00 ? 1511 GLY A C    2  
ATOM   2679  O O    . GLY A 1 31  ? -10.452 -10.894 9.492   1.00 0.00 ? 1511 GLY A O    2  
ATOM   2680  H H    . GLY A 1 31  ? -11.134 -8.890  8.515   1.00 0.00 ? 1511 GLY A H    2  
ATOM   2681  H HA2  . GLY A 1 31  ? -9.746  -8.008  10.592  1.00 0.00 ? 1511 GLY A HA2  2  
ATOM   2682  H HA3  . GLY A 1 31  ? -11.130 -8.724  11.450  1.00 0.00 ? 1511 GLY A HA3  2  
ATOM   2683  N N    . ALA A 1 32  ? -8.944  -10.476 11.109  1.00 0.00 ? 1512 ALA A N    2  
ATOM   2684  C CA   . ALA A 1 32  ? -8.292  -11.788 11.131  1.00 0.00 ? 1512 ALA A CA   2  
ATOM   2685  C C    . ALA A 1 32  ? -7.750  -12.282 9.775   1.00 0.00 ? 1512 ALA A C    2  
ATOM   2686  O O    . ALA A 1 32  ? -7.359  -13.445 9.656   1.00 0.00 ? 1512 ALA A O    2  
ATOM   2687  C CB   . ALA A 1 32  ? -9.249  -12.787 11.794  1.00 0.00 ? 1512 ALA A CB   2  
ATOM   2688  H H    . ALA A 1 32  ? -8.587  -9.788  11.764  1.00 0.00 ? 1512 ALA A H    2  
ATOM   2689  H HA   . ALA A 1 32  ? -7.424  -11.687 11.776  1.00 0.00 ? 1512 ALA A HA   2  
ATOM   2690  H HB1  . ALA A 1 32  ? -10.123 -12.924 11.161  1.00 0.00 ? 1512 ALA A HB1  2  
ATOM   2691  H HB2  . ALA A 1 32  ? -8.756  -13.748 11.939  1.00 0.00 ? 1512 ALA A HB2  2  
ATOM   2692  H HB3  . ALA A 1 32  ? -9.572  -12.398 12.760  1.00 0.00 ? 1512 ALA A HB3  2  
ATOM   2693  N N    . GLY A 1 33  ? -7.729  -11.426 8.749   1.00 0.00 ? 1513 GLY A N    2  
ATOM   2694  C CA   . GLY A 1 33  ? -7.266  -11.735 7.405   1.00 0.00 ? 1513 GLY A CA   2  
ATOM   2695  C C    . GLY A 1 33  ? -8.435  -11.789 6.429   1.00 0.00 ? 1513 GLY A C    2  
ATOM   2696  O O    . GLY A 1 33  ? -8.208  -11.912 5.232   1.00 0.00 ? 1513 GLY A O    2  
ATOM   2697  H H    . GLY A 1 33  ? -8.147  -10.516 8.872   1.00 0.00 ? 1513 GLY A H    2  
ATOM   2698  H HA2  . GLY A 1 33  ? -6.576  -10.955 7.079   1.00 0.00 ? 1513 GLY A HA2  2  
ATOM   2699  H HA3  . GLY A 1 33  ? -6.743  -12.692 7.384   1.00 0.00 ? 1513 GLY A HA3  2  
ATOM   2700  N N    . LYS A 1 34  ? -9.689  -11.753 6.893   1.00 0.00 ? 1514 LYS A N    2  
ATOM   2701  C CA   . LYS A 1 34  ? -10.832 -11.615 6.006   1.00 0.00 ? 1514 LYS A CA   2  
ATOM   2702  C C    . LYS A 1 34  ? -10.897 -10.174 5.537   1.00 0.00 ? 1514 LYS A C    2  
ATOM   2703  O O    . LYS A 1 34  ? -10.803 -9.258  6.351   1.00 0.00 ? 1514 LYS A O    2  
ATOM   2704  C CB   . LYS A 1 34  ? -12.151 -11.937 6.725   1.00 0.00 ? 1514 LYS A CB   2  
ATOM   2705  C CG   . LYS A 1 34  ? -12.493 -13.420 6.852   1.00 0.00 ? 1514 LYS A CG   2  
ATOM   2706  C CD   . LYS A 1 34  ? -11.868 -14.140 8.065   1.00 0.00 ? 1514 LYS A CD   2  
ATOM   2707  C CE   . LYS A 1 34  ? -12.412 -13.689 9.435   1.00 0.00 ? 1514 LYS A CE   2  
ATOM   2708  N NZ   . LYS A 1 34  ? -13.812 -14.140 9.696   1.00 0.00 ? 1514 LYS A NZ   2  
ATOM   2709  H H    . LYS A 1 34  ? -9.863  -11.695 7.889   1.00 0.00 ? 1514 LYS A H    2  
ATOM   2710  H HA   . LYS A 1 34  ? -10.708 -12.259 5.143   1.00 0.00 ? 1514 LYS A HA   2  
ATOM   2711  H HB2  . LYS A 1 34  ? -12.193 -11.454 7.698   1.00 0.00 ? 1514 LYS A HB2  2  
ATOM   2712  H HB3  . LYS A 1 34  ? -12.945 -11.496 6.124   1.00 0.00 ? 1514 LYS A HB3  2  
ATOM   2713  H HG2  . LYS A 1 34  ? -13.577 -13.482 6.906   1.00 0.00 ? 1514 LYS A HG2  2  
ATOM   2714  H HG3  . LYS A 1 34  ? -12.163 -13.915 5.936   1.00 0.00 ? 1514 LYS A HG3  2  
ATOM   2715  H HD2  . LYS A 1 34  ? -12.027 -15.214 7.959   1.00 0.00 ? 1514 LYS A HD2  2  
ATOM   2716  H HD3  . LYS A 1 34  ? -10.790 -13.977 8.056   1.00 0.00 ? 1514 LYS A HD3  2  
ATOM   2717  H HE2  . LYS A 1 34  ? -11.768 -14.120 10.210  1.00 0.00 ? 1514 LYS A HE2  2  
ATOM   2718  H HE3  . LYS A 1 34  ? -12.335 -12.600 9.524   1.00 0.00 ? 1514 LYS A HE3  2  
ATOM   2719  H HZ1  . LYS A 1 34  ? -13.892 -15.150 9.648   1.00 0.00 ? 1514 LYS A HZ1  2  
ATOM   2720  H HZ2  . LYS A 1 34  ? -14.107 -13.872 10.629  1.00 0.00 ? 1514 LYS A HZ2  2  
ATOM   2721  H HZ3  . LYS A 1 34  ? -14.481 -13.740 9.047   1.00 0.00 ? 1514 LYS A HZ3  2  
ATOM   2722  N N    . TYR A 1 35  ? -11.216 -9.982  4.267   1.00 0.00 ? 1515 TYR A N    2  
ATOM   2723  C CA   . TYR A 1 35  ? -11.546 -8.692  3.680   1.00 0.00 ? 1515 TYR A CA   2  
ATOM   2724  C C    . TYR A 1 35  ? -12.876 -8.909  2.967   1.00 0.00 ? 1515 TYR A C    2  
ATOM   2725  O O    . TYR A 1 35  ? -13.087 -9.950  2.351   1.00 0.00 ? 1515 TYR A O    2  
ATOM   2726  C CB   . TYR A 1 35  ? -10.459 -8.192  2.726   1.00 0.00 ? 1515 TYR A CB   2  
ATOM   2727  C CG   . TYR A 1 35  ? -9.040  -8.133  3.269   1.00 0.00 ? 1515 TYR A CG   2  
ATOM   2728  C CD1  . TYR A 1 35  ? -8.312  -9.319  3.488   1.00 0.00 ? 1515 TYR A CD1  2  
ATOM   2729  C CD2  . TYR A 1 35  ? -8.439  -6.891  3.558   1.00 0.00 ? 1515 TYR A CD2  2  
ATOM   2730  C CE1  . TYR A 1 35  ? -7.005  -9.277  3.991   1.00 0.00 ? 1515 TYR A CE1  2  
ATOM   2731  C CE2  . TYR A 1 35  ? -7.130  -6.839  4.070   1.00 0.00 ? 1515 TYR A CE2  2  
ATOM   2732  C CZ   . TYR A 1 35  ? -6.405  -8.033  4.291   1.00 0.00 ? 1515 TYR A CZ   2  
ATOM   2733  O OH   . TYR A 1 35  ? -5.137  -7.968  4.790   1.00 0.00 ? 1515 TYR A OH   2  
ATOM   2734  H H    . TYR A 1 35  ? -11.353 -10.797 3.672   1.00 0.00 ? 1515 TYR A H    2  
ATOM   2735  H HA   . TYR A 1 35  ? -11.668 -7.939  4.453   1.00 0.00 ? 1515 TYR A HA   2  
ATOM   2736  H HB2  . TYR A 1 35  ? -10.469 -8.799  1.828   1.00 0.00 ? 1515 TYR A HB2  2  
ATOM   2737  H HB3  . TYR A 1 35  ? -10.758 -7.184  2.456   1.00 0.00 ? 1515 TYR A HB3  2  
ATOM   2738  H HD1  . TYR A 1 35  ? -8.748  -10.280 3.268   1.00 0.00 ? 1515 TYR A HD1  2  
ATOM   2739  H HD2  . TYR A 1 35  ? -8.976  -5.970  3.387   1.00 0.00 ? 1515 TYR A HD2  2  
ATOM   2740  H HE1  . TYR A 1 35  ? -6.479  -10.211 4.147   1.00 0.00 ? 1515 TYR A HE1  2  
ATOM   2741  H HE2  . TYR A 1 35  ? -6.672  -5.886  4.295   1.00 0.00 ? 1515 TYR A HE2  2  
ATOM   2742  H HH   . TYR A 1 35  ? -4.717  -8.834  4.925   1.00 0.00 ? 1515 TYR A HH   2  
ATOM   2743  N N    . LYS A 1 36  ? -13.826 -7.985  3.116   1.00 0.00 ? 1516 LYS A N    2  
ATOM   2744  C CA   . LYS A 1 36  ? -15.095 -8.059  2.417   1.00 0.00 ? 1516 LYS A CA   2  
ATOM   2745  C C    . LYS A 1 36  ? -14.913 -7.448  1.045   1.00 0.00 ? 1516 LYS A C    2  
ATOM   2746  O O    . LYS A 1 36  ? -14.132 -6.509  0.871   1.00 0.00 ? 1516 LYS A O    2  
ATOM   2747  C CB   . LYS A 1 36  ? -16.152 -7.391  3.291   1.00 0.00 ? 1516 LYS A CB   2  
ATOM   2748  C CG   . LYS A 1 36  ? -17.567 -7.407  2.712   1.00 0.00 ? 1516 LYS A CG   2  
ATOM   2749  C CD   . LYS A 1 36  ? -18.618 -7.353  3.828   1.00 0.00 ? 1516 LYS A CD   2  
ATOM   2750  C CE   . LYS A 1 36  ? -18.437 -6.199  4.841   1.00 0.00 ? 1516 LYS A CE   2  
ATOM   2751  N NZ   . LYS A 1 36  ? -19.629 -6.032  5.722   1.00 0.00 ? 1516 LYS A NZ   2  
ATOM   2752  H H    . LYS A 1 36  ? -13.677 -7.174  3.716   1.00 0.00 ? 1516 LYS A H    2  
ATOM   2753  H HA   . LYS A 1 36  ? -15.356 -9.103  2.262   1.00 0.00 ? 1516 LYS A HA   2  
ATOM   2754  H HB2  . LYS A 1 36  ? -16.168 -7.971  4.208   1.00 0.00 ? 1516 LYS A HB2  2  
ATOM   2755  H HB3  . LYS A 1 36  ? -15.855 -6.363  3.515   1.00 0.00 ? 1516 LYS A HB3  2  
ATOM   2756  H HG2  . LYS A 1 36  ? -17.707 -6.574  2.023   1.00 0.00 ? 1516 LYS A HG2  2  
ATOM   2757  H HG3  . LYS A 1 36  ? -17.725 -8.323  2.152   1.00 0.00 ? 1516 LYS A HG3  2  
ATOM   2758  H HD2  . LYS A 1 36  ? -19.591 -7.272  3.335   1.00 0.00 ? 1516 LYS A HD2  2  
ATOM   2759  H HD3  . LYS A 1 36  ? -18.556 -8.295  4.371   1.00 0.00 ? 1516 LYS A HD3  2  
ATOM   2760  H HE2  . LYS A 1 36  ? -17.551 -6.401  5.464   1.00 0.00 ? 1516 LYS A HE2  2  
ATOM   2761  H HE3  . LYS A 1 36  ? -18.258 -5.263  4.298   1.00 0.00 ? 1516 LYS A HE3  2  
ATOM   2762  H HZ1  . LYS A 1 36  ? -19.818 -6.866  6.269   1.00 0.00 ? 1516 LYS A HZ1  2  
ATOM   2763  H HZ2  . LYS A 1 36  ? -19.495 -5.272  6.383   1.00 0.00 ? 1516 LYS A HZ2  2  
ATOM   2764  H HZ3  . LYS A 1 36  ? -20.463 -5.813  5.191   1.00 0.00 ? 1516 LYS A HZ3  2  
ATOM   2765  N N    . LEU A 1 37  ? -15.597 -8.026  0.068   1.00 0.00 ? 1517 LEU A N    2  
ATOM   2766  C CA   . LEU A 1 37  ? -15.396 -7.736  -1.335  1.00 0.00 ? 1517 LEU A CA   2  
ATOM   2767  C C    . LEU A 1 37  ? -16.748 -7.443  -1.951  1.00 0.00 ? 1517 LEU A C    2  
ATOM   2768  O O    . LEU A 1 37  ? -17.606 -8.321  -1.979  1.00 0.00 ? 1517 LEU A O    2  
ATOM   2769  C CB   . LEU A 1 37  ? -14.806 -8.968  -2.050  1.00 0.00 ? 1517 LEU A CB   2  
ATOM   2770  C CG   . LEU A 1 37  ? -13.282 -9.114  -2.110  1.00 0.00 ? 1517 LEU A CG   2  
ATOM   2771  C CD1  . LEU A 1 37  ? -12.653 -8.111  -3.073  1.00 0.00 ? 1517 LEU A CD1  2  
ATOM   2772  C CD2  . LEU A 1 37  ? -12.573 -9.011  -0.767  1.00 0.00 ? 1517 LEU A CD2  2  
ATOM   2773  H H    . LEU A 1 37  ? -16.227 -8.791  0.290   1.00 0.00 ? 1517 LEU A H    2  
ATOM   2774  H HA   . LEU A 1 37  ? -14.732 -6.882  -1.460  1.00 0.00 ? 1517 LEU A HA   2  
ATOM   2775  H HB2  . LEU A 1 37  ? -15.233 -9.873  -1.612  1.00 0.00 ? 1517 LEU A HB2  2  
ATOM   2776  H HB3  . LEU A 1 37  ? -15.148 -8.939  -3.081  1.00 0.00 ? 1517 LEU A HB3  2  
ATOM   2777  H HG   . LEU A 1 37  ? -13.082 -10.108 -2.487  1.00 0.00 ? 1517 LEU A HG   2  
ATOM   2778  H HD11 . LEU A 1 37  ? -11.573 -8.257  -3.090  1.00 0.00 ? 1517 LEU A HD11 2  
ATOM   2779  H HD12 . LEU A 1 37  ? -13.047 -8.253  -4.081  1.00 0.00 ? 1517 LEU A HD12 2  
ATOM   2780  H HD13 . LEU A 1 37  ? -12.866 -7.098  -2.748  1.00 0.00 ? 1517 LEU A HD13 2  
ATOM   2781  H HD21 . LEU A 1 37  ? -12.666 -8.011  -0.349  1.00 0.00 ? 1517 LEU A HD21 2  
ATOM   2782  H HD22 . LEU A 1 37  ? -12.989 -9.751  -0.081  1.00 0.00 ? 1517 LEU A HD22 2  
ATOM   2783  H HD23 . LEU A 1 37  ? -11.516 -9.208  -0.905  1.00 0.00 ? 1517 LEU A HD23 2  
ATOM   2784  N N    . LEU A 1 38  ? -16.908 -6.232  -2.475  1.00 0.00 ? 1518 LEU A N    2  
ATOM   2785  C CA   . LEU A 1 38  ? -18.018 -5.827  -3.319  1.00 0.00 ? 1518 LEU A CA   2  
ATOM   2786  C C    . LEU A 1 38  ? -17.579 -6.298  -4.690  1.00 0.00 ? 1518 LEU A C    2  
ATOM   2787  O O    . LEU A 1 38  ? -16.820 -5.614  -5.379  1.00 0.00 ? 1518 LEU A O    2  
ATOM   2788  C CB   . LEU A 1 38  ? -18.261 -4.309  -3.273  1.00 0.00 ? 1518 LEU A CB   2  
ATOM   2789  C CG   . LEU A 1 38  ? -19.213 -3.764  -4.359  1.00 0.00 ? 1518 LEU A CG   2  
ATOM   2790  C CD1  . LEU A 1 38  ? -20.618 -4.367  -4.306  1.00 0.00 ? 1518 LEU A CD1  2  
ATOM   2791  C CD2  . LEU A 1 38  ? -19.316 -2.247  -4.171  1.00 0.00 ? 1518 LEU A CD2  2  
ATOM   2792  H H    . LEU A 1 38  ? -16.147 -5.574  -2.378  1.00 0.00 ? 1518 LEU A H    2  
ATOM   2793  H HA   . LEU A 1 38  ? -18.925 -6.354  -3.026  1.00 0.00 ? 1518 LEU A HA   2  
ATOM   2794  H HB2  . LEU A 1 38  ? -18.707 -4.074  -2.314  1.00 0.00 ? 1518 LEU A HB2  2  
ATOM   2795  H HB3  . LEU A 1 38  ? -17.300 -3.791  -3.350  1.00 0.00 ? 1518 LEU A HB3  2  
ATOM   2796  H HG   . LEU A 1 38  ? -18.798 -3.955  -5.346  1.00 0.00 ? 1518 LEU A HG   2  
ATOM   2797  H HD11 . LEU A 1 38  ? -21.221 -3.972  -5.126  1.00 0.00 ? 1518 LEU A HD11 2  
ATOM   2798  H HD12 . LEU A 1 38  ? -20.575 -5.453  -4.408  1.00 0.00 ? 1518 LEU A HD12 2  
ATOM   2799  H HD13 . LEU A 1 38  ? -21.098 -4.119  -3.361  1.00 0.00 ? 1518 LEU A HD13 2  
ATOM   2800  H HD21 . LEU A 1 38  ? -19.978 -1.821  -4.929  1.00 0.00 ? 1518 LEU A HD21 2  
ATOM   2801  H HD22 . LEU A 1 38  ? -19.717 -2.026  -3.182  1.00 0.00 ? 1518 LEU A HD22 2  
ATOM   2802  H HD23 . LEU A 1 38  ? -18.329 -1.783  -4.259  1.00 0.00 ? 1518 LEU A HD23 2  
ATOM   2803  N N    . PHE A 1 39  ? -17.950 -7.530  -5.014  1.00 0.00 ? 1519 PHE A N    2  
ATOM   2804  C CA   . PHE A 1 39  ? -17.697 -8.118  -6.310  1.00 0.00 ? 1519 PHE A CA   2  
ATOM   2805  C C    . PHE A 1 39  ? -18.235 -7.176  -7.393  1.00 0.00 ? 1519 PHE A C    2  
ATOM   2806  O O    . PHE A 1 39  ? -19.243 -6.492  -7.203  1.00 0.00 ? 1519 PHE A O    2  
ATOM   2807  C CB   . PHE A 1 39  ? -18.329 -9.510  -6.359  1.00 0.00 ? 1519 PHE A CB   2  
ATOM   2808  C CG   . PHE A 1 39  ? -17.595 -10.591 -5.585  1.00 0.00 ? 1519 PHE A CG   2  
ATOM   2809  C CD1  . PHE A 1 39  ? -16.485 -11.218 -6.173  1.00 0.00 ? 1519 PHE A CD1  2  
ATOM   2810  C CD2  . PHE A 1 39  ? -18.013 -10.987 -4.299  1.00 0.00 ? 1519 PHE A CD2  2  
ATOM   2811  C CE1  . PHE A 1 39  ? -15.814 -12.253 -5.503  1.00 0.00 ? 1519 PHE A CE1  2  
ATOM   2812  C CE2  . PHE A 1 39  ? -17.349 -12.039 -3.633  1.00 0.00 ? 1519 PHE A CE2  2  
ATOM   2813  C CZ   . PHE A 1 39  ? -16.239 -12.669 -4.234  1.00 0.00 ? 1519 PHE A CZ   2  
ATOM   2814  H H    . PHE A 1 39  ? -18.614 -8.003  -4.411  1.00 0.00 ? 1519 PHE A H    2  
ATOM   2815  H HA   . PHE A 1 39  ? -16.626 -8.244  -6.440  1.00 0.00 ? 1519 PHE A HA   2  
ATOM   2816  H HB2  . PHE A 1 39  ? -19.353 -9.442  -6.000  1.00 0.00 ? 1519 PHE A HB2  2  
ATOM   2817  H HB3  . PHE A 1 39  ? -18.360 -9.828  -7.400  1.00 0.00 ? 1519 PHE A HB3  2  
ATOM   2818  H HD1  . PHE A 1 39  ? -16.141 -10.918 -7.149  1.00 0.00 ? 1519 PHE A HD1  2  
ATOM   2819  H HD2  . PHE A 1 39  ? -18.846 -10.491 -3.819  1.00 0.00 ? 1519 PHE A HD2  2  
ATOM   2820  H HE1  . PHE A 1 39  ? -14.964 -12.730 -5.975  1.00 0.00 ? 1519 PHE A HE1  2  
ATOM   2821  H HE2  . PHE A 1 39  ? -17.700 -12.358 -2.657  1.00 0.00 ? 1519 PHE A HE2  2  
ATOM   2822  H HZ   . PHE A 1 39  ? -15.704 -13.474 -3.741  1.00 0.00 ? 1519 PHE A HZ   2  
ATOM   2823  N N    . ASP A 1 40  ? -17.583 -7.154  -8.553  1.00 0.00 ? 1520 ASP A N    2  
ATOM   2824  C CA   . ASP A 1 40  ? -18.066 -6.410  -9.721  1.00 0.00 ? 1520 ASP A CA   2  
ATOM   2825  C C    . ASP A 1 40  ? -19.371 -7.040  -10.226 1.00 0.00 ? 1520 ASP A C    2  
ATOM   2826  O O    . ASP A 1 40  ? -20.200 -6.377  -10.848 1.00 0.00 ? 1520 ASP A O    2  
ATOM   2827  C CB   . ASP A 1 40  ? -17.021 -6.410  -10.840 1.00 0.00 ? 1520 ASP A CB   2  
ATOM   2828  C CG   . ASP A 1 40  ? -15.902 -5.394  -10.586 1.00 0.00 ? 1520 ASP A CG   2  
ATOM   2829  O OD1  . ASP A 1 40  ? -16.131 -4.174  -10.757 1.00 0.00 ? 1520 ASP A OD1  2  
ATOM   2830  O OD2  . ASP A 1 40  ? -14.787 -5.813  -10.210 1.00 0.00 ? 1520 ASP A OD2  2  
ATOM   2831  H H    . ASP A 1 40  ? -16.796 -7.784  -8.676  1.00 0.00 ? 1520 ASP A H    2  
ATOM   2832  H HA   . ASP A 1 40  ? -18.270 -5.380  -9.436  1.00 0.00 ? 1520 ASP A HA   2  
ATOM   2833  H HB2  . ASP A 1 40  ? -16.603 -7.416  -10.952 1.00 0.00 ? 1520 ASP A HB2  2  
ATOM   2834  H HB3  . ASP A 1 40  ? -17.528 -6.157  -11.773 1.00 0.00 ? 1520 ASP A HB3  2  
ATOM   2835  N N    . ASP A 1 41  ? -19.559 -8.326  -9.910  1.00 0.00 ? 1521 ASP A N    2  
ATOM   2836  C CA   . ASP A 1 41  ? -20.792 -9.076  -10.089 1.00 0.00 ? 1521 ASP A CA   2  
ATOM   2837  C C    . ASP A 1 41  ? -21.922 -8.603  -9.157  1.00 0.00 ? 1521 ASP A C    2  
ATOM   2838  O O    . ASP A 1 41  ? -23.064 -9.029  -9.318  1.00 0.00 ? 1521 ASP A O    2  
ATOM   2839  C CB   . ASP A 1 41  ? -20.474 -10.576 -9.999  1.00 0.00 ? 1521 ASP A CB   2  
ATOM   2840  C CG   . ASP A 1 41  ? -20.953 -11.248 -8.720  1.00 0.00 ? 1521 ASP A CG   2  
ATOM   2841  O OD1  . ASP A 1 41  ? -20.773 -10.661 -7.636  1.00 0.00 ? 1521 ASP A OD1  2  
ATOM   2842  O OD2  . ASP A 1 41  ? -21.502 -12.363 -8.816  1.00 0.00 ? 1521 ASP A OD2  2  
ATOM   2843  H H    . ASP A 1 41  ? -18.834 -8.794  -9.392  1.00 0.00 ? 1521 ASP A H    2  
ATOM   2844  H HA   . ASP A 1 41  ? -21.156 -8.892  -11.089 1.00 0.00 ? 1521 ASP A HA   2  
ATOM   2845  H HB2  . ASP A 1 41  ? -20.946 -11.057 -10.844 1.00 0.00 ? 1521 ASP A HB2  2  
ATOM   2846  H HB3  . ASP A 1 41  ? -19.400 -10.756 -10.107 1.00 0.00 ? 1521 ASP A HB3  2  
ATOM   2847  N N    . GLY A 1 42  ? -21.632 -7.686  -8.236  1.00 0.00 ? 1522 GLY A N    2  
ATOM   2848  C CA   . GLY A 1 42  ? -22.616 -6.978  -7.430  1.00 0.00 ? 1522 GLY A CA   2  
ATOM   2849  C C    . GLY A 1 42  ? -22.875 -7.622  -6.073  1.00 0.00 ? 1522 GLY A C    2  
ATOM   2850  O O    . GLY A 1 42  ? -23.659 -7.069  -5.297  1.00 0.00 ? 1522 GLY A O    2  
ATOM   2851  H H    . GLY A 1 42  ? -20.669 -7.389  -8.134  1.00 0.00 ? 1522 GLY A H    2  
ATOM   2852  H HA2  . GLY A 1 42  ? -22.244 -5.967  -7.264  1.00 0.00 ? 1522 GLY A HA2  2  
ATOM   2853  H HA3  . GLY A 1 42  ? -23.560 -6.924  -7.976  1.00 0.00 ? 1522 GLY A HA3  2  
ATOM   2854  N N    . TYR A 1 43  ? -22.286 -8.778  -5.775  1.00 0.00 ? 1523 TYR A N    2  
ATOM   2855  C CA   . TYR A 1 43  ? -22.383 -9.401  -4.457  1.00 0.00 ? 1523 TYR A CA   2  
ATOM   2856  C C    . TYR A 1 43  ? -21.445 -8.722  -3.449  1.00 0.00 ? 1523 TYR A C    2  
ATOM   2857  O O    . TYR A 1 43  ? -20.482 -8.066  -3.844  1.00 0.00 ? 1523 TYR A O    2  
ATOM   2858  C CB   . TYR A 1 43  ? -22.034 -10.880 -4.611  1.00 0.00 ? 1523 TYR A CB   2  
ATOM   2859  C CG   . TYR A 1 43  ? -23.189 -11.699 -5.157  1.00 0.00 ? 1523 TYR A CG   2  
ATOM   2860  C CD1  . TYR A 1 43  ? -23.640 -11.566 -6.494  1.00 0.00 ? 1523 TYR A CD1  2  
ATOM   2861  C CD2  . TYR A 1 43  ? -23.824 -12.606 -4.282  1.00 0.00 ? 1523 TYR A CD2  2  
ATOM   2862  C CE1  . TYR A 1 43  ? -24.762 -12.291 -6.908  1.00 0.00 ? 1523 TYR A CE1  2  
ATOM   2863  C CE2  . TYR A 1 43  ? -24.959 -13.318 -4.706  1.00 0.00 ? 1523 TYR A CE2  2  
ATOM   2864  C CZ   . TYR A 1 43  ? -25.435 -13.165 -6.025  1.00 0.00 ? 1523 TYR A CZ   2  
ATOM   2865  O OH   . TYR A 1 43  ? -26.525 -13.871 -6.438  1.00 0.00 ? 1523 TYR A OH   2  
ATOM   2866  H H    . TYR A 1 43  ? -21.711 -9.251  -6.476  1.00 0.00 ? 1523 TYR A H    2  
ATOM   2867  H HA   . TYR A 1 43  ? -23.409 -9.323  -4.091  1.00 0.00 ? 1523 TYR A HA   2  
ATOM   2868  H HB2  . TYR A 1 43  ? -21.163 -10.974 -5.249  1.00 0.00 ? 1523 TYR A HB2  2  
ATOM   2869  H HB3  . TYR A 1 43  ? -21.757 -11.279 -3.634  1.00 0.00 ? 1523 TYR A HB3  2  
ATOM   2870  H HD1  . TYR A 1 43  ? -23.168 -10.925 -7.244  1.00 0.00 ? 1523 TYR A HD1  2  
ATOM   2871  H HD2  . TYR A 1 43  ? -23.446 -12.764 -3.275  1.00 0.00 ? 1523 TYR A HD2  2  
ATOM   2872  H HE1  . TYR A 1 43  ? -25.095 -12.162 -7.916  1.00 0.00 ? 1523 TYR A HE1  2  
ATOM   2873  H HE2  . TYR A 1 43  ? -25.464 -13.986 -4.020  1.00 0.00 ? 1523 TYR A HE2  2  
ATOM   2874  H HH   . TYR A 1 43  ? -26.709 -13.762 -7.385  1.00 0.00 ? 1523 TYR A HH   2  
ATOM   2875  N N    . GLU A 1 44  ? -21.671 -8.933  -2.147  1.00 0.00 ? 1524 GLU A N    2  
ATOM   2876  C CA   . GLU A 1 44  ? -20.804 -8.458  -1.065  1.00 0.00 ? 1524 GLU A CA   2  
ATOM   2877  C C    . GLU A 1 44  ? -20.734 -9.540  0.016   1.00 0.00 ? 1524 GLU A C    2  
ATOM   2878  O O    . GLU A 1 44  ? -21.711 -9.733  0.748   1.00 0.00 ? 1524 GLU A O    2  
ATOM   2879  C CB   . GLU A 1 44  ? -21.310 -7.145  -0.435  1.00 0.00 ? 1524 GLU A CB   2  
ATOM   2880  C CG   . GLU A 1 44  ? -21.038 -5.896  -1.253  1.00 0.00 ? 1524 GLU A CG   2  
ATOM   2881  C CD   . GLU A 1 44  ? -21.725 -4.668  -0.627  1.00 0.00 ? 1524 GLU A CD   2  
ATOM   2882  O OE1  . GLU A 1 44  ? -22.895 -4.377  -0.972  1.00 0.00 ? 1524 GLU A OE1  2  
ATOM   2883  O OE2  . GLU A 1 44  ? -21.098 -3.980  0.215   1.00 0.00 ? 1524 GLU A OE2  2  
ATOM   2884  H H    . GLU A 1 44  ? -22.427 -9.545  -1.874  1.00 0.00 ? 1524 GLU A H    2  
ATOM   2885  H HA   . GLU A 1 44  ? -19.810 -8.283  -1.454  1.00 0.00 ? 1524 GLU A HA   2  
ATOM   2886  H HB2  . GLU A 1 44  ? -22.384 -7.203  -0.274  1.00 0.00 ? 1524 GLU A HB2  2  
ATOM   2887  H HB3  . GLU A 1 44  ? -20.783 -7.003  0.511   1.00 0.00 ? 1524 GLU A HB3  2  
ATOM   2888  H HG2  . GLU A 1 44  ? -19.958 -5.745  -1.263  1.00 0.00 ? 1524 GLU A HG2  2  
ATOM   2889  H HG3  . GLU A 1 44  ? -21.407 -6.052  -2.264  1.00 0.00 ? 1524 GLU A HG3  2  
ATOM   2890  N N    . CYS A 1 45  ? -19.582 -10.213 0.139   1.00 0.00 ? 1525 CYS A N    2  
ATOM   2891  C CA   . CYS A 1 45  ? -19.301 -11.196 1.189   1.00 0.00 ? 1525 CYS A CA   2  
ATOM   2892  C C    . CYS A 1 45  ? -17.829 -11.080 1.603   1.00 0.00 ? 1525 CYS A C    2  
ATOM   2893  O O    . CYS A 1 45  ? -17.008 -10.507 0.882   1.00 0.00 ? 1525 CYS A O    2  
ATOM   2894  C CB   . CYS A 1 45  ? -19.583 -12.626 0.689   1.00 0.00 ? 1525 CYS A CB   2  
ATOM   2895  S SG   . CYS A 1 45  ? -21.331 -12.877 0.251   1.00 0.00 ? 1525 CYS A SG   2  
ATOM   2896  H H    . CYS A 1 45  ? -18.806 -9.988  -0.476  1.00 0.00 ? 1525 CYS A H    2  
ATOM   2897  H HA   . CYS A 1 45  ? -19.930 -10.995 2.059   1.00 0.00 ? 1525 CYS A HA   2  
ATOM   2898  H HB2  . CYS A 1 45  ? -18.937 -12.842 -0.158  1.00 0.00 ? 1525 CYS A HB2  2  
ATOM   2899  H HB3  . CYS A 1 45  ? -19.344 -13.343 1.472   1.00 0.00 ? 1525 CYS A HB3  2  
ATOM   2900  H HG   . CYS A 1 45  ? -21.227 -14.185 -0.041  1.00 0.00 ? 1525 CYS A HG   2  
ATOM   2901  N N    . ASP A 1 46  ? -17.502 -11.623 2.774   1.00 0.00 ? 1526 ASP A N    2  
ATOM   2902  C CA   . ASP A 1 46  ? -16.135 -11.798 3.244   1.00 0.00 ? 1526 ASP A CA   2  
ATOM   2903  C C    . ASP A 1 46  ? -15.423 -12.872 2.422   1.00 0.00 ? 1526 ASP A C    2  
ATOM   2904  O O    . ASP A 1 46  ? -16.033 -13.864 2.010   1.00 0.00 ? 1526 ASP A O    2  
ATOM   2905  C CB   . ASP A 1 46  ? -16.091 -12.164 4.735   1.00 0.00 ? 1526 ASP A CB   2  
ATOM   2906  C CG   . ASP A 1 46  ? -16.473 -13.630 5.009   1.00 0.00 ? 1526 ASP A CG   2  
ATOM   2907  O OD1  . ASP A 1 46  ? -17.689 -13.936 5.029   1.00 0.00 ? 1526 ASP A OD1  2  
ATOM   2908  O OD2  . ASP A 1 46  ? -15.564 -14.468 5.212   1.00 0.00 ? 1526 ASP A OD2  2  
ATOM   2909  H H    . ASP A 1 46  ? -18.213 -12.119 3.292   1.00 0.00 ? 1526 ASP A H    2  
ATOM   2910  H HA   . ASP A 1 46  ? -15.602 -10.863 3.126   1.00 0.00 ? 1526 ASP A HA   2  
ATOM   2911  H HB2  . ASP A 1 46  ? -15.071 -11.999 5.081   1.00 0.00 ? 1526 ASP A HB2  2  
ATOM   2912  H HB3  . ASP A 1 46  ? -16.744 -11.489 5.294   1.00 0.00 ? 1526 ASP A HB3  2  
ATOM   2913  N N    . VAL A 1 47  ? -14.123 -12.671 2.227   1.00 0.00 ? 1527 VAL A N    2  
ATOM   2914  C CA   . VAL A 1 47  ? -13.201 -13.615 1.616   1.00 0.00 ? 1527 VAL A CA   2  
ATOM   2915  C C    . VAL A 1 47  ? -11.902 -13.529 2.428   1.00 0.00 ? 1527 VAL A C    2  
ATOM   2916  O O    . VAL A 1 47  ? -11.526 -12.448 2.882   1.00 0.00 ? 1527 VAL A O    2  
ATOM   2917  C CB   . VAL A 1 47  ? -13.014 -13.248 0.126   1.00 0.00 ? 1527 VAL A CB   2  
ATOM   2918  C CG1  . VAL A 1 47  ? -11.944 -14.101 -0.558  1.00 0.00 ? 1527 VAL A CG1  2  
ATOM   2919  C CG2  . VAL A 1 47  ? -14.307 -13.436 -0.687  1.00 0.00 ? 1527 VAL A CG2  2  
ATOM   2920  H H    . VAL A 1 47  ? -13.714 -11.787 2.525   1.00 0.00 ? 1527 VAL A H    2  
ATOM   2921  H HA   . VAL A 1 47  ? -13.606 -14.623 1.689   1.00 0.00 ? 1527 VAL A HA   2  
ATOM   2922  H HB   . VAL A 1 47  ? -12.706 -12.202 0.056   1.00 0.00 ? 1527 VAL A HB   2  
ATOM   2923  H HG11 . VAL A 1 47  ? -11.739 -13.699 -1.546  1.00 0.00 ? 1527 VAL A HG11 2  
ATOM   2924  H HG12 . VAL A 1 47  ? -11.021 -14.065 0.010   1.00 0.00 ? 1527 VAL A HG12 2  
ATOM   2925  H HG13 . VAL A 1 47  ? -12.281 -15.134 -0.642  1.00 0.00 ? 1527 VAL A HG13 2  
ATOM   2926  H HG21 . VAL A 1 47  ? -14.656 -14.463 -0.566  1.00 0.00 ? 1527 VAL A HG21 2  
ATOM   2927  H HG22 . VAL A 1 47  ? -15.078 -12.742 -0.351  1.00 0.00 ? 1527 VAL A HG22 2  
ATOM   2928  H HG23 . VAL A 1 47  ? -14.120 -13.279 -1.749  1.00 0.00 ? 1527 VAL A HG23 2  
ATOM   2929  N N    . LEU A 1 48  ? -11.220 -14.659 2.660   1.00 0.00 ? 1528 LEU A N    2  
ATOM   2930  C CA   . LEU A 1 48  ? -9.963  -14.687 3.412   1.00 0.00 ? 1528 LEU A CA   2  
ATOM   2931  C C    . LEU A 1 48  ? -8.795  -14.229 2.538   1.00 0.00 ? 1528 LEU A C    2  
ATOM   2932  O O    . LEU A 1 48  ? -8.819  -14.437 1.331   1.00 0.00 ? 1528 LEU A O    2  
ATOM   2933  C CB   . LEU A 1 48  ? -9.721  -16.100 3.988   1.00 0.00 ? 1528 LEU A CB   2  
ATOM   2934  C CG   . LEU A 1 48  ? -9.814  -16.172 5.527   1.00 0.00 ? 1528 LEU A CG   2  
ATOM   2935  C CD1  . LEU A 1 48  ? -9.641  -17.619 5.990   1.00 0.00 ? 1528 LEU A CD1  2  
ATOM   2936  C CD2  . LEU A 1 48  ? -8.775  -15.288 6.223   1.00 0.00 ? 1528 LEU A CD2  2  
ATOM   2937  H H    . LEU A 1 48  ? -11.533 -15.519 2.235   1.00 0.00 ? 1528 LEU A H    2  
ATOM   2938  H HA   . LEU A 1 48  ? -10.045 -13.977 4.224   1.00 0.00 ? 1528 LEU A HA   2  
ATOM   2939  H HB2  . LEU A 1 48  ? -10.444 -16.799 3.555   1.00 0.00 ? 1528 LEU A HB2  2  
ATOM   2940  H HB3  . LEU A 1 48  ? -8.739  -16.455 3.679   1.00 0.00 ? 1528 LEU A HB3  2  
ATOM   2941  H HG   . LEU A 1 48  ? -10.792 -15.812 5.835   1.00 0.00 ? 1528 LEU A HG   2  
ATOM   2942  H HD11 . LEU A 1 48  ? -8.652  -17.988 5.714   1.00 0.00 ? 1528 LEU A HD11 2  
ATOM   2943  H HD12 . LEU A 1 48  ? -9.754  -17.678 7.074   1.00 0.00 ? 1528 LEU A HD12 2  
ATOM   2944  H HD13 . LEU A 1 48  ? -10.401 -18.250 5.529   1.00 0.00 ? 1528 LEU A HD13 2  
ATOM   2945  H HD21 . LEU A 1 48  ? -9.077  -14.250 6.129   1.00 0.00 ? 1528 LEU A HD21 2  
ATOM   2946  H HD22 . LEU A 1 48  ? -8.747  -15.510 7.289   1.00 0.00 ? 1528 LEU A HD22 2  
ATOM   2947  H HD23 . LEU A 1 48  ? -7.778  -15.440 5.801   1.00 0.00 ? 1528 LEU A HD23 2  
ATOM   2948  N N    . GLY A 1 49  ? -7.743  -13.667 3.144   1.00 0.00 ? 1529 GLY A N    2  
ATOM   2949  C CA   . GLY A 1 49  ? -6.626  -13.028 2.456   1.00 0.00 ? 1529 GLY A CA   2  
ATOM   2950  C C    . GLY A 1 49  ? -5.956  -13.929 1.424   1.00 0.00 ? 1529 GLY A C    2  
ATOM   2951  O O    . GLY A 1 49  ? -5.649  -13.486 0.317   1.00 0.00 ? 1529 GLY A O    2  
ATOM   2952  H H    . GLY A 1 49  ? -7.796  -13.474 4.142   1.00 0.00 ? 1529 GLY A H    2  
ATOM   2953  H HA2  . GLY A 1 49  ? -6.984  -12.121 1.972   1.00 0.00 ? 1529 GLY A HA2  2  
ATOM   2954  H HA3  . GLY A 1 49  ? -5.882  -12.747 3.204   1.00 0.00 ? 1529 GLY A HA3  2  
ATOM   2955  N N    . LYS A 1 50  ? -5.771  -15.220 1.740   1.00 0.00 ? 1530 LYS A N    2  
ATOM   2956  C CA   . LYS A 1 50  ? -5.147  -16.139 0.776   1.00 0.00 ? 1530 LYS A CA   2  
ATOM   2957  C C    . LYS A 1 50  ? -5.951  -16.244 -0.526  1.00 0.00 ? 1530 LYS A C    2  
ATOM   2958  O O    . LYS A 1 50  ? -5.383  -16.519 -1.577  1.00 0.00 ? 1530 LYS A O    2  
ATOM   2959  C CB   . LYS A 1 50  ? -4.811  -17.521 1.375   1.00 0.00 ? 1530 LYS A CB   2  
ATOM   2960  C CG   . LYS A 1 50  ? -5.991  -18.394 1.848   1.00 0.00 ? 1530 LYS A CG   2  
ATOM   2961  C CD   . LYS A 1 50  ? -6.346  -18.267 3.345   1.00 0.00 ? 1530 LYS A CD   2  
ATOM   2962  C CE   . LYS A 1 50  ? -5.237  -18.694 4.326   1.00 0.00 ? 1530 LYS A CE   2  
ATOM   2963  N NZ   . LYS A 1 50  ? -4.935  -20.156 4.299   1.00 0.00 ? 1530 LYS A NZ   2  
ATOM   2964  H H    . LYS A 1 50  ? -6.057  -15.550 2.655   1.00 0.00 ? 1530 LYS A H    2  
ATOM   2965  H HA   . LYS A 1 50  ? -4.197  -15.682 0.502   1.00 0.00 ? 1530 LYS A HA   2  
ATOM   2966  H HB2  . LYS A 1 50  ? -4.291  -18.081 0.594   1.00 0.00 ? 1530 LYS A HB2  2  
ATOM   2967  H HB3  . LYS A 1 50  ? -4.085  -17.396 2.180   1.00 0.00 ? 1530 LYS A HB3  2  
ATOM   2968  H HG2  . LYS A 1 50  ? -6.879  -18.155 1.264   1.00 0.00 ? 1530 LYS A HG2  2  
ATOM   2969  H HG3  . LYS A 1 50  ? -5.748  -19.437 1.642   1.00 0.00 ? 1530 LYS A HG3  2  
ATOM   2970  H HD2  . LYS A 1 50  ? -6.598  -17.231 3.561   1.00 0.00 ? 1530 LYS A HD2  2  
ATOM   2971  H HD3  . LYS A 1 50  ? -7.242  -18.861 3.549   1.00 0.00 ? 1530 LYS A HD3  2  
ATOM   2972  H HE2  . LYS A 1 50  ? -4.328  -18.122 4.113   1.00 0.00 ? 1530 LYS A HE2  2  
ATOM   2973  H HE3  . LYS A 1 50  ? -5.552  -18.421 5.337   1.00 0.00 ? 1530 LYS A HE3  2  
ATOM   2974  H HZ1  . LYS A 1 50  ? -5.753  -20.717 4.507   1.00 0.00 ? 1530 LYS A HZ1  2  
ATOM   2975  H HZ2  . LYS A 1 50  ? -4.565  -20.455 3.404   1.00 0.00 ? 1530 LYS A HZ2  2  
ATOM   2976  H HZ3  . LYS A 1 50  ? -4.238  -20.387 5.002   1.00 0.00 ? 1530 LYS A HZ3  2  
ATOM   2977  N N    . ASP A 1 51  ? -7.257  -15.984 -0.465  1.00 0.00 ? 1531 ASP A N    2  
ATOM   2978  C CA   . ASP A 1 51  ? -8.214  -16.181 -1.552  1.00 0.00 ? 1531 ASP A CA   2  
ATOM   2979  C C    . ASP A 1 51  ? -8.515  -14.888 -2.310  1.00 0.00 ? 1531 ASP A C    2  
ATOM   2980  O O    . ASP A 1 51  ? -9.474  -14.850 -3.083  1.00 0.00 ? 1531 ASP A O    2  
ATOM   2981  C CB   . ASP A 1 51  ? -9.502  -16.812 -0.989  1.00 0.00 ? 1531 ASP A CB   2  
ATOM   2982  C CG   . ASP A 1 51  ? -9.328  -18.278 -0.573  1.00 0.00 ? 1531 ASP A CG   2  
ATOM   2983  O OD1  . ASP A 1 51  ? -8.551  -19.006 -1.235  1.00 0.00 ? 1531 ASP A OD1  2  
ATOM   2984  O OD2  . ASP A 1 51  ? -9.969  -18.706 0.418   1.00 0.00 ? 1531 ASP A OD2  2  
ATOM   2985  H H    . ASP A 1 51  ? -7.651  -15.680 0.421   1.00 0.00 ? 1531 ASP A H    2  
ATOM   2986  H HA   . ASP A 1 51  ? -7.792  -16.874 -2.277  1.00 0.00 ? 1531 ASP A HA   2  
ATOM   2987  H HB2  . ASP A 1 51  ? -9.885  -16.219 -0.159  1.00 0.00 ? 1531 ASP A HB2  2  
ATOM   2988  H HB3  . ASP A 1 51  ? -10.264 -16.790 -1.758  1.00 0.00 ? 1531 ASP A HB3  2  
ATOM   2989  N N    . ILE A 1 52  ? -7.726  -13.823 -2.129  1.00 0.00 ? 1532 ILE A N    2  
ATOM   2990  C CA   . ILE A 1 52  ? -7.907  -12.551 -2.828  1.00 0.00 ? 1532 ILE A CA   2  
ATOM   2991  C C    . ILE A 1 52  ? -6.604  -12.297 -3.570  1.00 0.00 ? 1532 ILE A C    2  
ATOM   2992  O O    . ILE A 1 52  ? -5.530  -12.373 -2.981  1.00 0.00 ? 1532 ILE A O    2  
ATOM   2993  C CB   . ILE A 1 52  ? -8.314  -11.390 -1.882  1.00 0.00 ? 1532 ILE A CB   2  
ATOM   2994  C CG1  . ILE A 1 52  ? -8.787  -11.892 -0.504  1.00 0.00 ? 1532 ILE A CG1  2  
ATOM   2995  C CG2  . ILE A 1 52  ? -9.348  -10.468 -2.548  1.00 0.00 ? 1532 ILE A CG2  2  
ATOM   2996  C CD1  . ILE A 1 52  ? -9.450  -10.892 0.432   1.00 0.00 ? 1532 ILE A CD1  2  
ATOM   2997  H H    . ILE A 1 52  ? -6.943  -13.879 -1.483  1.00 0.00 ? 1532 ILE A H    2  
ATOM   2998  H HA   . ILE A 1 52  ? -8.699  -12.667 -3.562  1.00 0.00 ? 1532 ILE A HA   2  
ATOM   2999  H HB   . ILE A 1 52  ? -7.443  -10.772 -1.729  1.00 0.00 ? 1532 ILE A HB   2  
ATOM   3000  H HG12 . ILE A 1 52  ? -9.500  -12.694 -0.654  1.00 0.00 ? 1532 ILE A HG12 2  
ATOM   3001  H HG13 . ILE A 1 52  ? -7.923  -12.297 0.018   1.00 0.00 ? 1532 ILE A HG13 2  
ATOM   3002  H HG21 . ILE A 1 52  ? -10.321 -10.961 -2.564  1.00 0.00 ? 1532 ILE A HG21 2  
ATOM   3003  H HG22 . ILE A 1 52  ? -9.426  -9.532  -1.987  1.00 0.00 ? 1532 ILE A HG22 2  
ATOM   3004  H HG23 . ILE A 1 52  ? -9.035  -10.219 -3.566  1.00 0.00 ? 1532 ILE A HG23 2  
ATOM   3005  H HD11 . ILE A 1 52  ? -8.915  -9.944  0.429   1.00 0.00 ? 1532 ILE A HD11 2  
ATOM   3006  H HD12 . ILE A 1 52  ? -10.482 -10.747 0.133   1.00 0.00 ? 1532 ILE A HD12 2  
ATOM   3007  H HD13 . ILE A 1 52  ? -9.448  -11.307 1.439   1.00 0.00 ? 1532 ILE A HD13 2  
ATOM   3008  N N    . LEU A 1 53  ? -6.711  -12.042 -4.870  1.00 0.00 ? 1533 LEU A N    2  
ATOM   3009  C CA   . LEU A 1 53  ? -5.642  -11.954 -5.844  1.00 0.00 ? 1533 LEU A CA   2  
ATOM   3010  C C    . LEU A 1 53  ? -5.585  -10.487 -6.257  1.00 0.00 ? 1533 LEU A C    2  
ATOM   3011  O O    . LEU A 1 53  ? -6.545  -10.009 -6.859  1.00 0.00 ? 1533 LEU A O    2  
ATOM   3012  C CB   . LEU A 1 53  ? -5.995  -12.808 -7.086  1.00 0.00 ? 1533 LEU A CB   2  
ATOM   3013  C CG   . LEU A 1 53  ? -6.338  -14.292 -6.856  1.00 0.00 ? 1533 LEU A CG   2  
ATOM   3014  C CD1  . LEU A 1 53  ? -6.781  -14.922 -8.180  1.00 0.00 ? 1533 LEU A CD1  2  
ATOM   3015  C CD2  . LEU A 1 53  ? -5.155  -15.072 -6.293  1.00 0.00 ? 1533 LEU A CD2  2  
ATOM   3016  H H    . LEU A 1 53  ? -7.641  -11.908 -5.237  1.00 0.00 ? 1533 LEU A H    2  
ATOM   3017  H HA   . LEU A 1 53  ? -4.704  -12.283 -5.407  1.00 0.00 ? 1533 LEU A HA   2  
ATOM   3018  H HB2  . LEU A 1 53  ? -6.861  -12.355 -7.573  1.00 0.00 ? 1533 LEU A HB2  2  
ATOM   3019  H HB3  . LEU A 1 53  ? -5.166  -12.740 -7.788  1.00 0.00 ? 1533 LEU A HB3  2  
ATOM   3020  H HG   . LEU A 1 53  ? -7.160  -14.386 -6.151  1.00 0.00 ? 1533 LEU A HG   2  
ATOM   3021  H HD11 . LEU A 1 53  ? -7.037  -15.977 -8.025  1.00 0.00 ? 1533 LEU A HD11 2  
ATOM   3022  H HD12 . LEU A 1 53  ? -7.668  -14.406 -8.564  1.00 0.00 ? 1533 LEU A HD12 2  
ATOM   3023  H HD13 . LEU A 1 53  ? -5.987  -14.854 -8.924  1.00 0.00 ? 1533 LEU A HD13 2  
ATOM   3024  H HD21 . LEU A 1 53  ? -5.458  -16.111 -6.159  1.00 0.00 ? 1533 LEU A HD21 2  
ATOM   3025  H HD22 . LEU A 1 53  ? -4.318  -15.042 -6.990  1.00 0.00 ? 1533 LEU A HD22 2  
ATOM   3026  H HD23 . LEU A 1 53  ? -4.853  -14.658 -5.325  1.00 0.00 ? 1533 LEU A HD23 2  
ATOM   3027  N N    . LEU A 1 54  ? -4.502  -9.770  -5.946  1.00 0.00 ? 1534 LEU A N    2  
ATOM   3028  C CA   . LEU A 1 54  ? -4.445  -8.313  -6.138  1.00 0.00 ? 1534 LEU A CA   2  
ATOM   3029  C C    . LEU A 1 54  ? -3.424  -7.841  -7.181  1.00 0.00 ? 1534 LEU A C    2  
ATOM   3030  O O    . LEU A 1 54  ? -3.258  -6.638  -7.388  1.00 0.00 ? 1534 LEU A O    2  
ATOM   3031  C CB   . LEU A 1 54  ? -4.284  -7.580  -4.801  1.00 0.00 ? 1534 LEU A CB   2  
ATOM   3032  C CG   . LEU A 1 54  ? -3.049  -7.889  -3.939  1.00 0.00 ? 1534 LEU A CG   2  
ATOM   3033  C CD1  . LEU A 1 54  ? -1.698  -7.842  -4.654  1.00 0.00 ? 1534 LEU A CD1  2  
ATOM   3034  C CD2  . LEU A 1 54  ? -3.061  -6.892  -2.773  1.00 0.00 ? 1534 LEU A CD2  2  
ATOM   3035  H H    . LEU A 1 54  ? -3.756  -10.214 -5.420  1.00 0.00 ? 1534 LEU A H    2  
ATOM   3036  H HA   . LEU A 1 54  ? -5.415  -7.994  -6.514  1.00 0.00 ? 1534 LEU A HA   2  
ATOM   3037  H HB2  . LEU A 1 54  ? -4.320  -6.507  -4.992  1.00 0.00 ? 1534 LEU A HB2  2  
ATOM   3038  H HB3  . LEU A 1 54  ? -5.161  -7.829  -4.201  1.00 0.00 ? 1534 LEU A HB3  2  
ATOM   3039  H HG   . LEU A 1 54  ? -3.156  -8.898  -3.552  1.00 0.00 ? 1534 LEU A HG   2  
ATOM   3040  H HD11 . LEU A 1 54  ? -0.896  -7.971  -3.928  1.00 0.00 ? 1534 LEU A HD11 2  
ATOM   3041  H HD12 . LEU A 1 54  ? -1.640  -8.664  -5.367  1.00 0.00 ? 1534 LEU A HD12 2  
ATOM   3042  H HD13 . LEU A 1 54  ? -1.572  -6.892  -5.176  1.00 0.00 ? 1534 LEU A HD13 2  
ATOM   3043  H HD21 . LEU A 1 54  ? -2.714  -5.916  -3.108  1.00 0.00 ? 1534 LEU A HD21 2  
ATOM   3044  H HD22 . LEU A 1 54  ? -4.077  -6.774  -2.384  1.00 0.00 ? 1534 LEU A HD22 2  
ATOM   3045  H HD23 . LEU A 1 54  ? -2.419  -7.266  -1.972  1.00 0.00 ? 1534 LEU A HD23 2  
ATOM   3046  N N    . CYS A 1 55  ? -2.762  -8.786  -7.855  1.00 0.00 ? 1535 CYS A N    2  
ATOM   3047  C CA   . CYS A 1 55  ? -1.853  -8.555  -8.982  1.00 0.00 ? 1535 CYS A CA   2  
ATOM   3048  C C    . CYS A 1 55  ? -2.465  -9.329  -10.157 1.00 0.00 ? 1535 CYS A C    2  
ATOM   3049  O O    . CYS A 1 55  ? -1.792  -10.038 -10.900 1.00 0.00 ? 1535 CYS A O    2  
ATOM   3050  C CB   . CYS A 1 55  ? -0.431  -9.026  -8.624  1.00 0.00 ? 1535 CYS A CB   2  
ATOM   3051  S SG   . CYS A 1 55  ? 0.355   -7.876  -7.462  1.00 0.00 ? 1535 CYS A SG   2  
ATOM   3052  H H    . CYS A 1 55  ? -3.050  -9.739  -7.697  1.00 0.00 ? 1535 CYS A H    2  
ATOM   3053  H HA   . CYS A 1 55  ? -1.844  -7.490  -9.218  1.00 0.00 ? 1535 CYS A HA   2  
ATOM   3054  H HB2  . CYS A 1 55  ? -0.472  -10.021 -8.183  1.00 0.00 ? 1535 CYS A HB2  2  
ATOM   3055  H HB3  . CYS A 1 55  ? 0.182   -9.100  -9.527  1.00 0.00 ? 1535 CYS A HB3  2  
ATOM   3056  H HG   . CYS A 1 55  ? 1.534   -8.525  -7.373  1.00 0.00 ? 1535 CYS A HG   2  
ATOM   3057  N N    . ASP A 1 56  ? -3.783  -9.188  -10.286 1.00 0.00 ? 1536 ASP A N    2  
ATOM   3058  C CA   . ASP A 1 56  ? -4.680  -9.971  -11.122 1.00 0.00 ? 1536 ASP A CA   2  
ATOM   3059  C C    . ASP A 1 56  ? -4.976  -9.642  -12.593 1.00 0.00 ? 1536 ASP A C    2  
ATOM   3060  O O    . ASP A 1 56  ? -5.819  -10.376 -13.120 1.00 0.00 ? 1536 ASP A O    2  
ATOM   3061  C CB   . ASP A 1 56  ? -6.014  -9.967  -10.373 1.00 0.00 ? 1536 ASP A CB   2  
ATOM   3062  C CG   . ASP A 1 56  ? -6.623  -8.553  -10.454 1.00 0.00 ? 1536 ASP A CG   2  
ATOM   3063  O OD1  . ASP A 1 56  ? -6.205  -7.697  -9.640  1.00 0.00 ? 1536 ASP A OD1  2  
ATOM   3064  O OD2  . ASP A 1 56  ? -7.496  -8.290  -11.313 1.00 0.00 ? 1536 ASP A OD2  2  
ATOM   3065  H H    . ASP A 1 56  ? -4.247  -8.504  -9.697  1.00 0.00 ? 1536 ASP A H    2  
ATOM   3066  H HA   . ASP A 1 56  ? -4.266  -10.975 -11.145 1.00 0.00 ? 1536 ASP A HA   2  
ATOM   3067  H HB2  . ASP A 1 56  ? -6.684  -10.709 -10.808 1.00 0.00 ? 1536 ASP A HB2  2  
ATOM   3068  H HB3  . ASP A 1 56  ? -5.858  -10.249 -9.332  1.00 0.00 ? 1536 ASP A HB3  2  
ATOM   3069  N N    . PRO A 1 57  ? -4.390  -8.660  -13.316 1.00 0.00 ? 1537 PRO A N    2  
ATOM   3070  C CA   . PRO A 1 57  ? -4.588  -8.609  -14.769 1.00 0.00 ? 1537 PRO A CA   2  
ATOM   3071  C C    . PRO A 1 57  ? -4.187  -9.984  -15.337 1.00 0.00 ? 1537 PRO A C    2  
ATOM   3072  O O    . PRO A 1 57  ? -3.038  -10.399 -15.170 1.00 0.00 ? 1537 PRO A O    2  
ATOM   3073  C CB   . PRO A 1 57  ? -3.719  -7.456  -15.283 1.00 0.00 ? 1537 PRO A CB   2  
ATOM   3074  C CG   . PRO A 1 57  ? -2.683  -7.297  -14.174 1.00 0.00 ? 1537 PRO A CG   2  
ATOM   3075  C CD   . PRO A 1 57  ? -3.472  -7.611  -12.912 1.00 0.00 ? 1537 PRO A CD   2  
ATOM   3076  H HA   . PRO A 1 57  ? -5.633  -8.399  -14.982 1.00 0.00 ? 1537 PRO A HA   2  
ATOM   3077  H HB2  . PRO A 1 57  ? -3.258  -7.679  -16.246 1.00 0.00 ? 1537 PRO A HB2  2  
ATOM   3078  H HB3  . PRO A 1 57  ? -4.320  -6.546  -15.355 1.00 0.00 ? 1537 PRO A HB3  2  
ATOM   3079  H HG2  . PRO A 1 57  ? -1.913  -8.064  -14.266 1.00 0.00 ? 1537 PRO A HG2  2  
ATOM   3080  H HG3  . PRO A 1 57  ? -2.240  -6.301  -14.151 1.00 0.00 ? 1537 PRO A HG3  2  
ATOM   3081  H HD2  . PRO A 1 57  ? -2.769  -7.911  -12.147 1.00 0.00 ? 1537 PRO A HD2  2  
ATOM   3082  H HD3  . PRO A 1 57  ? -4.035  -6.733  -12.584 1.00 0.00 ? 1537 PRO A HD3  2  
ATOM   3083  N N    . ILE A 1 58  ? -5.134  -10.708 -15.953 1.00 0.00 ? 1538 ILE A N    2  
ATOM   3084  C CA   . ILE A 1 58  ? -4.931  -12.113 -16.306 1.00 0.00 ? 1538 ILE A CA   2  
ATOM   3085  C C    . ILE A 1 58  ? -3.733  -12.218 -17.268 1.00 0.00 ? 1538 ILE A C    2  
ATOM   3086  O O    . ILE A 1 58  ? -3.778  -11.591 -18.334 1.00 0.00 ? 1538 ILE A O    2  
ATOM   3087  C CB   . ILE A 1 58  ? -6.182  -12.772 -16.952 1.00 0.00 ? 1538 ILE A CB   2  
ATOM   3088  C CG1  . ILE A 1 58  ? -7.586  -12.398 -16.411 1.00 0.00 ? 1538 ILE A CG1  2  
ATOM   3089  C CG2  . ILE A 1 58  ? -5.989  -14.299 -16.905 1.00 0.00 ? 1538 ILE A CG2  2  
ATOM   3090  C CD1  . ILE A 1 58  ? -8.031  -13.039 -15.100 1.00 0.00 ? 1538 ILE A CD1  2  
ATOM   3091  H H    . ILE A 1 58  ? -6.061  -10.313 -16.052 1.00 0.00 ? 1538 ILE A H    2  
ATOM   3092  H HA   . ILE A 1 58  ? -4.723  -12.626 -15.369 1.00 0.00 ? 1538 ILE A HA   2  
ATOM   3093  H HB   . ILE A 1 58  ? -6.190  -12.480 -18.003 1.00 0.00 ? 1538 ILE A HB   2  
ATOM   3094  H HG12 . ILE A 1 58  ? -7.645  -11.332 -16.267 1.00 0.00 ? 1538 ILE A HG12 2  
ATOM   3095  H HG13 . ILE A 1 58  ? -8.317  -12.643 -17.182 1.00 0.00 ? 1538 ILE A HG13 2  
ATOM   3096  H HG21 . ILE A 1 58  ? -5.850  -14.643 -15.878 1.00 0.00 ? 1538 ILE A HG21 2  
ATOM   3097  H HG22 . ILE A 1 58  ? -6.855  -14.803 -17.331 1.00 0.00 ? 1538 ILE A HG22 2  
ATOM   3098  H HG23 . ILE A 1 58  ? -5.116  -14.574 -17.493 1.00 0.00 ? 1538 ILE A HG23 2  
ATOM   3099  H HD11 . ILE A 1 58  ? -9.023  -12.664 -14.835 1.00 0.00 ? 1538 ILE A HD11 2  
ATOM   3100  H HD12 . ILE A 1 58  ? -8.099  -14.117 -15.225 1.00 0.00 ? 1538 ILE A HD12 2  
ATOM   3101  H HD13 . ILE A 1 58  ? -7.331  -12.785 -14.307 1.00 0.00 ? 1538 ILE A HD13 2  
ATOM   3102  N N    . PRO A 1 59  ? -2.686  -12.999 -16.948 1.00 0.00 ? 1539 PRO A N    2  
ATOM   3103  C CA   . PRO A 1 59  ? -1.612  -13.246 -17.893 1.00 0.00 ? 1539 PRO A CA   2  
ATOM   3104  C C    . PRO A 1 59  ? -2.131  -14.064 -19.070 1.00 0.00 ? 1539 PRO A C    2  
ATOM   3105  O O    . PRO A 1 59  ? -2.940  -14.987 -18.937 1.00 0.00 ? 1539 PRO A O    2  
ATOM   3106  C CB   . PRO A 1 59  ? -0.493  -13.935 -17.099 1.00 0.00 ? 1539 PRO A CB   2  
ATOM   3107  C CG   . PRO A 1 59  ? -1.177  -14.503 -15.850 1.00 0.00 ? 1539 PRO A CG   2  
ATOM   3108  C CD   . PRO A 1 59  ? -2.445  -13.667 -15.677 1.00 0.00 ? 1539 PRO A CD   2  
ATOM   3109  H HA   . PRO A 1 59  ? -1.252  -12.300 -18.306 1.00 0.00 ? 1539 PRO A HA   2  
ATOM   3110  H HB2  . PRO A 1 59  ? -0.002  -14.718 -17.681 1.00 0.00 ? 1539 PRO A HB2  2  
ATOM   3111  H HB3  . PRO A 1 59  ? 0.238   -13.187 -16.793 1.00 0.00 ? 1539 PRO A HB3  2  
ATOM   3112  H HG2  . PRO A 1 59  ? -1.447  -15.548 -16.000 1.00 0.00 ? 1539 PRO A HG2  2  
ATOM   3113  H HG3  . PRO A 1 59  ? -0.534  -14.426 -14.976 1.00 0.00 ? 1539 PRO A HG3  2  
ATOM   3114  H HD2  . PRO A 1 59  ? -3.279  -14.319 -15.417 1.00 0.00 ? 1539 PRO A HD2  2  
ATOM   3115  H HD3  . PRO A 1 59  ? -2.287  -12.918 -14.901 1.00 0.00 ? 1539 PRO A HD3  2  
ATOM   3116  N N    . LEU A 1 60  ? -1.660  -13.692 -20.253 1.00 0.00 ? 1540 LEU A N    2  
ATOM   3117  C CA   . LEU A 1 60  ? -2.060  -14.314 -21.494 1.00 0.00 ? 1540 LEU A CA   2  
ATOM   3118  C C    . LEU A 1 60  ? -1.615  -15.783 -21.460 1.00 0.00 ? 1540 LEU A C    2  
ATOM   3119  O O    . LEU A 1 60  ? -0.617  -16.118 -20.820 1.00 0.00 ? 1540 LEU A O    2  
ATOM   3120  C CB   . LEU A 1 60  ? -1.472  -13.530 -22.680 1.00 0.00 ? 1540 LEU A CB   2  
ATOM   3121  C CG   . LEU A 1 60  ? -1.933  -12.056 -22.812 1.00 0.00 ? 1540 LEU A CG   2  
ATOM   3122  C CD1  . LEU A 1 60  ? -1.214  -11.077 -21.875 1.00 0.00 ? 1540 LEU A CD1  2  
ATOM   3123  C CD2  . LEU A 1 60  ? -1.699  -11.606 -24.260 1.00 0.00 ? 1540 LEU A CD2  2  
ATOM   3124  H H    . LEU A 1 60  ? -0.953  -12.971 -20.295 1.00 0.00 ? 1540 LEU A H    2  
ATOM   3125  H HA   . LEU A 1 60  ? -3.144  -14.280 -21.561 1.00 0.00 ? 1540 LEU A HA   2  
ATOM   3126  H HB2  . LEU A 1 60  ? -0.383  -13.560 -22.625 1.00 0.00 ? 1540 LEU A HB2  2  
ATOM   3127  H HB3  . LEU A 1 60  ? -1.772  -14.068 -23.577 1.00 0.00 ? 1540 LEU A HB3  2  
ATOM   3128  H HG   . LEU A 1 60  ? -2.995  -11.980 -22.592 1.00 0.00 ? 1540 LEU A HG   2  
ATOM   3129  H HD11 . LEU A 1 60  ? -1.577  -11.188 -20.853 1.00 0.00 ? 1540 LEU A HD11 2  
ATOM   3130  H HD12 . LEU A 1 60  ? -0.133  -11.218 -21.916 1.00 0.00 ? 1540 LEU A HD12 2  
ATOM   3131  H HD13 . LEU A 1 60  ? -1.438  -10.053 -22.173 1.00 0.00 ? 1540 LEU A HD13 2  
ATOM   3132  H HD21 . LEU A 1 60  ? -2.273  -12.239 -24.943 1.00 0.00 ? 1540 LEU A HD21 2  
ATOM   3133  H HD22 . LEU A 1 60  ? -2.023  -10.576 -24.386 1.00 0.00 ? 1540 LEU A HD22 2  
ATOM   3134  H HD23 . LEU A 1 60  ? -0.641  -11.682 -24.515 1.00 0.00 ? 1540 LEU A HD23 2  
ATOM   3135  N N    . ASP A 1 61  ? -2.380  -16.650 -22.130 1.00 0.00 ? 1541 ASP A N    2  
ATOM   3136  C CA   . ASP A 1 61  ? -2.275  -18.117 -22.125 1.00 0.00 ? 1541 ASP A CA   2  
ATOM   3137  C C    . ASP A 1 61  ? -2.895  -18.775 -20.882 1.00 0.00 ? 1541 ASP A C    2  
ATOM   3138  O O    . ASP A 1 61  ? -3.053  -19.998 -20.869 1.00 0.00 ? 1541 ASP A O    2  
ATOM   3139  C CB   . ASP A 1 61  ? -0.850  -18.618 -22.417 1.00 0.00 ? 1541 ASP A CB   2  
ATOM   3140  C CG   . ASP A 1 61  ? -0.848  -20.040 -23.002 1.00 0.00 ? 1541 ASP A CG   2  
ATOM   3141  O OD1  . ASP A 1 61  ? -1.354  -20.211 -24.140 1.00 0.00 ? 1541 ASP A OD1  2  
ATOM   3142  O OD2  . ASP A 1 61  ? -0.340  -20.978 -22.340 1.00 0.00 ? 1541 ASP A OD2  2  
ATOM   3143  H H    . ASP A 1 61  ? -3.169  -16.283 -22.661 1.00 0.00 ? 1541 ASP A H    2  
ATOM   3144  H HA   . ASP A 1 61  ? -2.878  -18.461 -22.964 1.00 0.00 ? 1541 ASP A HA   2  
ATOM   3145  H HB2  . ASP A 1 61  ? -0.384  -17.954 -23.145 1.00 0.00 ? 1541 ASP A HB2  2  
ATOM   3146  H HB3  . ASP A 1 61  ? -0.258  -18.597 -21.501 1.00 0.00 ? 1541 ASP A HB3  2  
ATOM   3147  N N    . THR A 1 62  ? -3.316  -18.011 -19.862 1.00 0.00 ? 1542 THR A N    2  
ATOM   3148  C CA   . THR A 1 62  ? -4.075  -18.561 -18.742 1.00 0.00 ? 1542 THR A CA   2  
ATOM   3149  C C    . THR A 1 62  ? -5.460  -18.968 -19.249 1.00 0.00 ? 1542 THR A C    2  
ATOM   3150  O O    . THR A 1 62  ? -6.085  -18.252 -20.042 1.00 0.00 ? 1542 THR A O    2  
ATOM   3151  C CB   . THR A 1 62  ? -4.166  -17.534 -17.603 1.00 0.00 ? 1542 THR A CB   2  
ATOM   3152  O OG1  . THR A 1 62  ? -2.868  -17.091 -17.293 1.00 0.00 ? 1542 THR A OG1  2  
ATOM   3153  C CG2  . THR A 1 62  ? -4.758  -18.067 -16.298 1.00 0.00 ? 1542 THR A CG2  2  
ATOM   3154  H H    . THR A 1 62  ? -3.182  -17.013 -19.875 1.00 0.00 ? 1542 THR A H    2  
ATOM   3155  H HA   . THR A 1 62  ? -3.553  -19.446 -18.377 1.00 0.00 ? 1542 THR A HA   2  
ATOM   3156  H HB   . THR A 1 62  ? -4.761  -16.688 -17.945 1.00 0.00 ? 1542 THR A HB   2  
ATOM   3157  H HG1  . THR A 1 62  ? -2.696  -16.313 -17.858 1.00 0.00 ? 1542 THR A HG1  2  
ATOM   3158  H HG21 . THR A 1 62  ? -4.618  -17.329 -15.505 1.00 0.00 ? 1542 THR A HG21 2  
ATOM   3159  H HG22 . THR A 1 62  ? -5.826  -18.244 -16.419 1.00 0.00 ? 1542 THR A HG22 2  
ATOM   3160  H HG23 . THR A 1 62  ? -4.265  -18.996 -16.006 1.00 0.00 ? 1542 THR A HG23 2  
ATOM   3161  N N    . GLU A 1 63  ? -5.941  -20.117 -18.782 1.00 0.00 ? 1543 GLU A N    2  
ATOM   3162  C CA   . GLU A 1 63  ? -7.299  -20.571 -19.038 1.00 0.00 ? 1543 GLU A CA   2  
ATOM   3163  C C    . GLU A 1 63  ? -8.222  -19.800 -18.102 1.00 0.00 ? 1543 GLU A C    2  
ATOM   3164  O O    . GLU A 1 63  ? -7.889  -19.557 -16.941 1.00 0.00 ? 1543 GLU A O    2  
ATOM   3165  C CB   . GLU A 1 63  ? -7.403  -22.088 -18.821 1.00 0.00 ? 1543 GLU A CB   2  
ATOM   3166  C CG   . GLU A 1 63  ? -8.742  -22.661 -19.301 1.00 0.00 ? 1543 GLU A CG   2  
ATOM   3167  C CD   . GLU A 1 63  ? -8.837  -24.173 -19.025 1.00 0.00 ? 1543 GLU A CD   2  
ATOM   3168  O OE1  . GLU A 1 63  ? -8.208  -24.972 -19.763 1.00 0.00 ? 1543 GLU A OE1  2  
ATOM   3169  O OE2  . GLU A 1 63  ? -9.545  -24.575 -18.070 1.00 0.00 ? 1543 GLU A OE2  2  
ATOM   3170  H H    . GLU A 1 63  ? -5.428  -20.595 -18.058 1.00 0.00 ? 1543 GLU A H    2  
ATOM   3171  H HA   . GLU A 1 63  ? -7.564  -20.348 -20.069 1.00 0.00 ? 1543 GLU A HA   2  
ATOM   3172  H HB2  . GLU A 1 63  ? -6.598  -22.580 -19.367 1.00 0.00 ? 1543 GLU A HB2  2  
ATOM   3173  H HB3  . GLU A 1 63  ? -7.282  -22.306 -17.761 1.00 0.00 ? 1543 GLU A HB3  2  
ATOM   3174  H HG2  . GLU A 1 63  ? -9.561  -22.146 -18.795 1.00 0.00 ? 1543 GLU A HG2  2  
ATOM   3175  H HG3  . GLU A 1 63  ? -8.839  -22.484 -20.372 1.00 0.00 ? 1543 GLU A HG3  2  
ATOM   3176  N N    . VAL A 1 64  ? -9.387  -19.427 -18.600 1.00 0.00 ? 1544 VAL A N    2  
ATOM   3177  C CA   . VAL A 1 64  ? -10.384 -18.677 -17.864 1.00 0.00 ? 1544 VAL A CA   2  
ATOM   3178  C C    . VAL A 1 64  ? -11.763 -19.131 -18.318 1.00 0.00 ? 1544 VAL A C    2  
ATOM   3179  O O    . VAL A 1 64  ? -11.964 -19.578 -19.452 1.00 0.00 ? 1544 VAL A O    2  
ATOM   3180  C CB   . VAL A 1 64  ? -10.224 -17.164 -18.099 1.00 0.00 ? 1544 VAL A CB   2  
ATOM   3181  C CG1  . VAL A 1 64  ? -9.042  -16.565 -17.327 1.00 0.00 ? 1544 VAL A CG1  2  
ATOM   3182  C CG2  . VAL A 1 64  ? -10.049 -16.805 -19.584 1.00 0.00 ? 1544 VAL A CG2  2  
ATOM   3183  H H    . VAL A 1 64  ? -9.612  -19.676 -19.560 1.00 0.00 ? 1544 VAL A H    2  
ATOM   3184  H HA   . VAL A 1 64  ? -10.285 -18.884 -16.798 1.00 0.00 ? 1544 VAL A HA   2  
ATOM   3185  H HB   . VAL A 1 64  ? -11.125 -16.665 -17.734 1.00 0.00 ? 1544 VAL A HB   2  
ATOM   3186  H HG11 . VAL A 1 64  ? -9.025  -15.483 -17.477 1.00 0.00 ? 1544 VAL A HG11 2  
ATOM   3187  H HG12 . VAL A 1 64  ? -9.168  -16.769 -16.263 1.00 0.00 ? 1544 VAL A HG12 2  
ATOM   3188  H HG13 . VAL A 1 64  ? -8.098  -16.988 -17.672 1.00 0.00 ? 1544 VAL A HG13 2  
ATOM   3189  H HG21 . VAL A 1 64  ? -10.921 -17.131 -20.155 1.00 0.00 ? 1544 VAL A HG21 2  
ATOM   3190  H HG22 . VAL A 1 64  ? -9.951  -15.729 -19.669 1.00 0.00 ? 1544 VAL A HG22 2  
ATOM   3191  H HG23 . VAL A 1 64  ? -9.153  -17.266 -20.000 1.00 0.00 ? 1544 VAL A HG23 2  
ATOM   3192  N N    . THR A 1 65  ? -12.725 -18.971 -17.428 1.00 0.00 ? 1545 THR A N    2  
ATOM   3193  C CA   . THR A 1 65  ? -14.126 -19.129 -17.736 1.00 0.00 ? 1545 THR A CA   2  
ATOM   3194  C C    . THR A 1 65  ? -14.604 -17.733 -18.164 1.00 0.00 ? 1545 THR A C    2  
ATOM   3195  O O    . THR A 1 65  ? -14.045 -16.710 -17.761 1.00 0.00 ? 1545 THR A O    2  
ATOM   3196  C CB   . THR A 1 65  ? -14.818 -19.717 -16.503 1.00 0.00 ? 1545 THR A CB   2  
ATOM   3197  O OG1  . THR A 1 65  ? -14.385 -21.046 -16.287 1.00 0.00 ? 1545 THR A OG1  2  
ATOM   3198  C CG2  . THR A 1 65  ? -16.340 -19.734 -16.623 1.00 0.00 ? 1545 THR A CG2  2  
ATOM   3199  H H    . THR A 1 65  ? -12.515 -18.474 -16.568 1.00 0.00 ? 1545 THR A H    2  
ATOM   3200  H HA   . THR A 1 65  ? -14.265 -19.836 -18.549 1.00 0.00 ? 1545 THR A HA   2  
ATOM   3201  H HB   . THR A 1 65  ? -14.536 -19.133 -15.636 1.00 0.00 ? 1545 THR A HB   2  
ATOM   3202  H HG1  . THR A 1 65  ? -13.480 -21.037 -15.924 1.00 0.00 ? 1545 THR A HG1  2  
ATOM   3203  H HG21 . THR A 1 65  ? -16.724 -18.710 -16.650 1.00 0.00 ? 1545 THR A HG21 2  
ATOM   3204  H HG22 . THR A 1 65  ? -16.650 -20.275 -17.519 1.00 0.00 ? 1545 THR A HG22 2  
ATOM   3205  H HG23 . THR A 1 65  ? -16.746 -20.237 -15.752 1.00 0.00 ? 1545 THR A HG23 2  
ATOM   3206  N N    . ALA A 1 66  ? -15.621 -17.686 -19.017 1.00 0.00 ? 1546 ALA A N    2  
ATOM   3207  C CA   . ALA A 1 66  ? -16.099 -16.505 -19.704 1.00 0.00 ? 1546 ALA A CA   2  
ATOM   3208  C C    . ALA A 1 66  ? -17.622 -16.532 -19.608 1.00 0.00 ? 1546 ALA A C    2  
ATOM   3209  O O    . ALA A 1 66  ? -18.215 -17.568 -19.913 1.00 0.00 ? 1546 ALA A O    2  
ATOM   3210  C CB   . ALA A 1 66  ? -15.626 -16.568 -21.158 1.00 0.00 ? 1546 ALA A CB   2  
ATOM   3211  H H    . ALA A 1 66  ? -16.095 -18.547 -19.264 1.00 0.00 ? 1546 ALA A H    2  
ATOM   3212  H HA   . ALA A 1 66  ? -15.680 -15.610 -19.256 1.00 0.00 ? 1546 ALA A HA   2  
ATOM   3213  H HB1  . ALA A 1 66  ? -15.975 -15.682 -21.678 1.00 0.00 ? 1546 ALA A HB1  2  
ATOM   3214  H HB2  . ALA A 1 66  ? -14.537 -16.577 -21.199 1.00 0.00 ? 1546 ALA A HB2  2  
ATOM   3215  H HB3  . ALA A 1 66  ? -16.013 -17.462 -21.654 1.00 0.00 ? 1546 ALA A HB3  2  
ATOM   3216  N N    . LEU A 1 67  ? -18.263 -15.436 -19.194 1.00 0.00 ? 1547 LEU A N    2  
ATOM   3217  C CA   . LEU A 1 67  ? -19.726 -15.326 -19.130 1.00 0.00 ? 1547 LEU A CA   2  
ATOM   3218  C C    . LEU A 1 67  ? -20.125 -14.173 -20.037 1.00 0.00 ? 1547 LEU A C    2  
ATOM   3219  O O    . LEU A 1 67  ? -19.699 -13.044 -19.811 1.00 0.00 ? 1547 LEU A O    2  
ATOM   3220  C CB   . LEU A 1 67  ? -20.250 -15.057 -17.696 1.00 0.00 ? 1547 LEU A CB   2  
ATOM   3221  C CG   . LEU A 1 67  ? -20.433 -16.256 -16.761 1.00 0.00 ? 1547 LEU A CG   2  
ATOM   3222  C CD1  . LEU A 1 67  ? -21.676 -17.067 -17.128 1.00 0.00 ? 1547 LEU A CD1  2  
ATOM   3223  C CD2  . LEU A 1 67  ? -19.210 -17.171 -16.669 1.00 0.00 ? 1547 LEU A CD2  2  
ATOM   3224  H H    . LEU A 1 67  ? -17.720 -14.618 -18.940 1.00 0.00 ? 1547 LEU A H    2  
ATOM   3225  H HA   . LEU A 1 67  ? -20.180 -16.240 -19.499 1.00 0.00 ? 1547 LEU A HA   2  
ATOM   3226  H HB2  . LEU A 1 67  ? -19.605 -14.317 -17.209 1.00 0.00 ? 1547 LEU A HB2  2  
ATOM   3227  H HB3  . LEU A 1 67  ? -21.248 -14.616 -17.772 1.00 0.00 ? 1547 LEU A HB3  2  
ATOM   3228  H HG   . LEU A 1 67  ? -20.614 -15.848 -15.771 1.00 0.00 ? 1547 LEU A HG   2  
ATOM   3229  H HD11 . LEU A 1 67  ? -21.731 -17.952 -16.493 1.00 0.00 ? 1547 LEU A HD11 2  
ATOM   3230  H HD12 . LEU A 1 67  ? -22.573 -16.465 -16.968 1.00 0.00 ? 1547 LEU A HD12 2  
ATOM   3231  H HD13 . LEU A 1 67  ? -21.651 -17.372 -18.170 1.00 0.00 ? 1547 LEU A HD13 2  
ATOM   3232  H HD21 . LEU A 1 67  ? -19.112 -17.767 -17.575 1.00 0.00 ? 1547 LEU A HD21 2  
ATOM   3233  H HD22 . LEU A 1 67  ? -18.307 -16.573 -16.522 1.00 0.00 ? 1547 LEU A HD22 2  
ATOM   3234  H HD23 . LEU A 1 67  ? -19.335 -17.859 -15.829 1.00 0.00 ? 1547 LEU A HD23 2  
ATOM   3235  N N    . SER A 1 68  ? -20.934 -14.441 -21.057 1.00 0.00 ? 1548 SER A N    2  
ATOM   3236  C CA   . SER A 1 68  ? -21.552 -13.394 -21.859 1.00 0.00 ? 1548 SER A CA   2  
ATOM   3237  C C    . SER A 1 68  ? -22.468 -12.549 -20.972 1.00 0.00 ? 1548 SER A C    2  
ATOM   3238  O O    . SER A 1 68  ? -22.900 -12.991 -19.907 1.00 0.00 ? 1548 SER A O    2  
ATOM   3239  C CB   . SER A 1 68  ? -22.291 -14.047 -23.034 1.00 0.00 ? 1548 SER A CB   2  
ATOM   3240  O OG   . SER A 1 68  ? -21.374 -14.840 -23.780 1.00 0.00 ? 1548 SER A OG   2  
ATOM   3241  H H    . SER A 1 68  ? -21.243 -15.396 -21.228 1.00 0.00 ? 1548 SER A H    2  
ATOM   3242  H HA   . SER A 1 68  ? -20.782 -12.731 -22.249 1.00 0.00 ? 1548 SER A HA   2  
ATOM   3243  H HB2  . SER A 1 68  ? -23.094 -14.680 -22.659 1.00 0.00 ? 1548 SER A HB2  2  
ATOM   3244  H HB3  . SER A 1 68  ? -22.719 -13.272 -23.672 1.00 0.00 ? 1548 SER A HB3  2  
ATOM   3245  H HG   . SER A 1 68  ? -21.830 -15.187 -24.573 1.00 0.00 ? 1548 SER A HG   2  
ATOM   3246  N N    . GLU A 1 69  ? -22.805 -11.336 -21.420 1.00 0.00 ? 1549 GLU A N    2  
ATOM   3247  C CA   . GLU A 1 69  ? -23.658 -10.434 -20.650 1.00 0.00 ? 1549 GLU A CA   2  
ATOM   3248  C C    . GLU A 1 69  ? -25.103 -10.976 -20.592 1.00 0.00 ? 1549 GLU A C    2  
ATOM   3249  O O    . GLU A 1 69  ? -25.849 -10.649 -19.671 1.00 0.00 ? 1549 GLU A O    2  
ATOM   3250  C CB   . GLU A 1 69  ? -23.540 -9.018  -21.238 1.00 0.00 ? 1549 GLU A CB   2  
ATOM   3251  C CG   . GLU A 1 69  ? -23.840 -7.922  -20.206 1.00 0.00 ? 1549 GLU A CG   2  
ATOM   3252  C CD   . GLU A 1 69  ? -23.312 -6.549  -20.670 1.00 0.00 ? 1549 GLU A CD   2  
ATOM   3253  O OE1  . GLU A 1 69  ? -22.087 -6.299  -20.538 1.00 0.00 ? 1549 GLU A OE1  2  
ATOM   3254  O OE2  . GLU A 1 69  ? -24.114 -5.722  -21.167 1.00 0.00 ? 1549 GLU A OE2  2  
ATOM   3255  H H    . GLU A 1 69  ? -22.425 -10.998 -22.297 1.00 0.00 ? 1549 GLU A H    2  
ATOM   3256  H HA   . GLU A 1 69  ? -23.265 -10.415 -19.630 1.00 0.00 ? 1549 GLU A HA   2  
ATOM   3257  H HB2  . GLU A 1 69  ? -22.515 -8.876  -21.578 1.00 0.00 ? 1549 GLU A HB2  2  
ATOM   3258  H HB3  . GLU A 1 69  ? -24.200 -8.917  -22.102 1.00 0.00 ? 1549 GLU A HB3  2  
ATOM   3259  H HG2  . GLU A 1 69  ? -24.917 -7.877  -20.033 1.00 0.00 ? 1549 GLU A HG2  2  
ATOM   3260  H HG3  . GLU A 1 69  ? -23.362 -8.180  -19.259 1.00 0.00 ? 1549 GLU A HG3  2  
ATOM   3261  N N    . ASP A 1 70  ? -25.472 -11.874 -21.522 1.00 0.00 ? 1550 ASP A N    2  
ATOM   3262  C CA   . ASP A 1 70  ? -26.724 -12.652 -21.500 1.00 0.00 ? 1550 ASP A CA   2  
ATOM   3263  C C    . ASP A 1 70  ? -26.558 -13.976 -20.730 1.00 0.00 ? 1550 ASP A C    2  
ATOM   3264  O O    . ASP A 1 70  ? -27.290 -14.943 -20.930 1.00 0.00 ? 1550 ASP A O    2  
ATOM   3265  C CB   . ASP A 1 70  ? -27.191 -12.913 -22.933 1.00 0.00 ? 1550 ASP A CB   2  
ATOM   3266  C CG   . ASP A 1 70  ? -28.676 -13.330 -23.012 1.00 0.00 ? 1550 ASP A CG   2  
ATOM   3267  O OD1  . ASP A 1 70  ? -29.513 -12.807 -22.234 1.00 0.00 ? 1550 ASP A OD1  2  
ATOM   3268  O OD2  . ASP A 1 70  ? -29.016 -14.180 -23.867 1.00 0.00 ? 1550 ASP A OD2  2  
ATOM   3269  H H    . ASP A 1 70  ? -24.838 -12.062 -22.285 1.00 0.00 ? 1550 ASP A H    2  
ATOM   3270  H HA   . ASP A 1 70  ? -27.481 -12.056 -20.990 1.00 0.00 ? 1550 ASP A HA   2  
ATOM   3271  H HB2  . ASP A 1 70  ? -27.059 -12.003 -23.520 1.00 0.00 ? 1550 ASP A HB2  2  
ATOM   3272  H HB3  . ASP A 1 70  ? -26.557 -13.696 -23.348 1.00 0.00 ? 1550 ASP A HB3  2  
ATOM   3273  N N    . GLU A 1 71  ? -25.541 -14.032 -19.868 1.00 0.00 ? 1551 GLU A N    2  
ATOM   3274  C CA   . GLU A 1 71  ? -25.165 -15.110 -18.961 1.00 0.00 ? 1551 GLU A CA   2  
ATOM   3275  C C    . GLU A 1 71  ? -24.726 -16.426 -19.624 1.00 0.00 ? 1551 GLU A C    2  
ATOM   3276  O O    . GLU A 1 71  ? -24.589 -17.417 -18.914 1.00 0.00 ? 1551 GLU A O    2  
ATOM   3277  C CB   . GLU A 1 71  ? -26.210 -15.380 -17.851 1.00 0.00 ? 1551 GLU A CB   2  
ATOM   3278  C CG   . GLU A 1 71  ? -27.262 -14.326 -17.467 1.00 0.00 ? 1551 GLU A CG   2  
ATOM   3279  C CD   . GLU A 1 71  ? -28.350 -14.989 -16.603 1.00 0.00 ? 1551 GLU A CD   2  
ATOM   3280  O OE1  . GLU A 1 71  ? -28.133 -15.178 -15.383 1.00 0.00 ? 1551 GLU A OE1  2  
ATOM   3281  O OE2  . GLU A 1 71  ? -29.429 -15.333 -17.137 1.00 0.00 ? 1551 GLU A OE2  2  
ATOM   3282  H H    . GLU A 1 71  ? -24.942 -13.217 -19.821 1.00 0.00 ? 1551 GLU A H    2  
ATOM   3283  H HA   . GLU A 1 71  ? -24.279 -14.740 -18.449 1.00 0.00 ? 1551 GLU A HA   2  
ATOM   3284  H HB2  . GLU A 1 71  ? -26.733 -16.308 -18.098 1.00 0.00 ? 1551 GLU A HB2  2  
ATOM   3285  H HB3  . GLU A 1 71  ? -25.632 -15.564 -16.949 1.00 0.00 ? 1551 GLU A HB3  2  
ATOM   3286  H HG2  . GLU A 1 71  ? -26.778 -13.515 -16.920 1.00 0.00 ? 1551 GLU A HG2  2  
ATOM   3287  H HG3  . GLU A 1 71  ? -27.737 -13.906 -18.352 1.00 0.00 ? 1551 GLU A HG3  2  
ATOM   3288  N N    . TYR A 1 72  ? -24.523 -16.530 -20.938 1.00 0.00 ? 1552 TYR A N    2  
ATOM   3289  C CA   . TYR A 1 72  ? -24.008 -17.785 -21.498 1.00 0.00 ? 1552 TYR A CA   2  
ATOM   3290  C C    . TYR A 1 72  ? -22.593 -18.047 -20.976 1.00 0.00 ? 1552 TYR A C    2  
ATOM   3291  O O    . TYR A 1 72  ? -21.744 -17.160 -21.035 1.00 0.00 ? 1552 TYR A O    2  
ATOM   3292  C CB   . TYR A 1 72  ? -24.104 -17.807 -23.021 1.00 0.00 ? 1552 TYR A CB   2  
ATOM   3293  C CG   . TYR A 1 72  ? -25.505 -18.178 -23.462 1.00 0.00 ? 1552 TYR A CG   2  
ATOM   3294  C CD1  . TYR A 1 72  ? -25.882 -19.533 -23.523 1.00 0.00 ? 1552 TYR A CD1  2  
ATOM   3295  C CD2  . TYR A 1 72  ? -26.430 -17.175 -23.795 1.00 0.00 ? 1552 TYR A CD2  2  
ATOM   3296  C CE1  . TYR A 1 72  ? -27.190 -19.891 -23.895 1.00 0.00 ? 1552 TYR A CE1  2  
ATOM   3297  C CE2  . TYR A 1 72  ? -27.736 -17.525 -24.182 1.00 0.00 ? 1552 TYR A CE2  2  
ATOM   3298  C CZ   . TYR A 1 72  ? -28.125 -18.883 -24.228 1.00 0.00 ? 1552 TYR A CZ   2  
ATOM   3299  O OH   . TYR A 1 72  ? -29.399 -19.202 -24.595 1.00 0.00 ? 1552 TYR A OH   2  
ATOM   3300  H H    . TYR A 1 72  ? -24.684 -15.735 -21.539 1.00 0.00 ? 1552 TYR A H    2  
ATOM   3301  H HA   . TYR A 1 72  ? -24.644 -18.592 -21.129 1.00 0.00 ? 1552 TYR A HA   2  
ATOM   3302  H HB2  . TYR A 1 72  ? -23.813 -16.843 -23.437 1.00 0.00 ? 1552 TYR A HB2  2  
ATOM   3303  H HB3  . TYR A 1 72  ? -23.412 -18.556 -23.409 1.00 0.00 ? 1552 TYR A HB3  2  
ATOM   3304  H HD1  . TYR A 1 72  ? -25.168 -20.312 -23.285 1.00 0.00 ? 1552 TYR A HD1  2  
ATOM   3305  H HD2  . TYR A 1 72  ? -26.137 -16.134 -23.751 1.00 0.00 ? 1552 TYR A HD2  2  
ATOM   3306  H HE1  . TYR A 1 72  ? -27.464 -20.937 -23.921 1.00 0.00 ? 1552 TYR A HE1  2  
ATOM   3307  H HE2  . TYR A 1 72  ? -28.448 -16.753 -24.443 1.00 0.00 ? 1552 TYR A HE2  2  
ATOM   3308  H HH   . TYR A 1 72  ? -29.586 -20.158 -24.615 1.00 0.00 ? 1552 TYR A HH   2  
ATOM   3309  N N    . PHE A 1 73  ? -22.358 -19.246 -20.435 1.00 0.00 ? 1553 PHE A N    2  
ATOM   3310  C CA   . PHE A 1 73  ? -21.093 -19.628 -19.821 1.00 0.00 ? 1553 PHE A CA   2  
ATOM   3311  C C    . PHE A 1 73  ? -20.262 -20.391 -20.854 1.00 0.00 ? 1553 PHE A C    2  
ATOM   3312  O O    . PHE A 1 73  ? -20.805 -21.163 -21.652 1.00 0.00 ? 1553 PHE A O    2  
ATOM   3313  C CB   . PHE A 1 73  ? -21.348 -20.402 -18.513 1.00 0.00 ? 1553 PHE A CB   2  
ATOM   3314  C CG   . PHE A 1 73  ? -20.849 -21.825 -18.485 1.00 0.00 ? 1553 PHE A CG   2  
ATOM   3315  C CD1  . PHE A 1 73  ? -19.512 -22.085 -18.128 1.00 0.00 ? 1553 PHE A CD1  2  
ATOM   3316  C CD2  . PHE A 1 73  ? -21.714 -22.886 -18.808 1.00 0.00 ? 1553 PHE A CD2  2  
ATOM   3317  C CE1  . PHE A 1 73  ? -19.014 -23.394 -18.150 1.00 0.00 ? 1553 PHE A CE1  2  
ATOM   3318  C CE2  . PHE A 1 73  ? -21.207 -24.200 -18.842 1.00 0.00 ? 1553 PHE A CE2  2  
ATOM   3319  C CZ   . PHE A 1 73  ? -19.856 -24.455 -18.533 1.00 0.00 ? 1553 PHE A CZ   2  
ATOM   3320  H H    . PHE A 1 73  ? -23.061 -19.966 -20.507 1.00 0.00 ? 1553 PHE A H    2  
ATOM   3321  H HA   . PHE A 1 73  ? -20.544 -18.735 -19.540 1.00 0.00 ? 1553 PHE A HA   2  
ATOM   3322  H HB2  . PHE A 1 73  ? -20.857 -19.867 -17.700 1.00 0.00 ? 1553 PHE A HB2  2  
ATOM   3323  H HB3  . PHE A 1 73  ? -22.410 -20.406 -18.285 1.00 0.00 ? 1553 PHE A HB3  2  
ATOM   3324  H HD1  . PHE A 1 73  ? -18.856 -21.281 -17.822 1.00 0.00 ? 1553 PHE A HD1  2  
ATOM   3325  H HD2  . PHE A 1 73  ? -22.765 -22.684 -19.023 1.00 0.00 ? 1553 PHE A HD2  2  
ATOM   3326  H HE1  . PHE A 1 73  ? -17.987 -23.559 -17.855 1.00 0.00 ? 1553 PHE A HE1  2  
ATOM   3327  H HE2  . PHE A 1 73  ? -21.857 -25.022 -19.108 1.00 0.00 ? 1553 PHE A HE2  2  
ATOM   3328  H HZ   . PHE A 1 73  ? -19.469 -25.465 -18.587 1.00 0.00 ? 1553 PHE A HZ   2  
ATOM   3329  N N    . SER A 1 74  ? -18.953 -20.157 -20.854 1.00 0.00 ? 1554 SER A N    2  
ATOM   3330  C CA   . SER A 1 74  ? -17.965 -20.832 -21.680 1.00 0.00 ? 1554 SER A CA   2  
ATOM   3331  C C    . SER A 1 74  ? -16.619 -20.833 -20.959 1.00 0.00 ? 1554 SER A C    2  
ATOM   3332  O O    . SER A 1 74  ? -16.472 -20.158 -19.944 1.00 0.00 ? 1554 SER A O    2  
ATOM   3333  C CB   . SER A 1 74  ? -17.888 -20.081 -23.017 1.00 0.00 ? 1554 SER A CB   2  
ATOM   3334  O OG   . SER A 1 74  ? -18.798 -20.638 -23.955 1.00 0.00 ? 1554 SER A OG   2  
ATOM   3335  H H    . SER A 1 74  ? -18.581 -19.451 -20.224 1.00 0.00 ? 1554 SER A H    2  
ATOM   3336  H HA   . SER A 1 74  ? -18.260 -21.872 -21.822 1.00 0.00 ? 1554 SER A HA   2  
ATOM   3337  H HB2  . SER A 1 74  ? -18.110 -19.024 -22.861 1.00 0.00 ? 1554 SER A HB2  2  
ATOM   3338  H HB3  . SER A 1 74  ? -16.882 -20.151 -23.418 1.00 0.00 ? 1554 SER A HB3  2  
ATOM   3339  H HG   . SER A 1 74  ? -19.690 -20.646 -23.554 1.00 0.00 ? 1554 SER A HG   2  
ATOM   3340  N N    . ALA A 1 75  ? -15.613 -21.530 -21.494 1.00 0.00 ? 1555 ALA A N    2  
ATOM   3341  C CA   . ALA A 1 75  ? -14.236 -21.435 -21.021 1.00 0.00 ? 1555 ALA A CA   2  
ATOM   3342  C C    . ALA A 1 75  ? -13.283 -21.495 -22.213 1.00 0.00 ? 1555 ALA A C    2  
ATOM   3343  O O    . ALA A 1 75  ? -13.571 -22.157 -23.213 1.00 0.00 ? 1555 ALA A O    2  
ATOM   3344  C CB   . ALA A 1 75  ? -13.937 -22.561 -20.028 1.00 0.00 ? 1555 ALA A CB   2  
ATOM   3345  H H    . ALA A 1 75  ? -15.770 -22.090 -22.324 1.00 0.00 ? 1555 ALA A H    2  
ATOM   3346  H HA   . ALA A 1 75  ? -14.097 -20.477 -20.529 1.00 0.00 ? 1555 ALA A HA   2  
ATOM   3347  H HB1  . ALA A 1 75  ? -14.609 -22.486 -19.172 1.00 0.00 ? 1555 ALA A HB1  2  
ATOM   3348  H HB2  . ALA A 1 75  ? -14.067 -23.530 -20.515 1.00 0.00 ? 1555 ALA A HB2  2  
ATOM   3349  H HB3  . ALA A 1 75  ? -12.910 -22.471 -19.677 1.00 0.00 ? 1555 ALA A HB3  2  
ATOM   3350  N N    . GLY A 1 76  ? -12.163 -20.785 -22.099 1.00 0.00 ? 1556 GLY A N    2  
ATOM   3351  C CA   . GLY A 1 76  ? -11.191 -20.567 -23.159 1.00 0.00 ? 1556 GLY A CA   2  
ATOM   3352  C C    . GLY A 1 76  ? -9.919  -19.997 -22.544 1.00 0.00 ? 1556 GLY A C    2  
ATOM   3353  O O    . GLY A 1 76  ? -9.690  -20.154 -21.345 1.00 0.00 ? 1556 GLY A O    2  
ATOM   3354  H H    . GLY A 1 76  ? -11.961 -20.327 -21.212 1.00 0.00 ? 1556 GLY A H    2  
ATOM   3355  H HA2  . GLY A 1 76  ? -10.966 -21.509 -23.665 1.00 0.00 ? 1556 GLY A HA2  2  
ATOM   3356  H HA3  . GLY A 1 76  ? -11.599 -19.865 -23.881 1.00 0.00 ? 1556 GLY A HA3  2  
ATOM   3357  N N    . VAL A 1 77  ? -9.083  -19.322 -23.327 1.00 0.00 ? 1557 VAL A N    2  
ATOM   3358  C CA   . VAL A 1 77  ? -7.772  -18.857 -22.880 1.00 0.00 ? 1557 VAL A CA   2  
ATOM   3359  C C    . VAL A 1 77  ? -7.596  -17.406 -23.291 1.00 0.00 ? 1557 VAL A C    2  
ATOM   3360  O O    . VAL A 1 77  ? -7.985  -17.016 -24.386 1.00 0.00 ? 1557 VAL A O    2  
ATOM   3361  C CB   . VAL A 1 77  ? -6.682  -19.792 -23.452 1.00 0.00 ? 1557 VAL A CB   2  
ATOM   3362  C CG1  . VAL A 1 77  ? -5.315  -19.126 -23.584 1.00 0.00 ? 1557 VAL A CG1  2  
ATOM   3363  C CG2  . VAL A 1 77  ? -6.492  -20.989 -22.518 1.00 0.00 ? 1557 VAL A CG2  2  
ATOM   3364  H H    . VAL A 1 77  ? -9.338  -19.155 -24.300 1.00 0.00 ? 1557 VAL A H    2  
ATOM   3365  H HA   . VAL A 1 77  ? -7.726  -18.887 -21.794 1.00 0.00 ? 1557 VAL A HA   2  
ATOM   3366  H HB   . VAL A 1 77  ? -6.986  -20.150 -24.437 1.00 0.00 ? 1557 VAL A HB   2  
ATOM   3367  H HG11 . VAL A 1 77  ? -5.352  -18.369 -24.362 1.00 0.00 ? 1557 VAL A HG11 2  
ATOM   3368  H HG12 . VAL A 1 77  ? -5.052  -18.649 -22.640 1.00 0.00 ? 1557 VAL A HG12 2  
ATOM   3369  H HG13 . VAL A 1 77  ? -4.559  -19.868 -23.853 1.00 0.00 ? 1557 VAL A HG13 2  
ATOM   3370  H HG21 . VAL A 1 77  ? -7.454  -21.429 -22.264 1.00 0.00 ? 1557 VAL A HG21 2  
ATOM   3371  H HG22 . VAL A 1 77  ? -5.867  -21.739 -23.004 1.00 0.00 ? 1557 VAL A HG22 2  
ATOM   3372  H HG23 . VAL A 1 77  ? -5.984  -20.649 -21.613 1.00 0.00 ? 1557 VAL A HG23 2  
ATOM   3373  N N    . VAL A 1 78  ? -6.986  -16.599 -22.426 1.00 0.00 ? 1558 VAL A N    2  
ATOM   3374  C CA   . VAL A 1 78  ? -6.652  -15.221 -22.752 1.00 0.00 ? 1558 VAL A CA   2  
ATOM   3375  C C    . VAL A 1 78  ? -5.611  -15.226 -23.872 1.00 0.00 ? 1558 VAL A C    2  
ATOM   3376  O O    . VAL A 1 78  ? -4.570  -15.861 -23.723 1.00 0.00 ? 1558 VAL A O    2  
ATOM   3377  C CB   . VAL A 1 78  ? -6.108  -14.528 -21.490 1.00 0.00 ? 1558 VAL A CB   2  
ATOM   3378  C CG1  . VAL A 1 78  ? -5.709  -13.076 -21.778 1.00 0.00 ? 1558 VAL A CG1  2  
ATOM   3379  C CG2  . VAL A 1 78  ? -7.138  -14.517 -20.355 1.00 0.00 ? 1558 VAL A CG2  2  
ATOM   3380  H H    . VAL A 1 78  ? -6.629  -16.987 -21.556 1.00 0.00 ? 1558 VAL A H    2  
ATOM   3381  H HA   . VAL A 1 78  ? -7.556  -14.717 -23.088 1.00 0.00 ? 1558 VAL A HA   2  
ATOM   3382  H HB   . VAL A 1 78  ? -5.229  -15.078 -21.151 1.00 0.00 ? 1558 VAL A HB   2  
ATOM   3383  H HG11 . VAL A 1 78  ? -5.299  -12.615 -20.876 1.00 0.00 ? 1558 VAL A HG11 2  
ATOM   3384  H HG12 . VAL A 1 78  ? -4.944  -13.031 -22.552 1.00 0.00 ? 1558 VAL A HG12 2  
ATOM   3385  H HG13 . VAL A 1 78  ? -6.570  -12.505 -22.119 1.00 0.00 ? 1558 VAL A HG13 2  
ATOM   3386  H HG21 . VAL A 1 78  ? -7.390  -15.530 -20.040 1.00 0.00 ? 1558 VAL A HG21 2  
ATOM   3387  H HG22 . VAL A 1 78  ? -6.717  -13.992 -19.508 1.00 0.00 ? 1558 VAL A HG22 2  
ATOM   3388  H HG23 . VAL A 1 78  ? -8.041  -13.992 -20.663 1.00 0.00 ? 1558 VAL A HG23 2  
ATOM   3389  N N    . LYS A 1 79  ? -5.834  -14.477 -24.952 1.00 0.00 ? 1559 LYS A N    2  
ATOM   3390  C CA   . LYS A 1 79  ? -4.833  -14.263 -26.007 1.00 0.00 ? 1559 LYS A CA   2  
ATOM   3391  C C    . LYS A 1 79  ? -4.685  -12.779 -26.366 1.00 0.00 ? 1559 LYS A C    2  
ATOM   3392  O O    . LYS A 1 79  ? -4.010  -12.459 -27.345 1.00 0.00 ? 1559 LYS A O    2  
ATOM   3393  C CB   . LYS A 1 79  ? -5.161  -15.146 -27.237 1.00 0.00 ? 1559 LYS A CB   2  
ATOM   3394  C CG   . LYS A 1 79  ? -4.840  -16.632 -26.999 1.00 0.00 ? 1559 LYS A CG   2  
ATOM   3395  C CD   . LYS A 1 79  ? -3.332  -16.954 -27.010 1.00 0.00 ? 1559 LYS A CD   2  
ATOM   3396  C CE   . LYS A 1 79  ? -3.083  -18.374 -26.475 1.00 0.00 ? 1559 LYS A CE   2  
ATOM   3397  N NZ   . LYS A 1 79  ? -1.645  -18.769 -26.521 1.00 0.00 ? 1559 LYS A NZ   2  
ATOM   3398  H H    . LYS A 1 79  ? -6.745  -14.036 -25.080 1.00 0.00 ? 1559 LYS A H    2  
ATOM   3399  H HA   . LYS A 1 79  ? -3.856  -14.549 -25.611 1.00 0.00 ? 1559 LYS A HA   2  
ATOM   3400  H HB2  . LYS A 1 79  ? -6.221  -15.042 -27.477 1.00 0.00 ? 1559 LYS A HB2  2  
ATOM   3401  H HB3  . LYS A 1 79  ? -4.592  -14.817 -28.107 1.00 0.00 ? 1559 LYS A HB3  2  
ATOM   3402  H HG2  . LYS A 1 79  ? -5.277  -16.928 -26.050 1.00 0.00 ? 1559 LYS A HG2  2  
ATOM   3403  H HG3  . LYS A 1 79  ? -5.318  -17.221 -27.781 1.00 0.00 ? 1559 LYS A HG3  2  
ATOM   3404  H HD2  . LYS A 1 79  ? -2.960  -16.866 -28.035 1.00 0.00 ? 1559 LYS A HD2  2  
ATOM   3405  H HD3  . LYS A 1 79  ? -2.790  -16.248 -26.379 1.00 0.00 ? 1559 LYS A HD3  2  
ATOM   3406  H HE2  . LYS A 1 79  ? -3.414  -18.401 -25.435 1.00 0.00 ? 1559 LYS A HE2  2  
ATOM   3407  H HE3  . LYS A 1 79  ? -3.681  -19.098 -27.041 1.00 0.00 ? 1559 LYS A HE3  2  
ATOM   3408  H HZ1  . LYS A 1 79  ? -1.479  -19.551 -25.878 1.00 0.00 ? 1559 LYS A HZ1  2  
ATOM   3409  H HZ2  . LYS A 1 79  ? -1.362  -19.061 -27.448 1.00 0.00 ? 1559 LYS A HZ2  2  
ATOM   3410  H HZ3  . LYS A 1 79  ? -1.033  -18.019 -26.221 1.00 0.00 ? 1559 LYS A HZ3  2  
ATOM   3411  N N    . GLY A 1 80  ? -5.241  -11.872 -25.562 1.00 0.00 ? 1560 GLY A N    2  
ATOM   3412  C CA   . GLY A 1 80  ? -5.004  -10.445 -25.703 1.00 0.00 ? 1560 GLY A CA   2  
ATOM   3413  C C    . GLY A 1 80  ? -5.814  -9.658  -24.684 1.00 0.00 ? 1560 GLY A C    2  
ATOM   3414  O O    . GLY A 1 80  ? -6.482  -10.231 -23.820 1.00 0.00 ? 1560 GLY A O    2  
ATOM   3415  H H    . GLY A 1 80  ? -5.836  -12.147 -24.796 1.00 0.00 ? 1560 GLY A H    2  
ATOM   3416  H HA2  . GLY A 1 80  ? -3.945  -10.238 -25.547 1.00 0.00 ? 1560 GLY A HA2  2  
ATOM   3417  H HA3  . GLY A 1 80  ? -5.268  -10.127 -26.710 1.00 0.00 ? 1560 GLY A HA3  2  
ATOM   3418  N N    . HIS A 1 81  ? -5.747  -8.336  -24.822 1.00 0.00 ? 1561 HIS A N    2  
ATOM   3419  C CA   . HIS A 1 81  ? -6.238  -7.331  -23.882 1.00 0.00 ? 1561 HIS A CA   2  
ATOM   3420  C C    . HIS A 1 81  ? -6.811  -6.137  -24.638 1.00 0.00 ? 1561 HIS A C    2  
ATOM   3421  O O    . HIS A 1 81  ? -6.364  -5.831  -25.748 1.00 0.00 ? 1561 HIS A O    2  
ATOM   3422  C CB   . HIS A 1 81  ? -5.077  -6.778  -23.045 1.00 0.00 ? 1561 HIS A CB   2  
ATOM   3423  C CG   . HIS A 1 81  ? -4.795  -7.541  -21.788 1.00 0.00 ? 1561 HIS A CG   2  
ATOM   3424  N ND1  . HIS A 1 81  ? -3.937  -8.637  -21.665 1.00 0.00 ? 1561 HIS A ND1  2  
ATOM   3425  C CD2  . HIS A 1 81  ? -5.272  -7.180  -20.565 1.00 0.00 ? 1561 HIS A CD2  2  
ATOM   3426  C CE1  . HIS A 1 81  ? -3.920  -8.921  -20.350 1.00 0.00 ? 1561 HIS A CE1  2  
ATOM   3427  N NE2  . HIS A 1 81  ? -4.697  -8.052  -19.668 1.00 0.00 ? 1561 HIS A NE2  2  
ATOM   3428  H H    . HIS A 1 81  ? -5.293  -7.988  -25.653 1.00 0.00 ? 1561 HIS A H    2  
ATOM   3429  H HA   . HIS A 1 81  ? -6.991  -7.766  -23.226 1.00 0.00 ? 1561 HIS A HA   2  
ATOM   3430  H HB2  . HIS A 1 81  ? -4.172  -6.729  -23.648 1.00 0.00 ? 1561 HIS A HB2  2  
ATOM   3431  H HB3  . HIS A 1 81  ? -5.311  -5.756  -22.732 1.00 0.00 ? 1561 HIS A HB3  2  
ATOM   3432  H HD2  . HIS A 1 81  ? -5.965  -6.365  -20.366 1.00 0.00 ? 1561 HIS A HD2  2  
ATOM   3433  H HE1  . HIS A 1 81  ? -3.353  -9.732  -19.908 1.00 0.00 ? 1561 HIS A HE1  2  
ATOM   3434  H HE2  . HIS A 1 81  ? -4.833  -8.044  -18.664 1.00 0.00 ? 1561 HIS A HE2  2  
ATOM   3435  N N    . ARG A 1 82  ? -7.723  -5.407  -23.994 1.00 0.00 ? 1562 ARG A N    2  
ATOM   3436  C CA   . ARG A 1 82  ? -8.223  -4.121  -24.457 1.00 0.00 ? 1562 ARG A CA   2  
ATOM   3437  C C    . ARG A 1 82  ? -8.621  -3.304  -23.234 1.00 0.00 ? 1562 ARG A C    2  
ATOM   3438  O O    . ARG A 1 82  ? -8.909  -3.864  -22.176 1.00 0.00 ? 1562 ARG A O    2  
ATOM   3439  C CB   . ARG A 1 82  ? -9.386  -4.386  -25.430 1.00 0.00 ? 1562 ARG A CB   2  
ATOM   3440  C CG   . ARG A 1 82  ? -10.278 -3.182  -25.776 1.00 0.00 ? 1562 ARG A CG   2  
ATOM   3441  C CD   . ARG A 1 82  ? -11.268 -3.572  -26.884 1.00 0.00 ? 1562 ARG A CD   2  
ATOM   3442  N NE   . ARG A 1 82  ? -12.029 -2.410  -27.384 1.00 0.00 ? 1562 ARG A NE   2  
ATOM   3443  C CZ   . ARG A 1 82  ? -12.720 -2.370  -28.534 1.00 0.00 ? 1562 ARG A CZ   2  
ATOM   3444  N NH1  . ARG A 1 82  ? -12.776 -3.429  -29.341 1.00 0.00 ? 1562 ARG A NH1  2  
ATOM   3445  N NH2  . ARG A 1 82  ? -13.357 -1.257  -28.874 1.00 0.00 ? 1562 ARG A NH2  2  
ATOM   3446  H H    . ARG A 1 82  ? -8.079  -5.717  -23.088 1.00 0.00 ? 1562 ARG A H    2  
ATOM   3447  H HA   . ARG A 1 82  ? -7.424  -3.596  -24.986 1.00 0.00 ? 1562 ARG A HA   2  
ATOM   3448  H HB2  . ARG A 1 82  ? -8.957  -4.765  -26.357 1.00 0.00 ? 1562 ARG A HB2  2  
ATOM   3449  H HB3  . ARG A 1 82  ? -10.010 -5.175  -25.018 1.00 0.00 ? 1562 ARG A HB3  2  
ATOM   3450  H HG2  . ARG A 1 82  ? -10.827 -2.858  -24.887 1.00 0.00 ? 1562 ARG A HG2  2  
ATOM   3451  H HG3  . ARG A 1 82  ? -9.651  -2.364  -26.128 1.00 0.00 ? 1562 ARG A HG3  2  
ATOM   3452  H HD2  . ARG A 1 82  ? -10.704 -4.008  -27.712 1.00 0.00 ? 1562 ARG A HD2  2  
ATOM   3453  H HD3  . ARG A 1 82  ? -11.965 -4.321  -26.501 1.00 0.00 ? 1562 ARG A HD3  2  
ATOM   3454  H HE   . ARG A 1 82  ? -12.018 -1.580  -26.805 1.00 0.00 ? 1562 ARG A HE   2  
ATOM   3455  H HH11 . ARG A 1 82  ? -12.308 -4.293  -29.098 1.00 0.00 ? 1562 ARG A HH11 2  
ATOM   3456  H HH12 . ARG A 1 82  ? -13.300 -3.421  -30.211 1.00 0.00 ? 1562 ARG A HH12 2  
ATOM   3457  H HH21 . ARG A 1 82  ? -13.364 -0.444  -28.243 1.00 0.00 ? 1562 ARG A HH21 2  
ATOM   3458  H HH22 . ARG A 1 82  ? -13.882 -1.170  -29.738 1.00 0.00 ? 1562 ARG A HH22 2  
ATOM   3459  N N    . LYS A 1 83  ? -8.696  -1.986  -23.400 1.00 0.00 ? 1563 LYS A N    2  
ATOM   3460  C CA   . LYS A 1 83  ? -9.260  -1.062  -22.426 1.00 0.00 ? 1563 LYS A CA   2  
ATOM   3461  C C    . LYS A 1 83  ? -10.338 -0.285  -23.170 1.00 0.00 ? 1563 LYS A C    2  
ATOM   3462  O O    . LYS A 1 83  ? -10.070 0.256   -24.245 1.00 0.00 ? 1563 LYS A O    2  
ATOM   3463  C CB   . LYS A 1 83  ? -8.150  -0.143  -21.896 1.00 0.00 ? 1563 LYS A CB   2  
ATOM   3464  C CG   . LYS A 1 83  ? -7.359  -0.759  -20.729 1.00 0.00 ? 1563 LYS A CG   2  
ATOM   3465  C CD   . LYS A 1 83  ? -8.195  -0.747  -19.435 1.00 0.00 ? 1563 LYS A CD   2  
ATOM   3466  C CE   . LYS A 1 83  ? -7.326  -0.862  -18.167 1.00 0.00 ? 1563 LYS A CE   2  
ATOM   3467  N NZ   . LYS A 1 83  ? -6.535  0.371   -17.876 1.00 0.00 ? 1563 LYS A NZ   2  
ATOM   3468  H H    . LYS A 1 83  ? -8.438  -1.591  -24.298 1.00 0.00 ? 1563 LYS A H    2  
ATOM   3469  H HA   . LYS A 1 83  ? -9.723  -1.611  -21.605 1.00 0.00 ? 1563 LYS A HA   2  
ATOM   3470  H HB2  . LYS A 1 83  ? -7.460  0.101   -22.706 1.00 0.00 ? 1563 LYS A HB2  2  
ATOM   3471  H HB3  . LYS A 1 83  ? -8.595  0.797   -21.563 1.00 0.00 ? 1563 LYS A HB3  2  
ATOM   3472  H HG2  . LYS A 1 83  ? -7.050  -1.787  -20.964 1.00 0.00 ? 1563 LYS A HG2  2  
ATOM   3473  H HG3  . LYS A 1 83  ? -6.461  -0.156  -20.592 1.00 0.00 ? 1563 LYS A HG3  2  
ATOM   3474  H HD2  . LYS A 1 83  ? -8.798  0.161   -19.379 1.00 0.00 ? 1563 LYS A HD2  2  
ATOM   3475  H HD3  . LYS A 1 83  ? -8.891  -1.586  -19.479 1.00 0.00 ? 1563 LYS A HD3  2  
ATOM   3476  H HE2  . LYS A 1 83  ? -7.985  -1.062  -17.318 1.00 0.00 ? 1563 LYS A HE2  2  
ATOM   3477  H HE3  . LYS A 1 83  ? -6.646  -1.714  -18.277 1.00 0.00 ? 1563 LYS A HE3  2  
ATOM   3478  H HZ1  . LYS A 1 83  ? -6.002  0.264   -17.018 1.00 0.00 ? 1563 LYS A HZ1  2  
ATOM   3479  H HZ2  . LYS A 1 83  ? -5.870  0.586   -18.610 1.00 0.00 ? 1563 LYS A HZ2  2  
ATOM   3480  H HZ3  . LYS A 1 83  ? -7.136  1.178   -17.752 1.00 0.00 ? 1563 LYS A HZ3  2  
ATOM   3481  N N    . GLU A 1 84  ? -11.553 -0.260  -22.632 1.00 0.00 ? 1564 GLU A N    2  
ATOM   3482  C CA   . GLU A 1 84  ? -12.702 0.394   -23.246 1.00 0.00 ? 1564 GLU A CA   2  
ATOM   3483  C C    . GLU A 1 84  ? -13.616 0.844   -22.116 1.00 0.00 ? 1564 GLU A C    2  
ATOM   3484  O O    . GLU A 1 84  ? -13.725 0.139   -21.114 1.00 0.00 ? 1564 GLU A O    2  
ATOM   3485  C CB   . GLU A 1 84  ? -13.407 -0.612  -24.168 1.00 0.00 ? 1564 GLU A CB   2  
ATOM   3486  C CG   . GLU A 1 84  ? -14.531 0.003   -25.014 1.00 0.00 ? 1564 GLU A CG   2  
ATOM   3487  C CD   . GLU A 1 84  ? -14.002 1.117   -25.935 1.00 0.00 ? 1564 GLU A CD   2  
ATOM   3488  O OE1  . GLU A 1 84  ? -13.485 0.788   -27.030 1.00 0.00 ? 1564 GLU A OE1  2  
ATOM   3489  O OE2  . GLU A 1 84  ? -14.100 2.312   -25.569 1.00 0.00 ? 1564 GLU A OE2  2  
ATOM   3490  H H    . GLU A 1 84  ? -11.725 -0.714  -21.733 1.00 0.00 ? 1564 GLU A H    2  
ATOM   3491  H HA   . GLU A 1 84  ? -12.368 1.267   -23.808 1.00 0.00 ? 1564 GLU A HA   2  
ATOM   3492  H HB2  . GLU A 1 84  ? -12.675 -1.058  -24.839 1.00 0.00 ? 1564 GLU A HB2  2  
ATOM   3493  H HB3  . GLU A 1 84  ? -13.824 -1.405  -23.547 1.00 0.00 ? 1564 GLU A HB3  2  
ATOM   3494  H HG2  . GLU A 1 84  ? -14.980 -0.788  -25.622 1.00 0.00 ? 1564 GLU A HG2  2  
ATOM   3495  H HG3  . GLU A 1 84  ? -15.308 0.394   -24.355 1.00 0.00 ? 1564 GLU A HG3  2  
ATOM   3496  N N    . SER A 1 85  ? -14.243 2.017   -22.253 1.00 0.00 ? 1565 SER A N    2  
ATOM   3497  C CA   . SER A 1 85  ? -15.073 2.633   -21.217 1.00 0.00 ? 1565 SER A CA   2  
ATOM   3498  C C    . SER A 1 85  ? -14.373 2.720   -19.844 1.00 0.00 ? 1565 SER A C    2  
ATOM   3499  O O    . SER A 1 85  ? -15.034 2.722   -18.799 1.00 0.00 ? 1565 SER A O    2  
ATOM   3500  C CB   . SER A 1 85  ? -16.427 1.909   -21.169 1.00 0.00 ? 1565 SER A CB   2  
ATOM   3501  O OG   . SER A 1 85  ? -17.054 1.915   -22.449 1.00 0.00 ? 1565 SER A OG   2  
ATOM   3502  H H    . SER A 1 85  ? -14.176 2.514   -23.130 1.00 0.00 ? 1565 SER A H    2  
ATOM   3503  H HA   . SER A 1 85  ? -15.266 3.660   -21.530 1.00 0.00 ? 1565 SER A HA   2  
ATOM   3504  H HB2  . SER A 1 85  ? -16.281 0.879   -20.838 1.00 0.00 ? 1565 SER A HB2  2  
ATOM   3505  H HB3  . SER A 1 85  ? -17.067 2.417   -20.446 1.00 0.00 ? 1565 SER A HB3  2  
ATOM   3506  H HG   . SER A 1 85  ? -17.930 1.483   -22.365 1.00 0.00 ? 1565 SER A HG   2  
ATOM   3507  N N    . GLY A 1 86  ? -13.032 2.795   -19.832 1.00 0.00 ? 1566 GLY A N    2  
ATOM   3508  C CA   . GLY A 1 86  ? -12.236 2.802   -18.613 1.00 0.00 ? 1566 GLY A CA   2  
ATOM   3509  C C    . GLY A 1 86  ? -12.353 1.488   -17.834 1.00 0.00 ? 1566 GLY A C    2  
ATOM   3510  O O    . GLY A 1 86  ? -12.322 1.511   -16.599 1.00 0.00 ? 1566 GLY A O    2  
ATOM   3511  H H    . GLY A 1 86  ? -12.541 2.825   -20.715 1.00 0.00 ? 1566 GLY A H    2  
ATOM   3512  H HA2  . GLY A 1 86  ? -11.189 2.952   -18.881 1.00 0.00 ? 1566 GLY A HA2  2  
ATOM   3513  H HA3  . GLY A 1 86  ? -12.552 3.631   -17.982 1.00 0.00 ? 1566 GLY A HA3  2  
ATOM   3514  N N    . GLU A 1 87  ? -12.503 0.348   -18.517 1.00 0.00 ? 1567 GLU A N    2  
ATOM   3515  C CA   . GLU A 1 87  ? -12.704 -0.962  -17.931 1.00 0.00 ? 1567 GLU A CA   2  
ATOM   3516  C C    . GLU A 1 87  ? -11.865 -1.949  -18.750 1.00 0.00 ? 1567 GLU A C    2  
ATOM   3517  O O    . GLU A 1 87  ? -11.506 -1.679  -19.906 1.00 0.00 ? 1567 GLU A O    2  
ATOM   3518  C CB   . GLU A 1 87  ? -14.212 -1.278  -17.938 1.00 0.00 ? 1567 GLU A CB   2  
ATOM   3519  C CG   . GLU A 1 87  ? -14.577 -2.695  -17.477 1.00 0.00 ? 1567 GLU A CG   2  
ATOM   3520  C CD   . GLU A 1 87  ? -14.195 -2.971  -16.013 1.00 0.00 ? 1567 GLU A CD   2  
ATOM   3521  O OE1  . GLU A 1 87  ? -12.985 -2.965  -15.692 1.00 0.00 ? 1567 GLU A OE1  2  
ATOM   3522  O OE2  . GLU A 1 87  ? -15.089 -3.195  -15.166 1.00 0.00 ? 1567 GLU A OE2  2  
ATOM   3523  H H    . GLU A 1 87  ? -12.519 0.328   -19.534 1.00 0.00 ? 1567 GLU A H    2  
ATOM   3524  H HA   . GLU A 1 87  ? -12.341 -0.959  -16.901 1.00 0.00 ? 1567 GLU A HA   2  
ATOM   3525  H HB2  . GLU A 1 87  ? -14.727 -0.561  -17.297 1.00 0.00 ? 1567 GLU A HB2  2  
ATOM   3526  H HB3  . GLU A 1 87  ? -14.599 -1.156  -18.952 1.00 0.00 ? 1567 GLU A HB3  2  
ATOM   3527  H HG2  . GLU A 1 87  ? -15.652 -2.820  -17.606 1.00 0.00 ? 1567 GLU A HG2  2  
ATOM   3528  H HG3  . GLU A 1 87  ? -14.081 -3.406  -18.136 1.00 0.00 ? 1567 GLU A HG3  2  
ATOM   3529  N N    . LEU A 1 88  ? -11.516 -3.081  -18.136 1.00 0.00 ? 1568 LEU A N    2  
ATOM   3530  C CA   . LEU A 1 88  ? -10.592 -4.045  -18.711 1.00 0.00 ? 1568 LEU A CA   2  
ATOM   3531  C C    . LEU A 1 88  ? -11.344 -5.094  -19.510 1.00 0.00 ? 1568 LEU A C    2  
ATOM   3532  O O    . LEU A 1 88  ? -12.365 -5.614  -19.060 1.00 0.00 ? 1568 LEU A O    2  
ATOM   3533  C CB   . LEU A 1 88  ? -9.790  -4.747  -17.595 1.00 0.00 ? 1568 LEU A CB   2  
ATOM   3534  C CG   . LEU A 1 88  ? -8.288  -4.435  -17.607 1.00 0.00 ? 1568 LEU A CG   2  
ATOM   3535  C CD1  . LEU A 1 88  ? -7.624  -5.278  -16.521 1.00 0.00 ? 1568 LEU A CD1  2  
ATOM   3536  C CD2  . LEU A 1 88  ? -7.633  -4.729  -18.961 1.00 0.00 ? 1568 LEU A CD2  2  
ATOM   3537  H H    . LEU A 1 88  ? -11.899 -3.272  -17.211 1.00 0.00 ? 1568 LEU A H    2  
ATOM   3538  H HA   . LEU A 1 88  ? -9.932  -3.511  -19.389 1.00 0.00 ? 1568 LEU A HA   2  
ATOM   3539  H HB2  . LEU A 1 88  ? -10.203 -4.477  -16.621 1.00 0.00 ? 1568 LEU A HB2  2  
ATOM   3540  H HB3  . LEU A 1 88  ? -9.906  -5.825  -17.703 1.00 0.00 ? 1568 LEU A HB3  2  
ATOM   3541  H HG   . LEU A 1 88  ? -8.144  -3.384  -17.371 1.00 0.00 ? 1568 LEU A HG   2  
ATOM   3542  H HD11 . LEU A 1 88  ? -7.772  -6.335  -16.742 1.00 0.00 ? 1568 LEU A HD11 2  
ATOM   3543  H HD12 . LEU A 1 88  ? -6.554  -5.066  -16.473 1.00 0.00 ? 1568 LEU A HD12 2  
ATOM   3544  H HD13 . LEU A 1 88  ? -8.073  -5.055  -15.549 1.00 0.00 ? 1568 LEU A HD13 2  
ATOM   3545  H HD21 . LEU A 1 88  ? -7.940  -3.994  -19.707 1.00 0.00 ? 1568 LEU A HD21 2  
ATOM   3546  H HD22 . LEU A 1 88  ? -6.545  -4.662  -18.869 1.00 0.00 ? 1568 LEU A HD22 2  
ATOM   3547  H HD23 . LEU A 1 88  ? -7.914  -5.728  -19.305 1.00 0.00 ? 1568 LEU A HD23 2  
ATOM   3548  N N    . TYR A 1 89  ? -10.748 -5.473  -20.636 1.00 0.00 ? 1569 TYR A N    2  
ATOM   3549  C CA   . TYR A 1 89  ? -11.229 -6.498  -21.537 1.00 0.00 ? 1569 TYR A CA   2  
ATOM   3550  C C    . TYR A 1 89  ? -10.091 -7.441  -21.881 1.00 0.00 ? 1569 TYR A C    2  
ATOM   3551  O O    . TYR A 1 89  ? -8.926  -7.049  -21.899 1.00 0.00 ? 1569 TYR A O    2  
ATOM   3552  C CB   . TYR A 1 89  ? -11.772 -5.841  -22.810 1.00 0.00 ? 1569 TYR A CB   2  
ATOM   3553  C CG   . TYR A 1 89  ? -13.170 -5.303  -22.647 1.00 0.00 ? 1569 TYR A CG   2  
ATOM   3554  C CD1  . TYR A 1 89  ? -13.371 -4.016  -22.121 1.00 0.00 ? 1569 TYR A CD1  2  
ATOM   3555  C CD2  . TYR A 1 89  ? -14.264 -6.097  -23.023 1.00 0.00 ? 1569 TYR A CD2  2  
ATOM   3556  C CE1  . TYR A 1 89  ? -14.674 -3.523  -21.962 1.00 0.00 ? 1569 TYR A CE1  2  
ATOM   3557  C CE2  . TYR A 1 89  ? -15.571 -5.613  -22.860 1.00 0.00 ? 1569 TYR A CE2  2  
ATOM   3558  C CZ   . TYR A 1 89  ? -15.787 -4.318  -22.330 1.00 0.00 ? 1569 TYR A CZ   2  
ATOM   3559  O OH   . TYR A 1 89  ? -17.062 -3.856  -22.181 1.00 0.00 ? 1569 TYR A OH   2  
ATOM   3560  H H    . TYR A 1 89  ? -9.893  -5.005  -20.934 1.00 0.00 ? 1569 TYR A H    2  
ATOM   3561  H HA   . TYR A 1 89  ? -12.032 -7.057  -21.060 1.00 0.00 ? 1569 TYR A HA   2  
ATOM   3562  H HB2  . TYR A 1 89  ? -11.111 -5.028  -23.108 1.00 0.00 ? 1569 TYR A HB2  2  
ATOM   3563  H HB3  . TYR A 1 89  ? -11.776 -6.574  -23.616 1.00 0.00 ? 1569 TYR A HB3  2  
ATOM   3564  H HD1  . TYR A 1 89  ? -12.529 -3.403  -21.836 1.00 0.00 ? 1569 TYR A HD1  2  
ATOM   3565  H HD2  . TYR A 1 89  ? -14.106 -7.083  -23.438 1.00 0.00 ? 1569 TYR A HD2  2  
ATOM   3566  H HE1  . TYR A 1 89  ? -14.798 -2.532  -21.554 1.00 0.00 ? 1569 TYR A HE1  2  
ATOM   3567  H HE2  . TYR A 1 89  ? -16.402 -6.240  -23.143 1.00 0.00 ? 1569 TYR A HE2  2  
ATOM   3568  H HH   . TYR A 1 89  ? -17.113 -2.931  -21.875 1.00 0.00 ? 1569 TYR A HH   2  
ATOM   3569  N N    . TYR A 1 90  ? -10.459 -8.670  -22.224 1.00 0.00 ? 1570 TYR A N    2  
ATOM   3570  C CA   . TYR A 1 90  ? -9.561  -9.741  -22.610 1.00 0.00 ? 1570 TYR A CA   2  
ATOM   3571  C C    . TYR A 1 90  ? -10.179 -10.399 -23.826 1.00 0.00 ? 1570 TYR A C    2  
ATOM   3572  O O    . TYR A 1 90  ? -11.377 -10.686 -23.831 1.00 0.00 ? 1570 TYR A O    2  
ATOM   3573  C CB   . TYR A 1 90  ? -9.434  -10.769 -21.478 1.00 0.00 ? 1570 TYR A CB   2  
ATOM   3574  C CG   . TYR A 1 90  ? -8.910  -10.235 -20.171 1.00 0.00 ? 1570 TYR A CG   2  
ATOM   3575  C CD1  . TYR A 1 90  ? -9.786  -9.626  -19.251 1.00 0.00 ? 1570 TYR A CD1  2  
ATOM   3576  C CD2  . TYR A 1 90  ? -7.544  -10.357 -19.875 1.00 0.00 ? 1570 TYR A CD2  2  
ATOM   3577  C CE1  . TYR A 1 90  ? -9.285  -9.133  -18.034 1.00 0.00 ? 1570 TYR A CE1  2  
ATOM   3578  C CE2  . TYR A 1 90  ? -7.050  -9.894  -18.652 1.00 0.00 ? 1570 TYR A CE2  2  
ATOM   3579  C CZ   . TYR A 1 90  ? -7.918  -9.274  -17.730 1.00 0.00 ? 1570 TYR A CZ   2  
ATOM   3580  O OH   . TYR A 1 90  ? -7.412  -8.831  -16.546 1.00 0.00 ? 1570 TYR A OH   2  
ATOM   3581  H H    . TYR A 1 90  ? -11.451 -8.899  -22.227 1.00 0.00 ? 1570 TYR A H    2  
ATOM   3582  H HA   . TYR A 1 90  ? -8.576  -9.342  -22.850 1.00 0.00 ? 1570 TYR A HA   2  
ATOM   3583  H HB2  . TYR A 1 90  ? -10.403 -11.218 -21.282 1.00 0.00 ? 1570 TYR A HB2  2  
ATOM   3584  H HB3  . TYR A 1 90  ? -8.775  -11.569 -21.809 1.00 0.00 ? 1570 TYR A HB3  2  
ATOM   3585  H HD1  . TYR A 1 90  ? -10.840 -9.536  -19.478 1.00 0.00 ? 1570 TYR A HD1  2  
ATOM   3586  H HD2  . TYR A 1 90  ? -6.866  -10.805 -20.586 1.00 0.00 ? 1570 TYR A HD2  2  
ATOM   3587  H HE1  . TYR A 1 90  ? -9.945  -8.648  -17.336 1.00 0.00 ? 1570 TYR A HE1  2  
ATOM   3588  H HE2  . TYR A 1 90  ? -6.005  -10.015 -18.424 1.00 0.00 ? 1570 TYR A HE2  2  
ATOM   3589  H HH   . TYR A 1 90  ? -8.068  -8.439  -15.938 1.00 0.00 ? 1570 TYR A HH   2  
ATOM   3590  N N    . SER A 1 91  ? -9.382  -10.655 -24.855 1.00 0.00 ? 1571 SER A N    2  
ATOM   3591  C CA   . SER A 1 91  ? -9.808  -11.446 -25.988 1.00 0.00 ? 1571 SER A CA   2  
ATOM   3592  C C    . SER A 1 91  ? -9.570  -12.900 -25.589 1.00 0.00 ? 1571 SER A C    2  
ATOM   3593  O O    . SER A 1 91  ? -8.428  -13.356 -25.488 1.00 0.00 ? 1571 SER A O    2  
ATOM   3594  C CB   . SER A 1 91  ? -9.081  -10.973 -27.251 1.00 0.00 ? 1571 SER A CB   2  
ATOM   3595  O OG   . SER A 1 91  ? -7.766  -10.516 -26.986 1.00 0.00 ? 1571 SER A OG   2  
ATOM   3596  H H    . SER A 1 91  ? -8.398  -10.406 -24.828 1.00 0.00 ? 1571 SER A H    2  
ATOM   3597  H HA   . SER A 1 91  ? -10.876 -11.306 -26.154 1.00 0.00 ? 1571 SER A HA   2  
ATOM   3598  H HB2  . SER A 1 91  ? -9.047  -11.780 -27.969 1.00 0.00 ? 1571 SER A HB2  2  
ATOM   3599  H HB3  . SER A 1 91  ? -9.649  -10.154 -27.690 1.00 0.00 ? 1571 SER A HB3  2  
ATOM   3600  H HG   . SER A 1 91  ? -7.396  -10.152 -27.815 1.00 0.00 ? 1571 SER A HG   2  
ATOM   3601  N N    . ILE A 1 92  ? -10.647 -13.601 -25.244 1.00 0.00 ? 1572 ILE A N    2  
ATOM   3602  C CA   . ILE A 1 92  ? -10.596 -14.994 -24.840 1.00 0.00 ? 1572 ILE A CA   2  
ATOM   3603  C C    . ILE A 1 92  ? -10.727 -15.797 -26.127 1.00 0.00 ? 1572 ILE A C    2  
ATOM   3604  O O    . ILE A 1 92  ? -11.737 -15.713 -26.819 1.00 0.00 ? 1572 ILE A O    2  
ATOM   3605  C CB   . ILE A 1 92  ? -11.713 -15.304 -23.813 1.00 0.00 ? 1572 ILE A CB   2  
ATOM   3606  C CG1  . ILE A 1 92  ? -11.721 -14.321 -22.613 1.00 0.00 ? 1572 ILE A CG1  2  
ATOM   3607  C CG2  . ILE A 1 92  ? -11.609 -16.739 -23.266 1.00 0.00 ? 1572 ILE A CG2  2  
ATOM   3608  C CD1  . ILE A 1 92  ? -10.348 -14.133 -21.960 1.00 0.00 ? 1572 ILE A CD1  2  
ATOM   3609  H H    . ILE A 1 92  ? -11.575 -13.184 -25.351 1.00 0.00 ? 1572 ILE A H    2  
ATOM   3610  H HA   . ILE A 1 92  ? -9.630  -15.201 -24.378 1.00 0.00 ? 1572 ILE A HA   2  
ATOM   3611  H HB   . ILE A 1 92  ? -12.669 -15.228 -24.325 1.00 0.00 ? 1572 ILE A HB   2  
ATOM   3612  H HG12 . ILE A 1 92  ? -12.074 -13.339 -22.936 1.00 0.00 ? 1572 ILE A HG12 2  
ATOM   3613  H HG13 . ILE A 1 92  ? -12.424 -14.683 -21.859 1.00 0.00 ? 1572 ILE A HG13 2  
ATOM   3614  H HG21 . ILE A 1 92  ? -10.632 -16.914 -22.811 1.00 0.00 ? 1572 ILE A HG21 2  
ATOM   3615  H HG22 . ILE A 1 92  ? -12.392 -16.906 -22.522 1.00 0.00 ? 1572 ILE A HG22 2  
ATOM   3616  H HG23 . ILE A 1 92  ? -11.749 -17.451 -24.078 1.00 0.00 ? 1572 ILE A HG23 2  
ATOM   3617  H HD11 . ILE A 1 92  ? -9.871  -15.095 -21.788 1.00 0.00 ? 1572 ILE A HD11 2  
ATOM   3618  H HD12 . ILE A 1 92  ? -9.705  -13.537 -22.606 1.00 0.00 ? 1572 ILE A HD12 2  
ATOM   3619  H HD13 . ILE A 1 92  ? -10.462 -13.622 -21.002 1.00 0.00 ? 1572 ILE A HD13 2  
ATOM   3620  N N    . GLU A 1 93  ? -9.677  -16.521 -26.500 1.00 0.00 ? 1573 GLU A N    2  
ATOM   3621  C CA   . GLU A 1 93  ? -9.745  -17.501 -27.567 1.00 0.00 ? 1573 GLU A CA   2  
ATOM   3622  C C    . GLU A 1 93  ? -10.606 -18.642 -27.028 1.00 0.00 ? 1573 GLU A C    2  
ATOM   3623  O O    . GLU A 1 93  ? -10.298 -19.213 -25.979 1.00 0.00 ? 1573 GLU A O    2  
ATOM   3624  C CB   . GLU A 1 93  ? -8.339  -17.950 -27.974 1.00 0.00 ? 1573 GLU A CB   2  
ATOM   3625  C CG   . GLU A 1 93  ? -8.383  -18.792 -29.257 1.00 0.00 ? 1573 GLU A CG   2  
ATOM   3626  C CD   . GLU A 1 93  ? -6.966  -19.165 -29.725 1.00 0.00 ? 1573 GLU A CD   2  
ATOM   3627  O OE1  . GLU A 1 93  ? -6.278  -18.281 -30.293 1.00 0.00 ? 1573 GLU A OE1  2  
ATOM   3628  O OE2  . GLU A 1 93  ? -6.547  -20.330 -29.529 1.00 0.00 ? 1573 GLU A OE2  2  
ATOM   3629  H H    . GLU A 1 93  ? -8.877  -16.560 -25.879 1.00 0.00 ? 1573 GLU A H    2  
ATOM   3630  H HA   . GLU A 1 93  ? -10.232 -17.051 -28.423 1.00 0.00 ? 1573 GLU A HA   2  
ATOM   3631  H HB2  . GLU A 1 93  ? -7.736  -17.061 -28.162 1.00 0.00 ? 1573 GLU A HB2  2  
ATOM   3632  H HB3  . GLU A 1 93  ? -7.874  -18.520 -27.170 1.00 0.00 ? 1573 GLU A HB3  2  
ATOM   3633  H HG2  . GLU A 1 93  ? -8.974  -19.696 -29.087 1.00 0.00 ? 1573 GLU A HG2  2  
ATOM   3634  H HG3  . GLU A 1 93  ? -8.885  -18.219 -30.042 1.00 0.00 ? 1573 GLU A HG3  2  
ATOM   3635  N N    . LYS A 1 94  ? -11.713 -18.930 -27.709 1.00 0.00 ? 1574 LYS A N    2  
ATOM   3636  C CA   . LYS A 1 94  ? -12.745 -19.861 -27.273 1.00 0.00 ? 1574 LYS A CA   2  
ATOM   3637  C C    . LYS A 1 94  ? -13.195 -20.535 -28.558 1.00 0.00 ? 1574 LYS A C    2  
ATOM   3638  O O    . LYS A 1 94  ? -13.442 -19.838 -29.538 1.00 0.00 ? 1574 LYS A O    2  
ATOM   3639  C CB   . LYS A 1 94  ? -13.848 -19.028 -26.577 1.00 0.00 ? 1574 LYS A CB   2  
ATOM   3640  C CG   . LYS A 1 94  ? -14.574 -19.780 -25.458 1.00 0.00 ? 1574 LYS A CG   2  
ATOM   3641  C CD   . LYS A 1 94  ? -15.577 -20.869 -25.870 1.00 0.00 ? 1574 LYS A CD   2  
ATOM   3642  C CE   . LYS A 1 94  ? -16.763 -20.298 -26.675 1.00 0.00 ? 1574 LYS A CE   2  
ATOM   3643  N NZ   . LYS A 1 94  ? -17.957 -21.190 -26.654 1.00 0.00 ? 1574 LYS A NZ   2  
ATOM   3644  H H    . LYS A 1 94  ? -11.921 -18.404 -28.555 1.00 0.00 ? 1574 LYS A H    2  
ATOM   3645  H HA   . LYS A 1 94  ? -12.308 -20.586 -26.580 1.00 0.00 ? 1574 LYS A HA   2  
ATOM   3646  H HB2  . LYS A 1 94  ? -13.377 -18.168 -26.098 1.00 0.00 ? 1574 LYS A HB2  2  
ATOM   3647  H HB3  . LYS A 1 94  ? -14.557 -18.635 -27.302 1.00 0.00 ? 1574 LYS A HB3  2  
ATOM   3648  H HG2  . LYS A 1 94  ? -13.812 -20.244 -24.836 1.00 0.00 ? 1574 LYS A HG2  2  
ATOM   3649  H HG3  . LYS A 1 94  ? -15.101 -19.048 -24.843 1.00 0.00 ? 1574 LYS A HG3  2  
ATOM   3650  H HD2  . LYS A 1 94  ? -15.063 -21.641 -26.438 1.00 0.00 ? 1574 LYS A HD2  2  
ATOM   3651  H HD3  . LYS A 1 94  ? -15.934 -21.337 -24.949 1.00 0.00 ? 1574 LYS A HD3  2  
ATOM   3652  H HE2  . LYS A 1 94  ? -17.048 -19.329 -26.249 1.00 0.00 ? 1574 LYS A HE2  2  
ATOM   3653  H HE3  . LYS A 1 94  ? -16.445 -20.121 -27.708 1.00 0.00 ? 1574 LYS A HE3  2  
ATOM   3654  H HZ1  . LYS A 1 94  ? -17.746 -22.133 -26.963 1.00 0.00 ? 1574 LYS A HZ1  2  
ATOM   3655  H HZ2  . LYS A 1 94  ? -18.356 -21.236 -25.714 1.00 0.00 ? 1574 LYS A HZ2  2  
ATOM   3656  H HZ3  . LYS A 1 94  ? -18.685 -20.829 -27.263 1.00 0.00 ? 1574 LYS A HZ3  2  
ATOM   3657  N N    . GLU A 1 95  ? -13.241 -21.862 -28.587 1.00 0.00 ? 1575 GLU A N    2  
ATOM   3658  C CA   . GLU A 1 95  ? -13.439 -22.653 -29.809 1.00 0.00 ? 1575 GLU A CA   2  
ATOM   3659  C C    . GLU A 1 95  ? -12.461 -22.239 -30.929 1.00 0.00 ? 1575 GLU A C    2  
ATOM   3660  O O    . GLU A 1 95  ? -12.801 -22.256 -32.114 1.00 0.00 ? 1575 GLU A O    2  
ATOM   3661  C CB   . GLU A 1 95  ? -14.924 -22.659 -30.235 1.00 0.00 ? 1575 GLU A CB   2  
ATOM   3662  C CG   . GLU A 1 95  ? -15.856 -23.336 -29.218 1.00 0.00 ? 1575 GLU A CG   2  
ATOM   3663  C CD   . GLU A 1 95  ? -15.528 -24.831 -29.029 1.00 0.00 ? 1575 GLU A CD   2  
ATOM   3664  O OE1  . GLU A 1 95  ? -15.946 -25.659 -29.873 1.00 0.00 ? 1575 GLU A OE1  2  
ATOM   3665  O OE2  . GLU A 1 95  ? -14.851 -25.188 -28.036 1.00 0.00 ? 1575 GLU A OE2  2  
ATOM   3666  H H    . GLU A 1 95  ? -13.030 -22.383 -27.745 1.00 0.00 ? 1575 GLU A H    2  
ATOM   3667  H HA   . GLU A 1 95  ? -13.166 -23.672 -29.551 1.00 0.00 ? 1575 GLU A HA   2  
ATOM   3668  H HB2  . GLU A 1 95  ? -15.260 -21.632 -30.388 1.00 0.00 ? 1575 GLU A HB2  2  
ATOM   3669  H HB3  . GLU A 1 95  ? -15.030 -23.189 -31.184 1.00 0.00 ? 1575 GLU A HB3  2  
ATOM   3670  H HG2  . GLU A 1 95  ? -15.787 -22.813 -28.265 1.00 0.00 ? 1575 GLU A HG2  2  
ATOM   3671  H HG3  . GLU A 1 95  ? -16.885 -23.233 -29.572 1.00 0.00 ? 1575 GLU A HG3  2  
ATOM   3672  N N    . GLY A 1 96  ? -11.230 -21.858 -30.555 1.00 0.00 ? 1576 GLY A N    2  
ATOM   3673  C CA   . GLY A 1 96  ? -10.158 -21.544 -31.498 1.00 0.00 ? 1576 GLY A CA   2  
ATOM   3674  C C    . GLY A 1 96  ? -10.340 -20.220 -32.243 1.00 0.00 ? 1576 GLY A C    2  
ATOM   3675  O O    . GLY A 1 96  ? -9.668  -19.997 -33.251 1.00 0.00 ? 1576 GLY A O    2  
ATOM   3676  H H    . GLY A 1 96  ? -10.990 -21.898 -29.572 1.00 0.00 ? 1576 GLY A H    2  
ATOM   3677  H HA2  . GLY A 1 96  ? -9.215  -21.497 -30.952 1.00 0.00 ? 1576 GLY A HA2  2  
ATOM   3678  H HA3  . GLY A 1 96  ? -10.084 -22.350 -32.229 1.00 0.00 ? 1576 GLY A HA3  2  
ATOM   3679  N N    . GLN A 1 97  ? -11.222 -19.333 -31.762 1.00 0.00 ? 1577 GLN A N    2  
ATOM   3680  C CA   . GLN A 1 97  ? -11.455 -17.999 -32.328 1.00 0.00 ? 1577 GLN A CA   2  
ATOM   3681  C C    . GLN A 1 97  ? -11.574 -17.002 -31.176 1.00 0.00 ? 1577 GLN A C    2  
ATOM   3682  O O    . GLN A 1 97  ? -11.914 -17.407 -30.066 1.00 0.00 ? 1577 GLN A O    2  
ATOM   3683  C CB   . GLN A 1 97  ? -12.674 -18.032 -33.273 1.00 0.00 ? 1577 GLN A CB   2  
ATOM   3684  C CG   . GLN A 1 97  ? -13.990 -18.575 -32.683 1.00 0.00 ? 1577 GLN A CG   2  
ATOM   3685  C CD   . GLN A 1 97  ? -14.808 -17.522 -31.927 1.00 0.00 ? 1577 GLN A CD   2  
ATOM   3686  O OE1  . GLN A 1 97  ? -15.378 -16.606 -32.519 1.00 0.00 ? 1577 GLN A OE1  2  
ATOM   3687  N NE2  . GLN A 1 97  ? -14.891 -17.627 -30.611 1.00 0.00 ? 1577 GLN A NE2  2  
ATOM   3688  H H    . GLN A 1 97  ? -11.761 -19.581 -30.938 1.00 0.00 ? 1577 GLN A H    2  
ATOM   3689  H HA   . GLN A 1 97  ? -10.589 -17.712 -32.923 1.00 0.00 ? 1577 GLN A HA   2  
ATOM   3690  H HB2  . GLN A 1 97  ? -12.846 -17.034 -33.678 1.00 0.00 ? 1577 GLN A HB2  2  
ATOM   3691  H HB3  . GLN A 1 97  ? -12.407 -18.675 -34.112 1.00 0.00 ? 1577 GLN A HB3  2  
ATOM   3692  H HG2  . GLN A 1 97  ? -14.601 -18.943 -33.506 1.00 0.00 ? 1577 GLN A HG2  2  
ATOM   3693  H HG3  . GLN A 1 97  ? -13.787 -19.433 -32.038 1.00 0.00 ? 1577 GLN A HG3  2  
ATOM   3694  H HE21 . GLN A 1 97  ? -14.360 -18.362 -30.146 1.00 0.00 ? 1577 GLN A HE21 2  
ATOM   3695  H HE22 . GLN A 1 97  ? -15.425 -16.958 -30.075 1.00 0.00 ? 1577 GLN A HE22 2  
ATOM   3696  N N    . ARG A 1 98  ? -11.227 -15.728 -31.374 1.00 0.00 ? 1578 ARG A N    2  
ATOM   3697  C CA   . ARG A 1 98  ? -11.146 -14.776 -30.261 1.00 0.00 ? 1578 ARG A CA   2  
ATOM   3698  C C    . ARG A 1 98  ? -12.522 -14.157 -30.026 1.00 0.00 ? 1578 ARG A C    2  
ATOM   3699  O O    . ARG A 1 98  ? -13.229 -13.825 -30.979 1.00 0.00 ? 1578 ARG A O    2  
ATOM   3700  C CB   . ARG A 1 98  ? -10.069 -13.699 -30.512 1.00 0.00 ? 1578 ARG A CB   2  
ATOM   3701  C CG   . ARG A 1 98  ? -8.628  -14.214 -30.315 1.00 0.00 ? 1578 ARG A CG   2  
ATOM   3702  C CD   . ARG A 1 98  ? -8.049  -14.944 -31.537 1.00 0.00 ? 1578 ARG A CD   2  
ATOM   3703  N NE   . ARG A 1 98  ? -6.813  -15.677 -31.204 1.00 0.00 ? 1578 ARG A NE   2  
ATOM   3704  C CZ   . ARG A 1 98  ? -5.549  -15.241 -31.221 1.00 0.00 ? 1578 ARG A CZ   2  
ATOM   3705  N NH1  . ARG A 1 98  ? -5.236  -13.996 -31.576 1.00 0.00 ? 1578 ARG A NH1  2  
ATOM   3706  N NH2  . ARG A 1 98  ? -4.609  -16.106 -30.866 1.00 0.00 ? 1578 ARG A NH2  2  
ATOM   3707  H H    . ARG A 1 98  ? -11.069 -15.385 -32.315 1.00 0.00 ? 1578 ARG A H    2  
ATOM   3708  H HA   . ARG A 1 98  ? -10.877 -15.315 -29.352 1.00 0.00 ? 1578 ARG A HA   2  
ATOM   3709  H HB2  . ARG A 1 98  ? -10.186 -13.266 -31.507 1.00 0.00 ? 1578 ARG A HB2  2  
ATOM   3710  H HB3  . ARG A 1 98  ? -10.225 -12.901 -29.787 1.00 0.00 ? 1578 ARG A HB3  2  
ATOM   3711  H HG2  . ARG A 1 98  ? -7.979  -13.362 -30.099 1.00 0.00 ? 1578 ARG A HG2  2  
ATOM   3712  H HG3  . ARG A 1 98  ? -8.593  -14.878 -29.446 1.00 0.00 ? 1578 ARG A HG3  2  
ATOM   3713  H HD2  . ARG A 1 98  ? -8.764  -15.678 -31.902 1.00 0.00 ? 1578 ARG A HD2  2  
ATOM   3714  H HD3  . ARG A 1 98  ? -7.869  -14.230 -32.342 1.00 0.00 ? 1578 ARG A HD3  2  
ATOM   3715  H HE   . ARG A 1 98  ? -6.933  -16.654 -30.923 1.00 0.00 ? 1578 ARG A HE   2  
ATOM   3716  H HH11 . ARG A 1 98  ? -5.951  -13.341 -31.866 1.00 0.00 ? 1578 ARG A HH11 2  
ATOM   3717  H HH12 . ARG A 1 98  ? -4.281  -13.663 -31.592 1.00 0.00 ? 1578 ARG A HH12 2  
ATOM   3718  H HH21 . ARG A 1 98  ? -4.905  -17.060 -30.619 1.00 0.00 ? 1578 ARG A HH21 2  
ATOM   3719  H HH22 . ARG A 1 98  ? -3.621  -15.891 -30.885 1.00 0.00 ? 1578 ARG A HH22 2  
ATOM   3720  N N    . LYS A 1 99  ? -12.868 -13.958 -28.752 1.00 0.00 ? 1579 LYS A N    2  
ATOM   3721  C CA   . LYS A 1 99  ? -14.141 -13.394 -28.308 1.00 0.00 ? 1579 LYS A CA   2  
ATOM   3722  C C    . LYS A 1 99  ? -13.798 -12.415 -27.198 1.00 0.00 ? 1579 LYS A C    2  
ATOM   3723  O O    . LYS A 1 99  ? -13.086 -12.780 -26.268 1.00 0.00 ? 1579 LYS A O    2  
ATOM   3724  C CB   . LYS A 1 99  ? -15.017 -14.557 -27.801 1.00 0.00 ? 1579 LYS A CB   2  
ATOM   3725  C CG   . LYS A 1 99  ? -16.536 -14.327 -27.832 1.00 0.00 ? 1579 LYS A CG   2  
ATOM   3726  C CD   . LYS A 1 99  ? -17.047 -13.070 -27.107 1.00 0.00 ? 1579 LYS A CD   2  
ATOM   3727  C CE   . LYS A 1 99  ? -18.576 -13.090 -26.891 1.00 0.00 ? 1579 LYS A CE   2  
ATOM   3728  N NZ   . LYS A 1 99  ? -19.361 -12.953 -28.151 1.00 0.00 ? 1579 LYS A NZ   2  
ATOM   3729  H H    . LYS A 1 99  ? -12.263 -14.319 -28.012 1.00 0.00 ? 1579 LYS A H    2  
ATOM   3730  H HA   . LYS A 1 99  ? -14.634 -12.888 -29.140 1.00 0.00 ? 1579 LYS A HA   2  
ATOM   3731  H HB2  . LYS A 1 99  ? -14.826 -15.434 -28.417 1.00 0.00 ? 1579 LYS A HB2  2  
ATOM   3732  H HB3  . LYS A 1 99  ? -14.712 -14.820 -26.786 1.00 0.00 ? 1579 LYS A HB3  2  
ATOM   3733  H HG2  . LYS A 1 99  ? -16.846 -14.289 -28.875 1.00 0.00 ? 1579 LYS A HG2  2  
ATOM   3734  H HG3  . LYS A 1 99  ? -16.991 -15.202 -27.368 1.00 0.00 ? 1579 LYS A HG3  2  
ATOM   3735  H HD2  . LYS A 1 99  ? -16.574 -13.013 -26.125 1.00 0.00 ? 1579 LYS A HD2  2  
ATOM   3736  H HD3  . LYS A 1 99  ? -16.779 -12.174 -27.672 1.00 0.00 ? 1579 LYS A HD3  2  
ATOM   3737  H HE2  . LYS A 1 99  ? -18.849 -14.017 -26.378 1.00 0.00 ? 1579 LYS A HE2  2  
ATOM   3738  H HE3  . LYS A 1 99  ? -18.830 -12.265 -26.221 1.00 0.00 ? 1579 LYS A HE3  2  
ATOM   3739  H HZ1  . LYS A 1 99  ? -20.355 -12.951 -27.952 1.00 0.00 ? 1579 LYS A HZ1  2  
ATOM   3740  H HZ2  . LYS A 1 99  ? -19.153 -12.083 -28.627 1.00 0.00 ? 1579 LYS A HZ2  2  
ATOM   3741  H HZ3  . LYS A 1 99  ? -19.186 -13.717 -28.796 1.00 0.00 ? 1579 LYS A HZ3  2  
ATOM   3742  N N    . TRP A 1 100 ? -14.267 -11.177 -27.270 1.00 0.00 ? 1580 TRP A N    2  
ATOM   3743  C CA   . TRP A 1 100 ? -13.957 -10.180 -26.252 1.00 0.00 ? 1580 TRP A CA   2  
ATOM   3744  C C    . TRP A 1 100 ? -14.862 -10.397 -25.040 1.00 0.00 ? 1580 TRP A C    2  
ATOM   3745  O O    . TRP A 1 100 ? -16.082 -10.469 -25.191 1.00 0.00 ? 1580 TRP A O    2  
ATOM   3746  C CB   . TRP A 1 100 ? -14.165 -8.773  -26.831 1.00 0.00 ? 1580 TRP A CB   2  
ATOM   3747  C CG   . TRP A 1 100 ? -13.085 -8.357  -27.774 1.00 0.00 ? 1580 TRP A CG   2  
ATOM   3748  C CD1  . TRP A 1 100 ? -13.182 -8.221  -29.118 1.00 0.00 ? 1580 TRP A CD1  2  
ATOM   3749  C CD2  . TRP A 1 100 ? -11.712 -8.020  -27.440 1.00 0.00 ? 1580 TRP A CD2  2  
ATOM   3750  N NE1  . TRP A 1 100 ? -11.961 -7.833  -29.632 1.00 0.00 ? 1580 TRP A NE1  2  
ATOM   3751  C CE2  . TRP A 1 100 ? -11.011 -7.708  -28.640 1.00 0.00 ? 1580 TRP A CE2  2  
ATOM   3752  C CE3  . TRP A 1 100 ? -10.995 -7.971  -26.227 1.00 0.00 ? 1580 TRP A CE3  2  
ATOM   3753  C CZ2  . TRP A 1 100 ? -9.647  -7.374  -28.636 1.00 0.00 ? 1580 TRP A CZ2  2  
ATOM   3754  C CZ3  . TRP A 1 100 ? -9.628  -7.647  -26.216 1.00 0.00 ? 1580 TRP A CZ3  2  
ATOM   3755  C CH2  . TRP A 1 100 ? -8.953  -7.347  -27.414 1.00 0.00 ? 1580 TRP A CH2  2  
ATOM   3756  H H    . TRP A 1 100 ? -14.856 -10.898 -28.045 1.00 0.00 ? 1580 TRP A H    2  
ATOM   3757  H HA   . TRP A 1 100 ? -12.907 -10.286 -25.958 1.00 0.00 ? 1580 TRP A HA   2  
ATOM   3758  H HB2  . TRP A 1 100 ? -15.135 -8.707  -27.332 1.00 0.00 ? 1580 TRP A HB2  2  
ATOM   3759  H HB3  . TRP A 1 100 ? -14.169 -8.055  -26.010 1.00 0.00 ? 1580 TRP A HB3  2  
ATOM   3760  H HD1  . TRP A 1 100 ? -14.080 -8.392  -29.701 1.00 0.00 ? 1580 TRP A HD1  2  
ATOM   3761  H HE1  . TRP A 1 100 ? -11.809 -7.668  -30.623 1.00 0.00 ? 1580 TRP A HE1  2  
ATOM   3762  H HE3  . TRP A 1 100 ? -11.508 -8.188  -25.299 1.00 0.00 ? 1580 TRP A HE3  2  
ATOM   3763  H HZ2  . TRP A 1 100 ? -9.136  -7.143  -29.562 1.00 0.00 ? 1580 TRP A HZ2  2  
ATOM   3764  H HZ3  . TRP A 1 100 ? -9.090  -7.627  -25.277 1.00 0.00 ? 1580 TRP A HZ3  2  
ATOM   3765  H HH2  . TRP A 1 100 ? -7.902  -7.096  -27.393 1.00 0.00 ? 1580 TRP A HH2  2  
ATOM   3766  N N    . TYR A 1 101 ? -14.270 -10.436 -23.845 1.00 0.00 ? 1581 TYR A N    2  
ATOM   3767  C CA   . TYR A 1 101 ? -14.982 -10.456 -22.568 1.00 0.00 ? 1581 TYR A CA   2  
ATOM   3768  C C    . TYR A 1 101 ? -14.372 -9.413  -21.628 1.00 0.00 ? 1581 TYR A C    2  
ATOM   3769  O O    . TYR A 1 101 ? -13.225 -9.015  -21.814 1.00 0.00 ? 1581 TYR A O    2  
ATOM   3770  C CB   . TYR A 1 101 ? -14.913 -11.865 -21.966 1.00 0.00 ? 1581 TYR A CB   2  
ATOM   3771  C CG   . TYR A 1 101 ? -15.800 -12.880 -22.655 1.00 0.00 ? 1581 TYR A CG   2  
ATOM   3772  C CD1  . TYR A 1 101 ? -17.180 -12.868 -22.404 1.00 0.00 ? 1581 TYR A CD1  2  
ATOM   3773  C CD2  . TYR A 1 101 ? -15.261 -13.832 -23.535 1.00 0.00 ? 1581 TYR A CD2  2  
ATOM   3774  C CE1  . TYR A 1 101 ? -18.013 -13.811 -23.022 1.00 0.00 ? 1581 TYR A CE1  2  
ATOM   3775  C CE2  . TYR A 1 101 ? -16.089 -14.791 -24.146 1.00 0.00 ? 1581 TYR A CE2  2  
ATOM   3776  C CZ   . TYR A 1 101 ? -17.479 -14.784 -23.892 1.00 0.00 ? 1581 TYR A CZ   2  
ATOM   3777  O OH   . TYR A 1 101 ? -18.291 -15.705 -24.482 1.00 0.00 ? 1581 TYR A OH   2  
ATOM   3778  H H    . TYR A 1 101 ? -13.251 -10.442 -23.798 1.00 0.00 ? 1581 TYR A H    2  
ATOM   3779  H HA   . TYR A 1 101 ? -16.031 -10.198 -22.728 1.00 0.00 ? 1581 TYR A HA   2  
ATOM   3780  H HB2  . TYR A 1 101 ? -13.879 -12.212 -21.978 1.00 0.00 ? 1581 TYR A HB2  2  
ATOM   3781  H HB3  . TYR A 1 101 ? -15.224 -11.823 -20.923 1.00 0.00 ? 1581 TYR A HB3  2  
ATOM   3782  H HD1  . TYR A 1 101 ? -17.617 -12.137 -21.736 1.00 0.00 ? 1581 TYR A HD1  2  
ATOM   3783  H HD2  . TYR A 1 101 ? -14.207 -13.831 -23.745 1.00 0.00 ? 1581 TYR A HD2  2  
ATOM   3784  H HE1  . TYR A 1 101 ? -19.065 -13.780 -22.823 1.00 0.00 ? 1581 TYR A HE1  2  
ATOM   3785  H HE2  . TYR A 1 101 ? -15.657 -15.529 -24.808 1.00 0.00 ? 1581 TYR A HE2  2  
ATOM   3786  H HH   . TYR A 1 101 ? -19.230 -15.609 -24.238 1.00 0.00 ? 1581 TYR A HH   2  
ATOM   3787  N N    . LYS A 1 102 ? -15.122 -8.981  -20.611 1.00 0.00 ? 1582 LYS A N    2  
ATOM   3788  C CA   . LYS A 1 102 ? -14.694 -7.931  -19.657 1.00 0.00 ? 1582 LYS A CA   2  
ATOM   3789  C C    . LYS A 1 102 ? -14.183 -8.570  -18.373 1.00 0.00 ? 1582 LYS A C    2  
ATOM   3790  O O    . LYS A 1 102 ? -14.571 -9.697  -18.093 1.00 0.00 ? 1582 LYS A O    2  
ATOM   3791  C CB   . LYS A 1 102 ? -15.836 -6.923  -19.397 1.00 0.00 ? 1582 LYS A CB   2  
ATOM   3792  C CG   . LYS A 1 102 ? -17.208 -7.572  -19.134 1.00 0.00 ? 1582 LYS A CG   2  
ATOM   3793  C CD   . LYS A 1 102 ? -18.275 -6.589  -18.618 1.00 0.00 ? 1582 LYS A CD   2  
ATOM   3794  C CE   . LYS A 1 102 ? -18.574 -5.371  -19.515 1.00 0.00 ? 1582 LYS A CE   2  
ATOM   3795  N NZ   . LYS A 1 102 ? -19.352 -5.698  -20.740 1.00 0.00 ? 1582 LYS A NZ   2  
ATOM   3796  H H    . LYS A 1 102 ? -16.024 -9.431  -20.467 1.00 0.00 ? 1582 LYS A H    2  
ATOM   3797  H HA   . LYS A 1 102 ? -13.869 -7.368  -20.097 1.00 0.00 ? 1582 LYS A HA   2  
ATOM   3798  H HB2  . LYS A 1 102 ? -15.560 -6.283  -18.555 1.00 0.00 ? 1582 LYS A HB2  2  
ATOM   3799  H HB3  . LYS A 1 102 ? -15.919 -6.282  -20.273 1.00 0.00 ? 1582 LYS A HB3  2  
ATOM   3800  H HG2  . LYS A 1 102 ? -17.575 -8.027  -20.056 1.00 0.00 ? 1582 LYS A HG2  2  
ATOM   3801  H HG3  . LYS A 1 102 ? -17.094 -8.354  -18.382 1.00 0.00 ? 1582 LYS A HG3  2  
ATOM   3802  H HD2  . LYS A 1 102 ? -19.191 -7.157  -18.451 1.00 0.00 ? 1582 LYS A HD2  2  
ATOM   3803  H HD3  . LYS A 1 102 ? -17.939 -6.213  -17.653 1.00 0.00 ? 1582 LYS A HD3  2  
ATOM   3804  H HE2  . LYS A 1 102 ? -19.146 -4.650  -18.925 1.00 0.00 ? 1582 LYS A HE2  2  
ATOM   3805  H HE3  . LYS A 1 102 ? -17.636 -4.881  -19.783 1.00 0.00 ? 1582 LYS A HE3  2  
ATOM   3806  H HZ1  . LYS A 1 102 ? -19.440 -4.873  -21.322 1.00 0.00 ? 1582 LYS A HZ1  2  
ATOM   3807  H HZ2  . LYS A 1 102 ? -18.913 -6.415  -21.305 1.00 0.00 ? 1582 LYS A HZ2  2  
ATOM   3808  H HZ3  . LYS A 1 102 ? -20.311 -5.998  -20.521 1.00 0.00 ? 1582 LYS A HZ3  2  
ATOM   3809  N N    . ARG A 1 103 ? -13.385 -7.883  -17.544 1.00 0.00 ? 1583 ARG A N    2  
ATOM   3810  C CA   . ARG A 1 103 ? -12.790 -8.512  -16.346 1.00 0.00 ? 1583 ARG A CA   2  
ATOM   3811  C C    . ARG A 1 103 ? -13.802 -9.278  -15.485 1.00 0.00 ? 1583 ARG A C    2  
ATOM   3812  O O    . ARG A 1 103 ? -13.528 -10.407 -15.109 1.00 0.00 ? 1583 ARG A O    2  
ATOM   3813  C CB   . ARG A 1 103 ? -11.920 -7.543  -15.508 1.00 0.00 ? 1583 ARG A CB   2  
ATOM   3814  C CG   . ARG A 1 103 ? -12.608 -6.301  -14.909 1.00 0.00 ? 1583 ARG A CG   2  
ATOM   3815  C CD   . ARG A 1 103 ? -12.146 -6.004  -13.470 1.00 0.00 ? 1583 ARG A CD   2  
ATOM   3816  N NE   . ARG A 1 103 ? -10.696 -5.733  -13.355 1.00 0.00 ? 1583 ARG A NE   2  
ATOM   3817  C CZ   . ARG A 1 103 ? -9.775  -6.500  -12.746 1.00 0.00 ? 1583 ARG A CZ   2  
ATOM   3818  N NH1  . ARG A 1 103 ? -10.055 -7.696  -12.238 1.00 0.00 ? 1583 ARG A NH1  2  
ATOM   3819  N NH2  . ARG A 1 103 ? -8.521  -6.085  -12.624 1.00 0.00 ? 1583 ARG A NH2  2  
ATOM   3820  H H    . ARG A 1 103 ? -13.051 -6.965  -17.843 1.00 0.00 ? 1583 ARG A H    2  
ATOM   3821  H HA   . ARG A 1 103 ? -12.090 -9.270  -16.724 1.00 0.00 ? 1583 ARG A HA   2  
ATOM   3822  H HB2  . ARG A 1 103 ? -11.484 -8.133  -14.698 1.00 0.00 ? 1583 ARG A HB2  2  
ATOM   3823  H HB3  . ARG A 1 103 ? -11.092 -7.188  -16.123 1.00 0.00 ? 1583 ARG A HB3  2  
ATOM   3824  H HG2  . ARG A 1 103 ? -12.393 -5.444  -15.544 1.00 0.00 ? 1583 ARG A HG2  2  
ATOM   3825  H HG3  . ARG A 1 103 ? -13.688 -6.432  -14.891 1.00 0.00 ? 1583 ARG A HG3  2  
ATOM   3826  H HD2  . ARG A 1 103 ? -12.684 -5.130  -13.107 1.00 0.00 ? 1583 ARG A HD2  2  
ATOM   3827  H HD3  . ARG A 1 103 ? -12.426 -6.830  -12.827 1.00 0.00 ? 1583 ARG A HD3  2  
ATOM   3828  H HE   . ARG A 1 103 ? -10.391 -4.862  -13.788 1.00 0.00 ? 1583 ARG A HE   2  
ATOM   3829  H HH11 . ARG A 1 103 ? -10.980 -8.130  -12.271 1.00 0.00 ? 1583 ARG A HH11 2  
ATOM   3830  H HH12 . ARG A 1 103 ? -9.290  -8.219  -11.794 1.00 0.00 ? 1583 ARG A HH12 2  
ATOM   3831  H HH21 . ARG A 1 103 ? -8.209  -5.165  -12.916 1.00 0.00 ? 1583 ARG A HH21 2  
ATOM   3832  H HH22 . ARG A 1 103 ? -7.850  -6.709  -12.149 1.00 0.00 ? 1583 ARG A HH22 2  
ATOM   3833  N N    . MET A 1 104 ? -15.001 -8.732  -15.228 1.00 0.00 ? 1584 MET A N    2  
ATOM   3834  C CA   . MET A 1 104 ? -15.997 -9.432  -14.389 1.00 0.00 ? 1584 MET A CA   2  
ATOM   3835  C C    . MET A 1 104 ? -16.585 -10.682 -15.067 1.00 0.00 ? 1584 MET A C    2  
ATOM   3836  O O    . MET A 1 104 ? -17.053 -11.582 -14.375 1.00 0.00 ? 1584 MET A O    2  
ATOM   3837  C CB   . MET A 1 104 ? -17.079 -8.460  -13.875 1.00 0.00 ? 1584 MET A CB   2  
ATOM   3838  C CG   . MET A 1 104 ? -18.053 -7.848  -14.903 1.00 0.00 ? 1584 MET A CG   2  
ATOM   3839  S SD   . MET A 1 104 ? -19.224 -8.957  -15.745 1.00 0.00 ? 1584 MET A SD   2  
ATOM   3840  C CE   . MET A 1 104 ? -20.187 -9.621  -14.353 1.00 0.00 ? 1584 MET A CE   2  
ATOM   3841  H H    . MET A 1 104 ? -15.214 -7.804  -15.578 1.00 0.00 ? 1584 MET A H    2  
ATOM   3842  H HA   . MET A 1 104 ? -15.467 -9.795  -13.508 1.00 0.00 ? 1584 MET A HA   2  
ATOM   3843  H HB2  . MET A 1 104 ? -17.660 -8.963  -13.103 1.00 0.00 ? 1584 MET A HB2  2  
ATOM   3844  H HB3  . MET A 1 104 ? -16.559 -7.632  -13.392 1.00 0.00 ? 1584 MET A HB3  2  
ATOM   3845  H HG2  . MET A 1 104 ? -18.646 -7.094  -14.382 1.00 0.00 ? 1584 MET A HG2  2  
ATOM   3846  H HG3  . MET A 1 104 ? -17.473 -7.328  -15.663 1.00 0.00 ? 1584 MET A HG3  2  
ATOM   3847  H HE1  . MET A 1 104 ? -20.641 -8.800  -13.796 1.00 0.00 ? 1584 MET A HE1  2  
ATOM   3848  H HE2  . MET A 1 104 ? -20.973 -10.273 -14.740 1.00 0.00 ? 1584 MET A HE2  2  
ATOM   3849  H HE3  . MET A 1 104 ? -19.542 -10.204 -13.694 1.00 0.00 ? 1584 MET A HE3  2  
ATOM   3850  N N    . ALA A 1 105 ? -16.548 -10.750 -16.402 1.00 0.00 ? 1585 ALA A N    2  
ATOM   3851  C CA   . ALA A 1 105 ? -16.964 -11.910 -17.172 1.00 0.00 ? 1585 ALA A CA   2  
ATOM   3852  C C    . ALA A 1 105 ? -15.852 -12.951 -17.236 1.00 0.00 ? 1585 ALA A C    2  
ATOM   3853  O O    . ALA A 1 105 ? -16.148 -14.122 -17.472 1.00 0.00 ? 1585 ALA A O    2  
ATOM   3854  C CB   . ALA A 1 105 ? -17.289 -11.468 -18.602 1.00 0.00 ? 1585 ALA A CB   2  
ATOM   3855  H H    . ALA A 1 105 ? -16.082 -10.021 -16.916 1.00 0.00 ? 1585 ALA A H    2  
ATOM   3856  H HA   . ALA A 1 105 ? -17.850 -12.363 -16.723 1.00 0.00 ? 1585 ALA A HA   2  
ATOM   3857  H HB1  . ALA A 1 105 ? -18.188 -10.848 -18.616 1.00 0.00 ? 1585 ALA A HB1  2  
ATOM   3858  H HB2  . ALA A 1 105 ? -16.456 -10.925 -19.038 1.00 0.00 ? 1585 ALA A HB2  2  
ATOM   3859  H HB3  . ALA A 1 105 ? -17.445 -12.350 -19.219 1.00 0.00 ? 1585 ALA A HB3  2  
ATOM   3860  N N    . VAL A 1 106 ? -14.590 -12.543 -17.074 1.00 0.00 ? 1586 VAL A N    2  
ATOM   3861  C CA   . VAL A 1 106 ? -13.447 -13.410 -17.199 1.00 0.00 ? 1586 VAL A CA   2  
ATOM   3862  C C    . VAL A 1 106 ? -13.169 -13.873 -15.777 1.00 0.00 ? 1586 VAL A C    2  
ATOM   3863  O O    . VAL A 1 106 ? -12.429 -13.246 -15.016 1.00 0.00 ? 1586 VAL A O    2  
ATOM   3864  C CB   . VAL A 1 106 ? -12.305 -12.630 -17.874 1.00 0.00 ? 1586 VAL A CB   2  
ATOM   3865  C CG1  . VAL A 1 106 ? -11.034 -13.468 -17.979 1.00 0.00 ? 1586 VAL A CG1  2  
ATOM   3866  C CG2  . VAL A 1 106 ? -12.713 -12.235 -19.300 1.00 0.00 ? 1586 VAL A CG2  2  
ATOM   3867  H H    . VAL A 1 106 ? -14.385 -11.594 -16.794 1.00 0.00 ? 1586 VAL A H    2  
ATOM   3868  H HA   . VAL A 1 106 ? -13.698 -14.271 -17.818 1.00 0.00 ? 1586 VAL A HA   2  
ATOM   3869  H HB   . VAL A 1 106 ? -12.081 -11.727 -17.306 1.00 0.00 ? 1586 VAL A HB   2  
ATOM   3870  H HG11 . VAL A 1 106 ? -11.268 -14.390 -18.511 1.00 0.00 ? 1586 VAL A HG11 2  
ATOM   3871  H HG12 . VAL A 1 106 ? -10.263 -12.909 -18.511 1.00 0.00 ? 1586 VAL A HG12 2  
ATOM   3872  H HG13 . VAL A 1 106 ? -10.667 -13.709 -16.982 1.00 0.00 ? 1586 VAL A HG13 2  
ATOM   3873  H HG21 . VAL A 1 106 ? -13.581 -11.579 -19.279 1.00 0.00 ? 1586 VAL A HG21 2  
ATOM   3874  H HG22 . VAL A 1 106 ? -11.905 -11.695 -19.780 1.00 0.00 ? 1586 VAL A HG22 2  
ATOM   3875  H HG23 . VAL A 1 106 ? -12.952 -13.127 -19.881 1.00 0.00 ? 1586 VAL A HG23 2  
ATOM   3876  N N    . ILE A 1 107 ? -13.809 -14.977 -15.412 1.00 0.00 ? 1587 ILE A N    2  
ATOM   3877  C CA   . ILE A 1 107 ? -13.755 -15.517 -14.067 1.00 0.00 ? 1587 ILE A CA   2  
ATOM   3878  C C    . ILE A 1 107 ? -12.697 -16.612 -14.115 1.00 0.00 ? 1587 ILE A C    2  
ATOM   3879  O O    . ILE A 1 107 ? -12.566 -17.339 -15.107 1.00 0.00 ? 1587 ILE A O    2  
ATOM   3880  C CB   . ILE A 1 107 ? -15.157 -15.930 -13.564 1.00 0.00 ? 1587 ILE A CB   2  
ATOM   3881  C CG1  . ILE A 1 107 ? -15.661 -17.222 -14.223 1.00 0.00 ? 1587 ILE A CG1  2  
ATOM   3882  C CG2  . ILE A 1 107 ? -16.155 -14.782 -13.811 1.00 0.00 ? 1587 ILE A CG2  2  
ATOM   3883  C CD1  . ILE A 1 107 ? -17.080 -17.656 -13.831 1.00 0.00 ? 1587 ILE A CD1  2  
ATOM   3884  H H    . ILE A 1 107 ? -14.293 -15.512 -16.121 1.00 0.00 ? 1587 ILE A H    2  
ATOM   3885  H HA   . ILE A 1 107 ? -13.402 -14.745 -13.386 1.00 0.00 ? 1587 ILE A HA   2  
ATOM   3886  H HB   . ILE A 1 107 ? -15.092 -16.105 -12.489 1.00 0.00 ? 1587 ILE A HB   2  
ATOM   3887  H HG12 . ILE A 1 107 ? -15.622 -17.090 -15.304 1.00 0.00 ? 1587 ILE A HG12 2  
ATOM   3888  H HG13 . ILE A 1 107 ? -14.987 -18.023 -13.919 1.00 0.00 ? 1587 ILE A HG13 2  
ATOM   3889  H HG21 . ILE A 1 107 ? -17.084 -14.973 -13.281 1.00 0.00 ? 1587 ILE A HG21 2  
ATOM   3890  H HG22 . ILE A 1 107 ? -15.741 -13.838 -13.455 1.00 0.00 ? 1587 ILE A HG22 2  
ATOM   3891  H HG23 . ILE A 1 107 ? -16.390 -14.710 -14.875 1.00 0.00 ? 1587 ILE A HG23 2  
ATOM   3892  H HD11 . ILE A 1 107 ? -17.151 -17.756 -12.750 1.00 0.00 ? 1587 ILE A HD11 2  
ATOM   3893  H HD12 . ILE A 1 107 ? -17.821 -16.936 -14.177 1.00 0.00 ? 1587 ILE A HD12 2  
ATOM   3894  H HD13 . ILE A 1 107 ? -17.301 -18.621 -14.290 1.00 0.00 ? 1587 ILE A HD13 2  
ATOM   3895  N N    . LEU A 1 108 ? -11.895 -16.715 -13.063 1.00 0.00 ? 1588 LEU A N    2  
ATOM   3896  C CA   . LEU A 1 108 ? -10.757 -17.615 -13.065 1.00 0.00 ? 1588 LEU A CA   2  
ATOM   3897  C C    . LEU A 1 108 ? -11.258 -18.871 -12.395 1.00 0.00 ? 1588 LEU A C    2  
ATOM   3898  O O    . LEU A 1 108 ? -11.611 -18.845 -11.214 1.00 0.00 ? 1588 LEU A O    2  
ATOM   3899  C CB   . LEU A 1 108 ? -9.578  -16.974 -12.316 1.00 0.00 ? 1588 LEU A CB   2  
ATOM   3900  C CG   . LEU A 1 108 ? -8.639  -16.178 -13.230 1.00 0.00 ? 1588 LEU A CG   2  
ATOM   3901  C CD1  . LEU A 1 108 ? -7.918  -15.112 -12.397 1.00 0.00 ? 1588 LEU A CD1  2  
ATOM   3902  C CD2  . LEU A 1 108 ? -7.615  -17.109 -13.899 1.00 0.00 ? 1588 LEU A CD2  2  
ATOM   3903  H H    . LEU A 1 108 ? -12.101 -16.184 -12.223 1.00 0.00 ? 1588 LEU A H    2  
ATOM   3904  H HA   . LEU A 1 108 ? -10.449 -17.846 -14.085 1.00 0.00 ? 1588 LEU A HA   2  
ATOM   3905  H HB2  . LEU A 1 108 ? -9.985  -16.280 -11.583 1.00 0.00 ? 1588 LEU A HB2  2  
ATOM   3906  H HB3  . LEU A 1 108 ? -9.009  -17.741 -11.786 1.00 0.00 ? 1588 LEU A HB3  2  
ATOM   3907  H HG   . LEU A 1 108 ? -9.224  -15.679 -14.004 1.00 0.00 ? 1588 LEU A HG   2  
ATOM   3908  H HD11 . LEU A 1 108 ? -7.080  -14.689 -12.957 1.00 0.00 ? 1588 LEU A HD11 2  
ATOM   3909  H HD12 . LEU A 1 108 ? -8.606  -14.298 -12.152 1.00 0.00 ? 1588 LEU A HD12 2  
ATOM   3910  H HD13 . LEU A 1 108 ? -7.545  -15.544 -11.467 1.00 0.00 ? 1588 LEU A HD13 2  
ATOM   3911  H HD21 . LEU A 1 108 ? -6.972  -17.574 -13.150 1.00 0.00 ? 1588 LEU A HD21 2  
ATOM   3912  H HD22 . LEU A 1 108 ? -8.114  -17.898 -14.466 1.00 0.00 ? 1588 LEU A HD22 2  
ATOM   3913  H HD23 . LEU A 1 108 ? -6.993  -16.540 -14.595 1.00 0.00 ? 1588 LEU A HD23 2  
ATOM   3914  N N    . SER A 1 109 ? -11.326 -19.953 -13.167 1.00 0.00 ? 1589 SER A N    2  
ATOM   3915  C CA   . SER A 1 109 ? -11.726 -21.267 -12.694 1.00 0.00 ? 1589 SER A CA   2  
ATOM   3916  C C    . SER A 1 109 ? -10.798 -21.636 -11.530 1.00 0.00 ? 1589 SER A C    2  
ATOM   3917  O O    . SER A 1 109 ? -9.616  -21.298 -11.566 1.00 0.00 ? 1589 SER A O    2  
ATOM   3918  C CB   . SER A 1 109 ? -11.732 -22.266 -13.872 1.00 0.00 ? 1589 SER A CB   2  
ATOM   3919  O OG   . SER A 1 109 ? -11.711 -21.589 -15.136 1.00 0.00 ? 1589 SER A OG   2  
ATOM   3920  H H    . SER A 1 109 ? -11.088 -19.906 -14.155 1.00 0.00 ? 1589 SER A H    2  
ATOM   3921  H HA   . SER A 1 109 ? -12.746 -21.164 -12.330 1.00 0.00 ? 1589 SER A HA   2  
ATOM   3922  H HB2  . SER A 1 109 ? -10.868 -22.925 -13.812 1.00 0.00 ? 1589 SER A HB2  2  
ATOM   3923  H HB3  . SER A 1 109 ? -12.628 -22.885 -13.816 1.00 0.00 ? 1589 SER A HB3  2  
ATOM   3924  H HG   . SER A 1 109 ? -11.652 -22.259 -15.852 1.00 0.00 ? 1589 SER A HG   2  
ATOM   3925  N N    . LEU A 1 110 ? -11.296 -22.312 -10.493 1.00 0.00 ? 1590 LEU A N    2  
ATOM   3926  C CA   . LEU A 1 110 ? -10.557 -22.491 -9.232  1.00 0.00 ? 1590 LEU A CA   2  
ATOM   3927  C C    . LEU A 1 110 ? -9.193  -23.158 -9.371  1.00 0.00 ? 1590 LEU A C    2  
ATOM   3928  O O    . LEU A 1 110 ? -8.280  -22.778 -8.649  1.00 0.00 ? 1590 LEU A O    2  
ATOM   3929  C CB   . LEU A 1 110 ? -11.435 -23.113 -8.123  1.00 0.00 ? 1590 LEU A CB   2  
ATOM   3930  C CG   . LEU A 1 110 ? -11.855 -24.574 -8.386  1.00 0.00 ? 1590 LEU A CG   2  
ATOM   3931  C CD1  . LEU A 1 110 ? -10.988 -25.575 -7.612  1.00 0.00 ? 1590 LEU A CD1  2  
ATOM   3932  C CD2  . LEU A 1 110 ? -13.333 -24.797 -8.034  1.00 0.00 ? 1590 LEU A CD2  2  
ATOM   3933  H H    . LEU A 1 110 ? -12.252 -22.641 -10.542 1.00 0.00 ? 1590 LEU A H    2  
ATOM   3934  H HA   . LEU A 1 110 ? -10.351 -21.485 -8.890  1.00 0.00 ? 1590 LEU A HA   2  
ATOM   3935  H HB2  . LEU A 1 110 ? -10.901 -23.054 -7.168  1.00 0.00 ? 1590 LEU A HB2  2  
ATOM   3936  H HB3  . LEU A 1 110 ? -12.323 -22.487 -8.015  1.00 0.00 ? 1590 LEU A HB3  2  
ATOM   3937  H HG   . LEU A 1 110 ? -11.721 -24.760 -9.447  1.00 0.00 ? 1590 LEU A HG   2  
ATOM   3938  H HD11 . LEU A 1 110 ? -11.103 -25.429 -6.536  1.00 0.00 ? 1590 LEU A HD11 2  
ATOM   3939  H HD12 . LEU A 1 110 ? -11.290 -26.596 -7.860  1.00 0.00 ? 1590 LEU A HD12 2  
ATOM   3940  H HD13 . LEU A 1 110 ? -9.939  -25.453 -7.874  1.00 0.00 ? 1590 LEU A HD13 2  
ATOM   3941  H HD21 . LEU A 1 110 ? -13.615 -25.826 -8.257  1.00 0.00 ? 1590 LEU A HD21 2  
ATOM   3942  H HD22 . LEU A 1 110 ? -13.513 -24.596 -6.977  1.00 0.00 ? 1590 LEU A HD22 2  
ATOM   3943  H HD23 . LEU A 1 110 ? -13.976 -24.141 -8.625  1.00 0.00 ? 1590 LEU A HD23 2  
ATOM   3944  N N    . GLU A 1 111 ? -8.998  -24.091 -10.301 1.00 0.00 ? 1591 GLU A N    2  
ATOM   3945  C CA   . GLU A 1 111 ? -7.683  -24.709 -10.499 1.00 0.00 ? 1591 GLU A CA   2  
ATOM   3946  C C    . GLU A 1 111 ? -6.711  -23.697 -11.121 1.00 0.00 ? 1591 GLU A C    2  
ATOM   3947  O O    . GLU A 1 111 ? -5.518  -23.704 -10.819 1.00 0.00 ? 1591 GLU A O    2  
ATOM   3948  C CB   . GLU A 1 111 ? -7.850  -25.940 -11.400 1.00 0.00 ? 1591 GLU A CB   2  
ATOM   3949  C CG   . GLU A 1 111 ? -6.611  -26.842 -11.479 1.00 0.00 ? 1591 GLU A CG   2  
ATOM   3950  C CD   . GLU A 1 111 ? -6.320  -27.561 -10.144 1.00 0.00 ? 1591 GLU A CD   2  
ATOM   3951  O OE1  . GLU A 1 111 ? -6.877  -28.663 -9.909  1.00 0.00 ? 1591 GLU A OE1  2  
ATOM   3952  O OE2  . GLU A 1 111 ? -5.537  -27.032 -9.319  1.00 0.00 ? 1591 GLU A OE2  2  
ATOM   3953  H H    . GLU A 1 111 ? -9.765  -24.395 -10.893 1.00 0.00 ? 1591 GLU A H    2  
ATOM   3954  H HA   . GLU A 1 111 ? -7.291  -25.026 -9.530  1.00 0.00 ? 1591 GLU A HA   2  
ATOM   3955  H HB2  . GLU A 1 111 ? -8.689  -26.533 -11.032 1.00 0.00 ? 1591 GLU A HB2  2  
ATOM   3956  H HB3  . GLU A 1 111 ? -8.096  -25.591 -12.401 1.00 0.00 ? 1591 GLU A HB3  2  
ATOM   3957  H HG2  . GLU A 1 111 ? -6.776  -27.593 -12.257 1.00 0.00 ? 1591 GLU A HG2  2  
ATOM   3958  H HG3  . GLU A 1 111 ? -5.747  -26.253 -11.787 1.00 0.00 ? 1591 GLU A HG3  2  
ATOM   3959  N N    . GLN A 1 112 ? -7.224  -22.787 -11.958 1.00 0.00 ? 1592 GLN A N    2  
ATOM   3960  C CA   . GLN A 1 112 ? -6.427  -21.742 -12.594 1.00 0.00 ? 1592 GLN A CA   2  
ATOM   3961  C C    . GLN A 1 112 ? -6.058  -20.716 -11.525 1.00 0.00 ? 1592 GLN A C    2  
ATOM   3962  O O    . GLN A 1 112 ? -4.882  -20.478 -11.275 1.00 0.00 ? 1592 GLN A O    2  
ATOM   3963  C CB   . GLN A 1 112 ? -7.179  -21.103 -13.795 1.00 0.00 ? 1592 GLN A CB   2  
ATOM   3964  C CG   . GLN A 1 112 ? -7.951  -22.115 -14.665 1.00 0.00 ? 1592 GLN A CG   2  
ATOM   3965  C CD   . GLN A 1 112 ? -7.106  -23.296 -15.157 1.00 0.00 ? 1592 GLN A CD   2  
ATOM   3966  O OE1  . GLN A 1 112 ? -5.920  -23.166 -15.450 1.00 0.00 ? 1592 GLN A OE1  2  
ATOM   3967  N NE2  . GLN A 1 112 ? -7.700  -24.481 -15.253 1.00 0.00 ? 1592 GLN A NE2  2  
ATOM   3968  H H    . GLN A 1 112 ? -8.226  -22.748 -12.084 1.00 0.00 ? 1592 GLN A H    2  
ATOM   3969  H HA   . GLN A 1 112 ? -5.512  -22.196 -12.974 1.00 0.00 ? 1592 GLN A HA   2  
ATOM   3970  H HB2  . GLN A 1 112 ? -7.894  -20.357 -13.438 1.00 0.00 ? 1592 GLN A HB2  2  
ATOM   3971  H HB3  . GLN A 1 112 ? -6.456  -20.583 -14.421 1.00 0.00 ? 1592 GLN A HB3  2  
ATOM   3972  H HG2  . GLN A 1 112 ? -8.786  -22.490 -14.080 1.00 0.00 ? 1592 GLN A HG2  2  
ATOM   3973  H HG3  . GLN A 1 112 ? -8.380  -21.604 -15.527 1.00 0.00 ? 1592 GLN A HG3  2  
ATOM   3974  H HE21 . GLN A 1 112 ? -8.694  -24.577 -15.086 1.00 0.00 ? 1592 GLN A HE21 2  
ATOM   3975  H HE22 . GLN A 1 112 ? -7.184  -25.287 -15.585 1.00 0.00 ? 1592 GLN A HE22 2  
ATOM   3976  N N    . GLY A 1 113 ? -7.054  -20.181 -10.807 1.00 0.00 ? 1593 GLY A N    2  
ATOM   3977  C CA   . GLY A 1 113 ? -6.857  -19.165 -9.769  1.00 0.00 ? 1593 GLY A CA   2  
ATOM   3978  C C    . GLY A 1 113 ? -6.003  -19.666 -8.608  1.00 0.00 ? 1593 GLY A C    2  
ATOM   3979  O O    . GLY A 1 113 ? -5.284  -18.880 -8.001  1.00 0.00 ? 1593 GLY A O    2  
ATOM   3980  H H    . GLY A 1 113 ? -8.006  -20.483 -11.006 1.00 0.00 ? 1593 GLY A H    2  
ATOM   3981  H HA2  . GLY A 1 113 ? -6.373  -18.291 -10.211 1.00 0.00 ? 1593 GLY A HA2  2  
ATOM   3982  H HA3  . GLY A 1 113 ? -7.828  -18.857 -9.384  1.00 0.00 ? 1593 GLY A HA3  2  
ATOM   3983  N N    . ASN A 1 114 ? -5.973  -20.978 -8.354  1.00 0.00 ? 1594 ASN A N    2  
ATOM   3984  C CA   . ASN A 1 114 ? -5.066  -21.573 -7.363  1.00 0.00 ? 1594 ASN A CA   2  
ATOM   3985  C C    . ASN A 1 114 ? -3.616  -21.226 -7.678  1.00 0.00 ? 1594 ASN A C    2  
ATOM   3986  O O    . ASN A 1 114 ? -2.899  -20.733 -6.810  1.00 0.00 ? 1594 ASN A O    2  
ATOM   3987  C CB   . ASN A 1 114 ? -5.215  -23.102 -7.303  1.00 0.00 ? 1594 ASN A CB   2  
ATOM   3988  C CG   . ASN A 1 114 ? -5.976  -23.535 -6.065  1.00 0.00 ? 1594 ASN A CG   2  
ATOM   3989  O OD1  . ASN A 1 114 ? -5.388  -23.699 -4.999  1.00 0.00 ? 1594 ASN A OD1  2  
ATOM   3990  N ND2  . ASN A 1 114 ? -7.279  -23.720 -6.177  1.00 0.00 ? 1594 ASN A ND2  2  
ATOM   3991  H H    . ASN A 1 114 ? -6.582  -21.587 -8.891  1.00 0.00 ? 1594 ASN A H    2  
ATOM   3992  H HA   . ASN A 1 114 ? -5.304  -21.153 -6.387  1.00 0.00 ? 1594 ASN A HA   2  
ATOM   3993  H HB2  . ASN A 1 114 ? -5.699  -23.480 -8.201  1.00 0.00 ? 1594 ASN A HB2  2  
ATOM   3994  H HB3  . ASN A 1 114 ? -4.224  -23.564 -7.255  1.00 0.00 ? 1594 ASN A HB3  2  
ATOM   3995  H HD21 . ASN A 1 114 ? -7.738  -23.533 -7.071  1.00 0.00 ? 1594 ASN A HD21 2  
ATOM   3996  H HD22 . ASN A 1 114 ? -7.818  -24.046 -5.386  1.00 0.00 ? 1594 ASN A HD22 2  
ATOM   3997  N N    . ARG A 1 115 ? -3.220  -21.401 -8.944  1.00 0.00 ? 1595 ARG A N    2  
ATOM   3998  C CA   . ARG A 1 115 ? -1.864  -21.099 -9.420  1.00 0.00 ? 1595 ARG A CA   2  
ATOM   3999  C C    . ARG A 1 115 ? -1.526  -19.622 -9.235  1.00 0.00 ? 1595 ARG A C    2  
ATOM   4000  O O    . ARG A 1 115 ? -0.351  -19.261 -9.236  1.00 0.00 ? 1595 ARG A O    2  
ATOM   4001  C CB   . ARG A 1 115 ? -1.719  -21.466 -10.900 1.00 0.00 ? 1595 ARG A CB   2  
ATOM   4002  C CG   . ARG A 1 115 ? -1.954  -22.963 -11.156 1.00 0.00 ? 1595 ARG A CG   2  
ATOM   4003  C CD   . ARG A 1 115 ? -2.539  -23.141 -12.550 1.00 0.00 ? 1595 ARG A CD   2  
ATOM   4004  N NE   . ARG A 1 115 ? -1.543  -22.907 -13.619 1.00 0.00 ? 1595 ARG A NE   2  
ATOM   4005  C CZ   . ARG A 1 115 ? -0.654  -23.793 -14.095 1.00 0.00 ? 1595 ARG A CZ   2  
ATOM   4006  N NH1  . ARG A 1 115 ? -0.597  -25.032 -13.611 1.00 0.00 ? 1595 ARG A NH1  2  
ATOM   4007  N NH2  . ARG A 1 115 ? 0.180   -23.434 -15.067 1.00 0.00 ? 1595 ARG A NH2  2  
ATOM   4008  H H    . ARG A 1 115 ? -3.900  -21.727 -9.623  1.00 0.00 ? 1595 ARG A H    2  
ATOM   4009  H HA   . ARG A 1 115 ? -1.157  -21.715 -8.869  1.00 0.00 ? 1595 ARG A HA   2  
ATOM   4010  H HB2  . ARG A 1 115 ? -2.423  -20.855 -11.466 1.00 0.00 ? 1595 ARG A HB2  2  
ATOM   4011  H HB3  . ARG A 1 115 ? -0.714  -21.211 -11.241 1.00 0.00 ? 1595 ARG A HB3  2  
ATOM   4012  H HG2  . ARG A 1 115 ? -1.020  -23.514 -11.053 1.00 0.00 ? 1595 ARG A HG2  2  
ATOM   4013  H HG3  . ARG A 1 115 ? -2.674  -23.373 -10.448 1.00 0.00 ? 1595 ARG A HG3  2  
ATOM   4014  H HD2  . ARG A 1 115 ? -2.977  -24.133 -12.630 1.00 0.00 ? 1595 ARG A HD2  2  
ATOM   4015  H HD3  . ARG A 1 115 ? -3.341  -22.409 -12.640 1.00 0.00 ? 1595 ARG A HD3  2  
ATOM   4016  H HE   . ARG A 1 115 ? -1.552  -21.973 -14.020 1.00 0.00 ? 1595 ARG A HE   2  
ATOM   4017  H HH11 . ARG A 1 115 ? -1.221  -25.332 -12.872 1.00 0.00 ? 1595 ARG A HH11 2  
ATOM   4018  H HH12 . ARG A 1 115 ? 0.066   -25.717 -13.956 1.00 0.00 ? 1595 ARG A HH12 2  
ATOM   4019  H HH21 . ARG A 1 115 ? 0.163   -22.495 -15.452 1.00 0.00 ? 1595 ARG A HH21 2  
ATOM   4020  H HH22 . ARG A 1 115 ? 0.866   -24.074 -15.457 1.00 0.00 ? 1595 ARG A HH22 2  
ATOM   4021  N N    . LEU A 1 116 ? -2.545  -18.761 -9.124  1.00 0.00 ? 1596 LEU A N    2  
ATOM   4022  C CA   . LEU A 1 116 ? -2.362  -17.338 -8.929  1.00 0.00 ? 1596 LEU A CA   2  
ATOM   4023  C C    . LEU A 1 116 ? -2.324  -17.018 -7.433  1.00 0.00 ? 1596 LEU A C    2  
ATOM   4024  O O    . LEU A 1 116 ? -1.647  -16.058 -7.076  1.00 0.00 ? 1596 LEU A O    2  
ATOM   4025  C CB   . LEU A 1 116 ? -3.463  -16.545 -9.656  1.00 0.00 ? 1596 LEU A CB   2  
ATOM   4026  C CG   . LEU A 1 116 ? -3.258  -16.369 -11.178 1.00 0.00 ? 1596 LEU A CG   2  
ATOM   4027  C CD1  . LEU A 1 116 ? -3.108  -17.677 -11.963 1.00 0.00 ? 1596 LEU A CD1  2  
ATOM   4028  C CD2  . LEU A 1 116 ? -4.473  -15.640 -11.752 1.00 0.00 ? 1596 LEU A CD2  2  
ATOM   4029  H H    . LEU A 1 116 ? -3.498  -19.101 -9.154  1.00 0.00 ? 1596 LEU A H    2  
ATOM   4030  H HA   . LEU A 1 116 ? -1.403  -17.052 -9.365  1.00 0.00 ? 1596 LEU A HA   2  
ATOM   4031  H HB2  . LEU A 1 116 ? -4.432  -16.998 -9.460  1.00 0.00 ? 1596 LEU A HB2  2  
ATOM   4032  H HB3  . LEU A 1 116 ? -3.487  -15.545 -9.216  1.00 0.00 ? 1596 LEU A HB3  2  
ATOM   4033  H HG   . LEU A 1 116 ? -2.368  -15.772 -11.351 1.00 0.00 ? 1596 LEU A HG   2  
ATOM   4034  H HD11 . LEU A 1 116 ? -2.184  -18.181 -11.685 1.00 0.00 ? 1596 LEU A HD11 2  
ATOM   4035  H HD12 . LEU A 1 116 ? -3.961  -18.322 -11.765 1.00 0.00 ? 1596 LEU A HD12 2  
ATOM   4036  H HD13 . LEU A 1 116 ? -3.056  -17.477 -13.034 1.00 0.00 ? 1596 LEU A HD13 2  
ATOM   4037  H HD21 . LEU A 1 116 ? -5.356  -16.274 -11.657 1.00 0.00 ? 1596 LEU A HD21 2  
ATOM   4038  H HD22 . LEU A 1 116 ? -4.649  -14.702 -11.222 1.00 0.00 ? 1596 LEU A HD22 2  
ATOM   4039  H HD23 . LEU A 1 116 ? -4.314  -15.415 -12.811 1.00 0.00 ? 1596 LEU A HD23 2  
ATOM   4040  N N    . ARG A 1 117 ? -2.970  -17.783 -6.532  1.00 0.00 ? 1597 ARG A N    2  
ATOM   4041  C CA   . ARG A 1 117 ? -2.914  -17.506 -5.083  1.00 0.00 ? 1597 ARG A CA   2  
ATOM   4042  C C    . ARG A 1 117 ? -1.473  -17.435 -4.586  1.00 0.00 ? 1597 ARG A C    2  
ATOM   4043  O O    . ARG A 1 117 ? -1.142  -16.550 -3.806  1.00 0.00 ? 1597 ARG A O    2  
ATOM   4044  C CB   . ARG A 1 117 ? -3.671  -18.553 -4.237  1.00 0.00 ? 1597 ARG A CB   2  
ATOM   4045  C CG   . ARG A 1 117 ? -5.204  -18.520 -4.369  1.00 0.00 ? 1597 ARG A CG   2  
ATOM   4046  C CD   . ARG A 1 117 ? -5.915  -19.273 -3.231  1.00 0.00 ? 1597 ARG A CD   2  
ATOM   4047  N NE   . ARG A 1 117 ? -5.623  -20.724 -3.203  1.00 0.00 ? 1597 ARG A NE   2  
ATOM   4048  C CZ   . ARG A 1 117 ? -6.094  -21.590 -2.290  1.00 0.00 ? 1597 ARG A CZ   2  
ATOM   4049  N NH1  . ARG A 1 117 ? -6.915  -21.194 -1.323  1.00 0.00 ? 1597 ARG A NH1  2  
ATOM   4050  N NH2  . ARG A 1 117 ? -5.740  -22.871 -2.344  1.00 0.00 ? 1597 ARG A NH2  2  
ATOM   4051  H H    . ARG A 1 117 ? -3.529  -18.572 -6.859  1.00 0.00 ? 1597 ARG A H    2  
ATOM   4052  H HA   . ARG A 1 117 ? -3.357  -16.524 -4.897  1.00 0.00 ? 1597 ARG A HA   2  
ATOM   4053  H HB2  . ARG A 1 117 ? -3.298  -19.553 -4.469  1.00 0.00 ? 1597 ARG A HB2  2  
ATOM   4054  H HB3  . ARG A 1 117 ? -3.431  -18.357 -3.191  1.00 0.00 ? 1597 ARG A HB3  2  
ATOM   4055  H HG2  . ARG A 1 117 ? -5.535  -17.481 -4.321  1.00 0.00 ? 1597 ARG A HG2  2  
ATOM   4056  H HG3  . ARG A 1 117 ? -5.508  -18.931 -5.331  1.00 0.00 ? 1597 ARG A HG3  2  
ATOM   4057  H HD2  . ARG A 1 117 ? -5.608  -18.838 -2.280  1.00 0.00 ? 1597 ARG A HD2  2  
ATOM   4058  H HD3  . ARG A 1 117 ? -6.988  -19.119 -3.342  1.00 0.00 ? 1597 ARG A HD3  2  
ATOM   4059  H HE   . ARG A 1 117 ? -5.016  -21.080 -3.931  1.00 0.00 ? 1597 ARG A HE   2  
ATOM   4060  H HH11 . ARG A 1 117 ? -7.354  -20.261 -1.338  1.00 0.00 ? 1597 ARG A HH11 2  
ATOM   4061  H HH12 . ARG A 1 117 ? -7.274  -21.829 -0.624  1.00 0.00 ? 1597 ARG A HH12 2  
ATOM   4062  H HH21 . ARG A 1 117 ? -5.259  -23.247 -3.165  1.00 0.00 ? 1597 ARG A HH21 2  
ATOM   4063  H HH22 . ARG A 1 117 ? -6.037  -23.546 -1.647  1.00 0.00 ? 1597 ARG A HH22 2  
ATOM   4064  N N    . GLU A 1 118 ? -0.612  -18.328 -5.065  1.00 0.00 ? 1598 GLU A N    2  
ATOM   4065  C CA   . GLU A 1 118 ? 0.774   -18.400 -4.609  1.00 0.00 ? 1598 GLU A CA   2  
ATOM   4066  C C    . GLU A 1 118 ? 1.606   -17.151 -4.971  1.00 0.00 ? 1598 GLU A C    2  
ATOM   4067  O O    . GLU A 1 118 ? 2.663   -16.953 -4.368  1.00 0.00 ? 1598 GLU A O    2  
ATOM   4068  C CB   . GLU A 1 118 ? 1.432   -19.699 -5.104  1.00 0.00 ? 1598 GLU A CB   2  
ATOM   4069  C CG   . GLU A 1 118 ? 1.337   -19.913 -6.620  1.00 0.00 ? 1598 GLU A CG   2  
ATOM   4070  C CD   . GLU A 1 118 ? 2.200   -21.107 -7.077  1.00 0.00 ? 1598 GLU A CD   2  
ATOM   4071  O OE1  . GLU A 1 118 ? 1.697   -22.259 -7.087  1.00 0.00 ? 1598 GLU A OE1  2  
ATOM   4072  O OE2  . GLU A 1 118 ? 3.389   -20.899 -7.428  1.00 0.00 ? 1598 GLU A OE2  2  
ATOM   4073  H H    . GLU A 1 118 ? -0.949  -19.042 -5.700  1.00 0.00 ? 1598 GLU A H    2  
ATOM   4074  H HA   . GLU A 1 118 ? 0.756   -18.452 -3.519  1.00 0.00 ? 1598 GLU A HA   2  
ATOM   4075  H HB2  . GLU A 1 118 ? 2.483   -19.692 -4.812  1.00 0.00 ? 1598 GLU A HB2  2  
ATOM   4076  H HB3  . GLU A 1 118 ? 0.954   -20.545 -4.605  1.00 0.00 ? 1598 GLU A HB3  2  
ATOM   4077  H HG2  . GLU A 1 118 ? 0.294   -20.108 -6.871  1.00 0.00 ? 1598 GLU A HG2  2  
ATOM   4078  H HG3  . GLU A 1 118 ? 1.654   -19.006 -7.136  1.00 0.00 ? 1598 GLU A HG3  2  
ATOM   4079  N N    . GLN A 1 119 ? 1.161   -16.302 -5.914  1.00 0.00 ? 1599 GLN A N    2  
ATOM   4080  C CA   . GLN A 1 119 ? 1.875   -15.083 -6.294  1.00 0.00 ? 1599 GLN A CA   2  
ATOM   4081  C C    . GLN A 1 119 ? 1.075   -13.831 -5.906  1.00 0.00 ? 1599 GLN A C    2  
ATOM   4082  O O    . GLN A 1 119 ? 1.635   -12.874 -5.371  1.00 0.00 ? 1599 GLN A O    2  
ATOM   4083  C CB   . GLN A 1 119 ? 2.196   -15.160 -7.801  1.00 0.00 ? 1599 GLN A CB   2  
ATOM   4084  C CG   . GLN A 1 119 ? 3.132   -14.034 -8.268  1.00 0.00 ? 1599 GLN A CG   2  
ATOM   4085  C CD   . GLN A 1 119 ? 3.819   -14.359 -9.600  1.00 0.00 ? 1599 GLN A CD   2  
ATOM   4086  O OE1  . GLN A 1 119 ? 5.041   -14.298 -9.712  1.00 0.00 ? 1599 GLN A OE1  2  
ATOM   4087  N NE2  . GLN A 1 119 ? 3.076   -14.712 -10.642 1.00 0.00 ? 1599 GLN A NE2  2  
ATOM   4088  H H    . GLN A 1 119 ? 0.268   -16.468 -6.361  1.00 0.00 ? 1599 GLN A H    2  
ATOM   4089  H HA   . GLN A 1 119 ? 2.824   -15.041 -5.758  1.00 0.00 ? 1599 GLN A HA   2  
ATOM   4090  H HB2  . GLN A 1 119 ? 2.702   -16.105 -7.996  1.00 0.00 ? 1599 GLN A HB2  2  
ATOM   4091  H HB3  . GLN A 1 119 ? 1.274   -15.146 -8.382  1.00 0.00 ? 1599 GLN A HB3  2  
ATOM   4092  H HG2  . GLN A 1 119 ? 2.576   -13.101 -8.367  1.00 0.00 ? 1599 GLN A HG2  2  
ATOM   4093  H HG3  . GLN A 1 119 ? 3.900   -13.885 -7.508  1.00 0.00 ? 1599 GLN A HG3  2  
ATOM   4094  H HE21 . GLN A 1 119 ? 2.071   -14.792 -10.557 1.00 0.00 ? 1599 GLN A HE21 2  
ATOM   4095  H HE22 . GLN A 1 119 ? 3.519   -14.936 -11.526 1.00 0.00 ? 1599 GLN A HE22 2  
ATOM   4096  N N    . TYR A 1 120 ? -0.231  -13.830 -6.181  1.00 0.00 ? 1600 TYR A N    2  
ATOM   4097  C CA   . TYR A 1 120 ? -1.105  -12.661 -6.081  1.00 0.00 ? 1600 TYR A CA   2  
ATOM   4098  C C    . TYR A 1 120 ? -1.922  -12.645 -4.788  1.00 0.00 ? 1600 TYR A C    2  
ATOM   4099  O O    . TYR A 1 120 ? -2.553  -11.625 -4.493  1.00 0.00 ? 1600 TYR A O    2  
ATOM   4100  C CB   . TYR A 1 120 ? -2.089  -12.698 -7.258  1.00 0.00 ? 1600 TYR A CB   2  
ATOM   4101  C CG   . TYR A 1 120 ? -1.538  -12.757 -8.667  1.00 0.00 ? 1600 TYR A CG   2  
ATOM   4102  C CD1  . TYR A 1 120 ? -0.176  -12.541 -8.947  1.00 0.00 ? 1600 TYR A CD1  2  
ATOM   4103  C CD2  . TYR A 1 120 ? -2.425  -13.034 -9.721  1.00 0.00 ? 1600 TYR A CD2  2  
ATOM   4104  C CE1  . TYR A 1 120 ? 0.308   -12.662 -10.257 1.00 0.00 ? 1600 TYR A CE1  2  
ATOM   4105  C CE2  . TYR A 1 120 ? -1.949  -13.146 -11.040 1.00 0.00 ? 1600 TYR A CE2  2  
ATOM   4106  C CZ   . TYR A 1 120 ? -0.577  -12.967 -11.316 1.00 0.00 ? 1600 TYR A CZ   2  
ATOM   4107  O OH   . TYR A 1 120 ? -0.122  -13.091 -12.594 1.00 0.00 ? 1600 TYR A OH   2  
ATOM   4108  H H    . TYR A 1 120 ? -0.623  -14.639 -6.656  1.00 0.00 ? 1600 TYR A H    2  
ATOM   4109  H HA   . TYR A 1 120 ? -0.513  -11.743 -6.122  1.00 0.00 ? 1600 TYR A HA   2  
ATOM   4110  H HB2  . TYR A 1 120 ? -2.722  -13.575 -7.126  1.00 0.00 ? 1600 TYR A HB2  2  
ATOM   4111  H HB3  . TYR A 1 120 ? -2.744  -11.838 -7.195  1.00 0.00 ? 1600 TYR A HB3  2  
ATOM   4112  H HD1  . TYR A 1 120 ? 0.510   -12.276 -8.155  1.00 0.00 ? 1600 TYR A HD1  2  
ATOM   4113  H HD2  . TYR A 1 120 ? -3.481  -13.161 -9.518  1.00 0.00 ? 1600 TYR A HD2  2  
ATOM   4114  H HE1  . TYR A 1 120 ? 1.359   -12.516 -10.441 1.00 0.00 ? 1600 TYR A HE1  2  
ATOM   4115  H HE2  . TYR A 1 120 ? -2.630  -13.369 -11.847 1.00 0.00 ? 1600 TYR A HE2  2  
ATOM   4116  H HH   . TYR A 1 120 ? 0.830   -12.914 -12.693 1.00 0.00 ? 1600 TYR A HH   2  
ATOM   4117  N N    . GLY A 1 121 ? -1.974  -13.775 -4.078  1.00 0.00 ? 1601 GLY A N    2  
ATOM   4118  C CA   . GLY A 1 121 ? -2.714  -13.929 -2.837  1.00 0.00 ? 1601 GLY A CA   2  
ATOM   4119  C C    . GLY A 1 121 ? -2.268  -12.885 -1.813  1.00 0.00 ? 1601 GLY A C    2  
ATOM   4120  O O    . GLY A 1 121 ? -1.062  -12.639 -1.684  1.00 0.00 ? 1601 GLY A O    2  
ATOM   4121  H H    . GLY A 1 121 ? -1.407  -14.560 -4.376  1.00 0.00 ? 1601 GLY A H    2  
ATOM   4122  H HA2  . GLY A 1 121 ? -3.775  -13.850 -3.037  1.00 0.00 ? 1601 GLY A HA2  2  
ATOM   4123  H HA3  . GLY A 1 121 ? -2.530  -14.919 -2.419  1.00 0.00 ? 1601 GLY A HA3  2  
ATOM   4124  N N    . LEU A 1 122 ? -3.211  -12.277 -1.080  1.00 0.00 ? 1602 LEU A N    2  
ATOM   4125  C CA   . LEU A 1 122 ? -2.846  -11.316 -0.046  1.00 0.00 ? 1602 LEU A CA   2  
ATOM   4126  C C    . LEU A 1 122 ? -2.134  -12.015 1.111   1.00 0.00 ? 1602 LEU A C    2  
ATOM   4127  O O    . LEU A 1 122 ? -1.233  -11.437 1.725   1.00 0.00 ? 1602 LEU A O    2  
ATOM   4128  C CB   . LEU A 1 122 ? -4.037  -10.565 0.565   1.00 0.00 ? 1602 LEU A CB   2  
ATOM   4129  C CG   . LEU A 1 122 ? -5.250  -10.250 -0.308  1.00 0.00 ? 1602 LEU A CG   2  
ATOM   4130  C CD1  . LEU A 1 122 ? -6.222  -9.399  0.514   1.00 0.00 ? 1602 LEU A CD1  2  
ATOM   4131  C CD2  . LEU A 1 122 ? -4.909  -9.533  -1.604  1.00 0.00 ? 1602 LEU A CD2  2  
ATOM   4132  H H    . LEU A 1 122 ? -4.192  -12.444 -1.261  1.00 0.00 ? 1602 LEU A H    2  
ATOM   4133  H HA   . LEU A 1 122 ? -2.190  -10.577 -0.497  1.00 0.00 ? 1602 LEU A HA   2  
ATOM   4134  H HB2  . LEU A 1 122 ? -4.405  -11.111 1.436   1.00 0.00 ? 1602 LEU A HB2  2  
ATOM   4135  H HB3  . LEU A 1 122 ? -3.627  -9.632  0.928   1.00 0.00 ? 1602 LEU A HB3  2  
ATOM   4136  H HG   . LEU A 1 122 ? -5.717  -11.192 -0.558  1.00 0.00 ? 1602 LEU A HG   2  
ATOM   4137  H HD11 . LEU A 1 122 ? -6.647  -10.016 1.304   1.00 0.00 ? 1602 LEU A HD11 2  
ATOM   4138  H HD12 . LEU A 1 122 ? -5.699  -8.571  0.989   1.00 0.00 ? 1602 LEU A HD12 2  
ATOM   4139  H HD13 . LEU A 1 122 ? -7.013  -8.993  -0.111  1.00 0.00 ? 1602 LEU A HD13 2  
ATOM   4140  H HD21 . LEU A 1 122 ? -4.336  -8.653  -1.357  1.00 0.00 ? 1602 LEU A HD21 2  
ATOM   4141  H HD22 . LEU A 1 122 ? -4.320  -10.193 -2.242  1.00 0.00 ? 1602 LEU A HD22 2  
ATOM   4142  H HD23 . LEU A 1 122 ? -5.810  -9.251  -2.150  1.00 0.00 ? 1602 LEU A HD23 2  
ATOM   4143  N N    . GLY A 1 123 ? -2.622  -13.215 1.449   1.00 0.00 ? 1603 GLY A N    2  
ATOM   4144  C CA   . GLY A 1 123 ? -2.202  -13.950 2.628   1.00 0.00 ? 1603 GLY A CA   2  
ATOM   4145  C C    . GLY A 1 123 ? -0.713  -14.297 2.534   1.00 0.00 ? 1603 GLY A C    2  
ATOM   4146  O O    . GLY A 1 123 ? 0.017   -14.061 3.522   1.00 0.00 ? 1603 GLY A O    2  
ATOM   4147  O OXT  . GLY A 1 123 ? -0.291  -14.824 1.480   1.00 0.00 ? 1603 GLY A OXT  2  
ATOM   4148  H H    . GLY A 1 123 ? -3.344  -13.617 0.868   1.00 0.00 ? 1603 GLY A H    2  
ATOM   4149  H HA2  . GLY A 1 123 ? -2.392  -13.318 3.496   1.00 0.00 ? 1603 GLY A HA2  2  
ATOM   4150  H HA3  . GLY A 1 123 ? -2.795  -14.858 2.725   1.00 0.00 ? 1603 GLY A HA3  2  
ATOM   4151  N N    . GLY B 2 1   ? -29.404 -24.142 -24.454 1.00 0.00 ? 14   GLY B N    2  
ATOM   4152  C CA   . GLY B 2 1   ? -27.922 -24.184 -24.396 1.00 0.00 ? 14   GLY B CA   2  
ATOM   4153  C C    . GLY B 2 1   ? -27.385 -24.317 -22.966 1.00 0.00 ? 14   GLY B C    2  
ATOM   4154  O O    . GLY B 2 1   ? -28.135 -24.611 -22.033 1.00 0.00 ? 14   GLY B O    2  
ATOM   4155  H H1   . GLY B 2 1   ? -29.713 -24.059 -25.408 1.00 0.00 ? 14   GLY B H1   2  
ATOM   4156  H H2   . GLY B 2 1   ? -29.751 -23.355 -23.926 1.00 0.00 ? 14   GLY B H2   2  
ATOM   4157  H H3   . GLY B 2 1   ? -29.788 -24.983 -24.057 1.00 0.00 ? 14   GLY B H3   2  
ATOM   4158  H HA2  . GLY B 2 1   ? -27.565 -25.037 -24.977 1.00 0.00 ? 14   GLY B HA2  2  
ATOM   4159  H HA3  . GLY B 2 1   ? -27.520 -23.274 -24.843 1.00 0.00 ? 14   GLY B HA3  2  
ATOM   4160  N N    . ALA B 2 2   ? -26.070 -24.123 -22.792 1.00 0.00 ? 15   ALA B N    2  
ATOM   4161  C CA   . ALA B 2 2   ? -25.370 -24.419 -21.541 1.00 0.00 ? 15   ALA B CA   2  
ATOM   4162  C C    . ALA B 2 2   ? -25.814 -23.505 -20.391 1.00 0.00 ? 15   ALA B C    2  
ATOM   4163  O O    . ALA B 2 2   ? -26.231 -24.001 -19.342 1.00 0.00 ? 15   ALA B O    2  
ATOM   4164  C CB   . ALA B 2 2   ? -23.857 -24.315 -21.773 1.00 0.00 ? 15   ALA B CB   2  
ATOM   4165  H H    . ALA B 2 2   ? -25.504 -23.882 -23.597 1.00 0.00 ? 15   ALA B H    2  
ATOM   4166  H HA   . ALA B 2 2   ? -25.598 -25.449 -21.263 1.00 0.00 ? 15   ALA B HA   2  
ATOM   4167  H HB1  . ALA B 2 2   ? -23.578 -23.303 -22.073 1.00 0.00 ? 15   ALA B HB1  2  
ATOM   4168  H HB2  . ALA B 2 2   ? -23.334 -24.567 -20.853 1.00 0.00 ? 15   ALA B HB2  2  
ATOM   4169  H HB3  . ALA B 2 2   ? -23.553 -25.019 -22.550 1.00 0.00 ? 15   ALA B HB3  2  
ATOM   4170  N N    . LYS B 2 3   ? -25.769 -22.180 -20.636 1.00 0.00 ? 16   LYS B N    2  
ATOM   4171  C CA   . LYS B 2 3   ? -26.107 -21.081 -19.710 1.00 0.00 ? 16   LYS B CA   2  
ATOM   4172  C C    . LYS B 2 3   ? -25.281 -21.047 -18.412 1.00 0.00 ? 16   LYS B C    2  
ATOM   4173  O O    . LYS B 2 3   ? -24.698 -22.047 -18.009 1.00 0.00 ? 16   LYS B O    2  
ATOM   4174  C CB   . LYS B 2 3   ? -27.613 -21.130 -19.377 1.00 0.00 ? 16   LYS B CB   2  
ATOM   4175  C CG   . LYS B 2 3   ? -28.475 -19.992 -19.945 1.00 0.00 ? 16   LYS B CG   2  
ATOM   4176  C CD   . LYS B 2 3   ? -28.045 -18.590 -19.481 1.00 0.00 ? 16   LYS B CD   2  
ATOM   4177  C CE   . LYS B 2 3   ? -29.061 -17.516 -19.910 1.00 0.00 ? 16   LYS B CE   2  
ATOM   4178  N NZ   . LYS B 2 3   ? -30.158 -17.298 -18.928 1.00 0.00 ? 16   LYS B NZ   2  
ATOM   4179  H H    . LYS B 2 3   ? -25.440 -21.913 -21.554 1.00 0.00 ? 16   LYS B H    2  
ATOM   4180  H HA   . LYS B 2 3   ? -25.900 -20.157 -20.246 1.00 0.00 ? 16   LYS B HA   2  
ATOM   4181  H HB2  . LYS B 2 3   ? -28.019 -22.076 -19.738 1.00 0.00 ? 16   LYS B HB2  2  
ATOM   4182  H HB3  . LYS B 2 3   ? -27.716 -21.146 -18.291 1.00 0.00 ? 16   LYS B HB3  2  
ATOM   4183  H HG2  . LYS B 2 3   ? -28.446 -20.034 -21.034 1.00 0.00 ? 16   LYS B HG2  2  
ATOM   4184  H HG3  . LYS B 2 3   ? -29.505 -20.171 -19.630 1.00 0.00 ? 16   LYS B HG3  2  
ATOM   4185  H HD2  . LYS B 2 3   ? -27.917 -18.575 -18.397 1.00 0.00 ? 16   LYS B HD2  2  
ATOM   4186  H HD3  . LYS B 2 3   ? -27.086 -18.346 -19.943 1.00 0.00 ? 16   LYS B HD3  2  
ATOM   4187  H HE2  . LYS B 2 3   ? -28.535 -16.571 -20.039 1.00 0.00 ? 16   LYS B HE2  2  
ATOM   4188  H HE3  . LYS B 2 3   ? -29.480 -17.797 -20.883 1.00 0.00 ? 16   LYS B HE3  2  
ATOM   4189  H HZ1  . LYS B 2 3   ? -29.836 -16.743 -18.129 1.00 0.00 ? 16   LYS B HZ1  2  
ATOM   4190  H HZ2  . LYS B 2 3   ? -30.898 -16.751 -19.352 1.00 0.00 ? 16   LYS B HZ2  2  
ATOM   4191  H HZ3  . LYS B 2 3   ? -30.566 -18.164 -18.600 1.00 0.00 ? 16   LYS B HZ3  2  
ATOM   4192  N N    . ARG B 2 4   ? -25.248 -19.875 -17.753 1.00 0.00 ? 17   ARG B N    2  
ATOM   4193  C CA   . ARG B 2 4   ? -24.584 -19.621 -16.469 1.00 0.00 ? 17   ARG B CA   2  
ATOM   4194  C C    . ARG B 2 4   ? -24.681 -20.846 -15.558 1.00 0.00 ? 17   ARG B C    2  
ATOM   4195  O O    . ARG B 2 4   ? -25.770 -21.358 -15.290 1.00 0.00 ? 17   ARG B O    2  
ATOM   4196  C CB   . ARG B 2 4   ? -25.115 -18.333 -15.862 1.00 0.00 ? 17   ARG B CB   2  
ATOM   4197  C CG   . ARG B 2 4   ? -24.380 -18.033 -14.562 1.00 0.00 ? 17   ARG B CG   2  
ATOM   4198  C CD   . ARG B 2 4   ? -24.725 -16.639 -14.085 1.00 0.00 ? 17   ARG B CD   2  
ATOM   4199  N NE   . ARG B 2 4   ? -26.166 -16.431 -13.873 1.00 0.00 ? 17   ARG B NE   2  
ATOM   4200  C CZ   . ARG B 2 4   ? -26.933 -16.941 -12.904 1.00 0.00 ? 17   ARG B CZ   2  
ATOM   4201  N NH1  . ARG B 2 4   ? -26.440 -17.758 -11.971 1.00 0.00 ? 17   ARG B NH1  2  
ATOM   4202  N NH2  . ARG B 2 4   ? -28.216 -16.606 -12.916 1.00 0.00 ? 17   ARG B NH2  2  
ATOM   4203  H H    . ARG B 2 4   ? -25.635 -19.060 -18.205 1.00 0.00 ? 17   ARG B H    2  
ATOM   4204  H HA   . ARG B 2 4   ? -23.539 -19.393 -16.664 1.00 0.00 ? 17   ARG B HA   2  
ATOM   4205  H HB2  . ARG B 2 4   ? -24.880 -17.521 -16.544 1.00 0.00 ? 17   ARG B HB2  2  
ATOM   4206  H HB3  . ARG B 2 4   ? -26.193 -18.400 -15.700 1.00 0.00 ? 17   ARG B HB3  2  
ATOM   4207  H HG2  . ARG B 2 4   ? -24.665 -18.778 -13.829 1.00 0.00 ? 17   ARG B HG2  2  
ATOM   4208  H HG3  . ARG B 2 4   ? -23.302 -18.045 -14.734 1.00 0.00 ? 17   ARG B HG3  2  
ATOM   4209  H HD2  . ARG B 2 4   ? -24.197 -16.423 -13.164 1.00 0.00 ? 17   ARG B HD2  2  
ATOM   4210  H HD3  . ARG B 2 4   ? -24.369 -15.980 -14.875 1.00 0.00 ? 17   ARG B HD3  2  
ATOM   4211  H HE   . ARG B 2 4   ? -26.645 -15.823 -14.543 1.00 0.00 ? 17   ARG B HE   2  
ATOM   4212  H HH11 . ARG B 2 4   ? -25.461 -18.056 -11.984 1.00 0.00 ? 17   ARG B HH11 2  
ATOM   4213  H HH12 . ARG B 2 4   ? -27.029 -18.160 -11.251 1.00 0.00 ? 17   ARG B HH12 2  
ATOM   4214  H HH21 . ARG B 2 4   ? -28.550 -16.010 -13.681 1.00 0.00 ? 17   ARG B HH21 2  
ATOM   4215  H HH22 . ARG B 2 4   ? -28.884 -16.930 -12.225 1.00 0.00 ? 17   ARG B HH22 2  
ATOM   4216  N N    . HIS B 2 5   ? -23.519 -21.252 -15.054 1.00 0.00 ? 18   HIS B N    2  
ATOM   4217  C CA   . HIS B 2 5   ? -23.292 -22.526 -14.387 1.00 0.00 ? 18   HIS B CA   2  
ATOM   4218  C C    . HIS B 2 5   ? -22.853 -22.440 -12.908 1.00 0.00 ? 18   HIS B C    2  
ATOM   4219  O O    . HIS B 2 5   ? -22.643 -23.463 -12.255 1.00 0.00 ? 18   HIS B O    2  
ATOM   4220  C CB   . HIS B 2 5   ? -22.241 -23.202 -15.253 1.00 0.00 ? 18   HIS B CB   2  
ATOM   4221  C CG   . HIS B 2 5   ? -20.901 -22.551 -15.168 1.00 0.00 ? 18   HIS B CG   2  
ATOM   4222  N ND1  . HIS B 2 5   ? -20.611 -21.201 -14.943 1.00 0.00 ? 18   HIS B ND1  2  
ATOM   4223  C CD2  . HIS B 2 5   ? -19.756 -23.242 -15.310 1.00 0.00 ? 18   HIS B CD2  2  
ATOM   4224  C CE1  . HIS B 2 5   ? -19.270 -21.134 -14.920 1.00 0.00 ? 18   HIS B CE1  2  
ATOM   4225  N NE2  . HIS B 2 5   ? -18.730 -22.341 -15.164 1.00 0.00 ? 18   HIS B NE2  2  
ATOM   4226  H H    . HIS B 2 5   ? -22.670 -20.763 -15.313 1.00 0.00 ? 18   HIS B H    2  
ATOM   4227  H HA   . HIS B 2 5   ? -24.161 -23.161 -14.497 1.00 0.00 ? 18   HIS B HA   2  
ATOM   4228  H HB2  . HIS B 2 5   ? -22.152 -24.248 -14.962 1.00 0.00 ? 18   HIS B HB2  2  
ATOM   4229  H HB3  . HIS B 2 5   ? -22.554 -23.168 -16.297 1.00 0.00 ? 18   HIS B HB3  2  
ATOM   4230  H HD2  . HIS B 2 5   ? -19.712 -24.303 -15.505 1.00 0.00 ? 18   HIS B HD2  2  
ATOM   4231  H HE1  . HIS B 2 5   ? -18.704 -20.251 -14.676 1.00 0.00 ? 18   HIS B HE1  2  
ATOM   4232  H HE2  . HIS B 2 5   ? -17.742 -22.564 -15.236 1.00 0.00 ? 18   HIS B HE2  2  
ATOM   4233  N N    . ARG B 2 6   ? -22.702 -21.227 -12.374 1.00 0.00 ? 19   ARG B N    2  
ATOM   4234  C CA   . ARG B 2 6   ? -22.349 -20.849 -10.996 1.00 0.00 ? 19   ARG B CA   2  
ATOM   4235  C C    . ARG B 2 6   ? -23.155 -19.577 -10.753 1.00 0.00 ? 19   ARG B C    2  
ATOM   4236  O O    . ARG B 2 6   ? -23.686 -18.993 -11.706 1.00 0.00 ? 19   ARG B O    2  
ATOM   4237  C CB   . ARG B 2 6   ? -20.841 -20.488 -10.896 1.00 0.00 ? 19   ARG B CB   2  
ATOM   4238  C CG   . ARG B 2 6   ? -19.820 -21.451 -11.512 1.00 0.00 ? 19   ARG B CG   2  
ATOM   4239  C CD   . ARG B 2 6   ? -19.570 -22.795 -10.824 1.00 0.00 ? 19   ARG B CD   2  
ATOM   4240  N NE   . ARG B 2 6   ? -18.646 -23.597 -11.666 1.00 0.00 ? 19   ARG B NE   2  
ATOM   4241  C CZ   . ARG B 2 6   ? -18.997 -24.509 -12.589 1.00 0.00 ? 19   ARG B CZ   2  
ATOM   4242  N NH1  . ARG B 2 6   ? -20.257 -24.895 -12.695 1.00 0.00 ? 19   ARG B NH1  2  
ATOM   4243  N NH2  . ARG B 2 6   ? -18.104 -25.039 -13.421 1.00 0.00 ? 19   ARG B NH2  2  
ATOM   4244  H H    . ARG B 2 6   ? -22.937 -20.438 -12.965 1.00 0.00 ? 19   ARG B H    2  
ATOM   4245  H HA   . ARG B 2 6   ? -22.608 -21.589 -10.226 1.00 0.00 ? 19   ARG B HA   2  
ATOM   4246  H HB2  . ARG B 2 6   ? -20.697 -19.536 -11.418 1.00 0.00 ? 19   ARG B HB2  2  
ATOM   4247  H HB3  . ARG B 2 6   ? -20.581 -20.325 -9.849  1.00 0.00 ? 19   ARG B HB3  2  
ATOM   4248  H HG2  . ARG B 2 6   ? -20.129 -21.663 -12.524 1.00 0.00 ? 19   ARG B HG2  2  
ATOM   4249  H HG3  . ARG B 2 6   ? -18.865 -20.930 -11.568 1.00 0.00 ? 19   ARG B HG3  2  
ATOM   4250  H HD2  . ARG B 2 6   ? -19.115 -22.622 -9.849  1.00 0.00 ? 19   ARG B HD2  2  
ATOM   4251  H HD3  . ARG B 2 6   ? -20.514 -23.314 -10.666 1.00 0.00 ? 19   ARG B HD3  2  
ATOM   4252  H HE   . ARG B 2 6   ? -17.659 -23.413 -11.508 1.00 0.00 ? 19   ARG B HE   2  
ATOM   4253  H HH11 . ARG B 2 6   ? -20.996 -24.420 -12.177 1.00 0.00 ? 19   ARG B HH11 2  
ATOM   4254  H HH12 . ARG B 2 6   ? -20.549 -25.641 -13.314 1.00 0.00 ? 19   ARG B HH12 2  
ATOM   4255  H HH21 . ARG B 2 6   ? -17.127 -24.757 -13.395 1.00 0.00 ? 19   ARG B HH21 2  
ATOM   4256  H HH22 . ARG B 2 6   ? -18.337 -25.773 -14.081 1.00 0.00 ? 19   ARG B HH22 2  
HETATM 4257  N N    . MLY B 2 7   ? -23.257 -19.096 -9.521  1.00 0.00 ? 20   MLY B N    2  
HETATM 4258  C CA   . MLY B 2 7   ? -23.791 -17.753 -9.348  1.00 0.00 ? 20   MLY B CA   2  
HETATM 4259  C CB   . MLY B 2 7   ? -24.221 -17.463 -7.897  1.00 0.00 ? 20   MLY B CB   2  
HETATM 4260  C CG   . MLY B 2 7   ? -23.124 -16.952 -6.944  1.00 0.00 ? 20   MLY B CG   2  
HETATM 4261  C CD   . MLY B 2 7   ? -22.844 -15.434 -7.072  1.00 0.00 ? 20   MLY B CD   2  
HETATM 4262  C CE   . MLY B 2 7   ? -21.680 -14.996 -6.182  1.00 0.00 ? 20   MLY B CE   2  
HETATM 4263  N NZ   . MLY B 2 7   ? -20.678 -14.098 -6.831  1.00 0.00 ? 20   MLY B NZ   2  
HETATM 4264  C CH1  . MLY B 2 7   ? -19.832 -13.370 -5.848  1.00 0.00 ? 20   MLY B CH1  2  
HETATM 4265  C CH2  . MLY B 2 7   ? -19.831 -14.707 -7.895  1.00 0.00 ? 20   MLY B CH2  2  
HETATM 4266  C C    . MLY B 2 7   ? -22.686 -16.844 -9.857  1.00 0.00 ? 20   MLY B C    2  
HETATM 4267  O O    . MLY B 2 7   ? -21.500 -17.056 -9.615  1.00 0.00 ? 20   MLY B O    2  
HETATM 4268  H H    . MLY B 2 7   ? -22.815 -19.570 -8.742  1.00 0.00 ? 20   MLY B H    2  
HETATM 4269  H HA   . MLY B 2 7   ? -24.663 -17.587 -9.997  1.00 0.00 ? 20   MLY B HA   2  
HETATM 4270  H HB2  . MLY B 2 7   ? -24.647 -18.379 -7.480  1.00 0.00 ? 20   MLY B HB2  2  
HETATM 4271  H HB3  . MLY B 2 7   ? -25.026 -16.722 -7.919  1.00 0.00 ? 20   MLY B HB3  2  
HETATM 4272  H HG2  . MLY B 2 7   ? -22.211 -17.526 -7.106  1.00 0.00 ? 20   MLY B HG2  2  
HETATM 4273  H HG3  . MLY B 2 7   ? -23.453 -17.142 -5.920  1.00 0.00 ? 20   MLY B HG3  2  
HETATM 4274  H HD2  . MLY B 2 7   ? -23.742 -14.901 -6.778  1.00 0.00 ? 20   MLY B HD2  2  
HETATM 4275  H HD3  . MLY B 2 7   ? -22.640 -15.134 -8.087  1.00 0.00 ? 20   MLY B HD3  2  
HETATM 4276  H HE2  . MLY B 2 7   ? -21.136 -15.881 -5.884  1.00 0.00 ? 20   MLY B HE2  2  
HETATM 4277  H HE3  . MLY B 2 7   ? -22.104 -14.542 -5.283  1.00 0.00 ? 20   MLY B HE3  2  
HETATM 4278  H HH11 . MLY B 2 7   ? -19.008 -13.995 -5.505  1.00 0.00 ? 20   MLY B HH11 2  
HETATM 4279  H HH12 . MLY B 2 7   ? -19.412 -12.481 -6.317  1.00 0.00 ? 20   MLY B HH12 2  
HETATM 4280  H HH13 . MLY B 2 7   ? -20.401 -13.062 -4.971  1.00 0.00 ? 20   MLY B HH13 2  
HETATM 4281  H HH21 . MLY B 2 7   ? -19.136 -13.967 -8.293  1.00 0.00 ? 20   MLY B HH21 2  
HETATM 4282  H HH22 . MLY B 2 7   ? -19.260 -15.552 -7.502  1.00 0.00 ? 20   MLY B HH22 2  
HETATM 4283  H HH23 . MLY B 2 7   ? -20.428 -15.054 -8.729  1.00 0.00 ? 20   MLY B HH23 2  
HETATM 4284  H HZ   . MLY B 2 7   ? -21.218 -13.354 -7.327  1.00 0.00 ? 20   MLY B HZ   2  
ATOM   4285  N N    . VAL B 2 8   ? -23.140 -15.835 -10.567 1.00 0.00 ? 21   VAL B N    2  
ATOM   4286  C CA   . VAL B 2 8   ? -22.431 -14.663 -11.024 1.00 0.00 ? 21   VAL B CA   2  
ATOM   4287  C C    . VAL B 2 8   ? -23.562 -13.633 -11.162 1.00 0.00 ? 21   VAL B C    2  
ATOM   4288  O O    . VAL B 2 8   ? -24.737 -14.020 -11.208 1.00 0.00 ? 21   VAL B O    2  
ATOM   4289  C CB   . VAL B 2 8   ? -21.678 -14.870 -12.366 1.00 0.00 ? 21   VAL B CB   2  
ATOM   4290  C CG1  . VAL B 2 8   ? -20.461 -13.945 -12.464 1.00 0.00 ? 21   VAL B CG1  2  
ATOM   4291  C CG2  . VAL B 2 8   ? -21.281 -16.305 -12.718 1.00 0.00 ? 21   VAL B CG2  2  
ATOM   4292  H H    . VAL B 2 8   ? -24.143 -15.745 -10.674 1.00 0.00 ? 21   VAL B H    2  
ATOM   4293  H HA   . VAL B 2 8   ? -21.734 -14.341 -10.252 1.00 0.00 ? 21   VAL B HA   2  
ATOM   4294  H HB   . VAL B 2 8   ? -22.335 -14.578 -13.163 1.00 0.00 ? 21   VAL B HB   2  
ATOM   4295  H HG11 . VAL B 2 8   ? -20.784 -12.913 -12.606 1.00 0.00 ? 21   VAL B HG11 2  
ATOM   4296  H HG12 . VAL B 2 8   ? -19.880 -14.009 -11.545 1.00 0.00 ? 21   VAL B HG12 2  
ATOM   4297  H HG13 . VAL B 2 8   ? -19.841 -14.212 -13.323 1.00 0.00 ? 21   VAL B HG13 2  
ATOM   4298  H HG21 . VAL B 2 8   ? -22.176 -16.913 -12.833 1.00 0.00 ? 21   VAL B HG21 2  
ATOM   4299  H HG22 . VAL B 2 8   ? -20.750 -16.319 -13.666 1.00 0.00 ? 21   VAL B HG22 2  
ATOM   4300  H HG23 . VAL B 2 8   ? -20.659 -16.733 -11.941 1.00 0.00 ? 21   VAL B HG23 2  
ATOM   4301  N N    . LEU B 2 9   ? -23.159 -12.372 -11.320 1.00 0.00 ? 22   LEU B N    2  
ATOM   4302  C CA   . LEU B 2 9   ? -23.902 -11.172 -11.673 1.00 0.00 ? 22   LEU B CA   2  
ATOM   4303  C C    . LEU B 2 9   ? -25.165 -10.864 -10.834 1.00 0.00 ? 22   LEU B C    2  
ATOM   4304  O O    . LEU B 2 9   ? -25.725 -11.720 -10.150 1.00 0.00 ? 22   LEU B O    2  
ATOM   4305  C CB   . LEU B 2 9   ? -24.078 -10.998 -13.198 1.00 0.00 ? 22   LEU B CB   2  
ATOM   4306  C CG   . LEU B 2 9   ? -24.917 -12.023 -13.992 1.00 0.00 ? 22   LEU B CG   2  
ATOM   4307  C CD1  . LEU B 2 9   ? -24.155 -13.297 -14.364 1.00 0.00 ? 22   LEU B CD1  2  
ATOM   4308  C CD2  . LEU B 2 9   ? -26.311 -12.246 -13.403 1.00 0.00 ? 22   LEU B CD2  2  
ATOM   4309  H H    . LEU B 2 9   ? -22.204 -12.203 -11.040 1.00 0.00 ? 22   LEU B H    2  
ATOM   4310  H HA   . LEU B 2 9   ? -23.182 -10.408 -11.416 1.00 0.00 ? 22   LEU B HA   2  
ATOM   4311  H HB2  . LEU B 2 9   ? -24.526 -10.019 -13.370 1.00 0.00 ? 22   LEU B HB2  2  
ATOM   4312  H HB3  . LEU B 2 9   ? -23.086 -10.938 -13.651 1.00 0.00 ? 22   LEU B HB3  2  
ATOM   4313  H HG   . LEU B 2 9   ? -25.081 -11.586 -14.955 1.00 0.00 ? 22   LEU B HG   2  
ATOM   4314  H HD11 . LEU B 2 9   ? -24.525 -13.688 -15.309 1.00 0.00 ? 22   LEU B HD11 2  
ATOM   4315  H HD12 . LEU B 2 9   ? -23.082 -13.089 -14.475 1.00 0.00 ? 22   LEU B HD12 2  
ATOM   4316  H HD13 . LEU B 2 9   ? -24.312 -14.057 -13.612 1.00 0.00 ? 22   LEU B HD13 2  
ATOM   4317  H HD21 . LEU B 2 9   ? -26.252 -12.710 -12.424 1.00 0.00 ? 22   LEU B HD21 2  
ATOM   4318  H HD22 . LEU B 2 9   ? -26.807 -11.286 -13.266 1.00 0.00 ? 22   LEU B HD22 2  
ATOM   4319  H HD23 . LEU B 2 9   ? -26.904 -12.874 -14.060 1.00 0.00 ? 22   LEU B HD23 2  
ATOM   4320  N N    . ARG B 2 10  ? -25.639 -9.612  -10.876 1.00 0.00 ? 23   ARG B N    2  
ATOM   4321  C CA   . ARG B 2 10  ? -26.812 -9.195  -10.109 1.00 0.00 ? 23   ARG B CA   2  
ATOM   4322  C C    . ARG B 2 10  ? -27.459 -7.976  -10.763 1.00 0.00 ? 23   ARG B C    2  
ATOM   4323  O O    . ARG B 2 10  ? -26.856 -7.337  -11.632 1.00 0.00 ? 23   ARG B O    2  
ATOM   4324  C CB   . ARG B 2 10  ? -26.404 -8.938  -8.638  1.00 0.00 ? 23   ARG B CB   2  
ATOM   4325  C CG   . ARG B 2 10  ? -27.549 -9.239  -7.662  1.00 0.00 ? 23   ARG B CG   2  
ATOM   4326  C CD   . ARG B 2 10  ? -27.083 -9.373  -6.204  1.00 0.00 ? 23   ARG B CD   2  
ATOM   4327  N NE   . ARG B 2 10  ? -26.435 -8.155  -5.689  1.00 0.00 ? 23   ARG B NE   2  
ATOM   4328  C CZ   . ARG B 2 10  ? -27.047 -7.049  -5.241  1.00 0.00 ? 23   ARG B CZ   2  
ATOM   4329  N NH1  . ARG B 2 10  ? -28.374 -6.952  -5.202  1.00 0.00 ? 23   ARG B NH1  2  
ATOM   4330  N NH2  . ARG B 2 10  ? -26.290 -6.034  -4.831  1.00 0.00 ? 23   ARG B NH2  2  
ATOM   4331  H H    . ARG B 2 10  ? -25.188 -8.908  -11.443 1.00 0.00 ? 23   ARG B H    2  
ATOM   4332  H HA   . ARG B 2 10  ? -27.524 -10.019 -10.147 1.00 0.00 ? 23   ARG B HA   2  
ATOM   4333  H HB2  . ARG B 2 10  ? -25.578 -9.600  -8.374  1.00 0.00 ? 23   ARG B HB2  2  
ATOM   4334  H HB3  . ARG B 2 10  ? -26.063 -7.908  -8.516  1.00 0.00 ? 23   ARG B HB3  2  
ATOM   4335  H HG2  . ARG B 2 10  ? -28.305 -8.458  -7.728  1.00 0.00 ? 23   ARG B HG2  2  
ATOM   4336  H HG3  . ARG B 2 10  ? -28.005 -10.190 -7.948  1.00 0.00 ? 23   ARG B HG3  2  
ATOM   4337  H HD2  . ARG B 2 10  ? -27.934 -9.627  -5.571  1.00 0.00 ? 23   ARG B HD2  2  
ATOM   4338  H HD3  . ARG B 2 10  ? -26.369 -10.195 -6.139  1.00 0.00 ? 23   ARG B HD3  2  
ATOM   4339  H HE   . ARG B 2 10  ? -25.421 -8.172  -5.675  1.00 0.00 ? 23   ARG B HE   2  
ATOM   4340  H HH11 . ARG B 2 10  ? -28.975 -7.748  -5.473  1.00 0.00 ? 23   ARG B HH11 2  
ATOM   4341  H HH12 . ARG B 2 10  ? -28.849 -6.128  -4.867  1.00 0.00 ? 23   ARG B HH12 2  
ATOM   4342  H HH21 . ARG B 2 10  ? -25.272 -6.122  -4.844  1.00 0.00 ? 23   ARG B HH21 2  
ATOM   4343  H HH22 . ARG B 2 10  ? -26.679 -5.162  -4.490  1.00 0.00 ? 23   ARG B HH22 2  
ATOM   4344  N N    . ASP B 2 11  ? -28.674 -7.646  -10.338 1.00 0.00 ? 24   ASP B N    2  
ATOM   4345  C CA   . ASP B 2 11  ? -29.468 -6.506  -10.791 1.00 0.00 ? 24   ASP B CA   2  
ATOM   4346  C C    . ASP B 2 11  ? -30.301 -6.036  -9.591  1.00 0.00 ? 24   ASP B C    2  
ATOM   4347  O O    . ASP B 2 11  ? -30.298 -6.690  -8.547  1.00 0.00 ? 24   ASP B O    2  
ATOM   4348  C CB   . ASP B 2 11  ? -30.348 -6.914  -11.991 1.00 0.00 ? 24   ASP B CB   2  
ATOM   4349  C CG   . ASP B 2 11  ? -30.909 -5.725  -12.798 1.00 0.00 ? 24   ASP B CG   2  
ATOM   4350  O OD1  . ASP B 2 11  ? -30.655 -4.545  -12.447 1.00 0.00 ? 24   ASP B OD1  2  
ATOM   4351  O OD2  . ASP B 2 11  ? -31.615 -5.971  -13.806 1.00 0.00 ? 24   ASP B OD2  2  
ATOM   4352  H H    . ASP B 2 11  ? -29.093 -8.178  -9.590  1.00 0.00 ? 24   ASP B H    2  
ATOM   4353  H HA   . ASP B 2 11  ? -28.795 -5.703  -11.100 1.00 0.00 ? 24   ASP B HA   2  
ATOM   4354  H HB2  . ASP B 2 11  ? -29.751 -7.523  -12.673 1.00 0.00 ? 24   ASP B HB2  2  
ATOM   4355  H HB3  . ASP B 2 11  ? -31.174 -7.535  -11.633 1.00 0.00 ? 24   ASP B HB3  2  
ATOM   4356  N N    . ASN B 2 12  ? -31.029 -4.923  -9.710  1.00 0.00 ? 25   ASN B N    2  
ATOM   4357  C CA   . ASN B 2 12  ? -31.687 -4.246  -8.588  1.00 0.00 ? 25   ASN B CA   2  
ATOM   4358  C C    . ASN B 2 12  ? -32.814 -5.013  -7.904  1.00 0.00 ? 25   ASN B C    2  
ATOM   4359  O O    . ASN B 2 12  ? -33.416 -4.506  -6.954  1.00 0.00 ? 25   ASN B O    2  
ATOM   4360  C CB   . ASN B 2 12  ? -32.221 -2.874  -9.030  1.00 0.00 ? 25   ASN B CB   2  
ATOM   4361  C CG   . ASN B 2 12  ? -31.936 -1.777  -8.006  1.00 0.00 ? 25   ASN B CG   2  
ATOM   4362  O OD1  . ASN B 2 12  ? -31.148 -0.867  -8.261  1.00 0.00 ? 25   ASN B OD1  2  
ATOM   4363  N ND2  . ASN B 2 12  ? -32.555 -1.825  -6.837  1.00 0.00 ? 25   ASN B ND2  2  
ATOM   4364  H H    . ASN B 2 12  ? -31.018 -4.456  -10.615 1.00 0.00 ? 25   ASN B H    2  
ATOM   4365  H HA   . ASN B 2 12  ? -30.923 -4.138  -7.832  1.00 0.00 ? 25   ASN B HA   2  
ATOM   4366  H HB2  . ASN B 2 12  ? -31.778 -2.609  -9.979  1.00 0.00 ? 25   ASN B HB2  2  
ATOM   4367  H HB3  . ASN B 2 12  ? -33.296 -2.930  -9.208  1.00 0.00 ? 25   ASN B HB3  2  
ATOM   4368  H HD21 . ASN B 2 12  ? -33.163 -2.616  -6.626  1.00 0.00 ? 25   ASN B HD21 2  
ATOM   4369  H HD22 . ASN B 2 12  ? -32.403 -1.107  -6.139  1.00 0.00 ? 25   ASN B HD22 2  
ATOM   4370  N N    . ILE B 2 13  ? -33.135 -6.200  -8.401  1.00 0.00 ? 26   ILE B N    2  
ATOM   4371  C CA   . ILE B 2 13  ? -34.305 -6.964  -8.008  1.00 0.00 ? 26   ILE B CA   2  
ATOM   4372  C C    . ILE B 2 13  ? -33.900 -8.369  -7.542  1.00 0.00 ? 26   ILE B C    2  
ATOM   4373  O O    . ILE B 2 13  ? -34.746 -9.261  -7.432  1.00 0.00 ? 26   ILE B O    2  
ATOM   4374  C CB   . ILE B 2 13  ? -35.314 -6.984  -9.175  1.00 0.00 ? 26   ILE B CB   2  
ATOM   4375  C CG1  . ILE B 2 13  ? -34.777 -7.720  -10.420 1.00 0.00 ? 26   ILE B CG1  2  
ATOM   4376  C CG2  . ILE B 2 13  ? -35.738 -5.551  -9.483  1.00 0.00 ? 26   ILE B CG2  2  
ATOM   4377  C CD1  . ILE B 2 13  ? -34.165 -6.898  -11.558 1.00 0.00 ? 26   ILE B CD1  2  
ATOM   4378  H H    . ILE B 2 13  ? -32.562 -6.577  -9.139  1.00 0.00 ? 26   ILE B H    2  
ATOM   4379  H HA   . ILE B 2 13  ? -34.753 -6.441  -7.178  1.00 0.00 ? 26   ILE B HA   2  
ATOM   4380  H HB   . ILE B 2 13  ? -36.200 -7.519  -8.830  1.00 0.00 ? 26   ILE B HB   2  
ATOM   4381  H HG12 . ILE B 2 13  ? -33.994 -8.371  -10.066 1.00 0.00 ? 26   ILE B HG12 2  
ATOM   4382  H HG13 . ILE B 2 13  ? -35.577 -8.336  -10.835 1.00 0.00 ? 26   ILE B HG13 2  
ATOM   4383  H HG21 . ILE B 2 13  ? -34.874 -4.999  -9.855  1.00 0.00 ? 26   ILE B HG21 2  
ATOM   4384  H HG22 . ILE B 2 13  ? -36.522 -5.563  -10.235 1.00 0.00 ? 26   ILE B HG22 2  
ATOM   4385  H HG23 . ILE B 2 13  ? -36.099 -5.089  -8.569  1.00 0.00 ? 26   ILE B HG23 2  
ATOM   4386  H HD11 . ILE B 2 13  ? -33.766 -7.574  -12.313 1.00 0.00 ? 26   ILE B HD11 2  
ATOM   4387  H HD12 . ILE B 2 13  ? -34.923 -6.263  -12.022 1.00 0.00 ? 26   ILE B HD12 2  
ATOM   4388  H HD13 . ILE B 2 13  ? -33.351 -6.280  -11.185 1.00 0.00 ? 26   ILE B HD13 2  
ATOM   4389  N N    . GLN B 2 14  ? -32.601 -8.562  -7.316  1.00 0.00 ? 27   GLN B N    2  
ATOM   4390  C CA   . GLN B 2 14  ? -31.973 -9.841  -7.102  1.00 0.00 ? 27   GLN B CA   2  
ATOM   4391  C C    . GLN B 2 14  ? -31.153 -9.779  -5.818  1.00 0.00 ? 27   GLN B C    2  
ATOM   4392  O O    . GLN B 2 14  ? -30.388 -8.803  -5.635  1.00 0.00 ? 27   GLN B O    2  
ATOM   4393  C CB   . GLN B 2 14  ? -31.083 -10.137 -8.319  1.00 0.00 ? 27   GLN B CB   2  
ATOM   4394  C CG   . GLN B 2 14  ? -31.846 -10.307 -9.638  1.00 0.00 ? 27   GLN B CG   2  
ATOM   4395  C CD   . GLN B 2 14  ? -30.976 -10.924 -10.743 1.00 0.00 ? 27   GLN B CD   2  
ATOM   4396  O OE1  . GLN B 2 14  ? -29.828 -10.536 -10.946 1.00 0.00 ? 27   GLN B OE1  2  
ATOM   4397  N NE2  . GLN B 2 14  ? -31.494 -11.895 -11.481 1.00 0.00 ? 27   GLN B NE2  2  
ATOM   4398  O OXT  . GLN B 2 14  ? -31.292 -10.704 -4.986  1.00 0.00 ? 27   GLN B OXT  2  
ATOM   4399  H H    . GLN B 2 14  ? -31.969 -7.772  -7.339  1.00 0.00 ? 27   GLN B H    2  
ATOM   4400  H HA   . GLN B 2 14  ? -32.748 -10.599 -7.020  1.00 0.00 ? 27   GLN B HA   2  
ATOM   4401  H HB2  . GLN B 2 14  ? -30.425 -9.282  -8.458  1.00 0.00 ? 27   GLN B HB2  2  
ATOM   4402  H HB3  . GLN B 2 14  ? -30.497 -11.035 -8.120  1.00 0.00 ? 27   GLN B HB3  2  
ATOM   4403  H HG2  . GLN B 2 14  ? -32.726 -10.932 -9.470  1.00 0.00 ? 27   GLN B HG2  2  
ATOM   4404  H HG3  . GLN B 2 14  ? -32.161 -9.315  -9.969  1.00 0.00 ? 27   GLN B HG3  2  
ATOM   4405  H HE21 . GLN B 2 14  ? -32.438 -12.218 -11.314 1.00 0.00 ? 27   GLN B HE21 2  
ATOM   4406  H HE22 . GLN B 2 14  ? -30.949 -12.316 -12.223 1.00 0.00 ? 27   GLN B HE22 2  
ATOM   4407  N N    . GLY A 1 1   ? 4.871   8.037   -1.520  1.00 0.00 ? -3   GLY A N    3  
ATOM   4408  C CA   . GLY A 1 1   ? 3.503   7.868   -2.057  1.00 0.00 ? -3   GLY A CA   3  
ATOM   4409  C C    . GLY A 1 1   ? 3.018   6.423   -1.945  1.00 0.00 ? -3   GLY A C    3  
ATOM   4410  O O    . GLY A 1 1   ? 3.807   5.479   -2.060  1.00 0.00 ? -3   GLY A O    3  
ATOM   4411  H H1   . GLY A 1 1   ? 4.891   7.786   -0.543  1.00 0.00 ? -3   GLY A H1   3  
ATOM   4412  H H2   . GLY A 1 1   ? 5.513   7.439   -2.019  1.00 0.00 ? -3   GLY A H2   3  
ATOM   4413  H H3   . GLY A 1 1   ? 5.161   8.997   -1.615  1.00 0.00 ? -3   GLY A H3   3  
ATOM   4414  H HA2  . GLY A 1 1   ? 2.820   8.519   -1.509  1.00 0.00 ? -3   GLY A HA2  3  
ATOM   4415  H HA3  . GLY A 1 1   ? 3.483   8.163   -3.107  1.00 0.00 ? -3   GLY A HA3  3  
ATOM   4416  N N    . HIS A 1 2   ? 1.712   6.233   -1.733  1.00 0.00 ? -2   HIS A N    3  
ATOM   4417  C CA   . HIS A 1 2   ? 1.049   4.925   -1.648  1.00 0.00 ? -2   HIS A CA   3  
ATOM   4418  C C    . HIS A 1 2   ? -0.375  5.086   -2.181  1.00 0.00 ? -2   HIS A C    3  
ATOM   4419  O O    . HIS A 1 2   ? -0.989  6.140   -1.975  1.00 0.00 ? -2   HIS A O    3  
ATOM   4420  C CB   . HIS A 1 2   ? 1.033   4.452   -0.183  1.00 0.00 ? -2   HIS A CB   3  
ATOM   4421  C CG   . HIS A 1 2   ? 0.563   3.030   0.029   1.00 0.00 ? -2   HIS A CG   3  
ATOM   4422  N ND1  . HIS A 1 2   ? 0.575   2.001   -0.920  1.00 0.00 ? -2   HIS A ND1  3  
ATOM   4423  C CD2  . HIS A 1 2   ? 0.154   2.518   1.229   1.00 0.00 ? -2   HIS A CD2  3  
ATOM   4424  C CE1  . HIS A 1 2   ? 0.181   0.896   -0.263  1.00 0.00 ? -2   HIS A CE1  3  
ATOM   4425  N NE2  . HIS A 1 2   ? -0.088  1.178   1.025   1.00 0.00 ? -2   HIS A NE2  3  
ATOM   4426  H H    . HIS A 1 2   ? 1.092   7.035   -1.676  1.00 0.00 ? -2   HIS A H    3  
ATOM   4427  H HA   . HIS A 1 2   ? 1.594   4.202   -2.256  1.00 0.00 ? -2   HIS A HA   3  
ATOM   4428  H HB2  . HIS A 1 2   ? 2.044   4.521   0.217   1.00 0.00 ? -2   HIS A HB2  3  
ATOM   4429  H HB3  . HIS A 1 2   ? 0.401   5.123   0.402   1.00 0.00 ? -2   HIS A HB3  3  
ATOM   4430  H HD2  . HIS A 1 2   ? 0.047   3.061   2.162   1.00 0.00 ? -2   HIS A HD2  3  
ATOM   4431  H HE1  . HIS A 1 2   ? 0.076   -0.085  -0.710  1.00 0.00 ? -2   HIS A HE1  3  
ATOM   4432  H HE2  . HIS A 1 2   ? -0.413  0.511   1.727   1.00 0.00 ? -2   HIS A HE2  3  
ATOM   4433  N N    . MET A 1 3   ? -0.900  4.067   -2.865  1.00 0.00 ? -1   MET A N    3  
ATOM   4434  C CA   . MET A 1 3   ? -2.297  4.037   -3.302  1.00 0.00 ? -1   MET A CA   3  
ATOM   4435  C C    . MET A 1 3   ? -3.141  3.717   -2.063  1.00 0.00 ? -1   MET A C    3  
ATOM   4436  O O    . MET A 1 3   ? -3.772  4.599   -1.478  1.00 0.00 ? -1   MET A O    3  
ATOM   4437  C CB   . MET A 1 3   ? -2.449  3.007   -4.434  1.00 0.00 ? -1   MET A CB   3  
ATOM   4438  C CG   . MET A 1 3   ? -3.904  2.844   -4.901  1.00 0.00 ? -1   MET A CG   3  
ATOM   4439  S SD   . MET A 1 3   ? -4.140  1.834   -6.396  1.00 0.00 ? -1   MET A SD   3  
ATOM   4440  C CE   . MET A 1 3   ? -3.216  0.326   -5.982  1.00 0.00 ? -1   MET A CE   3  
ATOM   4441  H H    . MET A 1 3   ? -0.351  3.221   -2.967  1.00 0.00 ? -1   MET A H    3  
ATOM   4442  H HA   . MET A 1 3   ? -2.584  5.018   -3.682  1.00 0.00 ? -1   MET A HA   3  
ATOM   4443  H HB2  . MET A 1 3   ? -1.848  3.329   -5.283  1.00 0.00 ? -1   MET A HB2  3  
ATOM   4444  H HB3  . MET A 1 3   ? -2.073  2.040   -4.087  1.00 0.00 ? -1   MET A HB3  3  
ATOM   4445  H HG2  . MET A 1 3   ? -4.487  2.395   -4.097  1.00 0.00 ? -1   MET A HG2  3  
ATOM   4446  H HG3  . MET A 1 3   ? -4.315  3.833   -5.099  1.00 0.00 ? -1   MET A HG3  3  
ATOM   4447  H HE1  . MET A 1 3   ? -3.470  -0.463  -6.693  1.00 0.00 ? -1   MET A HE1  3  
ATOM   4448  H HE2  . MET A 1 3   ? -2.142  0.519   -6.039  1.00 0.00 ? -1   MET A HE2  3  
ATOM   4449  H HE3  . MET A 1 3   ? -3.471  -0.002  -4.977  1.00 0.00 ? -1   MET A HE3  3  
ATOM   4450  N N    . ASN A 1 4   ? -3.107  2.449   -1.647  1.00 0.00 ? 1484 ASN A N    3  
ATOM   4451  C CA   . ASN A 1 4   ? -3.626  1.894   -0.402  1.00 0.00 ? 1484 ASN A CA   3  
ATOM   4452  C C    . ASN A 1 4   ? -3.074  0.470   -0.339  1.00 0.00 ? 1484 ASN A C    3  
ATOM   4453  O O    . ASN A 1 4   ? -2.711  -0.107  -1.369  1.00 0.00 ? 1484 ASN A O    3  
ATOM   4454  C CB   . ASN A 1 4   ? -5.167  1.863   -0.356  1.00 0.00 ? 1484 ASN A CB   3  
ATOM   4455  C CG   . ASN A 1 4   ? -5.672  1.515   1.044   1.00 0.00 ? 1484 ASN A CG   3  
ATOM   4456  O OD1  . ASN A 1 4   ? -5.716  0.351   1.433   1.00 0.00 ? 1484 ASN A OD1  3  
ATOM   4457  N ND2  . ASN A 1 4   ? -6.056  2.501   1.836   1.00 0.00 ? 1484 ASN A ND2  3  
ATOM   4458  H H    . ASN A 1 4   ? -2.555  1.785   -2.180  1.00 0.00 ? 1484 ASN A H    3  
ATOM   4459  H HA   . ASN A 1 4   ? -3.240  2.485   0.434   1.00 0.00 ? 1484 ASN A HA   3  
ATOM   4460  H HB2  . ASN A 1 4   ? -5.565  2.834   -0.651  1.00 0.00 ? 1484 ASN A HB2  3  
ATOM   4461  H HB3  . ASN A 1 4   ? -5.546  1.126   -1.063  1.00 0.00 ? 1484 ASN A HB3  3  
ATOM   4462  H HD21 . ASN A 1 4   ? -6.027  3.466   1.521   1.00 0.00 ? 1484 ASN A HD21 3  
ATOM   4463  H HD22 . ASN A 1 4   ? -6.391  2.300   2.767   1.00 0.00 ? 1484 ASN A HD22 3  
ATOM   4464  N N    . SER A 1 5   ? -2.999  -0.107  0.851   1.00 0.00 ? 1485 SER A N    3  
ATOM   4465  C CA   . SER A 1 5   ? -2.538  -1.472  1.037   1.00 0.00 ? 1485 SER A CA   3  
ATOM   4466  C C    . SER A 1 5   ? -3.468  -2.500  0.412   1.00 0.00 ? 1485 SER A C    3  
ATOM   4467  O O    . SER A 1 5   ? -3.001  -3.439  -0.237  1.00 0.00 ? 1485 SER A O    3  
ATOM   4468  C CB   . SER A 1 5   ? -2.390  -1.686  2.546   1.00 0.00 ? 1485 SER A CB   3  
ATOM   4469  O OG   . SER A 1 5   ? -1.404  -0.782  3.037   1.00 0.00 ? 1485 SER A OG   3  
ATOM   4470  H H    . SER A 1 5   ? -3.280  0.403   1.680   1.00 0.00 ? 1485 SER A H    3  
ATOM   4471  H HA   . SER A 1 5   ? -1.593  -1.611  0.521   1.00 0.00 ? 1485 SER A HA   3  
ATOM   4472  H HB2  . SER A 1 5   ? -3.352  -1.479  3.029   1.00 0.00 ? 1485 SER A HB2  3  
ATOM   4473  H HB3  . SER A 1 5   ? -2.120  -2.719  2.760   1.00 0.00 ? 1485 SER A HB3  3  
ATOM   4474  H HG   . SER A 1 5   ? -1.302  -0.916  4.000   1.00 0.00 ? 1485 SER A HG   3  
ATOM   4475  N N    . PHE A 1 6   ? -4.774  -2.315  0.595   1.00 0.00 ? 1486 PHE A N    3  
ATOM   4476  C CA   . PHE A 1 6   ? -5.776  -3.305  0.228   1.00 0.00 ? 1486 PHE A CA   3  
ATOM   4477  C C    . PHE A 1 6   ? -7.077  -2.603  -0.093  1.00 0.00 ? 1486 PHE A C    3  
ATOM   4478  O O    . PHE A 1 6   ? -7.657  -2.799  -1.153  1.00 0.00 ? 1486 PHE A O    3  
ATOM   4479  C CB   . PHE A 1 6   ? -5.973  -4.310  1.383   1.00 0.00 ? 1486 PHE A CB   3  
ATOM   4480  C CG   . PHE A 1 6   ? -4.759  -5.171  1.649   1.00 0.00 ? 1486 PHE A CG   3  
ATOM   4481  C CD1  . PHE A 1 6   ? -4.476  -6.237  0.780   1.00 0.00 ? 1486 PHE A CD1  3  
ATOM   4482  C CD2  . PHE A 1 6   ? -3.914  -4.917  2.746   1.00 0.00 ? 1486 PHE A CD2  3  
ATOM   4483  C CE1  . PHE A 1 6   ? -3.360  -7.050  1.009   1.00 0.00 ? 1486 PHE A CE1  3  
ATOM   4484  C CE2  . PHE A 1 6   ? -2.797  -5.743  2.980   1.00 0.00 ? 1486 PHE A CE2  3  
ATOM   4485  C CZ   . PHE A 1 6   ? -2.517  -6.812  2.109   1.00 0.00 ? 1486 PHE A CZ   3  
ATOM   4486  H H    . PHE A 1 6   ? -5.081  -1.442  1.017   1.00 0.00 ? 1486 PHE A H    3  
ATOM   4487  H HA   . PHE A 1 6   ? -5.451  -3.853  -0.649  1.00 0.00 ? 1486 PHE A HA   3  
ATOM   4488  H HB2  . PHE A 1 6   ? -6.245  -3.793  2.302   1.00 0.00 ? 1486 PHE A HB2  3  
ATOM   4489  H HB3  . PHE A 1 6   ? -6.797  -4.976  1.145   1.00 0.00 ? 1486 PHE A HB3  3  
ATOM   4490  H HD1  . PHE A 1 6   ? -5.119  -6.430  -0.068  1.00 0.00 ? 1486 PHE A HD1  3  
ATOM   4491  H HD2  . PHE A 1 6   ? -4.119  -4.089  3.410   1.00 0.00 ? 1486 PHE A HD2  3  
ATOM   4492  H HE1  . PHE A 1 6   ? -3.158  -7.861  0.333   1.00 0.00 ? 1486 PHE A HE1  3  
ATOM   4493  H HE2  . PHE A 1 6   ? -2.150  -5.556  3.829   1.00 0.00 ? 1486 PHE A HE2  3  
ATOM   4494  H HZ   . PHE A 1 6   ? -1.656  -7.445  2.289   1.00 0.00 ? 1486 PHE A HZ   3  
ATOM   4495  N N    . VAL A 1 7   ? -7.529  -1.759  0.824   1.00 0.00 ? 1487 VAL A N    3  
ATOM   4496  C CA   . VAL A 1 7   ? -8.846  -1.159  0.799   1.00 0.00 ? 1487 VAL A CA   3  
ATOM   4497  C C    . VAL A 1 7   ? -8.948  -0.221  -0.409  1.00 0.00 ? 1487 VAL A C    3  
ATOM   4498  O O    . VAL A 1 7   ? -8.261  0.798   -0.478  1.00 0.00 ? 1487 VAL A O    3  
ATOM   4499  C CB   . VAL A 1 7   ? -9.118  -0.494  2.166   1.00 0.00 ? 1487 VAL A CB   3  
ATOM   4500  C CG1  . VAL A 1 7   ? -10.608 -0.175  2.259   1.00 0.00 ? 1487 VAL A CG1  3  
ATOM   4501  C CG2  . VAL A 1 7   ? -8.786  -1.437  3.344   1.00 0.00 ? 1487 VAL A CG2  3  
ATOM   4502  H H    . VAL A 1 7   ? -6.920  -1.505  1.586   1.00 0.00 ? 1487 VAL A H    3  
ATOM   4503  H HA   . VAL A 1 7   ? -9.565  -1.963  0.662   1.00 0.00 ? 1487 VAL A HA   3  
ATOM   4504  H HB   . VAL A 1 7   ? -8.520  0.413   2.270   1.00 0.00 ? 1487 VAL A HB   3  
ATOM   4505  H HG11 . VAL A 1 7   ? -11.163 -1.097  2.080   1.00 0.00 ? 1487 VAL A HG11 3  
ATOM   4506  H HG12 . VAL A 1 7   ? -10.863 0.217   3.246   1.00 0.00 ? 1487 VAL A HG12 3  
ATOM   4507  H HG13 . VAL A 1 7   ? -10.894 0.563   1.505   1.00 0.00 ? 1487 VAL A HG13 3  
ATOM   4508  H HG21 . VAL A 1 7   ? -9.253  -2.413  3.201   1.00 0.00 ? 1487 VAL A HG21 3  
ATOM   4509  H HG22 . VAL A 1 7   ? -7.705  -1.563  3.438   1.00 0.00 ? 1487 VAL A HG22 3  
ATOM   4510  H HG23 . VAL A 1 7   ? -9.139  -1.002  4.280   1.00 0.00 ? 1487 VAL A HG23 3  
ATOM   4511  N N    . GLY A 1 8   ? -9.783  -0.600  -1.381  1.00 0.00 ? 1488 GLY A N    3  
ATOM   4512  C CA   . GLY A 1 8   ? -10.044 0.165   -2.593  1.00 0.00 ? 1488 GLY A CA   3  
ATOM   4513  C C    . GLY A 1 8   ? -9.449  -0.482  -3.841  1.00 0.00 ? 1488 GLY A C    3  
ATOM   4514  O O    . GLY A 1 8   ? -9.812  -0.092  -4.952  1.00 0.00 ? 1488 GLY A O    3  
ATOM   4515  H H    . GLY A 1 8   ? -10.332 -1.450  -1.260  1.00 0.00 ? 1488 GLY A H    3  
ATOM   4516  H HA2  . GLY A 1 8   ? -11.125 0.249   -2.716  1.00 0.00 ? 1488 GLY A HA2  3  
ATOM   4517  H HA3  . GLY A 1 8   ? -9.626  1.167   -2.490  1.00 0.00 ? 1488 GLY A HA3  3  
ATOM   4518  N N    . LEU A 1 9   ? -8.544  -1.458  -3.689  1.00 0.00 ? 1489 LEU A N    3  
ATOM   4519  C CA   . LEU A 1 9   ? -7.868  -2.092  -4.818  1.00 0.00 ? 1489 LEU A CA   3  
ATOM   4520  C C    . LEU A 1 9   ? -8.855  -2.989  -5.546  1.00 0.00 ? 1489 LEU A C    3  
ATOM   4521  O O    . LEU A 1 9   ? -9.578  -3.759  -4.911  1.00 0.00 ? 1489 LEU A O    3  
ATOM   4522  C CB   . LEU A 1 9   ? -6.630  -2.887  -4.347  1.00 0.00 ? 1489 LEU A CB   3  
ATOM   4523  C CG   . LEU A 1 9   ? -5.364  -2.055  -4.057  1.00 0.00 ? 1489 LEU A CG   3  
ATOM   4524  C CD1  . LEU A 1 9   ? -5.555  -0.880  -3.100  1.00 0.00 ? 1489 LEU A CD1  3  
ATOM   4525  C CD2  . LEU A 1 9   ? -4.267  -2.977  -3.499  1.00 0.00 ? 1489 LEU A CD2  3  
ATOM   4526  H H    . LEU A 1 9   ? -8.306  -1.775  -2.752  1.00 0.00 ? 1489 LEU A H    3  
ATOM   4527  H HA   . LEU A 1 9   ? -7.543  -1.337  -5.529  1.00 0.00 ? 1489 LEU A HA   3  
ATOM   4528  H HB2  . LEU A 1 9   ? -6.891  -3.471  -3.466  1.00 0.00 ? 1489 LEU A HB2  3  
ATOM   4529  H HB3  . LEU A 1 9   ? -6.361  -3.590  -5.135  1.00 0.00 ? 1489 LEU A HB3  3  
ATOM   4530  H HG   . LEU A 1 9   ? -5.017  -1.656  -5.005  1.00 0.00 ? 1489 LEU A HG   3  
ATOM   4531  H HD11 . LEU A 1 9   ? -4.604  -0.368  -2.971  1.00 0.00 ? 1489 LEU A HD11 3  
ATOM   4532  H HD12 . LEU A 1 9   ? -6.258  -0.158  -3.512  1.00 0.00 ? 1489 LEU A HD12 3  
ATOM   4533  H HD13 . LEU A 1 9   ? -5.901  -1.228  -2.133  1.00 0.00 ? 1489 LEU A HD13 3  
ATOM   4534  H HD21 . LEU A 1 9   ? -3.984  -3.718  -4.243  1.00 0.00 ? 1489 LEU A HD21 3  
ATOM   4535  H HD22 . LEU A 1 9   ? -3.378  -2.400  -3.226  1.00 0.00 ? 1489 LEU A HD22 3  
ATOM   4536  H HD23 . LEU A 1 9   ? -4.623  -3.492  -2.609  1.00 0.00 ? 1489 LEU A HD23 3  
ATOM   4537  N N    . ARG A 1 10  ? -8.863  -2.904  -6.880  1.00 0.00 ? 1490 ARG A N    3  
ATOM   4538  C CA   . ARG A 1 10  ? -9.577  -3.838  -7.748  1.00 0.00 ? 1490 ARG A CA   3  
ATOM   4539  C C    . ARG A 1 10  ? -8.741  -5.114  -7.760  1.00 0.00 ? 1490 ARG A C    3  
ATOM   4540  O O    . ARG A 1 10  ? -7.555  -5.073  -8.081  1.00 0.00 ? 1490 ARG A O    3  
ATOM   4541  C CB   . ARG A 1 10  ? -9.693  -3.248  -9.169  1.00 0.00 ? 1490 ARG A CB   3  
ATOM   4542  C CG   . ARG A 1 10  ? -10.688 -2.076  -9.215  1.00 0.00 ? 1490 ARG A CG   3  
ATOM   4543  C CD   . ARG A 1 10  ? -10.837 -1.479  -10.622 1.00 0.00 ? 1490 ARG A CD   3  
ATOM   4544  N NE   . ARG A 1 10  ? -9.568  -0.899  -11.112 1.00 0.00 ? 1490 ARG A NE   3  
ATOM   4545  C CZ   . ARG A 1 10  ? -9.080  0.325   -10.851 1.00 0.00 ? 1490 ARG A CZ   3  
ATOM   4546  N NH1  . ARG A 1 10  ? -9.758  1.192   -10.103 1.00 0.00 ? 1490 ARG A NH1  3  
ATOM   4547  N NH2  . ARG A 1 10  ? -7.898  0.675   -11.349 1.00 0.00 ? 1490 ARG A NH2  3  
ATOM   4548  H H    . ARG A 1 10  ? -8.224  -2.258  -7.325  1.00 0.00 ? 1490 ARG A H    3  
ATOM   4549  H HA   . ARG A 1 10  ? -10.574 -4.036  -7.342  1.00 0.00 ? 1490 ARG A HA   3  
ATOM   4550  H HB2  . ARG A 1 10  ? -8.711  -2.911  -9.501  1.00 0.00 ? 1490 ARG A HB2  3  
ATOM   4551  H HB3  . ARG A 1 10  ? -10.026 -4.030  -9.857  1.00 0.00 ? 1490 ARG A HB3  3  
ATOM   4552  H HG2  . ARG A 1 10  ? -11.666 -2.433  -8.893  1.00 0.00 ? 1490 ARG A HG2  3  
ATOM   4553  H HG3  . ARG A 1 10  ? -10.367 -1.295  -8.525  1.00 0.00 ? 1490 ARG A HG3  3  
ATOM   4554  H HD2  . ARG A 1 10  ? -11.154 -2.265  -11.309 1.00 0.00 ? 1490 ARG A HD2  3  
ATOM   4555  H HD3  . ARG A 1 10  ? -11.614 -0.716  -10.616 1.00 0.00 ? 1490 ARG A HD3  3  
ATOM   4556  H HE   . ARG A 1 10  ? -9.021  -1.514  -11.710 1.00 0.00 ? 1490 ARG A HE   3  
ATOM   4557  H HH11 . ARG A 1 10  ? -10.666 0.956   -9.720  1.00 0.00 ? 1490 ARG A HH11 3  
ATOM   4558  H HH12 . ARG A 1 10  ? -9.402  2.119   -9.899  1.00 0.00 ? 1490 ARG A HH12 3  
ATOM   4559  H HH21 . ARG A 1 10  ? -7.354  0.037   -11.922 1.00 0.00 ? 1490 ARG A HH21 3  
ATOM   4560  H HH22 . ARG A 1 10  ? -7.490  1.588   -11.181 1.00 0.00 ? 1490 ARG A HH22 3  
ATOM   4561  N N    . VAL A 1 11  ? -9.351  -6.234  -7.391  1.00 0.00 ? 1491 VAL A N    3  
ATOM   4562  C CA   . VAL A 1 11  ? -8.692  -7.522  -7.194  1.00 0.00 ? 1491 VAL A CA   3  
ATOM   4563  C C    . VAL A 1 11  ? -9.649  -8.600  -7.714  1.00 0.00 ? 1491 VAL A C    3  
ATOM   4564  O O    . VAL A 1 11  ? -10.728 -8.278  -8.225  1.00 0.00 ? 1491 VAL A O    3  
ATOM   4565  C CB   . VAL A 1 11  ? -8.284  -7.662  -5.701  1.00 0.00 ? 1491 VAL A CB   3  
ATOM   4566  C CG1  . VAL A 1 11  ? -7.369  -6.526  -5.237  1.00 0.00 ? 1491 VAL A CG1  3  
ATOM   4567  C CG2  . VAL A 1 11  ? -9.488  -7.699  -4.760  1.00 0.00 ? 1491 VAL A CG2  3  
ATOM   4568  H H    . VAL A 1 11  ? -10.347 -6.218  -7.185  1.00 0.00 ? 1491 VAL A H    3  
ATOM   4569  H HA   . VAL A 1 11  ? -7.782  -7.589  -7.796  1.00 0.00 ? 1491 VAL A HA   3  
ATOM   4570  H HB   . VAL A 1 11  ? -7.724  -8.581  -5.554  1.00 0.00 ? 1491 VAL A HB   3  
ATOM   4571  H HG11 . VAL A 1 11  ? -6.563  -6.360  -5.956  1.00 0.00 ? 1491 VAL A HG11 3  
ATOM   4572  H HG12 . VAL A 1 11  ? -7.931  -5.608  -5.117  1.00 0.00 ? 1491 VAL A HG12 3  
ATOM   4573  H HG13 . VAL A 1 11  ? -6.944  -6.782  -4.273  1.00 0.00 ? 1491 VAL A HG13 3  
ATOM   4574  H HG21 . VAL A 1 11  ? -9.125  -7.870  -3.745  1.00 0.00 ? 1491 VAL A HG21 3  
ATOM   4575  H HG22 . VAL A 1 11  ? -10.039 -6.756  -4.790  1.00 0.00 ? 1491 VAL A HG22 3  
ATOM   4576  H HG23 . VAL A 1 11  ? -10.152 -8.520  -5.032  1.00 0.00 ? 1491 VAL A HG23 3  
ATOM   4577  N N    . VAL A 1 12  ? -9.294  -9.868  -7.567  1.00 0.00 ? 1492 VAL A N    3  
ATOM   4578  C CA   . VAL A 1 12  ? -10.182 -11.002 -7.822  1.00 0.00 ? 1492 VAL A CA   3  
ATOM   4579  C C    . VAL A 1 12  ? -10.230 -11.774 -6.504  1.00 0.00 ? 1492 VAL A C    3  
ATOM   4580  O O    . VAL A 1 12  ? -9.263  -11.733 -5.748  1.00 0.00 ? 1492 VAL A O    3  
ATOM   4581  C CB   . VAL A 1 12  ? -9.654  -11.853 -9.006  1.00 0.00 ? 1492 VAL A CB   3  
ATOM   4582  C CG1  . VAL A 1 12  ? -10.751 -12.771 -9.574  1.00 0.00 ? 1492 VAL A CG1  3  
ATOM   4583  C CG2  . VAL A 1 12  ? -9.120  -10.993 -10.166 1.00 0.00 ? 1492 VAL A CG2  3  
ATOM   4584  H H    . VAL A 1 12  ? -8.392  -10.091 -7.158  1.00 0.00 ? 1492 VAL A H    3  
ATOM   4585  H HA   . VAL A 1 12  ? -11.183 -10.642 -8.060  1.00 0.00 ? 1492 VAL A HA   3  
ATOM   4586  H HB   . VAL A 1 12  ? -8.841  -12.483 -8.645  1.00 0.00 ? 1492 VAL A HB   3  
ATOM   4587  H HG11 . VAL A 1 12  ? -11.528 -12.178 -10.053 1.00 0.00 ? 1492 VAL A HG11 3  
ATOM   4588  H HG12 . VAL A 1 12  ? -10.312 -13.450 -10.310 1.00 0.00 ? 1492 VAL A HG12 3  
ATOM   4589  H HG13 . VAL A 1 12  ? -11.197 -13.368 -8.781  1.00 0.00 ? 1492 VAL A HG13 3  
ATOM   4590  H HG21 . VAL A 1 12  ? -8.873  -11.642 -11.013 1.00 0.00 ? 1492 VAL A HG21 3  
ATOM   4591  H HG22 . VAL A 1 12  ? -9.852  -10.238 -10.463 1.00 0.00 ? 1492 VAL A HG22 3  
ATOM   4592  H HG23 . VAL A 1 12  ? -8.201  -10.485 -9.862  1.00 0.00 ? 1492 VAL A HG23 3  
ATOM   4593  N N    . ALA A 1 13  ? -11.332 -12.441 -6.176  1.00 0.00 ? 1493 ALA A N    3  
ATOM   4594  C CA   . ALA A 1 13  ? -11.538 -13.054 -4.873  1.00 0.00 ? 1493 ALA A CA   3  
ATOM   4595  C C    . ALA A 1 13  ? -12.355 -14.324 -5.042  1.00 0.00 ? 1493 ALA A C    3  
ATOM   4596  O O    . ALA A 1 13  ? -13.204 -14.366 -5.931  1.00 0.00 ? 1493 ALA A O    3  
ATOM   4597  C CB   . ALA A 1 13  ? -12.293 -12.055 -3.994  1.00 0.00 ? 1493 ALA A CB   3  
ATOM   4598  H H    . ALA A 1 13  ? -12.125 -12.459 -6.805  1.00 0.00 ? 1493 ALA A H    3  
ATOM   4599  H HA   . ALA A 1 13  ? -10.575 -13.286 -4.423  1.00 0.00 ? 1493 ALA A HA   3  
ATOM   4600  H HB1  . ALA A 1 13  ? -12.370 -12.441 -2.975  1.00 0.00 ? 1493 ALA A HB1  3  
ATOM   4601  H HB2  . ALA A 1 13  ? -11.758 -11.107 -3.989  1.00 0.00 ? 1493 ALA A HB2  3  
ATOM   4602  H HB3  . ALA A 1 13  ? -13.297 -11.877 -4.385  1.00 0.00 ? 1493 ALA A HB3  3  
ATOM   4603  N N    . LYS A 1 14  ? -12.182 -15.326 -4.180  1.00 0.00 ? 1494 LYS A N    3  
ATOM   4604  C CA   . LYS A 1 14  ? -12.986 -16.548 -4.266  1.00 0.00 ? 1494 LYS A CA   3  
ATOM   4605  C C    . LYS A 1 14  ? -14.283 -16.257 -3.555  1.00 0.00 ? 1494 LYS A C    3  
ATOM   4606  O O    . LYS A 1 14  ? -14.286 -15.738 -2.443  1.00 0.00 ? 1494 LYS A O    3  
ATOM   4607  C CB   . LYS A 1 14  ? -12.306 -17.755 -3.595  1.00 0.00 ? 1494 LYS A CB   3  
ATOM   4608  C CG   . LYS A 1 14  ? -13.228 -18.997 -3.602  1.00 0.00 ? 1494 LYS A CG   3  
ATOM   4609  C CD   . LYS A 1 14  ? -12.489 -20.248 -3.093  1.00 0.00 ? 1494 LYS A CD   3  
ATOM   4610  C CE   . LYS A 1 14  ? -13.340 -21.512 -3.318  1.00 0.00 ? 1494 LYS A CE   3  
ATOM   4611  N NZ   . LYS A 1 14  ? -12.720 -22.749 -2.747  1.00 0.00 ? 1494 LYS A NZ   3  
ATOM   4612  H H    . LYS A 1 14  ? -11.551 -15.193 -3.391  1.00 0.00 ? 1494 LYS A H    3  
ATOM   4613  H HA   . LYS A 1 14  ? -13.192 -16.801 -5.305  1.00 0.00 ? 1494 LYS A HA   3  
ATOM   4614  H HB2  . LYS A 1 14  ? -11.375 -17.979 -4.113  1.00 0.00 ? 1494 LYS A HB2  3  
ATOM   4615  H HB3  . LYS A 1 14  ? -12.081 -17.516 -2.560  1.00 0.00 ? 1494 LYS A HB3  3  
ATOM   4616  H HG2  . LYS A 1 14  ? -14.084 -18.817 -2.941  1.00 0.00 ? 1494 LYS A HG2  3  
ATOM   4617  H HG3  . LYS A 1 14  ? -13.632 -19.166 -4.602  1.00 0.00 ? 1494 LYS A HG3  3  
ATOM   4618  H HD2  . LYS A 1 14  ? -11.533 -20.347 -3.609  1.00 0.00 ? 1494 LYS A HD2  3  
ATOM   4619  H HD3  . LYS A 1 14  ? -12.288 -20.126 -2.025  1.00 0.00 ? 1494 LYS A HD3  3  
ATOM   4620  H HE2  . LYS A 1 14  ? -14.321 -21.339 -2.866  1.00 0.00 ? 1494 LYS A HE2  3  
ATOM   4621  H HE3  . LYS A 1 14  ? -13.492 -21.639 -4.396  1.00 0.00 ? 1494 LYS A HE3  3  
ATOM   4622  H HZ1  . LYS A 1 14  ? -13.288 -23.580 -2.939  1.00 0.00 ? 1494 LYS A HZ1  3  
ATOM   4623  H HZ2  . LYS A 1 14  ? -11.803 -22.929 -3.137  1.00 0.00 ? 1494 LYS A HZ2  3  
ATOM   4624  H HZ3  . LYS A 1 14  ? -12.610 -22.683 -1.739  1.00 0.00 ? 1494 LYS A HZ3  3  
ATOM   4625  N N    . TRP A 1 15  ? -15.381 -16.628 -4.197  1.00 0.00 ? 1495 TRP A N    3  
ATOM   4626  C CA   . TRP A 1 15  ? -16.672 -16.628 -3.553  1.00 0.00 ? 1495 TRP A CA   3  
ATOM   4627  C C    . TRP A 1 15  ? -16.675 -17.811 -2.578  1.00 0.00 ? 1495 TRP A C    3  
ATOM   4628  O O    . TRP A 1 15  ? -16.561 -18.969 -2.989  1.00 0.00 ? 1495 TRP A O    3  
ATOM   4629  C CB   . TRP A 1 15  ? -17.710 -16.708 -4.650  1.00 0.00 ? 1495 TRP A CB   3  
ATOM   4630  C CG   . TRP A 1 15  ? -19.082 -17.078 -4.211  1.00 0.00 ? 1495 TRP A CG   3  
ATOM   4631  C CD1  . TRP A 1 15  ? -19.717 -18.199 -4.595  1.00 0.00 ? 1495 TRP A CD1  3  
ATOM   4632  C CD2  . TRP A 1 15  ? -19.997 -16.376 -3.327  1.00 0.00 ? 1495 TRP A CD2  3  
ATOM   4633  N NE1  . TRP A 1 15  ? -21.010 -18.192 -4.109  1.00 0.00 ? 1495 TRP A NE1  3  
ATOM   4634  C CE2  . TRP A 1 15  ? -21.230 -17.094 -3.292  1.00 0.00 ? 1495 TRP A CE2  3  
ATOM   4635  C CE3  . TRP A 1 15  ? -19.910 -15.180 -2.588  1.00 0.00 ? 1495 TRP A CE3  3  
ATOM   4636  C CZ2  . TRP A 1 15  ? -22.337 -16.619 -2.572  1.00 0.00 ? 1495 TRP A CZ2  3  
ATOM   4637  C CZ3  . TRP A 1 15  ? -21.016 -14.701 -1.869  1.00 0.00 ? 1495 TRP A CZ3  3  
ATOM   4638  C CH2  . TRP A 1 15  ? -22.227 -15.414 -1.856  1.00 0.00 ? 1495 TRP A CH2  3  
ATOM   4639  H H    . TRP A 1 15  ? -15.300 -17.062 -5.114  1.00 0.00 ? 1495 TRP A H    3  
ATOM   4640  H HA   . TRP A 1 15  ? -16.810 -15.691 -3.011  1.00 0.00 ? 1495 TRP A HA   3  
ATOM   4641  H HB2  . TRP A 1 15  ? -17.740 -15.727 -5.124  1.00 0.00 ? 1495 TRP A HB2  3  
ATOM   4642  H HB3  . TRP A 1 15  ? -17.383 -17.436 -5.393  1.00 0.00 ? 1495 TRP A HB3  3  
ATOM   4643  H HD1  . TRP A 1 15  ? -19.252 -18.967 -5.199  1.00 0.00 ? 1495 TRP A HD1  3  
ATOM   4644  H HE1  . TRP A 1 15  ? -21.688 -18.915 -4.344  1.00 0.00 ? 1495 TRP A HE1  3  
ATOM   4645  H HE3  . TRP A 1 15  ? -18.985 -14.615 -2.573  1.00 0.00 ? 1495 TRP A HE3  3  
ATOM   4646  H HZ2  . TRP A 1 15  ? -23.265 -17.176 -2.567  1.00 0.00 ? 1495 TRP A HZ2  3  
ATOM   4647  H HZ3  . TRP A 1 15  ? -20.933 -13.776 -1.322  1.00 0.00 ? 1495 TRP A HZ3  3  
ATOM   4648  H HH2  . TRP A 1 15  ? -23.064 -15.024 -1.295  1.00 0.00 ? 1495 TRP A HH2  3  
ATOM   4649  N N    . SER A 1 16  ? -16.755 -17.512 -1.284  1.00 0.00 ? 1496 SER A N    3  
ATOM   4650  C CA   . SER A 1 16  ? -16.549 -18.439 -0.177  1.00 0.00 ? 1496 SER A CA   3  
ATOM   4651  C C    . SER A 1 16  ? -17.413 -19.707 -0.170  1.00 0.00 ? 1496 SER A C    3  
ATOM   4652  O O    . SER A 1 16  ? -16.997 -20.700 0.434   1.00 0.00 ? 1496 SER A O    3  
ATOM   4653  C CB   . SER A 1 16  ? -16.753 -17.655 1.123   1.00 0.00 ? 1496 SER A CB   3  
ATOM   4654  O OG   . SER A 1 16  ? -16.029 -16.434 1.078   1.00 0.00 ? 1496 SER A OG   3  
ATOM   4655  H H    . SER A 1 16  ? -16.775 -16.539 -1.006  1.00 0.00 ? 1496 SER A H    3  
ATOM   4656  H HA   . SER A 1 16  ? -15.505 -18.759 -0.212  1.00 0.00 ? 1496 SER A HA   3  
ATOM   4657  H HB2  . SER A 1 16  ? -17.815 -17.438 1.225   1.00 0.00 ? 1496 SER A HB2  3  
ATOM   4658  H HB3  . SER A 1 16  ? -16.427 -18.247 1.980   1.00 0.00 ? 1496 SER A HB3  3  
ATOM   4659  H HG   . SER A 1 16  ? -16.231 -15.912 1.876   1.00 0.00 ? 1496 SER A HG   3  
ATOM   4660  N N    . SER A 1 17  ? -18.567 -19.721 -0.846  1.00 0.00 ? 1497 SER A N    3  
ATOM   4661  C CA   . SER A 1 17  ? -19.445 -20.889 -0.961  1.00 0.00 ? 1497 SER A CA   3  
ATOM   4662  C C    . SER A 1 17  ? -18.895 -21.899 -1.987  1.00 0.00 ? 1497 SER A C    3  
ATOM   4663  O O    . SER A 1 17  ? -19.566 -22.273 -2.948  1.00 0.00 ? 1497 SER A O    3  
ATOM   4664  C CB   . SER A 1 17  ? -20.873 -20.420 -1.272  1.00 0.00 ? 1497 SER A CB   3  
ATOM   4665  O OG   . SER A 1 17  ? -21.295 -19.433 -0.336  1.00 0.00 ? 1497 SER A OG   3  
ATOM   4666  H H    . SER A 1 17  ? -18.874 -18.876 -1.308  1.00 0.00 ? 1497 SER A H    3  
ATOM   4667  H HA   . SER A 1 17  ? -19.468 -21.389 0.009   1.00 0.00 ? 1497 SER A HA   3  
ATOM   4668  H HB2  . SER A 1 17  ? -20.900 -20.007 -2.280  1.00 0.00 ? 1497 SER A HB2  3  
ATOM   4669  H HB3  . SER A 1 17  ? -21.547 -21.276 -1.228  1.00 0.00 ? 1497 SER A HB3  3  
ATOM   4670  H HG   . SER A 1 17  ? -22.220 -19.182 -0.540  1.00 0.00 ? 1497 SER A HG   3  
ATOM   4671  N N    . ASN A 1 18  ? -17.635 -22.307 -1.787  1.00 0.00 ? 1498 ASN A N    3  
ATOM   4672  C CA   . ASN A 1 18  ? -16.791 -23.114 -2.670  1.00 0.00 ? 1498 ASN A CA   3  
ATOM   4673  C C    . ASN A 1 18  ? -16.935 -22.759 -4.158  1.00 0.00 ? 1498 ASN A C    3  
ATOM   4674  O O    . ASN A 1 18  ? -17.129 -23.631 -5.009  1.00 0.00 ? 1498 ASN A O    3  
ATOM   4675  C CB   . ASN A 1 18  ? -16.939 -24.619 -2.382  1.00 0.00 ? 1498 ASN A CB   3  
ATOM   4676  C CG   . ASN A 1 18  ? -15.813 -25.415 -3.047  1.00 0.00 ? 1498 ASN A CG   3  
ATOM   4677  O OD1  . ASN A 1 18  ? -14.690 -24.921 -3.182  1.00 0.00 ? 1498 ASN A OD1  3  
ATOM   4678  N ND2  . ASN A 1 18  ? -16.076 -26.642 -3.471  1.00 0.00 ? 1498 ASN A ND2  3  
ATOM   4679  H H    . ASN A 1 18  ? -17.194 -21.965 -0.943  1.00 0.00 ? 1498 ASN A H    3  
ATOM   4680  H HA   . ASN A 1 18  ? -15.774 -22.850 -2.388  1.00 0.00 ? 1498 ASN A HA   3  
ATOM   4681  H HB2  . ASN A 1 18  ? -16.904 -24.804 -1.307  1.00 0.00 ? 1498 ASN A HB2  3  
ATOM   4682  H HB3  . ASN A 1 18  ? -17.908 -24.959 -2.751  1.00 0.00 ? 1498 ASN A HB3  3  
ATOM   4683  H HD21 . ASN A 1 18  ? -16.997 -27.044 -3.349  1.00 0.00 ? 1498 ASN A HD21 3  
ATOM   4684  H HD22 . ASN A 1 18  ? -15.349 -27.193 -3.912  1.00 0.00 ? 1498 ASN A HD22 3  
ATOM   4685  N N    . GLY A 1 19  ? -16.877 -21.460 -4.466  1.00 0.00 ? 1499 GLY A N    3  
ATOM   4686  C CA   . GLY A 1 19  ? -17.102 -20.935 -5.801  1.00 0.00 ? 1499 GLY A CA   3  
ATOM   4687  C C    . GLY A 1 19  ? -15.823 -20.676 -6.578  1.00 0.00 ? 1499 GLY A C    3  
ATOM   4688  O O    . GLY A 1 19  ? -14.717 -20.987 -6.139  1.00 0.00 ? 1499 GLY A O    3  
ATOM   4689  H H    . GLY A 1 19  ? -16.723 -20.772 -3.734  1.00 0.00 ? 1499 GLY A H    3  
ATOM   4690  H HA2  . GLY A 1 19  ? -17.741 -21.611 -6.372  1.00 0.00 ? 1499 GLY A HA2  3  
ATOM   4691  H HA3  . GLY A 1 19  ? -17.613 -19.983 -5.707  1.00 0.00 ? 1499 GLY A HA3  3  
ATOM   4692  N N    . TYR A 1 20  ? -16.004 -20.082 -7.756  1.00 0.00 ? 1500 TYR A N    3  
ATOM   4693  C CA   . TYR A 1 20  ? -14.933 -19.546 -8.577  1.00 0.00 ? 1500 TYR A CA   3  
ATOM   4694  C C    . TYR A 1 20  ? -14.448 -18.224 -7.998  1.00 0.00 ? 1500 TYR A C    3  
ATOM   4695  O O    . TYR A 1 20  ? -14.917 -17.764 -6.953  1.00 0.00 ? 1500 TYR A O    3  
ATOM   4696  C CB   . TYR A 1 20  ? -15.468 -19.344 -9.996  1.00 0.00 ? 1500 TYR A CB   3  
ATOM   4697  C CG   . TYR A 1 20  ? -15.722 -20.566 -10.839 1.00 0.00 ? 1500 TYR A CG   3  
ATOM   4698  C CD1  . TYR A 1 20  ? -15.416 -21.882 -10.436 1.00 0.00 ? 1500 TYR A CD1  3  
ATOM   4699  C CD2  . TYR A 1 20  ? -16.283 -20.334 -12.094 1.00 0.00 ? 1500 TYR A CD2  3  
ATOM   4700  C CE1  . TYR A 1 20  ? -15.613 -22.943 -11.344 1.00 0.00 ? 1500 TYR A CE1  3  
ATOM   4701  C CE2  . TYR A 1 20  ? -16.474 -21.375 -13.001 1.00 0.00 ? 1500 TYR A CE2  3  
ATOM   4702  C CZ   . TYR A 1 20  ? -16.132 -22.693 -12.640 1.00 0.00 ? 1500 TYR A CZ   3  
ATOM   4703  O OH   . TYR A 1 20  ? -16.317 -23.692 -13.544 1.00 0.00 ? 1500 TYR A OH   3  
ATOM   4704  H H    . TYR A 1 20  ? -16.946 -19.848 -8.034  1.00 0.00 ? 1500 TYR A H    3  
ATOM   4705  H HA   . TYR A 1 20  ? -14.088 -20.236 -8.596  1.00 0.00 ? 1500 TYR A HA   3  
ATOM   4706  H HB2  . TYR A 1 20  ? -16.387 -18.767 -9.950  1.00 0.00 ? 1500 TYR A HB2  3  
ATOM   4707  H HB3  . TYR A 1 20  ? -14.761 -18.741 -10.565 1.00 0.00 ? 1500 TYR A HB3  3  
ATOM   4708  H HD1  . TYR A 1 20  ? -15.029 -22.088 -9.442  1.00 0.00 ? 1500 TYR A HD1  3  
ATOM   4709  H HD2  . TYR A 1 20  ? -16.575 -19.341 -12.375 1.00 0.00 ? 1500 TYR A HD2  3  
ATOM   4710  H HE1  . TYR A 1 20  ? -15.368 -23.953 -11.044 1.00 0.00 ? 1500 TYR A HE1  3  
ATOM   4711  H HE2  . TYR A 1 20  ? -16.889 -21.137 -13.969 1.00 0.00 ? 1500 TYR A HE2  3  
ATOM   4712  H HH   . TYR A 1 20  ? -16.011 -24.569 -13.249 1.00 0.00 ? 1500 TYR A HH   3  
ATOM   4713  N N    . PHE A 1 21  ? -13.465 -17.631 -8.665  1.00 0.00 ? 1501 PHE A N    3  
ATOM   4714  C CA   . PHE A 1 21  ? -12.834 -16.413 -8.246  1.00 0.00 ? 1501 PHE A CA   3  
ATOM   4715  C C    . PHE A 1 21  ? -13.373 -15.324 -9.178  1.00 0.00 ? 1501 PHE A C    3  
ATOM   4716  O O    . PHE A 1 21  ? -13.178 -15.399 -10.395 1.00 0.00 ? 1501 PHE A O    3  
ATOM   4717  C CB   . PHE A 1 21  ? -11.307 -16.566 -8.301  1.00 0.00 ? 1501 PHE A CB   3  
ATOM   4718  C CG   . PHE A 1 21  ? -10.598 -17.643 -7.470  1.00 0.00 ? 1501 PHE A CG   3  
ATOM   4719  C CD1  . PHE A 1 21  ? -11.253 -18.749 -6.882  1.00 0.00 ? 1501 PHE A CD1  3  
ATOM   4720  C CD2  . PHE A 1 21  ? -9.207  -17.523 -7.289  1.00 0.00 ? 1501 PHE A CD2  3  
ATOM   4721  C CE1  . PHE A 1 21  ? -10.523 -19.757 -6.238  1.00 0.00 ? 1501 PHE A CE1  3  
ATOM   4722  C CE2  . PHE A 1 21  ? -8.476  -18.516 -6.608  1.00 0.00 ? 1501 PHE A CE2  3  
ATOM   4723  C CZ   . PHE A 1 21  ? -9.137  -19.655 -6.116  1.00 0.00 ? 1501 PHE A CZ   3  
ATOM   4724  H H    . PHE A 1 21  ? -13.101 -18.038 -9.523  1.00 0.00 ? 1501 PHE A H    3  
ATOM   4725  H HA   . PHE A 1 21  ? -13.129 -16.207 -7.230  1.00 0.00 ? 1501 PHE A HA   3  
ATOM   4726  H HB2  . PHE A 1 21  ? -11.023 -16.731 -9.340  1.00 0.00 ? 1501 PHE A HB2  3  
ATOM   4727  H HB3  . PHE A 1 21  ? -10.890 -15.608 -8.017  1.00 0.00 ? 1501 PHE A HB3  3  
ATOM   4728  H HD1  . PHE A 1 21  ? -12.316 -18.868 -6.905  1.00 0.00 ? 1501 PHE A HD1  3  
ATOM   4729  H HD2  . PHE A 1 21  ? -8.694  -16.659 -7.683  1.00 0.00 ? 1501 PHE A HD2  3  
ATOM   4730  H HE1  . PHE A 1 21  ? -11.034 -20.618 -5.829  1.00 0.00 ? 1501 PHE A HE1  3  
ATOM   4731  H HE2  . PHE A 1 21  ? -7.409  -18.406 -6.464  1.00 0.00 ? 1501 PHE A HE2  3  
ATOM   4732  H HZ   . PHE A 1 21  ? -8.595  -20.458 -5.642  1.00 0.00 ? 1501 PHE A HZ   3  
ATOM   4733  N N    . TYR A 1 22  ? -14.077 -14.345 -8.607  1.00 0.00 ? 1502 TYR A N    3  
ATOM   4734  C CA   . TYR A 1 22  ? -14.781 -13.299 -9.343  1.00 0.00 ? 1502 TYR A CA   3  
ATOM   4735  C C    . TYR A 1 22  ? -14.099 -11.976 -9.025  1.00 0.00 ? 1502 TYR A C    3  
ATOM   4736  O O    . TYR A 1 22  ? -13.502 -11.803 -7.961  1.00 0.00 ? 1502 TYR A O    3  
ATOM   4737  C CB   . TYR A 1 22  ? -16.266 -13.232 -8.933  1.00 0.00 ? 1502 TYR A CB   3  
ATOM   4738  C CG   . TYR A 1 22  ? -17.076 -14.486 -9.176  1.00 0.00 ? 1502 TYR A CG   3  
ATOM   4739  C CD1  . TYR A 1 22  ? -16.872 -15.579 -8.314  1.00 0.00 ? 1502 TYR A CD1  3  
ATOM   4740  C CD2  . TYR A 1 22  ? -18.029 -14.583 -10.219 1.00 0.00 ? 1502 TYR A CD2  3  
ATOM   4741  C CE1  . TYR A 1 22  ? -17.533 -16.793 -8.530  1.00 0.00 ? 1502 TYR A CE1  3  
ATOM   4742  C CE2  . TYR A 1 22  ? -18.630 -15.825 -10.480 1.00 0.00 ? 1502 TYR A CE2  3  
ATOM   4743  C CZ   . TYR A 1 22  ? -18.383 -16.928 -9.642  1.00 0.00 ? 1502 TYR A CZ   3  
ATOM   4744  O OH   . TYR A 1 22  ? -18.957 -18.129 -9.901  1.00 0.00 ? 1502 TYR A OH   3  
ATOM   4745  H H    . TYR A 1 22  ? -14.095 -14.281 -7.588  1.00 0.00 ? 1502 TYR A H    3  
ATOM   4746  H HA   . TYR A 1 22  ? -14.719 -13.494 -10.416 1.00 0.00 ? 1502 TYR A HA   3  
ATOM   4747  H HB2  . TYR A 1 22  ? -16.310 -13.035 -7.863  1.00 0.00 ? 1502 TYR A HB2  3  
ATOM   4748  H HB3  . TYR A 1 22  ? -16.748 -12.396 -9.445  1.00 0.00 ? 1502 TYR A HB3  3  
ATOM   4749  H HD1  . TYR A 1 22  ? -16.201 -15.495 -7.469  1.00 0.00 ? 1502 TYR A HD1  3  
ATOM   4750  H HD2  . TYR A 1 22  ? -18.339 -13.737 -10.837 1.00 0.00 ? 1502 TYR A HD2  3  
ATOM   4751  H HE1  . TYR A 1 22  ? -17.390 -17.617 -7.846  1.00 0.00 ? 1502 TYR A HE1  3  
ATOM   4752  H HE2  . TYR A 1 22  ? -19.293 -15.931 -11.329 1.00 0.00 ? 1502 TYR A HE2  3  
ATOM   4753  H HH   . TYR A 1 22  ? -19.532 -18.099 -10.683 1.00 0.00 ? 1502 TYR A HH   3  
ATOM   4754  N N    . SER A 1 23  ? -14.174 -11.039 -9.959  1.00 0.00 ? 1503 SER A N    3  
ATOM   4755  C CA   . SER A 1 23  ? -13.636 -9.697  -9.813  1.00 0.00 ? 1503 SER A CA   3  
ATOM   4756  C C    . SER A 1 23  ? -14.355 -8.950  -8.687  1.00 0.00 ? 1503 SER A C    3  
ATOM   4757  O O    . SER A 1 23  ? -15.570 -9.095  -8.522  1.00 0.00 ? 1503 SER A O    3  
ATOM   4758  C CB   . SER A 1 23  ? -13.866 -9.006  -11.156 1.00 0.00 ? 1503 SER A CB   3  
ATOM   4759  O OG   . SER A 1 23  ? -13.441 -9.849  -12.212 1.00 0.00 ? 1503 SER A OG   3  
ATOM   4760  H H    . SER A 1 23  ? -14.618 -11.244 -10.846 1.00 0.00 ? 1503 SER A H    3  
ATOM   4761  H HA   . SER A 1 23  ? -12.564 -9.746  -9.604  1.00 0.00 ? 1503 SER A HA   3  
ATOM   4762  H HB2  . SER A 1 23  ? -14.930 -8.798  -11.276 1.00 0.00 ? 1503 SER A HB2  3  
ATOM   4763  H HB3  . SER A 1 23  ? -13.326 -8.077  -11.204 1.00 0.00 ? 1503 SER A HB3  3  
ATOM   4764  H HG   . SER A 1 23  ? -12.466 -9.915  -12.241 1.00 0.00 ? 1503 SER A HG   3  
ATOM   4765  N N    . GLY A 1 24  ? -13.635 -8.106  -7.952  1.00 0.00 ? 1504 GLY A N    3  
ATOM   4766  C CA   . GLY A 1 24  ? -14.224 -7.229  -6.949  1.00 0.00 ? 1504 GLY A CA   3  
ATOM   4767  C C    . GLY A 1 24  ? -13.270 -6.118  -6.560  1.00 0.00 ? 1504 GLY A C    3  
ATOM   4768  O O    . GLY A 1 24  ? -12.204 -5.977  -7.160  1.00 0.00 ? 1504 GLY A O    3  
ATOM   4769  H H    . GLY A 1 24  ? -12.623 -8.065  -8.061  1.00 0.00 ? 1504 GLY A H    3  
ATOM   4770  H HA2  . GLY A 1 24  ? -15.138 -6.783  -7.341  1.00 0.00 ? 1504 GLY A HA2  3  
ATOM   4771  H HA3  . GLY A 1 24  ? -14.466 -7.813  -6.061  1.00 0.00 ? 1504 GLY A HA3  3  
ATOM   4772  N N    . LYS A 1 25  ? -13.640 -5.334  -5.549  1.00 0.00 ? 1505 LYS A N    3  
ATOM   4773  C CA   . LYS A 1 25  ? -12.757 -4.361  -4.906  1.00 0.00 ? 1505 LYS A CA   3  
ATOM   4774  C C    . LYS A 1 25  ? -12.826 -4.630  -3.412  1.00 0.00 ? 1505 LYS A C    3  
ATOM   4775  O O    . LYS A 1 25  ? -13.890 -4.984  -2.906  1.00 0.00 ? 1505 LYS A O    3  
ATOM   4776  C CB   . LYS A 1 25  ? -13.131 -2.883  -5.183  1.00 0.00 ? 1505 LYS A CB   3  
ATOM   4777  C CG   . LYS A 1 25  ? -13.831 -2.607  -6.526  1.00 0.00 ? 1505 LYS A CG   3  
ATOM   4778  C CD   . LYS A 1 25  ? -15.363 -2.698  -6.374  1.00 0.00 ? 1505 LYS A CD   3  
ATOM   4779  C CE   . LYS A 1 25  ? -16.073 -3.240  -7.622  1.00 0.00 ? 1505 LYS A CE   3  
ATOM   4780  N NZ   . LYS A 1 25  ? -16.009 -2.321  -8.798  1.00 0.00 ? 1505 LYS A NZ   3  
ATOM   4781  H H    . LYS A 1 25  ? -14.542 -5.509  -5.103  1.00 0.00 ? 1505 LYS A H    3  
ATOM   4782  H HA   . LYS A 1 25  ? -11.741 -4.543  -5.251  1.00 0.00 ? 1505 LYS A HA   3  
ATOM   4783  H HB2  . LYS A 1 25  ? -13.747 -2.498  -4.365  1.00 0.00 ? 1505 LYS A HB2  3  
ATOM   4784  H HB3  . LYS A 1 25  ? -12.202 -2.307  -5.165  1.00 0.00 ? 1505 LYS A HB3  3  
ATOM   4785  H HG2  . LYS A 1 25  ? -13.580 -1.596  -6.855  1.00 0.00 ? 1505 LYS A HG2  3  
ATOM   4786  H HG3  . LYS A 1 25  ? -13.466 -3.306  -7.281  1.00 0.00 ? 1505 LYS A HG3  3  
ATOM   4787  H HD2  . LYS A 1 25  ? -15.602 -3.378  -5.553  1.00 0.00 ? 1505 LYS A HD2  3  
ATOM   4788  H HD3  . LYS A 1 25  ? -15.765 -1.717  -6.112  1.00 0.00 ? 1505 LYS A HD3  3  
ATOM   4789  H HE2  . LYS A 1 25  ? -15.622 -4.201  -7.882  1.00 0.00 ? 1505 LYS A HE2  3  
ATOM   4790  H HE3  . LYS A 1 25  ? -17.117 -3.434  -7.358  1.00 0.00 ? 1505 LYS A HE3  3  
ATOM   4791  H HZ1  . LYS A 1 25  ? -15.067 -2.008  -8.999  1.00 0.00 ? 1505 LYS A HZ1  3  
ATOM   4792  H HZ2  . LYS A 1 25  ? -16.328 -2.821  -9.636  1.00 0.00 ? 1505 LYS A HZ2  3  
ATOM   4793  H HZ3  . LYS A 1 25  ? -16.602 -1.504  -8.674  1.00 0.00 ? 1505 LYS A HZ3  3  
ATOM   4794  N N    . ILE A 1 26  ? -11.709 -4.490  -2.710  1.00 0.00 ? 1506 ILE A N    3  
ATOM   4795  C CA   . ILE A 1 26  ? -11.702 -4.668  -1.259  1.00 0.00 ? 1506 ILE A CA   3  
ATOM   4796  C C    . ILE A 1 26  ? -12.398 -3.449  -0.674  1.00 0.00 ? 1506 ILE A C    3  
ATOM   4797  O O    . ILE A 1 26  ? -11.941 -2.328  -0.885  1.00 0.00 ? 1506 ILE A O    3  
ATOM   4798  C CB   . ILE A 1 26  ? -10.251 -4.795  -0.772  1.00 0.00 ? 1506 ILE A CB   3  
ATOM   4799  C CG1  . ILE A 1 26  ? -9.565  -6.060  -1.332  1.00 0.00 ? 1506 ILE A CG1  3  
ATOM   4800  C CG2  . ILE A 1 26  ? -10.173 -4.821  0.762   1.00 0.00 ? 1506 ILE A CG2  3  
ATOM   4801  C CD1  . ILE A 1 26  ? -8.115  -5.817  -1.761  1.00 0.00 ? 1506 ILE A CD1  3  
ATOM   4802  H H    . ILE A 1 26  ? -10.863 -4.164  -3.171  1.00 0.00 ? 1506 ILE A H    3  
ATOM   4803  H HA   . ILE A 1 26  ? -12.267 -5.562  -0.982  1.00 0.00 ? 1506 ILE A HA   3  
ATOM   4804  H HB   . ILE A 1 26  ? -9.727  -3.920  -1.133  1.00 0.00 ? 1506 ILE A HB   3  
ATOM   4805  H HG12 . ILE A 1 26  ? -9.592  -6.850  -0.587  1.00 0.00 ? 1506 ILE A HG12 3  
ATOM   4806  H HG13 . ILE A 1 26  ? -10.104 -6.413  -2.204  1.00 0.00 ? 1506 ILE A HG13 3  
ATOM   4807  H HG21 . ILE A 1 26  ? -9.127  -4.936  1.065   1.00 0.00 ? 1506 ILE A HG21 3  
ATOM   4808  H HG22 . ILE A 1 26  ? -10.570 -3.891  1.184   1.00 0.00 ? 1506 ILE A HG22 3  
ATOM   4809  H HG23 . ILE A 1 26  ? -10.768 -5.662  1.127   1.00 0.00 ? 1506 ILE A HG23 3  
ATOM   4810  H HD11 . ILE A 1 26  ? -7.536  -5.438  -0.926  1.00 0.00 ? 1506 ILE A HD11 3  
ATOM   4811  H HD12 . ILE A 1 26  ? -7.664  -6.751  -2.092  1.00 0.00 ? 1506 ILE A HD12 3  
ATOM   4812  H HD13 . ILE A 1 26  ? -8.098  -5.094  -2.579  1.00 0.00 ? 1506 ILE A HD13 3  
ATOM   4813  N N    . THR A 1 27  ? -13.476 -3.654  0.071   1.00 0.00 ? 1507 THR A N    3  
ATOM   4814  C CA   . THR A 1 27  ? -14.246 -2.560  0.642   1.00 0.00 ? 1507 THR A CA   3  
ATOM   4815  C C    . THR A 1 27  ? -13.654 -2.119  1.977   1.00 0.00 ? 1507 THR A C    3  
ATOM   4816  O O    . THR A 1 27  ? -13.659 -0.929  2.284   1.00 0.00 ? 1507 THR A O    3  
ATOM   4817  C CB   . THR A 1 27  ? -15.683 -3.030  0.845   1.00 0.00 ? 1507 THR A CB   3  
ATOM   4818  O OG1  . THR A 1 27  ? -15.657 -4.206  1.624   1.00 0.00 ? 1507 THR A OG1  3  
ATOM   4819  C CG2  . THR A 1 27  ? -16.345 -3.420  -0.463  1.00 0.00 ? 1507 THR A CG2  3  
ATOM   4820  H H    . THR A 1 27  ? -13.824 -4.594  0.243   1.00 0.00 ? 1507 THR A H    3  
ATOM   4821  H HA   . THR A 1 27  ? -14.237 -1.721  -0.051  1.00 0.00 ? 1507 THR A HA   3  
ATOM   4822  H HB   . THR A 1 27  ? -16.264 -2.257  1.338   1.00 0.00 ? 1507 THR A HB   3  
ATOM   4823  H HG1  . THR A 1 27  ? -16.421 -4.181  2.234   1.00 0.00 ? 1507 THR A HG1  3  
ATOM   4824  H HG21 . THR A 1 27  ? -16.504 -2.535  -1.083  1.00 0.00 ? 1507 THR A HG21 3  
ATOM   4825  H HG22 . THR A 1 27  ? -15.714 -4.129  -1.001  1.00 0.00 ? 1507 THR A HG22 3  
ATOM   4826  H HG23 . THR A 1 27  ? -17.303 -3.893  -0.237  1.00 0.00 ? 1507 THR A HG23 3  
ATOM   4827  N N    . ARG A 1 28  ? -13.157 -3.084  2.770   1.00 0.00 ? 1508 ARG A N    3  
ATOM   4828  C CA   . ARG A 1 28  ? -12.629 -2.863  4.120   1.00 0.00 ? 1508 ARG A CA   3  
ATOM   4829  C C    . ARG A 1 28  ? -11.894 -4.125  4.579   1.00 0.00 ? 1508 ARG A C    3  
ATOM   4830  O O    . ARG A 1 28  ? -12.394 -5.227  4.375   1.00 0.00 ? 1508 ARG A O    3  
ATOM   4831  C CB   . ARG A 1 28  ? -13.833 -2.520  5.033   1.00 0.00 ? 1508 ARG A CB   3  
ATOM   4832  C CG   . ARG A 1 28  ? -13.475 -2.302  6.511   1.00 0.00 ? 1508 ARG A CG   3  
ATOM   4833  C CD   . ARG A 1 28  ? -13.996 -3.455  7.371   1.00 0.00 ? 1508 ARG A CD   3  
ATOM   4834  N NE   . ARG A 1 28  ? -13.425 -3.413  8.733   1.00 0.00 ? 1508 ARG A NE   3  
ATOM   4835  C CZ   . ARG A 1 28  ? -13.987 -2.938  9.853   1.00 0.00 ? 1508 ARG A CZ   3  
ATOM   4836  N NH1  . ARG A 1 28  ? -15.167 -2.321  9.826   1.00 0.00 ? 1508 ARG A NH1  3  
ATOM   4837  N NH2  . ARG A 1 28  ? -13.355 -3.089  11.011  1.00 0.00 ? 1508 ARG A NH2  3  
ATOM   4838  H H    . ARG A 1 28  ? -13.274 -4.052  2.465   1.00 0.00 ? 1508 ARG A H    3  
ATOM   4839  H HA   . ARG A 1 28  ? -11.939 -2.017  4.110   1.00 0.00 ? 1508 ARG A HA   3  
ATOM   4840  H HB2  . ARG A 1 28  ? -14.286 -1.592  4.679   1.00 0.00 ? 1508 ARG A HB2  3  
ATOM   4841  H HB3  . ARG A 1 28  ? -14.597 -3.294  4.936   1.00 0.00 ? 1508 ARG A HB3  3  
ATOM   4842  H HG2  . ARG A 1 28  ? -12.393 -2.206  6.620   1.00 0.00 ? 1508 ARG A HG2  3  
ATOM   4843  H HG3  . ARG A 1 28  ? -13.934 -1.376  6.860   1.00 0.00 ? 1508 ARG A HG3  3  
ATOM   4844  H HD2  . ARG A 1 28  ? -15.085 -3.440  7.399   1.00 0.00 ? 1508 ARG A HD2  3  
ATOM   4845  H HD3  . ARG A 1 28  ? -13.695 -4.389  6.896   1.00 0.00 ? 1508 ARG A HD3  3  
ATOM   4846  H HE   . ARG A 1 28  ? -12.481 -3.800  8.799   1.00 0.00 ? 1508 ARG A HE   3  
ATOM   4847  H HH11 . ARG A 1 28  ? -15.653 -2.158  8.950   1.00 0.00 ? 1508 ARG A HH11 3  
ATOM   4848  H HH12 . ARG A 1 28  ? -15.606 -1.952  10.662  1.00 0.00 ? 1508 ARG A HH12 3  
ATOM   4849  H HH21 . ARG A 1 28  ? -12.472 -3.584  11.066  1.00 0.00 ? 1508 ARG A HH21 3  
ATOM   4850  H HH22 . ARG A 1 28  ? -13.733 -2.739  11.884  1.00 0.00 ? 1508 ARG A HH22 3  
ATOM   4851  N N    . ASP A 1 29  ? -10.735 -3.985  5.221   1.00 0.00 ? 1509 ASP A N    3  
ATOM   4852  C CA   . ASP A 1 29  ? -10.057 -5.091  5.903   1.00 0.00 ? 1509 ASP A CA   3  
ATOM   4853  C C    . ASP A 1 29  ? -10.888 -5.393  7.146   1.00 0.00 ? 1509 ASP A C    3  
ATOM   4854  O O    . ASP A 1 29  ? -10.956 -4.564  8.052   1.00 0.00 ? 1509 ASP A O    3  
ATOM   4855  C CB   . ASP A 1 29  ? -8.615  -4.708  6.268   1.00 0.00 ? 1509 ASP A CB   3  
ATOM   4856  C CG   . ASP A 1 29  ? -8.044  -5.581  7.403   1.00 0.00 ? 1509 ASP A CG   3  
ATOM   4857  O OD1  . ASP A 1 29  ? -8.160  -6.826  7.337   1.00 0.00 ? 1509 ASP A OD1  3  
ATOM   4858  O OD2  . ASP A 1 29  ? -7.470  -5.013  8.366   1.00 0.00 ? 1509 ASP A OD2  3  
ATOM   4859  H H    . ASP A 1 29  ? -10.378 -3.058  5.399   1.00 0.00 ? 1509 ASP A H    3  
ATOM   4860  H HA   . ASP A 1 29  ? -10.028 -5.971  5.265   1.00 0.00 ? 1509 ASP A HA   3  
ATOM   4861  H HB2  . ASP A 1 29  ? -7.995  -4.799  5.375   1.00 0.00 ? 1509 ASP A HB2  3  
ATOM   4862  H HB3  . ASP A 1 29  ? -8.584  -3.665  6.579   1.00 0.00 ? 1509 ASP A HB3  3  
ATOM   4863  N N    . VAL A 1 30  ? -11.623 -6.507  7.138   1.00 0.00 ? 1510 VAL A N    3  
ATOM   4864  C CA   . VAL A 1 30  ? -12.550 -6.876  8.205   1.00 0.00 ? 1510 VAL A CA   3  
ATOM   4865  C C    . VAL A 1 30  ? -11.743 -7.041  9.499   1.00 0.00 ? 1510 VAL A C    3  
ATOM   4866  O O    . VAL A 1 30  ? -12.035 -6.386  10.503  1.00 0.00 ? 1510 VAL A O    3  
ATOM   4867  C CB   . VAL A 1 30  ? -13.325 -8.167  7.861   1.00 0.00 ? 1510 VAL A CB   3  
ATOM   4868  C CG1  . VAL A 1 30  ? -14.588 -8.345  8.682   1.00 0.00 ? 1510 VAL A CG1  3  
ATOM   4869  C CG2  . VAL A 1 30  ? -13.793 -8.255  6.410   1.00 0.00 ? 1510 VAL A CG2  3  
ATOM   4870  H H    . VAL A 1 30  ? -11.456 -7.189  6.412   1.00 0.00 ? 1510 VAL A H    3  
ATOM   4871  H HA   . VAL A 1 30  ? -13.265 -6.067  8.316   1.00 0.00 ? 1510 VAL A HA   3  
ATOM   4872  H HB   . VAL A 1 30  ? -12.681 -9.012  8.062   1.00 0.00 ? 1510 VAL A HB   3  
ATOM   4873  H HG11 . VAL A 1 30  ? -15.342 -7.615  8.363   1.00 0.00 ? 1510 VAL A HG11 3  
ATOM   4874  H HG12 . VAL A 1 30  ? -14.961 -9.359  8.504   1.00 0.00 ? 1510 VAL A HG12 3  
ATOM   4875  H HG13 . VAL A 1 30  ? -14.348 -8.237  9.739   1.00 0.00 ? 1510 VAL A HG13 3  
ATOM   4876  H HG21 . VAL A 1 30  ? -12.927 -8.390  5.785   1.00 0.00 ? 1510 VAL A HG21 3  
ATOM   4877  H HG22 . VAL A 1 30  ? -14.448 -9.124  6.254   1.00 0.00 ? 1510 VAL A HG22 3  
ATOM   4878  H HG23 . VAL A 1 30  ? -14.313 -7.335  6.142   1.00 0.00 ? 1510 VAL A HG23 3  
ATOM   4879  N N    . GLY A 1 31  ? -10.717 -7.894  9.446   1.00 0.00 ? 1511 GLY A N    3  
ATOM   4880  C CA   . GLY A 1 31  ? -9.839  -8.216  10.557  1.00 0.00 ? 1511 GLY A CA   3  
ATOM   4881  C C    . GLY A 1 31  ? -9.490  -9.693  10.485  1.00 0.00 ? 1511 GLY A C    3  
ATOM   4882  O O    . GLY A 1 31  ? -10.109 -10.438 9.725   1.00 0.00 ? 1511 GLY A O    3  
ATOM   4883  H H    . GLY A 1 31  ? -10.567 -8.427  8.589   1.00 0.00 ? 1511 GLY A H    3  
ATOM   4884  H HA2  . GLY A 1 31  ? -8.929  -7.621  10.489  1.00 0.00 ? 1511 GLY A HA2  3  
ATOM   4885  H HA3  . GLY A 1 31  ? -10.329 -8.014  11.507  1.00 0.00 ? 1511 GLY A HA3  3  
ATOM   4886  N N    . ALA A 1 32  ? -8.508  -10.133 11.273  1.00 0.00 ? 1512 ALA A N    3  
ATOM   4887  C CA   . ALA A 1 32  ? -8.096  -11.535 11.414  1.00 0.00 ? 1512 ALA A CA   3  
ATOM   4888  C C    . ALA A 1 32  ? -7.684  -12.249 10.111  1.00 0.00 ? 1512 ALA A C    3  
ATOM   4889  O O    . ALA A 1 32  ? -7.495  -13.469 10.112  1.00 0.00 ? 1512 ALA A O    3  
ATOM   4890  C CB   . ALA A 1 32  ? -9.197  -12.293 12.171  1.00 0.00 ? 1512 ALA A CB   3  
ATOM   4891  H H    . ALA A 1 32  ? -8.025  -9.458  11.856  1.00 0.00 ? 1512 ALA A H    3  
ATOM   4892  H HA   . ALA A 1 32  ? -7.209  -11.530 12.043  1.00 0.00 ? 1512 ALA A HA   3  
ATOM   4893  H HB1  . ALA A 1 32  ? -8.858  -13.301 12.414  1.00 0.00 ? 1512 ALA A HB1  3  
ATOM   4894  H HB2  . ALA A 1 32  ? -9.441  -11.767 13.095  1.00 0.00 ? 1512 ALA A HB2  3  
ATOM   4895  H HB3  . ALA A 1 32  ? -10.090 -12.350 11.550  1.00 0.00 ? 1512 ALA A HB3  3  
ATOM   4896  N N    . GLY A 1 33  ? -7.548  -11.521 8.998   1.00 0.00 ? 1513 GLY A N    3  
ATOM   4897  C CA   . GLY A 1 33  ? -7.211  -12.047 7.683   1.00 0.00 ? 1513 GLY A CA   3  
ATOM   4898  C C    . GLY A 1 33  ? -8.409  -11.997 6.746   1.00 0.00 ? 1513 GLY A C    3  
ATOM   4899  O O    . GLY A 1 33  ? -8.243  -12.261 5.560   1.00 0.00 ? 1513 GLY A O    3  
ATOM   4900  H H    . GLY A 1 33  ? -7.809  -10.546 9.026   1.00 0.00 ? 1513 GLY A H    3  
ATOM   4901  H HA2  . GLY A 1 33  ? -6.414  -11.434 7.261   1.00 0.00 ? 1513 GLY A HA2  3  
ATOM   4902  H HA3  . GLY A 1 33  ? -6.858  -13.076 7.751   1.00 0.00 ? 1513 GLY A HA3  3  
ATOM   4903  N N    . LYS A 1 34  ? -9.615  -11.683 7.230   1.00 0.00 ? 1514 LYS A N    3  
ATOM   4904  C CA   . LYS A 1 34  ? -10.757 -11.423 6.366   1.00 0.00 ? 1514 LYS A CA   3  
ATOM   4905  C C    . LYS A 1 34  ? -10.639 -10.005 5.830   1.00 0.00 ? 1514 LYS A C    3  
ATOM   4906  O O    . LYS A 1 34  ? -10.401 -9.071  6.594   1.00 0.00 ? 1514 LYS A O    3  
ATOM   4907  C CB   . LYS A 1 34  ? -12.080 -11.534 7.140   1.00 0.00 ? 1514 LYS A CB   3  
ATOM   4908  C CG   . LYS A 1 34  ? -12.609 -12.948 7.370   1.00 0.00 ? 1514 LYS A CG   3  
ATOM   4909  C CD   . LYS A 1 34  ? -12.087 -13.625 8.654   1.00 0.00 ? 1514 LYS A CD   3  
ATOM   4910  C CE   . LYS A 1 34  ? -12.664 -13.044 9.963   1.00 0.00 ? 1514 LYS A CE   3  
ATOM   4911  N NZ   . LYS A 1 34  ? -14.076 -13.452 10.219  1.00 0.00 ? 1514 LYS A NZ   3  
ATOM   4912  H H    . LYS A 1 34  ? -9.707  -11.426 8.209   1.00 0.00 ? 1514 LYS A H    3  
ATOM   4913  H HA   . LYS A 1 34  ? -10.761 -12.126 5.531   1.00 0.00 ? 1514 LYS A HA   3  
ATOM   4914  H HB2  . LYS A 1 34  ? -12.010 -11.011 8.087   1.00 0.00 ? 1514 LYS A HB2  3  
ATOM   4915  H HB3  . LYS A 1 34  ? -12.832 -11.015 6.552   1.00 0.00 ? 1514 LYS A HB3  3  
ATOM   4916  H HG2  . LYS A 1 34  ? -13.692 -12.873 7.424   1.00 0.00 ? 1514 LYS A HG2  3  
ATOM   4917  H HG3  . LYS A 1 34  ? -12.360 -13.557 6.500   1.00 0.00 ? 1514 LYS A HG3  3  
ATOM   4918  H HD2  . LYS A 1 34  ? -12.311 -14.693 8.604   1.00 0.00 ? 1514 LYS A HD2  3  
ATOM   4919  H HD3  . LYS A 1 34  ? -11.002 -13.526 8.695   1.00 0.00 ? 1514 LYS A HD3  3  
ATOM   4920  H HE2  . LYS A 1 34  ? -12.046 -13.403 10.794  1.00 0.00 ? 1514 LYS A HE2  3  
ATOM   4921  H HE3  . LYS A 1 34  ? -12.580 -11.951 9.944   1.00 0.00 ? 1514 LYS A HE3  3  
ATOM   4922  H HZ1  . LYS A 1 34  ? -14.397 -13.087 11.112  1.00 0.00 ? 1514 LYS A HZ1  3  
ATOM   4923  H HZ2  . LYS A 1 34  ? -14.717 -13.115 9.512   1.00 0.00 ? 1514 LYS A HZ2  3  
ATOM   4924  H HZ3  . LYS A 1 34  ? -14.167 -14.462 10.271  1.00 0.00 ? 1514 LYS A HZ3  3  
ATOM   4925  N N    . TYR A 1 35  ? -10.980 -9.833  4.559   1.00 0.00 ? 1515 TYR A N    3  
ATOM   4926  C CA   . TYR A 1 35  ? -11.154 -8.553  3.891   1.00 0.00 ? 1515 TYR A CA   3  
ATOM   4927  C C    . TYR A 1 35  ? -12.516 -8.664  3.208   1.00 0.00 ? 1515 TYR A C    3  
ATOM   4928  O O    . TYR A 1 35  ? -12.838 -9.714  2.652   1.00 0.00 ? 1515 TYR A O    3  
ATOM   4929  C CB   . TYR A 1 35  ? -10.035 -8.286  2.879   1.00 0.00 ? 1515 TYR A CB   3  
ATOM   4930  C CG   . TYR A 1 35  ? -8.598  -8.432  3.365   1.00 0.00 ? 1515 TYR A CG   3  
ATOM   4931  C CD1  . TYR A 1 35  ? -8.067  -9.704  3.662   1.00 0.00 ? 1515 TYR A CD1  3  
ATOM   4932  C CD2  . TYR A 1 35  ? -7.781  -7.293  3.519   1.00 0.00 ? 1515 TYR A CD2  3  
ATOM   4933  C CE1  . TYR A 1 35  ? -6.748  -9.844  4.124   1.00 0.00 ? 1515 TYR A CE1  3  
ATOM   4934  C CE2  . TYR A 1 35  ? -6.455  -7.425  3.971   1.00 0.00 ? 1515 TYR A CE2  3  
ATOM   4935  C CZ   . TYR A 1 35  ? -5.929  -8.703  4.272   1.00 0.00 ? 1515 TYR A CZ   3  
ATOM   4936  O OH   . TYR A 1 35  ? -4.641  -8.854  4.701   1.00 0.00 ? 1515 TYR A OH   3  
ATOM   4937  H H    . TYR A 1 35  ? -11.212 -10.653 4.005   1.00 0.00 ? 1515 TYR A H    3  
ATOM   4938  H HA   . TYR A 1 35  ? -11.162 -7.738  4.609   1.00 0.00 ? 1515 TYR A HA   3  
ATOM   4939  H HB2  . TYR A 1 35  ? -10.180 -8.944  2.029   1.00 0.00 ? 1515 TYR A HB2  3  
ATOM   4940  H HB3  . TYR A 1 35  ? -10.178 -7.264  2.542   1.00 0.00 ? 1515 TYR A HB3  3  
ATOM   4941  H HD1  . TYR A 1 35  ? -8.670  -10.591 3.536   1.00 0.00 ? 1515 TYR A HD1  3  
ATOM   4942  H HD2  . TYR A 1 35  ? -8.164  -6.306  3.292   1.00 0.00 ? 1515 TYR A HD2  3  
ATOM   4943  H HE1  . TYR A 1 35  ? -6.370  -10.830 4.367   1.00 0.00 ? 1515 TYR A HE1  3  
ATOM   4944  H HE2  . TYR A 1 35  ? -5.839  -6.542  4.087   1.00 0.00 ? 1515 TYR A HE2  3  
ATOM   4945  H HH   . TYR A 1 35  ? -4.148  -8.019  4.768   1.00 0.00 ? 1515 TYR A HH   3  
ATOM   4946  N N    . LYS A 1 36  ? -13.374 -7.653  3.323   1.00 0.00 ? 1516 LYS A N    3  
ATOM   4947  C CA   . LYS A 1 36  ? -14.673 -7.677  2.674   1.00 0.00 ? 1516 LYS A CA   3  
ATOM   4948  C C    . LYS A 1 36  ? -14.491 -7.208  1.248   1.00 0.00 ? 1516 LYS A C    3  
ATOM   4949  O O    . LYS A 1 36  ? -13.686 -6.315  0.978   1.00 0.00 ? 1516 LYS A O    3  
ATOM   4950  C CB   . LYS A 1 36  ? -15.651 -6.857  3.510   1.00 0.00 ? 1516 LYS A CB   3  
ATOM   4951  C CG   . LYS A 1 36  ? -17.085 -6.857  2.974   1.00 0.00 ? 1516 LYS A CG   3  
ATOM   4952  C CD   . LYS A 1 36  ? -18.103 -6.710  4.111   1.00 0.00 ? 1516 LYS A CD   3  
ATOM   4953  C CE   . LYS A 1 36  ? -17.874 -5.498  5.040   1.00 0.00 ? 1516 LYS A CE   3  
ATOM   4954  N NZ   . LYS A 1 36  ? -19.026 -5.274  5.960   1.00 0.00 ? 1516 LYS A NZ   3  
ATOM   4955  H H    . LYS A 1 36  ? -13.136 -6.819  3.853   1.00 0.00 ? 1516 LYS A H    3  
ATOM   4956  H HA   . LYS A 1 36  ? -15.023 -8.710  2.631   1.00 0.00 ? 1516 LYS A HA   3  
ATOM   4957  H HB2  . LYS A 1 36  ? -15.665 -7.330  4.482   1.00 0.00 ? 1516 LYS A HB2  3  
ATOM   4958  H HB3  . LYS A 1 36  ? -15.284 -5.831  3.615   1.00 0.00 ? 1516 LYS A HB3  3  
ATOM   4959  H HG2  . LYS A 1 36  ? -17.224 -6.065  2.242   1.00 0.00 ? 1516 LYS A HG2  3  
ATOM   4960  H HG3  . LYS A 1 36  ? -17.282 -7.808  2.482   1.00 0.00 ? 1516 LYS A HG3  3  
ATOM   4961  H HD2  . LYS A 1 36  ? -19.087 -6.644  3.641   1.00 0.00 ? 1516 LYS A HD2  3  
ATOM   4962  H HD3  . LYS A 1 36  ? -18.043 -7.622  4.715   1.00 0.00 ? 1516 LYS A HD3  3  
ATOM   4963  H HE2  . LYS A 1 36  ? -16.963 -5.665  5.633   1.00 0.00 ? 1516 LYS A HE2  3  
ATOM   4964  H HE3  . LYS A 1 36  ? -17.724 -4.603  4.429   1.00 0.00 ? 1516 LYS A HE3  3  
ATOM   4965  H HZ1  . LYS A 1 36  ? -19.886 -5.089  5.452   1.00 0.00 ? 1516 LYS A HZ1  3  
ATOM   4966  H HZ2  . LYS A 1 36  ? -19.193 -6.072  6.559   1.00 0.00 ? 1516 LYS A HZ2  3  
ATOM   4967  H HZ3  . LYS A 1 36  ? -18.864 -4.472  6.561   1.00 0.00 ? 1516 LYS A HZ3  3  
ATOM   4968  N N    . LEU A 1 37  ? -15.226 -7.837  0.343   1.00 0.00 ? 1517 LEU A N    3  
ATOM   4969  C CA   . LEU A 1 37  ? -15.042 -7.705  -1.085  1.00 0.00 ? 1517 LEU A CA   3  
ATOM   4970  C C    . LEU A 1 37  ? -16.377 -7.373  -1.711  1.00 0.00 ? 1517 LEU A C    3  
ATOM   4971  O O    . LEU A 1 37  ? -17.292 -8.191  -1.665  1.00 0.00 ? 1517 LEU A O    3  
ATOM   4972  C CB   . LEU A 1 37  ? -14.546 -9.050  -1.659  1.00 0.00 ? 1517 LEU A CB   3  
ATOM   4973  C CG   . LEU A 1 37  ? -13.033 -9.208  -1.827  1.00 0.00 ? 1517 LEU A CG   3  
ATOM   4974  C CD1  . LEU A 1 37  ? -12.532 -8.357  -2.990  1.00 0.00 ? 1517 LEU A CD1  3  
ATOM   4975  C CD2  . LEU A 1 37  ? -12.229 -8.880  -0.573  1.00 0.00 ? 1517 LEU A CD2  3  
ATOM   4976  H H    . LEU A 1 37  ? -15.876 -8.555  0.648   1.00 0.00 ? 1517 LEU A H    3  
ATOM   4977  H HA   . LEU A 1 37  ? -14.333 -6.912  -1.307  1.00 0.00 ? 1517 LEU A HA   3  
ATOM   4978  H HB2  . LEU A 1 37  ? -14.920 -9.871  -1.038  1.00 0.00 ? 1517 LEU A HB2  3  
ATOM   4979  H HB3  . LEU A 1 37  ? -14.992 -9.196  -2.641  1.00 0.00 ? 1517 LEU A HB3  3  
ATOM   4980  H HG   . LEU A 1 37  ? -12.841 -10.250 -2.061  1.00 0.00 ? 1517 LEU A HG   3  
ATOM   4981  H HD11 . LEU A 1 37  ? -12.715 -7.303  -2.794  1.00 0.00 ? 1517 LEU A HD11 3  
ATOM   4982  H HD12 . LEU A 1 37  ? -11.464 -8.512  -3.112  1.00 0.00 ? 1517 LEU A HD12 3  
ATOM   4983  H HD13 . LEU A 1 37  ? -13.037 -8.644  -3.913  1.00 0.00 ? 1517 LEU A HD13 3  
ATOM   4984  H HD21 . LEU A 1 37  ? -12.588 -9.503  0.244   1.00 0.00 ? 1517 LEU A HD21 3  
ATOM   4985  H HD22 . LEU A 1 37  ? -11.182 -9.101  -0.745  1.00 0.00 ? 1517 LEU A HD22 3  
ATOM   4986  H HD23 . LEU A 1 37  ? -12.310 -7.827  -0.309  1.00 0.00 ? 1517 LEU A HD23 3  
ATOM   4987  N N    . LEU A 1 38  ? -16.463 -6.189  -2.310  1.00 0.00 ? 1518 LEU A N    3  
ATOM   4988  C CA   . LEU A 1 38  ? -17.561 -5.788  -3.162  1.00 0.00 ? 1518 LEU A CA   3  
ATOM   4989  C C    . LEU A 1 38  ? -17.192 -6.390  -4.494  1.00 0.00 ? 1518 LEU A C    3  
ATOM   4990  O O    . LEU A 1 38  ? -16.371 -5.833  -5.226  1.00 0.00 ? 1518 LEU A O    3  
ATOM   4991  C CB   . LEU A 1 38  ? -17.706 -4.260  -3.245  1.00 0.00 ? 1518 LEU A CB   3  
ATOM   4992  C CG   . LEU A 1 38  ? -18.628 -3.757  -4.376  1.00 0.00 ? 1518 LEU A CG   3  
ATOM   4993  C CD1  . LEU A 1 38  ? -20.066 -4.262  -4.251  1.00 0.00 ? 1518 LEU A CD1  3  
ATOM   4994  C CD2  . LEU A 1 38  ? -18.649 -2.225  -4.345  1.00 0.00 ? 1518 LEU A CD2  3  
ATOM   4995  H H    . LEU A 1 38  ? -15.662 -5.574  -2.276  1.00 0.00 ? 1518 LEU A H    3  
ATOM   4996  H HA   . LEU A 1 38  ? -18.490 -6.221  -2.810  1.00 0.00 ? 1518 LEU A HA   3  
ATOM   4997  H HB2  . LEU A 1 38  ? -18.132 -3.914  -2.309  1.00 0.00 ? 1518 LEU A HB2  3  
ATOM   4998  H HB3  . LEU A 1 38  ? -16.715 -3.812  -3.355  1.00 0.00 ? 1518 LEU A HB3  3  
ATOM   4999  H HG   . LEU A 1 38  ? -18.237 -4.074  -5.340  1.00 0.00 ? 1518 LEU A HG   3  
ATOM   5000  H HD11 . LEU A 1 38  ? -20.645 -3.914  -5.103  1.00 0.00 ? 1518 LEU A HD11 3  
ATOM   5001  H HD12 . LEU A 1 38  ? -20.089 -5.350  -4.240  1.00 0.00 ? 1518 LEU A HD12 3  
ATOM   5002  H HD13 . LEU A 1 38  ? -20.521 -3.887  -3.334  1.00 0.00 ? 1518 LEU A HD13 3  
ATOM   5003  H HD21 . LEU A 1 38  ? -19.263 -1.842  -5.167  1.00 0.00 ? 1518 LEU A HD21 3  
ATOM   5004  H HD22 . LEU A 1 38  ? -19.064 -1.868  -3.401  1.00 0.00 ? 1518 LEU A HD22 3  
ATOM   5005  H HD23 . LEU A 1 38  ? -17.638 -1.832  -4.452  1.00 0.00 ? 1518 LEU A HD23 3  
ATOM   5006  N N    . PHE A 1 39  ? -17.715 -7.574  -4.758  1.00 0.00 ? 1519 PHE A N    3  
ATOM   5007  C CA   . PHE A 1 39  ? -17.623 -8.168  -6.068  1.00 0.00 ? 1519 PHE A CA   3  
ATOM   5008  C C    . PHE A 1 39  ? -18.268 -7.221  -7.078  1.00 0.00 ? 1519 PHE A C    3  
ATOM   5009  O O    . PHE A 1 39  ? -19.170 -6.450  -6.749  1.00 0.00 ? 1519 PHE A O    3  
ATOM   5010  C CB   . PHE A 1 39  ? -18.307 -9.527  -6.043  1.00 0.00 ? 1519 PHE A CB   3  
ATOM   5011  C CG   . PHE A 1 39  ? -17.580 -10.581 -5.238  1.00 0.00 ? 1519 PHE A CG   3  
ATOM   5012  C CD1  . PHE A 1 39  ? -16.515 -11.270 -5.836  1.00 0.00 ? 1519 PHE A CD1  3  
ATOM   5013  C CD2  . PHE A 1 39  ? -17.962 -10.885 -3.916  1.00 0.00 ? 1519 PHE A CD2  3  
ATOM   5014  C CE1  . PHE A 1 39  ? -15.865 -12.296 -5.139  1.00 0.00 ? 1519 PHE A CE1  3  
ATOM   5015  C CE2  . PHE A 1 39  ? -17.308 -11.916 -3.215  1.00 0.00 ? 1519 PHE A CE2  3  
ATOM   5016  C CZ   . PHE A 1 39  ? -16.254 -12.625 -3.832  1.00 0.00 ? 1519 PHE A CZ   3  
ATOM   5017  H H    . PHE A 1 39  ? -18.406 -7.950  -4.121  1.00 0.00 ? 1519 PHE A H    3  
ATOM   5018  H HA   . PHE A 1 39  ? -16.576 -8.321  -6.317  1.00 0.00 ? 1519 PHE A HA   3  
ATOM   5019  H HB2  . PHE A 1 39  ? -19.315 -9.394  -5.654  1.00 0.00 ? 1519 PHE A HB2  3  
ATOM   5020  H HB3  . PHE A 1 39  ? -18.380 -9.888  -7.068  1.00 0.00 ? 1519 PHE A HB3  3  
ATOM   5021  H HD1  . PHE A 1 39  ? -16.188 -11.016 -6.834  1.00 0.00 ? 1519 PHE A HD1  3  
ATOM   5022  H HD2  . PHE A 1 39  ? -18.757 -10.329 -3.434  1.00 0.00 ? 1519 PHE A HD2  3  
ATOM   5023  H HE1  . PHE A 1 39  ? -15.062 -12.833 -5.617  1.00 0.00 ? 1519 PHE A HE1  3  
ATOM   5024  H HE2  . PHE A 1 39  ? -17.629 -12.154 -2.204  1.00 0.00 ? 1519 PHE A HE2  3  
ATOM   5025  H HZ   . PHE A 1 39  ? -15.733 -13.424 -3.320  1.00 0.00 ? 1519 PHE A HZ   3  
ATOM   5026  N N    . ASP A 1 40  ? -17.805 -7.272  -8.323  1.00 0.00 ? 1520 ASP A N    3  
ATOM   5027  C CA   . ASP A 1 40  ? -18.301 -6.385  -9.380  1.00 0.00 ? 1520 ASP A CA   3  
ATOM   5028  C C    . ASP A 1 40  ? -19.766 -6.681  -9.718  1.00 0.00 ? 1520 ASP A C    3  
ATOM   5029  O O    . ASP A 1 40  ? -20.457 -5.833  -10.284 1.00 0.00 ? 1520 ASP A O    3  
ATOM   5030  C CB   . ASP A 1 40  ? -17.429 -6.512  -10.636 1.00 0.00 ? 1520 ASP A CB   3  
ATOM   5031  C CG   . ASP A 1 40  ? -16.206 -5.589  -10.579 1.00 0.00 ? 1520 ASP A CG   3  
ATOM   5032  O OD1  . ASP A 1 40  ? -16.386 -4.350  -10.612 1.00 0.00 ? 1520 ASP A OD1  3  
ATOM   5033  O OD2  . ASP A 1 40  ? -15.062 -6.095  -10.500 1.00 0.00 ? 1520 ASP A OD2  3  
ATOM   5034  H H    . ASP A 1 40  ? -17.090 -7.960  -8.554  1.00 0.00 ? 1520 ASP A H    3  
ATOM   5035  H HA   . ASP A 1 40  ? -18.253 -5.354  -9.031  1.00 0.00 ? 1520 ASP A HA   3  
ATOM   5036  H HB2  . ASP A 1 40  ? -17.124 -7.551  -10.774 1.00 0.00 ? 1520 ASP A HB2  3  
ATOM   5037  H HB3  . ASP A 1 40  ? -18.020 -6.226  -11.506 1.00 0.00 ? 1520 ASP A HB3  3  
ATOM   5038  N N    . ASP A 1 41  ? -20.257 -7.867  -9.343  1.00 0.00 ? 1521 ASP A N    3  
ATOM   5039  C CA   . ASP A 1 41  ? -21.660 -8.269  -9.438  1.00 0.00 ? 1521 ASP A CA   3  
ATOM   5040  C C    . ASP A 1 41  ? -22.518 -7.794  -8.262  1.00 0.00 ? 1521 ASP A C    3  
ATOM   5041  O O    . ASP A 1 41  ? -23.709 -8.104  -8.209  1.00 0.00 ? 1521 ASP A O    3  
ATOM   5042  C CB   . ASP A 1 41  ? -21.768 -9.775  -9.654  1.00 0.00 ? 1521 ASP A CB   3  
ATOM   5043  C CG   . ASP A 1 41  ? -21.493 -10.617 -8.422  1.00 0.00 ? 1521 ASP A CG   3  
ATOM   5044  O OD1  . ASP A 1 41  ? -20.904 -10.103 -7.448  1.00 0.00 ? 1521 ASP A OD1  3  
ATOM   5045  O OD2  . ASP A 1 41  ? -21.869 -11.809 -8.431  1.00 0.00 ? 1521 ASP A OD2  3  
ATOM   5046  H H    . ASP A 1 41  ? -19.662 -8.490  -8.812  1.00 0.00 ? 1521 ASP A H    3  
ATOM   5047  H HA   . ASP A 1 41  ? -22.097 -7.821  -10.317 1.00 0.00 ? 1521 ASP A HA   3  
ATOM   5048  H HB2  . ASP A 1 41  ? -22.788 -9.972  -9.964  1.00 0.00 ? 1521 ASP A HB2  3  
ATOM   5049  H HB3  . ASP A 1 41  ? -21.092 -10.080 -10.456 1.00 0.00 ? 1521 ASP A HB3  3  
ATOM   5050  N N    . GLY A 1 42  ? -21.951 -7.001  -7.352  1.00 0.00 ? 1522 GLY A N    3  
ATOM   5051  C CA   . GLY A 1 42  ? -22.688 -6.309  -6.308  1.00 0.00 ? 1522 GLY A CA   3  
ATOM   5052  C C    . GLY A 1 42  ? -22.803 -7.121  -5.021  1.00 0.00 ? 1522 GLY A C    3  
ATOM   5053  O O    . GLY A 1 42  ? -23.353 -6.605  -4.044  1.00 0.00 ? 1522 GLY A O    3  
ATOM   5054  H H    . GLY A 1 42  ? -20.952 -6.842  -7.402  1.00 0.00 ? 1522 GLY A H    3  
ATOM   5055  H HA2  . GLY A 1 42  ? -22.173 -5.378  -6.086  1.00 0.00 ? 1522 GLY A HA2  3  
ATOM   5056  H HA3  . GLY A 1 42  ? -23.691 -6.069  -6.663  1.00 0.00 ? 1522 GLY A HA3  3  
ATOM   5057  N N    . TYR A 1 43  ? -22.314 -8.369  -4.991  1.00 0.00 ? 1523 TYR A N    3  
ATOM   5058  C CA   . TYR A 1 43  ? -22.200 -9.107  -3.741  1.00 0.00 ? 1523 TYR A CA   3  
ATOM   5059  C C    . TYR A 1 43  ? -21.161 -8.412  -2.852  1.00 0.00 ? 1523 TYR A C    3  
ATOM   5060  O O    . TYR A 1 43  ? -20.165 -7.895  -3.360  1.00 0.00 ? 1523 TYR A O    3  
ATOM   5061  C CB   . TYR A 1 43  ? -21.792 -10.548 -4.036  1.00 0.00 ? 1523 TYR A CB   3  
ATOM   5062  C CG   . TYR A 1 43  ? -22.949 -11.407 -4.491  1.00 0.00 ? 1523 TYR A CG   3  
ATOM   5063  C CD1  . TYR A 1 43  ? -23.490 -11.262 -5.786  1.00 0.00 ? 1523 TYR A CD1  3  
ATOM   5064  C CD2  . TYR A 1 43  ? -23.494 -12.360 -3.606  1.00 0.00 ? 1523 TYR A CD2  3  
ATOM   5065  C CE1  . TYR A 1 43  ? -24.587 -12.043 -6.159  1.00 0.00 ? 1523 TYR A CE1  3  
ATOM   5066  C CE2  . TYR A 1 43  ? -24.595 -13.142 -3.992  1.00 0.00 ? 1523 TYR A CE2  3  
ATOM   5067  C CZ   . TYR A 1 43  ? -25.161 -12.982 -5.275  1.00 0.00 ? 1523 TYR A CZ   3  
ATOM   5068  O OH   . TYR A 1 43  ? -26.237 -13.720 -5.672  1.00 0.00 ? 1523 TYR A OH   3  
ATOM   5069  H H    . TYR A 1 43  ? -21.860 -8.752  -5.815  1.00 0.00 ? 1523 TYR A H    3  
ATOM   5070  H HA   . TYR A 1 43  ? -23.171 -9.123  -3.240  1.00 0.00 ? 1523 TYR A HA   3  
ATOM   5071  H HB2  . TYR A 1 43  ? -21.015 -10.556 -4.796  1.00 0.00 ? 1523 TYR A HB2  3  
ATOM   5072  H HB3  . TYR A 1 43  ? -21.368 -10.984 -3.130  1.00 0.00 ? 1523 TYR A HB3  3  
ATOM   5073  H HD1  . TYR A 1 43  ? -23.090 -10.566 -6.530  1.00 0.00 ? 1523 TYR A HD1  3  
ATOM   5074  H HD2  . TYR A 1 43  ? -23.074 -12.503 -2.617  1.00 0.00 ? 1523 TYR A HD2  3  
ATOM   5075  H HE1  . TYR A 1 43  ? -24.977 -11.910 -7.146  1.00 0.00 ? 1523 TYR A HE1  3  
ATOM   5076  H HE2  . TYR A 1 43  ? -24.999 -13.864 -3.292  1.00 0.00 ? 1523 TYR A HE2  3  
ATOM   5077  H HH   . TYR A 1 43  ? -26.575 -14.329 -4.993  1.00 0.00 ? 1523 TYR A HH   3  
ATOM   5078  N N    . GLU A 1 44  ? -21.345 -8.460  -1.529  1.00 0.00 ? 1524 GLU A N    3  
ATOM   5079  C CA   . GLU A 1 44  ? -20.407 -7.911  -0.555  1.00 0.00 ? 1524 GLU A CA   3  
ATOM   5080  C C    . GLU A 1 44  ? -20.345 -8.889  0.609   1.00 0.00 ? 1524 GLU A C    3  
ATOM   5081  O O    . GLU A 1 44  ? -21.292 -8.971  1.399   1.00 0.00 ? 1524 GLU A O    3  
ATOM   5082  C CB   . GLU A 1 44  ? -20.813 -6.517  -0.048  1.00 0.00 ? 1524 GLU A CB   3  
ATOM   5083  C CG   . GLU A 1 44  ? -20.458 -5.389  -0.996  1.00 0.00 ? 1524 GLU A CG   3  
ATOM   5084  C CD   . GLU A 1 44  ? -21.007 -4.047  -0.477  1.00 0.00 ? 1524 GLU A CD   3  
ATOM   5085  O OE1  . GLU A 1 44  ? -22.157 -3.681  -0.815  1.00 0.00 ? 1524 GLU A OE1  3  
ATOM   5086  O OE2  . GLU A 1 44  ? -20.287 -3.349  0.277   1.00 0.00 ? 1524 GLU A OE2  3  
ATOM   5087  H H    . GLU A 1 44  ? -22.115 -8.988  -1.152  1.00 0.00 ? 1524 GLU A H    3  
ATOM   5088  H HA   . GLU A 1 44  ? -19.427 -7.825  -1.005  1.00 0.00 ? 1524 GLU A HA   3  
ATOM   5089  H HB2  . GLU A 1 44  ? -21.888 -6.477  0.128   1.00 0.00 ? 1524 GLU A HB2  3  
ATOM   5090  H HB3  . GLU A 1 44  ? -20.267 -6.315  0.873   1.00 0.00 ? 1524 GLU A HB3  3  
ATOM   5091  H HG2  . GLU A 1 44  ? -19.370 -5.339  -1.059  1.00 0.00 ? 1524 GLU A HG2  3  
ATOM   5092  H HG3  . GLU A 1 44  ? -20.886 -5.614  -1.971  1.00 0.00 ? 1524 GLU A HG3  3  
ATOM   5093  N N    . CYS A 1 45  ? -19.232 -9.618  0.716   1.00 0.00 ? 1525 CYS A N    3  
ATOM   5094  C CA   . CYS A 1 45  ? -19.004 -10.620 1.750   1.00 0.00 ? 1525 CYS A CA   3  
ATOM   5095  C C    . CYS A 1 45  ? -17.526 -10.607 2.132   1.00 0.00 ? 1525 CYS A C    3  
ATOM   5096  O O    . CYS A 1 45  ? -16.681 -10.122 1.375   1.00 0.00 ? 1525 CYS A O    3  
ATOM   5097  C CB   . CYS A 1 45  ? -19.400 -12.021 1.246   1.00 0.00 ? 1525 CYS A CB   3  
ATOM   5098  S SG   . CYS A 1 45  ? -21.146 -12.093 0.728   1.00 0.00 ? 1525 CYS A SG   3  
ATOM   5099  H H    . CYS A 1 45  ? -18.477 -9.479  0.050   1.00 0.00 ? 1525 CYS A H    3  
ATOM   5100  H HA   . CYS A 1 45  ? -19.603 -10.373 2.629   1.00 0.00 ? 1525 CYS A HA   3  
ATOM   5101  H HB2  . CYS A 1 45  ? -18.742 -12.300 0.426   1.00 0.00 ? 1525 CYS A HB2  3  
ATOM   5102  H HB3  . CYS A 1 45  ? -19.256 -12.752 2.042   1.00 0.00 ? 1525 CYS A HB3  3  
ATOM   5103  H HG   . CYS A 1 45  ? -21.679 -11.607 1.861   1.00 0.00 ? 1525 CYS A HG   3  
ATOM   5104  N N    . ASP A 1 46  ? -17.220 -11.140 3.309   1.00 0.00 ? 1526 ASP A N    3  
ATOM   5105  C CA   . ASP A 1 46  ? -15.857 -11.394 3.741   1.00 0.00 ? 1526 ASP A CA   3  
ATOM   5106  C C    . ASP A 1 46  ? -15.246 -12.519 2.899   1.00 0.00 ? 1526 ASP A C    3  
ATOM   5107  O O    . ASP A 1 46  ? -15.927 -13.479 2.526   1.00 0.00 ? 1526 ASP A O    3  
ATOM   5108  C CB   . ASP A 1 46  ? -15.801 -11.758 5.230   1.00 0.00 ? 1526 ASP A CB   3  
ATOM   5109  C CG   . ASP A 1 46  ? -16.270 -13.194 5.524   1.00 0.00 ? 1526 ASP A CG   3  
ATOM   5110  O OD1  . ASP A 1 46  ? -17.501 -13.409 5.628   1.00 0.00 ? 1526 ASP A OD1  3  
ATOM   5111  O OD2  . ASP A 1 46  ? -15.414 -14.097 5.659   1.00 0.00 ? 1526 ASP A OD2  3  
ATOM   5112  H H    . ASP A 1 46  ? -17.953 -11.569 3.855   1.00 0.00 ? 1526 ASP A H    3  
ATOM   5113  H HA   . ASP A 1 46  ? -15.270 -10.489 3.609   1.00 0.00 ? 1526 ASP A HA   3  
ATOM   5114  H HB2  . ASP A 1 46  ? -14.768 -11.650 5.552   1.00 0.00 ? 1526 ASP A HB2  3  
ATOM   5115  H HB3  . ASP A 1 46  ? -16.392 -11.042 5.805   1.00 0.00 ? 1526 ASP A HB3  3  
ATOM   5116  N N    . VAL A 1 47  ? -13.945 -12.387 2.641   1.00 0.00 ? 1527 VAL A N    3  
ATOM   5117  C CA   . VAL A 1 47  ? -13.099 -13.394 2.011   1.00 0.00 ? 1527 VAL A CA   3  
ATOM   5118  C C    . VAL A 1 47  ? -11.753 -13.309 2.730   1.00 0.00 ? 1527 VAL A C    3  
ATOM   5119  O O    . VAL A 1 47  ? -11.308 -12.218 3.091   1.00 0.00 ? 1527 VAL A O    3  
ATOM   5120  C CB   . VAL A 1 47  ? -12.984 -13.124 0.491   1.00 0.00 ? 1527 VAL A CB   3  
ATOM   5121  C CG1  . VAL A 1 47  ? -11.913 -13.978 -0.185  1.00 0.00 ? 1527 VAL A CG1  3  
ATOM   5122  C CG2  . VAL A 1 47  ? -14.287 -13.456 -0.245  1.00 0.00 ? 1527 VAL A CG2  3  
ATOM   5123  H H    . VAL A 1 47  ? -13.476 -11.539 2.948   1.00 0.00 ? 1527 VAL A H    3  
ATOM   5124  H HA   . VAL A 1 47  ? -13.529 -14.383 2.172   1.00 0.00 ? 1527 VAL A HA   3  
ATOM   5125  H HB   . VAL A 1 47  ? -12.735 -12.073 0.330   1.00 0.00 ? 1527 VAL A HB   3  
ATOM   5126  H HG11 . VAL A 1 47  ? -11.776 -13.638 -1.209  1.00 0.00 ? 1527 VAL A HG11 3  
ATOM   5127  H HG12 . VAL A 1 47  ? -10.972 -13.866 0.334   1.00 0.00 ? 1527 VAL A HG12 3  
ATOM   5128  H HG13 . VAL A 1 47  ? -12.201 -15.026 -0.186  1.00 0.00 ? 1527 VAL A HG13 3  
ATOM   5129  H HG21 . VAL A 1 47  ? -14.553 -14.496 -0.028  1.00 0.00 ? 1527 VAL A HG21 3  
ATOM   5130  H HG22 . VAL A 1 47  ? -15.089 -12.797 0.081   1.00 0.00 ? 1527 VAL A HG22 3  
ATOM   5131  H HG23 . VAL A 1 47  ? -14.150 -13.362 -1.324  1.00 0.00 ? 1527 VAL A HG23 3  
ATOM   5132  N N    . LEU A 1 48  ? -11.107 -14.451 2.988   1.00 0.00 ? 1528 LEU A N    3  
ATOM   5133  C CA   . LEU A 1 48  ? -9.824  -14.465 3.681   1.00 0.00 ? 1528 LEU A CA   3  
ATOM   5134  C C    . LEU A 1 48  ? -8.676  -14.162 2.719   1.00 0.00 ? 1528 LEU A C    3  
ATOM   5135  O O    . LEU A 1 48  ? -8.781  -14.450 1.532   1.00 0.00 ? 1528 LEU A O    3  
ATOM   5136  C CB   . LEU A 1 48  ? -9.629  -15.814 4.390   1.00 0.00 ? 1528 LEU A CB   3  
ATOM   5137  C CG   . LEU A 1 48  ? -8.746  -15.641 5.647   1.00 0.00 ? 1528 LEU A CG   3  
ATOM   5138  C CD1  . LEU A 1 48  ? -9.587  -15.250 6.856   1.00 0.00 ? 1528 LEU A CD1  3  
ATOM   5139  C CD2  . LEU A 1 48  ? -7.917  -16.889 5.925   1.00 0.00 ? 1528 LEU A CD2  3  
ATOM   5140  H H    . LEU A 1 48  ? -11.472 -15.329 2.638   1.00 0.00 ? 1528 LEU A H    3  
ATOM   5141  H HA   . LEU A 1 48  ? -9.843  -13.683 4.432   1.00 0.00 ? 1528 LEU A HA   3  
ATOM   5142  H HB2  . LEU A 1 48  ? -10.605 -16.215 4.675   1.00 0.00 ? 1528 LEU A HB2  3  
ATOM   5143  H HB3  . LEU A 1 48  ? -9.169  -16.519 3.692   1.00 0.00 ? 1528 LEU A HB3  3  
ATOM   5144  H HG   . LEU A 1 48  ? -8.040  -14.832 5.486   1.00 0.00 ? 1528 LEU A HG   3  
ATOM   5145  H HD11 . LEU A 1 48  ? -10.291 -16.044 7.107   1.00 0.00 ? 1528 LEU A HD11 3  
ATOM   5146  H HD12 . LEU A 1 48  ? -8.942  -15.056 7.715   1.00 0.00 ? 1528 LEU A HD12 3  
ATOM   5147  H HD13 . LEU A 1 48  ? -10.134 -14.336 6.626   1.00 0.00 ? 1528 LEU A HD13 3  
ATOM   5148  H HD21 . LEU A 1 48  ? -8.565  -17.758 6.033   1.00 0.00 ? 1528 LEU A HD21 3  
ATOM   5149  H HD22 . LEU A 1 48  ? -7.239  -17.038 5.086   1.00 0.00 ? 1528 LEU A HD22 3  
ATOM   5150  H HD23 . LEU A 1 48  ? -7.328  -16.752 6.835   1.00 0.00 ? 1528 LEU A HD23 3  
ATOM   5151  N N    . GLY A 1 49  ? -7.558  -13.642 3.241   1.00 0.00 ? 1529 GLY A N    3  
ATOM   5152  C CA   . GLY A 1 49  ? -6.444  -13.112 2.463   1.00 0.00 ? 1529 GLY A CA   3  
ATOM   5153  C C    . GLY A 1 49  ? -5.915  -14.067 1.402   1.00 0.00 ? 1529 GLY A C    3  
ATOM   5154  O O    . GLY A 1 49  ? -5.600  -13.636 0.293   1.00 0.00 ? 1529 GLY A O    3  
ATOM   5155  H H    . GLY A 1 49  ? -7.549  -13.440 4.240   1.00 0.00 ? 1529 GLY A H    3  
ATOM   5156  H HA2  . GLY A 1 49  ? -6.766  -12.188 1.987   1.00 0.00 ? 1529 GLY A HA2  3  
ATOM   5157  H HA3  . GLY A 1 49  ? -5.624  -12.877 3.143   1.00 0.00 ? 1529 GLY A HA3  3  
ATOM   5158  N N    . LYS A 1 50  ? -5.832  -15.372 1.705   1.00 0.00 ? 1530 LYS A N    3  
ATOM   5159  C CA   . LYS A 1 50  ? -5.292  -16.323 0.719   1.00 0.00 ? 1530 LYS A CA   3  
ATOM   5160  C C    . LYS A 1 50  ? -6.128  -16.246 -0.554  1.00 0.00 ? 1530 LYS A C    3  
ATOM   5161  O O    . LYS A 1 50  ? -5.599  -16.233 -1.659  1.00 0.00 ? 1530 LYS A O    3  
ATOM   5162  C CB   . LYS A 1 50  ? -5.215  -17.801 1.181   1.00 0.00 ? 1530 LYS A CB   3  
ATOM   5163  C CG   . LYS A 1 50  ? -5.524  -18.155 2.638   1.00 0.00 ? 1530 LYS A CG   3  
ATOM   5164  C CD   . LYS A 1 50  ? -4.445  -17.713 3.642   1.00 0.00 ? 1530 LYS A CD   3  
ATOM   5165  C CE   . LYS A 1 50  ? -4.685  -18.483 4.947   1.00 0.00 ? 1530 LYS A CE   3  
ATOM   5166  N NZ   . LYS A 1 50  ? -3.641  -18.219 5.978   1.00 0.00 ? 1530 LYS A NZ   3  
ATOM   5167  H H    . LYS A 1 50  ? -6.167  -15.686 2.607   1.00 0.00 ? 1530 LYS A H    3  
ATOM   5168  H HA   . LYS A 1 50  ? -4.282  -15.991 0.479   1.00 0.00 ? 1530 LYS A HA   3  
ATOM   5169  H HB2  . LYS A 1 50  ? -5.914  -18.386 0.581   1.00 0.00 ? 1530 LYS A HB2  3  
ATOM   5170  H HB3  . LYS A 1 50  ? -4.227  -18.187 0.931   1.00 0.00 ? 1530 LYS A HB3  3  
ATOM   5171  H HG2  . LYS A 1 50  ? -6.497  -17.744 2.915   1.00 0.00 ? 1530 LYS A HG2  3  
ATOM   5172  H HG3  . LYS A 1 50  ? -5.604  -19.243 2.678   1.00 0.00 ? 1530 LYS A HG3  3  
ATOM   5173  H HD2  . LYS A 1 50  ? -3.456  -17.953 3.249   1.00 0.00 ? 1530 LYS A HD2  3  
ATOM   5174  H HD3  . LYS A 1 50  ? -4.522  -16.641 3.829   1.00 0.00 ? 1530 LYS A HD3  3  
ATOM   5175  H HE2  . LYS A 1 50  ? -5.674  -18.210 5.318   1.00 0.00 ? 1530 LYS A HE2  3  
ATOM   5176  H HE3  . LYS A 1 50  ? -4.707  -19.550 4.715   1.00 0.00 ? 1530 LYS A HE3  3  
ATOM   5177  H HZ1  . LYS A 1 50  ? -3.824  -18.755 6.820   1.00 0.00 ? 1530 LYS A HZ1  3  
ATOM   5178  H HZ2  . LYS A 1 50  ? -2.721  -18.492 5.654   1.00 0.00 ? 1530 LYS A HZ2  3  
ATOM   5179  H HZ3  . LYS A 1 50  ? -3.604  -17.243 6.245   1.00 0.00 ? 1530 LYS A HZ3  3  
ATOM   5180  N N    . ASP A 1 51  ? -7.442  -16.185 -0.368  1.00 0.00 ? 1531 ASP A N    3  
ATOM   5181  C CA   . ASP A 1 51  ? -8.452  -16.258 -1.423  1.00 0.00 ? 1531 ASP A CA   3  
ATOM   5182  C C    . ASP A 1 51  ? -8.665  -14.934 -2.163  1.00 0.00 ? 1531 ASP A C    3  
ATOM   5183  O O    . ASP A 1 51  ? -9.683  -14.795 -2.839  1.00 0.00 ? 1531 ASP A O    3  
ATOM   5184  C CB   . ASP A 1 51  ? -9.760  -16.823 -0.833  1.00 0.00 ? 1531 ASP A CB   3  
ATOM   5185  C CG   . ASP A 1 51  ? -9.784  -18.358 -0.891  1.00 0.00 ? 1531 ASP A CG   3  
ATOM   5186  O OD1  . ASP A 1 51  ? -9.483  -18.926 -1.967  1.00 0.00 ? 1531 ASP A OD1  3  
ATOM   5187  O OD2  . ASP A 1 51  ? -10.105 -18.995 0.139   1.00 0.00 ? 1531 ASP A OD2  3  
ATOM   5188  H H    . ASP A 1 51  ? -7.773  -16.146 0.591   1.00 0.00 ? 1531 ASP A H    3  
ATOM   5189  H HA   . ASP A 1 51  ? -8.094  -16.953 -2.180  1.00 0.00 ? 1531 ASP A HA   3  
ATOM   5190  H HB2  . ASP A 1 51  ? -9.905  -16.460 0.183   1.00 0.00 ? 1531 ASP A HB2  3  
ATOM   5191  H HB3  . ASP A 1 51  ? -10.615 -16.464 -1.400  1.00 0.00 ? 1531 ASP A HB3  3  
ATOM   5192  N N    . ILE A 1 52  ? -7.752  -13.957 -2.085  1.00 0.00 ? 1532 ILE A N    3  
ATOM   5193  C CA   . ILE A 1 52  ? -7.883  -12.683 -2.800  1.00 0.00 ? 1532 ILE A CA   3  
ATOM   5194  C C    . ILE A 1 52  ? -6.570  -12.462 -3.545  1.00 0.00 ? 1532 ILE A C    3  
ATOM   5195  O O    . ILE A 1 52  ? -5.495  -12.656 -2.980  1.00 0.00 ? 1532 ILE A O    3  
ATOM   5196  C CB   . ILE A 1 52  ? -8.257  -11.504 -1.858  1.00 0.00 ? 1532 ILE A CB   3  
ATOM   5197  C CG1  . ILE A 1 52  ? -8.682  -11.979 -0.452  1.00 0.00 ? 1532 ILE A CG1  3  
ATOM   5198  C CG2  . ILE A 1 52  ? -9.324  -10.592 -2.473  1.00 0.00 ? 1532 ILE A CG2  3  
ATOM   5199  C CD1  . ILE A 1 52  ? -9.302  -10.967 0.500   1.00 0.00 ? 1532 ILE A CD1  3  
ATOM   5200  H H    . ILE A 1 52  ? -6.923  -14.070 -1.507  1.00 0.00 ? 1532 ILE A H    3  
ATOM   5201  H HA   . ILE A 1 52  ? -8.669  -12.773 -3.540  1.00 0.00 ? 1532 ILE A HA   3  
ATOM   5202  H HB   . ILE A 1 52  ? -7.379  -10.883 -1.753  1.00 0.00 ? 1532 ILE A HB   3  
ATOM   5203  H HG12 . ILE A 1 52  ? -9.412  -12.772 -0.567  1.00 0.00 ? 1532 ILE A HG12 3  
ATOM   5204  H HG13 . ILE A 1 52  ? -7.807  -12.393 0.034   1.00 0.00 ? 1532 ILE A HG13 3  
ATOM   5205  H HG21 . ILE A 1 52  ? -9.328  -9.624  -1.962  1.00 0.00 ? 1532 ILE A HG21 3  
ATOM   5206  H HG22 . ILE A 1 52  ? -9.102  -10.411 -3.526  1.00 0.00 ? 1532 ILE A HG22 3  
ATOM   5207  H HG23 . ILE A 1 52  ? -10.296 -11.064 -2.369  1.00 0.00 ? 1532 ILE A HG23 3  
ATOM   5208  H HD11 . ILE A 1 52  ? -10.351 -10.831 0.250   1.00 0.00 ? 1532 ILE A HD11 3  
ATOM   5209  H HD12 . ILE A 1 52  ? -9.256  -11.370 1.510   1.00 0.00 ? 1532 ILE A HD12 3  
ATOM   5210  H HD13 . ILE A 1 52  ? -8.773  -10.017 0.454   1.00 0.00 ? 1532 ILE A HD13 3  
ATOM   5211  N N    . LEU A 1 53  ? -6.663  -12.083 -4.821  1.00 0.00 ? 1533 LEU A N    3  
ATOM   5212  C CA   . LEU A 1 53  ? -5.571  -12.011 -5.777  1.00 0.00 ? 1533 LEU A CA   3  
ATOM   5213  C C    . LEU A 1 53  ? -5.476  -10.560 -6.207  1.00 0.00 ? 1533 LEU A C    3  
ATOM   5214  O O    . LEU A 1 53  ? -6.406  -10.075 -6.854  1.00 0.00 ? 1533 LEU A O    3  
ATOM   5215  C CB   . LEU A 1 53  ? -5.865  -12.907 -6.997  1.00 0.00 ? 1533 LEU A CB   3  
ATOM   5216  C CG   . LEU A 1 53  ? -6.149  -14.398 -6.746  1.00 0.00 ? 1533 LEU A CG   3  
ATOM   5217  C CD1  . LEU A 1 53  ? -6.395  -15.104 -8.084  1.00 0.00 ? 1533 LEU A CD1  3  
ATOM   5218  C CD2  . LEU A 1 53  ? -5.006  -15.092 -6.020  1.00 0.00 ? 1533 LEU A CD2  3  
ATOM   5219  H H    . LEU A 1 53  ? -7.584  -11.871 -5.190  1.00 0.00 ? 1533 LEU A H    3  
ATOM   5220  H HA   . LEU A 1 53  ? -4.647  -12.330 -5.303  1.00 0.00 ? 1533 LEU A HA   3  
ATOM   5221  H HB2  . LEU A 1 53  ? -6.719  -12.493 -7.534  1.00 0.00 ? 1533 LEU A HB2  3  
ATOM   5222  H HB3  . LEU A 1 53  ? -5.005  -12.841 -7.661  1.00 0.00 ? 1533 LEU A HB3  3  
ATOM   5223  H HG   . LEU A 1 53  ? -7.032  -14.524 -6.126  1.00 0.00 ? 1533 LEU A HG   3  
ATOM   5224  H HD11 . LEU A 1 53  ? -6.453  -16.187 -7.946  1.00 0.00 ? 1533 LEU A HD11 3  
ATOM   5225  H HD12 . LEU A 1 53  ? -7.327  -14.743 -8.523  1.00 0.00 ? 1533 LEU A HD12 3  
ATOM   5226  H HD13 . LEU A 1 53  ? -5.595  -14.876 -8.786  1.00 0.00 ? 1533 LEU A HD13 3  
ATOM   5227  H HD21 . LEU A 1 53  ? -5.315  -16.113 -5.796  1.00 0.00 ? 1533 LEU A HD21 3  
ATOM   5228  H HD22 . LEU A 1 53  ? -4.109  -15.111 -6.643  1.00 0.00 ? 1533 LEU A HD22 3  
ATOM   5229  H HD23 . LEU A 1 53  ? -4.797  -14.582 -5.076  1.00 0.00 ? 1533 LEU A HD23 3  
ATOM   5230  N N    . LEU A 1 54  ? -4.389  -9.857  -5.863  1.00 0.00 ? 1534 LEU A N    3  
ATOM   5231  C CA   . LEU A 1 54  ? -4.310  -8.393  -6.030  1.00 0.00 ? 1534 LEU A CA   3  
ATOM   5232  C C    . LEU A 1 54  ? -3.275  -7.888  -7.038  1.00 0.00 ? 1534 LEU A C    3  
ATOM   5233  O O    . LEU A 1 54  ? -3.161  -6.684  -7.255  1.00 0.00 ? 1534 LEU A O    3  
ATOM   5234  C CB   . LEU A 1 54  ? -4.182  -7.686  -4.673  1.00 0.00 ? 1534 LEU A CB   3  
ATOM   5235  C CG   . LEU A 1 54  ? -2.942  -7.973  -3.806  1.00 0.00 ? 1534 LEU A CG   3  
ATOM   5236  C CD1  . LEU A 1 54  ? -1.583  -7.839  -4.483  1.00 0.00 ? 1534 LEU A CD1  3  
ATOM   5237  C CD2  . LEU A 1 54  ? -3.007  -7.004  -2.620  1.00 0.00 ? 1534 LEU A CD2  3  
ATOM   5238  H H    . LEU A 1 54  ? -3.645  -10.331 -5.358  1.00 0.00 ? 1534 LEU A H    3  
ATOM   5239  H HA   . LEU A 1 54  ? -5.268  -8.073  -6.430  1.00 0.00 ? 1534 LEU A HA   3  
ATOM   5240  H HB2  . LEU A 1 54  ? -4.246  -6.609  -4.844  1.00 0.00 ? 1534 LEU A HB2  3  
ATOM   5241  H HB3  . LEU A 1 54  ? -5.054  -7.972  -4.083  1.00 0.00 ? 1534 LEU A HB3  3  
ATOM   5242  H HG   . LEU A 1 54  ? -3.004  -9.001  -3.452  1.00 0.00 ? 1534 LEU A HG   3  
ATOM   5243  H HD11 . LEU A 1 54  ? -1.508  -6.878  -4.989  1.00 0.00 ? 1534 LEU A HD11 3  
ATOM   5244  H HD12 . LEU A 1 54  ? -0.789  -7.917  -3.741  1.00 0.00 ? 1534 LEU A HD12 3  
ATOM   5245  H HD13 . LEU A 1 54  ? -1.447  -8.652  -5.196  1.00 0.00 ? 1534 LEU A HD13 3  
ATOM   5246  H HD21 . LEU A 1 54  ? -2.721  -5.996  -2.926  1.00 0.00 ? 1534 LEU A HD21 3  
ATOM   5247  H HD22 . LEU A 1 54  ? -4.024  -6.962  -2.228  1.00 0.00 ? 1534 LEU A HD22 3  
ATOM   5248  H HD23 . LEU A 1 54  ? -2.338  -7.351  -1.833  1.00 0.00 ? 1534 LEU A HD23 3  
ATOM   5249  N N    . CYS A 1 55  ? -2.559  -8.806  -7.680  1.00 0.00 ? 1535 CYS A N    3  
ATOM   5250  C CA   . CYS A 1 55  ? -1.612  -8.538  -8.758  1.00 0.00 ? 1535 CYS A CA   3  
ATOM   5251  C C    . CYS A 1 55  ? -2.119  -9.359  -9.947  1.00 0.00 ? 1535 CYS A C    3  
ATOM   5252  O O    . CYS A 1 55  ? -1.327  -10.000 -10.629 1.00 0.00 ? 1535 CYS A O    3  
ATOM   5253  C CB   . CYS A 1 55  ? -0.201  -8.960  -8.301  1.00 0.00 ? 1535 CYS A CB   3  
ATOM   5254  S SG   . CYS A 1 55  ? 0.511   -7.693  -7.213  1.00 0.00 ? 1535 CYS A SG   3  
ATOM   5255  H H    . CYS A 1 55  ? -2.780  -9.776  -7.508  1.00 0.00 ? 1535 CYS A H    3  
ATOM   5256  H HA   . CYS A 1 55  ? -1.620  -7.477  -9.020  1.00 0.00 ? 1535 CYS A HA   3  
ATOM   5257  H HB2  . CYS A 1 55  ? -0.246  -9.918  -7.779  1.00 0.00 ? 1535 CYS A HB2  3  
ATOM   5258  H HB3  . CYS A 1 55  ? 0.457   -9.101  -9.161  1.00 0.00 ? 1535 CYS A HB3  3  
ATOM   5259  H HG   . CYS A 1 55  ? 1.687   -8.310  -7.001  1.00 0.00 ? 1535 CYS A HG   3  
ATOM   5260  N N    . ASP A 1 56  ? -3.446  -9.354  -10.173 1.00 0.00 ? 1536 ASP A N    3  
ATOM   5261  C CA   . ASP A 1 56  ? -4.089  -10.295 -11.090 1.00 0.00 ? 1536 ASP A CA   3  
ATOM   5262  C C    . ASP A 1 56  ? -4.757  -9.759  -12.364 1.00 0.00 ? 1536 ASP A C    3  
ATOM   5263  O O    . ASP A 1 56  ? -5.938  -10.043 -12.593 1.00 0.00 ? 1536 ASP A O    3  
ATOM   5264  C CB   . ASP A 1 56  ? -5.017  -11.215 -10.287 1.00 0.00 ? 1536 ASP A CB   3  
ATOM   5265  C CG   . ASP A 1 56  ? -5.474  -12.455 -11.096 1.00 0.00 ? 1536 ASP A CG   3  
ATOM   5266  O OD1  . ASP A 1 56  ? -4.819  -12.839 -12.096 1.00 0.00 ? 1536 ASP A OD1  3  
ATOM   5267  O OD2  . ASP A 1 56  ? -6.505  -13.039 -10.695 1.00 0.00 ? 1536 ASP A OD2  3  
ATOM   5268  H H    . ASP A 1 56  ? -4.045  -8.727  -9.653  1.00 0.00 ? 1536 ASP A H    3  
ATOM   5269  H HA   . ASP A 1 56  ? -3.305  -10.951 -11.463 1.00 0.00 ? 1536 ASP A HA   3  
ATOM   5270  H HB2  . ASP A 1 56  ? -4.488  -11.548 -9.398  1.00 0.00 ? 1536 ASP A HB2  3  
ATOM   5271  H HB3  . ASP A 1 56  ? -5.881  -10.644 -9.954  1.00 0.00 ? 1536 ASP A HB3  3  
ATOM   5272  N N    . PRO A 1 57  ? -4.117  -8.877  -13.159 1.00 0.00 ? 1537 PRO A N    3  
ATOM   5273  C CA   . PRO A 1 57  ? -4.629  -8.636  -14.498 1.00 0.00 ? 1537 PRO A CA   3  
ATOM   5274  C C    . PRO A 1 57  ? -4.335  -10.013 -15.142 1.00 0.00 ? 1537 PRO A C    3  
ATOM   5275  O O    . PRO A 1 57  ? -3.176  -10.447 -15.123 1.00 0.00 ? 1537 PRO A O    3  
ATOM   5276  C CB   . PRO A 1 57  ? -3.814  -7.474  -15.070 1.00 0.00 ? 1537 PRO A CB   3  
ATOM   5277  C CG   . PRO A 1 57  ? -2.495  -7.529  -14.294 1.00 0.00 ? 1537 PRO A CG   3  
ATOM   5278  C CD   . PRO A 1 57  ? -2.852  -8.189  -12.960 1.00 0.00 ? 1537 PRO A CD   3  
ATOM   5279  H HA   . PRO A 1 57  ? -5.694  -8.399  -14.497 1.00 0.00 ? 1537 PRO A HA   3  
ATOM   5280  H HB2  . PRO A 1 57  ? -3.658  -7.582  -16.145 1.00 0.00 ? 1537 PRO A HB2  3  
ATOM   5281  H HB3  . PRO A 1 57  ? -4.326  -6.536  -14.850 1.00 0.00 ? 1537 PRO A HB3  3  
ATOM   5282  H HG2  . PRO A 1 57  ? -1.781  -8.155  -14.834 1.00 0.00 ? 1537 PRO A HG2  3  
ATOM   5283  H HG3  . PRO A 1 57  ? -2.080  -6.534  -14.146 1.00 0.00 ? 1537 PRO A HG3  3  
ATOM   5284  H HD2  . PRO A 1 57  ? -2.070  -8.895  -12.693 1.00 0.00 ? 1537 PRO A HD2  3  
ATOM   5285  H HD3  . PRO A 1 57  ? -2.977  -7.426  -12.192 1.00 0.00 ? 1537 PRO A HD3  3  
ATOM   5286  N N    . ILE A 1 58  ? -5.335  -10.711 -15.693 1.00 0.00 ? 1538 ILE A N    3  
ATOM   5287  C CA   . ILE A 1 58  ? -5.160  -12.116 -16.064 1.00 0.00 ? 1538 ILE A CA   3  
ATOM   5288  C C    . ILE A 1 58  ? -3.992  -12.261 -17.056 1.00 0.00 ? 1538 ILE A C    3  
ATOM   5289  O O    . ILE A 1 58  ? -4.039  -11.643 -18.125 1.00 0.00 ? 1538 ILE A O    3  
ATOM   5290  C CB   . ILE A 1 58  ? -6.428  -12.749 -16.686 1.00 0.00 ? 1538 ILE A CB   3  
ATOM   5291  C CG1  . ILE A 1 58  ? -7.805  -12.354 -16.110 1.00 0.00 ? 1538 ILE A CG1  3  
ATOM   5292  C CG2  . ILE A 1 58  ? -6.238  -14.276 -16.680 1.00 0.00 ? 1538 ILE A CG2  3  
ATOM   5293  C CD1  . ILE A 1 58  ? -8.154  -12.953 -14.748 1.00 0.00 ? 1538 ILE A CD1  3  
ATOM   5294  H H    . ILE A 1 58  ? -6.259  -10.303 -15.742 1.00 0.00 ? 1538 ILE A H    3  
ATOM   5295  H HA   . ILE A 1 58  ? -4.940  -12.642 -15.136 1.00 0.00 ? 1538 ILE A HA   3  
ATOM   5296  H HB   . ILE A 1 58  ? -6.455  -12.437 -17.727 1.00 0.00 ? 1538 ILE A HB   3  
ATOM   5297  H HG12 . ILE A 1 58  ? -7.866  -11.281 -16.008 1.00 0.00 ? 1538 ILE A HG12 3  
ATOM   5298  H HG13 . ILE A 1 58  ? -8.573  -12.636 -16.834 1.00 0.00 ? 1538 ILE A HG13 3  
ATOM   5299  H HG21 . ILE A 1 58  ? -7.081  -14.752 -17.170 1.00 0.00 ? 1538 ILE A HG21 3  
ATOM   5300  H HG22 . ILE A 1 58  ? -5.344  -14.537 -17.242 1.00 0.00 ? 1538 ILE A HG22 3  
ATOM   5301  H HG23 . ILE A 1 58  ? -6.142  -14.657 -15.662 1.00 0.00 ? 1538 ILE A HG23 3  
ATOM   5302  H HD11 . ILE A 1 58  ? -8.307  -14.025 -14.850 1.00 0.00 ? 1538 ILE A HD11 3  
ATOM   5303  H HD12 . ILE A 1 58  ? -7.355  -12.748 -14.035 1.00 0.00 ? 1538 ILE A HD12 3  
ATOM   5304  H HD13 . ILE A 1 58  ? -9.082  -12.509 -14.390 1.00 0.00 ? 1538 ILE A HD13 3  
ATOM   5305  N N    . PRO A 1 59  ? -2.953  -13.063 -16.742 1.00 0.00 ? 1539 PRO A N    3  
ATOM   5306  C CA   . PRO A 1 59  ? -1.869  -13.303 -17.671 1.00 0.00 ? 1539 PRO A CA   3  
ATOM   5307  C C    . PRO A 1 59  ? -2.369  -14.048 -18.900 1.00 0.00 ? 1539 PRO A C    3  
ATOM   5308  O O    . PRO A 1 59  ? -3.237  -14.924 -18.847 1.00 0.00 ? 1539 PRO A O    3  
ATOM   5309  C CB   . PRO A 1 59  ? -0.784  -14.058 -16.894 1.00 0.00 ? 1539 PRO A CB   3  
ATOM   5310  C CG   . PRO A 1 59  ? -1.455  -14.560 -15.611 1.00 0.00 ? 1539 PRO A CG   3  
ATOM   5311  C CD   . PRO A 1 59  ? -2.730  -13.735 -15.470 1.00 0.00 ? 1539 PRO A CD   3  
ATOM   5312  H HA   . PRO A 1 59  ? -1.471  -12.346 -18.020 1.00 0.00 ? 1539 PRO A HA   3  
ATOM   5313  H HB2  . PRO A 1 59  ? -0.367  -14.885 -17.473 1.00 0.00 ? 1539 PRO A HB2  3  
ATOM   5314  H HB3  . PRO A 1 59  ? 0.011   -13.360 -16.625 1.00 0.00 ? 1539 PRO A HB3  3  
ATOM   5315  H HG2  . PRO A 1 59  ? -1.713  -15.612 -15.695 1.00 0.00 ? 1539 PRO A HG2  3  
ATOM   5316  H HG3  . PRO A 1 59  ? -0.798  -14.419 -14.750 1.00 0.00 ? 1539 PRO A HG3  3  
ATOM   5317  H HD2  . PRO A 1 59  ? -3.570  -14.389 -15.224 1.00 0.00 ? 1539 PRO A HD2  3  
ATOM   5318  H HD3  . PRO A 1 59  ? -2.594  -12.991 -14.684 1.00 0.00 ? 1539 PRO A HD3  3  
ATOM   5319  N N    . LEU A 1 60  ? -1.796  -13.682 -20.037 1.00 0.00 ? 1540 LEU A N    3  
ATOM   5320  C CA   . LEU A 1 60  ? -2.146  -14.257 -21.313 1.00 0.00 ? 1540 LEU A CA   3  
ATOM   5321  C C    . LEU A 1 60  ? -1.715  -15.729 -21.297 1.00 0.00 ? 1540 LEU A C    3  
ATOM   5322  O O    . LEU A 1 60  ? -0.746  -16.086 -20.624 1.00 0.00 ? 1540 LEU A O    3  
ATOM   5323  C CB   . LEU A 1 60  ? -1.490  -13.436 -22.436 1.00 0.00 ? 1540 LEU A CB   3  
ATOM   5324  C CG   . LEU A 1 60  ? -1.923  -11.950 -22.506 1.00 0.00 ? 1540 LEU A CG   3  
ATOM   5325  C CD1  . LEU A 1 60  ? -1.246  -11.037 -21.471 1.00 0.00 ? 1540 LEU A CD1  3  
ATOM   5326  C CD2  . LEU A 1 60  ? -1.600  -11.404 -23.900 1.00 0.00 ? 1540 LEU A CD2  3  
ATOM   5327  H H    . LEU A 1 60  ? -1.042  -13.010 -20.012 1.00 0.00 ? 1540 LEU A H    3  
ATOM   5328  H HA   . LEU A 1 60  ? -3.225  -14.204 -21.428 1.00 0.00 ? 1540 LEU A HA   3  
ATOM   5329  H HB2  . LEU A 1 60  ? -0.408  -13.490 -22.348 1.00 0.00 ? 1540 LEU A HB2  3  
ATOM   5330  H HB3  . LEU A 1 60  ? -1.776  -13.916 -23.371 1.00 0.00 ? 1540 LEU A HB3  3  
ATOM   5331  H HG   . LEU A 1 60  ? -2.996  -11.878 -22.338 1.00 0.00 ? 1540 LEU A HG   3  
ATOM   5332  H HD11 . LEU A 1 60  ? -1.690  -11.175 -20.484 1.00 0.00 ? 1540 LEU A HD11 3  
ATOM   5333  H HD12 . LEU A 1 60  ? -0.170  -11.217 -21.435 1.00 0.00 ? 1540 LEU A HD12 3  
ATOM   5334  H HD13 . LEU A 1 60  ? -1.408  -9.993  -21.739 1.00 0.00 ? 1540 LEU A HD13 3  
ATOM   5335  H HD21 . LEU A 1 60  ? -2.105  -12.000 -24.659 1.00 0.00 ? 1540 LEU A HD21 3  
ATOM   5336  H HD22 . LEU A 1 60  ? -1.946  -10.374 -23.980 1.00 0.00 ? 1540 LEU A HD22 3  
ATOM   5337  H HD23 . LEU A 1 60  ? -0.521  -11.438 -24.079 1.00 0.00 ? 1540 LEU A HD23 3  
ATOM   5338  N N    . ASP A 1 61  ? -2.460  -16.577 -22.009 1.00 0.00 ? 1541 ASP A N    3  
ATOM   5339  C CA   . ASP A 1 61  ? -2.395  -18.046 -22.028 1.00 0.00 ? 1541 ASP A CA   3  
ATOM   5340  C C    . ASP A 1 61  ? -3.051  -18.711 -20.804 1.00 0.00 ? 1541 ASP A C    3  
ATOM   5341  O O    . ASP A 1 61  ? -3.240  -19.928 -20.801 1.00 0.00 ? 1541 ASP A O    3  
ATOM   5342  C CB   . ASP A 1 61  ? -0.979  -18.580 -22.294 1.00 0.00 ? 1541 ASP A CB   3  
ATOM   5343  C CG   . ASP A 1 61  ? -0.996  -20.062 -22.718 1.00 0.00 ? 1541 ASP A CG   3  
ATOM   5344  O OD1  . ASP A 1 61  ? -1.622  -20.383 -23.756 1.00 0.00 ? 1541 ASP A OD1  3  
ATOM   5345  O OD2  . ASP A 1 61  ? -0.377  -20.903 -22.020 1.00 0.00 ? 1541 ASP A OD2  3  
ATOM   5346  H H    . ASP A 1 61  ? -3.230  -16.190 -22.544 1.00 0.00 ? 1541 ASP A H    3  
ATOM   5347  H HA   . ASP A 1 61  ? -2.995  -18.361 -22.881 1.00 0.00 ? 1541 ASP A HA   3  
ATOM   5348  H HB2  . ASP A 1 61  ? -0.519  -17.997 -23.094 1.00 0.00 ? 1541 ASP A HB2  3  
ATOM   5349  H HB3  . ASP A 1 61  ? -0.374  -18.467 -21.396 1.00 0.00 ? 1541 ASP A HB3  3  
ATOM   5350  N N    . THR A 1 62  ? -3.472  -17.945 -19.790 1.00 0.00 ? 1542 THR A N    3  
ATOM   5351  C CA   . THR A 1 62  ? -4.236  -18.486 -18.672 1.00 0.00 ? 1542 THR A CA   3  
ATOM   5352  C C    . THR A 1 62  ? -5.639  -18.853 -19.160 1.00 0.00 ? 1542 THR A C    3  
ATOM   5353  O O    . THR A 1 62  ? -6.278  -18.091 -19.898 1.00 0.00 ? 1542 THR A O    3  
ATOM   5354  C CB   . THR A 1 62  ? -4.276  -17.466 -17.524 1.00 0.00 ? 1542 THR A CB   3  
ATOM   5355  O OG1  . THR A 1 62  ? -2.958  -17.066 -17.242 1.00 0.00 ? 1542 THR A OG1  3  
ATOM   5356  C CG2  . THR A 1 62  ? -4.853  -17.981 -16.205 1.00 0.00 ? 1542 THR A CG2  3  
ATOM   5357  H H    . THR A 1 62  ? -3.327  -16.945 -19.802 1.00 0.00 ? 1542 THR A H    3  
ATOM   5358  H HA   . THR A 1 62  ? -3.731  -19.383 -18.315 1.00 0.00 ? 1542 THR A HA   3  
ATOM   5359  H HB   . THR A 1 62  ? -4.862  -16.605 -17.845 1.00 0.00 ? 1542 THR A HB   3  
ATOM   5360  H HG1  . THR A 1 62  ? -2.786  -16.282 -17.796 1.00 0.00 ? 1542 THR A HG1  3  
ATOM   5361  H HG21 . THR A 1 62  ? -4.360  -18.905 -15.911 1.00 0.00 ? 1542 THR A HG21 3  
ATOM   5362  H HG22 . THR A 1 62  ? -4.695  -17.227 -15.433 1.00 0.00 ? 1542 THR A HG22 3  
ATOM   5363  H HG23 . THR A 1 62  ? -5.924  -18.146 -16.314 1.00 0.00 ? 1542 THR A HG23 3  
ATOM   5364  N N    . GLU A 1 63  ? -6.109  -20.028 -18.748 1.00 0.00 ? 1543 GLU A N    3  
ATOM   5365  C CA   . GLU A 1 63  ? -7.473  -20.460 -18.984 1.00 0.00 ? 1543 GLU A CA   3  
ATOM   5366  C C    . GLU A 1 63  ? -8.373  -19.681 -18.026 1.00 0.00 ? 1543 GLU A C    3  
ATOM   5367  O O    . GLU A 1 63  ? -8.013  -19.463 -16.869 1.00 0.00 ? 1543 GLU A O    3  
ATOM   5368  C CB   . GLU A 1 63  ? -7.581  -21.974 -18.765 1.00 0.00 ? 1543 GLU A CB   3  
ATOM   5369  C CG   . GLU A 1 63  ? -8.872  -22.549 -19.355 1.00 0.00 ? 1543 GLU A CG   3  
ATOM   5370  C CD   . GLU A 1 63  ? -9.056  -24.013 -18.927 1.00 0.00 ? 1543 GLU A CD   3  
ATOM   5371  O OE1  . GLU A 1 63  ? -9.465  -24.253 -17.765 1.00 0.00 ? 1543 GLU A OE1  3  
ATOM   5372  O OE2  . GLU A 1 63  ? -8.798  -24.926 -19.748 1.00 0.00 ? 1543 GLU A OE2  3  
ATOM   5373  H H    . GLU A 1 63  ? -5.556  -20.575 -18.104 1.00 0.00 ? 1543 GLU A H    3  
ATOM   5374  H HA   . GLU A 1 63  ? -7.744  -20.225 -20.008 1.00 0.00 ? 1543 GLU A HA   3  
ATOM   5375  H HB2  . GLU A 1 63  ? -6.735  -22.466 -19.248 1.00 0.00 ? 1543 GLU A HB2  3  
ATOM   5376  H HB3  . GLU A 1 63  ? -7.537  -22.181 -17.696 1.00 0.00 ? 1543 GLU A HB3  3  
ATOM   5377  H HG2  . GLU A 1 63  ? -9.729  -21.967 -19.021 1.00 0.00 ? 1543 GLU A HG2  3  
ATOM   5378  H HG3  . GLU A 1 63  ? -8.828  -22.478 -20.442 1.00 0.00 ? 1543 GLU A HG3  3  
ATOM   5379  N N    . VAL A 1 64  ? -9.539  -19.272 -18.509 1.00 0.00 ? 1544 VAL A N    3  
ATOM   5380  C CA   . VAL A 1 64  ? -10.534 -18.523 -17.756 1.00 0.00 ? 1544 VAL A CA   3  
ATOM   5381  C C    . VAL A 1 64  ? -11.930 -18.922 -18.209 1.00 0.00 ? 1544 VAL A C    3  
ATOM   5382  O O    . VAL A 1 64  ? -12.121 -19.362 -19.345 1.00 0.00 ? 1544 VAL A O    3  
ATOM   5383  C CB   . VAL A 1 64  ? -10.352 -17.005 -17.917 1.00 0.00 ? 1544 VAL A CB   3  
ATOM   5384  C CG1  . VAL A 1 64  ? -9.179  -16.469 -17.099 1.00 0.00 ? 1544 VAL A CG1  3  
ATOM   5385  C CG2  . VAL A 1 64  ? -10.147 -16.570 -19.370 1.00 0.00 ? 1544 VAL A CG2  3  
ATOM   5386  H H    . VAL A 1 64  ? -9.767  -19.512 -19.470 1.00 0.00 ? 1544 VAL A H    3  
ATOM   5387  H HA   . VAL A 1 64  ? -10.435 -18.741 -16.701 1.00 0.00 ? 1544 VAL A HA   3  
ATOM   5388  H HB   . VAL A 1 64  ? -11.247 -16.508 -17.535 1.00 0.00 ? 1544 VAL A HB   3  
ATOM   5389  H HG11 . VAL A 1 64  ? -9.174  -15.382 -17.146 1.00 0.00 ? 1544 VAL A HG11 3  
ATOM   5390  H HG12 . VAL A 1 64  ? -9.308  -16.775 -16.069 1.00 0.00 ? 1544 VAL A HG12 3  
ATOM   5391  H HG13 . VAL A 1 64  ? -8.235  -16.858 -17.486 1.00 0.00 ? 1544 VAL A HG13 3  
ATOM   5392  H HG21 . VAL A 1 64  ? -9.259  -17.041 -19.790 1.00 0.00 ? 1544 VAL A HG21 3  
ATOM   5393  H HG22 . VAL A 1 64  ? -11.025 -16.834 -19.959 1.00 0.00 ? 1544 VAL A HG22 3  
ATOM   5394  H HG23 . VAL A 1 64  ? -9.998  -15.493 -19.382 1.00 0.00 ? 1544 VAL A HG23 3  
ATOM   5395  N N    . THR A 1 65  ? -12.906 -18.726 -17.335 1.00 0.00 ? 1545 THR A N    3  
ATOM   5396  C CA   . THR A 1 65  ? -14.315 -18.829 -17.667 1.00 0.00 ? 1545 THR A CA   3  
ATOM   5397  C C    . THR A 1 65  ? -14.746 -17.428 -18.105 1.00 0.00 ? 1545 THR A C    3  
ATOM   5398  O O    . THR A 1 65  ? -14.230 -16.422 -17.610 1.00 0.00 ? 1545 THR A O    3  
ATOM   5399  C CB   . THR A 1 65  ? -15.085 -19.379 -16.458 1.00 0.00 ? 1545 THR A CB   3  
ATOM   5400  O OG1  . THR A 1 65  ? -14.775 -20.751 -16.323 1.00 0.00 ? 1545 THR A OG1  3  
ATOM   5401  C CG2  . THR A 1 65  ? -16.609 -19.267 -16.587 1.00 0.00 ? 1545 THR A CG2  3  
ATOM   5402  H H    . THR A 1 65  ? -12.692 -18.256 -16.463 1.00 0.00 ? 1545 THR A H    3  
ATOM   5403  H HA   . THR A 1 65  ? -14.449 -19.519 -18.492 1.00 0.00 ? 1545 THR A HA   3  
ATOM   5404  H HB   . THR A 1 65  ? -14.772 -18.856 -15.557 1.00 0.00 ? 1545 THR A HB   3  
ATOM   5405  H HG1  . THR A 1 65  ? -14.200 -20.880 -15.544 1.00 0.00 ? 1545 THR A HG1  3  
ATOM   5406  H HG21 . THR A 1 65  ? -16.954 -19.735 -17.512 1.00 0.00 ? 1545 THR A HG21 3  
ATOM   5407  H HG22 . THR A 1 65  ? -17.086 -19.786 -15.759 1.00 0.00 ? 1545 THR A HG22 3  
ATOM   5408  H HG23 . THR A 1 65  ? -16.898 -18.214 -16.549 1.00 0.00 ? 1545 THR A HG23 3  
ATOM   5409  N N    . ALA A 1 66  ? -15.671 -17.357 -19.057 1.00 0.00 ? 1546 ALA A N    3  
ATOM   5410  C CA   . ALA A 1 66  ? -16.114 -16.146 -19.718 1.00 0.00 ? 1546 ALA A CA   3  
ATOM   5411  C C    . ALA A 1 66  ? -17.643 -16.147 -19.715 1.00 0.00 ? 1546 ALA A C    3  
ATOM   5412  O O    . ALA A 1 66  ? -18.258 -17.204 -19.917 1.00 0.00 ? 1546 ALA A O    3  
ATOM   5413  C CB   . ALA A 1 66  ? -15.553 -16.107 -21.140 1.00 0.00 ? 1546 ALA A CB   3  
ATOM   5414  H H    . ALA A 1 66  ? -16.121 -18.212 -19.370 1.00 0.00 ? 1546 ALA A H    3  
ATOM   5415  H HA   . ALA A 1 66  ? -15.719 -15.280 -19.195 1.00 0.00 ? 1546 ALA A HA   3  
ATOM   5416  H HB1  . ALA A 1 66  ? -14.462 -16.160 -21.114 1.00 0.00 ? 1546 ALA A HB1  3  
ATOM   5417  H HB2  . ALA A 1 66  ? -15.947 -16.938 -21.725 1.00 0.00 ? 1546 ALA A HB2  3  
ATOM   5418  H HB3  . ALA A 1 66  ? -15.840 -15.168 -21.603 1.00 0.00 ? 1546 ALA A HB3  3  
ATOM   5419  N N    . LEU A 1 67  ? -18.246 -14.980 -19.463 1.00 0.00 ? 1547 LEU A N    3  
ATOM   5420  C CA   . LEU A 1 67  ? -19.693 -14.811 -19.314 1.00 0.00 ? 1547 LEU A CA   3  
ATOM   5421  C C    . LEU A 1 67  ? -20.173 -13.740 -20.290 1.00 0.00 ? 1547 LEU A C    3  
ATOM   5422  O O    . LEU A 1 67  ? -19.801 -12.576 -20.163 1.00 0.00 ? 1547 LEU A O    3  
ATOM   5423  C CB   . LEU A 1 67  ? -20.071 -14.402 -17.870 1.00 0.00 ? 1547 LEU A CB   3  
ATOM   5424  C CG   . LEU A 1 67  ? -20.237 -15.518 -16.828 1.00 0.00 ? 1547 LEU A CG   3  
ATOM   5425  C CD1  . LEU A 1 67  ? -21.286 -16.548 -17.242 1.00 0.00 ? 1547 LEU A CD1  3  
ATOM   5426  C CD2  . LEU A 1 67  ? -18.942 -16.258 -16.512 1.00 0.00 ? 1547 LEU A CD2  3  
ATOM   5427  H H    . LEU A 1 67  ? -17.667 -14.175 -19.253 1.00 0.00 ? 1547 LEU A H    3  
ATOM   5428  H HA   . LEU A 1 67  ? -20.192 -15.741 -19.565 1.00 0.00 ? 1547 LEU A HA   3  
ATOM   5429  H HB2  . LEU A 1 67  ? -19.346 -13.677 -17.502 1.00 0.00 ? 1547 LEU A HB2  3  
ATOM   5430  H HB3  . LEU A 1 67  ? -21.030 -13.878 -17.915 1.00 0.00 ? 1547 LEU A HB3  3  
ATOM   5431  H HG   . LEU A 1 67  ? -20.589 -15.047 -15.915 1.00 0.00 ? 1547 LEU A HG   3  
ATOM   5432  H HD11 . LEU A 1 67  ? -21.480 -17.228 -16.411 1.00 0.00 ? 1547 LEU A HD11 3  
ATOM   5433  H HD12 . LEU A 1 67  ? -22.205 -16.057 -17.555 1.00 0.00 ? 1547 LEU A HD12 3  
ATOM   5434  H HD13 . LEU A 1 67  ? -20.909 -17.126 -18.079 1.00 0.00 ? 1547 LEU A HD13 3  
ATOM   5435  H HD21 . LEU A 1 67  ? -19.122 -16.949 -15.692 1.00 0.00 ? 1547 LEU A HD21 3  
ATOM   5436  H HD22 . LEU A 1 67  ? -18.615 -16.838 -17.372 1.00 0.00 ? 1547 LEU A HD22 3  
ATOM   5437  H HD23 . LEU A 1 67  ? -18.160 -15.549 -16.228 1.00 0.00 ? 1547 LEU A HD23 3  
ATOM   5438  N N    . SER A 1 68  ? -20.992 -14.130 -21.265 1.00 0.00 ? 1548 SER A N    3  
ATOM   5439  C CA   . SER A 1 68  ? -21.588 -13.207 -22.232 1.00 0.00 ? 1548 SER A CA   3  
ATOM   5440  C C    . SER A 1 68  ? -22.670 -12.342 -21.579 1.00 0.00 ? 1548 SER A C    3  
ATOM   5441  O O    . SER A 1 68  ? -23.242 -12.717 -20.557 1.00 0.00 ? 1548 SER A O    3  
ATOM   5442  C CB   . SER A 1 68  ? -22.118 -14.020 -23.422 1.00 0.00 ? 1548 SER A CB   3  
ATOM   5443  O OG   . SER A 1 68  ? -21.082 -14.864 -23.907 1.00 0.00 ? 1548 SER A OG   3  
ATOM   5444  H H    . SER A 1 68  ? -21.211 -15.114 -21.358 1.00 0.00 ? 1548 SER A H    3  
ATOM   5445  H HA   . SER A 1 68  ? -20.820 -12.525 -22.598 1.00 0.00 ? 1548 SER A HA   3  
ATOM   5446  H HB2  . SER A 1 68  ? -22.962 -14.633 -23.108 1.00 0.00 ? 1548 SER A HB2  3  
ATOM   5447  H HB3  . SER A 1 68  ? -22.447 -13.348 -24.215 1.00 0.00 ? 1548 SER A HB3  3  
ATOM   5448  H HG   . SER A 1 68  ? -21.427 -15.373 -24.671 1.00 0.00 ? 1548 SER A HG   3  
ATOM   5449  N N    . GLU A 1 69  ? -22.993 -11.201 -22.200 1.00 0.00 ? 1549 GLU A N    3  
ATOM   5450  C CA   . GLU A 1 69  ? -24.058 -10.305 -21.733 1.00 0.00 ? 1549 GLU A CA   3  
ATOM   5451  C C    . GLU A 1 69  ? -25.429 -10.976 -21.863 1.00 0.00 ? 1549 GLU A C    3  
ATOM   5452  O O    . GLU A 1 69  ? -26.331 -10.694 -21.072 1.00 0.00 ? 1549 GLU A O    3  
ATOM   5453  C CB   . GLU A 1 69  ? -24.029 -9.003  -22.546 1.00 0.00 ? 1549 GLU A CB   3  
ATOM   5454  C CG   . GLU A 1 69  ? -22.842 -8.092  -22.190 1.00 0.00 ? 1549 GLU A CG   3  
ATOM   5455  C CD   . GLU A 1 69  ? -23.059 -7.331  -20.868 1.00 0.00 ? 1549 GLU A CD   3  
ATOM   5456  O OE1  . GLU A 1 69  ? -23.708 -6.257  -20.880 1.00 0.00 ? 1549 GLU A OE1  3  
ATOM   5457  O OE2  . GLU A 1 69  ? -22.582 -7.788  -19.803 1.00 0.00 ? 1549 GLU A OE2  3  
ATOM   5458  H H    . GLU A 1 69  ? -22.477 -10.917 -23.025 1.00 0.00 ? 1549 GLU A H    3  
ATOM   5459  H HA   . GLU A 1 69  ? -23.889 -10.072 -20.683 1.00 0.00 ? 1549 GLU A HA   3  
ATOM   5460  H HB2  . GLU A 1 69  ? -23.974 -9.251  -23.606 1.00 0.00 ? 1549 GLU A HB2  3  
ATOM   5461  H HB3  . GLU A 1 69  ? -24.952 -8.444  -22.379 1.00 0.00 ? 1549 GLU A HB3  3  
ATOM   5462  H HG2  . GLU A 1 69  ? -21.925 -8.680  -22.130 1.00 0.00 ? 1549 GLU A HG2  3  
ATOM   5463  H HG3  . GLU A 1 69  ? -22.715 -7.366  -22.993 1.00 0.00 ? 1549 GLU A HG3  3  
ATOM   5464  N N    . ASP A 1 70  ? -25.579 -11.918 -22.809 1.00 0.00 ? 1550 ASP A N    3  
ATOM   5465  C CA   . ASP A 1 70  ? -26.781 -12.750 -22.958 1.00 0.00 ? 1550 ASP A CA   3  
ATOM   5466  C C    . ASP A 1 70  ? -26.734 -13.968 -22.013 1.00 0.00 ? 1550 ASP A C    3  
ATOM   5467  O O    . ASP A 1 70  ? -27.436 -14.958 -22.200 1.00 0.00 ? 1550 ASP A O    3  
ATOM   5468  C CB   . ASP A 1 70  ? -26.951 -13.147 -24.431 1.00 0.00 ? 1550 ASP A CB   3  
ATOM   5469  C CG   . ASP A 1 70  ? -28.365 -13.667 -24.766 1.00 0.00 ? 1550 ASP A CG   3  
ATOM   5470  O OD1  . ASP A 1 70  ? -29.363 -13.196 -24.168 1.00 0.00 ? 1550 ASP A OD1  3  
ATOM   5471  O OD2  . ASP A 1 70  ? -28.487 -14.550 -25.649 1.00 0.00 ? 1550 ASP A OD2  3  
ATOM   5472  H H    . ASP A 1 70  ? -24.814 -12.105 -23.445 1.00 0.00 ? 1550 ASP A H    3  
ATOM   5473  H HA   . ASP A 1 70  ? -27.646 -12.149 -22.677 1.00 0.00 ? 1550 ASP A HA   3  
ATOM   5474  H HB2  . ASP A 1 70  ? -26.768 -12.269 -25.053 1.00 0.00 ? 1550 ASP A HB2  3  
ATOM   5475  H HB3  . ASP A 1 70  ? -26.203 -13.899 -24.689 1.00 0.00 ? 1550 ASP A HB3  3  
ATOM   5476  N N    . GLU A 1 71  ? -25.873 -13.882 -20.993 1.00 0.00 ? 1551 GLU A N    3  
ATOM   5477  C CA   . GLU A 1 71  ? -25.650 -14.806 -19.889 1.00 0.00 ? 1551 GLU A CA   3  
ATOM   5478  C C    . GLU A 1 71  ? -25.472 -16.276 -20.255 1.00 0.00 ? 1551 GLU A C    3  
ATOM   5479  O O    . GLU A 1 71  ? -26.149 -17.150 -19.723 1.00 0.00 ? 1551 GLU A O    3  
ATOM   5480  C CB   . GLU A 1 71  ? -26.580 -14.538 -18.701 1.00 0.00 ? 1551 GLU A CB   3  
ATOM   5481  C CG   . GLU A 1 71  ? -28.079 -14.435 -19.000 1.00 0.00 ? 1551 GLU A CG   3  
ATOM   5482  C CD   . GLU A 1 71  ? -28.925 -14.735 -17.755 1.00 0.00 ? 1551 GLU A CD   3  
ATOM   5483  O OE1  . GLU A 1 71  ? -28.823 -13.975 -16.766 1.00 0.00 ? 1551 GLU A OE1  3  
ATOM   5484  O OE2  . GLU A 1 71  ? -29.688 -15.729 -17.765 1.00 0.00 ? 1551 GLU A OE2  3  
ATOM   5485  H H    . GLU A 1 71  ? -25.322 -13.036 -20.945 1.00 0.00 ? 1551 GLU A H    3  
ATOM   5486  H HA   . GLU A 1 71  ? -24.665 -14.532 -19.505 1.00 0.00 ? 1551 GLU A HA   3  
ATOM   5487  H HB2  . GLU A 1 71  ? -26.432 -15.313 -17.960 1.00 0.00 ? 1551 GLU A HB2  3  
ATOM   5488  H HB3  . GLU A 1 71  ? -26.242 -13.622 -18.231 1.00 0.00 ? 1551 GLU A HB3  3  
ATOM   5489  H HG2  . GLU A 1 71  ? -28.307 -13.435 -19.372 1.00 0.00 ? 1551 GLU A HG2  3  
ATOM   5490  H HG3  . GLU A 1 71  ? -28.335 -15.148 -19.773 1.00 0.00 ? 1551 GLU A HG3  3  
ATOM   5491  N N    . TYR A 1 72  ? -24.483 -16.555 -21.102 1.00 0.00 ? 1552 TYR A N    3  
ATOM   5492  C CA   . TYR A 1 72  ? -24.015 -17.911 -21.364 1.00 0.00 ? 1552 TYR A CA   3  
ATOM   5493  C C    . TYR A 1 72  ? -22.636 -18.042 -20.721 1.00 0.00 ? 1552 TYR A C    3  
ATOM   5494  O O    . TYR A 1 72  ? -21.937 -17.045 -20.536 1.00 0.00 ? 1552 TYR A O    3  
ATOM   5495  C CB   . TYR A 1 72  ? -24.041 -18.221 -22.864 1.00 0.00 ? 1552 TYR A CB   3  
ATOM   5496  C CG   . TYR A 1 72  ? -25.457 -18.501 -23.327 1.00 0.00 ? 1552 TYR A CG   3  
ATOM   5497  C CD1  . TYR A 1 72  ? -25.991 -19.796 -23.167 1.00 0.00 ? 1552 TYR A CD1  3  
ATOM   5498  C CD2  . TYR A 1 72  ? -26.241 -17.481 -23.896 1.00 0.00 ? 1552 TYR A CD2  3  
ATOM   5499  C CE1  . TYR A 1 72  ? -27.323 -20.058 -23.529 1.00 0.00 ? 1552 TYR A CE1  3  
ATOM   5500  C CE2  . TYR A 1 72  ? -27.566 -17.749 -24.281 1.00 0.00 ? 1552 TYR A CE2  3  
ATOM   5501  C CZ   . TYR A 1 72  ? -28.118 -19.039 -24.097 1.00 0.00 ? 1552 TYR A CZ   3  
ATOM   5502  O OH   . TYR A 1 72  ? -29.403 -19.312 -24.458 1.00 0.00 ? 1552 TYR A OH   3  
ATOM   5503  H H    . TYR A 1 72  ? -23.937 -15.794 -21.484 1.00 0.00 ? 1552 TYR A H    3  
ATOM   5504  H HA   . TYR A 1 72  ? -24.677 -18.625 -20.871 1.00 0.00 ? 1552 TYR A HA   3  
ATOM   5505  H HB2  . TYR A 1 72  ? -23.618 -17.387 -23.425 1.00 0.00 ? 1552 TYR A HB2  3  
ATOM   5506  H HB3  . TYR A 1 72  ? -23.434 -19.110 -23.058 1.00 0.00 ? 1552 TYR A HB3  3  
ATOM   5507  H HD1  . TYR A 1 72  ? -25.383 -20.594 -22.761 1.00 0.00 ? 1552 TYR A HD1  3  
ATOM   5508  H HD2  . TYR A 1 72  ? -25.830 -16.488 -24.037 1.00 0.00 ? 1552 TYR A HD2  3  
ATOM   5509  H HE1  . TYR A 1 72  ? -27.732 -21.047 -23.364 1.00 0.00 ? 1552 TYR A HE1  3  
ATOM   5510  H HE2  . TYR A 1 72  ? -28.161 -16.957 -24.711 1.00 0.00 ? 1552 TYR A HE2  3  
ATOM   5511  H HH   . TYR A 1 72  ? -29.868 -18.557 -24.866 1.00 0.00 ? 1552 TYR A HH   3  
ATOM   5512  N N    . PHE A 1 73  ? -22.275 -19.265 -20.333 1.00 0.00 ? 1553 PHE A N    3  
ATOM   5513  C CA   . PHE A 1 73  ? -21.104 -19.586 -19.520 1.00 0.00 ? 1553 PHE A CA   3  
ATOM   5514  C C    . PHE A 1 73  ? -20.274 -20.584 -20.324 1.00 0.00 ? 1553 PHE A C    3  
ATOM   5515  O O    . PHE A 1 73  ? -20.792 -21.608 -20.782 1.00 0.00 ? 1553 PHE A O    3  
ATOM   5516  C CB   . PHE A 1 73  ? -21.546 -20.057 -18.119 1.00 0.00 ? 1553 PHE A CB   3  
ATOM   5517  C CG   . PHE A 1 73  ? -21.249 -21.492 -17.772 1.00 0.00 ? 1553 PHE A CG   3  
ATOM   5518  C CD1  . PHE A 1 73  ? -19.985 -21.841 -17.267 1.00 0.00 ? 1553 PHE A CD1  3  
ATOM   5519  C CD2  . PHE A 1 73  ? -22.239 -22.475 -17.954 1.00 0.00 ? 1553 PHE A CD2  3  
ATOM   5520  C CE1  . PHE A 1 73  ? -19.661 -23.182 -17.038 1.00 0.00 ? 1553 PHE A CE1  3  
ATOM   5521  C CE2  . PHE A 1 73  ? -21.908 -23.826 -17.728 1.00 0.00 ? 1553 PHE A CE2  3  
ATOM   5522  C CZ   . PHE A 1 73  ? -20.617 -24.183 -17.291 1.00 0.00 ? 1553 PHE A CZ   3  
ATOM   5523  H H    . PHE A 1 73  ? -22.836 -20.058 -20.618 1.00 0.00 ? 1553 PHE A H    3  
ATOM   5524  H HA   . PHE A 1 73  ? -20.495 -18.707 -19.342 1.00 0.00 ? 1553 PHE A HA   3  
ATOM   5525  H HB2  . PHE A 1 73  ? -21.043 -19.435 -17.375 1.00 0.00 ? 1553 PHE A HB2  3  
ATOM   5526  H HB3  . PHE A 1 73  ? -22.614 -19.898 -18.009 1.00 0.00 ? 1553 PHE A HB3  3  
ATOM   5527  H HD1  . PHE A 1 73  ? -19.248 -21.087 -17.036 1.00 0.00 ? 1553 PHE A HD1  3  
ATOM   5528  H HD2  . PHE A 1 73  ? -23.245 -22.186 -18.260 1.00 0.00 ? 1553 PHE A HD2  3  
ATOM   5529  H HE1  . PHE A 1 73  ? -18.671 -23.414 -16.659 1.00 0.00 ? 1553 PHE A HE1  3  
ATOM   5530  H HE2  . PHE A 1 73  ? -22.651 -24.595 -17.887 1.00 0.00 ? 1553 PHE A HE2  3  
ATOM   5531  H HZ   . PHE A 1 73  ? -20.361 -25.226 -17.144 1.00 0.00 ? 1553 PHE A HZ   3  
ATOM   5532  N N    . SER A 1 74  ? -18.999 -20.260 -20.537 1.00 0.00 ? 1554 SER A N    3  
ATOM   5533  C CA   . SER A 1 74  ? -18.034 -21.120 -21.215 1.00 0.00 ? 1554 SER A CA   3  
ATOM   5534  C C    . SER A 1 74  ? -16.641 -20.854 -20.649 1.00 0.00 ? 1554 SER A C    3  
ATOM   5535  O O    . SER A 1 74  ? -16.466 -19.897 -19.899 1.00 0.00 ? 1554 SER A O    3  
ATOM   5536  C CB   . SER A 1 74  ? -18.022 -20.823 -22.720 1.00 0.00 ? 1554 SER A CB   3  
ATOM   5537  O OG   . SER A 1 74  ? -19.301 -20.861 -23.340 1.00 0.00 ? 1554 SER A OG   3  
ATOM   5538  H H    . SER A 1 74  ? -18.640 -19.375 -20.189 1.00 0.00 ? 1554 SER A H    3  
ATOM   5539  H HA   . SER A 1 74  ? -18.289 -22.171 -21.048 1.00 0.00 ? 1554 SER A HA   3  
ATOM   5540  H HB2  . SER A 1 74  ? -17.583 -19.837 -22.888 1.00 0.00 ? 1554 SER A HB2  3  
ATOM   5541  H HB3  . SER A 1 74  ? -17.375 -21.558 -23.190 1.00 0.00 ? 1554 SER A HB3  3  
ATOM   5542  H HG   . SER A 1 74  ? -19.822 -21.608 -22.974 1.00 0.00 ? 1554 SER A HG   3  
ATOM   5543  N N    . ALA A 1 75  ? -15.631 -21.626 -21.061 1.00 0.00 ? 1555 ALA A N    3  
ATOM   5544  C CA   . ALA A 1 75  ? -14.241 -21.359 -20.721 1.00 0.00 ? 1555 ALA A CA   3  
ATOM   5545  C C    . ALA A 1 75  ? -13.367 -21.418 -21.968 1.00 0.00 ? 1555 ALA A C    3  
ATOM   5546  O O    . ALA A 1 75  ? -13.686 -22.120 -22.927 1.00 0.00 ? 1555 ALA A O    3  
ATOM   5547  C CB   . ALA A 1 75  ? -13.777 -22.344 -19.651 1.00 0.00 ? 1555 ALA A CB   3  
ATOM   5548  H H    . ALA A 1 75  ? -15.804 -22.400 -21.693 1.00 0.00 ? 1555 ALA A H    3  
ATOM   5549  H HA   . ALA A 1 75  ? -14.160 -20.351 -20.325 1.00 0.00 ? 1555 ALA A HA   3  
ATOM   5550  H HB1  . ALA A 1 75  ? -12.734 -22.148 -19.405 1.00 0.00 ? 1555 ALA A HB1  3  
ATOM   5551  H HB2  . ALA A 1 75  ? -14.391 -22.218 -18.757 1.00 0.00 ? 1555 ALA A HB2  3  
ATOM   5552  H HB3  . ALA A 1 75  ? -13.882 -23.365 -20.028 1.00 0.00 ? 1555 ALA A HB3  3  
ATOM   5553  N N    . GLY A 1 76  ? -12.268 -20.670 -21.932 1.00 0.00 ? 1556 GLY A N    3  
ATOM   5554  C CA   . GLY A 1 76  ? -11.345 -20.431 -23.031 1.00 0.00 ? 1556 GLY A CA   3  
ATOM   5555  C C    . GLY A 1 76  ? -10.066 -19.848 -22.441 1.00 0.00 ? 1556 GLY A C    3  
ATOM   5556  O O    . GLY A 1 76  ? -9.823  -19.998 -21.244 1.00 0.00 ? 1556 GLY A O    3  
ATOM   5557  H H    . GLY A 1 76  ? -12.041 -20.195 -21.061 1.00 0.00 ? 1556 GLY A H    3  
ATOM   5558  H HA2  . GLY A 1 76  ? -11.117 -21.363 -23.548 1.00 0.00 ? 1556 GLY A HA2  3  
ATOM   5559  H HA3  . GLY A 1 76  ? -11.787 -19.728 -23.742 1.00 0.00 ? 1556 GLY A HA3  3  
ATOM   5560  N N    . VAL A 1 77  ? -9.240  -19.180 -23.238 1.00 0.00 ? 1557 VAL A N    3  
ATOM   5561  C CA   . VAL A 1 77  ? -7.919  -18.722 -22.799 1.00 0.00 ? 1557 VAL A CA   3  
ATOM   5562  C C    . VAL A 1 77  ? -7.722  -17.268 -23.191 1.00 0.00 ? 1557 VAL A C    3  
ATOM   5563  O O    . VAL A 1 77  ? -8.051  -16.877 -24.307 1.00 0.00 ? 1557 VAL A O    3  
ATOM   5564  C CB   . VAL A 1 77  ? -6.837  -19.660 -23.379 1.00 0.00 ? 1557 VAL A CB   3  
ATOM   5565  C CG1  . VAL A 1 77  ? -5.462  -19.003 -23.547 1.00 0.00 ? 1557 VAL A CG1  3  
ATOM   5566  C CG2  . VAL A 1 77  ? -6.642  -20.853 -22.443 1.00 0.00 ? 1557 VAL A CG2  3  
ATOM   5567  H H    . VAL A 1 77  ? -9.509  -19.016 -24.208 1.00 0.00 ? 1557 VAL A H    3  
ATOM   5568  H HA   . VAL A 1 77  ? -7.857  -18.759 -21.712 1.00 0.00 ? 1557 VAL A HA   3  
ATOM   5569  H HB   . VAL A 1 77  ? -7.163  -20.020 -24.355 1.00 0.00 ? 1557 VAL A HB   3  
ATOM   5570  H HG11 . VAL A 1 77  ? -5.176  -18.525 -22.609 1.00 0.00 ? 1557 VAL A HG11 3  
ATOM   5571  H HG12 . VAL A 1 77  ? -4.716  -19.753 -23.827 1.00 0.00 ? 1557 VAL A HG12 3  
ATOM   5572  H HG13 . VAL A 1 77  ? -5.508  -18.250 -24.331 1.00 0.00 ? 1557 VAL A HG13 3  
ATOM   5573  H HG21 . VAL A 1 77  ? -6.019  -21.603 -22.932 1.00 0.00 ? 1557 VAL A HG21 3  
ATOM   5574  H HG22 . VAL A 1 77  ? -6.130  -20.513 -21.543 1.00 0.00 ? 1557 VAL A HG22 3  
ATOM   5575  H HG23 . VAL A 1 77  ? -7.601  -21.294 -22.175 1.00 0.00 ? 1557 VAL A HG23 3  
ATOM   5576  N N    . VAL A 1 78  ? -7.156  -16.468 -22.290 1.00 0.00 ? 1558 VAL A N    3  
ATOM   5577  C CA   . VAL A 1 78  ? -6.759  -15.105 -22.605 1.00 0.00 ? 1558 VAL A CA   3  
ATOM   5578  C C    . VAL A 1 78  ? -5.693  -15.153 -23.702 1.00 0.00 ? 1558 VAL A C    3  
ATOM   5579  O O    . VAL A 1 78  ? -4.697  -15.853 -23.525 1.00 0.00 ? 1558 VAL A O    3  
ATOM   5580  C CB   . VAL A 1 78  ? -6.182  -14.431 -21.345 1.00 0.00 ? 1558 VAL A CB   3  
ATOM   5581  C CG1  . VAL A 1 78  ? -5.747  -12.987 -21.627 1.00 0.00 ? 1558 VAL A CG1  3  
ATOM   5582  C CG2  . VAL A 1 78  ? -7.172  -14.401 -20.175 1.00 0.00 ? 1558 VAL A CG2  3  
ATOM   5583  H H    . VAL A 1 78  ? -6.847  -16.864 -21.405 1.00 0.00 ? 1558 VAL A H    3  
ATOM   5584  H HA   . VAL A 1 78  ? -7.634  -14.564 -22.959 1.00 0.00 ? 1558 VAL A HA   3  
ATOM   5585  H HB   . VAL A 1 78  ? -5.312  -15.005 -21.022 1.00 0.00 ? 1558 VAL A HB   3  
ATOM   5586  H HG11 . VAL A 1 78  ? -5.321  -12.543 -20.725 1.00 0.00 ? 1558 VAL A HG11 3  
ATOM   5587  H HG12 . VAL A 1 78  ? -4.988  -12.954 -22.407 1.00 0.00 ? 1558 VAL A HG12 3  
ATOM   5588  H HG13 . VAL A 1 78  ? -6.602  -12.389 -21.952 1.00 0.00 ? 1558 VAL A HG13 3  
ATOM   5589  H HG21 . VAL A 1 78  ? -7.460  -15.408 -19.876 1.00 0.00 ? 1558 VAL A HG21 3  
ATOM   5590  H HG22 . VAL A 1 78  ? -6.680  -13.925 -19.330 1.00 0.00 ? 1558 VAL A HG22 3  
ATOM   5591  H HG23 . VAL A 1 78  ? -8.054  -13.820 -20.430 1.00 0.00 ? 1558 VAL A HG23 3  
ATOM   5592  N N    . LYS A 1 79  ? -5.824  -14.366 -24.774 1.00 0.00 ? 1559 LYS A N    3  
ATOM   5593  C CA   . LYS A 1 79  ? -4.757  -14.186 -25.763 1.00 0.00 ? 1559 LYS A CA   3  
ATOM   5594  C C    . LYS A 1 79  ? -4.538  -12.707 -26.112 1.00 0.00 ? 1559 LYS A C    3  
ATOM   5595  O O    . LYS A 1 79  ? -3.801  -12.406 -27.051 1.00 0.00 ? 1559 LYS A O    3  
ATOM   5596  C CB   . LYS A 1 79  ? -5.006  -15.068 -27.005 1.00 0.00 ? 1559 LYS A CB   3  
ATOM   5597  C CG   . LYS A 1 79  ? -4.836  -16.559 -26.668 1.00 0.00 ? 1559 LYS A CG   3  
ATOM   5598  C CD   . LYS A 1 79  ? -4.621  -17.419 -27.921 1.00 0.00 ? 1559 LYS A CD   3  
ATOM   5599  C CE   . LYS A 1 79  ? -4.311  -18.868 -27.509 1.00 0.00 ? 1559 LYS A CE   3  
ATOM   5600  N NZ   . LYS A 1 79  ? -4.164  -19.774 -28.677 1.00 0.00 ? 1559 LYS A NZ   3  
ATOM   5601  H H    . LYS A 1 79  ? -6.700  -13.871 -24.928 1.00 0.00 ? 1559 LYS A H    3  
ATOM   5602  H HA   . LYS A 1 79  ? -3.811  -14.512 -25.316 1.00 0.00 ? 1559 LYS A HA   3  
ATOM   5603  H HB2  . LYS A 1 79  ? -6.006  -14.882 -27.403 1.00 0.00 ? 1559 LYS A HB2  3  
ATOM   5604  H HB3  . LYS A 1 79  ? -4.279  -14.814 -27.776 1.00 0.00 ? 1559 LYS A HB3  3  
ATOM   5605  H HG2  . LYS A 1 79  ? -3.969  -16.681 -26.021 1.00 0.00 ? 1559 LYS A HG2  3  
ATOM   5606  H HG3  . LYS A 1 79  ? -5.721  -16.908 -26.139 1.00 0.00 ? 1559 LYS A HG3  3  
ATOM   5607  H HD2  . LYS A 1 79  ? -5.518  -17.388 -28.537 1.00 0.00 ? 1559 LYS A HD2  3  
ATOM   5608  H HD3  . LYS A 1 79  ? -3.784  -17.022 -28.498 1.00 0.00 ? 1559 LYS A HD3  3  
ATOM   5609  H HE2  . LYS A 1 79  ? -3.383  -18.873 -26.929 1.00 0.00 ? 1559 LYS A HE2  3  
ATOM   5610  H HE3  . LYS A 1 79  ? -5.117  -19.242 -26.872 1.00 0.00 ? 1559 LYS A HE3  3  
ATOM   5611  H HZ1  . LYS A 1 79  ? -3.463  -19.447 -29.329 1.00 0.00 ? 1559 LYS A HZ1  3  
ATOM   5612  H HZ2  . LYS A 1 79  ? -3.898  -20.705 -28.385 1.00 0.00 ? 1559 LYS A HZ2  3  
ATOM   5613  H HZ3  . LYS A 1 79  ? -5.059  -19.861 -29.174 1.00 0.00 ? 1559 LYS A HZ3  3  
ATOM   5614  N N    . GLY A 1 80  ? -5.116  -11.782 -25.345 1.00 0.00 ? 1560 GLY A N    3  
ATOM   5615  C CA   . GLY A 1 80  ? -4.869  -10.358 -25.498 1.00 0.00 ? 1560 GLY A CA   3  
ATOM   5616  C C    . GLY A 1 80  ? -5.674  -9.548  -24.492 1.00 0.00 ? 1560 GLY A C    3  
ATOM   5617  O O    . GLY A 1 80  ? -6.357  -10.106 -23.628 1.00 0.00 ? 1560 GLY A O    3  
ATOM   5618  H H    . GLY A 1 80  ? -5.747  -12.044 -24.603 1.00 0.00 ? 1560 GLY A H    3  
ATOM   5619  H HA2  . GLY A 1 80  ? -3.810  -10.159 -25.343 1.00 0.00 ? 1560 GLY A HA2  3  
ATOM   5620  H HA3  . GLY A 1 80  ? -5.127  -10.046 -26.510 1.00 0.00 ? 1560 GLY A HA3  3  
ATOM   5621  N N    . HIS A 1 81  ? -5.584  -8.226  -24.629 1.00 0.00 ? 1561 HIS A N    3  
ATOM   5622  C CA   . HIS A 1 81  ? -6.069  -7.217  -23.692 1.00 0.00 ? 1561 HIS A CA   3  
ATOM   5623  C C    . HIS A 1 81  ? -6.625  -6.019  -24.449 1.00 0.00 ? 1561 HIS A C    3  
ATOM   5624  O O    . HIS A 1 81  ? -6.163  -5.699  -25.546 1.00 0.00 ? 1561 HIS A O    3  
ATOM   5625  C CB   . HIS A 1 81  ? -4.912  -6.695  -22.825 1.00 0.00 ? 1561 HIS A CB   3  
ATOM   5626  C CG   . HIS A 1 81  ? -4.708  -7.465  -21.556 1.00 0.00 ? 1561 HIS A CG   3  
ATOM   5627  N ND1  . HIS A 1 81  ? -3.894  -8.588  -21.396 1.00 0.00 ? 1561 HIS A ND1  3  
ATOM   5628  C CD2  . HIS A 1 81  ? -5.239  -7.105  -20.352 1.00 0.00 ? 1561 HIS A CD2  3  
ATOM   5629  C CE1  . HIS A 1 81  ? -3.947  -8.879  -20.085 1.00 0.00 ? 1561 HIS A CE1  3  
ATOM   5630  N NE2  . HIS A 1 81  ? -4.734  -7.999  -19.433 1.00 0.00 ? 1561 HIS A NE2  3  
ATOM   5631  H H    . HIS A 1 81  ? -5.131  -7.873  -25.460 1.00 0.00 ? 1561 HIS A H    3  
ATOM   5632  H HA   . HIS A 1 81  ? -6.838  -7.639  -23.047 1.00 0.00 ? 1561 HIS A HA   3  
ATOM   5633  H HB2  . HIS A 1 81  ? -3.991  -6.678  -23.403 1.00 0.00 ? 1561 HIS A HB2  3  
ATOM   5634  H HB3  . HIS A 1 81  ? -5.127  -5.664  -22.531 1.00 0.00 ? 1561 HIS A HB3  3  
ATOM   5635  H HD2  . HIS A 1 81  ? -5.915  -6.271  -20.176 1.00 0.00 ? 1561 HIS A HD2  3  
ATOM   5636  H HE1  . HIS A 1 81  ? -3.423  -9.706  -19.618 1.00 0.00 ? 1561 HIS A HE1  3  
ATOM   5637  H HE2  . HIS A 1 81  ? -4.920  -7.994  -18.436 1.00 0.00 ? 1561 HIS A HE2  3  
ATOM   5638  N N    . ARG A 1 82  ? -7.555  -5.295  -23.822 1.00 0.00 ? 1562 ARG A N    3  
ATOM   5639  C CA   . ARG A 1 82  ? -8.056  -4.005  -24.288 1.00 0.00 ? 1562 ARG A CA   3  
ATOM   5640  C C    . ARG A 1 82  ? -8.381  -3.161  -23.060 1.00 0.00 ? 1562 ARG A C    3  
ATOM   5641  O O    . ARG A 1 82  ? -8.630  -3.695  -21.980 1.00 0.00 ? 1562 ARG A O    3  
ATOM   5642  C CB   . ARG A 1 82  ? -9.266  -4.257  -25.212 1.00 0.00 ? 1562 ARG A CB   3  
ATOM   5643  C CG   . ARG A 1 82  ? -10.197 -3.058  -25.457 1.00 0.00 ? 1562 ARG A CG   3  
ATOM   5644  C CD   . ARG A 1 82  ? -11.339 -3.459  -26.392 1.00 0.00 ? 1562 ARG A CD   3  
ATOM   5645  N NE   . ARG A 1 82  ? -12.096 -2.287  -26.855 1.00 0.00 ? 1562 ARG A NE   3  
ATOM   5646  C CZ   . ARG A 1 82  ? -11.854 -1.556  -27.953 1.00 0.00 ? 1562 ARG A CZ   3  
ATOM   5647  N NH1  . ARG A 1 82  ? -10.796 -1.788  -28.733 1.00 0.00 ? 1562 ARG A NH1  3  
ATOM   5648  N NH2  . ARG A 1 82  ? -12.696 -0.578  -28.258 1.00 0.00 ? 1562 ARG A NH2  3  
ATOM   5649  H H    . ARG A 1 82  ? -7.903  -5.602  -22.915 1.00 0.00 ? 1562 ARG A H    3  
ATOM   5650  H HA   . ARG A 1 82  ? -7.270  -3.504  -24.858 1.00 0.00 ? 1562 ARG A HA   3  
ATOM   5651  H HB2  . ARG A 1 82  ? -8.881  -4.593  -26.176 1.00 0.00 ? 1562 ARG A HB2  3  
ATOM   5652  H HB3  . ARG A 1 82  ? -9.859  -5.074  -24.806 1.00 0.00 ? 1562 ARG A HB3  3  
ATOM   5653  H HG2  . ARG A 1 82  ? -10.626 -2.719  -24.510 1.00 0.00 ? 1562 ARG A HG2  3  
ATOM   5654  H HG3  . ARG A 1 82  ? -9.620  -2.243  -25.897 1.00 0.00 ? 1562 ARG A HG3  3  
ATOM   5655  H HD2  . ARG A 1 82  ? -10.945 -4.005  -27.252 1.00 0.00 ? 1562 ARG A HD2  3  
ATOM   5656  H HD3  . ARG A 1 82  ? -12.016 -4.126  -25.857 1.00 0.00 ? 1562 ARG A HD3  3  
ATOM   5657  H HE   . ARG A 1 82  ? -12.893 -2.010  -26.272 1.00 0.00 ? 1562 ARG A HE   3  
ATOM   5658  H HH11 . ARG A 1 82  ? -10.142 -2.530  -28.519 1.00 0.00 ? 1562 ARG A HH11 3  
ATOM   5659  H HH12 . ARG A 1 82  ? -10.614 -1.240  -29.567 1.00 0.00 ? 1562 ARG A HH12 3  
ATOM   5660  H HH21 . ARG A 1 82  ? -13.534 -0.477  -27.674 1.00 0.00 ? 1562 ARG A HH21 3  
ATOM   5661  H HH22 . ARG A 1 82  ? -12.585 0.020   -29.068 1.00 0.00 ? 1562 ARG A HH22 3  
ATOM   5662  N N    . LYS A 1 83  ? -8.437  -1.848  -23.247 1.00 0.00 ? 1563 LYS A N    3  
ATOM   5663  C CA   . LYS A 1 83  ? -8.934  -0.879  -22.279 1.00 0.00 ? 1563 LYS A CA   3  
ATOM   5664  C C    . LYS A 1 83  ? -9.991  -0.068  -23.016 1.00 0.00 ? 1563 LYS A C    3  
ATOM   5665  O O    . LYS A 1 83  ? -9.743  0.397   -24.131 1.00 0.00 ? 1563 LYS A O    3  
ATOM   5666  C CB   . LYS A 1 83  ? -7.766  0.006   -21.812 1.00 0.00 ? 1563 LYS A CB   3  
ATOM   5667  C CG   . LYS A 1 83  ? -6.996  -0.579  -20.615 1.00 0.00 ? 1563 LYS A CG   3  
ATOM   5668  C CD   . LYS A 1 83  ? -7.794  -0.415  -19.307 1.00 0.00 ? 1563 LYS A CD   3  
ATOM   5669  C CE   . LYS A 1 83  ? -6.898  -0.404  -18.056 1.00 0.00 ? 1563 LYS A CE   3  
ATOM   5670  N NZ   . LYS A 1 83  ? -6.147  0.874   -17.877 1.00 0.00 ? 1563 LYS A NZ   3  
ATOM   5671  H H    . LYS A 1 83  ? -8.226  -1.478  -24.166 1.00 0.00 ? 1563 LYS A H    3  
ATOM   5672  H HA   . LYS A 1 83  ? -9.392  -1.388  -21.429 1.00 0.00 ? 1563 LYS A HA   3  
ATOM   5673  H HB2  . LYS A 1 83  ? -7.072  0.153   -22.640 1.00 0.00 ? 1563 LYS A HB2  3  
ATOM   5674  H HB3  . LYS A 1 83  ? -8.143  0.995   -21.540 1.00 0.00 ? 1563 LYS A HB3  3  
ATOM   5675  H HG2  . LYS A 1 83  ? -6.777  -1.642  -20.778 1.00 0.00 ? 1563 LYS A HG2  3  
ATOM   5676  H HG3  . LYS A 1 83  ? -6.055  -0.038  -20.531 1.00 0.00 ? 1563 LYS A HG3  3  
ATOM   5677  H HD2  . LYS A 1 83  ? -8.389  0.500   -19.335 1.00 0.00 ? 1563 LYS A HD2  3  
ATOM   5678  H HD3  . LYS A 1 83  ? -8.490  -1.252  -19.243 1.00 0.00 ? 1563 LYS A HD3  3  
ATOM   5679  H HE2  . LYS A 1 83  ? -7.534  -0.559  -17.178 1.00 0.00 ? 1563 LYS A HE2  3  
ATOM   5680  H HE3  . LYS A 1 83  ? -6.190  -1.238  -18.111 1.00 0.00 ? 1563 LYS A HE3  3  
ATOM   5681  H HZ1  . LYS A 1 83  ? -5.510  1.050   -18.642 1.00 0.00 ? 1563 LYS A HZ1  3  
ATOM   5682  H HZ2  . LYS A 1 83  ? -6.768  1.670   -17.784 1.00 0.00 ? 1563 LYS A HZ2  3  
ATOM   5683  H HZ3  . LYS A 1 83  ? -5.591  0.844   -17.031 1.00 0.00 ? 1563 LYS A HZ3  3  
ATOM   5684  N N    . GLU A 1 84  ? -11.168 0.089   -22.417 1.00 0.00 ? 1564 GLU A N    3  
ATOM   5685  C CA   . GLU A 1 84  ? -12.292 0.818   -22.994 1.00 0.00 ? 1564 GLU A CA   3  
ATOM   5686  C C    . GLU A 1 84  ? -13.077 1.403   -21.827 1.00 0.00 ? 1564 GLU A C    3  
ATOM   5687  O O    . GLU A 1 84  ? -13.240 0.722   -20.817 1.00 0.00 ? 1564 GLU A O    3  
ATOM   5688  C CB   . GLU A 1 84  ? -13.155 -0.149  -23.822 1.00 0.00 ? 1564 GLU A CB   3  
ATOM   5689  C CG   . GLU A 1 84  ? -14.344 0.560   -24.489 1.00 0.00 ? 1564 GLU A CG   3  
ATOM   5690  C CD   . GLU A 1 84  ? -15.176 -0.398  -25.359 1.00 0.00 ? 1564 GLU A CD   3  
ATOM   5691  O OE1  . GLU A 1 84  ? -14.621 -0.943  -26.344 1.00 0.00 ? 1564 GLU A OE1  3  
ATOM   5692  O OE2  . GLU A 1 84  ? -16.381 -0.607  -25.073 1.00 0.00 ? 1564 GLU A OE2  3  
ATOM   5693  H H    . GLU A 1 84  ? -11.323 -0.307  -21.494 1.00 0.00 ? 1564 GLU A H    3  
ATOM   5694  H HA   . GLU A 1 84  ? -11.944 1.629   -23.632 1.00 0.00 ? 1564 GLU A HA   3  
ATOM   5695  H HB2  . GLU A 1 84  ? -12.535 -0.599  -24.596 1.00 0.00 ? 1564 GLU A HB2  3  
ATOM   5696  H HB3  . GLU A 1 84  ? -13.534 -0.942  -23.177 1.00 0.00 ? 1564 GLU A HB3  3  
ATOM   5697  H HG2  . GLU A 1 84  ? -14.982 0.996   -23.717 1.00 0.00 ? 1564 GLU A HG2  3  
ATOM   5698  H HG3  . GLU A 1 84  ? -13.966 1.369   -25.121 1.00 0.00 ? 1564 GLU A HG3  3  
ATOM   5699  N N    . SER A 1 85  ? -13.541 2.652   -21.959 1.00 0.00 ? 1565 SER A N    3  
ATOM   5700  C CA   . SER A 1 85  ? -14.345 3.341   -20.947 1.00 0.00 ? 1565 SER A CA   3  
ATOM   5701  C C    . SER A 1 85  ? -13.741 3.276   -19.530 1.00 0.00 ? 1565 SER A C    3  
ATOM   5702  O O    . SER A 1 85  ? -14.467 3.309   -18.531 1.00 0.00 ? 1565 SER A O    3  
ATOM   5703  C CB   . SER A 1 85  ? -15.783 2.815   -21.033 1.00 0.00 ? 1565 SER A CB   3  
ATOM   5704  O OG   . SER A 1 85  ? -16.321 3.029   -22.337 1.00 0.00 ? 1565 SER A OG   3  
ATOM   5705  H H    . SER A 1 85  ? -13.403 3.144   -22.832 1.00 0.00 ? 1565 SER A H    3  
ATOM   5706  H HA   . SER A 1 85  ? -14.366 4.397   -21.214 1.00 0.00 ? 1565 SER A HA   3  
ATOM   5707  H HB2  . SER A 1 85  ? -15.797 1.750   -20.791 1.00 0.00 ? 1565 SER A HB2  3  
ATOM   5708  H HB3  . SER A 1 85  ? -16.393 3.349   -20.306 1.00 0.00 ? 1565 SER A HB3  3  
ATOM   5709  H HG   . SER A 1 85  ? -17.239 2.682   -22.357 1.00 0.00 ? 1565 SER A HG   3  
ATOM   5710  N N    . GLY A 1 86  ? -12.406 3.188   -19.432 1.00 0.00 ? 1566 GLY A N    3  
ATOM   5711  C CA   . GLY A 1 86  ? -11.706 3.097   -18.164 1.00 0.00 ? 1566 GLY A CA   3  
ATOM   5712  C C    . GLY A 1 86  ? -11.968 1.774   -17.439 1.00 0.00 ? 1566 GLY A C    3  
ATOM   5713  O O    . GLY A 1 86  ? -11.957 1.763   -16.204 1.00 0.00 ? 1566 GLY A O    3  
ATOM   5714  H H    . GLY A 1 86  ? -11.853 3.186   -20.278 1.00 0.00 ? 1566 GLY A H    3  
ATOM   5715  H HA2  . GLY A 1 86  ? -10.634 3.187   -18.346 1.00 0.00 ? 1566 GLY A HA2  3  
ATOM   5716  H HA3  . GLY A 1 86  ? -12.018 3.925   -17.524 1.00 0.00 ? 1566 GLY A HA3  3  
ATOM   5717  N N    . GLU A 1 87  ? -12.189 0.663   -18.154 1.00 0.00 ? 1567 GLU A N    3  
ATOM   5718  C CA   . GLU A 1 87  ? -12.253 -0.669  -17.564 1.00 0.00 ? 1567 GLU A CA   3  
ATOM   5719  C C    . GLU A 1 87  ? -11.473 -1.637  -18.454 1.00 0.00 ? 1567 GLU A C    3  
ATOM   5720  O O    . GLU A 1 87  ? -11.122 -1.322  -19.597 1.00 0.00 ? 1567 GLU A O    3  
ATOM   5721  C CB   . GLU A 1 87  ? -13.697 -1.106  -17.248 1.00 0.00 ? 1567 GLU A CB   3  
ATOM   5722  C CG   . GLU A 1 87  ? -14.563 -1.489  -18.453 1.00 0.00 ? 1567 GLU A CG   3  
ATOM   5723  C CD   . GLU A 1 87  ? -15.981 -1.889  -17.997 1.00 0.00 ? 1567 GLU A CD   3  
ATOM   5724  O OE1  . GLU A 1 87  ? -16.164 -3.023  -17.492 1.00 0.00 ? 1567 GLU A OE1  3  
ATOM   5725  O OE2  . GLU A 1 87  ? -16.923 -1.070  -18.142 1.00 0.00 ? 1567 GLU A OE2  3  
ATOM   5726  H H    . GLU A 1 87  ? -12.193 0.682   -19.176 1.00 0.00 ? 1567 GLU A H    3  
ATOM   5727  H HA   . GLU A 1 87  ? -11.727 -0.633  -16.608 1.00 0.00 ? 1567 GLU A HA   3  
ATOM   5728  H HB2  . GLU A 1 87  ? -13.644 -1.970  -16.584 1.00 0.00 ? 1567 GLU A HB2  3  
ATOM   5729  H HB3  . GLU A 1 87  ? -14.196 -0.305  -16.698 1.00 0.00 ? 1567 GLU A HB3  3  
ATOM   5730  H HG2  . GLU A 1 87  ? -14.624 -0.644  -19.136 1.00 0.00 ? 1567 GLU A HG2  3  
ATOM   5731  H HG3  . GLU A 1 87  ? -14.098 -2.329  -18.974 1.00 0.00 ? 1567 GLU A HG3  3  
ATOM   5732  N N    . LEU A 1 88  ? -11.154 -2.811  -17.903 1.00 0.00 ? 1568 LEU A N    3  
ATOM   5733  C CA   . LEU A 1 88  ? -10.227 -3.760  -18.505 1.00 0.00 ? 1568 LEU A CA   3  
ATOM   5734  C C    . LEU A 1 88  ? -10.967 -4.882  -19.220 1.00 0.00 ? 1568 LEU A C    3  
ATOM   5735  O O    . LEU A 1 88  ? -11.941 -5.428  -18.698 1.00 0.00 ? 1568 LEU A O    3  
ATOM   5736  C CB   . LEU A 1 88  ? -9.335  -4.304  -17.375 1.00 0.00 ? 1568 LEU A CB   3  
ATOM   5737  C CG   . LEU A 1 88  ? -8.083  -5.082  -17.830 1.00 0.00 ? 1568 LEU A CG   3  
ATOM   5738  C CD1  . LEU A 1 88  ? -7.139  -4.189  -18.648 1.00 0.00 ? 1568 LEU A CD1  3  
ATOM   5739  C CD2  . LEU A 1 88  ? -7.349  -5.561  -16.577 1.00 0.00 ? 1568 LEU A CD2  3  
ATOM   5740  H H    . LEU A 1 88  ? -11.541 -3.050  -17.000 1.00 0.00 ? 1568 LEU A H    3  
ATOM   5741  H HA   . LEU A 1 88  ? -9.610  -3.229  -19.227 1.00 0.00 ? 1568 LEU A HA   3  
ATOM   5742  H HB2  . LEU A 1 88  ? -9.003  -3.466  -16.758 1.00 0.00 ? 1568 LEU A HB2  3  
ATOM   5743  H HB3  . LEU A 1 88  ? -9.949  -4.953  -16.746 1.00 0.00 ? 1568 LEU A HB3  3  
ATOM   5744  H HG   . LEU A 1 88  ? -8.372  -5.950  -18.421 1.00 0.00 ? 1568 LEU A HG   3  
ATOM   5745  H HD11 . LEU A 1 88  ? -7.000  -3.235  -18.140 1.00 0.00 ? 1568 LEU A HD11 3  
ATOM   5746  H HD12 . LEU A 1 88  ? -6.162  -4.658  -18.755 1.00 0.00 ? 1568 LEU A HD12 3  
ATOM   5747  H HD13 . LEU A 1 88  ? -7.549  -4.010  -19.642 1.00 0.00 ? 1568 LEU A HD13 3  
ATOM   5748  H HD21 . LEU A 1 88  ? -8.028  -6.140  -15.946 1.00 0.00 ? 1568 LEU A HD21 3  
ATOM   5749  H HD22 . LEU A 1 88  ? -6.501  -6.191  -16.855 1.00 0.00 ? 1568 LEU A HD22 3  
ATOM   5750  H HD23 . LEU A 1 88  ? -6.976  -4.707  -16.006 1.00 0.00 ? 1568 LEU A HD23 3  
ATOM   5751  N N    . TYR A 1 89  ? -10.450 -5.256  -20.386 1.00 0.00 ? 1569 TYR A N    3  
ATOM   5752  C CA   . TYR A 1 89  ? -10.995 -6.273  -21.268 1.00 0.00 ? 1569 TYR A CA   3  
ATOM   5753  C C    . TYR A 1 89  ? -9.898  -7.266  -21.621 1.00 0.00 ? 1569 TYR A C    3  
ATOM   5754  O O    . TYR A 1 89  ? -8.711  -6.927  -21.636 1.00 0.00 ? 1569 TYR A O    3  
ATOM   5755  C CB   . TYR A 1 89  ? -11.522 -5.616  -22.551 1.00 0.00 ? 1569 TYR A CB   3  
ATOM   5756  C CG   . TYR A 1 89  ? -12.911 -5.049  -22.423 1.00 0.00 ? 1569 TYR A CG   3  
ATOM   5757  C CD1  . TYR A 1 89  ? -13.100 -3.779  -21.850 1.00 0.00 ? 1569 TYR A CD1  3  
ATOM   5758  C CD2  . TYR A 1 89  ? -14.014 -5.795  -22.876 1.00 0.00 ? 1569 TYR A CD2  3  
ATOM   5759  C CE1  . TYR A 1 89  ? -14.397 -3.260  -21.721 1.00 0.00 ? 1569 TYR A CE1  3  
ATOM   5760  C CE2  . TYR A 1 89  ? -15.313 -5.284  -22.741 1.00 0.00 ? 1569 TYR A CE2  3  
ATOM   5761  C CZ   . TYR A 1 89  ? -15.514 -4.008  -22.162 1.00 0.00 ? 1569 TYR A CZ   3  
ATOM   5762  O OH   . TYR A 1 89  ? -16.769 -3.491  -22.021 1.00 0.00 ? 1569 TYR A OH   3  
ATOM   5763  H H    . TYR A 1 89  ? -9.621  -4.781  -20.733 1.00 0.00 ? 1569 TYR A H    3  
ATOM   5764  H HA   . TYR A 1 89  ? -11.814 -6.796  -20.778 1.00 0.00 ? 1569 TYR A HA   3  
ATOM   5765  H HB2  . TYR A 1 89  ? -10.849 -4.818  -22.853 1.00 0.00 ? 1569 TYR A HB2  3  
ATOM   5766  H HB3  . TYR A 1 89  ? -11.533 -6.359  -23.349 1.00 0.00 ? 1569 TYR A HB3  3  
ATOM   5767  H HD1  . TYR A 1 89  ? -12.256 -3.197  -21.505 1.00 0.00 ? 1569 TYR A HD1  3  
ATOM   5768  H HD2  . TYR A 1 89  ? -13.864 -6.765  -23.326 1.00 0.00 ? 1569 TYR A HD2  3  
ATOM   5769  H HE1  . TYR A 1 89  ? -14.526 -2.288  -21.279 1.00 0.00 ? 1569 TYR A HE1  3  
ATOM   5770  H HE2  . TYR A 1 89  ? -16.146 -5.881  -23.083 1.00 0.00 ? 1569 TYR A HE2  3  
ATOM   5771  H HH   . TYR A 1 89  ? -17.474 -4.055  -22.380 1.00 0.00 ? 1569 TYR A HH   3  
ATOM   5772  N N    . TYR A 1 90  ? -10.318 -8.472  -21.987 1.00 0.00 ? 1570 TYR A N    3  
ATOM   5773  C CA   . TYR A 1 90  ? -9.463  -9.584  -22.350 1.00 0.00 ? 1570 TYR A CA   3  
ATOM   5774  C C    . TYR A 1 90  ? -10.078 -10.214 -23.587 1.00 0.00 ? 1570 TYR A C    3  
ATOM   5775  O O    . TYR A 1 90  ? -11.284 -10.464 -23.610 1.00 0.00 ? 1570 TYR A O    3  
ATOM   5776  C CB   . TYR A 1 90  ? -9.425  -10.609 -21.209 1.00 0.00 ? 1570 TYR A CB   3  
ATOM   5777  C CG   . TYR A 1 90  ? -8.927  -10.087 -19.885 1.00 0.00 ? 1570 TYR A CG   3  
ATOM   5778  C CD1  . TYR A 1 90  ? -9.806  -9.450  -18.981 1.00 0.00 ? 1570 TYR A CD1  3  
ATOM   5779  C CD2  . TYR A 1 90  ? -7.573  -10.247 -19.555 1.00 0.00 ? 1570 TYR A CD2  3  
ATOM   5780  C CE1  . TYR A 1 90  ? -9.318  -8.968  -17.755 1.00 0.00 ? 1570 TYR A CE1  3  
ATOM   5781  C CE2  . TYR A 1 90  ? -7.094  -9.795  -18.321 1.00 0.00 ? 1570 TYR A CE2  3  
ATOM   5782  C CZ   . TYR A 1 90  ? -7.961  -9.155  -17.416 1.00 0.00 ? 1570 TYR A CZ   3  
ATOM   5783  O OH   . TYR A 1 90  ? -7.473  -8.735  -16.217 1.00 0.00 ? 1570 TYR A OH   3  
ATOM   5784  H H    . TYR A 1 90  ? -11.320 -8.653  -22.015 1.00 0.00 ? 1570 TYR A H    3  
ATOM   5785  H HA   . TYR A 1 90  ? -8.456  -9.234  -22.562 1.00 0.00 ? 1570 TYR A HA   3  
ATOM   5786  H HB2  . TYR A 1 90  ? -10.419 -11.021 -21.043 1.00 0.00 ? 1570 TYR A HB2  3  
ATOM   5787  H HB3  . TYR A 1 90  ? -8.788  -11.438 -21.512 1.00 0.00 ? 1570 TYR A HB3  3  
ATOM   5788  H HD1  . TYR A 1 90  ? -10.855 -9.328  -19.225 1.00 0.00 ? 1570 TYR A HD1  3  
ATOM   5789  H HD2  . TYR A 1 90  ? -6.891  -10.720 -20.247 1.00 0.00 ? 1570 TYR A HD2  3  
ATOM   5790  H HE1  . TYR A 1 90  ? -9.982  -8.457  -17.074 1.00 0.00 ? 1570 TYR A HE1  3  
ATOM   5791  H HE2  . TYR A 1 90  ? -6.057  -9.950  -18.079 1.00 0.00 ? 1570 TYR A HE2  3  
ATOM   5792  H HH   . TYR A 1 90  ? -8.132  -8.329  -15.623 1.00 0.00 ? 1570 TYR A HH   3  
ATOM   5793  N N    . SER A 1 91  ? -9.279  -10.477 -24.613 1.00 0.00 ? 1571 SER A N    3  
ATOM   5794  C CA   . SER A 1 91  ? -9.715  -11.264 -25.748 1.00 0.00 ? 1571 SER A CA   3  
ATOM   5795  C C    . SER A 1 91  ? -9.521  -12.723 -25.352 1.00 0.00 ? 1571 SER A C    3  
ATOM   5796  O O    . SER A 1 91  ? -8.391  -13.213 -25.257 1.00 0.00 ? 1571 SER A O    3  
ATOM   5797  C CB   . SER A 1 91  ? -8.965  -10.828 -27.014 1.00 0.00 ? 1571 SER A CB   3  
ATOM   5798  O OG   . SER A 1 91  ? -7.647  -10.394 -26.733 1.00 0.00 ? 1571 SER A OG   3  
ATOM   5799  H H    . SER A 1 91  ? -8.290  -10.255 -24.576 1.00 0.00 ? 1571 SER A H    3  
ATOM   5800  H HA   . SER A 1 91  ? -10.779 -11.097 -25.931 1.00 0.00 ? 1571 SER A HA   3  
ATOM   5801  H HB2  . SER A 1 91  ? -8.942  -11.642 -27.727 1.00 0.00 ? 1571 SER A HB2  3  
ATOM   5802  H HB3  . SER A 1 91  ? -9.511  -10.000 -27.467 1.00 0.00 ? 1571 SER A HB3  3  
ATOM   5803  H HG   . SER A 1 91  ? -7.258  -10.044 -27.556 1.00 0.00 ? 1571 SER A HG   3  
ATOM   5804  N N    . ILE A 1 92  ? -10.621 -13.394 -25.015 1.00 0.00 ? 1572 ILE A N    3  
ATOM   5805  C CA   . ILE A 1 92  ? -10.620 -14.801 -24.654 1.00 0.00 ? 1572 ILE A CA   3  
ATOM   5806  C C    . ILE A 1 92  ? -10.798 -15.552 -25.968 1.00 0.00 ? 1572 ILE A C    3  
ATOM   5807  O O    . ILE A 1 92  ? -11.807 -15.381 -26.651 1.00 0.00 ? 1572 ILE A O    3  
ATOM   5808  C CB   . ILE A 1 92  ? -11.738 -15.103 -23.631 1.00 0.00 ? 1572 ILE A CB   3  
ATOM   5809  C CG1  . ILE A 1 92  ? -11.738 -14.143 -22.418 1.00 0.00 ? 1572 ILE A CG1  3  
ATOM   5810  C CG2  . ILE A 1 92  ? -11.646 -16.548 -23.116 1.00 0.00 ? 1572 ILE A CG2  3  
ATOM   5811  C CD1  . ILE A 1 92  ? -10.369 -13.970 -21.759 1.00 0.00 ? 1572 ILE A CD1  3  
ATOM   5812  H H    . ILE A 1 92  ? -11.531 -12.952 -25.146 1.00 0.00 ? 1572 ILE A H    3  
ATOM   5813  H HA   . ILE A 1 92  ? -9.661  -15.056 -24.211 1.00 0.00 ? 1572 ILE A HA   3  
ATOM   5814  H HB   . ILE A 1 92  ? -12.697 -15.014 -24.140 1.00 0.00 ? 1572 ILE A HB   3  
ATOM   5815  H HG12 . ILE A 1 92  ? -12.081 -13.152 -22.733 1.00 0.00 ? 1572 ILE A HG12 3  
ATOM   5816  H HG13 . ILE A 1 92  ? -12.444 -14.509 -21.667 1.00 0.00 ? 1572 ILE A HG13 3  
ATOM   5817  H HG21 . ILE A 1 92  ? -10.681 -16.738 -22.644 1.00 0.00 ? 1572 ILE A HG21 3  
ATOM   5818  H HG22 . ILE A 1 92  ? -12.445 -16.729 -22.389 1.00 0.00 ? 1572 ILE A HG22 3  
ATOM   5819  H HG23 . ILE A 1 92  ? -11.783 -17.243 -23.946 1.00 0.00 ? 1572 ILE A HG23 3  
ATOM   5820  H HD11 . ILE A 1 92  ? -9.895  -14.934 -21.593 1.00 0.00 ? 1572 ILE A HD11 3  
ATOM   5821  H HD12 . ILE A 1 92  ? -9.721  -13.374 -22.399 1.00 0.00 ? 1572 ILE A HD12 3  
ATOM   5822  H HD13 . ILE A 1 92  ? -10.488 -13.452 -20.808 1.00 0.00 ? 1572 ILE A HD13 3  
ATOM   5823  N N    . GLU A 1 93  ? -9.800  -16.325 -26.378 1.00 0.00 ? 1573 GLU A N    3  
ATOM   5824  C CA   . GLU A 1 93  ? -9.957  -17.242 -27.486 1.00 0.00 ? 1573 GLU A CA   3  
ATOM   5825  C C    . GLU A 1 93  ? -10.788 -18.422 -26.994 1.00 0.00 ? 1573 GLU A C    3  
ATOM   5826  O O    . GLU A 1 93  ? -10.529 -18.969 -25.917 1.00 0.00 ? 1573 GLU A O    3  
ATOM   5827  C CB   . GLU A 1 93  ? -8.592  -17.679 -28.043 1.00 0.00 ? 1573 GLU A CB   3  
ATOM   5828  C CG   . GLU A 1 93  ? -8.774  -18.582 -29.275 1.00 0.00 ? 1573 GLU A CG   3  
ATOM   5829  C CD   . GLU A 1 93  ? -7.456  -18.865 -30.005 1.00 0.00 ? 1573 GLU A CD   3  
ATOM   5830  O OE1  . GLU A 1 93  ? -6.754  -19.834 -29.637 1.00 0.00 ? 1573 GLU A OE1  3  
ATOM   5831  O OE2  . GLU A 1 93  ? -7.125  -18.113 -30.950 1.00 0.00 ? 1573 GLU A OE2  3  
ATOM   5832  H H    . GLU A 1 93  ? -8.998  -16.455 -25.770 1.00 0.00 ? 1573 GLU A H    3  
ATOM   5833  H HA   . GLU A 1 93  ? -10.497 -16.734 -28.278 1.00 0.00 ? 1573 GLU A HA   3  
ATOM   5834  H HB2  . GLU A 1 93  ? -8.041  -16.785 -28.341 1.00 0.00 ? 1573 GLU A HB2  3  
ATOM   5835  H HB3  . GLU A 1 93  ? -8.027  -18.211 -27.278 1.00 0.00 ? 1573 GLU A HB3  3  
ATOM   5836  H HG2  . GLU A 1 93  ? -9.231  -19.525 -28.972 1.00 0.00 ? 1573 GLU A HG2  3  
ATOM   5837  H HG3  . GLU A 1 93  ? -9.456  -18.088 -29.965 1.00 0.00 ? 1573 GLU A HG3  3  
ATOM   5838  N N    . LYS A 1 94  ? -11.772 -18.817 -27.802 1.00 0.00 ? 1574 LYS A N    3  
ATOM   5839  C CA   . LYS A 1 94  ? -12.534 -20.046 -27.628 1.00 0.00 ? 1574 LYS A CA   3  
ATOM   5840  C C    . LYS A 1 94  ? -12.828 -20.558 -29.036 1.00 0.00 ? 1574 LYS A C    3  
ATOM   5841  O O    . LYS A 1 94  ? -13.049 -19.739 -29.927 1.00 0.00 ? 1574 LYS A O    3  
ATOM   5842  C CB   . LYS A 1 94  ? -13.822 -19.743 -26.834 1.00 0.00 ? 1574 LYS A CB   3  
ATOM   5843  C CG   . LYS A 1 94  ? -14.258 -20.995 -26.064 1.00 0.00 ? 1574 LYS A CG   3  
ATOM   5844  C CD   . LYS A 1 94  ? -15.694 -20.952 -25.522 1.00 0.00 ? 1574 LYS A CD   3  
ATOM   5845  C CE   . LYS A 1 94  ? -16.710 -21.015 -26.684 1.00 0.00 ? 1574 LYS A CE   3  
ATOM   5846  N NZ   . LYS A 1 94  ? -18.118 -21.228 -26.246 1.00 0.00 ? 1574 LYS A NZ   3  
ATOM   5847  H H    . LYS A 1 94  ? -11.948 -18.291 -28.660 1.00 0.00 ? 1574 LYS A H    3  
ATOM   5848  H HA   . LYS A 1 94  ? -11.910 -20.765 -27.090 1.00 0.00 ? 1574 LYS A HA   3  
ATOM   5849  H HB2  . LYS A 1 94  ? -13.632 -18.952 -26.107 1.00 0.00 ? 1574 LYS A HB2  3  
ATOM   5850  H HB3  . LYS A 1 94  ? -14.604 -19.397 -27.513 1.00 0.00 ? 1574 LYS A HB3  3  
ATOM   5851  H HG2  . LYS A 1 94  ? -14.156 -21.878 -26.698 1.00 0.00 ? 1574 LYS A HG2  3  
ATOM   5852  H HG3  . LYS A 1 94  ? -13.565 -21.104 -25.229 1.00 0.00 ? 1574 LYS A HG3  3  
ATOM   5853  H HD2  . LYS A 1 94  ? -15.821 -21.821 -24.871 1.00 0.00 ? 1574 LYS A HD2  3  
ATOM   5854  H HD3  . LYS A 1 94  ? -15.839 -20.048 -24.929 1.00 0.00 ? 1574 LYS A HD3  3  
ATOM   5855  H HE2  . LYS A 1 94  ? -16.651 -20.086 -27.260 1.00 0.00 ? 1574 LYS A HE2  3  
ATOM   5856  H HE3  . LYS A 1 94  ? -16.429 -21.841 -27.344 1.00 0.00 ? 1574 LYS A HE3  3  
ATOM   5857  H HZ1  . LYS A 1 94  ? -18.451 -20.489 -25.634 1.00 0.00 ? 1574 LYS A HZ1  3  
ATOM   5858  H HZ2  . LYS A 1 94  ? -18.730 -21.248 -27.056 1.00 0.00 ? 1574 LYS A HZ2  3  
ATOM   5859  H HZ3  . LYS A 1 94  ? -18.239 -22.111 -25.765 1.00 0.00 ? 1574 LYS A HZ3  3  
ATOM   5860  N N    . GLU A 1 95  ? -12.830 -21.870 -29.253 1.00 0.00 ? 1575 GLU A N    3  
ATOM   5861  C CA   . GLU A 1 95  ? -13.057 -22.490 -30.569 1.00 0.00 ? 1575 GLU A CA   3  
ATOM   5862  C C    . GLU A 1 95  ? -12.138 -21.898 -31.663 1.00 0.00 ? 1575 GLU A C    3  
ATOM   5863  O O    . GLU A 1 95  ? -12.520 -21.805 -32.833 1.00 0.00 ? 1575 GLU A O    3  
ATOM   5864  C CB   . GLU A 1 95  ? -14.560 -22.457 -30.916 1.00 0.00 ? 1575 GLU A CB   3  
ATOM   5865  C CG   . GLU A 1 95  ? -15.412 -23.240 -29.907 1.00 0.00 ? 1575 GLU A CG   3  
ATOM   5866  C CD   . GLU A 1 95  ? -16.912 -23.178 -30.257 1.00 0.00 ? 1575 GLU A CD   3  
ATOM   5867  O OE1  . GLU A 1 95  ? -17.357 -23.898 -31.184 1.00 0.00 ? 1575 GLU A OE1  3  
ATOM   5868  O OE2  . GLU A 1 95  ? -17.657 -22.407 -29.604 1.00 0.00 ? 1575 GLU A OE2  3  
ATOM   5869  H H    . GLU A 1 95  ? -12.633 -22.499 -28.482 1.00 0.00 ? 1575 GLU A H    3  
ATOM   5870  H HA   . GLU A 1 95  ? -12.768 -23.537 -30.477 1.00 0.00 ? 1575 GLU A HA   3  
ATOM   5871  H HB2  . GLU A 1 95  ? -14.906 -21.424 -30.951 1.00 0.00 ? 1575 GLU A HB2  3  
ATOM   5872  H HB3  . GLU A 1 95  ? -14.710 -22.906 -31.898 1.00 0.00 ? 1575 GLU A HB3  3  
ATOM   5873  H HG2  . GLU A 1 95  ? -15.084 -24.282 -29.907 1.00 0.00 ? 1575 GLU A HG2  3  
ATOM   5874  H HG3  . GLU A 1 95  ? -15.254 -22.837 -28.907 1.00 0.00 ? 1575 GLU A HG3  3  
ATOM   5875  N N    . GLY A 1 96  ? -10.920 -21.489 -31.278 1.00 0.00 ? 1576 GLY A N    3  
ATOM   5876  C CA   . GLY A 1 96  ? -9.918  -20.941 -32.187 1.00 0.00 ? 1576 GLY A CA   3  
ATOM   5877  C C    . GLY A 1 96  ? -10.308 -19.594 -32.804 1.00 0.00 ? 1576 GLY A C    3  
ATOM   5878  O O    . GLY A 1 96  ? -9.768  -19.237 -33.854 1.00 0.00 ? 1576 GLY A O    3  
ATOM   5879  H H    . GLY A 1 96  ? -10.643 -21.629 -30.315 1.00 0.00 ? 1576 GLY A H    3  
ATOM   5880  H HA2  . GLY A 1 96  ? -8.990  -20.795 -31.627 1.00 0.00 ? 1576 GLY A HA2  3  
ATOM   5881  H HA3  . GLY A 1 96  ? -9.735  -21.657 -32.991 1.00 0.00 ? 1576 GLY A HA3  3  
ATOM   5882  N N    . GLN A 1 97  ? -11.212 -18.840 -32.167 1.00 0.00 ? 1577 GLN A N    3  
ATOM   5883  C CA   . GLN A 1 97  ? -11.540 -17.465 -32.543 1.00 0.00 ? 1577 GLN A CA   3  
ATOM   5884  C C    . GLN A 1 97  ? -11.552 -16.601 -31.285 1.00 0.00 ? 1577 GLN A C    3  
ATOM   5885  O O    . GLN A 1 97  ? -11.820 -17.099 -30.194 1.00 0.00 ? 1577 GLN A O    3  
ATOM   5886  C CB   . GLN A 1 97  ? -12.838 -17.412 -33.381 1.00 0.00 ? 1577 GLN A CB   3  
ATOM   5887  C CG   . GLN A 1 97  ? -14.096 -18.049 -32.770 1.00 0.00 ? 1577 GLN A CG   3  
ATOM   5888  C CD   . GLN A 1 97  ? -14.809 -17.158 -31.750 1.00 0.00 ? 1577 GLN A CD   3  
ATOM   5889  O OE1  . GLN A 1 97  ? -15.391 -16.129 -32.096 1.00 0.00 ? 1577 GLN A OE1  3  
ATOM   5890  N NE2  . GLN A 1 97  ? -14.786 -17.529 -30.480 1.00 0.00 ? 1577 GLN A NE2  3  
ATOM   5891  H H    . GLN A 1 97  ? -11.648 -19.202 -31.321 1.00 0.00 ? 1577 GLN A H    3  
ATOM   5892  H HA   . GLN A 1 97  ? -10.741 -17.085 -33.182 1.00 0.00 ? 1577 GLN A HA   3  
ATOM   5893  H HB2  . GLN A 1 97  ? -13.057 -16.374 -33.639 1.00 0.00 ? 1577 GLN A HB2  3  
ATOM   5894  H HB3  . GLN A 1 97  ? -12.635 -17.936 -34.317 1.00 0.00 ? 1577 GLN A HB3  3  
ATOM   5895  H HG2  . GLN A 1 97  ? -14.804 -18.244 -33.577 1.00 0.00 ? 1577 GLN A HG2  3  
ATOM   5896  H HG3  . GLN A 1 97  ? -13.846 -19.015 -32.334 1.00 0.00 ? 1577 GLN A HG3  3  
ATOM   5897  H HE21 . GLN A 1 97  ? -14.223 -18.335 -30.214 1.00 0.00 ? 1577 GLN A HE21 3  
ATOM   5898  H HE22 . GLN A 1 97  ? -15.242 -16.973 -29.774 1.00 0.00 ? 1577 GLN A HE22 3  
ATOM   5899  N N    . ARG A 1 98  ? -11.175 -15.327 -31.402 1.00 0.00 ? 1578 ARG A N    3  
ATOM   5900  C CA   . ARG A 1 98  ? -11.038 -14.436 -30.245 1.00 0.00 ? 1578 ARG A CA   3  
ATOM   5901  C C    . ARG A 1 98  ? -12.386 -13.765 -29.989 1.00 0.00 ? 1578 ARG A C    3  
ATOM   5902  O O    . ARG A 1 98  ? -13.055 -13.338 -30.932 1.00 0.00 ? 1578 ARG A O    3  
ATOM   5903  C CB   . ARG A 1 98  ? -9.925  -13.393 -30.480 1.00 0.00 ? 1578 ARG A CB   3  
ATOM   5904  C CG   . ARG A 1 98  ? -8.495  -13.931 -30.239 1.00 0.00 ? 1578 ARG A CG   3  
ATOM   5905  C CD   . ARG A 1 98  ? -8.030  -15.080 -31.142 1.00 0.00 ? 1578 ARG A CD   3  
ATOM   5906  N NE   . ARG A 1 98  ? -8.068  -14.733 -32.574 1.00 0.00 ? 1578 ARG A NE   3  
ATOM   5907  C CZ   . ARG A 1 98  ? -7.937  -15.599 -33.588 1.00 0.00 ? 1578 ARG A CZ   3  
ATOM   5908  N NH1  . ARG A 1 98  ? -7.680  -16.882 -33.361 1.00 0.00 ? 1578 ARG A NH1  3  
ATOM   5909  N NH2  . ARG A 1 98  ? -8.070  -15.172 -34.839 1.00 0.00 ? 1578 ARG A NH2  3  
ATOM   5910  H H    . ARG A 1 98  ? -11.044 -14.928 -32.325 1.00 0.00 ? 1578 ARG A H    3  
ATOM   5911  H HA   . ARG A 1 98  ? -10.786 -15.021 -29.362 1.00 0.00 ? 1578 ARG A HA   3  
ATOM   5912  H HB2  . ARG A 1 98  ? -10.010 -12.981 -31.487 1.00 0.00 ? 1578 ARG A HB2  3  
ATOM   5913  H HB3  . ARG A 1 98  ? -10.079 -12.569 -29.781 1.00 0.00 ? 1578 ARG A HB3  3  
ATOM   5914  H HG2  . ARG A 1 98  ? -7.795  -13.103 -30.358 1.00 0.00 ? 1578 ARG A HG2  3  
ATOM   5915  H HG3  . ARG A 1 98  ? -8.423  -14.274 -29.209 1.00 0.00 ? 1578 ARG A HG3  3  
ATOM   5916  H HD2  . ARG A 1 98  ? -7.002  -15.336 -30.877 1.00 0.00 ? 1578 ARG A HD2  3  
ATOM   5917  H HD3  . ARG A 1 98  ? -8.658  -15.951 -30.961 1.00 0.00 ? 1578 ARG A HD3  3  
ATOM   5918  H HE   . ARG A 1 98  ? -8.201  -13.751 -32.793 1.00 0.00 ? 1578 ARG A HE   3  
ATOM   5919  H HH11 . ARG A 1 98  ? -7.490  -17.225 -32.408 1.00 0.00 ? 1578 ARG A HH11 3  
ATOM   5920  H HH12 . ARG A 1 98  ? -7.619  -17.567 -34.103 1.00 0.00 ? 1578 ARG A HH12 3  
ATOM   5921  H HH21 . ARG A 1 98  ? -8.257  -14.196 -35.047 1.00 0.00 ? 1578 ARG A HH21 3  
ATOM   5922  H HH22 . ARG A 1 98  ? -7.948  -15.793 -35.632 1.00 0.00 ? 1578 ARG A HH22 3  
ATOM   5923  N N    . LYS A 1 99  ? -12.750 -13.636 -28.712 1.00 0.00 ? 1579 LYS A N    3  
ATOM   5924  C CA   . LYS A 1 99  ? -14.003 -13.036 -28.265 1.00 0.00 ? 1579 LYS A CA   3  
ATOM   5925  C C    . LYS A 1 99  ? -13.640 -12.071 -27.142 1.00 0.00 ? 1579 LYS A C    3  
ATOM   5926  O O    . LYS A 1 99  ? -12.944 -12.463 -26.210 1.00 0.00 ? 1579 LYS A O    3  
ATOM   5927  C CB   . LYS A 1 99  ? -14.917 -14.185 -27.790 1.00 0.00 ? 1579 LYS A CB   3  
ATOM   5928  C CG   . LYS A 1 99  ? -16.426 -13.899 -27.777 1.00 0.00 ? 1579 LYS A CG   3  
ATOM   5929  C CD   . LYS A 1 99  ? -16.846 -12.595 -27.084 1.00 0.00 ? 1579 LYS A CD   3  
ATOM   5930  C CE   . LYS A 1 99  ? -18.363 -12.521 -26.859 1.00 0.00 ? 1579 LYS A CE   3  
ATOM   5931  N NZ   . LYS A 1 99  ? -18.762 -11.223 -26.246 1.00 0.00 ? 1579 LYS A NZ   3  
ATOM   5932  H H    . LYS A 1 99  ? -12.187 -14.084 -27.987 1.00 0.00 ? 1579 LYS A H    3  
ATOM   5933  H HA   . LYS A 1 99  ? -14.474 -12.500 -29.092 1.00 0.00 ? 1579 LYS A HA   3  
ATOM   5934  H HB2  . LYS A 1 99  ? -14.772 -15.045 -28.449 1.00 0.00 ? 1579 LYS A HB2  3  
ATOM   5935  H HB3  . LYS A 1 99  ? -14.604 -14.495 -26.793 1.00 0.00 ? 1579 LYS A HB3  3  
ATOM   5936  H HG2  . LYS A 1 99  ? -16.775 -13.874 -28.809 1.00 0.00 ? 1579 LYS A HG2  3  
ATOM   5937  H HG3  . LYS A 1 99  ? -16.909 -14.737 -27.275 1.00 0.00 ? 1579 LYS A HG3  3  
ATOM   5938  H HD2  . LYS A 1 99  ? -16.341 -12.528 -26.120 1.00 0.00 ? 1579 LYS A HD2  3  
ATOM   5939  H HD3  . LYS A 1 99  ? -16.550 -11.753 -27.710 1.00 0.00 ? 1579 LYS A HD3  3  
ATOM   5940  H HE2  . LYS A 1 99  ? -18.866 -12.643 -27.825 1.00 0.00 ? 1579 LYS A HE2  3  
ATOM   5941  H HE3  . LYS A 1 99  ? -18.667 -13.355 -26.216 1.00 0.00 ? 1579 LYS A HE3  3  
ATOM   5942  H HZ1  . LYS A 1 99  ? -19.760 -11.198 -26.070 1.00 0.00 ? 1579 LYS A HZ1  3  
ATOM   5943  H HZ2  . LYS A 1 99  ? -18.284 -11.062 -25.365 1.00 0.00 ? 1579 LYS A HZ2  3  
ATOM   5944  H HZ3  . LYS A 1 99  ? -18.548 -10.445 -26.860 1.00 0.00 ? 1579 LYS A HZ3  3  
ATOM   5945  N N    . TRP A 1 100 ? -14.092 -10.818 -27.196 1.00 0.00 ? 1580 TRP A N    3  
ATOM   5946  C CA   . TRP A 1 100 ? -13.794 -9.851  -26.144 1.00 0.00 ? 1580 TRP A CA   3  
ATOM   5947  C C    . TRP A 1 100 ? -14.728 -10.072 -24.955 1.00 0.00 ? 1580 TRP A C    3  
ATOM   5948  O O    . TRP A 1 100 ? -15.945 -10.157 -25.131 1.00 0.00 ? 1580 TRP A O    3  
ATOM   5949  C CB   . TRP A 1 100 ? -13.957 -8.430  -26.703 1.00 0.00 ? 1580 TRP A CB   3  
ATOM   5950  C CG   . TRP A 1 100 ? -12.856 -8.036  -27.632 1.00 0.00 ? 1580 TRP A CG   3  
ATOM   5951  C CD1  . TRP A 1 100 ? -12.939 -7.868  -28.969 1.00 0.00 ? 1580 TRP A CD1  3  
ATOM   5952  C CD2  . TRP A 1 100 ? -11.471 -7.759  -27.280 1.00 0.00 ? 1580 TRP A CD2  3  
ATOM   5953  N NE1  . TRP A 1 100 ? -11.699 -7.519  -29.471 1.00 0.00 ? 1580 TRP A NE1  3  
ATOM   5954  C CE2  . TRP A 1 100 ? -10.747 -7.457  -28.472 1.00 0.00 ? 1580 TRP A CE2  3  
ATOM   5955  C CE3  . TRP A 1 100 ? -10.757 -7.763  -26.065 1.00 0.00 ? 1580 TRP A CE3  3  
ATOM   5956  C CZ2  . TRP A 1 100 ? -9.371  -7.187  -28.454 1.00 0.00 ? 1580 TRP A CZ2  3  
ATOM   5957  C CZ3  . TRP A 1 100 ? -9.377  -7.510  -26.039 1.00 0.00 ? 1580 TRP A CZ3  3  
ATOM   5958  C CH2  . TRP A 1 100 ? -8.686  -7.223  -27.228 1.00 0.00 ? 1580 TRP A CH2  3  
ATOM   5959  H H    . TRP A 1 100 ? -14.635 -10.510 -27.992 1.00 0.00 ? 1580 TRP A H    3  
ATOM   5960  H HA   . TRP A 1 100 ? -12.756 -9.984  -25.827 1.00 0.00 ? 1580 TRP A HA   3  
ATOM   5961  H HB2  . TRP A 1 100 ? -14.918 -8.332  -27.209 1.00 0.00 ? 1580 TRP A HB2  3  
ATOM   5962  H HB3  . TRP A 1 100 ? -13.949 -7.724  -25.876 1.00 0.00 ? 1580 TRP A HB3  3  
ATOM   5963  H HD1  . TRP A 1 100 ? -13.839 -7.990  -29.560 1.00 0.00 ? 1580 TRP A HD1  3  
ATOM   5964  H HE1  . TRP A 1 100 ? -11.536 -7.336  -30.454 1.00 0.00 ? 1580 TRP A HE1  3  
ATOM   5965  H HE3  . TRP A 1 100 ? -11.286 -7.967  -25.144 1.00 0.00 ? 1580 TRP A HE3  3  
ATOM   5966  H HZ2  . TRP A 1 100 ? -8.842  -6.961  -29.369 1.00 0.00 ? 1580 TRP A HZ2  3  
ATOM   5967  H HZ3  . TRP A 1 100 ? -8.847  -7.538  -25.097 1.00 0.00 ? 1580 TRP A HZ3  3  
ATOM   5968  H HH2  . TRP A 1 100 ? -7.621  -7.029  -27.201 1.00 0.00 ? 1580 TRP A HH2  3  
ATOM   5969  N N    . TYR A 1 101 ? -14.159 -10.102 -23.752 1.00 0.00 ? 1581 TYR A N    3  
ATOM   5970  C CA   . TYR A 1 101 ? -14.878 -10.126 -22.478 1.00 0.00 ? 1581 TYR A CA   3  
ATOM   5971  C C    . TYR A 1 101 ? -14.254 -9.102  -21.526 1.00 0.00 ? 1581 TYR A C    3  
ATOM   5972  O O    . TYR A 1 101 ? -13.108 -8.697  -21.700 1.00 0.00 ? 1581 TYR A O    3  
ATOM   5973  C CB   . TYR A 1 101 ? -14.833 -11.539 -21.889 1.00 0.00 ? 1581 TYR A CB   3  
ATOM   5974  C CG   . TYR A 1 101 ? -15.711 -12.532 -22.614 1.00 0.00 ? 1581 TYR A CG   3  
ATOM   5975  C CD1  . TYR A 1 101 ? -17.091 -12.528 -22.368 1.00 0.00 ? 1581 TYR A CD1  3  
ATOM   5976  C CD2  . TYR A 1 101 ? -15.168 -13.456 -23.524 1.00 0.00 ? 1581 TYR A CD2  3  
ATOM   5977  C CE1  . TYR A 1 101 ? -17.917 -13.459 -23.011 1.00 0.00 ? 1581 TYR A CE1  3  
ATOM   5978  C CE2  . TYR A 1 101 ? -15.993 -14.408 -24.156 1.00 0.00 ? 1581 TYR A CE2  3  
ATOM   5979  C CZ   . TYR A 1 101 ? -17.381 -14.412 -23.902 1.00 0.00 ? 1581 TYR A CZ   3  
ATOM   5980  O OH   . TYR A 1 101 ? -18.188 -15.325 -24.515 1.00 0.00 ? 1581 TYR A OH   3  
ATOM   5981  H H    . TYR A 1 101 ? -13.140 -10.103 -23.690 1.00 0.00 ? 1581 TYR A H    3  
ATOM   5982  H HA   . TYR A 1 101 ? -15.926 -9.862  -22.645 1.00 0.00 ? 1581 TYR A HA   3  
ATOM   5983  H HB2  . TYR A 1 101 ? -13.801 -11.889 -21.885 1.00 0.00 ? 1581 TYR A HB2  3  
ATOM   5984  H HB3  . TYR A 1 101 ? -15.180 -11.508 -20.855 1.00 0.00 ? 1581 TYR A HB3  3  
ATOM   5985  H HD1  . TYR A 1 101 ? -17.530 -11.815 -21.686 1.00 0.00 ? 1581 TYR A HD1  3  
ATOM   5986  H HD2  . TYR A 1 101 ? -14.116 -13.442 -23.741 1.00 0.00 ? 1581 TYR A HD2  3  
ATOM   5987  H HE1  . TYR A 1 101 ? -18.968 -13.430 -22.813 1.00 0.00 ? 1581 TYR A HE1  3  
ATOM   5988  H HE2  . TYR A 1 101 ? -15.568 -15.135 -24.833 1.00 0.00 ? 1581 TYR A HE2  3  
ATOM   5989  H HH   . TYR A 1 101 ? -19.129 -15.244 -24.270 1.00 0.00 ? 1581 TYR A HH   3  
ATOM   5990  N N    . LYS A 1 102 ? -15.007 -8.691  -20.505 1.00 0.00 ? 1582 LYS A N    3  
ATOM   5991  C CA   . LYS A 1 102 ? -14.603 -7.649  -19.541 1.00 0.00 ? 1582 LYS A CA   3  
ATOM   5992  C C    . LYS A 1 102 ? -14.156 -8.281  -18.232 1.00 0.00 ? 1582 LYS A C    3  
ATOM   5993  O O    . LYS A 1 102 ? -14.589 -9.394  -17.961 1.00 0.00 ? 1582 LYS A O    3  
ATOM   5994  C CB   . LYS A 1 102 ? -15.762 -6.656  -19.328 1.00 0.00 ? 1582 LYS A CB   3  
ATOM   5995  C CG   . LYS A 1 102 ? -17.077 -7.308  -18.858 1.00 0.00 ? 1582 LYS A CG   3  
ATOM   5996  C CD   . LYS A 1 102 ? -18.219 -6.286  -18.752 1.00 0.00 ? 1582 LYS A CD   3  
ATOM   5997  C CE   . LYS A 1 102 ? -19.566 -7.017  -18.602 1.00 0.00 ? 1582 LYS A CE   3  
ATOM   5998  N NZ   . LYS A 1 102 ? -20.729 -6.093  -18.610 1.00 0.00 ? 1582 LYS A NZ   3  
ATOM   5999  H H    . LYS A 1 102 ? -15.914 -9.135  -20.390 1.00 0.00 ? 1582 LYS A H    3  
ATOM   6000  H HA   . LYS A 1 102 ? -13.762 -7.083  -19.955 1.00 0.00 ? 1582 LYS A HA   3  
ATOM   6001  H HB2  . LYS A 1 102 ? -15.458 -5.895  -18.609 1.00 0.00 ? 1582 LYS A HB2  3  
ATOM   6002  H HB3  . LYS A 1 102 ? -15.942 -6.157  -20.277 1.00 0.00 ? 1582 LYS A HB3  3  
ATOM   6003  H HG2  . LYS A 1 102 ? -17.371 -8.073  -19.579 1.00 0.00 ? 1582 LYS A HG2  3  
ATOM   6004  H HG3  . LYS A 1 102 ? -16.931 -7.777  -17.885 1.00 0.00 ? 1582 LYS A HG3  3  
ATOM   6005  H HD2  . LYS A 1 102 ? -18.038 -5.628  -17.900 1.00 0.00 ? 1582 LYS A HD2  3  
ATOM   6006  H HD3  . LYS A 1 102 ? -18.238 -5.691  -19.669 1.00 0.00 ? 1582 LYS A HD3  3  
ATOM   6007  H HE2  . LYS A 1 102 ? -19.672 -7.717  -19.439 1.00 0.00 ? 1582 LYS A HE2  3  
ATOM   6008  H HE3  . LYS A 1 102 ? -19.569 -7.598  -17.673 1.00 0.00 ? 1582 LYS A HE3  3  
ATOM   6009  H HZ1  . LYS A 1 102 ? -20.670 -5.420  -19.365 1.00 0.00 ? 1582 LYS A HZ1  3  
ATOM   6010  H HZ2  . LYS A 1 102 ? -21.584 -6.634  -18.770 1.00 0.00 ? 1582 LYS A HZ2  3  
ATOM   6011  H HZ3  . LYS A 1 102 ? -20.828 -5.579  -17.742 1.00 0.00 ? 1582 LYS A HZ3  3  
ATOM   6012  N N    . ARG A 1 103 ? -13.391 -7.589  -17.380 1.00 0.00 ? 1583 ARG A N    3  
ATOM   6013  C CA   . ARG A 1 103 ? -12.864 -8.164  -16.125 1.00 0.00 ? 1583 ARG A CA   3  
ATOM   6014  C C    . ARG A 1 103 ? -13.891 -8.999  -15.374 1.00 0.00 ? 1583 ARG A C    3  
ATOM   6015  O O    . ARG A 1 103 ? -13.663 -10.186 -15.187 1.00 0.00 ? 1583 ARG A O    3  
ATOM   6016  C CB   . ARG A 1 103 ? -12.188 -7.112  -15.209 1.00 0.00 ? 1583 ARG A CB   3  
ATOM   6017  C CG   . ARG A 1 103 ? -13.034 -5.872  -14.857 1.00 0.00 ? 1583 ARG A CG   3  
ATOM   6018  C CD   . ARG A 1 103 ? -12.392 -4.993  -13.773 1.00 0.00 ? 1583 ARG A CD   3  
ATOM   6019  N NE   . ARG A 1 103 ? -12.710 -5.435  -12.393 1.00 0.00 ? 1583 ARG A NE   3  
ATOM   6020  C CZ   . ARG A 1 103 ? -11.865 -5.821  -11.430 1.00 0.00 ? 1583 ARG A CZ   3  
ATOM   6021  N NH1  . ARG A 1 103 ? -10.571 -5.999  -11.677 1.00 0.00 ? 1583 ARG A NH1  3  
ATOM   6022  N NH2  . ARG A 1 103 ? -12.341 -6.027  -10.211 1.00 0.00 ? 1583 ARG A NH2  3  
ATOM   6023  H H    . ARG A 1 103 ? -13.017 -6.691  -17.693 1.00 0.00 ? 1583 ARG A H    3  
ATOM   6024  H HA   . ARG A 1 103 ? -12.081 -8.870  -16.416 1.00 0.00 ? 1583 ARG A HA   3  
ATOM   6025  H HB2  . ARG A 1 103 ? -11.891 -7.607  -14.280 1.00 0.00 ? 1583 ARG A HB2  3  
ATOM   6026  H HB3  . ARG A 1 103 ? -11.275 -6.768  -15.699 1.00 0.00 ? 1583 ARG A HB3  3  
ATOM   6027  H HG2  . ARG A 1 103 ? -13.145 -5.270  -15.761 1.00 0.00 ? 1583 ARG A HG2  3  
ATOM   6028  H HG3  . ARG A 1 103 ? -14.027 -6.160  -14.517 1.00 0.00 ? 1583 ARG A HG3  3  
ATOM   6029  H HD2  . ARG A 1 103 ? -11.316 -4.928  -13.922 1.00 0.00 ? 1583 ARG A HD2  3  
ATOM   6030  H HD3  . ARG A 1 103 ? -12.805 -3.995  -13.888 1.00 0.00 ? 1583 ARG A HD3  3  
ATOM   6031  H HE   . ARG A 1 103 ? -13.704 -5.432  -12.156 1.00 0.00 ? 1583 ARG A HE   3  
ATOM   6032  H HH11 . ARG A 1 103 ? -10.179 -5.822  -12.597 1.00 0.00 ? 1583 ARG A HH11 3  
ATOM   6033  H HH12 . ARG A 1 103 ? -9.928  -6.374  -10.984 1.00 0.00 ? 1583 ARG A HH12 3  
ATOM   6034  H HH21 . ARG A 1 103 ? -13.361 -5.932  -10.055 1.00 0.00 ? 1583 ARG A HH21 3  
ATOM   6035  H HH22 . ARG A 1 103 ? -11.763 -6.266  -9.409  1.00 0.00 ? 1583 ARG A HH22 3  
ATOM   6036  N N    . MET A 1 104 ? -15.060 -8.437  -15.046 1.00 0.00 ? 1584 MET A N    3  
ATOM   6037  C CA   . MET A 1 104 ? -16.043 -9.152  -14.219 1.00 0.00 ? 1584 MET A CA   3  
ATOM   6038  C C    . MET A 1 104 ? -16.659 -10.351 -14.937 1.00 0.00 ? 1584 MET A C    3  
ATOM   6039  O O    . MET A 1 104 ? -17.217 -11.238 -14.295 1.00 0.00 ? 1584 MET A O    3  
ATOM   6040  C CB   . MET A 1 104 ? -17.128 -8.203  -13.699 1.00 0.00 ? 1584 MET A CB   3  
ATOM   6041  C CG   . MET A 1 104 ? -18.125 -7.720  -14.768 1.00 0.00 ? 1584 MET A CG   3  
ATOM   6042  S SD   . MET A 1 104 ? -19.568 -6.835  -14.124 1.00 0.00 ? 1584 MET A SD   3  
ATOM   6043  C CE   . MET A 1 104 ? -20.387 -8.156  -13.181 1.00 0.00 ? 1584 MET A CE   3  
ATOM   6044  H H    . MET A 1 104 ? -15.225 -7.467  -15.283 1.00 0.00 ? 1584 MET A H    3  
ATOM   6045  H HA   . MET A 1 104 ? -15.524 -9.552  -13.351 1.00 0.00 ? 1584 MET A HA   3  
ATOM   6046  H HB2  . MET A 1 104 ? -17.678 -8.738  -12.926 1.00 0.00 ? 1584 MET A HB2  3  
ATOM   6047  H HB3  . MET A 1 104 ? -16.646 -7.340  -13.242 1.00 0.00 ? 1584 MET A HB3  3  
ATOM   6048  H HG2  . MET A 1 104 ? -17.604 -7.062  -15.465 1.00 0.00 ? 1584 MET A HG2  3  
ATOM   6049  H HG3  . MET A 1 104 ? -18.505 -8.573  -15.331 1.00 0.00 ? 1584 MET A HG3  3  
ATOM   6050  H HE1  . MET A 1 104 ? -21.363 -7.806  -12.844 1.00 0.00 ? 1584 MET A HE1  3  
ATOM   6051  H HE2  . MET A 1 104 ? -20.523 -9.039  -13.807 1.00 0.00 ? 1584 MET A HE2  3  
ATOM   6052  H HE3  . MET A 1 104 ? -19.788 -8.419  -12.306 1.00 0.00 ? 1584 MET A HE3  3  
ATOM   6053  N N    . ALA A 1 105 ? -16.587 -10.357 -16.271 1.00 0.00 ? 1585 ALA A N    3  
ATOM   6054  C CA   . ALA A 1 105 ? -17.058 -11.467 -17.085 1.00 0.00 ? 1585 ALA A CA   3  
ATOM   6055  C C    . ALA A 1 105 ? -16.007 -12.569 -17.187 1.00 0.00 ? 1585 ALA A C    3  
ATOM   6056  O O    . ALA A 1 105 ? -16.355 -13.694 -17.535 1.00 0.00 ? 1585 ALA A O    3  
ATOM   6057  C CB   . ALA A 1 105 ? -17.402 -10.962 -18.485 1.00 0.00 ? 1585 ALA A CB   3  
ATOM   6058  H H    . ALA A 1 105 ? -16.004 -9.650  -16.712 1.00 0.00 ? 1585 ALA A H    3  
ATOM   6059  H HA   . ALA A 1 105 ? -17.957 -11.894 -16.638 1.00 0.00 ? 1585 ALA A HA   3  
ATOM   6060  H HB1  . ALA A 1 105 ? -18.234 -10.257 -18.436 1.00 0.00 ? 1585 ALA A HB1  3  
ATOM   6061  H HB2  . ALA A 1 105 ? -16.541 -10.485 -18.944 1.00 0.00 ? 1585 ALA A HB2  3  
ATOM   6062  H HB3  . ALA A 1 105 ? -17.685 -11.808 -19.110 1.00 0.00 ? 1585 ALA A HB3  3  
ATOM   6063  N N    . VAL A 1 106 ? -14.739 -12.258 -16.929 1.00 0.00 ? 1586 VAL A N    3  
ATOM   6064  C CA   . VAL A 1 106 ? -13.629 -13.184 -17.027 1.00 0.00 ? 1586 VAL A CA   3  
ATOM   6065  C C    . VAL A 1 106 ? -13.349 -13.652 -15.600 1.00 0.00 ? 1586 VAL A C    3  
ATOM   6066  O O    . VAL A 1 106 ? -12.590 -13.034 -14.853 1.00 0.00 ? 1586 VAL A O    3  
ATOM   6067  C CB   . VAL A 1 106 ? -12.442 -12.485 -17.711 1.00 0.00 ? 1586 VAL A CB   3  
ATOM   6068  C CG1  . VAL A 1 106 ? -11.255 -13.438 -17.841 1.00 0.00 ? 1586 VAL A CG1  3  
ATOM   6069  C CG2  . VAL A 1 106 ? -12.827 -12.043 -19.129 1.00 0.00 ? 1586 VAL A CG2  3  
ATOM   6070  H H    . VAL A 1 106 ? -14.500 -11.327 -16.611 1.00 0.00 ? 1586 VAL A H    3  
ATOM   6071  H HA   . VAL A 1 106 ? -13.918 -14.038 -17.636 1.00 0.00 ? 1586 VAL A HA   3  
ATOM   6072  H HB   . VAL A 1 106 ? -12.134 -11.607 -17.139 1.00 0.00 ? 1586 VAL A HB   3  
ATOM   6073  H HG11 . VAL A 1 106 ? -11.580 -14.326 -18.374 1.00 0.00 ? 1586 VAL A HG11 3  
ATOM   6074  H HG12 . VAL A 1 106 ? -10.440 -12.950 -18.378 1.00 0.00 ? 1586 VAL A HG12 3  
ATOM   6075  H HG13 . VAL A 1 106 ? -10.903 -13.724 -16.850 1.00 0.00 ? 1586 VAL A HG13 3  
ATOM   6076  H HG21 . VAL A 1 106 ? -13.146 -12.904 -19.719 1.00 0.00 ? 1586 VAL A HG21 3  
ATOM   6077  H HG22 . VAL A 1 106 ? -13.635 -11.316 -19.096 1.00 0.00 ? 1586 VAL A HG22 3  
ATOM   6078  H HG23 . VAL A 1 106 ? -11.974 -11.572 -19.611 1.00 0.00 ? 1586 VAL A HG23 3  
ATOM   6079  N N    . ILE A 1 107 ? -13.998 -14.746 -15.219 1.00 0.00 ? 1587 ILE A N    3  
ATOM   6080  C CA   . ILE A 1 107 ? -13.910 -15.295 -13.876 1.00 0.00 ? 1587 ILE A CA   3  
ATOM   6081  C C    . ILE A 1 107 ? -12.941 -16.467 -13.955 1.00 0.00 ? 1587 ILE A C    3  
ATOM   6082  O O    . ILE A 1 107 ? -12.882 -17.174 -14.964 1.00 0.00 ? 1587 ILE A O    3  
ATOM   6083  C CB   . ILE A 1 107 ? -15.313 -15.622 -13.323 1.00 0.00 ? 1587 ILE A CB   3  
ATOM   6084  C CG1  . ILE A 1 107 ? -15.963 -16.858 -13.975 1.00 0.00 ? 1587 ILE A CG1  3  
ATOM   6085  C CG2  . ILE A 1 107 ? -16.232 -14.404 -13.516 1.00 0.00 ? 1587 ILE A CG2  3  
ATOM   6086  C CD1  . ILE A 1 107 ? -17.399 -17.136 -13.511 1.00 0.00 ? 1587 ILE A CD1  3  
ATOM   6087  H H    . ILE A 1 107 ? -14.492 -15.292 -15.913 1.00 0.00 ? 1587 ILE A H    3  
ATOM   6088  H HA   . ILE A 1 107 ? -13.478 -14.545 -13.212 1.00 0.00 ? 1587 ILE A HA   3  
ATOM   6089  H HB   . ILE A 1 107 ? -15.209 -15.817 -12.253 1.00 0.00 ? 1587 ILE A HB   3  
ATOM   6090  H HG12 . ILE A 1 107 ? -15.972 -16.722 -15.054 1.00 0.00 ? 1587 ILE A HG12 3  
ATOM   6091  H HG13 . ILE A 1 107 ? -15.373 -17.739 -13.737 1.00 0.00 ? 1587 ILE A HG13 3  
ATOM   6092  H HG21 . ILE A 1 107 ? -17.107 -14.484 -12.871 1.00 0.00 ? 1587 ILE A HG21 3  
ATOM   6093  H HG22 . ILE A 1 107 ? -15.705 -13.486 -13.256 1.00 0.00 ? 1587 ILE A HG22 3  
ATOM   6094  H HG23 . ILE A 1 107 ? -16.572 -14.362 -14.556 1.00 0.00 ? 1587 ILE A HG23 3  
ATOM   6095  H HD11 . ILE A 1 107 ? -17.412 -17.282 -12.432 1.00 0.00 ? 1587 ILE A HD11 3  
ATOM   6096  H HD12 . ILE A 1 107 ? -18.065 -16.314 -13.768 1.00 0.00 ? 1587 ILE A HD12 3  
ATOM   6097  H HD13 . ILE A 1 107 ? -17.762 -18.037 -14.000 1.00 0.00 ? 1587 ILE A HD13 3  
ATOM   6098  N N    . LEU A 1 108 ? -12.147 -16.666 -12.912 1.00 0.00 ? 1588 LEU A N    3  
ATOM   6099  C CA   . LEU A 1 108 ? -11.165 -17.734 -12.894 1.00 0.00 ? 1588 LEU A CA   3  
ATOM   6100  C C    . LEU A 1 108 ? -11.811 -18.862 -12.122 1.00 0.00 ? 1588 LEU A C    3  
ATOM   6101  O O    . LEU A 1 108 ? -12.142 -18.697 -10.948 1.00 0.00 ? 1588 LEU A O    3  
ATOM   6102  C CB   . LEU A 1 108 ? -9.867  -17.268 -12.227 1.00 0.00 ? 1588 LEU A CB   3  
ATOM   6103  C CG   . LEU A 1 108 ? -8.951  -16.480 -13.182 1.00 0.00 ? 1588 LEU A CG   3  
ATOM   6104  C CD1  . LEU A 1 108 ? -8.153  -15.438 -12.389 1.00 0.00 ? 1588 LEU A CD1  3  
ATOM   6105  C CD2  . LEU A 1 108 ? -7.965  -17.423 -13.884 1.00 0.00 ? 1588 LEU A CD2  3  
ATOM   6106  H H    . LEU A 1 108 ? -12.303 -16.147 -12.054 1.00 0.00 ? 1588 LEU A H    3  
ATOM   6107  H HA   . LEU A 1 108 ? -10.932 -18.073 -13.902 1.00 0.00 ? 1588 LEU A HA   3  
ATOM   6108  H HB2  . LEU A 1 108 ? -10.124 -16.653 -11.366 1.00 0.00 ? 1588 LEU A HB2  3  
ATOM   6109  H HB3  . LEU A 1 108 ? -9.333  -18.153 -11.865 1.00 0.00 ? 1588 LEU A HB3  3  
ATOM   6110  H HG   . LEU A 1 108 ? -9.543  -15.968 -13.954 1.00 0.00 ? 1588 LEU A HG   3  
ATOM   6111  H HD11 . LEU A 1 108 ? -8.799  -14.616 -12.068 1.00 0.00 ? 1588 LEU A HD11 3  
ATOM   6112  H HD12 . LEU A 1 108 ? -7.698  -15.890 -11.507 1.00 0.00 ? 1588 LEU A HD12 3  
ATOM   6113  H HD13 . LEU A 1 108 ? -7.352  -15.017 -13.000 1.00 0.00 ? 1588 LEU A HD13 3  
ATOM   6114  H HD21 . LEU A 1 108 ? -7.348  -16.859 -14.584 1.00 0.00 ? 1588 LEU A HD21 3  
ATOM   6115  H HD22 . LEU A 1 108 ? -7.310  -17.906 -13.160 1.00 0.00 ? 1588 LEU A HD22 3  
ATOM   6116  H HD23 . LEU A 1 108 ? -8.514  -18.186 -14.441 1.00 0.00 ? 1588 LEU A HD23 3  
ATOM   6117  N N    . SER A 1 109 ? -12.012 -20.001 -12.777 1.00 0.00 ? 1589 SER A N    3  
ATOM   6118  C CA   . SER A 1 109 ? -12.413 -21.227 -12.115 1.00 0.00 ? 1589 SER A CA   3  
ATOM   6119  C C    . SER A 1 109 ? -11.379 -21.537 -11.035 1.00 0.00 ? 1589 SER A C    3  
ATOM   6120  O O    . SER A 1 109 ? -10.204 -21.213 -11.196 1.00 0.00 ? 1589 SER A O    3  
ATOM   6121  C CB   . SER A 1 109 ? -12.557 -22.350 -13.145 1.00 0.00 ? 1589 SER A CB   3  
ATOM   6122  O OG   . SER A 1 109 ? -13.256 -21.878 -14.285 1.00 0.00 ? 1589 SER A OG   3  
ATOM   6123  H H    . SER A 1 109 ? -11.744 -20.078 -13.754 1.00 0.00 ? 1589 SER A H    3  
ATOM   6124  H HA   . SER A 1 109 ? -13.375 -21.037 -11.661 1.00 0.00 ? 1589 SER A HA   3  
ATOM   6125  H HB2  . SER A 1 109 ? -11.575 -22.702 -13.455 1.00 0.00 ? 1589 SER A HB2  3  
ATOM   6126  H HB3  . SER A 1 109 ? -13.102 -23.180 -12.694 1.00 0.00 ? 1589 SER A HB3  3  
ATOM   6127  H HG   . SER A 1 109 ? -13.508 -22.649 -14.836 1.00 0.00 ? 1589 SER A HG   3  
ATOM   6128  N N    . LEU A 1 110 ? -11.784 -22.169 -9.932  1.00 0.00 ? 1590 LEU A N    3  
ATOM   6129  C CA   . LEU A 1 110 ? -10.930 -22.316 -8.745  1.00 0.00 ? 1590 LEU A CA   3  
ATOM   6130  C C    . LEU A 1 110 ? -9.575  -22.975 -9.022  1.00 0.00 ? 1590 LEU A C    3  
ATOM   6131  O O    . LEU A 1 110 ? -8.581  -22.575 -8.427  1.00 0.00 ? 1590 LEU A O    3  
ATOM   6132  C CB   . LEU A 1 110 ? -11.715 -22.997 -7.606  1.00 0.00 ? 1590 LEU A CB   3  
ATOM   6133  C CG   . LEU A 1 110 ? -12.070 -24.470 -7.896  1.00 0.00 ? 1590 LEU A CG   3  
ATOM   6134  C CD1  . LEU A 1 110 ? -11.169 -25.433 -7.112  1.00 0.00 ? 1590 LEU A CD1  3  
ATOM   6135  C CD2  . LEU A 1 110 ? -13.548 -24.753 -7.604  1.00 0.00 ? 1590 LEU A CD2  3  
ATOM   6136  H H    . LEU A 1 110 ? -12.751 -22.456 -9.866  1.00 0.00 ? 1590 LEU A H    3  
ATOM   6137  H HA   . LEU A 1 110 ? -10.707 -21.308 -8.406  1.00 0.00 ? 1590 LEU A HA   3  
ATOM   6138  H HB2  . LEU A 1 110 ? -11.133 -22.932 -6.685  1.00 0.00 ? 1590 LEU A HB2  3  
ATOM   6139  H HB3  . LEU A 1 110 ? -12.623 -22.416 -7.429  1.00 0.00 ? 1590 LEU A HB3  3  
ATOM   6140  H HG   . LEU A 1 110 ? -11.907 -24.655 -8.952  1.00 0.00 ? 1590 LEU A HG   3  
ATOM   6141  H HD11 . LEU A 1 110 ? -11.398 -26.464 -7.388  1.00 0.00 ? 1590 LEU A HD11 3  
ATOM   6142  H HD12 . LEU A 1 110 ? -10.118 -25.247 -7.342  1.00 0.00 ? 1590 LEU A HD12 3  
ATOM   6143  H HD13 . LEU A 1 110 ? -11.324 -25.306 -6.040  1.00 0.00 ? 1590 LEU A HD13 3  
ATOM   6144  H HD21 . LEU A 1 110 ? -14.179 -24.114 -8.225  1.00 0.00 ? 1590 LEU A HD21 3  
ATOM   6145  H HD22 . LEU A 1 110 ? -13.782 -25.793 -7.843  1.00 0.00 ? 1590 LEU A HD22 3  
ATOM   6146  H HD23 . LEU A 1 110 ? -13.773 -24.558 -6.552  1.00 0.00 ? 1590 LEU A HD23 3  
ATOM   6147  N N    . GLU A 1 111 ? -9.493  -23.939 -9.942  1.00 0.00 ? 1591 GLU A N    3  
ATOM   6148  C CA   . GLU A 1 111 ? -8.213  -24.573 -10.284 1.00 0.00 ? 1591 GLU A CA   3  
ATOM   6149  C C    . GLU A 1 111 ? -7.318  -23.582 -11.040 1.00 0.00 ? 1591 GLU A C    3  
ATOM   6150  O O    . GLU A 1 111 ? -6.127  -23.491 -10.762 1.00 0.00 ? 1591 GLU A O    3  
ATOM   6151  C CB   . GLU A 1 111 ? -8.492  -25.843 -11.101 1.00 0.00 ? 1591 GLU A CB   3  
ATOM   6152  C CG   . GLU A 1 111 ? -7.214  -26.639 -11.406 1.00 0.00 ? 1591 GLU A CG   3  
ATOM   6153  C CD   . GLU A 1 111 ? -7.530  -27.978 -12.101 1.00 0.00 ? 1591 GLU A CD   3  
ATOM   6154  O OE1  . GLU A 1 111 ? -7.660  -28.005 -13.348 1.00 0.00 ? 1591 GLU A OE1  3  
ATOM   6155  O OE2  . GLU A 1 111 ? -7.642  -29.017 -11.405 1.00 0.00 ? 1591 GLU A OE2  3  
ATOM   6156  H H    . GLU A 1 111 ? -10.334 -24.263 -10.409 1.00 0.00 ? 1591 GLU A H    3  
ATOM   6157  H HA   . GLU A 1 111 ? -7.705  -24.861 -9.361  1.00 0.00 ? 1591 GLU A HA   3  
ATOM   6158  H HB2  . GLU A 1 111 ? -9.167  -26.474 -10.528 1.00 0.00 ? 1591 GLU A HB2  3  
ATOM   6159  H HB3  . GLU A 1 111 ? -8.984  -25.564 -12.032 1.00 0.00 ? 1591 GLU A HB3  3  
ATOM   6160  H HG2  . GLU A 1 111 ? -6.558  -26.044 -12.048 1.00 0.00 ? 1591 GLU A HG2  3  
ATOM   6161  H HG3  . GLU A 1 111 ? -6.682  -26.827 -10.468 1.00 0.00 ? 1591 GLU A HG3  3  
ATOM   6162  N N    . GLN A 1 112 ? -7.900  -22.783 -11.939 1.00 0.00 ? 1592 GLN A N    3  
ATOM   6163  C CA   . GLN A 1 112 ? -7.190  -21.748 -12.687 1.00 0.00 ? 1592 GLN A CA   3  
ATOM   6164  C C    . GLN A 1 112 ? -6.674  -20.707 -11.691 1.00 0.00 ? 1592 GLN A C    3  
ATOM   6165  O O    . GLN A 1 112 ? -5.491  -20.386 -11.684 1.00 0.00 ? 1592 GLN A O    3  
ATOM   6166  C CB   . GLN A 1 112 ? -8.125  -21.088 -13.724 1.00 0.00 ? 1592 GLN A CB   3  
ATOM   6167  C CG   . GLN A 1 112 ? -8.888  -22.067 -14.638 1.00 0.00 ? 1592 GLN A CG   3  
ATOM   6168  C CD   . GLN A 1 112 ? -10.039 -21.414 -15.411 1.00 0.00 ? 1592 GLN A CD   3  
ATOM   6169  O OE1  . GLN A 1 112 ? -10.507 -20.332 -15.076 1.00 0.00 ? 1592 GLN A OE1  3  
ATOM   6170  N NE2  . GLN A 1 112 ? -10.542 -22.040 -16.459 1.00 0.00 ? 1592 GLN A NE2  3  
ATOM   6171  H H    . GLN A 1 112 ? -8.907  -22.826 -12.036 1.00 0.00 ? 1592 GLN A H    3  
ATOM   6172  H HA   . GLN A 1 112 ? -6.337  -22.202 -13.198 1.00 0.00 ? 1592 GLN A HA   3  
ATOM   6173  H HB2  . GLN A 1 112 ? -8.850  -20.468 -13.199 1.00 0.00 ? 1592 GLN A HB2  3  
ATOM   6174  H HB3  . GLN A 1 112 ? -7.528  -20.424 -14.350 1.00 0.00 ? 1592 GLN A HB3  3  
ATOM   6175  H HG2  . GLN A 1 112 ? -8.178  -22.514 -15.335 1.00 0.00 ? 1592 GLN A HG2  3  
ATOM   6176  H HG3  . GLN A 1 112 ? -9.325  -22.865 -14.041 1.00 0.00 ? 1592 GLN A HG3  3  
ATOM   6177  H HE21 . GLN A 1 112 ? -10.141 -22.926 -16.784 1.00 0.00 ? 1592 GLN A HE21 3  
ATOM   6178  H HE22 . GLN A 1 112 ? -11.354 -21.665 -16.915 1.00 0.00 ? 1592 GLN A HE22 3  
ATOM   6179  N N    . GLY A 1 113 ? -7.555  -20.234 -10.805 1.00 0.00 ? 1593 GLY A N    3  
ATOM   6180  C CA   . GLY A 1 113 ? -7.262  -19.236 -9.787  1.00 0.00 ? 1593 GLY A CA   3  
ATOM   6181  C C    . GLY A 1 113 ? -6.172  -19.701 -8.832  1.00 0.00 ? 1593 GLY A C    3  
ATOM   6182  O O    . GLY A 1 113 ? -5.325  -18.903 -8.435  1.00 0.00 ? 1593 GLY A O    3  
ATOM   6183  H H    . GLY A 1 113 ? -8.505  -20.594 -10.842 1.00 0.00 ? 1593 GLY A H    3  
ATOM   6184  H HA2  . GLY A 1 113 ? -6.945  -18.309 -10.259 1.00 0.00 ? 1593 GLY A HA2  3  
ATOM   6185  H HA3  . GLY A 1 113 ? -8.170  -19.047 -9.217  1.00 0.00 ? 1593 GLY A HA3  3  
ATOM   6186  N N    . ASN A 1 114 ? -6.128  -20.997 -8.506  1.00 0.00 ? 1594 ASN A N    3  
ATOM   6187  C CA   . ASN A 1 114 ? -5.099  -21.569 -7.634  1.00 0.00 ? 1594 ASN A CA   3  
ATOM   6188  C C    . ASN A 1 114 ? -3.703  -21.272 -8.178  1.00 0.00 ? 1594 ASN A C    3  
ATOM   6189  O O    . ASN A 1 114 ? -2.840  -20.846 -7.413  1.00 0.00 ? 1594 ASN A O    3  
ATOM   6190  C CB   . ASN A 1 114 ? -5.293  -23.085 -7.442  1.00 0.00 ? 1594 ASN A CB   3  
ATOM   6191  C CG   . ASN A 1 114 ? -5.966  -23.422 -6.117  1.00 0.00 ? 1594 ASN A CG   3  
ATOM   6192  O OD1  . ASN A 1 114 ? -5.302  -23.662 -5.112  1.00 0.00 ? 1594 ASN A OD1  3  
ATOM   6193  N ND2  . ASN A 1 114 ? -7.289  -23.448 -6.080  1.00 0.00 ? 1594 ASN A ND2  3  
ATOM   6194  H H    . ASN A 1 114 ? -6.859  -21.607 -8.857  1.00 0.00 ? 1594 ASN A H    3  
ATOM   6195  H HA   . ASN A 1 114 ? -5.172  -21.092 -6.654  1.00 0.00 ? 1594 ASN A HA   3  
ATOM   6196  H HB2  . ASN A 1 114 ? -5.852  -23.515 -8.267  1.00 0.00 ? 1594 ASN A HB2  3  
ATOM   6197  H HB3  . ASN A 1 114 ? -4.316  -23.575 -7.445  1.00 0.00 ? 1594 ASN A HB3  3  
ATOM   6198  H HD21 . ASN A 1 114 ? -7.827  -23.219 -6.917  1.00 0.00 ? 1594 ASN A HD21 3  
ATOM   6199  H HD22 . ASN A 1 114 ? -7.770  -23.709 -5.233  1.00 0.00 ? 1594 ASN A HD22 3  
ATOM   6200  N N    . ARG A 1 115 ? -3.491  -21.391 -9.500  1.00 0.00 ? 1595 ARG A N    3  
ATOM   6201  C CA   . ARG A 1 115 ? -2.184  -21.108 -10.113 1.00 0.00 ? 1595 ARG A CA   3  
ATOM   6202  C C    . ARG A 1 115 ? -1.746  -19.671 -9.862  1.00 0.00 ? 1595 ARG A C    3  
ATOM   6203  O O    . ARG A 1 115 ? -0.544  -19.401 -9.856  1.00 0.00 ? 1595 ARG A O    3  
ATOM   6204  C CB   . ARG A 1 115 ? -2.176  -21.365 -11.634 1.00 0.00 ? 1595 ARG A CB   3  
ATOM   6205  C CG   . ARG A 1 115 ? -2.003  -22.839 -12.033 1.00 0.00 ? 1595 ARG A CG   3  
ATOM   6206  C CD   . ARG A 1 115 ? -3.280  -23.658 -11.841 1.00 0.00 ? 1595 ARG A CD   3  
ATOM   6207  N NE   . ARG A 1 115 ? -3.079  -25.077 -12.193 1.00 0.00 ? 1595 ARG A NE   3  
ATOM   6208  C CZ   . ARG A 1 115 ? -3.175  -25.642 -13.407 1.00 0.00 ? 1595 ARG A CZ   3  
ATOM   6209  N NH1  . ARG A 1 115 ? -3.461  -24.909 -14.484 1.00 0.00 ? 1595 ARG A NH1  3  
ATOM   6210  N NH2  . ARG A 1 115 ? -2.979  -26.951 -13.538 1.00 0.00 ? 1595 ARG A NH2  3  
ATOM   6211  H H    . ARG A 1 115 ? -4.268  -21.643 -10.099 1.00 0.00 ? 1595 ARG A H    3  
ATOM   6212  H HA   . ARG A 1 115 ? -1.433  -21.750 -9.641  1.00 0.00 ? 1595 ARG A HA   3  
ATOM   6213  H HB2  . ARG A 1 115 ? -3.081  -20.955 -12.086 1.00 0.00 ? 1595 ARG A HB2  3  
ATOM   6214  H HB3  . ARG A 1 115 ? -1.333  -20.827 -12.068 1.00 0.00 ? 1595 ARG A HB3  3  
ATOM   6215  H HG2  . ARG A 1 115 ? -1.723  -22.875 -13.088 1.00 0.00 ? 1595 ARG A HG2  3  
ATOM   6216  H HG3  . ARG A 1 115 ? -1.194  -23.284 -11.455 1.00 0.00 ? 1595 ARG A HG3  3  
ATOM   6217  H HD2  . ARG A 1 115 ? -3.571  -23.612 -10.795 1.00 0.00 ? 1595 ARG A HD2  3  
ATOM   6218  H HD3  . ARG A 1 115 ? -4.082  -23.216 -12.434 1.00 0.00 ? 1595 ARG A HD3  3  
ATOM   6219  H HE   . ARG A 1 115 ? -2.842  -25.677 -11.406 1.00 0.00 ? 1595 ARG A HE   3  
ATOM   6220  H HH11 . ARG A 1 115 ? -3.595  -23.910 -14.414 1.00 0.00 ? 1595 ARG A HH11 3  
ATOM   6221  H HH12 . ARG A 1 115 ? -3.534  -25.319 -15.408 1.00 0.00 ? 1595 ARG A HH12 3  
ATOM   6222  H HH21 . ARG A 1 115 ? -2.752  -27.533 -12.739 1.00 0.00 ? 1595 ARG A HH21 3  
ATOM   6223  H HH22 . ARG A 1 115 ? -3.049  -27.416 -14.436 1.00 0.00 ? 1595 ARG A HH22 3  
ATOM   6224  N N    . LEU A 1 116 ? -2.683  -18.742 -9.671  1.00 0.00 ? 1596 LEU A N    3  
ATOM   6225  C CA   . LEU A 1 116 ? -2.349  -17.369 -9.349  1.00 0.00 ? 1596 LEU A CA   3  
ATOM   6226  C C    . LEU A 1 116 ? -2.197  -17.172 -7.847  1.00 0.00 ? 1596 LEU A C    3  
ATOM   6227  O O    . LEU A 1 116 ? -1.452  -16.284 -7.439  1.00 0.00 ? 1596 LEU A O    3  
ATOM   6228  C CB   . LEU A 1 116 ? -3.428  -16.416 -9.876  1.00 0.00 ? 1596 LEU A CB   3  
ATOM   6229  C CG   . LEU A 1 116 ? -3.564  -16.250 -11.407 1.00 0.00 ? 1596 LEU A CG   3  
ATOM   6230  C CD1  . LEU A 1 116 ? -2.264  -16.449 -12.195 1.00 0.00 ? 1596 LEU A CD1  3  
ATOM   6231  C CD2  . LEU A 1 116 ? -4.633  -17.190 -11.963 1.00 0.00 ? 1596 LEU A CD2  3  
ATOM   6232  H H    . LEU A 1 116 ? -3.662  -18.996 -9.674  1.00 0.00 ? 1596 LEU A H    3  
ATOM   6233  H HA   . LEU A 1 116 ? -1.395  -17.124 -9.813  1.00 0.00 ? 1596 LEU A HA   3  
ATOM   6234  H HB2  . LEU A 1 116 ? -4.390  -16.693 -9.454  1.00 0.00 ? 1596 LEU A HB2  3  
ATOM   6235  H HB3  . LEU A 1 116 ? -3.190  -15.440 -9.464  1.00 0.00 ? 1596 LEU A HB3  3  
ATOM   6236  H HG   . LEU A 1 116 ? -3.911  -15.238 -11.595 1.00 0.00 ? 1596 LEU A HG   3  
ATOM   6237  H HD11 . LEU A 1 116 ? -1.480  -15.810 -11.785 1.00 0.00 ? 1596 LEU A HD11 3  
ATOM   6238  H HD12 . LEU A 1 116 ? -1.937  -17.488 -12.148 1.00 0.00 ? 1596 LEU A HD12 3  
ATOM   6239  H HD13 . LEU A 1 116 ? -2.430  -16.178 -13.237 1.00 0.00 ? 1596 LEU A HD13 3  
ATOM   6240  H HD21 . LEU A 1 116 ? -4.314  -18.224 -11.846 1.00 0.00 ? 1596 LEU A HD21 3  
ATOM   6241  H HD22 . LEU A 1 116 ? -5.569  -17.032 -11.428 1.00 0.00 ? 1596 LEU A HD22 3  
ATOM   6242  H HD23 . LEU A 1 116 ? -4.798  -16.987 -13.019 1.00 0.00 ? 1596 LEU A HD23 3  
ATOM   6243  N N    . ARG A 1 117 ? -2.883  -17.953 -7.006  1.00 0.00 ? 1597 ARG A N    3  
ATOM   6244  C CA   . ARG A 1 117 ? -2.874  -17.755 -5.557  1.00 0.00 ? 1597 ARG A CA   3  
ATOM   6245  C C    . ARG A 1 117 ? -1.466  -17.771 -4.984  1.00 0.00 ? 1597 ARG A C    3  
ATOM   6246  O O    . ARG A 1 117 ? -1.149  -16.940 -4.142  1.00 0.00 ? 1597 ARG A O    3  
ATOM   6247  C CB   . ARG A 1 117 ? -3.778  -18.791 -4.873  1.00 0.00 ? 1597 ARG A CB   3  
ATOM   6248  C CG   . ARG A 1 117 ? -4.237  -18.242 -3.516  1.00 0.00 ? 1597 ARG A CG   3  
ATOM   6249  C CD   . ARG A 1 117 ? -4.725  -19.313 -2.544  1.00 0.00 ? 1597 ARG A CD   3  
ATOM   6250  N NE   . ARG A 1 117 ? -6.136  -19.717 -2.743  1.00 0.00 ? 1597 ARG A NE   3  
ATOM   6251  C CZ   . ARG A 1 117 ? -6.645  -20.944 -2.558  1.00 0.00 ? 1597 ARG A CZ   3  
ATOM   6252  N NH1  . ARG A 1 117 ? -5.853  -21.992 -2.353  1.00 0.00 ? 1597 ARG A NH1  3  
ATOM   6253  N NH2  . ARG A 1 117 ? -7.961  -21.115 -2.577  1.00 0.00 ? 1597 ARG A NH2  3  
ATOM   6254  H H    . ARG A 1 117 ? -3.488  -18.680 -7.382  1.00 0.00 ? 1597 ARG A H    3  
ATOM   6255  H HA   . ARG A 1 117 ? -3.269  -16.768 -5.342  1.00 0.00 ? 1597 ARG A HA   3  
ATOM   6256  H HB2  . ARG A 1 117 ? -4.664  -18.980 -5.486  1.00 0.00 ? 1597 ARG A HB2  3  
ATOM   6257  H HB3  . ARG A 1 117 ? -3.227  -19.725 -4.747  1.00 0.00 ? 1597 ARG A HB3  3  
ATOM   6258  H HG2  . ARG A 1 117 ? -3.402  -17.739 -3.026  1.00 0.00 ? 1597 ARG A HG2  3  
ATOM   6259  H HG3  . ARG A 1 117 ? -5.020  -17.504 -3.685  1.00 0.00 ? 1597 ARG A HG3  3  
ATOM   6260  H HD2  . ARG A 1 117 ? -4.050  -20.164 -2.605  1.00 0.00 ? 1597 ARG A HD2  3  
ATOM   6261  H HD3  . ARG A 1 117 ? -4.652  -18.885 -1.548  1.00 0.00 ? 1597 ARG A HD3  3  
ATOM   6262  H HE   . ARG A 1 117 ? -6.774  -18.982 -3.043  1.00 0.00 ? 1597 ARG A HE   3  
ATOM   6263  H HH11 . ARG A 1 117 ? -4.844  -21.899 -2.354  1.00 0.00 ? 1597 ARG A HH11 3  
ATOM   6264  H HH12 . ARG A 1 117 ? -6.214  -22.928 -2.218  1.00 0.00 ? 1597 ARG A HH12 3  
ATOM   6265  H HH21 . ARG A 1 117 ? -8.585  -20.295 -2.518  1.00 0.00 ? 1597 ARG A HH21 3  
ATOM   6266  H HH22 . ARG A 1 117 ? -8.394  -22.018 -2.418  1.00 0.00 ? 1597 ARG A HH22 3  
ATOM   6267  N N    . GLU A 1 118 ? -0.614  -18.660 -5.482  1.00 0.00 ? 1598 GLU A N    3  
ATOM   6268  C CA   . GLU A 1 118 ? 0.761   -18.796 -5.014  1.00 0.00 ? 1598 GLU A CA   3  
ATOM   6269  C C    . GLU A 1 118 ? 1.615   -17.531 -5.231  1.00 0.00 ? 1598 GLU A C    3  
ATOM   6270  O O    . GLU A 1 118 ? 2.643   -17.398 -4.567  1.00 0.00 ? 1598 GLU A O    3  
ATOM   6271  C CB   . GLU A 1 118 ? 1.406   -20.036 -5.654  1.00 0.00 ? 1598 GLU A CB   3  
ATOM   6272  C CG   . GLU A 1 118 ? 1.297   -20.061 -7.188  1.00 0.00 ? 1598 GLU A CG   3  
ATOM   6273  C CD   . GLU A 1 118 ? 2.098   -21.234 -7.789  1.00 0.00 ? 1598 GLU A CD   3  
ATOM   6274  O OE1  . GLU A 1 118 ? 1.530   -22.341 -7.952  1.00 0.00 ? 1598 GLU A OE1  3  
ATOM   6275  O OE2  . GLU A 1 118 ? 3.301   -21.057 -8.100  1.00 0.00 ? 1598 GLU A OE2  3  
ATOM   6276  H H    . GLU A 1 118 ? -0.948  -19.320 -6.175  1.00 0.00 ? 1598 GLU A H    3  
ATOM   6277  H HA   . GLU A 1 118 ? 0.723   -18.965 -3.933  1.00 0.00 ? 1598 GLU A HA   3  
ATOM   6278  H HB2  . GLU A 1 118 ? 2.456   -20.081 -5.365  1.00 0.00 ? 1598 GLU A HB2  3  
ATOM   6279  H HB3  . GLU A 1 118 ? 0.913   -20.926 -5.260  1.00 0.00 ? 1598 GLU A HB3  3  
ATOM   6280  H HG2  . GLU A 1 118 ? 0.244   -20.170 -7.464  1.00 0.00 ? 1598 GLU A HG2  3  
ATOM   6281  H HG3  . GLU A 1 118 ? 1.665   -19.118 -7.597  1.00 0.00 ? 1598 GLU A HG3  3  
ATOM   6282  N N    . GLN A 1 119 ? 1.216   -16.605 -6.120  1.00 0.00 ? 1599 GLN A N    3  
ATOM   6283  C CA   . GLN A 1 119 ? 1.957   -15.373 -6.376  1.00 0.00 ? 1599 GLN A CA   3  
ATOM   6284  C C    . GLN A 1 119 ? 1.170   -14.139 -5.916  1.00 0.00 ? 1599 GLN A C    3  
ATOM   6285  O O    . GLN A 1 119 ? 1.734   -13.233 -5.301  1.00 0.00 ? 1599 GLN A O    3  
ATOM   6286  C CB   . GLN A 1 119 ? 2.318   -15.318 -7.871  1.00 0.00 ? 1599 GLN A CB   3  
ATOM   6287  C CG   . GLN A 1 119 ? 3.302   -14.183 -8.198  1.00 0.00 ? 1599 GLN A CG   3  
ATOM   6288  C CD   . GLN A 1 119 ? 4.024   -14.398 -9.536  1.00 0.00 ? 1599 GLN A CD   3  
ATOM   6289  O OE1  . GLN A 1 119 ? 5.252   -14.372 -9.605  1.00 0.00 ? 1599 GLN A OE1  3  
ATOM   6290  N NE2  . GLN A 1 119 ? 3.303   -14.620 -10.629 1.00 0.00 ? 1599 GLN A NE2  3  
ATOM   6291  H H    . GLN A 1 119 ? 0.336   -16.724 -6.615  1.00 0.00 ? 1599 GLN A H    3  
ATOM   6292  H HA   . GLN A 1 119 ? 2.889   -15.395 -5.811  1.00 0.00 ? 1599 GLN A HA   3  
ATOM   6293  H HB2  . GLN A 1 119 ? 2.782   -16.260 -8.154  1.00 0.00 ? 1599 GLN A HB2  3  
ATOM   6294  H HB3  . GLN A 1 119 ? 1.410   -15.201 -8.468  1.00 0.00 ? 1599 GLN A HB3  3  
ATOM   6295  H HG2  . GLN A 1 119 ? 2.771   -13.230 -8.217  1.00 0.00 ? 1599 GLN A HG2  3  
ATOM   6296  H HG3  . GLN A 1 119 ? 4.050   -14.137 -7.409  1.00 0.00 ? 1599 GLN A HG3  3  
ATOM   6297  H HE21 . GLN A 1 119 ? 2.295   -14.675 -10.579 1.00 0.00 ? 1599 GLN A HE21 3  
ATOM   6298  H HE22 . GLN A 1 119 ? 3.764   -14.772 -11.516 1.00 0.00 ? 1599 GLN A HE22 3  
ATOM   6299  N N    . TYR A 1 120 ? -0.133  -14.102 -6.218  1.00 0.00 ? 1600 TYR A N    3  
ATOM   6300  C CA   . TYR A 1 120 ? -0.978  -12.922 -6.059  1.00 0.00 ? 1600 TYR A CA   3  
ATOM   6301  C C    . TYR A 1 120 ? -1.828  -12.936 -4.793  1.00 0.00 ? 1600 TYR A C    3  
ATOM   6302  O O    . TYR A 1 120 ? -2.454  -11.917 -4.491  1.00 0.00 ? 1600 TYR A O    3  
ATOM   6303  C CB   . TYR A 1 120 ? -1.906  -12.840 -7.280  1.00 0.00 ? 1600 TYR A CB   3  
ATOM   6304  C CG   . TYR A 1 120 ? -1.262  -12.817 -8.652  1.00 0.00 ? 1600 TYR A CG   3  
ATOM   6305  C CD1  . TYR A 1 120 ? 0.098   -12.513 -8.826  1.00 0.00 ? 1600 TYR A CD1  3  
ATOM   6306  C CD2  . TYR A 1 120 ? -2.057  -13.109 -9.769  1.00 0.00 ? 1600 TYR A CD2  3  
ATOM   6307  C CE1  . TYR A 1 120 ? 0.675   -12.552 -10.109 1.00 0.00 ? 1600 TYR A CE1  3  
ATOM   6308  C CE2  . TYR A 1 120 ? -1.496  -13.147 -11.054 1.00 0.00 ? 1600 TYR A CE2  3  
ATOM   6309  C CZ   . TYR A 1 120 ? -0.124  -12.875 -11.235 1.00 0.00 ? 1600 TYR A CZ   3  
ATOM   6310  O OH   . TYR A 1 120 ? 0.417   -12.926 -12.487 1.00 0.00 ? 1600 TYR A OH   3  
ATOM   6311  H H    . TYR A 1 120 ? -0.524  -14.856 -6.774  1.00 0.00 ? 1600 TYR A H    3  
ATOM   6312  H HA   . TYR A 1 120 ? -0.358  -12.027 -6.019  1.00 0.00 ? 1600 TYR A HA   3  
ATOM   6313  H HB2  . TYR A 1 120 ? -2.572  -13.700 -7.250  1.00 0.00 ? 1600 TYR A HB2  3  
ATOM   6314  H HB3  . TYR A 1 120 ? -2.531  -11.963 -7.197  1.00 0.00 ? 1600 TYR A HB3  3  
ATOM   6315  H HD1  . TYR A 1 120 ? 0.712   -12.250 -7.977  1.00 0.00 ? 1600 TYR A HD1  3  
ATOM   6316  H HD2  . TYR A 1 120 ? -3.109  -13.303 -9.633  1.00 0.00 ? 1600 TYR A HD2  3  
ATOM   6317  H HE1  . TYR A 1 120 ? 1.726   -12.332 -10.213 1.00 0.00 ? 1600 TYR A HE1  3  
ATOM   6318  H HE2  . TYR A 1 120 ? -2.119  -13.384 -11.902 1.00 0.00 ? 1600 TYR A HE2  3  
ATOM   6319  H HH   . TYR A 1 120 ? 1.361   -12.684 -12.525 1.00 0.00 ? 1600 TYR A HH   3  
ATOM   6320  N N    . GLY A 1 121 ? -1.891  -14.071 -4.096  1.00 0.00 ? 1601 GLY A N    3  
ATOM   6321  C CA   . GLY A 1 121 ? -2.631  -14.219 -2.847  1.00 0.00 ? 1601 GLY A CA   3  
ATOM   6322  C C    . GLY A 1 121 ? -2.177  -13.162 -1.840  1.00 0.00 ? 1601 GLY A C    3  
ATOM   6323  O O    . GLY A 1 121 ? -0.968  -12.952 -1.692  1.00 0.00 ? 1601 GLY A O    3  
ATOM   6324  H H    . GLY A 1 121 ? -1.330  -14.856 -4.407  1.00 0.00 ? 1601 GLY A H    3  
ATOM   6325  H HA2  . GLY A 1 121 ? -3.696  -14.136 -3.041  1.00 0.00 ? 1601 GLY A HA2  3  
ATOM   6326  H HA3  . GLY A 1 121 ? -2.446  -15.205 -2.426  1.00 0.00 ? 1601 GLY A HA3  3  
ATOM   6327  N N    . LEU A 1 122 ? -3.110  -12.507 -1.133  1.00 0.00 ? 1602 LEU A N    3  
ATOM   6328  C CA   . LEU A 1 122 ? -2.746  -11.534 -0.107  1.00 0.00 ? 1602 LEU A CA   3  
ATOM   6329  C C    . LEU A 1 122 ? -2.004  -12.223 1.039   1.00 0.00 ? 1602 LEU A C    3  
ATOM   6330  O O    . LEU A 1 122 ? -1.067  -11.656 1.604   1.00 0.00 ? 1602 LEU A O    3  
ATOM   6331  C CB   . LEU A 1 122 ? -3.944  -10.821 0.535   1.00 0.00 ? 1602 LEU A CB   3  
ATOM   6332  C CG   . LEU A 1 122 ? -5.148  -10.443 -0.324  1.00 0.00 ? 1602 LEU A CG   3  
ATOM   6333  C CD1  . LEU A 1 122 ? -6.065  -9.532  0.496   1.00 0.00 ? 1602 LEU A CD1  3  
ATOM   6334  C CD2  . LEU A 1 122 ? -4.770  -9.741  -1.614  1.00 0.00 ? 1602 LEU A CD2  3  
ATOM   6335  H H    . LEU A 1 122 ? -4.094  -12.631 -1.343  1.00 0.00 ? 1602 LEU A H    3  
ATOM   6336  H HA   . LEU A 1 122 ? -2.120  -10.778 -0.573  1.00 0.00 ? 1602 LEU A HA   3  
ATOM   6337  H HB2  . LEU A 1 122 ? -4.322  -11.408 1.372   1.00 0.00 ? 1602 LEU A HB2  3  
ATOM   6338  H HB3  . LEU A 1 122 ? -3.536  -9.911  0.948   1.00 0.00 ? 1602 LEU A HB3  3  
ATOM   6339  H HG   . LEU A 1 122 ? -5.666  -11.354 -0.582  1.00 0.00 ? 1602 LEU A HG   3  
ATOM   6340  H HD11 . LEU A 1 122 ? -6.857  -9.113  -0.124  1.00 0.00 ? 1602 LEU A HD11 3  
ATOM   6341  H HD12 . LEU A 1 122 ? -6.505  -10.103 1.310   1.00 0.00 ? 1602 LEU A HD12 3  
ATOM   6342  H HD13 . LEU A 1 122 ? -5.511  -8.707  0.941   1.00 0.00 ? 1602 LEU A HD13 3  
ATOM   6343  H HD21 . LEU A 1 122 ? -4.289  -10.445 -2.291  1.00 0.00 ? 1602 LEU A HD21 3  
ATOM   6344  H HD22 . LEU A 1 122 ? -5.651  -9.334  -2.111  1.00 0.00 ? 1602 LEU A HD22 3  
ATOM   6345  H HD23 . LEU A 1 122 ? -4.083  -8.947  -1.355  1.00 0.00 ? 1602 LEU A HD23 3  
ATOM   6346  N N    . GLY A 1 123 ? -2.493  -13.413 1.407   1.00 0.00 ? 1603 GLY A N    3  
ATOM   6347  C CA   . GLY A 1 123 ? -2.060  -14.124 2.592   1.00 0.00 ? 1603 GLY A CA   3  
ATOM   6348  C C    . GLY A 1 123 ? -0.691  -14.750 2.347   1.00 0.00 ? 1603 GLY A C    3  
ATOM   6349  O O    . GLY A 1 123 ? 0.226   -14.539 3.174   1.00 0.00 ? 1603 GLY A O    3  
ATOM   6350  O OXT  . GLY A 1 123 ? -0.542  -15.470 1.332   1.00 0.00 ? 1603 GLY A OXT  3  
ATOM   6351  H H    . GLY A 1 123 ? -3.234  -13.818 0.856   1.00 0.00 ? 1603 GLY A H    3  
ATOM   6352  H HA2  . GLY A 1 123 ? -2.020  -13.414 3.415   1.00 0.00 ? 1603 GLY A HA2  3  
ATOM   6353  H HA3  . GLY A 1 123 ? -2.787  -14.899 2.823   1.00 0.00 ? 1603 GLY A HA3  3  
ATOM   6354  N N    . GLY B 2 1   ? -29.827 -25.943 -22.882 1.00 0.00 ? 14   GLY B N    3  
ATOM   6355  C CA   . GLY B 2 1   ? -28.360 -26.123 -22.806 1.00 0.00 ? 14   GLY B CA   3  
ATOM   6356  C C    . GLY B 2 1   ? -27.751 -25.436 -21.583 1.00 0.00 ? 14   GLY B C    3  
ATOM   6357  O O    . GLY B 2 1   ? -28.419 -25.263 -20.557 1.00 0.00 ? 14   GLY B O    3  
ATOM   6358  H H1   . GLY B 2 1   ? -30.196 -26.428 -23.685 1.00 0.00 ? 14   GLY B H1   3  
ATOM   6359  H H2   . GLY B 2 1   ? -30.054 -24.962 -22.955 1.00 0.00 ? 14   GLY B H2   3  
ATOM   6360  H H3   . GLY B 2 1   ? -30.260 -26.318 -22.054 1.00 0.00 ? 14   GLY B H3   3  
ATOM   6361  H HA2  . GLY B 2 1   ? -28.137 -27.188 -22.758 1.00 0.00 ? 14   GLY B HA2  3  
ATOM   6362  H HA3  . GLY B 2 1   ? -27.902 -25.720 -23.712 1.00 0.00 ? 14   GLY B HA3  3  
ATOM   6363  N N    . ALA B 2 2   ? -26.466 -25.063 -21.669 1.00 0.00 ? 15   ALA B N    3  
ATOM   6364  C CA   . ALA B 2 2   ? -25.774 -24.315 -20.620 1.00 0.00 ? 15   ALA B CA   3  
ATOM   6365  C C    . ALA B 2 2   ? -26.362 -22.911 -20.476 1.00 0.00 ? 15   ALA B C    3  
ATOM   6366  O O    . ALA B 2 2   ? -26.960 -22.386 -21.416 1.00 0.00 ? 15   ALA B O    3  
ATOM   6367  C CB   . ALA B 2 2   ? -24.275 -24.225 -20.943 1.00 0.00 ? 15   ALA B CB   3  
ATOM   6368  H H    . ALA B 2 2   ? -25.959 -25.232 -22.528 1.00 0.00 ? 15   ALA B H    3  
ATOM   6369  H HA   . ALA B 2 2   ? -25.904 -24.835 -19.675 1.00 0.00 ? 15   ALA B HA   3  
ATOM   6370  H HB1  . ALA B 2 2   ? -23.758 -23.678 -20.154 1.00 0.00 ? 15   ALA B HB1  3  
ATOM   6371  H HB2  . ALA B 2 2   ? -23.845 -25.221 -21.019 1.00 0.00 ? 15   ALA B HB2  3  
ATOM   6372  H HB3  . ALA B 2 2   ? -24.131 -23.685 -21.880 1.00 0.00 ? 15   ALA B HB3  3  
ATOM   6373  N N    . LYS B 2 3   ? -26.142 -22.269 -19.326 1.00 0.00 ? 16   LYS B N    3  
ATOM   6374  C CA   . LYS B 2 3   ? -26.455 -20.857 -19.082 1.00 0.00 ? 16   LYS B CA   3  
ATOM   6375  C C    . LYS B 2 3   ? -25.607 -20.371 -17.911 1.00 0.00 ? 16   LYS B C    3  
ATOM   6376  O O    . LYS B 2 3   ? -25.099 -21.213 -17.176 1.00 0.00 ? 16   LYS B O    3  
ATOM   6377  C CB   . LYS B 2 3   ? -27.953 -20.734 -18.743 1.00 0.00 ? 16   LYS B CB   3  
ATOM   6378  C CG   . LYS B 2 3   ? -28.550 -19.345 -19.025 1.00 0.00 ? 16   LYS B CG   3  
ATOM   6379  C CD   . LYS B 2 3   ? -28.636 -19.036 -20.525 1.00 0.00 ? 16   LYS B CD   3  
ATOM   6380  C CE   . LYS B 2 3   ? -29.052 -17.591 -20.850 1.00 0.00 ? 16   LYS B CE   3  
ATOM   6381  N NZ   . LYS B 2 3   ? -30.220 -17.078 -20.074 1.00 0.00 ? 16   LYS B NZ   3  
ATOM   6382  H H    . LYS B 2 3   ? -25.660 -22.750 -18.573 1.00 0.00 ? 16   LYS B H    3  
ATOM   6383  H HA   . LYS B 2 3   ? -26.201 -20.293 -19.977 1.00 0.00 ? 16   LYS B HA   3  
ATOM   6384  H HB2  . LYS B 2 3   ? -28.518 -21.470 -19.314 1.00 0.00 ? 16   LYS B HB2  3  
ATOM   6385  H HB3  . LYS B 2 3   ? -28.078 -20.980 -17.684 1.00 0.00 ? 16   LYS B HB3  3  
ATOM   6386  H HG2  . LYS B 2 3   ? -29.556 -19.325 -18.612 1.00 0.00 ? 16   LYS B HG2  3  
ATOM   6387  H HG3  . LYS B 2 3   ? -27.957 -18.572 -18.543 1.00 0.00 ? 16   LYS B HG3  3  
ATOM   6388  H HD2  . LYS B 2 3   ? -27.649 -19.184 -20.958 1.00 0.00 ? 16   LYS B HD2  3  
ATOM   6389  H HD3  . LYS B 2 3   ? -29.324 -19.738 -20.996 1.00 0.00 ? 16   LYS B HD3  3  
ATOM   6390  H HE2  . LYS B 2 3   ? -28.192 -16.945 -20.672 1.00 0.00 ? 16   LYS B HE2  3  
ATOM   6391  H HE3  . LYS B 2 3   ? -29.271 -17.541 -21.918 1.00 0.00 ? 16   LYS B HE3  3  
ATOM   6392  H HZ1  . LYS B 2 3   ? -30.564 -16.217 -20.480 1.00 0.00 ? 16   LYS B HZ1  3  
ATOM   6393  H HZ2  . LYS B 2 3   ? -30.987 -17.738 -20.075 1.00 0.00 ? 16   LYS B HZ2  3  
ATOM   6394  H HZ3  . LYS B 2 3   ? -29.970 -16.856 -19.107 1.00 0.00 ? 16   LYS B HZ3  3  
ATOM   6395  N N    . ARG B 2 4   ? -25.456 -19.048 -17.745 1.00 0.00 ? 17   ARG B N    3  
ATOM   6396  C CA   . ARG B 2 4   ? -24.694 -18.397 -16.669 1.00 0.00 ? 17   ARG B CA   3  
ATOM   6397  C C    . ARG B 2 4   ? -24.869 -19.169 -15.369 1.00 0.00 ? 17   ARG B C    3  
ATOM   6398  O O    . ARG B 2 4   ? -25.966 -19.220 -14.803 1.00 0.00 ? 17   ARG B O    3  
ATOM   6399  C CB   . ARG B 2 4   ? -25.086 -16.934 -16.555 1.00 0.00 ? 17   ARG B CB   3  
ATOM   6400  C CG   . ARG B 2 4   ? -24.371 -16.207 -15.414 1.00 0.00 ? 17   ARG B CG   3  
ATOM   6401  C CD   . ARG B 2 4   ? -24.197 -14.711 -15.734 1.00 0.00 ? 17   ARG B CD   3  
ATOM   6402  N NE   . ARG B 2 4   ? -25.480 -13.974 -15.757 1.00 0.00 ? 17   ARG B NE   3  
ATOM   6403  C CZ   . ARG B 2 4   ? -25.648 -12.645 -15.852 1.00 0.00 ? 17   ARG B CZ   3  
ATOM   6404  N NH1  . ARG B 2 4   ? -24.608 -11.814 -15.854 1.00 0.00 ? 17   ARG B NH1  3  
ATOM   6405  N NH2  . ARG B 2 4   ? -26.878 -12.158 -15.953 1.00 0.00 ? 17   ARG B NH2  3  
ATOM   6406  H H    . ARG B 2 4   ? -25.921 -18.437 -18.407 1.00 0.00 ? 17   ARG B H    3  
ATOM   6407  H HA   . ARG B 2 4   ? -23.645 -18.378 -16.945 1.00 0.00 ? 17   ARG B HA   3  
ATOM   6408  H HB2  . ARG B 2 4   ? -24.771 -16.476 -17.493 1.00 0.00 ? 17   ARG B HB2  3  
ATOM   6409  H HB3  . ARG B 2 4   ? -26.167 -16.852 -16.423 1.00 0.00 ? 17   ARG B HB3  3  
ATOM   6410  H HG2  . ARG B 2 4   ? -24.919 -16.351 -14.486 1.00 0.00 ? 17   ARG B HG2  3  
ATOM   6411  H HG3  . ARG B 2 4   ? -23.381 -16.638 -15.280 1.00 0.00 ? 17   ARG B HG3  3  
ATOM   6412  H HD2  . ARG B 2 4   ? -23.533 -14.293 -14.983 1.00 0.00 ? 17   ARG B HD2  3  
ATOM   6413  H HD3  . ARG B 2 4   ? -23.702 -14.622 -16.699 1.00 0.00 ? 17   ARG B HD3  3  
ATOM   6414  H HE   . ARG B 2 4   ? -26.322 -14.545 -15.691 1.00 0.00 ? 17   ARG B HE   3  
ATOM   6415  H HH11 . ARG B 2 4   ? -23.653 -12.150 -15.816 1.00 0.00 ? 17   ARG B HH11 3  
ATOM   6416  H HH12 . ARG B 2 4   ? -24.724 -10.808 -15.938 1.00 0.00 ? 17   ARG B HH12 3  
ATOM   6417  H HH21 . ARG B 2 4   ? -27.683 -12.789 -16.100 1.00 0.00 ? 17   ARG B HH21 3  
ATOM   6418  H HH22 . ARG B 2 4   ? -27.067 -11.166 -16.064 1.00 0.00 ? 17   ARG B HH22 3  
ATOM   6419  N N    . HIS B 2 5   ? -23.785 -19.815 -14.967 1.00 0.00 ? 18   HIS B N    3  
ATOM   6420  C CA   . HIS B 2 5   ? -23.773 -20.781 -13.894 1.00 0.00 ? 18   HIS B CA   3  
ATOM   6421  C C    . HIS B 2 5   ? -23.392 -20.087 -12.579 1.00 0.00 ? 18   HIS B C    3  
ATOM   6422  O O    . HIS B 2 5   ? -23.143 -18.874 -12.585 1.00 0.00 ? 18   HIS B O    3  
ATOM   6423  C CB   . HIS B 2 5   ? -22.851 -21.910 -14.316 1.00 0.00 ? 18   HIS B CB   3  
ATOM   6424  C CG   . HIS B 2 5   ? -21.403 -21.613 -14.213 1.00 0.00 ? 18   HIS B CG   3  
ATOM   6425  N ND1  . HIS B 2 5   ? -20.784 -20.367 -14.187 1.00 0.00 ? 18   HIS B ND1  3  
ATOM   6426  C CD2  . HIS B 2 5   ? -20.478 -22.593 -14.246 1.00 0.00 ? 18   HIS B CD2  3  
ATOM   6427  C CE1  . HIS B 2 5   ? -19.476 -20.640 -14.170 1.00 0.00 ? 18   HIS B CE1  3  
ATOM   6428  N NE2  . HIS B 2 5   ? -19.255 -21.969 -14.223 1.00 0.00 ? 18   HIS B NE2  3  
ATOM   6429  H H    . HIS B 2 5   ? -22.897 -19.669 -15.424 1.00 0.00 ? 18   HIS B H    3  
ATOM   6430  H HA   . HIS B 2 5   ? -24.733 -21.265 -13.825 1.00 0.00 ? 18   HIS B HA   3  
ATOM   6431  H HB2  . HIS B 2 5   ? -23.060 -22.791 -13.712 1.00 0.00 ? 18   HIS B HB2  3  
ATOM   6432  H HB3  . HIS B 2 5   ? -23.044 -22.150 -15.365 1.00 0.00 ? 18   HIS B HB3  3  
ATOM   6433  H HD2  . HIS B 2 5   ? -20.719 -23.649 -14.293 1.00 0.00 ? 18   HIS B HD2  3  
ATOM   6434  H HE1  . HIS B 2 5   ? -18.704 -19.891 -14.173 1.00 0.00 ? 18   HIS B HE1  3  
ATOM   6435  H HE2  . HIS B 2 5   ? -18.346 -22.427 -14.252 1.00 0.00 ? 18   HIS B HE2  3  
ATOM   6436  N N    . ARG B 2 6   ? -23.291 -20.844 -11.470 1.00 0.00 ? 19   ARG B N    3  
ATOM   6437  C CA   . ARG B 2 6   ? -22.825 -20.330 -10.172 1.00 0.00 ? 19   ARG B CA   3  
ATOM   6438  C C    . ARG B 2 6   ? -23.626 -19.055 -9.856  1.00 0.00 ? 19   ARG B C    3  
ATOM   6439  O O    . ARG B 2 6   ? -24.857 -19.089 -9.960  1.00 0.00 ? 19   ARG B O    3  
ATOM   6440  C CB   . ARG B 2 6   ? -21.277 -20.223 -10.223 1.00 0.00 ? 19   ARG B CB   3  
ATOM   6441  C CG   . ARG B 2 6   ? -20.652 -21.619 -10.395 1.00 0.00 ? 19   ARG B CG   3  
ATOM   6442  C CD   . ARG B 2 6   ? -19.124 -21.652 -10.308 1.00 0.00 ? 19   ARG B CD   3  
ATOM   6443  N NE   . ARG B 2 6   ? -18.631 -23.012 -9.996  1.00 0.00 ? 19   ARG B NE   3  
ATOM   6444  C CZ   . ARG B 2 6   ? -18.612 -24.100 -10.784 1.00 0.00 ? 19   ARG B CZ   3  
ATOM   6445  N NH1  . ARG B 2 6   ? -19.076 -24.060 -12.033 1.00 0.00 ? 19   ARG B NH1  3  
ATOM   6446  N NH2  . ARG B 2 6   ? -18.119 -25.241 -10.308 1.00 0.00 ? 19   ARG B NH2  3  
ATOM   6447  H H    . ARG B 2 6   ? -23.560 -21.816 -11.518 1.00 0.00 ? 19   ARG B H    3  
ATOM   6448  H HA   . ARG B 2 6   ? -23.073 -21.031 -9.367  1.00 0.00 ? 19   ARG B HA   3  
ATOM   6449  H HB2  . ARG B 2 6   ? -20.954 -19.588 -11.054 1.00 0.00 ? 19   ARG B HB2  3  
ATOM   6450  H HB3  . ARG B 2 6   ? -20.911 -19.792 -9.291  1.00 0.00 ? 19   ARG B HB3  3  
ATOM   6451  H HG2  . ARG B 2 6   ? -21.045 -22.273 -9.617  1.00 0.00 ? 19   ARG B HG2  3  
ATOM   6452  H HG3  . ARG B 2 6   ? -20.934 -22.016 -11.369 1.00 0.00 ? 19   ARG B HG3  3  
ATOM   6453  H HD2  . ARG B 2 6   ? -18.691 -21.291 -11.239 1.00 0.00 ? 19   ARG B HD2  3  
ATOM   6454  H HD3  . ARG B 2 6   ? -18.795 -20.982 -9.510  1.00 0.00 ? 19   ARG B HD3  3  
ATOM   6455  H HE   . ARG B 2 6   ? -18.262 -23.114 -9.055  1.00 0.00 ? 19   ARG B HE   3  
ATOM   6456  H HH11 . ARG B 2 6   ? -19.500 -23.215 -12.387 1.00 0.00 ? 19   ARG B HH11 3  
ATOM   6457  H HH12 . ARG B 2 6   ? -19.055 -24.876 -12.637 1.00 0.00 ? 19   ARG B HH12 3  
ATOM   6458  H HH21 . ARG B 2 6   ? -17.777 -25.312 -9.353  1.00 0.00 ? 19   ARG B HH21 3  
ATOM   6459  H HH22 . ARG B 2 6   ? -18.093 -26.093 -10.858 1.00 0.00 ? 19   ARG B HH22 3  
HETATM 6460  N N    . MLY B 2 7   ? -22.973 -17.960 -9.460  1.00 0.00 ? 20   MLY B N    3  
HETATM 6461  C CA   . MLY B 2 7   ? -23.589 -16.639 -9.356  1.00 0.00 ? 20   MLY B CA   3  
HETATM 6462  C CB   . MLY B 2 7   ? -24.145 -16.361 -7.946  1.00 0.00 ? 20   MLY B CB   3  
HETATM 6463  C CG   . MLY B 2 7   ? -23.238 -16.632 -6.724  1.00 0.00 ? 20   MLY B CG   3  
HETATM 6464  C CD   . MLY B 2 7   ? -21.907 -15.871 -6.640  1.00 0.00 ? 20   MLY B CD   3  
HETATM 6465  C CE   . MLY B 2 7   ? -22.090 -14.354 -6.731  1.00 0.00 ? 20   MLY B CE   3  
HETATM 6466  N NZ   . MLY B 2 7   ? -20.820 -13.591 -6.673  1.00 0.00 ? 20   MLY B NZ   3  
HETATM 6467  C CH1  . MLY B 2 7   ? -20.227 -13.381 -5.329  1.00 0.00 ? 20   MLY B CH1  3  
HETATM 6468  C CH2  . MLY B 2 7   ? -19.799 -13.928 -7.689  1.00 0.00 ? 20   MLY B CH2  3  
HETATM 6469  C C    . MLY B 2 7   ? -22.577 -15.617 -9.861  1.00 0.00 ? 20   MLY B C    3  
HETATM 6470  O O    . MLY B 2 7   ? -21.380 -15.846 -9.799  1.00 0.00 ? 20   MLY B O    3  
HETATM 6471  H H    . MLY B 2 7   ? -21.964 -17.991 -9.413  1.00 0.00 ? 20   MLY B H    3  
HETATM 6472  H HA   . MLY B 2 7   ? -24.434 -16.609 -10.047 1.00 0.00 ? 20   MLY B HA   3  
HETATM 6473  H HB2  . MLY B 2 7   ? -25.025 -16.995 -7.826  1.00 0.00 ? 20   MLY B HB2  3  
HETATM 6474  H HB3  . MLY B 2 7   ? -24.517 -15.336 -7.905  1.00 0.00 ? 20   MLY B HB3  3  
HETATM 6475  H HG2  . MLY B 2 7   ? -23.013 -17.699 -6.693  1.00 0.00 ? 20   MLY B HG2  3  
HETATM 6476  H HG3  . MLY B 2 7   ? -23.816 -16.407 -5.826  1.00 0.00 ? 20   MLY B HG3  3  
HETATM 6477  H HD2  . MLY B 2 7   ? -21.230 -16.248 -7.401  1.00 0.00 ? 20   MLY B HD2  3  
HETATM 6478  H HD3  . MLY B 2 7   ? -21.440 -16.089 -5.687  1.00 0.00 ? 20   MLY B HD3  3  
HETATM 6479  H HE2  . MLY B 2 7   ? -22.738 -14.043 -5.914  1.00 0.00 ? 20   MLY B HE2  3  
HETATM 6480  H HE3  . MLY B 2 7   ? -22.603 -14.100 -7.658  1.00 0.00 ? 20   MLY B HE3  3  
HETATM 6481  H HH11 . MLY B 2 7   ? -19.588 -14.221 -5.071  1.00 0.00 ? 20   MLY B HH11 3  
HETATM 6482  H HH12 . MLY B 2 7   ? -19.614 -12.477 -5.327  1.00 0.00 ? 20   MLY B HH12 3  
HETATM 6483  H HH13 . MLY B 2 7   ? -20.990 -13.277 -4.556  1.00 0.00 ? 20   MLY B HH13 3  
HETATM 6484  H HH21 . MLY B 2 7   ? -19.012 -13.173 -7.681  1.00 0.00 ? 20   MLY B HH21 3  
HETATM 6485  H HH22 . MLY B 2 7   ? -19.353 -14.903 -7.489  1.00 0.00 ? 20   MLY B HH22 3  
HETATM 6486  H HH23 . MLY B 2 7   ? -20.232 -13.927 -8.687  1.00 0.00 ? 20   MLY B HH23 3  
HETATM 6487  H HZ   . MLY B 2 7   ? -21.144 -12.656 -6.998  1.00 0.00 ? 20   MLY B HZ   3  
ATOM   6488  N N    . VAL B 2 8   ? -23.070 -14.513 -10.412 1.00 0.00 ? 21   VAL B N    3  
ATOM   6489  C CA   . VAL B 2 8   ? -22.302 -13.492 -11.137 1.00 0.00 ? 21   VAL B CA   3  
ATOM   6490  C C    . VAL B 2 8   ? -23.145 -12.216 -11.345 1.00 0.00 ? 21   VAL B C    3  
ATOM   6491  O O    . VAL B 2 8   ? -22.804 -11.357 -12.164 1.00 0.00 ? 21   VAL B O    3  
ATOM   6492  C CB   . VAL B 2 8   ? -21.892 -13.989 -12.556 1.00 0.00 ? 21   VAL B CB   3  
ATOM   6493  C CG1  . VAL B 2 8   ? -20.499 -13.477 -12.907 1.00 0.00 ? 21   VAL B CG1  3  
ATOM   6494  C CG2  . VAL B 2 8   ? -22.007 -15.480 -12.915 1.00 0.00 ? 21   VAL B CG2  3  
ATOM   6495  H H    . VAL B 2 8   ? -24.075 -14.408 -10.418 1.00 0.00 ? 21   VAL B H    3  
ATOM   6496  H HA   . VAL B 2 8   ? -21.432 -13.223 -10.536 1.00 0.00 ? 21   VAL B HA   3  
ATOM   6497  H HB   . VAL B 2 8   ? -22.574 -13.514 -13.256 1.00 0.00 ? 21   VAL B HB   3  
ATOM   6498  H HG11 . VAL B 2 8   ? -20.386 -13.440 -13.988 1.00 0.00 ? 21   VAL B HG11 3  
ATOM   6499  H HG12 . VAL B 2 8   ? -20.363 -12.472 -12.497 1.00 0.00 ? 21   VAL B HG12 3  
ATOM   6500  H HG13 . VAL B 2 8   ? -19.746 -14.136 -12.489 1.00 0.00 ? 21   VAL B HG13 3  
ATOM   6501  H HG21 . VAL B 2 8   ? -21.758 -15.626 -13.971 1.00 0.00 ? 21   VAL B HG21 3  
ATOM   6502  H HG22 . VAL B 2 8   ? -21.334 -16.097 -12.319 1.00 0.00 ? 21   VAL B HG22 3  
ATOM   6503  H HG23 . VAL B 2 8   ? -23.034 -15.818 -12.766 1.00 0.00 ? 21   VAL B HG23 3  
ATOM   6504  N N    . LEU B 2 9   ? -24.309 -12.126 -10.702 1.00 0.00 ? 22   LEU B N    3  
ATOM   6505  C CA   . LEU B 2 9   ? -25.314 -11.119 -10.987 1.00 0.00 ? 22   LEU B CA   3  
ATOM   6506  C C    . LEU B 2 9   ? -26.198 -10.946 -9.768  1.00 0.00 ? 22   LEU B C    3  
ATOM   6507  O O    . LEU B 2 9   ? -26.317 -11.865 -8.966  1.00 0.00 ? 22   LEU B O    3  
ATOM   6508  C CB   . LEU B 2 9   ? -26.160 -11.559 -12.212 1.00 0.00 ? 22   LEU B CB   3  
ATOM   6509  C CG   . LEU B 2 9   ? -26.643 -13.031 -12.338 1.00 0.00 ? 22   LEU B CG   3  
ATOM   6510  C CD1  . LEU B 2 9   ? -25.524 -14.039 -12.648 1.00 0.00 ? 22   LEU B CD1  3  
ATOM   6511  C CD2  . LEU B 2 9   ? -27.396 -13.575 -11.127 1.00 0.00 ? 22   LEU B CD2  3  
ATOM   6512  H H    . LEU B 2 9   ? -24.491 -12.732 -9.913  1.00 0.00 ? 22   LEU B H    3  
ATOM   6513  H HA   . LEU B 2 9   ? -24.827 -10.167 -11.208 1.00 0.00 ? 22   LEU B HA   3  
ATOM   6514  H HB2  . LEU B 2 9   ? -27.042 -10.916 -12.263 1.00 0.00 ? 22   LEU B HB2  3  
ATOM   6515  H HB3  . LEU B 2 9   ? -25.580 -11.326 -13.108 1.00 0.00 ? 22   LEU B HB3  3  
ATOM   6516  H HG   . LEU B 2 9   ? -27.327 -13.054 -13.184 1.00 0.00 ? 22   LEU B HG   3  
ATOM   6517  H HD11 . LEU B 2 9   ? -25.083 -14.450 -11.748 1.00 0.00 ? 22   LEU B HD11 3  
ATOM   6518  H HD12 . LEU B 2 9   ? -25.934 -14.886 -13.190 1.00 0.00 ? 22   LEU B HD12 3  
ATOM   6519  H HD13 . LEU B 2 9   ? -24.718 -13.568 -13.209 1.00 0.00 ? 22   LEU B HD13 3  
ATOM   6520  H HD21 . LEU B 2 9   ? -28.101 -12.838 -10.745 1.00 0.00 ? 22   LEU B HD21 3  
ATOM   6521  H HD22 . LEU B 2 9   ? -27.931 -14.484 -11.406 1.00 0.00 ? 22   LEU B HD22 3  
ATOM   6522  H HD23 . LEU B 2 9   ? -26.686 -13.826 -10.334 1.00 0.00 ? 22   LEU B HD23 3  
ATOM   6523  N N    . ARG B 2 10  ? -26.872 -9.802  -9.645  1.00 0.00 ? 23   ARG B N    3  
ATOM   6524  C CA   . ARG B 2 10  ? -27.748 -9.550  -8.501  1.00 0.00 ? 23   ARG B CA   3  
ATOM   6525  C C    . ARG B 2 10  ? -28.951 -8.706  -8.938  1.00 0.00 ? 23   ARG B C    3  
ATOM   6526  O O    . ARG B 2 10  ? -29.371 -7.781  -8.240  1.00 0.00 ? 23   ARG B O    3  
ATOM   6527  C CB   . ARG B 2 10  ? -26.895 -8.948  -7.364  1.00 0.00 ? 23   ARG B CB   3  
ATOM   6528  C CG   . ARG B 2 10  ? -27.477 -9.289  -5.987  1.00 0.00 ? 23   ARG B CG   3  
ATOM   6529  C CD   . ARG B 2 10  ? -26.600 -8.679  -4.889  1.00 0.00 ? 23   ARG B CD   3  
ATOM   6530  N NE   . ARG B 2 10  ? -27.251 -8.754  -3.568  1.00 0.00 ? 23   ARG B NE   3  
ATOM   6531  C CZ   . ARG B 2 10  ? -27.047 -9.668  -2.610  1.00 0.00 ? 23   ARG B CZ   3  
ATOM   6532  N NH1  . ARG B 2 10  ? -26.189 -10.670 -2.787  1.00 0.00 ? 23   ARG B NH1  3  
ATOM   6533  N NH2  . ARG B 2 10  ? -27.710 -9.576  -1.459  1.00 0.00 ? 23   ARG B NH2  3  
ATOM   6534  H H    . ARG B 2 10  ? -26.727 -9.050  -10.313 1.00 0.00 ? 23   ARG B H    3  
ATOM   6535  H HA   . ARG B 2 10  ? -28.120 -10.520 -8.167  1.00 0.00 ? 23   ARG B HA   3  
ATOM   6536  H HB2  . ARG B 2 10  ? -25.894 -9.380  -7.402  1.00 0.00 ? 23   ARG B HB2  3  
ATOM   6537  H HB3  . ARG B 2 10  ? -26.805 -7.867  -7.488  1.00 0.00 ? 23   ARG B HB3  3  
ATOM   6538  H HG2  . ARG B 2 10  ? -28.491 -8.897  -5.913  1.00 0.00 ? 23   ARG B HG2  3  
ATOM   6539  H HG3  . ARG B 2 10  ? -27.508 -10.375 -5.889  1.00 0.00 ? 23   ARG B HG3  3  
ATOM   6540  H HD2  . ARG B 2 10  ? -25.622 -9.165  -4.874  1.00 0.00 ? 23   ARG B HD2  3  
ATOM   6541  H HD3  . ARG B 2 10  ? -26.439 -7.626  -5.115  1.00 0.00 ? 23   ARG B HD3  3  
ATOM   6542  H HE   . ARG B 2 10  ? -27.927 -8.019  -3.387  1.00 0.00 ? 23   ARG B HE   3  
ATOM   6543  H HH11 . ARG B 2 10  ? -25.687 -10.778 -3.660  1.00 0.00 ? 23   ARG B HH11 3  
ATOM   6544  H HH12 . ARG B 2 10  ? -26.033 -11.374 -2.077  1.00 0.00 ? 23   ARG B HH12 3  
ATOM   6545  H HH21 . ARG B 2 10  ? -28.376 -8.827  -1.293  1.00 0.00 ? 23   ARG B HH21 3  
ATOM   6546  H HH22 . ARG B 2 10  ? -27.589 -10.244 -0.707  1.00 0.00 ? 23   ARG B HH22 3  
ATOM   6547  N N    . ASP B 2 11  ? -29.467 -8.997  -10.138 1.00 0.00 ? 24   ASP B N    3  
ATOM   6548  C CA   . ASP B 2 11  ? -30.515 -8.202  -10.799 1.00 0.00 ? 24   ASP B CA   3  
ATOM   6549  C C    . ASP B 2 11  ? -31.492 -9.066  -11.600 1.00 0.00 ? 24   ASP B C    3  
ATOM   6550  O O    . ASP B 2 11  ? -32.704 -8.898  -11.466 1.00 0.00 ? 24   ASP B O    3  
ATOM   6551  C CB   . ASP B 2 11  ? -29.848 -7.203  -11.743 1.00 0.00 ? 24   ASP B CB   3  
ATOM   6552  C CG   . ASP B 2 11  ? -30.899 -6.408  -12.536 1.00 0.00 ? 24   ASP B CG   3  
ATOM   6553  O OD1  . ASP B 2 11  ? -31.533 -5.496  -11.953 1.00 0.00 ? 24   ASP B OD1  3  
ATOM   6554  O OD2  . ASP B 2 11  ? -31.093 -6.689  -13.742 1.00 0.00 ? 24   ASP B OD2  3  
ATOM   6555  H H    . ASP B 2 11  ? -29.093 -9.790  -10.635 1.00 0.00 ? 24   ASP B H    3  
ATOM   6556  H HA   . ASP B 2 11  ? -31.083 -7.638  -10.059 1.00 0.00 ? 24   ASP B HA   3  
ATOM   6557  H HB2  . ASP B 2 11  ? -29.221 -6.521  -11.167 1.00 0.00 ? 24   ASP B HB2  3  
ATOM   6558  H HB3  . ASP B 2 11  ? -29.205 -7.764  -12.425 1.00 0.00 ? 24   ASP B HB3  3  
ATOM   6559  N N    . ASN B 2 12  ? -30.995 -10.057 -12.357 1.00 0.00 ? 25   ASN B N    3  
ATOM   6560  C CA   . ASN B 2 12  ? -31.834 -10.931 -13.199 1.00 0.00 ? 25   ASN B CA   3  
ATOM   6561  C C    . ASN B 2 12  ? -32.410 -12.109 -12.427 1.00 0.00 ? 25   ASN B C    3  
ATOM   6562  O O    . ASN B 2 12  ? -32.593 -13.207 -12.962 1.00 0.00 ? 25   ASN B O    3  
ATOM   6563  C CB   . ASN B 2 12  ? -31.008 -11.458 -14.383 1.00 0.00 ? 25   ASN B CB   3  
ATOM   6564  C CG   . ASN B 2 12  ? -31.887 -11.938 -15.544 1.00 0.00 ? 25   ASN B CG   3  
ATOM   6565  O OD1  . ASN B 2 12  ? -33.004 -11.464 -15.737 1.00 0.00 ? 25   ASN B OD1  3  
ATOM   6566  N ND2  . ASN B 2 12  ? -31.419 -12.879 -16.348 1.00 0.00 ? 25   ASN B ND2  3  
ATOM   6567  H H    . ASN B 2 12  ? -29.994 -10.139 -12.456 1.00 0.00 ? 25   ASN B H    3  
ATOM   6568  H HA   . ASN B 2 12  ? -32.686 -10.346 -13.538 1.00 0.00 ? 25   ASN B HA   3  
ATOM   6569  H HB2  . ASN B 2 12  ? -30.362 -10.664 -14.711 1.00 0.00 ? 25   ASN B HB2  3  
ATOM   6570  H HB3  . ASN B 2 12  ? -30.363 -12.275 -14.047 1.00 0.00 ? 25   ASN B HB3  3  
ATOM   6571  H HD21 . ASN B 2 12  ? -30.481 -13.265 -16.234 1.00 0.00 ? 25   ASN B HD21 3  
ATOM   6572  H HD22 . ASN B 2 12  ? -31.992 -13.229 -17.100 1.00 0.00 ? 25   ASN B HD22 3  
ATOM   6573  N N    . ILE B 2 13  ? -32.638 -11.895 -11.138 1.00 0.00 ? 26   ILE B N    3  
ATOM   6574  C CA   . ILE B 2 13  ? -32.950 -12.963 -10.208 1.00 0.00 ? 26   ILE B CA   3  
ATOM   6575  C C    . ILE B 2 13  ? -34.459 -13.122 -9.990  1.00 0.00 ? 26   ILE B C    3  
ATOM   6576  O O    . ILE B 2 13  ? -34.896 -13.844 -9.089  1.00 0.00 ? 26   ILE B O    3  
ATOM   6577  C CB   . ILE B 2 13  ? -32.123 -12.776 -8.914  1.00 0.00 ? 26   ILE B CB   3  
ATOM   6578  C CG1  . ILE B 2 13  ? -32.673 -11.692 -7.966  1.00 0.00 ? 26   ILE B CG1  3  
ATOM   6579  C CG2  . ILE B 2 13  ? -30.652 -12.526 -9.291  1.00 0.00 ? 26   ILE B CG2  3  
ATOM   6580  C CD1  . ILE B 2 13  ? -32.117 -10.269 -8.079  1.00 0.00 ? 26   ILE B CD1  3  
ATOM   6581  H H    . ILE B 2 13  ? -32.566 -10.953 -10.780 1.00 0.00 ? 26   ILE B H    3  
ATOM   6582  H HA   . ILE B 2 13  ? -32.592 -13.862 -10.686 1.00 0.00 ? 26   ILE B HA   3  
ATOM   6583  H HB   . ILE B 2 13  ? -32.169 -13.725 -8.377  1.00 0.00 ? 26   ILE B HB   3  
ATOM   6584  H HG12 . ILE B 2 13  ? -33.738 -11.629 -8.143  1.00 0.00 ? 26   ILE B HG12 3  
ATOM   6585  H HG13 . ILE B 2 13  ? -32.520 -12.024 -6.938  1.00 0.00 ? 26   ILE B HG13 3  
ATOM   6586  H HG21 . ILE B 2 13  ? -30.326 -13.329 -9.952  1.00 0.00 ? 26   ILE B HG21 3  
ATOM   6587  H HG22 . ILE B 2 13  ? -30.543 -11.576 -9.819  1.00 0.00 ? 26   ILE B HG22 3  
ATOM   6588  H HG23 . ILE B 2 13  ? -30.042 -12.517 -8.393  1.00 0.00 ? 26   ILE B HG23 3  
ATOM   6589  H HD11 . ILE B 2 13  ? -32.242 -9.905  -9.093  1.00 0.00 ? 26   ILE B HD11 3  
ATOM   6590  H HD12 . ILE B 2 13  ? -32.661 -9.612  -7.400  1.00 0.00 ? 26   ILE B HD12 3  
ATOM   6591  H HD13 . ILE B 2 13  ? -31.066 -10.255 -7.801  1.00 0.00 ? 26   ILE B HD13 3  
ATOM   6592  N N    . GLN B 2 14  ? -35.246 -12.405 -10.795 1.00 0.00 ? 27   GLN B N    3  
ATOM   6593  C CA   . GLN B 2 14  ? -36.671 -12.225 -10.628 1.00 0.00 ? 27   GLN B CA   3  
ATOM   6594  C C    . GLN B 2 14  ? -37.365 -12.612 -11.932 1.00 0.00 ? 27   GLN B C    3  
ATOM   6595  O O    . GLN B 2 14  ? -36.907 -12.167 -13.010 1.00 0.00 ? 27   GLN B O    3  
ATOM   6596  C CB   . GLN B 2 14  ? -36.948 -10.753 -10.267 1.00 0.00 ? 27   GLN B CB   3  
ATOM   6597  C CG   . GLN B 2 14  ? -36.405 -10.337 -8.889  1.00 0.00 ? 27   GLN B CG   3  
ATOM   6598  C CD   . GLN B 2 14  ? -36.871 -8.933  -8.469  1.00 0.00 ? 27   GLN B CD   3  
ATOM   6599  O OE1  . GLN B 2 14  ? -36.894 -7.988  -9.261  1.00 0.00 ? 27   GLN B OE1  3  
ATOM   6600  N NE2  . GLN B 2 14  ? -37.258 -8.753  -7.213  1.00 0.00 ? 27   GLN B NE2  3  
ATOM   6601  O OXT  . GLN B 2 14  ? -38.363 -13.368 -11.876 1.00 0.00 ? 27   GLN B OXT  3  
ATOM   6602  H H    . GLN B 2 14  ? -34.834 -11.924 -11.578 1.00 0.00 ? 27   GLN B H    3  
ATOM   6603  H HA   . GLN B 2 14  ? -37.005 -12.869 -9.819  1.00 0.00 ? 27   GLN B HA   3  
ATOM   6604  H HB2  . GLN B 2 14  ? -36.464 -10.122 -11.016 1.00 0.00 ? 27   GLN B HB2  3  
ATOM   6605  H HB3  . GLN B 2 14  ? -38.025 -10.587 -10.293 1.00 0.00 ? 27   GLN B HB3  3  
ATOM   6606  H HG2  . GLN B 2 14  ? -36.736 -11.069 -8.151  1.00 0.00 ? 27   GLN B HG2  3  
ATOM   6607  H HG3  . GLN B 2 14  ? -35.312 -10.343 -8.919  1.00 0.00 ? 27   GLN B HG3  3  
ATOM   6608  H HE21 . GLN B 2 14  ? -37.252 -9.526  -6.560  1.00 0.00 ? 27   GLN B HE21 3  
ATOM   6609  H HE22 . GLN B 2 14  ? -37.577 -7.844  -6.902  1.00 0.00 ? 27   GLN B HE22 3  
ATOM   6610  N N    . GLY A 1 1   ? 0.658   10.852  -2.983  1.00 0.00 ? -3   GLY A N    4  
ATOM   6611  C CA   . GLY A 1 1   ? 0.642   9.658   -2.105  1.00 0.00 ? -3   GLY A CA   4  
ATOM   6612  C C    . GLY A 1 1   ? 0.941   8.374   -2.884  1.00 0.00 ? -3   GLY A C    4  
ATOM   6613  O O    . GLY A 1 1   ? 1.696   8.385   -3.859  1.00 0.00 ? -3   GLY A O    4  
ATOM   6614  H H1   . GLY A 1 1   ? -0.040  10.760  -3.706  1.00 0.00 ? -3   GLY A H1   4  
ATOM   6615  H H2   . GLY A 1 1   ? 0.464   11.681  -2.445  1.00 0.00 ? -3   GLY A H2   4  
ATOM   6616  H H3   . GLY A 1 1   ? 1.562   10.938  -3.422  1.00 0.00 ? -3   GLY A H3   4  
ATOM   6617  H HA2  . GLY A 1 1   ? 1.398   9.777   -1.326  1.00 0.00 ? -3   GLY A HA2  4  
ATOM   6618  H HA3  . GLY A 1 1   ? -0.340  9.571   -1.633  1.00 0.00 ? -3   GLY A HA3  4  
ATOM   6619  N N    . HIS A 1 2   ? 0.368   7.248   -2.446  1.00 0.00 ? -2   HIS A N    4  
ATOM   6620  C CA   . HIS A 1 2   ? 0.508   5.932   -3.081  1.00 0.00 ? -2   HIS A CA   4  
ATOM   6621  C C    . HIS A 1 2   ? -0.779  5.128   -2.840  1.00 0.00 ? -2   HIS A C    4  
ATOM   6622  O O    . HIS A 1 2   ? -1.738  5.654   -2.264  1.00 0.00 ? -2   HIS A O    4  
ATOM   6623  C CB   . HIS A 1 2   ? 1.757   5.225   -2.534  1.00 0.00 ? -2   HIS A CB   4  
ATOM   6624  C CG   . HIS A 1 2   ? 2.269   4.153   -3.466  1.00 0.00 ? -2   HIS A CG   4  
ATOM   6625  N ND1  . HIS A 1 2   ? 1.991   2.784   -3.375  1.00 0.00 ? -2   HIS A ND1  4  
ATOM   6626  C CD2  . HIS A 1 2   ? 3.045   4.377   -4.568  1.00 0.00 ? -2   HIS A CD2  4  
ATOM   6627  C CE1  . HIS A 1 2   ? 2.627   2.216   -4.417  1.00 0.00 ? -2   HIS A CE1  4  
ATOM   6628  N NE2  . HIS A 1 2   ? 3.263   3.148   -5.147  1.00 0.00 ? -2   HIS A NE2  4  
ATOM   6629  H H    . HIS A 1 2   ? -0.278  7.287   -1.666  1.00 0.00 ? -2   HIS A H    4  
ATOM   6630  H HA   . HIS A 1 2   ? 0.626   6.065   -4.160  1.00 0.00 ? -2   HIS A HA   4  
ATOM   6631  H HB2  . HIS A 1 2   ? 2.557   5.956   -2.405  1.00 0.00 ? -2   HIS A HB2  4  
ATOM   6632  H HB3  . HIS A 1 2   ? 1.540   4.794   -1.555  1.00 0.00 ? -2   HIS A HB3  4  
ATOM   6633  H HD2  . HIS A 1 2   ? 3.412   5.339   -4.914  1.00 0.00 ? -2   HIS A HD2  4  
ATOM   6634  H HE1  . HIS A 1 2   ? 2.627   1.154   -4.642  1.00 0.00 ? -2   HIS A HE1  4  
ATOM   6635  H HE2  . HIS A 1 2   ? 3.811   2.967   -5.984  1.00 0.00 ? -2   HIS A HE2  4  
ATOM   6636  N N    . MET A 1 3   ? -0.830  3.873   -3.295  1.00 0.00 ? -1   MET A N    4  
ATOM   6637  C CA   . MET A 1 3   ? -1.978  2.988   -3.110  1.00 0.00 ? -1   MET A CA   4  
ATOM   6638  C C    . MET A 1 3   ? -2.235  2.783   -1.613  1.00 0.00 ? -1   MET A C    4  
ATOM   6639  O O    . MET A 1 3   ? -1.293  2.607   -0.829  1.00 0.00 ? -1   MET A O    4  
ATOM   6640  C CB   . MET A 1 3   ? -1.714  1.630   -3.785  1.00 0.00 ? -1   MET A CB   4  
ATOM   6641  C CG   . MET A 1 3   ? -1.568  1.721   -5.312  1.00 0.00 ? -1   MET A CG   4  
ATOM   6642  S SD   . MET A 1 3   ? -2.998  2.389   -6.220  1.00 0.00 ? -1   MET A SD   4  
ATOM   6643  C CE   . MET A 1 3   ? -4.224  1.078   -5.956  1.00 0.00 ? -1   MET A CE   4  
ATOM   6644  H H    . MET A 1 3   ? 0.022   3.458   -3.662  1.00 0.00 ? -1   MET A H    4  
ATOM   6645  H HA   . MET A 1 3   ? -2.851  3.457   -3.563  1.00 0.00 ? -1   MET A HA   4  
ATOM   6646  H HB2  . MET A 1 3   ? -0.801  1.193   -3.375  1.00 0.00 ? -1   MET A HB2  4  
ATOM   6647  H HB3  . MET A 1 3   ? -2.538  0.957   -3.549  1.00 0.00 ? -1   MET A HB3  4  
ATOM   6648  H HG2  . MET A 1 3   ? -0.701  2.340   -5.547  1.00 0.00 ? -1   MET A HG2  4  
ATOM   6649  H HG3  . MET A 1 3   ? -1.361  0.720   -5.695  1.00 0.00 ? -1   MET A HG3  4  
ATOM   6650  H HE1  . MET A 1 3   ? -3.825  0.122   -6.289  1.00 0.00 ? -1   MET A HE1  4  
ATOM   6651  H HE2  . MET A 1 3   ? -4.479  1.010   -4.899  1.00 0.00 ? -1   MET A HE2  4  
ATOM   6652  H HE3  . MET A 1 3   ? -5.127  1.301   -6.527  1.00 0.00 ? -1   MET A HE3  4  
ATOM   6653  N N    . ASN A 1 4   ? -3.509  2.782   -1.214  1.00 0.00 ? 1484 ASN A N    4  
ATOM   6654  C CA   . ASN A 1 4   ? -3.908  2.416   0.144   1.00 0.00 ? 1484 ASN A CA   4  
ATOM   6655  C C    . ASN A 1 4   ? -3.673  0.923   0.376   1.00 0.00 ? 1484 ASN A C    4  
ATOM   6656  O O    . ASN A 1 4   ? -3.686  0.132   -0.568  1.00 0.00 ? 1484 ASN A O    4  
ATOM   6657  C CB   . ASN A 1 4   ? -5.389  2.767   0.369   1.00 0.00 ? 1484 ASN A CB   4  
ATOM   6658  C CG   . ASN A 1 4   ? -5.804  2.548   1.825   1.00 0.00 ? 1484 ASN A CG   4  
ATOM   6659  O OD1  . ASN A 1 4   ? -5.073  2.881   2.754   1.00 0.00 ? 1484 ASN A OD1  4  
ATOM   6660  N ND2  . ASN A 1 4   ? -6.978  1.986   2.063   1.00 0.00 ? 1484 ASN A ND2  4  
ATOM   6661  H H    . ASN A 1 4   ? -4.241  2.924   -1.895  1.00 0.00 ? 1484 ASN A H    4  
ATOM   6662  H HA   . ASN A 1 4   ? -3.297  2.966   0.859   1.00 0.00 ? 1484 ASN A HA   4  
ATOM   6663  H HB2  . ASN A 1 4   ? -5.561  3.813   0.121   1.00 0.00 ? 1484 ASN A HB2  4  
ATOM   6664  H HB3  . ASN A 1 4   ? -6.010  2.153   -0.290  1.00 0.00 ? 1484 ASN A HB3  4  
ATOM   6665  H HD21 . ASN A 1 4   ? -7.573  1.694   1.283   1.00 0.00 ? 1484 ASN A HD21 4  
ATOM   6666  H HD22 . ASN A 1 4   ? -7.285  1.843   3.014   1.00 0.00 ? 1484 ASN A HD22 4  
ATOM   6667  N N    . SER A 1 5   ? -3.495  0.519   1.629   1.00 0.00 ? 1485 SER A N    4  
ATOM   6668  C CA   . SER A 1 5   ? -3.410  -0.883  2.003   1.00 0.00 ? 1485 SER A CA   4  
ATOM   6669  C C    . SER A 1 5   ? -4.781  -1.535  1.823   1.00 0.00 ? 1485 SER A C    4  
ATOM   6670  O O    . SER A 1 5   ? -5.679  -1.297  2.631   1.00 0.00 ? 1485 SER A O    4  
ATOM   6671  C CB   . SER A 1 5   ? -2.938  -0.978  3.462   1.00 0.00 ? 1485 SER A CB   4  
ATOM   6672  O OG   . SER A 1 5   ? -1.719  -0.263  3.648   1.00 0.00 ? 1485 SER A OG   4  
ATOM   6673  H H    . SER A 1 5   ? -3.480  1.196   2.383   1.00 0.00 ? 1485 SER A H    4  
ATOM   6674  H HA   . SER A 1 5   ? -2.693  -1.386  1.348   1.00 0.00 ? 1485 SER A HA   4  
ATOM   6675  H HB2  . SER A 1 5   ? -3.708  -0.557  4.115   1.00 0.00 ? 1485 SER A HB2  4  
ATOM   6676  H HB3  . SER A 1 5   ? -2.805  -2.030  3.725   1.00 0.00 ? 1485 SER A HB3  4  
ATOM   6677  H HG   . SER A 1 5   ? -1.429  -0.364  4.578   1.00 0.00 ? 1485 SER A HG   4  
ATOM   6678  N N    . PHE A 1 6   ? -4.922  -2.377  0.790   1.00 0.00 ? 1486 PHE A N    4  
ATOM   6679  C CA   . PHE A 1 6   ? -6.055  -3.273  0.527   1.00 0.00 ? 1486 PHE A CA   4  
ATOM   6680  C C    . PHE A 1 6   ? -7.354  -2.546  0.213   1.00 0.00 ? 1486 PHE A C    4  
ATOM   6681  O O    . PHE A 1 6   ? -7.850  -2.627  -0.905  1.00 0.00 ? 1486 PHE A O    4  
ATOM   6682  C CB   . PHE A 1 6   ? -6.195  -4.284  1.682   1.00 0.00 ? 1486 PHE A CB   4  
ATOM   6683  C CG   . PHE A 1 6   ? -4.919  -5.066  1.892   1.00 0.00 ? 1486 PHE A CG   4  
ATOM   6684  C CD1  . PHE A 1 6   ? -4.578  -6.075  0.978   1.00 0.00 ? 1486 PHE A CD1  4  
ATOM   6685  C CD2  . PHE A 1 6   ? -4.076  -4.785  2.982   1.00 0.00 ? 1486 PHE A CD2  4  
ATOM   6686  C CE1  . PHE A 1 6   ? -3.400  -6.815  1.165   1.00 0.00 ? 1486 PHE A CE1  4  
ATOM   6687  C CE2  . PHE A 1 6   ? -2.900  -5.529  3.168   1.00 0.00 ? 1486 PHE A CE2  4  
ATOM   6688  C CZ   . PHE A 1 6   ? -2.559  -6.549  2.258   1.00 0.00 ? 1486 PHE A CZ   4  
ATOM   6689  H H    . PHE A 1 6   ? -4.150  -2.442  0.139   1.00 0.00 ? 1486 PHE A H    4  
ATOM   6690  H HA   . PHE A 1 6   ? -5.833  -3.860  -0.361  1.00 0.00 ? 1486 PHE A HA   4  
ATOM   6691  H HB2  . PHE A 1 6   ? -6.471  -3.783  2.610   1.00 0.00 ? 1486 PHE A HB2  4  
ATOM   6692  H HB3  . PHE A 1 6   ? -6.998  -4.981  1.456   1.00 0.00 ? 1486 PHE A HB3  4  
ATOM   6693  H HD1  . PHE A 1 6   ? -5.222  -6.283  0.134   1.00 0.00 ? 1486 PHE A HD1  4  
ATOM   6694  H HD2  . PHE A 1 6   ? -4.326  -3.990  3.677   1.00 0.00 ? 1486 PHE A HD2  4  
ATOM   6695  H HE1  . PHE A 1 6   ? -3.153  -7.588  0.454   1.00 0.00 ? 1486 PHE A HE1  4  
ATOM   6696  H HE2  . PHE A 1 6   ? -2.251  -5.320  4.008   1.00 0.00 ? 1486 PHE A HE2  4  
ATOM   6697  H HZ   . PHE A 1 6   ? -1.656  -7.125  2.399   1.00 0.00 ? 1486 PHE A HZ   4  
ATOM   6698  N N    . VAL A 1 7   ? -7.925  -1.862  1.192   1.00 0.00 ? 1487 VAL A N    4  
ATOM   6699  C CA   . VAL A 1 7   ? -9.249  -1.280  1.143   1.00 0.00 ? 1487 VAL A CA   4  
ATOM   6700  C C    . VAL A 1 7   ? -9.297  -0.253  0.004   1.00 0.00 ? 1487 VAL A C    4  
ATOM   6701  O O    . VAL A 1 7   ? -8.594  0.757   0.047   1.00 0.00 ? 1487 VAL A O    4  
ATOM   6702  C CB   . VAL A 1 7   ? -9.607  -0.732  2.544   1.00 0.00 ? 1487 VAL A CB   4  
ATOM   6703  C CG1  . VAL A 1 7   ? -11.107 -0.450  2.587   1.00 0.00 ? 1487 VAL A CG1  4  
ATOM   6704  C CG2  . VAL A 1 7   ? -9.311  -1.751  3.667   1.00 0.00 ? 1487 VAL A CG2  4  
ATOM   6705  H H    . VAL A 1 7   ? -7.388  -1.744  2.041   1.00 0.00 ? 1487 VAL A H    4  
ATOM   6706  H HA   . VAL A 1 7   ? -9.943  -2.085  0.906   1.00 0.00 ? 1487 VAL A HA   4  
ATOM   6707  H HB   . VAL A 1 7   ? -9.047  0.179   2.749   1.00 0.00 ? 1487 VAL A HB   4  
ATOM   6708  H HG11 . VAL A 1 7   ? -11.375 0.325   1.863   1.00 0.00 ? 1487 VAL A HG11 4  
ATOM   6709  H HG12 . VAL A 1 7   ? -11.634 -1.368  2.331   1.00 0.00 ? 1487 VAL A HG12 4  
ATOM   6710  H HG13 . VAL A 1 7   ? -11.412 -0.128  3.589   1.00 0.00 ? 1487 VAL A HG13 4  
ATOM   6711  H HG21 . VAL A 1 7   ? -8.236  -1.875  3.796   1.00 0.00 ? 1487 VAL A HG21 4  
ATOM   6712  H HG22 . VAL A 1 7   ? -9.706  -1.382  4.616   1.00 0.00 ? 1487 VAL A HG22 4  
ATOM   6713  H HG23 . VAL A 1 7   ? -9.760  -2.719  3.434   1.00 0.00 ? 1487 VAL A HG23 4  
ATOM   6714  N N    . GLY A 1 8   ? -10.083 -0.558  -1.035  1.00 0.00 ? 1488 GLY A N    4  
ATOM   6715  C CA   . GLY A 1 8   ? -10.292 0.268   -2.216  1.00 0.00 ? 1488 GLY A CA   4  
ATOM   6716  C C    . GLY A 1 8   ? -9.731  -0.368  -3.492  1.00 0.00 ? 1488 GLY A C    4  
ATOM   6717  O O    . GLY A 1 8   ? -10.126 0.026   -4.589  1.00 0.00 ? 1488 GLY A O    4  
ATOM   6718  H H    . GLY A 1 8   ? -10.644 -1.406  -0.983  1.00 0.00 ? 1488 GLY A H    4  
ATOM   6719  H HA2  . GLY A 1 8   ? -11.363 0.427   -2.332  1.00 0.00 ? 1488 GLY A HA2  4  
ATOM   6720  H HA3  . GLY A 1 8   ? -9.813  1.238   -2.068  1.00 0.00 ? 1488 GLY A HA3  4  
ATOM   6721  N N    . LEU A 1 9   ? -8.808  -1.337  -3.379  1.00 0.00 ? 1489 LEU A N    4  
ATOM   6722  C CA   . LEU A 1 9   ? -8.114  -1.921  -4.531  1.00 0.00 ? 1489 LEU A CA   4  
ATOM   6723  C C    . LEU A 1 9   ? -9.045  -2.864  -5.278  1.00 0.00 ? 1489 LEU A C    4  
ATOM   6724  O O    . LEU A 1 9   ? -9.738  -3.675  -4.664  1.00 0.00 ? 1489 LEU A O    4  
ATOM   6725  C CB   . LEU A 1 9   ? -6.834  -2.665  -4.087  1.00 0.00 ? 1489 LEU A CB   4  
ATOM   6726  C CG   . LEU A 1 9   ? -5.591  -1.806  -3.788  1.00 0.00 ? 1489 LEU A CG   4  
ATOM   6727  C CD1  . LEU A 1 9   ? -5.840  -0.599  -2.878  1.00 0.00 ? 1489 LEU A CD1  4  
ATOM   6728  C CD2  . LEU A 1 9   ? -4.501  -2.685  -3.152  1.00 0.00 ? 1489 LEU A CD2  4  
ATOM   6729  H H    . LEU A 1 9   ? -8.543  -1.666  -2.453  1.00 0.00 ? 1489 LEU A H    4  
ATOM   6730  H HA   . LEU A 1 9   ? -7.838  -1.146  -5.238  1.00 0.00 ? 1489 LEU A HA   4  
ATOM   6731  H HB2  . LEU A 1 9   ? -7.066  -3.280  -3.223  1.00 0.00 ? 1489 LEU A HB2  4  
ATOM   6732  H HB3  . LEU A 1 9   ? -6.546  -3.338  -4.897  1.00 0.00 ? 1489 LEU A HB3  4  
ATOM   6733  H HG   . LEU A 1 9   ? -5.211  -1.422  -4.733  1.00 0.00 ? 1489 LEU A HG   4  
ATOM   6734  H HD11 . LEU A 1 9   ? -4.909  -0.052  -2.749  1.00 0.00 ? 1489 LEU A HD11 4  
ATOM   6735  H HD12 . LEU A 1 9   ? -6.561  0.082   -3.330  1.00 0.00 ? 1489 LEU A HD12 4  
ATOM   6736  H HD13 . LEU A 1 9   ? -6.194  -0.920  -1.899  1.00 0.00 ? 1489 LEU A HD13 4  
ATOM   6737  H HD21 . LEU A 1 9   ? -3.622  -2.083  -2.905  1.00 0.00 ? 1489 LEU A HD21 4  
ATOM   6738  H HD22 . LEU A 1 9   ? -4.873  -3.149  -2.237  1.00 0.00 ? 1489 LEU A HD22 4  
ATOM   6739  H HD23 . LEU A 1 9   ? -4.213  -3.475  -3.844  1.00 0.00 ? 1489 LEU A HD23 4  
ATOM   6740  N N    . ARG A 1 10  ? -9.031  -2.766  -6.615  1.00 0.00 ? 1490 ARG A N    4  
ATOM   6741  C CA   . ARG A 1 10  ? -9.679  -3.733  -7.498  1.00 0.00 ? 1490 ARG A CA   4  
ATOM   6742  C C    . ARG A 1 10  ? -8.770  -4.956  -7.522  1.00 0.00 ? 1490 ARG A C    4  
ATOM   6743  O O    . ARG A 1 10  ? -7.566  -4.826  -7.752  1.00 0.00 ? 1490 ARG A O    4  
ATOM   6744  C CB   . ARG A 1 10  ? -9.833  -3.176  -8.925  1.00 0.00 ? 1490 ARG A CB   4  
ATOM   6745  C CG   . ARG A 1 10  ? -10.858 -2.035  -8.996  1.00 0.00 ? 1490 ARG A CG   4  
ATOM   6746  C CD   . ARG A 1 10  ? -11.022 -1.534  -10.440 1.00 0.00 ? 1490 ARG A CD   4  
ATOM   6747  N NE   . ARG A 1 10  ? -11.880 -0.332  -10.509 1.00 0.00 ? 1490 ARG A NE   4  
ATOM   6748  C CZ   . ARG A 1 10  ? -11.489 0.946   -10.372 1.00 0.00 ? 1490 ARG A CZ   4  
ATOM   6749  N NH1  . ARG A 1 10  ? -10.211 1.258   -10.160 1.00 0.00 ? 1490 ARG A NH1  4  
ATOM   6750  N NH2  . ARG A 1 10  ? -12.392 1.919   -10.446 1.00 0.00 ? 1490 ARG A NH2  4  
ATOM   6751  H H    . ARG A 1 10  ? -8.405  -2.091  -7.043  1.00 0.00 ? 1490 ARG A H    4  
ATOM   6752  H HA   . ARG A 1 10  ? -10.658 -3.999  -7.094  1.00 0.00 ? 1490 ARG A HA   4  
ATOM   6753  H HB2  . ARG A 1 10  ? -8.863  -2.814  -9.276  1.00 0.00 ? 1490 ARG A HB2  4  
ATOM   6754  H HB3  . ARG A 1 10  ? -10.139 -3.992  -9.589  1.00 0.00 ? 1490 ARG A HB3  4  
ATOM   6755  H HG2  . ARG A 1 10  ? -11.822 -2.389  -8.630  1.00 0.00 ? 1490 ARG A HG2  4  
ATOM   6756  H HG3  . ARG A 1 10  ? -10.529 -1.212  -8.360  1.00 0.00 ? 1490 ARG A HG3  4  
ATOM   6757  H HD2  . ARG A 1 10  ? -10.045 -1.322  -10.871 1.00 0.00 ? 1490 ARG A HD2  4  
ATOM   6758  H HD3  . ARG A 1 10  ? -11.481 -2.329  -11.032 1.00 0.00 ? 1490 ARG A HD3  4  
ATOM   6759  H HE   . ARG A 1 10  ? -12.864 -0.519  -10.680 1.00 0.00 ? 1490 ARG A HE   4  
ATOM   6760  H HH11 . ARG A 1 10  ? -9.501  0.542   -10.115 1.00 0.00 ? 1490 ARG A HH11 4  
ATOM   6761  H HH12 . ARG A 1 10  ? -9.900  2.219   -10.055 1.00 0.00 ? 1490 ARG A HH12 4  
ATOM   6762  H HH21 . ARG A 1 10  ? -13.373 1.721   -10.622 1.00 0.00 ? 1490 ARG A HH21 4  
ATOM   6763  H HH22 . ARG A 1 10  ? -12.141 2.896   -10.349 1.00 0.00 ? 1490 ARG A HH22 4  
ATOM   6764  N N    . VAL A 1 11  ? -9.338  -6.126  -7.272  1.00 0.00 ? 1491 VAL A N    4  
ATOM   6765  C CA   . VAL A 1 11  ? -8.629  -7.385  -7.104  1.00 0.00 ? 1491 VAL A CA   4  
ATOM   6766  C C    . VAL A 1 11  ? -9.568  -8.477  -7.629  1.00 0.00 ? 1491 VAL A C    4  
ATOM   6767  O O    . VAL A 1 11  ? -10.721 -8.201  -7.965  1.00 0.00 ? 1491 VAL A O    4  
ATOM   6768  C CB   . VAL A 1 11  ? -8.234  -7.564  -5.616  1.00 0.00 ? 1491 VAL A CB   4  
ATOM   6769  C CG1  . VAL A 1 11  ? -7.342  -6.433  -5.081  1.00 0.00 ? 1491 VAL A CG1  4  
ATOM   6770  C CG2  . VAL A 1 11  ? -9.443  -7.655  -4.681  1.00 0.00 ? 1491 VAL A CG2  4  
ATOM   6771  H H    . VAL A 1 11  ? -10.349 -6.177  -7.174  1.00 0.00 ? 1491 VAL A H    4  
ATOM   6772  H HA   . VAL A 1 11  ? -7.711  -7.396  -7.690  1.00 0.00 ? 1491 VAL A HA   4  
ATOM   6773  H HB   . VAL A 1 11  ? -7.664  -8.485  -5.514  1.00 0.00 ? 1491 VAL A HB   4  
ATOM   6774  H HG11 . VAL A 1 11  ? -6.515  -6.248  -5.767  1.00 0.00 ? 1491 VAL A HG11 4  
ATOM   6775  H HG12 . VAL A 1 11  ? -7.912  -5.516  -4.959  1.00 0.00 ? 1491 VAL A HG12 4  
ATOM   6776  H HG13 . VAL A 1 11  ? -6.936  -6.711  -4.107  1.00 0.00 ? 1491 VAL A HG13 4  
ATOM   6777  H HG21 . VAL A 1 11  ? -9.090  -7.805  -3.662  1.00 0.00 ? 1491 VAL A HG21 4  
ATOM   6778  H HG22 . VAL A 1 11  ? -10.038 -6.738  -4.727  1.00 0.00 ? 1491 VAL A HG22 4  
ATOM   6779  H HG23 . VAL A 1 11  ? -10.065 -8.504  -4.966  1.00 0.00 ? 1491 VAL A HG23 4  
ATOM   6780  N N    . VAL A 1 12  ? -9.116  -9.722  -7.687  1.00 0.00 ? 1492 VAL A N    4  
ATOM   6781  C CA   . VAL A 1 12  ? -9.972  -10.874 -7.946  1.00 0.00 ? 1492 VAL A CA   4  
ATOM   6782  C C    . VAL A 1 12  ? -10.007 -11.631 -6.619  1.00 0.00 ? 1492 VAL A C    4  
ATOM   6783  O O    . VAL A 1 12  ? -9.076  -11.517 -5.827  1.00 0.00 ? 1492 VAL A O    4  
ATOM   6784  C CB   . VAL A 1 12  ? -9.426  -11.705 -9.126  1.00 0.00 ? 1492 VAL A CB   4  
ATOM   6785  C CG1  . VAL A 1 12  ? -10.485 -12.682 -9.654  1.00 0.00 ? 1492 VAL A CG1  4  
ATOM   6786  C CG2  . VAL A 1 12  ? -8.994  -10.836 -10.322 1.00 0.00 ? 1492 VAL A CG2  4  
ATOM   6787  H H    . VAL A 1 12  ? -8.165  -9.924  -7.379  1.00 0.00 ? 1492 VAL A H    4  
ATOM   6788  H HA   . VAL A 1 12  ? -10.987 -10.546 -8.182  1.00 0.00 ? 1492 VAL A HA   4  
ATOM   6789  H HB   . VAL A 1 12  ? -8.572  -12.285 -8.780  1.00 0.00 ? 1492 VAL A HB   4  
ATOM   6790  H HG11 . VAL A 1 12  ? -10.027 -13.367 -10.368 1.00 0.00 ? 1492 VAL A HG11 4  
ATOM   6791  H HG12 . VAL A 1 12  ? -10.902 -13.264 -8.835  1.00 0.00 ? 1492 VAL A HG12 4  
ATOM   6792  H HG13 . VAL A 1 12  ? -11.287 -12.138 -10.150 1.00 0.00 ? 1492 VAL A HG13 4  
ATOM   6793  H HG21 . VAL A 1 12  ? -8.713  -11.488 -11.153 1.00 0.00 ? 1492 VAL A HG21 4  
ATOM   6794  H HG22 . VAL A 1 12  ? -9.804  -10.168 -10.626 1.00 0.00 ? 1492 VAL A HG22 4  
ATOM   6795  H HG23 . VAL A 1 12  ? -8.124  -10.236 -10.056 1.00 0.00 ? 1492 VAL A HG23 4  
ATOM   6796  N N    . ALA A 1 13  ? -11.069 -12.359 -6.310  1.00 0.00 ? 1493 ALA A N    4  
ATOM   6797  C CA   . ALA A 1 13  ? -11.230 -13.008 -5.021  1.00 0.00 ? 1493 ALA A CA   4  
ATOM   6798  C C    . ALA A 1 13  ? -12.047 -14.272 -5.215  1.00 0.00 ? 1493 ALA A C    4  
ATOM   6799  O O    . ALA A 1 13  ? -12.894 -14.301 -6.109  1.00 0.00 ? 1493 ALA A O    4  
ATOM   6800  C CB   . ALA A 1 13  ? -11.939 -12.028 -4.081  1.00 0.00 ? 1493 ALA A CB   4  
ATOM   6801  H H    . ALA A 1 13  ? -11.865 -12.402 -6.937  1.00 0.00 ? 1493 ALA A H    4  
ATOM   6802  H HA   . ALA A 1 13  ? -10.256 -13.265 -4.616  1.00 0.00 ? 1493 ALA A HA   4  
ATOM   6803  H HB1  . ALA A 1 13  ? -12.969 -11.873 -4.392  1.00 0.00 ? 1493 ALA A HB1  4  
ATOM   6804  H HB2  . ALA A 1 13  ? -11.929 -12.409 -3.060  1.00 0.00 ? 1493 ALA A HB2  4  
ATOM   6805  H HB3  . ALA A 1 13  ? -11.433 -11.065 -4.113  1.00 0.00 ? 1493 ALA A HB3  4  
ATOM   6806  N N    . LYS A 1 14  ? -11.850 -15.293 -4.384  1.00 0.00 ? 1494 LYS A N    4  
ATOM   6807  C CA   . LYS A 1 14  ? -12.623 -16.530 -4.514  1.00 0.00 ? 1494 LYS A CA   4  
ATOM   6808  C C    . LYS A 1 14  ? -13.931 -16.311 -3.788  1.00 0.00 ? 1494 LYS A C    4  
ATOM   6809  O O    . LYS A 1 14  ? -13.951 -15.808 -2.667  1.00 0.00 ? 1494 LYS A O    4  
ATOM   6810  C CB   . LYS A 1 14  ? -11.899 -17.735 -3.893  1.00 0.00 ? 1494 LYS A CB   4  
ATOM   6811  C CG   . LYS A 1 14  ? -12.767 -19.008 -3.938  1.00 0.00 ? 1494 LYS A CG   4  
ATOM   6812  C CD   . LYS A 1 14  ? -11.923 -20.230 -3.532  1.00 0.00 ? 1494 LYS A CD   4  
ATOM   6813  C CE   . LYS A 1 14  ? -12.741 -21.521 -3.700  1.00 0.00 ? 1494 LYS A CE   4  
ATOM   6814  N NZ   . LYS A 1 14  ? -12.039 -22.719 -3.149  1.00 0.00 ? 1494 LYS A NZ   4  
ATOM   6815  H H    . LYS A 1 14  ? -11.211 -15.178 -3.601  1.00 0.00 ? 1494 LYS A H    4  
ATOM   6816  H HA   . LYS A 1 14  ? -12.813 -16.753 -5.564  1.00 0.00 ? 1494 LYS A HA   4  
ATOM   6817  H HB2  . LYS A 1 14  ? -10.963 -17.898 -4.426  1.00 0.00 ? 1494 LYS A HB2  4  
ATOM   6818  H HB3  . LYS A 1 14  ? -11.689 -17.526 -2.849  1.00 0.00 ? 1494 LYS A HB3  4  
ATOM   6819  H HG2  . LYS A 1 14  ? -13.601 -18.897 -3.234  1.00 0.00 ? 1494 LYS A HG2  4  
ATOM   6820  H HG3  . LYS A 1 14  ? -13.190 -19.146 -4.934  1.00 0.00 ? 1494 LYS A HG3  4  
ATOM   6821  H HD2  . LYS A 1 14  ? -11.029 -20.282 -4.159  1.00 0.00 ? 1494 LYS A HD2  4  
ATOM   6822  H HD3  . LYS A 1 14  ? -11.612 -20.109 -2.493  1.00 0.00 ? 1494 LYS A HD3  4  
ATOM   6823  H HE2  . LYS A 1 14  ? -13.700 -21.382 -3.199  1.00 0.00 ? 1494 LYS A HE2  4  
ATOM   6824  H HE3  . LYS A 1 14  ? -12.950 -21.670 -4.765  1.00 0.00 ? 1494 LYS A HE3  4  
ATOM   6825  H HZ1  . LYS A 1 14  ? -11.143 -22.877 -3.598  1.00 0.00 ? 1494 LYS A HZ1  4  
ATOM   6826  H HZ2  . LYS A 1 14  ? -11.871 -22.634 -2.149  1.00 0.00 ? 1494 LYS A HZ2  4  
ATOM   6827  H HZ3  . LYS A 1 14  ? -12.593 -23.568 -3.287  1.00 0.00 ? 1494 LYS A HZ3  4  
ATOM   6828  N N    . TRP A 1 15  ? -15.019 -16.730 -4.418  1.00 0.00 ? 1495 TRP A N    4  
ATOM   6829  C CA   . TRP A 1 15  ? -16.312 -16.801 -3.775  1.00 0.00 ? 1495 TRP A CA   4  
ATOM   6830  C C    . TRP A 1 15  ? -16.254 -17.982 -2.800  1.00 0.00 ? 1495 TRP A C    4  
ATOM   6831  O O    . TRP A 1 15  ? -16.119 -19.137 -3.215  1.00 0.00 ? 1495 TRP A O    4  
ATOM   6832  C CB   . TRP A 1 15  ? -17.331 -16.939 -4.888  1.00 0.00 ? 1495 TRP A CB   4  
ATOM   6833  C CG   . TRP A 1 15  ? -18.714 -17.308 -4.485  1.00 0.00 ? 1495 TRP A CG   4  
ATOM   6834  C CD1  . TRP A 1 15  ? -19.292 -18.479 -4.802  1.00 0.00 ? 1495 TRP A CD1  4  
ATOM   6835  C CD2  . TRP A 1 15  ? -19.702 -16.560 -3.722  1.00 0.00 ? 1495 TRP A CD2  4  
ATOM   6836  N NE1  . TRP A 1 15  ? -20.593 -18.497 -4.345  1.00 0.00 ? 1495 TRP A NE1  4  
ATOM   6837  C CE2  . TRP A 1 15  ? -20.877 -17.364 -3.600  1.00 0.00 ? 1495 TRP A CE2  4  
ATOM   6838  C CE3  . TRP A 1 15  ? -19.737 -15.269 -3.156  1.00 0.00 ? 1495 TRP A CE3  4  
ATOM   6839  C CZ2  . TRP A 1 15  ? -22.019 -16.910 -2.918  1.00 0.00 ? 1495 TRP A CZ2  4  
ATOM   6840  C CZ3  . TRP A 1 15  ? -20.882 -14.803 -2.482  1.00 0.00 ? 1495 TRP A CZ3  4  
ATOM   6841  C CH2  . TRP A 1 15  ? -22.007 -15.628 -2.339  1.00 0.00 ? 1495 TRP A CH2  4  
ATOM   6842  H H    . TRP A 1 15  ? -14.920 -17.164 -5.332  1.00 0.00 ? 1495 TRP A H    4  
ATOM   6843  H HA   . TRP A 1 15  ? -16.499 -15.871 -3.237  1.00 0.00 ? 1495 TRP A HA   4  
ATOM   6844  H HB2  . TRP A 1 15  ? -17.356 -15.984 -5.412  1.00 0.00 ? 1495 TRP A HB2  4  
ATOM   6845  H HB3  . TRP A 1 15  ? -16.972 -17.701 -5.576  1.00 0.00 ? 1495 TRP A HB3  4  
ATOM   6846  H HD1  . TRP A 1 15  ? -18.780 -19.265 -5.341  1.00 0.00 ? 1495 TRP A HD1  4  
ATOM   6847  H HE1  . TRP A 1 15  ? -21.233 -19.261 -4.553  1.00 0.00 ? 1495 TRP A HE1  4  
ATOM   6848  H HE3  . TRP A 1 15  ? -18.868 -14.629 -3.243  1.00 0.00 ? 1495 TRP A HE3  4  
ATOM   6849  H HZ2  . TRP A 1 15  ? -22.895 -17.539 -2.841  1.00 0.00 ? 1495 TRP A HZ2  4  
ATOM   6850  H HZ3  . TRP A 1 15  ? -20.901 -13.802 -2.070  1.00 0.00 ? 1495 TRP A HZ3  4  
ATOM   6851  H HH2  . TRP A 1 15  ? -22.860 -15.271 -1.782  1.00 0.00 ? 1495 TRP A HH2  4  
ATOM   6852  N N    . SER A 1 16  ? -16.303 -17.676 -1.505  1.00 0.00 ? 1496 SER A N    4  
ATOM   6853  C CA   . SER A 1 16  ? -16.047 -18.583 -0.391  1.00 0.00 ? 1496 SER A CA   4  
ATOM   6854  C C    . SER A 1 16  ? -16.913 -19.848 -0.335  1.00 0.00 ? 1496 SER A C    4  
ATOM   6855  O O    . SER A 1 16  ? -16.499 -20.812 0.311   1.00 0.00 ? 1496 SER A O    4  
ATOM   6856  C CB   . SER A 1 16  ? -16.203 -17.773 0.899   1.00 0.00 ? 1496 SER A CB   4  
ATOM   6857  O OG   . SER A 1 16  ? -15.441 -16.576 0.815   1.00 0.00 ? 1496 SER A OG   4  
ATOM   6858  H H    . SER A 1 16  ? -16.334 -16.698 -1.240  1.00 0.00 ? 1496 SER A H    4  
ATOM   6859  H HA   . SER A 1 16  ? -15.005 -18.900 -0.462  1.00 0.00 ? 1496 SER A HA   4  
ATOM   6860  H HB2  . SER A 1 16  ? -17.254 -17.523 1.012   1.00 0.00 ? 1496 SER A HB2  4  
ATOM   6861  H HB3  . SER A 1 16  ? -15.871 -18.364 1.753   1.00 0.00 ? 1496 SER A HB3  4  
ATOM   6862  H HG   . SER A 1 16  ? -15.708 -15.975 1.535   1.00 0.00 ? 1496 SER A HG   4  
ATOM   6863  N N    . SER A 1 17  ? -18.059 -19.903 -1.022  1.00 0.00 ? 1497 SER A N    4  
ATOM   6864  C CA   . SER A 1 17  ? -18.913 -21.091 -1.124  1.00 0.00 ? 1497 SER A CA   4  
ATOM   6865  C C    . SER A 1 17  ? -18.324 -22.115 -2.122  1.00 0.00 ? 1497 SER A C    4  
ATOM   6866  O O    . SER A 1 17  ? -19.009 -22.598 -3.026  1.00 0.00 ? 1497 SER A O    4  
ATOM   6867  C CB   . SER A 1 17  ? -20.350 -20.660 -1.463  1.00 0.00 ? 1497 SER A CB   4  
ATOM   6868  O OG   . SER A 1 17  ? -20.793 -19.646 -0.567  1.00 0.00 ? 1497 SER A OG   4  
ATOM   6869  H H    . SER A 1 17  ? -18.364 -19.083 -1.524  1.00 0.00 ? 1497 SER A H    4  
ATOM   6870  H HA   . SER A 1 17  ? -18.938 -21.573 -0.142  1.00 0.00 ? 1497 SER A HA   4  
ATOM   6871  H HB2  . SER A 1 17  ? -20.381 -20.281 -2.485  1.00 0.00 ? 1497 SER A HB2  4  
ATOM   6872  H HB3  . SER A 1 17  ? -21.014 -21.524 -1.388  1.00 0.00 ? 1497 SER A HB3  4  
ATOM   6873  H HG   . SER A 1 17  ? -21.722 -19.424 -0.783  1.00 0.00 ? 1497 SER A HG   4  
ATOM   6874  N N    . ASN A 1 18  ? -17.026 -22.411 -1.965  1.00 0.00 ? 1498 ASN A N    4  
ATOM   6875  C CA   . ASN A 1 18  ? -16.160 -23.198 -2.844  1.00 0.00 ? 1498 ASN A CA   4  
ATOM   6876  C C    . ASN A 1 18  ? -16.421 -22.967 -4.342  1.00 0.00 ? 1498 ASN A C    4  
ATOM   6877  O O    . ASN A 1 18  ? -16.627 -23.915 -5.107  1.00 0.00 ? 1498 ASN A O    4  
ATOM   6878  C CB   . ASN A 1 18  ? -16.146 -24.687 -2.444  1.00 0.00 ? 1498 ASN A CB   4  
ATOM   6879  C CG   . ASN A 1 18  ? -15.005 -25.432 -3.139  1.00 0.00 ? 1498 ASN A CG   4  
ATOM   6880  O OD1  . ASN A 1 18  ? -13.938 -24.865 -3.376  1.00 0.00 ? 1498 ASN A OD1  4  
ATOM   6881  N ND2  . ASN A 1 18  ? -15.192 -26.699 -3.478  1.00 0.00 ? 1498 ASN A ND2  4  
ATOM   6882  H H    . ASN A 1 18  ? -16.579 -22.003 -1.152  1.00 0.00 ? 1498 ASN A H    4  
ATOM   6883  H HA   . ASN A 1 18  ? -15.159 -22.819 -2.655  1.00 0.00 ? 1498 ASN A HA   4  
ATOM   6884  H HB2  . ASN A 1 18  ? -16.004 -24.784 -1.367  1.00 0.00 ? 1498 ASN A HB2  4  
ATOM   6885  H HB3  . ASN A 1 18  ? -17.103 -25.137 -2.710  1.00 0.00 ? 1498 ASN A HB3  4  
ATOM   6886  H HD21 . ASN A 1 18  ? -16.072 -27.160 -3.280  1.00 0.00 ? 1498 ASN A HD21 4  
ATOM   6887  H HD22 . ASN A 1 18  ? -14.449 -27.212 -3.936  1.00 0.00 ? 1498 ASN A HD22 4  
ATOM   6888  N N    . GLY A 1 19  ? -16.444 -21.696 -4.756  1.00 0.00 ? 1499 GLY A N    4  
ATOM   6889  C CA   . GLY A 1 19  ? -16.695 -21.303 -6.138  1.00 0.00 ? 1499 GLY A CA   4  
ATOM   6890  C C    . GLY A 1 19  ? -15.436 -20.797 -6.828  1.00 0.00 ? 1499 GLY A C    4  
ATOM   6891  O O    . GLY A 1 19  ? -14.314 -21.071 -6.402  1.00 0.00 ? 1499 GLY A O    4  
ATOM   6892  H H    . GLY A 1 19  ? -16.289 -20.944 -4.091  1.00 0.00 ? 1499 GLY A H    4  
ATOM   6893  H HA2  . GLY A 1 19  ? -17.101 -22.134 -6.715  1.00 0.00 ? 1499 GLY A HA2  4  
ATOM   6894  H HA3  . GLY A 1 19  ? -17.441 -20.520 -6.150  1.00 0.00 ? 1499 GLY A HA3  4  
ATOM   6895  N N    . TYR A 1 20  ? -15.642 -20.096 -7.941  1.00 0.00 ? 1500 TYR A N    4  
ATOM   6896  C CA   . TYR A 1 20  ? -14.585 -19.530 -8.766  1.00 0.00 ? 1500 TYR A CA   4  
ATOM   6897  C C    . TYR A 1 20  ? -14.112 -18.193 -8.198  1.00 0.00 ? 1500 TYR A C    4  
ATOM   6898  O O    . TYR A 1 20  ? -14.500 -17.789 -7.100  1.00 0.00 ? 1500 TYR A O    4  
ATOM   6899  C CB   . TYR A 1 20  ? -15.125 -19.399 -10.202 1.00 0.00 ? 1500 TYR A CB   4  
ATOM   6900  C CG   . TYR A 1 20  ? -15.293 -20.671 -11.007 1.00 0.00 ? 1500 TYR A CG   4  
ATOM   6901  C CD1  . TYR A 1 20  ? -14.893 -21.946 -10.549 1.00 0.00 ? 1500 TYR A CD1  4  
ATOM   6902  C CD2  . TYR A 1 20  ? -15.858 -20.542 -12.281 1.00 0.00 ? 1500 TYR A CD2  4  
ATOM   6903  C CE1  . TYR A 1 20  ? -14.994 -23.058 -11.415 1.00 0.00 ? 1500 TYR A CE1  4  
ATOM   6904  C CE2  . TYR A 1 20  ? -15.953 -21.636 -13.147 1.00 0.00 ? 1500 TYR A CE2  4  
ATOM   6905  C CZ   . TYR A 1 20  ? -15.509 -22.904 -12.725 1.00 0.00 ? 1500 TYR A CZ   4  
ATOM   6906  O OH   . TYR A 1 20  ? -15.583 -23.956 -13.587 1.00 0.00 ? 1500 TYR A OH   4  
ATOM   6907  H H    . TYR A 1 20  ? -16.593 -19.868 -8.204  1.00 0.00 ? 1500 TYR A H    4  
ATOM   6908  H HA   . TYR A 1 20  ? -13.721 -20.193 -8.769  1.00 0.00 ? 1500 TYR A HA   4  
ATOM   6909  H HB2  . TYR A 1 20  ? -16.082 -18.880 -10.185 1.00 0.00 ? 1500 TYR A HB2  4  
ATOM   6910  H HB3  . TYR A 1 20  ? -14.456 -18.773 -10.791 1.00 0.00 ? 1500 TYR A HB3  4  
ATOM   6911  H HD1  . TYR A 1 20  ? -14.505 -22.079 -9.542  1.00 0.00 ? 1500 TYR A HD1  4  
ATOM   6912  H HD2  . TYR A 1 20  ? -16.221 -19.584 -12.606 1.00 0.00 ? 1500 TYR A HD2  4  
ATOM   6913  H HE1  . TYR A 1 20  ? -14.677 -24.038 -11.084 1.00 0.00 ? 1500 TYR A HE1  4  
ATOM   6914  H HE2  . TYR A 1 20  ? -16.372 -21.486 -14.132 1.00 0.00 ? 1500 TYR A HE2  4  
ATOM   6915  H HH   . TYR A 1 20  ? -15.241 -24.794 -13.230 1.00 0.00 ? 1500 TYR A HH   4  
ATOM   6916  N N    . PHE A 1 21  ? -13.247 -17.522 -8.954  1.00 0.00 ? 1501 PHE A N    4  
ATOM   6917  C CA   . PHE A 1 21  ? -12.592 -16.297 -8.569  1.00 0.00 ? 1501 PHE A CA   4  
ATOM   6918  C C    . PHE A 1 21  ? -13.164 -15.187 -9.447  1.00 0.00 ? 1501 PHE A C    4  
ATOM   6919  O O    . PHE A 1 21  ? -13.128 -15.300 -10.675 1.00 0.00 ? 1501 PHE A O    4  
ATOM   6920  C CB   . PHE A 1 21  ? -11.081 -16.469 -8.770  1.00 0.00 ? 1501 PHE A CB   4  
ATOM   6921  C CG   . PHE A 1 21  ? -10.353 -17.407 -7.827  1.00 0.00 ? 1501 PHE A CG   4  
ATOM   6922  C CD1  . PHE A 1 21  ? -10.646 -18.787 -7.800  1.00 0.00 ? 1501 PHE A CD1  4  
ATOM   6923  C CD2  . PHE A 1 21  ? -9.362  -16.901 -6.966  1.00 0.00 ? 1501 PHE A CD2  4  
ATOM   6924  C CE1  . PHE A 1 21  ? -9.982  -19.636 -6.902  1.00 0.00 ? 1501 PHE A CE1  4  
ATOM   6925  C CE2  . PHE A 1 21  ? -8.660  -17.761 -6.105  1.00 0.00 ? 1501 PHE A CE2  4  
ATOM   6926  C CZ   . PHE A 1 21  ? -8.985  -19.128 -6.064  1.00 0.00 ? 1501 PHE A CZ   4  
ATOM   6927  H H    . PHE A 1 21  ? -12.972 -17.899 -9.856  1.00 0.00 ? 1501 PHE A H    4  
ATOM   6928  H HA   . PHE A 1 21  ? -12.799 -16.090 -7.529  1.00 0.00 ? 1501 PHE A HA   4  
ATOM   6929  H HB2  . PHE A 1 21  ? -10.920 -16.849 -9.769  1.00 0.00 ? 1501 PHE A HB2  4  
ATOM   6930  H HB3  . PHE A 1 21  ? -10.616 -15.489 -8.724  1.00 0.00 ? 1501 PHE A HB3  4  
ATOM   6931  H HD1  . PHE A 1 21  ? -11.379 -19.204 -8.472  1.00 0.00 ? 1501 PHE A HD1  4  
ATOM   6932  H HD2  . PHE A 1 21  ? -9.132  -15.844 -6.967  1.00 0.00 ? 1501 PHE A HD2  4  
ATOM   6933  H HE1  . PHE A 1 21  ? -10.227 -20.686 -6.846  1.00 0.00 ? 1501 PHE A HE1  4  
ATOM   6934  H HE2  . PHE A 1 21  ? -7.872  -17.363 -5.481  1.00 0.00 ? 1501 PHE A HE2  4  
ATOM   6935  H HZ   . PHE A 1 21  ? -8.486  -19.808 -5.395  1.00 0.00 ? 1501 PHE A HZ   4  
ATOM   6936  N N    . TYR A 1 22  ? -13.676 -14.125 -8.821  1.00 0.00 ? 1502 TYR A N    4  
ATOM   6937  C CA   . TYR A 1 22  ? -14.448 -13.065 -9.460  1.00 0.00 ? 1502 TYR A CA   4  
ATOM   6938  C C    . TYR A 1 22  ? -13.827 -11.724 -9.097  1.00 0.00 ? 1502 TYR A C    4  
ATOM   6939  O O    . TYR A 1 22  ? -13.222 -11.590 -8.034  1.00 0.00 ? 1502 TYR A O    4  
ATOM   6940  C CB   . TYR A 1 22  ? -15.903 -13.107 -8.956  1.00 0.00 ? 1502 TYR A CB   4  
ATOM   6941  C CG   . TYR A 1 22  ? -16.623 -14.413 -9.196  1.00 0.00 ? 1502 TYR A CG   4  
ATOM   6942  C CD1  . TYR A 1 22  ? -16.454 -15.469 -8.281  1.00 0.00 ? 1502 TYR A CD1  4  
ATOM   6943  C CD2  . TYR A 1 22  ? -17.453 -14.570 -10.319 1.00 0.00 ? 1502 TYR A CD2  4  
ATOM   6944  C CE1  . TYR A 1 22  ? -17.091 -16.697 -8.505  1.00 0.00 ? 1502 TYR A CE1  4  
ATOM   6945  C CE2  . TYR A 1 22  ? -18.093 -15.803 -10.546 1.00 0.00 ? 1502 TYR A CE2  4  
ATOM   6946  C CZ   . TYR A 1 22  ? -17.910 -16.868 -9.635  1.00 0.00 ? 1502 TYR A CZ   4  
ATOM   6947  O OH   . TYR A 1 22  ? -18.521 -18.065 -9.818  1.00 0.00 ? 1502 TYR A OH   4  
ATOM   6948  H H    . TYR A 1 22  ? -13.607 -14.071 -7.805  1.00 0.00 ? 1502 TYR A H    4  
ATOM   6949  H HA   . TYR A 1 22  ? -14.440 -13.198 -10.543 1.00 0.00 ? 1502 TYR A HA   4  
ATOM   6950  H HB2  . TYR A 1 22  ? -15.906 -12.942 -7.883  1.00 0.00 ? 1502 TYR A HB2  4  
ATOM   6951  H HB3  . TYR A 1 22  ? -16.467 -12.296 -9.417  1.00 0.00 ? 1502 TYR A HB3  4  
ATOM   6952  H HD1  . TYR A 1 22  ? -15.833 -15.335 -7.406  1.00 0.00 ? 1502 TYR A HD1  4  
ATOM   6953  H HD2  . TYR A 1 22  ? -17.601 -13.737 -11.007 1.00 0.00 ? 1502 TYR A HD2  4  
ATOM   6954  H HE1  . TYR A 1 22  ? -16.959 -17.516 -7.808  1.00 0.00 ? 1502 TYR A HE1  4  
ATOM   6955  H HE2  . TYR A 1 22  ? -18.728 -15.937 -11.412 1.00 0.00 ? 1502 TYR A HE2  4  
ATOM   6956  H HH   . TYR A 1 22  ? -19.285 -18.027 -10.420 1.00 0.00 ? 1502 TYR A HH   4  
ATOM   6957  N N    . SER A 1 23  ? -13.964 -10.731 -9.969  1.00 0.00 ? 1503 SER A N    4  
ATOM   6958  C CA   . SER A 1 23  ? -13.459 -9.388  -9.726  1.00 0.00 ? 1503 SER A CA   4  
ATOM   6959  C C    . SER A 1 23  ? -14.238 -8.708  -8.600  1.00 0.00 ? 1503 SER A C    4  
ATOM   6960  O O    . SER A 1 23  ? -15.457 -8.888  -8.500  1.00 0.00 ? 1503 SER A O    4  
ATOM   6961  C CB   . SER A 1 23  ? -13.610 -8.577  -11.013 1.00 0.00 ? 1503 SER A CB   4  
ATOM   6962  O OG   . SER A 1 23  ? -13.168 -9.328  -12.133 1.00 0.00 ? 1503 SER A OG   4  
ATOM   6963  H H    . SER A 1 23  ? -14.419 -10.888 -10.859 1.00 0.00 ? 1503 SER A H    4  
ATOM   6964  H HA   . SER A 1 23  ? -12.408 -9.443  -9.460  1.00 0.00 ? 1503 SER A HA   4  
ATOM   6965  H HB2  . SER A 1 23  ? -14.657 -8.324  -11.156 1.00 0.00 ? 1503 SER A HB2  4  
ATOM   6966  H HB3  . SER A 1 23  ? -13.039 -7.666  -10.929 1.00 0.00 ? 1503 SER A HB3  4  
ATOM   6967  H HG   . SER A 1 23  ? -12.194 -9.431  -12.117 1.00 0.00 ? 1503 SER A HG   4  
ATOM   6968  N N    . GLY A 1 24  ? -13.573 -7.879  -7.797  1.00 0.00 ? 1504 GLY A N    4  
ATOM   6969  C CA   . GLY A 1 24  ? -14.234 -7.046  -6.808  1.00 0.00 ? 1504 GLY A CA   4  
ATOM   6970  C C    . GLY A 1 24  ? -13.320 -5.955  -6.295  1.00 0.00 ? 1504 GLY A C    4  
ATOM   6971  O O    . GLY A 1 24  ? -12.152 -5.889  -6.672  1.00 0.00 ? 1504 GLY A O    4  
ATOM   6972  H H    . GLY A 1 24  ? -12.562 -7.775  -7.885  1.00 0.00 ? 1504 GLY A H    4  
ATOM   6973  H HA2  . GLY A 1 24  ? -15.104 -6.574  -7.260  1.00 0.00 ? 1504 GLY A HA2  4  
ATOM   6974  H HA3  . GLY A 1 24  ? -14.539 -7.667  -5.966  1.00 0.00 ? 1504 GLY A HA3  4  
ATOM   6975  N N    . LYS A 1 25  ? -13.849 -5.106  -5.414  1.00 0.00 ? 1505 LYS A N    4  
ATOM   6976  C CA   . LYS A 1 25  ? -13.064 -4.094  -4.701  1.00 0.00 ? 1505 LYS A CA   4  
ATOM   6977  C C    . LYS A 1 25  ? -13.093 -4.490  -3.242  1.00 0.00 ? 1505 LYS A C    4  
ATOM   6978  O O    . LYS A 1 25  ? -14.143 -4.918  -2.757  1.00 0.00 ? 1505 LYS A O    4  
ATOM   6979  C CB   . LYS A 1 25  ? -13.591 -2.651  -4.891  1.00 0.00 ? 1505 LYS A CB   4  
ATOM   6980  C CG   . LYS A 1 25  ? -14.226 -2.361  -6.266  1.00 0.00 ? 1505 LYS A CG   4  
ATOM   6981  C CD   . LYS A 1 25  ? -15.743 -2.642  -6.251  1.00 0.00 ? 1505 LYS A CD   4  
ATOM   6982  C CE   . LYS A 1 25  ? -16.262 -3.254  -7.562  1.00 0.00 ? 1505 LYS A CE   4  
ATOM   6983  N NZ   . LYS A 1 25  ? -16.409 -2.261  -8.668  1.00 0.00 ? 1505 LYS A NZ   4  
ATOM   6984  H H    . LYS A 1 25  ? -14.803 -5.269  -5.091  1.00 0.00 ? 1505 LYS A H    4  
ATOM   6985  H HA   . LYS A 1 25  ? -12.033 -4.135  -5.061  1.00 0.00 ? 1505 LYS A HA   4  
ATOM   6986  H HB2  . LYS A 1 25  ? -14.312 -2.414  -4.102  1.00 0.00 ? 1505 LYS A HB2  4  
ATOM   6987  H HB3  . LYS A 1 25  ? -12.743 -1.976  -4.754  1.00 0.00 ? 1505 LYS A HB3  4  
ATOM   6988  H HG2  . LYS A 1 25  ? -14.069 -1.308  -6.506  1.00 0.00 ? 1505 LYS A HG2  4  
ATOM   6989  H HG3  . LYS A 1 25  ? -13.724 -2.960  -7.023  1.00 0.00 ? 1505 LYS A HG3  4  
ATOM   6990  H HD2  . LYS A 1 25  ? -15.975 -3.346  -5.452  1.00 0.00 ? 1505 LYS A HD2  4  
ATOM   6991  H HD3  . LYS A 1 25  ? -16.288 -1.725  -6.018  1.00 0.00 ? 1505 LYS A HD3  4  
ATOM   6992  H HE2  . LYS A 1 25  ? -15.580 -4.054  -7.866  1.00 0.00 ? 1505 LYS A HE2  4  
ATOM   6993  H HE3  . LYS A 1 25  ? -17.234 -3.712  -7.351  1.00 0.00 ? 1505 LYS A HE3  4  
ATOM   6994  H HZ1  . LYS A 1 25  ? -17.167 -1.609  -8.493  1.00 0.00 ? 1505 LYS A HZ1  4  
ATOM   6995  H HZ2  . LYS A 1 25  ? -15.562 -1.724  -8.818  1.00 0.00 ? 1505 LYS A HZ2  4  
ATOM   6996  H HZ3  . LYS A 1 25  ? -16.625 -2.745  -9.547  1.00 0.00 ? 1505 LYS A HZ3  4  
ATOM   6997  N N    . ILE A 1 26  ? -11.965 -4.392  -2.545  1.00 0.00 ? 1506 ILE A N    4  
ATOM   6998  C CA   . ILE A 1 26  ? -11.917 -4.669  -1.111  1.00 0.00 ? 1506 ILE A CA   4  
ATOM   6999  C C    . ILE A 1 26  ? -12.657 -3.521  -0.435  1.00 0.00 ? 1506 ILE A C    4  
ATOM   7000  O O    . ILE A 1 26  ? -12.206 -2.380  -0.515  1.00 0.00 ? 1506 ILE A O    4  
ATOM   7001  C CB   . ILE A 1 26  ? -10.455 -4.793  -0.644  1.00 0.00 ? 1506 ILE A CB   4  
ATOM   7002  C CG1  . ILE A 1 26  ? -9.739  -5.983  -1.316  1.00 0.00 ? 1506 ILE A CG1  4  
ATOM   7003  C CG2  . ILE A 1 26  ? -10.388 -4.967  0.883   1.00 0.00 ? 1506 ILE A CG2  4  
ATOM   7004  C CD1  . ILE A 1 26  ? -8.250  -5.712  -1.553  1.00 0.00 ? 1506 ILE A CD1  4  
ATOM   7005  H H    . ILE A 1 26  ? -11.127 -4.042  -3.006  1.00 0.00 ? 1506 ILE A H    4  
ATOM   7006  H HA   . ILE A 1 26  ? -12.440 -5.602  -0.907  1.00 0.00 ? 1506 ILE A HA   4  
ATOM   7007  H HB   . ILE A 1 26  ? -9.940  -3.875  -0.922  1.00 0.00 ? 1506 ILE A HB   4  
ATOM   7008  H HG12 . ILE A 1 26  ? -9.849  -6.874  -0.701  1.00 0.00 ? 1506 ILE A HG12 4  
ATOM   7009  H HG13 . ILE A 1 26  ? -10.186 -6.186  -2.284  1.00 0.00 ? 1506 ILE A HG13 4  
ATOM   7010  H HG21 . ILE A 1 26  ? -10.979 -5.845  1.164   1.00 0.00 ? 1506 ILE A HG21 4  
ATOM   7011  H HG22 . ILE A 1 26  ? -9.348  -5.102  1.192   1.00 0.00 ? 1506 ILE A HG22 4  
ATOM   7012  H HG23 . ILE A 1 26  ? -10.799 -4.090  1.394   1.00 0.00 ? 1506 ILE A HG23 4  
ATOM   7013  H HD11 . ILE A 1 26  ? -8.146  -4.901  -2.279  1.00 0.00 ? 1506 ILE A HD11 4  
ATOM   7014  H HD12 . ILE A 1 26  ? -7.764  -5.430  -0.623  1.00 0.00 ? 1506 ILE A HD12 4  
ATOM   7015  H HD13 . ILE A 1 26  ? -7.769  -6.610  -1.942  1.00 0.00 ? 1506 ILE A HD13 4  
ATOM   7016  N N    . THR A 1 27  ? -13.777 -3.804  0.214   1.00 0.00 ? 1507 THR A N    4  
ATOM   7017  C CA   . THR A 1 27  ? -14.629 -2.774  0.787   1.00 0.00 ? 1507 THR A CA   4  
ATOM   7018  C C    . THR A 1 27  ? -14.105 -2.359  2.156   1.00 0.00 ? 1507 THR A C    4  
ATOM   7019  O O    . THR A 1 27  ? -14.140 -1.178  2.497   1.00 0.00 ? 1507 THR A O    4  
ATOM   7020  C CB   . THR A 1 27  ? -16.041 -3.332  0.923   1.00 0.00 ? 1507 THR A CB   4  
ATOM   7021  O OG1  . THR A 1 27  ? -15.979 -4.548  1.631   1.00 0.00 ? 1507 THR A OG1  4  
ATOM   7022  C CG2  . THR A 1 27  ? -16.619 -3.688  -0.433  1.00 0.00 ? 1507 THR A CG2  4  
ATOM   7023  H H    . THR A 1 27  ? -14.100 -4.767  0.305   1.00 0.00 ? 1507 THR A H    4  
ATOM   7024  H HA   . THR A 1 27  ? -14.655 -1.914  0.117   1.00 0.00 ? 1507 THR A HA   4  
ATOM   7025  H HB   . THR A 1 27  ? -16.683 -2.623  1.439   1.00 0.00 ? 1507 THR A HB   4  
ATOM   7026  H HG1  . THR A 1 27  ? -16.779 -4.607  2.189   1.00 0.00 ? 1507 THR A HG1  4  
ATOM   7027  H HG21 . THR A 1 27  ? -17.547 -4.234  -0.279  1.00 0.00 ? 1507 THR A HG21 4  
ATOM   7028  H HG22 . THR A 1 27  ? -16.819 -2.780  -1.009  1.00 0.00 ? 1507 THR A HG22 4  
ATOM   7029  H HG23 . THR A 1 27  ? -15.919 -4.309  -0.991  1.00 0.00 ? 1507 THR A HG23 4  
ATOM   7030  N N    . ARG A 1 28  ? -13.630 -3.341  2.940   1.00 0.00 ? 1508 ARG A N    4  
ATOM   7031  C CA   . ARG A 1 28  ? -13.179 -3.158  4.316   1.00 0.00 ? 1508 ARG A CA   4  
ATOM   7032  C C    . ARG A 1 28  ? -12.425 -4.406  4.767   1.00 0.00 ? 1508 ARG A C    4  
ATOM   7033  O O    . ARG A 1 28  ? -12.882 -5.520  4.518   1.00 0.00 ? 1508 ARG A O    4  
ATOM   7034  C CB   . ARG A 1 28  ? -14.438 -2.892  5.176   1.00 0.00 ? 1508 ARG A CB   4  
ATOM   7035  C CG   . ARG A 1 28  ? -14.165 -2.726  6.676   1.00 0.00 ? 1508 ARG A CG   4  
ATOM   7036  C CD   . ARG A 1 28  ? -14.675 -3.941  7.460   1.00 0.00 ? 1508 ARG A CD   4  
ATOM   7037  N NE   . ARG A 1 28  ? -14.180 -3.934  8.848   1.00 0.00 ? 1508 ARG A NE   4  
ATOM   7038  C CZ   . ARG A 1 28  ? -14.839 -3.566  9.957   1.00 0.00 ? 1508 ARG A CZ   4  
ATOM   7039  N NH1  . ARG A 1 28  ? -16.065 -3.050  9.884   1.00 0.00 ? 1508 ARG A NH1  4  
ATOM   7040  N NH2  . ARG A 1 28  ? -14.261 -3.723  11.142  1.00 0.00 ? 1508 ARG A NH2  4  
ATOM   7041  H H    . ARG A 1 28  ? -13.724 -4.298  2.599   1.00 0.00 ? 1508 ARG A H    4  
ATOM   7042  H HA   . ARG A 1 28  ? -12.519 -2.289  4.369   1.00 0.00 ? 1508 ARG A HA   4  
ATOM   7043  H HB2  . ARG A 1 28  ? -14.904 -1.964  4.838   1.00 0.00 ? 1508 ARG A HB2  4  
ATOM   7044  H HB3  . ARG A 1 28  ? -15.163 -3.691  5.006   1.00 0.00 ? 1508 ARG A HB3  4  
ATOM   7045  H HG2  . ARG A 1 28  ? -13.097 -2.587  6.838   1.00 0.00 ? 1508 ARG A HG2  4  
ATOM   7046  H HG3  . ARG A 1 28  ? -14.687 -1.837  7.036   1.00 0.00 ? 1508 ARG A HG3  4  
ATOM   7047  H HD2  . ARG A 1 28  ? -15.764 -3.974  7.421   1.00 0.00 ? 1508 ARG A HD2  4  
ATOM   7048  H HD3  . ARG A 1 28  ? -14.303 -4.837  6.961   1.00 0.00 ? 1508 ARG A HD3  4  
ATOM   7049  H HE   . ARG A 1 28  ? -13.214 -4.253  8.946   1.00 0.00 ? 1508 ARG A HE   4  
ATOM   7050  H HH11 . ARG A 1 28  ? -16.515 -2.892  8.989   1.00 0.00 ? 1508 ARG A HH11 4  
ATOM   7051  H HH12 . ARG A 1 28  ? -16.584 -2.776  10.711  1.00 0.00 ? 1508 ARG A HH12 4  
ATOM   7052  H HH21 . ARG A 1 28  ? -13.347 -4.153  11.222  1.00 0.00 ? 1508 ARG A HH21 4  
ATOM   7053  H HH22 . ARG A 1 28  ? -14.719 -3.453  12.006  1.00 0.00 ? 1508 ARG A HH22 4  
ATOM   7054  N N    . ASP A 1 29  ? -11.293 -4.239  5.448   1.00 0.00 ? 1509 ASP A N    4  
ATOM   7055  C CA   . ASP A 1 29  ? -10.600 -5.331  6.131   1.00 0.00 ? 1509 ASP A CA   4  
ATOM   7056  C C    . ASP A 1 29  ? -11.476 -5.733  7.312   1.00 0.00 ? 1509 ASP A C    4  
ATOM   7057  O O    . ASP A 1 29  ? -11.638 -4.951  8.248   1.00 0.00 ? 1509 ASP A O    4  
ATOM   7058  C CB   . ASP A 1 29  ? -9.218  -4.878  6.618   1.00 0.00 ? 1509 ASP A CB   4  
ATOM   7059  C CG   . ASP A 1 29  ? -8.645  -5.803  7.713   1.00 0.00 ? 1509 ASP A CG   4  
ATOM   7060  O OD1  . ASP A 1 29  ? -8.681  -7.042  7.549   1.00 0.00 ? 1509 ASP A OD1  4  
ATOM   7061  O OD2  . ASP A 1 29  ? -8.151  -5.288  8.744   1.00 0.00 ? 1509 ASP A OD2  4  
ATOM   7062  H H    . ASP A 1 29  ? -10.967 -3.302  5.644   1.00 0.00 ? 1509 ASP A H    4  
ATOM   7063  H HA   . ASP A 1 29  ? -10.477 -6.182  5.466   1.00 0.00 ? 1509 ASP A HA   4  
ATOM   7064  H HB2  . ASP A 1 29  ? -8.535  -4.851  5.770   1.00 0.00 ? 1509 ASP A HB2  4  
ATOM   7065  H HB3  . ASP A 1 29  ? -9.294  -3.868  7.023   1.00 0.00 ? 1509 ASP A HB3  4  
ATOM   7066  N N    . VAL A 1 30  ? -12.144 -6.885  7.217   1.00 0.00 ? 1510 VAL A N    4  
ATOM   7067  C CA   . VAL A 1 30  ? -13.111 -7.339  8.211   1.00 0.00 ? 1510 VAL A CA   4  
ATOM   7068  C C    . VAL A 1 30  ? -12.375 -7.527  9.542   1.00 0.00 ? 1510 VAL A C    4  
ATOM   7069  O O    . VAL A 1 30  ? -12.751 -6.938  10.556  1.00 0.00 ? 1510 VAL A O    4  
ATOM   7070  C CB   . VAL A 1 30  ? -13.806 -8.645  7.768   1.00 0.00 ? 1510 VAL A CB   4  
ATOM   7071  C CG1  . VAL A 1 30  ? -15.086 -8.936  8.528   1.00 0.00 ? 1510 VAL A CG1  4  
ATOM   7072  C CG2  . VAL A 1 30  ? -14.201 -8.671  6.293   1.00 0.00 ? 1510 VAL A CG2  4  
ATOM   7073  H H    . VAL A 1 30  ? -11.893 -7.527  6.479   1.00 0.00 ? 1510 VAL A H    4  
ATOM   7074  H HA   . VAL A 1 30  ? -13.868 -6.566  8.317   1.00 0.00 ? 1510 VAL A HA   4  
ATOM   7075  H HB   . VAL A 1 30  ? -13.126 -9.465  7.938   1.00 0.00 ? 1510 VAL A HB   4  
ATOM   7076  H HG11 . VAL A 1 30  ? -14.887 -8.900  9.598   1.00 0.00 ? 1510 VAL A HG11 4  
ATOM   7077  H HG12 . VAL A 1 30  ? -15.848 -8.201  8.239   1.00 0.00 ? 1510 VAL A HG12 4  
ATOM   7078  H HG13 . VAL A 1 30  ? -15.416 -9.942  8.258   1.00 0.00 ? 1510 VAL A HG13 4  
ATOM   7079  H HG21 . VAL A 1 30  ? -13.298 -8.738  5.713   1.00 0.00 ? 1510 VAL A HG21 4  
ATOM   7080  H HG22 . VAL A 1 30  ? -14.817 -9.550  6.052   1.00 0.00 ? 1510 VAL A HG22 4  
ATOM   7081  H HG23 . VAL A 1 30  ? -14.738 -7.754  6.050   1.00 0.00 ? 1510 VAL A HG23 4  
ATOM   7082  N N    . GLY A 1 31  ? -11.298 -8.315  9.509   1.00 0.00 ? 1511 GLY A N    4  
ATOM   7083  C CA   . GLY A 1 31  ? -10.442 -8.619  10.640  1.00 0.00 ? 1511 GLY A CA   4  
ATOM   7084  C C    . GLY A 1 31  ? -9.997  -10.067 10.541  1.00 0.00 ? 1511 GLY A C    4  
ATOM   7085  O O    . GLY A 1 31  ? -10.549 -10.833 9.746   1.00 0.00 ? 1511 GLY A O    4  
ATOM   7086  H H    . GLY A 1 31  ? -11.077 -8.806  8.640   1.00 0.00 ? 1511 GLY A H    4  
ATOM   7087  H HA2  . GLY A 1 31  ? -9.574  -7.958  10.623  1.00 0.00 ? 1511 GLY A HA2  4  
ATOM   7088  H HA3  . GLY A 1 31  ? -10.979 -8.474  11.578  1.00 0.00 ? 1511 GLY A HA3  4  
ATOM   7089  N N    . ALA A 1 32  ? -9.005  -10.462 11.342  1.00 0.00 ? 1512 ALA A N    4  
ATOM   7090  C CA   . ALA A 1 32  ? -8.515  -11.835 11.475  1.00 0.00 ? 1512 ALA A CA   4  
ATOM   7091  C C    . ALA A 1 32  ? -8.037  -12.512 10.177  1.00 0.00 ? 1512 ALA A C    4  
ATOM   7092  O O    . ALA A 1 32  ? -7.781  -13.718 10.173  1.00 0.00 ? 1512 ALA A O    4  
ATOM   7093  C CB   . ALA A 1 32  ? -9.582  -12.652 12.212  1.00 0.00 ? 1512 ALA A CB   4  
ATOM   7094  H H    . ALA A 1 32  ? -8.590  -9.772  11.957  1.00 0.00 ? 1512 ALA A H    4  
ATOM   7095  H HA   . ALA A 1 32  ? -7.638  -11.784 12.113  1.00 0.00 ? 1512 ALA A HA   4  
ATOM   7096  H HB1  . ALA A 1 32  ? -10.471 -12.727 11.584  1.00 0.00 ? 1512 ALA A HB1  4  
ATOM   7097  H HB2  . ALA A 1 32  ? -9.206  -13.651 12.429  1.00 0.00 ? 1512 ALA A HB2  4  
ATOM   7098  H HB3  . ALA A 1 32  ? -9.846  -12.158 13.147  1.00 0.00 ? 1512 ALA A HB3  4  
ATOM   7099  N N    . GLY A 1 33  ? -7.915  -11.765 9.075   1.00 0.00 ? 1513 GLY A N    4  
ATOM   7100  C CA   . GLY A 1 33  ? -7.495  -12.258 7.770   1.00 0.00 ? 1513 GLY A CA   4  
ATOM   7101  C C    . GLY A 1 33  ? -8.647  -12.216 6.777   1.00 0.00 ? 1513 GLY A C    4  
ATOM   7102  O O    . GLY A 1 33  ? -8.417  -12.442 5.597   1.00 0.00 ? 1513 GLY A O    4  
ATOM   7103  H H    . GLY A 1 33  ? -8.225  -10.805 9.100   1.00 0.00 ? 1513 GLY A H    4  
ATOM   7104  H HA2  . GLY A 1 33  ? -6.686  -11.628 7.396   1.00 0.00 ? 1513 GLY A HA2  4  
ATOM   7105  H HA3  . GLY A 1 33  ? -7.130  -13.284 7.845   1.00 0.00 ? 1513 GLY A HA3  4  
ATOM   7106  N N    . LYS A 1 34  ? -9.887  -11.961 7.211   1.00 0.00 ? 1514 LYS A N    4  
ATOM   7107  C CA   . LYS A 1 34  ? -10.993 -11.707 6.299   1.00 0.00 ? 1514 LYS A CA   4  
ATOM   7108  C C    . LYS A 1 34  ? -10.909 -10.264 5.822   1.00 0.00 ? 1514 LYS A C    4  
ATOM   7109  O O    . LYS A 1 34  ? -10.760 -9.352  6.632   1.00 0.00 ? 1514 LYS A O    4  
ATOM   7110  C CB   . LYS A 1 34  ? -12.349 -11.893 6.999   1.00 0.00 ? 1514 LYS A CB   4  
ATOM   7111  C CG   . LYS A 1 34  ? -12.859 -13.329 7.132   1.00 0.00 ? 1514 LYS A CG   4  
ATOM   7112  C CD   . LYS A 1 34  ? -12.446 -14.061 8.423   1.00 0.00 ? 1514 LYS A CD   4  
ATOM   7113  C CE   . LYS A 1 34  ? -13.157 -13.494 9.668   1.00 0.00 ? 1514 LYS A CE   4  
ATOM   7114  N NZ   . LYS A 1 34  ? -13.072 -14.417 10.837  1.00 0.00 ? 1514 LYS A NZ   4  
ATOM   7115  H H    . LYS A 1 34  ? -10.037 -11.747 8.194   1.00 0.00 ? 1514 LYS A H    4  
ATOM   7116  H HA   . LYS A 1 34  ? -10.921 -12.371 5.436   1.00 0.00 ? 1514 LYS A HA   4  
ATOM   7117  H HB2  . LYS A 1 34  ? -12.335 -11.425 7.974   1.00 0.00 ? 1514 LYS A HB2  4  
ATOM   7118  H HB3  . LYS A 1 34  ? -13.085 -11.361 6.404   1.00 0.00 ? 1514 LYS A HB3  4  
ATOM   7119  H HG2  . LYS A 1 34  ? -13.948 -13.280 7.104   1.00 0.00 ? 1514 LYS A HG2  4  
ATOM   7120  H HG3  . LYS A 1 34  ? -12.531 -13.896 6.258   1.00 0.00 ? 1514 LYS A HG3  4  
ATOM   7121  H HD2  . LYS A 1 34  ? -12.727 -15.113 8.306   1.00 0.00 ? 1514 LYS A HD2  4  
ATOM   7122  H HD3  . LYS A 1 34  ? -11.368 -14.005 8.561   1.00 0.00 ? 1514 LYS A HD3  4  
ATOM   7123  H HE2  . LYS A 1 34  ? -12.712 -12.525 9.924   1.00 0.00 ? 1514 LYS A HE2  4  
ATOM   7124  H HE3  . LYS A 1 34  ? -14.213 -13.336 9.430   1.00 0.00 ? 1514 LYS A HE3  4  
ATOM   7125  H HZ1  . LYS A 1 34  ? -13.546 -15.295 10.656  1.00 0.00 ? 1514 LYS A HZ1  4  
ATOM   7126  H HZ2  . LYS A 1 34  ? -12.115 -14.629 11.090  1.00 0.00 ? 1514 LYS A HZ2  4  
ATOM   7127  H HZ3  . LYS A 1 34  ? -13.522 -14.012 11.652  1.00 0.00 ? 1514 LYS A HZ3  4  
ATOM   7128  N N    . TYR A 1 35  ? -11.180 -10.048 4.541   1.00 0.00 ? 1515 TYR A N    4  
ATOM   7129  C CA   . TYR A 1 35  ? -11.371 -8.750  3.912   1.00 0.00 ? 1515 TYR A CA   4  
ATOM   7130  C C    . TYR A 1 35  ? -12.675 -8.900  3.139   1.00 0.00 ? 1515 TYR A C    4  
ATOM   7131  O O    . TYR A 1 35  ? -12.887 -9.929  2.495   1.00 0.00 ? 1515 TYR A O    4  
ATOM   7132  C CB   . TYR A 1 35  ? -10.215 -8.380  2.977   1.00 0.00 ? 1515 TYR A CB   4  
ATOM   7133  C CG   . TYR A 1 35  ? -8.794  -8.510  3.512   1.00 0.00 ? 1515 TYR A CG   4  
ATOM   7134  C CD1  . TYR A 1 35  ? -8.250  -9.776  3.811   1.00 0.00 ? 1515 TYR A CD1  4  
ATOM   7135  C CD2  . TYR A 1 35  ? -7.999  -7.360  3.712   1.00 0.00 ? 1515 TYR A CD2  4  
ATOM   7136  C CE1  . TYR A 1 35  ? -6.948  -9.899  4.326   1.00 0.00 ? 1515 TYR A CE1  4  
ATOM   7137  C CE2  . TYR A 1 35  ? -6.681  -7.474  4.200   1.00 0.00 ? 1515 TYR A CE2  4  
ATOM   7138  C CZ   . TYR A 1 35  ? -6.152  -8.748  4.512   1.00 0.00 ? 1515 TYR A CZ   4  
ATOM   7139  O OH   . TYR A 1 35  ? -4.882  -8.887  4.994   1.00 0.00 ? 1515 TYR A OH   4  
ATOM   7140  H H    . TYR A 1 35  ? -11.332 -10.849 3.936   1.00 0.00 ? 1515 TYR A H    4  
ATOM   7141  H HA   . TYR A 1 35  ? -11.465 -7.965  4.657   1.00 0.00 ? 1515 TYR A HA   4  
ATOM   7142  H HB2  . TYR A 1 35  ? -10.298 -8.980  2.077   1.00 0.00 ? 1515 TYR A HB2  4  
ATOM   7143  H HB3  . TYR A 1 35  ? -10.384 -7.347  2.696   1.00 0.00 ? 1515 TYR A HB3  4  
ATOM   7144  H HD1  . TYR A 1 35  ? -8.825  -10.675 3.653   1.00 0.00 ? 1515 TYR A HD1  4  
ATOM   7145  H HD2  . TYR A 1 35  ? -8.392  -6.377  3.489   1.00 0.00 ? 1515 TYR A HD2  4  
ATOM   7146  H HE1  . TYR A 1 35  ? -6.568  -10.880 4.578   1.00 0.00 ? 1515 TYR A HE1  4  
ATOM   7147  H HE2  . TYR A 1 35  ? -6.078  -6.586  4.335   1.00 0.00 ? 1515 TYR A HE2  4  
ATOM   7148  H HH   . TYR A 1 35  ? -4.405  -8.045  5.108   1.00 0.00 ? 1515 TYR A HH   4  
ATOM   7149  N N    . LYS A 1 36  ? -13.609 -7.956  3.256   1.00 0.00 ? 1516 LYS A N    4  
ATOM   7150  C CA   . LYS A 1 36  ? -14.877 -8.036  2.541   1.00 0.00 ? 1516 LYS A CA   4  
ATOM   7151  C C    . LYS A 1 36  ? -14.684 -7.470  1.152   1.00 0.00 ? 1516 LYS A C    4  
ATOM   7152  O O    . LYS A 1 36  ? -13.904 -6.537  0.955   1.00 0.00 ? 1516 LYS A O    4  
ATOM   7153  C CB   . LYS A 1 36  ? -15.948 -7.337  3.376   1.00 0.00 ? 1516 LYS A CB   4  
ATOM   7154  C CG   . LYS A 1 36  ? -17.354 -7.361  2.768   1.00 0.00 ? 1516 LYS A CG   4  
ATOM   7155  C CD   . LYS A 1 36  ? -18.430 -7.276  3.855   1.00 0.00 ? 1516 LYS A CD   4  
ATOM   7156  C CE   . LYS A 1 36  ? -18.287 -6.081  4.825   1.00 0.00 ? 1516 LYS A CE   4  
ATOM   7157  N NZ   . LYS A 1 36  ? -19.494 -5.914  5.684   1.00 0.00 ? 1516 LYS A NZ   4  
ATOM   7158  H H    . LYS A 1 36  ? -13.460 -7.147  3.853   1.00 0.00 ? 1516 LYS A H    4  
ATOM   7159  H HA   . LYS A 1 36  ? -15.144 -9.085  2.424   1.00 0.00 ? 1516 LYS A HA   4  
ATOM   7160  H HB2  . LYS A 1 36  ? -15.989 -7.899  4.302   1.00 0.00 ? 1516 LYS A HB2  4  
ATOM   7161  H HB3  . LYS A 1 36  ? -15.651 -6.309  3.597   1.00 0.00 ? 1516 LYS A HB3  4  
ATOM   7162  H HG2  . LYS A 1 36  ? -17.473 -6.542  2.063   1.00 0.00 ? 1516 LYS A HG2  4  
ATOM   7163  H HG3  . LYS A 1 36  ? -17.509 -8.294  2.230   1.00 0.00 ? 1516 LYS A HG3  4  
ATOM   7164  H HD2  . LYS A 1 36  ? -19.390 -7.220  3.333   1.00 0.00 ? 1516 LYS A HD2  4  
ATOM   7165  H HD3  . LYS A 1 36  ? -18.375 -8.203  4.430   1.00 0.00 ? 1516 LYS A HD3  4  
ATOM   7166  H HE2  . LYS A 1 36  ? -17.406 -6.236  5.467   1.00 0.00 ? 1516 LYS A HE2  4  
ATOM   7167  H HE3  . LYS A 1 36  ? -18.129 -5.167  4.245   1.00 0.00 ? 1516 LYS A HE3  4  
ATOM   7168  H HZ1  . LYS A 1 36  ? -19.380 -5.139  6.327   1.00 0.00 ? 1516 LYS A HZ1  4  
ATOM   7169  H HZ2  . LYS A 1 36  ? -20.320 -5.719  5.133   1.00 0.00 ? 1516 LYS A HZ2  4  
ATOM   7170  H HZ3  . LYS A 1 36  ? -19.678 -6.738  6.242   1.00 0.00 ? 1516 LYS A HZ3  4  
ATOM   7171  N N    . LEU A 1 37  ? -15.381 -8.065  0.199   1.00 0.00 ? 1517 LEU A N    4  
ATOM   7172  C CA   . LEU A 1 37  ? -15.193 -7.826  -1.215  1.00 0.00 ? 1517 LEU A CA   4  
ATOM   7173  C C    . LEU A 1 37  ? -16.547 -7.519  -1.803  1.00 0.00 ? 1517 LEU A C    4  
ATOM   7174  O O    . LEU A 1 37  ? -17.422 -8.381  -1.795  1.00 0.00 ? 1517 LEU A O    4  
ATOM   7175  C CB   . LEU A 1 37  ? -14.642 -9.096  -1.896  1.00 0.00 ? 1517 LEU A CB   4  
ATOM   7176  C CG   . LEU A 1 37  ? -13.117 -9.220  -2.013  1.00 0.00 ? 1517 LEU A CG   4  
ATOM   7177  C CD1  . LEU A 1 37  ? -12.558 -8.234  -3.039  1.00 0.00 ? 1517 LEU A CD1  4  
ATOM   7178  C CD2  . LEU A 1 37  ? -12.374 -9.038  -0.695  1.00 0.00 ? 1517 LEU A CD2  4  
ATOM   7179  H H    . LEU A 1 37  ? -16.013 -8.823  0.444   1.00 0.00 ? 1517 LEU A H    4  
ATOM   7180  H HA   . LEU A 1 37  ? -14.521 -6.983  -1.379  1.00 0.00 ? 1517 LEU A HA   4  
ATOM   7181  H HB2  . LEU A 1 37  ? -15.022 -9.981  -1.375  1.00 0.00 ? 1517 LEU A HB2  4  
ATOM   7182  H HB3  . LEU A 1 37  ? -15.045 -9.145  -2.910  1.00 0.00 ? 1517 LEU A HB3  4  
ATOM   7183  H HG   . LEU A 1 37  ? -12.909 -10.225 -2.367  1.00 0.00 ? 1517 LEU A HG   4  
ATOM   7184  H HD11 . LEU A 1 37  ? -11.477 -8.357  -3.096  1.00 0.00 ? 1517 LEU A HD11 4  
ATOM   7185  H HD12 . LEU A 1 37  ? -12.984 -8.441  -4.020  1.00 0.00 ? 1517 LEU A HD12 4  
ATOM   7186  H HD13 . LEU A 1 37  ? -12.785 -7.209  -2.750  1.00 0.00 ? 1517 LEU A HD13 4  
ATOM   7187  H HD21 . LEU A 1 37  ? -12.458 -8.019  -0.328  1.00 0.00 ? 1517 LEU A HD21 4  
ATOM   7188  H HD22 . LEU A 1 37  ? -12.777 -9.732  0.044   1.00 0.00 ? 1517 LEU A HD22 4  
ATOM   7189  H HD23 . LEU A 1 37  ? -11.322 -9.254  -0.844  1.00 0.00 ? 1517 LEU A HD23 4  
ATOM   7190  N N    . LEU A 1 38  ? -16.709 -6.310  -2.326  1.00 0.00 ? 1518 LEU A N    4  
ATOM   7191  C CA   . LEU A 1 38  ? -17.849 -5.947  -3.144  1.00 0.00 ? 1518 LEU A CA   4  
ATOM   7192  C C    . LEU A 1 38  ? -17.403 -6.425  -4.499  1.00 0.00 ? 1518 LEU A C    4  
ATOM   7193  O O    . LEU A 1 38  ? -16.600 -5.773  -5.172  1.00 0.00 ? 1518 LEU A O    4  
ATOM   7194  C CB   . LEU A 1 38  ? -18.134 -4.436  -3.137  1.00 0.00 ? 1518 LEU A CB   4  
ATOM   7195  C CG   . LEU A 1 38  ? -19.105 -3.956  -4.231  1.00 0.00 ? 1518 LEU A CG   4  
ATOM   7196  C CD1  . LEU A 1 38  ? -20.490 -4.607  -4.146  1.00 0.00 ? 1518 LEU A CD1  4  
ATOM   7197  C CD2  . LEU A 1 38  ? -19.254 -2.435  -4.099  1.00 0.00 ? 1518 LEU A CD2  4  
ATOM   7198  H H    . LEU A 1 38  ? -15.940 -5.656  -2.280  1.00 0.00 ? 1518 LEU A H    4  
ATOM   7199  H HA   . LEU A 1 38  ? -18.732 -6.502  -2.840  1.00 0.00 ? 1518 LEU A HA   4  
ATOM   7200  H HB2  . LEU A 1 38  ? -18.579 -4.189  -2.180  1.00 0.00 ? 1518 LEU A HB2  4  
ATOM   7201  H HB3  . LEU A 1 38  ? -17.190 -3.892  -3.235  1.00 0.00 ? 1518 LEU A HB3  4  
ATOM   7202  H HG   . LEU A 1 38  ? -18.680 -4.173  -5.210  1.00 0.00 ? 1518 LEU A HG   4  
ATOM   7203  H HD11 . LEU A 1 38  ? -21.113 -4.265  -4.975  1.00 0.00 ? 1518 LEU A HD11 4  
ATOM   7204  H HD12 . LEU A 1 38  ? -20.412 -5.693  -4.208  1.00 0.00 ? 1518 LEU A HD12 4  
ATOM   7205  H HD13 . LEU A 1 38  ? -20.972 -4.344  -3.206  1.00 0.00 ? 1518 LEU A HD13 4  
ATOM   7206  H HD21 . LEU A 1 38  ? -19.902 -2.055  -4.885  1.00 0.00 ? 1518 LEU A HD21 4  
ATOM   7207  H HD22 . LEU A 1 38  ? -19.686 -2.183  -3.126  1.00 0.00 ? 1518 LEU A HD22 4  
ATOM   7208  H HD23 . LEU A 1 38  ? -18.280 -1.953  -4.183  1.00 0.00 ? 1518 LEU A HD23 4  
ATOM   7209  N N    . PHE A 1 39  ? -17.826 -7.628  -4.843  1.00 0.00 ? 1519 PHE A N    4  
ATOM   7210  C CA   . PHE A 1 39  ? -17.601 -8.142  -6.159  1.00 0.00 ? 1519 PHE A CA   4  
ATOM   7211  C C    . PHE A 1 39  ? -18.287 -7.201  -7.152  1.00 0.00 ? 1519 PHE A C    4  
ATOM   7212  O O    . PHE A 1 39  ? -19.354 -6.648  -6.883  1.00 0.00 ? 1519 PHE A O    4  
ATOM   7213  C CB   . PHE A 1 39  ? -18.123 -9.570  -6.238  1.00 0.00 ? 1519 PHE A CB   4  
ATOM   7214  C CG   . PHE A 1 39  ? -17.356 -10.600 -5.439  1.00 0.00 ? 1519 PHE A CG   4  
ATOM   7215  C CD1  . PHE A 1 39  ? -16.194 -11.154 -5.993  1.00 0.00 ? 1519 PHE A CD1  4  
ATOM   7216  C CD2  . PHE A 1 39  ? -17.789 -11.019 -4.164  1.00 0.00 ? 1519 PHE A CD2  4  
ATOM   7217  C CE1  . PHE A 1 39  ? -15.493 -12.154 -5.311  1.00 0.00 ? 1519 PHE A CE1  4  
ATOM   7218  C CE2  . PHE A 1 39  ? -17.080 -12.024 -3.475  1.00 0.00 ? 1519 PHE A CE2  4  
ATOM   7219  C CZ   . PHE A 1 39  ? -15.933 -12.600 -4.058  1.00 0.00 ? 1519 PHE A CZ   4  
ATOM   7220  H H    . PHE A 1 39  ? -18.529 -8.080  -4.265  1.00 0.00 ? 1519 PHE A H    4  
ATOM   7221  H HA   . PHE A 1 39  ? -16.535 -8.161  -6.355  1.00 0.00 ? 1519 PHE A HA   4  
ATOM   7222  H HB2  . PHE A 1 39  ? -19.180 -9.597  -5.955  1.00 0.00 ? 1519 PHE A HB2  4  
ATOM   7223  H HB3  . PHE A 1 39  ? -18.030 -9.871  -7.276  1.00 0.00 ? 1519 PHE A HB3  4  
ATOM   7224  H HD1  . PHE A 1 39  ? -15.827 -10.823 -6.954  1.00 0.00 ? 1519 PHE A HD1  4  
ATOM   7225  H HD2  . PHE A 1 39  ? -18.664 -10.575 -3.713  1.00 0.00 ? 1519 PHE A HD2  4  
ATOM   7226  H HE1  . PHE A 1 39  ? -14.613 -12.582 -5.765  1.00 0.00 ? 1519 PHE A HE1  4  
ATOM   7227  H HE2  . PHE A 1 39  ? -17.424 -12.348 -2.499  1.00 0.00 ? 1519 PHE A HE2  4  
ATOM   7228  H HZ   . PHE A 1 39  ? -15.379 -13.388 -3.566  1.00 0.00 ? 1519 PHE A HZ   4  
ATOM   7229  N N    . ASP A 1 40  ? -17.708 -7.074  -8.340  1.00 0.00 ? 1520 ASP A N    4  
ATOM   7230  C CA   . ASP A 1 40  ? -18.348 -6.391  -9.479  1.00 0.00 ? 1520 ASP A CA   4  
ATOM   7231  C C    . ASP A 1 40  ? -19.586 -7.165  -9.913  1.00 0.00 ? 1520 ASP A C    4  
ATOM   7232  O O    . ASP A 1 40  ? -20.487 -6.646  -10.570 1.00 0.00 ? 1520 ASP A O    4  
ATOM   7233  C CB   . ASP A 1 40  ? -17.407 -6.351  -10.677 1.00 0.00 ? 1520 ASP A CB   4  
ATOM   7234  C CG   . ASP A 1 40  ? -16.265 -5.380  -10.425 1.00 0.00 ? 1520 ASP A CG   4  
ATOM   7235  O OD1  . ASP A 1 40  ? -16.400 -4.171  -10.715 1.00 0.00 ? 1520 ASP A OD1  4  
ATOM   7236  O OD2  . ASP A 1 40  ? -15.209 -5.821  -9.928  1.00 0.00 ? 1520 ASP A OD2  4  
ATOM   7237  H H    . ASP A 1 40  ? -16.882 -7.634  -8.518  1.00 0.00 ? 1520 ASP A H    4  
ATOM   7238  H HA   . ASP A 1 40  ? -18.638 -5.374  -9.202  1.00 0.00 ? 1520 ASP A HA   4  
ATOM   7239  H HB2  . ASP A 1 40  ? -17.042 -7.360  -10.880 1.00 0.00 ? 1520 ASP A HB2  4  
ATOM   7240  H HB3  . ASP A 1 40  ? -17.987 -6.051  -11.550 1.00 0.00 ? 1520 ASP A HB3  4  
ATOM   7241  N N    . ASP A 1 41  ? -19.608 -8.425  -9.487  1.00 0.00 ? 1521 ASP A N    4  
ATOM   7242  C CA   . ASP A 1 41  ? -20.700 -9.360  -9.534  1.00 0.00 ? 1521 ASP A CA   4  
ATOM   7243  C C    . ASP A 1 41  ? -21.948 -8.769  -8.873  1.00 0.00 ? 1521 ASP A C    4  
ATOM   7244  O O    . ASP A 1 41  ? -23.059 -9.219  -9.122  1.00 0.00 ? 1521 ASP A O    4  
ATOM   7245  C CB   . ASP A 1 41  ? -20.225 -10.572 -8.726  1.00 0.00 ? 1521 ASP A CB   4  
ATOM   7246  C CG   . ASP A 1 41  ? -20.794 -11.877 -9.211  1.00 0.00 ? 1521 ASP A CG   4  
ATOM   7247  O OD1  . ASP A 1 41  ? -20.355 -12.265 -10.307 1.00 0.00 ? 1521 ASP A OD1  4  
ATOM   7248  O OD2  . ASP A 1 41  ? -21.631 -12.487 -8.515  1.00 0.00 ? 1521 ASP A OD2  4  
ATOM   7249  H H    . ASP A 1 41  ? -18.792 -8.737  -8.990  1.00 0.00 ? 1521 ASP A H    4  
ATOM   7250  H HA   . ASP A 1 41  ? -20.873 -9.607  -10.581 1.00 0.00 ? 1521 ASP A HA   4  
ATOM   7251  H HB2  . ASP A 1 41  ? -19.148 -10.683 -8.841  1.00 0.00 ? 1521 ASP A HB2  4  
ATOM   7252  H HB3  . ASP A 1 41  ? -20.447 -10.429 -7.668  1.00 0.00 ? 1521 ASP A HB3  4  
ATOM   7253  N N    . GLY A 1 42  ? -21.761 -7.765  -8.006  1.00 0.00 ? 1522 GLY A N    4  
ATOM   7254  C CA   . GLY A 1 42  ? -22.789 -7.101  -7.233  1.00 0.00 ? 1522 GLY A CA   4  
ATOM   7255  C C    . GLY A 1 42  ? -22.960 -7.760  -5.864  1.00 0.00 ? 1522 GLY A C    4  
ATOM   7256  O O    . GLY A 1 42  ? -23.583 -7.177  -4.975  1.00 0.00 ? 1522 GLY A O    4  
ATOM   7257  H H    . GLY A 1 42  ? -20.816 -7.438  -7.843  1.00 0.00 ? 1522 GLY A H    4  
ATOM   7258  H HA2  . GLY A 1 42  ? -22.488 -6.060  -7.094  1.00 0.00 ? 1522 GLY A HA2  4  
ATOM   7259  H HA3  . GLY A 1 42  ? -23.727 -7.136  -7.784  1.00 0.00 ? 1522 GLY A HA3  4  
ATOM   7260  N N    . TYR A 1 43  ? -22.405 -8.964  -5.693  1.00 0.00 ? 1523 TYR A N    4  
ATOM   7261  C CA   . TYR A 1 43  ? -22.365 -9.677  -4.427  1.00 0.00 ? 1523 TYR A CA   4  
ATOM   7262  C C    . TYR A 1 43  ? -21.369 -9.011  -3.467  1.00 0.00 ? 1523 TYR A C    4  
ATOM   7263  O O    . TYR A 1 43  ? -20.403 -8.381  -3.901  1.00 0.00 ? 1523 TYR A O    4  
ATOM   7264  C CB   . TYR A 1 43  ? -22.001 -11.138 -4.713  1.00 0.00 ? 1523 TYR A CB   4  
ATOM   7265  C CG   . TYR A 1 43  ? -23.202 -11.954 -5.153  1.00 0.00 ? 1523 TYR A CG   4  
ATOM   7266  C CD1  . TYR A 1 43  ? -23.733 -11.853 -6.460  1.00 0.00 ? 1523 TYR A CD1  4  
ATOM   7267  C CD2  . TYR A 1 43  ? -23.798 -12.827 -4.225  1.00 0.00 ? 1523 TYR A CD2  4  
ATOM   7268  C CE1  . TYR A 1 43  ? -24.851 -12.609 -6.820  1.00 0.00 ? 1523 TYR A CE1  4  
ATOM   7269  C CE2  . TYR A 1 43  ? -24.942 -13.566 -4.577  1.00 0.00 ? 1523 TYR A CE2  4  
ATOM   7270  C CZ   . TYR A 1 43  ? -25.478 -13.462 -5.882  1.00 0.00 ? 1523 TYR A CZ   4  
ATOM   7271  O OH   . TYR A 1 43  ? -26.584 -14.188 -6.221  1.00 0.00 ? 1523 TYR A OH   4  
ATOM   7272  H H    . TYR A 1 43  ? -21.920 -9.379  -6.479  1.00 0.00 ? 1523 TYR A H    4  
ATOM   7273  H HA   . TYR A 1 43  ? -23.359 -9.652  -3.973  1.00 0.00 ? 1523 TYR A HA   4  
ATOM   7274  H HB2  . TYR A 1 43  ? -21.221 -11.187 -5.471  1.00 0.00 ? 1523 TYR A HB2  4  
ATOM   7275  H HB3  . TYR A 1 43  ? -21.591 -11.582 -3.802  1.00 0.00 ? 1523 TYR A HB3  4  
ATOM   7276  H HD1  . TYR A 1 43  ? -23.327 -11.213 -7.241  1.00 0.00 ? 1523 TYR A HD1  4  
ATOM   7277  H HD2  . TYR A 1 43  ? -23.378 -12.935 -3.232  1.00 0.00 ? 1523 TYR A HD2  4  
ATOM   7278  H HE1  . TYR A 1 43  ? -25.206 -12.512 -7.832  1.00 0.00 ? 1523 TYR A HE1  4  
ATOM   7279  H HE2  . TYR A 1 43  ? -25.403 -14.214 -3.845  1.00 0.00 ? 1523 TYR A HE2  4  
ATOM   7280  H HH   . TYR A 1 43  ? -26.867 -14.047 -7.141  1.00 0.00 ? 1523 TYR A HH   4  
ATOM   7281  N N    . GLU A 1 44  ? -21.559 -9.210  -2.159  1.00 0.00 ? 1524 GLU A N    4  
ATOM   7282  C CA   . GLU A 1 44  ? -20.659 -8.743  -1.107  1.00 0.00 ? 1524 GLU A CA   4  
ATOM   7283  C C    . GLU A 1 44  ? -20.577 -9.850  -0.060  1.00 0.00 ? 1524 GLU A C    4  
ATOM   7284  O O    . GLU A 1 44  ? -21.610 -10.221 0.503   1.00 0.00 ? 1524 GLU A O    4  
ATOM   7285  C CB   . GLU A 1 44  ? -21.162 -7.454  -0.425  1.00 0.00 ? 1524 GLU A CB   4  
ATOM   7286  C CG   . GLU A 1 44  ? -21.064 -6.182  -1.242  1.00 0.00 ? 1524 GLU A CG   4  
ATOM   7287  C CD   . GLU A 1 44  ? -21.810 -5.020  -0.561  1.00 0.00 ? 1524 GLU A CD   4  
ATOM   7288  O OE1  . GLU A 1 44  ? -21.203 -4.320  0.285   1.00 0.00 ? 1524 GLU A OE1  4  
ATOM   7289  O OE2  . GLU A 1 44  ? -23.007 -4.790  -0.864  1.00 0.00 ? 1524 GLU A OE2  4  
ATOM   7290  H H    . GLU A 1 44  ? -22.321 -9.802  -1.852  1.00 0.00 ? 1524 GLU A H    4  
ATOM   7291  H HA   . GLU A 1 44  ? -19.677 -8.561  -1.522  1.00 0.00 ? 1524 GLU A HA   4  
ATOM   7292  H HB2  . GLU A 1 44  ? -22.206 -7.574  -0.157  1.00 0.00 ? 1524 GLU A HB2  4  
ATOM   7293  H HB3  . GLU A 1 44  ? -20.557 -7.289  0.471   1.00 0.00 ? 1524 GLU A HB3  4  
ATOM   7294  H HG2  . GLU A 1 44  ? -20.012 -5.921  -1.318  1.00 0.00 ? 1524 GLU A HG2  4  
ATOM   7295  H HG3  . GLU A 1 44  ? -21.480 -6.363  -2.232  1.00 0.00 ? 1524 GLU A HG3  4  
ATOM   7296  N N    . CYS A 1 45  ? -19.375 -10.372 0.209   1.00 0.00 ? 1525 CYS A N    4  
ATOM   7297  C CA   . CYS A 1 45  ? -19.094 -11.299 1.306   1.00 0.00 ? 1525 CYS A CA   4  
ATOM   7298  C C    . CYS A 1 45  ? -17.637 -11.116 1.740   1.00 0.00 ? 1525 CYS A C    4  
ATOM   7299  O O    . CYS A 1 45  ? -16.831 -10.496 1.039   1.00 0.00 ? 1525 CYS A O    4  
ATOM   7300  C CB   . CYS A 1 45  ? -19.293 -12.764 0.871   1.00 0.00 ? 1525 CYS A CB   4  
ATOM   7301  S SG   . CYS A 1 45  ? -21.049 -13.226 0.760   1.00 0.00 ? 1525 CYS A SG   4  
ATOM   7302  H H    . CYS A 1 45  ? -18.562 -10.026 -0.289  1.00 0.00 ? 1525 CYS A H    4  
ATOM   7303  H HA   . CYS A 1 45  ? -19.744 -11.077 2.158   1.00 0.00 ? 1525 CYS A HA   4  
ATOM   7304  H HB2  . CYS A 1 45  ? -18.782 -12.916 -0.073  1.00 0.00 ? 1525 CYS A HB2  4  
ATOM   7305  H HB3  . CYS A 1 45  ? -18.833 -13.437 1.594   1.00 0.00 ? 1525 CYS A HB3  4  
ATOM   7306  H HG   . CYS A 1 45  ? -21.484 -12.038 0.318   1.00 0.00 ? 1525 CYS A HG   4  
ATOM   7307  N N    . ASP A 1 46  ? -17.316 -11.654 2.912   1.00 0.00 ? 1526 ASP A N    4  
ATOM   7308  C CA   . ASP A 1 46  ? -15.954 -11.798 3.402   1.00 0.00 ? 1526 ASP A CA   4  
ATOM   7309  C C    . ASP A 1 46  ? -15.221 -12.851 2.563   1.00 0.00 ? 1526 ASP A C    4  
ATOM   7310  O O    . ASP A 1 46  ? -15.820 -13.830 2.104   1.00 0.00 ? 1526 ASP A O    4  
ATOM   7311  C CB   . ASP A 1 46  ? -15.948 -12.204 4.880   1.00 0.00 ? 1526 ASP A CB   4  
ATOM   7312  C CG   . ASP A 1 46  ? -16.351 -13.677 5.100   1.00 0.00 ? 1526 ASP A CG   4  
ATOM   7313  O OD1  . ASP A 1 46  ? -17.573 -13.955 5.153   1.00 0.00 ? 1526 ASP A OD1  4  
ATOM   7314  O OD2  . ASP A 1 46  ? -15.456 -14.544 5.224   1.00 0.00 ? 1526 ASP A OD2  4  
ATOM   7315  H H    . ASP A 1 46  ? -18.025 -12.176 3.405   1.00 0.00 ? 1526 ASP A H    4  
ATOM   7316  H HA   . ASP A 1 46  ? -15.446 -10.843 3.321   1.00 0.00 ? 1526 ASP A HA   4  
ATOM   7317  H HB2  . ASP A 1 46  ? -14.940 -12.047 5.262   1.00 0.00 ? 1526 ASP A HB2  4  
ATOM   7318  H HB3  . ASP A 1 46  ? -16.611 -11.549 5.443   1.00 0.00 ? 1526 ASP A HB3  4  
ATOM   7319  N N    . VAL A 1 47  ? -13.920 -12.638 2.388   1.00 0.00 ? 1527 VAL A N    4  
ATOM   7320  C CA   . VAL A 1 47  ? -12.999 -13.582 1.769   1.00 0.00 ? 1527 VAL A CA   4  
ATOM   7321  C C    . VAL A 1 47  ? -11.699 -13.496 2.576   1.00 0.00 ? 1527 VAL A C    4  
ATOM   7322  O O    . VAL A 1 47  ? -11.312 -12.415 3.021   1.00 0.00 ? 1527 VAL A O    4  
ATOM   7323  C CB   . VAL A 1 47  ? -12.789 -13.241 0.275   1.00 0.00 ? 1527 VAL A CB   4  
ATOM   7324  C CG1  . VAL A 1 47  ? -11.704 -14.103 -0.375  1.00 0.00 ? 1527 VAL A CG1  4  
ATOM   7325  C CG2  . VAL A 1 47  ? -14.054 -13.492 -0.553  1.00 0.00 ? 1527 VAL A CG2  4  
ATOM   7326  H H    . VAL A 1 47  ? -13.506 -11.773 2.737   1.00 0.00 ? 1527 VAL A H    4  
ATOM   7327  H HA   . VAL A 1 47  ? -13.400 -14.592 1.853   1.00 0.00 ? 1527 VAL A HA   4  
ATOM   7328  H HB   . VAL A 1 47  ? -12.502 -12.192 0.177   1.00 0.00 ? 1527 VAL A HB   4  
ATOM   7329  H HG11 . VAL A 1 47  ? -12.012 -15.146 -0.398  1.00 0.00 ? 1527 VAL A HG11 4  
ATOM   7330  H HG12 . VAL A 1 47  ? -11.524 -13.746 -1.385  1.00 0.00 ? 1527 VAL A HG12 4  
ATOM   7331  H HG13 . VAL A 1 47  ? -10.780 -14.022 0.184   1.00 0.00 ? 1527 VAL A HG13 4  
ATOM   7332  H HG21 . VAL A 1 47  ? -13.847 -13.337 -1.612  1.00 0.00 ? 1527 VAL A HG21 4  
ATOM   7333  H HG22 . VAL A 1 47  ? -14.360 -14.536 -0.425  1.00 0.00 ? 1527 VAL A HG22 4  
ATOM   7334  H HG23 . VAL A 1 47  ? -14.861 -12.831 -0.237  1.00 0.00 ? 1527 VAL A HG23 4  
ATOM   7335  N N    . LEU A 1 48  ? -11.029 -14.628 2.801   1.00 0.00 ? 1528 LEU A N    4  
ATOM   7336  C CA   . LEU A 1 48  ? -9.779  -14.648 3.549   1.00 0.00 ? 1528 LEU A CA   4  
ATOM   7337  C C    . LEU A 1 48  ? -8.607  -14.244 2.660   1.00 0.00 ? 1528 LEU A C    4  
ATOM   7338  O O    . LEU A 1 48  ? -8.648  -14.470 1.457   1.00 0.00 ? 1528 LEU A O    4  
ATOM   7339  C CB   . LEU A 1 48  ? -9.582  -16.018 4.213   1.00 0.00 ? 1528 LEU A CB   4  
ATOM   7340  C CG   . LEU A 1 48  ? -8.892  -15.861 5.585   1.00 0.00 ? 1528 LEU A CG   4  
ATOM   7341  C CD1  . LEU A 1 48  ? -9.880  -15.421 6.656   1.00 0.00 ? 1528 LEU A CD1  4  
ATOM   7342  C CD2  . LEU A 1 48  ? -8.238  -17.166 6.020   1.00 0.00 ? 1528 LEU A CD2  4  
ATOM   7343  H H    . LEU A 1 48  ? -11.357 -15.496 2.403   1.00 0.00 ? 1528 LEU A H    4  
ATOM   7344  H HA   . LEU A 1 48  ? -9.845  -13.897 4.325   1.00 0.00 ? 1528 LEU A HA   4  
ATOM   7345  H HB2  . LEU A 1 48  ? -10.556 -16.498 4.341   1.00 0.00 ? 1528 LEU A HB2  4  
ATOM   7346  H HB3  . LEU A 1 48  ? -8.988  -16.654 3.553   1.00 0.00 ? 1528 LEU A HB3  4  
ATOM   7347  H HG   . LEU A 1 48  ? -8.133  -15.081 5.536   1.00 0.00 ? 1528 LEU A HG   4  
ATOM   7348  H HD11 . LEU A 1 48  ? -9.350  -15.265 7.601   1.00 0.00 ? 1528 LEU A HD11 4  
ATOM   7349  H HD12 . LEU A 1 48  ? -10.321 -14.479 6.353   1.00 0.00 ? 1528 LEU A HD12 4  
ATOM   7350  H HD13 . LEU A 1 48  ? -10.663 -16.171 6.786   1.00 0.00 ? 1528 LEU A HD13 4  
ATOM   7351  H HD21 . LEU A 1 48  ? -8.996  -17.946 6.131   1.00 0.00 ? 1528 LEU A HD21 4  
ATOM   7352  H HD22 . LEU A 1 48  ? -7.525  -17.473 5.260   1.00 0.00 ? 1528 LEU A HD22 4  
ATOM   7353  H HD23 . LEU A 1 48  ? -7.710  -17.022 6.966   1.00 0.00 ? 1528 LEU A HD23 4  
ATOM   7354  N N    . GLY A 1 49  ? -7.549  -13.694 3.262   1.00 0.00 ? 1529 GLY A N    4  
ATOM   7355  C CA   . GLY A 1 49  ? -6.439  -13.044 2.565   1.00 0.00 ? 1529 GLY A CA   4  
ATOM   7356  C C    . GLY A 1 49  ? -5.819  -13.914 1.481   1.00 0.00 ? 1529 GLY A C    4  
ATOM   7357  O O    . GLY A 1 49  ? -5.510  -13.432 0.390   1.00 0.00 ? 1529 GLY A O    4  
ATOM   7358  H H    . GLY A 1 49  ? -7.591  -13.566 4.273   1.00 0.00 ? 1529 GLY A H    4  
ATOM   7359  H HA2  . GLY A 1 49  ? -6.796  -12.119 2.124   1.00 0.00 ? 1529 GLY A HA2  4  
ATOM   7360  H HA3  . GLY A 1 49  ? -5.662  -12.803 3.289   1.00 0.00 ? 1529 GLY A HA3  4  
ATOM   7361  N N    . LYS A 1 50  ? -5.658  -15.215 1.741   1.00 0.00 ? 1530 LYS A N    4  
ATOM   7362  C CA   . LYS A 1 50  ? -5.016  -16.093 0.753   1.00 0.00 ? 1530 LYS A CA   4  
ATOM   7363  C C    . LYS A 1 50  ? -5.797  -16.031 -0.552  1.00 0.00 ? 1530 LYS A C    4  
ATOM   7364  O O    . LYS A 1 50  ? -5.219  -15.945 -1.625  1.00 0.00 ? 1530 LYS A O    4  
ATOM   7365  C CB   . LYS A 1 50  ? -4.933  -17.551 1.232   1.00 0.00 ? 1530 LYS A CB   4  
ATOM   7366  C CG   . LYS A 1 50  ? -4.316  -17.700 2.634   1.00 0.00 ? 1530 LYS A CG   4  
ATOM   7367  C CD   . LYS A 1 50  ? -5.283  -18.429 3.572   1.00 0.00 ? 1530 LYS A CD   4  
ATOM   7368  C CE   . LYS A 1 50  ? -4.857  -18.291 5.038   1.00 0.00 ? 1530 LYS A CE   4  
ATOM   7369  N NZ   . LYS A 1 50  ? -3.588  -19.007 5.360   1.00 0.00 ? 1530 LYS A NZ   4  
ATOM   7370  H H    . LYS A 1 50  ? -5.967  -15.587 2.633   1.00 0.00 ? 1530 LYS A H    4  
ATOM   7371  H HA   . LYS A 1 50  ? -4.006  -15.717 0.580   1.00 0.00 ? 1530 LYS A HA   4  
ATOM   7372  H HB2  . LYS A 1 50  ? -5.934  -17.988 1.213   1.00 0.00 ? 1530 LYS A HB2  4  
ATOM   7373  H HB3  . LYS A 1 50  ? -4.326  -18.115 0.519   1.00 0.00 ? 1530 LYS A HB3  4  
ATOM   7374  H HG2  . LYS A 1 50  ? -3.384  -18.256 2.552   1.00 0.00 ? 1530 LYS A HG2  4  
ATOM   7375  H HG3  . LYS A 1 50  ? -4.092  -16.720 3.061   1.00 0.00 ? 1530 LYS A HG3  4  
ATOM   7376  H HD2  . LYS A 1 50  ? -6.270  -17.973 3.471   1.00 0.00 ? 1530 LYS A HD2  4  
ATOM   7377  H HD3  . LYS A 1 50  ? -5.360  -19.482 3.284   1.00 0.00 ? 1530 LYS A HD3  4  
ATOM   7378  H HE2  . LYS A 1 50  ? -4.766  -17.222 5.252   1.00 0.00 ? 1530 LYS A HE2  4  
ATOM   7379  H HE3  . LYS A 1 50  ? -5.665  -18.684 5.659   1.00 0.00 ? 1530 LYS A HE3  4  
ATOM   7380  H HZ1  . LYS A 1 50  ? -3.363  -18.916 6.346   1.00 0.00 ? 1530 LYS A HZ1  4  
ATOM   7381  H HZ2  . LYS A 1 50  ? -3.664  -19.999 5.163   1.00 0.00 ? 1530 LYS A HZ2  4  
ATOM   7382  H HZ3  . LYS A 1 50  ? -2.799  -18.639 4.845   1.00 0.00 ? 1530 LYS A HZ3  4  
ATOM   7383  N N    . ASP A 1 51  ? -7.118  -16.041 -0.429  1.00 0.00 ? 1531 ASP A N    4  
ATOM   7384  C CA   . ASP A 1 51  ? -8.075  -16.170 -1.523  1.00 0.00 ? 1531 ASP A CA   4  
ATOM   7385  C C    . ASP A 1 51  ? -8.390  -14.841 -2.219  1.00 0.00 ? 1531 ASP A C    4  
ATOM   7386  O O    . ASP A 1 51  ? -9.392  -14.755 -2.930  1.00 0.00 ? 1531 ASP A O    4  
ATOM   7387  C CB   . ASP A 1 51  ? -9.343  -16.857 -0.987  1.00 0.00 ? 1531 ASP A CB   4  
ATOM   7388  C CG   . ASP A 1 51  ? -9.152  -18.369 -0.806  1.00 0.00 ? 1531 ASP A CG   4  
ATOM   7389  O OD1  . ASP A 1 51  ? -8.624  -19.030 -1.733  1.00 0.00 ? 1531 ASP A OD1  4  
ATOM   7390  O OD2  . ASP A 1 51  ? -9.532  -18.901 0.266   1.00 0.00 ? 1531 ASP A OD2  4  
ATOM   7391  H H    . ASP A 1 51  ? -7.496  -15.992 0.513   1.00 0.00 ? 1531 ASP A H    4  
ATOM   7392  H HA   . ASP A 1 51  ? -7.641  -16.819 -2.283  1.00 0.00 ? 1531 ASP A HA   4  
ATOM   7393  H HB2  . ASP A 1 51  ? -9.661  -16.387 -0.056  1.00 0.00 ? 1531 ASP A HB2  4  
ATOM   7394  H HB3  . ASP A 1 51  ? -10.154 -16.714 -1.692  1.00 0.00 ? 1531 ASP A HB3  4  
ATOM   7395  N N    . ILE A 1 52  ? -7.564  -13.797 -2.070  1.00 0.00 ? 1532 ILE A N    4  
ATOM   7396  C CA   . ILE A 1 52  ? -7.747  -12.521 -2.762  1.00 0.00 ? 1532 ILE A CA   4  
ATOM   7397  C C    . ILE A 1 52  ? -6.444  -12.277 -3.518  1.00 0.00 ? 1532 ILE A C    4  
ATOM   7398  O O    . ILE A 1 52  ? -5.365  -12.366 -2.941  1.00 0.00 ? 1532 ILE A O    4  
ATOM   7399  C CB   . ILE A 1 52  ? -8.129  -11.372 -1.799  1.00 0.00 ? 1532 ILE A CB   4  
ATOM   7400  C CG1  . ILE A 1 52  ? -8.603  -11.885 -0.420  1.00 0.00 ? 1532 ILE A CG1  4  
ATOM   7401  C CG2  . ILE A 1 52  ? -9.156  -10.426 -2.428  1.00 0.00 ? 1532 ILE A CG2  4  
ATOM   7402  C CD1  . ILE A 1 52  ? -9.222  -10.893 0.552   1.00 0.00 ? 1532 ILE A CD1  4  
ATOM   7403  H H    . ILE A 1 52  ? -6.750  -13.872 -1.471  1.00 0.00 ? 1532 ILE A H    4  
ATOM   7404  H HA   . ILE A 1 52  ? -8.544  -12.621 -3.491  1.00 0.00 ? 1532 ILE A HA   4  
ATOM   7405  H HB   . ILE A 1 52  ? -7.247  -10.768 -1.652  1.00 0.00 ? 1532 ILE A HB   4  
ATOM   7406  H HG12 . ILE A 1 52  ? -9.342  -12.663 -0.582  1.00 0.00 ? 1532 ILE A HG12 4  
ATOM   7407  H HG13 . ILE A 1 52  ? -7.751  -12.331 0.086   1.00 0.00 ? 1532 ILE A HG13 4  
ATOM   7408  H HG21 . ILE A 1 52  ? -9.169  -9.477  -1.887  1.00 0.00 ? 1532 ILE A HG21 4  
ATOM   7409  H HG22 . ILE A 1 52  ? -8.899  -10.226 -3.474  1.00 0.00 ? 1532 ILE A HG22 4  
ATOM   7410  H HG23 . ILE A 1 52  ? -10.144 -10.872 -2.367  1.00 0.00 ? 1532 ILE A HG23 4  
ATOM   7411  H HD11 . ILE A 1 52  ? -10.259 -10.728 0.285   1.00 0.00 ? 1532 ILE A HD11 4  
ATOM   7412  H HD12 . ILE A 1 52  ? -9.196  -11.332 1.544   1.00 0.00 ? 1532 ILE A HD12 4  
ATOM   7413  H HD13 . ILE A 1 52  ? -8.677  -9.952  0.557   1.00 0.00 ? 1532 ILE A HD13 4  
ATOM   7414  N N    . LEU A 1 53  ? -6.554  -12.009 -4.816  1.00 0.00 ? 1533 LEU A N    4  
ATOM   7415  C CA   . LEU A 1 53  ? -5.493  -11.945 -5.804  1.00 0.00 ? 1533 LEU A CA   4  
ATOM   7416  C C    . LEU A 1 53  ? -5.399  -10.482 -6.217  1.00 0.00 ? 1533 LEU A C    4  
ATOM   7417  O O    . LEU A 1 53  ? -6.299  -9.998  -6.909  1.00 0.00 ? 1533 LEU A O    4  
ATOM   7418  C CB   . LEU A 1 53  ? -5.845  -12.823 -7.028  1.00 0.00 ? 1533 LEU A CB   4  
ATOM   7419  C CG   . LEU A 1 53  ? -6.209  -14.297 -6.773  1.00 0.00 ? 1533 LEU A CG   4  
ATOM   7420  C CD1  . LEU A 1 53  ? -6.545  -14.992 -8.094  1.00 0.00 ? 1533 LEU A CD1  4  
ATOM   7421  C CD2  . LEU A 1 53  ? -5.084  -15.060 -6.085  1.00 0.00 ? 1533 LEU A CD2  4  
ATOM   7422  H H    . LEU A 1 53  ? -7.482  -11.851 -5.178  1.00 0.00 ? 1533 LEU A H    4  
ATOM   7423  H HA   . LEU A 1 53  ? -4.561  -12.291 -5.366  1.00 0.00 ? 1533 LEU A HA   4  
ATOM   7424  H HB2  . LEU A 1 53  ? -6.688  -12.370 -7.546  1.00 0.00 ? 1533 LEU A HB2  4  
ATOM   7425  H HB3  . LEU A 1 53  ? -4.996  -12.791 -7.705  1.00 0.00 ? 1533 LEU A HB3  4  
ATOM   7426  H HG   . LEU A 1 53  ? -7.082  -14.361 -6.130  1.00 0.00 ? 1533 LEU A HG   4  
ATOM   7427  H HD11 . LEU A 1 53  ? -6.740  -16.056 -7.934  1.00 0.00 ? 1533 LEU A HD11 4  
ATOM   7428  H HD12 . LEU A 1 53  ? -7.430  -14.530 -8.538  1.00 0.00 ? 1533 LEU A HD12 4  
ATOM   7429  H HD13 . LEU A 1 53  ? -5.723  -14.882 -8.798  1.00 0.00 ? 1533 LEU A HD13 4  
ATOM   7430  H HD21 . LEU A 1 53  ? -4.205  -15.099 -6.728  1.00 0.00 ? 1533 LEU A HD21 4  
ATOM   7431  H HD22 . LEU A 1 53  ? -4.843  -14.590 -5.127  1.00 0.00 ? 1533 LEU A HD22 4  
ATOM   7432  H HD23 . LEU A 1 53  ? -5.429  -16.077 -5.888  1.00 0.00 ? 1533 LEU A HD23 4  
ATOM   7433  N N    . LEU A 1 54  ? -4.352  -9.763  -5.800  1.00 0.00 ? 1534 LEU A N    4  
ATOM   7434  C CA   . LEU A 1 54  ? -4.304  -8.299  -5.961  1.00 0.00 ? 1534 LEU A CA   4  
ATOM   7435  C C    . LEU A 1 54  ? -3.302  -7.782  -7.000  1.00 0.00 ? 1534 LEU A C    4  
ATOM   7436  O O    . LEU A 1 54  ? -3.208  -6.575  -7.222  1.00 0.00 ? 1534 LEU A O    4  
ATOM   7437  C CB   . LEU A 1 54  ? -4.159  -7.591  -4.608  1.00 0.00 ? 1534 LEU A CB   4  
ATOM   7438  C CG   . LEU A 1 54  ? -2.909  -7.861  -3.753  1.00 0.00 ? 1534 LEU A CG   4  
ATOM   7439  C CD1  . LEU A 1 54  ? -1.567  -7.742  -4.460  1.00 0.00 ? 1534 LEU A CD1  4  
ATOM   7440  C CD2  . LEU A 1 54  ? -2.951  -6.870  -2.580  1.00 0.00 ? 1534 LEU A CD2  4  
ATOM   7441  H H    . LEU A 1 54  ? -3.638  -10.222 -5.241  1.00 0.00 ? 1534 LEU A H    4  
ATOM   7442  H HA   . LEU A 1 54  ? -5.277  -7.986  -6.331  1.00 0.00 ? 1534 LEU A HA   4  
ATOM   7443  H HB2  . LEU A 1 54  ? -4.226  -6.517  -4.792  1.00 0.00 ? 1534 LEU A HB2  4  
ATOM   7444  H HB3  . LEU A 1 54  ? -5.023  -7.869  -4.009  1.00 0.00 ? 1534 LEU A HB3  4  
ATOM   7445  H HG   . LEU A 1 54  ? -2.971  -8.879  -3.376  1.00 0.00 ? 1534 LEU A HG   4  
ATOM   7446  H HD11 . LEU A 1 54  ? -1.496  -6.786  -4.980  1.00 0.00 ? 1534 LEU A HD11 4  
ATOM   7447  H HD12 . LEU A 1 54  ? -0.758  -7.810  -3.733  1.00 0.00 ? 1534 LEU A HD12 4  
ATOM   7448  H HD13 . LEU A 1 54  ? -1.454  -8.558  -5.174  1.00 0.00 ? 1534 LEU A HD13 4  
ATOM   7449  H HD21 . LEU A 1 54  ? -2.294  -7.217  -1.780  1.00 0.00 ? 1534 LEU A HD21 4  
ATOM   7450  H HD22 . LEU A 1 54  ? -2.639  -5.880  -2.910  1.00 0.00 ? 1534 LEU A HD22 4  
ATOM   7451  H HD23 . LEU A 1 54  ? -3.971  -6.791  -2.193  1.00 0.00 ? 1534 LEU A HD23 4  
ATOM   7452  N N    . CYS A 1 55  ? -2.601  -8.695  -7.665  1.00 0.00 ? 1535 CYS A N    4  
ATOM   7453  C CA   . CYS A 1 55  ? -1.641  -8.424  -8.733  1.00 0.00 ? 1535 CYS A CA   4  
ATOM   7454  C C    . CYS A 1 55  ? -2.106  -9.268  -9.925  1.00 0.00 ? 1535 CYS A C    4  
ATOM   7455  O O    . CYS A 1 55  ? -1.289  -9.913  -10.574 1.00 0.00 ? 1535 CYS A O    4  
ATOM   7456  C CB   . CYS A 1 55  ? -0.225  -8.808  -8.247  1.00 0.00 ? 1535 CYS A CB   4  
ATOM   7457  S SG   . CYS A 1 55  ? 0.473   -7.486  -7.222  1.00 0.00 ? 1535 CYS A SG   4  
ATOM   7458  H H    . CYS A 1 55  ? -2.801  -9.669  -7.491  1.00 0.00 ? 1535 CYS A H    4  
ATOM   7459  H HA   . CYS A 1 55  ? -1.675  -7.370  -9.010  1.00 0.00 ? 1535 CYS A HA   4  
ATOM   7460  H HB2  . CYS A 1 55  ? -0.262  -9.736  -7.678  1.00 0.00 ? 1535 CYS A HB2  4  
ATOM   7461  H HB3  . CYS A 1 55  ? 0.443   -8.989  -9.093  1.00 0.00 ? 1535 CYS A HB3  4  
ATOM   7462  H HG   . CYS A 1 55  ? 1.665   -8.069  -7.008  1.00 0.00 ? 1535 CYS A HG   4  
ATOM   7463  N N    . ASP A 1 56  ? -3.423  -9.276  -10.194 1.00 0.00 ? 1536 ASP A N    4  
ATOM   7464  C CA   . ASP A 1 56  ? -4.023  -10.239 -11.114 1.00 0.00 ? 1536 ASP A CA   4  
ATOM   7465  C C    . ASP A 1 56  ? -4.687  -9.729  -12.405 1.00 0.00 ? 1536 ASP A C    4  
ATOM   7466  O O    . ASP A 1 56  ? -5.879  -9.990  -12.619 1.00 0.00 ? 1536 ASP A O    4  
ATOM   7467  C CB   . ASP A 1 56  ? -4.951  -11.156 -10.315 1.00 0.00 ? 1536 ASP A CB   4  
ATOM   7468  C CG   . ASP A 1 56  ? -5.396  -12.398 -11.122 1.00 0.00 ? 1536 ASP A CG   4  
ATOM   7469  O OD1  . ASP A 1 56  ? -4.736  -12.779 -12.123 1.00 0.00 ? 1536 ASP A OD1  4  
ATOM   7470  O OD2  . ASP A 1 56  ? -6.424  -12.990 -10.722 1.00 0.00 ? 1536 ASP A OD2  4  
ATOM   7471  H H    . ASP A 1 56  ? -4.049  -8.660  -9.689  1.00 0.00 ? 1536 ASP A H    4  
ATOM   7472  H HA   . ASP A 1 56  ? -3.222  -10.888 -11.464 1.00 0.00 ? 1536 ASP A HA   4  
ATOM   7473  H HB2  . ASP A 1 56  ? -4.422  -11.486 -9.422  1.00 0.00 ? 1536 ASP A HB2  4  
ATOM   7474  H HB3  . ASP A 1 56  ? -5.818  -10.587 -9.984  1.00 0.00 ? 1536 ASP A HB3  4  
ATOM   7475  N N    . PRO A 1 57  ? -4.018  -8.915  -13.246 1.00 0.00 ? 1537 PRO A N    4  
ATOM   7476  C CA   . PRO A 1 57  ? -4.534  -8.698  -14.589 1.00 0.00 ? 1537 PRO A CA   4  
ATOM   7477  C C    . PRO A 1 57  ? -4.286  -10.081 -15.231 1.00 0.00 ? 1537 PRO A C    4  
ATOM   7478  O O    . PRO A 1 57  ? -3.148  -10.564 -15.196 1.00 0.00 ? 1537 PRO A O    4  
ATOM   7479  C CB   . PRO A 1 57  ? -3.687  -7.571  -15.186 1.00 0.00 ? 1537 PRO A CB   4  
ATOM   7480  C CG   . PRO A 1 57  ? -2.358  -7.647  -14.422 1.00 0.00 ? 1537 PRO A CG   4  
ATOM   7481  C CD   . PRO A 1 57  ? -2.712  -8.293  -13.076 1.00 0.00 ? 1537 PRO A CD   4  
ATOM   7482  H HA   . PRO A 1 57  ? -5.593  -8.438  -14.586 1.00 0.00 ? 1537 PRO A HA   4  
ATOM   7483  H HB2  . PRO A 1 57  ? -3.542  -7.695  -16.259 1.00 0.00 ? 1537 PRO A HB2  4  
ATOM   7484  H HB3  . PRO A 1 57  ? -4.167  -6.615  -14.975 1.00 0.00 ? 1537 PRO A HB3  4  
ATOM   7485  H HG2  . PRO A 1 57  ? -1.667  -8.292  -14.965 1.00 0.00 ? 1537 PRO A HG2  4  
ATOM   7486  H HG3  . PRO A 1 57  ? -1.920  -6.659  -14.287 1.00 0.00 ? 1537 PRO A HG3  4  
ATOM   7487  H HD2  . PRO A 1 57  ? -1.957  -9.039  -12.829 1.00 0.00 ? 1537 PRO A HD2  4  
ATOM   7488  H HD3  . PRO A 1 57  ? -2.774  -7.525  -12.303 1.00 0.00 ? 1537 PRO A HD3  4  
ATOM   7489  N N    . ILE A 1 58  ? -5.305  -10.738 -15.804 1.00 0.00 ? 1538 ILE A N    4  
ATOM   7490  C CA   . ILE A 1 58  ? -5.174  -12.149 -16.190 1.00 0.00 ? 1538 ILE A CA   4  
ATOM   7491  C C    . ILE A 1 58  ? -4.012  -12.316 -17.192 1.00 0.00 ? 1538 ILE A C    4  
ATOM   7492  O O    . ILE A 1 58  ? -4.060  -11.715 -18.271 1.00 0.00 ? 1538 ILE A O    4  
ATOM   7493  C CB   . ILE A 1 58  ? -6.461  -12.748 -16.810 1.00 0.00 ? 1538 ILE A CB   4  
ATOM   7494  C CG1  . ILE A 1 58  ? -7.822  -12.308 -16.220 1.00 0.00 ? 1538 ILE A CG1  4  
ATOM   7495  C CG2  . ILE A 1 58  ? -6.325  -14.282 -16.787 1.00 0.00 ? 1538 ILE A CG2  4  
ATOM   7496  C CD1  . ILE A 1 58  ? -8.190  -12.885 -14.851 1.00 0.00 ? 1538 ILE A CD1  4  
ATOM   7497  H H    . ILE A 1 58  ? -6.211  -10.295 -15.872 1.00 0.00 ? 1538 ILE A H    4  
ATOM   7498  H HA   . ILE A 1 58  ? -4.970  -12.696 -15.271 1.00 0.00 ? 1538 ILE A HA   4  
ATOM   7499  H HB   . ILE A 1 58  ? -6.484  -12.454 -17.858 1.00 0.00 ? 1538 ILE A HB   4  
ATOM   7500  H HG12 . ILE A 1 58  ? -7.853  -11.232 -16.126 1.00 0.00 ? 1538 ILE A HG12 4  
ATOM   7501  H HG13 . ILE A 1 58  ? -8.604  -12.576 -16.933 1.00 0.00 ? 1538 ILE A HG13 4  
ATOM   7502  H HG21 . ILE A 1 58  ? -7.202  -14.735 -17.239 1.00 0.00 ? 1538 ILE A HG21 4  
ATOM   7503  H HG22 . ILE A 1 58  ? -5.452  -14.591 -17.361 1.00 0.00 ? 1538 ILE A HG22 4  
ATOM   7504  H HG23 . ILE A 1 58  ? -6.215  -14.646 -15.766 1.00 0.00 ? 1538 ILE A HG23 4  
ATOM   7505  H HD11 . ILE A 1 58  ? -8.332  -13.958 -14.934 1.00 0.00 ? 1538 ILE A HD11 4  
ATOM   7506  H HD12 . ILE A 1 58  ? -7.402  -12.667 -14.131 1.00 0.00 ? 1538 ILE A HD12 4  
ATOM   7507  H HD13 . ILE A 1 58  ? -9.125  -12.434 -14.511 1.00 0.00 ? 1538 ILE A HD13 4  
ATOM   7508  N N    . PRO A 1 59  ? -2.973  -13.117 -16.881 1.00 0.00 ? 1539 PRO A N    4  
ATOM   7509  C CA   . PRO A 1 59  ? -1.885  -13.355 -17.814 1.00 0.00 ? 1539 PRO A CA   4  
ATOM   7510  C C    . PRO A 1 59  ? -2.383  -14.152 -19.014 1.00 0.00 ? 1539 PRO A C    4  
ATOM   7511  O O    . PRO A 1 59  ? -3.234  -15.041 -18.921 1.00 0.00 ? 1539 PRO A O    4  
ATOM   7512  C CB   . PRO A 1 59  ? -0.773  -14.056 -17.022 1.00 0.00 ? 1539 PRO A CB   4  
ATOM   7513  C CG   . PRO A 1 59  ? -1.444  -14.585 -15.752 1.00 0.00 ? 1539 PRO A CG   4  
ATOM   7514  C CD   . PRO A 1 59  ? -2.749  -13.802 -15.618 1.00 0.00 ? 1539 PRO A CD   4  
ATOM   7515  H HA   . PRO A 1 59  ? -1.514  -12.401 -18.198 1.00 0.00 ? 1539 PRO A HA   4  
ATOM   7516  H HB2  . PRO A 1 59  ? -0.312  -14.865 -17.590 1.00 0.00 ? 1539 PRO A HB2  4  
ATOM   7517  H HB3  . PRO A 1 59  ? -0.017  -13.321 -16.744 1.00 0.00 ? 1539 PRO A HB3  4  
ATOM   7518  H HG2  . PRO A 1 59  ? -1.661  -15.648 -15.847 1.00 0.00 ? 1539 PRO A HG2  4  
ATOM   7519  H HG3  . PRO A 1 59  ? -0.804  -14.429 -14.884 1.00 0.00 ? 1539 PRO A HG3  4  
ATOM   7520  H HD2  . PRO A 1 59  ? -3.572  -14.487 -15.399 1.00 0.00 ? 1539 PRO A HD2  4  
ATOM   7521  H HD3  . PRO A 1 59  ? -2.654  -13.066 -14.821 1.00 0.00 ? 1539 PRO A HD3  4  
ATOM   7522  N N    . LEU A 1 60  ? -1.848  -13.795 -20.172 1.00 0.00 ? 1540 LEU A N    4  
ATOM   7523  C CA   . LEU A 1 60  ? -2.217  -14.385 -21.436 1.00 0.00 ? 1540 LEU A CA   4  
ATOM   7524  C C    . LEU A 1 60  ? -1.766  -15.852 -21.412 1.00 0.00 ? 1540 LEU A C    4  
ATOM   7525  O O    . LEU A 1 60  ? -0.752  -16.176 -20.793 1.00 0.00 ? 1540 LEU A O    4  
ATOM   7526  C CB   . LEU A 1 60  ? -1.599  -13.560 -22.578 1.00 0.00 ? 1540 LEU A CB   4  
ATOM   7527  C CG   . LEU A 1 60  ? -2.048  -12.076 -22.665 1.00 0.00 ? 1540 LEU A CG   4  
ATOM   7528  C CD1  . LEU A 1 60  ? -1.401  -11.147 -21.623 1.00 0.00 ? 1540 LEU A CD1  4  
ATOM   7529  C CD2  . LEU A 1 60  ? -1.718  -11.539 -24.059 1.00 0.00 ? 1540 LEU A CD2  4  
ATOM   7530  H H    . LEU A 1 60  ? -1.120  -13.099 -20.178 1.00 0.00 ? 1540 LEU A H    4  
ATOM   7531  H HA   . LEU A 1 60  ? -3.300  -14.353 -21.531 1.00 0.00 ? 1540 LEU A HA   4  
ATOM   7532  H HB2  . LEU A 1 60  ? -0.513  -13.600 -22.506 1.00 0.00 ? 1540 LEU A HB2  4  
ATOM   7533  H HB3  . LEU A 1 60  ? -1.885  -14.054 -23.504 1.00 0.00 ? 1540 LEU A HB3  4  
ATOM   7534  H HG   . LEU A 1 60  ? -3.123  -12.015 -22.507 1.00 0.00 ? 1540 LEU A HG   4  
ATOM   7535  H HD11 . LEU A 1 60  ? -1.864  -11.287 -20.647 1.00 0.00 ? 1540 LEU A HD11 4  
ATOM   7536  H HD12 . LEU A 1 60  ? -0.326  -11.317 -21.565 1.00 0.00 ? 1540 LEU A HD12 4  
ATOM   7537  H HD13 . LEU A 1 60  ? -1.575  -10.107 -21.897 1.00 0.00 ? 1540 LEU A HD13 4  
ATOM   7538  H HD21 . LEU A 1 60  ? -2.222  -12.132 -24.822 1.00 0.00 ? 1540 LEU A HD21 4  
ATOM   7539  H HD22 . LEU A 1 60  ? -2.051  -10.506 -24.145 1.00 0.00 ? 1540 LEU A HD22 4  
ATOM   7540  H HD23 . LEU A 1 60  ? -0.642  -11.581 -24.232 1.00 0.00 ? 1540 LEU A HD23 4  
ATOM   7541  N N    . ASP A 1 61  ? -2.554  -16.731 -22.039 1.00 0.00 ? 1541 ASP A N    4  
ATOM   7542  C CA   . ASP A 1 61  ? -2.459  -18.202 -22.035 1.00 0.00 ? 1541 ASP A CA   4  
ATOM   7543  C C    . ASP A 1 61  ? -3.123  -18.854 -20.810 1.00 0.00 ? 1541 ASP A C    4  
ATOM   7544  O O    . ASP A 1 61  ? -3.324  -20.068 -20.801 1.00 0.00 ? 1541 ASP A O    4  
ATOM   7545  C CB   . ASP A 1 61  ? -1.032  -18.730 -22.274 1.00 0.00 ? 1541 ASP A CB   4  
ATOM   7546  C CG   . ASP A 1 61  ? -1.030  -20.220 -22.656 1.00 0.00 ? 1541 ASP A CG   4  
ATOM   7547  O OD1  . ASP A 1 61  ? -1.646  -20.578 -23.690 1.00 0.00 ? 1541 ASP A OD1  4  
ATOM   7548  O OD2  . ASP A 1 61  ? -0.410  -21.038 -21.933 1.00 0.00 ? 1541 ASP A OD2  4  
ATOM   7549  H H    . ASP A 1 61  ? -3.361  -16.366 -22.537 1.00 0.00 ? 1541 ASP A H    4  
ATOM   7550  H HA   . ASP A 1 61  ? -3.043  -18.536 -22.891 1.00 0.00 ? 1541 ASP A HA   4  
ATOM   7551  H HB2  . ASP A 1 61  ? -0.569  -18.162 -23.084 1.00 0.00 ? 1541 ASP A HB2  4  
ATOM   7552  H HB3  . ASP A 1 61  ? -0.434  -18.595 -21.370 1.00 0.00 ? 1541 ASP A HB3  4  
ATOM   7553  N N    . THR A 1 62  ? -3.532  -18.079 -19.797 1.00 0.00 ? 1542 THR A N    4  
ATOM   7554  C CA   . THR A 1 62  ? -4.292  -18.619 -18.672 1.00 0.00 ? 1542 THR A CA   4  
ATOM   7555  C C    . THR A 1 62  ? -5.682  -19.028 -19.169 1.00 0.00 ? 1542 THR A C    4  
ATOM   7556  O O    . THR A 1 62  ? -6.331  -18.290 -19.919 1.00 0.00 ? 1542 THR A O    4  
ATOM   7557  C CB   . THR A 1 62  ? -4.369  -17.595 -17.533 1.00 0.00 ? 1542 THR A CB   4  
ATOM   7558  O OG1  . THR A 1 62  ? -3.070  -17.127 -17.248 1.00 0.00 ? 1542 THR A OG1  4  
ATOM   7559  C CG2  . THR A 1 62  ? -4.910  -18.155 -16.214 1.00 0.00 ? 1542 THR A CG2  4  
ATOM   7560  H H    . THR A 1 62  ? -3.379  -17.084 -19.813 1.00 0.00 ? 1542 THR A H    4  
ATOM   7561  H HA   . THR A 1 62  ? -3.768  -19.503 -18.305 1.00 0.00 ? 1542 THR A HA   4  
ATOM   7562  H HB   . THR A 1 62  ? -4.993  -16.759 -17.846 1.00 0.00 ? 1542 THR A HB   4  
ATOM   7563  H HG1  . THR A 1 62  ? -2.919  -16.350 -17.821 1.00 0.00 ? 1542 THR A HG1  4  
ATOM   7564  H HG21 . THR A 1 62  ? -5.972  -18.375 -16.306 1.00 0.00 ? 1542 THR A HG21 4  
ATOM   7565  H HG22 . THR A 1 62  ? -4.376  -19.065 -15.939 1.00 0.00 ? 1542 THR A HG22 4  
ATOM   7566  H HG23 . THR A 1 62  ? -4.775  -17.412 -15.425 1.00 0.00 ? 1542 THR A HG23 4  
ATOM   7567  N N    . GLU A 1 63  ? -6.124  -20.209 -18.736 1.00 0.00 ? 1543 GLU A N    4  
ATOM   7568  C CA   . GLU A 1 63  ? -7.480  -20.667 -18.943 1.00 0.00 ? 1543 GLU A CA   4  
ATOM   7569  C C    . GLU A 1 63  ? -8.380  -19.871 -18.004 1.00 0.00 ? 1543 GLU A C    4  
ATOM   7570  O O    . GLU A 1 63  ? -8.035  -19.638 -16.842 1.00 0.00 ? 1543 GLU A O    4  
ATOM   7571  C CB   . GLU A 1 63  ? -7.575  -22.178 -18.678 1.00 0.00 ? 1543 GLU A CB   4  
ATOM   7572  C CG   . GLU A 1 63  ? -8.964  -22.731 -19.017 1.00 0.00 ? 1543 GLU A CG   4  
ATOM   7573  C CD   . GLU A 1 63  ? -9.072  -24.238 -18.724 1.00 0.00 ? 1543 GLU A CD   4  
ATOM   7574  O OE1  . GLU A 1 63  ? -8.544  -25.054 -19.518 1.00 0.00 ? 1543 GLU A OE1  4  
ATOM   7575  O OE2  . GLU A 1 63  ? -9.689  -24.610 -17.698 1.00 0.00 ? 1543 GLU A OE2  4  
ATOM   7576  H H    . GLU A 1 63  ? -5.553  -20.734 -18.093 1.00 0.00 ? 1543 GLU A H    4  
ATOM   7577  H HA   . GLU A 1 63  ? -7.770  -20.469 -19.973 1.00 0.00 ? 1543 GLU A HA   4  
ATOM   7578  H HB2  . GLU A 1 63  ? -6.833  -22.685 -19.296 1.00 0.00 ? 1543 GLU A HB2  4  
ATOM   7579  H HB3  . GLU A 1 63  ? -7.343  -22.381 -17.631 1.00 0.00 ? 1543 GLU A HB3  4  
ATOM   7580  H HG2  . GLU A 1 63  ? -9.720  -22.197 -18.433 1.00 0.00 ? 1543 GLU A HG2  4  
ATOM   7581  H HG3  . GLU A 1 63  ? -9.170  -22.550 -20.072 1.00 0.00 ? 1543 GLU A HG3  4  
ATOM   7582  N N    . VAL A 1 64  ? -9.536  -19.464 -18.502 1.00 0.00 ? 1544 VAL A N    4  
ATOM   7583  C CA   . VAL A 1 64  ? -10.532 -18.718 -17.750 1.00 0.00 ? 1544 VAL A CA   4  
ATOM   7584  C C    . VAL A 1 64  ? -11.914 -19.125 -18.237 1.00 0.00 ? 1544 VAL A C    4  
ATOM   7585  O O    . VAL A 1 64  ? -12.088 -19.594 -19.364 1.00 0.00 ? 1544 VAL A O    4  
ATOM   7586  C CB   . VAL A 1 64  ? -10.339 -17.196 -17.921 1.00 0.00 ? 1544 VAL A CB   4  
ATOM   7587  C CG1  . VAL A 1 64  ? -9.192  -16.644 -17.080 1.00 0.00 ? 1544 VAL A CG1  4  
ATOM   7588  C CG2  . VAL A 1 64  ? -10.080 -16.770 -19.370 1.00 0.00 ? 1544 VAL A CG2  4  
ATOM   7589  H H    . VAL A 1 64  ? -9.763  -19.702 -19.465 1.00 0.00 ? 1544 VAL A H    4  
ATOM   7590  H HA   . VAL A 1 64  ? -10.449 -18.970 -16.691 1.00 0.00 ? 1544 VAL A HA   4  
ATOM   7591  H HB   . VAL A 1 64  ? -11.241 -16.690 -17.579 1.00 0.00 ? 1544 VAL A HB   4  
ATOM   7592  H HG11 . VAL A 1 64  ? -8.228  -17.012 -17.437 1.00 0.00 ? 1544 VAL A HG11 4  
ATOM   7593  H HG12 . VAL A 1 64  ? -9.205  -15.557 -17.130 1.00 0.00 ? 1544 VAL A HG12 4  
ATOM   7594  H HG13 . VAL A 1 64  ? -9.347  -16.937 -16.047 1.00 0.00 ? 1544 VAL A HG13 4  
ATOM   7595  H HG21 . VAL A 1 64  ? -10.952 -17.004 -19.981 1.00 0.00 ? 1544 VAL A HG21 4  
ATOM   7596  H HG22 . VAL A 1 64  ? -9.899  -15.697 -19.389 1.00 0.00 ? 1544 VAL A HG22 4  
ATOM   7597  H HG23 . VAL A 1 64  ? -9.194  -17.265 -19.768 1.00 0.00 ? 1544 VAL A HG23 4  
ATOM   7598  N N    . THR A 1 65  ? -12.902 -18.905 -17.382 1.00 0.00 ? 1545 THR A N    4  
ATOM   7599  C CA   . THR A 1 65  ? -14.298 -19.012 -17.739 1.00 0.00 ? 1545 THR A CA   4  
ATOM   7600  C C    . THR A 1 65  ? -14.726 -17.610 -18.202 1.00 0.00 ? 1545 THR A C    4  
ATOM   7601  O O    . THR A 1 65  ? -14.193 -16.601 -17.731 1.00 0.00 ? 1545 THR A O    4  
ATOM   7602  C CB   . THR A 1 65  ? -15.059 -19.560 -16.528 1.00 0.00 ? 1545 THR A CB   4  
ATOM   7603  O OG1  . THR A 1 65  ? -14.732 -20.917 -16.330 1.00 0.00 ? 1545 THR A OG1  4  
ATOM   7604  C CG2  . THR A 1 65  ? -16.577 -19.461 -16.666 1.00 0.00 ? 1545 THR A CG2  4  
ATOM   7605  H H    . THR A 1 65  ? -12.701 -18.392 -16.530 1.00 0.00 ? 1545 THR A H    4  
ATOM   7606  H HA   . THR A 1 65  ? -14.421 -19.715 -18.555 1.00 0.00 ? 1545 THR A HA   4  
ATOM   7607  H HB   . THR A 1 65  ? -14.750 -19.012 -15.649 1.00 0.00 ? 1545 THR A HB   4  
ATOM   7608  H HG1  . THR A 1 65  ? -13.848 -20.986 -15.914 1.00 0.00 ? 1545 THR A HG1  4  
ATOM   7609  H HG21 . THR A 1 65  ? -16.871 -18.408 -16.647 1.00 0.00 ? 1545 THR A HG21 4  
ATOM   7610  H HG22 . THR A 1 65  ? -16.909 -19.937 -17.591 1.00 0.00 ? 1545 THR A HG22 4  
ATOM   7611  H HG23 . THR A 1 65  ? -17.049 -19.971 -15.829 1.00 0.00 ? 1545 THR A HG23 4  
ATOM   7612  N N    . ALA A 1 66  ? -15.677 -17.540 -19.127 1.00 0.00 ? 1546 ALA A N    4  
ATOM   7613  C CA   . ALA A 1 66  ? -16.182 -16.323 -19.731 1.00 0.00 ? 1546 ALA A CA   4  
ATOM   7614  C C    . ALA A 1 66  ? -17.710 -16.372 -19.646 1.00 0.00 ? 1546 ALA A C    4  
ATOM   7615  O O    . ALA A 1 66  ? -18.289 -17.423 -19.950 1.00 0.00 ? 1546 ALA A O    4  
ATOM   7616  C CB   . ALA A 1 66  ? -15.714 -16.244 -21.185 1.00 0.00 ? 1546 ALA A CB   4  
ATOM   7617  H H    . ALA A 1 66  ? -16.110 -18.403 -19.444 1.00 0.00 ? 1546 ALA A H    4  
ATOM   7618  H HA   . ALA A 1 66  ? -15.776 -15.456 -19.218 1.00 0.00 ? 1546 ALA A HA   4  
ATOM   7619  H HB1  . ALA A 1 66  ? -16.079 -15.310 -21.607 1.00 0.00 ? 1546 ALA A HB1  4  
ATOM   7620  H HB2  . ALA A 1 66  ? -14.627 -16.248 -21.237 1.00 0.00 ? 1546 ALA A HB2  4  
ATOM   7621  H HB3  . ALA A 1 66  ? -16.115 -17.077 -21.765 1.00 0.00 ? 1546 ALA A HB3  4  
ATOM   7622  N N    . LEU A 1 67  ? -18.354 -15.269 -19.243 1.00 0.00 ? 1547 LEU A N    4  
ATOM   7623  C CA   . LEU A 1 67  ? -19.817 -15.151 -19.169 1.00 0.00 ? 1547 LEU A CA   4  
ATOM   7624  C C    . LEU A 1 67  ? -20.272 -14.033 -20.098 1.00 0.00 ? 1547 LEU A C    4  
ATOM   7625  O O    . LEU A 1 67  ? -19.888 -12.878 -19.916 1.00 0.00 ? 1547 LEU A O    4  
ATOM   7626  C CB   . LEU A 1 67  ? -20.314 -14.861 -17.735 1.00 0.00 ? 1547 LEU A CB   4  
ATOM   7627  C CG   . LEU A 1 67  ? -20.472 -16.060 -16.795 1.00 0.00 ? 1547 LEU A CG   4  
ATOM   7628  C CD1  . LEU A 1 67  ? -21.697 -16.909 -17.130 1.00 0.00 ? 1547 LEU A CD1  4  
ATOM   7629  C CD2  . LEU A 1 67  ? -19.240 -16.954 -16.656 1.00 0.00 ? 1547 LEU A CD2  4  
ATOM   7630  H H    . LEU A 1 67  ? -17.806 -14.466 -18.956 1.00 0.00 ? 1547 LEU A H    4  
ATOM   7631  H HA   . LEU A 1 67  ? -20.267 -16.082 -19.498 1.00 0.00 ? 1547 LEU A HA   4  
ATOM   7632  H HB2  . LEU A 1 67  ? -19.660 -14.118 -17.267 1.00 0.00 ? 1547 LEU A HB2  4  
ATOM   7633  H HB3  . LEU A 1 67  ? -21.323 -14.433 -17.785 1.00 0.00 ? 1547 LEU A HB3  4  
ATOM   7634  H HG   . LEU A 1 67  ? -20.675 -15.631 -15.824 1.00 0.00 ? 1547 LEU A HG   4  
ATOM   7635  H HD11 . LEU A 1 67  ? -21.633 -17.298 -18.146 1.00 0.00 ? 1547 LEU A HD11 4  
ATOM   7636  H HD12 . LEU A 1 67  ? -21.773 -17.733 -16.418 1.00 0.00 ? 1547 LEU A HD12 4  
ATOM   7637  H HD13 . LEU A 1 67  ? -22.601 -16.302 -17.055 1.00 0.00 ? 1547 LEU A HD13 4  
ATOM   7638  H HD21 . LEU A 1 67  ? -18.356 -16.334 -16.488 1.00 0.00 ? 1547 LEU A HD21 4  
ATOM   7639  H HD22 . LEU A 1 67  ? -19.369 -17.632 -15.810 1.00 0.00 ? 1547 LEU A HD22 4  
ATOM   7640  H HD23 . LEU A 1 67  ? -19.114 -17.554 -17.553 1.00 0.00 ? 1547 LEU A HD23 4  
ATOM   7641  N N    . SER A 1 68  ? -21.086 -14.365 -21.096 1.00 0.00 ? 1548 SER A N    4  
ATOM   7642  C CA   . SER A 1 68  ? -21.744 -13.398 -21.970 1.00 0.00 ? 1548 SER A CA   4  
ATOM   7643  C C    . SER A 1 68  ? -22.738 -12.522 -21.191 1.00 0.00 ? 1548 SER A C    4  
ATOM   7644  O O    . SER A 1 68  ? -23.114 -12.836 -20.059 1.00 0.00 ? 1548 SER A O    4  
ATOM   7645  C CB   . SER A 1 68  ? -22.406 -14.167 -23.124 1.00 0.00 ? 1548 SER A CB   4  
ATOM   7646  O OG   . SER A 1 68  ? -21.418 -14.937 -23.802 1.00 0.00 ? 1548 SER A OG   4  
ATOM   7647  H H    . SER A 1 68  ? -21.302 -15.344 -21.253 1.00 0.00 ? 1548 SER A H    4  
ATOM   7648  H HA   . SER A 1 68  ? -20.995 -12.728 -22.386 1.00 0.00 ? 1548 SER A HA   4  
ATOM   7649  H HB2  . SER A 1 68  ? -23.180 -14.831 -22.732 1.00 0.00 ? 1548 SER A HB2  4  
ATOM   7650  H HB3  . SER A 1 68  ? -22.870 -13.463 -23.816 1.00 0.00 ? 1548 SER A HB3  4  
ATOM   7651  H HG   . SER A 1 68  ? -21.828 -15.370 -24.579 1.00 0.00 ? 1548 SER A HG   4  
ATOM   7652  N N    . GLU A 1 69  ? -23.183 -11.424 -21.815 1.00 0.00 ? 1549 GLU A N    4  
ATOM   7653  C CA   . GLU A 1 69  ? -24.191 -10.534 -21.236 1.00 0.00 ? 1549 GLU A CA   4  
ATOM   7654  C C    . GLU A 1 69  ? -25.512 -11.296 -21.040 1.00 0.00 ? 1549 GLU A C    4  
ATOM   7655  O O    . GLU A 1 69  ? -26.190 -11.112 -20.028 1.00 0.00 ? 1549 GLU A O    4  
ATOM   7656  C CB   . GLU A 1 69  ? -24.362 -9.306  -22.145 1.00 0.00 ? 1549 GLU A CB   4  
ATOM   7657  C CG   . GLU A 1 69  ? -25.258 -8.230  -21.516 1.00 0.00 ? 1549 GLU A CG   4  
ATOM   7658  C CD   . GLU A 1 69  ? -25.362 -6.988  -22.419 1.00 0.00 ? 1549 GLU A CD   4  
ATOM   7659  O OE1  . GLU A 1 69  ? -26.231 -6.969  -23.327 1.00 0.00 ? 1549 GLU A OE1  4  
ATOM   7660  O OE2  . GLU A 1 69  ? -24.581 -6.026  -22.230 1.00 0.00 ? 1549 GLU A OE2  4  
ATOM   7661  H H    . GLU A 1 69  ? -22.804 -11.170 -22.725 1.00 0.00 ? 1549 GLU A H    4  
ATOM   7662  H HA   . GLU A 1 69  ? -23.832 -10.197 -20.260 1.00 0.00 ? 1549 GLU A HA   4  
ATOM   7663  H HB2  . GLU A 1 69  ? -23.378 -8.869  -22.329 1.00 0.00 ? 1549 GLU A HB2  4  
ATOM   7664  H HB3  . GLU A 1 69  ? -24.786 -9.617  -23.099 1.00 0.00 ? 1549 GLU A HB3  4  
ATOM   7665  H HG2  . GLU A 1 69  ? -26.254 -8.643  -21.349 1.00 0.00 ? 1549 GLU A HG2  4  
ATOM   7666  H HG3  . GLU A 1 69  ? -24.839 -7.950  -20.545 1.00 0.00 ? 1549 GLU A HG3  4  
ATOM   7667  N N    . ASP A 1 70  ? -25.833 -12.224 -21.955 1.00 0.00 ? 1550 ASP A N    4  
ATOM   7668  C CA   . ASP A 1 70  ? -26.962 -13.159 -21.814 1.00 0.00 ? 1550 ASP A CA   4  
ATOM   7669  C C    . ASP A 1 70  ? -26.517 -14.414 -21.061 1.00 0.00 ? 1550 ASP A C    4  
ATOM   7670  O O    . ASP A 1 70  ? -26.930 -15.533 -21.347 1.00 0.00 ? 1550 ASP A O    4  
ATOM   7671  C CB   . ASP A 1 70  ? -27.588 -13.507 -23.165 1.00 0.00 ? 1550 ASP A CB   4  
ATOM   7672  C CG   . ASP A 1 70  ? -28.946 -14.245 -23.049 1.00 0.00 ? 1550 ASP A CG   4  
ATOM   7673  O OD1  . ASP A 1 70  ? -29.557 -14.320 -21.950 1.00 0.00 ? 1550 ASP A OD1  4  
ATOM   7674  O OD2  . ASP A 1 70  ? -29.420 -14.762 -24.087 1.00 0.00 ? 1550 ASP A OD2  4  
ATOM   7675  H H    . ASP A 1 70  ? -25.224 -12.333 -22.756 1.00 0.00 ? 1550 ASP A H    4  
ATOM   7676  H HA   . ASP A 1 70  ? -27.733 -12.666 -21.227 1.00 0.00 ? 1550 ASP A HA   4  
ATOM   7677  H HB2  . ASP A 1 70  ? -27.738 -12.585 -23.723 1.00 0.00 ? 1550 ASP A HB2  4  
ATOM   7678  H HB3  . ASP A 1 70  ? -26.876 -14.134 -23.698 1.00 0.00 ? 1550 ASP A HB3  4  
ATOM   7679  N N    . GLU A 1 71  ? -25.627 -14.238 -20.088 1.00 0.00 ? 1551 GLU A N    4  
ATOM   7680  C CA   . GLU A 1 71  ? -25.187 -15.206 -19.095 1.00 0.00 ? 1551 GLU A CA   4  
ATOM   7681  C C    . GLU A 1 71  ? -24.629 -16.545 -19.610 1.00 0.00 ? 1551 GLU A C    4  
ATOM   7682  O O    . GLU A 1 71  ? -24.338 -17.406 -18.786 1.00 0.00 ? 1551 GLU A O    4  
ATOM   7683  C CB   . GLU A 1 71  ? -26.264 -15.436 -18.007 1.00 0.00 ? 1551 GLU A CB   4  
ATOM   7684  C CG   . GLU A 1 71  ? -27.579 -14.636 -17.975 1.00 0.00 ? 1551 GLU A CG   4  
ATOM   7685  C CD   . GLU A 1 71  ? -28.636 -15.426 -17.192 1.00 0.00 ? 1551 GLU A CD   4  
ATOM   7686  O OE1  . GLU A 1 71  ? -28.479 -15.589 -15.962 1.00 0.00 ? 1551 GLU A OE1  4  
ATOM   7687  O OE2  . GLU A 1 71  ? -29.621 -15.895 -17.812 1.00 0.00 ? 1551 GLU A OE2  4  
ATOM   7688  H H    . GLU A 1 71  ? -25.274 -13.296 -19.960 1.00 0.00 ? 1551 GLU A H    4  
ATOM   7689  H HA   . GLU A 1 71  ? -24.346 -14.726 -18.588 1.00 0.00 ? 1551 GLU A HA   4  
ATOM   7690  H HB2  . GLU A 1 71  ? -26.551 -16.488 -18.035 1.00 0.00 ? 1551 GLU A HB2  4  
ATOM   7691  H HB3  . GLU A 1 71  ? -25.765 -15.252 -17.060 1.00 0.00 ? 1551 GLU A HB3  4  
ATOM   7692  H HG2  . GLU A 1 71  ? -27.404 -13.666 -17.508 1.00 0.00 ? 1551 GLU A HG2  4  
ATOM   7693  H HG3  . GLU A 1 71  ? -27.969 -14.465 -18.975 1.00 0.00 ? 1551 GLU A HG3  4  
ATOM   7694  N N    . TYR A 1 72  ? -24.492 -16.784 -20.913 1.00 0.00 ? 1552 TYR A N    4  
ATOM   7695  C CA   . TYR A 1 72  ? -23.938 -18.043 -21.396 1.00 0.00 ? 1552 TYR A CA   4  
ATOM   7696  C C    . TYR A 1 72  ? -22.517 -18.205 -20.867 1.00 0.00 ? 1552 TYR A C    4  
ATOM   7697  O O    . TYR A 1 72  ? -21.715 -17.271 -20.930 1.00 0.00 ? 1552 TYR A O    4  
ATOM   7698  C CB   . TYR A 1 72  ? -24.024 -18.145 -22.917 1.00 0.00 ? 1552 TYR A CB   4  
ATOM   7699  C CG   . TYR A 1 72  ? -25.429 -18.500 -23.369 1.00 0.00 ? 1552 TYR A CG   4  
ATOM   7700  C CD1  . TYR A 1 72  ? -25.874 -19.832 -23.259 1.00 0.00 ? 1552 TYR A CD1  4  
ATOM   7701  C CD2  . TYR A 1 72  ? -26.290 -17.515 -23.887 1.00 0.00 ? 1552 TYR A CD2  4  
ATOM   7702  C CE1  . TYR A 1 72  ? -27.187 -20.176 -23.618 1.00 0.00 ? 1552 TYR A CE1  4  
ATOM   7703  C CE2  . TYR A 1 72  ? -27.596 -17.858 -24.275 1.00 0.00 ? 1552 TYR A CE2  4  
ATOM   7704  C CZ   . TYR A 1 72  ? -28.054 -19.191 -24.146 1.00 0.00 ? 1552 TYR A CZ   4  
ATOM   7705  O OH   . TYR A 1 72  ? -29.323 -19.538 -24.516 1.00 0.00 ? 1552 TYR A OH   4  
ATOM   7706  H H    . TYR A 1 72  ? -24.854 -16.115 -21.578 1.00 0.00 ? 1552 TYR A H    4  
ATOM   7707  H HA   . TYR A 1 72  ? -24.545 -18.848 -20.982 1.00 0.00 ? 1552 TYR A HA   4  
ATOM   7708  H HB2  . TYR A 1 72  ? -23.692 -17.212 -23.371 1.00 0.00 ? 1552 TYR A HB2  4  
ATOM   7709  H HB3  . TYR A 1 72  ? -23.355 -18.940 -23.251 1.00 0.00 ? 1552 TYR A HB3  4  
ATOM   7710  H HD1  . TYR A 1 72  ? -25.209 -20.598 -22.895 1.00 0.00 ? 1552 TYR A HD1  4  
ATOM   7711  H HD2  . TYR A 1 72  ? -25.951 -16.494 -23.989 1.00 0.00 ? 1552 TYR A HD2  4  
ATOM   7712  H HE1  . TYR A 1 72  ? -27.533 -21.191 -23.488 1.00 0.00 ? 1552 TYR A HE1  4  
ATOM   7713  H HE2  . TYR A 1 72  ? -28.245 -17.090 -24.674 1.00 0.00 ? 1552 TYR A HE2  4  
ATOM   7714  H HH   . TYR A 1 72  ? -29.839 -18.804 -24.903 1.00 0.00 ? 1552 TYR A HH   4  
ATOM   7715  N N    . PHE A 1 73  ? -22.245 -19.380 -20.310 1.00 0.00 ? 1553 PHE A N    4  
ATOM   7716  C CA   . PHE A 1 73  ? -21.049 -19.721 -19.567 1.00 0.00 ? 1553 PHE A CA   4  
ATOM   7717  C C    . PHE A 1 73  ? -20.248 -20.686 -20.447 1.00 0.00 ? 1553 PHE A C    4  
ATOM   7718  O O    . PHE A 1 73  ? -20.791 -21.662 -20.979 1.00 0.00 ? 1553 PHE A O    4  
ATOM   7719  C CB   . PHE A 1 73  ? -21.442 -20.284 -18.185 1.00 0.00 ? 1553 PHE A CB   4  
ATOM   7720  C CG   . PHE A 1 73  ? -21.097 -21.735 -17.960 1.00 0.00 ? 1553 PHE A CG   4  
ATOM   7721  C CD1  . PHE A 1 73  ? -19.807 -22.065 -17.512 1.00 0.00 ? 1553 PHE A CD1  4  
ATOM   7722  C CD2  . PHE A 1 73  ? -22.044 -22.748 -18.198 1.00 0.00 ? 1553 PHE A CD2  4  
ATOM   7723  C CE1  . PHE A 1 73  ? -19.423 -23.407 -17.388 1.00 0.00 ? 1553 PHE A CE1  4  
ATOM   7724  C CE2  . PHE A 1 73  ? -21.659 -24.097 -18.082 1.00 0.00 ? 1553 PHE A CE2  4  
ATOM   7725  C CZ   . PHE A 1 73  ? -20.343 -24.428 -17.698 1.00 0.00 ? 1553 PHE A CZ   4  
ATOM   7726  H H    . PHE A 1 73  ? -22.914 -20.133 -20.419 1.00 0.00 ? 1553 PHE A H    4  
ATOM   7727  H HA   . PHE A 1 73  ? -20.463 -18.833 -19.365 1.00 0.00 ? 1553 PHE A HA   4  
ATOM   7728  H HB2  . PHE A 1 73  ? -20.922 -19.700 -17.425 1.00 0.00 ? 1553 PHE A HB2  4  
ATOM   7729  H HB3  . PHE A 1 73  ? -22.507 -20.142 -18.012 1.00 0.00 ? 1553 PHE A HB3  4  
ATOM   7730  H HD1  . PHE A 1 73  ? -19.102 -21.290 -17.252 1.00 0.00 ? 1553 PHE A HD1  4  
ATOM   7731  H HD2  . PHE A 1 73  ? -23.066 -22.485 -18.471 1.00 0.00 ? 1553 PHE A HD2  4  
ATOM   7732  H HE1  . PHE A 1 73  ? -18.418 -23.625 -17.044 1.00 0.00 ? 1553 PHE A HE1  4  
ATOM   7733  H HE2  . PHE A 1 73  ? -22.374 -24.883 -18.289 1.00 0.00 ? 1553 PHE A HE2  4  
ATOM   7734  H HZ   . PHE A 1 73  ? -20.037 -25.463 -17.631 1.00 0.00 ? 1553 PHE A HZ   4  
ATOM   7735  N N    . SER A 1 74  ? -18.959 -20.406 -20.623 1.00 0.00 ? 1554 SER A N    4  
ATOM   7736  C CA   . SER A 1 74  ? -18.016 -21.297 -21.291 1.00 0.00 ? 1554 SER A CA   4  
ATOM   7737  C C    . SER A 1 74  ? -16.625 -21.077 -20.698 1.00 0.00 ? 1554 SER A C    4  
ATOM   7738  O O    . SER A 1 74  ? -16.426 -20.101 -19.979 1.00 0.00 ? 1554 SER A O    4  
ATOM   7739  C CB   . SER A 1 74  ? -17.964 -20.993 -22.797 1.00 0.00 ? 1554 SER A CB   4  
ATOM   7740  O OG   . SER A 1 74  ? -19.229 -20.989 -23.445 1.00 0.00 ? 1554 SER A OG   4  
ATOM   7741  H H    . SER A 1 74  ? -18.571 -19.558 -20.221 1.00 0.00 ? 1554 SER A H    4  
ATOM   7742  H HA   . SER A 1 74  ? -18.310 -22.335 -21.128 1.00 0.00 ? 1554 SER A HA   4  
ATOM   7743  H HB2  . SER A 1 74  ? -17.490 -20.025 -22.951 1.00 0.00 ? 1554 SER A HB2  4  
ATOM   7744  H HB3  . SER A 1 74  ? -17.343 -21.759 -23.247 1.00 0.00 ? 1554 SER A HB3  4  
ATOM   7745  H HG   . SER A 1 74  ? -19.785 -21.690 -23.049 1.00 0.00 ? 1554 SER A HG   4  
ATOM   7746  N N    . ALA A 1 75  ? -15.638 -21.899 -21.065 1.00 0.00 ? 1555 ALA A N    4  
ATOM   7747  C CA   . ALA A 1 75  ? -14.239 -21.658 -20.733 1.00 0.00 ? 1555 ALA A CA   4  
ATOM   7748  C C    . ALA A 1 75  ? -13.391 -21.656 -22.001 1.00 0.00 ? 1555 ALA A C    4  
ATOM   7749  O O    . ALA A 1 75  ? -13.767 -22.248 -23.016 1.00 0.00 ? 1555 ALA A O    4  
ATOM   7750  C CB   . ALA A 1 75  ? -13.757 -22.679 -19.696 1.00 0.00 ? 1555 ALA A CB   4  
ATOM   7751  H H    . ALA A 1 75  ? -15.832 -22.678 -21.682 1.00 0.00 ? 1555 ALA A H    4  
ATOM   7752  H HA   . ALA A 1 75  ? -14.137 -20.668 -20.297 1.00 0.00 ? 1555 ALA A HA   4  
ATOM   7753  H HB1  . ALA A 1 75  ? -12.719 -22.470 -19.432 1.00 0.00 ? 1555 ALA A HB1  4  
ATOM   7754  H HB2  . ALA A 1 75  ? -14.369 -22.595 -18.796 1.00 0.00 ? 1555 ALA A HB2  4  
ATOM   7755  H HB3  . ALA A 1 75  ? -13.824 -23.687 -20.103 1.00 0.00 ? 1555 ALA A HB3  4  
ATOM   7756  N N    . GLY A 1 76  ? -12.264 -20.955 -21.939 1.00 0.00 ? 1556 GLY A N    4  
ATOM   7757  C CA   . GLY A 1 76  ? -11.368 -20.669 -23.046 1.00 0.00 ? 1556 GLY A CA   4  
ATOM   7758  C C    . GLY A 1 76  ? -10.099 -20.057 -22.467 1.00 0.00 ? 1556 GLY A C    4  
ATOM   7759  O O    . GLY A 1 76  ? -9.837  -20.206 -21.271 1.00 0.00 ? 1556 GLY A O    4  
ATOM   7760  H H    . GLY A 1 76  ? -12.002 -20.537 -21.045 1.00 0.00 ? 1556 GLY A H    4  
ATOM   7761  H HA2  . GLY A 1 76  ? -11.117 -21.588 -23.581 1.00 0.00 ? 1556 GLY A HA2  4  
ATOM   7762  H HA3  . GLY A 1 76  ? -11.844 -19.971 -23.737 1.00 0.00 ? 1556 GLY A HA3  4  
ATOM   7763  N N    . VAL A 1 77  ? -9.302  -19.365 -23.277 1.00 0.00 ? 1557 VAL A N    4  
ATOM   7764  C CA   . VAL A 1 77  ? -7.992  -18.876 -22.847 1.00 0.00 ? 1557 VAL A CA   4  
ATOM   7765  C C    . VAL A 1 77  ? -7.817  -17.422 -23.246 1.00 0.00 ? 1557 VAL A C    4  
ATOM   7766  O O    . VAL A 1 77  ? -8.178  -17.027 -24.350 1.00 0.00 ? 1557 VAL A O    4  
ATOM   7767  C CB   . VAL A 1 77  ? -6.892  -19.799 -23.417 1.00 0.00 ? 1557 VAL A CB   4  
ATOM   7768  C CG1  . VAL A 1 77  ? -5.524  -19.126 -23.558 1.00 0.00 ? 1557 VAL A CG1  4  
ATOM   7769  C CG2  . VAL A 1 77  ? -6.689  -20.995 -22.483 1.00 0.00 ? 1557 VAL A CG2  4  
ATOM   7770  H H    . VAL A 1 77  ? -9.591  -19.218 -24.244 1.00 0.00 ? 1557 VAL A H    4  
ATOM   7771  H HA   . VAL A 1 77  ? -7.931  -18.911 -21.762 1.00 0.00 ? 1557 VAL A HA   4  
ATOM   7772  H HB   . VAL A 1 77  ? -7.198  -20.161 -24.399 1.00 0.00 ? 1557 VAL A HB   4  
ATOM   7773  H HG11 . VAL A 1 77  ? -5.248  -18.663 -22.612 1.00 0.00 ? 1557 VAL A HG11 4  
ATOM   7774  H HG12 . VAL A 1 77  ? -4.773  -19.860 -23.841 1.00 0.00 ? 1557 VAL A HG12 4  
ATOM   7775  H HG13 . VAL A 1 77  ? -5.555  -18.360 -24.331 1.00 0.00 ? 1557 VAL A HG13 4  
ATOM   7776  H HG21 . VAL A 1 77  ? -6.222  -20.650 -21.564 1.00 0.00 ? 1557 VAL A HG21 4  
ATOM   7777  H HG22 . VAL A 1 77  ? -7.645  -21.464 -22.253 1.00 0.00 ? 1557 VAL A HG22 4  
ATOM   7778  H HG23 . VAL A 1 77  ? -6.035  -21.724 -22.962 1.00 0.00 ? 1557 VAL A HG23 4  
ATOM   7779  N N    . VAL A 1 78  ? -7.222  -16.621 -22.365 1.00 0.00 ? 1558 VAL A N    4  
ATOM   7780  C CA   . VAL A 1 78  ? -6.834  -15.257 -22.694 1.00 0.00 ? 1558 VAL A CA   4  
ATOM   7781  C C    . VAL A 1 78  ? -5.773  -15.296 -23.790 1.00 0.00 ? 1558 VAL A C    4  
ATOM   7782  O O    . VAL A 1 78  ? -4.758  -15.968 -23.609 1.00 0.00 ? 1558 VAL A O    4  
ATOM   7783  C CB   . VAL A 1 78  ? -6.261  -14.573 -21.438 1.00 0.00 ? 1558 VAL A CB   4  
ATOM   7784  C CG1  . VAL A 1 78  ? -5.836  -13.128 -21.736 1.00 0.00 ? 1558 VAL A CG1  4  
ATOM   7785  C CG2  . VAL A 1 78  ? -7.259  -14.538 -20.281 1.00 0.00 ? 1558 VAL A CG2  4  
ATOM   7786  H H    . VAL A 1 78  ? -6.887  -17.015 -21.491 1.00 0.00 ? 1558 VAL A H    4  
ATOM   7787  H HA   . VAL A 1 78  ? -7.713  -14.720 -23.048 1.00 0.00 ? 1558 VAL A HA   4  
ATOM   7788  H HB   . VAL A 1 78  ? -5.388  -15.139 -21.110 1.00 0.00 ? 1558 VAL A HB   4  
ATOM   7789  H HG11 . VAL A 1 78  ? -5.075  -13.107 -22.515 1.00 0.00 ? 1558 VAL A HG11 4  
ATOM   7790  H HG12 . VAL A 1 78  ? -6.687  -12.535 -22.080 1.00 0.00 ? 1558 VAL A HG12 4  
ATOM   7791  H HG13 . VAL A 1 78  ? -5.409  -12.678 -20.839 1.00 0.00 ? 1558 VAL A HG13 4  
ATOM   7792  H HG21 . VAL A 1 78  ? -6.803  -14.021 -19.444 1.00 0.00 ? 1558 VAL A HG21 4  
ATOM   7793  H HG22 . VAL A 1 78  ? -8.156  -13.995 -20.568 1.00 0.00 ? 1558 VAL A HG22 4  
ATOM   7794  H HG23 . VAL A 1 78  ? -7.514  -15.547 -19.960 1.00 0.00 ? 1558 VAL A HG23 4  
ATOM   7795  N N    . LYS A 1 79  ? -5.925  -14.520 -24.869 1.00 0.00 ? 1559 LYS A N    4  
ATOM   7796  C CA   . LYS A 1 79  ? -4.865  -14.325 -25.868 1.00 0.00 ? 1559 LYS A CA   4  
ATOM   7797  C C    . LYS A 1 79  ? -4.695  -12.847 -26.243 1.00 0.00 ? 1559 LYS A C    4  
ATOM   7798  O O    . LYS A 1 79  ? -3.988  -12.541 -27.205 1.00 0.00 ? 1559 LYS A O    4  
ATOM   7799  C CB   . LYS A 1 79  ? -5.087  -15.235 -27.094 1.00 0.00 ? 1559 LYS A CB   4  
ATOM   7800  C CG   . LYS A 1 79  ? -4.908  -16.720 -26.734 1.00 0.00 ? 1559 LYS A CG   4  
ATOM   7801  C CD   . LYS A 1 79  ? -4.656  -17.582 -27.979 1.00 0.00 ? 1559 LYS A CD   4  
ATOM   7802  C CE   . LYS A 1 79  ? -4.440  -19.052 -27.580 1.00 0.00 ? 1559 LYS A CE   4  
ATOM   7803  N NZ   . LYS A 1 79  ? -4.243  -19.930 -28.763 1.00 0.00 ? 1559 LYS A NZ   4  
ATOM   7804  H H    . LYS A 1 79  ? -6.810  -14.036 -25.017 1.00 0.00 ? 1559 LYS A H    4  
ATOM   7805  H HA   . LYS A 1 79  ? -3.911  -14.606 -25.413 1.00 0.00 ? 1559 LYS A HA   4  
ATOM   7806  H HB2  . LYS A 1 79  ? -6.080  -15.069 -27.517 1.00 0.00 ? 1559 LYS A HB2  4  
ATOM   7807  H HB3  . LYS A 1 79  ? -4.343  -14.984 -27.854 1.00 0.00 ? 1559 LYS A HB3  4  
ATOM   7808  H HG2  . LYS A 1 79  ? -4.051  -16.828 -26.068 1.00 0.00 ? 1559 LYS A HG2  4  
ATOM   7809  H HG3  . LYS A 1 79  ? -5.802  -17.069 -26.219 1.00 0.00 ? 1559 LYS A HG3  4  
ATOM   7810  H HD2  . LYS A 1 79  ? -5.507  -17.488 -28.646 1.00 0.00 ? 1559 LYS A HD2  4  
ATOM   7811  H HD3  . LYS A 1 79  ? -3.761  -17.220 -28.490 1.00 0.00 ? 1559 LYS A HD3  4  
ATOM   7812  H HE2  . LYS A 1 79  ? -3.563  -19.110 -26.932 1.00 0.00 ? 1559 LYS A HE2  4  
ATOM   7813  H HE3  . LYS A 1 79  ? -5.305  -19.403 -27.010 1.00 0.00 ? 1559 LYS A HE3  4  
ATOM   7814  H HZ1  . LYS A 1 79  ? -5.073  -19.917 -29.364 1.00 0.00 ? 1559 LYS A HZ1  4  
ATOM   7815  H HZ2  . LYS A 1 79  ? -3.447  -19.643 -29.319 1.00 0.00 ? 1559 LYS A HZ2  4  
ATOM   7816  H HZ3  . LYS A 1 79  ? -4.091  -20.891 -28.480 1.00 0.00 ? 1559 LYS A HZ3  4  
ATOM   7817  N N    . GLY A 1 80  ? -5.273  -11.920 -25.476 1.00 0.00 ? 1560 GLY A N    4  
ATOM   7818  C CA   . GLY A 1 80  ? -5.032  -10.495 -25.637 1.00 0.00 ? 1560 GLY A CA   4  
ATOM   7819  C C    . GLY A 1 80  ? -5.845  -9.675  -24.641 1.00 0.00 ? 1560 GLY A C    4  
ATOM   7820  O O    . GLY A 1 80  ? -6.539  -10.227 -23.785 1.00 0.00 ? 1560 GLY A O    4  
ATOM   7821  H H    . GLY A 1 80  ? -5.891  -12.177 -24.720 1.00 0.00 ? 1560 GLY A H    4  
ATOM   7822  H HA2  . GLY A 1 80  ? -3.973  -10.289 -25.479 1.00 0.00 ? 1560 GLY A HA2  4  
ATOM   7823  H HA3  . GLY A 1 80  ? -5.287  -10.189 -26.650 1.00 0.00 ? 1560 GLY A HA3  4  
ATOM   7824  N N    . HIS A 1 81  ? -5.756  -8.355  -24.792 1.00 0.00 ? 1561 HIS A N    4  
ATOM   7825  C CA   . HIS A 1 81  ? -6.250  -7.339  -23.862 1.00 0.00 ? 1561 HIS A CA   4  
ATOM   7826  C C    . HIS A 1 81  ? -6.807  -6.152  -24.638 1.00 0.00 ? 1561 HIS A C    4  
ATOM   7827  O O    . HIS A 1 81  ? -6.354  -5.862  -25.748 1.00 0.00 ? 1561 HIS A O    4  
ATOM   7828  C CB   . HIS A 1 81  ? -5.100  -6.797  -23.001 1.00 0.00 ? 1561 HIS A CB   4  
ATOM   7829  C CG   . HIS A 1 81  ? -4.856  -7.557  -21.731 1.00 0.00 ? 1561 HIS A CG   4  
ATOM   7830  N ND1  . HIS A 1 81  ? -4.076  -8.708  -21.587 1.00 0.00 ? 1561 HIS A ND1  4  
ATOM   7831  C CD2  . HIS A 1 81  ? -5.295  -7.145  -20.508 1.00 0.00 ? 1561 HIS A CD2  4  
ATOM   7832  C CE1  . HIS A 1 81  ? -4.068  -8.969  -20.268 1.00 0.00 ? 1561 HIS A CE1  4  
ATOM   7833  N NE2  . HIS A 1 81  ? -4.778  -8.039  -19.599 1.00 0.00 ? 1561 HIS A NE2  4  
ATOM   7834  H H    . HIS A 1 81  ? -5.288  -8.012  -25.620 1.00 0.00 ? 1561 HIS A H    4  
ATOM   7835  H HA   . HIS A 1 81  ? -7.023  -7.759  -23.215 1.00 0.00 ? 1561 HIS A HA   4  
ATOM   7836  H HB2  . HIS A 1 81  ? -4.180  -6.757  -23.586 1.00 0.00 ? 1561 HIS A HB2  4  
ATOM   7837  H HB3  . HIS A 1 81  ? -5.329  -5.770  -22.700 1.00 0.00 ? 1561 HIS A HB3  4  
ATOM   7838  H HD2  . HIS A 1 81  ? -5.922  -6.278  -20.316 1.00 0.00 ? 1561 HIS A HD2  4  
ATOM   7839  H HE1  . HIS A 1 81  ? -3.547  -9.807  -19.812 1.00 0.00 ? 1561 HIS A HE1  4  
ATOM   7840  H HE2  . HIS A 1 81  ? -4.907  -8.007  -18.594 1.00 0.00 ? 1561 HIS A HE2  4  
ATOM   7841  N N    . ARG A 1 82  ? -7.737  -5.415  -24.021 1.00 0.00 ? 1562 ARG A N    4  
ATOM   7842  C CA   . ARG A 1 82  ? -8.253  -4.148  -24.525 1.00 0.00 ? 1562 ARG A CA   4  
ATOM   7843  C C    . ARG A 1 82  ? -8.611  -3.280  -23.324 1.00 0.00 ? 1562 ARG A C    4  
ATOM   7844  O O    . ARG A 1 82  ? -8.885  -3.797  -22.241 1.00 0.00 ? 1562 ARG A O    4  
ATOM   7845  C CB   . ARG A 1 82  ? -9.452  -4.453  -25.451 1.00 0.00 ? 1562 ARG A CB   4  
ATOM   7846  C CG   . ARG A 1 82  ? -10.401 -3.292  -25.792 1.00 0.00 ? 1562 ARG A CG   4  
ATOM   7847  C CD   . ARG A 1 82  ? -11.475 -3.819  -26.761 1.00 0.00 ? 1562 ARG A CD   4  
ATOM   7848  N NE   . ARG A 1 82  ? -12.361 -2.749  -27.259 1.00 0.00 ? 1562 ARG A NE   4  
ATOM   7849  C CZ   . ARG A 1 82  ? -13.334 -2.909  -28.165 1.00 0.00 ? 1562 ARG A CZ   4  
ATOM   7850  N NH1  . ARG A 1 82  ? -13.602 -4.109  -28.679 1.00 0.00 ? 1562 ARG A NH1  4  
ATOM   7851  N NH2  . ARG A 1 82  ? -14.041 -1.858  -28.556 1.00 0.00 ? 1562 ARG A NH2  4  
ATOM   7852  H H    . ARG A 1 82  ? -8.083  -5.706  -23.107 1.00 0.00 ? 1562 ARG A H    4  
ATOM   7853  H HA   . ARG A 1 82  ? -7.469  -3.646  -25.105 1.00 0.00 ? 1562 ARG A HA   4  
ATOM   7854  H HB2  . ARG A 1 82  ? -9.041  -4.833  -26.386 1.00 0.00 ? 1562 ARG A HB2  4  
ATOM   7855  H HB3  . ARG A 1 82  ? -10.044 -5.252  -25.010 1.00 0.00 ? 1562 ARG A HB3  4  
ATOM   7856  H HG2  . ARG A 1 82  ? -10.882 -2.919  -24.886 1.00 0.00 ? 1562 ARG A HG2  4  
ATOM   7857  H HG3  . ARG A 1 82  ? -9.840  -2.482  -26.262 1.00 0.00 ? 1562 ARG A HG3  4  
ATOM   7858  H HD2  . ARG A 1 82  ? -10.975 -4.285  -27.615 1.00 0.00 ? 1562 ARG A HD2  4  
ATOM   7859  H HD3  . ARG A 1 82  ? -12.076 -4.570  -26.247 1.00 0.00 ? 1562 ARG A HD3  4  
ATOM   7860  H HE   . ARG A 1 82  ? -12.208 -1.822  -26.876 1.00 0.00 ? 1562 ARG A HE   4  
ATOM   7861  H HH11 . ARG A 1 82  ? -13.081 -4.927  -28.401 1.00 0.00 ? 1562 ARG A HH11 4  
ATOM   7862  H HH12 . ARG A 1 82  ? -14.339 -4.252  -29.362 1.00 0.00 ? 1562 ARG A HH12 4  
ATOM   7863  H HH21 . ARG A 1 82  ? -13.843 -0.932  -28.160 1.00 0.00 ? 1562 ARG A HH21 4  
ATOM   7864  H HH22 . ARG A 1 82  ? -14.785 -1.927  -29.238 1.00 0.00 ? 1562 ARG A HH22 4  
ATOM   7865  N N    . LYS A 1 83  ? -8.664  -1.969  -23.538 1.00 0.00 ? 1563 LYS A N    4  
ATOM   7866  C CA   . LYS A 1 83  ? -9.182  -0.997  -22.588 1.00 0.00 ? 1563 LYS A CA   4  
ATOM   7867  C C    . LYS A 1 83  ? -10.243 -0.207  -23.342 1.00 0.00 ? 1563 LYS A C    4  
ATOM   7868  O O    . LYS A 1 83  ? -9.974  0.293   -24.436 1.00 0.00 ? 1563 LYS A O    4  
ATOM   7869  C CB   . LYS A 1 83  ? -8.033  -0.103  -22.095 1.00 0.00 ? 1563 LYS A CB   4  
ATOM   7870  C CG   . LYS A 1 83  ? -7.330  -0.647  -20.841 1.00 0.00 ? 1563 LYS A CG   4  
ATOM   7871  C CD   . LYS A 1 83  ? -8.230  -0.495  -19.604 1.00 0.00 ? 1563 LYS A CD   4  
ATOM   7872  C CE   . LYS A 1 83  ? -7.437  -0.385  -18.283 1.00 0.00 ? 1563 LYS A CE   4  
ATOM   7873  N NZ   . LYS A 1 83  ? -6.761  0.934   -18.108 1.00 0.00 ? 1563 LYS A NZ   4  
ATOM   7874  H H    . LYS A 1 83  ? -8.422  -1.611  -24.455 1.00 0.00 ? 1563 LYS A H    4  
ATOM   7875  H HA   . LYS A 1 83  ? -9.656  -1.507  -21.748 1.00 0.00 ? 1563 LYS A HA   4  
ATOM   7876  H HB2  . LYS A 1 83  ? -7.299  0.017   -22.891 1.00 0.00 ? 1563 LYS A HB2  4  
ATOM   7877  H HB3  . LYS A 1 83  ? -8.422  0.895   -21.875 1.00 0.00 ? 1563 LYS A HB3  4  
ATOM   7878  H HG2  . LYS A 1 83  ? -7.056  -1.702  -20.976 1.00 0.00 ? 1563 LYS A HG2  4  
ATOM   7879  H HG3  . LYS A 1 83  ? -6.411  -0.079  -20.703 1.00 0.00 ? 1563 LYS A HG3  4  
ATOM   7880  H HD2  . LYS A 1 83  ? -8.880  0.377   -19.706 1.00 0.00 ? 1563 LYS A HD2  4  
ATOM   7881  H HD3  . LYS A 1 83  ? -8.883  -1.367  -19.557 1.00 0.00 ? 1563 LYS A HD3  4  
ATOM   7882  H HE2  . LYS A 1 83  ? -8.132  -0.541  -17.450 1.00 0.00 ? 1563 LYS A HE2  4  
ATOM   7883  H HE3  . LYS A 1 83  ? -6.695  -1.185  -18.243 1.00 0.00 ? 1563 LYS A HE3  4  
ATOM   7884  H HZ1  . LYS A 1 83  ? -6.069  1.111   -18.822 1.00 0.00 ? 1563 LYS A HZ1  4  
ATOM   7885  H HZ2  . LYS A 1 83  ? -7.422  1.702   -18.115 1.00 0.00 ? 1563 LYS A HZ2  4  
ATOM   7886  H HZ3  . LYS A 1 83  ? -6.277  0.972   -17.217 1.00 0.00 ? 1563 LYS A HZ3  4  
ATOM   7887  N N    . GLU A 1 84  ? -11.455 -0.137  -22.797 1.00 0.00 ? 1564 GLU A N    4  
ATOM   7888  C CA   . GLU A 1 84  ? -12.601 0.493   -23.443 1.00 0.00 ? 1564 GLU A CA   4  
ATOM   7889  C C    . GLU A 1 84  ? -13.501 1.027   -22.340 1.00 0.00 ? 1564 GLU A C    4  
ATOM   7890  O O    . GLU A 1 84  ? -13.645 0.370   -21.310 1.00 0.00 ? 1564 GLU A O    4  
ATOM   7891  C CB   . GLU A 1 84  ? -13.324 -0.566  -24.290 1.00 0.00 ? 1564 GLU A CB   4  
ATOM   7892  C CG   . GLU A 1 84  ? -14.458 0.005   -25.151 1.00 0.00 ? 1564 GLU A CG   4  
ATOM   7893  C CD   . GLU A 1 84  ? -13.931 0.999   -26.199 1.00 0.00 ? 1564 GLU A CD   4  
ATOM   7894  O OE1  . GLU A 1 84  ? -13.529 0.546   -27.299 1.00 0.00 ? 1564 GLU A OE1  4  
ATOM   7895  O OE2  . GLU A 1 84  ? -13.913 2.224   -25.928 1.00 0.00 ? 1564 GLU A OE2  4  
ATOM   7896  H H    . GLU A 1 84  ? -11.632 -0.559  -21.886 1.00 0.00 ? 1564 GLU A H    4  
ATOM   7897  H HA   . GLU A 1 84  ? -12.266 1.317   -24.070 1.00 0.00 ? 1564 GLU A HA   4  
ATOM   7898  H HB2  . GLU A 1 84  ? -12.603 -1.048  -24.953 1.00 0.00 ? 1564 GLU A HB2  4  
ATOM   7899  H HB3  . GLU A 1 84  ? -13.736 -1.332  -23.631 1.00 0.00 ? 1564 GLU A HB3  4  
ATOM   7900  H HG2  . GLU A 1 84  ? -14.956 -0.823  -25.655 1.00 0.00 ? 1564 GLU A HG2  4  
ATOM   7901  H HG3  . GLU A 1 84  ? -15.199 0.483   -24.509 1.00 0.00 ? 1564 GLU A HG3  4  
ATOM   7902  N N    . SER A 1 85  ? -14.086 2.212   -22.530 1.00 0.00 ? 1565 SER A N    4  
ATOM   7903  C CA   . SER A 1 85  ? -14.933 2.885   -21.542 1.00 0.00 ? 1565 SER A CA   4  
ATOM   7904  C C    . SER A 1 85  ? -14.273 2.999   -20.148 1.00 0.00 ? 1565 SER A C    4  
ATOM   7905  O O    . SER A 1 85  ? -14.966 3.044   -19.128 1.00 0.00 ? 1565 SER A O    4  
ATOM   7906  C CB   . SER A 1 85  ? -16.309 2.194   -21.508 1.00 0.00 ? 1565 SER A CB   4  
ATOM   7907  O OG   . SER A 1 85  ? -16.898 2.172   -22.805 1.00 0.00 ? 1565 SER A OG   4  
ATOM   7908  H H    . SER A 1 85  ? -13.988 2.667   -23.429 1.00 0.00 ? 1565 SER A H    4  
ATOM   7909  H HA   . SER A 1 85  ? -15.085 3.906   -21.892 1.00 0.00 ? 1565 SER A HA   4  
ATOM   7910  H HB2  . SER A 1 85  ? -16.194 1.172   -21.136 1.00 0.00 ? 1565 SER A HB2  4  
ATOM   7911  H HB3  . SER A 1 85  ? -16.954 2.740   -20.825 1.00 0.00 ? 1565 SER A HB3  4  
ATOM   7912  H HG   . SER A 1 85  ? -17.795 1.786   -22.735 1.00 0.00 ? 1565 SER A HG   4  
ATOM   7913  N N    . GLY A 1 86  ? -12.933 3.039   -20.094 1.00 0.00 ? 1566 GLY A N    4  
ATOM   7914  C CA   . GLY A 1 86  ? -12.176 3.076   -18.849 1.00 0.00 ? 1566 GLY A CA   4  
ATOM   7915  C C    . GLY A 1 86  ? -12.305 1.769   -18.057 1.00 0.00 ? 1566 GLY A C    4  
ATOM   7916  O O    . GLY A 1 86  ? -12.276 1.803   -16.825 1.00 0.00 ? 1566 GLY A O    4  
ATOM   7917  H H    . GLY A 1 86  ? -12.413 3.025   -20.961 1.00 0.00 ? 1566 GLY A H    4  
ATOM   7918  H HA2  . GLY A 1 86  ? -11.126 3.242   -19.083 1.00 0.00 ? 1566 GLY A HA2  4  
ATOM   7919  H HA3  . GLY A 1 86  ? -12.536 3.903   -18.240 1.00 0.00 ? 1566 GLY A HA3  4  
ATOM   7920  N N    . GLU A 1 87  ? -12.464 0.624   -18.729 1.00 0.00 ? 1567 GLU A N    4  
ATOM   7921  C CA   . GLU A 1 87  ? -12.688 -0.681  -18.136 1.00 0.00 ? 1567 GLU A CA   4  
ATOM   7922  C C    . GLU A 1 87  ? -11.839 -1.691  -18.920 1.00 0.00 ? 1567 GLU A C    4  
ATOM   7923  O O    . GLU A 1 87  ? -11.470 -1.455  -20.078 1.00 0.00 ? 1567 GLU A O    4  
ATOM   7924  C CB   . GLU A 1 87  ? -14.202 -0.964  -18.177 1.00 0.00 ? 1567 GLU A CB   4  
ATOM   7925  C CG   . GLU A 1 87  ? -14.599 -2.338  -17.630 1.00 0.00 ? 1567 GLU A CG   4  
ATOM   7926  C CD   . GLU A 1 87  ? -14.197 -2.522  -16.155 1.00 0.00 ? 1567 GLU A CD   4  
ATOM   7927  O OE1  . GLU A 1 87  ? -12.994 -2.754  -15.901 1.00 0.00 ? 1567 GLU A OE1  4  
ATOM   7928  O OE2  . GLU A 1 87  ? -15.057 -2.444  -15.247 1.00 0.00 ? 1567 GLU A OE2  4  
ATOM   7929  H H    . GLU A 1 87  ? -12.508 0.608   -19.744 1.00 0.00 ? 1567 GLU A H    4  
ATOM   7930  H HA   . GLU A 1 87  ? -12.349 -0.665  -17.101 1.00 0.00 ? 1567 GLU A HA   4  
ATOM   7931  H HB2  . GLU A 1 87  ? -14.724 -0.199  -17.599 1.00 0.00 ? 1567 GLU A HB2  4  
ATOM   7932  H HB3  . GLU A 1 87  ? -14.552 -0.905  -19.207 1.00 0.00 ? 1567 GLU A HB3  4  
ATOM   7933  H HG2  . GLU A 1 87  ? -15.675 -2.454  -17.742 1.00 0.00 ? 1567 GLU A HG2  4  
ATOM   7934  H HG3  . GLU A 1 87  ? -14.114 -3.096  -18.246 1.00 0.00 ? 1567 GLU A HG3  4  
ATOM   7935  N N    . LEU A 1 88  ? -11.475 -2.794  -18.268 1.00 0.00 ? 1568 LEU A N    4  
ATOM   7936  C CA   . LEU A 1 88  ? -10.498 -3.759  -18.764 1.00 0.00 ? 1568 LEU A CA   4  
ATOM   7937  C C    . LEU A 1 88  ? -11.184 -4.953  -19.413 1.00 0.00 ? 1568 LEU A C    4  
ATOM   7938  O O    . LEU A 1 88  ? -12.121 -5.532  -18.856 1.00 0.00 ? 1568 LEU A O    4  
ATOM   7939  C CB   . LEU A 1 88  ? -9.627  -4.204  -17.582 1.00 0.00 ? 1568 LEU A CB   4  
ATOM   7940  C CG   . LEU A 1 88  ? -8.391  -5.027  -17.977 1.00 0.00 ? 1568 LEU A CG   4  
ATOM   7941  C CD1  . LEU A 1 88  ? -7.445  -4.219  -18.874 1.00 0.00 ? 1568 LEU A CD1  4  
ATOM   7942  C CD2  . LEU A 1 88  ? -7.654  -5.426  -16.696 1.00 0.00 ? 1568 LEU A CD2  4  
ATOM   7943  H H    . LEU A 1 88  ? -11.876 -2.957  -17.343 1.00 0.00 ? 1568 LEU A H    4  
ATOM   7944  H HA   . LEU A 1 88  ? -9.877  -3.269  -19.506 1.00 0.00 ? 1568 LEU A HA   4  
ATOM   7945  H HB2  . LEU A 1 88  ? -9.292  -3.315  -17.042 1.00 0.00 ? 1568 LEU A HB2  4  
ATOM   7946  H HB3  . LEU A 1 88  ? -10.250 -4.791  -16.904 1.00 0.00 ? 1568 LEU A HB3  4  
ATOM   7947  H HG   . LEU A 1 88  ? -8.696  -5.932  -18.501 1.00 0.00 ? 1568 LEU A HG   4  
ATOM   7948  H HD11 . LEU A 1 88  ? -6.480  -4.719  -18.951 1.00 0.00 ? 1568 LEU A HD11 4  
ATOM   7949  H HD12 . LEU A 1 88  ? -7.857  -4.119  -19.877 1.00 0.00 ? 1568 LEU A HD12 4  
ATOM   7950  H HD13 . LEU A 1 88  ? -7.284  -3.229  -18.454 1.00 0.00 ? 1568 LEU A HD13 4  
ATOM   7951  H HD21 . LEU A 1 88  ? -8.321  -6.000  -16.048 1.00 0.00 ? 1568 LEU A HD21 4  
ATOM   7952  H HD22 . LEU A 1 88  ? -6.787  -6.039  -16.945 1.00 0.00 ? 1568 LEU A HD22 4  
ATOM   7953  H HD23 . LEU A 1 88  ? -7.311  -4.540  -16.157 1.00 0.00 ? 1568 LEU A HD23 4  
ATOM   7954  N N    . TYR A 1 89  ? -10.655 -5.349  -20.567 1.00 0.00 ? 1569 TYR A N    4  
ATOM   7955  C CA   . TYR A 1 89  ? -11.181 -6.404  -21.415 1.00 0.00 ? 1569 TYR A CA   4  
ATOM   7956  C C    . TYR A 1 89  ? -10.067 -7.377  -21.766 1.00 0.00 ? 1569 TYR A C    4  
ATOM   7957  O O    . TYR A 1 89  ? -8.894  -7.004  -21.814 1.00 0.00 ? 1569 TYR A O    4  
ATOM   7958  C CB   . TYR A 1 89  ? -11.756 -5.784  -22.690 1.00 0.00 ? 1569 TYR A CB   4  
ATOM   7959  C CG   . TYR A 1 89  ? -13.133 -5.205  -22.508 1.00 0.00 ? 1569 TYR A CG   4  
ATOM   7960  C CD1  . TYR A 1 89  ? -13.294 -3.913  -21.980 1.00 0.00 ? 1569 TYR A CD1  4  
ATOM   7961  C CD2  . TYR A 1 89  ? -14.258 -5.966  -22.868 1.00 0.00 ? 1569 TYR A CD2  4  
ATOM   7962  C CE1  . TYR A 1 89  ? -14.580 -3.387  -21.786 1.00 0.00 ? 1569 TYR A CE1  4  
ATOM   7963  C CE2  . TYR A 1 89  ? -15.547 -5.452  -22.673 1.00 0.00 ? 1569 TYR A CE2  4  
ATOM   7964  C CZ   . TYR A 1 89  ? -15.720 -4.155  -22.132 1.00 0.00 ? 1569 TYR A CZ   4  
ATOM   7965  O OH   . TYR A 1 89  ? -16.981 -3.668  -21.946 1.00 0.00 ? 1569 TYR A OH   4  
ATOM   7966  H H    . TYR A 1 89  ? -9.854  -4.848  -20.945 1.00 0.00 ? 1569 TYR A H    4  
ATOM   7967  H HA   . TYR A 1 89  ? -11.971 -6.939  -20.897 1.00 0.00 ? 1569 TYR A HA   4  
ATOM   7968  H HB2  . TYR A 1 89  ? -11.098 -5.002  -23.056 1.00 0.00 ? 1569 TYR A HB2  4  
ATOM   7969  H HB3  . TYR A 1 89  ? -11.810 -6.552  -23.463 1.00 0.00 ? 1569 TYR A HB3  4  
ATOM   7970  H HD1  . TYR A 1 89  ? -12.430 -3.315  -21.716 1.00 0.00 ? 1569 TYR A HD1  4  
ATOM   7971  H HD2  . TYR A 1 89  ? -14.135 -6.954  -23.293 1.00 0.00 ? 1569 TYR A HD2  4  
ATOM   7972  H HE1  . TYR A 1 89  ? -14.674 -2.396  -21.373 1.00 0.00 ? 1569 TYR A HE1  4  
ATOM   7973  H HE2  . TYR A 1 89  ? -16.397 -6.062  -22.941 1.00 0.00 ? 1569 TYR A HE2  4  
ATOM   7974  H HH   . TYR A 1 89  ? -17.007 -2.765  -21.583 1.00 0.00 ? 1569 TYR A HH   4  
ATOM   7975  N N    . TYR A 1 90  ? -10.466 -8.604  -22.094 1.00 0.00 ? 1570 TYR A N    4  
ATOM   7976  C CA   . TYR A 1 90  ? -9.594  -9.693  -22.491 1.00 0.00 ? 1570 TYR A CA   4  
ATOM   7977  C C    . TYR A 1 90  ? -10.222 -10.329 -23.717 1.00 0.00 ? 1570 TYR A C    4  
ATOM   7978  O O    . TYR A 1 90  ? -11.427 -10.582 -23.725 1.00 0.00 ? 1570 TYR A O    4  
ATOM   7979  C CB   . TYR A 1 90  ? -9.477  -10.729 -21.361 1.00 0.00 ? 1570 TYR A CB   4  
ATOM   7980  C CG   . TYR A 1 90  ? -8.937  -10.198 -20.054 1.00 0.00 ? 1570 TYR A CG   4  
ATOM   7981  C CD1  . TYR A 1 90  ? -9.775  -9.506  -19.156 1.00 0.00 ? 1570 TYR A CD1  4  
ATOM   7982  C CD2  . TYR A 1 90  ? -7.585  -10.400 -19.737 1.00 0.00 ? 1570 TYR A CD2  4  
ATOM   7983  C CE1  . TYR A 1 90  ? -9.241  -8.976  -17.966 1.00 0.00 ? 1570 TYR A CE1  4  
ATOM   7984  C CE2  . TYR A 1 90  ? -7.059  -9.890  -18.545 1.00 0.00 ? 1570 TYR A CE2  4  
ATOM   7985  C CZ   . TYR A 1 90  ? -7.878  -9.174  -17.655 1.00 0.00 ? 1570 TYR A CZ   4  
ATOM   7986  O OH   . TYR A 1 90  ? -7.336  -8.693  -16.500 1.00 0.00 ? 1570 TYR A OH   4  
ATOM   7987  H H    . TYR A 1 90  ? -11.467 -8.809  -22.095 1.00 0.00 ? 1570 TYR A H    4  
ATOM   7988  H HA   . TYR A 1 90  ? -8.605  -9.308  -22.733 1.00 0.00 ? 1570 TYR A HA   4  
ATOM   7989  H HB2  . TYR A 1 90  ? -10.447 -11.170 -21.165 1.00 0.00 ? 1570 TYR A HB2  4  
ATOM   7990  H HB3  . TYR A 1 90  ? -8.829  -11.533 -21.709 1.00 0.00 ? 1570 TYR A HB3  4  
ATOM   7991  H HD1  . TYR A 1 90  ? -10.828 -9.379  -19.373 1.00 0.00 ? 1570 TYR A HD1  4  
ATOM   7992  H HD2  . TYR A 1 90  ? -6.941  -10.946 -20.402 1.00 0.00 ? 1570 TYR A HD2  4  
ATOM   7993  H HE1  . TYR A 1 90  ? -9.873  -8.422  -17.295 1.00 0.00 ? 1570 TYR A HE1  4  
ATOM   7994  H HE2  . TYR A 1 90  ? -6.020  -10.053 -18.313 1.00 0.00 ? 1570 TYR A HE2  4  
ATOM   7995  H HH   . TYR A 1 90  ? -7.968  -8.239  -15.909 1.00 0.00 ? 1570 TYR A HH   4  
ATOM   7996  N N    . SER A 1 91  ? -9.429  -10.603 -24.741 1.00 0.00 ? 1571 SER A N    4  
ATOM   7997  C CA   . SER A 1 91  ? -9.871  -11.394 -25.870 1.00 0.00 ? 1571 SER A CA   4  
ATOM   7998  C C    . SER A 1 91  ? -9.646  -12.850 -25.467 1.00 0.00 ? 1571 SER A C    4  
ATOM   7999  O O    . SER A 1 91  ? -8.510  -13.317 -25.358 1.00 0.00 ? 1571 SER A O    4  
ATOM   8000  C CB   . SER A 1 91  ? -9.153  -10.938 -27.147 1.00 0.00 ? 1571 SER A CB   4  
ATOM   8001  O OG   . SER A 1 91  ? -7.827  -10.492 -26.900 1.00 0.00 ? 1571 SER A OG   4  
ATOM   8002  H H    . SER A 1 91  ? -8.437  -10.389 -24.706 1.00 0.00 ? 1571 SER A H    4  
ATOM   8003  H HA   . SER A 1 91  ? -10.938 -11.241 -26.034 1.00 0.00 ? 1571 SER A HA   4  
ATOM   8004  H HB2  . SER A 1 91  ? -9.145  -11.753 -27.856 1.00 0.00 ? 1571 SER A HB2  4  
ATOM   8005  H HB3  . SER A 1 91  ? -9.717  -10.118 -27.587 1.00 0.00 ? 1571 SER A HB3  4  
ATOM   8006  H HG   . SER A 1 91  ? -7.464  -10.130 -27.734 1.00 0.00 ? 1571 SER A HG   4  
ATOM   8007  N N    . ILE A 1 92  ? -10.736 -13.538 -25.137 1.00 0.00 ? 1572 ILE A N    4  
ATOM   8008  C CA   . ILE A 1 92  ? -10.706 -14.944 -24.778 1.00 0.00 ? 1572 ILE A CA   4  
ATOM   8009  C C    . ILE A 1 92  ? -10.826 -15.693 -26.099 1.00 0.00 ? 1572 ILE A C    4  
ATOM   8010  O O    . ILE A 1 92  ? -11.847 -15.585 -26.778 1.00 0.00 ? 1572 ILE A O    4  
ATOM   8011  C CB   . ILE A 1 92  ? -11.834 -15.265 -23.764 1.00 0.00 ? 1572 ILE A CB   4  
ATOM   8012  C CG1  . ILE A 1 92  ? -11.850 -14.302 -22.551 1.00 0.00 ? 1572 ILE A CG1  4  
ATOM   8013  C CG2  . ILE A 1 92  ? -11.738 -16.704 -23.232 1.00 0.00 ? 1572 ILE A CG2  4  
ATOM   8014  C CD1  . ILE A 1 92  ? -10.492 -14.140 -21.861 1.00 0.00 ? 1572 ILE A CD1  4  
ATOM   8015  H H    . ILE A 1 92  ? -11.655 -13.105 -25.262 1.00 0.00 ? 1572 ILE A H    4  
ATOM   8016  H HA   . ILE A 1 92  ? -9.746  -15.173 -24.314 1.00 0.00 ? 1572 ILE A HA   4  
ATOM   8017  H HB   . ILE A 1 92  ? -12.788 -15.178 -24.284 1.00 0.00 ? 1572 ILE A HB   4  
ATOM   8018  H HG12 . ILE A 1 92  ? -12.185 -13.314 -22.869 1.00 0.00 ? 1572 ILE A HG12 4  
ATOM   8019  H HG13 . ILE A 1 92  ? -12.566 -14.665 -21.813 1.00 0.00 ? 1572 ILE A HG13 4  
ATOM   8020  H HG21 . ILE A 1 92  ? -11.864 -17.408 -24.058 1.00 0.00 ? 1572 ILE A HG21 4  
ATOM   8021  H HG22 . ILE A 1 92  ? -10.766 -16.884 -22.763 1.00 0.00 ? 1572 ILE A HG22 4  
ATOM   8022  H HG23 . ILE A 1 92  ? -12.532 -16.880 -22.497 1.00 0.00 ? 1572 ILE A HG23 4  
ATOM   8023  H HD11 . ILE A 1 92  ? -10.620 -13.566 -20.944 1.00 0.00 ? 1572 ILE A HD11 4  
ATOM   8024  H HD12 . ILE A 1 92  ? -10.073 -15.114 -21.615 1.00 0.00 ? 1572 ILE A HD12 4  
ATOM   8025  H HD13 . ILE A 1 92  ? -9.800  -13.604 -22.506 1.00 0.00 ? 1572 ILE A HD13 4  
ATOM   8026  N N    . GLU A 1 93  ? -9.763  -16.369 -26.529 1.00 0.00 ? 1573 GLU A N    4  
ATOM   8027  C CA   . GLU A 1 93  ? -9.867  -17.290 -27.644 1.00 0.00 ? 1573 GLU A CA   4  
ATOM   8028  C C    . GLU A 1 93  ? -10.610 -18.517 -27.134 1.00 0.00 ? 1573 GLU A C    4  
ATOM   8029  O O    . GLU A 1 93  ? -10.288 -19.062 -26.072 1.00 0.00 ? 1573 GLU A O    4  
ATOM   8030  C CB   . GLU A 1 93  ? -8.502  -17.636 -28.255 1.00 0.00 ? 1573 GLU A CB   4  
ATOM   8031  C CG   . GLU A 1 93  ? -8.666  -18.501 -29.518 1.00 0.00 ? 1573 GLU A CG   4  
ATOM   8032  C CD   . GLU A 1 93  ? -7.353  -18.657 -30.302 1.00 0.00 ? 1573 GLU A CD   4  
ATOM   8033  O OE1  . GLU A 1 93  ? -7.015  -17.767 -31.118 1.00 0.00 ? 1573 GLU A OE1  4  
ATOM   8034  O OE2  . GLU A 1 93  ? -6.655  -19.676 -30.097 1.00 0.00 ? 1573 GLU A OE2  4  
ATOM   8035  H H    . GLU A 1 93  ? -8.965  -16.467 -25.910 1.00 0.00 ? 1573 GLU A H    4  
ATOM   8036  H HA   . GLU A 1 93  ? -10.461 -16.814 -28.411 1.00 0.00 ? 1573 GLU A HA   4  
ATOM   8037  H HB2  . GLU A 1 93  ? -8.014  -16.711 -28.540 1.00 0.00 ? 1573 GLU A HB2  4  
ATOM   8038  H HB3  . GLU A 1 93  ? -7.884  -18.157 -27.526 1.00 0.00 ? 1573 GLU A HB3  4  
ATOM   8039  H HG2  . GLU A 1 93  ? -9.046  -19.487 -29.240 1.00 0.00 ? 1573 GLU A HG2  4  
ATOM   8040  H HG3  . GLU A 1 93  ? -9.401  -18.035 -30.173 1.00 0.00 ? 1573 GLU A HG3  4  
ATOM   8041  N N    . LYS A 1 94  ? -11.612 -18.939 -27.893 1.00 0.00 ? 1574 LYS A N    4  
ATOM   8042  C CA   . LYS A 1 94  ? -12.383 -20.142 -27.633 1.00 0.00 ? 1574 LYS A CA   4  
ATOM   8043  C C    . LYS A 1 94  ? -12.717 -20.731 -28.990 1.00 0.00 ? 1574 LYS A C    4  
ATOM   8044  O O    . LYS A 1 94  ? -13.042 -19.971 -29.902 1.00 0.00 ? 1574 LYS A O    4  
ATOM   8045  C CB   . LYS A 1 94  ? -13.635 -19.742 -26.834 1.00 0.00 ? 1574 LYS A CB   4  
ATOM   8046  C CG   . LYS A 1 94  ? -14.276 -20.979 -26.192 1.00 0.00 ? 1574 LYS A CG   4  
ATOM   8047  C CD   . LYS A 1 94  ? -15.517 -20.655 -25.347 1.00 0.00 ? 1574 LYS A CD   4  
ATOM   8048  C CE   . LYS A 1 94  ? -16.688 -19.992 -26.107 1.00 0.00 ? 1574 LYS A CE   4  
ATOM   8049  N NZ   . LYS A 1 94  ? -17.653 -20.964 -26.693 1.00 0.00 ? 1574 LYS A NZ   4  
ATOM   8050  H H    . LYS A 1 94  ? -11.849 -18.420 -28.739 1.00 0.00 ? 1574 LYS A H    4  
ATOM   8051  H HA   . LYS A 1 94  ? -11.773 -20.845 -27.056 1.00 0.00 ? 1574 LYS A HA   4  
ATOM   8052  H HB2  . LYS A 1 94  ? -13.348 -19.056 -26.034 1.00 0.00 ? 1574 LYS A HB2  4  
ATOM   8053  H HB3  . LYS A 1 94  ? -14.338 -19.227 -27.489 1.00 0.00 ? 1574 LYS A HB3  4  
ATOM   8054  H HG2  . LYS A 1 94  ? -14.545 -21.700 -26.958 1.00 0.00 ? 1574 LYS A HG2  4  
ATOM   8055  H HG3  . LYS A 1 94  ? -13.523 -21.421 -25.532 1.00 0.00 ? 1574 LYS A HG3  4  
ATOM   8056  H HD2  . LYS A 1 94  ? -15.848 -21.589 -24.886 1.00 0.00 ? 1574 LYS A HD2  4  
ATOM   8057  H HD3  . LYS A 1 94  ? -15.201 -19.982 -24.549 1.00 0.00 ? 1574 LYS A HD3  4  
ATOM   8058  H HE2  . LYS A 1 94  ? -17.235 -19.361 -25.402 1.00 0.00 ? 1574 LYS A HE2  4  
ATOM   8059  H HE3  . LYS A 1 94  ? -16.297 -19.340 -26.894 1.00 0.00 ? 1574 LYS A HE3  4  
ATOM   8060  H HZ1  . LYS A 1 94  ? -18.065 -21.567 -25.991 1.00 0.00 ? 1574 LYS A HZ1  4  
ATOM   8061  H HZ2  . LYS A 1 94  ? -18.416 -20.478 -27.144 1.00 0.00 ? 1574 LYS A HZ2  4  
ATOM   8062  H HZ3  . LYS A 1 94  ? -17.242 -21.557 -27.418 1.00 0.00 ? 1574 LYS A HZ3  4  
ATOM   8063  N N    . GLU A 1 95  ? -12.628 -22.048 -29.139 1.00 0.00 ? 1575 GLU A N    4  
ATOM   8064  C CA   . GLU A 1 95  ? -12.905 -22.757 -30.396 1.00 0.00 ? 1575 GLU A CA   4  
ATOM   8065  C C    . GLU A 1 95  ? -12.114 -22.162 -31.579 1.00 0.00 ? 1575 GLU A C    4  
ATOM   8066  O O    . GLU A 1 95  ? -12.584 -22.145 -32.720 1.00 0.00 ? 1575 GLU A O    4  
ATOM   8067  C CB   . GLU A 1 95  ? -14.429 -22.841 -30.614 1.00 0.00 ? 1575 GLU A CB   4  
ATOM   8068  C CG   . GLU A 1 95  ? -15.128 -23.664 -29.518 1.00 0.00 ? 1575 GLU A CG   4  
ATOM   8069  C CD   . GLU A 1 95  ? -16.654 -23.502 -29.588 1.00 0.00 ? 1575 GLU A CD   4  
ATOM   8070  O OE1  . GLU A 1 95  ? -17.314 -24.199 -30.400 1.00 0.00 ? 1575 GLU A OE1  4  
ATOM   8071  O OE2  . GLU A 1 95  ? -17.199 -22.669 -28.818 1.00 0.00 ? 1575 GLU A OE2  4  
ATOM   8072  H H    . GLU A 1 95  ? -12.347 -22.617 -28.350 1.00 0.00 ? 1575 GLU A H    4  
ATOM   8073  H HA   . GLU A 1 95  ? -12.533 -23.774 -30.283 1.00 0.00 ? 1575 GLU A HA   4  
ATOM   8074  H HB2  . GLU A 1 95  ? -14.851 -21.832 -30.631 1.00 0.00 ? 1575 GLU A HB2  4  
ATOM   8075  H HB3  . GLU A 1 95  ? -14.636 -23.316 -31.572 1.00 0.00 ? 1575 GLU A HB3  4  
ATOM   8076  H HG2  . GLU A 1 95  ? -14.856 -24.716 -29.630 1.00 0.00 ? 1575 GLU A HG2  4  
ATOM   8077  H HG3  . GLU A 1 95  ? -14.789 -23.344 -28.531 1.00 0.00 ? 1575 GLU A HG3  4  
ATOM   8078  N N    . GLY A 1 96  ? -10.903 -21.661 -31.305 1.00 0.00 ? 1576 GLY A N    4  
ATOM   8079  C CA   . GLY A 1 96  ? -9.995  -21.153 -32.329 1.00 0.00 ? 1576 GLY A CA   4  
ATOM   8080  C C    . GLY A 1 96  ? -10.408 -19.792 -32.895 1.00 0.00 ? 1576 GLY A C    4  
ATOM   8081  O O    . GLY A 1 96  ? -9.932  -19.428 -33.973 1.00 0.00 ? 1576 GLY A O    4  
ATOM   8082  H H    . GLY A 1 96  ? -10.557 -21.700 -30.353 1.00 0.00 ? 1576 GLY A H    4  
ATOM   8083  H HA2  . GLY A 1 96  ? -8.999  -21.058 -31.894 1.00 0.00 ? 1576 GLY A HA2  4  
ATOM   8084  H HA3  . GLY A 1 96  ? -9.944  -21.875 -33.145 1.00 0.00 ? 1576 GLY A HA3  4  
ATOM   8085  N N    . GLN A 1 97  ? -11.267 -19.034 -32.201 1.00 0.00 ? 1577 GLN A N    4  
ATOM   8086  C CA   . GLN A 1 97  ? -11.628 -17.666 -32.581 1.00 0.00 ? 1577 GLN A CA   4  
ATOM   8087  C C    . GLN A 1 97  ? -11.661 -16.783 -31.336 1.00 0.00 ? 1577 GLN A C    4  
ATOM   8088  O O    . GLN A 1 97  ? -11.913 -17.272 -30.233 1.00 0.00 ? 1577 GLN A O    4  
ATOM   8089  C CB   . GLN A 1 97  ? -12.931 -17.655 -33.414 1.00 0.00 ? 1577 GLN A CB   4  
ATOM   8090  C CG   . GLN A 1 97  ? -14.160 -18.346 -32.799 1.00 0.00 ? 1577 GLN A CG   4  
ATOM   8091  C CD   . GLN A 1 97  ? -14.910 -17.485 -31.779 1.00 0.00 ? 1577 GLN A CD   4  
ATOM   8092  O OE1  . GLN A 1 97  ? -15.540 -16.488 -32.125 1.00 0.00 ? 1577 GLN A OE1  4  
ATOM   8093  N NE2  . GLN A 1 97  ? -14.864 -17.843 -30.504 1.00 0.00 ? 1577 GLN A NE2  4  
ATOM   8094  H H    . GLN A 1 97  ? -11.655 -19.391 -31.331 1.00 0.00 ? 1577 GLN A H    4  
ATOM   8095  H HA   . GLN A 1 97  ? -10.841 -17.271 -33.227 1.00 0.00 ? 1577 GLN A HA   4  
ATOM   8096  H HB2  . GLN A 1 97  ? -13.185 -16.625 -33.667 1.00 0.00 ? 1577 GLN A HB2  4  
ATOM   8097  H HB3  . GLN A 1 97  ? -12.711 -18.169 -34.354 1.00 0.00 ? 1577 GLN A HB3  4  
ATOM   8098  H HG2  . GLN A 1 97  ? -14.853 -18.572 -33.607 1.00 0.00 ? 1577 GLN A HG2  4  
ATOM   8099  H HG3  . GLN A 1 97  ? -13.873 -19.300 -32.358 1.00 0.00 ? 1577 GLN A HG3  4  
ATOM   8100  H HE21 . GLN A 1 97  ? -14.259 -18.622 -30.237 1.00 0.00 ? 1577 GLN A HE21 4  
ATOM   8101  H HE22 . GLN A 1 97  ? -15.328 -17.288 -29.800 1.00 0.00 ? 1577 GLN A HE22 4  
ATOM   8102  N N    . ARG A 1 98  ? -11.336 -15.497 -31.476 1.00 0.00 ? 1578 ARG A N    4  
ATOM   8103  C CA   . ARG A 1 98  ? -11.223 -14.578 -30.337 1.00 0.00 ? 1578 ARG A CA   4  
ATOM   8104  C C    . ARG A 1 98  ? -12.591 -13.966 -30.064 1.00 0.00 ? 1578 ARG A C    4  
ATOM   8105  O O    . ARG A 1 98  ? -13.306 -13.601 -31.000 1.00 0.00 ? 1578 ARG A O    4  
ATOM   8106  C CB   . ARG A 1 98  ? -10.165 -13.496 -30.622 1.00 0.00 ? 1578 ARG A CB   4  
ATOM   8107  C CG   . ARG A 1 98  ? -8.748  -14.098 -30.614 1.00 0.00 ? 1578 ARG A CG   4  
ATOM   8108  C CD   . ARG A 1 98  ? -7.647  -13.067 -30.901 1.00 0.00 ? 1578 ARG A CD   4  
ATOM   8109  N NE   . ARG A 1 98  ? -7.750  -12.506 -32.261 1.00 0.00 ? 1578 ARG A NE   4  
ATOM   8110  C CZ   . ARG A 1 98  ? -7.308  -13.065 -33.401 1.00 0.00 ? 1578 ARG A CZ   4  
ATOM   8111  N NH1  . ARG A 1 98  ? -6.715  -14.258 -33.396 1.00 0.00 ? 1578 ARG A NH1  4  
ATOM   8112  N NH2  . ARG A 1 98  ? -7.464  -12.416 -34.553 1.00 0.00 ? 1578 ARG A NH2  4  
ATOM   8113  H H    . ARG A 1 98  ? -11.206 -15.121 -32.409 1.00 0.00 ? 1578 ARG A H    4  
ATOM   8114  H HA   . ARG A 1 98  ? -10.918 -15.131 -29.451 1.00 0.00 ? 1578 ARG A HA   4  
ATOM   8115  H HB2  . ARG A 1 98  ? -10.370 -13.033 -31.589 1.00 0.00 ? 1578 ARG A HB2  4  
ATOM   8116  H HB3  . ARG A 1 98  ? -10.220 -12.727 -29.850 1.00 0.00 ? 1578 ARG A HB3  4  
ATOM   8117  H HG2  . ARG A 1 98  ? -8.566  -14.530 -29.628 1.00 0.00 ? 1578 ARG A HG2  4  
ATOM   8118  H HG3  . ARG A 1 98  ? -8.688  -14.899 -31.353 1.00 0.00 ? 1578 ARG A HG3  4  
ATOM   8119  H HD2  . ARG A 1 98  ? -7.714  -12.257 -30.174 1.00 0.00 ? 1578 ARG A HD2  4  
ATOM   8120  H HD3  . ARG A 1 98  ? -6.673  -13.536 -30.767 1.00 0.00 ? 1578 ARG A HD3  4  
ATOM   8121  H HE   . ARG A 1 98  ? -8.206  -11.600 -32.317 1.00 0.00 ? 1578 ARG A HE   4  
ATOM   8122  H HH11 . ARG A 1 98  ? -6.575  -14.773 -32.536 1.00 0.00 ? 1578 ARG A HH11 4  
ATOM   8123  H HH12 . ARG A 1 98  ? -6.378  -14.698 -34.248 1.00 0.00 ? 1578 ARG A HH12 4  
ATOM   8124  H HH21 . ARG A 1 98  ? -7.906  -11.500 -34.591 1.00 0.00 ? 1578 ARG A HH21 4  
ATOM   8125  H HH22 . ARG A 1 98  ? -7.145  -12.797 -35.436 1.00 0.00 ? 1578 ARG A HH22 4  
ATOM   8126  N N    . LYS A 1 99  ? -12.923 -13.793 -28.781 1.00 0.00 ? 1579 LYS A N    4  
ATOM   8127  C CA   . LYS A 1 99  ? -14.184 -13.209 -28.327 1.00 0.00 ? 1579 LYS A CA   4  
ATOM   8128  C C    . LYS A 1 99  ? -13.827 -12.246 -27.199 1.00 0.00 ? 1579 LYS A C    4  
ATOM   8129  O O    . LYS A 1 99  ? -13.108 -12.631 -26.282 1.00 0.00 ? 1579 LYS A O    4  
ATOM   8130  C CB   . LYS A 1 99  ? -15.089 -14.368 -27.859 1.00 0.00 ? 1579 LYS A CB   4  
ATOM   8131  C CG   . LYS A 1 99  ? -16.602 -14.100 -27.833 1.00 0.00 ? 1579 LYS A CG   4  
ATOM   8132  C CD   . LYS A 1 99  ? -17.042 -12.810 -27.124 1.00 0.00 ? 1579 LYS A CD   4  
ATOM   8133  C CE   . LYS A 1 99  ? -18.560 -12.761 -26.902 1.00 0.00 ? 1579 LYS A CE   4  
ATOM   8134  N NZ   . LYS A 1 99  ? -18.979 -11.484 -26.264 1.00 0.00 ? 1579 LYS A NZ   4  
ATOM   8135  H H    . LYS A 1 99  ? -12.320 -14.173 -28.047 1.00 0.00 ? 1579 LYS A H    4  
ATOM   8136  H HA   . LYS A 1 99  ? -14.658 -12.673 -29.152 1.00 0.00 ? 1579 LYS A HA   4  
ATOM   8137  H HB2  . LYS A 1 99  ? -14.936 -15.212 -28.534 1.00 0.00 ? 1579 LYS A HB2  4  
ATOM   8138  H HB3  . LYS A 1 99  ? -14.761 -14.701 -26.875 1.00 0.00 ? 1579 LYS A HB3  4  
ATOM   8139  H HG2  . LYS A 1 99  ? -16.963 -14.072 -28.861 1.00 0.00 ? 1579 LYS A HG2  4  
ATOM   8140  H HG3  . LYS A 1 99  ? -17.069 -14.947 -27.331 1.00 0.00 ? 1579 LYS A HG3  4  
ATOM   8141  H HD2  . LYS A 1 99  ? -16.543 -12.753 -26.158 1.00 0.00 ? 1579 LYS A HD2  4  
ATOM   8142  H HD3  . LYS A 1 99  ? -16.760 -11.957 -27.738 1.00 0.00 ? 1579 LYS A HD3  4  
ATOM   8143  H HE2  . LYS A 1 99  ? -19.063 -12.876 -27.867 1.00 0.00 ? 1579 LYS A HE2  4  
ATOM   8144  H HE3  . LYS A 1 99  ? -18.853 -13.600 -26.265 1.00 0.00 ? 1579 LYS A HE3  4  
ATOM   8145  H HZ1  . LYS A 1 99  ? -19.971 -11.489 -26.058 1.00 0.00 ? 1579 LYS A HZ1  4  
ATOM   8146  H HZ2  . LYS A 1 99  ? -18.477 -11.313 -25.399 1.00 0.00 ? 1579 LYS A HZ2  4  
ATOM   8147  H HZ3  . LYS A 1 99  ? -18.805 -10.698 -26.879 1.00 0.00 ? 1579 LYS A HZ3  4  
ATOM   8148  N N    . TRP A 1 100 ? -14.305 -11.006 -27.245 1.00 0.00 ? 1580 TRP A N    4  
ATOM   8149  C CA   . TRP A 1 100 ? -14.021 -10.032 -26.198 1.00 0.00 ? 1580 TRP A CA   4  
ATOM   8150  C C    . TRP A 1 100 ? -14.931 -10.278 -24.998 1.00 0.00 ? 1580 TRP A C    4  
ATOM   8151  O O    . TRP A 1 100 ? -16.152 -10.371 -25.152 1.00 0.00 ? 1580 TRP A O    4  
ATOM   8152  C CB   . TRP A 1 100 ? -14.236 -8.616  -26.753 1.00 0.00 ? 1580 TRP A CB   4  
ATOM   8153  C CG   . TRP A 1 100 ? -13.165 -8.190  -27.703 1.00 0.00 ? 1580 TRP A CG   4  
ATOM   8154  C CD1  . TRP A 1 100 ? -13.279 -8.002  -29.039 1.00 0.00 ? 1580 TRP A CD1  4  
ATOM   8155  C CD2  . TRP A 1 100 ? -11.780 -7.900  -27.375 1.00 0.00 ? 1580 TRP A CD2  4  
ATOM   8156  N NE1  . TRP A 1 100 ? -12.055 -7.632  -29.556 1.00 0.00 ? 1580 TRP A NE1  4  
ATOM   8157  C CE2  . TRP A 1 100 ? -11.082 -7.584  -28.578 1.00 0.00 ? 1580 TRP A CE2  4  
ATOM   8158  C CE3  . TRP A 1 100 ? -11.046 -7.902  -26.173 1.00 0.00 ? 1580 TRP A CE3  4  
ATOM   8159  C CZ2  . TRP A 1 100 ? -9.706  -7.319  -28.591 1.00 0.00 ? 1580 TRP A CZ2  4  
ATOM   8160  C CZ3  . TRP A 1 100 ? -9.660  -7.656  -26.177 1.00 0.00 ? 1580 TRP A CZ3  4  
ATOM   8161  C CH2  . TRP A 1 100 ? -8.992  -7.364  -27.382 1.00 0.00 ? 1580 TRP A CH2  4  
ATOM   8162  H H    . TRP A 1 100 ? -14.864 -10.703 -28.032 1.00 0.00 ? 1580 TRP A H    4  
ATOM   8163  H HA   . TRP A 1 100 ? -12.972 -10.141 -25.901 1.00 0.00 ? 1580 TRP A HA   4  
ATOM   8164  H HB2  . TRP A 1 100 ? -15.209 -8.554  -27.242 1.00 0.00 ? 1580 TRP A HB2  4  
ATOM   8165  H HB3  . TRP A 1 100 ? -14.241 -7.907  -25.925 1.00 0.00 ? 1580 TRP A HB3  4  
ATOM   8166  H HD1  . TRP A 1 100 ? -14.191 -8.128  -29.615 1.00 0.00 ? 1580 TRP A HD1  4  
ATOM   8167  H HE1  . TRP A 1 100 ? -11.917 -7.429  -30.542 1.00 0.00 ? 1580 TRP A HE1  4  
ATOM   8168  H HE3  . TRP A 1 100 ? -11.565 -8.098  -25.243 1.00 0.00 ? 1580 TRP A HE3  4  
ATOM   8169  H HZ2  . TRP A 1 100 ? -9.198  -7.086  -29.517 1.00 0.00 ? 1580 TRP A HZ2  4  
ATOM   8170  H HZ3  . TRP A 1 100 ? -9.102  -7.691  -25.252 1.00 0.00 ? 1580 TRP A HZ3  4  
ATOM   8171  H HH2  . TRP A 1 100 ? -7.928  -7.171  -27.381 1.00 0.00 ? 1580 TRP A HH2  4  
ATOM   8172  N N    . TYR A 1 101 ? -14.341 -10.319 -23.802 1.00 0.00 ? 1581 TYR A N    4  
ATOM   8173  C CA   . TYR A 1 101 ? -15.055 -10.336 -22.524 1.00 0.00 ? 1581 TYR A CA   4  
ATOM   8174  C C    . TYR A 1 101 ? -14.409 -9.326  -21.573 1.00 0.00 ? 1581 TYR A C    4  
ATOM   8175  O O    . TYR A 1 101 ? -13.261 -8.930  -21.762 1.00 0.00 ? 1581 TYR A O    4  
ATOM   8176  C CB   . TYR A 1 101 ? -15.027 -11.754 -21.942 1.00 0.00 ? 1581 TYR A CB   4  
ATOM   8177  C CG   . TYR A 1 101 ? -15.924 -12.737 -22.656 1.00 0.00 ? 1581 TYR A CG   4  
ATOM   8178  C CD1  . TYR A 1 101 ? -17.304 -12.729 -22.400 1.00 0.00 ? 1581 TYR A CD1  4  
ATOM   8179  C CD2  . TYR A 1 101 ? -15.385 -13.662 -23.570 1.00 0.00 ? 1581 TYR A CD2  4  
ATOM   8180  C CE1  . TYR A 1 101 ? -18.132 -13.655 -23.046 1.00 0.00 ? 1581 TYR A CE1  4  
ATOM   8181  C CE2  . TYR A 1 101 ? -16.214 -14.609 -24.195 1.00 0.00 ? 1581 TYR A CE2  4  
ATOM   8182  C CZ   . TYR A 1 101 ? -17.601 -14.611 -23.939 1.00 0.00 ? 1581 TYR A CZ   4  
ATOM   8183  O OH   . TYR A 1 101 ? -18.413 -15.518 -24.550 1.00 0.00 ? 1581 TYR A OH   4  
ATOM   8184  H H    . TYR A 1 101 ? -13.322 -10.304 -23.754 1.00 0.00 ? 1581 TYR A H    4  
ATOM   8185  H HA   . TYR A 1 101 ? -16.102 -10.053 -22.671 1.00 0.00 ? 1581 TYR A HA   4  
ATOM   8186  H HB2  . TYR A 1 101 ? -14.002 -12.123 -21.954 1.00 0.00 ? 1581 TYR A HB2  4  
ATOM   8187  H HB3  . TYR A 1 101 ? -15.361 -11.723 -20.905 1.00 0.00 ? 1581 TYR A HB3  4  
ATOM   8188  H HD1  . TYR A 1 101 ? -17.744 -12.016 -21.708 1.00 0.00 ? 1581 TYR A HD1  4  
ATOM   8189  H HD2  . TYR A 1 101 ? -14.331 -13.649 -23.791 1.00 0.00 ? 1581 TYR A HD2  4  
ATOM   8190  H HE1  . TYR A 1 101 ? -19.183 -13.622 -22.845 1.00 0.00 ? 1581 TYR A HE1  4  
ATOM   8191  H HE2  . TYR A 1 101 ? -15.778 -15.333 -24.865 1.00 0.00 ? 1581 TYR A HE2  4  
ATOM   8192  H HH   . TYR A 1 101 ? -19.354 -15.438 -24.293 1.00 0.00 ? 1581 TYR A HH   4  
ATOM   8193  N N    . LYS A 1 102 ? -15.145 -8.911  -20.542 1.00 0.00 ? 1582 LYS A N    4  
ATOM   8194  C CA   . LYS A 1 102 ? -14.706 -7.872  -19.590 1.00 0.00 ? 1582 LYS A CA   4  
ATOM   8195  C C    . LYS A 1 102 ? -14.190 -8.527  -18.325 1.00 0.00 ? 1582 LYS A C    4  
ATOM   8196  O O    . LYS A 1 102 ? -14.620 -9.633  -18.025 1.00 0.00 ? 1582 LYS A O    4  
ATOM   8197  C CB   . LYS A 1 102 ? -15.852 -6.873  -19.326 1.00 0.00 ? 1582 LYS A CB   4  
ATOM   8198  C CG   . LYS A 1 102 ? -17.072 -7.467  -18.598 1.00 0.00 ? 1582 LYS A CG   4  
ATOM   8199  C CD   . LYS A 1 102 ? -18.320 -6.566  -18.637 1.00 0.00 ? 1582 LYS A CD   4  
ATOM   8200  C CE   . LYS A 1 102 ? -18.145 -5.226  -17.899 1.00 0.00 ? 1582 LYS A CE   4  
ATOM   8201  N NZ   . LYS A 1 102 ? -19.358 -4.363  -18.019 1.00 0.00 ? 1582 LYS A NZ   4  
ATOM   8202  H H    . LYS A 1 102 ? -16.044 -9.364  -20.407 1.00 0.00 ? 1582 LYS A H    4  
ATOM   8203  H HA   . LYS A 1 102 ? -13.883 -7.307  -20.037 1.00 0.00 ? 1582 LYS A HA   4  
ATOM   8204  H HB2  . LYS A 1 102 ? -15.467 -6.027  -18.750 1.00 0.00 ? 1582 LYS A HB2  4  
ATOM   8205  H HB3  . LYS A 1 102 ? -16.170 -6.493  -20.294 1.00 0.00 ? 1582 LYS A HB3  4  
ATOM   8206  H HG2  . LYS A 1 102 ? -17.344 -8.405  -19.076 1.00 0.00 ? 1582 LYS A HG2  4  
ATOM   8207  H HG3  . LYS A 1 102 ? -16.810 -7.682  -17.560 1.00 0.00 ? 1582 LYS A HG3  4  
ATOM   8208  H HD2  . LYS A 1 102 ? -18.583 -6.382  -19.683 1.00 0.00 ? 1582 LYS A HD2  4  
ATOM   8209  H HD3  . LYS A 1 102 ? -19.147 -7.118  -18.175 1.00 0.00 ? 1582 LYS A HD3  4  
ATOM   8210  H HE2  . LYS A 1 102 ? -17.949 -5.421  -16.840 1.00 0.00 ? 1582 LYS A HE2  4  
ATOM   8211  H HE3  . LYS A 1 102 ? -17.281 -4.694  -18.311 1.00 0.00 ? 1582 LYS A HE3  4  
ATOM   8212  H HZ1  . LYS A 1 102 ? -19.234 -3.483  -17.528 1.00 0.00 ? 1582 LYS A HZ1  4  
ATOM   8213  H HZ2  . LYS A 1 102 ? -19.560 -4.137  -18.985 1.00 0.00 ? 1582 LYS A HZ2  4  
ATOM   8214  H HZ3  . LYS A 1 102 ? -20.178 -4.814  -17.624 1.00 0.00 ? 1582 LYS A HZ3  4  
ATOM   8215  N N    . ARG A 1 103 ? -13.343 -7.864  -17.532 1.00 0.00 ? 1583 ARG A N    4  
ATOM   8216  C CA   . ARG A 1 103 ? -12.675 -8.512  -16.392 1.00 0.00 ? 1583 ARG A CA   4  
ATOM   8217  C C    . ARG A 1 103 ? -13.629 -9.322  -15.518 1.00 0.00 ? 1583 ARG A C    4  
ATOM   8218  O O    . ARG A 1 103 ? -13.331 -10.470 -15.231 1.00 0.00 ? 1583 ARG A O    4  
ATOM   8219  C CB   . ARG A 1 103 ? -11.843 -7.513  -15.556 1.00 0.00 ? 1583 ARG A CB   4  
ATOM   8220  C CG   . ARG A 1 103 ? -12.679 -6.507  -14.759 1.00 0.00 ? 1583 ARG A CG   4  
ATOM   8221  C CD   . ARG A 1 103 ? -11.840 -5.450  -14.037 1.00 0.00 ? 1583 ARG A CD   4  
ATOM   8222  N NE   . ARG A 1 103 ? -12.730 -4.335  -13.690 1.00 0.00 ? 1583 ARG A NE   4  
ATOM   8223  C CZ   . ARG A 1 103 ? -13.491 -4.219  -12.606 1.00 0.00 ? 1583 ARG A CZ   4  
ATOM   8224  N NH1  . ARG A 1 103 ? -13.199 -4.917  -11.512 1.00 0.00 ? 1583 ARG A NH1  4  
ATOM   8225  N NH2  . ARG A 1 103 ? -14.539 -3.412  -12.650 1.00 0.00 ? 1583 ARG A NH2  4  
ATOM   8226  H H    . ARG A 1 103 ? -13.004 -6.947  -17.836 1.00 0.00 ? 1583 ARG A H    4  
ATOM   8227  H HA   . ARG A 1 103 ? -11.967 -9.236  -16.810 1.00 0.00 ? 1583 ARG A HA   4  
ATOM   8228  H HB2  . ARG A 1 103 ? -11.226 -8.079  -14.858 1.00 0.00 ? 1583 ARG A HB2  4  
ATOM   8229  H HB3  . ARG A 1 103 ? -11.182 -6.960  -16.223 1.00 0.00 ? 1583 ARG A HB3  4  
ATOM   8230  H HG2  . ARG A 1 103 ? -13.349 -5.998  -15.454 1.00 0.00 ? 1583 ARG A HG2  4  
ATOM   8231  H HG3  . ARG A 1 103 ? -13.272 -7.030  -14.010 1.00 0.00 ? 1583 ARG A HG3  4  
ATOM   8232  H HD2  . ARG A 1 103 ? -11.358 -5.872  -13.151 1.00 0.00 ? 1583 ARG A HD2  4  
ATOM   8233  H HD3  . ARG A 1 103 ? -11.073 -5.086  -14.717 1.00 0.00 ? 1583 ARG A HD3  4  
ATOM   8234  H HE   . ARG A 1 103 ? -12.764 -3.583  -14.393 1.00 0.00 ? 1583 ARG A HE   4  
ATOM   8235  H HH11 . ARG A 1 103 ? -12.324 -5.422  -11.430 1.00 0.00 ? 1583 ARG A HH11 4  
ATOM   8236  H HH12 . ARG A 1 103 ? -13.882 -5.030  -10.750 1.00 0.00 ? 1583 ARG A HH12 4  
ATOM   8237  H HH21 . ARG A 1 103 ? -14.773 -2.950  -13.542 1.00 0.00 ? 1583 ARG A HH21 4  
ATOM   8238  H HH22 . ARG A 1 103 ? -15.252 -3.432  -11.918 1.00 0.00 ? 1583 ARG A HH22 4  
ATOM   8239  N N    . MET A 1 104 ? -14.799 -8.778  -15.161 1.00 0.00 ? 1584 MET A N    4  
ATOM   8240  C CA   . MET A 1 104 ? -15.684 -9.481  -14.228 1.00 0.00 ? 1584 MET A CA   4  
ATOM   8241  C C    . MET A 1 104 ? -16.441 -10.621 -14.902 1.00 0.00 ? 1584 MET A C    4  
ATOM   8242  O O    . MET A 1 104 ? -16.925 -11.520 -14.220 1.00 0.00 ? 1584 MET A O    4  
ATOM   8243  C CB   . MET A 1 104 ? -16.592 -8.487  -13.493 1.00 0.00 ? 1584 MET A CB   4  
ATOM   8244  C CG   . MET A 1 104 ? -17.737 -7.867  -14.312 1.00 0.00 ? 1584 MET A CG   4  
ATOM   8245  S SD   . MET A 1 104 ? -19.148 -8.939  -14.720 1.00 0.00 ? 1584 MET A SD   4  
ATOM   8246  C CE   . MET A 1 104 ? -19.592 -9.555  -13.071 1.00 0.00 ? 1584 MET A CE   4  
ATOM   8247  H H    . MET A 1 104 ? -15.031 -7.837  -15.456 1.00 0.00 ? 1584 MET A H    4  
ATOM   8248  H HA   . MET A 1 104 ? -15.054 -9.950  -13.475 1.00 0.00 ? 1584 MET A HA   4  
ATOM   8249  H HB2  . MET A 1 104 ? -16.999 -8.987  -12.614 1.00 0.00 ? 1584 MET A HB2  4  
ATOM   8250  H HB3  . MET A 1 104 ? -15.966 -7.675  -13.125 1.00 0.00 ? 1584 MET A HB3  4  
ATOM   8251  H HG2  . MET A 1 104 ? -18.135 -7.023  -13.745 1.00 0.00 ? 1584 MET A HG2  4  
ATOM   8252  H HG3  . MET A 1 104 ? -17.335 -7.460  -15.241 1.00 0.00 ? 1584 MET A HG3  4  
ATOM   8253  H HE1  . MET A 1 104 ? -20.599 -9.972  -13.093 1.00 0.00 ? 1584 MET A HE1  4  
ATOM   8254  H HE2  . MET A 1 104 ? -18.897 -10.342 -12.777 1.00 0.00 ? 1584 MET A HE2  4  
ATOM   8255  H HE3  . MET A 1 104 ? -19.523 -8.739  -12.348 1.00 0.00 ? 1584 MET A HE3  4  
ATOM   8256  N N    . ALA A 1 105 ? -16.523 -10.603 -16.234 1.00 0.00 ? 1585 ALA A N    4  
ATOM   8257  C CA   . ALA A 1 105 ? -17.020 -11.725 -17.014 1.00 0.00 ? 1585 ALA A CA   4  
ATOM   8258  C C    . ALA A 1 105 ? -15.942 -12.793 -17.174 1.00 0.00 ? 1585 ALA A C    4  
ATOM   8259  O O    . ALA A 1 105 ? -16.289 -13.947 -17.420 1.00 0.00 ? 1585 ALA A O    4  
ATOM   8260  C CB   . ALA A 1 105 ? -17.439 -11.242 -18.403 1.00 0.00 ? 1585 ALA A CB   4  
ATOM   8261  H H    . ALA A 1 105 ? -16.004 -9.891  -16.731 1.00 0.00 ? 1585 ALA A H    4  
ATOM   8262  H HA   . ALA A 1 105 ? -17.884 -12.161 -16.510 1.00 0.00 ? 1585 ALA A HA   4  
ATOM   8263  H HB1  . ALA A 1 105 ? -16.599 -10.765 -18.902 1.00 0.00 ? 1585 ALA A HB1  4  
ATOM   8264  H HB2  . ALA A 1 105 ? -17.730 -12.101 -19.007 1.00 0.00 ? 1585 ALA A HB2  4  
ATOM   8265  H HB3  . ALA A 1 105 ? -18.279 -10.549 -18.330 1.00 0.00 ? 1585 ALA A HB3  4  
ATOM   8266  N N    . VAL A 1 106 ? -14.662 -12.421 -17.079 1.00 0.00 ? 1586 VAL A N    4  
ATOM   8267  C CA   . VAL A 1 106 ? -13.543 -13.320 -17.231 1.00 0.00 ? 1586 VAL A CA   4  
ATOM   8268  C C    . VAL A 1 106 ? -13.206 -13.787 -15.818 1.00 0.00 ? 1586 VAL A C    4  
ATOM   8269  O O    . VAL A 1 106 ? -12.387 -13.205 -15.107 1.00 0.00 ? 1586 VAL A O    4  
ATOM   8270  C CB   . VAL A 1 106 ? -12.393 -12.577 -17.934 1.00 0.00 ? 1586 VAL A CB   4  
ATOM   8271  C CG1  . VAL A 1 106 ? -11.169 -13.471 -18.105 1.00 0.00 ? 1586 VAL A CG1  4  
ATOM   8272  C CG2  . VAL A 1 106 ? -12.841 -12.128 -19.332 1.00 0.00 ? 1586 VAL A CG2  4  
ATOM   8273  H H    . VAL A 1 106 ? -14.425 -11.463 -16.849 1.00 0.00 ? 1586 VAL A H    4  
ATOM   8274  H HA   . VAL A 1 106 ? -13.834 -14.170 -17.848 1.00 0.00 ? 1586 VAL A HA   4  
ATOM   8275  H HB   . VAL A 1 106 ? -12.112 -11.694 -17.359 1.00 0.00 ? 1586 VAL A HB   4  
ATOM   8276  H HG11 . VAL A 1 106 ? -11.460 -14.352 -18.675 1.00 0.00 ? 1586 VAL A HG11 4  
ATOM   8277  H HG12 . VAL A 1 106 ? -10.383 -12.933 -18.635 1.00 0.00 ? 1586 VAL A HG12 4  
ATOM   8278  H HG13 . VAL A 1 106 ? -10.786 -13.782 -17.135 1.00 0.00 ? 1586 VAL A HG13 4  
ATOM   8279  H HG21 . VAL A 1 106 ? -13.705 -11.471 -19.272 1.00 0.00 ? 1586 VAL A HG21 4  
ATOM   8280  H HG22 . VAL A 1 106 ? -12.044 -11.568 -19.810 1.00 0.00 ? 1586 VAL A HG22 4  
ATOM   8281  H HG23 . VAL A 1 106 ? -13.094 -12.999 -19.939 1.00 0.00 ? 1586 VAL A HG23 4  
ATOM   8282  N N    . ILE A 1 107 ? -13.857 -14.865 -15.411 1.00 0.00 ? 1587 ILE A N    4  
ATOM   8283  C CA   . ILE A 1 107 ? -13.756 -15.384 -14.066 1.00 0.00 ? 1587 ILE A CA   4  
ATOM   8284  C C    . ILE A 1 107 ? -12.731 -16.509 -14.116 1.00 0.00 ? 1587 ILE A C    4  
ATOM   8285  O O    . ILE A 1 107 ? -12.616 -17.225 -15.117 1.00 0.00 ? 1587 ILE A O    4  
ATOM   8286  C CB   . ILE A 1 107 ? -15.146 -15.768 -13.508 1.00 0.00 ? 1587 ILE A CB   4  
ATOM   8287  C CG1  . ILE A 1 107 ? -15.700 -17.023 -14.190 1.00 0.00 ? 1587 ILE A CG1  4  
ATOM   8288  C CG2  . ILE A 1 107 ? -16.114 -14.584 -13.658 1.00 0.00 ? 1587 ILE A CG2  4  
ATOM   8289  C CD1  . ILE A 1 107 ? -17.128 -17.389 -13.781 1.00 0.00 ? 1587 ILE A CD1  4  
ATOM   8290  H H    . ILE A 1 107 ? -14.374 -15.407 -16.091 1.00 0.00 ? 1587 ILE A H    4  
ATOM   8291  H HA   . ILE A 1 107 ? -13.368 -14.608 -13.410 1.00 0.00 ? 1587 ILE A HA   4  
ATOM   8292  H HB   . ILE A 1 107 ? -15.037 -15.975 -12.443 1.00 0.00 ? 1587 ILE A HB   4  
ATOM   8293  H HG12 . ILE A 1 107 ? -15.680 -16.876 -15.273 1.00 0.00 ? 1587 ILE A HG12 4  
ATOM   8294  H HG13 . ILE A 1 107 ? -15.049 -17.859 -13.930 1.00 0.00 ? 1587 ILE A HG13 4  
ATOM   8295  H HG21 . ILE A 1 107 ? -17.018 -14.757 -13.078 1.00 0.00 ? 1587 ILE A HG21 4  
ATOM   8296  H HG22 . ILE A 1 107 ? -15.648 -13.666 -13.296 1.00 0.00 ? 1587 ILE A HG22 4  
ATOM   8297  H HG23 . ILE A 1 107 ? -16.401 -14.465 -14.703 1.00 0.00 ? 1587 ILE A HG23 4  
ATOM   8298  H HD11 . ILE A 1 107 ? -17.200 -17.478 -12.697 1.00 0.00 ? 1587 ILE A HD11 4  
ATOM   8299  H HD12 . ILE A 1 107 ? -17.831 -16.639 -14.136 1.00 0.00 ? 1587 ILE A HD12 4  
ATOM   8300  H HD13 . ILE A 1 107 ? -17.385 -18.340 -14.236 1.00 0.00 ? 1587 ILE A HD13 4  
ATOM   8301  N N    . LEU A 1 108 ? -11.962 -16.665 -13.047 1.00 0.00 ? 1588 LEU A N    4  
ATOM   8302  C CA   . LEU A 1 108 ? -10.889 -17.640 -13.027 1.00 0.00 ? 1588 LEU A CA   4  
ATOM   8303  C C    . LEU A 1 108 ? -11.479 -18.861 -12.364 1.00 0.00 ? 1588 LEU A C    4  
ATOM   8304  O O    . LEU A 1 108 ? -11.858 -18.808 -11.192 1.00 0.00 ? 1588 LEU A O    4  
ATOM   8305  C CB   . LEU A 1 108 ? -9.670  -17.066 -12.286 1.00 0.00 ? 1588 LEU A CB   4  
ATOM   8306  C CG   . LEU A 1 108 ? -8.696  -16.356 -13.239 1.00 0.00 ? 1588 LEU A CG   4  
ATOM   8307  C CD1  . LEU A 1 108 ? -7.890  -15.315 -12.451 1.00 0.00 ? 1588 LEU A CD1  4  
ATOM   8308  C CD2  . LEU A 1 108 ? -7.729  -17.364 -13.878 1.00 0.00 ? 1588 LEU A CD2  4  
ATOM   8309  H H    . LEU A 1 108 ? -12.160 -16.133 -12.203 1.00 0.00 ? 1588 LEU A H    4  
ATOM   8310  H HA   . LEU A 1 108 ? -10.592 -17.892 -14.043 1.00 0.00 ? 1588 LEU A HA   4  
ATOM   8311  H HB2  . LEU A 1 108 ? -10.019 -16.334 -11.562 1.00 0.00 ? 1588 LEU A HB2  4  
ATOM   8312  H HB3  . LEU A 1 108 ? -9.150  -17.859 -11.751 1.00 0.00 ? 1588 LEU A HB3  4  
ATOM   8313  H HG   . LEU A 1 108 ? -9.259  -15.858 -14.036 1.00 0.00 ? 1588 LEU A HG   4  
ATOM   8314  H HD11 . LEU A 1 108 ? -7.084  -14.914 -13.065 1.00 0.00 ? 1588 LEU A HD11 4  
ATOM   8315  H HD12 . LEU A 1 108 ? -8.530  -14.483 -12.142 1.00 0.00 ? 1588 LEU A HD12 4  
ATOM   8316  H HD13 . LEU A 1 108 ? -7.458  -15.756 -11.552 1.00 0.00 ? 1588 LEU A HD13 4  
ATOM   8317  H HD21 . LEU A 1 108 ? -7.083  -16.843 -14.588 1.00 0.00 ? 1588 LEU A HD21 4  
ATOM   8318  H HD22 . LEU A 1 108 ? -7.112  -17.838 -13.113 1.00 0.00 ? 1588 LEU A HD22 4  
ATOM   8319  H HD23 . LEU A 1 108 ? -8.278  -18.137 -14.416 1.00 0.00 ? 1588 LEU A HD23 4  
ATOM   8320  N N    . SER A 1 109 ? -11.599 -19.941 -13.134 1.00 0.00 ? 1589 SER A N    4  
ATOM   8321  C CA   . SER A 1 109 ? -12.026 -21.242 -12.642 1.00 0.00 ? 1589 SER A CA   4  
ATOM   8322  C C    . SER A 1 109 ? -11.107 -21.607 -11.467 1.00 0.00 ? 1589 SER A C    4  
ATOM   8323  O O    . SER A 1 109 ? -9.926  -21.264 -11.495 1.00 0.00 ? 1589 SER A O    4  
ATOM   8324  C CB   . SER A 1 109 ? -12.028 -22.253 -13.803 1.00 0.00 ? 1589 SER A CB   4  
ATOM   8325  O OG   . SER A 1 109 ? -12.184 -21.595 -15.062 1.00 0.00 ? 1589 SER A OG   4  
ATOM   8326  H H    . SER A 1 109 ? -11.355 -19.910 -14.117 1.00 0.00 ? 1589 SER A H    4  
ATOM   8327  H HA   . SER A 1 109 ? -13.046 -21.128 -12.287 1.00 0.00 ? 1589 SER A HA   4  
ATOM   8328  H HB2  . SER A 1 109 ? -11.094 -22.804 -13.818 1.00 0.00 ? 1589 SER A HB2  4  
ATOM   8329  H HB3  . SER A 1 109 ? -12.837 -22.968 -13.657 1.00 0.00 ? 1589 SER A HB3  4  
ATOM   8330  H HG   . SER A 1 109 ? -12.134 -22.266 -15.775 1.00 0.00 ? 1589 SER A HG   4  
ATOM   8331  N N    . LEU A 1 110 ? -11.602 -22.302 -10.440 1.00 0.00 ? 1590 LEU A N    4  
ATOM   8332  C CA   . LEU A 1 110 ? -10.862 -22.473 -9.178  1.00 0.00 ? 1590 LEU A CA   4  
ATOM   8333  C C    . LEU A 1 110 ? -9.477  -23.103 -9.319  1.00 0.00 ? 1590 LEU A C    4  
ATOM   8334  O O    . LEU A 1 110 ? -8.558  -22.680 -8.626  1.00 0.00 ? 1590 LEU A O    4  
ATOM   8335  C CB   . LEU A 1 110 ? -11.727 -23.139 -8.091  1.00 0.00 ? 1590 LEU A CB   4  
ATOM   8336  C CG   . LEU A 1 110 ? -12.001 -24.637 -8.321  1.00 0.00 ? 1590 LEU A CG   4  
ATOM   8337  C CD1  . LEU A 1 110 ? -11.059 -25.537 -7.511  1.00 0.00 ? 1590 LEU A CD1  4  
ATOM   8338  C CD2  . LEU A 1 110 ? -13.452 -24.979 -7.963  1.00 0.00 ? 1590 LEU A CD2  4  
ATOM   8339  H H    . LEU A 1 110 ? -12.558 -22.637 -10.495 1.00 0.00 ? 1590 LEU A H    4  
ATOM   8340  H HA   . LEU A 1 110 ? -10.670 -21.464 -8.829  1.00 0.00 ? 1590 LEU A HA   4  
ATOM   8341  H HB2  . LEU A 1 110 ? -11.242 -23.006 -7.123  1.00 0.00 ? 1590 LEU A HB2  4  
ATOM   8342  H HB3  . LEU A 1 110 ? -12.670 -22.596 -8.038  1.00 0.00 ? 1590 LEU A HB3  4  
ATOM   8343  H HG   . LEU A 1 110 ? -11.846 -24.828 -9.378  1.00 0.00 ? 1590 LEU A HG   4  
ATOM   8344  H HD11 . LEU A 1 110 ? -11.216 -25.380 -6.442  1.00 0.00 ? 1590 LEU A HD11 4  
ATOM   8345  H HD12 . LEU A 1 110 ? -11.260 -26.585 -7.740  1.00 0.00 ? 1590 LEU A HD12 4  
ATOM   8346  H HD13 . LEU A 1 110 ? -10.020 -25.332 -7.759  1.00 0.00 ? 1590 LEU A HD13 4  
ATOM   8347  H HD21 . LEU A 1 110 ? -14.143 -24.413 -8.587  1.00 0.00 ? 1590 LEU A HD21 4  
ATOM   8348  H HD22 . LEU A 1 110 ? -13.633 -26.044 -8.136  1.00 0.00 ? 1590 LEU A HD22 4  
ATOM   8349  H HD23 . LEU A 1 110 ? -13.649 -24.751 -6.912  1.00 0.00 ? 1590 LEU A HD23 4  
ATOM   8350  N N    . GLU A 1 111 ? -9.283  -24.056 -10.228 1.00 0.00 ? 1591 GLU A N    4  
ATOM   8351  C CA   . GLU A 1 111 ? -7.962  -24.646 -10.474 1.00 0.00 ? 1591 GLU A CA   4  
ATOM   8352  C C    . GLU A 1 111 ? -6.998  -23.580 -11.012 1.00 0.00 ? 1591 GLU A C    4  
ATOM   8353  O O    . GLU A 1 111 ? -5.806  -23.591 -10.707 1.00 0.00 ? 1591 GLU A O    4  
ATOM   8354  C CB   . GLU A 1 111 ? -8.138  -25.789 -11.479 1.00 0.00 ? 1591 GLU A CB   4  
ATOM   8355  C CG   . GLU A 1 111 ? -6.829  -26.480 -11.895 1.00 0.00 ? 1591 GLU A CG   4  
ATOM   8356  C CD   . GLU A 1 111 ? -7.073  -27.533 -12.993 1.00 0.00 ? 1591 GLU A CD   4  
ATOM   8357  O OE1  . GLU A 1 111 ? -7.356  -28.712 -12.661 1.00 0.00 ? 1591 GLU A OE1  4  
ATOM   8358  O OE2  . GLU A 1 111 ? -6.982  -27.183 -14.195 1.00 0.00 ? 1591 GLU A OE2  4  
ATOM   8359  H H    . GLU A 1 111 ? -10.070 -24.394 -10.772 1.00 0.00 ? 1591 GLU A H    4  
ATOM   8360  H HA   . GLU A 1 111 ? -7.553  -25.048 -9.544  1.00 0.00 ? 1591 GLU A HA   4  
ATOM   8361  H HB2  . GLU A 1 111 ? -8.807  -26.534 -11.045 1.00 0.00 ? 1591 GLU A HB2  4  
ATOM   8362  H HB3  . GLU A 1 111 ? -8.625  -25.370 -12.353 1.00 0.00 ? 1591 GLU A HB3  4  
ATOM   8363  H HG2  . GLU A 1 111 ? -6.123  -25.743 -12.278 1.00 0.00 ? 1591 GLU A HG2  4  
ATOM   8364  H HG3  . GLU A 1 111 ? -6.378  -26.951 -11.020 1.00 0.00 ? 1591 GLU A HG3  4  
ATOM   8365  N N    . GLN A 1 112 ? -7.517  -22.635 -11.799 1.00 0.00 ? 1592 GLN A N    4  
ATOM   8366  C CA   . GLN A 1 112 ? -6.712  -21.611 -12.442 1.00 0.00 ? 1592 GLN A CA   4  
ATOM   8367  C C    . GLN A 1 112 ? -6.421  -20.508 -11.428 1.00 0.00 ? 1592 GLN A C    4  
ATOM   8368  O O    . GLN A 1 112 ? -5.259  -20.181 -11.222 1.00 0.00 ? 1592 GLN A O    4  
ATOM   8369  C CB   . GLN A 1 112 ? -7.380  -21.100 -13.736 1.00 0.00 ? 1592 GLN A CB   4  
ATOM   8370  C CG   . GLN A 1 112 ? -8.080  -22.202 -14.563 1.00 0.00 ? 1592 GLN A CG   4  
ATOM   8371  C CD   . GLN A 1 112 ? -7.272  -23.497 -14.747 1.00 0.00 ? 1592 GLN A CD   4  
ATOM   8372  O OE1  . GLN A 1 112 ? -6.043  -23.502 -14.764 1.00 0.00 ? 1592 GLN A OE1  4  
ATOM   8373  N NE2  . GLN A 1 112 ? -7.957  -24.620 -14.882 1.00 0.00 ? 1592 GLN A NE2  4  
ATOM   8374  H H    . GLN A 1 112 ? -8.523  -22.592 -11.918 1.00 0.00 ? 1592 GLN A H    4  
ATOM   8375  H HA   . GLN A 1 112 ? -5.762  -22.061 -12.721 1.00 0.00 ? 1592 GLN A HA   4  
ATOM   8376  H HB2  . GLN A 1 112 ? -8.124  -20.340 -13.489 1.00 0.00 ? 1592 GLN A HB2  4  
ATOM   8377  H HB3  . GLN A 1 112 ? -6.618  -20.626 -14.354 1.00 0.00 ? 1592 GLN A HB3  4  
ATOM   8378  H HG2  . GLN A 1 112 ? -9.004  -22.451 -14.042 1.00 0.00 ? 1592 GLN A HG2  4  
ATOM   8379  H HG3  . GLN A 1 112 ? -8.365  -21.808 -15.536 1.00 0.00 ? 1592 GLN A HG3  4  
ATOM   8380  H HE21 . GLN A 1 112 ? -8.966  -24.611 -14.966 1.00 0.00 ? 1592 GLN A HE21 4  
ATOM   8381  H HE22 . GLN A 1 112 ? -7.476  -25.524 -14.845 1.00 0.00 ? 1592 GLN A HE22 4  
ATOM   8382  N N    . GLY A 1 113 ? -7.437  -20.038 -10.694 1.00 0.00 ? 1593 GLY A N    4  
ATOM   8383  C CA   . GLY A 1 113 ? -7.269  -19.102 -9.580  1.00 0.00 ? 1593 GLY A CA   4  
ATOM   8384  C C    . GLY A 1 113 ? -6.221  -19.592 -8.585  1.00 0.00 ? 1593 GLY A C    4  
ATOM   8385  O O    . GLY A 1 113 ? -5.387  -18.807 -8.138  1.00 0.00 ? 1593 GLY A O    4  
ATOM   8386  H H    . GLY A 1 113 ? -8.380  -20.370 -10.887 1.00 0.00 ? 1593 GLY A H    4  
ATOM   8387  H HA2  . GLY A 1 113 ? -6.977  -18.125 -9.964  1.00 0.00 ? 1593 GLY A HA2  4  
ATOM   8388  H HA3  . GLY A 1 113 ? -8.221  -18.998 -9.058  1.00 0.00 ? 1593 GLY A HA3  4  
ATOM   8389  N N    . ASN A 1 114 ? -6.183  -20.905 -8.317  1.00 0.00 ? 1594 ASN A N    4  
ATOM   8390  C CA   . ASN A 1 114 ? -5.184  -21.506 -7.424  1.00 0.00 ? 1594 ASN A CA   4  
ATOM   8391  C C    . ASN A 1 114 ? -3.761  -21.179 -7.875  1.00 0.00 ? 1594 ASN A C    4  
ATOM   8392  O O    . ASN A 1 114 ? -2.947  -20.738 -7.068  1.00 0.00 ? 1594 ASN A O    4  
ATOM   8393  C CB   . ASN A 1 114 ? -5.355  -23.033 -7.325  1.00 0.00 ? 1594 ASN A CB   4  
ATOM   8394  C CG   . ASN A 1 114 ? -6.126  -23.436 -6.076  1.00 0.00 ? 1594 ASN A CG   4  
ATOM   8395  O OD1  . ASN A 1 114 ? -5.548  -23.642 -5.013  1.00 0.00 ? 1594 ASN A OD1  4  
ATOM   8396  N ND2  . ASN A 1 114 ? -7.443  -23.550 -6.179  1.00 0.00 ? 1594 ASN A ND2  4  
ATOM   8397  H H    . ASN A 1 114 ? -6.881  -21.506 -8.746  1.00 0.00 ? 1594 ASN A H    4  
ATOM   8398  H HA   . ASN A 1 114 ? -5.311  -21.083 -6.432  1.00 0.00 ? 1594 ASN A HA   4  
ATOM   8399  H HB2  . ASN A 1 114 ? -5.843  -23.436 -8.210  1.00 0.00 ? 1594 ASN A HB2  4  
ATOM   8400  H HB3  . ASN A 1 114 ? -4.369  -23.502 -7.285  1.00 0.00 ? 1594 ASN A HB3  4  
ATOM   8401  H HD21 . ASN A 1 114 ? -7.914  -23.325 -7.054  1.00 0.00 ? 1594 ASN A HD21 4  
ATOM   8402  H HD22 . ASN A 1 114 ? -7.990  -23.839 -5.379  1.00 0.00 ? 1594 ASN A HD22 4  
ATOM   8403  N N    . ARG A 1 115 ? -3.478  -21.321 -9.171  1.00 0.00 ? 1595 ARG A N    4  
ATOM   8404  C CA   . ARG A 1 115 ? -2.140  -21.092 -9.725  1.00 0.00 ? 1595 ARG A CA   4  
ATOM   8405  C C    . ARG A 1 115 ? -1.710  -19.641 -9.549  1.00 0.00 ? 1595 ARG A C    4  
ATOM   8406  O O    . ARG A 1 115 ? -0.510  -19.373 -9.502  1.00 0.00 ? 1595 ARG A O    4  
ATOM   8407  C CB   . ARG A 1 115 ? -2.099  -21.457 -11.208 1.00 0.00 ? 1595 ARG A CB   4  
ATOM   8408  C CG   . ARG A 1 115 ? -2.394  -22.948 -11.431 1.00 0.00 ? 1595 ARG A CG   4  
ATOM   8409  C CD   . ARG A 1 115 ? -3.003  -23.137 -12.810 1.00 0.00 ? 1595 ARG A CD   4  
ATOM   8410  N NE   . ARG A 1 115 ? -1.976  -23.189 -13.866 1.00 0.00 ? 1595 ARG A NE   4  
ATOM   8411  C CZ   . ARG A 1 115 ? -2.163  -23.551 -15.145 1.00 0.00 ? 1595 ARG A CZ   4  
ATOM   8412  N NH1  . ARG A 1 115 ? -3.371  -23.854 -15.613 1.00 0.00 ? 1595 ARG A NH1  4  
ATOM   8413  N NH2  . ARG A 1 115 ? -1.114  -23.608 -15.961 1.00 0.00 ? 1595 ARG A NH2  4  
ATOM   8414  H H    . ARG A 1 115 ? -4.219  -21.606 -9.803  1.00 0.00 ? 1595 ARG A H    4  
ATOM   8415  H HA   . ARG A 1 115 ? -1.435  -21.744 -9.212  1.00 0.00 ? 1595 ARG A HA   4  
ATOM   8416  H HB2  . ARG A 1 115 ? -2.819  -20.830 -11.732 1.00 0.00 ? 1595 ARG A HB2  4  
ATOM   8417  H HB3  . ARG A 1 115 ? -1.114  -21.228 -11.614 1.00 0.00 ? 1595 ARG A HB3  4  
ATOM   8418  H HG2  . ARG A 1 115 ? -1.483  -23.541 -11.324 1.00 0.00 ? 1595 ARG A HG2  4  
ATOM   8419  H HG3  . ARG A 1 115 ? -3.121  -23.311 -10.705 1.00 0.00 ? 1595 ARG A HG3  4  
ATOM   8420  H HD2  . ARG A 1 115 ? -3.581  -24.058 -12.785 1.00 0.00 ? 1595 ARG A HD2  4  
ATOM   8421  H HD3  . ARG A 1 115 ? -3.673  -22.292 -12.971 1.00 0.00 ? 1595 ARG A HD3  4  
ATOM   8422  H HE   . ARG A 1 115 ? -1.037  -22.927 -13.584 1.00 0.00 ? 1595 ARG A HE   4  
ATOM   8423  H HH11 . ARG A 1 115 ? -4.216  -23.775 -15.040 1.00 0.00 ? 1595 ARG A HH11 4  
ATOM   8424  H HH12 . ARG A 1 115 ? -3.510  -24.174 -16.567 1.00 0.00 ? 1595 ARG A HH12 4  
ATOM   8425  H HH21 . ARG A 1 115 ? -0.174  -23.400 -15.638 1.00 0.00 ? 1595 ARG A HH21 4  
ATOM   8426  H HH22 . ARG A 1 115 ? -1.202  -23.871 -16.937 1.00 0.00 ? 1595 ARG A HH22 4  
ATOM   8427  N N    . LEU A 1 116 ? -2.659  -18.701 -9.463  1.00 0.00 ? 1596 LEU A N    4  
ATOM   8428  C CA   . LEU A 1 116 ? -2.326  -17.318 -9.168  1.00 0.00 ? 1596 LEU A CA   4  
ATOM   8429  C C    . LEU A 1 116 ? -2.185  -17.096 -7.665  1.00 0.00 ? 1596 LEU A C    4  
ATOM   8430  O O    . LEU A 1 116 ? -1.436  -16.214 -7.254  1.00 0.00 ? 1596 LEU A O    4  
ATOM   8431  C CB   . LEU A 1 116 ? -3.401  -16.367 -9.711  1.00 0.00 ? 1596 LEU A CB   4  
ATOM   8432  C CG   . LEU A 1 116 ? -3.510  -16.190 -11.240 1.00 0.00 ? 1596 LEU A CG   4  
ATOM   8433  C CD1  . LEU A 1 116 ? -2.182  -16.310 -11.999 1.00 0.00 ? 1596 LEU A CD1  4  
ATOM   8434  C CD2  . LEU A 1 116 ? -4.502  -17.179 -11.849 1.00 0.00 ? 1596 LEU A CD2  4  
ATOM   8435  H H    . LEU A 1 116 ? -3.639  -18.954 -9.495  1.00 0.00 ? 1596 LEU A H    4  
ATOM   8436  H HA   . LEU A 1 116 ? -1.375  -17.088 -9.637  1.00 0.00 ? 1596 LEU A HA   4  
ATOM   8437  H HB2  . LEU A 1 116 ? -4.367  -16.655 -9.299  1.00 0.00 ? 1596 LEU A HB2  4  
ATOM   8438  H HB3  . LEU A 1 116 ? -3.177  -15.394 -9.294  1.00 0.00 ? 1596 LEU A HB3  4  
ATOM   8439  H HG   . LEU A 1 116 ? -3.905  -15.192 -11.411 1.00 0.00 ? 1596 LEU A HG   4  
ATOM   8440  H HD11 . LEU A 1 116 ? -2.320  -16.009 -13.039 1.00 0.00 ? 1596 LEU A HD11 4  
ATOM   8441  H HD12 . LEU A 1 116 ? -1.432  -15.665 -11.544 1.00 0.00 ? 1596 LEU A HD12 4  
ATOM   8442  H HD13 . LEU A 1 116 ? -1.818  -17.339 -11.983 1.00 0.00 ? 1596 LEU A HD13 4  
ATOM   8443  H HD21 . LEU A 1 116 ? -4.074  -18.177 -11.850 1.00 0.00 ? 1596 LEU A HD21 4  
ATOM   8444  H HD22 . LEU A 1 116 ? -5.428  -17.169 -11.277 1.00 0.00 ? 1596 LEU A HD22 4  
ATOM   8445  H HD23 . LEU A 1 116 ? -4.726  -16.889 -12.876 1.00 0.00 ? 1596 LEU A HD23 4  
ATOM   8446  N N    . ARG A 1 117 ? -2.909  -17.852 -6.831  1.00 0.00 ? 1597 ARG A N    4  
ATOM   8447  C CA   . ARG A 1 117 ? -2.960  -17.652 -5.382  1.00 0.00 ? 1597 ARG A CA   4  
ATOM   8448  C C    . ARG A 1 117 ? -1.580  -17.678 -4.749  1.00 0.00 ? 1597 ARG A C    4  
ATOM   8449  O O    . ARG A 1 117 ? -1.300  -16.866 -3.874  1.00 0.00 ? 1597 ARG A O    4  
ATOM   8450  C CB   . ARG A 1 117 ? -3.905  -18.704 -4.771  1.00 0.00 ? 1597 ARG A CB   4  
ATOM   8451  C CG   . ARG A 1 117 ? -4.472  -18.222 -3.435  1.00 0.00 ? 1597 ARG A CG   4  
ATOM   8452  C CD   . ARG A 1 117 ? -5.544  -19.140 -2.838  1.00 0.00 ? 1597 ARG A CD   4  
ATOM   8453  N NE   . ARG A 1 117 ? -5.022  -20.469 -2.465  1.00 0.00 ? 1597 ARG A NE   4  
ATOM   8454  C CZ   . ARG A 1 117 ? -5.732  -21.445 -1.881  1.00 0.00 ? 1597 ARG A CZ   4  
ATOM   8455  N NH1  . ARG A 1 117 ? -7.012  -21.268 -1.564  1.00 0.00 ? 1597 ARG A NH1  4  
ATOM   8456  N NH2  . ARG A 1 117 ? -5.147  -22.608 -1.615  1.00 0.00 ? 1597 ARG A NH2  4  
ATOM   8457  H H    . ARG A 1 117 ? -3.529  -18.555 -7.224  1.00 0.00 ? 1597 ARG A H    4  
ATOM   8458  H HA   . ARG A 1 117 ? -3.358  -16.658 -5.195  1.00 0.00 ? 1597 ARG A HA   4  
ATOM   8459  H HB2  . ARG A 1 117 ? -4.747  -18.866 -5.448  1.00 0.00 ? 1597 ARG A HB2  4  
ATOM   8460  H HB3  . ARG A 1 117 ? -3.374  -19.643 -4.641  1.00 0.00 ? 1597 ARG A HB3  4  
ATOM   8461  H HG2  . ARG A 1 117 ? -3.672  -18.078 -2.705  1.00 0.00 ? 1597 ARG A HG2  4  
ATOM   8462  H HG3  . ARG A 1 117 ? -4.945  -17.261 -3.627  1.00 0.00 ? 1597 ARG A HG3  4  
ATOM   8463  H HD2  . ARG A 1 117 ? -5.942  -18.659 -1.944  1.00 0.00 ? 1597 ARG A HD2  4  
ATOM   8464  H HD3  . ARG A 1 117 ? -6.354  -19.265 -3.557  1.00 0.00 ? 1597 ARG A HD3  4  
ATOM   8465  H HE   . ARG A 1 117 ? -4.044  -20.640 -2.672  1.00 0.00 ? 1597 ARG A HE   4  
ATOM   8466  H HH11 . ARG A 1 117 ? -7.493  -20.369 -1.720  1.00 0.00 ? 1597 ARG A HH11 4  
ATOM   8467  H HH12 . ARG A 1 117 ? -7.556  -21.987 -1.106  1.00 0.00 ? 1597 ARG A HH12 4  
ATOM   8468  H HH21 . ARG A 1 117 ? -4.180  -22.785 -1.867  1.00 0.00 ? 1597 ARG A HH21 4  
ATOM   8469  H HH22 . ARG A 1 117 ? -5.643  -23.372 -1.173  1.00 0.00 ? 1597 ARG A HH22 4  
ATOM   8470  N N    . GLU A 1 118 ? -0.699  -18.549 -5.227  1.00 0.00 ? 1598 GLU A N    4  
ATOM   8471  C CA   . GLU A 1 118 ? 0.661   -18.671 -4.714  1.00 0.00 ? 1598 GLU A CA   4  
ATOM   8472  C C    . GLU A 1 118 ? 1.521   -17.413 -4.941  1.00 0.00 ? 1598 GLU A C    4  
ATOM   8473  O O    . GLU A 1 118 ? 2.536   -17.265 -4.255  1.00 0.00 ? 1598 GLU A O    4  
ATOM   8474  C CB   . GLU A 1 118 ? 1.327   -19.927 -5.299  1.00 0.00 ? 1598 GLU A CB   4  
ATOM   8475  C CG   . GLU A 1 118 ? 1.272   -19.995 -6.833  1.00 0.00 ? 1598 GLU A CG   4  
ATOM   8476  C CD   . GLU A 1 118 ? 2.142   -21.142 -7.384  1.00 0.00 ? 1598 GLU A CD   4  
ATOM   8477  O OE1  . GLU A 1 118 ? 1.637   -22.284 -7.518  1.00 0.00 ? 1598 GLU A OE1  4  
ATOM   8478  O OE2  . GLU A 1 118 ? 3.340   -20.913 -7.691  1.00 0.00 ? 1598 GLU A OE2  4  
ATOM   8479  H H    . GLU A 1 118 ? -0.998  -19.210 -5.933  1.00 0.00 ? 1598 GLU A H    4  
ATOM   8480  H HA   . GLU A 1 118 ? 0.592   -18.811 -3.632  1.00 0.00 ? 1598 GLU A HA   4  
ATOM   8481  H HB2  . GLU A 1 118 ? 2.368   -19.953 -4.973  1.00 0.00 ? 1598 GLU A HB2  4  
ATOM   8482  H HB3  . GLU A 1 118 ? 0.823   -20.804 -4.894  1.00 0.00 ? 1598 GLU A HB3  4  
ATOM   8483  H HG2  . GLU A 1 118 ? 0.232   -20.153 -7.127  1.00 0.00 ? 1598 GLU A HG2  4  
ATOM   8484  H HG3  . GLU A 1 118 ? 1.602   -19.041 -7.253  1.00 0.00 ? 1598 GLU A HG3  4  
ATOM   8485  N N    . GLN A 1 119 ? 1.143   -16.501 -5.854  1.00 0.00 ? 1599 GLN A N    4  
ATOM   8486  C CA   . GLN A 1 119 ? 1.896   -15.275 -6.120  1.00 0.00 ? 1599 GLN A CA   4  
ATOM   8487  C C    . GLN A 1 119 ? 1.105   -14.038 -5.682  1.00 0.00 ? 1599 GLN A C    4  
ATOM   8488  O O    . GLN A 1 119 ? 1.660   -13.131 -5.059  1.00 0.00 ? 1599 GLN A O    4  
ATOM   8489  C CB   . GLN A 1 119 ? 2.258   -15.229 -7.617  1.00 0.00 ? 1599 GLN A CB   4  
ATOM   8490  C CG   . GLN A 1 119 ? 3.246   -14.104 -7.957  1.00 0.00 ? 1599 GLN A CG   4  
ATOM   8491  C CD   . GLN A 1 119 ? 3.993   -14.368 -9.271  1.00 0.00 ? 1599 GLN A CD   4  
ATOM   8492  O OE1  . GLN A 1 119 ? 5.217   -14.502 -9.284  1.00 0.00 ? 1599 GLN A OE1  4  
ATOM   8493  N NE2  . GLN A 1 119 ? 3.299   -14.455 -10.398 1.00 0.00 ? 1599 GLN A NE2  4  
ATOM   8494  H H    . GLN A 1 119 ? 0.279   -16.625 -6.367  1.00 0.00 ? 1599 GLN A H    4  
ATOM   8495  H HA   . GLN A 1 119 ? 2.826   -15.286 -5.551  1.00 0.00 ? 1599 GLN A HA   4  
ATOM   8496  H HB2  . GLN A 1 119 ? 2.726   -16.169 -7.891  1.00 0.00 ? 1599 GLN A HB2  4  
ATOM   8497  H HB3  . GLN A 1 119 ? 1.351   -15.126 -8.216  1.00 0.00 ? 1599 GLN A HB3  4  
ATOM   8498  H HG2  . GLN A 1 119 ? 2.719   -13.152 -8.013  1.00 0.00 ? 1599 GLN A HG2  4  
ATOM   8499  H HG3  . GLN A 1 119 ? 3.979   -14.029 -7.155  1.00 0.00 ? 1599 GLN A HG3  4  
ATOM   8500  H HE21 . GLN A 1 119 ? 2.293   -14.351 -10.403 1.00 0.00 ? 1599 GLN A HE21 4  
ATOM   8501  H HE22 . GLN A 1 119 ? 3.778   -14.626 -11.273 1.00 0.00 ? 1599 GLN A HE22 4  
ATOM   8502  N N    . TYR A 1 120 ? -0.190  -14.004 -5.999  1.00 0.00 ? 1600 TYR A N    4  
ATOM   8503  C CA   . TYR A 1 120 ? -1.040  -12.822 -5.865  1.00 0.00 ? 1600 TYR A CA   4  
ATOM   8504  C C    . TYR A 1 120 ? -1.902  -12.838 -4.610  1.00 0.00 ? 1600 TYR A C    4  
ATOM   8505  O O    . TYR A 1 120 ? -2.492  -11.805 -4.289  1.00 0.00 ? 1600 TYR A O    4  
ATOM   8506  C CB   . TYR A 1 120 ? -1.950  -12.755 -7.100  1.00 0.00 ? 1600 TYR A CB   4  
ATOM   8507  C CG   . TYR A 1 120 ? -1.263  -12.726 -8.449  1.00 0.00 ? 1600 TYR A CG   4  
ATOM   8508  C CD1  . TYR A 1 120 ? 0.099   -12.403 -8.581  1.00 0.00 ? 1600 TYR A CD1  4  
ATOM   8509  C CD2  . TYR A 1 120 ? -2.014  -13.033 -9.593  1.00 0.00 ? 1600 TYR A CD2  4  
ATOM   8510  C CE1  . TYR A 1 120 ? 0.715   -12.442 -9.842  1.00 0.00 ? 1600 TYR A CE1  4  
ATOM   8511  C CE2  . TYR A 1 120 ? -1.413  -13.072 -10.862 1.00 0.00 ? 1600 TYR A CE2  4  
ATOM   8512  C CZ   . TYR A 1 120 ? -0.030  -12.786 -10.990 1.00 0.00 ? 1600 TYR A CZ   4  
ATOM   8513  O OH   . TYR A 1 120 ? 0.594   -12.839 -12.203 1.00 0.00 ? 1600 TYR A OH   4  
ATOM   8514  H H    . TYR A 1 120 ? -0.566  -14.770 -6.554  1.00 0.00 ? 1600 TYR A H    4  
ATOM   8515  H HA   . TYR A 1 120 ? -0.427  -11.921 -5.824  1.00 0.00 ? 1600 TYR A HA   4  
ATOM   8516  H HB2  . TYR A 1 120 ? -2.603  -13.626 -7.076  1.00 0.00 ? 1600 TYR A HB2  4  
ATOM   8517  H HB3  . TYR A 1 120 ? -2.584  -11.879 -7.033  1.00 0.00 ? 1600 TYR A HB3  4  
ATOM   8518  H HD1  . TYR A 1 120 ? 0.686   -12.125 -7.723  1.00 0.00 ? 1600 TYR A HD1  4  
ATOM   8519  H HD2  . TYR A 1 120 ? -3.067  -13.242 -9.496  1.00 0.00 ? 1600 TYR A HD2  4  
ATOM   8520  H HE1  . TYR A 1 120 ? 1.764   -12.204 -9.923  1.00 0.00 ? 1600 TYR A HE1  4  
ATOM   8521  H HE2  . TYR A 1 120 ? -2.012  -13.319 -11.724 1.00 0.00 ? 1600 TYR A HE2  4  
ATOM   8522  H HH   . TYR A 1 120 ? 0.007   -13.052 -12.946 1.00 0.00 ? 1600 TYR A HH   4  
ATOM   8523  N N    . GLY A 1 121 ? -2.002  -13.991 -3.942  1.00 0.00 ? 1601 GLY A N    4  
ATOM   8524  C CA   . GLY A 1 121 ? -2.695  -14.122 -2.669  1.00 0.00 ? 1601 GLY A CA   4  
ATOM   8525  C C    . GLY A 1 121 ? -2.188  -13.057 -1.694  1.00 0.00 ? 1601 GLY A C    4  
ATOM   8526  O O    . GLY A 1 121 ? -0.970  -12.883 -1.569  1.00 0.00 ? 1601 GLY A O    4  
ATOM   8527  H H    . GLY A 1 121 ? -1.455  -14.783 -4.264  1.00 0.00 ? 1601 GLY A H    4  
ATOM   8528  H HA2  . GLY A 1 121 ? -3.764  -14.035 -2.824  1.00 0.00 ? 1601 GLY A HA2  4  
ATOM   8529  H HA3  . GLY A 1 121 ? -2.495  -15.106 -2.248  1.00 0.00 ? 1601 GLY A HA3  4  
ATOM   8530  N N    . LEU A 1 122 ? -3.087  -12.351 -0.995  1.00 0.00 ? 1602 LEU A N    4  
ATOM   8531  C CA   . LEU A 1 122 ? -2.676  -11.371 0.005   1.00 0.00 ? 1602 LEU A CA   4  
ATOM   8532  C C    . LEU A 1 122 ? -1.923  -12.046 1.149   1.00 0.00 ? 1602 LEU A C    4  
ATOM   8533  O O    . LEU A 1 122 ? -1.001  -11.451 1.713   1.00 0.00 ? 1602 LEU A O    4  
ATOM   8534  C CB   . LEU A 1 122 ? -3.849  -10.623 0.661   1.00 0.00 ? 1602 LEU A CB   4  
ATOM   8535  C CG   . LEU A 1 122 ? -5.069  -10.268 -0.183  1.00 0.00 ? 1602 LEU A CG   4  
ATOM   8536  C CD1  . LEU A 1 122 ? -5.998  -9.403  0.674   1.00 0.00 ? 1602 LEU A CD1  4  
ATOM   8537  C CD2  . LEU A 1 122 ? -4.715  -9.540  -1.472  1.00 0.00 ? 1602 LEU A CD2  4  
ATOM   8538  H H    . LEU A 1 122 ? -4.075  -12.446 -1.194  1.00 0.00 ? 1602 LEU A H    4  
ATOM   8539  H HA   . LEU A 1 122 ? -2.035  -10.645 -0.487  1.00 0.00 ? 1602 LEU A HA   4  
ATOM   8540  H HB2  . LEU A 1 122 ? -4.210  -11.189 1.519   1.00 0.00 ? 1602 LEU A HB2  4  
ATOM   8541  H HB3  . LEU A 1 122 ? -3.419  -9.703  1.036   1.00 0.00 ? 1602 LEU A HB3  4  
ATOM   8542  H HG   . LEU A 1 122 ? -5.572  -11.184 -0.447  1.00 0.00 ? 1602 LEU A HG   4  
ATOM   8543  H HD11 . LEU A 1 122 ? -5.452  -8.591  1.144   1.00 0.00 ? 1602 LEU A HD11 4  
ATOM   8544  H HD12 . LEU A 1 122 ? -6.794  -8.981  0.064   1.00 0.00 ? 1602 LEU A HD12 4  
ATOM   8545  H HD13 . LEU A 1 122 ? -6.424  -10.012 1.469   1.00 0.00 ? 1602 LEU A HD13 4  
ATOM   8546  H HD21 . LEU A 1 122 ? -4.077  -8.710  -1.208  1.00 0.00 ? 1602 LEU A HD21 4  
ATOM   8547  H HD22 . LEU A 1 122 ? -4.188  -10.217 -2.141  1.00 0.00 ? 1602 LEU A HD22 4  
ATOM   8548  H HD23 . LEU A 1 122 ? -5.609  -9.182  -1.985  1.00 0.00 ? 1602 LEU A HD23 4  
ATOM   8549  N N    . GLY A 1 123 ? -2.396  -13.236 1.533   1.00 0.00 ? 1603 GLY A N    4  
ATOM   8550  C CA   . GLY A 1 123 ? -1.934  -13.951 2.709   1.00 0.00 ? 1603 GLY A CA   4  
ATOM   8551  C C    . GLY A 1 123 ? -0.437  -14.235 2.601   1.00 0.00 ? 1603 GLY A C    4  
ATOM   8552  O O    . GLY A 1 123 ? -0.013  -14.824 1.580   1.00 0.00 ? 1603 GLY A O    4  
ATOM   8553  O OXT  . GLY A 1 123 ? 0.302   -13.891 3.549   1.00 0.00 ? 1603 GLY A OXT  4  
ATOM   8554  H H    . GLY A 1 123 ? -3.146  -13.642 0.998   1.00 0.00 ? 1603 GLY A H    4  
ATOM   8555  H HA2  . GLY A 1 123 ? -2.138  -13.318 3.572   1.00 0.00 ? 1603 GLY A HA2  4  
ATOM   8556  H HA3  . GLY A 1 123 ? -2.487  -14.883 2.801   1.00 0.00 ? 1603 GLY A HA3  4  
ATOM   8557  N N    . GLY B 2 1   ? -28.861 -25.843 -21.308 1.00 0.00 ? 14   GLY B N    4  
ATOM   8558  C CA   . GLY B 2 1   ? -27.618 -26.179 -22.045 1.00 0.00 ? 14   GLY B CA   4  
ATOM   8559  C C    . GLY B 2 1   ? -26.364 -25.657 -21.338 1.00 0.00 ? 14   GLY B C    4  
ATOM   8560  O O    . GLY B 2 1   ? -25.743 -26.390 -20.565 1.00 0.00 ? 14   GLY B O    4  
ATOM   8561  H H1   . GLY B 2 1   ? -28.981 -24.846 -21.250 1.00 0.00 ? 14   GLY B H1   4  
ATOM   8562  H H2   . GLY B 2 1   ? -28.820 -26.219 -20.371 1.00 0.00 ? 14   GLY B H2   4  
ATOM   8563  H H3   . GLY B 2 1   ? -29.659 -26.239 -21.777 1.00 0.00 ? 14   GLY B H3   4  
ATOM   8564  H HA2  . GLY B 2 1   ? -27.540 -27.266 -22.132 1.00 0.00 ? 14   GLY B HA2  4  
ATOM   8565  H HA3  . GLY B 2 1   ? -27.662 -25.769 -23.057 1.00 0.00 ? 14   GLY B HA3  4  
ATOM   8566  N N    . ALA B 2 2   ? -25.977 -24.394 -21.595 1.00 0.00 ? 15   ALA B N    4  
ATOM   8567  C CA   . ALA B 2 2   ? -24.698 -23.811 -21.165 1.00 0.00 ? 15   ALA B CA   4  
ATOM   8568  C C    . ALA B 2 2   ? -24.893 -22.417 -20.556 1.00 0.00 ? 15   ALA B C    4  
ATOM   8569  O O    . ALA B 2 2   ? -24.090 -21.509 -20.761 1.00 0.00 ? 15   ALA B O    4  
ATOM   8570  C CB   . ALA B 2 2   ? -23.726 -23.809 -22.353 1.00 0.00 ? 15   ALA B CB   4  
ATOM   8571  H H    . ALA B 2 2   ? -26.526 -23.838 -22.247 1.00 0.00 ? 15   ALA B H    4  
ATOM   8572  H HA   . ALA B 2 2   ? -24.266 -24.435 -20.383 1.00 0.00 ? 15   ALA B HA   4  
ATOM   8573  H HB1  . ALA B 2 2   ? -22.754 -23.439 -22.034 1.00 0.00 ? 15   ALA B HB1  4  
ATOM   8574  H HB2  . ALA B 2 2   ? -23.605 -24.824 -22.735 1.00 0.00 ? 15   ALA B HB2  4  
ATOM   8575  H HB3  . ALA B 2 2   ? -24.105 -23.167 -23.149 1.00 0.00 ? 15   ALA B HB3  4  
ATOM   8576  N N    . LYS B 2 3   ? -26.005 -22.198 -19.851 1.00 0.00 ? 16   LYS B N    4  
ATOM   8577  C CA   . LYS B 2 3   ? -26.275 -20.920 -19.179 1.00 0.00 ? 16   LYS B CA   4  
ATOM   8578  C C    . LYS B 2 3   ? -25.486 -20.833 -17.871 1.00 0.00 ? 16   LYS B C    4  
ATOM   8579  O O    . LYS B 2 3   ? -25.084 -21.862 -17.332 1.00 0.00 ? 16   LYS B O    4  
ATOM   8580  C CB   . LYS B 2 3   ? -27.783 -20.823 -18.886 1.00 0.00 ? 16   LYS B CB   4  
ATOM   8581  C CG   . LYS B 2 3   ? -28.407 -19.438 -19.146 1.00 0.00 ? 16   LYS B CG   4  
ATOM   8582  C CD   . LYS B 2 3   ? -28.318 -19.025 -20.622 1.00 0.00 ? 16   LYS B CD   4  
ATOM   8583  C CE   . LYS B 2 3   ? -29.400 -18.006 -21.033 1.00 0.00 ? 16   LYS B CE   4  
ATOM   8584  N NZ   . LYS B 2 3   ? -29.230 -16.672 -20.413 1.00 0.00 ? 16   LYS B NZ   4  
ATOM   8585  H H    . LYS B 2 3   ? -26.610 -22.982 -19.647 1.00 0.00 ? 16   LYS B H    4  
ATOM   8586  H HA   . LYS B 2 3   ? -25.963 -20.112 -19.839 1.00 0.00 ? 16   LYS B HA   4  
ATOM   8587  H HB2  . LYS B 2 3   ? -28.314 -21.551 -19.496 1.00 0.00 ? 16   LYS B HB2  4  
ATOM   8588  H HB3  . LYS B 2 3   ? -27.941 -21.109 -17.847 1.00 0.00 ? 16   LYS B HB3  4  
ATOM   8589  H HG2  . LYS B 2 3   ? -29.457 -19.488 -18.860 1.00 0.00 ? 16   LYS B HG2  4  
ATOM   8590  H HG3  . LYS B 2 3   ? -27.908 -18.680 -18.544 1.00 0.00 ? 16   LYS B HG3  4  
ATOM   8591  H HD2  . LYS B 2 3   ? -27.319 -18.635 -20.831 1.00 0.00 ? 16   LYS B HD2  4  
ATOM   8592  H HD3  . LYS B 2 3   ? -28.457 -19.922 -21.227 1.00 0.00 ? 16   LYS B HD3  4  
ATOM   8593  H HE2  . LYS B 2 3   ? -29.348 -17.889 -22.121 1.00 0.00 ? 16   LYS B HE2  4  
ATOM   8594  H HE3  . LYS B 2 3   ? -30.387 -18.406 -20.788 1.00 0.00 ? 16   LYS B HE3  4  
ATOM   8595  H HZ1  . LYS B 2 3   ? -29.788 -15.967 -20.894 1.00 0.00 ? 16   LYS B HZ1  4  
ATOM   8596  H HZ2  . LYS B 2 3   ? -29.471 -16.646 -19.421 1.00 0.00 ? 16   LYS B HZ2  4  
ATOM   8597  H HZ3  . LYS B 2 3   ? -28.284 -16.339 -20.555 1.00 0.00 ? 16   LYS B HZ3  4  
ATOM   8598  N N    . ARG B 2 4   ? -25.328 -19.605 -17.356 1.00 0.00 ? 17   ARG B N    4  
ATOM   8599  C CA   . ARG B 2 4   ? -24.669 -19.229 -16.098 1.00 0.00 ? 17   ARG B CA   4  
ATOM   8600  C C    . ARG B 2 4   ? -24.742 -20.342 -15.057 1.00 0.00 ? 17   ARG B C    4  
ATOM   8601  O O    . ARG B 2 4   ? -25.823 -20.775 -14.651 1.00 0.00 ? 17   ARG B O    4  
ATOM   8602  C CB   . ARG B 2 4   ? -25.247 -17.910 -15.610 1.00 0.00 ? 17   ARG B CB   4  
ATOM   8603  C CG   . ARG B 2 4   ? -24.577 -17.435 -14.324 1.00 0.00 ? 17   ARG B CG   4  
ATOM   8604  C CD   . ARG B 2 4   ? -24.902 -15.965 -14.108 1.00 0.00 ? 17   ARG B CD   4  
ATOM   8605  N NE   . ARG B 2 4   ? -26.357 -15.702 -14.057 1.00 0.00 ? 17   ARG B NE   4  
ATOM   8606  C CZ   . ARG B 2 4   ? -27.135 -15.398 -13.009 1.00 0.00 ? 17   ARG B CZ   4  
ATOM   8607  N NH1  . ARG B 2 4   ? -26.628 -15.124 -11.812 1.00 0.00 ? 17   ARG B NH1  4  
ATOM   8608  N NH2  . ARG B 2 4   ? -28.447 -15.381 -13.202 1.00 0.00 ? 17   ARG B NH2  4  
ATOM   8609  H H    . ARG B 2 4   ? -25.604 -18.828 -17.940 1.00 0.00 ? 17   ARG B H    4  
ATOM   8610  H HA   . ARG B 2 4   ? -23.631 -18.998 -16.317 1.00 0.00 ? 17   ARG B HA   4  
ATOM   8611  H HB2  . ARG B 2 4   ? -25.019 -17.170 -16.373 1.00 0.00 ? 17   ARG B HB2  4  
ATOM   8612  H HB3  . ARG B 2 4   ? -26.326 -17.999 -15.473 1.00 0.00 ? 17   ARG B HB3  4  
ATOM   8613  H HG2  . ARG B 2 4   ? -24.903 -18.026 -13.466 1.00 0.00 ? 17   ARG B HG2  4  
ATOM   8614  H HG3  . ARG B 2 4   ? -23.495 -17.512 -14.453 1.00 0.00 ? 17   ARG B HG3  4  
ATOM   8615  H HD2  . ARG B 2 4   ? -24.397 -15.642 -13.206 1.00 0.00 ? 17   ARG B HD2  4  
ATOM   8616  H HD3  . ARG B 2 4   ? -24.469 -15.447 -14.967 1.00 0.00 ? 17   ARG B HD3  4  
ATOM   8617  H HE   . ARG B 2 4   ? -26.855 -15.759 -14.950 1.00 0.00 ? 17   ARG B HE   4  
ATOM   8618  H HH11 . ARG B 2 4   ? -25.644 -14.846 -11.739 1.00 0.00 ? 17   ARG B HH11 4  
ATOM   8619  H HH12 . ARG B 2 4   ? -27.212 -14.924 -11.011 1.00 0.00 ? 17   ARG B HH12 4  
ATOM   8620  H HH21 . ARG B 2 4   ? -28.795 -15.523 -14.160 1.00 0.00 ? 17   ARG B HH21 4  
ATOM   8621  H HH22 . ARG B 2 4   ? -29.115 -15.173 -12.468 1.00 0.00 ? 17   ARG B HH22 4  
ATOM   8622  N N    . HIS B 2 5   ? -23.561 -20.740 -14.594 1.00 0.00 ? 18   HIS B N    4  
ATOM   8623  C CA   . HIS B 2 5   ? -23.371 -21.934 -13.789 1.00 0.00 ? 18   HIS B CA   4  
ATOM   8624  C C    . HIS B 2 5   ? -23.059 -21.664 -12.309 1.00 0.00 ? 18   HIS B C    4  
ATOM   8625  O O    . HIS B 2 5   ? -23.404 -22.483 -11.455 1.00 0.00 ? 18   HIS B O    4  
ATOM   8626  C CB   . HIS B 2 5   ? -22.304 -22.740 -14.496 1.00 0.00 ? 18   HIS B CB   4  
ATOM   8627  C CG   . HIS B 2 5   ? -20.947 -22.157 -14.401 1.00 0.00 ? 18   HIS B CG   4  
ATOM   8628  N ND1  . HIS B 2 5   ? -20.610 -20.814 -14.255 1.00 0.00 ? 18   HIS B ND1  4  
ATOM   8629  C CD2  . HIS B 2 5   ? -19.842 -22.902 -14.559 1.00 0.00 ? 18   HIS B CD2  4  
ATOM   8630  C CE1  . HIS B 2 5   ? -19.273 -20.798 -14.302 1.00 0.00 ? 18   HIS B CE1  4  
ATOM   8631  N NE2  . HIS B 2 5   ? -18.784 -22.036 -14.502 1.00 0.00 ? 18   HIS B NE2  4  
ATOM   8632  H H    . HIS B 2 5   ? -22.710 -20.330 -14.961 1.00 0.00 ? 18   HIS B H    4  
ATOM   8633  H HA   . HIS B 2 5   ? -24.229 -22.579 -13.874 1.00 0.00 ? 18   HIS B HA   4  
ATOM   8634  H HB2  . HIS B 2 5   ? -22.281 -23.748 -14.082 1.00 0.00 ? 18   HIS B HB2  4  
ATOM   8635  H HB3  . HIS B 2 5   ? -22.541 -22.799 -15.563 1.00 0.00 ? 18   HIS B HB3  4  
ATOM   8636  H HD2  . HIS B 2 5   ? -19.850 -23.971 -14.713 1.00 0.00 ? 18   HIS B HD2  4  
ATOM   8637  H HE1  . HIS B 2 5   ? -18.685 -19.906 -14.226 1.00 0.00 ? 18   HIS B HE1  4  
ATOM   8638  H HE2  . HIS B 2 5   ? -17.805 -22.286 -14.607 1.00 0.00 ? 18   HIS B HE2  4  
ATOM   8639  N N    . ARG B 2 6   ? -22.441 -20.519 -11.990 1.00 0.00 ? 19   ARG B N    4  
ATOM   8640  C CA   . ARG B 2 6   ? -21.902 -20.177 -10.667 1.00 0.00 ? 19   ARG B CA   4  
ATOM   8641  C C    . ARG B 2 6   ? -22.235 -18.726 -10.354 1.00 0.00 ? 19   ARG B C    4  
ATOM   8642  O O    . ARG B 2 6   ? -21.335 -17.910 -10.194 1.00 0.00 ? 19   ARG B O    4  
ATOM   8643  C CB   . ARG B 2 6   ? -20.392 -20.496 -10.597 1.00 0.00 ? 19   ARG B CB   4  
ATOM   8644  C CG   . ARG B 2 6   ? -20.087 -22.003 -10.654 1.00 0.00 ? 19   ARG B CG   4  
ATOM   8645  C CD   . ARG B 2 6   ? -18.588 -22.288 -10.514 1.00 0.00 ? 19   ARG B CD   4  
ATOM   8646  N NE   . ARG B 2 6   ? -18.321 -23.723 -10.270 1.00 0.00 ? 19   ARG B NE   4  
ATOM   8647  C CZ   . ARG B 2 6   ? -18.235 -24.717 -11.171 1.00 0.00 ? 19   ARG B CZ   4  
ATOM   8648  N NH1  . ARG B 2 6   ? -18.453 -24.498 -12.468 1.00 0.00 ? 19   ARG B NH1  4  
ATOM   8649  N NH2  . ARG B 2 6   ? -17.920 -25.943 -10.764 1.00 0.00 ? 19   ARG B NH2  4  
ATOM   8650  H H    . ARG B 2 6   ? -22.129 -19.936 -12.758 1.00 0.00 ? 19   ARG B H    4  
ATOM   8651  H HA   . ARG B 2 6   ? -22.389 -20.766 -9.879  1.00 0.00 ? 19   ARG B HA   4  
ATOM   8652  H HB2  . ARG B 2 6   ? -19.859 -19.987 -11.405 1.00 0.00 ? 19   ARG B HB2  4  
ATOM   8653  H HB3  . ARG B 2 6   ? -20.022 -20.127 -9.639  1.00 0.00 ? 19   ARG B HB3  4  
ATOM   8654  H HG2  . ARG B 2 6   ? -20.621 -22.496 -9.842  1.00 0.00 ? 19   ARG B HG2  4  
ATOM   8655  H HG3  . ARG B 2 6   ? -20.422 -22.405 -11.606 1.00 0.00 ? 19   ARG B HG3  4  
ATOM   8656  H HD2  . ARG B 2 6   ? -18.059 -21.940 -11.399 1.00 0.00 ? 19   ARG B HD2  4  
ATOM   8657  H HD3  . ARG B 2 6   ? -18.204 -21.718 -9.667  1.00 0.00 ? 19   ARG B HD3  4  
ATOM   8658  H HE   . ARG B 2 6   ? -18.186 -23.964 -9.292  1.00 0.00 ? 19   ARG B HE   4  
ATOM   8659  H HH11 . ARG B 2 6   ? -18.745 -23.586 -12.779 1.00 0.00 ? 19   ARG B HH11 4  
ATOM   8660  H HH12 . ARG B 2 6   ? -18.340 -25.232 -13.162 1.00 0.00 ? 19   ARG B HH12 4  
ATOM   8661  H HH21 . ARG B 2 6   ? -17.751 -26.153 -9.784  1.00 0.00 ? 19   ARG B HH21 4  
ATOM   8662  H HH22 . ARG B 2 6   ? -17.859 -26.727 -11.400 1.00 0.00 ? 19   ARG B HH22 4  
HETATM 8663  N N    . MLY B 2 7   ? -23.533 -18.414 -10.364 1.00 0.00 ? 20   MLY B N    4  
HETATM 8664  C CA   . MLY B 2 7   ? -24.240 -17.200 -9.912  1.00 0.00 ? 20   MLY B CA   4  
HETATM 8665  C CB   . MLY B 2 7   ? -24.570 -17.362 -8.407  1.00 0.00 ? 20   MLY B CB   4  
HETATM 8666  C CG   . MLY B 2 7   ? -23.366 -17.204 -7.440  1.00 0.00 ? 20   MLY B CG   4  
HETATM 8667  C CD   . MLY B 2 7   ? -23.274 -15.830 -6.733  1.00 0.00 ? 20   MLY B CD   4  
HETATM 8668  C CE   . MLY B 2 7   ? -21.893 -15.461 -6.172  1.00 0.00 ? 20   MLY B CE   4  
HETATM 8669  N NZ   . MLY B 2 7   ? -20.991 -14.704 -7.084  1.00 0.00 ? 20   MLY B NZ   4  
HETATM 8670  C CH1  . MLY B 2 7   ? -19.872 -14.024 -6.372  1.00 0.00 ? 20   MLY B CH1  4  
HETATM 8671  C CH2  . MLY B 2 7   ? -20.520 -15.429 -8.287  1.00 0.00 ? 20   MLY B CH2  4  
HETATM 8672  C C    . MLY B 2 7   ? -23.661 -15.833 -10.227 1.00 0.00 ? 20   MLY B C    4  
HETATM 8673  O O    . MLY B 2 7   ? -24.087 -14.870 -9.601  1.00 0.00 ? 20   MLY B O    4  
HETATM 8674  H H    . MLY B 2 7   ? -24.149 -19.188 -10.599 1.00 0.00 ? 20   MLY B H    4  
HETATM 8675  H HA   . MLY B 2 7   ? -25.176 -17.161 -10.482 1.00 0.00 ? 20   MLY B HA   4  
HETATM 8676  H HB2  . MLY B 2 7   ? -24.989 -18.360 -8.270  1.00 0.00 ? 20   MLY B HB2  4  
HETATM 8677  H HB3  . MLY B 2 7   ? -25.357 -16.658 -8.124  1.00 0.00 ? 20   MLY B HB3  4  
HETATM 8678  H HG2  . MLY B 2 7   ? -22.441 -17.418 -7.966  1.00 0.00 ? 20   MLY B HG2  4  
HETATM 8679  H HG3  . MLY B 2 7   ? -23.455 -17.965 -6.662  1.00 0.00 ? 20   MLY B HG3  4  
HETATM 8680  H HD2  . MLY B 2 7   ? -23.972 -15.881 -5.894  1.00 0.00 ? 20   MLY B HD2  4  
HETATM 8681  H HD3  . MLY B 2 7   ? -23.605 -15.014 -7.356  1.00 0.00 ? 20   MLY B HD3  4  
HETATM 8682  H HE2  . MLY B 2 7   ? -21.389 -16.379 -5.885  1.00 0.00 ? 20   MLY B HE2  4  
HETATM 8683  H HE3  . MLY B 2 7   ? -22.065 -14.875 -5.268  1.00 0.00 ? 20   MLY B HE3  4  
HETATM 8684  H HH11 . MLY B 2 7   ? -19.338 -13.350 -7.049  1.00 0.00 ? 20   MLY B HH11 4  
HETATM 8685  H HH12 . MLY B 2 7   ? -20.238 -13.429 -5.536  1.00 0.00 ? 20   MLY B HH12 4  
HETATM 8686  H HH13 . MLY B 2 7   ? -19.161 -14.759 -6.000  1.00 0.00 ? 20   MLY B HH13 4  
HETATM 8687  H HH21 . MLY B 2 7   ? -21.357 -15.699 -8.917  1.00 0.00 ? 20   MLY B HH21 4  
HETATM 8688  H HH22 . MLY B 2 7   ? -19.874 -14.786 -8.880  1.00 0.00 ? 20   MLY B HH22 4  
HETATM 8689  H HH23 . MLY B 2 7   ? -19.987 -16.333 -7.998  1.00 0.00 ? 20   MLY B HH23 4  
HETATM 8690  H HZ   . MLY B 2 7   ? -21.543 -13.911 -7.490  1.00 0.00 ? 20   MLY B HZ   4  
ATOM   8691  N N    . VAL B 2 8   ? -22.754 -15.731 -11.202 1.00 0.00 ? 21   VAL B N    4  
ATOM   8692  C CA   . VAL B 2 8   ? -22.105 -14.465 -11.576 1.00 0.00 ? 21   VAL B CA   4  
ATOM   8693  C C    . VAL B 2 8   ? -23.142 -13.358 -11.748 1.00 0.00 ? 21   VAL B C    4  
ATOM   8694  O O    . VAL B 2 8   ? -24.301 -13.665 -12.013 1.00 0.00 ? 21   VAL B O    4  
ATOM   8695  C CB   . VAL B 2 8   ? -21.278 -14.572 -12.875 1.00 0.00 ? 21   VAL B CB   4  
ATOM   8696  C CG1  . VAL B 2 8   ? -20.058 -13.655 -12.959 1.00 0.00 ? 21   VAL B CG1  4  
ATOM   8697  C CG2  . VAL B 2 8   ? -20.899 -16.005 -13.219 1.00 0.00 ? 21   VAL B CG2  4  
ATOM   8698  H H    . VAL B 2 8   ? -22.390 -16.587 -11.597 1.00 0.00 ? 21   VAL B H    4  
ATOM   8699  H HA   . VAL B 2 8   ? -21.441 -14.219 -10.755 1.00 0.00 ? 21   VAL B HA   4  
ATOM   8700  H HB   . VAL B 2 8   ? -21.905 -14.241 -13.686 1.00 0.00 ? 21   VAL B HB   4  
ATOM   8701  H HG11 . VAL B 2 8   ? -20.374 -12.617 -12.924 1.00 0.00 ? 21   VAL B HG11 4  
ATOM   8702  H HG12 . VAL B 2 8   ? -19.403 -13.846 -12.120 1.00 0.00 ? 21   VAL B HG12 4  
ATOM   8703  H HG13 . VAL B 2 8   ? -19.519 -13.805 -13.897 1.00 0.00 ? 21   VAL B HG13 4  
ATOM   8704  H HG21 . VAL B 2 8   ? -20.039 -16.013 -13.875 1.00 0.00 ? 21   VAL B HG21 4  
ATOM   8705  H HG22 . VAL B 2 8   ? -20.652 -16.566 -12.324 1.00 0.00 ? 21   VAL B HG22 4  
ATOM   8706  H HG23 . VAL B 2 8   ? -21.755 -16.428 -13.741 1.00 0.00 ? 21   VAL B HG23 4  
ATOM   8707  N N    . LEU B 2 9   ? -22.707 -12.104 -11.759 1.00 0.00 ? 22   LEU B N    4  
ATOM   8708  C CA   . LEU B 2 9   ? -23.504 -10.902 -11.923 1.00 0.00 ? 22   LEU B CA   4  
ATOM   8709  C C    . LEU B 2 9   ? -24.751 -10.839 -11.003 1.00 0.00 ? 22   LEU B C    4  
ATOM   8710  O O    . LEU B 2 9   ? -24.944 -11.683 -10.128 1.00 0.00 ? 22   LEU B O    4  
ATOM   8711  C CB   . LEU B 2 9   ? -23.743 -10.540 -13.412 1.00 0.00 ? 22   LEU B CB   4  
ATOM   8712  C CG   . LEU B 2 9   ? -24.482 -11.531 -14.340 1.00 0.00 ? 22   LEU B CG   4  
ATOM   8713  C CD1  . LEU B 2 9   ? -23.606 -12.675 -14.867 1.00 0.00 ? 22   LEU B CD1  4  
ATOM   8714  C CD2  . LEU B 2 9   ? -25.890 -11.896 -13.846 1.00 0.00 ? 22   LEU B CD2  4  
ATOM   8715  H H    . LEU B 2 9   ? -21.753 -11.985 -11.427 1.00 0.00 ? 22   LEU B H    4  
ATOM   8716  H HA   . LEU B 2 9   ? -22.814 -10.155 -11.575 1.00 0.00 ? 22   LEU B HA   4  
ATOM   8717  H HB2  . LEU B 2 9   ? -24.282 -9.593  -13.447 1.00 0.00 ? 22   LEU B HB2  4  
ATOM   8718  H HB3  . LEU B 2 9   ? -22.771 -10.326 -13.861 1.00 0.00 ? 22   LEU B HB3  4  
ATOM   8719  H HG   . LEU B 2 9   ? -24.663 -11.008 -15.251 1.00 0.00 ? 22   LEU B HG   4  
ATOM   8720  H HD11 . LEU B 2 9   ? -23.846 -12.881 -15.912 1.00 0.00 ? 22   LEU B HD11 4  
ATOM   8721  H HD12 . LEU B 2 9   ? -22.546 -12.423 -14.798 1.00 0.00 ? 22   LEU B HD12 4  
ATOM   8722  H HD13 . LEU B 2 9   ? -23.788 -13.577 -14.310 1.00 0.00 ? 22   LEU B HD13 4  
ATOM   8723  H HD21 . LEU B 2 9   ? -25.891 -12.211 -12.804 1.00 0.00 ? 22   LEU B HD21 4  
ATOM   8724  H HD22 . LEU B 2 9   ? -26.524 -11.011 -13.907 1.00 0.00 ? 22   LEU B HD22 4  
ATOM   8725  H HD23 . LEU B 2 9   ? -26.308 -12.691 -14.464 1.00 0.00 ? 22   LEU B HD23 4  
ATOM   8726  N N    . ARG B 2 10  ? -25.635 -9.845  -11.188 1.00 0.00 ? 23   ARG B N    4  
ATOM   8727  C CA   . ARG B 2 10  ? -26.933 -9.800  -10.504 1.00 0.00 ? 23   ARG B CA   4  
ATOM   8728  C C    . ARG B 2 10  ? -27.991 -9.176  -11.418 1.00 0.00 ? 23   ARG B C    4  
ATOM   8729  O O    . ARG B 2 10  ? -27.651 -8.462  -12.362 1.00 0.00 ? 23   ARG B O    4  
ATOM   8730  C CB   . ARG B 2 10  ? -26.820 -9.079  -9.141  1.00 0.00 ? 23   ARG B CB   4  
ATOM   8731  C CG   . ARG B 2 10  ? -26.335 -7.623  -9.223  1.00 0.00 ? 23   ARG B CG   4  
ATOM   8732  C CD   . ARG B 2 10  ? -26.429 -6.959  -7.841  1.00 0.00 ? 23   ARG B CD   4  
ATOM   8733  N NE   . ARG B 2 10  ? -25.997 -5.551  -7.888  1.00 0.00 ? 23   ARG B NE   4  
ATOM   8734  C CZ   . ARG B 2 10  ? -25.933 -4.711  -6.844  1.00 0.00 ? 23   ARG B CZ   4  
ATOM   8735  N NH1  . ARG B 2 10  ? -26.257 -5.121  -5.618  1.00 0.00 ? 23   ARG B NH1  4  
ATOM   8736  N NH2  . ARG B 2 10  ? -25.542 -3.456  -7.036  1.00 0.00 ? 23   ARG B NH2  4  
ATOM   8737  H H    . ARG B 2 10  ? -25.493 -9.168  -11.924 1.00 0.00 ? 23   ARG B H    4  
ATOM   8738  H HA   . ARG B 2 10  ? -27.243 -10.828 -10.304 1.00 0.00 ? 23   ARG B HA   4  
ATOM   8739  H HB2  . ARG B 2 10  ? -27.800 -9.100  -8.656  1.00 0.00 ? 23   ARG B HB2  4  
ATOM   8740  H HB3  . ARG B 2 10  ? -26.128 -9.636  -8.507  1.00 0.00 ? 23   ARG B HB3  4  
ATOM   8741  H HG2  . ARG B 2 10  ? -25.302 -7.608  -9.563  1.00 0.00 ? 23   ARG B HG2  4  
ATOM   8742  H HG3  . ARG B 2 10  ? -26.944 -7.067  -9.935  1.00 0.00 ? 23   ARG B HG3  4  
ATOM   8743  H HD2  . ARG B 2 10  ? -27.466 -6.996  -7.500  1.00 0.00 ? 23   ARG B HD2  4  
ATOM   8744  H HD3  . ARG B 2 10  ? -25.809 -7.514  -7.134  1.00 0.00 ? 23   ARG B HD3  4  
ATOM   8745  H HE   . ARG B 2 10  ? -25.731 -5.199  -8.803  1.00 0.00 ? 23   ARG B HE   4  
ATOM   8746  H HH11 . ARG B 2 10  ? -26.537 -6.080  -5.449  1.00 0.00 ? 23   ARG B HH11 4  
ATOM   8747  H HH12 . ARG B 2 10  ? -26.218 -4.506  -4.813  1.00 0.00 ? 23   ARG B HH12 4  
ATOM   8748  H HH21 . ARG B 2 10  ? -25.300 -3.112  -7.960  1.00 0.00 ? 23   ARG B HH21 4  
ATOM   8749  H HH22 . ARG B 2 10  ? -25.491 -2.790  -6.273  1.00 0.00 ? 23   ARG B HH22 4  
ATOM   8750  N N    . ASP B 2 11  ? -29.265 -9.459  -11.136 1.00 0.00 ? 24   ASP B N    4  
ATOM   8751  C CA   . ASP B 2 11  ? -30.390 -9.130  -12.029 1.00 0.00 ? 24   ASP B CA   4  
ATOM   8752  C C    . ASP B 2 11  ? -31.724 -8.945  -11.290 1.00 0.00 ? 24   ASP B C    4  
ATOM   8753  O O    . ASP B 2 11  ? -32.642 -8.321  -11.816 1.00 0.00 ? 24   ASP B O    4  
ATOM   8754  C CB   . ASP B 2 11  ? -30.535 -10.286 -13.016 1.00 0.00 ? 24   ASP B CB   4  
ATOM   8755  C CG   . ASP B 2 11  ? -31.682 -10.075 -14.021 1.00 0.00 ? 24   ASP B CG   4  
ATOM   8756  O OD1  . ASP B 2 11  ? -31.571 -9.167  -14.879 1.00 0.00 ? 24   ASP B OD1  4  
ATOM   8757  O OD2  . ASP B 2 11  ? -32.691 -10.821 -13.960 1.00 0.00 ? 24   ASP B OD2  4  
ATOM   8758  H H    . ASP B 2 11  ? -29.452 -10.084 -10.362 1.00 0.00 ? 24   ASP B H    4  
ATOM   8759  H HA   . ASP B 2 11  ? -30.175 -8.217  -12.585 1.00 0.00 ? 24   ASP B HA   4  
ATOM   8760  H HB2  . ASP B 2 11  ? -29.602 -10.420 -13.567 1.00 0.00 ? 24   ASP B HB2  4  
ATOM   8761  H HB3  . ASP B 2 11  ? -30.713 -11.184 -12.426 1.00 0.00 ? 24   ASP B HB3  4  
ATOM   8762  N N    . ASN B 2 12  ? -31.837 -9.419  -10.040 1.00 0.00 ? 25   ASN B N    4  
ATOM   8763  C CA   . ASN B 2 12  ? -33.060 -9.322  -9.220  1.00 0.00 ? 25   ASN B CA   4  
ATOM   8764  C C    . ASN B 2 12  ? -33.035 -8.072  -8.364  1.00 0.00 ? 25   ASN B C    4  
ATOM   8765  O O    . ASN B 2 12  ? -33.369 -8.070  -7.175  1.00 0.00 ? 25   ASN B O    4  
ATOM   8766  C CB   . ASN B 2 12  ? -33.137 -10.559 -8.324  1.00 0.00 ? 25   ASN B CB   4  
ATOM   8767  C CG   . ASN B 2 12  ? -34.542 -10.786 -7.760  1.00 0.00 ? 25   ASN B CG   4  
ATOM   8768  O OD1  . ASN B 2 12  ? -35.550 -10.434 -8.372  1.00 0.00 ? 25   ASN B OD1  4  
ATOM   8769  N ND2  . ASN B 2 12  ? -34.650 -11.380 -6.581  1.00 0.00 ? 25   ASN B ND2  4  
ATOM   8770  H H    . ASN B 2 12  ? -31.048 -9.888  -9.620  1.00 0.00 ? 25   ASN B H    4  
ATOM   8771  H HA   . ASN B 2 12  ? -33.918 -9.237  -9.883  1.00 0.00 ? 25   ASN B HA   4  
ATOM   8772  H HB2  . ASN B 2 12  ? -32.815 -11.399 -8.914  1.00 0.00 ? 25   ASN B HB2  4  
ATOM   8773  H HB3  . ASN B 2 12  ? -32.419 -10.461 -7.509  1.00 0.00 ? 25   ASN B HB3  4  
ATOM   8774  H HD21 . ASN B 2 12  ? -33.821 -11.665 -6.072  1.00 0.00 ? 25   ASN B HD21 4  
ATOM   8775  H HD22 . ASN B 2 12  ? -35.565 -11.543 -6.178  1.00 0.00 ? 25   ASN B HD22 4  
ATOM   8776  N N    . ILE B 2 13  ? -32.569 -7.005  -8.988  1.00 0.00 ? 26   ILE B N    4  
ATOM   8777  C CA   . ILE B 2 13  ? -32.211 -5.782  -8.305  1.00 0.00 ? 26   ILE B CA   4  
ATOM   8778  C C    . ILE B 2 13  ? -33.350 -4.759  -8.262  1.00 0.00 ? 26   ILE B C    4  
ATOM   8779  O O    . ILE B 2 13  ? -33.149 -3.620  -7.826  1.00 0.00 ? 26   ILE B O    4  
ATOM   8780  C CB   . ILE B 2 13  ? -30.880 -5.269  -8.894  1.00 0.00 ? 26   ILE B CB   4  
ATOM   8781  C CG1  . ILE B 2 13  ? -31.029 -4.500  -10.223 1.00 0.00 ? 26   ILE B CG1  4  
ATOM   8782  C CG2  . ILE B 2 13  ? -29.883 -6.437  -9.032  1.00 0.00 ? 26   ILE B CG2  4  
ATOM   8783  C CD1  . ILE B 2 13  ? -31.189 -5.291  -11.524 1.00 0.00 ? 26   ILE B CD1  4  
ATOM   8784  H H    . ILE B 2 13  ? -32.384 -7.065  -9.980  1.00 0.00 ? 26   ILE B H    4  
ATOM   8785  H HA   . ILE B 2 13  ? -32.011 -6.082  -7.286  1.00 0.00 ? 26   ILE B HA   4  
ATOM   8786  H HB   . ILE B 2 13  ? -30.466 -4.563  -8.174  1.00 0.00 ? 26   ILE B HB   4  
ATOM   8787  H HG12 . ILE B 2 13  ? -31.921 -3.901  -10.117 1.00 0.00 ? 26   ILE B HG12 4  
ATOM   8788  H HG13 . ILE B 2 13  ? -30.170 -3.840  -10.340 1.00 0.00 ? 26   ILE B HG13 4  
ATOM   8789  H HG21 . ILE B 2 13  ? -28.916 -6.036  -9.320  1.00 0.00 ? 26   ILE B HG21 4  
ATOM   8790  H HG22 . ILE B 2 13  ? -29.822 -6.960  -8.075  1.00 0.00 ? 26   ILE B HG22 4  
ATOM   8791  H HG23 . ILE B 2 13  ? -30.212 -7.156  -9.785  1.00 0.00 ? 26   ILE B HG23 4  
ATOM   8792  H HD11 . ILE B 2 13  ? -31.285 -4.590  -12.353 1.00 0.00 ? 26   ILE B HD11 4  
ATOM   8793  H HD12 . ILE B 2 13  ? -30.321 -5.924  -11.704 1.00 0.00 ? 26   ILE B HD12 4  
ATOM   8794  H HD13 . ILE B 2 13  ? -32.095 -5.888  -11.473 1.00 0.00 ? 26   ILE B HD13 4  
ATOM   8795  N N    . GLN B 2 14  ? -34.529 -5.155  -8.742  1.00 0.00 ? 27   GLN B N    4  
ATOM   8796  C CA   . GLN B 2 14  ? -35.659 -4.287  -8.995  1.00 0.00 ? 27   GLN B CA   4  
ATOM   8797  C C    . GLN B 2 14  ? -36.883 -4.864  -8.292  1.00 0.00 ? 27   GLN B C    4  
ATOM   8798  O O    . GLN B 2 14  ? -37.582 -4.095  -7.596  1.00 0.00 ? 27   GLN B O    4  
ATOM   8799  C CB   . GLN B 2 14  ? -35.887 -4.179  -10.512 1.00 0.00 ? 27   GLN B CB   4  
ATOM   8800  C CG   . GLN B 2 14  ? -34.751 -3.466  -11.257 1.00 0.00 ? 27   GLN B CG   4  
ATOM   8801  C CD   . GLN B 2 14  ? -35.113 -3.177  -12.720 1.00 0.00 ? 27   GLN B CD   4  
ATOM   8802  O OE1  . GLN B 2 14  ? -35.565 -4.051  -13.460 1.00 0.00 ? 27   GLN B OE1  4  
ATOM   8803  N NE2  . GLN B 2 14  ? -34.923 -1.947  -13.178 1.00 0.00 ? 27   GLN B NE2  4  
ATOM   8804  O OXT  . GLN B 2 14  ? -37.138 -6.085  -8.425  1.00 0.00 ? 27   GLN B OXT  4  
ATOM   8805  H H    . GLN B 2 14  ? -34.663 -6.130  -8.963  1.00 0.00 ? 27   GLN B H    4  
ATOM   8806  H HA   . GLN B 2 14  ? -35.424 -3.304  -8.591  1.00 0.00 ? 27   GLN B HA   4  
ATOM   8807  H HB2  . GLN B 2 14  ? -35.985 -5.186  -10.923 1.00 0.00 ? 27   GLN B HB2  4  
ATOM   8808  H HB3  . GLN B 2 14  ? -36.821 -3.637  -10.685 1.00 0.00 ? 27   GLN B HB3  4  
ATOM   8809  H HG2  . GLN B 2 14  ? -34.523 -2.529  -10.744 1.00 0.00 ? 27   GLN B HG2  4  
ATOM   8810  H HG3  . GLN B 2 14  ? -33.861 -4.093  -11.243 1.00 0.00 ? 27   GLN B HG3  4  
ATOM   8811  H HE21 . GLN B 2 14  ? -34.563 -1.225  -12.564 1.00 0.00 ? 27   GLN B HE21 4  
ATOM   8812  H HE22 . GLN B 2 14  ? -35.144 -1.719  -14.139 1.00 0.00 ? 27   GLN B HE22 4  
ATOM   8813  N N    . GLY A 1 1   ? -9.866  10.481  -4.379  1.00 0.00 ? -3   GLY A N    5  
ATOM   8814  C CA   . GLY A 1 1   ? -9.729  9.118   -3.813  1.00 0.00 ? -3   GLY A CA   5  
ATOM   8815  C C    . GLY A 1 1   ? -8.405  8.465   -4.216  1.00 0.00 ? -3   GLY A C    5  
ATOM   8816  O O    . GLY A 1 1   ? -7.862  8.744   -5.290  1.00 0.00 ? -3   GLY A O    5  
ATOM   8817  H H1   . GLY A 1 1   ? -10.751 10.881  -4.110  1.00 0.00 ? -3   GLY A H1   5  
ATOM   8818  H H2   . GLY A 1 1   ? -9.122  11.071  -4.040  1.00 0.00 ? -3   GLY A H2   5  
ATOM   8819  H H3   . GLY A 1 1   ? -9.813  10.441  -5.386  1.00 0.00 ? -3   GLY A H3   5  
ATOM   8820  H HA2  . GLY A 1 1   ? -9.788  9.173   -2.725  1.00 0.00 ? -3   GLY A HA2  5  
ATOM   8821  H HA3  . GLY A 1 1   ? -10.552 8.498   -4.170  1.00 0.00 ? -3   GLY A HA3  5  
ATOM   8822  N N    . HIS A 1 2   ? -7.880  7.574   -3.367  1.00 0.00 ? -2   HIS A N    5  
ATOM   8823  C CA   . HIS A 1 2   ? -6.647  6.822   -3.612  1.00 0.00 ? -2   HIS A CA   5  
ATOM   8824  C C    . HIS A 1 2   ? -6.745  5.458   -2.920  1.00 0.00 ? -2   HIS A C    5  
ATOM   8825  O O    . HIS A 1 2   ? -7.645  5.235   -2.103  1.00 0.00 ? -2   HIS A O    5  
ATOM   8826  C CB   . HIS A 1 2   ? -5.437  7.620   -3.096  1.00 0.00 ? -2   HIS A CB   5  
ATOM   8827  C CG   . HIS A 1 2   ? -4.098  7.004   -3.435  1.00 0.00 ? -2   HIS A CG   5  
ATOM   8828  N ND1  . HIS A 1 2   ? -3.774  6.378   -4.647  1.00 0.00 ? -2   HIS A ND1  5  
ATOM   8829  C CD2  . HIS A 1 2   ? -3.026  6.920   -2.597  1.00 0.00 ? -2   HIS A CD2  5  
ATOM   8830  C CE1  . HIS A 1 2   ? -2.503  5.952   -4.509  1.00 0.00 ? -2   HIS A CE1  5  
ATOM   8831  N NE2  . HIS A 1 2   ? -2.034  6.265   -3.290  1.00 0.00 ? -2   HIS A NE2  5  
ATOM   8832  H H    . HIS A 1 2   ? -8.388  7.321   -2.528  1.00 0.00 ? -2   HIS A H    5  
ATOM   8833  H HA   . HIS A 1 2   ? -6.526  6.665   -4.687  1.00 0.00 ? -2   HIS A HA   5  
ATOM   8834  H HB2  . HIS A 1 2   ? -5.463  8.622   -3.530  1.00 0.00 ? -2   HIS A HB2  5  
ATOM   8835  H HB3  . HIS A 1 2   ? -5.513  7.722   -2.011  1.00 0.00 ? -2   HIS A HB3  5  
ATOM   8836  H HD2  . HIS A 1 2   ? -2.970  7.296   -1.582  1.00 0.00 ? -2   HIS A HD2  5  
ATOM   8837  H HE1  . HIS A 1 2   ? -1.931  5.434   -5.274  1.00 0.00 ? -2   HIS A HE1  5  
ATOM   8838  H HE2  . HIS A 1 2   ? -1.100  6.050   -2.948  1.00 0.00 ? -2   HIS A HE2  5  
ATOM   8839  N N    . MET A 1 3   ? -5.826  4.547   -3.249  1.00 0.00 ? -1   MET A N    5  
ATOM   8840  C CA   . MET A 1 3   ? -5.698  3.242   -2.613  1.00 0.00 ? -1   MET A CA   5  
ATOM   8841  C C    . MET A 1 3   ? -5.380  3.398   -1.118  1.00 0.00 ? -1   MET A C    5  
ATOM   8842  O O    . MET A 1 3   ? -4.776  4.392   -0.703  1.00 0.00 ? -1   MET A O    5  
ATOM   8843  C CB   . MET A 1 3   ? -4.589  2.439   -3.315  1.00 0.00 ? -1   MET A CB   5  
ATOM   8844  C CG   . MET A 1 3   ? -4.878  2.139   -4.793  1.00 0.00 ? -1   MET A CG   5  
ATOM   8845  S SD   . MET A 1 3   ? -6.447  1.282   -5.115  1.00 0.00 ? -1   MET A SD   5  
ATOM   8846  C CE   . MET A 1 3   ? -6.182  0.775   -6.835  1.00 0.00 ? -1   MET A CE   5  
ATOM   8847  H H    . MET A 1 3   ? -5.088  4.831   -3.883  1.00 0.00 ? -1   MET A H    5  
ATOM   8848  H HA   . MET A 1 3   ? -6.649  2.713   -2.717  1.00 0.00 ? -1   MET A HA   5  
ATOM   8849  H HB2  . MET A 1 3   ? -3.650  2.995   -3.252  1.00 0.00 ? -1   MET A HB2  5  
ATOM   8850  H HB3  . MET A 1 3   ? -4.453  1.498   -2.789  1.00 0.00 ? -1   MET A HB3  5  
ATOM   8851  H HG2  . MET A 1 3   ? -4.867  3.072   -5.357  1.00 0.00 ? -1   MET A HG2  5  
ATOM   8852  H HG3  . MET A 1 3   ? -4.066  1.517   -5.175  1.00 0.00 ? -1   MET A HG3  5  
ATOM   8853  H HE1  . MET A 1 3   ? -7.075  0.273   -7.208  1.00 0.00 ? -1   MET A HE1  5  
ATOM   8854  H HE2  . MET A 1 3   ? -5.973  1.649   -7.453  1.00 0.00 ? -1   MET A HE2  5  
ATOM   8855  H HE3  . MET A 1 3   ? -5.336  0.086   -6.886  1.00 0.00 ? -1   MET A HE3  5  
ATOM   8856  N N    . ASN A 1 4   ? -5.747  2.392   -0.314  1.00 0.00 ? 1484 ASN A N    5  
ATOM   8857  C CA   . ASN A 1 4   ? -5.552  2.379   1.138   1.00 0.00 ? 1484 ASN A CA   5  
ATOM   8858  C C    . ASN A 1 4   ? -5.230  0.953   1.595   1.00 0.00 ? 1484 ASN A C    5  
ATOM   8859  O O    . ASN A 1 4   ? -6.051  0.294   2.239   1.00 0.00 ? 1484 ASN A O    5  
ATOM   8860  C CB   . ASN A 1 4   ? -6.778  2.967   1.861   1.00 0.00 ? 1484 ASN A CB   5  
ATOM   8861  C CG   . ASN A 1 4   ? -6.585  3.013   3.380   1.00 0.00 ? 1484 ASN A CG   5  
ATOM   8862  O OD1  . ASN A 1 4   ? -5.467  3.080   3.888   1.00 0.00 ? 1484 ASN A OD1  5  
ATOM   8863  N ND2  . ASN A 1 4   ? -7.669  2.983   4.147   1.00 0.00 ? 1484 ASN A ND2  5  
ATOM   8864  H H    . ASN A 1 4   ? -6.232  1.595   -0.704  1.00 0.00 ? 1484 ASN A H    5  
ATOM   8865  H HA   . ASN A 1 4   ? -4.694  3.004   1.383   1.00 0.00 ? 1484 ASN A HA   5  
ATOM   8866  H HB2  . ASN A 1 4   ? -6.951  3.981   1.505   1.00 0.00 ? 1484 ASN A HB2  5  
ATOM   8867  H HB3  . ASN A 1 4   ? -7.654  2.366   1.624   1.00 0.00 ? 1484 ASN A HB3  5  
ATOM   8868  H HD21 . ASN A 1 4   ? -8.594  2.943   3.731   1.00 0.00 ? 1484 ASN A HD21 5  
ATOM   8869  H HD22 . ASN A 1 4   ? -7.579  3.020   5.155   1.00 0.00 ? 1484 ASN A HD22 5  
ATOM   8870  N N    . SER A 1 5   ? -4.056  0.459   1.182   1.00 0.00 ? 1485 SER A N    5  
ATOM   8871  C CA   . SER A 1 5   ? -3.451  -0.833  1.537   1.00 0.00 ? 1485 SER A CA   5  
ATOM   8872  C C    . SER A 1 5   ? -4.152  -2.049  0.935   1.00 0.00 ? 1485 SER A C    5  
ATOM   8873  O O    . SER A 1 5   ? -3.542  -2.812  0.184   1.00 0.00 ? 1485 SER A O    5  
ATOM   8874  C CB   . SER A 1 5   ? -3.296  -0.950  3.067   1.00 0.00 ? 1485 SER A CB   5  
ATOM   8875  O OG   . SER A 1 5   ? -2.434  0.074   3.546   1.00 0.00 ? 1485 SER A OG   5  
ATOM   8876  H H    . SER A 1 5   ? -3.467  1.072   0.635   1.00 0.00 ? 1485 SER A H    5  
ATOM   8877  H HA   . SER A 1 5   ? -2.462  -0.861  1.096   1.00 0.00 ? 1485 SER A HA   5  
ATOM   8878  H HB2  . SER A 1 5   ? -4.269  -0.855  3.549   1.00 0.00 ? 1485 SER A HB2  5  
ATOM   8879  H HB3  . SER A 1 5   ? -2.908  -1.936  3.327   1.00 0.00 ? 1485 SER A HB3  5  
ATOM   8880  H HG   . SER A 1 5   ? -2.338  -0.019  4.515   1.00 0.00 ? 1485 SER A HG   5  
ATOM   8881  N N    . PHE A 1 6   ? -5.438  -2.192  1.225   1.00 0.00 ? 1486 PHE A N    5  
ATOM   8882  C CA   . PHE A 1 6   ? -6.290  -3.268  0.756   1.00 0.00 ? 1486 PHE A CA   5  
ATOM   8883  C C    . PHE A 1 6   ? -7.647  -2.665  0.445   1.00 0.00 ? 1486 PHE A C    5  
ATOM   8884  O O    . PHE A 1 6   ? -8.144  -2.807  -0.663  1.00 0.00 ? 1486 PHE A O    5  
ATOM   8885  C CB   . PHE A 1 6   ? -6.368  -4.365  1.829   1.00 0.00 ? 1486 PHE A CB   5  
ATOM   8886  C CG   . PHE A 1 6   ? -5.062  -5.113  1.995   1.00 0.00 ? 1486 PHE A CG   5  
ATOM   8887  C CD1  . PHE A 1 6   ? -4.746  -6.137  1.085   1.00 0.00 ? 1486 PHE A CD1  5  
ATOM   8888  C CD2  . PHE A 1 6   ? -4.169  -4.798  3.038   1.00 0.00 ? 1486 PHE A CD2  5  
ATOM   8889  C CE1  . PHE A 1 6   ? -3.547  -6.848  1.225   1.00 0.00 ? 1486 PHE A CE1  5  
ATOM   8890  C CE2  . PHE A 1 6   ? -2.964  -5.513  3.174   1.00 0.00 ? 1486 PHE A CE2  5  
ATOM   8891  C CZ   . PHE A 1 6   ? -2.652  -6.539  2.266   1.00 0.00 ? 1486 PHE A CZ   5  
ATOM   8892  H H    . PHE A 1 6   ? -5.865  -1.454  1.772   1.00 0.00 ? 1486 PHE A H    5  
ATOM   8893  H HA   . PHE A 1 6   ? -5.887  -3.691  -0.157  1.00 0.00 ? 1486 PHE A HA   5  
ATOM   8894  H HB2  . PHE A 1 6   ? -6.655  -3.945  2.789   1.00 0.00 ? 1486 PHE A HB2  5  
ATOM   8895  H HB3  . PHE A 1 6   ? -7.140  -5.087  1.561   1.00 0.00 ? 1486 PHE A HB3  5  
ATOM   8896  H HD1  . PHE A 1 6   ? -5.422  -6.382  0.278   1.00 0.00 ? 1486 PHE A HD1  5  
ATOM   8897  H HD2  . PHE A 1 6   ? -4.405  -4.007  3.738   1.00 0.00 ? 1486 PHE A HD2  5  
ATOM   8898  H HE1  . PHE A 1 6   ? -3.326  -7.633  0.524   1.00 0.00 ? 1486 PHE A HE1  5  
ATOM   8899  H HE2  . PHE A 1 6   ? -2.280  -5.272  3.976   1.00 0.00 ? 1486 PHE A HE2  5  
ATOM   8900  H HZ   . PHE A 1 6   ? -1.724  -7.092  2.367   1.00 0.00 ? 1486 PHE A HZ   5  
ATOM   8901  N N    . VAL A 1 7   ? -8.206  -1.926  1.396   1.00 0.00 ? 1487 VAL A N    5  
ATOM   8902  C CA   . VAL A 1 7   ? -9.493  -1.275  1.265   1.00 0.00 ? 1487 VAL A CA   5  
ATOM   8903  C C    . VAL A 1 7   ? -9.472  -0.356  0.030   1.00 0.00 ? 1487 VAL A C    5  
ATOM   8904  O O    . VAL A 1 7   ? -8.647  0.553   -0.060  1.00 0.00 ? 1487 VAL A O    5  
ATOM   8905  C CB   . VAL A 1 7   ? -9.873  -0.575  2.594   1.00 0.00 ? 1487 VAL A CB   5  
ATOM   8906  C CG1  . VAL A 1 7   ? -11.389 -0.403  2.645   1.00 0.00 ? 1487 VAL A CG1  5  
ATOM   8907  C CG2  . VAL A 1 7   ? -9.494  -1.402  3.842   1.00 0.00 ? 1487 VAL A CG2  5  
ATOM   8908  H H    . VAL A 1 7   ? -7.702  -1.794  2.261   1.00 0.00 ? 1487 VAL A H    5  
ATOM   8909  H HA   . VAL A 1 7   ? -10.221 -2.063  1.080   1.00 0.00 ? 1487 VAL A HA   5  
ATOM   8910  H HB   . VAL A 1 7   ? -9.393  0.402   2.661   1.00 0.00 ? 1487 VAL A HB   5  
ATOM   8911  H HG11 . VAL A 1 7   ? -11.730 0.247   1.835   1.00 0.00 ? 1487 VAL A HG11 5  
ATOM   8912  H HG12 . VAL A 1 7   ? -11.847 -1.386  2.529   1.00 0.00 ? 1487 VAL A HG12 5  
ATOM   8913  H HG13 . VAL A 1 7   ? -11.706 0.021   3.600   1.00 0.00 ? 1487 VAL A HG13 5  
ATOM   8914  H HG21 . VAL A 1 7   ? -9.928  -0.948  4.734   1.00 0.00 ? 1487 VAL A HG21 5  
ATOM   8915  H HG22 . VAL A 1 7   ? -9.862  -2.428  3.748   1.00 0.00 ? 1487 VAL A HG22 5  
ATOM   8916  H HG23 . VAL A 1 7   ? -8.413  -1.409  3.990   1.00 0.00 ? 1487 VAL A HG23 5  
ATOM   8917  N N    . GLY A 1 8   ? -10.350 -0.640  -0.937  1.00 0.00 ? 1488 GLY A N    5  
ATOM   8918  C CA   . GLY A 1 8   ? -10.546 0.148   -2.145  1.00 0.00 ? 1488 GLY A CA   5  
ATOM   8919  C C    . GLY A 1 8   ? -9.878  -0.453  -3.384  1.00 0.00 ? 1488 GLY A C    5  
ATOM   8920  O O    . GLY A 1 8   ? -10.239 -0.064  -4.498  1.00 0.00 ? 1488 GLY A O    5  
ATOM   8921  H H    . GLY A 1 8   ? -10.973 -1.435  -0.811  1.00 0.00 ? 1488 GLY A H    5  
ATOM   8922  H HA2  . GLY A 1 8   ? -11.619 0.225   -2.330  1.00 0.00 ? 1488 GLY A HA2  5  
ATOM   8923  H HA3  . GLY A 1 8   ? -10.146 1.153   -1.992  1.00 0.00 ? 1488 GLY A HA3  5  
ATOM   8924  N N    . LEU A 1 9   ? -8.941  -1.401  -3.234  1.00 0.00 ? 1489 LEU A N    5  
ATOM   8925  C CA   . LEU A 1 9   ? -8.270  -2.024  -4.381  1.00 0.00 ? 1489 LEU A CA   5  
ATOM   8926  C C    . LEU A 1 9   ? -9.249  -2.930  -5.123  1.00 0.00 ? 1489 LEU A C    5  
ATOM   8927  O O    . LEU A 1 9   ? -9.983  -3.699  -4.493  1.00 0.00 ? 1489 LEU A O    5  
ATOM   8928  C CB   . LEU A 1 9   ? -7.020  -2.831  -3.966  1.00 0.00 ? 1489 LEU A CB   5  
ATOM   8929  C CG   . LEU A 1 9   ? -5.726  -2.046  -3.659  1.00 0.00 ? 1489 LEU A CG   5  
ATOM   8930  C CD1  . LEU A 1 9   ? -5.815  -1.116  -2.447  1.00 0.00 ? 1489 LEU A CD1  5  
ATOM   8931  C CD2  . LEU A 1 9   ? -4.591  -3.045  -3.410  1.00 0.00 ? 1489 LEU A CD2  5  
ATOM   8932  H H    . LEU A 1 9   ? -8.713  -1.744  -2.306  1.00 0.00 ? 1489 LEU A H    5  
ATOM   8933  H HA   . LEU A 1 9   ? -7.964  -1.263  -5.086  1.00 0.00 ? 1489 LEU A HA   5  
ATOM   8934  H HB2  . LEU A 1 9   ? -7.268  -3.465  -3.117  1.00 0.00 ? 1489 LEU A HB2  5  
ATOM   8935  H HB3  . LEU A 1 9   ? -6.782  -3.488  -4.804  1.00 0.00 ? 1489 LEU A HB3  5  
ATOM   8936  H HG   . LEU A 1 9   ? -5.458  -1.452  -4.533  1.00 0.00 ? 1489 LEU A HG   5  
ATOM   8937  H HD11 . LEU A 1 9   ? -4.839  -0.669  -2.247  1.00 0.00 ? 1489 LEU A HD11 5  
ATOM   8938  H HD12 . LEU A 1 9   ? -6.543  -0.321  -2.626  1.00 0.00 ? 1489 LEU A HD12 5  
ATOM   8939  H HD13 . LEU A 1 9   ? -6.108  -1.682  -1.572  1.00 0.00 ? 1489 LEU A HD13 5  
ATOM   8940  H HD21 . LEU A 1 9   ? -3.657  -2.514  -3.219  1.00 0.00 ? 1489 LEU A HD21 5  
ATOM   8941  H HD22 . LEU A 1 9   ? -4.823  -3.675  -2.546  1.00 0.00 ? 1489 LEU A HD22 5  
ATOM   8942  H HD23 . LEU A 1 9   ? -4.454  -3.678  -4.288  1.00 0.00 ? 1489 LEU A HD23 5  
ATOM   8943  N N    . ARG A 1 10  ? -9.230  -2.856  -6.459  1.00 0.00 ? 1490 ARG A N    5  
ATOM   8944  C CA   . ARG A 1 10  ? -9.915  -3.820  -7.315  1.00 0.00 ? 1490 ARG A CA   5  
ATOM   8945  C C    . ARG A 1 10  ? -8.984  -5.028  -7.357  1.00 0.00 ? 1490 ARG A C    5  
ATOM   8946  O O    . ARG A 1 10  ? -7.796  -4.885  -7.653  1.00 0.00 ? 1490 ARG A O    5  
ATOM   8947  C CB   . ARG A 1 10  ? -10.128 -3.278  -8.739  1.00 0.00 ? 1490 ARG A CB   5  
ATOM   8948  C CG   . ARG A 1 10  ? -11.241 -2.220  -8.806  1.00 0.00 ? 1490 ARG A CG   5  
ATOM   8949  C CD   . ARG A 1 10  ? -11.597 -1.897  -10.259 1.00 0.00 ? 1490 ARG A CD   5  
ATOM   8950  N NE   . ARG A 1 10  ? -12.748 -0.971  -10.355 1.00 0.00 ? 1490 ARG A NE   5  
ATOM   8951  C CZ   . ARG A 1 10  ? -13.617 -0.898  -11.378 1.00 0.00 ? 1490 ARG A CZ   5  
ATOM   8952  N NH1  . ARG A 1 10  ? -13.444 -1.653  -12.456 1.00 0.00 ? 1490 ARG A NH1  5  
ATOM   8953  N NH2  . ARG A 1 10  ? -14.655 -0.071  -11.319 1.00 0.00 ? 1490 ARG A NH2  5  
ATOM   8954  H H    . ARG A 1 10  ? -8.591  -2.210  -6.904  1.00 0.00 ? 1490 ARG A H    5  
ATOM   8955  H HA   . ARG A 1 10  ? -10.876 -4.101  -6.870  1.00 0.00 ? 1490 ARG A HA   5  
ATOM   8956  H HB2  . ARG A 1 10  ? -9.195  -2.856  -9.123  1.00 0.00 ? 1490 ARG A HB2  5  
ATOM   8957  H HB3  . ARG A 1 10  ? -10.402 -4.127  -9.372  1.00 0.00 ? 1490 ARG A HB3  5  
ATOM   8958  H HG2  . ARG A 1 10  ? -12.130 -2.621  -8.324  1.00 0.00 ? 1490 ARG A HG2  5  
ATOM   8959  H HG3  . ARG A 1 10  ? -10.922 -1.316  -8.287  1.00 0.00 ? 1490 ARG A HG3  5  
ATOM   8960  H HD2  . ARG A 1 10  ? -10.735 -1.449  -10.753 1.00 0.00 ? 1490 ARG A HD2  5  
ATOM   8961  H HD3  . ARG A 1 10  ? -11.843 -2.837  -10.756 1.00 0.00 ? 1490 ARG A HD3  5  
ATOM   8962  H HE   . ARG A 1 10  ? -12.873 -0.345  -9.563  1.00 0.00 ? 1490 ARG A HE   5  
ATOM   8963  H HH11 . ARG A 1 10  ? -12.626 -2.229  -12.551 1.00 0.00 ? 1490 ARG A HH11 5  
ATOM   8964  H HH12 . ARG A 1 10  ? -14.113 -1.678  -13.239 1.00 0.00 ? 1490 ARG A HH12 5  
ATOM   8965  H HH21 . ARG A 1 10  ? -14.812 0.531   -10.518 1.00 0.00 ? 1490 ARG A HH21 5  
ATOM   8966  H HH22 . ARG A 1 10  ? -15.323 0.001   -12.080 1.00 0.00 ? 1490 ARG A HH22 5  
ATOM   8967  N N    . VAL A 1 11  ? -9.514  -6.199  -7.040  1.00 0.00 ? 1491 VAL A N    5  
ATOM   8968  C CA   . VAL A 1 11  ? -8.773  -7.440  -6.876  1.00 0.00 ? 1491 VAL A CA   5  
ATOM   8969  C C    . VAL A 1 11  ? -9.660  -8.565  -7.418  1.00 0.00 ? 1491 VAL A C    5  
ATOM   8970  O O    . VAL A 1 11  ? -10.774 -8.318  -7.892  1.00 0.00 ? 1491 VAL A O    5  
ATOM   8971  C CB   . VAL A 1 11  ? -8.369  -7.604  -5.389  1.00 0.00 ? 1491 VAL A CB   5  
ATOM   8972  C CG1  . VAL A 1 11  ? -7.546  -6.415  -4.863  1.00 0.00 ? 1491 VAL A CG1  5  
ATOM   8973  C CG2  . VAL A 1 11  ? -9.559  -7.775  -4.450  1.00 0.00 ? 1491 VAL A CG2  5  
ATOM   8974  H H    . VAL A 1 11  ? -10.512 -6.256  -6.863  1.00 0.00 ? 1491 VAL A H    5  
ATOM   8975  H HA   . VAL A 1 11  ? -7.854  -7.418  -7.462  1.00 0.00 ? 1491 VAL A HA   5  
ATOM   8976  H HB   . VAL A 1 11  ? -7.750  -8.487  -5.289  1.00 0.00 ? 1491 VAL A HB   5  
ATOM   8977  H HG11 . VAL A 1 11  ? -6.753  -6.151  -5.563  1.00 0.00 ? 1491 VAL A HG11 5  
ATOM   8978  H HG12 . VAL A 1 11  ? -8.187  -5.547  -4.714  1.00 0.00 ? 1491 VAL A HG12 5  
ATOM   8979  H HG13 . VAL A 1 11  ? -7.103  -6.671  -3.906  1.00 0.00 ? 1491 VAL A HG13 5  
ATOM   8980  H HG21 . VAL A 1 11  ? -10.201 -6.895  -4.481  1.00 0.00 ? 1491 VAL A HG21 5  
ATOM   8981  H HG22 . VAL A 1 11  ? -10.135 -8.663  -4.730  1.00 0.00 ? 1491 VAL A HG22 5  
ATOM   8982  H HG23 . VAL A 1 11  ? -9.183  -7.916  -3.438  1.00 0.00 ? 1491 VAL A HG23 5  
ATOM   8983  N N    . VAL A 1 12  ? -9.206  -9.810  -7.330  1.00 0.00 ? 1492 VAL A N    5  
ATOM   8984  C CA   . VAL A 1 12  ? -10.024 -10.984 -7.607  1.00 0.00 ? 1492 VAL A CA   5  
ATOM   8985  C C    . VAL A 1 12  ? -10.077 -11.761 -6.293  1.00 0.00 ? 1492 VAL A C    5  
ATOM   8986  O O    . VAL A 1 12  ? -9.145  -11.678 -5.497  1.00 0.00 ? 1492 VAL A O    5  
ATOM   8987  C CB   . VAL A 1 12  ? -9.431  -11.803 -8.780  1.00 0.00 ? 1492 VAL A CB   5  
ATOM   8988  C CG1  . VAL A 1 12  ? -10.493 -12.721 -9.397  1.00 0.00 ? 1492 VAL A CG1  5  
ATOM   8989  C CG2  . VAL A 1 12  ? -8.890  -10.918 -9.912  1.00 0.00 ? 1492 VAL A CG2  5  
ATOM   8990  H H    . VAL A 1 12  ? -8.283  -9.986  -6.940  1.00 0.00 ? 1492 VAL A H    5  
ATOM   8991  H HA   . VAL A 1 12  ? -11.038 -10.679 -7.868  1.00 0.00 ? 1492 VAL A HA   5  
ATOM   8992  H HB   . VAL A 1 12  ? -8.611  -12.417 -8.407  1.00 0.00 ? 1492 VAL A HB   5  
ATOM   8993  H HG11 . VAL A 1 12  ? -10.028 -13.382 -10.132 1.00 0.00 ? 1492 VAL A HG11 5  
ATOM   8994  H HG12 . VAL A 1 12  ? -10.950 -13.333 -8.624  1.00 0.00 ? 1492 VAL A HG12 5  
ATOM   8995  H HG13 . VAL A 1 12  ? -11.259 -12.126 -9.893  1.00 0.00 ? 1492 VAL A HG13 5  
ATOM   8996  H HG21 . VAL A 1 12  ? -8.015  -10.369 -9.565  1.00 0.00 ? 1492 VAL A HG21 5  
ATOM   8997  H HG22 . VAL A 1 12  ? -8.569  -11.561 -10.735 1.00 0.00 ? 1492 VAL A HG22 5  
ATOM   8998  H HG23 . VAL A 1 12  ? -9.649  -10.209 -10.247 1.00 0.00 ? 1492 VAL A HG23 5  
ATOM   8999  N N    . ALA A 1 13  ? -11.159 -12.473 -6.014  1.00 0.00 ? 1493 ALA A N    5  
ATOM   9000  C CA   . ALA A 1 13  ? -11.389 -13.121 -4.737  1.00 0.00 ? 1493 ALA A CA   5  
ATOM   9001  C C    . ALA A 1 13  ? -12.117 -14.428 -4.997  1.00 0.00 ? 1493 ALA A C    5  
ATOM   9002  O O    . ALA A 1 13  ? -12.941 -14.481 -5.909  1.00 0.00 ? 1493 ALA A O    5  
ATOM   9003  C CB   . ALA A 1 13  ? -12.232 -12.169 -3.878  1.00 0.00 ? 1493 ALA A CB   5  
ATOM   9004  H H    . ALA A 1 13  ? -11.931 -12.488 -6.671  1.00 0.00 ? 1493 ALA A H    5  
ATOM   9005  H HA   . ALA A 1 13  ? -10.442 -13.322 -4.243  1.00 0.00 ? 1493 ALA A HA   5  
ATOM   9006  H HB1  . ALA A 1 13  ? -11.762 -11.184 -3.853  1.00 0.00 ? 1493 ALA A HB1  5  
ATOM   9007  H HB2  . ALA A 1 13  ? -13.230 -12.057 -4.298  1.00 0.00 ? 1493 ALA A HB2  5  
ATOM   9008  H HB3  . ALA A 1 13  ? -12.314 -12.553 -2.864  1.00 0.00 ? 1493 ALA A HB3  5  
ATOM   9009  N N    . LYS A 1 14  ? -11.870 -15.459 -4.196  1.00 0.00 ? 1494 LYS A N    5  
ATOM   9010  C CA   . LYS A 1 14  ? -12.576 -16.727 -4.360  1.00 0.00 ? 1494 LYS A CA   5  
ATOM   9011  C C    . LYS A 1 14  ? -13.880 -16.567 -3.624  1.00 0.00 ? 1494 LYS A C    5  
ATOM   9012  O O    . LYS A 1 14  ? -13.926 -16.065 -2.506  1.00 0.00 ? 1494 LYS A O    5  
ATOM   9013  C CB   . LYS A 1 14  ? -11.801 -17.915 -3.776  1.00 0.00 ? 1494 LYS A CB   5  
ATOM   9014  C CG   . LYS A 1 14  ? -12.654 -19.199 -3.803  1.00 0.00 ? 1494 LYS A CG   5  
ATOM   9015  C CD   . LYS A 1 14  ? -11.795 -20.410 -3.399  1.00 0.00 ? 1494 LYS A CD   5  
ATOM   9016  C CE   . LYS A 1 14  ? -12.530 -21.733 -3.666  1.00 0.00 ? 1494 LYS A CE   5  
ATOM   9017  N NZ   . LYS A 1 14  ? -11.822 -22.906 -3.070  1.00 0.00 ? 1494 LYS A NZ   5  
ATOM   9018  H H    . LYS A 1 14  ? -11.283 -15.318 -3.381  1.00 0.00 ? 1494 LYS A H    5  
ATOM   9019  H HA   . LYS A 1 14  ? -12.770 -16.930 -5.419  1.00 0.00 ? 1494 LYS A HA   5  
ATOM   9020  H HB2  . LYS A 1 14  ? -10.889 -18.055 -4.358  1.00 0.00 ? 1494 LYS A HB2  5  
ATOM   9021  H HB3  . LYS A 1 14  ? -11.543 -17.704 -2.745  1.00 0.00 ? 1494 LYS A HB3  5  
ATOM   9022  H HG2  . LYS A 1 14  ? -13.505 -19.088 -3.115  1.00 0.00 ? 1494 LYS A HG2  5  
ATOM   9023  H HG3  . LYS A 1 14  ? -13.080 -19.344 -4.798  1.00 0.00 ? 1494 LYS A HG3  5  
ATOM   9024  H HD2  . LYS A 1 14  ? -10.871 -20.405 -3.978  1.00 0.00 ? 1494 LYS A HD2  5  
ATOM   9025  H HD3  . LYS A 1 14  ? -11.553 -20.323 -2.336  1.00 0.00 ? 1494 LYS A HD3  5  
ATOM   9026  H HE2  . LYS A 1 14  ? -13.541 -21.652 -3.254  1.00 0.00 ? 1494 LYS A HE2  5  
ATOM   9027  H HE3  . LYS A 1 14  ? -12.615 -21.869 -4.752  1.00 0.00 ? 1494 LYS A HE3  5  
ATOM   9028  H HZ1  . LYS A 1 14  ? -11.738 -22.821 -2.061  1.00 0.00 ? 1494 LYS A HZ1  5  
ATOM   9029  H HZ2  . LYS A 1 14  ? -12.331 -23.778 -3.258  1.00 0.00 ? 1494 LYS A HZ2  5  
ATOM   9030  H HZ3  . LYS A 1 14  ? -10.887 -23.014 -3.449  1.00 0.00 ? 1494 LYS A HZ3  5  
ATOM   9031  N N    . TRP A 1 15  ? -14.930 -17.047 -4.265  1.00 0.00 ? 1495 TRP A N    5  
ATOM   9032  C CA   . TRP A 1 15  ? -16.222 -17.181 -3.648  1.00 0.00 ? 1495 TRP A CA   5  
ATOM   9033  C C    . TRP A 1 15  ? -16.172 -18.377 -2.693  1.00 0.00 ? 1495 TRP A C    5  
ATOM   9034  O O    . TRP A 1 15  ? -16.009 -19.523 -3.121  1.00 0.00 ? 1495 TRP A O    5  
ATOM   9035  C CB   . TRP A 1 15  ? -17.192 -17.307 -4.802  1.00 0.00 ? 1495 TRP A CB   5  
ATOM   9036  C CG   . TRP A 1 15  ? -18.600 -17.653 -4.484  1.00 0.00 ? 1495 TRP A CG   5  
ATOM   9037  C CD1  . TRP A 1 15  ? -19.190 -18.788 -4.894  1.00 0.00 ? 1495 TRP A CD1  5  
ATOM   9038  C CD2  . TRP A 1 15  ? -19.603 -16.912 -3.730  1.00 0.00 ? 1495 TRP A CD2  5  
ATOM   9039  N NE1  . TRP A 1 15  ? -20.525 -18.774 -4.540  1.00 0.00 ? 1495 TRP A NE1  5  
ATOM   9040  C CE2  . TRP A 1 15  ? -20.817 -17.669 -3.755  1.00 0.00 ? 1495 TRP A CE2  5  
ATOM   9041  C CE3  . TRP A 1 15  ? -19.614 -15.665 -3.066  1.00 0.00 ? 1495 TRP A CE3  5  
ATOM   9042  C CZ2  . TRP A 1 15  ? -21.982 -17.203 -3.127  1.00 0.00 ? 1495 TRP A CZ2  5  
ATOM   9043  C CZ3  . TRP A 1 15  ? -20.789 -15.194 -2.452  1.00 0.00 ? 1495 TRP A CZ3  5  
ATOM   9044  C CH2  . TRP A 1 15  ? -21.959 -15.968 -2.455  1.00 0.00 ? 1495 TRP A CH2  5  
ATOM   9045  H H    . TRP A 1 15  ? -14.801 -17.463 -5.185  1.00 0.00 ? 1495 TRP A H    5  
ATOM   9046  H HA   . TRP A 1 15  ? -16.438 -16.263 -3.102  1.00 0.00 ? 1495 TRP A HA   5  
ATOM   9047  H HB2  . TRP A 1 15  ? -17.185 -16.344 -5.310  1.00 0.00 ? 1495 TRP A HB2  5  
ATOM   9048  H HB3  . TRP A 1 15  ? -16.811 -18.052 -5.501  1.00 0.00 ? 1495 TRP A HB3  5  
ATOM   9049  H HD1  . TRP A 1 15  ? -18.655 -19.566 -5.428  1.00 0.00 ? 1495 TRP A HD1  5  
ATOM   9050  H HE1  . TRP A 1 15  ? -21.177 -19.495 -4.843  1.00 0.00 ? 1495 TRP A HE1  5  
ATOM   9051  H HE3  . TRP A 1 15  ? -18.715 -15.060 -3.029  1.00 0.00 ? 1495 TRP A HE3  5  
ATOM   9052  H HZ2  . TRP A 1 15  ? -22.893 -17.783 -3.159  1.00 0.00 ? 1495 TRP A HZ2  5  
ATOM   9053  H HZ3  . TRP A 1 15  ? -20.801 -14.224 -1.975  1.00 0.00 ? 1495 TRP A HZ3  5  
ATOM   9054  H HH2  . TRP A 1 15  ? -22.832 -15.594 -1.936  1.00 0.00 ? 1495 TRP A HH2  5  
ATOM   9055  N N    . SER A 1 16  ? -16.261 -18.089 -1.395  1.00 0.00 ? 1496 SER A N    5  
ATOM   9056  C CA   . SER A 1 16  ? -16.022 -19.014 -0.286  1.00 0.00 ? 1496 SER A CA   5  
ATOM   9057  C C    . SER A 1 16  ? -16.886 -20.286 -0.280  1.00 0.00 ? 1496 SER A C    5  
ATOM   9058  O O    . SER A 1 16  ? -16.509 -21.257 0.382   1.00 0.00 ? 1496 SER A O    5  
ATOM   9059  C CB   . SER A 1 16  ? -16.221 -18.230 1.014   1.00 0.00 ? 1496 SER A CB   5  
ATOM   9060  O OG   . SER A 1 16  ? -15.501 -17.001 0.974   1.00 0.00 ? 1496 SER A OG   5  
ATOM   9061  H H    . SER A 1 16  ? -16.331 -17.119 -1.119  1.00 0.00 ? 1496 SER A H    5  
ATOM   9062  H HA   . SER A 1 16  ? -14.979 -19.331 -0.332  1.00 0.00 ? 1496 SER A HA   5  
ATOM   9063  H HB2  . SER A 1 16  ? -17.282 -18.017 1.112   1.00 0.00 ? 1496 SER A HB2  5  
ATOM   9064  H HB3  . SER A 1 16  ? -15.894 -18.830 1.867   1.00 0.00 ? 1496 SER A HB3  5  
ATOM   9065  H HG   . SER A 1 16  ? -15.750 -16.472 1.756   1.00 0.00 ? 1496 SER A HG   5  
ATOM   9066  N N    . SER A 1 17  ? -17.996 -20.333 -1.027  1.00 0.00 ? 1497 SER A N    5  
ATOM   9067  C CA   . SER A 1 17  ? -18.833 -21.518 -1.222  1.00 0.00 ? 1497 SER A CA   5  
ATOM   9068  C C    . SER A 1 17  ? -18.160 -22.538 -2.172  1.00 0.00 ? 1497 SER A C    5  
ATOM   9069  O O    . SER A 1 17  ? -18.788 -23.060 -3.096  1.00 0.00 ? 1497 SER A O    5  
ATOM   9070  C CB   . SER A 1 17  ? -20.221 -21.073 -1.709  1.00 0.00 ? 1497 SER A CB   5  
ATOM   9071  O OG   . SER A 1 17  ? -20.761 -20.078 -0.844  1.00 0.00 ? 1497 SER A OG   5  
ATOM   9072  H H    . SER A 1 17  ? -18.286 -19.499 -1.520  1.00 0.00 ? 1497 SER A H    5  
ATOM   9073  H HA   . SER A 1 17  ? -18.958 -22.011 -0.255  1.00 0.00 ? 1497 SER A HA   5  
ATOM   9074  H HB2  . SER A 1 17  ? -20.133 -20.667 -2.718  1.00 0.00 ? 1497 SER A HB2  5  
ATOM   9075  H HB3  . SER A 1 17  ? -20.885 -21.937 -1.739  1.00 0.00 ? 1497 SER A HB3  5  
ATOM   9076  H HG   . SER A 1 17  ? -21.650 -19.837 -1.164  1.00 0.00 ? 1497 SER A HG   5  
ATOM   9077  N N    . ASN A 1 18  ? -16.859 -22.792 -1.960  1.00 0.00 ? 1498 ASN A N    5  
ATOM   9078  C CA   . ASN A 1 18  ? -15.930 -23.543 -2.807  1.00 0.00 ? 1498 ASN A CA   5  
ATOM   9079  C C    . ASN A 1 18  ? -16.147 -23.304 -4.312  1.00 0.00 ? 1498 ASN A C    5  
ATOM   9080  O O    . ASN A 1 18  ? -16.285 -24.248 -5.093  1.00 0.00 ? 1498 ASN A O    5  
ATOM   9081  C CB   . ASN A 1 18  ? -15.887 -25.031 -2.422  1.00 0.00 ? 1498 ASN A CB   5  
ATOM   9082  C CG   . ASN A 1 18  ? -14.697 -25.732 -3.082  1.00 0.00 ? 1498 ASN A CG   5  
ATOM   9083  O OD1  . ASN A 1 18  ? -13.647 -25.125 -3.298  1.00 0.00 ? 1498 ASN A OD1  5  
ATOM   9084  N ND2  . ASN A 1 18  ? -14.814 -27.010 -3.416  1.00 0.00 ? 1498 ASN A ND2  5  
ATOM   9085  H H    . ASN A 1 18  ? -16.456 -22.376 -1.127  1.00 0.00 ? 1498 ASN A H    5  
ATOM   9086  H HA   . ASN A 1 18  ? -14.945 -23.136 -2.575  1.00 0.00 ? 1498 ASN A HA   5  
ATOM   9087  H HB2  . ASN A 1 18  ? -15.789 -25.136 -1.339  1.00 0.00 ? 1498 ASN A HB2  5  
ATOM   9088  H HB3  . ASN A 1 18  ? -16.818 -25.512 -2.726  1.00 0.00 ? 1498 ASN A HB3  5  
ATOM   9089  H HD21 . ASN A 1 18  ? -15.679 -27.515 -3.244  1.00 0.00 ? 1498 ASN A HD21 5  
ATOM   9090  H HD22 . ASN A 1 18  ? -14.041 -27.488 -3.863  1.00 0.00 ? 1498 ASN A HD22 5  
ATOM   9091  N N    . GLY A 1 19  ? -16.207 -22.028 -4.707  1.00 0.00 ? 1499 GLY A N    5  
ATOM   9092  C CA   . GLY A 1 19  ? -16.461 -21.617 -6.082  1.00 0.00 ? 1499 GLY A CA   5  
ATOM   9093  C C    . GLY A 1 19  ? -15.214 -21.079 -6.767  1.00 0.00 ? 1499 GLY A C    5  
ATOM   9094  O O    . GLY A 1 19  ? -14.089 -21.325 -6.341  1.00 0.00 ? 1499 GLY A O    5  
ATOM   9095  H H    . GLY A 1 19  ? -16.096 -21.281 -4.026  1.00 0.00 ? 1499 GLY A H    5  
ATOM   9096  H HA2  . GLY A 1 19  ? -16.856 -22.445 -6.667  1.00 0.00 ? 1499 GLY A HA2  5  
ATOM   9097  H HA3  . GLY A 1 19  ? -17.213 -20.836 -6.073  1.00 0.00 ? 1499 GLY A HA3  5  
ATOM   9098  N N    . TYR A 1 20  ? -15.434 -20.375 -7.875  1.00 0.00 ? 1500 TYR A N    5  
ATOM   9099  C CA   . TYR A 1 20  ? -14.400 -19.752 -8.690  1.00 0.00 ? 1500 TYR A CA   5  
ATOM   9100  C C    . TYR A 1 20  ? -13.952 -18.418 -8.089  1.00 0.00 ? 1500 TYR A C    5  
ATOM   9101  O O    . TYR A 1 20  ? -14.361 -18.041 -6.989  1.00 0.00 ? 1500 TYR A O    5  
ATOM   9102  C CB   . TYR A 1 20  ? -14.967 -19.581 -10.111 1.00 0.00 ? 1500 TYR A CB   5  
ATOM   9103  C CG   . TYR A 1 20  ? -15.138 -20.812 -10.972 1.00 0.00 ? 1500 TYR A CG   5  
ATOM   9104  C CD1  . TYR A 1 20  ? -14.650 -22.087 -10.628 1.00 0.00 ? 1500 TYR A CD1  5  
ATOM   9105  C CD2  . TYR A 1 20  ? -15.814 -20.634 -12.186 1.00 0.00 ? 1500 TYR A CD2  5  
ATOM   9106  C CE1  . TYR A 1 20  ? -14.762 -23.146 -11.557 1.00 0.00 ? 1500 TYR A CE1  5  
ATOM   9107  C CE2  . TYR A 1 20  ? -15.912 -21.668 -13.119 1.00 0.00 ? 1500 TYR A CE2  5  
ATOM   9108  C CZ   . TYR A 1 20  ? -15.357 -22.932 -12.821 1.00 0.00 ? 1500 TYR A CZ   5  
ATOM   9109  O OH   . TYR A 1 20  ? -15.428 -23.919 -13.755 1.00 0.00 ? 1500 TYR A OH   5  
ATOM   9110  H H    . TYR A 1 20  ? -16.392 -20.190 -8.138  1.00 0.00 ? 1500 TYR A H    5  
ATOM   9111  H HA   . TYR A 1 20  ? -13.520 -20.393 -8.731  1.00 0.00 ? 1500 TYR A HA   5  
ATOM   9112  H HB2  . TYR A 1 20  ? -15.931 -19.087 -10.045 1.00 0.00 ? 1500 TYR A HB2  5  
ATOM   9113  H HB3  . TYR A 1 20  ? -14.333 -18.912 -10.688 1.00 0.00 ? 1500 TYR A HB3  5  
ATOM   9114  H HD1  . TYR A 1 20  ? -14.193 -22.252 -9.657  1.00 0.00 ? 1500 TYR A HD1  5  
ATOM   9115  H HD2  . TYR A 1 20  ? -16.265 -19.686 -12.406 1.00 0.00 ? 1500 TYR A HD2  5  
ATOM   9116  H HE1  . TYR A 1 20  ? -14.397 -24.135 -11.311 1.00 0.00 ? 1500 TYR A HE1  5  
ATOM   9117  H HE2  . TYR A 1 20  ? -16.413 -21.472 -14.057 1.00 0.00 ? 1500 TYR A HE2  5  
ATOM   9118  H HH   . TYR A 1 20  ? -14.929 -24.729 -13.531 1.00 0.00 ? 1500 TYR A HH   5  
ATOM   9119  N N    . PHE A 1 21  ? -13.100 -17.708 -8.826  1.00 0.00 ? 1501 PHE A N    5  
ATOM   9120  C CA   . PHE A 1 21  ? -12.487 -16.459 -8.434  1.00 0.00 ? 1501 PHE A CA   5  
ATOM   9121  C C    . PHE A 1 21  ? -13.135 -15.363 -9.283  1.00 0.00 ? 1501 PHE A C    5  
ATOM   9122  O O    . PHE A 1 21  ? -13.125 -15.468 -10.514 1.00 0.00 ? 1501 PHE A O    5  
ATOM   9123  C CB   . PHE A 1 21  ? -10.976 -16.571 -8.684  1.00 0.00 ? 1501 PHE A CB   5  
ATOM   9124  C CG   . PHE A 1 21  ? -10.198 -17.507 -7.777  1.00 0.00 ? 1501 PHE A CG   5  
ATOM   9125  C CD1  . PHE A 1 21  ? -10.444 -18.892 -7.796  1.00 0.00 ? 1501 PHE A CD1  5  
ATOM   9126  C CD2  . PHE A 1 21  ? -9.212  -16.993 -6.916  1.00 0.00 ? 1501 PHE A CD2  5  
ATOM   9127  C CE1  . PHE A 1 21  ? -9.751  -19.752 -6.930  1.00 0.00 ? 1501 PHE A CE1  5  
ATOM   9128  C CE2  . PHE A 1 21  ? -8.486  -17.862 -6.084  1.00 0.00 ? 1501 PHE A CE2  5  
ATOM   9129  C CZ   . PHE A 1 21  ? -8.770  -19.239 -6.077  1.00 0.00 ? 1501 PHE A CZ   5  
ATOM   9130  H H    . PHE A 1 21  ? -12.830 -18.051 -9.746  1.00 0.00 ? 1501 PHE A H    5  
ATOM   9131  H HA   . PHE A 1 21  ? -12.666 -16.268 -7.384  1.00 0.00 ? 1501 PHE A HA   5  
ATOM   9132  H HB2  . PHE A 1 21  ? -10.830 -16.931 -9.694  1.00 0.00 ? 1501 PHE A HB2  5  
ATOM   9133  H HB3  . PHE A 1 21  ? -10.539 -15.577 -8.617  1.00 0.00 ? 1501 PHE A HB3  5  
ATOM   9134  H HD1  . PHE A 1 21  ? -11.169 -19.308 -8.478  1.00 0.00 ? 1501 PHE A HD1  5  
ATOM   9135  H HD2  . PHE A 1 21  ? -9.002  -15.932 -6.886  1.00 0.00 ? 1501 PHE A HD2  5  
ATOM   9136  H HE1  . PHE A 1 21  ? -9.965  -20.810 -6.913  1.00 0.00 ? 1501 PHE A HE1  5  
ATOM   9137  H HE2  . PHE A 1 21  ? -7.710  -17.464 -5.452  1.00 0.00 ? 1501 PHE A HE2  5  
ATOM   9138  H HZ   . PHE A 1 21  ? -8.245  -19.922 -5.426  1.00 0.00 ? 1501 PHE A HZ   5  
ATOM   9139  N N    . TYR A 1 22  ? -13.681 -14.326 -8.642  1.00 0.00 ? 1502 TYR A N    5  
ATOM   9140  C CA   . TYR A 1 22  ? -14.475 -13.283 -9.289  1.00 0.00 ? 1502 TYR A CA   5  
ATOM   9141  C C    . TYR A 1 22  ? -13.894 -11.929 -8.914  1.00 0.00 ? 1502 TYR A C    5  
ATOM   9142  O O    . TYR A 1 22  ? -13.313 -11.780 -7.835  1.00 0.00 ? 1502 TYR A O    5  
ATOM   9143  C CB   . TYR A 1 22  ? -15.937 -13.369 -8.824  1.00 0.00 ? 1502 TYR A CB   5  
ATOM   9144  C CG   . TYR A 1 22  ? -16.629 -14.677 -9.119  1.00 0.00 ? 1502 TYR A CG   5  
ATOM   9145  C CD1  . TYR A 1 22  ? -16.372 -15.791 -8.302  1.00 0.00 ? 1502 TYR A CD1  5  
ATOM   9146  C CD2  . TYR A 1 22  ? -17.526 -14.780 -10.196 1.00 0.00 ? 1502 TYR A CD2  5  
ATOM   9147  C CE1  . TYR A 1 22  ? -16.988 -17.025 -8.569  1.00 0.00 ? 1502 TYR A CE1  5  
ATOM   9148  C CE2  . TYR A 1 22  ? -18.094 -16.030 -10.500 1.00 0.00 ? 1502 TYR A CE2  5  
ATOM   9149  C CZ   . TYR A 1 22  ? -17.838 -17.158 -9.685  1.00 0.00 ? 1502 TYR A CZ   5  
ATOM   9150  O OH   . TYR A 1 22  ? -18.396 -18.368 -9.956  1.00 0.00 ? 1502 TYR A OH   5  
ATOM   9151  H H    . TYR A 1 22  ? -13.612 -14.271 -7.624  1.00 0.00 ? 1502 TYR A H    5  
ATOM   9152  H HA   . TYR A 1 22  ? -14.442 -13.402 -10.373 1.00 0.00 ? 1502 TYR A HA   5  
ATOM   9153  H HB2  . TYR A 1 22  ? -15.964 -13.247 -7.745  1.00 0.00 ? 1502 TYR A HB2  5  
ATOM   9154  H HB3  . TYR A 1 22  ? -16.505 -12.551 -9.270  1.00 0.00 ? 1502 TYR A HB3  5  
ATOM   9155  H HD1  . TYR A 1 22  ? -15.702 -15.689 -7.459  1.00 0.00 ? 1502 TYR A HD1  5  
ATOM   9156  H HD2  . TYR A 1 22  ? -17.783 -13.904 -10.794 1.00 0.00 ? 1502 TYR A HD2  5  
ATOM   9157  H HE1  . TYR A 1 22  ? -16.815 -17.873 -7.919  1.00 0.00 ? 1502 TYR A HE1  5  
ATOM   9158  H HE2  . TYR A 1 22  ? -18.727 -16.121 -11.365 1.00 0.00 ? 1502 TYR A HE2  5  
ATOM   9159  H HH   . TYR A 1 22  ? -19.028 -18.353 -10.692 1.00 0.00 ? 1502 TYR A HH   5  
ATOM   9160  N N    . SER A 1 23  ? -14.025 -10.947 -9.800  1.00 0.00 ? 1503 SER A N    5  
ATOM   9161  C CA   . SER A 1 23  ? -13.540 -9.595  -9.581  1.00 0.00 ? 1503 SER A CA   5  
ATOM   9162  C C    . SER A 1 23  ? -14.321 -8.923  -8.450  1.00 0.00 ? 1503 SER A C    5  
ATOM   9163  O O    . SER A 1 23  ? -15.538 -9.099  -8.335  1.00 0.00 ? 1503 SER A O    5  
ATOM   9164  C CB   . SER A 1 23  ? -13.713 -8.805  -10.878 1.00 0.00 ? 1503 SER A CB   5  
ATOM   9165  O OG   . SER A 1 23  ? -13.315 -9.582  -12.001 1.00 0.00 ? 1503 SER A OG   5  
ATOM   9166  H H    . SER A 1 23  ? -14.482 -11.116 -10.687 1.00 0.00 ? 1503 SER A H    5  
ATOM   9167  H HA   . SER A 1 23  ? -12.480 -9.630  -9.325  1.00 0.00 ? 1503 SER A HA   5  
ATOM   9168  H HB2  . SER A 1 23  ? -14.764 -8.545  -11.001 1.00 0.00 ? 1503 SER A HB2  5  
ATOM   9169  H HB3  . SER A 1 23  ? -13.123 -7.901  -10.826 1.00 0.00 ? 1503 SER A HB3  5  
ATOM   9170  H HG   . SER A 1 23  ? -12.344 -9.705  -12.003 1.00 0.00 ? 1503 SER A HG   5  
ATOM   9171  N N    . GLY A 1 24  ? -13.658 -8.095  -7.641  1.00 0.00 ? 1504 GLY A N    5  
ATOM   9172  C CA   . GLY A 1 24  ? -14.326 -7.346  -6.592  1.00 0.00 ? 1504 GLY A CA   5  
ATOM   9173  C C    . GLY A 1 24  ? -13.444 -6.268  -6.005  1.00 0.00 ? 1504 GLY A C    5  
ATOM   9174  O O    . GLY A 1 24  ? -12.245 -6.217  -6.265  1.00 0.00 ? 1504 GLY A O    5  
ATOM   9175  H H    . GLY A 1 24  ? -12.652 -7.955  -7.745  1.00 0.00 ? 1504 GLY A H    5  
ATOM   9176  H HA2  . GLY A 1 24  ? -15.213 -6.871  -7.011  1.00 0.00 ? 1504 GLY A HA2  5  
ATOM   9177  H HA3  . GLY A 1 24  ? -14.623 -8.030  -5.798  1.00 0.00 ? 1504 GLY A HA3  5  
ATOM   9178  N N    . LYS A 1 25  ? -14.044 -5.396  -5.200  1.00 0.00 ? 1505 LYS A N    5  
ATOM   9179  C CA   . LYS A 1 25  ? -13.368 -4.288  -4.537  1.00 0.00 ? 1505 LYS A CA   5  
ATOM   9180  C C    . LYS A 1 25  ? -13.377 -4.596  -3.055  1.00 0.00 ? 1505 LYS A C    5  
ATOM   9181  O O    . LYS A 1 25  ? -14.413 -4.987  -2.524  1.00 0.00 ? 1505 LYS A O    5  
ATOM   9182  C CB   . LYS A 1 25  ? -14.143 -2.997  -4.824  1.00 0.00 ? 1505 LYS A CB   5  
ATOM   9183  C CG   . LYS A 1 25  ? -14.112 -2.642  -6.323  1.00 0.00 ? 1505 LYS A CG   5  
ATOM   9184  C CD   . LYS A 1 25  ? -15.450 -2.171  -6.905  1.00 0.00 ? 1505 LYS A CD   5  
ATOM   9185  C CE   . LYS A 1 25  ? -16.498 -3.293  -7.050  1.00 0.00 ? 1505 LYS A CE   5  
ATOM   9186  N NZ   . LYS A 1 25  ? -17.602 -2.881  -7.965  1.00 0.00 ? 1505 LYS A NZ   5  
ATOM   9187  H H    . LYS A 1 25  ? -15.045 -5.481  -5.031  1.00 0.00 ? 1505 LYS A H    5  
ATOM   9188  H HA   . LYS A 1 25  ? -12.340 -4.201  -4.895  1.00 0.00 ? 1505 LYS A HA   5  
ATOM   9189  H HB2  . LYS A 1 25  ? -15.165 -3.111  -4.454  1.00 0.00 ? 1505 LYS A HB2  5  
ATOM   9190  H HB3  . LYS A 1 25  ? -13.682 -2.181  -4.265  1.00 0.00 ? 1505 LYS A HB3  5  
ATOM   9191  H HG2  . LYS A 1 25  ? -13.383 -1.842  -6.451  1.00 0.00 ? 1505 LYS A HG2  5  
ATOM   9192  H HG3  . LYS A 1 25  ? -13.756 -3.485  -6.915  1.00 0.00 ? 1505 LYS A HG3  5  
ATOM   9193  H HD2  . LYS A 1 25  ? -15.852 -1.378  -6.271  1.00 0.00 ? 1505 LYS A HD2  5  
ATOM   9194  H HD3  . LYS A 1 25  ? -15.240 -1.760  -7.891  1.00 0.00 ? 1505 LYS A HD3  5  
ATOM   9195  H HE2  . LYS A 1 25  ? -16.027 -4.192  -7.459  1.00 0.00 ? 1505 LYS A HE2  5  
ATOM   9196  H HE3  . LYS A 1 25  ? -16.899 -3.552  -6.063  1.00 0.00 ? 1505 LYS A HE3  5  
ATOM   9197  H HZ1  . LYS A 1 25  ? -18.452 -3.405  -7.788  1.00 0.00 ? 1505 LYS A HZ1  5  
ATOM   9198  H HZ2  . LYS A 1 25  ? -17.828 -1.895  -7.876  1.00 0.00 ? 1505 LYS A HZ2  5  
ATOM   9199  H HZ3  . LYS A 1 25  ? -17.335 -3.079  -8.938  1.00 0.00 ? 1505 LYS A HZ3  5  
ATOM   9200  N N    . ILE A 1 26  ? -12.238 -4.467  -2.393  1.00 0.00 ? 1506 ILE A N    5  
ATOM   9201  C CA   . ILE A 1 26  ? -12.154 -4.731  -0.960  1.00 0.00 ? 1506 ILE A CA   5  
ATOM   9202  C C    . ILE A 1 26  ? -12.896 -3.601  -0.264  1.00 0.00 ? 1506 ILE A C    5  
ATOM   9203  O O    . ILE A 1 26  ? -12.467 -2.451  -0.344  1.00 0.00 ? 1506 ILE A O    5  
ATOM   9204  C CB   . ILE A 1 26  ? -10.683 -4.814  -0.532  1.00 0.00 ? 1506 ILE A CB   5  
ATOM   9205  C CG1  . ILE A 1 26  ? -9.978  -6.024  -1.186  1.00 0.00 ? 1506 ILE A CG1  5  
ATOM   9206  C CG2  . ILE A 1 26  ? -10.566 -4.930  0.994   1.00 0.00 ? 1506 ILE A CG2  5  
ATOM   9207  C CD1  . ILE A 1 26  ? -8.474  -5.819  -1.387  1.00 0.00 ? 1506 ILE A CD1  5  
ATOM   9208  H H    . ILE A 1 26  ? -11.409 -4.136  -2.884  1.00 0.00 ? 1506 ILE A H    5  
ATOM   9209  H HA   . ILE A 1 26  ? -12.654 -5.672  -0.728  1.00 0.00 ? 1506 ILE A HA   5  
ATOM   9210  H HB   . ILE A 1 26  ? -10.213 -3.898  -0.872  1.00 0.00 ? 1506 ILE A HB   5  
ATOM   9211  H HG12 . ILE A 1 26  ? -10.146 -6.908  -0.570  1.00 0.00 ? 1506 ILE A HG12 5  
ATOM   9212  H HG13 . ILE A 1 26  ? -10.405 -6.204  -2.170  1.00 0.00 ? 1506 ILE A HG13 5  
ATOM   9213  H HG21 . ILE A 1 26  ? -10.975 -4.044  1.488   1.00 0.00 ? 1506 ILE A HG21 5  
ATOM   9214  H HG22 . ILE A 1 26  ? -11.141 -5.795  1.323   1.00 0.00 ? 1506 ILE A HG22 5  
ATOM   9215  H HG23 . ILE A 1 26  ? -9.518  -5.040  1.277   1.00 0.00 ? 1506 ILE A HG23 5  
ATOM   9216  H HD11 . ILE A 1 26  ? -8.317  -5.027  -2.122  1.00 0.00 ? 1506 ILE A HD11 5  
ATOM   9217  H HD12 . ILE A 1 26  ? -7.993  -5.552  -0.451  1.00 0.00 ? 1506 ILE A HD12 5  
ATOM   9218  H HD13 . ILE A 1 26  ? -8.018  -6.740  -1.749  1.00 0.00 ? 1506 ILE A HD13 5  
ATOM   9219  N N    . THR A 1 27  ? -13.997 -3.909  0.404   1.00 0.00 ? 1507 THR A N    5  
ATOM   9220  C CA   . THR A 1 27  ? -14.831 -2.900  1.034   1.00 0.00 ? 1507 THR A CA   5  
ATOM   9221  C C    . THR A 1 27  ? -14.260 -2.493  2.386   1.00 0.00 ? 1507 THR A C    5  
ATOM   9222  O O    . THR A 1 27  ? -14.339 -1.321  2.757   1.00 0.00 ? 1507 THR A O    5  
ATOM   9223  C CB   . THR A 1 27  ? -16.234 -3.467  1.222   1.00 0.00 ? 1507 THR A CB   5  
ATOM   9224  O OG1  . THR A 1 27  ? -16.147 -4.685  1.926   1.00 0.00 ? 1507 THR A OG1  5  
ATOM   9225  C CG2  . THR A 1 27  ? -16.853 -3.821  -0.111  1.00 0.00 ? 1507 THR A CG2  5  
ATOM   9226  H H    . THR A 1 27  ? -14.319 -4.875  0.459   1.00 0.00 ? 1507 THR A H    5  
ATOM   9227  H HA   . THR A 1 27  ? -14.879 -2.025  0.385   1.00 0.00 ? 1507 THR A HA   5  
ATOM   9228  H HB   . THR A 1 27  ? -16.865 -2.757  1.752   1.00 0.00 ? 1507 THR A HB   5  
ATOM   9229  H HG1  . THR A 1 27  ? -16.923 -4.752  2.515   1.00 0.00 ? 1507 THR A HG1  5  
ATOM   9230  H HG21 . THR A 1 27  ? -16.195 -4.503  -0.644  1.00 0.00 ? 1507 THR A HG21 5  
ATOM   9231  H HG22 . THR A 1 27  ? -17.810 -4.311  0.074   1.00 0.00 ? 1507 THR A HG22 5  
ATOM   9232  H HG23 . THR A 1 27  ? -16.998 -2.918  -0.710  1.00 0.00 ? 1507 THR A HG23 5  
ATOM   9233  N N    . ARG A 1 28  ? -13.697 -3.468  3.123   1.00 0.00 ? 1508 ARG A N    5  
ATOM   9234  C CA   . ARG A 1 28  ? -13.191 -3.289  4.484   1.00 0.00 ? 1508 ARG A CA   5  
ATOM   9235  C C    . ARG A 1 28  ? -12.397 -4.525  4.912   1.00 0.00 ? 1508 ARG A C    5  
ATOM   9236  O O    . ARG A 1 28  ? -12.814 -5.650  4.639   1.00 0.00 ? 1508 ARG A O    5  
ATOM   9237  C CB   . ARG A 1 28  ? -14.423 -3.041  5.384   1.00 0.00 ? 1508 ARG A CB   5  
ATOM   9238  C CG   . ARG A 1 28  ? -14.118 -2.875  6.877   1.00 0.00 ? 1508 ARG A CG   5  
ATOM   9239  C CD   . ARG A 1 28  ? -14.572 -4.116  7.650   1.00 0.00 ? 1508 ARG A CD   5  
ATOM   9240  N NE   . ARG A 1 28  ? -14.073 -4.094  9.037   1.00 0.00 ? 1508 ARG A NE   5  
ATOM   9241  C CZ   . ARG A 1 28  ? -14.727 -3.719  10.148  1.00 0.00 ? 1508 ARG A CZ   5  
ATOM   9242  N NH1  . ARG A 1 28  ? -15.955 -3.207  10.081  1.00 0.00 ? 1508 ARG A NH1  5  
ATOM   9243  N NH2  . ARG A 1 28  ? -14.136 -3.865  11.329  1.00 0.00 ? 1508 ARG A NH2  5  
ATOM   9244  H H    . ARG A 1 28  ? -13.755 -4.421  2.768   1.00 0.00 ? 1508 ARG A H    5  
ATOM   9245  H HA   . ARG A 1 28  ? -12.549 -2.404  4.521   1.00 0.00 ? 1508 ARG A HA   5  
ATOM   9246  H HB2  . ARG A 1 28  ? -14.913 -2.119  5.068   1.00 0.00 ? 1508 ARG A HB2  5  
ATOM   9247  H HB3  . ARG A 1 28  ? -15.146 -3.843  5.226   1.00 0.00 ? 1508 ARG A HB3  5  
ATOM   9248  H HG2  . ARG A 1 28  ? -13.050 -2.701  7.011   1.00 0.00 ? 1508 ARG A HG2  5  
ATOM   9249  H HG3  . ARG A 1 28  ? -14.663 -2.004  7.250   1.00 0.00 ? 1508 ARG A HG3  5  
ATOM   9250  H HD2  . ARG A 1 28  ? -15.662 -4.193  7.626   1.00 0.00 ? 1508 ARG A HD2  5  
ATOM   9251  H HD3  . ARG A 1 28  ? -14.172 -4.992  7.147   1.00 0.00 ? 1508 ARG A HD3  5  
ATOM   9252  H HE   . ARG A 1 28  ? -13.104 -4.402  9.135   1.00 0.00 ? 1508 ARG A HE   5  
ATOM   9253  H HH11 . ARG A 1 28  ? -16.417 -3.058  9.194   1.00 0.00 ? 1508 ARG A HH11 5  
ATOM   9254  H HH12 . ARG A 1 28  ? -16.468 -2.924  10.910  1.00 0.00 ? 1508 ARG A HH12 5  
ATOM   9255  H HH21 . ARG A 1 28  ? -13.217 -4.289  11.411  1.00 0.00 ? 1508 ARG A HH21 5  
ATOM   9256  H HH22 . ARG A 1 28  ? -14.583 -3.578  12.193  1.00 0.00 ? 1508 ARG A HH22 5  
ATOM   9257  N N    . ASP A 1 29  ? -11.274 -4.342  5.604   1.00 0.00 ? 1509 ASP A N    5  
ATOM   9258  C CA   . ASP A 1 29  ? -10.544 -5.427  6.273   1.00 0.00 ? 1509 ASP A CA   5  
ATOM   9259  C C    . ASP A 1 29  ? -11.395 -5.834  7.470   1.00 0.00 ? 1509 ASP A C    5  
ATOM   9260  O O    . ASP A 1 29  ? -11.535 -5.060  8.417   1.00 0.00 ? 1509 ASP A O    5  
ATOM   9261  C CB   . ASP A 1 29  ? -9.147  -4.961  6.713   1.00 0.00 ? 1509 ASP A CB   5  
ATOM   9262  C CG   . ASP A 1 29  ? -8.556  -5.821  7.850   1.00 0.00 ? 1509 ASP A CG   5  
ATOM   9263  O OD1  . ASP A 1 29  ? -8.571  -7.068  7.750   1.00 0.00 ? 1509 ASP A OD1  5  
ATOM   9264  O OD2  . ASP A 1 29  ? -8.068  -5.241  8.849   1.00 0.00 ? 1509 ASP A OD2  5  
ATOM   9265  H H    . ASP A 1 29  ? -10.978 -3.397  5.822   1.00 0.00 ? 1509 ASP A H    5  
ATOM   9266  H HA   . ASP A 1 29  ? -10.431 -6.277  5.606   1.00 0.00 ? 1509 ASP A HA   5  
ATOM   9267  H HB2  . ASP A 1 29  ? -8.482  -4.979  5.851   1.00 0.00 ? 1509 ASP A HB2  5  
ATOM   9268  H HB3  . ASP A 1 29  ? -9.207  -3.930  7.059   1.00 0.00 ? 1509 ASP A HB3  5  
ATOM   9269  N N    . VAL A 1 30  ? -12.062 -6.987  7.377   1.00 0.00 ? 1510 VAL A N    5  
ATOM   9270  C CA   . VAL A 1 30  ? -13.001 -7.472  8.386   1.00 0.00 ? 1510 VAL A CA   5  
ATOM   9271  C C    . VAL A 1 30  ? -12.240 -7.635  9.707   1.00 0.00 ? 1510 VAL A C    5  
ATOM   9272  O O    . VAL A 1 30  ? -12.638 -7.066  10.727  1.00 0.00 ? 1510 VAL A O    5  
ATOM   9273  C CB   . VAL A 1 30  ? -13.641 -8.812  7.955   1.00 0.00 ? 1510 VAL A CB   5  
ATOM   9274  C CG1  . VAL A 1 30  ? -14.885 -9.173  8.747   1.00 0.00 ? 1510 VAL A CG1  5  
ATOM   9275  C CG2  . VAL A 1 30  ? -14.081 -8.853  6.493   1.00 0.00 ? 1510 VAL A CG2  5  
ATOM   9276  H H    . VAL A 1 30  ? -11.808 -7.624  6.633   1.00 0.00 ? 1510 VAL A H    5  
ATOM   9277  H HA   . VAL A 1 30  ? -13.787 -6.731  8.505   1.00 0.00 ? 1510 VAL A HA   5  
ATOM   9278  H HB   . VAL A 1 30  ? -12.917 -9.596  8.103   1.00 0.00 ? 1510 VAL A HB   5  
ATOM   9279  H HG11 . VAL A 1 30  ? -15.704 -8.503  8.466   1.00 0.00 ? 1510 VAL A HG11 5  
ATOM   9280  H HG12 . VAL A 1 30  ? -15.158 -10.205 8.502   1.00 0.00 ? 1510 VAL A HG12 5  
ATOM   9281  H HG13 . VAL A 1 30  ? -14.668 -9.106  9.813   1.00 0.00 ? 1510 VAL A HG13 5  
ATOM   9282  H HG21 . VAL A 1 30  ? -14.690 -7.976  6.274   1.00 0.00 ? 1510 VAL A HG21 5  
ATOM   9283  H HG22 . VAL A 1 30  ? -13.200 -8.863  5.881   1.00 0.00 ? 1510 VAL A HG22 5  
ATOM   9284  H HG23 . VAL A 1 30  ? -14.640 -9.773  6.272   1.00 0.00 ? 1510 VAL A HG23 5  
ATOM   9285  N N    . GLY A 1 31  ? -11.144 -8.396  9.667   1.00 0.00 ? 1511 GLY A N    5  
ATOM   9286  C CA   . GLY A 1 31  ? -10.310 -8.701  10.817  1.00 0.00 ? 1511 GLY A CA   5  
ATOM   9287  C C    . GLY A 1 31  ? -9.772  -10.113 10.662  1.00 0.00 ? 1511 GLY A C    5  
ATOM   9288  O O    . GLY A 1 31  ? -10.279 -10.889 9.849   1.00 0.00 ? 1511 GLY A O    5  
ATOM   9289  H H    . GLY A 1 31  ? -10.893 -8.873  8.799   1.00 0.00 ? 1511 GLY A H    5  
ATOM   9290  H HA2  . GLY A 1 31  ? -9.485  -7.990  10.867  1.00 0.00 ? 1511 GLY A HA2  5  
ATOM   9291  H HA3  . GLY A 1 31  ? -10.887 -8.646  11.740  1.00 0.00 ? 1511 GLY A HA3  5  
ATOM   9292  N N    . ALA A 1 32  ? -8.753  -10.463 11.441  1.00 0.00 ? 1512 ALA A N    5  
ATOM   9293  C CA   . ALA A 1 32  ? -8.136  -11.791 11.503  1.00 0.00 ? 1512 ALA A CA   5  
ATOM   9294  C C    . ALA A 1 32  ? -7.619  -12.341 10.160  1.00 0.00 ? 1512 ALA A C    5  
ATOM   9295  O O    . ALA A 1 32  ? -7.264  -13.517 10.076  1.00 0.00 ? 1512 ALA A O    5  
ATOM   9296  C CB   . ALA A 1 32  ? -9.118  -12.738 12.204  1.00 0.00 ? 1512 ALA A CB   5  
ATOM   9297  H H    . ALA A 1 32  ? -8.390  -9.766  12.082  1.00 0.00 ? 1512 ALA A H    5  
ATOM   9298  H HA   . ALA A 1 32  ? -7.256  -11.699 12.132  1.00 0.00 ? 1512 ALA A HA   5  
ATOM   9299  H HB1  . ALA A 1 32  ? -9.399  -12.326 13.170  1.00 0.00 ? 1512 ALA A HB1  5  
ATOM   9300  H HB2  . ALA A 1 32  ? -10.014 -12.842 11.595  1.00 0.00 ? 1512 ALA A HB2  5  
ATOM   9301  H HB3  . ALA A 1 32  ? -8.659  -13.716 12.359  1.00 0.00 ? 1512 ALA A HB3  5  
ATOM   9302  N N    . GLY A 1 33  ? -7.575  -11.516 9.110   1.00 0.00 ? 1513 GLY A N    5  
ATOM   9303  C CA   . GLY A 1 33  ? -7.121  -11.865 7.774   1.00 0.00 ? 1513 GLY A CA   5  
ATOM   9304  C C    . GLY A 1 33  ? -8.287  -11.884 6.799   1.00 0.00 ? 1513 GLY A C    5  
ATOM   9305  O O    . GLY A 1 33  ? -8.059  -12.000 5.603   1.00 0.00 ? 1513 GLY A O    5  
ATOM   9306  H H    . GLY A 1 33  ? -7.973  -10.593 9.214   1.00 0.00 ? 1513 GLY A H    5  
ATOM   9307  H HA2  . GLY A 1 33  ? -6.398  -11.118 7.445   1.00 0.00 ? 1513 GLY A HA2  5  
ATOM   9308  H HA3  . GLY A 1 33  ? -6.639  -12.841 7.775   1.00 0.00 ? 1513 GLY A HA3  5  
ATOM   9309  N N    . LYS A 1 34  ? -9.544  -11.818 7.254   1.00 0.00 ? 1514 LYS A N    5  
ATOM   9310  C CA   . LYS A 1 34  ? -10.679 -11.671 6.355   1.00 0.00 ? 1514 LYS A CA   5  
ATOM   9311  C C    . LYS A 1 34  ? -10.730 -10.237 5.860   1.00 0.00 ? 1514 LYS A C    5  
ATOM   9312  O O    . LYS A 1 34  ? -10.610 -9.302  6.652   1.00 0.00 ? 1514 LYS A O    5  
ATOM   9313  C CB   . LYS A 1 34  ? -12.004 -11.975 7.074   1.00 0.00 ? 1514 LYS A CB   5  
ATOM   9314  C CG   . LYS A 1 34  ? -12.370 -13.455 7.178   1.00 0.00 ? 1514 LYS A CG   5  
ATOM   9315  C CD   . LYS A 1 34  ? -11.848 -14.198 8.420   1.00 0.00 ? 1514 LYS A CD   5  
ATOM   9316  C CE   . LYS A 1 34  ? -12.490 -13.695 9.728   1.00 0.00 ? 1514 LYS A CE   5  
ATOM   9317  N NZ   . LYS A 1 34  ? -12.319 -14.659 10.853  1.00 0.00 ? 1514 LYS A NZ   5  
ATOM   9318  H H    . LYS A 1 34  ? -9.722  -11.750 8.249   1.00 0.00 ? 1514 LYS A H    5  
ATOM   9319  H HA   . LYS A 1 34  ? -10.562 -12.324 5.498   1.00 0.00 ? 1514 LYS A HA   5  
ATOM   9320  H HB2  . LYS A 1 34  ? -12.041 -11.505 8.053   1.00 0.00 ? 1514 LYS A HB2  5  
ATOM   9321  H HB3  . LYS A 1 34  ? -12.790 -11.513 6.484   1.00 0.00 ? 1514 LYS A HB3  5  
ATOM   9322  H HG2  . LYS A 1 34  ? -13.458 -13.493 7.182   1.00 0.00 ? 1514 LYS A HG2  5  
ATOM   9323  H HG3  . LYS A 1 34  ? -12.018 -13.961 6.279   1.00 0.00 ? 1514 LYS A HG3  5  
ATOM   9324  H HD2  . LYS A 1 34  ? -12.095 -15.255 8.292   1.00 0.00 ? 1514 LYS A HD2  5  
ATOM   9325  H HD3  . LYS A 1 34  ? -10.760 -14.107 8.483   1.00 0.00 ? 1514 LYS A HD3  5  
ATOM   9326  H HE2  . LYS A 1 34  ? -12.048 -12.730 10.001  1.00 0.00 ? 1514 LYS A HE2  5  
ATOM   9327  H HE3  . LYS A 1 34  ? -13.559 -13.536 9.554   1.00 0.00 ? 1514 LYS A HE3  5  
ATOM   9328  H HZ1  . LYS A 1 34  ? -12.810 -15.527 10.673  1.00 0.00 ? 1514 LYS A HZ1  5  
ATOM   9329  H HZ2  . LYS A 1 34  ? -11.345 -14.884 11.020  1.00 0.00 ? 1514 LYS A HZ2  5  
ATOM   9330  H HZ3  . LYS A 1 34  ? -12.704 -14.286 11.716  1.00 0.00 ? 1514 LYS A HZ3  5  
ATOM   9331  N N    . TYR A 1 35  ? -11.076 -10.067 4.591   1.00 0.00 ? 1515 TYR A N    5  
ATOM   9332  C CA   . TYR A 1 35  ? -11.397 -8.787  3.975   1.00 0.00 ? 1515 TYR A CA   5  
ATOM   9333  C C    . TYR A 1 35  ? -12.742 -9.000  3.280   1.00 0.00 ? 1515 TYR A C    5  
ATOM   9334  O O    . TYR A 1 35  ? -12.963 -10.046 2.668   1.00 0.00 ? 1515 TYR A O    5  
ATOM   9335  C CB   . TYR A 1 35  ? -10.316 -8.322  2.996   1.00 0.00 ? 1515 TYR A CB   5  
ATOM   9336  C CG   . TYR A 1 35  ? -8.886  -8.282  3.511   1.00 0.00 ? 1515 TYR A CG   5  
ATOM   9337  C CD1  . TYR A 1 35  ? -8.174  -9.478  3.717   1.00 0.00 ? 1515 TYR A CD1  5  
ATOM   9338  C CD2  . TYR A 1 35  ? -8.262  -7.049  3.780   1.00 0.00 ? 1515 TYR A CD2  5  
ATOM   9339  C CE1  . TYR A 1 35  ? -6.858  -9.450  4.197   1.00 0.00 ? 1515 TYR A CE1  5  
ATOM   9340  C CE2  . TYR A 1 35  ? -6.939  -7.012  4.264   1.00 0.00 ? 1515 TYR A CE2  5  
ATOM   9341  C CZ   . TYR A 1 35  ? -6.228  -8.216  4.473   1.00 0.00 ? 1515 TYR A CZ   5  
ATOM   9342  O OH   . TYR A 1 35  ? -4.945  -8.212  4.938   1.00 0.00 ? 1515 TYR A OH   5  
ATOM   9343  H H    . TYR A 1 35  ? -11.220 -10.891 4.012   1.00 0.00 ? 1515 TYR A H    5  
ATOM   9344  H HA   . TYR A 1 35  ? -11.499 -8.019  4.738   1.00 0.00 ? 1515 TYR A HA   5  
ATOM   9345  H HB2  . TYR A 1 35  ? -10.355 -8.944  2.107   1.00 0.00 ? 1515 TYR A HB2  5  
ATOM   9346  H HB3  . TYR A 1 35  ? -10.603 -7.316  2.714   1.00 0.00 ? 1515 TYR A HB3  5  
ATOM   9347  H HD1  . TYR A 1 35  ? -8.631  -10.433 3.510   1.00 0.00 ? 1515 TYR A HD1  5  
ATOM   9348  H HD2  . TYR A 1 35  ? -8.791  -6.119  3.617   1.00 0.00 ? 1515 TYR A HD2  5  
ATOM   9349  H HE1  . TYR A 1 35  ? -6.327  -10.378 4.352   1.00 0.00 ? 1515 TYR A HE1  5  
ATOM   9350  H HE2  . TYR A 1 35  ? -6.471  -6.061  4.472   1.00 0.00 ? 1515 TYR A HE2  5  
ATOM   9351  H HH   . TYR A 1 35  ? -4.581  -7.320  5.079   1.00 0.00 ? 1515 TYR A HH   5  
ATOM   9352  N N    . LYS A 1 36  ? -13.688 -8.076  3.437   1.00 0.00 ? 1516 LYS A N    5  
ATOM   9353  C CA   . LYS A 1 36  ? -14.965 -8.160  2.760   1.00 0.00 ? 1516 LYS A CA   5  
ATOM   9354  C C    . LYS A 1 36  ? -14.806 -7.569  1.381   1.00 0.00 ? 1516 LYS A C    5  
ATOM   9355  O O    . LYS A 1 36  ? -14.045 -6.620  1.187   1.00 0.00 ? 1516 LYS A O    5  
ATOM   9356  C CB   . LYS A 1 36  ? -16.010 -7.476  3.638   1.00 0.00 ? 1516 LYS A CB   5  
ATOM   9357  C CG   . LYS A 1 36  ? -17.436 -7.519  3.087   1.00 0.00 ? 1516 LYS A CG   5  
ATOM   9358  C CD   . LYS A 1 36  ? -18.467 -7.467  4.215   1.00 0.00 ? 1516 LYS A CD   5  
ATOM   9359  C CE   . LYS A 1 36  ? -18.288 -6.301  5.216   1.00 0.00 ? 1516 LYS A CE   5  
ATOM   9360  N NZ   . LYS A 1 36  ? -19.468 -6.158  6.121   1.00 0.00 ? 1516 LYS A NZ   5  
ATOM   9361  H H    . LYS A 1 36  ? -13.522 -7.261  4.023   1.00 0.00 ? 1516 LYS A H    5  
ATOM   9362  H HA   . LYS A 1 36  ? -15.232 -9.208  2.628   1.00 0.00 ? 1516 LYS A HA   5  
ATOM   9363  H HB2  . LYS A 1 36  ? -16.009 -8.031  4.569   1.00 0.00 ? 1516 LYS A HB2  5  
ATOM   9364  H HB3  . LYS A 1 36  ? -15.717 -6.443  3.833   1.00 0.00 ? 1516 LYS A HB3  5  
ATOM   9365  H HG2  . LYS A 1 36  ? -17.603 -6.698  2.396   1.00 0.00 ? 1516 LYS A HG2  5  
ATOM   9366  H HG3  . LYS A 1 36  ? -17.587 -8.444  2.537   1.00 0.00 ? 1516 LYS A HG3  5  
ATOM   9367  H HD2  . LYS A 1 36  ? -19.449 -7.400  3.737   1.00 0.00 ? 1516 LYS A HD2  5  
ATOM   9368  H HD3  . LYS A 1 36  ? -18.385 -8.408  4.767   1.00 0.00 ? 1516 LYS A HD3  5  
ATOM   9369  H HE2  . LYS A 1 36  ? -17.390 -6.480  5.824   1.00 0.00 ? 1516 LYS A HE2  5  
ATOM   9370  H HE3  . LYS A 1 36  ? -18.148 -5.369  4.663   1.00 0.00 ? 1516 LYS A HE3  5  
ATOM   9371  H HZ1  . LYS A 1 36  ? -19.355 -5.379  6.758   1.00 0.00 ? 1516 LYS A HZ1  5  
ATOM   9372  H HZ2  . LYS A 1 36  ? -20.317 -5.977  5.599   1.00 0.00 ? 1516 LYS A HZ2  5  
ATOM   9373  H HZ3  . LYS A 1 36  ? -19.626 -6.988  6.683   1.00 0.00 ? 1516 LYS A HZ3  5  
ATOM   9374  N N    . LEU A 1 37  ? -15.504 -8.162  0.424   1.00 0.00 ? 1517 LEU A N    5  
ATOM   9375  C CA   . LEU A 1 37  ? -15.327 -7.899  -0.987  1.00 0.00 ? 1517 LEU A CA   5  
ATOM   9376  C C    . LEU A 1 37  ? -16.683 -7.618  -1.605  1.00 0.00 ? 1517 LEU A C    5  
ATOM   9377  O O    . LEU A 1 37  ? -17.537 -8.502  -1.616  1.00 0.00 ? 1517 LEU A O    5  
ATOM   9378  C CB   . LEU A 1 37  ? -14.741 -9.146  -1.683  1.00 0.00 ? 1517 LEU A CB   5  
ATOM   9379  C CG   . LEU A 1 37  ? -13.220 -9.249  -1.806  1.00 0.00 ? 1517 LEU A CG   5  
ATOM   9380  C CD1  . LEU A 1 37  ? -12.681 -8.228  -2.805  1.00 0.00 ? 1517 LEU A CD1  5  
ATOM   9381  C CD2  . LEU A 1 37  ? -12.465 -9.115  -0.490  1.00 0.00 ? 1517 LEU A CD2  5  
ATOM   9382  H H    . LEU A 1 37  ? -16.116 -8.937  0.667   1.00 0.00 ? 1517 LEU A H    5  
ATOM   9383  H HA   . LEU A 1 37  ? -14.668 -7.043  -1.135  1.00 0.00 ? 1517 LEU A HA   5  
ATOM   9384  H HB2  . LEU A 1 37  ? -15.114 -10.041 -1.191  1.00 0.00 ? 1517 LEU A HB2  5  
ATOM   9385  H HB3  . LEU A 1 37  ? -15.131 -9.167  -2.699  1.00 0.00 ? 1517 LEU A HB3  5  
ATOM   9386  H HG   . LEU A 1 37  ? -12.999 -10.235 -2.193  1.00 0.00 ? 1517 LEU A HG   5  
ATOM   9387  H HD11 . LEU A 1 37  ? -12.920 -7.216  -2.483  1.00 0.00 ? 1517 LEU A HD11 5  
ATOM   9388  H HD12 . LEU A 1 37  ? -11.599 -8.329  -2.862  1.00 0.00 ? 1517 LEU A HD12 5  
ATOM   9389  H HD13 . LEU A 1 37  ? -13.103 -8.413  -3.793  1.00 0.00 ? 1517 LEU A HD13 5  
ATOM   9390  H HD21 . LEU A 1 37  ? -12.592 -8.126  -0.058  1.00 0.00 ? 1517 LEU A HD21 5  
ATOM   9391  H HD22 . LEU A 1 37  ? -12.820 -9.878  0.207   1.00 0.00 ? 1517 LEU A HD22 5  
ATOM   9392  H HD23 . LEU A 1 37  ? -11.405 -9.269  -0.669  1.00 0.00 ? 1517 LEU A HD23 5  
ATOM   9393  N N    . LEU A 1 38  ? -16.849 -6.416  -2.147  1.00 0.00 ? 1518 LEU A N    5  
ATOM   9394  C CA   . LEU A 1 38  ? -17.966 -6.032  -2.989  1.00 0.00 ? 1518 LEU A CA   5  
ATOM   9395  C C    . LEU A 1 38  ? -17.543 -6.532  -4.354  1.00 0.00 ? 1518 LEU A C    5  
ATOM   9396  O O    . LEU A 1 38  ? -16.817 -5.850  -5.081  1.00 0.00 ? 1518 LEU A O    5  
ATOM   9397  C CB   . LEU A 1 38  ? -18.203 -4.513  -2.978  1.00 0.00 ? 1518 LEU A CB   5  
ATOM   9398  C CG   . LEU A 1 38  ? -19.163 -3.983  -4.061  1.00 0.00 ? 1518 LEU A CG   5  
ATOM   9399  C CD1  . LEU A 1 38  ? -20.571 -4.573  -3.979  1.00 0.00 ? 1518 LEU A CD1  5  
ATOM   9400  C CD2  . LEU A 1 38  ? -19.252 -2.459  -3.917  1.00 0.00 ? 1518 LEU A CD2  5  
ATOM   9401  H H    . LEU A 1 38  ? -16.091 -5.751  -2.066  1.00 0.00 ? 1518 LEU A H    5  
ATOM   9402  H HA   . LEU A 1 38  ? -18.875 -6.548  -2.680  1.00 0.00 ? 1518 LEU A HA   5  
ATOM   9403  H HB2  . LEU A 1 38  ? -18.629 -4.250  -2.016  1.00 0.00 ? 1518 LEU A HB2  5  
ATOM   9404  H HB3  . LEU A 1 38  ? -17.241 -4.000  -3.075  1.00 0.00 ? 1518 LEU A HB3  5  
ATOM   9405  H HG   . LEU A 1 38  ? -18.770 -4.199  -5.052  1.00 0.00 ? 1518 LEU A HG   5  
ATOM   9406  H HD11 . LEU A 1 38  ? -21.181 -4.188  -4.794  1.00 0.00 ? 1518 LEU A HD11 5  
ATOM   9407  H HD12 . LEU A 1 38  ? -20.536 -5.661  -4.060  1.00 0.00 ? 1518 LEU A HD12 5  
ATOM   9408  H HD13 . LEU A 1 38  ? -21.042 -4.303  -3.032  1.00 0.00 ? 1518 LEU A HD13 5  
ATOM   9409  H HD21 . LEU A 1 38  ? -19.914 -2.038  -4.678  1.00 0.00 ? 1518 LEU A HD21 5  
ATOM   9410  H HD22 . LEU A 1 38  ? -19.639 -2.200  -2.928  1.00 0.00 ? 1518 LEU A HD22 5  
ATOM   9411  H HD23 . LEU A 1 38  ? -18.261 -2.010  -4.021  1.00 0.00 ? 1518 LEU A HD23 5  
ATOM   9412  N N    . PHE A 1 39  ? -17.906 -7.772  -4.646  1.00 0.00 ? 1519 PHE A N    5  
ATOM   9413  C CA   . PHE A 1 39  ? -17.747 -8.336  -5.964  1.00 0.00 ? 1519 PHE A CA   5  
ATOM   9414  C C    . PHE A 1 39  ? -18.413 -7.391  -6.968  1.00 0.00 ? 1519 PHE A C    5  
ATOM   9415  O O    . PHE A 1 39  ? -19.402 -6.724  -6.651  1.00 0.00 ? 1519 PHE A O    5  
ATOM   9416  C CB   . PHE A 1 39  ? -18.361 -9.738  -5.992  1.00 0.00 ? 1519 PHE A CB   5  
ATOM   9417  C CG   . PHE A 1 39  ? -17.582 -10.803 -5.238  1.00 0.00 ? 1519 PHE A CG   5  
ATOM   9418  C CD1  . PHE A 1 39  ? -16.487 -11.430 -5.862  1.00 0.00 ? 1519 PHE A CD1  5  
ATOM   9419  C CD2  . PHE A 1 39  ? -17.942 -11.182 -3.927  1.00 0.00 ? 1519 PHE A CD2  5  
ATOM   9420  C CE1  . PHE A 1 39  ? -15.771 -12.435 -5.194  1.00 0.00 ? 1519 PHE A CE1  5  
ATOM   9421  C CE2  . PHE A 1 39  ? -17.243 -12.218 -3.272  1.00 0.00 ? 1519 PHE A CE2  5  
ATOM   9422  C CZ   . PHE A 1 39  ? -16.144 -12.840 -3.903  1.00 0.00 ? 1519 PHE A CZ   5  
ATOM   9423  H H    . PHE A 1 39  ? -18.532 -8.246  -4.001  1.00 0.00 ? 1519 PHE A H    5  
ATOM   9424  H HA   . PHE A 1 39  ? -16.692 -8.425  -6.194  1.00 0.00 ? 1519 PHE A HA   5  
ATOM   9425  H HB2  . PHE A 1 39  ? -19.379 -9.687  -5.606  1.00 0.00 ? 1519 PHE A HB2  5  
ATOM   9426  H HB3  . PHE A 1 39  ? -18.415 -10.051 -7.029  1.00 0.00 ? 1519 PHE A HB3  5  
ATOM   9427  H HD1  . PHE A 1 39  ? -16.189 -11.151 -6.859  1.00 0.00 ? 1519 PHE A HD1  5  
ATOM   9428  H HD2  . PHE A 1 39  ? -18.758 -10.684 -3.421  1.00 0.00 ? 1519 PHE A HD2  5  
ATOM   9429  H HE1  . PHE A 1 39  ? -14.922 -12.899 -5.679  1.00 0.00 ? 1519 PHE A HE1  5  
ATOM   9430  H HE2  . PHE A 1 39  ? -17.567 -12.529 -2.283  1.00 0.00 ? 1519 PHE A HE2  5  
ATOM   9431  H HZ   . PHE A 1 39  ? -15.567 -13.622 -3.425  1.00 0.00 ? 1519 PHE A HZ   5  
ATOM   9432  N N    . ASP A 1 40  ? -17.908 -7.346  -8.197  1.00 0.00 ? 1520 ASP A N    5  
ATOM   9433  C CA   . ASP A 1 40  ? -18.556 -6.586  -9.279  1.00 0.00 ? 1520 ASP A CA   5  
ATOM   9434  C C    . ASP A 1 40  ? -19.933 -7.161  -9.596  1.00 0.00 ? 1520 ASP A C    5  
ATOM   9435  O O    . ASP A 1 40  ? -20.803 -6.500  -10.163 1.00 0.00 ? 1520 ASP A O    5  
ATOM   9436  C CB   . ASP A 1 40  ? -17.712 -6.599  -10.549 1.00 0.00 ? 1520 ASP A CB   5  
ATOM   9437  C CG   . ASP A 1 40  ? -16.589 -5.554  -10.506 1.00 0.00 ? 1520 ASP A CG   5  
ATOM   9438  O OD1  . ASP A 1 40  ? -16.881 -4.374  -10.187 1.00 0.00 ? 1520 ASP A OD1  5  
ATOM   9439  O OD2  . ASP A 1 40  ? -15.427 -5.919  -10.789 1.00 0.00 ? 1520 ASP A OD2  5  
ATOM   9440  H H    . ASP A 1 40  ? -17.167 -8.002  -8.432  1.00 0.00 ? 1520 ASP A H    5  
ATOM   9441  H HA   . ASP A 1 40  ? -18.699 -5.557  -8.949  1.00 0.00 ? 1520 ASP A HA   5  
ATOM   9442  H HB2  . ASP A 1 40  ? -17.324 -7.608  -10.691 1.00 0.00 ? 1520 ASP A HB2  5  
ATOM   9443  H HB3  . ASP A 1 40  ? -18.363 -6.380  -11.399 1.00 0.00 ? 1520 ASP A HB3  5  
ATOM   9444  N N    . ASP A 1 41  ? -20.134 -8.395  -9.156  1.00 0.00 ? 1521 ASP A N    5  
ATOM   9445  C CA   . ASP A 1 41  ? -21.358 -9.151  -9.109  1.00 0.00 ? 1521 ASP A CA   5  
ATOM   9446  C C    . ASP A 1 41  ? -22.432 -8.408  -8.307  1.00 0.00 ? 1521 ASP A C    5  
ATOM   9447  O O    . ASP A 1 41  ? -23.606 -8.753  -8.395  1.00 0.00 ? 1521 ASP A O    5  
ATOM   9448  C CB   . ASP A 1 41  ? -21.086 -10.481 -8.382  1.00 0.00 ? 1521 ASP A CB   5  
ATOM   9449  C CG   . ASP A 1 41  ? -19.955 -11.383 -8.905  1.00 0.00 ? 1521 ASP A CG   5  
ATOM   9450  O OD1  . ASP A 1 41  ? -18.924 -10.864 -9.377  1.00 0.00 ? 1521 ASP A OD1  5  
ATOM   9451  O OD2  . ASP A 1 41  ? -20.106 -12.618 -8.824  1.00 0.00 ? 1521 ASP A OD2  5  
ATOM   9452  H H    . ASP A 1 41  ? -19.330 -8.880  -8.790  1.00 0.00 ? 1521 ASP A H    5  
ATOM   9453  H HA   . ASP A 1 41  ? -21.687 -9.316  -10.133 1.00 0.00 ? 1521 ASP A HA   5  
ATOM   9454  H HB2  . ASP A 1 41  ? -20.873 -10.264 -7.337  1.00 0.00 ? 1521 ASP A HB2  5  
ATOM   9455  H HB3  . ASP A 1 41  ? -22.013 -11.038 -8.391  1.00 0.00 ? 1521 ASP A HB3  5  
ATOM   9456  N N    . GLY A 1 42  ? -22.037 -7.436  -7.476  1.00 0.00 ? 1522 GLY A N    5  
ATOM   9457  C CA   . GLY A 1 42  ? -22.888 -6.728  -6.534  1.00 0.00 ? 1522 GLY A CA   5  
ATOM   9458  C C    . GLY A 1 42  ? -23.027 -7.465  -5.196  1.00 0.00 ? 1522 GLY A C    5  
ATOM   9459  O O    . GLY A 1 42  ? -23.557 -6.908  -4.236  1.00 0.00 ? 1522 GLY A O    5  
ATOM   9460  H H    . GLY A 1 42  ? -21.048 -7.194  -7.442  1.00 0.00 ? 1522 GLY A H    5  
ATOM   9461  H HA2  . GLY A 1 42  ? -22.434 -5.755  -6.355  1.00 0.00 ? 1522 GLY A HA2  5  
ATOM   9462  H HA3  . GLY A 1 42  ? -23.874 -6.588  -6.974  1.00 0.00 ? 1522 GLY A HA3  5  
ATOM   9463  N N    . TYR A 1 43  ? -22.543 -8.711  -5.127  1.00 0.00 ? 1523 TYR A N    5  
ATOM   9464  C CA   . TYR A 1 43  ? -22.452 -9.487  -3.900  1.00 0.00 ? 1523 TYR A CA   5  
ATOM   9465  C C    . TYR A 1 43  ? -21.422 -8.859  -2.954  1.00 0.00 ? 1523 TYR A C    5  
ATOM   9466  O O    . TYR A 1 43  ? -20.445 -8.272  -3.416  1.00 0.00 ? 1523 TYR A O    5  
ATOM   9467  C CB   . TYR A 1 43  ? -22.041 -10.912 -4.280  1.00 0.00 ? 1523 TYR A CB   5  
ATOM   9468  C CG   . TYR A 1 43  ? -23.199 -11.775 -4.747  1.00 0.00 ? 1523 TYR A CG   5  
ATOM   9469  C CD1  . TYR A 1 43  ? -23.799 -11.596 -6.018  1.00 0.00 ? 1523 TYR A CD1  5  
ATOM   9470  C CD2  . TYR A 1 43  ? -23.685 -12.778 -3.884  1.00 0.00 ? 1523 TYR A CD2  5  
ATOM   9471  C CE1  . TYR A 1 43  ? -24.876 -12.398 -6.399  1.00 0.00 ? 1523 TYR A CE1  5  
ATOM   9472  C CE2  . TYR A 1 43  ? -24.790 -13.563 -4.261  1.00 0.00 ? 1523 TYR A CE2  5  
ATOM   9473  C CZ   . TYR A 1 43  ? -25.390 -13.380 -5.528  1.00 0.00 ? 1523 TYR A CZ   5  
ATOM   9474  O OH   . TYR A 1 43  ? -26.450 -14.141 -5.924  1.00 0.00 ? 1523 TYR A OH   5  
ATOM   9475  H H    . TYR A 1 43  ? -22.113 -9.096  -5.954  1.00 0.00 ? 1523 TYR A H    5  
ATOM   9476  H HA   . TYR A 1 43  ? -23.432 -9.518  -3.414  1.00 0.00 ? 1523 TYR A HA   5  
ATOM   9477  H HB2  . TYR A 1 43  ? -21.288 -10.865 -5.060  1.00 0.00 ? 1523 TYR A HB2  5  
ATOM   9478  H HB3  . TYR A 1 43  ? -21.578 -11.387 -3.411  1.00 0.00 ? 1523 TYR A HB3  5  
ATOM   9479  H HD1  . TYR A 1 43  ? -23.475 -10.863 -6.743  1.00 0.00 ? 1523 TYR A HD1  5  
ATOM   9480  H HD2  . TYR A 1 43  ? -23.218 -12.960 -2.921  1.00 0.00 ? 1523 TYR A HD2  5  
ATOM   9481  H HE1  . TYR A 1 43  ? -25.295 -12.248 -7.376  1.00 0.00 ? 1523 TYR A HE1  5  
ATOM   9482  H HE2  . TYR A 1 43  ? -25.168 -14.300 -3.570  1.00 0.00 ? 1523 TYR A HE2  5  
ATOM   9483  H HH   . TYR A 1 43  ? -26.709 -14.811 -5.266  1.00 0.00 ? 1523 TYR A HH   5  
ATOM   9484  N N    . GLU A 1 44  ? -21.580 -9.059  -1.642  1.00 0.00 ? 1524 GLU A N    5  
ATOM   9485  C CA   . GLU A 1 44  ? -20.680 -8.548  -0.608  1.00 0.00 ? 1524 GLU A CA   5  
ATOM   9486  C C    . GLU A 1 44  ? -20.572 -9.606  0.487   1.00 0.00 ? 1524 GLU A C    5  
ATOM   9487  O O    . GLU A 1 44  ? -21.533 -9.818  1.234   1.00 0.00 ? 1524 GLU A O    5  
ATOM   9488  C CB   . GLU A 1 44  ? -21.175 -7.225  0.011   1.00 0.00 ? 1524 GLU A CB   5  
ATOM   9489  C CG   . GLU A 1 44  ? -20.894 -5.996  -0.836  1.00 0.00 ? 1524 GLU A CG   5  
ATOM   9490  C CD   . GLU A 1 44  ? -21.544 -4.740  -0.221  1.00 0.00 ? 1524 GLU A CD   5  
ATOM   9491  O OE1  . GLU A 1 44  ? -22.718 -4.436  -0.537  1.00 0.00 ? 1524 GLU A OE1  5  
ATOM   9492  O OE2  . GLU A 1 44  ? -20.883 -4.043  0.583   1.00 0.00 ? 1524 GLU A OE2  5  
ATOM   9493  H H    . GLU A 1 44  ? -22.314 -9.678  -1.325  1.00 0.00 ? 1524 GLU A H    5  
ATOM   9494  H HA   . GLU A 1 44  ? -19.709 -8.368  -1.038  1.00 0.00 ? 1524 GLU A HA   5  
ATOM   9495  H HB2  . GLU A 1 44  ? -22.246 -7.275  0.183   1.00 0.00 ? 1524 GLU A HB2  5  
ATOM   9496  H HB3  . GLU A 1 44  ? -20.646 -7.067  0.953   1.00 0.00 ? 1524 GLU A HB3  5  
ATOM   9497  H HG2  . GLU A 1 44  ? -19.817 -5.863  -0.872  1.00 0.00 ? 1524 GLU A HG2  5  
ATOM   9498  H HG3  . GLU A 1 44  ? -21.283 -6.172  -1.837  1.00 0.00 ? 1524 GLU A HG3  5  
ATOM   9499  N N    . CYS A 1 45  ? -19.414 -10.270 0.580   1.00 0.00 ? 1525 CYS A N    5  
ATOM   9500  C CA   . CYS A 1 45  ? -19.139 -11.290 1.589   1.00 0.00 ? 1525 CYS A CA   5  
ATOM   9501  C C    . CYS A 1 45  ? -17.672 -11.194 2.015   1.00 0.00 ? 1525 CYS A C    5  
ATOM   9502  O O    . CYS A 1 45  ? -16.846 -10.629 1.295   1.00 0.00 ? 1525 CYS A O    5  
ATOM   9503  C CB   . CYS A 1 45  ? -19.422 -12.698 1.030   1.00 0.00 ? 1525 CYS A CB   5  
ATOM   9504  S SG   . CYS A 1 45  ? -21.099 -12.846 0.341   1.00 0.00 ? 1525 CYS A SG   5  
ATOM   9505  H H    . CYS A 1 45  ? -18.647 -10.041 -0.049  1.00 0.00 ? 1525 CYS A H    5  
ATOM   9506  H HA   . CYS A 1 45  ? -19.773 -11.122 2.461   1.00 0.00 ? 1525 CYS A HA   5  
ATOM   9507  H HB2  . CYS A 1 45  ? -18.680 -12.938 0.271   1.00 0.00 ? 1525 CYS A HB2  5  
ATOM   9508  H HB3  . CYS A 1 45  ? -19.317 -13.435 1.830   1.00 0.00 ? 1525 CYS A HB3  5  
ATOM   9509  H HG   . CYS A 1 45  ? -21.745 -12.308 1.391   1.00 0.00 ? 1525 CYS A HG   5  
ATOM   9510  N N    . ASP A 1 46  ? -17.352 -11.726 3.192   1.00 0.00 ? 1526 ASP A N    5  
ATOM   9511  C CA   . ASP A 1 46  ? -15.980 -11.912 3.646   1.00 0.00 ? 1526 ASP A CA   5  
ATOM   9512  C C    . ASP A 1 46  ? -15.296 -12.985 2.803   1.00 0.00 ? 1526 ASP A C    5  
ATOM   9513  O O    . ASP A 1 46  ? -15.924 -13.967 2.387   1.00 0.00 ? 1526 ASP A O    5  
ATOM   9514  C CB   . ASP A 1 46  ? -15.929 -12.293 5.132   1.00 0.00 ? 1526 ASP A CB   5  
ATOM   9515  C CG   . ASP A 1 46  ? -16.297 -13.766 5.393   1.00 0.00 ? 1526 ASP A CG   5  
ATOM   9516  O OD1  . ASP A 1 46  ? -17.508 -14.078 5.475   1.00 0.00 ? 1526 ASP A OD1  5  
ATOM   9517  O OD2  . ASP A 1 46  ? -15.373 -14.605 5.519   1.00 0.00 ? 1526 ASP A OD2  5  
ATOM   9518  H H    . ASP A 1 46  ? -18.066 -12.199 3.724   1.00 0.00 ? 1526 ASP A H    5  
ATOM   9519  H HA   . ASP A 1 46  ? -15.443 -10.975 3.530   1.00 0.00 ? 1526 ASP A HA   5  
ATOM   9520  H HB2  . ASP A 1 46  ? -14.914 -12.118 5.489   1.00 0.00 ? 1526 ASP A HB2  5  
ATOM   9521  H HB3  . ASP A 1 46  ? -16.596 -11.638 5.695   1.00 0.00 ? 1526 ASP A HB3  5  
ATOM   9522  N N    . VAL A 1 47  ? -13.999 -12.791 2.581   1.00 0.00 ? 1527 VAL A N    5  
ATOM   9523  C CA   . VAL A 1 47  ? -13.091 -13.750 1.968   1.00 0.00 ? 1527 VAL A CA   5  
ATOM   9524  C C    . VAL A 1 47  ? -11.796 -13.649 2.781   1.00 0.00 ? 1527 VAL A C    5  
ATOM   9525  O O    . VAL A 1 47  ? -11.413 -12.555 3.204   1.00 0.00 ? 1527 VAL A O    5  
ATOM   9526  C CB   . VAL A 1 47  ? -12.917 -13.417 0.467   1.00 0.00 ? 1527 VAL A CB   5  
ATOM   9527  C CG1  . VAL A 1 47  ? -11.809 -14.246 -0.181  1.00 0.00 ? 1527 VAL A CG1  5  
ATOM   9528  C CG2  . VAL A 1 47  ? -14.181 -13.700 -0.365  1.00 0.00 ? 1527 VAL A CG2  5  
ATOM   9529  H H    . VAL A 1 47  ? -13.570 -11.922 2.893   1.00 0.00 ? 1527 VAL A H    5  
ATOM   9530  H HA   . VAL A 1 47  ? -13.498 -14.755 2.067   1.00 0.00 ? 1527 VAL A HA   5  
ATOM   9531  H HB   . VAL A 1 47  ? -12.653 -12.363 0.367   1.00 0.00 ? 1527 VAL A HB   5  
ATOM   9532  H HG11 . VAL A 1 47  ? -12.101 -15.293 -0.242  1.00 0.00 ? 1527 VAL A HG11 5  
ATOM   9533  H HG12 . VAL A 1 47  ? -11.609 -13.855 -1.176  1.00 0.00 ? 1527 VAL A HG12 5  
ATOM   9534  H HG13 . VAL A 1 47  ? -10.896 -14.157 0.396   1.00 0.00 ? 1527 VAL A HG13 5  
ATOM   9535  H HG21 . VAL A 1 47  ? -14.999 -13.050 -0.053  1.00 0.00 ? 1527 VAL A HG21 5  
ATOM   9536  H HG22 . VAL A 1 47  ? -13.981 -13.546 -1.423  1.00 0.00 ? 1527 VAL A HG22 5  
ATOM   9537  H HG23 . VAL A 1 47  ? -14.480 -14.742 -0.240  1.00 0.00 ? 1527 VAL A HG23 5  
ATOM   9538  N N    . LEU A 1 48  ? -11.135 -14.777 3.064   1.00 0.00 ? 1528 LEU A N    5  
ATOM   9539  C CA   . LEU A 1 48  ? -9.874  -14.794 3.812   1.00 0.00 ? 1528 LEU A CA   5  
ATOM   9540  C C    . LEU A 1 48  ? -8.724  -14.334 2.917   1.00 0.00 ? 1528 LEU A C    5  
ATOM   9541  O O    . LEU A 1 48  ? -8.758  -14.560 1.713   1.00 0.00 ? 1528 LEU A O    5  
ATOM   9542  C CB   . LEU A 1 48  ? -9.619  -16.200 4.403   1.00 0.00 ? 1528 LEU A CB   5  
ATOM   9543  C CG   . LEU A 1 48  ? -9.696  -16.253 5.943   1.00 0.00 ? 1528 LEU A CG   5  
ATOM   9544  C CD1  . LEU A 1 48  ? -9.508  -17.697 6.413   1.00 0.00 ? 1528 LEU A CD1  5  
ATOM   9545  C CD2  . LEU A 1 48  ? -8.648  -15.360 6.616   1.00 0.00 ? 1528 LEU A CD2  5  
ATOM   9546  H H    . LEU A 1 48  ? -11.459 -15.652 2.671   1.00 0.00 ? 1528 LEU A H    5  
ATOM   9547  H HA   . LEU A 1 48  ? -9.964  -14.080 4.620   1.00 0.00 ? 1528 LEU A HA   5  
ATOM   9548  H HB2  . LEU A 1 48  ? -10.342 -16.906 3.989   1.00 0.00 ? 1528 LEU A HB2  5  
ATOM   9549  H HB3  . LEU A 1 48  ? -8.638  -16.550 4.091   1.00 0.00 ? 1528 LEU A HB3  5  
ATOM   9550  H HG   . LEU A 1 48  ? -10.673 -15.896 6.263   1.00 0.00 ? 1528 LEU A HG   5  
ATOM   9551  H HD11 . LEU A 1 48  ? -8.518  -18.068 6.143   1.00 0.00 ? 1528 LEU A HD11 5  
ATOM   9552  H HD12 . LEU A 1 48  ? -9.627  -17.748 7.496   1.00 0.00 ? 1528 LEU A HD12 5  
ATOM   9553  H HD13 . LEU A 1 48  ? -10.268 -18.339 5.963   1.00 0.00 ? 1528 LEU A HD13 5  
ATOM   9554  H HD21 . LEU A 1 48  ? -7.656  -15.516 6.185   1.00 0.00 ? 1528 LEU A HD21 5  
ATOM   9555  H HD22 . LEU A 1 48  ? -8.950  -14.323 6.507   1.00 0.00 ? 1528 LEU A HD22 5  
ATOM   9556  H HD23 . LEU A 1 48  ? -8.611  -15.562 7.692   1.00 0.00 ? 1528 LEU A HD23 5  
ATOM   9557  N N    . GLY A 1 49  ? -7.676  -13.735 3.493   1.00 0.00 ? 1529 GLY A N    5  
ATOM   9558  C CA   . GLY A 1 49  ? -6.585  -13.089 2.763   1.00 0.00 ? 1529 GLY A CA   5  
ATOM   9559  C C    . GLY A 1 49  ? -5.907  -14.004 1.753   1.00 0.00 ? 1529 GLY A C    5  
ATOM   9560  O O    . GLY A 1 49  ? -5.594  -13.584 0.639   1.00 0.00 ? 1529 GLY A O    5  
ATOM   9561  H H    . GLY A 1 49  ? -7.712  -13.516 4.486   1.00 0.00 ? 1529 GLY A H    5  
ATOM   9562  H HA2  . GLY A 1 49  ? -6.982  -12.216 2.251   1.00 0.00 ? 1529 GLY A HA2  5  
ATOM   9563  H HA3  . GLY A 1 49  ? -5.836  -12.755 3.485   1.00 0.00 ? 1529 GLY A HA3  5  
ATOM   9564  N N    . LYS A 1 50  ? -5.715  -15.285 2.097   1.00 0.00 ? 1530 LYS A N    5  
ATOM   9565  C CA   . LYS A 1 50  ? -5.093  -16.221 1.152   1.00 0.00 ? 1530 LYS A CA   5  
ATOM   9566  C C    . LYS A 1 50  ? -5.908  -16.361 -0.138  1.00 0.00 ? 1530 LYS A C    5  
ATOM   9567  O O    . LYS A 1 50  ? -5.336  -16.671 -1.172  1.00 0.00 ? 1530 LYS A O    5  
ATOM   9568  C CB   . LYS A 1 50  ? -4.734  -17.582 1.782   1.00 0.00 ? 1530 LYS A CB   5  
ATOM   9569  C CG   . LYS A 1 50  ? -5.906  -18.468 2.259   1.00 0.00 ? 1530 LYS A CG   5  
ATOM   9570  C CD   . LYS A 1 50  ? -6.273  -18.313 3.745   1.00 0.00 ? 1530 LYS A CD   5  
ATOM   9571  C CE   . LYS A 1 50  ? -5.174  -18.742 4.740   1.00 0.00 ? 1530 LYS A CE   5  
ATOM   9572  N NZ   . LYS A 1 50  ? -4.930  -20.214 4.761   1.00 0.00 ? 1530 LYS A NZ   5  
ATOM   9573  H H    . LYS A 1 50  ? -6.003  -15.598 3.020   1.00 0.00 ? 1530 LYS A H    5  
ATOM   9574  H HA   . LYS A 1 50  ? -4.144  -15.766 0.863   1.00 0.00 ? 1530 LYS A HA   5  
ATOM   9575  H HB2  . LYS A 1 50  ? -4.199  -18.149 1.018   1.00 0.00 ? 1530 LYS A HB2  5  
ATOM   9576  H HB3  . LYS A 1 50  ? -4.021  -17.420 2.593   1.00 0.00 ? 1530 LYS A HB3  5  
ATOM   9577  H HG2  . LYS A 1 50  ? -6.790  -18.257 1.657   1.00 0.00 ? 1530 LYS A HG2  5  
ATOM   9578  H HG3  . LYS A 1 50  ? -5.641  -19.510 2.080   1.00 0.00 ? 1530 LYS A HG3  5  
ATOM   9579  H HD2  . LYS A 1 50  ? -6.498  -17.267 3.939   1.00 0.00 ? 1530 LYS A HD2  5  
ATOM   9580  H HD3  . LYS A 1 50  ? -7.180  -18.891 3.944   1.00 0.00 ? 1530 LYS A HD3  5  
ATOM   9581  H HE2  . LYS A 1 50  ? -4.252  -18.211 4.499   1.00 0.00 ? 1530 LYS A HE2  5  
ATOM   9582  H HE3  . LYS A 1 50  ? -5.482  -18.419 5.736   1.00 0.00 ? 1530 LYS A HE3  5  
ATOM   9583  H HZ1  . LYS A 1 50  ? -4.233  -20.449 5.457   1.00 0.00 ? 1530 LYS A HZ1  5  
ATOM   9584  H HZ2  . LYS A 1 50  ? -5.774  -20.727 4.993   1.00 0.00 ? 1530 LYS A HZ2  5  
ATOM   9585  H HZ3  . LYS A 1 50  ? -4.586  -20.563 3.874   1.00 0.00 ? 1530 LYS A HZ3  5  
ATOM   9586  N N    . ASP A 1 51  ? -7.210  -16.100 -0.093  1.00 0.00 ? 1531 ASP A N    5  
ATOM   9587  C CA   . ASP A 1 51  ? -8.160  -16.306 -1.186  1.00 0.00 ? 1531 ASP A CA   5  
ATOM   9588  C C    . ASP A 1 51  ? -8.426  -15.015 -1.978  1.00 0.00 ? 1531 ASP A C    5  
ATOM   9589  O O    . ASP A 1 51  ? -9.399  -14.957 -2.731  1.00 0.00 ? 1531 ASP A O    5  
ATOM   9590  C CB   . ASP A 1 51  ? -9.461  -16.908 -0.617  1.00 0.00 ? 1531 ASP A CB   5  
ATOM   9591  C CG   . ASP A 1 51  ? -9.359  -18.419 -0.355  1.00 0.00 ? 1531 ASP A CG   5  
ATOM   9592  O OD1  . ASP A 1 51  ? -8.993  -19.175 -1.287  1.00 0.00 ? 1531 ASP A OD1  5  
ATOM   9593  O OD2  . ASP A 1 51  ? -9.648  -18.848 0.787   1.00 0.00 ? 1531 ASP A OD2  5  
ATOM   9594  H H    . ASP A 1 51  ? -7.606  -15.790 0.791   1.00 0.00 ? 1531 ASP A H    5  
ATOM   9595  H HA   . ASP A 1 51  ? -7.740  -17.023 -1.891  1.00 0.00 ? 1531 ASP A HA   5  
ATOM   9596  H HB2  . ASP A 1 51  ? -9.740  -16.383 0.296   1.00 0.00 ? 1531 ASP A HB2  5  
ATOM   9597  H HB3  . ASP A 1 51  ? -10.275 -16.756 -1.320  1.00 0.00 ? 1531 ASP A HB3  5  
ATOM   9598  N N    . ILE A 1 52  ? -7.600  -13.970 -1.848  1.00 0.00 ? 1532 ILE A N    5  
ATOM   9599  C CA   . ILE A 1 52  ? -7.789  -12.696 -2.550  1.00 0.00 ? 1532 ILE A CA   5  
ATOM   9600  C C    . ILE A 1 52  ? -6.481  -12.398 -3.267  1.00 0.00 ? 1532 ILE A C    5  
ATOM   9601  O O    . ILE A 1 52  ? -5.418  -12.499 -2.667  1.00 0.00 ? 1532 ILE A O    5  
ATOM   9602  C CB   . ILE A 1 52  ? -8.209  -11.544 -1.600  1.00 0.00 ? 1532 ILE A CB   5  
ATOM   9603  C CG1  . ILE A 1 52  ? -8.735  -12.058 -0.246  1.00 0.00 ? 1532 ILE A CG1  5  
ATOM   9604  C CG2  . ILE A 1 52  ? -9.206  -10.598 -2.286  1.00 0.00 ? 1532 ILE A CG2  5  
ATOM   9605  C CD1  . ILE A 1 52  ? -9.363  -11.045 0.706   1.00 0.00 ? 1532 ILE A CD1  5  
ATOM   9606  H H    . ILE A 1 52  ? -6.801  -14.024 -1.222  1.00 0.00 ? 1532 ILE A H    5  
ATOM   9607  H HA   . ILE A 1 52  ? -8.566  -12.815 -3.300  1.00 0.00 ? 1532 ILE A HA   5  
ATOM   9608  H HB   . ILE A 1 52  ? -7.335  -10.939 -1.402  1.00 0.00 ? 1532 ILE A HB   5  
ATOM   9609  H HG12 . ILE A 1 52  ? -9.474  -12.824 -0.435  1.00 0.00 ? 1532 ILE A HG12 5  
ATOM   9610  H HG13 . ILE A 1 52  ? -7.899  -12.508 0.281   1.00 0.00 ? 1532 ILE A HG13 5  
ATOM   9611  H HG21 . ILE A 1 52  ? -10.183 -11.076 -2.332  1.00 0.00 ? 1532 ILE A HG21 5  
ATOM   9612  H HG22 . ILE A 1 52  ? -9.287  -9.668  -1.715  1.00 0.00 ? 1532 ILE A HG22 5  
ATOM   9613  H HG23 . ILE A 1 52  ? -8.859  -10.351 -3.290  1.00 0.00 ? 1532 ILE A HG23 5  
ATOM   9614  H HD11 . ILE A 1 52  ? -9.438  -11.496 1.692   1.00 0.00 ? 1532 ILE A HD11 5  
ATOM   9615  H HD12 . ILE A 1 52  ? -8.760  -10.142 0.761   1.00 0.00 ? 1532 ILE A HD12 5  
ATOM   9616  H HD13 . ILE A 1 52  ? -10.365 -10.818 0.366   1.00 0.00 ? 1532 ILE A HD13 5  
ATOM   9617  N N    . LEU A 1 53  ? -6.559  -12.061 -4.548  1.00 0.00 ? 1533 LEU A N    5  
ATOM   9618  C CA   . LEU A 1 53  ? -5.456  -11.930 -5.487  1.00 0.00 ? 1533 LEU A CA   5  
ATOM   9619  C C    . LEU A 1 53  ? -5.482  -10.470 -5.899  1.00 0.00 ? 1533 LEU A C    5  
ATOM   9620  O O    . LEU A 1 53  ? -6.446  -10.064 -6.546  1.00 0.00 ? 1533 LEU A O    5  
ATOM   9621  C CB   . LEU A 1 53  ? -5.703  -12.814 -6.723  1.00 0.00 ? 1533 LEU A CB   5  
ATOM   9622  C CG   . LEU A 1 53  ? -5.376  -14.314 -6.608  1.00 0.00 ? 1533 LEU A CG   5  
ATOM   9623  C CD1  . LEU A 1 53  ? -5.962  -14.985 -5.372  1.00 0.00 ? 1533 LEU A CD1  5  
ATOM   9624  C CD2  . LEU A 1 53  ? -5.872  -15.011 -7.874  1.00 0.00 ? 1533 LEU A CD2  5  
ATOM   9625  H H    . LEU A 1 53  ? -7.480  -11.916 -4.943  1.00 0.00 ? 1533 LEU A H    5  
ATOM   9626  H HA   . LEU A 1 53  ? -4.522  -12.199 -5.013  1.00 0.00 ? 1533 LEU A HA   5  
ATOM   9627  H HB2  . LEU A 1 53  ? -6.744  -12.693 -7.021  1.00 0.00 ? 1533 LEU A HB2  5  
ATOM   9628  H HB3  . LEU A 1 53  ? -5.096  -12.425 -7.537  1.00 0.00 ? 1533 LEU A HB3  5  
ATOM   9629  H HG   . LEU A 1 53  ? -4.302  -14.444 -6.552  1.00 0.00 ? 1533 LEU A HG   5  
ATOM   9630  H HD11 . LEU A 1 53  ? -7.026  -14.748 -5.276  1.00 0.00 ? 1533 LEU A HD11 5  
ATOM   9631  H HD12 . LEU A 1 53  ? -5.841  -16.064 -5.445  1.00 0.00 ? 1533 LEU A HD12 5  
ATOM   9632  H HD13 . LEU A 1 53  ? -5.417  -14.644 -4.486  1.00 0.00 ? 1533 LEU A HD13 5  
ATOM   9633  H HD21 . LEU A 1 53  ? -5.680  -16.080 -7.814  1.00 0.00 ? 1533 LEU A HD21 5  
ATOM   9634  H HD22 . LEU A 1 53  ? -6.940  -14.826 -8.025  1.00 0.00 ? 1533 LEU A HD22 5  
ATOM   9635  H HD23 . LEU A 1 53  ? -5.338  -14.613 -8.738  1.00 0.00 ? 1533 LEU A HD23 5  
ATOM   9636  N N    . LEU A 1 54  ? -4.454  -9.684  -5.567  1.00 0.00 ? 1534 LEU A N    5  
ATOM   9637  C CA   . LEU A 1 54  ? -4.528  -8.221  -5.716  1.00 0.00 ? 1534 LEU A CA   5  
ATOM   9638  C C    . LEU A 1 54  ? -3.638  -7.596  -6.791  1.00 0.00 ? 1534 LEU A C    5  
ATOM   9639  O O    . LEU A 1 54  ? -3.665  -6.379  -6.959  1.00 0.00 ? 1534 LEU A O    5  
ATOM   9640  C CB   . LEU A 1 54  ? -4.356  -7.539  -4.350  1.00 0.00 ? 1534 LEU A CB   5  
ATOM   9641  C CG   . LEU A 1 54  ? -3.044  -7.762  -3.582  1.00 0.00 ? 1534 LEU A CG   5  
ATOM   9642  C CD1  . LEU A 1 54  ? -1.753  -7.577  -4.378  1.00 0.00 ? 1534 LEU A CD1  5  
ATOM   9643  C CD2  . LEU A 1 54  ? -3.062  -6.809  -2.387  1.00 0.00 ? 1534 LEU A CD2  5  
ATOM   9644  H H    . LEU A 1 54  ? -3.656  -10.094 -5.084  1.00 0.00 ? 1534 LEU A H    5  
ATOM   9645  H HA   . LEU A 1 54  ? -5.540  -7.981  -6.032  1.00 0.00 ? 1534 LEU A HA   5  
ATOM   9646  H HB2  . LEU A 1 54  ? -4.516  -6.466  -4.481  1.00 0.00 ? 1534 LEU A HB2  5  
ATOM   9647  H HB3  . LEU A 1 54  ? -5.167  -7.895  -3.713  1.00 0.00 ? 1534 LEU A HB3  5  
ATOM   9648  H HG   . LEU A 1 54  ? -3.041  -8.785  -3.220  1.00 0.00 ? 1534 LEU A HG   5  
ATOM   9649  H HD11 . LEU A 1 54  ? -0.901  -7.598  -3.695  1.00 0.00 ? 1534 LEU A HD11 5  
ATOM   9650  H HD12 . LEU A 1 54  ? -1.633  -8.398  -5.083  1.00 0.00 ? 1534 LEU A HD12 5  
ATOM   9651  H HD13 . LEU A 1 54  ? -1.769  -6.625  -4.911  1.00 0.00 ? 1534 LEU A HD13 5  
ATOM   9652  H HD21 . LEU A 1 54  ? -2.340  -7.141  -1.637  1.00 0.00 ? 1534 LEU A HD21 5  
ATOM   9653  H HD22 . LEU A 1 54  ? -2.830  -5.792  -2.711  1.00 0.00 ? 1534 LEU A HD22 5  
ATOM   9654  H HD23 . LEU A 1 54  ? -4.056  -6.793  -1.930  1.00 0.00 ? 1534 LEU A HD23 5  
ATOM   9655  N N    . CYS A 1 55  ? -2.880  -8.405  -7.530  1.00 0.00 ? 1535 CYS A N    5  
ATOM   9656  C CA   . CYS A 1 55  ? -2.032  -7.950  -8.629  1.00 0.00 ? 1535 CYS A CA   5  
ATOM   9657  C C    . CYS A 1 55  ? -2.331  -8.897  -9.793  1.00 0.00 ? 1535 CYS A C    5  
ATOM   9658  O O    . CYS A 1 55  ? -1.420  -9.495  -10.361 1.00 0.00 ? 1535 CYS A O    5  
ATOM   9659  C CB   . CYS A 1 55  ? -0.562  -7.953  -8.163  1.00 0.00 ? 1535 CYS A CB   5  
ATOM   9660  S SG   . CYS A 1 55  ? 0.500   -7.079  -9.356  1.00 0.00 ? 1535 CYS A SG   5  
ATOM   9661  H H    . CYS A 1 55  ? -2.933  -9.402  -7.380  1.00 0.00 ? 1535 CYS A H    5  
ATOM   9662  H HA   . CYS A 1 55  ? -2.308  -6.931  -8.910  1.00 0.00 ? 1535 CYS A HA   5  
ATOM   9663  H HB2  . CYS A 1 55  ? -0.488  -7.448  -7.201  1.00 0.00 ? 1535 CYS A HB2  5  
ATOM   9664  H HB3  . CYS A 1 55  ? -0.209  -8.980  -8.048  1.00 0.00 ? 1535 CYS A HB3  5  
ATOM   9665  H HG   . CYS A 1 55  ? 0.327   -7.965  -10.354 1.00 0.00 ? 1535 CYS A HG   5  
ATOM   9666  N N    . ASP A 1 56  ? -3.625  -9.071  -10.108 1.00 0.00 ? 1536 ASP A N    5  
ATOM   9667  C CA   . ASP A 1 56  ? -4.081  -10.126 -11.014 1.00 0.00 ? 1536 ASP A CA   5  
ATOM   9668  C C    . ASP A 1 56  ? -4.827  -9.684  -12.283 1.00 0.00 ? 1536 ASP A C    5  
ATOM   9669  O O    . ASP A 1 56  ? -5.992  -10.051 -12.472 1.00 0.00 ? 1536 ASP A O    5  
ATOM   9670  C CB   . ASP A 1 56  ? -4.876  -11.152 -10.206 1.00 0.00 ? 1536 ASP A CB   5  
ATOM   9671  C CG   . ASP A 1 56  ? -5.255  -12.411 -11.025 1.00 0.00 ? 1536 ASP A CG   5  
ATOM   9672  O OD1  . ASP A 1 56  ? -4.552  -12.759 -12.007 1.00 0.00 ? 1536 ASP A OD1  5  
ATOM   9673  O OD2  . ASP A 1 56  ? -6.269  -13.048 -10.653 1.00 0.00 ? 1536 ASP A OD2  5  
ATOM   9674  H H    . ASP A 1 56  ? -4.333  -8.513  -9.646  1.00 0.00 ? 1536 ASP A H    5  
ATOM   9675  H HA   . ASP A 1 56  ? -3.209  -10.667 -11.374 1.00 0.00 ? 1536 ASP A HA   5  
ATOM   9676  H HB2  . ASP A 1 56  ? -4.280  -11.449 -9.343  1.00 0.00 ? 1536 ASP A HB2  5  
ATOM   9677  H HB3  . ASP A 1 56  ? -5.777  -10.675 -9.819  1.00 0.00 ? 1536 ASP A HB3  5  
ATOM   9678  N N    . PRO A 1 57  ? -4.256  -8.804  -13.130 1.00 0.00 ? 1537 PRO A N    5  
ATOM   9679  C CA   . PRO A 1 57  ? -4.814  -8.606  -14.459 1.00 0.00 ? 1537 PRO A CA   5  
ATOM   9680  C C    . PRO A 1 57  ? -4.520  -9.957  -15.147 1.00 0.00 ? 1537 PRO A C    5  
ATOM   9681  O O    . PRO A 1 57  ? -3.362  -10.400 -15.132 1.00 0.00 ? 1537 PRO A O    5  
ATOM   9682  C CB   . PRO A 1 57  ? -4.049  -7.428  -15.063 1.00 0.00 ? 1537 PRO A CB   5  
ATOM   9683  C CG   . PRO A 1 57  ? -2.697  -7.453  -14.343 1.00 0.00 ? 1537 PRO A CG   5  
ATOM   9684  C CD   . PRO A 1 57  ? -2.993  -8.096  -12.985 1.00 0.00 ? 1537 PRO A CD   5  
ATOM   9685  H HA   . PRO A 1 57  ? -5.883  -8.396  -14.423 1.00 0.00 ? 1537 PRO A HA   5  
ATOM   9686  H HB2  . PRO A 1 57  ? -3.939  -7.521  -16.143 1.00 0.00 ? 1537 PRO A HB2  5  
ATOM   9687  H HB3  . PRO A 1 57  ? -4.567  -6.500  -14.818 1.00 0.00 ? 1537 PRO A HB3  5  
ATOM   9688  H HG2  . PRO A 1 57  ? -2.002  -8.088  -14.892 1.00 0.00 ? 1537 PRO A HG2  5  
ATOM   9689  H HG3  . PRO A 1 57  ? -2.282  -6.454  -14.229 1.00 0.00 ? 1537 PRO A HG3  5  
ATOM   9690  H HD2  . PRO A 1 57  ? -2.190  -8.786  -12.721 1.00 0.00 ? 1537 PRO A HD2  5  
ATOM   9691  H HD3  . PRO A 1 57  ? -3.099  -7.320  -12.226 1.00 0.00 ? 1537 PRO A HD3  5  
ATOM   9692  N N    . ILE A 1 58  ? -5.522  -10.630 -15.727 1.00 0.00 ? 1538 ILE A N    5  
ATOM   9693  C CA   . ILE A 1 58  ? -5.342  -12.021 -16.168 1.00 0.00 ? 1538 ILE A CA   5  
ATOM   9694  C C    . ILE A 1 58  ? -4.192  -12.101 -17.190 1.00 0.00 ? 1538 ILE A C    5  
ATOM   9695  O O    . ILE A 1 58  ? -4.287  -11.458 -18.242 1.00 0.00 ? 1538 ILE A O    5  
ATOM   9696  C CB   . ILE A 1 58  ? -6.614  -12.643 -16.795 1.00 0.00 ? 1538 ILE A CB   5  
ATOM   9697  C CG1  . ILE A 1 58  ? -7.967  -12.292 -16.145 1.00 0.00 ? 1538 ILE A CG1  5  
ATOM   9698  C CG2  . ILE A 1 58  ? -6.409  -14.168 -16.828 1.00 0.00 ? 1538 ILE A CG2  5  
ATOM   9699  C CD1  . ILE A 1 58  ? -8.191  -12.863 -14.748 1.00 0.00 ? 1538 ILE A CD1  5  
ATOM   9700  H H    . ILE A 1 58  ? -6.450  -10.222 -15.760 1.00 0.00 ? 1538 ILE A H    5  
ATOM   9701  H HA   . ILE A 1 58  ? -5.097  -12.584 -15.270 1.00 0.00 ? 1538 ILE A HA   5  
ATOM   9702  H HB   . ILE A 1 58  ? -6.668  -12.311 -17.829 1.00 0.00 ? 1538 ILE A HB   5  
ATOM   9703  H HG12 . ILE A 1 58  ? -8.072  -11.217 -16.076 1.00 0.00 ? 1538 ILE A HG12 5  
ATOM   9704  H HG13 . ILE A 1 58  ? -8.770  -12.639 -16.802 1.00 0.00 ? 1538 ILE A HG13 5  
ATOM   9705  H HG21 . ILE A 1 58  ? -7.282  -14.652 -17.255 1.00 0.00 ? 1538 ILE A HG21 5  
ATOM   9706  H HG22 . ILE A 1 58  ? -5.547  -14.410 -17.452 1.00 0.00 ? 1538 ILE A HG22 5  
ATOM   9707  H HG23 . ILE A 1 58  ? -6.240  -14.555 -15.819 1.00 0.00 ? 1538 ILE A HG23 5  
ATOM   9708  H HD11 . ILE A 1 58  ? -9.126  -12.472 -14.342 1.00 0.00 ? 1538 ILE A HD11 5  
ATOM   9709  H HD12 . ILE A 1 58  ? -8.265  -13.943 -14.823 1.00 0.00 ? 1538 ILE A HD12 5  
ATOM   9710  H HD13 . ILE A 1 58  ? -7.362  -12.585 -14.091 1.00 0.00 ? 1538 ILE A HD13 5  
ATOM   9711  N N    . PRO A 1 59  ? -3.113  -12.866 -16.924 1.00 0.00 ? 1539 PRO A N    5  
ATOM   9712  C CA   . PRO A 1 59  ? -2.048  -13.041 -17.889 1.00 0.00 ? 1539 PRO A CA   5  
ATOM   9713  C C    . PRO A 1 59  ? -2.558  -13.834 -19.086 1.00 0.00 ? 1539 PRO A C    5  
ATOM   9714  O O    . PRO A 1 59  ? -3.374  -14.752 -18.978 1.00 0.00 ? 1539 PRO A O    5  
ATOM   9715  C CB   . PRO A 1 59  ? -0.894  -13.724 -17.147 1.00 0.00 ? 1539 PRO A CB   5  
ATOM   9716  C CG   . PRO A 1 59  ? -1.506  -14.304 -15.870 1.00 0.00 ? 1539 PRO A CG   5  
ATOM   9717  C CD   . PRO A 1 59  ? -2.833  -13.570 -15.683 1.00 0.00 ? 1539 PRO A CD   5  
ATOM   9718  H HA   . PRO A 1 59  ? -1.729  -12.065 -18.268 1.00 0.00 ? 1539 PRO A HA   5  
ATOM   9719  H HB2  . PRO A 1 59  ? -0.431  -14.511 -17.748 1.00 0.00 ? 1539 PRO A HB2  5  
ATOM   9720  H HB3  . PRO A 1 59  ? -0.149  -12.972 -16.877 1.00 0.00 ? 1539 PRO A HB3  5  
ATOM   9721  H HG2  . PRO A 1 59  ? -1.690  -15.370 -15.984 1.00 0.00 ? 1539 PRO A HG2  5  
ATOM   9722  H HG3  . PRO A 1 59  ? -0.853  -14.140 -15.015 1.00 0.00 ? 1539 PRO A HG3  5  
ATOM   9723  H HD2  . PRO A 1 59  ? -3.624  -14.286 -15.457 1.00 0.00 ? 1539 PRO A HD2  5  
ATOM   9724  H HD3  . PRO A 1 59  ? -2.743  -12.847 -14.875 1.00 0.00 ? 1539 PRO A HD3  5  
ATOM   9725  N N    . LEU A 1 60  ? -2.077  -13.434 -20.254 1.00 0.00 ? 1540 LEU A N    5  
ATOM   9726  C CA   . LEU A 1 60  ? -2.474  -14.006 -21.521 1.00 0.00 ? 1540 LEU A CA   5  
ATOM   9727  C C    . LEU A 1 60  ? -1.978  -15.461 -21.542 1.00 0.00 ? 1540 LEU A C    5  
ATOM   9728  O O    . LEU A 1 60  ? -0.915  -15.756 -20.992 1.00 0.00 ? 1540 LEU A O    5  
ATOM   9729  C CB   . LEU A 1 60  ? -1.915  -13.140 -22.660 1.00 0.00 ? 1540 LEU A CB   5  
ATOM   9730  C CG   . LEU A 1 60  ? -2.424  -11.677 -22.698 1.00 0.00 ? 1540 LEU A CG   5  
ATOM   9731  C CD1  . LEU A 1 60  ? -1.790  -10.746 -21.649 1.00 0.00 ? 1540 LEU A CD1  5  
ATOM   9732  C CD2  . LEU A 1 60  ? -2.155  -11.095 -24.088 1.00 0.00 ? 1540 LEU A CD2  5  
ATOM   9733  H H    . LEU A 1 60  ? -1.374  -12.710 -20.275 1.00 0.00 ? 1540 LEU A H    5  
ATOM   9734  H HA   . LEU A 1 60  ? -3.559  -14.003 -21.579 1.00 0.00 ? 1540 LEU A HA   5  
ATOM   9735  H HB2  . LEU A 1 60  ? -0.826  -13.132 -22.604 1.00 0.00 ? 1540 LEU A HB2  5  
ATOM   9736  H HB3  . LEU A 1 60  ? -2.201  -13.630 -23.589 1.00 0.00 ? 1540 LEU A HB3  5  
ATOM   9737  H HG   . LEU A 1 60  ? -3.494  -11.663 -22.516 1.00 0.00 ? 1540 LEU A HG   5  
ATOM   9738  H HD11 . LEU A 1 60  ? -0.706  -10.876 -21.621 1.00 0.00 ? 1540 LEU A HD11 5  
ATOM   9739  H HD12 . LEU A 1 60  ? -2.005  -9.706  -21.895 1.00 0.00 ? 1540 LEU A HD12 5  
ATOM   9740  H HD13 . LEU A 1 60  ? -2.232  -10.927 -20.667 1.00 0.00 ? 1540 LEU A HD13 5  
ATOM   9741  H HD21 . LEU A 1 60  ? -2.538  -10.077 -24.144 1.00 0.00 ? 1540 LEU A HD21 5  
ATOM   9742  H HD22 . LEU A 1 60  ? -1.081  -11.088 -24.288 1.00 0.00 ? 1540 LEU A HD22 5  
ATOM   9743  H HD23 . LEU A 1 60  ? -2.652  -11.699 -24.847 1.00 0.00 ? 1540 LEU A HD23 5  
ATOM   9744  N N    . ASP A 1 61  ? -2.777  -16.352 -22.136 1.00 0.00 ? 1541 ASP A N    5  
ATOM   9745  C CA   . ASP A 1 61  ? -2.645  -17.820 -22.184 1.00 0.00 ? 1541 ASP A CA   5  
ATOM   9746  C C    . ASP A 1 61  ? -3.262  -18.513 -20.958 1.00 0.00 ? 1541 ASP A C    5  
ATOM   9747  O O    . ASP A 1 61  ? -3.447  -19.731 -20.976 1.00 0.00 ? 1541 ASP A O    5  
ATOM   9748  C CB   . ASP A 1 61  ? -1.211  -18.304 -22.453 1.00 0.00 ? 1541 ASP A CB   5  
ATOM   9749  C CG   . ASP A 1 61  ? -1.174  -19.784 -22.875 1.00 0.00 ? 1541 ASP A CG   5  
ATOM   9750  O OD1  . ASP A 1 61  ? -1.796  -20.133 -23.907 1.00 0.00 ? 1541 ASP A OD1  5  
ATOM   9751  O OD2  . ASP A 1 61  ? -0.510  -20.598 -22.184 1.00 0.00 ? 1541 ASP A OD2  5  
ATOM   9752  H H    . ASP A 1 61  ? -3.617  -16.001 -22.589 1.00 0.00 ? 1541 ASP A H    5  
ATOM   9753  H HA   . ASP A 1 61  ? -3.239  -18.154 -23.036 1.00 0.00 ? 1541 ASP A HA   5  
ATOM   9754  H HB2  . ASP A 1 61  ? -0.771  -17.705 -23.255 1.00 0.00 ? 1541 ASP A HB2  5  
ATOM   9755  H HB3  . ASP A 1 61  ? -0.611  -18.176 -21.552 1.00 0.00 ? 1541 ASP A HB3  5  
ATOM   9756  N N    . THR A 1 62  ? -3.654  -17.772 -19.914 1.00 0.00 ? 1542 THR A N    5  
ATOM   9757  C CA   . THR A 1 62  ? -4.384  -18.338 -18.786 1.00 0.00 ? 1542 THR A CA   5  
ATOM   9758  C C    . THR A 1 62  ? -5.784  -18.749 -19.259 1.00 0.00 ? 1542 THR A C    5  
ATOM   9759  O O    . THR A 1 62  ? -6.454  -18.005 -19.986 1.00 0.00 ? 1542 THR A O    5  
ATOM   9760  C CB   . THR A 1 62  ? -4.444  -17.330 -17.627 1.00 0.00 ? 1542 THR A CB   5  
ATOM   9761  O OG1  . THR A 1 62  ? -3.140  -16.879 -17.349 1.00 0.00 ? 1542 THR A OG1  5  
ATOM   9762  C CG2  . THR A 1 62  ? -4.983  -17.899 -16.313 1.00 0.00 ? 1542 THR A CG2  5  
ATOM   9763  H H    . THR A 1 62  ? -3.512  -16.771 -19.911 1.00 0.00 ? 1542 THR A H    5  
ATOM   9764  H HA   . THR A 1 62  ? -3.839  -19.217 -18.450 1.00 0.00 ? 1542 THR A HA   5  
ATOM   9765  H HB   . THR A 1 62  ? -5.063  -16.487 -17.922 1.00 0.00 ? 1542 THR A HB   5  
ATOM   9766  H HG1  . THR A 1 62  ? -2.978  -16.106 -17.922 1.00 0.00 ? 1542 THR A HG1  5  
ATOM   9767  H HG21 . THR A 1 62  ? -4.852  -17.155 -15.525 1.00 0.00 ? 1542 THR A HG21 5  
ATOM   9768  H HG22 . THR A 1 62  ? -6.048  -18.108 -16.411 1.00 0.00 ? 1542 THR A HG22 5  
ATOM   9769  H HG23 . THR A 1 62  ? -4.448  -18.811 -16.043 1.00 0.00 ? 1542 THR A HG23 5  
ATOM   9770  N N    . GLU A 1 63  ? -6.214  -19.936 -18.836 1.00 0.00 ? 1543 GLU A N    5  
ATOM   9771  C CA   . GLU A 1 63  ? -7.572  -20.406 -19.029 1.00 0.00 ? 1543 GLU A CA   5  
ATOM   9772  C C    . GLU A 1 63  ? -8.469  -19.648 -18.058 1.00 0.00 ? 1543 GLU A C    5  
ATOM   9773  O O    . GLU A 1 63  ? -8.097  -19.403 -16.910 1.00 0.00 ? 1543 GLU A O    5  
ATOM   9774  C CB   . GLU A 1 63  ? -7.641  -21.925 -18.812 1.00 0.00 ? 1543 GLU A CB   5  
ATOM   9775  C CG   . GLU A 1 63  ? -9.022  -22.503 -19.156 1.00 0.00 ? 1543 GLU A CG   5  
ATOM   9776  C CD   . GLU A 1 63  ? -9.086  -24.017 -18.881 1.00 0.00 ? 1543 GLU A CD   5  
ATOM   9777  O OE1  . GLU A 1 63  ? -8.549  -24.808 -19.693 1.00 0.00 ? 1543 GLU A OE1  5  
ATOM   9778  O OE2  . GLU A 1 63  ? -9.682  -24.418 -17.851 1.00 0.00 ? 1543 GLU A OE2  5  
ATOM   9779  H H    . GLU A 1 63  ? -5.644  -20.456 -18.188 1.00 0.00 ? 1543 GLU A H    5  
ATOM   9780  H HA   . GLU A 1 63  ? -7.881  -20.180 -20.047 1.00 0.00 ? 1543 GLU A HA   5  
ATOM   9781  H HB2  . GLU A 1 63  ? -6.895  -22.398 -19.450 1.00 0.00 ? 1543 GLU A HB2  5  
ATOM   9782  H HB3  . GLU A 1 63  ? -7.406  -22.152 -17.776 1.00 0.00 ? 1543 GLU A HB3  5  
ATOM   9783  H HG2  . GLU A 1 63  ? -9.786  -21.991 -18.570 1.00 0.00 ? 1543 GLU A HG2  5  
ATOM   9784  H HG3  . GLU A 1 63  ? -9.230  -22.316 -20.211 1.00 0.00 ? 1543 GLU A HG3  5  
ATOM   9785  N N    . VAL A 1 64  ? -9.661  -19.290 -18.509 1.00 0.00 ? 1544 VAL A N    5  
ATOM   9786  C CA   . VAL A 1 64  ? -10.656 -18.581 -17.725 1.00 0.00 ? 1544 VAL A CA   5  
ATOM   9787  C C    . VAL A 1 64  ? -12.035 -19.012 -18.192 1.00 0.00 ? 1544 VAL A C    5  
ATOM   9788  O O    . VAL A 1 64  ? -12.223 -19.448 -19.329 1.00 0.00 ? 1544 VAL A O    5  
ATOM   9789  C CB   . VAL A 1 64  ? -10.508 -17.051 -17.879 1.00 0.00 ? 1544 VAL A CB   5  
ATOM   9790  C CG1  . VAL A 1 64  ? -9.395  -16.467 -17.014 1.00 0.00 ? 1544 VAL A CG1  5  
ATOM   9791  C CG2  . VAL A 1 64  ? -10.256 -16.599 -19.319 1.00 0.00 ? 1544 VAL A CG2  5  
ATOM   9792  H H    . VAL A 1 64  ? -9.913  -19.541 -19.464 1.00 0.00 ? 1544 VAL A H    5  
ATOM   9793  H HA   . VAL A 1 64  ? -10.547 -18.845 -16.674 1.00 0.00 ? 1544 VAL A HA   5  
ATOM   9794  H HB   . VAL A 1 64  ? -11.434 -16.586 -17.540 1.00 0.00 ? 1544 VAL A HB   5  
ATOM   9795  H HG11 . VAL A 1 64  ? -9.599  -16.733 -15.984 1.00 0.00 ? 1544 VAL A HG11 5  
ATOM   9796  H HG12 . VAL A 1 64  ? -8.421  -16.848 -17.321 1.00 0.00 ? 1544 VAL A HG12 5  
ATOM   9797  H HG13 . VAL A 1 64  ? -9.397  -15.379 -17.093 1.00 0.00 ? 1544 VAL A HG13 5  
ATOM   9798  H HG21 . VAL A 1 64  ? -11.100 -16.878 -19.946 1.00 0.00 ? 1544 VAL A HG21 5  
ATOM   9799  H HG22 . VAL A 1 64  ? -10.130 -15.521 -19.323 1.00 0.00 ? 1544 VAL A HG22 5  
ATOM   9800  H HG23 . VAL A 1 64  ? -9.342  -17.040 -19.711 1.00 0.00 ? 1544 VAL A HG23 5  
ATOM   9801  N N    . THR A 1 65  ? -13.005 -18.844 -17.315 1.00 0.00 ? 1545 THR A N    5  
ATOM   9802  C CA   . THR A 1 65  ? -14.405 -18.975 -17.650 1.00 0.00 ? 1545 THR A CA   5  
ATOM   9803  C C    . THR A 1 65  ? -14.851 -17.565 -18.058 1.00 0.00 ? 1545 THR A C    5  
ATOM   9804  O O    . THR A 1 65  ? -14.316 -16.561 -17.583 1.00 0.00 ? 1545 THR A O    5  
ATOM   9805  C CB   . THR A 1 65  ? -15.140 -19.561 -16.441 1.00 0.00 ? 1545 THR A CB   5  
ATOM   9806  O OG1  . THR A 1 65  ? -14.765 -20.909 -16.251 1.00 0.00 ? 1545 THR A OG1  5  
ATOM   9807  C CG2  . THR A 1 65  ? -16.663 -19.511 -16.570 1.00 0.00 ? 1545 THR A CG2  5  
ATOM   9808  H H    . THR A 1 65  ? -12.801 -18.351 -16.449 1.00 0.00 ? 1545 THR A H    5  
ATOM   9809  H HA   . THR A 1 65  ? -14.532 -19.651 -18.488 1.00 0.00 ? 1545 THR A HA   5  
ATOM   9810  H HB   . THR A 1 65  ? -14.844 -19.014 -15.556 1.00 0.00 ? 1545 THR A HB   5  
ATOM   9811  H HG1  . THR A 1 65  ? -13.853 -20.959 -15.902 1.00 0.00 ? 1545 THR A HG1  5  
ATOM   9812  H HG21 . THR A 1 65  ? -17.117 -20.030 -15.734 1.00 0.00 ? 1545 THR A HG21 5  
ATOM   9813  H HG22 . THR A 1 65  ? -16.998 -18.471 -16.559 1.00 0.00 ? 1545 THR A HG22 5  
ATOM   9814  H HG23 . THR A 1 65  ? -16.984 -20.007 -17.487 1.00 0.00 ? 1545 THR A HG23 5  
ATOM   9815  N N    . ALA A 1 66  ? -15.826 -17.484 -18.956 1.00 0.00 ? 1546 ALA A N    5  
ATOM   9816  C CA   . ALA A 1 66  ? -16.352 -16.263 -19.520 1.00 0.00 ? 1546 ALA A CA   5  
ATOM   9817  C C    . ALA A 1 66  ? -17.872 -16.324 -19.367 1.00 0.00 ? 1546 ALA A C    5  
ATOM   9818  O O    . ALA A 1 66  ? -18.444 -17.405 -19.543 1.00 0.00 ? 1546 ALA A O    5  
ATOM   9819  C CB   . ALA A 1 66  ? -15.953 -16.176 -20.989 1.00 0.00 ? 1546 ALA A CB   5  
ATOM   9820  H H    . ALA A 1 66  ? -16.280 -18.337 -19.269 1.00 0.00 ? 1546 ALA A H    5  
ATOM   9821  H HA   . ALA A 1 66  ? -15.925 -15.399 -19.015 1.00 0.00 ? 1546 ALA A HA   5  
ATOM   9822  H HB1  . ALA A 1 66  ? -16.379 -15.268 -21.401 1.00 0.00 ? 1546 ALA A HB1  5  
ATOM   9823  H HB2  . ALA A 1 66  ? -14.865 -16.135 -21.091 1.00 0.00 ? 1546 ALA A HB2  5  
ATOM   9824  H HB3  . ALA A 1 66  ? -16.347 -17.031 -21.543 1.00 0.00 ? 1546 ALA A HB3  5  
ATOM   9825  N N    . LEU A 1 67  ? -18.528 -15.195 -19.070 1.00 0.00 ? 1547 LEU A N    5  
ATOM   9826  C CA   . LEU A 1 67  ? -19.990 -15.114 -19.070 1.00 0.00 ? 1547 LEU A CA   5  
ATOM   9827  C C    . LEU A 1 67  ? -20.456 -13.969 -19.948 1.00 0.00 ? 1547 LEU A C    5  
ATOM   9828  O O    . LEU A 1 67  ? -19.989 -12.840 -19.828 1.00 0.00 ? 1547 LEU A O    5  
ATOM   9829  C CB   . LEU A 1 67  ? -20.616 -14.978 -17.672 1.00 0.00 ? 1547 LEU A CB   5  
ATOM   9830  C CG   . LEU A 1 67  ? -20.644 -16.302 -16.910 1.00 0.00 ? 1547 LEU A CG   5  
ATOM   9831  C CD1  . LEU A 1 67  ? -19.348 -16.551 -16.141 1.00 0.00 ? 1547 LEU A CD1  5  
ATOM   9832  C CD2  . LEU A 1 67  ? -21.816 -16.269 -15.938 1.00 0.00 ? 1547 LEU A CD2  5  
ATOM   9833  H H    . LEU A 1 67  ? -17.998 -14.359 -18.852 1.00 0.00 ? 1547 LEU A H    5  
ATOM   9834  H HA   . LEU A 1 67  ? -20.375 -16.030 -19.505 1.00 0.00 ? 1547 LEU A HA   5  
ATOM   9835  H HB2  . LEU A 1 67  ? -20.109 -14.191 -17.095 1.00 0.00 ? 1547 LEU A HB2  5  
ATOM   9836  H HB3  . LEU A 1 67  ? -21.667 -14.690 -17.807 1.00 0.00 ? 1547 LEU A HB3  5  
ATOM   9837  H HG   . LEU A 1 67  ? -20.833 -17.132 -17.586 1.00 0.00 ? 1547 LEU A HG   5  
ATOM   9838  H HD11 . LEU A 1 67  ? -19.157 -15.719 -15.462 1.00 0.00 ? 1547 LEU A HD11 5  
ATOM   9839  H HD12 . LEU A 1 67  ? -19.426 -17.485 -15.588 1.00 0.00 ? 1547 LEU A HD12 5  
ATOM   9840  H HD13 . LEU A 1 67  ? -18.509 -16.634 -16.826 1.00 0.00 ? 1547 LEU A HD13 5  
ATOM   9841  H HD21 . LEU A 1 67  ? -21.782 -15.368 -15.322 1.00 0.00 ? 1547 LEU A HD21 5  
ATOM   9842  H HD22 . LEU A 1 67  ? -22.744 -16.281 -16.515 1.00 0.00 ? 1547 LEU A HD22 5  
ATOM   9843  H HD23 . LEU A 1 67  ? -21.769 -17.159 -15.315 1.00 0.00 ? 1547 LEU A HD23 5  
ATOM   9844  N N    . SER A 1 68  ? -21.407 -14.268 -20.818 1.00 0.00 ? 1548 SER A N    5  
ATOM   9845  C CA   . SER A 1 68  ? -22.100 -13.282 -21.633 1.00 0.00 ? 1548 SER A CA   5  
ATOM   9846  C C    . SER A 1 68  ? -22.991 -12.403 -20.751 1.00 0.00 ? 1548 SER A C    5  
ATOM   9847  O O    . SER A 1 68  ? -23.269 -12.733 -19.598 1.00 0.00 ? 1548 SER A O    5  
ATOM   9848  C CB   . SER A 1 68  ? -22.876 -14.020 -22.733 1.00 0.00 ? 1548 SER A CB   5  
ATOM   9849  O OG   . SER A 1 68  ? -21.963 -14.807 -23.493 1.00 0.00 ? 1548 SER A OG   5  
ATOM   9850  H H    . SER A 1 68  ? -21.735 -15.228 -20.850 1.00 0.00 ? 1548 SER A H    5  
ATOM   9851  H HA   . SER A 1 68  ? -21.366 -12.631 -22.106 1.00 0.00 ? 1548 SER A HA   5  
ATOM   9852  H HB2  . SER A 1 68  ? -23.630 -14.668 -22.283 1.00 0.00 ? 1548 SER A HB2  5  
ATOM   9853  H HB3  . SER A 1 68  ? -23.369 -13.301 -23.390 1.00 0.00 ? 1548 SER A HB3  5  
ATOM   9854  H HG   . SER A 1 68  ? -22.444 -15.228 -24.233 1.00 0.00 ? 1548 SER A HG   5  
ATOM   9855  N N    . GLU A 1 69  ? -23.467 -11.282 -21.299 1.00 0.00 ? 1549 GLU A N    5  
ATOM   9856  C CA   . GLU A 1 69  ? -24.371 -10.382 -20.584 1.00 0.00 ? 1549 GLU A CA   5  
ATOM   9857  C C    . GLU A 1 69  ? -25.725 -11.069 -20.352 1.00 0.00 ? 1549 GLU A C    5  
ATOM   9858  O O    . GLU A 1 69  ? -26.384 -10.809 -19.346 1.00 0.00 ? 1549 GLU A O    5  
ATOM   9859  C CB   . GLU A 1 69  ? -24.527 -9.068  -21.366 1.00 0.00 ? 1549 GLU A CB   5  
ATOM   9860  C CG   . GLU A 1 69  ? -23.193 -8.324  -21.557 1.00 0.00 ? 1549 GLU A CG   5  
ATOM   9861  C CD   . GLU A 1 69  ? -22.656 -7.691  -20.264 1.00 0.00 ? 1549 GLU A CD   5  
ATOM   9862  O OE1  . GLU A 1 69  ? -21.906 -8.360  -19.518 1.00 0.00 ? 1549 GLU A OE1  5  
ATOM   9863  O OE2  . GLU A 1 69  ? -22.955 -6.513  -19.965 1.00 0.00 ? 1549 GLU A OE2  5  
ATOM   9864  H H    . GLU A 1 69  ? -23.186 -11.019 -22.235 1.00 0.00 ? 1549 GLU A H    5  
ATOM   9865  H HA   . GLU A 1 69  ? -23.935 -10.158 -19.607 1.00 0.00 ? 1549 GLU A HA   5  
ATOM   9866  H HB2  . GLU A 1 69  ? -24.945 -9.292  -22.351 1.00 0.00 ? 1549 GLU A HB2  5  
ATOM   9867  H HB3  . GLU A 1 69  ? -25.226 -8.413  -20.843 1.00 0.00 ? 1549 GLU A HB3  5  
ATOM   9868  H HG2  . GLU A 1 69  ? -22.441 -9.009  -21.952 1.00 0.00 ? 1549 GLU A HG2  5  
ATOM   9869  H HG3  . GLU A 1 69  ? -23.345 -7.541  -22.304 1.00 0.00 ? 1549 GLU A HG3  5  
ATOM   9870  N N    . ASP A 1 70  ? -26.108 -12.004 -21.240 1.00 0.00 ? 1550 ASP A N    5  
ATOM   9871  C CA   . ASP A 1 70  ? -27.256 -12.907 -21.054 1.00 0.00 ? 1550 ASP A CA   5  
ATOM   9872  C C    . ASP A 1 70  ? -26.831 -14.179 -20.301 1.00 0.00 ? 1550 ASP A C    5  
ATOM   9873  O O    . ASP A 1 70  ? -27.414 -15.253 -20.428 1.00 0.00 ? 1550 ASP A O    5  
ATOM   9874  C CB   . ASP A 1 70  ? -27.915 -13.244 -22.393 1.00 0.00 ? 1550 ASP A CB   5  
ATOM   9875  C CG   . ASP A 1 70  ? -29.336 -13.840 -22.256 1.00 0.00 ? 1550 ASP A CG   5  
ATOM   9876  O OD1  . ASP A 1 70  ? -29.929 -13.854 -21.150 1.00 0.00 ? 1550 ASP A OD1  5  
ATOM   9877  O OD2  . ASP A 1 70  ? -29.878 -14.302 -23.292 1.00 0.00 ? 1550 ASP A OD2  5  
ATOM   9878  H H    . ASP A 1 70  ? -25.553 -12.130 -22.077 1.00 0.00 ? 1550 ASP A H    5  
ATOM   9879  H HA   . ASP A 1 70  ? -27.992 -12.384 -20.443 1.00 0.00 ? 1550 ASP A HA   5  
ATOM   9880  H HB2  . ASP A 1 70  ? -27.987 -12.329 -22.983 1.00 0.00 ? 1550 ASP A HB2  5  
ATOM   9881  H HB3  . ASP A 1 70  ? -27.269 -13.945 -22.921 1.00 0.00 ? 1550 ASP A HB3  5  
ATOM   9882  N N    . GLU A 1 71  ? -25.748 -14.082 -19.536 1.00 0.00 ? 1551 GLU A N    5  
ATOM   9883  C CA   . GLU A 1 71  ? -25.254 -15.041 -18.561 1.00 0.00 ? 1551 GLU A CA   5  
ATOM   9884  C C    . GLU A 1 71  ? -24.736 -16.374 -19.116 1.00 0.00 ? 1551 GLU A C    5  
ATOM   9885  O O    . GLU A 1 71  ? -24.272 -17.189 -18.326 1.00 0.00 ? 1551 GLU A O    5  
ATOM   9886  C CB   . GLU A 1 71  ? -26.312 -15.310 -17.480 1.00 0.00 ? 1551 GLU A CB   5  
ATOM   9887  C CG   . GLU A 1 71  ? -27.236 -14.186 -17.005 1.00 0.00 ? 1551 GLU A CG   5  
ATOM   9888  C CD   . GLU A 1 71  ? -28.437 -14.817 -16.289 1.00 0.00 ? 1551 GLU A CD   5  
ATOM   9889  O OE1  . GLU A 1 71  ? -28.305 -15.191 -15.101 1.00 0.00 ? 1551 GLU A OE1  5  
ATOM   9890  O OE2  . GLU A 1 71  ? -29.510 -14.950 -16.932 1.00 0.00 ? 1551 GLU A OE2  5  
ATOM   9891  H H    . GLU A 1 71  ? -25.262 -13.194 -19.535 1.00 0.00 ? 1551 GLU A H    5  
ATOM   9892  H HA   . GLU A 1 71  ? -24.403 -14.561 -18.077 1.00 0.00 ? 1551 GLU A HA   5  
ATOM   9893  H HB2  . GLU A 1 71  ? -26.931 -16.144 -17.813 1.00 0.00 ? 1551 GLU A HB2  5  
ATOM   9894  H HB3  . GLU A 1 71  ? -25.764 -15.607 -16.603 1.00 0.00 ? 1551 GLU A HB3  5  
ATOM   9895  H HG2  . GLU A 1 71  ? -26.682 -13.534 -16.325 1.00 0.00 ? 1551 GLU A HG2  5  
ATOM   9896  H HG3  . GLU A 1 71  ? -27.608 -13.595 -17.839 1.00 0.00 ? 1551 GLU A HG3  5  
ATOM   9897  N N    . TYR A 1 72  ? -24.821 -16.653 -20.420 1.00 0.00 ? 1552 TYR A N    5  
ATOM   9898  C CA   . TYR A 1 72  ? -24.301 -17.907 -20.971 1.00 0.00 ? 1552 TYR A CA   5  
ATOM   9899  C C    . TYR A 1 72  ? -22.829 -18.069 -20.582 1.00 0.00 ? 1552 TYR A C    5  
ATOM   9900  O O    . TYR A 1 72  ? -22.055 -17.116 -20.680 1.00 0.00 ? 1552 TYR A O    5  
ATOM   9901  C CB   . TYR A 1 72  ? -24.543 -17.988 -22.482 1.00 0.00 ? 1552 TYR A CB   5  
ATOM   9902  C CG   . TYR A 1 72  ? -25.995 -18.273 -22.805 1.00 0.00 ? 1552 TYR A CG   5  
ATOM   9903  C CD1  . TYR A 1 72  ? -26.460 -19.604 -22.811 1.00 0.00 ? 1552 TYR A CD1  5  
ATOM   9904  C CD2  . TYR A 1 72  ? -26.887 -17.224 -23.094 1.00 0.00 ? 1552 TYR A CD2  5  
ATOM   9905  C CE1  . TYR A 1 72  ? -27.812 -19.882 -23.072 1.00 0.00 ? 1552 TYR A CE1  5  
ATOM   9906  C CE2  . TYR A 1 72  ? -28.240 -17.497 -23.360 1.00 0.00 ? 1552 TYR A CE2  5  
ATOM   9907  C CZ   . TYR A 1 72  ? -28.715 -18.828 -23.338 1.00 0.00 ? 1552 TYR A CZ   5  
ATOM   9908  O OH   . TYR A 1 72  ? -30.030 -19.112 -23.570 1.00 0.00 ? 1552 TYR A OH   5  
ATOM   9909  H H    . TYR A 1 72  ? -25.298 -16.007 -21.034 1.00 0.00 ? 1552 TYR A H    5  
ATOM   9910  H HA   . TYR A 1 72  ? -24.850 -18.726 -20.509 1.00 0.00 ? 1552 TYR A HA   5  
ATOM   9911  H HB2  . TYR A 1 72  ? -24.221 -17.057 -22.955 1.00 0.00 ? 1552 TYR A HB2  5  
ATOM   9912  H HB3  . TYR A 1 72  ? -23.931 -18.800 -22.884 1.00 0.00 ? 1552 TYR A HB3  5  
ATOM   9913  H HD1  . TYR A 1 72  ? -25.775 -20.421 -22.614 1.00 0.00 ? 1552 TYR A HD1  5  
ATOM   9914  H HD2  . TYR A 1 72  ? -26.541 -16.203 -23.117 1.00 0.00 ? 1552 TYR A HD2  5  
ATOM   9915  H HE1  . TYR A 1 72  ? -28.165 -20.906 -23.062 1.00 0.00 ? 1552 TYR A HE1  5  
ATOM   9916  H HE2  . TYR A 1 72  ? -28.914 -16.681 -23.579 1.00 0.00 ? 1552 TYR A HE2  5  
ATOM   9917  H HH   . TYR A 1 72  ? -30.577 -18.329 -23.779 1.00 0.00 ? 1552 TYR A HH   5  
ATOM   9918  N N    . PHE A 1 73  ? -22.473 -19.255 -20.095 1.00 0.00 ? 1553 PHE A N    5  
ATOM   9919  C CA   . PHE A 1 73  ? -21.197 -19.567 -19.465 1.00 0.00 ? 1553 PHE A CA   5  
ATOM   9920  C C    . PHE A 1 73  ? -20.401 -20.453 -20.427 1.00 0.00 ? 1553 PHE A C    5  
ATOM   9921  O O    . PHE A 1 73  ? -20.957 -21.365 -21.051 1.00 0.00 ? 1553 PHE A O    5  
ATOM   9922  C CB   . PHE A 1 73  ? -21.443 -20.199 -18.082 1.00 0.00 ? 1553 PHE A CB   5  
ATOM   9923  C CG   . PHE A 1 73  ? -21.109 -21.667 -17.976 1.00 0.00 ? 1553 PHE A CG   5  
ATOM   9924  C CD1  . PHE A 1 73  ? -22.059 -22.633 -18.360 1.00 0.00 ? 1553 PHE A CD1  5  
ATOM   9925  C CD2  . PHE A 1 73  ? -19.850 -22.064 -17.497 1.00 0.00 ? 1553 PHE A CD2  5  
ATOM   9926  C CE1  . PHE A 1 73  ? -21.703 -23.994 -18.346 1.00 0.00 ? 1553 PHE A CE1  5  
ATOM   9927  C CE2  . PHE A 1 73  ? -19.494 -23.417 -17.477 1.00 0.00 ? 1553 PHE A CE2  5  
ATOM   9928  C CZ   . PHE A 1 73  ? -20.417 -24.386 -17.919 1.00 0.00 ? 1553 PHE A CZ   5  
ATOM   9929  H H    . PHE A 1 73  ? -23.120 -20.031 -20.192 1.00 0.00 ? 1553 PHE A H    5  
ATOM   9930  H HA   . PHE A 1 73  ? -20.641 -18.665 -19.258 1.00 0.00 ? 1553 PHE A HA   5  
ATOM   9931  H HB2  . PHE A 1 73  ? -20.847 -19.660 -17.343 1.00 0.00 ? 1553 PHE A HB2  5  
ATOM   9932  H HB3  . PHE A 1 73  ? -22.484 -20.068 -17.802 1.00 0.00 ? 1553 PHE A HB3  5  
ATOM   9933  H HD1  . PHE A 1 73  ? -23.060 -22.324 -18.661 1.00 0.00 ? 1553 PHE A HD1  5  
ATOM   9934  H HD2  . PHE A 1 73  ? -19.135 -21.347 -17.127 1.00 0.00 ? 1553 PHE A HD2  5  
ATOM   9935  H HE1  . PHE A 1 73  ? -22.419 -24.738 -18.663 1.00 0.00 ? 1553 PHE A HE1  5  
ATOM   9936  H HE2  . PHE A 1 73  ? -18.506 -23.677 -17.108 1.00 0.00 ? 1553 PHE A HE2  5  
ATOM   9937  H HZ   . PHE A 1 73  ? -20.146 -25.432 -17.925 1.00 0.00 ? 1553 PHE A HZ   5  
ATOM   9938  N N    . SER A 1 74  ? -19.100 -20.188 -20.567 1.00 0.00 ? 1554 SER A N    5  
ATOM   9939  C CA   . SER A 1 74  ? -18.169 -21.061 -21.279 1.00 0.00 ? 1554 SER A CA   5  
ATOM   9940  C C    . SER A 1 74  ? -16.775 -20.906 -20.678 1.00 0.00 ? 1554 SER A C    5  
ATOM   9941  O O    . SER A 1 74  ? -16.568 -19.997 -19.880 1.00 0.00 ? 1554 SER A O    5  
ATOM   9942  C CB   . SER A 1 74  ? -18.115 -20.699 -22.773 1.00 0.00 ? 1554 SER A CB   5  
ATOM   9943  O OG   . SER A 1 74  ? -19.384 -20.607 -23.406 1.00 0.00 ? 1554 SER A OG   5  
ATOM   9944  H H    . SER A 1 74  ? -18.692 -19.394 -20.079 1.00 0.00 ? 1554 SER A H    5  
ATOM   9945  H HA   . SER A 1 74  ? -18.483 -22.102 -21.169 1.00 0.00 ? 1554 SER A HA   5  
ATOM   9946  H HB2  . SER A 1 74  ? -17.584 -19.755 -22.902 1.00 0.00 ? 1554 SER A HB2  5  
ATOM   9947  H HB3  . SER A 1 74  ? -17.531 -21.477 -23.257 1.00 0.00 ? 1554 SER A HB3  5  
ATOM   9948  H HG   . SER A 1 74  ? -19.998 -21.228 -22.970 1.00 0.00 ? 1554 SER A HG   5  
ATOM   9949  N N    . ALA A 1 75  ? -15.793 -21.704 -21.110 1.00 0.00 ? 1555 ALA A N    5  
ATOM   9950  C CA   . ALA A 1 75  ? -14.392 -21.494 -20.760 1.00 0.00 ? 1555 ALA A CA   5  
ATOM   9951  C C    . ALA A 1 75  ? -13.531 -21.485 -22.018 1.00 0.00 ? 1555 ALA A C    5  
ATOM   9952  O O    . ALA A 1 75  ? -13.889 -22.078 -23.035 1.00 0.00 ? 1555 ALA A O    5  
ATOM   9953  C CB   . ALA A 1 75  ? -13.944 -22.549 -19.743 1.00 0.00 ? 1555 ALA A CB   5  
ATOM   9954  H H    . ALA A 1 75  ? -15.987 -22.435 -21.780 1.00 0.00 ? 1555 ALA A H    5  
ATOM   9955  H HA   . ALA A 1 75  ? -14.284 -20.515 -20.300 1.00 0.00 ? 1555 ALA A HA   5  
ATOM   9956  H HB1  . ALA A 1 75  ? -14.576 -22.489 -18.856 1.00 0.00 ? 1555 ALA A HB1  5  
ATOM   9957  H HB2  . ALA A 1 75  ? -14.022 -23.548 -20.180 1.00 0.00 ? 1555 ALA A HB2  5  
ATOM   9958  H HB3  . ALA A 1 75  ? -12.911 -22.364 -19.450 1.00 0.00 ? 1555 ALA A HB3  5  
ATOM   9959  N N    . GLY A 1 76  ? -12.408 -20.780 -21.933 1.00 0.00 ? 1556 GLY A N    5  
ATOM   9960  C CA   . GLY A 1 76  ? -11.519 -20.466 -23.041 1.00 0.00 ? 1556 GLY A CA   5  
ATOM   9961  C C    . GLY A 1 76  ? -10.259 -19.831 -22.472 1.00 0.00 ? 1556 GLY A C    5  
ATOM   9962  O O    . GLY A 1 76  ? -9.991  -19.966 -21.280 1.00 0.00 ? 1556 GLY A O    5  
ATOM   9963  H H    . GLY A 1 76  ? -12.151 -20.362 -21.041 1.00 0.00 ? 1556 GLY A H    5  
ATOM   9964  H HA2  . GLY A 1 76  ? -11.264 -21.378 -23.581 1.00 0.00 ? 1556 GLY A HA2  5  
ATOM   9965  H HA3  . GLY A 1 76  ? -12.016 -19.772 -23.724 1.00 0.00 ? 1556 GLY A HA3  5  
ATOM   9966  N N    . VAL A 1 77  ? -9.477  -19.135 -23.291 1.00 0.00 ? 1557 VAL A N    5  
ATOM   9967  C CA   . VAL A 1 77  ? -8.162  -18.633 -22.880 1.00 0.00 ? 1557 VAL A CA   5  
ATOM   9968  C C    . VAL A 1 77  ? -8.016  -17.171 -23.276 1.00 0.00 ? 1557 VAL A C    5  
ATOM   9969  O O    . VAL A 1 77  ? -8.394  -16.776 -24.372 1.00 0.00 ? 1557 VAL A O    5  
ATOM   9970  C CB   . VAL A 1 77  ? -7.061  -19.535 -23.475 1.00 0.00 ? 1557 VAL A CB   5  
ATOM   9971  C CG1  . VAL A 1 77  ? -5.698  -18.848 -23.624 1.00 0.00 ? 1557 VAL A CG1  5  
ATOM   9972  C CG2  . VAL A 1 77  ? -6.832  -20.733 -22.550 1.00 0.00 ? 1557 VAL A CG2  5  
ATOM   9973  H H    . VAL A 1 77  ? -9.784  -18.978 -24.253 1.00 0.00 ? 1557 VAL A H    5  
ATOM   9974  H HA   . VAL A 1 77  ? -8.079  -18.677 -21.794 1.00 0.00 ? 1557 VAL A HA   5  
ATOM   9975  H HB   . VAL A 1 77  ? -7.371  -19.893 -24.458 1.00 0.00 ? 1557 VAL A HB   5  
ATOM   9976  H HG11 . VAL A 1 77  ? -5.745  -18.092 -24.404 1.00 0.00 ? 1557 VAL A HG11 5  
ATOM   9977  H HG12 . VAL A 1 77  ? -5.422  -18.376 -22.678 1.00 0.00 ? 1557 VAL A HG12 5  
ATOM   9978  H HG13 . VAL A 1 77  ? -4.935  -19.577 -23.898 1.00 0.00 ? 1557 VAL A HG13 5  
ATOM   9979  H HG21 . VAL A 1 77  ? -6.201  -21.467 -23.053 1.00 0.00 ? 1557 VAL A HG21 5  
ATOM   9980  H HG22 . VAL A 1 77  ? -6.315  -20.399 -21.650 1.00 0.00 ? 1557 VAL A HG22 5  
ATOM   9981  H HG23 . VAL A 1 77  ? -7.781  -21.191 -22.269 1.00 0.00 ? 1557 VAL A HG23 5  
ATOM   9982  N N    . VAL A 1 78  ? -7.433  -16.364 -22.392 1.00 0.00 ? 1558 VAL A N    5  
ATOM   9983  C CA   . VAL A 1 78  ? -7.086  -14.989 -22.708 1.00 0.00 ? 1558 VAL A CA   5  
ATOM   9984  C C    . VAL A 1 78  ? -6.049  -14.997 -23.828 1.00 0.00 ? 1558 VAL A C    5  
ATOM   9985  O O    . VAL A 1 78  ? -5.008  -15.637 -23.668 1.00 0.00 ? 1558 VAL A O    5  
ATOM   9986  C CB   . VAL A 1 78  ? -6.506  -14.306 -21.455 1.00 0.00 ? 1558 VAL A CB   5  
ATOM   9987  C CG1  . VAL A 1 78  ? -6.110  -12.851 -21.737 1.00 0.00 ? 1558 VAL A CG1  5  
ATOM   9988  C CG2  . VAL A 1 78  ? -7.485  -14.298 -20.278 1.00 0.00 ? 1558 VAL A CG2  5  
ATOM   9989  H H    . VAL A 1 78  ? -7.088  -16.754 -21.520 1.00 0.00 ? 1558 VAL A H    5  
ATOM   9990  H HA   . VAL A 1 78  ? -7.984  -14.471 -23.038 1.00 0.00 ? 1558 VAL A HA   5  
ATOM   9991  H HB   . VAL A 1 78  ? -5.616  -14.858 -21.144 1.00 0.00 ? 1558 VAL A HB   5  
ATOM   9992  H HG11 . VAL A 1 78  ? -5.644  -12.406 -20.853 1.00 0.00 ? 1558 VAL A HG11 5  
ATOM   9993  H HG12 . VAL A 1 78  ? -5.385  -12.802 -22.545 1.00 0.00 ? 1558 VAL A HG12 5  
ATOM   9994  H HG13 . VAL A 1 78  ? -6.982  -12.266 -22.025 1.00 0.00 ? 1558 VAL A HG13 5  
ATOM   9995  H HG21 . VAL A 1 78  ? -7.030  -13.768 -19.448 1.00 0.00 ? 1558 VAL A HG21 5  
ATOM   9996  H HG22 . VAL A 1 78  ? -8.401  -13.780 -20.551 1.00 0.00 ? 1558 VAL A HG22 5  
ATOM   9997  H HG23 . VAL A 1 78  ? -7.711  -15.316 -19.956 1.00 0.00 ? 1558 VAL A HG23 5  
ATOM   9998  N N    . LYS A 1 79  ? -6.258  -14.244 -24.910 1.00 0.00 ? 1559 LYS A N    5  
ATOM   9999  C CA   . LYS A 1 79  ? -5.221  -14.021 -25.928 1.00 0.00 ? 1559 LYS A CA   5  
ATOM   10000 C C    . LYS A 1 79  ? -5.089  -12.538 -26.294 1.00 0.00 ? 1559 LYS A C    5  
ATOM   10001 O O    . LYS A 1 79  ? -4.412  -12.213 -27.270 1.00 0.00 ? 1559 LYS A O    5  
ATOM   10002 C CB   . LYS A 1 79  ? -5.443  -14.938 -27.151 1.00 0.00 ? 1559 LYS A CB   5  
ATOM   10003 C CG   . LYS A 1 79  ? -5.202  -16.415 -26.789 1.00 0.00 ? 1559 LYS A CG   5  
ATOM   10004 C CD   . LYS A 1 79  ? -5.025  -17.315 -28.018 1.00 0.00 ? 1559 LYS A CD   5  
ATOM   10005 C CE   . LYS A 1 79  ? -4.648  -18.740 -27.566 1.00 0.00 ? 1559 LYS A CE   5  
ATOM   10006 N NZ   . LYS A 1 79  ? -4.671  -19.716 -28.687 1.00 0.00 ? 1559 LYS A NZ   5  
ATOM   10007 H H    . LYS A 1 79  ? -7.160  -13.782 -25.033 1.00 0.00 ? 1559 LYS A H    5  
ATOM   10008 H HA   . LYS A 1 79  ? -4.255  -14.291 -25.493 1.00 0.00 ? 1559 LYS A HA   5  
ATOM   10009 H HB2  . LYS A 1 79  ? -6.455  -14.804 -27.539 1.00 0.00 ? 1559 LYS A HB2  5  
ATOM   10010 H HB3  . LYS A 1 79  ? -4.731  -14.667 -27.932 1.00 0.00 ? 1559 LYS A HB3  5  
ATOM   10011 H HG2  . LYS A 1 79  ? -4.295  -16.485 -26.185 1.00 0.00 ? 1559 LYS A HG2  5  
ATOM   10012 H HG3  . LYS A 1 79  ? -6.044  -16.776 -26.201 1.00 0.00 ? 1559 LYS A HG3  5  
ATOM   10013 H HD2  . LYS A 1 79  ? -5.951  -17.328 -28.596 1.00 0.00 ? 1559 LYS A HD2  5  
ATOM   10014 H HD3  . LYS A 1 79  ? -4.229  -16.916 -28.650 1.00 0.00 ? 1559 LYS A HD3  5  
ATOM   10015 H HE2  . LYS A 1 79  ? -3.650  -18.717 -27.121 1.00 0.00 ? 1559 LYS A HE2  5  
ATOM   10016 H HE3  . LYS A 1 79  ? -5.349  -19.070 -26.794 1.00 0.00 ? 1559 LYS A HE3  5  
ATOM   10017 H HZ1  . LYS A 1 79  ? -4.318  -20.616 -28.386 1.00 0.00 ? 1559 LYS A HZ1  5  
ATOM   10018 H HZ2  . LYS A 1 79  ? -5.633  -19.872 -29.002 1.00 0.00 ? 1559 LYS A HZ2  5  
ATOM   10019 H HZ3  . LYS A 1 79  ? -4.110  -19.409 -29.473 1.00 0.00 ? 1559 LYS A HZ3  5  
ATOM   10020 N N    . GLY A 1 80  ? -5.670  -11.629 -25.505 1.00 0.00 ? 1560 GLY A N    5  
ATOM   10021 C CA   . GLY A 1 80  ? -5.462  -10.197 -25.657 1.00 0.00 ? 1560 GLY A CA   5  
ATOM   10022 C C    . GLY A 1 80  ? -6.269  -9.404  -24.637 1.00 0.00 ? 1560 GLY A C    5  
ATOM   10023 O O    . GLY A 1 80  ? -6.923  -9.975  -23.760 1.00 0.00 ? 1560 GLY A O    5  
ATOM   10024 H H    . GLY A 1 80  ? -6.264  -11.909 -24.737 1.00 0.00 ? 1560 GLY A H    5  
ATOM   10025 H HA2  . GLY A 1 80  ? -4.405  -9.970  -25.523 1.00 0.00 ? 1560 GLY A HA2  5  
ATOM   10026 H HA3  . GLY A 1 80  ? -5.746  -9.887  -26.664 1.00 0.00 ? 1560 GLY A HA3  5  
ATOM   10027 N N    . HIS A 1 81  ? -6.218  -8.080  -24.779 1.00 0.00 ? 1561 HIS A N    5  
ATOM   10028 C CA   . HIS A 1 81  ? -6.721  -7.089  -23.828 1.00 0.00 ? 1561 HIS A CA   5  
ATOM   10029 C C    . HIS A 1 81  ? -7.341  -5.914  -24.578 1.00 0.00 ? 1561 HIS A C    5  
ATOM   10030 O O    . HIS A 1 81  ? -6.912  -5.586  -25.689 1.00 0.00 ? 1561 HIS A O    5  
ATOM   10031 C CB   . HIS A 1 81  ? -5.568  -6.524  -22.981 1.00 0.00 ? 1561 HIS A CB   5  
ATOM   10032 C CG   . HIS A 1 81  ? -5.312  -7.280  -21.712 1.00 0.00 ? 1561 HIS A CG   5  
ATOM   10033 N ND1  . HIS A 1 81  ? -4.496  -8.404  -21.560 1.00 0.00 ? 1561 HIS A ND1  5  
ATOM   10034 C CD2  . HIS A 1 81  ? -5.797  -6.897  -20.498 1.00 0.00 ? 1561 HIS A CD2  5  
ATOM   10035 C CE1  . HIS A 1 81  ? -4.504  -8.676  -20.246 1.00 0.00 ? 1561 HIS A CE1  5  
ATOM   10036 N NE2  . HIS A 1 81  ? -5.265  -7.779  -19.583 1.00 0.00 ? 1561 HIS A NE2  5  
ATOM   10037 H H    . HIS A 1 81  ? -5.773  -7.716  -25.611 1.00 0.00 ? 1561 HIS A H    5  
ATOM   10038 H HA   . HIS A 1 81  ? -7.461  -7.540  -23.166 1.00 0.00 ? 1561 HIS A HA   5  
ATOM   10039 H HB2  . HIS A 1 81  ? -4.654  -6.482  -23.576 1.00 0.00 ? 1561 HIS A HB2  5  
ATOM   10040 H HB3  . HIS A 1 81  ? -5.811  -5.498  -22.687 1.00 0.00 ? 1561 HIS A HB3  5  
ATOM   10041 H HD2  . HIS A 1 81  ? -6.466  -6.061  -20.319 1.00 0.00 ? 1561 HIS A HD2  5  
ATOM   10042 H HE1  . HIS A 1 81  ? -3.970  -9.507  -19.785 1.00 0.00 ? 1561 HIS A HE1  5  
ATOM   10043 H HE2  . HIS A 1 81  ? -5.417  -7.763  -18.583 1.00 0.00 ? 1561 HIS A HE2  5  
ATOM   10044 N N    . ARG A 1 82  ? -8.296  -5.236  -23.936 1.00 0.00 ? 1562 ARG A N    5  
ATOM   10045 C CA   . ARG A 1 82  ? -8.901  -4.003  -24.420 1.00 0.00 ? 1562 ARG A CA   5  
ATOM   10046 C C    . ARG A 1 82  ? -9.248  -3.151  -23.209 1.00 0.00 ? 1562 ARG A C    5  
ATOM   10047 O O    . ARG A 1 82  ? -9.422  -3.670  -22.108 1.00 0.00 ? 1562 ARG A O    5  
ATOM   10048 C CB   . ARG A 1 82  ? -10.118 -4.379  -25.293 1.00 0.00 ? 1562 ARG A CB   5  
ATOM   10049 C CG   . ARG A 1 82  ? -11.169 -3.295  -25.583 1.00 0.00 ? 1562 ARG A CG   5  
ATOM   10050 C CD   . ARG A 1 82  ? -12.237 -3.896  -26.507 1.00 0.00 ? 1562 ARG A CD   5  
ATOM   10051 N NE   . ARG A 1 82  ? -13.212 -2.894  -26.974 1.00 0.00 ? 1562 ARG A NE   5  
ATOM   10052 C CZ   . ARG A 1 82  ? -14.215 -3.133  -27.835 1.00 0.00 ? 1562 ARG A CZ   5  
ATOM   10053 N NH1  . ARG A 1 82  ? -14.404 -4.350  -28.346 1.00 0.00 ? 1562 ARG A NH1  5  
ATOM   10054 N NH2  . ARG A 1 82  ? -15.029 -2.145  -28.177 1.00 0.00 ? 1562 ARG A NH2  5  
ATOM   10055 H H    . ARG A 1 82  ? -8.611  -5.550  -23.019 1.00 0.00 ? 1562 ARG A H    5  
ATOM   10056 H HA   . ARG A 1 82  ? -8.177  -3.461  -25.035 1.00 0.00 ? 1562 ARG A HA   5  
ATOM   10057 H HB2  . ARG A 1 82  ? -9.730  -4.727  -26.249 1.00 0.00 ? 1562 ARG A HB2  5  
ATOM   10058 H HB3  . ARG A 1 82  ? -10.627 -5.217  -24.823 1.00 0.00 ? 1562 ARG A HB3  5  
ATOM   10059 H HG2  . ARG A 1 82  ? -11.632 -2.961  -24.649 1.00 0.00 ? 1562 ARG A HG2  5  
ATOM   10060 H HG3  . ARG A 1 82  ? -10.691 -2.444  -26.070 1.00 0.00 ? 1562 ARG A HG3  5  
ATOM   10061 H HD2  . ARG A 1 82  ? -11.746 -4.334  -27.379 1.00 0.00 ? 1562 ARG A HD2  5  
ATOM   10062 H HD3  . ARG A 1 82  ? -12.765 -4.686  -25.971 1.00 0.00 ? 1562 ARG A HD3  5  
ATOM   10063 H HE   . ARG A 1 82  ? -13.101 -1.954  -26.609 1.00 0.00 ? 1562 ARG A HE   5  
ATOM   10064 H HH11 . ARG A 1 82  ? -13.795 -5.122  -28.103 1.00 0.00 ? 1562 ARG A HH11 5  
ATOM   10065 H HH12 . ARG A 1 82  ? -15.155 -4.549  -28.998 1.00 0.00 ? 1562 ARG A HH12 5  
ATOM   10066 H HH21 . ARG A 1 82  ? -14.895 -1.197  -27.796 1.00 0.00 ? 1562 ARG A HH21 5  
ATOM   10067 H HH22 . ARG A 1 82  ? -15.793 -2.264  -28.830 1.00 0.00 ? 1562 ARG A HH22 5  
ATOM   10068 N N    . LYS A 1 83  ? -9.415  -1.853  -23.431 1.00 0.00 ? 1563 LYS A N    5  
ATOM   10069 C CA   . LYS A 1 83  ? -9.949  -0.908  -22.462 1.00 0.00 ? 1563 LYS A CA   5  
ATOM   10070 C C    . LYS A 1 83  ? -11.099 -0.204  -23.168 1.00 0.00 ? 1563 LYS A C    5  
ATOM   10071 O O    . LYS A 1 83  ? -10.920 0.309   -24.273 1.00 0.00 ? 1563 LYS A O    5  
ATOM   10072 C CB   . LYS A 1 83  ? -8.829  0.057   -22.041 1.00 0.00 ? 1563 LYS A CB   5  
ATOM   10073 C CG   . LYS A 1 83  ? -8.020  -0.458  -20.836 1.00 0.00 ? 1563 LYS A CG   5  
ATOM   10074 C CD   . LYS A 1 83  ? -8.839  -0.337  -19.537 1.00 0.00 ? 1563 LYS A CD   5  
ATOM   10075 C CE   . LYS A 1 83  ? -7.960  -0.188  -18.278 1.00 0.00 ? 1563 LYS A CE   5  
ATOM   10076 N NZ   . LYS A 1 83  ? -7.326  1.164   -18.162 1.00 0.00 ? 1563 LYS A NZ   5  
ATOM   10077 H H    . LYS A 1 83  ? -9.252  -1.491  -24.363 1.00 0.00 ? 1563 LYS A H    5  
ATOM   10078 H HA   . LYS A 1 83  ? -10.340 -1.437  -21.593 1.00 0.00 ? 1563 LYS A HA   5  
ATOM   10079 H HB2  . LYS A 1 83  ? -8.154  0.220   -22.886 1.00 0.00 ? 1563 LYS A HB2  5  
ATOM   10080 H HB3  . LYS A 1 83  ? -9.263  1.029   -21.794 1.00 0.00 ? 1563 LYS A HB3  5  
ATOM   10081 H HG2  . LYS A 1 83  ? -7.711  -1.503  -20.983 1.00 0.00 ? 1563 LYS A HG2  5  
ATOM   10082 H HG3  . LYS A 1 83  ? -7.118  0.145   -20.771 1.00 0.00 ? 1563 LYS A HG3  5  
ATOM   10083 H HD2  . LYS A 1 83  ? -9.530  0.507   -19.594 1.00 0.00 ? 1563 LYS A HD2  5  
ATOM   10084 H HD3  . LYS A 1 83  ? -9.452  -1.232  -19.443 1.00 0.00 ? 1563 LYS A HD3  5  
ATOM   10085 H HE2  . LYS A 1 83  ? -8.586  -0.354  -17.397 1.00 0.00 ? 1563 LYS A HE2  5  
ATOM   10086 H HE3  . LYS A 1 83  ? -7.176  -0.951  -18.288 1.00 0.00 ? 1563 LYS A HE3  5  
ATOM   10087 H HZ1  . LYS A 1 83  ? -8.017  1.905   -18.126 1.00 0.00 ? 1563 LYS A HZ1  5  
ATOM   10088 H HZ2  . LYS A 1 83  ? -6.782  1.229   -17.309 1.00 0.00 ? 1563 LYS A HZ2  5  
ATOM   10089 H HZ3  . LYS A 1 83  ? -6.694  1.357   -18.931 1.00 0.00 ? 1563 LYS A HZ3  5  
ATOM   10090 N N    . GLU A 1 84  ? -12.286 -0.221  -22.566 1.00 0.00 ? 1564 GLU A N    5  
ATOM   10091 C CA   . GLU A 1 84  ? -13.513 0.317   -23.151 1.00 0.00 ? 1564 GLU A CA   5  
ATOM   10092 C C    . GLU A 1 84  ? -14.385 0.789   -21.996 1.00 0.00 ? 1564 GLU A C    5  
ATOM   10093 O O    . GLU A 1 84  ? -14.403 0.140   -20.952 1.00 0.00 ? 1564 GLU A O    5  
ATOM   10094 C CB   . GLU A 1 84  ? -14.211 -0.789  -23.961 1.00 0.00 ? 1564 GLU A CB   5  
ATOM   10095 C CG   . GLU A 1 84  ? -15.433 -0.310  -24.753 1.00 0.00 ? 1564 GLU A CG   5  
ATOM   10096 C CD   . GLU A 1 84  ? -15.045 0.723   -25.827 1.00 0.00 ? 1564 GLU A CD   5  
ATOM   10097 O OE1  . GLU A 1 84  ? -14.657 0.304   -26.944 1.00 0.00 ? 1564 GLU A OE1  5  
ATOM   10098 O OE2  . GLU A 1 84  ? -15.125 1.947   -25.559 1.00 0.00 ? 1564 GLU A OE2  5  
ATOM   10099 H H    . GLU A 1 84  ? -12.384 -0.644  -21.644 1.00 0.00 ? 1564 GLU A H    5  
ATOM   10100 H HA   . GLU A 1 84  ? -13.275 1.164   -23.796 1.00 0.00 ? 1564 GLU A HA   5  
ATOM   10101 H HB2  . GLU A 1 84  ? -13.498 -1.221  -24.659 1.00 0.00 ? 1564 GLU A HB2  5  
ATOM   10102 H HB3  . GLU A 1 84  ? -14.524 -1.577  -23.280 1.00 0.00 ? 1564 GLU A HB3  5  
ATOM   10103 H HG2  . GLU A 1 84  ? -15.893 -1.177  -25.234 1.00 0.00 ? 1564 GLU A HG2  5  
ATOM   10104 H HG3  . GLU A 1 84  ? -16.171 0.113   -24.072 1.00 0.00 ? 1564 GLU A HG3  5  
ATOM   10105 N N    . SER A 1 85  ? -15.074 1.920   -22.157 1.00 0.00 ? 1565 SER A N    5  
ATOM   10106 C CA   . SER A 1 85  ? -15.874 2.554   -21.107 1.00 0.00 ? 1565 SER A CA   5  
ATOM   10107 C C    . SER A 1 85  ? -15.095 2.743   -19.786 1.00 0.00 ? 1565 SER A C    5  
ATOM   10108 O O    . SER A 1 85  ? -15.690 2.768   -18.705 1.00 0.00 ? 1565 SER A O    5  
ATOM   10109 C CB   . SER A 1 85  ? -17.184 1.768   -20.929 1.00 0.00 ? 1565 SER A CB   5  
ATOM   10110 O OG   . SER A 1 85  ? -17.881 1.651   -22.169 1.00 0.00 ? 1565 SER A OG   5  
ATOM   10111 H H    . SER A 1 85  ? -15.071 2.372   -23.063 1.00 0.00 ? 1565 SER A H    5  
ATOM   10112 H HA   . SER A 1 85  ? -16.133 3.555   -21.463 1.00 0.00 ? 1565 SER A HA   5  
ATOM   10113 H HB2  . SER A 1 85  ? -16.965 0.769   -20.538 1.00 0.00 ? 1565 SER A HB2  5  
ATOM   10114 H HB3  . SER A 1 85  ? -17.812 2.292   -20.208 1.00 0.00 ? 1565 SER A HB3  5  
ATOM   10115 H HG   . SER A 1 85  ? -18.710 1.152   -22.017 1.00 0.00 ? 1565 SER A HG   5  
ATOM   10116 N N    . GLY A 1 86  ? -13.764 2.885   -19.865 1.00 0.00 ? 1566 GLY A N    5  
ATOM   10117 C CA   . GLY A 1 86  ? -12.893 2.996   -18.701 1.00 0.00 ? 1566 GLY A CA   5  
ATOM   10118 C C    . GLY A 1 86  ? -12.886 1.717   -17.856 1.00 0.00 ? 1566 GLY A C    5  
ATOM   10119 O O    . GLY A 1 86  ? -12.744 1.799   -16.633 1.00 0.00 ? 1566 GLY A O    5  
ATOM   10120 H H    . GLY A 1 86  ? -13.328 2.899   -20.775 1.00 0.00 ? 1566 GLY A H    5  
ATOM   10121 H HA2  . GLY A 1 86  ? -11.874 3.193   -19.034 1.00 0.00 ? 1566 GLY A HA2  5  
ATOM   10122 H HA3  . GLY A 1 86  ? -13.230 3.832   -18.086 1.00 0.00 ? 1566 GLY A HA3  5  
ATOM   10123 N N    . GLU A 1 87  ? -13.050 0.541   -18.475 1.00 0.00 ? 1567 GLU A N    5  
ATOM   10124 C CA   . GLU A 1 87  ? -13.163 -0.746  -17.822 1.00 0.00 ? 1567 GLU A CA   5  
ATOM   10125 C C    . GLU A 1 87  ? -12.328 -1.739  -18.633 1.00 0.00 ? 1567 GLU A C    5  
ATOM   10126 O O    . GLU A 1 87  ? -12.045 -1.515  -19.816 1.00 0.00 ? 1567 GLU A O    5  
ATOM   10127 C CB   . GLU A 1 87  ? -14.655 -1.110  -17.758 1.00 0.00 ? 1567 GLU A CB   5  
ATOM   10128 C CG   . GLU A 1 87  ? -14.921 -2.429  -17.037 1.00 0.00 ? 1567 GLU A CG   5  
ATOM   10129 C CD   . GLU A 1 87  ? -14.375 -2.414  -15.603 1.00 0.00 ? 1567 GLU A CD   5  
ATOM   10130 O OE1  . GLU A 1 87  ? -15.081 -1.986  -14.662 1.00 0.00 ? 1567 GLU A OE1  5  
ATOM   10131 O OE2  . GLU A 1 87  ? -13.208 -2.832  -15.420 1.00 0.00 ? 1567 GLU A OE2  5  
ATOM   10132 H H    . GLU A 1 87  ? -13.182 0.481   -19.480 1.00 0.00 ? 1567 GLU A H    5  
ATOM   10133 H HA   . GLU A 1 87  ? -12.756 -0.678  -16.812 1.00 0.00 ? 1567 GLU A HA   5  
ATOM   10134 H HB2  . GLU A 1 87  ? -15.195 -0.315  -17.239 1.00 0.00 ? 1567 GLU A HB2  5  
ATOM   10135 H HB3  . GLU A 1 87  ? -15.054 -1.185  -18.765 1.00 0.00 ? 1567 GLU A HB3  5  
ATOM   10136 H HG2  . GLU A 1 87  ? -15.992 -2.617  -17.029 1.00 0.00 ? 1567 GLU A HG2  5  
ATOM   10137 H HG3  . GLU A 1 87  ? -14.436 -3.223  -17.605 1.00 0.00 ? 1567 GLU A HG3  5  
ATOM   10138 N N    . LEU A 1 88  ? -11.868 -2.809  -17.986 1.00 0.00 ? 1568 LEU A N    5  
ATOM   10139 C CA   . LEU A 1 88  ? -10.894 -3.732  -18.547 1.00 0.00 ? 1568 LEU A CA   5  
ATOM   10140 C C    . LEU A 1 88  ? -11.600 -4.904  -19.216 1.00 0.00 ? 1568 LEU A C    5  
ATOM   10141 O O    . LEU A 1 88  ? -12.528 -5.492  -18.653 1.00 0.00 ? 1568 LEU A O    5  
ATOM   10142 C CB   . LEU A 1 88  ? -9.960  -4.210  -17.425 1.00 0.00 ? 1568 LEU A CB   5  
ATOM   10143 C CG   . LEU A 1 88  ? -8.702  -4.946  -17.922 1.00 0.00 ? 1568 LEU A CG   5  
ATOM   10144 C CD1  . LEU A 1 88  ? -7.828  -4.025  -18.780 1.00 0.00 ? 1568 LEU A CD1  5  
ATOM   10145 C CD2  . LEU A 1 88  ? -7.908  -5.409  -16.701 1.00 0.00 ? 1568 LEU A CD2  5  
ATOM   10146 H H    . LEU A 1 88  ? -12.216 -2.998  -17.048 1.00 0.00 ? 1568 LEU A H    5  
ATOM   10147 H HA   . LEU A 1 88  ? -10.313 -3.200  -19.299 1.00 0.00 ? 1568 LEU A HA   5  
ATOM   10148 H HB2  . LEU A 1 88  ? -9.645  -3.342  -16.839 1.00 0.00 ? 1568 LEU A HB2  5  
ATOM   10149 H HB3  . LEU A 1 88  ? -10.520 -4.869  -16.761 1.00 0.00 ? 1568 LEU A HB3  5  
ATOM   10150 H HG   . LEU A 1 88  ? -8.984  -5.823  -18.500 1.00 0.00 ? 1568 LEU A HG   5  
ATOM   10151 H HD11 . LEU A 1 88  ? -8.272  -3.877  -19.766 1.00 0.00 ? 1568 LEU A HD11 5  
ATOM   10152 H HD12 . LEU A 1 88  ? -7.708  -3.058  -18.289 1.00 0.00 ? 1568 LEU A HD12 5  
ATOM   10153 H HD13 . LEU A 1 88  ? -6.841  -4.457  -18.923 1.00 0.00 ? 1568 LEU A HD13 5  
ATOM   10154 H HD21 . LEU A 1 88  ? -8.534  -6.039  -16.070 1.00 0.00 ? 1568 LEU A HD21 5  
ATOM   10155 H HD22 . LEU A 1 88  ? -7.044  -5.995  -17.021 1.00 0.00 ? 1568 LEU A HD22 5  
ATOM   10156 H HD23 . LEU A 1 88  ? -7.570  -4.550  -16.118 1.00 0.00 ? 1568 LEU A HD23 5  
ATOM   10157 N N    . TYR A 1 89  ? -11.097 -5.273  -20.389 1.00 0.00 ? 1569 TYR A N    5  
ATOM   10158 C CA   . TYR A 1 89  ? -11.618 -6.337  -21.227 1.00 0.00 ? 1569 TYR A CA   5  
ATOM   10159 C C    . TYR A 1 89  ? -10.484 -7.272  -21.604 1.00 0.00 ? 1569 TYR A C    5  
ATOM   10160 O O    . TYR A 1 89  ? -9.327  -6.863  -21.699 1.00 0.00 ? 1569 TYR A O    5  
ATOM   10161 C CB   . TYR A 1 89  ? -12.240 -5.737  -22.488 1.00 0.00 ? 1569 TYR A CB   5  
ATOM   10162 C CG   . TYR A 1 89  ? -13.642 -5.229  -22.282 1.00 0.00 ? 1569 TYR A CG   5  
ATOM   10163 C CD1  . TYR A 1 89  ? -13.857 -3.983  -21.675 1.00 0.00 ? 1569 TYR A CD1  5  
ATOM   10164 C CD2  . TYR A 1 89  ? -14.732 -6.010  -22.700 1.00 0.00 ? 1569 TYR A CD2  5  
ATOM   10165 C CE1  . TYR A 1 89  ? -15.161 -3.524  -21.458 1.00 0.00 ? 1569 TYR A CE1  5  
ATOM   10166 C CE2  . TYR A 1 89  ? -16.043 -5.557  -22.492 1.00 0.00 ? 1569 TYR A CE2  5  
ATOM   10167 C CZ   . TYR A 1 89  ? -16.269 -4.307  -21.868 1.00 0.00 ? 1569 TYR A CZ   5  
ATOM   10168 O OH   . TYR A 1 89  ? -17.549 -3.871  -21.672 1.00 0.00 ? 1569 TYR A OH   5  
ATOM   10169 H H    . TYR A 1 89  ? -10.311 -4.759  -20.777 1.00 0.00 ? 1569 TYR A H    5  
ATOM   10170 H HA   . TYR A 1 89  ? -12.383 -6.896  -20.692 1.00 0.00 ? 1569 TYR A HA   5  
ATOM   10171 H HB2  . TYR A 1 89  ? -11.620 -4.917  -22.845 1.00 0.00 ? 1569 TYR A HB2  5  
ATOM   10172 H HB3  . TYR A 1 89  ? -12.264 -6.495  -23.270 1.00 0.00 ? 1569 TYR A HB3  5  
ATOM   10173 H HD1  . TYR A 1 89  ? -13.022 -3.369  -21.367 1.00 0.00 ? 1569 TYR A HD1  5  
ATOM   10174 H HD2  . TYR A 1 89  ? -14.568 -6.964  -23.180 1.00 0.00 ? 1569 TYR A HD2  5  
ATOM   10175 H HE1  . TYR A 1 89  ? -15.292 -2.568  -20.980 1.00 0.00 ? 1569 TYR A HE1  5  
ATOM   10176 H HE2  . TYR A 1 89  ? -16.866 -6.175  -22.813 1.00 0.00 ? 1569 TYR A HE2  5  
ATOM   10177 H HH   . TYR A 1 89  ? -17.601 -2.993  -21.252 1.00 0.00 ? 1569 TYR A HH   5  
ATOM   10178 N N    . TYR A 1 90  ? -10.851 -8.514  -21.895 1.00 0.00 ? 1570 TYR A N    5  
ATOM   10179 C CA   . TYR A 1 90  ? -9.951  -9.568  -22.318 1.00 0.00 ? 1570 TYR A CA   5  
ATOM   10180 C C    . TYR A 1 90  ? -10.597 -10.207 -23.534 1.00 0.00 ? 1570 TYR A C    5  
ATOM   10181 O O    . TYR A 1 90  ? -11.795 -10.505 -23.514 1.00 0.00 ? 1570 TYR A O    5  
ATOM   10182 C CB   . TYR A 1 90  ? -9.778  -10.607 -21.199 1.00 0.00 ? 1570 TYR A CB   5  
ATOM   10183 C CG   . TYR A 1 90  ? -9.246  -10.074 -19.886 1.00 0.00 ? 1570 TYR A CG   5  
ATOM   10184 C CD1  . TYR A 1 90  ? -10.099 -9.441  -18.961 1.00 0.00 ? 1570 TYR A CD1  5  
ATOM   10185 C CD2  . TYR A 1 90  ? -7.881  -10.215 -19.593 1.00 0.00 ? 1570 TYR A CD2  5  
ATOM   10186 C CE1  . TYR A 1 90  ? -9.579  -8.940  -17.753 1.00 0.00 ? 1570 TYR A CE1  5  
ATOM   10187 C CE2  . TYR A 1 90  ? -7.366  -9.728  -18.386 1.00 0.00 ? 1570 TYR A CE2  5  
ATOM   10188 C CZ   . TYR A 1 90  ? -8.209  -9.090  -17.459 1.00 0.00 ? 1570 TYR A CZ   5  
ATOM   10189 O OH   . TYR A 1 90  ? -7.678  -8.639  -16.287 1.00 0.00 ? 1570 TYR A OH   5  
ATOM   10190 H H    . TYR A 1 90  ? -11.845 -8.754  -21.861 1.00 0.00 ? 1570 TYR A H    5  
ATOM   10191 H HA   . TYR A 1 90  ? -8.980  -9.151  -22.577 1.00 0.00 ? 1570 TYR A HA   5  
ATOM   10192 H HB2  . TYR A 1 90  ? -10.728 -11.088 -20.997 1.00 0.00 ? 1570 TYR A HB2  5  
ATOM   10193 H HB3  . TYR A 1 90  ? -9.102  -11.384 -21.563 1.00 0.00 ? 1570 TYR A HB3  5  
ATOM   10194 H HD1  . TYR A 1 90  ? -11.159 -9.338  -19.173 1.00 0.00 ? 1570 TYR A HD1  5  
ATOM   10195 H HD2  . TYR A 1 90  ? -7.218  -10.700 -20.291 1.00 0.00 ? 1570 TYR A HD2  5  
ATOM   10196 H HE1  . TYR A 1 90  ? -10.228 -8.442  -17.052 1.00 0.00 ? 1570 TYR A HE1  5  
ATOM   10197 H HE2  . TYR A 1 90  ? -6.316  -9.850  -18.171 1.00 0.00 ? 1570 TYR A HE2  5  
ATOM   10198 H HH   . TYR A 1 90  ? -8.320  -8.223  -15.682 1.00 0.00 ? 1570 TYR A HH   5  
ATOM   10199 N N    . SER A 1 91  ? -9.838  -10.416 -24.600 1.00 0.00 ? 1571 SER A N    5  
ATOM   10200 C CA   . SER A 1 91  ? -10.289 -11.208 -25.724 1.00 0.00 ? 1571 SER A CA   5  
ATOM   10201 C C    . SER A 1 91  ? -10.035 -12.662 -25.336 1.00 0.00 ? 1571 SER A C    5  
ATOM   10202 O O    . SER A 1 91  ? -8.888  -13.112 -25.260 1.00 0.00 ? 1571 SER A O    5  
ATOM   10203 C CB   . SER A 1 91  ? -9.602  -10.747 -27.014 1.00 0.00 ? 1571 SER A CB   5  
ATOM   10204 O OG   . SER A 1 91  ? -8.290  -10.267 -26.791 1.00 0.00 ? 1571 SER A OG   5  
ATOM   10205 H H    . SER A 1 91  ? -8.852  -10.165 -24.598 1.00 0.00 ? 1571 SER A H    5  
ATOM   10206 H HA   . SER A 1 91  ? -11.361 -11.067 -25.863 1.00 0.00 ? 1571 SER A HA   5  
ATOM   10207 H HB2  . SER A 1 91  ? -9.582  -11.564 -27.726 1.00 0.00 ? 1571 SER A HB2  5  
ATOM   10208 H HB3  . SER A 1 91  ? -10.187 -9.938  -27.448 1.00 0.00 ? 1571 SER A HB3  5  
ATOM   10209 H HG   . SER A 1 91  ? -7.969  -9.854  -27.617 1.00 0.00 ? 1571 SER A HG   5  
ATOM   10210 N N    . ILE A 1 92  ? -11.104 -13.370 -24.981 1.00 0.00 ? 1572 ILE A N    5  
ATOM   10211 C CA   . ILE A 1 92  ? -11.038 -14.779 -24.643 1.00 0.00 ? 1572 ILE A CA   5  
ATOM   10212 C C    . ILE A 1 92  ? -11.170 -15.509 -25.974 1.00 0.00 ? 1572 ILE A C    5  
ATOM   10213 O O    . ILE A 1 92  ? -12.220 -15.448 -26.615 1.00 0.00 ? 1572 ILE A O    5  
ATOM   10214 C CB   . ILE A 1 92  ? -12.131 -15.142 -23.610 1.00 0.00 ? 1572 ILE A CB   5  
ATOM   10215 C CG1  . ILE A 1 92  ? -12.146 -14.188 -22.387 1.00 0.00 ? 1572 ILE A CG1  5  
ATOM   10216 C CG2  . ILE A 1 92  ? -11.984 -16.586 -23.105 1.00 0.00 ? 1572 ILE A CG2  5  
ATOM   10217 C CD1  . ILE A 1 92  ? -10.777 -13.989 -21.730 1.00 0.00 ? 1572 ILE A CD1  5  
ATOM   10218 H H    . ILE A 1 92  ? -12.033 -12.959 -25.086 1.00 0.00 ? 1572 ILE A H    5  
ATOM   10219 H HA   . ILE A 1 92  ? -10.070 -15.000 -24.203 1.00 0.00 ? 1572 ILE A HA   5  
ATOM   10220 H HB   . ILE A 1 92  ? -13.102 -15.067 -24.096 1.00 0.00 ? 1572 ILE A HB   5  
ATOM   10221 H HG12 . ILE A 1 92  ? -12.518 -13.209 -22.692 1.00 0.00 ? 1572 ILE A HG12 5  
ATOM   10222 H HG13 . ILE A 1 92  ? -12.843 -14.575 -21.640 1.00 0.00 ? 1572 ILE A HG13 5  
ATOM   10223 H HG21 . ILE A 1 92  ? -12.763 -16.796 -22.363 1.00 0.00 ? 1572 ILE A HG21 5  
ATOM   10224 H HG22 . ILE A 1 92  ? -12.112 -17.278 -23.941 1.00 0.00 ? 1572 ILE A HG22 5  
ATOM   10225 H HG23 . ILE A 1 92  ? -11.006 -16.739 -22.650 1.00 0.00 ? 1572 ILE A HG23 5  
ATOM   10226 H HD11 . ILE A 1 92  ? -10.133 -13.389 -22.371 1.00 0.00 ? 1572 ILE A HD11 5  
ATOM   10227 H HD12 . ILE A 1 92  ? -10.907 -13.464 -20.783 1.00 0.00 ? 1572 ILE A HD12 5  
ATOM   10228 H HD13 . ILE A 1 92  ? -10.294 -14.943 -21.541 1.00 0.00 ? 1572 ILE A HD13 5  
ATOM   10229 N N    . GLU A 1 93  ? -10.082 -16.106 -26.453 1.00 0.00 ? 1573 GLU A N    5  
ATOM   10230 C CA   . GLU A 1 93  ? -10.154 -17.009 -27.583 1.00 0.00 ? 1573 GLU A CA   5  
ATOM   10231 C C    . GLU A 1 93  ? -10.871 -18.257 -27.088 1.00 0.00 ? 1573 GLU A C    5  
ATOM   10232 O O    . GLU A 1 93  ? -10.563 -18.788 -26.012 1.00 0.00 ? 1573 GLU A O    5  
ATOM   10233 C CB   . GLU A 1 93  ? -8.766  -17.294 -28.161 1.00 0.00 ? 1573 GLU A CB   5  
ATOM   10234 C CG   . GLU A 1 93  ? -8.805  -18.129 -29.453 1.00 0.00 ? 1573 GLU A CG   5  
ATOM   10235 C CD   . GLU A 1 93  ? -8.564  -19.633 -29.219 1.00 0.00 ? 1573 GLU A CD   5  
ATOM   10236 O OE1  . GLU A 1 93  ? -7.379  -20.029 -29.131 1.00 0.00 ? 1573 GLU A OE1  5  
ATOM   10237 O OE2  . GLU A 1 93  ? -9.549  -20.403 -29.127 1.00 0.00 ? 1573 GLU A OE2  5  
ATOM   10238 H H    . GLU A 1 93  ? -9.265  -16.170 -25.858 1.00 0.00 ? 1573 GLU A H    5  
ATOM   10239 H HA   . GLU A 1 93  ? -10.753 -16.538 -28.354 1.00 0.00 ? 1573 GLU A HA   5  
ATOM   10240 H HB2  . GLU A 1 93  ? -8.326  -16.332 -28.413 1.00 0.00 ? 1573 GLU A HB2  5  
ATOM   10241 H HB3  . GLU A 1 93  ? -8.142  -17.777 -27.410 1.00 0.00 ? 1573 GLU A HB3  5  
ATOM   10242 H HG2  . GLU A 1 93  ? -9.752  -17.975 -29.970 1.00 0.00 ? 1573 GLU A HG2  5  
ATOM   10243 H HG3  . GLU A 1 93  ? -8.023  -17.753 -30.117 1.00 0.00 ? 1573 GLU A HG3  5  
ATOM   10244 N N    . LYS A 1 94  ? -11.851 -18.698 -27.869 1.00 0.00 ? 1574 LYS A N    5  
ATOM   10245 C CA   . LYS A 1 94  ? -12.593 -19.913 -27.625 1.00 0.00 ? 1574 LYS A CA   5  
ATOM   10246 C C    . LYS A 1 94  ? -12.878 -20.512 -28.991 1.00 0.00 ? 1574 LYS A C    5  
ATOM   10247 O O    . LYS A 1 94  ? -13.293 -19.779 -29.890 1.00 0.00 ? 1574 LYS A O    5  
ATOM   10248 C CB   . LYS A 1 94  ? -13.867 -19.552 -26.844 1.00 0.00 ? 1574 LYS A CB   5  
ATOM   10249 C CG   . LYS A 1 94  ? -14.467 -20.808 -26.205 1.00 0.00 ? 1574 LYS A CG   5  
ATOM   10250 C CD   . LYS A 1 94  ? -15.749 -20.541 -25.401 1.00 0.00 ? 1574 LYS A CD   5  
ATOM   10251 C CE   . LYS A 1 94  ? -16.939 -19.979 -26.212 1.00 0.00 ? 1574 LYS A CE   5  
ATOM   10252 N NZ   . LYS A 1 94  ? -17.825 -21.033 -26.787 1.00 0.00 ? 1574 LYS A NZ   5  
ATOM   10253 H H    . LYS A 1 94  ? -12.057 -18.211 -28.738 1.00 0.00 ? 1574 LYS A H    5  
ATOM   10254 H HA   . LYS A 1 94  ? -11.963 -20.593 -27.046 1.00 0.00 ? 1574 LYS A HA   5  
ATOM   10255 H HB2  . LYS A 1 94  ? -13.618 -18.843 -26.051 1.00 0.00 ? 1574 LYS A HB2  5  
ATOM   10256 H HB3  . LYS A 1 94  ? -14.583 -19.075 -27.518 1.00 0.00 ? 1574 LYS A HB3  5  
ATOM   10257 H HG2  . LYS A 1 94  ? -14.673 -21.555 -26.969 1.00 0.00 ? 1574 LYS A HG2  5  
ATOM   10258 H HG3  . LYS A 1 94  ? -13.710 -21.201 -25.522 1.00 0.00 ? 1574 LYS A HG3  5  
ATOM   10259 H HD2  . LYS A 1 94  ? -16.037 -21.479 -24.926 1.00 0.00 ? 1574 LYS A HD2  5  
ATOM   10260 H HD3  . LYS A 1 94  ? -15.503 -19.827 -24.612 1.00 0.00 ? 1574 LYS A HD3  5  
ATOM   10261 H HE2  . LYS A 1 94  ? -17.541 -19.357 -25.543 1.00 0.00 ? 1574 LYS A HE2  5  
ATOM   10262 H HE3  . LYS A 1 94  ? -16.568 -19.334 -27.012 1.00 0.00 ? 1574 LYS A HE3  5  
ATOM   10263 H HZ1  . LYS A 1 94  ? -18.601 -20.610 -27.283 1.00 0.00 ? 1574 LYS A HZ1  5  
ATOM   10264 H HZ2  . LYS A 1 94  ? -17.350 -21.640 -27.461 1.00 0.00 ? 1574 LYS A HZ2  5  
ATOM   10265 H HZ3  . LYS A 1 94  ? -18.229 -21.624 -26.071 1.00 0.00 ? 1574 LYS A HZ3  5  
ATOM   10266 N N    . GLU A 1 95  ? -12.688 -21.822 -29.146 1.00 0.00 ? 1575 GLU A N    5  
ATOM   10267 C CA   . GLU A 1 95  ? -12.939 -22.556 -30.388 1.00 0.00 ? 1575 GLU A CA   5  
ATOM   10268 C C    . GLU A 1 95  ? -12.247 -21.914 -31.606 1.00 0.00 ? 1575 GLU A C    5  
ATOM   10269 O O    . GLU A 1 95  ? -12.754 -21.962 -32.731 1.00 0.00 ? 1575 GLU A O    5  
ATOM   10270 C CB   . GLU A 1 95  ? -14.455 -22.797 -30.555 1.00 0.00 ? 1575 GLU A CB   5  
ATOM   10271 C CG   . GLU A 1 95  ? -15.031 -23.678 -29.431 1.00 0.00 ? 1575 GLU A CG   5  
ATOM   10272 C CD   . GLU A 1 95  ? -16.568 -23.697 -29.462 1.00 0.00 ? 1575 GLU A CD   5  
ATOM   10273 O OE1  . GLU A 1 95  ? -17.161 -24.530 -30.192 1.00 0.00 ? 1575 GLU A OE1  5  
ATOM   10274 O OE2  . GLU A 1 95  ? -17.184 -22.870 -28.746 1.00 0.00 ? 1575 GLU A OE2  5  
ATOM   10275 H H    . GLU A 1 95  ? -12.333 -22.357 -28.367 1.00 0.00 ? 1575 GLU A H    5  
ATOM   10276 H HA   . GLU A 1 95  ? -12.462 -23.529 -30.273 1.00 0.00 ? 1575 GLU A HA   5  
ATOM   10277 H HB2  . GLU A 1 95  ? -14.976 -21.839 -30.559 1.00 0.00 ? 1575 GLU A HB2  5  
ATOM   10278 H HB3  . GLU A 1 95  ? -14.640 -23.297 -31.504 1.00 0.00 ? 1575 GLU A HB3  5  
ATOM   10279 H HG2  . GLU A 1 95  ? -14.650 -24.693 -29.547 1.00 0.00 ? 1575 GLU A HG2  5  
ATOM   10280 H HG3  . GLU A 1 95  ? -14.712 -23.310 -28.452 1.00 0.00 ? 1575 GLU A HG3  5  
ATOM   10281 N N    . GLY A 1 96  ? -11.067 -21.320 -31.390 1.00 0.00 ? 1576 GLY A N    5  
ATOM   10282 C CA   . GLY A 1 96  ? -10.216 -20.808 -32.457 1.00 0.00 ? 1576 GLY A CA   5  
ATOM   10283 C C    . GLY A 1 96  ? -10.613 -19.412 -32.926 1.00 0.00 ? 1576 GLY A C    5  
ATOM   10284 O O    . GLY A 1 96  ? -10.142 -18.988 -33.982 1.00 0.00 ? 1576 GLY A O    5  
ATOM   10285 H H    . GLY A 1 96  ? -10.699 -21.244 -30.444 1.00 0.00 ? 1576 GLY A H    5  
ATOM   10286 H HA2  . GLY A 1 96  ? -9.194  -20.770 -32.082 1.00 0.00 ? 1576 GLY A HA2  5  
ATOM   10287 H HA3  . GLY A 1 96  ? -10.246 -21.492 -33.304 1.00 0.00 ? 1576 GLY A HA3  5  
ATOM   10288 N N    . GLN A 1 97  ? -11.454 -18.688 -32.175 1.00 0.00 ? 1577 GLN A N    5  
ATOM   10289 C CA   . GLN A 1 97  ? -11.858 -17.322 -32.517 1.00 0.00 ? 1577 GLN A CA   5  
ATOM   10290 C C    . GLN A 1 97  ? -11.926 -16.465 -31.254 1.00 0.00 ? 1577 GLN A C    5  
ATOM   10291 O O    . GLN A 1 97  ? -12.192 -16.977 -30.169 1.00 0.00 ? 1577 GLN A O    5  
ATOM   10292 C CB   . GLN A 1 97  ? -13.158 -17.335 -33.352 1.00 0.00 ? 1577 GLN A CB   5  
ATOM   10293 C CG   . GLN A 1 97  ? -14.361 -18.086 -32.757 1.00 0.00 ? 1577 GLN A CG   5  
ATOM   10294 C CD   . GLN A 1 97  ? -15.157 -17.273 -31.728 1.00 0.00 ? 1577 GLN A CD   5  
ATOM   10295 O OE1  . GLN A 1 97  ? -15.830 -16.299 -32.063 1.00 0.00 ? 1577 GLN A OE1  5  
ATOM   10296 N NE2  . GLN A 1 97  ? -15.103 -17.653 -30.464 1.00 0.00 ? 1577 GLN A NE2  5  
ATOM   10297 H H    . GLN A 1 97  ? -11.808 -19.084 -31.305 1.00 0.00 ? 1577 GLN A H    5  
ATOM   10298 H HA   . GLN A 1 97  ? -11.085 -16.884 -33.148 1.00 0.00 ? 1577 GLN A HA   5  
ATOM   10299 H HB2  . GLN A 1 97  ? -13.451 -16.306 -33.579 1.00 0.00 ? 1577 GLN A HB2  5  
ATOM   10300 H HB3  . GLN A 1 97  ? -12.919 -17.813 -34.301 1.00 0.00 ? 1577 GLN A HB3  5  
ATOM   10301 H HG2  . GLN A 1 97  ? -15.041 -18.330 -33.573 1.00 0.00 ? 1577 GLN A HG2  5  
ATOM   10302 H HG3  . GLN A 1 97  ? -14.039 -19.034 -32.329 1.00 0.00 ? 1577 GLN A HG3  5  
ATOM   10303 H HE21 . GLN A 1 97  ? -14.471 -18.411 -30.203 1.00 0.00 ? 1577 GLN A HE21 5  
ATOM   10304 H HE22 . GLN A 1 97  ? -15.608 -17.140 -29.759 1.00 0.00 ? 1577 GLN A HE22 5  
ATOM   10305 N N    . ARG A 1 98  ? -11.622 -15.169 -31.370 1.00 0.00 ? 1578 ARG A N    5  
ATOM   10306 C CA   . ARG A 1 98  ? -11.579 -14.253 -30.224 1.00 0.00 ? 1578 ARG A CA   5  
ATOM   10307 C C    . ARG A 1 98  ? -12.995 -13.774 -29.915 1.00 0.00 ? 1578 ARG A C    5  
ATOM   10308 O O    . ARG A 1 98  ? -13.763 -13.486 -30.836 1.00 0.00 ? 1578 ARG A O    5  
ATOM   10309 C CB   . ARG A 1 98  ? -10.657 -13.056 -30.525 1.00 0.00 ? 1578 ARG A CB   5  
ATOM   10310 C CG   . ARG A 1 98  ? -9.176  -13.479 -30.615 1.00 0.00 ? 1578 ARG A CG   5  
ATOM   10311 C CD   . ARG A 1 98  ? -8.232  -12.291 -30.849 1.00 0.00 ? 1578 ARG A CD   5  
ATOM   10312 N NE   . ARG A 1 98  ? -8.407  -11.690 -32.188 1.00 0.00 ? 1578 ARG A NE   5  
ATOM   10313 C CZ   . ARG A 1 98  ? -7.772  -10.604 -32.655 1.00 0.00 ? 1578 ARG A CZ   5  
ATOM   10314 N NH1  . ARG A 1 98  ? -6.853  -9.981  -31.916 1.00 0.00 ? 1578 ARG A NH1  5  
ATOM   10315 N NH2  . ARG A 1 98  ? -8.059  -10.139 -33.866 1.00 0.00 ? 1578 ARG A NH2  5  
ATOM   10316 H H    . ARG A 1 98  ? -11.489 -14.779 -32.296 1.00 0.00 ? 1578 ARG A H    5  
ATOM   10317 H HA   . ARG A 1 98  ? -11.198 -14.775 -29.348 1.00 0.00 ? 1578 ARG A HA   5  
ATOM   10318 H HB2  . ARG A 1 98  ? -10.969 -12.581 -31.458 1.00 0.00 ? 1578 ARG A HB2  5  
ATOM   10319 H HB3  . ARG A 1 98  ? -10.759 -12.319 -29.727 1.00 0.00 ? 1578 ARG A HB3  5  
ATOM   10320 H HG2  . ARG A 1 98  ? -8.892  -13.959 -29.678 1.00 0.00 ? 1578 ARG A HG2  5  
ATOM   10321 H HG3  . ARG A 1 98  ? -9.044  -14.199 -31.422 1.00 0.00 ? 1578 ARG A HG3  5  
ATOM   10322 H HD2  . ARG A 1 98  ? -8.409  -11.538 -30.080 1.00 0.00 ? 1578 ARG A HD2  5  
ATOM   10323 H HD3  . ARG A 1 98  ? -7.203  -12.644 -30.759 1.00 0.00 ? 1578 ARG A HD3  5  
ATOM   10324 H HE   . ARG A 1 98  ? -9.075  -12.154 -32.796 1.00 0.00 ? 1578 ARG A HE   5  
ATOM   10325 H HH11 . ARG A 1 98  ? -6.611  -10.318 -30.995 1.00 0.00 ? 1578 ARG A HH11 5  
ATOM   10326 H HH12 . ARG A 1 98  ? -6.367  -9.154  -32.245 1.00 0.00 ? 1578 ARG A HH12 5  
ATOM   10327 H HH21 . ARG A 1 98  ? -8.746  -10.594 -34.457 1.00 0.00 ? 1578 ARG A HH21 5  
ATOM   10328 H HH22 . ARG A 1 98  ? -7.601  -9.317  -34.250 1.00 0.00 ? 1578 ARG A HH22 5  
ATOM   10329 N N    . LYS A 1 99  ? -13.311 -13.614 -28.627 1.00 0.00 ? 1579 LYS A N    5  
ATOM   10330 C CA   . LYS A 1 99  ? -14.578 -13.067 -28.144 1.00 0.00 ? 1579 LYS A CA   5  
ATOM   10331 C C    . LYS A 1 99  ? -14.227 -12.114 -27.008 1.00 0.00 ? 1579 LYS A C    5  
ATOM   10332 O O    . LYS A 1 99  ? -13.484 -12.494 -26.107 1.00 0.00 ? 1579 LYS A O    5  
ATOM   10333 C CB   . LYS A 1 99  ? -15.452 -14.257 -27.677 1.00 0.00 ? 1579 LYS A CB   5  
ATOM   10334 C CG   . LYS A 1 99  ? -16.970 -14.014 -27.622 1.00 0.00 ? 1579 LYS A CG   5  
ATOM   10335 C CD   . LYS A 1 99  ? -17.411 -12.742 -26.884 1.00 0.00 ? 1579 LYS A CD   5  
ATOM   10336 C CE   . LYS A 1 99  ? -18.927 -12.715 -26.645 1.00 0.00 ? 1579 LYS A CE   5  
ATOM   10337 N NZ   . LYS A 1 99  ? -19.347 -11.457 -25.959 1.00 0.00 ? 1579 LYS A NZ   5  
ATOM   10338 H H    . LYS A 1 99  ? -12.671 -13.961 -27.915 1.00 0.00 ? 1579 LYS A H    5  
ATOM   10339 H HA   . LYS A 1 99  ? -15.074 -12.531 -28.958 1.00 0.00 ? 1579 LYS A HA   5  
ATOM   10340 H HB2  . LYS A 1 99  ? -15.291 -15.093 -28.360 1.00 0.00 ? 1579 LYS A HB2  5  
ATOM   10341 H HB3  . LYS A 1 99  ? -15.110 -14.583 -26.695 1.00 0.00 ? 1579 LYS A HB3  5  
ATOM   10342 H HG2  . LYS A 1 99  ? -17.351 -13.966 -28.645 1.00 0.00 ? 1579 LYS A HG2  5  
ATOM   10343 H HG3  . LYS A 1 99  ? -17.413 -14.879 -27.129 1.00 0.00 ? 1579 LYS A HG3  5  
ATOM   10344 H HD2  . LYS A 1 99  ? -16.896 -12.691 -25.923 1.00 0.00 ? 1579 LYS A HD2  5  
ATOM   10345 H HD3  . LYS A 1 99  ? -17.148 -11.875 -27.493 1.00 0.00 ? 1579 LYS A HD3  5  
ATOM   10346 H HE2  . LYS A 1 99  ? -19.441 -12.801 -27.607 1.00 0.00 ? 1579 LYS A HE2  5  
ATOM   10347 H HE3  . LYS A 1 99  ? -19.207 -13.576 -26.039 1.00 0.00 ? 1579 LYS A HE3  5  
ATOM   10348 H HZ1  . LYS A 1 99  ? -19.193 -10.652 -26.554 1.00 0.00 ? 1579 LYS A HZ1  5  
ATOM   10349 H HZ2  . LYS A 1 99  ? -20.337 -11.482 -25.740 1.00 0.00 ? 1579 LYS A HZ2  5  
ATOM   10350 H HZ3  . LYS A 1 99  ? -18.824 -11.306 -25.102 1.00 0.00 ? 1579 LYS A HZ3  5  
ATOM   10351 N N    . TRP A 1 100 ? -14.736 -10.885 -27.024 1.00 0.00 ? 1580 TRP A N    5  
ATOM   10352 C CA   . TRP A 1 100 ? -14.451 -9.916  -25.968 1.00 0.00 ? 1580 TRP A CA   5  
ATOM   10353 C C    . TRP A 1 100 ? -15.337 -10.199 -24.758 1.00 0.00 ? 1580 TRP A C    5  
ATOM   10354 O O    . TRP A 1 100 ? -16.554 -10.325 -24.902 1.00 0.00 ? 1580 TRP A O    5  
ATOM   10355 C CB   . TRP A 1 100 ? -14.707 -8.497  -26.498 1.00 0.00 ? 1580 TRP A CB   5  
ATOM   10356 C CG   . TRP A 1 100 ? -13.670 -8.049  -27.472 1.00 0.00 ? 1580 TRP A CG   5  
ATOM   10357 C CD1  . TRP A 1 100 ? -13.833 -7.837  -28.796 1.00 0.00 ? 1580 TRP A CD1  5  
ATOM   10358 C CD2  . TRP A 1 100 ? -12.274 -7.758  -27.193 1.00 0.00 ? 1580 TRP A CD2  5  
ATOM   10359 N NE1  . TRP A 1 100 ? -12.628 -7.448  -29.351 1.00 0.00 ? 1580 TRP A NE1  5  
ATOM   10360 C CE2  . TRP A 1 100 ? -11.621 -7.408  -28.410 1.00 0.00 ? 1580 TRP A CE2  5  
ATOM   10361 C CE3  . TRP A 1 100 ? -11.495 -7.795  -26.021 1.00 0.00 ? 1580 TRP A CE3  5  
ATOM   10362 C CZ2  . TRP A 1 100 ? -10.251 -7.130  -28.468 1.00 0.00 ? 1580 TRP A CZ2  5  
ATOM   10363 C CZ3  . TRP A 1 100 ? -10.111 -7.536  -26.070 1.00 0.00 ? 1580 TRP A CZ3  5  
ATOM   10364 C CH2  . TRP A 1 100 ? -9.493  -7.200  -27.287 1.00 0.00 ? 1580 TRP A CH2  5  
ATOM   10365 H H    . TRP A 1 100 ? -15.323 -10.587 -27.793 1.00 0.00 ? 1580 TRP A H    5  
ATOM   10366 H HA   . TRP A 1 100 ? -13.396 -10.011 -25.683 1.00 0.00 ? 1580 TRP A HA   5  
ATOM   10367 H HB2  . TRP A 1 100 ? -15.698 -8.443  -26.954 1.00 0.00 ? 1580 TRP A HB2  5  
ATOM   10368 H HB3  . TRP A 1 100 ? -14.691 -7.799  -25.661 1.00 0.00 ? 1580 TRP A HB3  5  
ATOM   10369 H HD1  . TRP A 1 100 ? -14.765 -7.956  -29.339 1.00 0.00 ? 1580 TRP A HD1  5  
ATOM   10370 H HE1  . TRP A 1 100 ? -12.528 -7.226  -30.337 1.00 0.00 ? 1580 TRP A HE1  5  
ATOM   10371 H HE3  . TRP A 1 100 ? -11.976 -8.031  -25.077 1.00 0.00 ? 1580 TRP A HE3  5  
ATOM   10372 H HZ2  . TRP A 1 100 ? -9.785  -6.866  -29.406 1.00 0.00 ? 1580 TRP A HZ2  5  
ATOM   10373 H HZ3  . TRP A 1 100 ? -9.518  -7.591  -25.168 1.00 0.00 ? 1580 TRP A HZ3  5  
ATOM   10374 H HH2  . TRP A 1 100 ? -8.432  -6.994  -27.314 1.00 0.00 ? 1580 TRP A HH2  5  
ATOM   10375 N N    . TYR A 1 101 ? -14.732 -10.233 -23.568 1.00 0.00 ? 1581 TYR A N    5  
ATOM   10376 C CA   . TYR A 1 101 ? -15.427 -10.281 -22.283 1.00 0.00 ? 1581 TYR A CA   5  
ATOM   10377 C C    . TYR A 1 101 ? -14.788 -9.273  -21.328 1.00 0.00 ? 1581 TYR A C    5  
ATOM   10378 O O    . TYR A 1 101 ? -13.642 -8.867  -21.517 1.00 0.00 ? 1581 TYR A O    5  
ATOM   10379 C CB   . TYR A 1 101 ? -15.365 -11.705 -21.724 1.00 0.00 ? 1581 TYR A CB   5  
ATOM   10380 C CG   . TYR A 1 101 ? -16.254 -12.687 -22.450 1.00 0.00 ? 1581 TYR A CG   5  
ATOM   10381 C CD1  . TYR A 1 101 ? -17.636 -12.691 -22.199 1.00 0.00 ? 1581 TYR A CD1  5  
ATOM   10382 C CD2  . TYR A 1 101 ? -15.709 -13.600 -23.371 1.00 0.00 ? 1581 TYR A CD2  5  
ATOM   10383 C CE1  . TYR A 1 101 ? -18.465 -13.614 -22.847 1.00 0.00 ? 1581 TYR A CE1  5  
ATOM   10384 C CE2  . TYR A 1 101 ? -16.530 -14.553 -23.997 1.00 0.00 ? 1581 TYR A CE2  5  
ATOM   10385 C CZ   . TYR A 1 101 ? -17.923 -14.565 -23.742 1.00 0.00 ? 1581 TYR A CZ   5  
ATOM   10386 O OH   . TYR A 1 101 ? -18.725 -15.481 -24.356 1.00 0.00 ? 1581 TYR A OH   5  
ATOM   10387 H H    . TYR A 1 101 ? -13.713 -10.211 -23.525 1.00 0.00 ? 1581 TYR A H    5  
ATOM   10388 H HA   . TYR A 1 101 ? -16.480 -10.016 -22.415 1.00 0.00 ? 1581 TYR A HA   5  
ATOM   10389 H HB2  . TYR A 1 101 ? -14.333 -12.051 -21.749 1.00 0.00 ? 1581 TYR A HB2  5  
ATOM   10390 H HB3  . TYR A 1 101 ? -15.684 -11.694 -20.682 1.00 0.00 ? 1581 TYR A HB3  5  
ATOM   10391 H HD1  . TYR A 1 101 ? -18.073 -11.982 -21.507 1.00 0.00 ? 1581 TYR A HD1  5  
ATOM   10392 H HD2  . TYR A 1 101 ? -14.656 -13.576 -23.598 1.00 0.00 ? 1581 TYR A HD2  5  
ATOM   10393 H HE1  . TYR A 1 101 ? -19.516 -13.581 -22.649 1.00 0.00 ? 1581 TYR A HE1  5  
ATOM   10394 H HE2  . TYR A 1 101 ? -16.090 -15.269 -24.673 1.00 0.00 ? 1581 TYR A HE2  5  
ATOM   10395 H HH   . TYR A 1 101 ? -19.662 -15.422 -24.099 1.00 0.00 ? 1581 TYR A HH   5  
ATOM   10396 N N    . LYS A 1 102 ? -15.525 -8.875  -20.292 1.00 0.00 ? 1582 LYS A N    5  
ATOM   10397 C CA   . LYS A 1 102 ? -15.100 -7.822  -19.343 1.00 0.00 ? 1582 LYS A CA   5  
ATOM   10398 C C    . LYS A 1 102 ? -14.575 -8.452  -18.066 1.00 0.00 ? 1582 LYS A C    5  
ATOM   10399 O O    . LYS A 1 102 ? -14.975 -9.574  -17.777 1.00 0.00 ? 1582 LYS A O    5  
ATOM   10400 C CB   . LYS A 1 102 ? -16.264 -6.841  -19.091 1.00 0.00 ? 1582 LYS A CB   5  
ATOM   10401 C CG   . LYS A 1 102 ? -17.463 -7.419  -18.311 1.00 0.00 ? 1582 LYS A CG   5  
ATOM   10402 C CD   . LYS A 1 102 ? -18.697 -6.515  -18.441 1.00 0.00 ? 1582 LYS A CD   5  
ATOM   10403 C CE   . LYS A 1 102 ? -19.817 -6.948  -17.476 1.00 0.00 ? 1582 LYS A CE   5  
ATOM   10404 N NZ   . LYS A 1 102 ? -21.109 -6.298  -17.795 1.00 0.00 ? 1582 LYS A NZ   5  
ATOM   10405 H H    . LYS A 1 102 ? -16.423 -9.333  -20.167 1.00 0.00 ? 1582 LYS A H    5  
ATOM   10406 H HA   . LYS A 1 102 ? -14.288 -7.247  -19.796 1.00 0.00 ? 1582 LYS A HA   5  
ATOM   10407 H HB2  . LYS A 1 102 ? -15.884 -5.978  -18.539 1.00 0.00 ? 1582 LYS A HB2  5  
ATOM   10408 H HB3  . LYS A 1 102 ? -16.602 -6.494  -20.063 1.00 0.00 ? 1582 LYS A HB3  5  
ATOM   10409 H HG2  . LYS A 1 102 ? -17.720 -8.405  -18.698 1.00 0.00 ? 1582 LYS A HG2  5  
ATOM   10410 H HG3  . LYS A 1 102 ? -17.186 -7.516  -17.261 1.00 0.00 ? 1582 LYS A HG3  5  
ATOM   10411 H HD2  . LYS A 1 102 ? -18.418 -5.481  -18.223 1.00 0.00 ? 1582 LYS A HD2  5  
ATOM   10412 H HD3  . LYS A 1 102 ? -19.060 -6.571  -19.468 1.00 0.00 ? 1582 LYS A HD3  5  
ATOM   10413 H HE2  . LYS A 1 102 ? -19.954 -8.031  -17.531 1.00 0.00 ? 1582 LYS A HE2  5  
ATOM   10414 H HE3  . LYS A 1 102 ? -19.529 -6.690  -16.452 1.00 0.00 ? 1582 LYS A HE3  5  
ATOM   10415 H HZ1  . LYS A 1 102 ? -21.576 -6.789  -18.566 1.00 0.00 ? 1582 LYS A HZ1  5  
ATOM   10416 H HZ2  . LYS A 1 102 ? -21.748 -6.355  -16.999 1.00 0.00 ? 1582 LYS A HZ2  5  
ATOM   10417 H HZ3  . LYS A 1 102 ? -21.011 -5.321  -18.022 1.00 0.00 ? 1582 LYS A HZ3  5  
ATOM   10418 N N    . ARG A 1 103 ? -13.760 -7.757  -17.259 1.00 0.00 ? 1583 ARG A N    5  
ATOM   10419 C CA   . ARG A 1 103 ? -13.106 -8.379  -16.093 1.00 0.00 ? 1583 ARG A CA   5  
ATOM   10420 C C    . ARG A 1 103 ? -14.055 -9.242  -15.260 1.00 0.00 ? 1583 ARG A C    5  
ATOM   10421 O O    . ARG A 1 103 ? -13.737 -10.398 -15.021 1.00 0.00 ? 1583 ARG A O    5  
ATOM   10422 C CB   . ARG A 1 103 ? -12.320 -7.387  -15.204 1.00 0.00 ? 1583 ARG A CB   5  
ATOM   10423 C CG   . ARG A 1 103 ? -13.049 -6.117  -14.725 1.00 0.00 ? 1583 ARG A CG   5  
ATOM   10424 C CD   . ARG A 1 103 ? -12.450 -5.528  -13.430 1.00 0.00 ? 1583 ARG A CD   5  
ATOM   10425 N NE   . ARG A 1 103 ? -10.972 -5.385  -13.440 1.00 0.00 ? 1583 ARG A NE   5  
ATOM   10426 C CZ   . ARG A 1 103 ? -10.257 -4.278  -13.674 1.00 0.00 ? 1583 ARG A CZ   5  
ATOM   10427 N NH1  . ARG A 1 103 ? -10.829 -3.181  -14.158 1.00 0.00 ? 1583 ARG A NH1  5  
ATOM   10428 N NH2  . ARG A 1 103 ? -8.955  -4.272  -13.418 1.00 0.00 ? 1583 ARG A NH2  5  
ATOM   10429 H H    . ARG A 1 103 ? -13.436 -6.843  -17.568 1.00 0.00 ? 1583 ARG A H    5  
ATOM   10430 H HA   . ARG A 1 103 ? -12.366 -9.076  -16.496 1.00 0.00 ? 1583 ARG A HA   5  
ATOM   10431 H HB2  . ARG A 1 103 ? -11.973 -7.946  -14.330 1.00 0.00 ? 1583 ARG A HB2  5  
ATOM   10432 H HB3  . ARG A 1 103 ? -11.435 -7.059  -15.747 1.00 0.00 ? 1583 ARG A HB3  5  
ATOM   10433 H HG2  . ARG A 1 103 ? -13.006 -5.373  -15.521 1.00 0.00 ? 1583 ARG A HG2  5  
ATOM   10434 H HG3  . ARG A 1 103 ? -14.097 -6.334  -14.531 1.00 0.00 ? 1583 ARG A HG3  5  
ATOM   10435 H HD2  . ARG A 1 103 ? -12.918 -4.565  -13.217 1.00 0.00 ? 1583 ARG A HD2  5  
ATOM   10436 H HD3  . ARG A 1 103 ? -12.711 -6.177  -12.592 1.00 0.00 ? 1583 ARG A HD3  5  
ATOM   10437 H HE   . ARG A 1 103 ? -10.463 -6.244  -13.233 1.00 0.00 ? 1583 ARG A HE   5  
ATOM   10438 H HH11 . ARG A 1 103 ? -11.784 -3.199  -14.553 1.00 0.00 ? 1583 ARG A HH11 5  
ATOM   10439 H HH12 . ARG A 1 103 ? -10.303 -2.322  -14.311 1.00 0.00 ? 1583 ARG A HH12 5  
ATOM   10440 H HH21 . ARG A 1 103 ? -8.486  -5.075  -13.015 1.00 0.00 ? 1583 ARG A HH21 5  
ATOM   10441 H HH22 . ARG A 1 103 ? -8.380  -3.445  -13.550 1.00 0.00 ? 1583 ARG A HH22 5  
ATOM   10442 N N    . MET A 1 104 ? -15.240 -8.738  -14.900 1.00 0.00 ? 1584 MET A N    5  
ATOM   10443 C CA   . MET A 1 104 ? -16.105 -9.500  -13.995 1.00 0.00 ? 1584 MET A CA   5  
ATOM   10444 C C    . MET A 1 104 ? -16.794 -10.692 -14.674 1.00 0.00 ? 1584 MET A C    5  
ATOM   10445 O O    . MET A 1 104 ? -17.221 -11.617 -13.990 1.00 0.00 ? 1584 MET A O    5  
ATOM   10446 C CB   . MET A 1 104 ? -17.084 -8.569  -13.276 1.00 0.00 ? 1584 MET A CB   5  
ATOM   10447 C CG   . MET A 1 104 ? -18.266 -8.046  -14.104 1.00 0.00 ? 1584 MET A CG   5  
ATOM   10448 S SD   . MET A 1 104 ? -19.631 -9.204  -14.425 1.00 0.00 ? 1584 MET A SD   5  
ATOM   10449 C CE   . MET A 1 104 ? -20.087 -9.690  -12.733 1.00 0.00 ? 1584 MET A CE   5  
ATOM   10450 H H    . MET A 1 104 ? -15.481 -7.787  -15.156 1.00 0.00 ? 1584 MET A H    5  
ATOM   10451 H HA   . MET A 1 104 ? -15.459 -9.918  -13.224 1.00 0.00 ? 1584 MET A HA   5  
ATOM   10452 H HB2  . MET A 1 104 ? -17.469 -9.091  -12.402 1.00 0.00 ? 1584 MET A HB2  5  
ATOM   10453 H HB3  . MET A 1 104 ? -16.517 -7.708  -12.914 1.00 0.00 ? 1584 MET A HB3  5  
ATOM   10454 H HG2  . MET A 1 104 ? -18.691 -7.189  -13.573 1.00 0.00 ? 1584 MET A HG2  5  
ATOM   10455 H HG3  . MET A 1 104 ? -17.897 -7.666  -15.058 1.00 0.00 ? 1584 MET A HG3  5  
ATOM   10456 H HE1  . MET A 1 104 ? -19.321 -10.346 -12.317 1.00 0.00 ? 1584 MET A HE1  5  
ATOM   10457 H HE2  . MET A 1 104 ? -20.165 -8.804  -12.104 1.00 0.00 ? 1584 MET A HE2  5  
ATOM   10458 H HE3  . MET A 1 104 ? -21.038 -10.224 -12.753 1.00 0.00 ? 1584 MET A HE3  5  
ATOM   10459 N N    . ALA A 1 105 ? -16.892 -10.683 -16.008 1.00 0.00 ? 1585 ALA A N    5  
ATOM   10460 C CA   . ALA A 1 105 ? -17.345 -11.820 -16.788 1.00 0.00 ? 1585 ALA A CA   5  
ATOM   10461 C C    . ALA A 1 105 ? -16.223 -12.846 -16.962 1.00 0.00 ? 1585 ALA A C    5  
ATOM   10462 O O    . ALA A 1 105 ? -16.526 -14.013 -17.200 1.00 0.00 ? 1585 ALA A O    5  
ATOM   10463 C CB   . ALA A 1 105 ? -17.762 -11.331 -18.178 1.00 0.00 ? 1585 ALA A CB   5  
ATOM   10464 H H    . ALA A 1 105 ? -16.432 -9.959  -16.536 1.00 0.00 ? 1585 ALA A H    5  
ATOM   10465 H HA   . ALA A 1 105 ? -18.193 -12.303 -16.298 1.00 0.00 ? 1585 ALA A HA   5  
ATOM   10466 H HB1  . ALA A 1 105 ? -17.898 -12.191 -18.824 1.00 0.00 ? 1585 ALA A HB1  5  
ATOM   10467 H HB2  . ALA A 1 105 ? -18.692 -10.766 -18.113 1.00 0.00 ? 1585 ALA A HB2  5  
ATOM   10468 H HB3  . ALA A 1 105 ? -16.986 -10.714 -18.625 1.00 0.00 ? 1585 ALA A HB3  5  
ATOM   10469 N N    . VAL A 1 106 ? -14.959 -12.421 -16.900 1.00 0.00 ? 1586 VAL A N    5  
ATOM   10470 C CA   . VAL A 1 106 ? -13.806 -13.281 -17.052 1.00 0.00 ? 1586 VAL A CA   5  
ATOM   10471 C C    . VAL A 1 106 ? -13.471 -13.756 -15.640 1.00 0.00 ? 1586 VAL A C    5  
ATOM   10472 O O    . VAL A 1 106 ? -12.692 -13.144 -14.907 1.00 0.00 ? 1586 VAL A O    5  
ATOM   10473 C CB   . VAL A 1 106 ? -12.673 -12.499 -17.739 1.00 0.00 ? 1586 VAL A CB   5  
ATOM   10474 C CG1  . VAL A 1 106 ? -11.435 -13.381 -17.897 1.00 0.00 ? 1586 VAL A CG1  5  
ATOM   10475 C CG2  . VAL A 1 106 ? -13.106 -12.045 -19.142 1.00 0.00 ? 1586 VAL A CG2  5  
ATOM   10476 H H    . VAL A 1 106 ? -14.761 -11.463 -16.656 1.00 0.00 ? 1586 VAL A H    5  
ATOM   10477 H HA   . VAL A 1 106 ? -14.073 -14.135 -17.676 1.00 0.00 ? 1586 VAL A HA   5  
ATOM   10478 H HB   . VAL A 1 106 ? -12.407 -11.621 -17.152 1.00 0.00 ? 1586 VAL A HB   5  
ATOM   10479 H HG11 . VAL A 1 106 ? -11.046 -13.658 -16.919 1.00 0.00 ? 1586 VAL A HG11 5  
ATOM   10480 H HG12 . VAL A 1 106 ? -11.716 -14.280 -18.445 1.00 0.00 ? 1586 VAL A HG12 5  
ATOM   10481 H HG13 . VAL A 1 106 ? -10.658 -12.839 -18.438 1.00 0.00 ? 1586 VAL A HG13 5  
ATOM   10482 H HG21 . VAL A 1 106 ? -13.357 -12.909 -19.759 1.00 0.00 ? 1586 VAL A HG21 5  
ATOM   10483 H HG22 . VAL A 1 106 ? -13.969 -11.388 -19.080 1.00 0.00 ? 1586 VAL A HG22 5  
ATOM   10484 H HG23 . VAL A 1 106 ? -12.305 -11.482 -19.613 1.00 0.00 ? 1586 VAL A HG23 5  
ATOM   10485 N N    . ILE A 1 107 ? -14.081 -14.869 -15.259 1.00 0.00 ? 1587 ILE A N    5  
ATOM   10486 C CA   . ILE A 1 107 ? -13.954 -15.417 -13.927 1.00 0.00 ? 1587 ILE A CA   5  
ATOM   10487 C C    . ILE A 1 107 ? -12.905 -16.511 -14.027 1.00 0.00 ? 1587 ILE A C    5  
ATOM   10488 O O    . ILE A 1 107 ? -12.793 -17.206 -15.041 1.00 0.00 ? 1587 ILE A O    5  
ATOM   10489 C CB   . ILE A 1 107 ? -15.324 -15.845 -13.358 1.00 0.00 ? 1587 ILE A CB   5  
ATOM   10490 C CG1  . ILE A 1 107 ? -15.845 -17.117 -14.033 1.00 0.00 ? 1587 ILE A CG1  5  
ATOM   10491 C CG2  . ILE A 1 107 ? -16.338 -14.701 -13.528 1.00 0.00 ? 1587 ILE A CG2  5  
ATOM   10492 C CD1  . ILE A 1 107 ? -17.233 -17.562 -13.574 1.00 0.00 ? 1587 ILE A CD1  5  
ATOM   10493 H H    . ILE A 1 107 ? -14.572 -15.421 -15.951 1.00 0.00 ? 1587 ILE A H    5  
ATOM   10494 H HA   . ILE A 1 107 ? -13.567 -14.649 -13.260 1.00 0.00 ? 1587 ILE A HA   5  
ATOM   10495 H HB   . ILE A 1 107 ? -15.198 -16.046 -12.291 1.00 0.00 ? 1587 ILE A HB   5  
ATOM   10496 H HG12 . ILE A 1 107 ? -15.869 -16.953 -15.112 1.00 0.00 ? 1587 ILE A HG12 5  
ATOM   10497 H HG13 . ILE A 1 107 ? -15.154 -17.926 -13.806 1.00 0.00 ? 1587 ILE A HG13 5  
ATOM   10498 H HG21 . ILE A 1 107 ? -17.225 -14.887 -12.928 1.00 0.00 ? 1587 ILE A HG21 5  
ATOM   10499 H HG22 . ILE A 1 107 ? -15.898 -13.756 -13.213 1.00 0.00 ? 1587 ILE A HG22 5  
ATOM   10500 H HG23 . ILE A 1 107 ? -16.652 -14.635 -14.573 1.00 0.00 ? 1587 ILE A HG23 5  
ATOM   10501 H HD11 . ILE A 1 107 ? -17.233 -17.725 -12.498 1.00 0.00 ? 1587 ILE A HD11 5  
ATOM   10502 H HD12 . ILE A 1 107 ? -17.984 -16.818 -13.816 1.00 0.00 ? 1587 ILE A HD12 5  
ATOM   10503 H HD13 . ILE A 1 107 ? -17.481 -18.491 -14.080 1.00 0.00 ? 1587 ILE A HD13 5  
ATOM   10504 N N    . LEU A 1 108 ? -12.107 -16.671 -12.987 1.00 0.00 ? 1588 LEU A N    5  
ATOM   10505 C CA   . LEU A 1 108 ? -10.993 -17.595 -13.022 1.00 0.00 ? 1588 LEU A CA   5  
ATOM   10506 C C    . LEU A 1 108 ? -11.488 -18.867 -12.385 1.00 0.00 ? 1588 LEU A C    5  
ATOM   10507 O O    . LEU A 1 108 ? -11.818 -18.879 -11.198 1.00 0.00 ? 1588 LEU A O    5  
ATOM   10508 C CB   . LEU A 1 108 ? -9.791  -16.999 -12.287 1.00 0.00 ? 1588 LEU A CB   5  
ATOM   10509 C CG   . LEU A 1 108 ? -8.848  -16.232 -13.216 1.00 0.00 ? 1588 LEU A CG   5  
ATOM   10510 C CD1  . LEU A 1 108 ? -8.051  -15.243 -12.358 1.00 0.00 ? 1588 LEU A CD1  5  
ATOM   10511 C CD2  . LEU A 1 108 ? -7.886  -17.195 -13.927 1.00 0.00 ? 1588 LEU A CD2  5  
ATOM   10512 H H    . LEU A 1 108 ? -12.299 -16.162 -12.127 1.00 0.00 ? 1588 LEU A H    5  
ATOM   10513 H HA   . LEU A 1 108 ? -10.699 -17.806 -14.049 1.00 0.00 ? 1588 LEU A HA   5  
ATOM   10514 H HB2  . LEU A 1 108 ? -10.166 -16.302 -11.545 1.00 0.00 ? 1588 LEU A HB2  5  
ATOM   10515 H HB3  . LEU A 1 108 ? -9.238  -17.783 -11.768 1.00 0.00 ? 1588 LEU A HB3  5  
ATOM   10516 H HG   . LEU A 1 108 ? -9.429  -15.695 -13.977 1.00 0.00 ? 1588 LEU A HG   5  
ATOM   10517 H HD11 . LEU A 1 108 ? -7.632  -15.742 -11.482 1.00 0.00 ? 1588 LEU A HD11 5  
ATOM   10518 H HD12 . LEU A 1 108 ? -7.233  -14.810 -12.936 1.00 0.00 ? 1588 LEU A HD12 5  
ATOM   10519 H HD13 . LEU A 1 108 ? -8.694  -14.428 -12.022 1.00 0.00 ? 1588 LEU A HD13 5  
ATOM   10520 H HD21 . LEU A 1 108 ? -7.265  -17.719 -13.203 1.00 0.00 ? 1588 LEU A HD21 5  
ATOM   10521 H HD22 . LEU A 1 108 ? -8.429  -17.939 -14.508 1.00 0.00 ? 1588 LEU A HD22 5  
ATOM   10522 H HD23 . LEU A 1 108 ? -7.248  -16.630 -14.606 1.00 0.00 ? 1588 LEU A HD23 5  
ATOM   10523 N N    . SER A 1 109 ? -11.567 -19.924 -13.192 1.00 0.00 ? 1589 SER A N    5  
ATOM   10524 C CA   . SER A 1 109 ? -11.890 -21.266 -12.739 1.00 0.00 ? 1589 SER A CA   5  
ATOM   10525 C C    . SER A 1 109 ? -10.917 -21.601 -11.600 1.00 0.00 ? 1589 SER A C    5  
ATOM   10526 O O    . SER A 1 109 ? -9.752  -21.203 -11.657 1.00 0.00 ? 1589 SER A O    5  
ATOM   10527 C CB   . SER A 1 109 ? -11.873 -22.227 -13.947 1.00 0.00 ? 1589 SER A CB   5  
ATOM   10528 O OG   . SER A 1 109 ? -12.086 -21.522 -15.175 1.00 0.00 ? 1589 SER A OG   5  
ATOM   10529 H H    . SER A 1 109 ? -11.371 -19.838 -14.183 1.00 0.00 ? 1589 SER A H    5  
ATOM   10530 H HA   . SER A 1 109 ? -12.904 -21.227 -12.350 1.00 0.00 ? 1589 SER A HA   5  
ATOM   10531 H HB2  . SER A 1 109 ? -10.918 -22.739 -14.000 1.00 0.00 ? 1589 SER A HB2  5  
ATOM   10532 H HB3  . SER A 1 109 ? -12.646 -22.980 -13.820 1.00 0.00 ? 1589 SER A HB3  5  
ATOM   10533 H HG   . SER A 1 109 ? -12.043 -22.169 -15.911 1.00 0.00 ? 1589 SER A HG   5  
ATOM   10534 N N    . LEU A 1 110 ? -11.360 -22.316 -10.565 1.00 0.00 ? 1590 LEU A N    5  
ATOM   10535 C CA   . LEU A 1 110 ? -10.589 -22.456 -9.321  1.00 0.00 ? 1590 LEU A CA   5  
ATOM   10536 C C    . LEU A 1 110 ? -9.168  -22.986 -9.450  1.00 0.00 ? 1590 LEU A C    5  
ATOM   10537 O O    . LEU A 1 110 ? -8.306  -22.512 -8.718  1.00 0.00 ? 1590 LEU A O    5  
ATOM   10538 C CB   . LEU A 1 110 ? -11.410 -23.154 -8.213  1.00 0.00 ? 1590 LEU A CB   5  
ATOM   10539 C CG   . LEU A 1 110 ? -11.666 -24.652 -8.461  1.00 0.00 ? 1590 LEU A CG   5  
ATOM   10540 C CD1  . LEU A 1 110 ? -10.744 -25.544 -7.628  1.00 0.00 ? 1590 LEU A CD1  5  
ATOM   10541 C CD2  . LEU A 1 110 ? -13.133 -25.014 -8.183  1.00 0.00 ? 1590 LEU A CD2  5  
ATOM   10542 H H    . LEU A 1 110 ? -12.292 -22.707 -10.606 1.00 0.00 ? 1590 LEU A H    5  
ATOM   10543 H HA   . LEU A 1 110 ? -10.458 -21.436 -8.977  1.00 0.00 ? 1590 LEU A HA   5  
ATOM   10544 H HB2  . LEU A 1 110 ? -10.901 -23.031 -7.255  1.00 0.00 ? 1590 LEU A HB2  5  
ATOM   10545 H HB3  . LEU A 1 110 ? -12.358 -22.625 -8.113  1.00 0.00 ? 1590 LEU A HB3  5  
ATOM   10546 H HG   . LEU A 1 110 ? -11.463 -24.847 -9.507  1.00 0.00 ? 1590 LEU A HG   5  
ATOM   10547 H HD11 . LEU A 1 110 ? -10.923 -26.592 -7.871  1.00 0.00 ? 1590 LEU A HD11 5  
ATOM   10548 H HD12 . LEU A 1 110 ? -9.702  -25.319 -7.844  1.00 0.00 ? 1590 LEU A HD12 5  
ATOM   10549 H HD13 . LEU A 1 110 ? -10.934 -25.400 -6.565  1.00 0.00 ? 1590 LEU A HD13 5  
ATOM   10550 H HD21 . LEU A 1 110 ? -13.393 -24.789 -7.146  1.00 0.00 ? 1590 LEU A HD21 5  
ATOM   10551 H HD22 . LEU A 1 110 ? -13.798 -24.448 -8.841  1.00 0.00 ? 1590 LEU A HD22 5  
ATOM   10552 H HD23 . LEU A 1 110 ? -13.297 -26.074 -8.373  1.00 0.00 ? 1590 LEU A HD23 5  
ATOM   10553 N N    . GLU A 1 111 ? -8.856  -23.889 -10.381 1.00 0.00 ? 1591 GLU A N    5  
ATOM   10554 C CA   . GLU A 1 111 ? -7.465  -24.326 -10.549 1.00 0.00 ? 1591 GLU A CA   5  
ATOM   10555 C C    . GLU A 1 111 ? -6.625  -23.194 -11.162 1.00 0.00 ? 1591 GLU A C    5  
ATOM   10556 O O    . GLU A 1 111 ? -5.458  -23.012 -10.818 1.00 0.00 ? 1591 GLU A O    5  
ATOM   10557 C CB   . GLU A 1 111 ? -7.412  -25.600 -11.401 1.00 0.00 ? 1591 GLU A CB   5  
ATOM   10558 C CG   . GLU A 1 111 ? -6.033  -26.276 -11.312 1.00 0.00 ? 1591 GLU A CG   5  
ATOM   10559 C CD   . GLU A 1 111 ? -5.884  -27.452 -12.292 1.00 0.00 ? 1591 GLU A CD   5  
ATOM   10560 O OE1  . GLU A 1 111 ? -6.589  -28.476 -12.144 1.00 0.00 ? 1591 GLU A OE1  5  
ATOM   10561 O OE2  . GLU A 1 111 ? -5.040  -27.338 -13.217 1.00 0.00 ? 1591 GLU A OE2  5  
ATOM   10562 H H    . GLU A 1 111 ? -9.575  -24.299 -10.968 1.00 0.00 ? 1591 GLU A H    5  
ATOM   10563 H HA   . GLU A 1 111 ? -7.057  -24.567 -9.564  1.00 0.00 ? 1591 GLU A HA   5  
ATOM   10564 H HB2  . GLU A 1 111 ? -8.173  -26.299 -11.042 1.00 0.00 ? 1591 GLU A HB2  5  
ATOM   10565 H HB3  . GLU A 1 111 ? -7.637  -25.344 -12.432 1.00 0.00 ? 1591 GLU A HB3  5  
ATOM   10566 H HG2  . GLU A 1 111 ? -5.256  -25.543 -11.530 1.00 0.00 ? 1591 GLU A HG2  5  
ATOM   10567 H HG3  . GLU A 1 111 ? -5.878  -26.634 -10.291 1.00 0.00 ? 1591 GLU A HG3  5  
ATOM   10568 N N    . GLN A 1 112 ? -7.230  -22.387 -12.033 1.00 0.00 ? 1592 GLN A N    5  
ATOM   10569 C CA   . GLN A 1 112 ? -6.557  -21.286 -12.720 1.00 0.00 ? 1592 GLN A CA   5  
ATOM   10570 C C    . GLN A 1 112 ? -6.289  -20.162 -11.722 1.00 0.00 ? 1592 GLN A C    5  
ATOM   10571 O O    . GLN A 1 112 ? -5.154  -19.703 -11.610 1.00 0.00 ? 1592 GLN A O    5  
ATOM   10572 C CB   . GLN A 1 112 ? -7.373  -20.808 -13.941 1.00 0.00 ? 1592 GLN A CB   5  
ATOM   10573 C CG   . GLN A 1 112 ? -8.062  -21.932 -14.740 1.00 0.00 ? 1592 GLN A CG   5  
ATOM   10574 C CD   . GLN A 1 112 ? -7.151  -23.102 -15.131 1.00 0.00 ? 1592 GLN A CD   5  
ATOM   10575 O OE1  . GLN A 1 112 ? -5.960  -22.944 -15.395 1.00 0.00 ? 1592 GLN A OE1  5  
ATOM   10576 N NE2  . GLN A 1 112 ? -7.702  -24.309 -15.174 1.00 0.00 ? 1592 GLN A NE2  5  
ATOM   10577 H H    . GLN A 1 112 ? -8.227  -22.481 -12.172 1.00 0.00 ? 1592 GLN A H    5  
ATOM   10578 H HA   . GLN A 1 112 ? -5.599  -21.648 -13.088 1.00 0.00 ? 1592 GLN A HA   5  
ATOM   10579 H HB2  . GLN A 1 112 ? -8.155  -20.125 -13.607 1.00 0.00 ? 1592 GLN A HB2  5  
ATOM   10580 H HB3  . GLN A 1 112 ? -6.709  -20.246 -14.604 1.00 0.00 ? 1592 GLN A HB3  5  
ATOM   10581 H HG2  . GLN A 1 112 ? -8.873  -22.313 -14.128 1.00 0.00 ? 1592 GLN A HG2  5  
ATOM   10582 H HG3  . GLN A 1 112 ? -8.518  -21.523 -15.640 1.00 0.00 ? 1592 GLN A HG3  5  
ATOM   10583 H HE21 . GLN A 1 112 ? -8.702  -24.430 -15.048 1.00 0.00 ? 1592 GLN A HE21 5  
ATOM   10584 H HE22 . GLN A 1 112 ? -7.149  -25.108 -15.457 1.00 0.00 ? 1592 GLN A HE22 5  
ATOM   10585 N N    . GLY A 1 113 ? -7.303  -19.799 -10.923 1.00 0.00 ? 1593 GLY A N    5  
ATOM   10586 C CA   . GLY A 1 113 ? -7.162  -18.883 -9.791  1.00 0.00 ? 1593 GLY A CA   5  
ATOM   10587 C C    . GLY A 1 113 ? -6.054  -19.333 -8.846  1.00 0.00 ? 1593 GLY A C    5  
ATOM   10588 O O    . GLY A 1 113 ? -5.230  -18.529 -8.422  1.00 0.00 ? 1593 GLY A O    5  
ATOM   10589 H H    . GLY A 1 113 ? -8.209  -20.246 -11.058 1.00 0.00 ? 1593 GLY A H    5  
ATOM   10590 H HA2  . GLY A 1 113 ? -6.962  -17.870 -10.143 1.00 0.00 ? 1593 GLY A HA2  5  
ATOM   10591 H HA3  . GLY A 1 113 ? -8.100  -18.860 -9.233  1.00 0.00 ? 1593 GLY A HA3  5  
ATOM   10592 N N    . ASN A 1 114 ? -5.964  -20.636 -8.583  1.00 0.00 ? 1594 ASN A N    5  
ATOM   10593 C CA   . ASN A 1 114 ? -4.966  -21.209 -7.675  1.00 0.00 ? 1594 ASN A CA   5  
ATOM   10594 C C    . ASN A 1 114 ? -3.550  -20.931 -8.160  1.00 0.00 ? 1594 ASN A C    5  
ATOM   10595 O O    . ASN A 1 114 ? -2.733  -20.414 -7.402  1.00 0.00 ? 1594 ASN A O    5  
ATOM   10596 C CB   . ASN A 1 114 ? -5.169  -22.720 -7.489  1.00 0.00 ? 1594 ASN A CB   5  
ATOM   10597 C CG   . ASN A 1 114 ? -5.890  -23.007 -6.180  1.00 0.00 ? 1594 ASN A CG   5  
ATOM   10598 O OD1  . ASN A 1 114 ? -5.286  -22.950 -5.112  1.00 0.00 ? 1594 ASN A OD1  5  
ATOM   10599 N ND2  . ASN A 1 114 ? -7.177  -23.303 -6.236  1.00 0.00 ? 1594 ASN A ND2  5  
ATOM   10600 H H    . ASN A 1 114 ? -6.638  -21.238 -9.030  1.00 0.00 ? 1594 ASN A H    5  
ATOM   10601 H HA   . ASN A 1 114 ? -5.064  -20.727 -6.703  1.00 0.00 ? 1594 ASN A HA   5  
ATOM   10602 H HB2  . ASN A 1 114 ? -5.712  -23.155 -8.325  1.00 0.00 ? 1594 ASN A HB2  5  
ATOM   10603 H HB3  . ASN A 1 114 ? -4.196  -23.217 -7.468  1.00 0.00 ? 1594 ASN A HB3  5  
ATOM   10604 H HD21 . ASN A 1 114 ? -7.675  -23.239 -7.123  1.00 0.00 ? 1594 ASN A HD21 5  
ATOM   10605 H HD22 . ASN A 1 114 ? -7.683  -23.525 -5.387  1.00 0.00 ? 1594 ASN A HD22 5  
ATOM   10606 N N    . ARG A 1 115 ? -3.278  -21.182 -9.443  1.00 0.00 ? 1595 ARG A N    5  
ATOM   10607 C CA   . ARG A 1 115 ? -1.953  -20.946 -10.039 1.00 0.00 ? 1595 ARG A CA   5  
ATOM   10608 C C    . ARG A 1 115 ? -1.527  -19.474 -9.975  1.00 0.00 ? 1595 ARG A C    5  
ATOM   10609 O O    . ARG A 1 115 ? -0.365  -19.167 -10.239 1.00 0.00 ? 1595 ARG A O    5  
ATOM   10610 C CB   . ARG A 1 115 ? -1.958  -21.418 -11.492 1.00 0.00 ? 1595 ARG A CB   5  
ATOM   10611 C CG   . ARG A 1 115 ? -2.094  -22.946 -11.621 1.00 0.00 ? 1595 ARG A CG   5  
ATOM   10612 C CD   . ARG A 1 115 ? -2.855  -23.234 -12.909 1.00 0.00 ? 1595 ARG A CD   5  
ATOM   10613 N NE   . ARG A 1 115 ? -3.001  -24.674 -13.195 1.00 0.00 ? 1595 ARG A NE   5  
ATOM   10614 C CZ   . ARG A 1 115 ? -2.123  -25.472 -13.818 1.00 0.00 ? 1595 ARG A CZ   5  
ATOM   10615 N NH1  . ARG A 1 115 ? -0.933  -25.018 -14.213 1.00 0.00 ? 1595 ARG A NH1  5  
ATOM   10616 N NH2  . ARG A 1 115 ? -2.458  -26.737 -14.040 1.00 0.00 ? 1595 ARG A NH2  5  
ATOM   10617 H H    . ARG A 1 115 ? -4.011  -21.579 -10.028 1.00 0.00 ? 1595 ARG A H    5  
ATOM   10618 H HA   . ARG A 1 115 ? -1.214  -21.528 -9.486  1.00 0.00 ? 1595 ARG A HA   5  
ATOM   10619 H HB2  . ARG A 1 115 ? -2.775  -20.912 -12.007 1.00 0.00 ? 1595 ARG A HB2  5  
ATOM   10620 H HB3  . ARG A 1 115 ? -1.023  -21.115 -11.976 1.00 0.00 ? 1595 ARG A HB3  5  
ATOM   10621 H HG2  . ARG A 1 115 ? -1.103  -23.401 -11.647 1.00 0.00 ? 1595 ARG A HG2  5  
ATOM   10622 H HG3  . ARG A 1 115 ? -2.649  -23.371 -10.785 1.00 0.00 ? 1595 ARG A HG3  5  
ATOM   10623 H HD2  . ARG A 1 115 ? -3.843  -22.807 -12.766 1.00 0.00 ? 1595 ARG A HD2  5  
ATOM   10624 H HD3  . ARG A 1 115 ? -2.380  -22.712 -13.741 1.00 0.00 ? 1595 ARG A HD3  5  
ATOM   10625 H HE   . ARG A 1 115 ? -3.871  -25.090 -12.879 1.00 0.00 ? 1595 ARG A HE   5  
ATOM   10626 H HH11 . ARG A 1 115 ? -0.660  -24.056 -14.055 1.00 0.00 ? 1595 ARG A HH11 5  
ATOM   10627 H HH12 . ARG A 1 115 ? -0.260  -25.621 -14.676 1.00 0.00 ? 1595 ARG A HH12 5  
ATOM   10628 H HH21 . ARG A 1 115 ? -3.391  -27.077 -13.770 1.00 0.00 ? 1595 ARG A HH21 5  
ATOM   10629 H HH22 . ARG A 1 115 ? -1.841  -27.393 -14.504 1.00 0.00 ? 1595 ARG A HH22 5  
ATOM   10630 N N    . LEU A 1 116 ? -2.445  -18.563 -9.643  1.00 0.00 ? 1596 LEU A N    5  
ATOM   10631 C CA   . LEU A 1 116 ? -2.197  -17.138 -9.522  1.00 0.00 ? 1596 LEU A CA   5  
ATOM   10632 C C    . LEU A 1 116 ? -2.171  -16.764 -8.036  1.00 0.00 ? 1596 LEU A C    5  
ATOM   10633 O O    . LEU A 1 116 ? -1.445  -15.858 -7.634  1.00 0.00 ? 1596 LEU A O    5  
ATOM   10634 C CB   . LEU A 1 116 ? -3.310  -16.388 -10.267 1.00 0.00 ? 1596 LEU A CB   5  
ATOM   10635 C CG   . LEU A 1 116 ? -3.441  -16.781 -11.754 1.00 0.00 ? 1596 LEU A CG   5  
ATOM   10636 C CD1  . LEU A 1 116 ? -4.882  -16.557 -12.191 1.00 0.00 ? 1596 LEU A CD1  5  
ATOM   10637 C CD2  . LEU A 1 116 ? -2.471  -16.022 -12.658 1.00 0.00 ? 1596 LEU A CD2  5  
ATOM   10638 H H    . LEU A 1 116 ? -3.396  -18.859 -9.466  1.00 0.00 ? 1596 LEU A H    5  
ATOM   10639 H HA   . LEU A 1 116 ? -1.245  -16.894 -9.986  1.00 0.00 ? 1596 LEU A HA   5  
ATOM   10640 H HB2  . LEU A 1 116 ? -4.249  -16.597 -9.759  1.00 0.00 ? 1596 LEU A HB2  5  
ATOM   10641 H HB3  . LEU A 1 116 ? -3.132  -15.319 -10.195 1.00 0.00 ? 1596 LEU A HB3  5  
ATOM   10642 H HG   . LEU A 1 116 ? -3.239  -17.843 -11.889 1.00 0.00 ? 1596 LEU A HG   5  
ATOM   10643 H HD11 . LEU A 1 116 ? -5.536  -17.202 -11.607 1.00 0.00 ? 1596 LEU A HD11 5  
ATOM   10644 H HD12 . LEU A 1 116 ? -5.153  -15.515 -12.032 1.00 0.00 ? 1596 LEU A HD12 5  
ATOM   10645 H HD13 . LEU A 1 116 ? -4.992  -16.815 -13.241 1.00 0.00 ? 1596 LEU A HD13 5  
ATOM   10646 H HD21 . LEU A 1 116 ? -2.522  -16.431 -13.666 1.00 0.00 ? 1596 LEU A HD21 5  
ATOM   10647 H HD22 . LEU A 1 116 ? -2.743  -14.971 -12.693 1.00 0.00 ? 1596 LEU A HD22 5  
ATOM   10648 H HD23 . LEU A 1 116 ? -1.452  -16.131 -12.287 1.00 0.00 ? 1596 LEU A HD23 5  
ATOM   10649 N N    . ARG A 1 117 ? -2.907  -17.495 -7.190  1.00 0.00 ? 1597 ARG A N    5  
ATOM   10650 C CA   . ARG A 1 117 ? -2.983  -17.312 -5.742  1.00 0.00 ? 1597 ARG A CA   5  
ATOM   10651 C C    . ARG A 1 117 ? -1.600  -17.416 -5.121  1.00 0.00 ? 1597 ARG A C    5  
ATOM   10652 O O    . ARG A 1 117 ? -1.271  -16.617 -4.253  1.00 0.00 ? 1597 ARG A O    5  
ATOM   10653 C CB   . ARG A 1 117 ? -3.933  -18.367 -5.156  1.00 0.00 ? 1597 ARG A CB   5  
ATOM   10654 C CG   . ARG A 1 117 ? -4.218  -18.137 -3.671  1.00 0.00 ? 1597 ARG A CG   5  
ATOM   10655 C CD   . ARG A 1 117 ? -5.257  -19.139 -3.138  1.00 0.00 ? 1597 ARG A CD   5  
ATOM   10656 N NE   . ARG A 1 117 ? -4.834  -20.554 -3.280  1.00 0.00 ? 1597 ARG A NE   5  
ATOM   10657 C CZ   . ARG A 1 117 ? -3.907  -21.202 -2.562  1.00 0.00 ? 1597 ARG A CZ   5  
ATOM   10658 N NH1  . ARG A 1 117 ? -3.269  -20.606 -1.558  1.00 0.00 ? 1597 ARG A NH1  5  
ATOM   10659 N NH2  . ARG A 1 117 ? -3.625  -22.463 -2.860  1.00 0.00 ? 1597 ARG A NH2  5  
ATOM   10660 H H    . ARG A 1 117 ? -3.426  -18.279 -7.574  1.00 0.00 ? 1597 ARG A H    5  
ATOM   10661 H HA   . ARG A 1 117 ? -3.387  -16.325 -5.528  1.00 0.00 ? 1597 ARG A HA   5  
ATOM   10662 H HB2  . ARG A 1 117 ? -4.880  -18.339 -5.702  1.00 0.00 ? 1597 ARG A HB2  5  
ATOM   10663 H HB3  . ARG A 1 117 ? -3.484  -19.354 -5.272  1.00 0.00 ? 1597 ARG A HB3  5  
ATOM   10664 H HG2  . ARG A 1 117 ? -3.296  -18.225 -3.096  1.00 0.00 ? 1597 ARG A HG2  5  
ATOM   10665 H HG3  . ARG A 1 117 ? -4.608  -17.128 -3.546  1.00 0.00 ? 1597 ARG A HG3  5  
ATOM   10666 H HD2  . ARG A 1 117 ? -5.467  -18.932 -2.092  1.00 0.00 ? 1597 ARG A HD2  5  
ATOM   10667 H HD3  . ARG A 1 117 ? -6.182  -18.991 -3.695  1.00 0.00 ? 1597 ARG A HD3  5  
ATOM   10668 H HE   . ARG A 1 117 ? -5.312  -21.085 -4.006  1.00 0.00 ? 1597 ARG A HE   5  
ATOM   10669 H HH11 . ARG A 1 117 ? -3.491  -19.657 -1.284  1.00 0.00 ? 1597 ARG A HH11 5  
ATOM   10670 H HH12 . ARG A 1 117 ? -2.564  -21.087 -1.007  1.00 0.00 ? 1597 ARG A HH12 5  
ATOM   10671 H HH21 . ARG A 1 117 ? -4.117  -22.923 -3.630  1.00 0.00 ? 1597 ARG A HH21 5  
ATOM   10672 H HH22 . ARG A 1 117 ? -2.953  -23.012 -2.340  1.00 0.00 ? 1597 ARG A HH22 5  
ATOM   10673 N N    . GLU A 1 118 ? -0.778  -18.354 -5.595  1.00 0.00 ? 1598 GLU A N    5  
ATOM   10674 C CA   . GLU A 1 118 ? 0.572   -18.581 -5.088  1.00 0.00 ? 1598 GLU A CA   5  
ATOM   10675 C C    . GLU A 1 118 ? 1.472   -17.340 -5.177  1.00 0.00 ? 1598 GLU A C    5  
ATOM   10676 O O    . GLU A 1 118 ? 2.455   -17.271 -4.434  1.00 0.00 ? 1598 GLU A O    5  
ATOM   10677 C CB   . GLU A 1 118 ? 1.198   -19.797 -5.793  1.00 0.00 ? 1598 GLU A CB   5  
ATOM   10678 C CG   . GLU A 1 118 ? 1.237   -19.684 -7.322  1.00 0.00 ? 1598 GLU A CG   5  
ATOM   10679 C CD   . GLU A 1 118 ? 1.953   -20.894 -7.953  1.00 0.00 ? 1598 GLU A CD   5  
ATOM   10680 O OE1  . GLU A 1 118 ? 1.297   -21.936 -8.194  1.00 0.00 ? 1598 GLU A OE1  5  
ATOM   10681 O OE2  . GLU A 1 118 ? 3.178   -20.808 -8.212  1.00 0.00 ? 1598 GLU A OE2  5  
ATOM   10682 H H    . GLU A 1 118 ? -1.124  -18.992 -6.300  1.00 0.00 ? 1598 GLU A H    5  
ATOM   10683 H HA   . GLU A 1 118 ? 0.483   -18.829 -4.027  1.00 0.00 ? 1598 GLU A HA   5  
ATOM   10684 H HB2  . GLU A 1 118 ? 2.216   -19.934 -5.419  1.00 0.00 ? 1598 GLU A HB2  5  
ATOM   10685 H HB3  . GLU A 1 118 ? 0.621   -20.683 -5.529  1.00 0.00 ? 1598 GLU A HB3  5  
ATOM   10686 H HG2  . GLU A 1 118 ? 0.215   -19.636 -7.694  1.00 0.00 ? 1598 GLU A HG2  5  
ATOM   10687 H HG3  . GLU A 1 118 ? 1.744   -18.760 -7.605  1.00 0.00 ? 1598 GLU A HG3  5  
ATOM   10688 N N    . GLN A 1 119 ? 1.158   -16.355 -6.033  1.00 0.00 ? 1599 GLN A N    5  
ATOM   10689 C CA   . GLN A 1 119 ? 1.929   -15.120 -6.162  1.00 0.00 ? 1599 GLN A CA   5  
ATOM   10690 C C    . GLN A 1 119 ? 1.137   -13.901 -5.676  1.00 0.00 ? 1599 GLN A C    5  
ATOM   10691 O O    . GLN A 1 119 ? 1.681   -13.029 -4.997  1.00 0.00 ? 1599 GLN A O    5  
ATOM   10692 C CB   . GLN A 1 119 ? 2.357   -14.967 -7.635  1.00 0.00 ? 1599 GLN A CB   5  
ATOM   10693 C CG   . GLN A 1 119 ? 3.399   -13.858 -7.835  1.00 0.00 ? 1599 GLN A CG   5  
ATOM   10694 C CD   . GLN A 1 119 ? 4.172   -13.993 -9.154  1.00 0.00 ? 1599 GLN A CD   5  
ATOM   10695 O OE1  . GLN A 1 119 ? 5.401   -13.987 -9.169  1.00 0.00 ? 1599 GLN A OE1  5  
ATOM   10696 N NE2  . GLN A 1 119 ? 3.492   -14.121 -10.288 1.00 0.00 ? 1599 GLN A NE2  5  
ATOM   10697 H H    . GLN A 1 119 ? 0.333   -16.439 -6.610  1.00 0.00 ? 1599 GLN A H    5  
ATOM   10698 H HA   . GLN A 1 119 ? 2.828   -15.198 -5.552  1.00 0.00 ? 1599 GLN A HA   5  
ATOM   10699 H HB2  . GLN A 1 119 ? 2.792   -15.899 -7.980  1.00 0.00 ? 1599 GLN A HB2  5  
ATOM   10700 H HB3  . GLN A 1 119 ? 1.481   -14.770 -8.258  1.00 0.00 ? 1599 GLN A HB3  5  
ATOM   10701 H HG2  . GLN A 1 119 ? 2.905   -12.887 -7.799  1.00 0.00 ? 1599 GLN A HG2  5  
ATOM   10702 H HG3  . GLN A 1 119 ? 4.114   -13.904 -7.012  1.00 0.00 ? 1599 GLN A HG3  5  
ATOM   10703 H HE21 . GLN A 1 119 ? 2.480   -14.144 -10.283 1.00 0.00 ? 1599 GLN A HE21 5  
ATOM   10704 H HE22 . GLN A 1 119 ? 3.989   -14.209 -11.166 1.00 0.00 ? 1599 GLN A HE22 5  
ATOM   10705 N N    . TYR A 1 120 ? -0.152  -13.841 -6.016  1.00 0.00 ? 1600 TYR A N    5  
ATOM   10706 C CA   . TYR A 1 120 ? -0.991  -12.658 -5.841  1.00 0.00 ? 1600 TYR A CA   5  
ATOM   10707 C C    . TYR A 1 120 ? -1.849  -12.687 -4.578  1.00 0.00 ? 1600 TYR A C    5  
ATOM   10708 O O    . TYR A 1 120 ? -2.391  -11.647 -4.202  1.00 0.00 ? 1600 TYR A O    5  
ATOM   10709 C CB   . TYR A 1 120 ? -1.887  -12.569 -7.079  1.00 0.00 ? 1600 TYR A CB   5  
ATOM   10710 C CG   . TYR A 1 120 ? -1.193  -12.532 -8.428  1.00 0.00 ? 1600 TYR A CG   5  
ATOM   10711 C CD1  . TYR A 1 120 ? 0.150   -12.138 -8.570  1.00 0.00 ? 1600 TYR A CD1  5  
ATOM   10712 C CD2  . TYR A 1 120 ? -1.929  -12.906 -9.562  1.00 0.00 ? 1600 TYR A CD2  5  
ATOM   10713 C CE1  . TYR A 1 120 ? 0.762   -12.142 -9.836  1.00 0.00 ? 1600 TYR A CE1  5  
ATOM   10714 C CE2  . TYR A 1 120 ? -1.339  -12.886 -10.833 1.00 0.00 ? 1600 TYR A CE2  5  
ATOM   10715 C CZ   . TYR A 1 120 ? 0.016   -12.515 -10.984 1.00 0.00 ? 1600 TYR A CZ   5  
ATOM   10716 O OH   . TYR A 1 120 ? 0.585   -12.521 -12.225 1.00 0.00 ? 1600 TYR A OH   5  
ATOM   10717 H H    . TYR A 1 120 ? -0.527  -14.567 -6.617  1.00 0.00 ? 1600 TYR A H    5  
ATOM   10718 H HA   . TYR A 1 120 ? -0.369  -11.760 -5.790  1.00 0.00 ? 1600 TYR A HA   5  
ATOM   10719 H HB2  . TYR A 1 120 ? -2.525  -13.446 -7.083  1.00 0.00 ? 1600 TYR A HB2  5  
ATOM   10720 H HB3  . TYR A 1 120 ? -2.540  -11.705 -7.012  1.00 0.00 ? 1600 TYR A HB3  5  
ATOM   10721 H HD1  . TYR A 1 120 ? 0.724   -11.832 -7.708  1.00 0.00 ? 1600 TYR A HD1  5  
ATOM   10722 H HD2  . TYR A 1 120 ? -2.957  -13.212 -9.448  1.00 0.00 ? 1600 TYR A HD2  5  
ATOM   10723 H HE1  . TYR A 1 120 ? 1.803   -11.861 -9.916  1.00 0.00 ? 1600 TYR A HE1  5  
ATOM   10724 H HE2  . TYR A 1 120 ? -1.928  -13.156 -11.698 1.00 0.00 ? 1600 TYR A HE2  5  
ATOM   10725 H HH   . TYR A 1 120 ? 1.513   -12.220 -12.240 1.00 0.00 ? 1600 TYR A HH   5  
ATOM   10726 N N    . GLY A 1 121 ? -1.995  -13.865 -3.967  1.00 0.00 ? 1601 GLY A N    5  
ATOM   10727 C CA   . GLY A 1 121 ? -2.650  -14.073 -2.681  1.00 0.00 ? 1601 GLY A CA   5  
ATOM   10728 C C    . GLY A 1 121 ? -2.158  -13.060 -1.650  1.00 0.00 ? 1601 GLY A C    5  
ATOM   10729 O O    . GLY A 1 121 ? -0.941  -12.899 -1.503  1.00 0.00 ? 1601 GLY A O    5  
ATOM   10730 H H    . GLY A 1 121 ? -1.522  -14.667 -4.366  1.00 0.00 ? 1601 GLY A H    5  
ATOM   10731 H HA2  . GLY A 1 121 ? -3.724  -14.016 -2.814  1.00 0.00 ? 1601 GLY A HA2  5  
ATOM   10732 H HA3  . GLY A 1 121 ? -2.416  -15.076 -2.319  1.00 0.00 ? 1601 GLY A HA3  5  
ATOM   10733 N N    . LEU A 1 122 ? -3.068  -12.387 -0.932  1.00 0.00 ? 1602 LEU A N    5  
ATOM   10734 C CA   . LEU A 1 122 ? -2.669  -11.464 0.127   1.00 0.00 ? 1602 LEU A CA   5  
ATOM   10735 C C    . LEU A 1 122 ? -1.971  -12.239 1.244   1.00 0.00 ? 1602 LEU A C    5  
ATOM   10736 O O    . LEU A 1 122 ? -0.965  -11.782 1.793   1.00 0.00 ? 1602 LEU A O    5  
ATOM   10737 C CB   . LEU A 1 122 ? -3.833  -10.701 0.784   1.00 0.00 ? 1602 LEU A CB   5  
ATOM   10738 C CG   . LEU A 1 122 ? -5.073  -10.389 -0.049  1.00 0.00 ? 1602 LEU A CG   5  
ATOM   10739 C CD1  . LEU A 1 122 ? -6.035  -9.567  0.814   1.00 0.00 ? 1602 LEU A CD1  5  
ATOM   10740 C CD2  . LEU A 1 122 ? -4.780  -9.642  -1.339  1.00 0.00 ? 1602 LEU A CD2  5  
ATOM   10741 H H    . LEU A 1 122 ? -4.054  -12.464 -1.150  1.00 0.00 ? 1602 LEU A H    5  
ATOM   10742 H HA   . LEU A 1 122 ? -1.993  -10.732 -0.305  1.00 0.00 ? 1602 LEU A HA   5  
ATOM   10743 H HB2  . LEU A 1 122 ? -4.171  -11.238 1.668   1.00 0.00 ? 1602 LEU A HB2  5  
ATOM   10744 H HB3  . LEU A 1 122 ? -3.403  -9.764  1.124   1.00 0.00 ? 1602 LEU A HB3  5  
ATOM   10745 H HG   . LEU A 1 122 ? -5.539  -11.328 -0.311  1.00 0.00 ? 1602 LEU A HG   5  
ATOM   10746 H HD11 . LEU A 1 122 ? -6.855  -9.168  0.215   1.00 0.00 ? 1602 LEU A HD11 5  
ATOM   10747 H HD12 . LEU A 1 122 ? -6.434  -10.207 1.599   1.00 0.00 ? 1602 LEU A HD12 5  
ATOM   10748 H HD13 . LEU A 1 122 ? -5.527  -8.734  1.299   1.00 0.00 ? 1602 LEU A HD13 5  
ATOM   10749 H HD21 . LEU A 1 122 ? -5.703  -9.342  -1.839  1.00 0.00 ? 1602 LEU A HD21 5  
ATOM   10750 H HD22 . LEU A 1 122 ? -4.197  -8.772  -1.093  1.00 0.00 ? 1602 LEU A HD22 5  
ATOM   10751 H HD23 . LEU A 1 122 ? -4.215  -10.281 -2.015  1.00 0.00 ? 1602 LEU A HD23 5  
ATOM   10752 N N    . GLY A 1 123 ? -2.564  -13.381 1.606   1.00 0.00 ? 1603 GLY A N    5  
ATOM   10753 C CA   . GLY A 1 123 ? -2.103  -14.222 2.686   1.00 0.00 ? 1603 GLY A CA   5  
ATOM   10754 C C    . GLY A 1 123 ? -0.816  -14.919 2.260   1.00 0.00 ? 1603 GLY A C    5  
ATOM   10755 O O    . GLY A 1 123 ? 0.189   -14.822 3.000   1.00 0.00 ? 1603 GLY A O    5  
ATOM   10756 O OXT  . GLY A 1 123 ? -0.822  -15.563 1.187   1.00 0.00 ? 1603 GLY A OXT  5  
ATOM   10757 H H    . GLY A 1 123 ? -3.368  -13.685 1.079   1.00 0.00 ? 1603 GLY A H    5  
ATOM   10758 H HA2  . GLY A 1 123 ? -1.934  -13.594 3.559   1.00 0.00 ? 1603 GLY A HA2  5  
ATOM   10759 H HA3  . GLY A 1 123 ? -2.874  -14.958 2.917   1.00 0.00 ? 1603 GLY A HA3  5  
ATOM   10760 N N    . GLY B 2 1   ? -29.454 -24.834 -22.576 1.00 0.00 ? 14   GLY B N    5  
ATOM   10761 C CA   . GLY B 2 1   ? -28.043 -25.181 -22.877 1.00 0.00 ? 14   GLY B CA   5  
ATOM   10762 C C    . GLY B 2 1   ? -27.075 -24.639 -21.824 1.00 0.00 ? 14   GLY B C    5  
ATOM   10763 O O    . GLY B 2 1   ? -27.326 -24.755 -20.622 1.00 0.00 ? 14   GLY B O    5  
ATOM   10764 H H1   . GLY B 2 1   ? -29.703 -25.194 -21.667 1.00 0.00 ? 14   GLY B H1   5  
ATOM   10765 H H2   . GLY B 2 1   ? -29.577 -23.835 -22.575 1.00 0.00 ? 14   GLY B H2   5  
ATOM   10766 H H3   . GLY B 2 1   ? -30.069 -25.238 -23.262 1.00 0.00 ? 14   GLY B H3   5  
ATOM   10767 H HA2  . GLY B 2 1   ? -27.943 -26.270 -22.908 1.00 0.00 ? 14   GLY B HA2  5  
ATOM   10768 H HA3  . GLY B 2 1   ? -27.783 -24.780 -23.858 1.00 0.00 ? 14   GLY B HA3  5  
ATOM   10769 N N    . ALA B 2 2   ? -25.952 -24.043 -22.256 1.00 0.00 ? 15   ALA B N    5  
ATOM   10770 C CA   . ALA B 2 2   ? -24.829 -23.624 -21.407 1.00 0.00 ? 15   ALA B CA   5  
ATOM   10771 C C    . ALA B 2 2   ? -25.100 -22.302 -20.663 1.00 0.00 ? 15   ALA B C    5  
ATOM   10772 O O    . ALA B 2 2   ? -24.305 -21.361 -20.720 1.00 0.00 ? 15   ALA B O    5  
ATOM   10773 C CB   . ALA B 2 2   ? -23.562 -23.562 -22.269 1.00 0.00 ? 15   ALA B CB   5  
ATOM   10774 H H    . ALA B 2 2   ? -25.814 -23.938 -23.254 1.00 0.00 ? 15   ALA B H    5  
ATOM   10775 H HA   . ALA B 2 2   ? -24.670 -24.393 -20.651 1.00 0.00 ? 15   ALA B HA   5  
ATOM   10776 H HB1  . ALA B 2 2   ? -23.650 -22.771 -23.017 1.00 0.00 ? 15   ALA B HB1  5  
ATOM   10777 H HB2  . ALA B 2 2   ? -22.699 -23.361 -21.632 1.00 0.00 ? 15   ALA B HB2  5  
ATOM   10778 H HB3  . ALA B 2 2   ? -23.404 -24.522 -22.763 1.00 0.00 ? 15   ALA B HB3  5  
ATOM   10779 N N    . LYS B 2 3   ? -26.251 -22.170 -20.005 1.00 0.00 ? 16   LYS B N    5  
ATOM   10780 C CA   . LYS B 2 3   ? -26.544 -21.016 -19.149 1.00 0.00 ? 16   LYS B CA   5  
ATOM   10781 C C    . LYS B 2 3   ? -25.617 -21.007 -17.931 1.00 0.00 ? 16   LYS B C    5  
ATOM   10782 O O    . LYS B 2 3   ? -25.119 -22.059 -17.529 1.00 0.00 ? 16   LYS B O    5  
ATOM   10783 C CB   . LYS B 2 3   ? -27.995 -21.107 -18.655 1.00 0.00 ? 16   LYS B CB   5  
ATOM   10784 C CG   . LYS B 2 3   ? -28.969 -20.150 -19.355 1.00 0.00 ? 16   LYS B CG   5  
ATOM   10785 C CD   . LYS B 2 3   ? -28.667 -18.661 -19.076 1.00 0.00 ? 16   LYS B CD   5  
ATOM   10786 C CE   . LYS B 2 3   ? -29.858 -17.810 -19.562 1.00 0.00 ? 16   LYS B CE   5  
ATOM   10787 N NZ   . LYS B 2 3   ? -29.700 -16.354 -19.312 1.00 0.00 ? 16   LYS B NZ   5  
ATOM   10788 H H    . LYS B 2 3   ? -26.859 -22.980 -19.935 1.00 0.00 ? 16   LYS B H    5  
ATOM   10789 H HA   . LYS B 2 3   ? -26.387 -20.106 -19.728 1.00 0.00 ? 16   LYS B HA   5  
ATOM   10790 H HB2  . LYS B 2 3   ? -28.337 -22.135 -18.777 1.00 0.00 ? 16   LYS B HB2  5  
ATOM   10791 H HB3  . LYS B 2 3   ? -28.014 -20.900 -17.585 1.00 0.00 ? 16   LYS B HB3  5  
ATOM   10792 H HG2  . LYS B 2 3   ? -28.936 -20.323 -20.431 1.00 0.00 ? 16   LYS B HG2  5  
ATOM   10793 H HG3  . LYS B 2 3   ? -29.976 -20.379 -18.998 1.00 0.00 ? 16   LYS B HG3  5  
ATOM   10794 H HD2  . LYS B 2 3   ? -28.521 -18.520 -18.004 1.00 0.00 ? 16   LYS B HD2  5  
ATOM   10795 H HD3  . LYS B 2 3   ? -27.749 -18.369 -19.594 1.00 0.00 ? 16   LYS B HD3  5  
ATOM   10796 H HE2  . LYS B 2 3   ? -29.983 -17.979 -20.635 1.00 0.00 ? 16   LYS B HE2  5  
ATOM   10797 H HE3  . LYS B 2 3   ? -30.771 -18.157 -19.067 1.00 0.00 ? 16   LYS B HE3  5  
ATOM   10798 H HZ1  . LYS B 2 3   ? -29.687 -16.098 -18.321 1.00 0.00 ? 16   LYS B HZ1  5  
ATOM   10799 H HZ2  . LYS B 2 3   ? -28.853 -15.993 -19.748 1.00 0.00 ? 16   LYS B HZ2  5  
ATOM   10800 H HZ3  . LYS B 2 3   ? -30.460 -15.831 -19.733 1.00 0.00 ? 16   LYS B HZ3  5  
ATOM   10801 N N    . ARG B 2 4   ? -25.473 -19.822 -17.323 1.00 0.00 ? 17   ARG B N    5  
ATOM   10802 C CA   . ARG B 2 4   ? -24.768 -19.557 -16.067 1.00 0.00 ? 17   ARG B CA   5  
ATOM   10803 C C    . ARG B 2 4   ? -24.814 -20.755 -15.121 1.00 0.00 ? 17   ARG B C    5  
ATOM   10804 O O    . ARG B 2 4   ? -25.887 -21.242 -14.759 1.00 0.00 ? 17   ARG B O    5  
ATOM   10805 C CB   . ARG B 2 4   ? -25.333 -18.298 -15.430 1.00 0.00 ? 17   ARG B CB   5  
ATOM   10806 C CG   . ARG B 2 4   ? -24.533 -17.927 -14.182 1.00 0.00 ? 17   ARG B CG   5  
ATOM   10807 C CD   . ARG B 2 4   ? -24.782 -16.482 -13.801 1.00 0.00 ? 17   ARG B CD   5  
ATOM   10808 N NE   . ARG B 2 4   ? -26.204 -16.206 -13.549 1.00 0.00 ? 17   ARG B NE   5  
ATOM   10809 C CZ   . ARG B 2 4   ? -26.910 -16.528 -12.458 1.00 0.00 ? 17   ARG B CZ   5  
ATOM   10810 N NH1  . ARG B 2 4   ? -26.367 -17.193 -11.433 1.00 0.00 ? 17   ARG B NH1  5  
ATOM   10811 N NH2  . ARG B 2 4   ? -28.184 -16.158 -12.443 1.00 0.00 ? 17   ARG B NH2  5  
ATOM   10812 H H    . ARG B 2 4   ? -25.883 -19.012 -17.767 1.00 0.00 ? 17   ARG B H    5  
ATOM   10813 H HA   . ARG B 2 4   ? -23.735 -19.297 -16.294 1.00 0.00 ? 17   ARG B HA   5  
ATOM   10814 H HB2  . ARG B 2 4   ? -25.212 -17.502 -16.145 1.00 0.00 ? 17   ARG B HB2  5  
ATOM   10815 H HB3  . ARG B 2 4   ? -26.391 -18.424 -15.184 1.00 0.00 ? 17   ARG B HB3  5  
ATOM   10816 H HG2  . ARG B 2 4   ? -24.818 -18.590 -13.378 1.00 0.00 ? 17   ARG B HG2  5  
ATOM   10817 H HG3  . ARG B 2 4   ? -23.465 -18.010 -14.381 1.00 0.00 ? 17   ARG B HG3  5  
ATOM   10818 H HD2  . ARG B 2 4   ? -24.199 -16.224 -12.922 1.00 0.00 ? 17   ARG B HD2  5  
ATOM   10819 H HD3  . ARG B 2 4   ? -24.417 -15.891 -14.645 1.00 0.00 ? 17   ARG B HD3  5  
ATOM   10820 H HE   . ARG B 2 4   ? -26.724 -15.717 -14.284 1.00 0.00 ? 17   ARG B HE   5  
ATOM   10821 H HH11 . ARG B 2 4   ? -25.420 -17.565 -11.478 1.00 0.00 ? 17   ARG B HH11 5  
ATOM   10822 H HH12 . ARG B 2 4   ? -26.916 -17.438 -10.614 1.00 0.00 ? 17   ARG B HH12 5  
ATOM   10823 H HH21 . ARG B 2 4   ? -28.568 -15.709 -13.286 1.00 0.00 ? 17   ARG B HH21 5  
ATOM   10824 H HH22 . ARG B 2 4   ? -28.817 -16.350 -11.675 1.00 0.00 ? 17   ARG B HH22 5  
ATOM   10825 N N    . HIS B 2 5   ? -23.627 -21.171 -14.694 1.00 0.00 ? 18   HIS B N    5  
ATOM   10826 C CA   . HIS B 2 5   ? -23.393 -22.419 -13.983 1.00 0.00 ? 18   HIS B CA   5  
ATOM   10827 C C    . HIS B 2 5   ? -23.168 -22.242 -12.476 1.00 0.00 ? 18   HIS B C    5  
ATOM   10828 O O    . HIS B 2 5   ? -23.295 -23.206 -11.721 1.00 0.00 ? 18   HIS B O    5  
ATOM   10829 C CB   . HIS B 2 5   ? -22.231 -23.093 -14.681 1.00 0.00 ? 18   HIS B CB   5  
ATOM   10830 C CG   . HIS B 2 5   ? -20.935 -22.416 -14.455 1.00 0.00 ? 18   HIS B CG   5  
ATOM   10831 N ND1  . HIS B 2 5   ? -20.719 -21.046 -14.300 1.00 0.00 ? 18   HIS B ND1  5  
ATOM   10832 C CD2  . HIS B 2 5   ? -19.762 -23.074 -14.515 1.00 0.00 ? 18   HIS B CD2  5  
ATOM   10833 C CE1  . HIS B 2 5   ? -19.388 -20.922 -14.252 1.00 0.00 ? 18   HIS B CE1  5  
ATOM   10834 N NE2  . HIS B 2 5   ? -18.790 -22.117 -14.419 1.00 0.00 ? 18   HIS B NE2  5  
ATOM   10835 H H    . HIS B 2 5   ? -22.786 -20.698 -15.007 1.00 0.00 ? 18   HIS B H    5  
ATOM   10836 H HA   . HIS B 2 5   ? -24.202 -23.105 -14.149 1.00 0.00 ? 18   HIS B HA   5  
ATOM   10837 H HB2  . HIS B 2 5   ? -22.150 -24.132 -14.354 1.00 0.00 ? 18   HIS B HB2  5  
ATOM   10838 H HB3  . HIS B 2 5   ? -22.397 -23.070 -15.760 1.00 0.00 ? 18   HIS B HB3  5  
ATOM   10839 H HD2  . HIS B 2 5   ? -19.667 -24.145 -14.628 1.00 0.00 ? 18   HIS B HD2  5  
ATOM   10840 H HE1  . HIS B 2 5   ? -18.870 -19.990 -14.130 1.00 0.00 ? 18   HIS B HE1  5  
ATOM   10841 H HE2  . HIS B 2 5   ? -17.797 -22.289 -14.478 1.00 0.00 ? 18   HIS B HE2  5  
ATOM   10842 N N    . ARG B 2 6   ? -22.846 -21.022 -12.034 1.00 0.00 ? 19   ARG B N    5  
ATOM   10843 C CA   . ARG B 2 6   ? -22.527 -20.644 -10.653 1.00 0.00 ? 19   ARG B CA   5  
ATOM   10844 C C    . ARG B 2 6   ? -23.117 -19.260 -10.421 1.00 0.00 ? 19   ARG B C    5  
ATOM   10845 O O    . ARG B 2 6   ? -23.544 -18.582 -11.356 1.00 0.00 ? 19   ARG B O    5  
ATOM   10846 C CB   . ARG B 2 6   ? -20.988 -20.643 -10.448 1.00 0.00 ? 19   ARG B CB   5  
ATOM   10847 C CG   . ARG B 2 6   ? -20.378 -22.029 -10.716 1.00 0.00 ? 19   ARG B CG   5  
ATOM   10848 C CD   . ARG B 2 6   ? -18.897 -22.174 -10.343 1.00 0.00 ? 19   ARG B CD   5  
ATOM   10849 N NE   . ARG B 2 6   ? -18.201 -23.043 -11.319 1.00 0.00 ? 19   ARG B NE   5  
ATOM   10850 C CZ   . ARG B 2 6   ? -18.451 -24.335 -11.593 1.00 0.00 ? 19   ARG B CZ   5  
ATOM   10851 N NH1  . ARG B 2 6   ? -19.180 -25.060 -10.754 1.00 0.00 ? 19   ARG B NH1  5  
ATOM   10852 N NH2  . ARG B 2 6   ? -17.979 -24.906 -12.706 1.00 0.00 ? 19   ARG B NH2  5  
ATOM   10853 H H    . ARG B 2 6   ? -22.760 -20.272 -12.710 1.00 0.00 ? 19   ARG B H    5  
ATOM   10854 H HA   . ARG B 2 6   ? -22.972 -21.332 -9.923  1.00 0.00 ? 19   ARG B HA   5  
ATOM   10855 H HB2  . ARG B 2 6   ? -20.525 -19.918 -11.131 1.00 0.00 ? 19   ARG B HB2  5  
ATOM   10856 H HB3  . ARG B 2 6   ? -20.760 -20.348 -9.422  1.00 0.00 ? 19   ARG B HB3  5  
ATOM   10857 H HG2  . ARG B 2 6   ? -20.953 -22.787 -10.186 1.00 0.00 ? 19   ARG B HG2  5  
ATOM   10858 H HG3  . ARG B 2 6   ? -20.458 -22.216 -11.782 1.00 0.00 ? 19   ARG B HG3  5  
ATOM   10859 H HD2  . ARG B 2 6   ? -18.423 -21.186 -10.357 1.00 0.00 ? 19   ARG B HD2  5  
ATOM   10860 H HD3  . ARG B 2 6   ? -18.801 -22.577 -9.335  1.00 0.00 ? 19   ARG B HD3  5  
ATOM   10861 H HE   . ARG B 2 6   ? -17.459 -22.580 -11.825 1.00 0.00 ? 19   ARG B HE   5  
ATOM   10862 H HH11 . ARG B 2 6   ? -19.523 -24.663 -9.892  1.00 0.00 ? 19   ARG B HH11 5  
ATOM   10863 H HH12 . ARG B 2 6   ? -19.390 -26.034 -10.926 1.00 0.00 ? 19   ARG B HH12 5  
ATOM   10864 H HH21 . ARG B 2 6   ? -17.340 -24.437 -13.338 1.00 0.00 ? 19   ARG B HH21 5  
ATOM   10865 H HH22 . ARG B 2 6   ? -18.156 -25.886 -12.911 1.00 0.00 ? 19   ARG B HH22 5  
HETATM 10866 N N    . MLY B 2 7   ? -23.142 -18.822 -9.169  1.00 0.00 ? 20   MLY B N    5  
HETATM 10867 C CA   . MLY B 2 7   ? -23.454 -17.447 -8.821  1.00 0.00 ? 20   MLY B CA   5  
HETATM 10868 C CB   . MLY B 2 7   ? -23.560 -17.370 -7.284  1.00 0.00 ? 20   MLY B CB   5  
HETATM 10869 C CG   . MLY B 2 7   ? -23.641 -15.968 -6.631  1.00 0.00 ? 20   MLY B CG   5  
HETATM 10870 C CD   . MLY B 2 7   ? -22.315 -15.477 -6.014  1.00 0.00 ? 20   MLY B CD   5  
HETATM 10871 C CE   . MLY B 2 7   ? -21.653 -14.411 -6.880  1.00 0.00 ? 20   MLY B CE   5  
HETATM 10872 N NZ   . MLY B 2 7   ? -20.197 -14.219 -6.673  1.00 0.00 ? 20   MLY B NZ   5  
HETATM 10873 C CH1  . MLY B 2 7   ? -19.794 -13.400 -5.514  1.00 0.00 ? 20   MLY B CH1  5  
HETATM 10874 C CH2  . MLY B 2 7   ? -19.324 -15.357 -7.026  1.00 0.00 ? 20   MLY B CH2  5  
HETATM 10875 C C    . MLY B 2 7   ? -22.328 -16.618 -9.421  1.00 0.00 ? 20   MLY B C    5  
HETATM 10876 O O    . MLY B 2 7   ? -21.154 -16.913 -9.216  1.00 0.00 ? 20   MLY B O    5  
HETATM 10877 H H    . MLY B 2 7   ? -22.782 -19.427 -8.440  1.00 0.00 ? 20   MLY B H    5  
HETATM 10878 H HA   . MLY B 2 7   ? -24.398 -17.128 -9.277  1.00 0.00 ? 20   MLY B HA   5  
HETATM 10879 H HB2  . MLY B 2 7   ? -22.745 -17.936 -6.834  1.00 0.00 ? 20   MLY B HB2  5  
HETATM 10880 H HB3  . MLY B 2 7   ? -24.479 -17.897 -7.017  1.00 0.00 ? 20   MLY B HB3  5  
HETATM 10881 H HG2  . MLY B 2 7   ? -24.342 -16.068 -5.802  1.00 0.00 ? 20   MLY B HG2  5  
HETATM 10882 H HG3  . MLY B 2 7   ? -24.071 -15.239 -7.323  1.00 0.00 ? 20   MLY B HG3  5  
HETATM 10883 H HD2  . MLY B 2 7   ? -21.652 -16.325 -5.868  1.00 0.00 ? 20   MLY B HD2  5  
HETATM 10884 H HD3  . MLY B 2 7   ? -22.511 -15.039 -5.041  1.00 0.00 ? 20   MLY B HD3  5  
HETATM 10885 H HE2  . MLY B 2 7   ? -22.174 -13.468 -6.761  1.00 0.00 ? 20   MLY B HE2  5  
HETATM 10886 H HE3  . MLY B 2 7   ? -21.768 -14.703 -7.904  1.00 0.00 ? 20   MLY B HE3  5  
HETATM 10887 H HH11 . MLY B 2 7   ? -19.879 -12.354 -5.795  1.00 0.00 ? 20   MLY B HH11 5  
HETATM 10888 H HH12 . MLY B 2 7   ? -20.436 -13.591 -4.656  1.00 0.00 ? 20   MLY B HH12 5  
HETATM 10889 H HH13 . MLY B 2 7   ? -18.759 -13.581 -5.228  1.00 0.00 ? 20   MLY B HH13 5  
HETATM 10890 H HH21 . MLY B 2 7   ? -19.412 -15.556 -8.090  1.00 0.00 ? 20   MLY B HH21 5  
HETATM 10891 H HH22 . MLY B 2 7   ? -18.290 -15.098 -6.828  1.00 0.00 ? 20   MLY B HH22 5  
HETATM 10892 H HH23 . MLY B 2 7   ? -19.581 -16.264 -6.488  1.00 0.00 ? 20   MLY B HH23 5  
HETATM 10893 H HZ   . MLY B 2 7   ? -19.994 -13.593 -7.473  1.00 0.00 ? 20   MLY B HZ   5  
ATOM   10894 N N    . VAL B 2 8   ? -22.716 -15.575 -10.151 1.00 0.00 ? 21   VAL B N    5  
ATOM   10895 C CA   . VAL B 2 8   ? -21.850 -14.512 -10.651 1.00 0.00 ? 21   VAL B CA   5  
ATOM   10896 C C    . VAL B 2 8   ? -22.663 -13.257 -10.286 1.00 0.00 ? 21   VAL B C    5  
ATOM   10897 O O    . VAL B 2 8   ? -22.982 -13.060 -9.118  1.00 0.00 ? 21   VAL B O    5  
ATOM   10898 C CB   . VAL B 2 8   ? -21.512 -14.691 -12.150 1.00 0.00 ? 21   VAL B CB   5  
ATOM   10899 C CG1  . VAL B 2 8   ? -20.430 -13.729 -12.650 1.00 0.00 ? 21   VAL B CG1  5  
ATOM   10900 C CG2  . VAL B 2 8   ? -21.192 -16.129 -12.543 1.00 0.00 ? 21   VAL B CG2  5  
ATOM   10901 H H    . VAL B 2 8   ? -23.710 -15.382 -10.202 1.00 0.00 ? 21   VAL B H    5  
ATOM   10902 H HA   . VAL B 2 8   ? -20.916 -14.509 -10.090 1.00 0.00 ? 21   VAL B HA   5  
ATOM   10903 H HB   . VAL B 2 8   ? -22.387 -14.465 -12.720 1.00 0.00 ? 21   VAL B HB   5  
ATOM   10904 H HG11 . VAL B 2 8   ? -20.642 -12.705 -12.327 1.00 0.00 ? 21   VAL B HG11 5  
ATOM   10905 H HG12 . VAL B 2 8   ? -19.456 -14.016 -12.259 1.00 0.00 ? 21   VAL B HG12 5  
ATOM   10906 H HG13 . VAL B 2 8   ? -20.399 -13.735 -13.745 1.00 0.00 ? 21   VAL B HG13 5  
ATOM   10907 H HG21 . VAL B 2 8   ? -20.694 -16.653 -11.736 1.00 0.00 ? 21   VAL B HG21 5  
ATOM   10908 H HG22 . VAL B 2 8   ? -22.130 -16.645 -12.731 1.00 0.00 ? 21   VAL B HG22 5  
ATOM   10909 H HG23 . VAL B 2 8   ? -20.577 -16.150 -13.442 1.00 0.00 ? 21   VAL B HG23 5  
ATOM   10910 N N    . LEU B 2 9   ? -23.088 -12.468 -11.266 1.00 0.00 ? 22   LEU B N    5  
ATOM   10911 C CA   . LEU B 2 9   ? -24.039 -11.382 -11.127 1.00 0.00 ? 22   LEU B CA   5  
ATOM   10912 C C    . LEU B 2 9   ? -25.233 -11.720 -10.212 1.00 0.00 ? 22   LEU B C    5  
ATOM   10913 O O    . LEU B 2 9   ? -25.579 -12.886 -9.993  1.00 0.00 ? 22   LEU B O    5  
ATOM   10914 C CB   . LEU B 2 9   ? -24.503 -10.943 -12.527 1.00 0.00 ? 22   LEU B CB   5  
ATOM   10915 C CG   . LEU B 2 9   ? -25.192 -12.001 -13.426 1.00 0.00 ? 22   LEU B CG   5  
ATOM   10916 C CD1  . LEU B 2 9   ? -24.297 -13.173 -13.857 1.00 0.00 ? 22   LEU B CD1  5  
ATOM   10917 C CD2  . LEU B 2 9   ? -26.509 -12.521 -12.841 1.00 0.00 ? 22   LEU B CD2  5  
ATOM   10918 H H    . LEU B 2 9   ? -22.837 -12.719 -12.206 1.00 0.00 ? 22   LEU B H    5  
ATOM   10919 H HA   . LEU B 2 9   ? -23.487 -10.569 -10.672 1.00 0.00 ? 22   LEU B HA   5  
ATOM   10920 H HB2  . LEU B 2 9   ? -25.201 -10.111 -12.396 1.00 0.00 ? 22   LEU B HB2  5  
ATOM   10921 H HB3  . LEU B 2 9   ? -23.644 -10.550 -13.071 1.00 0.00 ? 22   LEU B HB3  5  
ATOM   10922 H HG   . LEU B 2 9   ? -25.433 -11.501 -14.351 1.00 0.00 ? 22   LEU B HG   5  
ATOM   10923 H HD11 . LEU B 2 9   ? -24.318 -13.937 -13.086 1.00 0.00 ? 22   LEU B HD11 5  
ATOM   10924 H HD12 . LEU B 2 9   ? -24.677 -13.613 -14.777 1.00 0.00 ? 22   LEU B HD12 5  
ATOM   10925 H HD13 . LEU B 2 9   ? -23.267 -12.846 -14.039 1.00 0.00 ? 22   LEU B HD13 5  
ATOM   10926 H HD21 . LEU B 2 9   ? -27.170 -12.840 -13.643 1.00 0.00 ? 22   LEU B HD21 5  
ATOM   10927 H HD22 . LEU B 2 9   ? -26.328 -13.366 -12.183 1.00 0.00 ? 22   LEU B HD22 5  
ATOM   10928 H HD23 . LEU B 2 9   ? -26.993 -11.742 -12.248 1.00 0.00 ? 22   LEU B HD23 5  
ATOM   10929 N N    . ARG B 2 10  ? -25.908 -10.682 -9.710  1.00 0.00 ? 23   ARG B N    5  
ATOM   10930 C CA   . ARG B 2 10  ? -27.155 -10.852 -8.979  1.00 0.00 ? 23   ARG B CA   5  
ATOM   10931 C C    . ARG B 2 10  ? -28.344 -10.804 -9.932  1.00 0.00 ? 23   ARG B C    5  
ATOM   10932 O O    . ARG B 2 10  ? -29.237 -11.643 -9.808  1.00 0.00 ? 23   ARG B O    5  
ATOM   10933 C CB   . ARG B 2 10  ? -27.262 -9.796  -7.873  1.00 0.00 ? 23   ARG B CB   5  
ATOM   10934 C CG   . ARG B 2 10  ? -28.474 -10.103 -6.985  1.00 0.00 ? 23   ARG B CG   5  
ATOM   10935 C CD   . ARG B 2 10  ? -28.535 -9.162  -5.775  1.00 0.00 ? 23   ARG B CD   5  
ATOM   10936 N NE   . ARG B 2 10  ? -29.685 -9.476  -4.907  1.00 0.00 ? 23   ARG B NE   5  
ATOM   10937 C CZ   . ARG B 2 10  ? -30.012 -8.840  -3.771  1.00 0.00 ? 23   ARG B CZ   5  
ATOM   10938 N NH1  . ARG B 2 10  ? -29.273 -7.826  -3.323  1.00 0.00 ? 23   ARG B NH1  5  
ATOM   10939 N NH2  . ARG B 2 10  ? -31.085 -9.228  -3.084  1.00 0.00 ? 23   ARG B NH2  5  
ATOM   10940 H H    . ARG B 2 10  ? -25.626 -9.736  -9.945  1.00 0.00 ? 23   ARG B H    5  
ATOM   10941 H HA   . ARG B 2 10  ? -27.157 -11.839 -8.513  1.00 0.00 ? 23   ARG B HA   5  
ATOM   10942 H HB2  . ARG B 2 10  ? -26.356 -9.828  -7.265  1.00 0.00 ? 23   ARG B HB2  5  
ATOM   10943 H HB3  . ARG B 2 10  ? -27.364 -8.802  -8.314  1.00 0.00 ? 23   ARG B HB3  5  
ATOM   10944 H HG2  . ARG B 2 10  ? -29.383 -9.995  -7.577  1.00 0.00 ? 23   ARG B HG2  5  
ATOM   10945 H HG3  . ARG B 2 10  ? -28.402 -11.134 -6.635  1.00 0.00 ? 23   ARG B HG3  5  
ATOM   10946 H HD2  . ARG B 2 10  ? -27.610 -9.266  -5.202  1.00 0.00 ? 23   ARG B HD2  5  
ATOM   10947 H HD3  . ARG B 2 10  ? -28.620 -8.134  -6.127  1.00 0.00 ? 23   ARG B HD3  5  
ATOM   10948 H HE   . ARG B 2 10  ? -30.270 -10.241 -5.216  1.00 0.00 ? 23   ARG B HE   5  
ATOM   10949 H HH11 . ARG B 2 10  ? -28.462 -7.503  -3.833  1.00 0.00 ? 23   ARG B HH11 5  
ATOM   10950 H HH12 . ARG B 2 10  ? -29.496 -7.336  -2.466  1.00 0.00 ? 23   ARG B HH12 5  
ATOM   10951 H HH21 . ARG B 2 10  ? -31.667 -9.997  -3.404  1.00 0.00 ? 23   ARG B HH21 5  
ATOM   10952 H HH22 . ARG B 2 10  ? -31.369 -8.780  -2.220  1.00 0.00 ? 23   ARG B HH22 5  
ATOM   10953 N N    . ASP B 2 11  ? -28.366 -9.869  -10.887 1.00 0.00 ? 24   ASP B N    5  
ATOM   10954 C CA   . ASP B 2 11  ? -29.467 -9.725  -11.841 1.00 0.00 ? 24   ASP B CA   5  
ATOM   10955 C C    . ASP B 2 11  ? -28.936 -9.155  -13.163 1.00 0.00 ? 24   ASP B C    5  
ATOM   10956 O O    . ASP B 2 11  ? -27.824 -8.621  -13.218 1.00 0.00 ? 24   ASP B O    5  
ATOM   10957 C CB   . ASP B 2 11  ? -30.583 -8.857  -11.234 1.00 0.00 ? 24   ASP B CB   5  
ATOM   10958 C CG   . ASP B 2 11  ? -31.823 -8.744  -12.145 1.00 0.00 ? 24   ASP B CG   5  
ATOM   10959 O OD1  . ASP B 2 11  ? -32.153 -9.723  -12.857 1.00 0.00 ? 24   ASP B OD1  5  
ATOM   10960 O OD2  . ASP B 2 11  ? -32.474 -7.675  -12.145 1.00 0.00 ? 24   ASP B OD2  5  
ATOM   10961 H H    . ASP B 2 11  ? -27.588 -9.219  -10.986 1.00 0.00 ? 24   ASP B H    5  
ATOM   10962 H HA   . ASP B 2 11  ? -29.882 -10.712 -12.045 1.00 0.00 ? 24   ASP B HA   5  
ATOM   10963 H HB2  . ASP B 2 11  ? -30.899 -9.301  -10.288 1.00 0.00 ? 24   ASP B HB2  5  
ATOM   10964 H HB3  . ASP B 2 11  ? -30.182 -7.865  -11.015 1.00 0.00 ? 24   ASP B HB3  5  
ATOM   10965 N N    . ASN B 2 12  ? -29.707 -9.286  -14.242 1.00 0.00 ? 25   ASN B N    5  
ATOM   10966 C CA   . ASN B 2 12  ? -29.273 -9.002  -15.609 1.00 0.00 ? 25   ASN B CA   5  
ATOM   10967 C C    . ASN B 2 12  ? -29.365 -7.526  -15.969 1.00 0.00 ? 25   ASN B C    5  
ATOM   10968 O O    . ASN B 2 12  ? -30.009 -7.137  -16.948 1.00 0.00 ? 25   ASN B O    5  
ATOM   10969 C CB   . ASN B 2 12  ? -30.007 -9.881  -16.634 1.00 0.00 ? 25   ASN B CB   5  
ATOM   10970 C CG   . ASN B 2 12  ? -29.635 -11.359 -16.533 1.00 0.00 ? 25   ASN B CG   5  
ATOM   10971 O OD1  . ASN B 2 12  ? -28.687 -11.736 -15.852 1.00 0.00 ? 25   ASN B OD1  5  
ATOM   10972 N ND2  . ASN B 2 12  ? -30.363 -12.239 -17.203 1.00 0.00 ? 25   ASN B ND2  5  
ATOM   10973 H H    . ASN B 2 12  ? -30.646 -9.654  -14.108 1.00 0.00 ? 25   ASN B H    5  
ATOM   10974 H HA   . ASN B 2 12  ? -28.209 -9.236  -15.661 1.00 0.00 ? 25   ASN B HA   5  
ATOM   10975 H HB2  . ASN B 2 12  ? -31.085 -9.756  -16.517 1.00 0.00 ? 25   ASN B HB2  5  
ATOM   10976 H HB3  . ASN B 2 12  ? -29.729 -9.517  -17.626 1.00 0.00 ? 25   ASN B HB3  5  
ATOM   10977 H HD21 . ASN B 2 12  ? -31.150 -11.945 -17.769 1.00 0.00 ? 25   ASN B HD21 5  
ATOM   10978 H HD22 . ASN B 2 12  ? -30.147 -13.235 -17.123 1.00 0.00 ? 25   ASN B HD22 5  
ATOM   10979 N N    . ILE B 2 13  ? -28.698 -6.704  -15.169 1.00 0.00 ? 26   ILE B N    5  
ATOM   10980 C CA   . ILE B 2 13  ? -28.460 -5.292  -15.440 1.00 0.00 ? 26   ILE B CA   5  
ATOM   10981 C C    . ILE B 2 13  ? -26.980 -4.953  -15.217 1.00 0.00 ? 26   ILE B C    5  
ATOM   10982 O O    . ILE B 2 13  ? -26.580 -3.784  -15.258 1.00 0.00 ? 26   ILE B O    5  
ATOM   10983 C CB   . ILE B 2 13  ? -29.411 -4.394  -14.617 1.00 0.00 ? 26   ILE B CB   5  
ATOM   10984 C CG1  . ILE B 2 13  ? -29.039 -4.303  -13.120 1.00 0.00 ? 26   ILE B CG1  5  
ATOM   10985 C CG2  . ILE B 2 13  ? -30.876 -4.802  -14.809 1.00 0.00 ? 26   ILE B CG2  5  
ATOM   10986 C CD1  . ILE B 2 13  ? -29.495 -5.434  -12.193 1.00 0.00 ? 26   ILE B CD1  5  
ATOM   10987 H H    . ILE B 2 13  ? -28.257 -7.103  -14.343 1.00 0.00 ? 26   ILE B H    5  
ATOM   10988 H HA   . ILE B 2 13  ? -28.670 -5.130  -16.485 1.00 0.00 ? 26   ILE B HA   5  
ATOM   10989 H HB   . ILE B 2 13  ? -29.311 -3.385  -15.025 1.00 0.00 ? 26   ILE B HB   5  
ATOM   10990 H HG12 . ILE B 2 13  ? -27.959 -4.256  -13.060 1.00 0.00 ? 26   ILE B HG12 5  
ATOM   10991 H HG13 . ILE B 2 13  ? -29.438 -3.369  -12.722 1.00 0.00 ? 26   ILE B HG13 5  
ATOM   10992 H HG21 . ILE B 2 13  ? -31.114 -4.787  -15.870 1.00 0.00 ? 26   ILE B HG21 5  
ATOM   10993 H HG22 . ILE B 2 13  ? -31.027 -5.810  -14.421 1.00 0.00 ? 26   ILE B HG22 5  
ATOM   10994 H HG23 . ILE B 2 13  ? -31.521 -4.106  -14.279 1.00 0.00 ? 26   ILE B HG23 5  
ATOM   10995 H HD11 . ILE B 2 13  ? -29.123 -6.389  -12.552 1.00 0.00 ? 26   ILE B HD11 5  
ATOM   10996 H HD12 . ILE B 2 13  ? -29.099 -5.256  -11.193 1.00 0.00 ? 26   ILE B HD12 5  
ATOM   10997 H HD13 . ILE B 2 13  ? -30.579 -5.455  -12.131 1.00 0.00 ? 26   ILE B HD13 5  
ATOM   10998 N N    . GLN B 2 14  ? -26.179 -5.986  -14.960 1.00 0.00 ? 27   GLN B N    5  
ATOM   10999 C CA   . GLN B 2 14  ? -24.821 -5.907  -14.485 1.00 0.00 ? 27   GLN B CA   5  
ATOM   11000 C C    . GLN B 2 14  ? -23.866 -6.481  -15.523 1.00 0.00 ? 27   GLN B C    5  
ATOM   11001 O O    . GLN B 2 14  ? -24.229 -7.471  -16.198 1.00 0.00 ? 27   GLN B O    5  
ATOM   11002 C CB   . GLN B 2 14  ? -24.762 -6.724  -13.185 1.00 0.00 ? 27   GLN B CB   5  
ATOM   11003 C CG   . GLN B 2 14  ? -25.565 -6.105  -12.035 1.00 0.00 ? 27   GLN B CG   5  
ATOM   11004 C CD   . GLN B 2 14  ? -25.447 -6.977  -10.786 1.00 0.00 ? 27   GLN B CD   5  
ATOM   11005 O OE1  . GLN B 2 14  ? -25.987 -8.076  -10.724 1.00 0.00 ? 27   GLN B OE1  5  
ATOM   11006 N NE2  . GLN B 2 14  ? -24.741 -6.530  -9.762  1.00 0.00 ? 27   GLN B NE2  5  
ATOM   11007 O OXT  . GLN B 2 14  ? -22.748 -5.939  -15.654 1.00 0.00 ? 27   GLN B OXT  5  
ATOM   11008 H H    . GLN B 2 14  ? -26.535 -6.919  -15.091 1.00 0.00 ? 27   GLN B H    5  
ATOM   11009 H HA   . GLN B 2 14  ? -24.579 -4.868  -14.273 1.00 0.00 ? 27   GLN B HA   5  
ATOM   11010 H HB2  . GLN B 2 14  ? -25.185 -7.714  -13.387 1.00 0.00 ? 27   GLN B HB2  5  
ATOM   11011 H HB3  . GLN B 2 14  ? -23.720 -6.833  -12.878 1.00 0.00 ? 27   GLN B HB3  5  
ATOM   11012 H HG2  . GLN B 2 14  ? -25.201 -5.096  -11.835 1.00 0.00 ? 27   GLN B HG2  5  
ATOM   11013 H HG3  . GLN B 2 14  ? -26.617 -6.050  -12.312 1.00 0.00 ? 27   GLN B HG3  5  
ATOM   11014 H HE21 . GLN B 2 14  ? -24.275 -5.631  -9.805  1.00 0.00 ? 27   GLN B HE21 5  
ATOM   11015 H HE22 . GLN B 2 14  ? -24.547 -7.178  -9.001  1.00 0.00 ? 27   GLN B HE22 5  
ATOM   11016 N N    . GLY A 1 1   ? 0.327   4.096   -10.589 1.00 0.00 ? -3   GLY A N    6  
ATOM   11017 C CA   . GLY A 1 1   ? -1.049  3.977   -10.053 1.00 0.00 ? -3   GLY A CA   6  
ATOM   11018 C C    . GLY A 1 1   ? -1.056  4.012   -8.525  1.00 0.00 ? -3   GLY A C    6  
ATOM   11019 O O    . GLY A 1 1   ? -0.459  3.146   -7.881  1.00 0.00 ? -3   GLY A O    6  
ATOM   11020 H H1   . GLY A 1 1   ? 0.897   3.344   -10.234 1.00 0.00 ? -3   GLY A H1   6  
ATOM   11021 H H2   . GLY A 1 1   ? 0.306   4.048   -11.592 1.00 0.00 ? -3   GLY A H2   6  
ATOM   11022 H H3   . GLY A 1 1   ? 0.731   4.977   -10.307 1.00 0.00 ? -3   GLY A H3   6  
ATOM   11023 H HA2  . GLY A 1 1   ? -1.661  4.791   -10.446 1.00 0.00 ? -3   GLY A HA2  6  
ATOM   11024 H HA3  . GLY A 1 1   ? -1.483  3.032   -10.382 1.00 0.00 ? -3   GLY A HA3  6  
ATOM   11025 N N    . HIS A 1 2   ? -1.715  5.014   -7.932  1.00 0.00 ? -2   HIS A N    6  
ATOM   11026 C CA   . HIS A 1 2   ? -1.862  5.130   -6.478  1.00 0.00 ? -2   HIS A CA   6  
ATOM   11027 C C    . HIS A 1 2   ? -2.726  3.982   -5.938  1.00 0.00 ? -2   HIS A C    6  
ATOM   11028 O O    . HIS A 1 2   ? -3.578  3.451   -6.662  1.00 0.00 ? -2   HIS A O    6  
ATOM   11029 C CB   . HIS A 1 2   ? -2.475  6.495   -6.136  1.00 0.00 ? -2   HIS A CB   6  
ATOM   11030 C CG   . HIS A 1 2   ? -2.548  6.757   -4.654  1.00 0.00 ? -2   HIS A CG   6  
ATOM   11031 N ND1  . HIS A 1 2   ? -1.473  6.661   -3.764  1.00 0.00 ? -2   HIS A ND1  6  
ATOM   11032 C CD2  . HIS A 1 2   ? -3.673  7.097   -3.962  1.00 0.00 ? -2   HIS A CD2  6  
ATOM   11033 C CE1  . HIS A 1 2   ? -1.981  6.961   -2.555  1.00 0.00 ? -2   HIS A CE1  6  
ATOM   11034 N NE2  . HIS A 1 2   ? -3.296  7.221   -2.644  1.00 0.00 ? -2   HIS A NE2  6  
ATOM   11035 H H    . HIS A 1 2   ? -2.215  5.684   -8.501  1.00 0.00 ? -2   HIS A H    6  
ATOM   11036 H HA   . HIS A 1 2   ? -0.871  5.065   -6.023  1.00 0.00 ? -2   HIS A HA   6  
ATOM   11037 H HB2  . HIS A 1 2   ? -1.870  7.284   -6.589  1.00 0.00 ? -2   HIS A HB2  6  
ATOM   11038 H HB3  . HIS A 1 2   ? -3.475  6.553   -6.564  1.00 0.00 ? -2   HIS A HB3  6  
ATOM   11039 H HD2  . HIS A 1 2   ? -4.668  7.235   -4.368  1.00 0.00 ? -2   HIS A HD2  6  
ATOM   11040 H HE1  . HIS A 1 2   ? -1.416  6.978   -1.627  1.00 0.00 ? -2   HIS A HE1  6  
ATOM   11041 H HE2  . HIS A 1 2   ? -3.902  7.465   -1.868  1.00 0.00 ? -2   HIS A HE2  6  
ATOM   11042 N N    . MET A 1 3   ? -2.527  3.615   -4.668  1.00 0.00 ? -1   MET A N    6  
ATOM   11043 C CA   . MET A 1 3   ? -3.225  2.526   -3.986  1.00 0.00 ? -1   MET A CA   6  
ATOM   11044 C C    . MET A 1 3   ? -3.382  2.861   -2.499  1.00 0.00 ? -1   MET A C    6  
ATOM   11045 O O    . MET A 1 3   ? -2.724  3.764   -1.976  1.00 0.00 ? -1   MET A O    6  
ATOM   11046 C CB   . MET A 1 3   ? -2.434  1.204   -4.138  1.00 0.00 ? -1   MET A CB   6  
ATOM   11047 C CG   . MET A 1 3   ? -2.571  0.583   -5.532  1.00 0.00 ? -1   MET A CG   6  
ATOM   11048 S SD   . MET A 1 3   ? -1.934  -1.112  -5.631  1.00 0.00 ? -1   MET A SD   6  
ATOM   11049 C CE   . MET A 1 3   ? -2.420  -1.509  -7.332  1.00 0.00 ? -1   MET A CE   6  
ATOM   11050 H H    . MET A 1 3   ? -1.890  4.156   -4.093  1.00 0.00 ? -1   MET A H    6  
ATOM   11051 H HA   . MET A 1 3   ? -4.223  2.406   -4.413  1.00 0.00 ? -1   MET A HA   6  
ATOM   11052 H HB2  . MET A 1 3   ? -1.378  1.371   -3.915  1.00 0.00 ? -1   MET A HB2  6  
ATOM   11053 H HB3  . MET A 1 3   ? -2.811  0.476   -3.424  1.00 0.00 ? -1   MET A HB3  6  
ATOM   11054 H HG2  . MET A 1 3   ? -3.626  0.570   -5.805  1.00 0.00 ? -1   MET A HG2  6  
ATOM   11055 H HG3  . MET A 1 3   ? -2.035  1.202   -6.252  1.00 0.00 ? -1   MET A HG3  6  
ATOM   11056 H HE1  . MET A 1 3   ? -2.079  -2.511  -7.587  1.00 0.00 ? -1   MET A HE1  6  
ATOM   11057 H HE2  . MET A 1 3   ? -3.506  -1.466  -7.426  1.00 0.00 ? -1   MET A HE2  6  
ATOM   11058 H HE3  . MET A 1 3   ? -1.973  -0.787  -8.015  1.00 0.00 ? -1   MET A HE3  6  
ATOM   11059 N N    . ASN A 1 4   ? -4.230  2.088   -1.819  1.00 0.00 ? 1484 ASN A N    6  
ATOM   11060 C CA   . ASN A 1 4   ? -4.416  2.076   -0.374  1.00 0.00 ? 1484 ASN A CA   6  
ATOM   11061 C C    . ASN A 1 4   ? -4.345  0.626   0.078   1.00 0.00 ? 1484 ASN A C    6  
ATOM   11062 O O    . ASN A 1 4   ? -4.659  -0.269  -0.706  1.00 0.00 ? 1484 ASN A O    6  
ATOM   11063 C CB   . ASN A 1 4   ? -5.786  2.669   -0.015  1.00 0.00 ? 1484 ASN A CB   6  
ATOM   11064 C CG   . ASN A 1 4   ? -6.060  2.600   1.485   1.00 0.00 ? 1484 ASN A CG   6  
ATOM   11065 O OD1  . ASN A 1 4   ? -5.280  3.101   2.289   1.00 0.00 ? 1484 ASN A OD1  6  
ATOM   11066 N ND2  . ASN A 1 4   ? -7.157  1.983   1.897   1.00 0.00 ? 1484 ASN A ND2  6  
ATOM   11067 H H    . ASN A 1 4   ? -4.700  1.334   -2.309  1.00 0.00 ? 1484 ASN A H    6  
ATOM   11068 H HA   . ASN A 1 4   ? -3.626  2.639   0.126   1.00 0.00 ? 1484 ASN A HA   6  
ATOM   11069 H HB2  . ASN A 1 4   ? -5.830  3.710   -0.335  1.00 0.00 ? 1484 ASN A HB2  6  
ATOM   11070 H HB3  . ASN A 1 4   ? -6.557  2.115   -0.552  1.00 0.00 ? 1484 ASN A HB3  6  
ATOM   11071 H HD21 . ASN A 1 4   ? -7.786  1.553   1.220   1.00 0.00 ? 1484 ASN A HD21 6  
ATOM   11072 H HD22 . ASN A 1 4   ? -7.374  1.936   2.884   1.00 0.00 ? 1484 ASN A HD22 6  
ATOM   11073 N N    . SER A 1 5   ? -3.934  0.391   1.321   1.00 0.00 ? 1485 SER A N    6  
ATOM   11074 C CA   . SER A 1 5   ? -3.790  -0.927  1.914   1.00 0.00 ? 1485 SER A CA   6  
ATOM   11075 C C    . SER A 1 5   ? -5.112  -1.696  1.891   1.00 0.00 ? 1485 SER A C    6  
ATOM   11076 O O    . SER A 1 5   ? -5.948  -1.522  2.779   1.00 0.00 ? 1485 SER A O    6  
ATOM   11077 C CB   . SER A 1 5   ? -3.269  -0.754  3.349   1.00 0.00 ? 1485 SER A CB   6  
ATOM   11078 O OG   . SER A 1 5   ? -2.022  -0.065  3.348   1.00 0.00 ? 1485 SER A OG   6  
ATOM   11079 H H    . SER A 1 5   ? -3.680  1.172   1.914   1.00 0.00 ? 1485 SER A H    6  
ATOM   11080 H HA   . SER A 1 5   ? -3.059  -1.490  1.324   1.00 0.00 ? 1485 SER A HA   6  
ATOM   11081 H HB2  . SER A 1 5   ? -3.993  -0.183  3.933   1.00 0.00 ? 1485 SER A HB2  6  
ATOM   11082 H HB3  . SER A 1 5   ? -3.169  -1.736  3.811   1.00 0.00 ? 1485 SER A HB3  6  
ATOM   11083 H HG   . SER A 1 5   ? -1.697  -0.005  4.271   1.00 0.00 ? 1485 SER A HG   6  
ATOM   11084 N N    . PHE A 1 6   ? -5.263  -2.569  0.888   1.00 0.00 ? 1486 PHE A N    6  
ATOM   11085 C CA   . PHE A 1 6   ? -6.370  -3.490  0.643   1.00 0.00 ? 1486 PHE A CA   6  
ATOM   11086 C C    . PHE A 1 6   ? -7.700  -2.797  0.397   1.00 0.00 ? 1486 PHE A C    6  
ATOM   11087 O O    . PHE A 1 6   ? -8.259  -2.937  -0.686  1.00 0.00 ? 1486 PHE A O    6  
ATOM   11088 C CB   . PHE A 1 6   ? -6.423  -4.558  1.752   1.00 0.00 ? 1486 PHE A CB   6  
ATOM   11089 C CG   . PHE A 1 6   ? -5.105  -5.279  1.886   1.00 0.00 ? 1486 PHE A CG   6  
ATOM   11090 C CD1  . PHE A 1 6   ? -4.810  -6.322  0.997   1.00 0.00 ? 1486 PHE A CD1  6  
ATOM   11091 C CD2  . PHE A 1 6   ? -4.173  -4.904  2.873   1.00 0.00 ? 1486 PHE A CD2  6  
ATOM   11092 C CE1  . PHE A 1 6   ? -3.587  -6.999  1.100   1.00 0.00 ? 1486 PHE A CE1  6  
ATOM   11093 C CE2  . PHE A 1 6   ? -2.950  -5.590  2.979   1.00 0.00 ? 1486 PHE A CE2  6  
ATOM   11094 C CZ   . PHE A 1 6   ? -2.654  -6.639  2.090   1.00 0.00 ? 1486 PHE A CZ   6  
ATOM   11095 H H    . PHE A 1 6   ? -4.534  -2.570  0.187   1.00 0.00 ? 1486 PHE A H    6  
ATOM   11096 H HA   . PHE A 1 6   ? -6.149  -4.035  -0.274  1.00 0.00 ? 1486 PHE A HA   6  
ATOM   11097 H HB2  . PHE A 1 6   ? -6.673  -4.116  2.712   1.00 0.00 ? 1486 PHE A HB2  6  
ATOM   11098 H HB3  . PHE A 1 6   ? -7.209  -5.285  1.540   1.00 0.00 ? 1486 PHE A HB3  6  
ATOM   11099 H HD1  . PHE A 1 6   ? -5.516  -6.605  0.233   1.00 0.00 ? 1486 PHE A HD1  6  
ATOM   11100 H HD2  . PHE A 1 6   ? -4.397  -4.088  3.548   1.00 0.00 ? 1486 PHE A HD2  6  
ATOM   11101 H HE1  . PHE A 1 6   ? -3.373  -7.798  0.410   1.00 0.00 ? 1486 PHE A HE1  6  
ATOM   11102 H HE2  . PHE A 1 6   ? -2.238  -5.314  3.747   1.00 0.00 ? 1486 PHE A HE2  6  
ATOM   11103 H HZ   . PHE A 1 6   ? -1.712  -7.168  2.163   1.00 0.00 ? 1486 PHE A HZ   6  
ATOM   11104 N N    . VAL A 1 7   ? -8.231  -2.063  1.366   1.00 0.00 ? 1487 VAL A N    6  
ATOM   11105 C CA   . VAL A 1 7   ? -9.565  -1.499  1.298   1.00 0.00 ? 1487 VAL A CA   6  
ATOM   11106 C C    . VAL A 1 7   ? -9.623  -0.492  0.137   1.00 0.00 ? 1487 VAL A C    6  
ATOM   11107 O O    . VAL A 1 7   ? -8.849  0.469   0.101   1.00 0.00 ? 1487 VAL A O    6  
ATOM   11108 C CB   . VAL A 1 7   ? -9.967  -0.932  2.676   1.00 0.00 ? 1487 VAL A CB   6  
ATOM   11109 C CG1  . VAL A 1 7   ? -11.463 -0.634  2.645   1.00 0.00 ? 1487 VAL A CG1  6  
ATOM   11110 C CG2  . VAL A 1 7   ? -9.734  -1.954  3.806   1.00 0.00 ? 1487 VAL A CG2  6  
ATOM   11111 H H    . VAL A 1 7   ? -7.676  -1.891  2.201   1.00 0.00 ? 1487 VAL A H    6  
ATOM   11112 H HA   . VAL A 1 7   ? -10.240 -2.318  1.060   1.00 0.00 ? 1487 VAL A HA   6  
ATOM   11113 H HB   . VAL A 1 7   ? -9.409  -0.022  2.896   1.00 0.00 ? 1487 VAL A HB   6  
ATOM   11114 H HG11 . VAL A 1 7   ? -11.970 -1.543  2.314   1.00 0.00 ? 1487 VAL A HG11 6  
ATOM   11115 H HG12 . VAL A 1 7   ? -11.821 -0.350  3.640   1.00 0.00 ? 1487 VAL A HG12 6  
ATOM   11116 H HG13 . VAL A 1 7   ? -11.682 0.178   1.950   1.00 0.00 ? 1487 VAL A HG13 6  
ATOM   11117 H HG21 . VAL A 1 7   ? -8.667  -2.119  3.974   1.00 0.00 ? 1487 VAL A HG21 6  
ATOM   11118 H HG22 . VAL A 1 7   ? -10.152 -1.581  4.745   1.00 0.00 ? 1487 VAL A HG22 6  
ATOM   11119 H HG23 . VAL A 1 7   ? -10.202 -2.912  3.568   1.00 0.00 ? 1487 VAL A HG23 6  
ATOM   11120 N N    . GLY A 1 8   ? -10.514 -0.755  -0.824  1.00 0.00 ? 1488 GLY A N    6  
ATOM   11121 C CA   . GLY A 1 8   ? -10.731 0.027   -2.033  1.00 0.00 ? 1488 GLY A CA   6  
ATOM   11122 C C    . GLY A 1 8   ? -10.205 -0.666  -3.293  1.00 0.00 ? 1488 GLY A C    6  
ATOM   11123 O O    . GLY A 1 8   ? -10.701 -0.381  -4.382  1.00 0.00 ? 1488 GLY A O    6  
ATOM   11124 H H    . GLY A 1 8   ? -11.124 -1.561  -0.714  1.00 0.00 ? 1488 GLY A H    6  
ATOM   11125 H HA2  . GLY A 1 8   ? -11.808 0.182   -2.144  1.00 0.00 ? 1488 GLY A HA2  6  
ATOM   11126 H HA3  . GLY A 1 8   ? -10.244 0.997   -1.934  1.00 0.00 ? 1488 GLY A HA3  6  
ATOM   11127 N N    . LEU A 1 9   ? -9.216  -1.566  -3.183  1.00 0.00 ? 1489 LEU A N    6  
ATOM   11128 C CA   . LEU A 1 9   ? -8.566  -2.183  -4.342  1.00 0.00 ? 1489 LEU A CA   6  
ATOM   11129 C C    . LEU A 1 9   ? -9.500  -3.118  -5.097  1.00 0.00 ? 1489 LEU A C    6  
ATOM   11130 O O    . LEU A 1 9   ? -10.203 -3.927  -4.490  1.00 0.00 ? 1489 LEU A O    6  
ATOM   11131 C CB   . LEU A 1 9   ? -7.273  -2.929  -3.947  1.00 0.00 ? 1489 LEU A CB   6  
ATOM   11132 C CG   . LEU A 1 9   ? -6.222  -2.104  -3.174  1.00 0.00 ? 1489 LEU A CG   6  
ATOM   11133 C CD1  . LEU A 1 9   ? -4.973  -2.953  -2.912  1.00 0.00 ? 1489 LEU A CD1  6  
ATOM   11134 C CD2  . LEU A 1 9   ? -5.856  -0.813  -3.909  1.00 0.00 ? 1489 LEU A CD2  6  
ATOM   11135 H H    . LEU A 1 9   ? -8.837  -1.791  -2.268  1.00 0.00 ? 1489 LEU A H    6  
ATOM   11136 H HA   . LEU A 1 9   ? -8.291  -1.404  -5.