data_2MF9
# 
_entry.id   2MF9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2MF9         
RCSB  RCSB103557   
BMRB  6923         
WWPDB D_1000103557 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2013-11-06 
_pdbx_database_PDB_obs_spr.pdb_id           2MF9 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2JWX 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_related.db_id          6923 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MF9 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2013-10-08 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kang, C.'    1 
'Ye, H.'      2 
'Simon, B.'   3 
'Sattler, M.' 4 
'Yoon, H.S.'  5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Functional role of the flexible N-terminal extension of FKBP38 in catalysis.'                    'Sci Rep'    3 2985 2985 
2013 ?      UK 2045-2322 ?    ? 24145868 10.1038/srep02985         
1       'Backbone 1H, 13C, and 15N resonance assignments of the N-terminal domain of FKBP38 (FKBP38NTD).' J.Biomol.Nmr 
'36 Suppl 1' 37   37   2006 JBNME9 NE 0925-2738 0800 ? 16718587 10.1007/s10858-006-9001-5 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kang, C.'         1  
primary 'Ye, H.'           2  
primary 'Chia, J.'         3  
primary 'Choi, B.H.'       4  
primary 'Dhe-Paganon, S.'  5  
primary 'Simon, B.'        6  
primary 'Schutz, U.'       7  
primary 'Sattler, M.'      8  
primary 'Yoon, H.S.'       9  
1       'Kang, C.B.'       10 
1       'Ye, H.'           11 
1       'Vivekanandan, S.' 12 
1       'Simon, B.'        13 
1       'Sattler, M.'      14 
1       'Yoon, H.S.'       15 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Peptidyl-prolyl cis-trans isomerase FKBP8' 
_entity.formula_weight             16910.133 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    5.2.1.8 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP RESIDUES 58-206' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'PPIase FKBP8, 38 kDa FK506-binding protein, 38 kDa FKBP, FKBP-38, hFKBP38, FK506-binding protein 8, FKBP-8, FKBPR38, Rotamase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRV
QEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRV
QEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   GLN n 
1 4   PRO n 
1 5   PRO n 
1 6   ALA n 
1 7   GLU n 
1 8   GLU n 
1 9   ALA n 
1 10  GLU n 
1 11  GLN n 
1 12  PRO n 
1 13  GLY n 
1 14  ALA n 
1 15  LEU n 
1 16  ALA n 
1 17  ARG n 
1 18  GLU n 
1 19  PHE n 
1 20  LEU n 
1 21  ALA n 
1 22  ALA n 
1 23  MET n 
1 24  GLU n 
1 25  PRO n 
1 26  GLU n 
1 27  PRO n 
1 28  ALA n 
1 29  PRO n 
1 30  ALA n 
1 31  PRO n 
1 32  ALA n 
1 33  PRO n 
1 34  GLU n 
1 35  GLU n 
1 36  TRP n 
1 37  LEU n 
1 38  ASP n 
1 39  ILE n 
1 40  LEU n 
1 41  GLY n 
1 42  ASN n 
1 43  GLY n 
1 44  LEU n 
1 45  LEU n 
1 46  ARG n 
1 47  LYS n 
1 48  LYS n 
1 49  THR n 
1 50  LEU n 
1 51  VAL n 
1 52  PRO n 
1 53  GLY n 
1 54  PRO n 
1 55  PRO n 
1 56  GLY n 
1 57  SER n 
1 58  SER n 
1 59  ARG n 
1 60  PRO n 
1 61  VAL n 
1 62  LYS n 
1 63  GLY n 
1 64  GLN n 
1 65  VAL n 
1 66  VAL n 
1 67  THR n 
1 68  VAL n 
1 69  HIS n 
1 70  LEU n 
1 71  GLN n 
1 72  THR n 
1 73  SER n 
1 74  LEU n 
1 75  GLU n 
1 76  ASN n 
1 77  GLY n 
1 78  THR n 
1 79  ARG n 
1 80  VAL n 
1 81  GLN n 
1 82  GLU n 
1 83  GLU n 
1 84  PRO n 
1 85  GLU n 
1 86  LEU n 
1 87  VAL n 
1 88  PHE n 
1 89  THR n 
1 90  LEU n 
1 91  GLY n 
1 92  ASP n 
1 93  CYS n 
1 94  ASP n 
1 95  VAL n 
1 96  ILE n 
1 97  GLN n 
1 98  ALA n 
1 99  LEU n 
1 100 ASP n 
1 101 LEU n 
1 102 SER n 
1 103 VAL n 
1 104 PRO n 
1 105 LEU n 
1 106 MET n 
1 107 ASP n 
1 108 VAL n 
1 109 GLY n 
1 110 GLU n 
1 111 THR n 
1 112 ALA n 
1 113 MET n 
1 114 VAL n 
1 115 THR n 
1 116 ALA n 
1 117 ASP n 
1 118 SER n 
1 119 LYS n 
1 120 TYR n 
1 121 CYS n 
1 122 TYR n 
1 123 GLY n 
1 124 PRO n 
1 125 GLN n 
1 126 GLY n 
1 127 SER n 
1 128 ARG n 
1 129 SER n 
1 130 PRO n 
1 131 TYR n 
1 132 ILE n 
1 133 PRO n 
1 134 PRO n 
1 135 HIS n 
1 136 ALA n 
1 137 ALA n 
1 138 LEU n 
1 139 CYS n 
1 140 LEU n 
1 141 GLU n 
1 142 VAL n 
1 143 THR n 
1 144 LEU n 
1 145 LYS n 
1 146 THR n 
1 147 ALA n 
1 148 VAL n 
1 149 ASP n 
1 150 LEU n 
1 151 GLU n 
1 152 HIS n 
1 153 HIS n 
1 154 HIS n 
1 155 HIS n 
1 156 HIS n 
1 157 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FKBP8, FKBP38' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET29 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    FKBP8_HUMAN 
_struct_ref.pdbx_db_accession          Q14318 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MGQPPAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRV
QEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVD
;
_struct_ref.pdbx_align_begin           58 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MF9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 149 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14318 
_struct_ref_seq.db_align_beg                  58 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  206 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       149 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2MF9 LEU A 150 ? UNP Q14318 ? ? 'EXPRESSION TAG' 150 1 
1 2MF9 GLU A 151 ? UNP Q14318 ? ? 'EXPRESSION TAG' 151 2 
1 2MF9 HIS A 152 ? UNP Q14318 ? ? 'EXPRESSION TAG' 152 3 
1 2MF9 HIS A 153 ? UNP Q14318 ? ? 'EXPRESSION TAG' 153 4 
1 2MF9 HIS A 154 ? UNP Q14318 ? ? 'EXPRESSION TAG' 154 5 
1 2MF9 HIS A 155 ? UNP Q14318 ? ? 'EXPRESSION TAG' 155 6 
1 2MF9 HIS A 156 ? UNP Q14318 ? ? 'EXPRESSION TAG' 156 7 
1 2MF9 HIS A 157 ? UNP Q14318 ? ? 'EXPRESSION TAG' 157 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 1H15N_HSQC                 
1 2  3 '3D HNCA'                  
1 3  3 '3D HN(CO)CA'              
1 4  3 '3D HNCO'                  
1 5  3 '3D HNCACB'                
1 6  3 '3D CBCA(CO)NH'            
1 7  2 '3D HCCH-TOCSY'            
1 8  3 '3D H(CCO)NH'              
1 9  3 '3D C(CO)NH'               
1 10 1 '2D 1H-1H NOESY'           
1 11 1 '3D 1H-15N NOESY'          
1 12 2 '3D 1H-13C NOESY'          
1 13 2 '3D 1H-13C NOESY aromatic' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      20 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.5-1 mM [U-15N] FKBP38-1, 20 mM Na-PO4-2, 50 mM NaCl-3, 1 mM DTT-4, 0.1 mM EDTA-5, 10 % [U-99% 2H] D2O-6, 90% H2O/10% D2O' 1 
'90% H2O/10% D2O' 
;0.5-1 mM [U-13C; U-15N] FKBP38-7, 20 mM Na-PO4-8, 50 mM NaCl-9, 1 mM DTT-10, 0.1 mM EDTA-11, 10 % [U-99% 2H] D2O-12, 0.5-1 mM [U-13C; U-15N] FKBP38-13, 20 mM Na-PO4-14, 50 mM NaCl-15, 1 mM DTT-16, 0.1 mM EDTA-17, 100 % [U-100% 2H] D2O-18, 90% H2O/10% D2O
;
2 '90% H2O/10% D2O' 
;0.5-1 mM [U-13C; U-15N] FKBP38-19, 20 mM Na-PO4-20, 50 mM NaCl-21, 1 mM DTT-22, 0.1 mM EDTA-23, 10 % [U-99% 2H] D2O-24, 0.5-1 mM [U-13C; U-15N] FKBP38-25, 20 mM Na-PO4-26, 50 mM NaCl-27, 1 mM DTT-28, 0.1 mM EDTA-29, 100 % [U-100% 2H] D2O-30, 90% H2O/10% D2O
;
3 '90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'BRUKER AVANCE' 
# 
_pdbx_nmr_refine.entry_id           2MF9 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MF9 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MF9 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
;LINGE, O'DONOGHUE, NILGES
;
refinement      ARIA            1 1.2       
'Bruker Biospin'                                    collection      TOPSPIN         2 1.3       
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing      NMRPipe         3 2.3       
'Accelrys Software Inc.'                            'data analysis' FELIX_FELIX2004 4 FELIX2004 
'Johnson, One Moon Scientific'                      'data analysis' NMRVIEW         5 5.2.2     
'BRUNGER, ADAMS, CLORE, GROS, NILGES, READ'         refinement      CNS             6 1.1       
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MF9 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MF9 
_struct.title                     'Solution structure of the N-terminal domain of human FKBP38 (FKBP38NTD)' 
_struct.pdbx_descriptor           'Peptidyl-prolyl cis-trans isomerase FKBP8 (E.C.5.2.1.8)' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MF9 
_struct_keywords.pdbx_keywords   'APOPTOSIS, ISOMERASE' 
_struct_keywords.text            'BETA BARREL, CENTRAL HELIX, FLEXIBLE N-TERMINAL EXTENSION, APOPTOSIS, ISOMERASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ILE A 96  ? VAL A 103 ? ILE A 96  VAL A 103 1 ? 8 
HELX_P HELX_P2 2 LYS A 119 ? CYS A 121 ? LYS A 119 CYS A 121 5 ? 3 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   7 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 37  ? ASP A 38  ? LEU A 37  ASP A 38  
A 2 LEU A 45  ? VAL A 51  ? LEU A 45  VAL A 51  
A 3 THR A 111 ? ASP A 117 ? THR A 111 ASP A 117 
A 4 ALA A 137 ? VAL A 148 ? ALA A 137 VAL A 148 
A 5 VAL A 65  ? SER A 73  ? VAL A 65  SER A 73  
A 6 VAL A 80  ? GLU A 83  ? VAL A 80  GLU A 83  
A 7 LEU A 86  ? THR A 89  ? LEU A 86  THR A 89  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 37  ? N LEU A 37  O LYS A 47  ? O LYS A 47  
A 2 3 N LYS A 48  ? N LYS A 48  O MET A 113 ? O MET A 113 
A 3 4 N VAL A 114 ? N VAL A 114 O LEU A 140 ? O LEU A 140 
A 4 5 O CYS A 139 ? O CYS A 139 N SER A 73  ? N SER A 73  
# 
_atom_sites.entry_id                    2MF9 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? -50.449 11.387  15.541  1.00 49.39 ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? -50.051 10.580  14.365  1.00 49.13 ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? -48.547 10.353  14.375  1.00 48.56 ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? -47.779 11.248  14.731  1.00 48.67 ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? -50.452 11.285  13.067  1.00 49.37 ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? -51.922 11.662  13.005  1.00 49.76 ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? -53.018 10.237  13.110  1.00 50.09 ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? -54.615 11.051  13.076  1.00 50.23 ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? -50.097 10.941  16.415  1.00 49.42 ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? -51.488 11.456  15.599  1.00 49.34 ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? -50.052 12.348  15.472  1.00 49.65 ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? -50.550 9.623   14.422  1.00 49.25 ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? -49.869 12.185  12.967  1.00 49.42 ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? -50.235 10.633  12.232  1.00 49.25 ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? -52.141 12.328  13.825  1.00 49.89 ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? -52.107 12.172  12.072  1.00 49.76 ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? -55.397 10.309  13.091  1.00 50.46 ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? -54.698 11.644  12.174  1.00 50.28 ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? -54.709 11.695  13.938  1.00 50.08 ? 1   MET A HE3  1  
ATOM 20    N N    . GLY A 1 2   ? -48.127 9.157   13.994  1.00 47.99 ? 2   GLY A N    1  
ATOM 21    C CA   . GLY A 1 2   ? -46.717 8.832   14.001  1.00 47.44 ? 2   GLY A CA   1  
ATOM 22    C C    . GLY A 1 2   ? -46.061 9.046   12.653  1.00 46.69 ? 2   GLY A C    1  
ATOM 23    O O    . GLY A 1 2   ? -45.651 10.157  12.323  1.00 46.54 ? 2   GLY A O    1  
ATOM 24    H H    . GLY A 1 2   ? -48.785 8.482   13.705  1.00 47.97 ? 2   GLY A H    1  
ATOM 25    H HA2  . GLY A 1 2   ? -46.218 9.454   14.731  1.00 47.53 ? 2   GLY A HA2  1  
ATOM 26    H HA3  . GLY A 1 2   ? -46.600 7.797   14.286  1.00 47.53 ? 2   GLY A HA3  1  
ATOM 27    N N    . GLN A 1 3   ? -45.972 7.980   11.872  1.00 46.26 ? 3   GLN A N    1  
ATOM 28    C CA   . GLN A 1 3   ? -45.296 8.028   10.581  1.00 45.58 ? 3   GLN A CA   1  
ATOM 29    C C    . GLN A 1 3   ? -46.306 8.024   9.441   1.00 45.14 ? 3   GLN A C    1  
ATOM 30    O O    . GLN A 1 3   ? -47.392 7.459   9.574   1.00 45.18 ? 3   GLN A O    1  
ATOM 31    C CB   . GLN A 1 3   ? -44.355 6.832   10.434  1.00 45.54 ? 3   GLN A CB   1  
ATOM 32    C CG   . GLN A 1 3   ? -43.275 6.772   11.501  1.00 45.20 ? 3   GLN A CG   1  
ATOM 33    C CD   . GLN A 1 3   ? -42.405 5.535   11.390  1.00 45.11 ? 3   GLN A CD   1  
ATOM 34    O OE1  . GLN A 1 3   ? -41.915 5.021   12.393  1.00 45.20 ? 3   GLN A OE1  1  
ATOM 35    N NE2  . GLN A 1 3   ? -42.199 5.053   10.173  1.00 45.01 ? 3   GLN A NE2  1  
ATOM 36    H H    . GLN A 1 3   ? -46.383 7.138   12.165  1.00 46.44 ? 3   GLN A H    1  
ATOM 37    H HA   . GLN A 1 3   ? -44.719 8.940   10.538  1.00 45.45 ? 3   GLN A HA   1  
ATOM 38    H HB2  . GLN A 1 3   ? -44.938 5.924   10.489  1.00 45.96 ? 3   GLN A HB2  1  
ATOM 39    H HB3  . GLN A 1 3   ? -43.875 6.883   9.469   1.00 45.41 ? 3   GLN A HB3  1  
ATOM 40    H HG2  . GLN A 1 3   ? -42.645 7.640   11.407  1.00 45.03 ? 3   GLN A HG2  1  
ATOM 41    H HG3  . GLN A 1 3   ? -43.750 6.777   12.470  1.00 45.22 ? 3   GLN A HG3  1  
ATOM 42    H HE21 . GLN A 1 3   ? -42.610 5.519   9.413   1.00 44.98 ? 3   GLN A HE21 1  
ATOM 43    H HE22 . GLN A 1 3   ? -41.661 4.237   10.080  1.00 44.99 ? 3   GLN A HE22 1  
ATOM 44    N N    . PRO A 1 4   ? -45.957 8.657   8.306   1.00 44.78 ? 4   PRO A N    1  
ATOM 45    C CA   . PRO A 1 4   ? -46.800 8.656   7.107   1.00 44.40 ? 4   PRO A CA   1  
ATOM 46    C C    . PRO A 1 4   ? -46.961 7.247   6.536   1.00 43.91 ? 4   PRO A C    1  
ATOM 47    O O    . PRO A 1 4   ? -45.978 6.517   6.382   1.00 43.73 ? 4   PRO A O    1  
ATOM 48    C CB   . PRO A 1 4   ? -46.041 9.555   6.118   1.00 44.25 ? 4   PRO A CB   1  
ATOM 49    C CG   . PRO A 1 4   ? -45.064 10.316  6.949   1.00 44.46 ? 4   PRO A CG   1  
ATOM 50    C CD   . PRO A 1 4   ? -44.717 9.424   8.103   1.00 44.80 ? 4   PRO A CD   1  
ATOM 51    H HA   . PRO A 1 4   ? -47.774 9.076   7.311   1.00 44.62 ? 4   PRO A HA   1  
ATOM 52    H HB2  . PRO A 1 4   ? -45.539 8.943   5.383   1.00 43.90 ? 4   PRO A HB2  1  
ATOM 53    H HB3  . PRO A 1 4   ? -46.737 10.218  5.628   1.00 44.42 ? 4   PRO A HB3  1  
ATOM 54    H HG2  . PRO A 1 4   ? -44.181 10.537  6.366   1.00 44.24 ? 4   PRO A HG2  1  
ATOM 55    H HG3  . PRO A 1 4   ? -45.519 11.229  7.303   1.00 44.66 ? 4   PRO A HG3  1  
ATOM 56    H HD2  . PRO A 1 4   ? -43.895 8.771   7.843   1.00 44.65 ? 4   PRO A HD2  1  
ATOM 57    H HD3  . PRO A 1 4   ? -44.476 10.009  8.978   1.00 45.22 ? 4   PRO A HD3  1  
ATOM 58    N N    . PRO A 1 5   ? -48.206 6.837   6.244   1.00 43.76 ? 5   PRO A N    1  
ATOM 59    C CA   . PRO A 1 5   ? -48.500 5.500   5.724   1.00 43.36 ? 5   PRO A CA   1  
ATOM 60    C C    . PRO A 1 5   ? -47.976 5.297   4.305   1.00 42.76 ? 5   PRO A C    1  
ATOM 61    O O    . PRO A 1 5   ? -48.311 6.050   3.392   1.00 42.58 ? 5   PRO A O    1  
ATOM 62    C CB   . PRO A 1 5   ? -50.038 5.421   5.750   1.00 43.41 ? 5   PRO A CB   1  
ATOM 63    C CG   . PRO A 1 5   ? -50.487 6.593   6.562   1.00 43.89 ? 5   PRO A CG   1  
ATOM 64    C CD   . PRO A 1 5   ? -49.425 7.639   6.403   1.00 44.02 ? 5   PRO A CD   1  
ATOM 65    H HA   . PRO A 1 5   ? -48.090 4.733   6.365   1.00 43.54 ? 5   PRO A HA   1  
ATOM 66    H HB2  . PRO A 1 5   ? -50.423 5.474   4.741   1.00 42.99 ? 5   PRO A HB2  1  
ATOM 67    H HB3  . PRO A 1 5   ? -50.342 4.491   6.206   1.00 43.59 ? 5   PRO A HB3  1  
ATOM 68    H HG2  . PRO A 1 5   ? -51.432 6.959   6.189   1.00 43.87 ? 5   PRO A HG2  1  
ATOM 69    H HG3  . PRO A 1 5   ? -50.578 6.307   7.600   1.00 44.19 ? 5   PRO A HG3  1  
ATOM 70    H HD2  . PRO A 1 5   ? -49.611 8.239   5.525   1.00 43.91 ? 5   PRO A HD2  1  
ATOM 71    H HD3  . PRO A 1 5   ? -49.366 8.261   7.284   1.00 44.45 ? 5   PRO A HD3  1  
ATOM 72    N N    . ALA A 1 6   ? -47.145 4.277   4.135   1.00 42.50 ? 6   ALA A N    1  
ATOM 73    C CA   . ALA A 1 6   ? -46.601 3.938   2.826   1.00 41.97 ? 6   ALA A CA   1  
ATOM 74    C C    . ALA A 1 6   ? -46.675 2.434   2.592   1.00 41.42 ? 6   ALA A C    1  
ATOM 75    O O    . ALA A 1 6   ? -46.019 1.894   1.700   1.00 41.39 ? 6   ALA A O    1  
ATOM 76    C CB   . ALA A 1 6   ? -45.163 4.432   2.725   1.00 42.03 ? 6   ALA A CB   1  
ATOM 77    H H    . ALA A 1 6   ? -46.867 3.754   4.915   1.00 42.71 ? 6   ALA A H    1  
ATOM 78    H HA   . ALA A 1 6   ? -47.192 4.440   2.072   1.00 42.00 ? 6   ALA A HA   1  
ATOM 79    H HB1  . ALA A 1 6   ? -45.139 5.501   2.874   1.00 42.08 ? 6   ALA A HB1  1  
ATOM 80    H HB2  . ALA A 1 6   ? -44.765 4.195   1.749   1.00 42.08 ? 6   ALA A HB2  1  
ATOM 81    H HB3  . ALA A 1 6   ? -44.564 3.950   3.483   1.00 42.02 ? 6   ALA A HB3  1  
ATOM 82    N N    . GLU A 1 7   ? -47.493 1.763   3.389   1.00 41.05 ? 7   GLU A N    1  
ATOM 83    C CA   . GLU A 1 7   ? -47.602 0.318   3.324   1.00 40.56 ? 7   GLU A CA   1  
ATOM 84    C C    . GLU A 1 7   ? -48.955 -0.090  2.748   1.00 40.16 ? 7   GLU A C    1  
ATOM 85    O O    . GLU A 1 7   ? -50.003 0.247   3.300   1.00 40.13 ? 7   GLU A O    1  
ATOM 86    C CB   . GLU A 1 7   ? -47.400 -0.274  4.720   1.00 40.61 ? 7   GLU A CB   1  
ATOM 87    C CG   . GLU A 1 7   ? -47.240 -1.783  4.733   1.00 40.78 ? 7   GLU A CG   1  
ATOM 88    C CD   . GLU A 1 7   ? -46.636 -2.281  6.029   1.00 41.03 ? 7   GLU A CD   1  
ATOM 89    O OE1  . GLU A 1 7   ? -45.413 -2.093  6.224   1.00 40.82 ? 7   GLU A OE1  1  
ATOM 90    O OE2  . GLU A 1 7   ? -47.368 -2.858  6.857   1.00 41.50 ? 7   GLU A OE2  1  
ATOM 91    H H    . GLU A 1 7   ? -48.048 2.253   4.027   1.00 41.14 ? 7   GLU A H    1  
ATOM 92    H HA   . GLU A 1 7   ? -46.821 -0.046  2.672   1.00 40.51 ? 7   GLU A HA   1  
ATOM 93    H HB2  . GLU A 1 7   ? -46.513 0.163   5.157   1.00 40.72 ? 7   GLU A HB2  1  
ATOM 94    H HB3  . GLU A 1 7   ? -48.254 -0.019  5.333   1.00 40.47 ? 7   GLU A HB3  1  
ATOM 95    H HG2  . GLU A 1 7   ? -48.213 -2.236  4.605   1.00 40.98 ? 7   GLU A HG2  1  
ATOM 96    H HG3  . GLU A 1 7   ? -46.597 -2.073  3.916   1.00 40.58 ? 7   GLU A HG3  1  
ATOM 97    N N    . GLU A 1 8   ? -48.920 -0.800  1.628   1.00 39.89 ? 8   GLU A N    1  
ATOM 98    C CA   . GLU A 1 8   ? -50.136 -1.222  0.943   1.00 39.55 ? 8   GLU A CA   1  
ATOM 99    C C    . GLU A 1 8   ? -50.241 -2.745  0.979   1.00 39.08 ? 8   GLU A C    1  
ATOM 100   O O    . GLU A 1 8   ? -49.228 -3.430  1.144   1.00 38.77 ? 8   GLU A O    1  
ATOM 101   C CB   . GLU A 1 8   ? -50.116 -0.712  -0.506  1.00 39.61 ? 8   GLU A CB   1  
ATOM 102   C CG   . GLU A 1 8   ? -51.478 -0.288  -1.056  1.00 39.77 ? 8   GLU A CG   1  
ATOM 103   C CD   . GLU A 1 8   ? -52.391 -1.453  -1.390  1.00 40.05 ? 8   GLU A CD   1  
ATOM 104   O OE1  . GLU A 1 8   ? -52.213 -2.065  -2.462  1.00 40.04 ? 8   GLU A OE1  1  
ATOM 105   O OE2  . GLU A 1 8   ? -53.304 -1.750  -0.586  1.00 40.33 ? 8   GLU A OE2  1  
ATOM 106   H H    . GLU A 1 8   ? -48.051 -1.058  1.255   1.00 39.97 ? 8   GLU A H    1  
ATOM 107   H HA   . GLU A 1 8   ? -50.984 -0.795  1.462   1.00 39.67 ? 8   GLU A HA   1  
ATOM 108   H HB2  . GLU A 1 8   ? -49.455 0.138   -0.564  1.00 39.61 ? 8   GLU A HB2  1  
ATOM 109   H HB3  . GLU A 1 8   ? -49.728 -1.496  -1.140  1.00 39.59 ? 8   GLU A HB3  1  
ATOM 110   H HG2  . GLU A 1 8   ? -51.970 0.324   -0.315  1.00 39.75 ? 8   GLU A HG2  1  
ATOM 111   H HG3  . GLU A 1 8   ? -51.321 0.296   -1.950  1.00 39.76 ? 8   GLU A HG3  1  
ATOM 112   N N    . ALA A 1 9   ? -51.467 -3.249  0.819   1.00 39.09 ? 9   ALA A N    1  
ATOM 113   C CA   . ALA A 1 9   ? -51.765 -4.684  0.864   1.00 38.75 ? 9   ALA A CA   1  
ATOM 114   C C    . ALA A 1 9   ? -51.597 -5.237  2.276   1.00 38.56 ? 9   ALA A C    1  
ATOM 115   O O    . ALA A 1 9   ? -51.372 -4.484  3.226   1.00 38.67 ? 9   ALA A O    1  
ATOM 116   C CB   . ALA A 1 9   ? -50.904 -5.455  -0.132  1.00 38.76 ? 9   ALA A CB   1  
ATOM 117   H H    . ALA A 1 9   ? -52.208 -2.625  0.655   1.00 39.39 ? 9   ALA A H    1  
ATOM 118   H HA   . ALA A 1 9   ? -52.800 -4.806  0.573   1.00 38.69 ? 9   ALA A HA   1  
ATOM 119   H HB1  . ALA A 1 9   ? -51.208 -6.491  -0.147  1.00 38.80 ? 9   ALA A HB1  1  
ATOM 120   H HB2  . ALA A 1 9   ? -49.868 -5.390  0.163   1.00 38.76 ? 9   ALA A HB2  1  
ATOM 121   H HB3  . ALA A 1 9   ? -51.022 -5.031  -1.120  1.00 38.78 ? 9   ALA A HB3  1  
ATOM 122   N N    . GLU A 1 10  ? -51.737 -6.550  2.418   1.00 38.35 ? 10  GLU A N    1  
ATOM 123   C CA   . GLU A 1 10  ? -51.620 -7.191  3.720   1.00 38.21 ? 10  GLU A CA   1  
ATOM 124   C C    . GLU A 1 10  ? -50.609 -8.334  3.663   1.00 37.73 ? 10  GLU A C    1  
ATOM 125   O O    . GLU A 1 10  ? -49.468 -8.195  4.104   1.00 37.49 ? 10  GLU A O    1  
ATOM 126   C CB   . GLU A 1 10  ? -52.983 -7.720  4.177   1.00 38.40 ? 10  GLU A CB   1  
ATOM 127   C CG   . GLU A 1 10  ? -52.980 -8.276  5.589   1.00 38.59 ? 10  GLU A CG   1  
ATOM 128   C CD   . GLU A 1 10  ? -54.212 -9.105  5.884   1.00 38.73 ? 10  GLU A CD   1  
ATOM 129   O OE1  . GLU A 1 10  ? -55.338 -8.598  5.693   1.00 38.82 ? 10  GLU A OE1  1  
ATOM 130   O OE2  . GLU A 1 10  ? -54.063 -10.274 6.286   1.00 38.81 ? 10  GLU A OE2  1  
ATOM 131   H H    . GLU A 1 10  ? -51.917 -7.100  1.628   1.00 38.34 ? 10  GLU A H    1  
ATOM 132   H HA   . GLU A 1 10  ? -51.275 -6.450  4.426   1.00 38.39 ? 10  GLU A HA   1  
ATOM 133   H HB2  . GLU A 1 10  ? -53.702 -6.915  4.132   1.00 38.43 ? 10  GLU A HB2  1  
ATOM 134   H HB3  . GLU A 1 10  ? -53.296 -8.506  3.506   1.00 38.43 ? 10  GLU A HB3  1  
ATOM 135   H HG2  . GLU A 1 10  ? -52.106 -8.898  5.715   1.00 38.64 ? 10  GLU A HG2  1  
ATOM 136   H HG3  . GLU A 1 10  ? -52.941 -7.453  6.286   1.00 38.66 ? 10  GLU A HG3  1  
ATOM 137   N N    . GLN A 1 11  ? -51.029 -9.460  3.098   1.00 37.65 ? 11  GLN A N    1  
ATOM 138   C CA   . GLN A 1 11  ? -50.167 -10.628 2.988   1.00 37.26 ? 11  GLN A CA   1  
ATOM 139   C C    . GLN A 1 11  ? -50.162 -11.143 1.554   1.00 36.82 ? 11  GLN A C    1  
ATOM 140   O O    . GLN A 1 11  ? -51.194 -11.572 1.042   1.00 36.78 ? 11  GLN A O    1  
ATOM 141   C CB   . GLN A 1 11  ? -50.630 -11.743 3.929   1.00 37.34 ? 11  GLN A CB   1  
ATOM 142   C CG   . GLN A 1 11  ? -50.863 -11.297 5.364   1.00 37.71 ? 11  GLN A CG   1  
ATOM 143   C CD   . GLN A 1 11  ? -51.205 -12.452 6.281   1.00 37.79 ? 11  GLN A CD   1  
ATOM 144   O OE1  . GLN A 1 11  ? -50.700 -13.565 6.121   1.00 37.58 ? 11  GLN A OE1  1  
ATOM 145   N NE2  . GLN A 1 11  ? -52.090 -12.204 7.233   1.00 38.16 ? 11  GLN A NE2  1  
ATOM 146   H H    . GLN A 1 11  ? -51.945 -9.505  2.737   1.00 37.91 ? 11  GLN A H    1  
ATOM 147   H HA   . GLN A 1 11  ? -49.166 -10.331 3.259   1.00 37.29 ? 11  GLN A HA   1  
ATOM 148   H HB2  . GLN A 1 11  ? -51.553 -12.157 3.551   1.00 37.36 ? 11  GLN A HB2  1  
ATOM 149   H HB3  . GLN A 1 11  ? -49.880 -12.521 3.936   1.00 37.16 ? 11  GLN A HB3  1  
ATOM 150   H HG2  . GLN A 1 11  ? -49.965 -10.822 5.732   1.00 37.78 ? 11  GLN A HG2  1  
ATOM 151   H HG3  . GLN A 1 11  ? -51.679 -10.590 5.380   1.00 37.94 ? 11  GLN A HG3  1  
ATOM 152   H HE21 . GLN A 1 11  ? -52.473 -11.299 7.286   1.00 38.35 ? 11  GLN A HE21 1  
ATOM 153   H HE22 . GLN A 1 11  ? -52.337 -12.934 7.838   1.00 38.26 ? 11  GLN A HE22 1  
ATOM 154   N N    . PRO A 1 12  ? -49.005 -11.089 0.881   1.00 36.56 ? 12  PRO A N    1  
ATOM 155   C CA   . PRO A 1 12  ? -48.838 -11.604 -0.478  1.00 36.18 ? 12  PRO A CA   1  
ATOM 156   C C    . PRO A 1 12  ? -48.571 -13.105 -0.492  1.00 35.97 ? 12  PRO A C    1  
ATOM 157   O O    . PRO A 1 12  ? -48.119 -13.658 -1.494  1.00 36.19 ? 12  PRO A O    1  
ATOM 158   C CB   . PRO A 1 12  ? -47.611 -10.841 -1.007  1.00 36.06 ? 12  PRO A CB   1  
ATOM 159   C CG   . PRO A 1 12  ? -47.163 -9.945  0.107   1.00 36.50 ? 12  PRO A CG   1  
ATOM 160   C CD   . PRO A 1 12  ? -47.762 -10.497 1.368   1.00 36.70 ? 12  PRO A CD   1  
ATOM 161   H HA   . PRO A 1 12  ? -49.697 -11.388 -1.094  1.00 36.21 ? 12  PRO A HA   1  
ATOM 162   H HB2  . PRO A 1 12  ? -46.839 -11.548 -1.277  1.00 35.77 ? 12  PRO A HB2  1  
ATOM 163   H HB3  . PRO A 1 12  ? -47.896 -10.270 -1.877  1.00 36.04 ? 12  PRO A HB3  1  
ATOM 164   H HG2  . PRO A 1 12  ? -46.084 -9.955  0.172   1.00 36.44 ? 12  PRO A HG2  1  
ATOM 165   H HG3  . PRO A 1 12  ? -47.518 -8.941  -0.068  1.00 36.79 ? 12  PRO A HG3  1  
ATOM 166   H HD2  . PRO A 1 12  ? -47.118 -11.250 1.799   1.00 36.66 ? 12  PRO A HD2  1  
ATOM 167   H HD3  . PRO A 1 12  ? -47.961 -9.708  2.077   1.00 37.04 ? 12  PRO A HD3  1  
ATOM 168   N N    . GLY A 1 13  ? -48.846 -13.755 0.628   1.00 35.61 ? 13  GLY A N    1  
ATOM 169   C CA   . GLY A 1 13  ? -48.634 -15.181 0.728   1.00 35.47 ? 13  GLY A CA   1  
ATOM 170   C C    . GLY A 1 13  ? -47.688 -15.538 1.851   1.00 35.16 ? 13  GLY A C    1  
ATOM 171   O O    . GLY A 1 13  ? -48.074 -16.215 2.803   1.00 35.17 ? 13  GLY A O    1  
ATOM 172   H H    . GLY A 1 13  ? -49.205 -13.260 1.392   1.00 35.50 ? 13  GLY A H    1  
ATOM 173   H HA2  . GLY A 1 13  ? -49.585 -15.661 0.907   1.00 35.46 ? 13  GLY A HA2  1  
ATOM 174   H HA3  . GLY A 1 13  ? -48.226 -15.542 -0.203  1.00 35.66 ? 13  GLY A HA3  1  
ATOM 175   N N    . ALA A 1 14  ? -46.454 -15.071 1.750   1.00 34.97 ? 14  ALA A N    1  
ATOM 176   C CA   . ALA A 1 14  ? -45.447 -15.359 2.759   1.00 34.74 ? 14  ALA A CA   1  
ATOM 177   C C    . ALA A 1 14  ? -45.328 -14.207 3.749   1.00 34.24 ? 14  ALA A C    1  
ATOM 178   O O    . ALA A 1 14  ? -45.884 -13.130 3.534   1.00 34.14 ? 14  ALA A O    1  
ATOM 179   C CB   . ALA A 1 14  ? -44.100 -15.631 2.101   1.00 35.03 ? 14  ALA A CB   1  
ATOM 180   H H    . ALA A 1 14  ? -46.214 -14.514 0.982   1.00 35.02 ? 14  ALA A H    1  
ATOM 181   H HA   . ALA A 1 14  ? -45.751 -16.250 3.291   1.00 34.81 ? 14  ALA A HA   1  
ATOM 182   H HB1  . ALA A 1 14  ? -44.195 -16.453 1.406   1.00 35.15 ? 14  ALA A HB1  1  
ATOM 183   H HB2  . ALA A 1 14  ? -43.374 -15.884 2.861   1.00 35.06 ? 14  ALA A HB2  1  
ATOM 184   H HB3  . ALA A 1 14  ? -43.773 -14.749 1.573   1.00 35.13 ? 14  ALA A HB3  1  
ATOM 185   N N    . LEU A 1 15  ? -44.597 -14.443 4.828   1.00 34.01 ? 15  LEU A N    1  
ATOM 186   C CA   . LEU A 1 15  ? -44.388 -13.426 5.849   1.00 33.60 ? 15  LEU A CA   1  
ATOM 187   C C    . LEU A 1 15  ? -42.915 -13.337 6.238   1.00 33.26 ? 15  LEU A C    1  
ATOM 188   O O    . LEU A 1 15  ? -42.352 -12.242 6.293   1.00 33.39 ? 15  LEU A O    1  
ATOM 189   C CB   . LEU A 1 15  ? -45.239 -13.738 7.080   1.00 33.42 ? 15  LEU A CB   1  
ATOM 190   C CG   . LEU A 1 15  ? -45.067 -12.772 8.252   1.00 33.48 ? 15  LEU A CG   1  
ATOM 191   C CD1  . LEU A 1 15  ? -45.565 -11.381 7.884   1.00 33.70 ? 15  LEU A CD1  1  
ATOM 192   C CD2  . LEU A 1 15  ? -45.794 -13.289 9.480   1.00 33.25 ? 15  LEU A CD2  1  
ATOM 193   H H    . LEU A 1 15  ? -44.186 -15.332 4.944   1.00 34.17 ? 15  LEU A H    1  
ATOM 194   H HA   . LEU A 1 15  ? -44.698 -12.477 5.437   1.00 33.74 ? 15  LEU A HA   1  
ATOM 195   H HB2  . LEU A 1 15  ? -46.279 -13.730 6.786   1.00 33.66 ? 15  LEU A HB2  1  
ATOM 196   H HB3  . LEU A 1 15  ? -44.989 -14.729 7.423   1.00 33.10 ? 15  LEU A HB3  1  
ATOM 197   H HG   . LEU A 1 15  ? -44.017 -12.697 8.493   1.00 33.61 ? 15  LEU A HG   1  
ATOM 198   H HD11 . LEU A 1 15  ? -45.439 -10.721 8.728   1.00 33.68 ? 15  LEU A HD11 1  
ATOM 199   H HD12 . LEU A 1 15  ? -46.610 -11.432 7.619   1.00 33.80 ? 15  LEU A HD12 1  
ATOM 200   H HD13 . LEU A 1 15  ? -44.998 -11.005 7.044   1.00 33.84 ? 15  LEU A HD13 1  
ATOM 201   H HD21 . LEU A 1 15  ? -45.630 -12.611 10.305  1.00 33.24 ? 15  LEU A HD21 1  
ATOM 202   H HD22 . LEU A 1 15  ? -45.419 -14.269 9.738   1.00 33.21 ? 15  LEU A HD22 1  
ATOM 203   H HD23 . LEU A 1 15  ? -46.852 -13.350 9.273   1.00 33.20 ? 15  LEU A HD23 1  
ATOM 204   N N    . ALA A 1 16  ? -42.311 -14.502 6.487   1.00 32.89 ? 16  ALA A N    1  
ATOM 205   C CA   . ALA A 1 16  ? -40.919 -14.602 6.935   1.00 32.59 ? 16  ALA A CA   1  
ATOM 206   C C    . ALA A 1 16  ? -40.733 -13.984 8.322   1.00 31.98 ? 16  ALA A C    1  
ATOM 207   O O    . ALA A 1 16  ? -40.578 -12.772 8.465   1.00 31.63 ? 16  ALA A O    1  
ATOM 208   C CB   . ALA A 1 16  ? -39.966 -13.966 5.925   1.00 32.80 ? 16  ALA A CB   1  
ATOM 209   H H    . ALA A 1 16  ? -42.820 -15.331 6.352   1.00 32.86 ? 16  ALA A H    1  
ATOM 210   H HA   . ALA A 1 16  ? -40.681 -15.656 7.000   1.00 32.73 ? 16  ALA A HA   1  
ATOM 211   H HB1  . ALA A 1 16  ? -40.114 -14.417 4.954   1.00 32.95 ? 16  ALA A HB1  1  
ATOM 212   H HB2  . ALA A 1 16  ? -38.944 -14.118 6.244   1.00 32.85 ? 16  ALA A HB2  1  
ATOM 213   H HB3  . ALA A 1 16  ? -40.167 -12.905 5.861   1.00 32.80 ? 16  ALA A HB3  1  
ATOM 214   N N    . ARG A 1 17  ? -40.748 -14.832 9.342   1.00 31.94 ? 17  ARG A N    1  
ATOM 215   C CA   . ARG A 1 17  ? -40.612 -14.379 10.722  1.00 31.46 ? 17  ARG A CA   1  
ATOM 216   C C    . ARG A 1 17  ? -39.143 -14.153 11.088  1.00 31.11 ? 17  ARG A C    1  
ATOM 217   O O    . ARG A 1 17  ? -38.244 -14.378 10.271  1.00 31.11 ? 17  ARG A O    1  
ATOM 218   C CB   . ARG A 1 17  ? -41.220 -15.405 11.684  1.00 31.72 ? 17  ARG A CB   1  
ATOM 219   C CG   . ARG A 1 17  ? -42.702 -15.653 11.478  1.00 31.75 ? 17  ARG A CG   1  
ATOM 220   C CD   . ARG A 1 17  ? -43.225 -16.676 12.474  1.00 31.70 ? 17  ARG A CD   1  
ATOM 221   N NE   . ARG A 1 17  ? -43.109 -16.205 13.854  1.00 31.67 ? 17  ARG A NE   1  
ATOM 222   C CZ   . ARG A 1 17  ? -43.147 -16.998 14.925  1.00 31.67 ? 17  ARG A CZ   1  
ATOM 223   N NH1  . ARG A 1 17  ? -43.299 -18.310 14.790  1.00 31.70 ? 17  ARG A NH1  1  
ATOM 224   N NH2  . ARG A 1 17  ? -43.035 -16.467 16.136  1.00 31.71 ? 17  ARG A NH2  1  
ATOM 225   H H    . ARG A 1 17  ? -40.844 -15.788 9.164   1.00 32.30 ? 17  ARG A H    1  
ATOM 226   H HA   . ARG A 1 17  ? -41.148 -13.444 10.819  1.00 31.22 ? 17  ARG A HA   1  
ATOM 227   H HB2  . ARG A 1 17  ? -40.705 -16.346 11.559  1.00 31.77 ? 17  ARG A HB2  1  
ATOM 228   H HB3  . ARG A 1 17  ? -41.074 -15.059 12.697  1.00 31.94 ? 17  ARG A HB3  1  
ATOM 229   H HG2  . ARG A 1 17  ? -43.238 -14.724 11.618  1.00 31.83 ? 17  ARG A HG2  1  
ATOM 230   H HG3  . ARG A 1 17  ? -42.862 -16.020 10.476  1.00 31.82 ? 17  ARG A HG3  1  
ATOM 231   H HD2  . ARG A 1 17  ? -44.263 -16.869 12.256  1.00 31.64 ? 17  ARG A HD2  1  
ATOM 232   H HD3  . ARG A 1 17  ? -42.656 -17.590 12.368  1.00 31.84 ? 17  ARG A HD3  1  
ATOM 233   H HE   . ARG A 1 17  ? -43.001 -15.231 13.994  1.00 31.70 ? 17  ARG A HE   1  
ATOM 234   H HH11 . ARG A 1 17  ? -43.394 -18.719 13.880  1.00 31.72 ? 17  ARG A HH11 1  
ATOM 235   H HH12 . ARG A 1 17  ? -43.315 -18.899 15.601  1.00 31.76 ? 17  ARG A HH12 1  
ATOM 236   H HH21 . ARG A 1 17  ? -42.921 -15.475 16.238  1.00 31.75 ? 17  ARG A HH21 1  
ATOM 237   H HH22 . ARG A 1 17  ? -43.075 -17.057 16.954  1.00 31.77 ? 17  ARG A HH22 1  
ATOM 238   N N    . GLU A 1 18  ? -38.916 -13.721 12.327  1.00 30.90 ? 18  GLU A N    1  
ATOM 239   C CA   . GLU A 1 18  ? -37.566 -13.530 12.866  1.00 30.62 ? 18  GLU A CA   1  
ATOM 240   C C    . GLU A 1 18  ? -36.902 -14.881 13.163  1.00 30.39 ? 18  GLU A C    1  
ATOM 241   O O    . GLU A 1 18  ? -36.548 -15.188 14.304  1.00 30.35 ? 18  GLU A O    1  
ATOM 242   C CB   . GLU A 1 18  ? -37.628 -12.670 14.136  1.00 30.67 ? 18  GLU A CB   1  
ATOM 243   C CG   . GLU A 1 18  ? -38.645 -13.164 15.153  1.00 30.69 ? 18  GLU A CG   1  
ATOM 244   C CD   . GLU A 1 18  ? -38.601 -12.386 16.452  1.00 30.90 ? 18  GLU A CD   1  
ATOM 245   O OE1  . GLU A 1 18  ? -37.853 -12.790 17.364  1.00 30.81 ? 18  GLU A OE1  1  
ATOM 246   O OE2  . GLU A 1 18  ? -39.332 -11.380 16.574  1.00 31.24 ? 18  GLU A OE2  1  
ATOM 247   H H    . GLU A 1 18  ? -39.683 -13.521 12.903  1.00 30.99 ? 18  GLU A H    1  
ATOM 248   H HA   . GLU A 1 18  ? -36.982 -13.012 12.120  1.00 30.62 ? 18  GLU A HA   1  
ATOM 249   H HB2  . GLU A 1 18  ? -36.655 -12.665 14.605  1.00 30.69 ? 18  GLU A HB2  1  
ATOM 250   H HB3  . GLU A 1 18  ? -37.890 -11.660 13.861  1.00 30.77 ? 18  GLU A HB3  1  
ATOM 251   H HG2  . GLU A 1 18  ? -39.634 -13.067 14.730  1.00 30.69 ? 18  GLU A HG2  1  
ATOM 252   H HG3  . GLU A 1 18  ? -38.447 -14.206 15.365  1.00 30.64 ? 18  GLU A HG3  1  
ATOM 253   N N    . PHE A 1 19  ? -36.740 -15.677 12.119  1.00 30.33 ? 19  PHE A N    1  
ATOM 254   C CA   . PHE A 1 19  ? -36.233 -17.032 12.246  1.00 30.21 ? 19  PHE A CA   1  
ATOM 255   C C    . PHE A 1 19  ? -34.706 -17.048 12.361  1.00 29.75 ? 19  PHE A C    1  
ATOM 256   O O    . PHE A 1 19  ? -34.160 -17.470 13.380  1.00 29.69 ? 19  PHE A O    1  
ATOM 257   C CB   . PHE A 1 19  ? -36.692 -17.863 11.044  1.00 30.57 ? 19  PHE A CB   1  
ATOM 258   C CG   . PHE A 1 19  ? -36.405 -19.333 11.158  1.00 30.68 ? 19  PHE A CG   1  
ATOM 259   C CD1  . PHE A 1 19  ? -36.894 -20.067 12.226  1.00 31.05 ? 19  PHE A CD1  1  
ATOM 260   C CD2  . PHE A 1 19  ? -35.656 -19.982 10.190  1.00 30.51 ? 19  PHE A CD2  1  
ATOM 261   C CE1  . PHE A 1 19  ? -36.646 -21.422 12.325  1.00 31.24 ? 19  PHE A CE1  1  
ATOM 262   C CE2  . PHE A 1 19  ? -35.403 -21.336 10.284  1.00 30.71 ? 19  PHE A CE2  1  
ATOM 263   C CZ   . PHE A 1 19  ? -35.898 -22.057 11.354  1.00 31.07 ? 19  PHE A CZ   1  
ATOM 264   H H    . PHE A 1 19  ? -36.988 -15.341 11.229  1.00 30.42 ? 19  PHE A H    1  
ATOM 265   H HA   . PHE A 1 19  ? -36.656 -17.457 13.145  1.00 30.28 ? 19  PHE A HA   1  
ATOM 266   H HB2  . PHE A 1 19  ? -37.757 -17.747 10.928  1.00 30.83 ? 19  PHE A HB2  1  
ATOM 267   H HB3  . PHE A 1 19  ? -36.199 -17.497 10.157  1.00 30.59 ? 19  PHE A HB3  1  
ATOM 268   H HD1  . PHE A 1 19  ? -37.479 -19.572 12.989  1.00 31.23 ? 19  PHE A HD1  1  
ATOM 269   H HD2  . PHE A 1 19  ? -35.268 -19.416 9.355   1.00 30.27 ? 19  PHE A HD2  1  
ATOM 270   H HE1  . PHE A 1 19  ? -37.033 -21.983 13.164  1.00 31.57 ? 19  PHE A HE1  1  
ATOM 271   H HE2  . PHE A 1 19  ? -34.819 -21.832 9.522   1.00 30.63 ? 19  PHE A HE2  1  
ATOM 272   H HZ   . PHE A 1 19  ? -35.703 -23.116 11.429  1.00 31.29 ? 19  PHE A HZ   1  
ATOM 273   N N    . LEU A 1 20  ? -34.021 -16.583 11.324  1.00 29.50 ? 20  LEU A N    1  
ATOM 274   C CA   . LEU A 1 20  ? -32.562 -16.602 11.314  1.00 29.16 ? 20  LEU A CA   1  
ATOM 275   C C    . LEU A 1 20  ? -31.992 -15.192 11.360  1.00 28.50 ? 20  LEU A C    1  
ATOM 276   O O    . LEU A 1 20  ? -32.111 -14.430 10.398  1.00 28.35 ? 20  LEU A O    1  
ATOM 277   C CB   . LEU A 1 20  ? -32.036 -17.336 10.079  1.00 29.33 ? 20  LEU A CB   1  
ATOM 278   C CG   . LEU A 1 20  ? -32.382 -18.825 10.007  1.00 29.60 ? 20  LEU A CG   1  
ATOM 279   C CD1  . LEU A 1 20  ? -31.865 -19.432 8.711   1.00 29.57 ? 20  LEU A CD1  1  
ATOM 280   C CD2  . LEU A 1 20  ? -31.807 -19.566 11.205  1.00 29.85 ? 20  LEU A CD2  1  
ATOM 281   H H    . LEU A 1 20  ? -34.502 -16.219 10.552  1.00 29.61 ? 20  LEU A H    1  
ATOM 282   H HA   . LEU A 1 20  ? -32.237 -17.131 12.199  1.00 29.36 ? 20  LEU A HA   1  
ATOM 283   H HB2  . LEU A 1 20  ? -32.441 -16.852 9.203   1.00 29.39 ? 20  LEU A HB2  1  
ATOM 284   H HB3  . LEU A 1 20  ? -30.961 -17.237 10.059  1.00 29.28 ? 20  LEU A HB3  1  
ATOM 285   H HG   . LEU A 1 20  ? -33.457 -18.941 10.025  1.00 29.74 ? 20  LEU A HG   1  
ATOM 286   H HD11 . LEU A 1 20  ? -30.794 -19.313 8.661   1.00 29.64 ? 20  LEU A HD11 1  
ATOM 287   H HD12 . LEU A 1 20  ? -32.323 -18.934 7.871   1.00 29.62 ? 20  LEU A HD12 1  
ATOM 288   H HD13 . LEU A 1 20  ? -32.112 -20.483 8.684   1.00 29.51 ? 20  LEU A HD13 1  
ATOM 289   H HD21 . LEU A 1 20  ? -30.730 -19.478 11.199  1.00 29.89 ? 20  LEU A HD21 1  
ATOM 290   H HD22 . LEU A 1 20  ? -32.083 -20.609 11.149  1.00 29.82 ? 20  LEU A HD22 1  
ATOM 291   H HD23 . LEU A 1 20  ? -32.200 -19.137 12.115  1.00 30.10 ? 20  LEU A HD23 1  
ATOM 292   N N    . ALA A 1 21  ? -31.378 -14.857 12.483  1.00 28.20 ? 21  ALA A N    1  
ATOM 293   C CA   . ALA A 1 21  ? -30.776 -13.547 12.672  1.00 27.66 ? 21  ALA A CA   1  
ATOM 294   C C    . ALA A 1 21  ? -29.353 -13.677 13.195  1.00 27.05 ? 21  ALA A C    1  
ATOM 295   O O    . ALA A 1 21  ? -29.131 -14.167 14.304  1.00 26.92 ? 21  ALA A O    1  
ATOM 296   C CB   . ALA A 1 21  ? -31.622 -12.705 13.620  1.00 27.59 ? 21  ALA A CB   1  
ATOM 297   H H    . ALA A 1 21  ? -31.323 -15.514 13.209  1.00 28.40 ? 21  ALA A H    1  
ATOM 298   H HA   . ALA A 1 21  ? -30.747 -13.052 11.711  1.00 27.85 ? 21  ALA A HA   1  
ATOM 299   H HB1  . ALA A 1 21  ? -32.642 -12.671 13.262  1.00 27.65 ? 21  ALA A HB1  1  
ATOM 300   H HB2  . ALA A 1 21  ? -31.223 -11.702 13.664  1.00 27.51 ? 21  ALA A HB2  1  
ATOM 301   H HB3  . ALA A 1 21  ? -31.602 -13.144 14.607  1.00 27.66 ? 21  ALA A HB3  1  
ATOM 302   N N    . ALA A 1 22  ? -28.401 -13.267 12.368  1.00 26.78 ? 22  ALA A N    1  
ATOM 303   C CA   . ALA A 1 22  ? -26.991 -13.251 12.739  1.00 26.29 ? 22  ALA A CA   1  
ATOM 304   C C    . ALA A 1 22  ? -26.290 -12.097 12.032  1.00 25.93 ? 22  ALA A C    1  
ATOM 305   O O    . ALA A 1 22  ? -25.110 -12.177 11.680  1.00 26.15 ? 22  ALA A O    1  
ATOM 306   C CB   . ALA A 1 22  ? -26.332 -14.581 12.390  1.00 26.23 ? 22  ALA A CB   1  
ATOM 307   H H    . ALA A 1 22  ? -28.656 -12.968 11.471  1.00 26.97 ? 22  ALA A H    1  
ATOM 308   H HA   . ALA A 1 22  ? -26.925 -13.102 13.807  1.00 26.35 ? 22  ALA A HA   1  
ATOM 309   H HB1  . ALA A 1 22  ? -25.305 -14.576 12.731  1.00 26.24 ? 22  ALA A HB1  1  
ATOM 310   H HB2  . ALA A 1 22  ? -26.354 -14.728 11.320  1.00 26.16 ? 22  ALA A HB2  1  
ATOM 311   H HB3  . ALA A 1 22  ? -26.866 -15.384 12.873  1.00 26.35 ? 22  ALA A HB3  1  
ATOM 312   N N    . MET A 1 23  ? -27.024 -11.010 11.856  1.00 25.45 ? 23  MET A N    1  
ATOM 313   C CA   . MET A 1 23  ? -26.541 -9.868  11.096  1.00 25.17 ? 23  MET A CA   1  
ATOM 314   C C    . MET A 1 23  ? -26.559 -8.618  11.973  1.00 24.29 ? 23  MET A C    1  
ATOM 315   O O    . MET A 1 23  ? -26.436 -7.493  11.492  1.00 24.04 ? 23  MET A O    1  
ATOM 316   C CB   . MET A 1 23  ? -27.417 -9.687  9.847   1.00 25.82 ? 23  MET A CB   1  
ATOM 317   C CG   . MET A 1 23  ? -26.872 -8.682  8.845   1.00 26.18 ? 23  MET A CG   1  
ATOM 318   S SD   . MET A 1 23  ? -27.866 -8.582  7.340   1.00 26.73 ? 23  MET A SD   1  
ATOM 319   C CE   . MET A 1 23  ? -29.466 -8.136  8.007   1.00 27.47 ? 23  MET A CE   1  
ATOM 320   H H    . MET A 1 23  ? -27.916 -10.961 12.278  1.00 25.35 ? 23  MET A H    1  
ATOM 321   H HA   . MET A 1 23  ? -25.523 -10.069 10.791  1.00 25.23 ? 23  MET A HA   1  
ATOM 322   H HB2  . MET A 1 23  ? -27.511 -10.641 9.350   1.00 26.04 ? 23  MET A HB2  1  
ATOM 323   H HB3  . MET A 1 23  ? -28.399 -9.357  10.153  1.00 25.92 ? 23  MET A HB3  1  
ATOM 324   H HG2  . MET A 1 23  ? -26.848 -7.707  9.311   1.00 26.11 ? 23  MET A HG2  1  
ATOM 325   H HG3  . MET A 1 23  ? -25.868 -8.975  8.578   1.00 26.28 ? 23  MET A HG3  1  
ATOM 326   H HE1  . MET A 1 23  ? -30.185 -8.065  7.203   1.00 27.66 ? 23  MET A HE1  1  
ATOM 327   H HE2  . MET A 1 23  ? -29.394 -7.184  8.510   1.00 27.63 ? 23  MET A HE2  1  
ATOM 328   H HE3  . MET A 1 23  ? -29.785 -8.891  8.710   1.00 27.66 ? 23  MET A HE3  1  
ATOM 329   N N    . GLU A 1 24  ? -26.684 -8.844  13.272  1.00 23.92 ? 24  GLU A N    1  
ATOM 330   C CA   . GLU A 1 24  ? -26.794 -7.775  14.252  1.00 23.15 ? 24  GLU A CA   1  
ATOM 331   C C    . GLU A 1 24  ? -25.514 -6.945  14.290  1.00 22.22 ? 24  GLU A C    1  
ATOM 332   O O    . GLU A 1 24  ? -24.454 -7.434  14.697  1.00 22.21 ? 24  GLU A O    1  
ATOM 333   C CB   . GLU A 1 24  ? -27.099 -8.352  15.643  1.00 23.57 ? 24  GLU A CB   1  
ATOM 334   C CG   . GLU A 1 24  ? -28.432 -9.098  15.740  1.00 23.67 ? 24  GLU A CG   1  
ATOM 335   C CD   . GLU A 1 24  ? -28.463 -10.380 14.922  1.00 24.03 ? 24  GLU A CD   1  
ATOM 336   O OE1  . GLU A 1 24  ? -27.895 -11.390 15.379  1.00 24.02 ? 24  GLU A OE1  1  
ATOM 337   O OE2  . GLU A 1 24  ? -29.042 -10.372 13.811  1.00 24.41 ? 24  GLU A OE2  1  
ATOM 338   H H    . GLU A 1 24  ? -26.703 -9.773  13.584  1.00 24.25 ? 24  GLU A H    1  
ATOM 339   H HA   . GLU A 1 24  ? -27.612 -7.135  13.953  1.00 23.03 ? 24  GLU A HA   1  
ATOM 340   H HB2  . GLU A 1 24  ? -26.311 -9.040  15.913  1.00 24.07 ? 24  GLU A HB2  1  
ATOM 341   H HB3  . GLU A 1 24  ? -27.114 -7.542  16.359  1.00 23.42 ? 24  GLU A HB3  1  
ATOM 342   H HG2  . GLU A 1 24  ? -28.611 -9.347  16.775  1.00 23.64 ? 24  GLU A HG2  1  
ATOM 343   H HG3  . GLU A 1 24  ? -29.216 -8.446  15.389  1.00 23.64 ? 24  GLU A HG3  1  
ATOM 344   N N    . PRO A 1 25  ? -25.599 -5.677  13.860  1.00 21.54 ? 25  PRO A N    1  
ATOM 345   C CA   . PRO A 1 25  ? -24.453 -4.786  13.769  1.00 20.70 ? 25  PRO A CA   1  
ATOM 346   C C    . PRO A 1 25  ? -24.172 -4.068  15.083  1.00 19.96 ? 25  PRO A C    1  
ATOM 347   O O    . PRO A 1 25  ? -24.760 -3.025  15.372  1.00 19.79 ? 25  PRO A O    1  
ATOM 348   C CB   . PRO A 1 25  ? -24.867 -3.776  12.686  1.00 20.35 ? 25  PRO A CB   1  
ATOM 349   C CG   . PRO A 1 25  ? -26.303 -4.072  12.357  1.00 20.99 ? 25  PRO A CG   1  
ATOM 350   C CD   . PRO A 1 25  ? -26.816 -5.005  13.417  1.00 21.63 ? 25  PRO A CD   1  
ATOM 351   H HA   . PRO A 1 25  ? -23.567 -5.315  13.451  1.00 20.98 ? 25  PRO A HA   1  
ATOM 352   H HB2  . PRO A 1 25  ? -24.754 -2.773  13.071  1.00 19.62 ? 25  PRO A HB2  1  
ATOM 353   H HB3  . PRO A 1 25  ? -24.233 -3.901  11.819  1.00 20.49 ? 25  PRO A HB3  1  
ATOM 354   H HG2  . PRO A 1 25  ? -26.873 -3.154  12.364  1.00 20.64 ? 25  PRO A HG2  1  
ATOM 355   H HG3  . PRO A 1 25  ? -26.365 -4.540  11.386  1.00 21.44 ? 25  PRO A HG3  1  
ATOM 356   H HD2  . PRO A 1 25  ? -27.271 -4.451  14.225  1.00 21.43 ? 25  PRO A HD2  1  
ATOM 357   H HD3  . PRO A 1 25  ? -27.517 -5.711  12.996  1.00 22.40 ? 25  PRO A HD3  1  
ATOM 358   N N    . GLU A 1 26  ? -23.293 -4.643  15.889  1.00 19.63 ? 26  GLU A N    1  
ATOM 359   C CA   . GLU A 1 26  ? -22.920 -4.027  17.152  1.00 19.01 ? 26  GLU A CA   1  
ATOM 360   C C    . GLU A 1 26  ? -21.578 -3.316  17.018  1.00 17.82 ? 26  GLU A C    1  
ATOM 361   O O    . GLU A 1 26  ? -20.709 -3.756  16.260  1.00 17.39 ? 26  GLU A O    1  
ATOM 362   C CB   . GLU A 1 26  ? -22.862 -5.069  18.271  1.00 19.23 ? 26  GLU A CB   1  
ATOM 363   C CG   . GLU A 1 26  ? -24.212 -5.693  18.588  1.00 19.90 ? 26  GLU A CG   1  
ATOM 364   C CD   . GLU A 1 26  ? -24.162 -6.617  19.785  1.00 20.41 ? 26  GLU A CD   1  
ATOM 365   O OE1  . GLU A 1 26  ? -24.067 -6.118  20.923  1.00 20.67 ? 26  GLU A OE1  1  
ATOM 366   O OE2  . GLU A 1 26  ? -24.228 -7.852  19.595  1.00 20.64 ? 26  GLU A OE2  1  
ATOM 367   H H    . GLU A 1 26  ? -22.888 -5.496  15.628  1.00 19.90 ? 26  GLU A H    1  
ATOM 368   H HA   . GLU A 1 26  ? -23.677 -3.292  17.390  1.00 19.36 ? 26  GLU A HA   1  
ATOM 369   H HB2  . GLU A 1 26  ? -22.182 -5.856  17.981  1.00 19.06 ? 26  GLU A HB2  1  
ATOM 370   H HB3  . GLU A 1 26  ? -22.490 -4.597  19.168  1.00 19.19 ? 26  GLU A HB3  1  
ATOM 371   H HG2  . GLU A 1 26  ? -24.924 -4.905  18.790  1.00 20.16 ? 26  GLU A HG2  1  
ATOM 372   H HG3  . GLU A 1 26  ? -24.542 -6.258  17.730  1.00 19.91 ? 26  GLU A HG3  1  
ATOM 373   N N    . PRO A 1 27  ? -21.401 -2.195  17.738  1.00 17.38 ? 27  PRO A N    1  
ATOM 374   C CA   . PRO A 1 27  ? -20.169 -1.400  17.689  1.00 16.31 ? 27  PRO A CA   1  
ATOM 375   C C    . PRO A 1 27  ? -18.937 -2.211  18.075  1.00 15.58 ? 27  PRO A C    1  
ATOM 376   O O    . PRO A 1 27  ? -18.847 -2.744  19.183  1.00 15.74 ? 27  PRO A O    1  
ATOM 377   C CB   . PRO A 1 27  ? -20.409 -0.277  18.707  1.00 16.33 ? 27  PRO A CB   1  
ATOM 378   C CG   . PRO A 1 27  ? -21.549 -0.743  19.549  1.00 17.43 ? 27  PRO A CG   1  
ATOM 379   C CD   . PRO A 1 27  ? -22.389 -1.613  18.660  1.00 18.02 ? 27  PRO A CD   1  
ATOM 380   H HA   . PRO A 1 27  ? -20.018 -0.968  16.710  1.00 16.18 ? 27  PRO A HA   1  
ATOM 381   H HB2  . PRO A 1 27  ? -19.517 -0.134  19.298  1.00 15.88 ? 27  PRO A HB2  1  
ATOM 382   H HB3  . PRO A 1 27  ? -20.652 0.638   18.190  1.00 16.16 ? 27  PRO A HB3  1  
ATOM 383   H HG2  . PRO A 1 27  ? -21.174 -1.311  20.387  1.00 17.52 ? 27  PRO A HG2  1  
ATOM 384   H HG3  . PRO A 1 27  ? -22.123 0.104   19.894  1.00 17.81 ? 27  PRO A HG3  1  
ATOM 385   H HD2  . PRO A 1 27  ? -22.877 -2.385  19.237  1.00 18.21 ? 27  PRO A HD2  1  
ATOM 386   H HD3  . PRO A 1 27  ? -23.114 -1.020  18.127  1.00 18.75 ? 27  PRO A HD3  1  
ATOM 387   N N    . ALA A 1 28  ? -17.997 -2.305  17.148  1.00 14.93 ? 28  ALA A N    1  
ATOM 388   C CA   . ALA A 1 28  ? -16.759 -3.028  17.378  1.00 14.31 ? 28  ALA A CA   1  
ATOM 389   C C    . ALA A 1 28  ? -15.603 -2.055  17.561  1.00 13.28 ? 28  ALA A C    1  
ATOM 390   O O    . ALA A 1 28  ? -15.576 -0.991  16.937  1.00 12.82 ? 28  ALA A O    1  
ATOM 391   C CB   . ALA A 1 28  ? -16.469 -3.972  16.222  1.00 14.27 ? 28  ALA A CB   1  
ATOM 392   H H    . ALA A 1 28  ? -18.134 -1.864  16.284  1.00 14.96 ? 28  ALA A H    1  
ATOM 393   H HA   . ALA A 1 28  ? -16.872 -3.615  18.279  1.00 14.81 ? 28  ALA A HA   1  
ATOM 394   H HB1  . ALA A 1 28  ? -16.355 -3.404  15.311  1.00 14.09 ? 28  ALA A HB1  1  
ATOM 395   H HB2  . ALA A 1 28  ? -17.286 -4.670  16.112  1.00 14.39 ? 28  ALA A HB2  1  
ATOM 396   H HB3  . ALA A 1 28  ? -15.554 -4.514  16.423  1.00 14.46 ? 28  ALA A HB3  1  
ATOM 397   N N    . PRO A 1 29  ? -14.651 -2.397  18.438  1.00 13.06 ? 29  PRO A N    1  
ATOM 398   C CA   . PRO A 1 29  ? -13.465 -1.576  18.677  1.00 12.21 ? 29  PRO A CA   1  
ATOM 399   C C    . PRO A 1 29  ? -12.572 -1.478  17.445  1.00 11.34 ? 29  PRO A C    1  
ATOM 400   O O    . PRO A 1 29  ? -12.610 -2.350  16.569  1.00 11.36 ? 29  PRO A O    1  
ATOM 401   C CB   . PRO A 1 29  ? -12.729 -2.314  19.798  1.00 12.51 ? 29  PRO A CB   1  
ATOM 402   C CG   . PRO A 1 29  ? -13.256 -3.705  19.769  1.00 13.50 ? 29  PRO A CG   1  
ATOM 403   C CD   . PRO A 1 29  ? -14.668 -3.605  19.278  1.00 13.81 ? 29  PRO A CD   1  
ATOM 404   H HA   . PRO A 1 29  ? -13.730 -0.581  19.008  1.00 12.20 ? 29  PRO A HA   1  
ATOM 405   H HB2  . PRO A 1 29  ? -11.669 -2.292  19.601  1.00 12.17 ? 29  PRO A HB2  1  
ATOM 406   H HB3  . PRO A 1 29  ? -12.933 -1.834  20.746  1.00 12.53 ? 29  PRO A HB3  1  
ATOM 407   H HG2  . PRO A 1 29  ? -12.667 -4.307  19.092  1.00 13.63 ? 29  PRO A HG2  1  
ATOM 408   H HG3  . PRO A 1 29  ? -13.235 -4.129  20.764  1.00 13.98 ? 29  PRO A HG3  1  
ATOM 409   H HD2  . PRO A 1 29  ? -14.928 -4.474  18.695  1.00 13.93 ? 29  PRO A HD2  1  
ATOM 410   H HD3  . PRO A 1 29  ? -15.347 -3.489  20.109  1.00 14.55 ? 29  PRO A HD3  1  
ATOM 411   N N    . ALA A 1 30  ? -11.765 -0.425  17.412  1.00 10.76 ? 30  ALA A N    1  
ATOM 412   C CA   . ALA A 1 30  ? -10.851 -0.147  16.308  1.00 10.06 ? 30  ALA A CA   1  
ATOM 413   C C    . ALA A 1 30  ? -11.593 0.051   14.985  1.00 8.93  ? 30  ALA A C    1  
ATOM 414   O O    . ALA A 1 30  ? -11.699 -0.871  14.174  1.00 8.35  ? 30  ALA A O    1  
ATOM 415   C CB   . ALA A 1 30  ? -9.797  -1.240  16.178  1.00 10.54 ? 30  ALA A CB   1  
ATOM 416   H H    . ALA A 1 30  ? -11.782 0.197   18.177  1.00 10.95 ? 30  ALA A H    1  
ATOM 417   H HA   . ALA A 1 30  ? -10.338 0.773   16.546  1.00 10.23 ? 30  ALA A HA   1  
ATOM 418   H HB1  . ALA A 1 30  ? -10.269 -2.164  15.874  1.00 10.55 ? 30  ALA A HB1  1  
ATOM 419   H HB2  . ALA A 1 30  ? -9.308  -1.383  17.130  1.00 10.83 ? 30  ALA A HB2  1  
ATOM 420   H HB3  . ALA A 1 30  ? -9.067  -0.950  15.438  1.00 10.80 ? 30  ALA A HB3  1  
ATOM 421   N N    . PRO A 1 31  ? -12.147 1.256   14.766  1.00 8.82  ? 31  PRO A N    1  
ATOM 422   C CA   . PRO A 1 31  ? -12.784 1.612   13.498  1.00 7.95  ? 31  PRO A CA   1  
ATOM 423   C C    . PRO A 1 31  ? -11.779 1.684   12.347  1.00 6.75  ? 31  PRO A C    1  
ATOM 424   O O    . PRO A 1 31  ? -11.094 2.696   12.156  1.00 6.83  ? 31  PRO A O    1  
ATOM 425   C CB   . PRO A 1 31  ? -13.395 2.991   13.769  1.00 8.63  ? 31  PRO A CB   1  
ATOM 426   C CG   . PRO A 1 31  ? -12.615 3.538   14.916  1.00 9.60  ? 31  PRO A CG   1  
ATOM 427   C CD   . PRO A 1 31  ? -12.219 2.351   15.747  1.00 9.77  ? 31  PRO A CD   1  
ATOM 428   H HA   . PRO A 1 31  ? -13.568 0.913   13.241  1.00 7.98  ? 31  PRO A HA   1  
ATOM 429   H HB2  . PRO A 1 31  ? -13.295 3.614   12.891  1.00 8.18  ? 31  PRO A HB2  1  
ATOM 430   H HB3  . PRO A 1 31  ? -14.441 2.883   14.019  1.00 9.06  ? 31  PRO A HB3  1  
ATOM 431   H HG2  . PRO A 1 31  ? -11.736 4.051   14.554  1.00 9.59  ? 31  PRO A HG2  1  
ATOM 432   H HG3  . PRO A 1 31  ? -13.232 4.211   15.494  1.00 10.36 ? 31  PRO A HG3  1  
ATOM 433   H HD2  . PRO A 1 31  ? -11.260 2.517   16.213  1.00 9.88  ? 31  PRO A HD2  1  
ATOM 434   H HD3  . PRO A 1 31  ? -12.971 2.149   16.496  1.00 10.60 ? 31  PRO A HD3  1  
ATOM 435   N N    . ALA A 1 32  ? -11.675 0.593   11.604  1.00 5.86  ? 32  ALA A N    1  
ATOM 436   C CA   . ALA A 1 32  ? -10.786 0.532   10.458  1.00 4.75  ? 32  ALA A CA   1  
ATOM 437   C C    . ALA A 1 32  ? -11.590 0.468   9.168   1.00 3.89  ? 32  ALA A C    1  
ATOM 438   O O    . ALA A 1 32  ? -12.512 -0.339  9.051   1.00 3.98  ? 32  ALA A O    1  
ATOM 439   C CB   . ALA A 1 32  ? -9.862  -0.671  10.564  1.00 4.57  ? 32  ALA A CB   1  
ATOM 440   H H    . ALA A 1 32  ? -12.212 -0.195  11.838  1.00 6.11  ? 32  ALA A H    1  
ATOM 441   H HA   . ALA A 1 32  ? -10.180 1.426   10.455  1.00 5.11  ? 32  ALA A HA   1  
ATOM 442   H HB1  . ALA A 1 32  ? -9.317  -0.625  11.494  1.00 4.83  ? 32  ALA A HB1  1  
ATOM 443   H HB2  . ALA A 1 32  ? -9.167  -0.663  9.738   1.00 4.63  ? 32  ALA A HB2  1  
ATOM 444   H HB3  . ALA A 1 32  ? -10.448 -1.579  10.532  1.00 4.62  ? 32  ALA A HB3  1  
ATOM 445   N N    . PRO A 1 33  ? -11.254 1.316   8.184   1.00 3.62  ? 33  PRO A N    1  
ATOM 446   C CA   . PRO A 1 33  ? -11.954 1.348   6.896   1.00 3.45  ? 33  PRO A CA   1  
ATOM 447   C C    . PRO A 1 33  ? -11.718 0.085   6.073   1.00 2.48  ? 33  PRO A C    1  
ATOM 448   O O    . PRO A 1 33  ? -12.484 -0.216  5.159   1.00 3.06  ? 33  PRO A O    1  
ATOM 449   C CB   . PRO A 1 33  ? -11.353 2.564   6.186   1.00 4.15  ? 33  PRO A CB   1  
ATOM 450   C CG   . PRO A 1 33  ? -10.022 2.762   6.826   1.00 4.47  ? 33  PRO A CG   1  
ATOM 451   C CD   . PRO A 1 33  ? -10.174 2.317   8.255   1.00 4.26  ? 33  PRO A CD   1  
ATOM 452   H HA   . PRO A 1 33  ? -13.017 1.495   7.028   1.00 4.15  ? 33  PRO A HA   1  
ATOM 453   H HB2  . PRO A 1 33  ? -11.255 2.355   5.131   1.00 4.01  ? 33  PRO A HB2  1  
ATOM 454   H HB3  . PRO A 1 33  ? -11.992 3.421   6.332   1.00 4.98  ? 33  PRO A HB3  1  
ATOM 455   H HG2  . PRO A 1 33  ? -9.283  2.159   6.322   1.00 4.40  ? 33  PRO A HG2  1  
ATOM 456   H HG3  . PRO A 1 33  ? -9.747  3.804   6.787   1.00 5.36  ? 33  PRO A HG3  1  
ATOM 457   H HD2  . PRO A 1 33  ? -9.257  1.871   8.611   1.00 4.15  ? 33  PRO A HD2  1  
ATOM 458   H HD3  . PRO A 1 33  ? -10.462 3.147   8.884   1.00 5.11  ? 33  PRO A HD3  1  
ATOM 459   N N    . GLU A 1 34  ? -10.644 -0.636  6.416   1.00 1.57  ? 34  GLU A N    1  
ATOM 460   C CA   . GLU A 1 34  ? -10.244 -1.875  5.736   1.00 1.27  ? 34  GLU A CA   1  
ATOM 461   C C    . GLU A 1 34  ? -9.696  -1.595  4.334   1.00 1.08  ? 34  GLU A C    1  
ATOM 462   O O    . GLU A 1 34  ? -8.571  -1.977  4.018   1.00 1.44  ? 34  GLU A O    1  
ATOM 463   C CB   . GLU A 1 34  ? -11.396 -2.887  5.686   1.00 2.01  ? 34  GLU A CB   1  
ATOM 464   C CG   . GLU A 1 34  ? -11.021 -4.202  5.020   1.00 2.68  ? 34  GLU A CG   1  
ATOM 465   C CD   . GLU A 1 34  ? -12.079 -5.268  5.195   1.00 3.58  ? 34  GLU A CD   1  
ATOM 466   O OE1  . GLU A 1 34  ? -13.195 -5.104  4.659   1.00 4.13  ? 34  GLU A OE1  1  
ATOM 467   O OE2  . GLU A 1 34  ? -11.796 -6.282  5.865   1.00 4.13  ? 34  GLU A OE2  1  
ATOM 468   H H    . GLU A 1 34  ? -10.097 -0.320  7.161   1.00 1.90  ? 34  GLU A H    1  
ATOM 469   H HA   . GLU A 1 34  ? -9.444  -2.305  6.319   1.00 1.85  ? 34  GLU A HA   1  
ATOM 470   H HB2  . GLU A 1 34  ? -11.715 -3.099  6.696   1.00 2.33  ? 34  GLU A HB2  1  
ATOM 471   H HB3  . GLU A 1 34  ? -12.221 -2.453  5.140   1.00 2.63  ? 34  GLU A HB3  1  
ATOM 472   H HG2  . GLU A 1 34  ? -10.874 -4.033  3.963   1.00 3.03  ? 34  GLU A HG2  1  
ATOM 473   H HG3  . GLU A 1 34  ? -10.101 -4.557  5.459   1.00 2.92  ? 34  GLU A HG3  1  
ATOM 474   N N    . GLU A 1 35  ? -10.481 -0.926  3.508   1.00 1.01  ? 35  GLU A N    1  
ATOM 475   C CA   . GLU A 1 35  ? -10.042 -0.546  2.176   1.00 0.87  ? 35  GLU A CA   1  
ATOM 476   C C    . GLU A 1 35  ? -9.411  0.842   2.223   1.00 0.73  ? 35  GLU A C    1  
ATOM 477   O O    . GLU A 1 35  ? -10.104 1.840   2.426   1.00 0.89  ? 35  GLU A O    1  
ATOM 478   C CB   . GLU A 1 35  ? -11.223 -0.565  1.205   1.00 1.09  ? 35  GLU A CB   1  
ATOM 479   C CG   . GLU A 1 35  ? -11.977 -1.886  1.201   1.00 1.72  ? 35  GLU A CG   1  
ATOM 480   C CD   . GLU A 1 35  ? -13.129 -1.901  0.220   1.00 1.94  ? 35  GLU A CD   1  
ATOM 481   O OE1  . GLU A 1 35  ? -14.246 -1.488  0.598   1.00 2.36  ? 35  GLU A OE1  1  
ATOM 482   O OE2  . GLU A 1 35  ? -12.920 -2.328  -0.935  1.00 2.45  ? 35  GLU A OE2  1  
ATOM 483   H H    . GLU A 1 35  ? -11.384 -0.673  3.806   1.00 1.36  ? 35  GLU A H    1  
ATOM 484   H HA   . GLU A 1 35  ? -9.300  -1.258  1.851   1.00 0.87  ? 35  GLU A HA   1  
ATOM 485   H HB2  . GLU A 1 35  ? -11.914 0.219   1.480   1.00 1.33  ? 35  GLU A HB2  1  
ATOM 486   H HB3  . GLU A 1 35  ? -10.858 -0.379  0.206   1.00 1.44  ? 35  GLU A HB3  1  
ATOM 487   H HG2  . GLU A 1 35  ? -11.292 -2.679  0.941   1.00 2.41  ? 35  GLU A HG2  1  
ATOM 488   H HG3  . GLU A 1 35  ? -12.368 -2.062  2.192   1.00 2.23  ? 35  GLU A HG3  1  
ATOM 489   N N    . TRP A 1 36  ? -8.094  0.902   2.075   1.00 0.53  ? 36  TRP A N    1  
ATOM 490   C CA   . TRP A 1 36  ? -7.377  2.167   2.183   1.00 0.45  ? 36  TRP A CA   1  
ATOM 491   C C    . TRP A 1 36  ? -7.154  2.783   0.808   1.00 0.46  ? 36  TRP A C    1  
ATOM 492   O O    . TRP A 1 36  ? -7.778  2.390   -0.181  1.00 0.52  ? 36  TRP A O    1  
ATOM 493   C CB   . TRP A 1 36  ? -6.014  1.972   2.855   1.00 0.38  ? 36  TRP A CB   1  
ATOM 494   C CG   . TRP A 1 36  ? -5.977  0.898   3.897   1.00 0.34  ? 36  TRP A CG   1  
ATOM 495   C CD1  . TRP A 1 36  ? -6.875  0.678   4.902   1.00 0.39  ? 36  TRP A CD1  1  
ATOM 496   C CD2  . TRP A 1 36  ? -4.959  -0.096  4.043   1.00 0.27  ? 36  TRP A CD2  1  
ATOM 497   N NE1  . TRP A 1 36  ? -6.482  -0.408  5.650   1.00 0.36  ? 36  TRP A NE1  1  
ATOM 498   C CE2  . TRP A 1 36  ? -5.306  -0.896  5.141   1.00 0.28  ? 36  TRP A CE2  1  
ATOM 499   C CE3  . TRP A 1 36  ? -3.783  -0.390  3.344   1.00 0.21  ? 36  TRP A CE3  1  
ATOM 500   C CZ2  . TRP A 1 36  ? -4.522  -1.973  5.552   1.00 0.24  ? 36  TRP A CZ2  1  
ATOM 501   C CZ3  . TRP A 1 36  ? -3.018  -1.451  3.754   1.00 0.17  ? 36  TRP A CZ3  1  
ATOM 502   C CH2  . TRP A 1 36  ? -3.384  -2.231  4.844   1.00 0.19  ? 36  TRP A CH2  1  
ATOM 503   H H    . TRP A 1 36  ? -7.593  0.078   1.903   1.00 0.51  ? 36  TRP A H    1  
ATOM 504   H HA   . TRP A 1 36  ? -7.975  2.841   2.776   1.00 0.53  ? 36  TRP A HA   1  
ATOM 505   H HB2  . TRP A 1 36  ? -5.286  1.720   2.098   1.00 0.38  ? 36  TRP A HB2  1  
ATOM 506   H HB3  . TRP A 1 36  ? -5.720  2.900   3.325   1.00 0.44  ? 36  TRP A HB3  1  
ATOM 507   H HD1  . TRP A 1 36  ? -7.763  1.269   5.068   1.00 0.46  ? 36  TRP A HD1  1  
ATOM 508   H HE1  . TRP A 1 36  ? -6.965  -0.775  6.421   1.00 0.39  ? 36  TRP A HE1  1  
ATOM 509   H HE3  . TRP A 1 36  ? -3.464  0.197   2.495   1.00 0.21  ? 36  TRP A HE3  1  
ATOM 510   H HZ2  . TRP A 1 36  ? -4.783  -2.583  6.398   1.00 0.27  ? 36  TRP A HZ2  1  
ATOM 511   H HZ3  . TRP A 1 36  ? -2.108  -1.689  3.223   1.00 0.16  ? 36  TRP A HZ3  1  
ATOM 512   H HH2  . TRP A 1 36  ? -2.746  -3.065  5.115   1.00 0.19  ? 36  TRP A HH2  1  
ATOM 513   N N    . LEU A 1 37  ? -6.245  3.747   0.762   1.00 0.43  ? 37  LEU A N    1  
ATOM 514   C CA   . LEU A 1 37  ? -5.882  4.406   -0.477  1.00 0.42  ? 37  LEU A CA   1  
ATOM 515   C C    . LEU A 1 37  ? -5.116  3.447   -1.375  1.00 0.37  ? 37  LEU A C    1  
ATOM 516   O O    . LEU A 1 37  ? -3.979  3.080   -1.069  1.00 0.35  ? 37  LEU A O    1  
ATOM 517   C CB   . LEU A 1 37  ? -5.012  5.626   -0.165  1.00 0.45  ? 37  LEU A CB   1  
ATOM 518   C CG   . LEU A 1 37  ? -4.508  6.405   -1.380  1.00 0.46  ? 37  LEU A CG   1  
ATOM 519   C CD1  . LEU A 1 37  ? -5.664  7.067   -2.111  1.00 0.49  ? 37  LEU A CD1  1  
ATOM 520   C CD2  . LEU A 1 37  ? -3.486  7.446   -0.952  1.00 0.50  ? 37  LEU A CD2  1  
ATOM 521   H H    . LEU A 1 37  ? -5.797  4.015   1.589   1.00 0.43  ? 37  LEU A H    1  
ATOM 522   H HA   . LEU A 1 37  ? -6.784  4.726   -0.974  1.00 0.46  ? 37  LEU A HA   1  
ATOM 523   H HB2  . LEU A 1 37  ? -5.586  6.293   0.453   1.00 0.51  ? 37  LEU A HB2  1  
ATOM 524   H HB3  . LEU A 1 37  ? -4.154  5.294   0.400   1.00 0.45  ? 37  LEU A HB3  1  
ATOM 525   H HG   . LEU A 1 37  ? -4.023  5.723   -2.063  1.00 0.43  ? 37  LEU A HG   1  
ATOM 526   H HD11 . LEU A 1 37  ? -6.197  7.711   -1.426  1.00 1.11  ? 37  LEU A HD11 1  
ATOM 527   H HD12 . LEU A 1 37  ? -6.333  6.311   -2.489  1.00 1.17  ? 37  LEU A HD12 1  
ATOM 528   H HD13 . LEU A 1 37  ? -5.281  7.655   -2.932  1.00 1.09  ? 37  LEU A HD13 1  
ATOM 529   H HD21 . LEU A 1 37  ? -3.947  8.133   -0.257  1.00 1.16  ? 37  LEU A HD21 1  
ATOM 530   H HD22 . LEU A 1 37  ? -3.140  7.989   -1.817  1.00 1.19  ? 37  LEU A HD22 1  
ATOM 531   H HD23 . LEU A 1 37  ? -2.651  6.956   -0.474  1.00 1.05  ? 37  LEU A HD23 1  
ATOM 532   N N    . ASP A 1 38  ? -5.738  3.019   -2.466  1.00 0.38  ? 38  ASP A N    1  
ATOM 533   C CA   . ASP A 1 38  ? -5.037  2.198   -3.437  1.00 0.41  ? 38  ASP A CA   1  
ATOM 534   C C    . ASP A 1 38  ? -4.073  3.036   -4.256  1.00 0.39  ? 38  ASP A C    1  
ATOM 535   O O    . ASP A 1 38  ? -4.459  4.019   -4.888  1.00 0.44  ? 38  ASP A O    1  
ATOM 536   C CB   . ASP A 1 38  ? -5.990  1.448   -4.358  1.00 0.56  ? 38  ASP A CB   1  
ATOM 537   C CG   . ASP A 1 38  ? -5.280  0.301   -5.032  1.00 1.78  ? 38  ASP A CG   1  
ATOM 538   O OD1  . ASP A 1 38  ? -4.586  0.533   -6.035  1.00 2.14  ? 38  ASP A OD1  1  
ATOM 539   O OD2  . ASP A 1 38  ? -5.406  -0.839  -4.564  1.00 2.51  ? 38  ASP A OD2  1  
ATOM 540   H H    . ASP A 1 38  ? -6.688  3.218   -2.595  1.00 0.43  ? 38  ASP A H    1  
ATOM 541   H HA   . ASP A 1 38  ? -4.463  1.476   -2.893  1.00 0.44  ? 38  ASP A HA   1  
ATOM 542   H HB2  . ASP A 1 38  ? -6.818  1.055   -3.789  1.00 0.96  ? 38  ASP A HB2  1  
ATOM 543   H HB3  . ASP A 1 38  ? -6.359  2.115   -5.123  1.00 0.85  ? 38  ASP A HB3  1  
ATOM 544   N N    . ILE A 1 39  ? -2.817  2.621   -4.227  1.00 0.38  ? 39  ILE A N    1  
ATOM 545   C CA   . ILE A 1 39  ? -1.733  3.281   -4.935  1.00 0.38  ? 39  ILE A CA   1  
ATOM 546   C C    . ILE A 1 39  ? -2.027  3.397   -6.430  1.00 0.39  ? 39  ILE A C    1  
ATOM 547   O O    . ILE A 1 39  ? -1.704  4.404   -7.062  1.00 0.46  ? 39  ILE A O    1  
ATOM 548   C CB   . ILE A 1 39  ? -0.421  2.494   -4.719  1.00 0.39  ? 39  ILE A CB   1  
ATOM 549   C CG1  . ILE A 1 39  ? -0.137  2.373   -3.218  1.00 0.40  ? 39  ILE A CG1  1  
ATOM 550   C CG2  . ILE A 1 39  ? 0.740   3.145   -5.451  1.00 0.41  ? 39  ILE A CG2  1  
ATOM 551   C CD1  . ILE A 1 39  ? 1.276   1.938   -2.879  1.00 0.43  ? 39  ILE A CD1  1  
ATOM 552   H H    . ILE A 1 39  ? -2.603  1.823   -3.694  1.00 0.43  ? 39  ILE A H    1  
ATOM 553   H HA   . ILE A 1 39  ? -1.607  4.270   -4.518  1.00 0.40  ? 39  ILE A HA   1  
ATOM 554   H HB   . ILE A 1 39  ? -0.552  1.503   -5.126  1.00 0.42  ? 39  ILE A HB   1  
ATOM 555   H HG12 . ILE A 1 39  ? -0.311  3.328   -2.752  1.00 0.38  ? 39  ILE A HG12 1  
ATOM 556   H HG13 . ILE A 1 39  ? -0.816  1.648   -2.795  1.00 0.45  ? 39  ILE A HG13 1  
ATOM 557   H HG21 . ILE A 1 39  ? 0.870   4.153   -5.090  1.00 1.04  ? 39  ILE A HG21 1  
ATOM 558   H HG22 . ILE A 1 39  ? 0.530   3.163   -6.511  1.00 1.05  ? 39  ILE A HG22 1  
ATOM 559   H HG23 . ILE A 1 39  ? 1.640   2.575   -5.271  1.00 0.96  ? 39  ILE A HG23 1  
ATOM 560   H HD11 . ILE A 1 39  ? 1.469   0.972   -3.318  1.00 1.14  ? 39  ILE A HD11 1  
ATOM 561   H HD12 . ILE A 1 39  ? 1.388   1.876   -1.807  1.00 1.00  ? 39  ILE A HD12 1  
ATOM 562   H HD13 . ILE A 1 39  ? 1.977   2.660   -3.273  1.00 1.15  ? 39  ILE A HD13 1  
ATOM 563   N N    . LEU A 1 40  ? -2.660  2.375   -6.984  1.00 0.39  ? 40  LEU A N    1  
ATOM 564   C CA   . LEU A 1 40  ? -2.963  2.354   -8.413  1.00 0.49  ? 40  LEU A CA   1  
ATOM 565   C C    . LEU A 1 40  ? -4.459  2.488   -8.641  1.00 0.49  ? 40  LEU A C    1  
ATOM 566   O O    . LEU A 1 40  ? -4.929  2.545   -9.779  1.00 0.62  ? 40  LEU A O    1  
ATOM 567   C CB   . LEU A 1 40  ? -2.456  1.056   -9.046  1.00 0.56  ? 40  LEU A CB   1  
ATOM 568   C CG   . LEU A 1 40  ? -0.955  0.803   -8.904  1.00 0.59  ? 40  LEU A CG   1  
ATOM 569   C CD1  . LEU A 1 40  ? -0.584  -0.504  -9.577  1.00 0.62  ? 40  LEU A CD1  1  
ATOM 570   C CD2  . LEU A 1 40  ? -0.163  1.958   -9.503  1.00 0.72  ? 40  LEU A CD2  1  
ATOM 571   H H    . LEU A 1 40  ? -2.943  1.618   -6.416  1.00 0.39  ? 40  LEU A H    1  
ATOM 572   H HA   . LEU A 1 40  ? -2.465  3.191   -8.874  1.00 0.60  ? 40  LEU A HA   1  
ATOM 573   H HB2  . LEU A 1 40  ? -2.983  0.227   -8.593  1.00 0.66  ? 40  LEU A HB2  1  
ATOM 574   H HB3  . LEU A 1 40  ? -2.697  1.079   -10.100 1.00 0.72  ? 40  LEU A HB3  1  
ATOM 575   H HG   . LEU A 1 40  ? -0.700  0.725   -7.855  1.00 0.82  ? 40  LEU A HG   1  
ATOM 576   H HD11 . LEU A 1 40  ? -0.825  -0.450  -10.629 1.00 1.21  ? 40  LEU A HD11 1  
ATOM 577   H HD12 . LEU A 1 40  ? -1.141  -1.312  -9.122  1.00 1.27  ? 40  LEU A HD12 1  
ATOM 578   H HD13 . LEU A 1 40  ? 0.473   -0.685  -9.457  1.00 1.08  ? 40  LEU A HD13 1  
ATOM 579   H HD21 . LEU A 1 40  ? -0.396  2.868   -8.969  1.00 1.43  ? 40  LEU A HD21 1  
ATOM 580   H HD22 . LEU A 1 40  ? -0.426  2.073   -10.544 1.00 1.27  ? 40  LEU A HD22 1  
ATOM 581   H HD23 . LEU A 1 40  ? 0.894   1.752   -9.418  1.00 1.06  ? 40  LEU A HD23 1  
ATOM 582   N N    . GLY A 1 41  ? -5.197  2.546   -7.542  1.00 0.43  ? 41  GLY A N    1  
ATOM 583   C CA   . GLY A 1 41  ? -6.641  2.530   -7.595  1.00 0.51  ? 41  GLY A CA   1  
ATOM 584   C C    . GLY A 1 41  ? -7.165  1.230   -8.177  1.00 0.45  ? 41  GLY A C    1  
ATOM 585   O O    . GLY A 1 41  ? -8.274  1.180   -8.715  1.00 0.52  ? 41  GLY A O    1  
ATOM 586   H H    . GLY A 1 41  ? -4.746  2.595   -6.672  1.00 0.38  ? 41  GLY A H    1  
ATOM 587   H HA2  . GLY A 1 41  ? -7.026  2.645   -6.592  1.00 0.54  ? 41  GLY A HA2  1  
ATOM 588   H HA3  . GLY A 1 41  ? -6.978  3.351   -8.196  1.00 0.65  ? 41  GLY A HA3  1  
ATOM 589   N N    . ASN A 1 42  ? -6.357  0.177   -8.061  1.00 0.39  ? 42  ASN A N    1  
ATOM 590   C CA   . ASN A 1 42  ? -6.706  -1.127  -8.630  1.00 0.42  ? 42  ASN A CA   1  
ATOM 591   C C    . ASN A 1 42  ? -7.382  -2.026  -7.603  1.00 0.43  ? 42  ASN A C    1  
ATOM 592   O O    . ASN A 1 42  ? -8.091  -2.965  -7.957  1.00 0.56  ? 42  ASN A O    1  
ATOM 593   C CB   . ASN A 1 42  ? -5.477  -1.831  -9.247  1.00 0.49  ? 42  ASN A CB   1  
ATOM 594   C CG   . ASN A 1 42  ? -4.452  -2.403  -8.265  1.00 0.55  ? 42  ASN A CG   1  
ATOM 595   O OD1  . ASN A 1 42  ? -3.834  -3.425  -8.549  1.00 0.95  ? 42  ASN A OD1  1  
ATOM 596   N ND2  . ASN A 1 42  ? -4.216  -1.751  -7.143  1.00 0.44  ? 42  ASN A ND2  1  
ATOM 597   H H    . ASN A 1 42  ? -5.500  0.287   -7.581  1.00 0.39  ? 42  ASN A H    1  
ATOM 598   H HA   . ASN A 1 42  ? -7.418  -0.940  -9.422  1.00 0.49  ? 42  ASN A HA   1  
ATOM 599   H HB2  . ASN A 1 42  ? -5.832  -2.646  -9.846  1.00 0.69  ? 42  ASN A HB2  1  
ATOM 600   H HB3  . ASN A 1 42  ? -4.970  -1.133  -9.887  1.00 0.57  ? 42  ASN A HB3  1  
ATOM 601   H HD21 . ASN A 1 42  ? -4.707  -0.916  -6.969  1.00 0.54  ? 42  ASN A HD21 1  
ATOM 602   H HD22 . ASN A 1 42  ? -3.548  -2.116  -6.526  1.00 0.56  ? 42  ASN A HD22 1  
ATOM 603   N N    . GLY A 1 43  ? -7.152  -1.741  -6.333  1.00 0.40  ? 43  GLY A N    1  
ATOM 604   C CA   . GLY A 1 43  ? -7.835  -2.456  -5.274  1.00 0.50  ? 43  GLY A CA   1  
ATOM 605   C C    . GLY A 1 43  ? -6.925  -3.436  -4.570  1.00 0.45  ? 43  GLY A C    1  
ATOM 606   O O    . GLY A 1 43  ? -7.209  -3.869  -3.454  1.00 0.72  ? 43  GLY A O    1  
ATOM 607   H H    . GLY A 1 43  ? -6.485  -1.054  -6.101  1.00 0.39  ? 43  GLY A H    1  
ATOM 608   H HA2  . GLY A 1 43  ? -8.204  -1.742  -4.554  1.00 0.60  ? 43  GLY A HA2  1  
ATOM 609   H HA3  . GLY A 1 43  ? -8.669  -2.993  -5.697  1.00 0.58  ? 43  GLY A HA3  1  
ATOM 610   N N    . LEU A 1 44  ? -5.814  -3.768  -5.211  1.00 0.29  ? 44  LEU A N    1  
ATOM 611   C CA   . LEU A 1 44  ? -4.925  -4.802  -4.699  1.00 0.36  ? 44  LEU A CA   1  
ATOM 612   C C    . LEU A 1 44  ? -3.783  -4.188  -3.890  1.00 0.25  ? 44  LEU A C    1  
ATOM 613   O O    . LEU A 1 44  ? -3.187  -4.850  -3.047  1.00 0.27  ? 44  LEU A O    1  
ATOM 614   C CB   . LEU A 1 44  ? -4.338  -5.639  -5.854  1.00 0.60  ? 44  LEU A CB   1  
ATOM 615   C CG   . LEU A 1 44  ? -5.208  -5.767  -7.112  1.00 0.51  ? 44  LEU A CG   1  
ATOM 616   C CD1  . LEU A 1 44  ? -4.537  -6.654  -8.140  1.00 1.46  ? 44  LEU A CD1  1  
ATOM 617   C CD2  . LEU A 1 44  ? -6.588  -6.296  -6.784  1.00 1.56  ? 44  LEU A CD2  1  
ATOM 618   H H    . LEU A 1 44  ? -5.587  -3.308  -6.047  1.00 0.39  ? 44  LEU A H    1  
ATOM 619   H HA   . LEU A 1 44  ? -5.503  -5.448  -4.056  1.00 0.47  ? 44  LEU A HA   1  
ATOM 620   H HB2  . LEU A 1 44  ? -3.395  -5.202  -6.148  1.00 1.23  ? 44  LEU A HB2  1  
ATOM 621   H HB3  . LEU A 1 44  ? -4.148  -6.635  -5.479  1.00 1.12  ? 44  LEU A HB3  1  
ATOM 622   H HG   . LEU A 1 44  ? -5.321  -4.792  -7.556  1.00 0.99  ? 44  LEU A HG   1  
ATOM 623   H HD11 . LEU A 1 44  ? -5.208  -6.811  -8.970  1.00 1.90  ? 44  LEU A HD11 1  
ATOM 624   H HD12 . LEU A 1 44  ? -4.289  -7.603  -7.689  1.00 2.02  ? 44  LEU A HD12 1  
ATOM 625   H HD13 . LEU A 1 44  ? -3.639  -6.175  -8.495  1.00 2.09  ? 44  LEU A HD13 1  
ATOM 626   H HD21 . LEU A 1 44  ? -7.071  -5.620  -6.096  1.00 2.16  ? 44  LEU A HD21 1  
ATOM 627   H HD22 . LEU A 1 44  ? -6.499  -7.270  -6.333  1.00 1.97  ? 44  LEU A HD22 1  
ATOM 628   H HD23 . LEU A 1 44  ? -7.169  -6.365  -7.691  1.00 2.15  ? 44  LEU A HD23 1  
ATOM 629   N N    . LEU A 1 45  ? -3.471  -2.928  -4.172  1.00 0.23  ? 45  LEU A N    1  
ATOM 630   C CA   . LEU A 1 45  ? -2.298  -2.269  -3.605  1.00 0.22  ? 45  LEU A CA   1  
ATOM 631   C C    . LEU A 1 45  ? -2.672  -0.982  -2.855  1.00 0.22  ? 45  LEU A C    1  
ATOM 632   O O    . LEU A 1 45  ? -2.852  0.063   -3.466  1.00 0.32  ? 45  LEU A O    1  
ATOM 633   C CB   . LEU A 1 45  ? -1.314  -2.001  -4.744  1.00 0.30  ? 45  LEU A CB   1  
ATOM 634   C CG   . LEU A 1 45  ? -0.157  -1.054  -4.442  1.00 0.26  ? 45  LEU A CG   1  
ATOM 635   C CD1  . LEU A 1 45  ? 0.633   -1.540  -3.240  1.00 0.28  ? 45  LEU A CD1  1  
ATOM 636   C CD2  . LEU A 1 45  ? 0.744   -0.950  -5.658  1.00 0.31  ? 45  LEU A CD2  1  
ATOM 637   H H    . LEU A 1 45  ? -4.077  -2.404  -4.743  1.00 0.26  ? 45  LEU A H    1  
ATOM 638   H HA   . LEU A 1 45  ? -1.838  -2.949  -2.907  1.00 0.22  ? 45  LEU A HA   1  
ATOM 639   H HB2  . LEU A 1 45  ? -0.893  -2.951  -5.042  1.00 0.43  ? 45  LEU A HB2  1  
ATOM 640   H HB3  . LEU A 1 45  ? -1.871  -1.607  -5.578  1.00 0.42  ? 45  LEU A HB3  1  
ATOM 641   H HG   . LEU A 1 45  ? -0.543  -0.068  -4.222  1.00 0.29  ? 45  LEU A HG   1  
ATOM 642   H HD11 . LEU A 1 45  ? -0.023  -1.599  -2.384  1.00 1.00  ? 45  LEU A HD11 1  
ATOM 643   H HD12 . LEU A 1 45  ? 1.436   -0.849  -3.032  1.00 1.01  ? 45  LEU A HD12 1  
ATOM 644   H HD13 . LEU A 1 45  ? 1.041   -2.516  -3.451  1.00 1.12  ? 45  LEU A HD13 1  
ATOM 645   H HD21 . LEU A 1 45  ? 0.165   -0.608  -6.504  1.00 0.96  ? 45  LEU A HD21 1  
ATOM 646   H HD22 . LEU A 1 45  ? 1.160   -1.923  -5.877  1.00 1.12  ? 45  LEU A HD22 1  
ATOM 647   H HD23 . LEU A 1 45  ? 1.542   -0.252  -5.460  1.00 1.10  ? 45  LEU A HD23 1  
ATOM 648   N N    . ARG A 1 46  ? -2.747  -1.047  -1.531  1.00 0.20  ? 46  ARG A N    1  
ATOM 649   C CA   . ARG A 1 46  ? -3.223  0.087   -0.736  1.00 0.22  ? 46  ARG A CA   1  
ATOM 650   C C    . ARG A 1 46  ? -2.271  0.412   0.410   1.00 0.19  ? 46  ARG A C    1  
ATOM 651   O O    . ARG A 1 46  ? -1.767  -0.493  1.067   1.00 0.19  ? 46  ARG A O    1  
ATOM 652   C CB   . ARG A 1 46  ? -4.603  -0.239  -0.173  1.00 0.25  ? 46  ARG A CB   1  
ATOM 653   C CG   . ARG A 1 46  ? -5.650  -0.432  -1.248  1.00 0.36  ? 46  ARG A CG   1  
ATOM 654   C CD   . ARG A 1 46  ? -6.953  -0.960  -0.681  1.00 0.37  ? 46  ARG A CD   1  
ATOM 655   N NE   . ARG A 1 46  ? -6.793  -2.312  -0.138  1.00 0.54  ? 46  ARG A NE   1  
ATOM 656   C CZ   . ARG A 1 46  ? -7.766  -3.227  -0.071  1.00 0.75  ? 46  ARG A CZ   1  
ATOM 657   N NH1  . ARG A 1 46  ? -8.973  -2.967  -0.568  1.00 1.14  ? 46  ARG A NH1  1  
ATOM 658   N NH2  . ARG A 1 46  ? -7.514  -4.417  0.472   1.00 0.99  ? 46  ARG A NH2  1  
ATOM 659   H H    . ARG A 1 46  ? -2.472  -1.875  -1.074  1.00 0.20  ? 46  ARG A H    1  
ATOM 660   H HA   . ARG A 1 46  ? -3.305  0.951   -1.387  1.00 0.25  ? 46  ARG A HA   1  
ATOM 661   H HB2  . ARG A 1 46  ? -4.537  -1.149  0.404   1.00 0.30  ? 46  ARG A HB2  1  
ATOM 662   H HB3  . ARG A 1 46  ? -4.920  0.569   0.471   1.00 0.35  ? 46  ARG A HB3  1  
ATOM 663   H HG2  . ARG A 1 46  ? -5.829  0.515   -1.723  1.00 0.50  ? 46  ARG A HG2  1  
ATOM 664   H HG3  . ARG A 1 46  ? -5.274  -1.135  -1.976  1.00 0.49  ? 46  ARG A HG3  1  
ATOM 665   H HD2  . ARG A 1 46  ? -7.275  -0.301  0.112   1.00 0.47  ? 46  ARG A HD2  1  
ATOM 666   H HD3  . ARG A 1 46  ? -7.696  -0.971  -1.464  1.00 0.51  ? 46  ARG A HD3  1  
ATOM 667   H HE   . ARG A 1 46  ? -5.906  -2.551  0.205   1.00 0.87  ? 46  ARG A HE   1  
ATOM 668   H HH11 . ARG A 1 46  ? -9.165  -2.078  -1.000  1.00 1.24  ? 46  ARG A HH11 1  
ATOM 669   H HH12 . ARG A 1 46  ? -9.702  -3.662  -0.517  1.00 1.49  ? 46  ARG A HH12 1  
ATOM 670   H HH21 . ARG A 1 46  ? -6.604  -4.628  0.827   1.00 1.18  ? 46  ARG A HH21 1  
ATOM 671   H HH22 . ARG A 1 46  ? -8.243  -5.118  0.529   1.00 1.21  ? 46  ARG A HH22 1  
ATOM 672   N N    . LYS A 1 47  ? -2.057  1.703   0.663   1.00 0.20  ? 47  LYS A N    1  
ATOM 673   C CA   . LYS A 1 47  ? -1.125  2.157   1.694   1.00 0.17  ? 47  LYS A CA   1  
ATOM 674   C C    . LYS A 1 47  ? -1.880  2.826   2.848   1.00 0.18  ? 47  LYS A C    1  
ATOM 675   O O    . LYS A 1 47  ? -2.656  3.756   2.630   1.00 0.22  ? 47  LYS A O    1  
ATOM 676   C CB   . LYS A 1 47  ? -0.144  3.165   1.085   1.00 0.23  ? 47  LYS A CB   1  
ATOM 677   C CG   . LYS A 1 47  ? 1.180   3.273   1.825   1.00 0.25  ? 47  LYS A CG   1  
ATOM 678   C CD   . LYS A 1 47  ? 1.833   4.631   1.628   1.00 0.32  ? 47  LYS A CD   1  
ATOM 679   C CE   . LYS A 1 47  ? 1.179   5.693   2.513   1.00 0.20  ? 47  LYS A CE   1  
ATOM 680   N NZ   . LYS A 1 47  ? 2.116   6.796   2.888   1.00 0.35  ? 47  LYS A NZ   1  
ATOM 681   H H    . LYS A 1 47  ? -2.545  2.378   0.142   1.00 0.22  ? 47  LYS A H    1  
ATOM 682   H HA   . LYS A 1 47  ? -0.578  1.306   2.072   1.00 0.15  ? 47  LYS A HA   1  
ATOM 683   H HB2  . LYS A 1 47  ? 0.064   2.874   0.067   1.00 0.31  ? 47  LYS A HB2  1  
ATOM 684   H HB3  . LYS A 1 47  ? -0.609  4.139   1.082   1.00 0.27  ? 47  LYS A HB3  1  
ATOM 685   H HG2  . LYS A 1 47  ? 1.012   3.117   2.881   1.00 0.25  ? 47  LYS A HG2  1  
ATOM 686   H HG3  . LYS A 1 47  ? 1.852   2.510   1.450   1.00 0.31  ? 47  LYS A HG3  1  
ATOM 687   H HD2  . LYS A 1 47  ? 2.879   4.552   1.868   1.00 0.45  ? 47  LYS A HD2  1  
ATOM 688   H HD3  . LYS A 1 47  ? 1.722   4.922   0.593   1.00 0.45  ? 47  LYS A HD3  1  
ATOM 689   H HE2  . LYS A 1 47  ? 0.342   6.115   1.975   1.00 0.39  ? 47  LYS A HE2  1  
ATOM 690   H HE3  . LYS A 1 47  ? 0.817   5.219   3.415   1.00 0.35  ? 47  LYS A HE3  1  
ATOM 691   H HZ1  . LYS A 1 47  ? 1.600   7.550   3.383   1.00 1.00  ? 47  LYS A HZ1  1  
ATOM 692   H HZ2  . LYS A 1 47  ? 2.571   7.200   2.042   1.00 1.12  ? 47  LYS A HZ2  1  
ATOM 693   H HZ3  . LYS A 1 47  ? 2.862   6.440   3.527   1.00 1.03  ? 47  LYS A HZ3  1  
ATOM 694   N N    . LYS A 1 48  ? -1.653  2.357   4.072   1.00 0.16  ? 48  LYS A N    1  
ATOM 695   C CA   . LYS A 1 48  ? -2.284  2.957   5.243   1.00 0.18  ? 48  LYS A CA   1  
ATOM 696   C C    . LYS A 1 48  ? -1.240  3.557   6.178   1.00 0.17  ? 48  LYS A C    1  
ATOM 697   O O    . LYS A 1 48  ? -0.361  2.855   6.676   1.00 0.22  ? 48  LYS A O    1  
ATOM 698   C CB   . LYS A 1 48  ? -3.124  1.924   6.001   1.00 0.25  ? 48  LYS A CB   1  
ATOM 699   C CG   . LYS A 1 48  ? -3.913  2.518   7.162   1.00 0.32  ? 48  LYS A CG   1  
ATOM 700   C CD   . LYS A 1 48  ? -4.902  1.521   7.745   1.00 0.69  ? 48  LYS A CD   1  
ATOM 701   C CE   . LYS A 1 48  ? -4.218  0.413   8.536   1.00 0.52  ? 48  LYS A CE   1  
ATOM 702   N NZ   . LYS A 1 48  ? -3.491  0.945   9.719   1.00 1.07  ? 48  LYS A NZ   1  
ATOM 703   H H    . LYS A 1 48  ? -1.057  1.584   4.191   1.00 0.15  ? 48  LYS A H    1  
ATOM 704   H HA   . LYS A 1 48  ? -2.936  3.746   4.895   1.00 0.21  ? 48  LYS A HA   1  
ATOM 705   H HB2  . LYS A 1 48  ? -3.824  1.471   5.313   1.00 0.30  ? 48  LYS A HB2  1  
ATOM 706   H HB3  . LYS A 1 48  ? -2.471  1.159   6.392   1.00 0.28  ? 48  LYS A HB3  1  
ATOM 707   H HG2  . LYS A 1 48  ? -3.222  2.818   7.935   1.00 0.51  ? 48  LYS A HG2  1  
ATOM 708   H HG3  . LYS A 1 48  ? -4.455  3.380   6.807   1.00 0.53  ? 48  LYS A HG3  1  
ATOM 709   H HD2  . LYS A 1 48  ? -5.579  2.049   8.399   1.00 1.29  ? 48  LYS A HD2  1  
ATOM 710   H HD3  . LYS A 1 48  ? -5.462  1.078   6.933   1.00 1.29  ? 48  LYS A HD3  1  
ATOM 711   H HE2  . LYS A 1 48  ? -4.971  -0.281  8.875   1.00 1.14  ? 48  LYS A HE2  1  
ATOM 712   H HE3  . LYS A 1 48  ? -3.518  -0.102  7.890   1.00 0.96  ? 48  LYS A HE3  1  
ATOM 713   H HZ1  . LYS A 1 48  ? -3.161  0.162   10.328  1.00 1.56  ? 48  LYS A HZ1  1  
ATOM 714   H HZ2  . LYS A 1 48  ? -4.120  1.560   10.285  1.00 1.60  ? 48  LYS A HZ2  1  
ATOM 715   H HZ3  . LYS A 1 48  ? -2.672  1.499   9.418   1.00 1.65  ? 48  LYS A HZ3  1  
ATOM 716   N N    . THR A 1 49  ? -1.350  4.853   6.421   1.00 0.18  ? 49  THR A N    1  
ATOM 717   C CA   . THR A 1 49  ? -0.425  5.556   7.295   1.00 0.20  ? 49  THR A CA   1  
ATOM 718   C C    . THR A 1 49  ? -0.691  5.245   8.760   1.00 0.21  ? 49  THR A C    1  
ATOM 719   O O    . THR A 1 49  ? -1.722  5.630   9.309   1.00 0.29  ? 49  THR A O    1  
ATOM 720   C CB   . THR A 1 49  ? -0.529  7.075   7.069   1.00 0.25  ? 49  THR A CB   1  
ATOM 721   O OG1  . THR A 1 49  ? -1.909  7.461   7.007   1.00 0.33  ? 49  THR A OG1  1  
ATOM 722   C CG2  . THR A 1 49  ? 0.179   7.483   5.789   1.00 0.25  ? 49  THR A CG2  1  
ATOM 723   H H    . THR A 1 49  ? -2.080  5.359   6.004   1.00 0.21  ? 49  THR A H    1  
ATOM 724   H HA   . THR A 1 49  ? 0.582   5.249   7.052   1.00 0.19  ? 49  THR A HA   1  
ATOM 725   H HB   . THR A 1 49  ? -0.059  7.580   7.901   1.00 0.28  ? 49  THR A HB   1  
ATOM 726   H HG1  . THR A 1 49  ? -2.304  7.370   7.884   1.00 0.68  ? 49  THR A HG1  1  
ATOM 727   H HG21 . THR A 1 49  ? -0.282  6.988   4.947   1.00 1.03  ? 49  THR A HG21 1  
ATOM 728   H HG22 . THR A 1 49  ? 1.219   7.198   5.851   1.00 1.01  ? 49  THR A HG22 1  
ATOM 729   H HG23 . THR A 1 49  ? 0.105   8.553   5.660   1.00 1.03  ? 49  THR A HG23 1  
ATOM 730   N N    . LEU A 1 50  ? 0.225   4.515   9.378   1.00 0.18  ? 50  LEU A N    1  
ATOM 731   C CA   . LEU A 1 50  ? 0.188   4.320   10.817  1.00 0.21  ? 50  LEU A CA   1  
ATOM 732   C C    . LEU A 1 50  ? 0.632   5.622   11.447  1.00 0.23  ? 50  LEU A C    1  
ATOM 733   O O    . LEU A 1 50  ? -0.032  6.192   12.312  1.00 0.28  ? 50  LEU A O    1  
ATOM 734   C CB   . LEU A 1 50  ? 1.148   3.210   11.224  1.00 0.21  ? 50  LEU A CB   1  
ATOM 735   C CG   . LEU A 1 50  ? 1.156   1.995   10.302  1.00 0.20  ? 50  LEU A CG   1  
ATOM 736   C CD1  . LEU A 1 50  ? 2.380   1.145   10.575  1.00 0.21  ? 50  LEU A CD1  1  
ATOM 737   C CD2  . LEU A 1 50  ? -0.114  1.186   10.474  1.00 0.24  ? 50  LEU A CD2  1  
ATOM 738   H H    . LEU A 1 50  ? 0.952   4.106   8.856   1.00 0.15  ? 50  LEU A H    1  
ATOM 739   H HA   . LEU A 1 50  ? -0.820  4.079   11.119  1.00 0.23  ? 50  LEU A HA   1  
ATOM 740   H HB2  . LEU A 1 50  ? 2.146   3.622   11.250  1.00 0.21  ? 50  LEU A HB2  1  
ATOM 741   H HB3  . LEU A 1 50  ? 0.885   2.879   12.219  1.00 0.25  ? 50  LEU A HB3  1  
ATOM 742   H HG   . LEU A 1 50  ? 1.204   2.328   9.275   1.00 0.17  ? 50  LEU A HG   1  
ATOM 743   H HD11 . LEU A 1 50  ? 3.269   1.736   10.389  1.00 1.02  ? 50  LEU A HD11 1  
ATOM 744   H HD12 . LEU A 1 50  ? 2.377   0.288   9.920   1.00 1.05  ? 50  LEU A HD12 1  
ATOM 745   H HD13 . LEU A 1 50  ? 2.375   0.818   11.603  1.00 1.04  ? 50  LEU A HD13 1  
ATOM 746   H HD21 . LEU A 1 50  ? -0.966  1.818   10.273  1.00 1.01  ? 50  LEU A HD21 1  
ATOM 747   H HD22 . LEU A 1 50  ? -0.170  0.813   11.485  1.00 1.02  ? 50  LEU A HD22 1  
ATOM 748   H HD23 . LEU A 1 50  ? -0.108  0.358   9.782   1.00 1.06  ? 50  LEU A HD23 1  
ATOM 749   N N    . VAL A 1 51  ? 1.781   6.069   10.966  1.00 0.23  ? 51  VAL A N    1  
ATOM 750   C CA   . VAL A 1 51  ? 2.319   7.379   11.254  1.00 0.27  ? 51  VAL A CA   1  
ATOM 751   C C    . VAL A 1 51  ? 2.771   7.963   9.937   1.00 0.24  ? 51  VAL A C    1  
ATOM 752   O O    . VAL A 1 51  ? 3.425   7.268   9.177   1.00 0.23  ? 51  VAL A O    1  
ATOM 753   C CB   . VAL A 1 51  ? 3.533   7.299   12.188  1.00 0.30  ? 51  VAL A CB   1  
ATOM 754   C CG1  . VAL A 1 51  ? 4.072   8.684   12.501  1.00 0.36  ? 51  VAL A CG1  1  
ATOM 755   C CG2  . VAL A 1 51  ? 3.185   6.561   13.465  1.00 0.36  ? 51  VAL A CG2  1  
ATOM 756   H H    . VAL A 1 51  ? 2.297   5.482   10.367  1.00 0.21  ? 51  VAL A H    1  
ATOM 757   H HA   . VAL A 1 51  ? 1.556   8.001   11.696  1.00 0.33  ? 51  VAL A HA   1  
ATOM 758   H HB   . VAL A 1 51  ? 4.300   6.746   11.671  1.00 0.26  ? 51  VAL A HB   1  
ATOM 759   H HG11 . VAL A 1 51  ? 4.368   9.168   11.581  1.00 1.03  ? 51  VAL A HG11 1  
ATOM 760   H HG12 . VAL A 1 51  ? 4.925   8.598   13.155  1.00 1.08  ? 51  VAL A HG12 1  
ATOM 761   H HG13 . VAL A 1 51  ? 3.304   9.269   12.985  1.00 1.14  ? 51  VAL A HG13 1  
ATOM 762   H HG21 . VAL A 1 51  ? 2.924   5.540   13.228  1.00 0.96  ? 51  VAL A HG21 1  
ATOM 763   H HG22 . VAL A 1 51  ? 2.343   7.047   13.937  1.00 1.11  ? 51  VAL A HG22 1  
ATOM 764   H HG23 . VAL A 1 51  ? 4.032   6.575   14.134  1.00 1.06  ? 51  VAL A HG23 1  
ATOM 765   N N    . PRO A 1 52  ? 2.387   9.200   9.620   1.00 0.29  ? 52  PRO A N    1  
ATOM 766   C CA   . PRO A 1 52  ? 2.710   9.833   8.355   1.00 0.32  ? 52  PRO A CA   1  
ATOM 767   C C    . PRO A 1 52  ? 3.764   10.943  8.463   1.00 0.34  ? 52  PRO A C    1  
ATOM 768   O O    . PRO A 1 52  ? 3.526   12.077  8.051   1.00 0.54  ? 52  PRO A O    1  
ATOM 769   C CB   . PRO A 1 52  ? 1.348   10.407  8.024   1.00 0.41  ? 52  PRO A CB   1  
ATOM 770   C CG   . PRO A 1 52  ? 0.804   10.873  9.349   1.00 0.46  ? 52  PRO A CG   1  
ATOM 771   C CD   . PRO A 1 52  ? 1.517   10.071  10.414  1.00 0.37  ? 52  PRO A CD   1  
ATOM 772   H HA   . PRO A 1 52  ? 3.002   9.115   7.599   1.00 0.32  ? 52  PRO A HA   1  
ATOM 773   H HB2  . PRO A 1 52  ? 1.449   11.217  7.317   1.00 0.45  ? 52  PRO A HB2  1  
ATOM 774   H HB3  . PRO A 1 52  ? 0.739   9.619   7.609   1.00 0.45  ? 52  PRO A HB3  1  
ATOM 775   H HG2  . PRO A 1 52  ? 1.010   11.922  9.483   1.00 0.51  ? 52  PRO A HG2  1  
ATOM 776   H HG3  . PRO A 1 52  ? -0.260  10.689  9.394   1.00 0.56  ? 52  PRO A HG3  1  
ATOM 777   H HD2  . PRO A 1 52  ? 2.097   10.719  11.056  1.00 0.39  ? 52  PRO A HD2  1  
ATOM 778   H HD3  . PRO A 1 52  ? 0.813   9.492   10.991  1.00 0.41  ? 52  PRO A HD3  1  
ATOM 779   N N    . GLY A 1 53  ? 4.932   10.597  8.991   1.00 0.24  ? 53  GLY A N    1  
ATOM 780   C CA   . GLY A 1 53  ? 6.008   11.559  9.115   1.00 0.28  ? 53  GLY A CA   1  
ATOM 781   C C    . GLY A 1 53  ? 5.865   12.450  10.338  1.00 0.29  ? 53  GLY A C    1  
ATOM 782   O O    . GLY A 1 53  ? 5.172   13.467  10.291  1.00 0.55  ? 53  GLY A O    1  
ATOM 783   H H    . GLY A 1 53  ? 5.073   9.672   9.278   1.00 0.26  ? 53  GLY A H    1  
ATOM 784   H HA2  . GLY A 1 53  ? 6.946   11.023  9.181   1.00 0.34  ? 53  GLY A HA2  1  
ATOM 785   H HA3  . GLY A 1 53  ? 6.025   12.177  8.230   1.00 0.35  ? 53  GLY A HA3  1  
ATOM 786   N N    . PRO A 1 54  ? 6.502   12.075  11.458  1.00 0.52  ? 54  PRO A N    1  
ATOM 787   C CA   . PRO A 1 54  ? 6.481   12.866  12.702  1.00 0.67  ? 54  PRO A CA   1  
ATOM 788   C C    . PRO A 1 54  ? 7.028   14.305  12.561  1.00 0.78  ? 54  PRO A C    1  
ATOM 789   O O    . PRO A 1 54  ? 6.392   15.250  13.039  1.00 1.20  ? 54  PRO A O    1  
ATOM 790   C CB   . PRO A 1 54  ? 7.351   12.050  13.664  1.00 1.03  ? 54  PRO A CB   1  
ATOM 791   C CG   . PRO A 1 54  ? 7.338   10.665  13.109  1.00 1.42  ? 54  PRO A CG   1  
ATOM 792   C CD   . PRO A 1 54  ? 7.262   10.822  11.618  1.00 0.91  ? 54  PRO A CD   1  
ATOM 793   H HA   . PRO A 1 54  ? 5.476   12.922  13.100  1.00 0.63  ? 54  PRO A HA   1  
ATOM 794   H HB2  . PRO A 1 54  ? 8.352   12.458  13.682  1.00 1.19  ? 54  PRO A HB2  1  
ATOM 795   H HB3  . PRO A 1 54  ? 6.924   12.081  14.655  1.00 1.08  ? 54  PRO A HB3  1  
ATOM 796   H HG2  . PRO A 1 54  ? 8.243   10.147  13.384  1.00 1.91  ? 54  PRO A HG2  1  
ATOM 797   H HG3  . PRO A 1 54  ? 6.472   10.133  13.471  1.00 1.81  ? 54  PRO A HG3  1  
ATOM 798   H HD2  . PRO A 1 54  ? 8.253   10.911  11.195  1.00 1.01  ? 54  PRO A HD2  1  
ATOM 799   H HD3  . PRO A 1 54  ? 6.735   9.990   11.176  1.00 0.97  ? 54  PRO A HD3  1  
ATOM 800   N N    . PRO A 1 55  ? 8.210   14.519  11.934  1.00 0.97  ? 55  PRO A N    1  
ATOM 801   C CA   . PRO A 1 55  ? 8.783   15.846  11.793  1.00 1.24  ? 55  PRO A CA   1  
ATOM 802   C C    . PRO A 1 55  ? 8.424   16.502  10.462  1.00 0.93  ? 55  PRO A C    1  
ATOM 803   O O    . PRO A 1 55  ? 7.440   16.128  9.817   1.00 1.20  ? 55  PRO A O    1  
ATOM 804   C CB   . PRO A 1 55  ? 10.290  15.567  11.859  1.00 1.81  ? 55  PRO A CB   1  
ATOM 805   C CG   . PRO A 1 55  ? 10.468  14.115  11.515  1.00 2.04  ? 55  PRO A CG   1  
ATOM 806   C CD   . PRO A 1 55  ? 9.095   13.522  11.324  1.00 1.47  ? 55  PRO A CD   1  
ATOM 807   H HA   . PRO A 1 55  ? 8.497   16.493  12.607  1.00 1.48  ? 55  PRO A HA   1  
ATOM 808   H HB2  . PRO A 1 55  ? 10.798  16.202  11.148  1.00 1.86  ? 55  PRO A HB2  1  
ATOM 809   H HB3  . PRO A 1 55  ? 10.652  15.781  12.853  1.00 2.24  ? 55  PRO A HB3  1  
ATOM 810   H HG2  . PRO A 1 55  ? 11.039  14.028  10.605  1.00 2.40  ? 55  PRO A HG2  1  
ATOM 811   H HG3  . PRO A 1 55  ? 10.980  13.614  12.324  1.00 2.53  ? 55  PRO A HG3  1  
ATOM 812   H HD2  . PRO A 1 55  ? 8.878   13.408  10.272  1.00 1.54  ? 55  PRO A HD2  1  
ATOM 813   H HD3  . PRO A 1 55  ? 9.017   12.572  11.832  1.00 1.66  ? 55  PRO A HD3  1  
ATOM 814   N N    . GLY A 1 56  ? 9.218   17.492  10.059  1.00 0.98  ? 56  GLY A N    1  
ATOM 815   C CA   . GLY A 1 56  ? 9.065   18.093  8.745   1.00 0.82  ? 56  GLY A CA   1  
ATOM 816   C C    . GLY A 1 56  ? 9.659   17.200  7.680   1.00 0.64  ? 56  GLY A C    1  
ATOM 817   O O    . GLY A 1 56  ? 10.698  17.516  7.094   1.00 0.69  ? 56  GLY A O    1  
ATOM 818   H H    . GLY A 1 56  ? 9.929   17.811  10.660  1.00 1.42  ? 56  GLY A H    1  
ATOM 819   H HA2  . GLY A 1 56  ? 8.013   18.242  8.540   1.00 0.98  ? 56  GLY A HA2  1  
ATOM 820   H HA3  . GLY A 1 56  ? 9.571   19.047  8.728   1.00 0.83  ? 56  GLY A HA3  1  
ATOM 821   N N    . SER A 1 57  ? 9.007   16.071  7.456   1.00 0.52  ? 57  SER A N    1  
ATOM 822   C CA   . SER A 1 57  ? 9.520   15.022  6.609   1.00 0.40  ? 57  SER A CA   1  
ATOM 823   C C    . SER A 1 57  ? 9.651   15.438  5.148   1.00 0.34  ? 57  SER A C    1  
ATOM 824   O O    . SER A 1 57  ? 9.284   16.543  4.749   1.00 0.43  ? 57  SER A O    1  
ATOM 825   C CB   . SER A 1 57  ? 8.606   13.817  6.728   1.00 0.40  ? 57  SER A CB   1  
ATOM 826   O OG   . SER A 1 57  ? 8.495   13.403  8.076   1.00 0.99  ? 57  SER A OG   1  
ATOM 827   H H    . SER A 1 57  ? 8.144   15.925  7.894   1.00 0.56  ? 57  SER A H    1  
ATOM 828   H HA   . SER A 1 57  ? 10.494  14.749  6.981   1.00 0.47  ? 57  SER A HA   1  
ATOM 829   H HB2  . SER A 1 57  ? 7.627   14.068  6.352   1.00 0.55  ? 57  SER A HB2  1  
ATOM 830   H HB3  . SER A 1 57  ? 9.012   13.013  6.154   1.00 0.66  ? 57  SER A HB3  1  
ATOM 831   H HG   . SER A 1 57  ? 8.920   12.537  8.173   1.00 1.36  ? 57  SER A HG   1  
ATOM 832   N N    . SER A 1 58  ? 10.205  14.530  4.366   1.00 0.28  ? 58  SER A N    1  
ATOM 833   C CA   . SER A 1 58  ? 10.396  14.715  2.945   1.00 0.30  ? 58  SER A CA   1  
ATOM 834   C C    . SER A 1 58  ? 10.247  13.363  2.265   1.00 0.27  ? 58  SER A C    1  
ATOM 835   O O    . SER A 1 58  ? 10.694  12.354  2.808   1.00 0.38  ? 58  SER A O    1  
ATOM 836   C CB   . SER A 1 58  ? 11.791  15.275  2.684   1.00 0.38  ? 58  SER A CB   1  
ATOM 837   O OG   . SER A 1 58  ? 12.027  16.435  3.469   1.00 1.28  ? 58  SER A OG   1  
ATOM 838   H H    . SER A 1 58  ? 10.495  13.690  4.760   1.00 0.31  ? 58  SER A H    1  
ATOM 839   H HA   . SER A 1 58  ? 9.647   15.398  2.574   1.00 0.36  ? 58  SER A HA   1  
ATOM 840   H HB2  . SER A 1 58  ? 12.524  14.521  2.941   1.00 0.97  ? 58  SER A HB2  1  
ATOM 841   H HB3  . SER A 1 58  ? 11.888  15.531  1.638   1.00 0.87  ? 58  SER A HB3  1  
ATOM 842   H HG   . SER A 1 58  ? 11.252  16.605  4.013   1.00 1.82  ? 58  SER A HG   1  
ATOM 843   N N    . ARG A 1 59  ? 9.606   13.321  1.116   1.00 0.32  ? 59  ARG A N    1  
ATOM 844   C CA   . ARG A 1 59  ? 9.452   12.068  0.403   1.00 0.30  ? 59  ARG A CA   1  
ATOM 845   C C    . ARG A 1 59  ? 10.629  11.859  -0.530  1.00 0.27  ? 59  ARG A C    1  
ATOM 846   O O    . ARG A 1 59  ? 10.867  12.665  -1.435  1.00 0.34  ? 59  ARG A O    1  
ATOM 847   C CB   . ARG A 1 59  ? 8.138   12.043  -0.375  1.00 0.42  ? 59  ARG A CB   1  
ATOM 848   C CG   . ARG A 1 59  ? 6.935   12.259  0.520   1.00 0.64  ? 59  ARG A CG   1  
ATOM 849   C CD   . ARG A 1 59  ? 5.620   12.078  -0.211  1.00 0.68  ? 59  ARG A CD   1  
ATOM 850   N NE   . ARG A 1 59  ? 4.493   12.258  0.701   1.00 1.41  ? 59  ARG A NE   1  
ATOM 851   C CZ   . ARG A 1 59  ? 3.223   12.367  0.325   1.00 1.81  ? 59  ARG A CZ   1  
ATOM 852   N NH1  . ARG A 1 59  ? 2.895   12.313  -0.959  1.00 1.78  ? 59  ARG A NH1  1  
ATOM 853   N NH2  . ARG A 1 59  ? 2.279   12.534  1.247   1.00 2.81  ? 59  ARG A NH2  1  
ATOM 854   H H    . ARG A 1 59  ? 9.210   14.142  0.747   1.00 0.44  ? 59  ARG A H    1  
ATOM 855   H HA   . ARG A 1 59  ? 9.441   11.272  1.135   1.00 0.30  ? 59  ARG A HA   1  
ATOM 856   H HB2  . ARG A 1 59  ? 8.156   12.824  -1.124  1.00 0.93  ? 59  ARG A HB2  1  
ATOM 857   H HB3  . ARG A 1 59  ? 8.034   11.079  -0.858  1.00 0.91  ? 59  ARG A HB3  1  
ATOM 858   H HG2  . ARG A 1 59  ? 6.977   11.554  1.334   1.00 1.11  ? 59  ARG A HG2  1  
ATOM 859   H HG3  . ARG A 1 59  ? 6.974   13.262  0.917   1.00 1.15  ? 59  ARG A HG3  1  
ATOM 860   H HD2  . ARG A 1 59  ? 5.555   12.806  -1.006  1.00 1.27  ? 59  ARG A HD2  1  
ATOM 861   H HD3  . ARG A 1 59  ? 5.585   11.083  -0.625  1.00 1.12  ? 59  ARG A HD3  1  
ATOM 862   H HE   . ARG A 1 59  ? 4.710   12.310  1.667   1.00 2.07  ? 59  ARG A HE   1  
ATOM 863   H HH11 . ARG A 1 59  ? 3.604   12.185  -1.657  1.00 1.77  ? 59  ARG A HH11 1  
ATOM 864   H HH12 . ARG A 1 59  ? 1.936   12.423  -1.242  1.00 2.29  ? 59  ARG A HH12 1  
ATOM 865   H HH21 . ARG A 1 59  ? 2.527   12.572  2.223   1.00 3.39  ? 59  ARG A HH21 1  
ATOM 866   H HH22 . ARG A 1 59  ? 1.310   12.630  0.975   1.00 3.15  ? 59  ARG A HH22 1  
ATOM 867   N N    . PRO A 1 60  ? 11.420  10.804  -0.277  1.00 0.23  ? 60  PRO A N    1  
ATOM 868   C CA   . PRO A 1 60  ? 12.565  10.432  -1.114  1.00 0.26  ? 60  PRO A CA   1  
ATOM 869   C C    . PRO A 1 60  ? 12.198  10.302  -2.587  1.00 0.26  ? 60  PRO A C    1  
ATOM 870   O O    . PRO A 1 60  ? 11.078  9.919   -2.928  1.00 0.28  ? 60  PRO A O    1  
ATOM 871   C CB   . PRO A 1 60  ? 12.999  9.066   -0.562  1.00 0.30  ? 60  PRO A CB   1  
ATOM 872   C CG   . PRO A 1 60  ? 11.897  8.633   0.346   1.00 0.28  ? 60  PRO A CG   1  
ATOM 873   C CD   . PRO A 1 60  ? 11.283  9.895   0.867   1.00 0.21  ? 60  PRO A CD   1  
ATOM 874   H HA   . PRO A 1 60  ? 13.374  11.139  -1.008  1.00 0.32  ? 60  PRO A HA   1  
ATOM 875   H HB2  . PRO A 1 60  ? 13.127  8.370   -1.382  1.00 0.41  ? 60  PRO A HB2  1  
ATOM 876   H HB3  . PRO A 1 60  ? 13.930  9.170   -0.028  1.00 0.42  ? 60  PRO A HB3  1  
ATOM 877   H HG2  . PRO A 1 60  ? 11.167  8.059   -0.207  1.00 0.43  ? 60  PRO A HG2  1  
ATOM 878   H HG3  . PRO A 1 60  ? 12.300  8.048   1.160   1.00 0.41  ? 60  PRO A HG3  1  
ATOM 879   H HD2  . PRO A 1 60  ? 10.244  9.737   1.128   1.00 0.24  ? 60  PRO A HD2  1  
ATOM 880   H HD3  . PRO A 1 60  ? 11.837  10.262  1.718   1.00 0.24  ? 60  PRO A HD3  1  
ATOM 881   N N    . VAL A 1 61  ? 13.148  10.608  -3.452  1.00 0.29  ? 61  VAL A N    1  
ATOM 882   C CA   . VAL A 1 61  ? 12.922  10.530  -4.882  1.00 0.31  ? 61  VAL A CA   1  
ATOM 883   C C    . VAL A 1 61  ? 13.395  9.178   -5.392  1.00 0.28  ? 61  VAL A C    1  
ATOM 884   O O    . VAL A 1 61  ? 14.281  8.562   -4.801  1.00 0.27  ? 61  VAL A O    1  
ATOM 885   C CB   . VAL A 1 61  ? 13.673  11.648  -5.640  1.00 0.40  ? 61  VAL A CB   1  
ATOM 886   C CG1  . VAL A 1 61  ? 13.234  11.714  -7.097  1.00 0.81  ? 61  VAL A CG1  1  
ATOM 887   C CG2  . VAL A 1 61  ? 13.470  12.993  -4.956  1.00 0.88  ? 61  VAL A CG2  1  
ATOM 888   H H    . VAL A 1 61  ? 14.037  10.872  -3.123  1.00 0.32  ? 61  VAL A H    1  
ATOM 889   H HA   . VAL A 1 61  ? 11.862  10.633  -5.069  1.00 0.33  ? 61  VAL A HA   1  
ATOM 890   H HB   . VAL A 1 61  ? 14.723  11.414  -5.619  1.00 0.80  ? 61  VAL A HB   1  
ATOM 891   H HG11 . VAL A 1 61  ? 13.472  10.781  -7.587  1.00 1.44  ? 61  VAL A HG11 1  
ATOM 892   H HG12 . VAL A 1 61  ? 13.749  12.525  -7.593  1.00 1.46  ? 61  VAL A HG12 1  
ATOM 893   H HG13 . VAL A 1 61  ? 12.168  11.883  -7.145  1.00 1.30  ? 61  VAL A HG13 1  
ATOM 894   H HG21 . VAL A 1 61  ? 14.018  13.754  -5.491  1.00 1.45  ? 61  VAL A HG21 1  
ATOM 895   H HG22 . VAL A 1 61  ? 13.830  12.936  -3.940  1.00 1.40  ? 61  VAL A HG22 1  
ATOM 896   H HG23 . VAL A 1 61  ? 12.418  13.240  -4.953  1.00 1.47  ? 61  VAL A HG23 1  
ATOM 897   N N    . LYS A 1 62  ? 12.796  8.706   -6.464  1.00 0.27  ? 62  LYS A N    1  
ATOM 898   C CA   . LYS A 1 62  ? 13.234  7.472   -7.086  1.00 0.27  ? 62  LYS A CA   1  
ATOM 899   C C    . LYS A 1 62  ? 14.644  7.644   -7.605  1.00 0.25  ? 62  LYS A C    1  
ATOM 900   O O    . LYS A 1 62  ? 14.930  8.516   -8.424  1.00 0.31  ? 62  LYS A O    1  
ATOM 901   C CB   . LYS A 1 62  ? 12.272  7.057   -8.201  1.00 0.30  ? 62  LYS A CB   1  
ATOM 902   C CG   . LYS A 1 62  ? 10.876  6.714   -7.692  1.00 0.37  ? 62  LYS A CG   1  
ATOM 903   C CD   . LYS A 1 62  ? 10.056  5.999   -8.752  1.00 0.41  ? 62  LYS A CD   1  
ATOM 904   C CE   . LYS A 1 62  ? 8.819   5.355   -8.150  1.00 0.60  ? 62  LYS A CE   1  
ATOM 905   N NZ   . LYS A 1 62  ? 8.374   4.168   -8.928  1.00 1.17  ? 62  LYS A NZ   1  
ATOM 906   H H    . LYS A 1 62  ? 12.055  9.204   -6.856  1.00 0.30  ? 62  LYS A H    1  
ATOM 907   H HA   . LYS A 1 62  ? 13.258  6.695   -6.318  1.00 0.29  ? 62  LYS A HA   1  
ATOM 908   H HB2  . LYS A 1 62  ? 12.187  7.870   -8.908  1.00 0.33  ? 62  LYS A HB2  1  
ATOM 909   H HB3  . LYS A 1 62  ? 12.672  6.192   -8.705  1.00 0.37  ? 62  LYS A HB3  1  
ATOM 910   H HG2  . LYS A 1 62  ? 10.963  6.071   -6.826  1.00 0.54  ? 62  LYS A HG2  1  
ATOM 911   H HG3  . LYS A 1 62  ? 10.369  7.626   -7.413  1.00 0.52  ? 62  LYS A HG3  1  
ATOM 912   H HD2  . LYS A 1 62  ? 9.749   6.717   -9.500  1.00 0.61  ? 62  LYS A HD2  1  
ATOM 913   H HD3  . LYS A 1 62  ? 10.664  5.234   -9.212  1.00 0.58  ? 62  LYS A HD3  1  
ATOM 914   H HE2  . LYS A 1 62  ? 9.046   5.047   -7.143  1.00 1.06  ? 62  LYS A HE2  1  
ATOM 915   H HE3  . LYS A 1 62  ? 8.019   6.082   -8.132  1.00 0.90  ? 62  LYS A HE3  1  
ATOM 916   H HZ1  . LYS A 1 62  ? 7.362   4.002   -8.775  1.00 1.64  ? 62  LYS A HZ1  1  
ATOM 917   H HZ2  . LYS A 1 62  ? 8.900   3.318   -8.617  1.00 1.67  ? 62  LYS A HZ2  1  
ATOM 918   H HZ3  . LYS A 1 62  ? 8.544   4.315   -9.950  1.00 1.71  ? 62  LYS A HZ3  1  
ATOM 919   N N    . GLY A 1 63  ? 15.511  6.804   -7.088  1.00 0.25  ? 63  GLY A N    1  
ATOM 920   C CA   . GLY A 1 63  ? 16.920  6.943   -7.296  1.00 0.27  ? 63  GLY A CA   1  
ATOM 921   C C    . GLY A 1 63  ? 17.645  6.894   -5.976  1.00 0.30  ? 63  GLY A C    1  
ATOM 922   O O    . GLY A 1 63  ? 18.680  6.243   -5.838  1.00 0.42  ? 63  GLY A O    1  
ATOM 923   H H    . GLY A 1 63  ? 15.176  6.055   -6.551  1.00 0.30  ? 63  GLY A H    1  
ATOM 924   H HA2  . GLY A 1 63  ? 17.271  6.140   -7.931  1.00 0.29  ? 63  GLY A HA2  1  
ATOM 925   H HA3  . GLY A 1 63  ? 17.120  7.891   -7.774  1.00 0.28  ? 63  GLY A HA3  1  
ATOM 926   N N    . GLN A 1 64  ? 17.080  7.564   -4.983  1.00 0.26  ? 64  GLN A N    1  
ATOM 927   C CA   . GLN A 1 64  ? 17.677  7.571   -3.663  1.00 0.28  ? 64  GLN A CA   1  
ATOM 928   C C    . GLN A 1 64  ? 17.541  6.192   -3.051  1.00 0.24  ? 64  GLN A C    1  
ATOM 929   O O    . GLN A 1 64  ? 16.470  5.583   -3.113  1.00 0.24  ? 64  GLN A O    1  
ATOM 930   C CB   . GLN A 1 64  ? 17.012  8.604   -2.742  1.00 0.30  ? 64  GLN A CB   1  
ATOM 931   C CG   . GLN A 1 64  ? 16.551  9.901   -3.412  1.00 0.36  ? 64  GLN A CG   1  
ATOM 932   C CD   . GLN A 1 64  ? 17.647  10.704  -4.105  1.00 0.44  ? 64  GLN A CD   1  
ATOM 933   O OE1  . GLN A 1 64  ? 17.608  11.931  -4.111  1.00 0.59  ? 64  GLN A OE1  1  
ATOM 934   N NE2  . GLN A 1 64  ? 18.589  10.034  -4.737  1.00 0.43  ? 64  GLN A NE2  1  
ATOM 935   H H    . GLN A 1 64  ? 16.235  8.049   -5.140  1.00 0.26  ? 64  GLN A H    1  
ATOM 936   H HA   . GLN A 1 64  ? 18.727  7.808   -3.765  1.00 0.33  ? 64  GLN A HA   1  
ATOM 937   H HB2  . GLN A 1 64  ? 16.142  8.143   -2.286  1.00 0.29  ? 64  GLN A HB2  1  
ATOM 938   H HB3  . GLN A 1 64  ? 17.721  8.864   -1.962  1.00 0.37  ? 64  GLN A HB3  1  
ATOM 939   H HG2  . GLN A 1 64  ? 15.800  9.654   -4.143  1.00 0.35  ? 64  GLN A HG2  1  
ATOM 940   H HG3  . GLN A 1 64  ? 16.108  10.528  -2.651  1.00 0.40  ? 64  GLN A HG3  1  
ATOM 941   H HE21 . GLN A 1 64  ? 18.540  9.058   -4.742  1.00 0.43  ? 64  GLN A HE21 1  
ATOM 942   H HE22 . GLN A 1 64  ? 19.319  10.549  -5.165  1.00 0.50  ? 64  GLN A HE22 1  
ATOM 943   N N    . VAL A 1 65  ? 18.622  5.676   -2.495  1.00 0.28  ? 65  VAL A N    1  
ATOM 944   C CA   . VAL A 1 65  ? 18.538  4.414   -1.804  1.00 0.31  ? 65  VAL A CA   1  
ATOM 945   C C    . VAL A 1 65  ? 18.074  4.668   -0.378  1.00 0.25  ? 65  VAL A C    1  
ATOM 946   O O    . VAL A 1 65  ? 18.690  5.411   0.390   1.00 0.32  ? 65  VAL A O    1  
ATOM 947   C CB   . VAL A 1 65  ? 19.854  3.591   -1.848  1.00 0.49  ? 65  VAL A CB   1  
ATOM 948   C CG1  . VAL A 1 65  ? 20.309  3.371   -3.284  1.00 1.22  ? 65  VAL A CG1  1  
ATOM 949   C CG2  . VAL A 1 65  ? 20.954  4.236   -1.038  1.00 1.05  ? 65  VAL A CG2  1  
ATOM 950   H H    . VAL A 1 65  ? 19.472  6.160   -2.535  1.00 0.35  ? 65  VAL A H    1  
ATOM 951   H HA   . VAL A 1 65  ? 17.770  3.835   -2.304  1.00 0.32  ? 65  VAL A HA   1  
ATOM 952   H HB   . VAL A 1 65  ? 19.649  2.622   -1.414  1.00 1.34  ? 65  VAL A HB   1  
ATOM 953   H HG11 . VAL A 1 65  ? 20.501  4.326   -3.752  1.00 1.66  ? 65  VAL A HG11 1  
ATOM 954   H HG12 . VAL A 1 65  ? 19.539  2.850   -3.832  1.00 1.83  ? 65  VAL A HG12 1  
ATOM 955   H HG13 . VAL A 1 65  ? 21.214  2.784   -3.285  1.00 1.86  ? 65  VAL A HG13 1  
ATOM 956   H HG21 . VAL A 1 65  ? 21.112  5.245   -1.382  1.00 1.67  ? 65  VAL A HG21 1  
ATOM 957   H HG22 . VAL A 1 65  ? 21.865  3.666   -1.150  1.00 1.64  ? 65  VAL A HG22 1  
ATOM 958   H HG23 . VAL A 1 65  ? 20.663  4.249   0.003   1.00 1.65  ? 65  VAL A HG23 1  
ATOM 959   N N    . VAL A 1 66  ? 16.938  4.101   -0.058  1.00 0.19  ? 66  VAL A N    1  
ATOM 960   C CA   . VAL A 1 66  ? 16.276  4.381   1.190   1.00 0.15  ? 66  VAL A CA   1  
ATOM 961   C C    . VAL A 1 66  ? 16.204  3.151   2.067   1.00 0.16  ? 66  VAL A C    1  
ATOM 962   O O    . VAL A 1 66  ? 16.069  2.033   1.571   1.00 0.21  ? 66  VAL A O    1  
ATOM 963   C CB   . VAL A 1 66  ? 14.853  4.919   0.943   1.00 0.17  ? 66  VAL A CB   1  
ATOM 964   C CG1  . VAL A 1 66  ? 14.895  6.257   0.223   1.00 0.18  ? 66  VAL A CG1  1  
ATOM 965   C CG2  . VAL A 1 66  ? 14.036  3.934   0.123   1.00 0.25  ? 66  VAL A CG2  1  
ATOM 966   H H    . VAL A 1 66  ? 16.528  3.480   -0.686  1.00 0.24  ? 66  VAL A H    1  
ATOM 967   H HA   . VAL A 1 66  ? 16.840  5.135   1.707   1.00 0.15  ? 66  VAL A HA   1  
ATOM 968   H HB   . VAL A 1 66  ? 14.375  5.054   1.899   1.00 0.21  ? 66  VAL A HB   1  
ATOM 969   H HG11 . VAL A 1 66  ? 15.489  6.166   -0.675  1.00 1.04  ? 66  VAL A HG11 1  
ATOM 970   H HG12 . VAL A 1 66  ? 15.324  7.006   0.868   1.00 1.01  ? 66  VAL A HG12 1  
ATOM 971   H HG13 . VAL A 1 66  ? 13.889  6.547   -0.043  1.00 1.02  ? 66  VAL A HG13 1  
ATOM 972   H HG21 . VAL A 1 66  ? 14.194  2.932   0.497   1.00 1.07  ? 66  VAL A HG21 1  
ATOM 973   H HG22 . VAL A 1 66  ? 14.337  3.990   -0.916  1.00 1.07  ? 66  VAL A HG22 1  
ATOM 974   H HG23 . VAL A 1 66  ? 12.990  4.185   0.205   1.00 1.00  ? 66  VAL A HG23 1  
ATOM 975   N N    . THR A 1 67  ? 16.317  3.370   3.367   1.00 0.13  ? 67  THR A N    1  
ATOM 976   C CA   . THR A 1 67  ? 16.219  2.297   4.329   1.00 0.15  ? 67  THR A CA   1  
ATOM 977   C C    . THR A 1 67  ? 14.769  2.095   4.746   1.00 0.16  ? 67  THR A C    1  
ATOM 978   O O    . THR A 1 67  ? 14.152  2.976   5.358   1.00 0.21  ? 67  THR A O    1  
ATOM 979   C CB   . THR A 1 67  ? 17.061  2.565   5.599   1.00 0.20  ? 67  THR A CB   1  
ATOM 980   O OG1  . THR A 1 67  ? 16.527  3.663   6.344   1.00 0.29  ? 67  THR A OG1  1  
ATOM 981   C CG2  . THR A 1 67  ? 18.509  2.863   5.268   1.00 0.27  ? 67  THR A CG2  1  
ATOM 982   H H    . THR A 1 67  ? 16.472  4.282   3.687   1.00 0.14  ? 67  THR A H    1  
ATOM 983   H HA   . THR A 1 67  ? 16.581  1.393   3.862   1.00 0.15  ? 67  THR A HA   1  
ATOM 984   H HB   . THR A 1 67  ? 17.027  1.681   6.210   1.00 0.27  ? 67  THR A HB   1  
ATOM 985   H HG1  . THR A 1 67  ? 17.225  4.063   6.882   1.00 0.56  ? 67  THR A HG1  1  
ATOM 986   H HG21 . THR A 1 67  ? 18.947  2.014   4.769   1.00 1.03  ? 67  THR A HG21 1  
ATOM 987   H HG22 . THR A 1 67  ? 19.050  3.060   6.184   1.00 1.06  ? 67  THR A HG22 1  
ATOM 988   H HG23 . THR A 1 67  ? 18.566  3.729   4.625   1.00 1.04  ? 67  THR A HG23 1  
ATOM 989   N N    . VAL A 1 68  ? 14.207  0.960   4.401   1.00 0.15  ? 68  VAL A N    1  
ATOM 990   C CA   . VAL A 1 68  ? 12.897  0.624   4.899   1.00 0.15  ? 68  VAL A CA   1  
ATOM 991   C C    . VAL A 1 68  ? 12.979  -0.536  5.865   1.00 0.15  ? 68  VAL A C    1  
ATOM 992   O O    . VAL A 1 68  ? 13.790  -1.439  5.702   1.00 0.17  ? 68  VAL A O    1  
ATOM 993   C CB   . VAL A 1 68  ? 11.887  0.272   3.786   1.00 0.16  ? 68  VAL A CB   1  
ATOM 994   C CG1  . VAL A 1 68  ? 11.572  1.496   2.943   1.00 0.18  ? 68  VAL A CG1  1  
ATOM 995   C CG2  . VAL A 1 68  ? 12.409  -0.862  2.916   1.00 0.19  ? 68  VAL A CG2  1  
ATOM 996   H H    . VAL A 1 68  ? 14.677  0.339   3.795   1.00 0.15  ? 68  VAL A H    1  
ATOM 997   H HA   . VAL A 1 68  ? 12.533  1.488   5.423   1.00 0.15  ? 68  VAL A HA   1  
ATOM 998   H HB   . VAL A 1 68  ? 10.966  -0.058  4.259   1.00 0.17  ? 68  VAL A HB   1  
ATOM 999   H HG11 . VAL A 1 68  ? 12.479  1.862   2.489   1.00 1.00  ? 68  VAL A HG11 1  
ATOM 1000  H HG12 . VAL A 1 68  ? 11.147  2.267   3.571   1.00 1.05  ? 68  VAL A HG12 1  
ATOM 1001  H HG13 . VAL A 1 68  ? 10.865  1.230   2.173   1.00 1.02  ? 68  VAL A HG13 1  
ATOM 1002  H HG21 . VAL A 1 68  ? 11.659  -1.129  2.184   1.00 1.04  ? 68  VAL A HG21 1  
ATOM 1003  H HG22 . VAL A 1 68  ? 12.629  -1.720  3.535   1.00 1.04  ? 68  VAL A HG22 1  
ATOM 1004  H HG23 . VAL A 1 68  ? 13.308  -0.543  2.411   1.00 1.02  ? 68  VAL A HG23 1  
ATOM 1005  N N    . HIS A 1 69  ? 12.160  -0.496  6.885   1.00 0.14  ? 69  HIS A N    1  
ATOM 1006  C CA   . HIS A 1 69  ? 11.976  -1.648  7.731   1.00 0.15  ? 69  HIS A CA   1  
ATOM 1007  C C    . HIS A 1 69  ? 10.662  -2.278  7.356   1.00 0.14  ? 69  HIS A C    1  
ATOM 1008  O O    . HIS A 1 69  ? 9.623   -1.658  7.512   1.00 0.15  ? 69  HIS A O    1  
ATOM 1009  C CB   . HIS A 1 69  ? 11.970  -1.275  9.228   1.00 0.15  ? 69  HIS A CB   1  
ATOM 1010  C CG   . HIS A 1 69  ? 11.701  -2.454  10.137  1.00 0.15  ? 69  HIS A CG   1  
ATOM 1011  N ND1  . HIS A 1 69  ? 12.094  -2.534  11.454  1.00 0.19  ? 69  HIS A ND1  1  
ATOM 1012  C CD2  . HIS A 1 69  ? 11.071  -3.620  9.879   1.00 0.18  ? 69  HIS A CD2  1  
ATOM 1013  C CE1  . HIS A 1 69  ? 11.716  -3.708  11.946  1.00 0.18  ? 69  HIS A CE1  1  
ATOM 1014  N NE2  . HIS A 1 69  ? 11.097  -4.374  11.010  1.00 0.18  ? 69  HIS A NE2  1  
ATOM 1015  H H    . HIS A 1 69  ? 11.664  0.332   7.070   1.00 0.14  ? 69  HIS A H    1  
ATOM 1016  H HA   . HIS A 1 69  ? 12.778  -2.346  7.533   1.00 0.16  ? 69  HIS A HA   1  
ATOM 1017  H HB2  . HIS A 1 69  ? 12.931  -0.855  9.488   1.00 0.17  ? 69  HIS A HB2  1  
ATOM 1018  H HB3  . HIS A 1 69  ? 11.200  -0.539  9.405   1.00 0.16  ? 69  HIS A HB3  1  
ATOM 1019  H HD1  . HIS A 1 69  ? 12.568  -1.826  11.967  1.00 0.27  ? 69  HIS A HD1  1  
ATOM 1020  H HD2  . HIS A 1 69  ? 10.625  -3.897  8.930   1.00 0.23  ? 69  HIS A HD2  1  
ATOM 1021  H HE1  . HIS A 1 69  ? 11.870  -4.060  12.942  1.00 0.21  ? 69  HIS A HE1  1  
ATOM 1022  H HE2  . HIS A 1 69  ? 10.554  -5.175  11.168  1.00 0.29  ? 69  HIS A HE2  1  
ATOM 1023  N N    . LEU A 1 70  ? 10.687  -3.506  6.886   1.00 0.15  ? 70  LEU A N    1  
ATOM 1024  C CA   . LEU A 1 70  ? 9.443   -4.161  6.586   1.00 0.16  ? 70  LEU A CA   1  
ATOM 1025  C C    . LEU A 1 70  ? 9.269   -5.412  7.428   1.00 0.15  ? 70  LEU A C    1  
ATOM 1026  O O    . LEU A 1 70  ? 10.211  -6.160  7.683   1.00 0.21  ? 70  LEU A O    1  
ATOM 1027  C CB   . LEU A 1 70  ? 9.287   -4.485  5.095   1.00 0.21  ? 70  LEU A CB   1  
ATOM 1028  C CG   . LEU A 1 70  ? 9.690   -5.893  4.668   1.00 0.31  ? 70  LEU A CG   1  
ATOM 1029  C CD1  . LEU A 1 70  ? 9.194   -6.175  3.260   1.00 0.39  ? 70  LEU A CD1  1  
ATOM 1030  C CD2  . LEU A 1 70  ? 11.195  -6.067  4.732   1.00 0.38  ? 70  LEU A CD2  1  
ATOM 1031  H H    . LEU A 1 70  ? 11.543  -3.982  6.772   1.00 0.18  ? 70  LEU A H    1  
ATOM 1032  H HA   . LEU A 1 70  ? 8.664   -3.468  6.861   1.00 0.15  ? 70  LEU A HA   1  
ATOM 1033  H HB2  . LEU A 1 70  ? 8.250   -4.345  4.837   1.00 0.25  ? 70  LEU A HB2  1  
ATOM 1034  H HB3  . LEU A 1 70  ? 9.878   -3.779  4.532   1.00 0.21  ? 70  LEU A HB3  1  
ATOM 1035  H HG   . LEU A 1 70  ? 9.231   -6.606  5.342   1.00 0.39  ? 70  LEU A HG   1  
ATOM 1036  H HD11 . LEU A 1 70  ? 8.120   -6.073  3.229   1.00 1.02  ? 70  LEU A HD11 1  
ATOM 1037  H HD12 . LEU A 1 70  ? 9.468   -7.181  2.978   1.00 1.09  ? 70  LEU A HD12 1  
ATOM 1038  H HD13 . LEU A 1 70  ? 9.645   -5.473  2.573   1.00 1.11  ? 70  LEU A HD13 1  
ATOM 1039  H HD21 . LEU A 1 70  ? 11.667  -5.363  4.064   1.00 1.13  ? 70  LEU A HD21 1  
ATOM 1040  H HD22 . LEU A 1 70  ? 11.453  -7.076  4.437   1.00 1.06  ? 70  LEU A HD22 1  
ATOM 1041  H HD23 . LEU A 1 70  ? 11.532  -5.888  5.740   1.00 1.10  ? 70  LEU A HD23 1  
ATOM 1042  N N    . GLN A 1 71  ? 8.070   -5.581  7.910   1.00 0.13  ? 71  GLN A N    1  
ATOM 1043  C CA   . GLN A 1 71  ? 7.633   -6.832  8.488   1.00 0.14  ? 71  GLN A CA   1  
ATOM 1044  C C    . GLN A 1 71  ? 6.303   -7.112  7.873   1.00 0.14  ? 71  GLN A C    1  
ATOM 1045  O O    . GLN A 1 71  ? 5.349   -6.358  8.057   1.00 0.14  ? 71  GLN A O    1  
ATOM 1046  C CB   . GLN A 1 71  ? 7.494   -6.789  10.008  1.00 0.15  ? 71  GLN A CB   1  
ATOM 1047  C CG   . GLN A 1 71  ? 8.424   -5.810  10.691  1.00 0.15  ? 71  GLN A CG   1  
ATOM 1048  C CD   . GLN A 1 71  ? 7.809   -4.439  10.850  1.00 0.16  ? 71  GLN A CD   1  
ATOM 1049  O OE1  . GLN A 1 71  ? 8.160   -3.692  11.757  1.00 0.27  ? 71  GLN A OE1  1  
ATOM 1050  N NE2  . GLN A 1 71  ? 6.867   -4.119  9.989   1.00 0.18  ? 71  GLN A NE2  1  
ATOM 1051  H H    . GLN A 1 71  ? 7.434   -4.836  7.852   1.00 0.15  ? 71  GLN A H    1  
ATOM 1052  H HA   . GLN A 1 71  ? 8.327   -7.611  8.200   1.00 0.14  ? 71  GLN A HA   1  
ATOM 1053  H HB2  . GLN A 1 71  ? 6.477   -6.523  10.236  1.00 0.17  ? 71  GLN A HB2  1  
ATOM 1054  H HB3  . GLN A 1 71  ? 7.697   -7.772  10.407  1.00 0.17  ? 71  GLN A HB3  1  
ATOM 1055  H HG2  . GLN A 1 71  ? 8.682   -6.191  11.664  1.00 0.20  ? 71  GLN A HG2  1  
ATOM 1056  H HG3  . GLN A 1 71  ? 9.320   -5.715  10.095  1.00 0.15  ? 71  GLN A HG3  1  
ATOM 1057  H HE21 . GLN A 1 71  ? 6.607   -4.782  9.311   1.00 0.26  ? 71  GLN A HE21 1  
ATOM 1058  H HE22 . GLN A 1 71  ? 6.484   -3.227  10.039  1.00 0.18  ? 71  GLN A HE22 1  
ATOM 1059  N N    . THR A 1 72  ? 6.263   -8.151  7.114   1.00 0.15  ? 72  THR A N    1  
ATOM 1060  C CA   . THR A 1 72  ? 5.143   -8.412  6.276   1.00 0.16  ? 72  THR A CA   1  
ATOM 1061  C C    . THR A 1 72  ? 4.284   -9.533  6.818   1.00 0.16  ? 72  THR A C    1  
ATOM 1062  O O    . THR A 1 72  ? 4.783   -10.592 7.188   1.00 0.17  ? 72  THR A O    1  
ATOM 1063  C CB   . THR A 1 72  ? 5.644   -8.764  4.887   1.00 0.17  ? 72  THR A CB   1  
ATOM 1064  O OG1  . THR A 1 72  ? 6.476   -7.707  4.395   1.00 0.19  ? 72  THR A OG1  1  
ATOM 1065  C CG2  . THR A 1 72  ? 4.487   -9.003  3.952   1.00 0.19  ? 72  THR A CG2  1  
ATOM 1066  H H    . THR A 1 72  ? 7.028   -8.756  7.095   1.00 0.17  ? 72  THR A H    1  
ATOM 1067  H HA   . THR A 1 72  ? 4.551   -7.512  6.209   1.00 0.17  ? 72  THR A HA   1  
ATOM 1068  H HB   . THR A 1 72  ? 6.230   -9.667  4.963   1.00 0.18  ? 72  THR A HB   1  
ATOM 1069  H HG1  . THR A 1 72  ? 7.006   -8.025  3.657   1.00 0.55  ? 72  THR A HG1  1  
ATOM 1070  H HG21 . THR A 1 72  ? 4.859   -9.135  2.949   1.00 1.04  ? 72  THR A HG21 1  
ATOM 1071  H HG22 . THR A 1 72  ? 3.816   -8.157  3.987   1.00 1.00  ? 72  THR A HG22 1  
ATOM 1072  H HG23 . THR A 1 72  ? 3.962   -9.895  4.262   1.00 1.00  ? 72  THR A HG23 1  
ATOM 1073  N N    . SER A 1 73  ? 2.997   -9.285  6.843   1.00 0.17  ? 73  SER A N    1  
ATOM 1074  C CA   . SER A 1 73  ? 2.037   -10.259 7.269   1.00 0.17  ? 73  SER A CA   1  
ATOM 1075  C C    . SER A 1 73  ? 1.333   -10.817 6.052   1.00 0.15  ? 73  SER A C    1  
ATOM 1076  O O    . SER A 1 73  ? 1.297   -10.192 4.993   1.00 0.26  ? 73  SER A O    1  
ATOM 1077  C CB   . SER A 1 73  ? 0.986   -9.615  8.179   1.00 0.23  ? 73  SER A CB   1  
ATOM 1078  O OG   . SER A 1 73  ? 1.571   -8.813  9.191   1.00 1.06  ? 73  SER A OG   1  
ATOM 1079  H H    . SER A 1 73  ? 2.672   -8.411  6.537   1.00 0.20  ? 73  SER A H    1  
ATOM 1080  H HA   . SER A 1 73  ? 2.554   -11.053 7.793   1.00 0.18  ? 73  SER A HA   1  
ATOM 1081  H HB2  . SER A 1 73  ? 0.339   -8.991  7.585   1.00 0.96  ? 73  SER A HB2  1  
ATOM 1082  H HB3  . SER A 1 73  ? 0.402   -10.393 8.646   1.00 1.03  ? 73  SER A HB3  1  
ATOM 1083  H HG   . SER A 1 73  ? 0.983   -8.791  9.954   1.00 1.54  ? 73  SER A HG   1  
ATOM 1084  N N    . LEU A 1 74  ? 0.798   -11.996 6.204   1.00 0.19  ? 74  LEU A N    1  
ATOM 1085  C CA   . LEU A 1 74  ? -0.077  -12.562 5.215   1.00 0.18  ? 74  LEU A CA   1  
ATOM 1086  C C    . LEU A 1 74  ? -1.458  -11.974 5.389   1.00 0.19  ? 74  LEU A C    1  
ATOM 1087  O O    . LEU A 1 74  ? -1.726  -11.343 6.407   1.00 0.21  ? 74  LEU A O    1  
ATOM 1088  C CB   . LEU A 1 74  ? -0.116  -14.072 5.360   1.00 0.22  ? 74  LEU A CB   1  
ATOM 1089  C CG   . LEU A 1 74  ? 1.172   -14.776 4.965   1.00 0.38  ? 74  LEU A CG   1  
ATOM 1090  C CD1  . LEU A 1 74  ? 0.921   -16.247 4.680   1.00 0.84  ? 74  LEU A CD1  1  
ATOM 1091  C CD2  . LEU A 1 74  ? 1.797   -14.080 3.771   1.00 0.72  ? 74  LEU A CD2  1  
ATOM 1092  H H    . LEU A 1 74  ? 1.007   -12.514 7.010   1.00 0.34  ? 74  LEU A H    1  
ATOM 1093  H HA   . LEU A 1 74  ? 0.302   -12.301 4.238   1.00 0.18  ? 74  LEU A HA   1  
ATOM 1094  H HB2  . LEU A 1 74  ? -0.316  -14.300 6.394   1.00 0.30  ? 74  LEU A HB2  1  
ATOM 1095  H HB3  . LEU A 1 74  ? -0.919  -14.454 4.757   1.00 0.20  ? 74  LEU A HB3  1  
ATOM 1096  H HG   . LEU A 1 74  ? 1.871   -14.713 5.788   1.00 0.97  ? 74  LEU A HG   1  
ATOM 1097  H HD11 . LEU A 1 74  ? 0.221   -16.338 3.863   1.00 1.51  ? 74  LEU A HD11 1  
ATOM 1098  H HD12 . LEU A 1 74  ? 0.512   -16.724 5.559   1.00 1.44  ? 74  LEU A HD12 1  
ATOM 1099  H HD13 . LEU A 1 74  ? 1.851   -16.725 4.412   1.00 1.32  ? 74  LEU A HD13 1  
ATOM 1100  H HD21 . LEU A 1 74  ? 2.081   -13.070 4.056   1.00 1.44  ? 74  LEU A HD21 1  
ATOM 1101  H HD22 . LEU A 1 74  ? 1.076   -14.036 2.969   1.00 1.33  ? 74  LEU A HD22 1  
ATOM 1102  H HD23 . LEU A 1 74  ? 2.670   -14.624 3.448   1.00 1.28  ? 74  LEU A HD23 1  
ATOM 1103  N N    . GLU A 1 75  ? -2.329  -12.167 4.410   1.00 0.21  ? 75  GLU A N    1  
ATOM 1104  C CA   . GLU A 1 75  ? -3.680  -11.629 4.488   1.00 0.26  ? 75  GLU A CA   1  
ATOM 1105  C C    . GLU A 1 75  ? -4.442  -12.172 5.699   1.00 0.32  ? 75  GLU A C    1  
ATOM 1106  O O    . GLU A 1 75  ? -5.482  -11.636 6.078   1.00 0.39  ? 75  GLU A O    1  
ATOM 1107  C CB   . GLU A 1 75  ? -4.448  -11.916 3.199   1.00 0.30  ? 75  GLU A CB   1  
ATOM 1108  C CG   . GLU A 1 75  ? -4.523  -13.382 2.818   1.00 0.34  ? 75  GLU A CG   1  
ATOM 1109  C CD   . GLU A 1 75  ? -5.227  -13.578 1.491   1.00 0.67  ? 75  GLU A CD   1  
ATOM 1110  O OE1  . GLU A 1 75  ? -6.465  -13.730 1.487   1.00 1.14  ? 75  GLU A OE1  1  
ATOM 1111  O OE2  . GLU A 1 75  ? -4.544  -13.565 0.444   1.00 0.82  ? 75  GLU A OE2  1  
ATOM 1112  H H    . GLU A 1 75  ? -2.058  -12.664 3.610   1.00 0.21  ? 75  GLU A H    1  
ATOM 1113  H HA   . GLU A 1 75  ? -3.589  -10.555 4.595   1.00 0.27  ? 75  GLU A HA   1  
ATOM 1114  H HB2  . GLU A 1 75  ? -5.456  -11.545 3.305   1.00 0.37  ? 75  GLU A HB2  1  
ATOM 1115  H HB3  . GLU A 1 75  ? -3.965  -11.390 2.392   1.00 0.29  ? 75  GLU A HB3  1  
ATOM 1116  H HG2  . GLU A 1 75  ? -3.521  -13.770 2.741   1.00 0.47  ? 75  GLU A HG2  1  
ATOM 1117  H HG3  . GLU A 1 75  ? -5.064  -13.923 3.583   1.00 0.54  ? 75  GLU A HG3  1  
ATOM 1118  N N    . ASN A 1 76  ? -3.921  -13.237 6.311   1.00 0.34  ? 76  ASN A N    1  
ATOM 1119  C CA   . ASN A 1 76  ? -4.537  -13.792 7.512   1.00 0.41  ? 76  ASN A CA   1  
ATOM 1120  C C    . ASN A 1 76  ? -3.902  -13.196 8.771   1.00 0.39  ? 76  ASN A C    1  
ATOM 1121  O O    . ASN A 1 76  ? -4.463  -13.281 9.862   1.00 0.51  ? 76  ASN A O    1  
ATOM 1122  C CB   . ASN A 1 76  ? -4.424  -15.325 7.535   1.00 0.50  ? 76  ASN A CB   1  
ATOM 1123  C CG   . ASN A 1 76  ? -3.131  -15.836 8.139   1.00 1.13  ? 76  ASN A CG   1  
ATOM 1124  O OD1  . ASN A 1 76  ? -3.027  -16.016 9.352   1.00 2.14  ? 76  ASN A OD1  1  
ATOM 1125  N ND2  . ASN A 1 76  ? -2.148  -16.102 7.293   1.00 1.13  ? 76  ASN A ND2  1  
ATOM 1126  H H    . ASN A 1 76  ? -3.115  -13.654 5.943   1.00 0.32  ? 76  ASN A H    1  
ATOM 1127  H HA   . ASN A 1 76  ? -5.583  -13.523 7.495   1.00 0.47  ? 76  ASN A HA   1  
ATOM 1128  H HB2  . ASN A 1 76  ? -5.244  -15.728 8.109   1.00 1.21  ? 76  ASN A HB2  1  
ATOM 1129  H HB3  . ASN A 1 76  ? -4.488  -15.693 6.520   1.00 1.00  ? 76  ASN A HB3  1  
ATOM 1130  H HD21 . ASN A 1 76  ? -2.307  -15.956 6.330   1.00 0.98  ? 76  ASN A HD21 1  
ATOM 1131  H HD22 . ASN A 1 76  ? -1.302  -16.448 7.661   1.00 1.79  ? 76  ASN A HD22 1  
ATOM 1132  N N    . GLY A 1 77  ? -2.745  -12.569 8.604   1.00 0.30  ? 77  GLY A N    1  
ATOM 1133  C CA   . GLY A 1 77  ? -2.061  -11.959 9.729   1.00 0.32  ? 77  GLY A CA   1  
ATOM 1134  C C    . GLY A 1 77  ? -0.709  -12.585 10.033  1.00 0.32  ? 77  GLY A C    1  
ATOM 1135  O O    . GLY A 1 77  ? 0.008   -12.114 10.915  1.00 0.51  ? 77  GLY A O    1  
ATOM 1136  H H    . GLY A 1 77  ? -2.371  -12.491 7.704   1.00 0.27  ? 77  GLY A H    1  
ATOM 1137  H HA2  . GLY A 1 77  ? -1.914  -10.910 9.517   1.00 0.32  ? 77  GLY A HA2  1  
ATOM 1138  H HA3  . GLY A 1 77  ? -2.691  -12.050 10.602  1.00 0.38  ? 77  GLY A HA3  1  
ATOM 1139  N N    . THR A 1 78  ? -0.349  -13.641 9.312   1.00 0.28  ? 78  THR A N    1  
ATOM 1140  C CA   . THR A 1 78  ? 0.908   -14.335 9.562   1.00 0.28  ? 78  THR A CA   1  
ATOM 1141  C C    . THR A 1 78  ? 2.094   -13.553 9.025   1.00 0.23  ? 78  THR A C    1  
ATOM 1142  O O    . THR A 1 78  ? 2.263   -13.425 7.817   1.00 0.21  ? 78  THR A O    1  
ATOM 1143  C CB   . THR A 1 78  ? 0.921   -15.737 8.929   1.00 0.34  ? 78  THR A CB   1  
ATOM 1144  O OG1  . THR A 1 78  ? -0.242  -16.462 9.330   1.00 0.46  ? 78  THR A OG1  1  
ATOM 1145  C CG2  . THR A 1 78  ? 2.167   -16.510 9.336   1.00 0.39  ? 78  THR A CG2  1  
ATOM 1146  H H    . THR A 1 78  ? -0.939  -13.965 8.607   1.00 0.39  ? 78  THR A H    1  
ATOM 1147  H HA   . THR A 1 78  ? 1.019   -14.438 10.620  1.00 0.32  ? 78  THR A HA   1  
ATOM 1148  H HB   . THR A 1 78  ? 0.918   -15.630 7.853   1.00 0.33  ? 78  THR A HB   1  
ATOM 1149  H HG1  . THR A 1 78  ? -0.450  -16.250 10.254  1.00 0.91  ? 78  THR A HG1  1  
ATOM 1150  H HG21 . THR A 1 78  ? 2.182   -16.628 10.411  1.00 1.16  ? 78  THR A HG21 1  
ATOM 1151  H HG22 . THR A 1 78  ? 3.047   -15.968 9.022   1.00 1.12  ? 78  THR A HG22 1  
ATOM 1152  H HG23 . THR A 1 78  ? 2.156   -17.482 8.867   1.00 0.98  ? 78  THR A HG23 1  
ATOM 1153  N N    . ARG A 1 79  ? 2.911   -13.029 9.919   1.00 0.24  ? 79  ARG A N    1  
ATOM 1154  C CA   . ARG A 1 79  ? 4.096   -12.309 9.507   1.00 0.22  ? 79  ARG A CA   1  
ATOM 1155  C C    . ARG A 1 79  ? 5.174   -13.263 9.054   1.00 0.24  ? 79  ARG A C    1  
ATOM 1156  O O    . ARG A 1 79  ? 5.738   -14.025 9.838   1.00 0.33  ? 79  ARG A O    1  
ATOM 1157  C CB   . ARG A 1 79  ? 4.573   -11.386 10.606  1.00 0.25  ? 79  ARG A CB   1  
ATOM 1158  C CG   . ARG A 1 79  ? 3.639   -10.208 10.742  1.00 0.25  ? 79  ARG A CG   1  
ATOM 1159  C CD   . ARG A 1 79  ? 4.396   -8.918  10.989  1.00 0.28  ? 79  ARG A CD   1  
ATOM 1160  N NE   . ARG A 1 79  ? 3.585   -7.740  10.657  1.00 0.33  ? 79  ARG A NE   1  
ATOM 1161  C CZ   . ARG A 1 79  ? 3.777   -6.515  11.159  1.00 0.38  ? 79  ARG A CZ   1  
ATOM 1162  N NH1  . ARG A 1 79  ? 4.685   -6.311  12.107  1.00 0.42  ? 79  ARG A NH1  1  
ATOM 1163  N NH2  . ARG A 1 79  ? 3.029   -5.499  10.734  1.00 0.47  ? 79  ARG A NH2  1  
ATOM 1164  H H    . ARG A 1 79  ? 2.712   -13.130 10.874  1.00 0.27  ? 79  ARG A H    1  
ATOM 1165  H HA   . ARG A 1 79  ? 3.819   -11.698 8.657   1.00 0.19  ? 79  ARG A HA   1  
ATOM 1166  H HB2  . ARG A 1 79  ? 4.600   -11.928 11.542  1.00 0.29  ? 79  ARG A HB2  1  
ATOM 1167  H HB3  . ARG A 1 79  ? 5.561   -11.021 10.366  1.00 0.25  ? 79  ARG A HB3  1  
ATOM 1168  H HG2  . ARG A 1 79  ? 3.069   -10.115 9.821   1.00 0.23  ? 79  ARG A HG2  1  
ATOM 1169  H HG3  . ARG A 1 79  ? 2.961   -10.388 11.565  1.00 0.29  ? 79  ARG A HG3  1  
ATOM 1170  H HD2  . ARG A 1 79  ? 4.679   -8.880  12.028  1.00 0.34  ? 79  ARG A HD2  1  
ATOM 1171  H HD3  . ARG A 1 79  ? 5.283   -8.919  10.369  1.00 0.31  ? 79  ARG A HD3  1  
ATOM 1172  H HE   . ARG A 1 79  ? 2.865   -7.873  9.991   1.00 0.39  ? 79  ARG A HE   1  
ATOM 1173  H HH11 . ARG A 1 79  ? 5.229   -7.078  12.457  1.00 0.43  ? 79  ARG A HH11 1  
ATOM 1174  H HH12 . ARG A 1 79  ? 4.826   -5.391  12.479  1.00 0.49  ? 79  ARG A HH12 1  
ATOM 1175  H HH21 . ARG A 1 79  ? 2.324   -5.650  10.041  1.00 0.54  ? 79  ARG A HH21 1  
ATOM 1176  H HH22 . ARG A 1 79  ? 3.164   -4.565  11.111  1.00 0.51  ? 79  ARG A HH22 1  
ATOM 1177  N N    . VAL A 1 80  ? 5.442   -13.196 7.765   1.00 0.20  ? 80  VAL A N    1  
ATOM 1178  C CA   . VAL A 1 80  ? 6.267   -14.173 7.086   1.00 0.22  ? 80  VAL A CA   1  
ATOM 1179  C C    . VAL A 1 80  ? 7.697   -13.693 6.899   1.00 0.21  ? 80  VAL A C    1  
ATOM 1180  O O    . VAL A 1 80  ? 8.584   -14.477 6.567   1.00 0.27  ? 80  VAL A O    1  
ATOM 1181  C CB   . VAL A 1 80  ? 5.667   -14.497 5.713   1.00 0.23  ? 80  VAL A CB   1  
ATOM 1182  C CG1  . VAL A 1 80  ? 4.326   -15.181 5.878   1.00 0.26  ? 80  VAL A CG1  1  
ATOM 1183  C CG2  . VAL A 1 80  ? 5.529   -13.236 4.869   1.00 0.22  ? 80  VAL A CG2  1  
ATOM 1184  H H    . VAL A 1 80  ? 5.064   -12.454 7.247   1.00 0.20  ? 80  VAL A H    1  
ATOM 1185  H HA   . VAL A 1 80  ? 6.272   -15.076 7.672   1.00 0.26  ? 80  VAL A HA   1  
ATOM 1186  H HB   . VAL A 1 80  ? 6.326   -15.171 5.206   1.00 0.27  ? 80  VAL A HB   1  
ATOM 1187  H HG11 . VAL A 1 80  ? 3.648   -14.520 6.396   1.00 0.98  ? 80  VAL A HG11 1  
ATOM 1188  H HG12 . VAL A 1 80  ? 4.452   -16.088 6.449   1.00 1.06  ? 80  VAL A HG12 1  
ATOM 1189  H HG13 . VAL A 1 80  ? 3.922   -15.420 4.905   1.00 1.01  ? 80  VAL A HG13 1  
ATOM 1190  H HG21 . VAL A 1 80  ? 6.508   -12.816 4.687   1.00 0.95  ? 80  VAL A HG21 1  
ATOM 1191  H HG22 . VAL A 1 80  ? 4.920   -12.513 5.395   1.00 1.01  ? 80  VAL A HG22 1  
ATOM 1192  H HG23 . VAL A 1 80  ? 5.063   -13.484 3.928   1.00 1.03  ? 80  VAL A HG23 1  
ATOM 1193  N N    . GLN A 1 81  ? 7.917   -12.408 7.102   1.00 0.18  ? 81  GLN A N    1  
ATOM 1194  C CA   . GLN A 1 81  ? 9.223   -11.825 6.861   1.00 0.19  ? 81  GLN A CA   1  
ATOM 1195  C C    . GLN A 1 81  ? 9.393   -10.547 7.662   1.00 0.19  ? 81  GLN A C    1  
ATOM 1196  O O    . GLN A 1 81  ? 8.476   -9.729  7.747   1.00 0.26  ? 81  GLN A O    1  
ATOM 1197  C CB   . GLN A 1 81  ? 9.409   -11.552 5.362   1.00 0.23  ? 81  GLN A CB   1  
ATOM 1198  C CG   . GLN A 1 81  ? 8.369   -10.607 4.773   1.00 0.23  ? 81  GLN A CG   1  
ATOM 1199  C CD   . GLN A 1 81  ? 8.425   -10.528 3.258   1.00 0.37  ? 81  GLN A CD   1  
ATOM 1200  O OE1  . GLN A 1 81  ? 9.147   -9.713  2.686   1.00 0.59  ? 81  GLN A OE1  1  
ATOM 1201  N NE2  . GLN A 1 81  ? 7.643   -11.370 2.593   1.00 0.50  ? 81  GLN A NE2  1  
ATOM 1202  H H    . GLN A 1 81  ? 7.190   -11.838 7.431   1.00 0.17  ? 81  GLN A H    1  
ATOM 1203  H HA   . GLN A 1 81  ? 9.969   -12.538 7.182   1.00 0.21  ? 81  GLN A HA   1  
ATOM 1204  H HB2  . GLN A 1 81  ? 10.387  -11.119 5.206   1.00 0.26  ? 81  GLN A HB2  1  
ATOM 1205  H HB3  . GLN A 1 81  ? 9.350   -12.487 4.828   1.00 0.24  ? 81  GLN A HB3  1  
ATOM 1206  H HG2  . GLN A 1 81  ? 7.386   -10.947 5.059   1.00 0.20  ? 81  GLN A HG2  1  
ATOM 1207  H HG3  . GLN A 1 81  ? 8.529   -9.621  5.175   1.00 0.25  ? 81  GLN A HG3  1  
ATOM 1208  H HE21 . GLN A 1 81  ? 7.082   -11.988 3.110   1.00 0.63  ? 81  GLN A HE21 1  
ATOM 1209  H HE22 . GLN A 1 81  ? 7.653   -11.330 1.614   1.00 0.59  ? 81  GLN A HE22 1  
ATOM 1210  N N    . GLU A 1 82  ? 10.558  -10.393 8.265   1.00 0.24  ? 82  GLU A N    1  
ATOM 1211  C CA   . GLU A 1 82  ? 10.896  -9.179  8.980   1.00 0.24  ? 82  GLU A CA   1  
ATOM 1212  C C    . GLU A 1 82  ? 12.317  -8.769  8.647   1.00 0.25  ? 82  GLU A C    1  
ATOM 1213  O O    . GLU A 1 82  ? 13.239  -9.583  8.694   1.00 0.41  ? 82  GLU A O    1  
ATOM 1214  C CB   . GLU A 1 82  ? 10.749  -9.353  10.495  1.00 0.35  ? 82  GLU A CB   1  
ATOM 1215  C CG   . GLU A 1 82  ? 11.290  -8.165  11.279  1.00 0.44  ? 82  GLU A CG   1  
ATOM 1216  C CD   . GLU A 1 82  ? 11.048  -8.266  12.768  1.00 0.82  ? 82  GLU A CD   1  
ATOM 1217  O OE1  . GLU A 1 82  ? 11.399  -9.301  13.370  1.00 1.21  ? 82  GLU A OE1  1  
ATOM 1218  O OE2  . GLU A 1 82  ? 10.513  -7.295  13.342  1.00 1.34  ? 82  GLU A OE2  1  
ATOM 1219  H H    . GLU A 1 82  ? 11.219  -11.117 8.222   1.00 0.35  ? 82  GLU A H    1  
ATOM 1220  H HA   . GLU A 1 82  ? 10.226  -8.402  8.647   1.00 0.24  ? 82  GLU A HA   1  
ATOM 1221  H HB2  . GLU A 1 82  ? 9.703   -9.477  10.735  1.00 0.43  ? 82  GLU A HB2  1  
ATOM 1222  H HB3  . GLU A 1 82  ? 11.289  -10.237 10.799  1.00 0.37  ? 82  GLU A HB3  1  
ATOM 1223  H HG2  . GLU A 1 82  ? 12.354  -8.097  11.108  1.00 0.68  ? 82  GLU A HG2  1  
ATOM 1224  H HG3  . GLU A 1 82  ? 10.813  -7.266  10.913  1.00 0.57  ? 82  GLU A HG3  1  
ATOM 1225  N N    . GLU A 1 83  ? 12.477  -7.512  8.293   1.00 0.22  ? 83  GLU A N    1  
ATOM 1226  C CA   . GLU A 1 83  ? 13.773  -6.964  7.975   1.00 0.26  ? 83  GLU A CA   1  
ATOM 1227  C C    . GLU A 1 83  ? 13.848  -5.517  8.436   1.00 0.23  ? 83  GLU A C    1  
ATOM 1228  O O    . GLU A 1 83  ? 13.137  -4.644  7.938   1.00 0.24  ? 83  GLU A O    1  
ATOM 1229  C CB   . GLU A 1 83  ? 14.037  -7.145  6.472   1.00 0.39  ? 83  GLU A CB   1  
ATOM 1230  C CG   . GLU A 1 83  ? 14.922  -6.099  5.817   1.00 1.20  ? 83  GLU A CG   1  
ATOM 1231  C CD   . GLU A 1 83  ? 15.372  -6.539  4.442   1.00 1.73  ? 83  GLU A CD   1  
ATOM 1232  O OE1  . GLU A 1 83  ? 14.619  -6.350  3.472   1.00 2.59  ? 83  GLU A OE1  1  
ATOM 1233  O OE2  . GLU A 1 83  ? 16.478  -7.112  4.330   1.00 1.69  ? 83  GLU A OE2  1  
ATOM 1234  H H    . GLU A 1 83  ? 11.686  -6.930  8.229   1.00 0.26  ? 83  GLU A H    1  
ATOM 1235  H HA   . GLU A 1 83  ? 14.503  -7.525  8.532   1.00 0.31  ? 83  GLU A HA   1  
ATOM 1236  H HB2  . GLU A 1 83  ? 14.509  -8.106  6.328   1.00 1.15  ? 83  GLU A HB2  1  
ATOM 1237  H HB3  . GLU A 1 83  ? 13.087  -7.150  5.958   1.00 1.13  ? 83  GLU A HB3  1  
ATOM 1238  H HG2  . GLU A 1 83  ? 14.359  -5.177  5.721   1.00 1.73  ? 83  GLU A HG2  1  
ATOM 1239  H HG3  . GLU A 1 83  ? 15.793  -5.930  6.430   1.00 1.68  ? 83  GLU A HG3  1  
ATOM 1240  N N    . PRO A 1 84  ? 14.703  -5.266  9.440   1.00 0.23  ? 84  PRO A N    1  
ATOM 1241  C CA   . PRO A 1 84  ? 14.787  -3.976  10.126  1.00 0.21  ? 84  PRO A CA   1  
ATOM 1242  C C    . PRO A 1 84  ? 15.334  -2.861  9.247   1.00 0.19  ? 84  PRO A C    1  
ATOM 1243  O O    . PRO A 1 84  ? 15.175  -1.681  9.563   1.00 0.20  ? 84  PRO A O    1  
ATOM 1244  C CB   . PRO A 1 84  ? 15.740  -4.240  11.304  1.00 0.25  ? 84  PRO A CB   1  
ATOM 1245  C CG   . PRO A 1 84  ? 15.875  -5.723  11.388  1.00 0.50  ? 84  PRO A CG   1  
ATOM 1246  C CD   . PRO A 1 84  ? 15.662  -6.233  9.995   1.00 0.31  ? 84  PRO A CD   1  
ATOM 1247  H HA   . PRO A 1 84  ? 13.820  -3.675  10.507  1.00 0.20  ? 84  PRO A HA   1  
ATOM 1248  H HB2  . PRO A 1 84  ? 16.693  -3.769  11.108  1.00 0.45  ? 84  PRO A HB2  1  
ATOM 1249  H HB3  . PRO A 1 84  ? 15.315  -3.832  12.209  1.00 0.41  ? 84  PRO A HB3  1  
ATOM 1250  H HG2  . PRO A 1 84  ? 16.864  -5.981  11.734  1.00 0.90  ? 84  PRO A HG2  1  
ATOM 1251  H HG3  . PRO A 1 84  ? 15.124  -6.123  12.055  1.00 0.88  ? 84  PRO A HG3  1  
ATOM 1252  H HD2  . PRO A 1 84  ? 16.588  -6.222  9.441   1.00 0.47  ? 84  PRO A HD2  1  
ATOM 1253  H HD3  . PRO A 1 84  ? 15.241  -7.226  10.019  1.00 0.50  ? 84  PRO A HD3  1  
ATOM 1254  N N    . GLU A 1 85  ? 15.953  -3.224  8.133   1.00 0.20  ? 85  GLU A N    1  
ATOM 1255  C CA   . GLU A 1 85  ? 16.586  -2.238  7.281   1.00 0.22  ? 85  GLU A CA   1  
ATOM 1256  C C    . GLU A 1 85  ? 16.932  -2.813  5.929   1.00 0.24  ? 85  GLU A C    1  
ATOM 1257  O O    . GLU A 1 85  ? 17.763  -3.709  5.795   1.00 0.35  ? 85  GLU A O    1  
ATOM 1258  C CB   . GLU A 1 85  ? 17.827  -1.671  7.963   1.00 0.31  ? 85  GLU A CB   1  
ATOM 1259  C CG   . GLU A 1 85  ? 18.446  -0.494  7.242   1.00 0.34  ? 85  GLU A CG   1  
ATOM 1260  C CD   . GLU A 1 85  ? 19.371  0.279   8.147   1.00 0.90  ? 85  GLU A CD   1  
ATOM 1261  O OE1  . GLU A 1 85  ? 20.566  -0.071  8.227   1.00 1.30  ? 85  GLU A OE1  1  
ATOM 1262  O OE2  . GLU A 1 85  ? 18.892  1.232   8.799   1.00 1.37  ? 85  GLU A OE2  1  
ATOM 1263  H H    . GLU A 1 85  ? 15.965  -4.168  7.871   1.00 0.23  ? 85  GLU A H    1  
ATOM 1264  H HA   . GLU A 1 85  ? 15.876  -1.441  7.123   1.00 0.23  ? 85  GLU A HA   1  
ATOM 1265  H HB2  . GLU A 1 85  ? 17.562  -1.350  8.959   1.00 0.43  ? 85  GLU A HB2  1  
ATOM 1266  H HB3  . GLU A 1 85  ? 18.570  -2.450  8.032   1.00 0.36  ? 85  GLU A HB3  1  
ATOM 1267  H HG2  . GLU A 1 85  ? 19.009  -0.856  6.395   1.00 0.68  ? 85  GLU A HG2  1  
ATOM 1268  H HG3  . GLU A 1 85  ? 17.662  0.166   6.903   1.00 0.66  ? 85  GLU A HG3  1  
ATOM 1269  N N    . LEU A 1 86  ? 16.244  -2.290  4.947   1.00 0.23  ? 86  LEU A N    1  
ATOM 1270  C CA   . LEU A 1 86  ? 16.456  -2.624  3.568   1.00 0.24  ? 86  LEU A CA   1  
ATOM 1271  C C    . LEU A 1 86  ? 16.674  -1.346  2.786   1.00 0.23  ? 86  LEU A C    1  
ATOM 1272  O O    . LEU A 1 86  ? 15.757  -0.543  2.647   1.00 0.25  ? 86  LEU A O    1  
ATOM 1273  C CB   . LEU A 1 86  ? 15.234  -3.351  3.026   1.00 0.26  ? 86  LEU A CB   1  
ATOM 1274  C CG   . LEU A 1 86  ? 15.237  -3.579  1.525   1.00 0.33  ? 86  LEU A CG   1  
ATOM 1275  C CD1  . LEU A 1 86  ? 16.393  -4.479  1.113   1.00 0.38  ? 86  LEU A CD1  1  
ATOM 1276  C CD2  . LEU A 1 86  ? 13.910  -4.169  1.084   1.00 0.38  ? 86  LEU A CD2  1  
ATOM 1277  H H    . LEU A 1 86  ? 15.532  -1.650  5.164   1.00 0.29  ? 86  LEU A H    1  
ATOM 1278  H HA   . LEU A 1 86  ? 17.325  -3.257  3.489   1.00 0.26  ? 86  LEU A HA   1  
ATOM 1279  H HB2  . LEU A 1 86  ? 15.160  -4.307  3.515   1.00 0.27  ? 86  LEU A HB2  1  
ATOM 1280  H HB3  . LEU A 1 86  ? 14.357  -2.770  3.275   1.00 0.27  ? 86  LEU A HB3  1  
ATOM 1281  H HG   . LEU A 1 86  ? 15.363  -2.624  1.041   1.00 0.35  ? 86  LEU A HG   1  
ATOM 1282  H HD11 . LEU A 1 86  ? 17.325  -4.033  1.425   1.00 1.08  ? 86  LEU A HD11 1  
ATOM 1283  H HD12 . LEU A 1 86  ? 16.393  -4.598  0.040   1.00 1.14  ? 86  LEU A HD12 1  
ATOM 1284  H HD13 . LEU A 1 86  ? 16.282  -5.446  1.583   1.00 1.05  ? 86  LEU A HD13 1  
ATOM 1285  H HD21 . LEU A 1 86  ? 13.947  -4.392  0.027   1.00 1.08  ? 86  LEU A HD21 1  
ATOM 1286  H HD22 . LEU A 1 86  ? 13.120  -3.459  1.275   1.00 1.04  ? 86  LEU A HD22 1  
ATOM 1287  H HD23 . LEU A 1 86  ? 13.720  -5.078  1.642   1.00 0.99  ? 86  LEU A HD23 1  
ATOM 1288  N N    . VAL A 1 87  ? 17.888  -1.138  2.312   1.00 0.24  ? 87  VAL A N    1  
ATOM 1289  C CA   . VAL A 1 87  ? 18.191  0.045   1.522   1.00 0.22  ? 87  VAL A CA   1  
ATOM 1290  C C    . VAL A 1 87  ? 18.210  -0.331  0.044   1.00 0.21  ? 87  VAL A C    1  
ATOM 1291  O O    . VAL A 1 87  ? 18.927  -1.248  -0.359  1.00 0.28  ? 87  VAL A O    1  
ATOM 1292  C CB   . VAL A 1 87  ? 19.548  0.665   1.911   1.00 0.27  ? 87  VAL A CB   1  
ATOM 1293  C CG1  . VAL A 1 87  ? 19.606  2.136   1.544   1.00 1.00  ? 87  VAL A CG1  1  
ATOM 1294  C CG2  . VAL A 1 87  ? 19.832  0.469   3.387   1.00 0.94  ? 87  VAL A CG2  1  
ATOM 1295  H H    . VAL A 1 87  ? 18.592  -1.798  2.482   1.00 0.29  ? 87  VAL A H    1  
ATOM 1296  H HA   . VAL A 1 87  ? 17.409  0.777   1.698   1.00 0.20  ? 87  VAL A HA   1  
ATOM 1297  H HB   . VAL A 1 87  ? 20.312  0.163   1.355   1.00 0.79  ? 87  VAL A HB   1  
ATOM 1298  H HG11 . VAL A 1 87  ? 19.527  2.245   0.472   1.00 1.46  ? 87  VAL A HG11 1  
ATOM 1299  H HG12 . VAL A 1 87  ? 20.542  2.556   1.883   1.00 1.48  ? 87  VAL A HG12 1  
ATOM 1300  H HG13 . VAL A 1 87  ? 18.787  2.655   2.019   1.00 1.59  ? 87  VAL A HG13 1  
ATOM 1301  H HG21 . VAL A 1 87  ? 19.055  0.948   3.963   1.00 1.54  ? 87  VAL A HG21 1  
ATOM 1302  H HG22 . VAL A 1 87  ? 20.787  0.909   3.632   1.00 1.50  ? 87  VAL A HG22 1  
ATOM 1303  H HG23 . VAL A 1 87  ? 19.850  -0.586  3.613   1.00 1.54  ? 87  VAL A HG23 1  
ATOM 1304  N N    . PHE A 1 88  ? 17.423  0.370   -0.758  1.00 0.17  ? 88  PHE A N    1  
ATOM 1305  C CA   . PHE A 1 88  ? 17.235  -0.009  -2.156  1.00 0.19  ? 88  PHE A CA   1  
ATOM 1306  C C    . PHE A 1 88  ? 17.065  1.210   -3.043  1.00 0.20  ? 88  PHE A C    1  
ATOM 1307  O O    . PHE A 1 88  ? 16.721  2.294   -2.568  1.00 0.23  ? 88  PHE A O    1  
ATOM 1308  C CB   . PHE A 1 88  ? 16.015  -0.913  -2.293  1.00 0.21  ? 88  PHE A CB   1  
ATOM 1309  C CG   . PHE A 1 88  ? 14.717  -0.221  -1.998  1.00 0.18  ? 88  PHE A CG   1  
ATOM 1310  C CD1  . PHE A 1 88  ? 14.229  -0.154  -0.702  1.00 0.19  ? 88  PHE A CD1  1  
ATOM 1311  C CD2  . PHE A 1 88  ? 13.973  0.343   -3.022  1.00 0.17  ? 88  PHE A CD2  1  
ATOM 1312  C CE1  . PHE A 1 88  ? 13.028  0.470   -0.433  1.00 0.17  ? 88  PHE A CE1  1  
ATOM 1313  C CE2  . PHE A 1 88  ? 12.770  0.964   -2.763  1.00 0.16  ? 88  PHE A CE2  1  
ATOM 1314  C CZ   . PHE A 1 88  ? 12.294  1.028   -1.468  1.00 0.15  ? 88  PHE A CZ   1  
ATOM 1315  H H    . PHE A 1 88  ? 16.964  1.163   -0.406  1.00 0.18  ? 88  PHE A H    1  
ATOM 1316  H HA   . PHE A 1 88  ? 18.103  -0.554  -2.486  1.00 0.21  ? 88  PHE A HA   1  
ATOM 1317  H HB2  . PHE A 1 88  ? 15.968  -1.293  -3.302  1.00 0.25  ? 88  PHE A HB2  1  
ATOM 1318  H HB3  . PHE A 1 88  ? 16.114  -1.739  -1.608  1.00 0.24  ? 88  PHE A HB3  1  
ATOM 1319  H HD1  . PHE A 1 88  ? 14.800  -0.591  0.104   1.00 0.21  ? 88  PHE A HD1  1  
ATOM 1320  H HD2  . PHE A 1 88  ? 14.348  0.297   -4.034  1.00 0.18  ? 88  PHE A HD2  1  
ATOM 1321  H HE1  . PHE A 1 88  ? 12.667  0.520   0.585   1.00 0.19  ? 88  PHE A HE1  1  
ATOM 1322  H HE2  . PHE A 1 88  ? 12.201  1.400   -3.575  1.00 0.16  ? 88  PHE A HE2  1  
ATOM 1323  H HZ   . PHE A 1 88  ? 11.349  1.505   -1.268  1.00 0.15  ? 88  PHE A HZ   1  
ATOM 1324  N N    . THR A 1 89  ? 17.284  1.014   -4.329  1.00 0.23  ? 89  THR A N    1  
ATOM 1325  C CA   . THR A 1 89  ? 17.149  2.083   -5.298  1.00 0.25  ? 89  THR A CA   1  
ATOM 1326  C C    . THR A 1 89  ? 15.677  2.310   -5.639  1.00 0.21  ? 89  THR A C    1  
ATOM 1327  O O    . THR A 1 89  ? 15.056  1.489   -6.320  1.00 0.22  ? 89  THR A O    1  
ATOM 1328  C CB   . THR A 1 89  ? 17.922  1.755   -6.587  1.00 0.33  ? 89  THR A CB   1  
ATOM 1329  O OG1  . THR A 1 89  ? 19.197  1.176   -6.259  1.00 0.42  ? 89  THR A OG1  1  
ATOM 1330  C CG2  . THR A 1 89  ? 18.130  3.009   -7.427  1.00 0.37  ? 89  THR A CG2  1  
ATOM 1331  H H    . THR A 1 89  ? 17.536  0.111   -4.639  1.00 0.28  ? 89  THR A H    1  
ATOM 1332  H HA   . THR A 1 89  ? 17.561  2.987   -4.867  1.00 0.26  ? 89  THR A HA   1  
ATOM 1333  H HB   . THR A 1 89  ? 17.347  1.043   -7.165  1.00 0.33  ? 89  THR A HB   1  
ATOM 1334  H HG1  . THR A 1 89  ? 19.090  0.557   -5.525  1.00 0.78  ? 89  THR A HG1  1  
ATOM 1335  H HG21 . THR A 1 89  ? 18.675  3.741   -6.850  1.00 1.05  ? 89  THR A HG21 1  
ATOM 1336  H HG22 . THR A 1 89  ? 17.171  3.415   -7.712  1.00 1.02  ? 89  THR A HG22 1  
ATOM 1337  H HG23 . THR A 1 89  ? 18.692  2.758   -8.313  1.00 1.07  ? 89  THR A HG23 1  
ATOM 1338  N N    . LEU A 1 90  ? 15.120  3.408   -5.136  1.00 0.19  ? 90  LEU A N    1  
ATOM 1339  C CA   . LEU A 1 90  ? 13.725  3.754   -5.386  1.00 0.16  ? 90  LEU A CA   1  
ATOM 1340  C C    . LEU A 1 90  ? 13.471  3.900   -6.880  1.00 0.15  ? 90  LEU A C    1  
ATOM 1341  O O    . LEU A 1 90  ? 14.269  4.499   -7.589  1.00 0.18  ? 90  LEU A O    1  
ATOM 1342  C CB   . LEU A 1 90  ? 13.371  5.066   -4.683  1.00 0.16  ? 90  LEU A CB   1  
ATOM 1343  C CG   . LEU A 1 90  ? 11.880  5.317   -4.512  1.00 0.34  ? 90  LEU A CG   1  
ATOM 1344  C CD1  . LEU A 1 90  ? 11.219  4.115   -3.857  1.00 0.60  ? 90  LEU A CD1  1  
ATOM 1345  C CD2  . LEU A 1 90  ? 11.646  6.570   -3.685  1.00 0.60  ? 90  LEU A CD2  1  
ATOM 1346  H H    . LEU A 1 90  ? 15.664  4.003   -4.574  1.00 0.20  ? 90  LEU A H    1  
ATOM 1347  H HA   . LEU A 1 90  ? 13.095  2.966   -4.994  1.00 0.17  ? 90  LEU A HA   1  
ATOM 1348  H HB2  . LEU A 1 90  ? 13.830  5.080   -3.719  1.00 0.37  ? 90  LEU A HB2  1  
ATOM 1349  H HB3  . LEU A 1 90  ? 13.782  5.878   -5.258  1.00 0.39  ? 90  LEU A HB3  1  
ATOM 1350  H HG   . LEU A 1 90  ? 11.433  5.462   -5.483  1.00 0.78  ? 90  LEU A HG   1  
ATOM 1351  H HD11 . LEU A 1 90  ? 11.637  3.963   -2.872  1.00 1.17  ? 90  LEU A HD11 1  
ATOM 1352  H HD12 . LEU A 1 90  ? 11.394  3.235   -4.460  1.00 1.31  ? 90  LEU A HD12 1  
ATOM 1353  H HD13 . LEU A 1 90  ? 10.159  4.290   -3.775  1.00 1.19  ? 90  LEU A HD13 1  
ATOM 1354  H HD21 . LEU A 1 90  ? 10.584  6.727   -3.568  1.00 1.19  ? 90  LEU A HD21 1  
ATOM 1355  H HD22 . LEU A 1 90  ? 12.083  7.420   -4.186  1.00 1.33  ? 90  LEU A HD22 1  
ATOM 1356  H HD23 . LEU A 1 90  ? 12.101  6.450   -2.714  1.00 1.18  ? 90  LEU A HD23 1  
ATOM 1357  N N    . GLY A 1 91  ? 12.388  3.323   -7.361  1.00 0.20  ? 91  GLY A N    1  
ATOM 1358  C CA   . GLY A 1 91  ? 11.991  3.522   -8.740  1.00 0.23  ? 91  GLY A CA   1  
ATOM 1359  C C    . GLY A 1 91  ? 12.733  2.641   -9.705  1.00 0.26  ? 91  GLY A C    1  
ATOM 1360  O O    . GLY A 1 91  ? 12.411  2.601   -10.890 1.00 0.37  ? 91  GLY A O    1  
ATOM 1361  H H    . GLY A 1 91  ? 11.858  2.725   -6.784  1.00 0.24  ? 91  GLY A H    1  
ATOM 1362  H HA2  . GLY A 1 91  ? 10.935  3.322   -8.831  1.00 0.26  ? 91  GLY A HA2  1  
ATOM 1363  H HA3  . GLY A 1 91  ? 12.171  4.554   -9.002  1.00 0.24  ? 91  GLY A HA3  1  
ATOM 1364  N N    . ASP A 1 92  ? 13.703  1.907   -9.203  1.00 0.27  ? 92  ASP A N    1  
ATOM 1365  C CA   . ASP A 1 92  ? 14.520  1.080   -10.063 1.00 0.32  ? 92  ASP A CA   1  
ATOM 1366  C C    . ASP A 1 92  ? 14.139  -0.362  -9.844  1.00 0.30  ? 92  ASP A C    1  
ATOM 1367  O O    . ASP A 1 92  ? 14.835  -1.289  -10.265 1.00 0.37  ? 92  ASP A O    1  
ATOM 1368  C CB   . ASP A 1 92  ? 16.012  1.357   -9.817  1.00 0.42  ? 92  ASP A CB   1  
ATOM 1369  C CG   . ASP A 1 92  ? 16.925  0.677   -10.824 1.00 0.59  ? 92  ASP A CG   1  
ATOM 1370  O OD1  . ASP A 1 92  ? 16.708  0.845   -12.044 1.00 0.93  ? 92  ASP A OD1  1  
ATOM 1371  O OD2  . ASP A 1 92  ? 17.876  -0.015  -10.398 1.00 0.82  ? 92  ASP A OD2  1  
ATOM 1372  H H    . ASP A 1 92  ? 13.858  1.903   -8.227  1.00 0.29  ? 92  ASP A H    1  
ATOM 1373  H HA   . ASP A 1 92  ? 14.277  1.331   -11.076 1.00 0.38  ? 92  ASP A HA   1  
ATOM 1374  H HB2  . ASP A 1 92  ? 16.184  2.422   -9.881  1.00 0.47  ? 92  ASP A HB2  1  
ATOM 1375  H HB3  . ASP A 1 92  ? 16.280  1.022   -8.828  1.00 0.43  ? 92  ASP A HB3  1  
ATOM 1376  N N    . CYS A 1 93  ? 12.974  -0.529  -9.205  1.00 0.28  ? 93  CYS A N    1  
ATOM 1377  C CA   . CYS A 1 93  ? 12.399  -1.838  -8.961  1.00 0.27  ? 93  CYS A CA   1  
ATOM 1378  C C    . CYS A 1 93  ? 13.415  -2.718  -8.260  1.00 0.26  ? 93  CYS A C    1  
ATOM 1379  O O    . CYS A 1 93  ? 13.520  -3.918  -8.532  1.00 0.31  ? 93  CYS A O    1  
ATOM 1380  C CB   . CYS A 1 93  ? 11.959  -2.468  -10.279 1.00 0.38  ? 93  CYS A CB   1  
ATOM 1381  S SG   . CYS A 1 93  ? 10.933  -1.380  -11.299 1.00 0.62  ? 93  CYS A SG   1  
ATOM 1382  H H    . CYS A 1 93  ? 12.490  0.268   -8.877  1.00 0.30  ? 93  CYS A H    1  
ATOM 1383  H HA   . CYS A 1 93  ? 11.540  -1.711  -8.321  1.00 0.26  ? 93  CYS A HA   1  
ATOM 1384  H HB2  . CYS A 1 93  ? 12.835  -2.730  -10.852 1.00 0.68  ? 93  CYS A HB2  1  
ATOM 1385  H HB3  . CYS A 1 93  ? 11.386  -3.362  -10.065 1.00 0.47  ? 93  CYS A HB3  1  
ATOM 1386  H HG   . CYS A 1 93  ? 11.392  -0.144  -11.166 1.00 1.55  ? 93  CYS A HG   1  
ATOM 1387  N N    . ASP A 1 94  ? 14.145  -2.107  -7.331  1.00 0.27  ? 94  ASP A N    1  
ATOM 1388  C CA   . ASP A 1 94  ? 15.177  -2.802  -6.591  1.00 0.33  ? 94  ASP A CA   1  
ATOM 1389  C C    . ASP A 1 94  ? 14.506  -3.671  -5.529  1.00 0.33  ? 94  ASP A C    1  
ATOM 1390  O O    . ASP A 1 94  ? 15.142  -4.422  -4.788  1.00 0.48  ? 94  ASP A O    1  
ATOM 1391  C CB   . ASP A 1 94  ? 16.111  -1.771  -5.951  1.00 0.41  ? 94  ASP A CB   1  
ATOM 1392  C CG   . ASP A 1 94  ? 17.443  -2.339  -5.494  1.00 0.65  ? 94  ASP A CG   1  
ATOM 1393  O OD1  . ASP A 1 94  ? 17.788  -3.473  -5.887  1.00 0.96  ? 94  ASP A OD1  1  
ATOM 1394  O OD2  . ASP A 1 94  ? 18.166  -1.631  -4.763  1.00 1.33  ? 94  ASP A OD2  1  
ATOM 1395  H H    . ASP A 1 94  ? 13.976  -1.161  -7.127  1.00 0.28  ? 94  ASP A H    1  
ATOM 1396  H HA   . ASP A 1 94  ? 15.730  -3.411  -7.287  1.00 0.37  ? 94  ASP A HA   1  
ATOM 1397  H HB2  . ASP A 1 94  ? 16.309  -0.991  -6.669  1.00 0.64  ? 94  ASP A HB2  1  
ATOM 1398  H HB3  . ASP A 1 94  ? 15.614  -1.340  -5.093  1.00 0.46  ? 94  ASP A HB3  1  
ATOM 1399  N N    . VAL A 1 95  ? 13.183  -3.544  -5.494  1.00 0.23  ? 95  VAL A N    1  
ATOM 1400  C CA   . VAL A 1 95  ? 12.331  -4.209  -4.519  1.00 0.21  ? 95  VAL A CA   1  
ATOM 1401  C C    . VAL A 1 95  ? 11.057  -4.711  -5.172  1.00 0.20  ? 95  VAL A C    1  
ATOM 1402  O O    . VAL A 1 95  ? 11.005  -4.906  -6.387  1.00 0.22  ? 95  VAL A O    1  
ATOM 1403  C CB   . VAL A 1 95  ? 11.934  -3.244  -3.396  1.00 0.20  ? 95  VAL A CB   1  
ATOM 1404  C CG1  . VAL A 1 95  ? 13.103  -3.008  -2.477  1.00 0.23  ? 95  VAL A CG1  1  
ATOM 1405  C CG2  . VAL A 1 95  ? 11.431  -1.931  -3.986  1.00 0.19  ? 95  VAL A CG2  1  
ATOM 1406  H H    . VAL A 1 95  ? 12.759  -2.974  -6.172  1.00 0.25  ? 95  VAL A H    1  
ATOM 1407  H HA   . VAL A 1 95  ? 12.872  -5.039  -4.090  1.00 0.23  ? 95  VAL A HA   1  
ATOM 1408  H HB   . VAL A 1 95  ? 11.133  -3.687  -2.825  1.00 0.20  ? 95  VAL A HB   1  
ATOM 1409  H HG11 . VAL A 1 95  ? 13.929  -2.610  -3.051  1.00 0.99  ? 95  VAL A HG11 1  
ATOM 1410  H HG12 . VAL A 1 95  ? 13.394  -3.941  -2.021  1.00 1.04  ? 95  VAL A HG12 1  
ATOM 1411  H HG13 . VAL A 1 95  ? 12.821  -2.301  -1.714  1.00 0.98  ? 95  VAL A HG13 1  
ATOM 1412  H HG21 . VAL A 1 95  ? 10.532  -2.115  -4.555  1.00 1.08  ? 95  VAL A HG21 1  
ATOM 1413  H HG22 . VAL A 1 95  ? 12.190  -1.512  -4.639  1.00 1.02  ? 95  VAL A HG22 1  
ATOM 1414  H HG23 . VAL A 1 95  ? 11.219  -1.236  -3.189  1.00 1.01  ? 95  VAL A HG23 1  
ATOM 1415  N N    . ILE A 1 96  ? 10.021  -4.898  -4.361  1.00 0.19  ? 96  ILE A N    1  
ATOM 1416  C CA   . ILE A 1 96  ? 8.718   -5.229  -4.867  1.00 0.19  ? 96  ILE A CA   1  
ATOM 1417  C C    . ILE A 1 96  ? 8.048   -3.937  -5.284  1.00 0.16  ? 96  ILE A C    1  
ATOM 1418  O O    . ILE A 1 96  ? 8.185   -2.916  -4.608  1.00 0.15  ? 96  ILE A O    1  
ATOM 1419  C CB   . ILE A 1 96  ? 7.863   -5.973  -3.817  1.00 0.22  ? 96  ILE A CB   1  
ATOM 1420  C CG1  . ILE A 1 96  ? 7.673   -5.117  -2.562  1.00 0.25  ? 96  ILE A CG1  1  
ATOM 1421  C CG2  . ILE A 1 96  ? 8.518   -7.303  -3.455  1.00 0.26  ? 96  ILE A CG2  1  
ATOM 1422  C CD1  . ILE A 1 96  ? 6.790   -5.757  -1.512  1.00 0.29  ? 96  ILE A CD1  1  
ATOM 1423  H H    . ILE A 1 96  ? 10.126  -4.761  -3.404  1.00 0.21  ? 96  ILE A H    1  
ATOM 1424  H HA   . ILE A 1 96  ? 8.840   -5.861  -5.734  1.00 0.21  ? 96  ILE A HA   1  
ATOM 1425  H HB   . ILE A 1 96  ? 6.896   -6.183  -4.254  1.00 0.22  ? 96  ILE A HB   1  
ATOM 1426  H HG12 . ILE A 1 96  ? 8.637   -4.934  -2.113  1.00 0.27  ? 96  ILE A HG12 1  
ATOM 1427  H HG13 . ILE A 1 96  ? 7.225   -4.174  -2.842  1.00 0.24  ? 96  ILE A HG13 1  
ATOM 1428  H HG21 . ILE A 1 96  ? 8.653   -7.895  -4.349  1.00 1.03  ? 96  ILE A HG21 1  
ATOM 1429  H HG22 . ILE A 1 96  ? 7.887   -7.839  -2.762  1.00 1.06  ? 96  ILE A HG22 1  
ATOM 1430  H HG23 . ILE A 1 96  ? 9.478   -7.117  -2.998  1.00 1.05  ? 96  ILE A HG23 1  
ATOM 1431  H HD11 . ILE A 1 96  ? 6.705   -5.096  -0.662  1.00 1.00  ? 96  ILE A HD11 1  
ATOM 1432  H HD12 . ILE A 1 96  ? 7.227   -6.694  -1.196  1.00 1.02  ? 96  ILE A HD12 1  
ATOM 1433  H HD13 . ILE A 1 96  ? 5.810   -5.937  -1.926  1.00 0.98  ? 96  ILE A HD13 1  
ATOM 1434  N N    . GLN A 1 97  ? 7.362   -3.971  -6.403  1.00 0.17  ? 97  GLN A N    1  
ATOM 1435  C CA   . GLN A 1 97  ? 6.827   -2.753  -6.996  1.00 0.17  ? 97  GLN A CA   1  
ATOM 1436  C C    . GLN A 1 97  ? 5.881   -2.039  -6.035  1.00 0.16  ? 97  GLN A C    1  
ATOM 1437  O O    . GLN A 1 97  ? 5.798   -0.812  -6.043  1.00 0.16  ? 97  GLN A O    1  
ATOM 1438  C CB   . GLN A 1 97  ? 6.113   -3.038  -8.312  1.00 0.19  ? 97  GLN A CB   1  
ATOM 1439  C CG   . GLN A 1 97  ? 6.059   -1.818  -9.213  1.00 0.25  ? 97  GLN A CG   1  
ATOM 1440  C CD   . GLN A 1 97  ? 7.399   -1.523  -9.860  1.00 0.31  ? 97  GLN A CD   1  
ATOM 1441  O OE1  . GLN A 1 97  ? 7.663   -1.963  -10.975 1.00 0.40  ? 97  GLN A OE1  1  
ATOM 1442  N NE2  . GLN A 1 97  ? 8.274   -0.822  -9.148  1.00 0.32  ? 97  GLN A NE2  1  
ATOM 1443  H H    . GLN A 1 97  ? 7.222   -4.829  -6.844  1.00 0.19  ? 97  GLN A H    1  
ATOM 1444  H HA   . GLN A 1 97  ? 7.665   -2.101  -7.191  1.00 0.17  ? 97  GLN A HA   1  
ATOM 1445  H HB2  . GLN A 1 97  ? 6.636   -3.826  -8.830  1.00 0.23  ? 97  GLN A HB2  1  
ATOM 1446  H HB3  . GLN A 1 97  ? 5.102   -3.356  -8.104  1.00 0.21  ? 97  GLN A HB3  1  
ATOM 1447  H HG2  . GLN A 1 97  ? 5.329   -1.990  -9.991  1.00 0.29  ? 97  GLN A HG2  1  
ATOM 1448  H HG3  . GLN A 1 97  ? 5.765   -0.963  -8.625  1.00 0.29  ? 97  GLN A HG3  1  
ATOM 1449  H HE21 . GLN A 1 97  ? 8.022   -0.530  -8.244  1.00 0.29  ? 97  GLN A HE21 1  
ATOM 1450  H HE22 . GLN A 1 97  ? 9.141   -0.621  -9.556  1.00 0.39  ? 97  GLN A HE22 1  
ATOM 1451  N N    . ALA A 1 98  ? 5.189   -2.811  -5.200  1.00 0.17  ? 98  ALA A N    1  
ATOM 1452  C CA   . ALA A 1 98  ? 4.318   -2.247  -4.174  1.00 0.18  ? 98  ALA A CA   1  
ATOM 1453  C C    . ALA A 1 98  ? 5.096   -1.301  -3.278  1.00 0.17  ? 98  ALA A C    1  
ATOM 1454  O O    . ALA A 1 98  ? 4.648   -0.198  -2.970  1.00 0.20  ? 98  ALA A O    1  
ATOM 1455  C CB   . ALA A 1 98  ? 3.709   -3.361  -3.343  1.00 0.20  ? 98  ALA A CB   1  
ATOM 1456  H H    . ALA A 1 98  ? 5.269   -3.787  -5.273  1.00 0.18  ? 98  ALA A H    1  
ATOM 1457  H HA   . ALA A 1 98  ? 3.519   -1.701  -4.660  1.00 0.19  ? 98  ALA A HA   1  
ATOM 1458  H HB1  . ALA A 1 98  ? 3.081   -2.938  -2.573  1.00 1.08  ? 98  ALA A HB1  1  
ATOM 1459  H HB2  . ALA A 1 98  ? 4.497   -3.942  -2.886  1.00 1.01  ? 98  ALA A HB2  1  
ATOM 1460  H HB3  . ALA A 1 98  ? 3.115   -4.000  -3.978  1.00 1.00  ? 98  ALA A HB3  1  
ATOM 1461  N N    . LEU A 1 99  ? 6.285   -1.734  -2.896  1.00 0.17  ? 99  LEU A N    1  
ATOM 1462  C CA   . LEU A 1 99  ? 7.130   -0.951  -2.008  1.00 0.17  ? 99  LEU A CA   1  
ATOM 1463  C C    . LEU A 1 99  ? 7.764   0.204   -2.758  1.00 0.15  ? 99  LEU A C    1  
ATOM 1464  O O    . LEU A 1 99  ? 7.891   1.310   -2.239  1.00 0.15  ? 99  LEU A O    1  
ATOM 1465  C CB   . LEU A 1 99  ? 8.234   -1.802  -1.395  1.00 0.19  ? 99  LEU A CB   1  
ATOM 1466  C CG   . LEU A 1 99  ? 9.144   -1.037  -0.427  1.00 0.18  ? 99  LEU A CG   1  
ATOM 1467  C CD1  . LEU A 1 99  ? 8.335   -0.443  0.718   1.00 0.21  ? 99  LEU A CD1  1  
ATOM 1468  C CD2  . LEU A 1 99  ? 10.251  -1.926  0.108   1.00 0.22  ? 99  LEU A CD2  1  
ATOM 1469  H H    . LEU A 1 99  ? 6.607   -2.596  -3.241  1.00 0.19  ? 99  LEU A H    1  
ATOM 1470  H HA   . LEU A 1 99  ? 6.512   -0.562  -1.219  1.00 0.17  ? 99  LEU A HA   1  
ATOM 1471  H HB2  . LEU A 1 99  ? 7.781   -2.632  -0.868  1.00 0.23  ? 99  LEU A HB2  1  
ATOM 1472  H HB3  . LEU A 1 99  ? 8.843   -2.190  -2.202  1.00 0.21  ? 99  LEU A HB3  1  
ATOM 1473  H HG   . LEU A 1 99  ? 9.604   -0.218  -0.961  1.00 0.15  ? 99  LEU A HG   1  
ATOM 1474  H HD11 . LEU A 1 99  ? 7.847   -1.235  1.266   1.00 1.03  ? 99  LEU A HD11 1  
ATOM 1475  H HD12 . LEU A 1 99  ? 7.592   0.232   0.319   1.00 1.02  ? 99  LEU A HD12 1  
ATOM 1476  H HD13 . LEU A 1 99  ? 8.994   0.100   1.380   1.00 1.06  ? 99  LEU A HD13 1  
ATOM 1477  H HD21 . LEU A 1 99  ? 9.822   -2.761  0.641   1.00 0.97  ? 99  LEU A HD21 1  
ATOM 1478  H HD22 . LEU A 1 99  ? 10.871  -1.348  0.780   1.00 1.01  ? 99  LEU A HD22 1  
ATOM 1479  H HD23 . LEU A 1 99  ? 10.850  -2.287  -0.713  1.00 1.07  ? 99  LEU A HD23 1  
ATOM 1480  N N    . ASP A 1 100 ? 8.135   -0.071  -3.993  1.00 0.15  ? 100 ASP A N    1  
ATOM 1481  C CA   . ASP A 1 100 ? 8.849   0.881   -4.822  1.00 0.16  ? 100 ASP A CA   1  
ATOM 1482  C C    . ASP A 1 100 ? 7.998   2.121   -5.034  1.00 0.15  ? 100 ASP A C    1  
ATOM 1483  O O    . ASP A 1 100 ? 8.507   3.225   -5.217  1.00 0.16  ? 100 ASP A O    1  
ATOM 1484  C CB   . ASP A 1 100 ? 9.188   0.215   -6.157  1.00 0.17  ? 100 ASP A CB   1  
ATOM 1485  C CG   . ASP A 1 100 ? 9.976   1.103   -7.098  1.00 0.20  ? 100 ASP A CG   1  
ATOM 1486  O OD1  . ASP A 1 100 ? 9.362   1.923   -7.819  1.00 0.26  ? 100 ASP A OD1  1  
ATOM 1487  O OD2  . ASP A 1 100 ? 11.214  0.962   -7.137  1.00 0.21  ? 100 ASP A OD2  1  
ATOM 1488  H H    . ASP A 1 100 ? 7.900   -0.943  -4.372  1.00 0.16  ? 100 ASP A H    1  
ATOM 1489  H HA   . ASP A 1 100 ? 9.762   1.156   -4.314  1.00 0.16  ? 100 ASP A HA   1  
ATOM 1490  H HB2  . ASP A 1 100 ? 9.774   -0.671  -5.963  1.00 0.19  ? 100 ASP A HB2  1  
ATOM 1491  H HB3  . ASP A 1 100 ? 8.272   -0.074  -6.644  1.00 0.16  ? 100 ASP A HB3  1  
ATOM 1492  N N    . LEU A 1 101 ? 6.690   1.916   -5.021  1.00 0.16  ? 101 LEU A N    1  
ATOM 1493  C CA   . LEU A 1 101 ? 5.733   2.997   -5.128  1.00 0.16  ? 101 LEU A CA   1  
ATOM 1494  C C    . LEU A 1 101 ? 5.337   3.550   -3.755  1.00 0.15  ? 101 LEU A C    1  
ATOM 1495  O O    . LEU A 1 101 ? 5.127   4.753   -3.598  1.00 0.16  ? 101 LEU A O    1  
ATOM 1496  C CB   . LEU A 1 101 ? 4.493   2.495   -5.863  1.00 0.19  ? 101 LEU A CB   1  
ATOM 1497  C CG   . LEU A 1 101 ? 4.752   1.880   -7.243  1.00 0.22  ? 101 LEU A CG   1  
ATOM 1498  C CD1  . LEU A 1 101 ? 3.450   1.402   -7.865  1.00 0.25  ? 101 LEU A CD1  1  
ATOM 1499  C CD2  . LEU A 1 101 ? 5.460   2.865   -8.163  1.00 0.25  ? 101 LEU A CD2  1  
ATOM 1500  H H    . LEU A 1 101 ? 6.355   0.999   -4.951  1.00 0.16  ? 101 LEU A H    1  
ATOM 1501  H HA   . LEU A 1 101 ? 6.192   3.791   -5.699  1.00 0.17  ? 101 LEU A HA   1  
ATOM 1502  H HB2  . LEU A 1 101 ? 4.014   1.748   -5.246  1.00 0.20  ? 101 LEU A HB2  1  
ATOM 1503  H HB3  . LEU A 1 101 ? 3.819   3.316   -5.981  1.00 0.19  ? 101 LEU A HB3  1  
ATOM 1504  H HG   . LEU A 1 101 ? 5.389   1.017   -7.125  1.00 0.23  ? 101 LEU A HG   1  
ATOM 1505  H HD11 . LEU A 1 101 ? 3.650   0.983   -8.839  1.00 0.87  ? 101 LEU A HD11 1  
ATOM 1506  H HD12 . LEU A 1 101 ? 2.768   2.234   -7.962  1.00 1.03  ? 101 LEU A HD12 1  
ATOM 1507  H HD13 . LEU A 1 101 ? 3.007   0.647   -7.233  1.00 1.01  ? 101 LEU A HD13 1  
ATOM 1508  H HD21 . LEU A 1 101 ? 4.867   3.761   -8.262  1.00 1.01  ? 101 LEU A HD21 1  
ATOM 1509  H HD22 . LEU A 1 101 ? 5.597   2.415   -9.136  1.00 1.02  ? 101 LEU A HD22 1  
ATOM 1510  H HD23 . LEU A 1 101 ? 6.424   3.114   -7.746  1.00 1.06  ? 101 LEU A HD23 1  
ATOM 1511  N N    . SER A 1 102 ? 5.243   2.671   -2.762  1.00 0.15  ? 102 SER A N    1  
ATOM 1512  C CA   . SER A 1 102 ? 4.751   3.051   -1.447  1.00 0.17  ? 102 SER A CA   1  
ATOM 1513  C C    . SER A 1 102 ? 5.688   4.046   -0.775  1.00 0.15  ? 102 SER A C    1  
ATOM 1514  O O    . SER A 1 102 ? 5.248   4.890   -0.005  1.00 0.18  ? 102 SER A O    1  
ATOM 1515  C CB   . SER A 1 102 ? 4.579   1.814   -0.567  1.00 0.23  ? 102 SER A CB   1  
ATOM 1516  O OG   . SER A 1 102 ? 4.092   2.160   0.717   1.00 1.01  ? 102 SER A OG   1  
ATOM 1517  H H    . SER A 1 102 ? 5.511   1.745   -2.914  1.00 0.15  ? 102 SER A H    1  
ATOM 1518  H HA   . SER A 1 102 ? 3.786   3.516   -1.583  1.00 0.20  ? 102 SER A HA   1  
ATOM 1519  H HB2  . SER A 1 102 ? 3.875   1.141   -1.035  1.00 0.79  ? 102 SER A HB2  1  
ATOM 1520  H HB3  . SER A 1 102 ? 5.532   1.320   -0.455  1.00 1.05  ? 102 SER A HB3  1  
ATOM 1521  H HG   . SER A 1 102 ? 4.792   2.592   1.220   1.00 1.53  ? 102 SER A HG   1  
ATOM 1522  N N    . VAL A 1 103 ? 6.973   3.944   -1.078  1.00 0.15  ? 103 VAL A N    1  
ATOM 1523  C CA   . VAL A 1 103 ? 7.973   4.838   -0.507  1.00 0.16  ? 103 VAL A CA   1  
ATOM 1524  C C    . VAL A 1 103 ? 7.776   6.282   -0.968  1.00 0.16  ? 103 VAL A C    1  
ATOM 1525  O O    . VAL A 1 103 ? 7.715   7.176   -0.143  1.00 0.18  ? 103 VAL A O    1  
ATOM 1526  C CB   . VAL A 1 103 ? 9.383   4.381   -0.862  1.00 0.18  ? 103 VAL A CB   1  
ATOM 1527  C CG1  . VAL A 1 103 ? 10.429  5.386   -0.392  1.00 0.21  ? 103 VAL A CG1  1  
ATOM 1528  C CG2  . VAL A 1 103 ? 9.643   3.019   -0.263  1.00 0.19  ? 103 VAL A CG2  1  
ATOM 1529  H H    . VAL A 1 103 ? 7.258   3.245   -1.704  1.00 0.15  ? 103 VAL A H    1  
ATOM 1530  H HA   . VAL A 1 103 ? 7.873   4.796   0.568   1.00 0.17  ? 103 VAL A HA   1  
ATOM 1531  H HB   . VAL A 1 103 ? 9.430   4.298   -1.938  1.00 0.18  ? 103 VAL A HB   1  
ATOM 1532  H HG11 . VAL A 1 103 ? 11.406  5.063   -0.714  1.00 1.02  ? 103 VAL A HG11 1  
ATOM 1533  H HG12 . VAL A 1 103 ? 10.409  5.453   0.687   1.00 1.06  ? 103 VAL A HG12 1  
ATOM 1534  H HG13 . VAL A 1 103 ? 10.214  6.355   -0.816  1.00 1.00  ? 103 VAL A HG13 1  
ATOM 1535  H HG21 . VAL A 1 103 ? 9.185   2.265   -0.885  1.00 1.03  ? 103 VAL A HG21 1  
ATOM 1536  H HG22 . VAL A 1 103 ? 9.215   2.977   0.728   1.00 1.00  ? 103 VAL A HG22 1  
ATOM 1537  H HG23 . VAL A 1 103 ? 10.706  2.854   -0.202  1.00 1.03  ? 103 VAL A HG23 1  
ATOM 1538  N N    . PRO A 1 104 ? 7.703   6.541   -2.291  1.00 0.17  ? 104 PRO A N    1  
ATOM 1539  C CA   . PRO A 1 104 ? 7.328   7.864   -2.805  1.00 0.21  ? 104 PRO A CA   1  
ATOM 1540  C C    . PRO A 1 104 ? 6.021   8.378   -2.210  1.00 0.19  ? 104 PRO A C    1  
ATOM 1541  O O    . PRO A 1 104 ? 5.800   9.585   -2.112  1.00 0.22  ? 104 PRO A O    1  
ATOM 1542  C CB   . PRO A 1 104 ? 7.109   7.612   -4.294  1.00 0.27  ? 104 PRO A CB   1  
ATOM 1543  C CG   . PRO A 1 104 ? 7.944   6.433   -4.639  1.00 0.21  ? 104 PRO A CG   1  
ATOM 1544  C CD   . PRO A 1 104 ? 8.108   5.625   -3.379  1.00 0.17  ? 104 PRO A CD   1  
ATOM 1545  H HA   . PRO A 1 104 ? 8.112   8.596   -2.656  1.00 0.24  ? 104 PRO A HA   1  
ATOM 1546  H HB2  . PRO A 1 104 ? 6.065   7.402   -4.460  1.00 0.38  ? 104 PRO A HB2  1  
ATOM 1547  H HB3  . PRO A 1 104 ? 7.398   8.484   -4.857  1.00 0.41  ? 104 PRO A HB3  1  
ATOM 1548  H HG2  . PRO A 1 104 ? 7.444   5.845   -5.394  1.00 0.31  ? 104 PRO A HG2  1  
ATOM 1549  H HG3  . PRO A 1 104 ? 8.905   6.759   -5.003  1.00 0.33  ? 104 PRO A HG3  1  
ATOM 1550  H HD2  . PRO A 1 104 ? 7.481   4.750   -3.409  1.00 0.16  ? 104 PRO A HD2  1  
ATOM 1551  H HD3  . PRO A 1 104 ? 9.145   5.334   -3.262  1.00 0.20  ? 104 PRO A HD3  1  
ATOM 1552  N N    . LEU A 1 105 ? 5.152   7.453   -1.847  1.00 0.18  ? 105 LEU A N    1  
ATOM 1553  C CA   . LEU A 1 105 ? 3.880   7.792   -1.231  1.00 0.19  ? 105 LEU A CA   1  
ATOM 1554  C C    . LEU A 1 105 ? 4.024   7.964   0.278   1.00 0.22  ? 105 LEU A C    1  
ATOM 1555  O O    . LEU A 1 105 ? 3.106   8.419   0.960   1.00 0.32  ? 105 LEU A O    1  
ATOM 1556  C CB   . LEU A 1 105 ? 2.872   6.705   -1.552  1.00 0.18  ? 105 LEU A CB   1  
ATOM 1557  C CG   . LEU A 1 105 ? 2.055   6.934   -2.827  1.00 0.25  ? 105 LEU A CG   1  
ATOM 1558  C CD1  . LEU A 1 105 ? 2.949   7.077   -4.052  1.00 0.53  ? 105 LEU A CD1  1  
ATOM 1559  C CD2  . LEU A 1 105 ? 1.073   5.803   -3.029  1.00 0.64  ? 105 LEU A CD2  1  
ATOM 1560  H H    . LEU A 1 105 ? 5.364   6.506   -2.017  1.00 0.18  ? 105 LEU A H    1  
ATOM 1561  H HA   . LEU A 1 105 ? 3.540   8.724   -1.659  1.00 0.22  ? 105 LEU A HA   1  
ATOM 1562  H HB2  . LEU A 1 105 ? 3.420   5.772   -1.658  1.00 0.15  ? 105 LEU A HB2  1  
ATOM 1563  H HB3  . LEU A 1 105 ? 2.189   6.616   -0.721  1.00 0.22  ? 105 LEU A HB3  1  
ATOM 1564  H HG   . LEU A 1 105 ? 1.494   7.848   -2.720  1.00 0.63  ? 105 LEU A HG   1  
ATOM 1565  H HD11 . LEU A 1 105 ? 3.629   7.903   -3.908  1.00 1.26  ? 105 LEU A HD11 1  
ATOM 1566  H HD12 . LEU A 1 105 ? 2.337   7.265   -4.923  1.00 1.14  ? 105 LEU A HD12 1  
ATOM 1567  H HD13 . LEU A 1 105 ? 3.512   6.168   -4.197  1.00 1.09  ? 105 LEU A HD13 1  
ATOM 1568  H HD21 . LEU A 1 105 ? 0.524   5.967   -3.943  1.00 1.17  ? 105 LEU A HD21 1  
ATOM 1569  H HD22 . LEU A 1 105 ? 0.389   5.769   -2.195  1.00 1.35  ? 105 LEU A HD22 1  
ATOM 1570  H HD23 . LEU A 1 105 ? 1.611   4.869   -3.095  1.00 1.29  ? 105 LEU A HD23 1  
ATOM 1571  N N    . MET A 1 106 ? 5.170   7.555   0.784   1.00 0.20  ? 106 MET A N    1  
ATOM 1572  C CA   . MET A 1 106 ? 5.520   7.700   2.186   1.00 0.24  ? 106 MET A CA   1  
ATOM 1573  C C    . MET A 1 106 ? 6.446   8.896   2.390   1.00 0.21  ? 106 MET A C    1  
ATOM 1574  O O    . MET A 1 106 ? 7.312   9.169   1.564   1.00 0.26  ? 106 MET A O    1  
ATOM 1575  C CB   . MET A 1 106 ? 6.218   6.419   2.661   1.00 0.33  ? 106 MET A CB   1  
ATOM 1576  C CG   . MET A 1 106 ? 5.372   5.530   3.543   1.00 0.53  ? 106 MET A CG   1  
ATOM 1577  S SD   . MET A 1 106 ? 5.702   3.777   3.280   1.00 0.78  ? 106 MET A SD   1  
ATOM 1578  C CE   . MET A 1 106 ? 7.401   3.679   3.824   1.00 0.54  ? 106 MET A CE   1  
ATOM 1579  H H    . MET A 1 106 ? 5.815   7.119   0.189   1.00 0.21  ? 106 MET A H    1  
ATOM 1580  H HA   . MET A 1 106 ? 4.615   7.847   2.751   1.00 0.30  ? 106 MET A HA   1  
ATOM 1581  H HB2  . MET A 1 106 ? 6.500   5.837   1.801   1.00 0.74  ? 106 MET A HB2  1  
ATOM 1582  H HB3  . MET A 1 106 ? 7.111   6.691   3.207   1.00 0.76  ? 106 MET A HB3  1  
ATOM 1583  H HG2  . MET A 1 106 ? 5.598   5.773   4.574   1.00 0.87  ? 106 MET A HG2  1  
ATOM 1584  H HG3  . MET A 1 106 ? 4.326   5.730   3.347   1.00 0.79  ? 106 MET A HG3  1  
ATOM 1585  H HE1  . MET A 1 106 ? 7.746   2.660   3.733   1.00 1.31  ? 106 MET A HE1  1  
ATOM 1586  H HE2  . MET A 1 106 ? 7.465   3.994   4.860   1.00 1.14  ? 106 MET A HE2  1  
ATOM 1587  H HE3  . MET A 1 106 ? 8.011   4.322   3.213   1.00 1.28  ? 106 MET A HE3  1  
ATOM 1588  N N    . ASP A 1 107 ? 6.262   9.620   3.482   1.00 0.18  ? 107 ASP A N    1  
ATOM 1589  C CA   . ASP A 1 107 ? 7.198   10.676  3.844   1.00 0.18  ? 107 ASP A CA   1  
ATOM 1590  C C    . ASP A 1 107 ? 8.292   10.083  4.708   1.00 0.14  ? 107 ASP A C    1  
ATOM 1591  O O    . ASP A 1 107 ? 8.100   9.032   5.328   1.00 0.13  ? 107 ASP A O    1  
ATOM 1592  C CB   . ASP A 1 107 ? 6.502   11.824  4.590   1.00 0.25  ? 107 ASP A CB   1  
ATOM 1593  C CG   . ASP A 1 107 ? 6.198   13.011  3.695   1.00 0.56  ? 107 ASP A CG   1  
ATOM 1594  O OD1  . ASP A 1 107 ? 7.084   13.880  3.523   1.00 0.97  ? 107 ASP A OD1  1  
ATOM 1595  O OD2  . ASP A 1 107 ? 5.072   13.086  3.159   1.00 0.92  ? 107 ASP A OD2  1  
ATOM 1596  H H    . ASP A 1 107 ? 5.491   9.432   4.071   1.00 0.20  ? 107 ASP A H    1  
ATOM 1597  H HA   . ASP A 1 107 ? 7.644   11.053  2.927   1.00 0.21  ? 107 ASP A HA   1  
ATOM 1598  H HB2  . ASP A 1 107 ? 5.571   11.463  5.001   1.00 0.58  ? 107 ASP A HB2  1  
ATOM 1599  H HB3  . ASP A 1 107 ? 7.139   12.159  5.396   1.00 0.60  ? 107 ASP A HB3  1  
ATOM 1600  N N    . VAL A 1 108 ? 9.445   10.725  4.750   1.00 0.16  ? 108 VAL A N    1  
ATOM 1601  C CA   . VAL A 1 108 ? 10.548  10.174  5.508   1.00 0.16  ? 108 VAL A CA   1  
ATOM 1602  C C    . VAL A 1 108 ? 10.221  10.171  7.003   1.00 0.15  ? 108 VAL A C    1  
ATOM 1603  O O    . VAL A 1 108 ? 9.806   11.176  7.581   1.00 0.19  ? 108 VAL A O    1  
ATOM 1604  C CB   . VAL A 1 108 ? 11.887  10.915  5.239   1.00 0.21  ? 108 VAL A CB   1  
ATOM 1605  C CG1  . VAL A 1 108 ? 12.061  12.149  6.116   1.00 0.68  ? 108 VAL A CG1  1  
ATOM 1606  C CG2  . VAL A 1 108 ? 13.064  9.965   5.415   1.00 0.80  ? 108 VAL A CG2  1  
ATOM 1607  H H    . VAL A 1 108 ? 9.557   11.561  4.252   1.00 0.20  ? 108 VAL A H    1  
ATOM 1608  H HA   . VAL A 1 108 ? 10.666  9.148   5.183   1.00 0.16  ? 108 VAL A HA   1  
ATOM 1609  H HB   . VAL A 1 108 ? 11.881  11.244  4.211   1.00 0.63  ? 108 VAL A HB   1  
ATOM 1610  H HG11 . VAL A 1 108 ? 12.482  11.854  7.067   1.00 1.22  ? 108 VAL A HG11 1  
ATOM 1611  H HG12 . VAL A 1 108 ? 11.099  12.610  6.282   1.00 1.47  ? 108 VAL A HG12 1  
ATOM 1612  H HG13 . VAL A 1 108 ? 12.722  12.850  5.630   1.00 1.26  ? 108 VAL A HG13 1  
ATOM 1613  H HG21 . VAL A 1 108 ? 13.058  9.566   6.419   1.00 1.43  ? 108 VAL A HG21 1  
ATOM 1614  H HG22 . VAL A 1 108 ? 13.985  10.502  5.244   1.00 1.43  ? 108 VAL A HG22 1  
ATOM 1615  H HG23 . VAL A 1 108 ? 12.981  9.155   4.705   1.00 1.25  ? 108 VAL A HG23 1  
ATOM 1616  N N    . GLY A 1 109 ? 10.353  9.013   7.604   1.00 0.15  ? 109 GLY A N    1  
ATOM 1617  C CA   . GLY A 1 109 ? 10.167  8.888   9.029   1.00 0.17  ? 109 GLY A CA   1  
ATOM 1618  C C    . GLY A 1 109 ? 8.837   8.260   9.380   1.00 0.18  ? 109 GLY A C    1  
ATOM 1619  O O    . GLY A 1 109 ? 8.544   8.032   10.554  1.00 0.28  ? 109 GLY A O    1  
ATOM 1620  H H    . GLY A 1 109 ? 10.556  8.216   7.068   1.00 0.16  ? 109 GLY A H    1  
ATOM 1621  H HA2  . GLY A 1 109 ? 10.959  8.275   9.431   1.00 0.18  ? 109 GLY A HA2  1  
ATOM 1622  H HA3  . GLY A 1 109 ? 10.219  9.870   9.479   1.00 0.18  ? 109 GLY A HA3  1  
ATOM 1623  N N    . GLU A 1 110 ? 8.023   7.961   8.374   1.00 0.13  ? 110 GLU A N    1  
ATOM 1624  C CA   . GLU A 1 110 ? 6.713   7.404   8.635   1.00 0.13  ? 110 GLU A CA   1  
ATOM 1625  C C    . GLU A 1 110 ? 6.733   5.896   8.512   1.00 0.10  ? 110 GLU A C    1  
ATOM 1626  O O    . GLU A 1 110 ? 7.706   5.299   8.038   1.00 0.12  ? 110 GLU A O    1  
ATOM 1627  C CB   . GLU A 1 110 ? 5.640   7.993   7.715   1.00 0.17  ? 110 GLU A CB   1  
ATOM 1628  C CG   . GLU A 1 110 ? 5.585   7.427   6.310   1.00 0.20  ? 110 GLU A CG   1  
ATOM 1629  C CD   . GLU A 1 110 ? 4.332   7.860   5.562   1.00 0.27  ? 110 GLU A CD   1  
ATOM 1630  O OE1  . GLU A 1 110 ? 4.235   9.046   5.195   1.00 0.41  ? 110 GLU A OE1  1  
ATOM 1631  O OE2  . GLU A 1 110 ? 3.449   7.005   5.310   1.00 0.39  ? 110 GLU A OE2  1  
ATOM 1632  H H    . GLU A 1 110 ? 8.313   8.099   7.446   1.00 0.13  ? 110 GLU A H    1  
ATOM 1633  H HA   . GLU A 1 110 ? 6.459   7.652   9.655   1.00 0.15  ? 110 GLU A HA   1  
ATOM 1634  H HB2  . GLU A 1 110 ? 4.675   7.819   8.172   1.00 0.18  ? 110 GLU A HB2  1  
ATOM 1635  H HB3  . GLU A 1 110 ? 5.799   9.059   7.642   1.00 0.23  ? 110 GLU A HB3  1  
ATOM 1636  H HG2  . GLU A 1 110 ? 6.447   7.773   5.764   1.00 0.25  ? 110 GLU A HG2  1  
ATOM 1637  H HG3  . GLU A 1 110 ? 5.598   6.351   6.366   1.00 0.20  ? 110 GLU A HG3  1  
ATOM 1638  N N    . THR A 1 111 ? 5.662   5.284   8.965   1.00 0.10  ? 111 THR A N    1  
ATOM 1639  C CA   . THR A 1 111 ? 5.515   3.863   8.873   1.00 0.11  ? 111 THR A CA   1  
ATOM 1640  C C    . THR A 1 111 ? 4.160   3.562   8.274   1.00 0.11  ? 111 THR A C    1  
ATOM 1641  O O    . THR A 1 111 ? 3.120   3.929   8.833   1.00 0.12  ? 111 THR A O    1  
ATOM 1642  C CB   . THR A 1 111 ? 5.665   3.195   10.250  1.00 0.16  ? 111 THR A CB   1  
ATOM 1643  O OG1  . THR A 1 111 ? 6.821   3.729   10.914  1.00 0.22  ? 111 THR A OG1  1  
ATOM 1644  C CG2  . THR A 1 111 ? 5.823   1.694   10.107  1.00 0.19  ? 111 THR A CG2  1  
ATOM 1645  H H    . THR A 1 111 ? 4.928   5.811   9.341   1.00 0.12  ? 111 THR A H    1  
ATOM 1646  H HA   . THR A 1 111 ? 6.282   3.489   8.218   1.00 0.14  ? 111 THR A HA   1  
ATOM 1647  H HB   . THR A 1 111 ? 4.784   3.400   10.836  1.00 0.17  ? 111 THR A HB   1  
ATOM 1648  H HG1  . THR A 1 111 ? 7.481   3.956   10.250  1.00 0.27  ? 111 THR A HG1  1  
ATOM 1649  H HG21 . THR A 1 111 ? 4.961   1.286   9.598   1.00 1.07  ? 111 THR A HG21 1  
ATOM 1650  H HG22 . THR A 1 111 ? 5.910   1.248   11.083  1.00 1.02  ? 111 THR A HG22 1  
ATOM 1651  H HG23 . THR A 1 111 ? 6.715   1.485   9.533   1.00 1.01  ? 111 THR A HG23 1  
ATOM 1652  N N    . ALA A 1 112 ? 4.170   2.941   7.115   1.00 0.12  ? 112 ALA A N    1  
ATOM 1653  C CA   . ALA A 1 112 ? 2.950   2.671   6.403   1.00 0.13  ? 112 ALA A CA   1  
ATOM 1654  C C    . ALA A 1 112 ? 2.718   1.178   6.305   1.00 0.12  ? 112 ALA A C    1  
ATOM 1655  O O    . ALA A 1 112 ? 3.638   0.408   6.030   1.00 0.13  ? 112 ALA A O    1  
ATOM 1656  C CB   . ALA A 1 112 ? 3.001   3.314   5.026   1.00 0.18  ? 112 ALA A CB   1  
ATOM 1657  H H    . ALA A 1 112 ? 5.026   2.648   6.726   1.00 0.14  ? 112 ALA A H    1  
ATOM 1658  H HA   . ALA A 1 112 ? 2.133   3.117   6.954   1.00 0.14  ? 112 ALA A HA   1  
ATOM 1659  H HB1  . ALA A 1 112 ? 2.056   3.175   4.525   1.00 1.00  ? 112 ALA A HB1  1  
ATOM 1660  H HB2  . ALA A 1 112 ? 3.790   2.858   4.443   1.00 0.96  ? 112 ALA A HB2  1  
ATOM 1661  H HB3  . ALA A 1 112 ? 3.205   4.374   5.128   1.00 0.95  ? 112 ALA A HB3  1  
ATOM 1662  N N    . MET A 1 113 ? 1.493   0.772   6.562   1.00 0.12  ? 113 MET A N    1  
ATOM 1663  C CA   . MET A 1 113 ? 1.102   -0.606  6.379   1.00 0.12  ? 113 MET A CA   1  
ATOM 1664  C C    . MET A 1 113 ? 0.431   -0.702  5.032   1.00 0.12  ? 113 MET A C    1  
ATOM 1665  O O    . MET A 1 113 ? -0.589  -0.060  4.798   1.00 0.14  ? 113 MET A O    1  
ATOM 1666  C CB   . MET A 1 113 ? 0.142   -1.056  7.485   1.00 0.16  ? 113 MET A CB   1  
ATOM 1667  C CG   . MET A 1 113 ? -0.678  -2.285  7.113   1.00 0.25  ? 113 MET A CG   1  
ATOM 1668  S SD   . MET A 1 113 ? -1.869  -2.744  8.383   1.00 0.53  ? 113 MET A SD   1  
ATOM 1669  C CE   . MET A 1 113 ? -0.837  -3.742  9.447   1.00 1.32  ? 113 MET A CE   1  
ATOM 1670  H H    . MET A 1 113 ? 0.817   1.430   6.848   1.00 0.13  ? 113 MET A H    1  
ATOM 1671  H HA   . MET A 1 113 ? 1.995   -1.224  6.391   1.00 0.13  ? 113 MET A HA   1  
ATOM 1672  H HB2  . MET A 1 113 ? 0.713   -1.284  8.373   1.00 0.19  ? 113 MET A HB2  1  
ATOM 1673  H HB3  . MET A 1 113 ? -0.541  -0.248  7.705   1.00 0.18  ? 113 MET A HB3  1  
ATOM 1674  H HG2  . MET A 1 113 ? -1.212  -2.085  6.199   1.00 0.27  ? 113 MET A HG2  1  
ATOM 1675  H HG3  . MET A 1 113 ? -0.002  -3.115  6.959   1.00 0.25  ? 113 MET A HG3  1  
ATOM 1676  H HE1  . MET A 1 113 ? -0.508  -4.618  8.904   1.00 1.94  ? 113 MET A HE1  1  
ATOM 1677  H HE2  . MET A 1 113 ? -1.401  -4.047  10.315  1.00 1.89  ? 113 MET A HE2  1  
ATOM 1678  H HE3  . MET A 1 113 ? 0.022   -3.166  9.755   1.00 1.90  ? 113 MET A HE3  1  
ATOM 1679  N N    . VAL A 1 114 ? 1.018   -1.463  4.144   1.00 0.12  ? 114 VAL A N    1  
ATOM 1680  C CA   . VAL A 1 114 ? 0.509   -1.570  2.797   1.00 0.12  ? 114 VAL A CA   1  
ATOM 1681  C C    . VAL A 1 114 ? 0.004   -2.964  2.559   1.00 0.13  ? 114 VAL A C    1  
ATOM 1682  O O    . VAL A 1 114 ? 0.688   -3.938  2.867   1.00 0.16  ? 114 VAL A O    1  
ATOM 1683  C CB   . VAL A 1 114 ? 1.609   -1.276  1.763   1.00 0.15  ? 114 VAL A CB   1  
ATOM 1684  C CG1  . VAL A 1 114 ? 1.031   -0.926  0.403   1.00 0.18  ? 114 VAL A CG1  1  
ATOM 1685  C CG2  . VAL A 1 114 ? 2.521   -0.183  2.269   1.00 0.17  ? 114 VAL A CG2  1  
ATOM 1686  H H    . VAL A 1 114 ? 1.833   -1.966  4.397   1.00 0.12  ? 114 VAL A H    1  
ATOM 1687  H HA   . VAL A 1 114 ? -0.298  -0.865  2.670   1.00 0.13  ? 114 VAL A HA   1  
ATOM 1688  H HB   . VAL A 1 114 ? 2.191   -2.168  1.648   1.00 0.16  ? 114 VAL A HB   1  
ATOM 1689  H HG11 . VAL A 1 114 ? 0.424   -1.747  0.048   1.00 1.06  ? 114 VAL A HG11 1  
ATOM 1690  H HG12 . VAL A 1 114 ? 1.834   -0.742  -0.295  1.00 1.03  ? 114 VAL A HG12 1  
ATOM 1691  H HG13 . VAL A 1 114 ? 0.419   -0.039  0.493   1.00 1.01  ? 114 VAL A HG13 1  
ATOM 1692  H HG21 . VAL A 1 114 ? 1.950   0.723   2.402   1.00 0.97  ? 114 VAL A HG21 1  
ATOM 1693  H HG22 . VAL A 1 114 ? 3.312   -0.014  1.557   1.00 0.98  ? 114 VAL A HG22 1  
ATOM 1694  H HG23 . VAL A 1 114 ? 2.941   -0.483  3.217   1.00 0.95  ? 114 VAL A HG23 1  
ATOM 1695  N N    . THR A 1 115 ? -1.189  -3.078  2.037   1.00 0.14  ? 115 THR A N    1  
ATOM 1696  C CA   . THR A 1 115 ? -1.649  -4.354  1.605   1.00 0.14  ? 115 THR A CA   1  
ATOM 1697  C C    . THR A 1 115 ? -1.612  -4.379  0.097   1.00 0.13  ? 115 THR A C    1  
ATOM 1698  O O    . THR A 1 115 ? -2.336  -3.646  -0.578  1.00 0.16  ? 115 THR A O    1  
ATOM 1699  C CB   . THR A 1 115 ? -3.044  -4.685  2.139   1.00 0.17  ? 115 THR A CB   1  
ATOM 1700  O OG1  . THR A 1 115 ? -3.013  -4.708  3.563   1.00 0.21  ? 115 THR A OG1  1  
ATOM 1701  C CG2  . THR A 1 115 ? -3.480  -6.038  1.643   1.00 0.20  ? 115 THR A CG2  1  
ATOM 1702  H H    . THR A 1 115 ? -1.756  -2.277  1.909   1.00 0.16  ? 115 THR A H    1  
ATOM 1703  H HA   . THR A 1 115 ? -0.956  -5.095  1.977   1.00 0.15  ? 115 THR A HA   1  
ATOM 1704  H HB   . THR A 1 115 ? -3.742  -3.936  1.802   1.00 0.18  ? 115 THR A HB   1  
ATOM 1705  H HG1  . THR A 1 115 ? -2.115  -4.525  3.861   1.00 0.68  ? 115 THR A HG1  1  
ATOM 1706  H HG21 . THR A 1 115 ? -3.466  -6.044  0.565   1.00 1.03  ? 115 THR A HG21 1  
ATOM 1707  H HG22 . THR A 1 115 ? -4.475  -6.248  1.998   1.00 1.00  ? 115 THR A HG22 1  
ATOM 1708  H HG23 . THR A 1 115 ? -2.794  -6.785  2.020   1.00 1.02  ? 115 THR A HG23 1  
ATOM 1709  N N    . ALA A 1 116 ? -0.724  -5.199  -0.399  1.00 0.12  ? 116 ALA A N    1  
ATOM 1710  C CA   . ALA A 1 116 ? -0.464  -5.317  -1.814  1.00 0.13  ? 116 ALA A CA   1  
ATOM 1711  C C    . ALA A 1 116 ? -0.613  -6.753  -2.226  1.00 0.12  ? 116 ALA A C    1  
ATOM 1712  O O    . ALA A 1 116 ? -0.117  -7.651  -1.543  1.00 0.13  ? 116 ALA A O    1  
ATOM 1713  C CB   . ALA A 1 116 ? 0.932   -4.823  -2.124  1.00 0.15  ? 116 ALA A CB   1  
ATOM 1714  H H    . ALA A 1 116 ? -0.214  -5.766  0.227   1.00 0.13  ? 116 ALA A H    1  
ATOM 1715  H HA   . ALA A 1 116 ? -1.169  -4.709  -2.364  1.00 0.14  ? 116 ALA A HA   1  
ATOM 1716  H HB1  . ALA A 1 116 ? 1.650   -5.389  -1.549  1.00 1.01  ? 116 ALA A HB1  1  
ATOM 1717  H HB2  . ALA A 1 116 ? 1.007   -3.779  -1.865  1.00 0.97  ? 116 ALA A HB2  1  
ATOM 1718  H HB3  . ALA A 1 116 ? 1.135   -4.948  -3.177  1.00 0.99  ? 116 ALA A HB3  1  
ATOM 1719  N N    . ASP A 1 117 ? -1.314  -6.976  -3.317  1.00 0.13  ? 117 ASP A N    1  
ATOM 1720  C CA   . ASP A 1 117 ? -1.433  -8.304  -3.867  1.00 0.13  ? 117 ASP A CA   1  
ATOM 1721  C C    . ASP A 1 117 ? -0.043  -8.888  -4.047  1.00 0.11  ? 117 ASP A C    1  
ATOM 1722  O O    . ASP A 1 117 ? 0.903   -8.154  -4.339  1.00 0.12  ? 117 ASP A O    1  
ATOM 1723  C CB   . ASP A 1 117 ? -2.138  -8.275  -5.210  1.00 0.16  ? 117 ASP A CB   1  
ATOM 1724  C CG   . ASP A 1 117 ? -2.621  -9.648  -5.621  1.00 0.20  ? 117 ASP A CG   1  
ATOM 1725  O OD1  . ASP A 1 117 ? -1.783  -10.466 -6.059  1.00 0.50  ? 117 ASP A OD1  1  
ATOM 1726  O OD2  . ASP A 1 117 ? -3.833  -9.909  -5.544  1.00 0.58  ? 117 ASP A OD2  1  
ATOM 1727  H H    . ASP A 1 117 ? -1.776  -6.230  -3.748  1.00 0.15  ? 117 ASP A H    1  
ATOM 1728  H HA   . ASP A 1 117 ? -1.992  -8.912  -3.183  1.00 0.14  ? 117 ASP A HA   1  
ATOM 1729  H HB2  . ASP A 1 117 ? -2.975  -7.598  -5.175  1.00 0.20  ? 117 ASP A HB2  1  
ATOM 1730  H HB3  . ASP A 1 117 ? -1.441  -7.930  -5.951  1.00 0.16  ? 117 ASP A HB3  1  
ATOM 1731  N N    . SER A 1 118 ? 0.083   -10.185 -3.858  1.00 0.13  ? 118 SER A N    1  
ATOM 1732  C CA   . SER A 1 118 ? 1.358   -10.860 -4.003  1.00 0.16  ? 118 SER A CA   1  
ATOM 1733  C C    . SER A 1 118 ? 1.976   -10.531 -5.363  1.00 0.13  ? 118 SER A C    1  
ATOM 1734  O O    . SER A 1 118 ? 3.188   -10.485 -5.508  1.00 0.15  ? 118 SER A O    1  
ATOM 1735  C CB   . SER A 1 118 ? 1.162   -12.365 -3.850  1.00 0.27  ? 118 SER A CB   1  
ATOM 1736  O OG   . SER A 1 118 ? 2.340   -13.004 -3.392  1.00 0.82  ? 118 SER A OG   1  
ATOM 1737  H H    . SER A 1 118 ? -0.703  -10.706 -3.595  1.00 0.16  ? 118 SER A H    1  
ATOM 1738  H HA   . SER A 1 118 ? 2.014   -10.504 -3.223  1.00 0.20  ? 118 SER A HA   1  
ATOM 1739  H HB2  . SER A 1 118 ? 0.371   -12.550 -3.136  1.00 0.43  ? 118 SER A HB2  1  
ATOM 1740  H HB3  . SER A 1 118 ? 0.889   -12.785 -4.807  1.00 0.38  ? 118 SER A HB3  1  
ATOM 1741  H HG   . SER A 1 118 ? 2.130   -13.915 -3.141  1.00 1.04  ? 118 SER A HG   1  
ATOM 1742  N N    . LYS A 1 119 ? 1.142   -10.271 -6.353  1.00 0.13  ? 119 LYS A N    1  
ATOM 1743  C CA   . LYS A 1 119 ? 1.624   -9.871  -7.669  1.00 0.14  ? 119 LYS A CA   1  
ATOM 1744  C C    . LYS A 1 119 ? 2.514   -8.618  -7.606  1.00 0.14  ? 119 LYS A C    1  
ATOM 1745  O O    . LYS A 1 119 ? 3.379   -8.435  -8.459  1.00 0.18  ? 119 LYS A O    1  
ATOM 1746  C CB   . LYS A 1 119 ? 0.456   -9.634  -8.615  1.00 0.17  ? 119 LYS A CB   1  
ATOM 1747  C CG   . LYS A 1 119 ? -0.611  -8.718  -8.065  1.00 0.19  ? 119 LYS A CG   1  
ATOM 1748  C CD   . LYS A 1 119 ? -1.699  -8.463  -9.088  1.00 0.29  ? 119 LYS A CD   1  
ATOM 1749  C CE   . LYS A 1 119 ? -2.387  -9.748  -9.524  1.00 0.38  ? 119 LYS A CE   1  
ATOM 1750  N NZ   . LYS A 1 119 ? -3.249  -10.330 -8.461  1.00 0.81  ? 119 LYS A NZ   1  
ATOM 1751  H H    . LYS A 1 119 ? 0.178   -10.355 -6.198  1.00 0.13  ? 119 LYS A H    1  
ATOM 1752  H HA   . LYS A 1 119 ? 2.218   -10.688 -8.054  1.00 0.17  ? 119 LYS A HA   1  
ATOM 1753  H HB2  . LYS A 1 119 ? 0.835   -9.178  -9.507  1.00 0.19  ? 119 LYS A HB2  1  
ATOM 1754  H HB3  . LYS A 1 119 ? 0.004   -10.586 -8.860  1.00 0.21  ? 119 LYS A HB3  1  
ATOM 1755  H HG2  . LYS A 1 119 ? -1.060  -9.168  -7.185  1.00 0.18  ? 119 LYS A HG2  1  
ATOM 1756  H HG3  . LYS A 1 119 ? -0.151  -7.781  -7.794  1.00 0.20  ? 119 LYS A HG3  1  
ATOM 1757  H HD2  . LYS A 1 119 ? -2.433  -7.809  -8.651  1.00 0.33  ? 119 LYS A HD2  1  
ATOM 1758  H HD3  . LYS A 1 119 ? -1.260  -7.988  -9.953  1.00 0.34  ? 119 LYS A HD3  1  
ATOM 1759  H HE2  . LYS A 1 119 ? -2.997  -9.533  -10.385 1.00 0.57  ? 119 LYS A HE2  1  
ATOM 1760  H HE3  . LYS A 1 119 ? -1.630  -10.469 -9.792  1.00 0.72  ? 119 LYS A HE3  1  
ATOM 1761  H HZ1  . LYS A 1 119 ? -3.595  -11.266 -8.753  1.00 1.31  ? 119 LYS A HZ1  1  
ATOM 1762  H HZ2  . LYS A 1 119 ? -4.073  -9.712  -8.285  1.00 1.31  ? 119 LYS A HZ2  1  
ATOM 1763  H HZ3  . LYS A 1 119 ? -2.713  -10.431 -7.570  1.00 1.43  ? 119 LYS A HZ3  1  
ATOM 1764  N N    . TYR A 1 120 ? 2.309   -7.763  -6.600  1.00 0.13  ? 120 TYR A N    1  
ATOM 1765  C CA   . TYR A 1 120 ? 3.173   -6.599  -6.408  1.00 0.15  ? 120 TYR A CA   1  
ATOM 1766  C C    . TYR A 1 120 ? 4.200   -6.890  -5.332  1.00 0.15  ? 120 TYR A C    1  
ATOM 1767  O O    . TYR A 1 120 ? 5.033   -6.048  -4.999  1.00 0.19  ? 120 TYR A O    1  
ATOM 1768  C CB   . TYR A 1 120 ? 2.357   -5.364  -6.026  1.00 0.16  ? 120 TYR A CB   1  
ATOM 1769  C CG   . TYR A 1 120 ? 1.341   -4.980  -7.060  1.00 0.20  ? 120 TYR A CG   1  
ATOM 1770  C CD1  . TYR A 1 120 ? 1.667   -4.106  -8.082  1.00 0.28  ? 120 TYR A CD1  1  
ATOM 1771  C CD2  . TYR A 1 120 ? 0.060   -5.505  -7.018  1.00 0.23  ? 120 TYR A CD2  1  
ATOM 1772  C CE1  . TYR A 1 120 ? 0.737   -3.766  -9.043  1.00 0.34  ? 120 TYR A CE1  1  
ATOM 1773  C CE2  . TYR A 1 120 ? -0.875  -5.170  -7.969  1.00 0.30  ? 120 TYR A CE2  1  
ATOM 1774  C CZ   . TYR A 1 120 ? -0.535  -4.302  -8.982  1.00 0.34  ? 120 TYR A CZ   1  
ATOM 1775  O OH   . TYR A 1 120 ? -1.467  -3.973  -9.940  1.00 0.42  ? 120 TYR A OH   1  
ATOM 1776  H H    . TYR A 1 120 ? 1.560   -7.914  -5.968  1.00 0.12  ? 120 TYR A H    1  
ATOM 1777  H HA   . TYR A 1 120 ? 3.688   -6.415  -7.336  1.00 0.17  ? 120 TYR A HA   1  
ATOM 1778  H HB2  . TYR A 1 120 ? 1.832   -5.555  -5.104  1.00 0.16  ? 120 TYR A HB2  1  
ATOM 1779  H HB3  . TYR A 1 120 ? 3.023   -4.524  -5.893  1.00 0.18  ? 120 TYR A HB3  1  
ATOM 1780  H HD1  . TYR A 1 120 ? 2.666   -3.687  -8.118  1.00 0.32  ? 120 TYR A HD1  1  
ATOM 1781  H HD2  . TYR A 1 120 ? -0.205  -6.186  -6.219  1.00 0.25  ? 120 TYR A HD2  1  
ATOM 1782  H HE1  . TYR A 1 120 ? 1.004   -3.087  -9.837  1.00 0.41  ? 120 TYR A HE1  1  
ATOM 1783  H HE2  . TYR A 1 120 ? -1.864  -5.592  -7.917  1.00 0.35  ? 120 TYR A HE2  1  
ATOM 1784  H HH   . TYR A 1 120 ? -2.311  -3.764  -9.512  1.00 1.04  ? 120 TYR A HH   1  
ATOM 1785  N N    . CYS A 1 121 ? 4.130   -8.097  -4.814  1.00 0.14  ? 121 CYS A N    1  
ATOM 1786  C CA   . CYS A 1 121 ? 5.003   -8.531  -3.750  1.00 0.15  ? 121 CYS A CA   1  
ATOM 1787  C C    . CYS A 1 121 ? 5.825   -9.734  -4.207  1.00 0.16  ? 121 CYS A C    1  
ATOM 1788  O O    . CYS A 1 121 ? 6.881   -9.569  -4.808  1.00 0.18  ? 121 CYS A O    1  
ATOM 1789  C CB   . CYS A 1 121 ? 4.178   -8.870  -2.508  1.00 0.14  ? 121 CYS A CB   1  
ATOM 1790  S SG   . CYS A 1 121 ? 3.140   -7.513  -1.911  1.00 0.16  ? 121 CYS A SG   1  
ATOM 1791  H H    . CYS A 1 121 ? 3.470   -8.727  -5.172  1.00 0.14  ? 121 CYS A H    1  
ATOM 1792  H HA   . CYS A 1 121 ? 5.676   -7.717  -3.519  1.00 0.16  ? 121 CYS A HA   1  
ATOM 1793  H HB2  . CYS A 1 121 ? 3.527   -9.698  -2.736  1.00 0.14  ? 121 CYS A HB2  1  
ATOM 1794  H HB3  . CYS A 1 121 ? 4.842   -9.154  -1.706  1.00 0.15  ? 121 CYS A HB3  1  
ATOM 1795  H HG   . CYS A 1 121 ? 1.865   -7.850  -2.090  1.00 0.87  ? 121 CYS A HG   1  
ATOM 1796  N N    . TYR A 1 122 ? 5.333   -10.949 -3.959  1.00 0.16  ? 122 TYR A N    1  
ATOM 1797  C CA   . TYR A 1 122 ? 6.047   -12.144 -4.392  1.00 0.18  ? 122 TYR A CA   1  
ATOM 1798  C C    . TYR A 1 122 ? 5.086   -13.234 -4.883  1.00 0.18  ? 122 TYR A C    1  
ATOM 1799  O O    . TYR A 1 122 ? 5.271   -14.393 -4.543  1.00 0.20  ? 122 TYR A O    1  
ATOM 1800  C CB   . TYR A 1 122 ? 6.889   -12.721 -3.248  1.00 0.19  ? 122 TYR A CB   1  
ATOM 1801  C CG   . TYR A 1 122 ? 7.651   -11.699 -2.424  1.00 0.20  ? 122 TYR A CG   1  
ATOM 1802  C CD1  . TYR A 1 122 ? 8.920   -11.285 -2.802  1.00 0.21  ? 122 TYR A CD1  1  
ATOM 1803  C CD2  . TYR A 1 122 ? 7.106   -11.169 -1.261  1.00 0.19  ? 122 TYR A CD2  1  
ATOM 1804  C CE1  . TYR A 1 122 ? 9.624   -10.364 -2.049  1.00 0.23  ? 122 TYR A CE1  1  
ATOM 1805  C CE2  . TYR A 1 122 ? 7.803   -10.250 -0.506  1.00 0.20  ? 122 TYR A CE2  1  
ATOM 1806  C CZ   . TYR A 1 122 ? 9.063   -9.853  -0.901  1.00 0.22  ? 122 TYR A CZ   1  
ATOM 1807  O OH   . TYR A 1 122 ? 9.762   -8.937  -0.141  1.00 0.24  ? 122 TYR A OH   1  
ATOM 1808  H H    . TYR A 1 122 ? 4.485   -11.043 -3.471  1.00 0.15  ? 122 TYR A H    1  
ATOM 1809  H HA   . TYR A 1 122 ? 6.702   -11.865 -5.204  1.00 0.19  ? 122 TYR A HA   1  
ATOM 1810  H HB2  . TYR A 1 122 ? 6.252   -13.279 -2.582  1.00 0.20  ? 122 TYR A HB2  1  
ATOM 1811  H HB3  . TYR A 1 122 ? 7.616   -13.397 -3.675  1.00 0.22  ? 122 TYR A HB3  1  
ATOM 1812  H HD1  . TYR A 1 122 ? 9.357   -11.689 -3.703  1.00 0.23  ? 122 TYR A HD1  1  
ATOM 1813  H HD2  . TYR A 1 122 ? 6.122   -11.482 -0.951  1.00 0.19  ? 122 TYR A HD2  1  
ATOM 1814  H HE1  . TYR A 1 122 ? 10.607  -10.055 -2.358  1.00 0.25  ? 122 TYR A HE1  1  
ATOM 1815  H HE2  . TYR A 1 122 ? 7.361   -9.851  0.394   1.00 0.21  ? 122 TYR A HE2  1  
ATOM 1816  H HH   . TYR A 1 122 ? 9.655   -9.145  0.794   1.00 0.96  ? 122 TYR A HH   1  
ATOM 1817  N N    . GLY A 1 123 ? 4.075   -12.858 -5.676  1.00 0.19  ? 123 GLY A N    1  
ATOM 1818  C CA   . GLY A 1 123 ? 3.105   -13.823 -6.194  1.00 0.21  ? 123 GLY A CA   1  
ATOM 1819  C C    . GLY A 1 123 ? 3.735   -15.052 -6.826  1.00 0.21  ? 123 GLY A C    1  
ATOM 1820  O O    . GLY A 1 123 ? 3.946   -16.054 -6.154  1.00 0.25  ? 123 GLY A O    1  
ATOM 1821  H H    . GLY A 1 123 ? 3.944   -11.896 -5.876  1.00 0.20  ? 123 GLY A H    1  
ATOM 1822  H HA2  . GLY A 1 123 ? 2.469   -14.140 -5.382  1.00 0.24  ? 123 GLY A HA2  1  
ATOM 1823  H HA3  . GLY A 1 123 ? 2.493   -13.329 -6.935  1.00 0.25  ? 123 GLY A HA3  1  
ATOM 1824  N N    . PRO A 1 124 ? 4.018   -15.022 -8.134  1.00 0.25  ? 124 PRO A N    1  
ATOM 1825  C CA   . PRO A 1 124 ? 4.738   -16.095 -8.807  1.00 0.30  ? 124 PRO A CA   1  
ATOM 1826  C C    . PRO A 1 124 ? 6.242   -15.909 -8.660  1.00 0.30  ? 124 PRO A C    1  
ATOM 1827  O O    . PRO A 1 124 ? 7.039   -16.513 -9.376  1.00 0.34  ? 124 PRO A O    1  
ATOM 1828  C CB   . PRO A 1 124 ? 4.313   -15.953 -10.276 1.00 0.37  ? 124 PRO A CB   1  
ATOM 1829  C CG   . PRO A 1 124 ? 3.415   -14.752 -10.340 1.00 0.58  ? 124 PRO A CG   1  
ATOM 1830  C CD   . PRO A 1 124 ? 3.642   -13.971 -9.077  1.00 0.32  ? 124 PRO A CD   1  
ATOM 1831  H HA   . PRO A 1 124 ? 4.455   -17.068 -8.432  1.00 0.33  ? 124 PRO A HA   1  
ATOM 1832  H HB2  . PRO A 1 124 ? 5.191   -15.821 -10.892 1.00 0.46  ? 124 PRO A HB2  1  
ATOM 1833  H HB3  . PRO A 1 124 ? 3.791   -16.846 -10.582 1.00 0.45  ? 124 PRO A HB3  1  
ATOM 1834  H HG2  . PRO A 1 124 ? 3.667   -14.151 -11.202 1.00 0.90  ? 124 PRO A HG2  1  
ATOM 1835  H HG3  . PRO A 1 124 ? 2.384   -15.071 -10.401 1.00 0.87  ? 124 PRO A HG3  1  
ATOM 1836  H HD2  . PRO A 1 124 ? 4.440   -13.259 -9.209  1.00 0.40  ? 124 PRO A HD2  1  
ATOM 1837  H HD3  . PRO A 1 124 ? 2.733   -13.477 -8.766  1.00 0.38  ? 124 PRO A HD3  1  
ATOM 1838  N N    . GLN A 1 125 ? 6.616   -15.046 -7.726  1.00 0.27  ? 125 GLN A N    1  
ATOM 1839  C CA   . GLN A 1 125 ? 8.005   -14.692 -7.513  1.00 0.30  ? 125 GLN A CA   1  
ATOM 1840  C C    . GLN A 1 125 ? 8.524   -15.387 -6.269  1.00 0.32  ? 125 GLN A C    1  
ATOM 1841  O O    . GLN A 1 125 ? 9.625   -15.931 -6.253  1.00 0.39  ? 125 GLN A O    1  
ATOM 1842  C CB   . GLN A 1 125 ? 8.126   -13.178 -7.355  1.00 0.30  ? 125 GLN A CB   1  
ATOM 1843  C CG   . GLN A 1 125 ? 7.383   -12.409 -8.433  1.00 0.33  ? 125 GLN A CG   1  
ATOM 1844  C CD   . GLN A 1 125 ? 7.323   -10.924 -8.154  1.00 0.35  ? 125 GLN A CD   1  
ATOM 1845  O OE1  . GLN A 1 125 ? 8.183   -10.164 -8.586  1.00 0.65  ? 125 GLN A OE1  1  
ATOM 1846  N NE2  . GLN A 1 125 ? 6.293   -10.506 -7.434  1.00 0.29  ? 125 GLN A NE2  1  
ATOM 1847  H H    . GLN A 1 125 ? 5.935   -14.663 -7.134  1.00 0.24  ? 125 GLN A H    1  
ATOM 1848  H HA   . GLN A 1 125 ? 8.578   -15.013 -8.370  1.00 0.34  ? 125 GLN A HA   1  
ATOM 1849  H HB2  . GLN A 1 125 ? 7.726   -12.893 -6.392  1.00 0.33  ? 125 GLN A HB2  1  
ATOM 1850  H HB3  . GLN A 1 125 ? 9.169   -12.904 -7.398  1.00 0.36  ? 125 GLN A HB3  1  
ATOM 1851  H HG2  . GLN A 1 125 ? 7.885   -12.559 -9.375  1.00 0.39  ? 125 GLN A HG2  1  
ATOM 1852  H HG3  . GLN A 1 125 ? 6.374   -12.789 -8.501  1.00 0.38  ? 125 GLN A HG3  1  
ATOM 1853  H HE21 . GLN A 1 125 ? 5.639   -11.166 -7.136  1.00 0.45  ? 125 GLN A HE21 1  
ATOM 1854  H HE22 . GLN A 1 125 ? 6.245   -9.555  -7.203  1.00 0.29  ? 125 GLN A HE22 1  
ATOM 1855  N N    . GLY A 1 126 ? 7.691   -15.366 -5.234  1.00 0.27  ? 126 GLY A N    1  
ATOM 1856  C CA   . GLY A 1 126 ? 8.039   -15.939 -3.960  1.00 0.27  ? 126 GLY A CA   1  
ATOM 1857  C C    . GLY A 1 126 ? 8.998   -15.079 -3.179  1.00 0.28  ? 126 GLY A C    1  
ATOM 1858  O O    . GLY A 1 126 ? 9.871   -14.417 -3.738  1.00 0.30  ? 126 GLY A O    1  
ATOM 1859  H H    . GLY A 1 126 ? 6.811   -14.950 -5.337  1.00 0.24  ? 126 GLY A H    1  
ATOM 1860  H HA2  . GLY A 1 126 ? 7.134   -16.048 -3.379  1.00 0.25  ? 126 GLY A HA2  1  
ATOM 1861  H HA3  . GLY A 1 126 ? 8.474   -16.910 -4.114  1.00 0.30  ? 126 GLY A HA3  1  
ATOM 1862  N N    . SER A 1 127 ? 8.828   -15.085 -1.875  1.00 0.27  ? 127 SER A N    1  
ATOM 1863  C CA   . SER A 1 127 ? 9.632   -14.258 -1.007  1.00 0.28  ? 127 SER A CA   1  
ATOM 1864  C C    . SER A 1 127 ? 10.867  -15.008 -0.513  1.00 0.32  ? 127 SER A C    1  
ATOM 1865  O O    . SER A 1 127 ? 10.918  -16.237 -0.560  1.00 0.33  ? 127 SER A O    1  
ATOM 1866  C CB   . SER A 1 127 ? 8.770   -13.737 0.155   1.00 0.27  ? 127 SER A CB   1  
ATOM 1867  O OG   . SER A 1 127 ? 9.553   -13.153 1.184   1.00 0.30  ? 127 SER A OG   1  
ATOM 1868  H H    . SER A 1 127 ? 8.126   -15.636 -1.493  1.00 0.26  ? 127 SER A H    1  
ATOM 1869  H HA   . SER A 1 127 ? 9.958   -13.433 -1.589  1.00 0.29  ? 127 SER A HA   1  
ATOM 1870  H HB2  . SER A 1 127 ? 8.083   -12.989 -0.218  1.00 0.25  ? 127 SER A HB2  1  
ATOM 1871  H HB3  . SER A 1 127 ? 8.189   -14.553 0.567   1.00 0.27  ? 127 SER A HB3  1  
ATOM 1872  H HG   . SER A 1 127 ? 8.993   -12.963 1.944   1.00 0.90  ? 127 SER A HG   1  
ATOM 1873  N N    . ARG A 1 128 ? 11.864  -14.237 -0.067  1.00 0.38  ? 128 ARG A N    1  
ATOM 1874  C CA   . ARG A 1 128 ? 13.174  -14.771 0.309   1.00 0.42  ? 128 ARG A CA   1  
ATOM 1875  C C    . ARG A 1 128 ? 13.036  -15.900 1.319   1.00 0.42  ? 128 ARG A C    1  
ATOM 1876  O O    . ARG A 1 128 ? 13.510  -17.012 1.091   1.00 0.52  ? 128 ARG A O    1  
ATOM 1877  C CB   . ARG A 1 128 ? 14.049  -13.674 0.919   1.00 0.52  ? 128 ARG A CB   1  
ATOM 1878  C CG   . ARG A 1 128 ? 13.943  -12.325 0.229   1.00 1.12  ? 128 ARG A CG   1  
ATOM 1879  C CD   . ARG A 1 128 ? 14.796  -11.291 0.944   1.00 1.41  ? 128 ARG A CD   1  
ATOM 1880  N NE   . ARG A 1 128 ? 14.383  -9.919  0.653   1.00 1.81  ? 128 ARG A NE   1  
ATOM 1881  C CZ   . ARG A 1 128 ? 14.610  -8.894  1.479   1.00 2.33  ? 128 ARG A CZ   1  
ATOM 1882  N NH1  . ARG A 1 128 ? 15.287  -9.090  2.602   1.00 2.45  ? 128 ARG A NH1  1  
ATOM 1883  N NH2  . ARG A 1 128 ? 14.173  -7.677  1.187   1.00 3.17  ? 128 ARG A NH2  1  
ATOM 1884  H H    . ARG A 1 128 ? 11.709  -13.276 0.015   1.00 0.44  ? 128 ARG A H    1  
ATOM 1885  H HA   . ARG A 1 128 ? 13.651  -15.150 -0.583  1.00 0.43  ? 128 ARG A HA   1  
ATOM 1886  H HB2  . ARG A 1 128 ? 13.766  -13.542 1.953   1.00 0.97  ? 128 ARG A HB2  1  
ATOM 1887  H HB3  . ARG A 1 128 ? 15.082  -13.992 0.880   1.00 1.07  ? 128 ARG A HB3  1  
ATOM 1888  H HG2  . ARG A 1 128 ? 14.283  -12.419 -0.792  1.00 1.62  ? 128 ARG A HG2  1  
ATOM 1889  H HG3  . ARG A 1 128 ? 12.911  -12.003 0.244   1.00 1.72  ? 128 ARG A HG3  1  
ATOM 1890  H HD2  . ARG A 1 128 ? 14.713  -11.459 2.007   1.00 1.89  ? 128 ARG A HD2  1  
ATOM 1891  H HD3  . ARG A 1 128 ? 15.826  -11.420 0.639   1.00 1.87  ? 128 ARG A HD3  1  
ATOM 1892  H HE   . ARG A 1 128 ? 13.901  -9.760  -0.185  1.00 2.16  ? 128 ARG A HE   1  
ATOM 1893  H HH11 . ARG A 1 128 ? 15.628  -10.002 2.836   1.00 2.38  ? 128 ARG A HH11 1  
ATOM 1894  H HH12 . ARG A 1 128 ? 15.461  -8.315  3.228   1.00 2.95  ? 128 ARG A HH12 1  
ATOM 1895  H HH21 . ARG A 1 128 ? 13.667  -7.507  0.343   1.00 3.53  ? 128 ARG A HH21 1  
ATOM 1896  H HH22 . ARG A 1 128 ? 14.341  -6.915  1.837   1.00 3.61  ? 128 ARG A HH22 1  
ATOM 1897  N N    . SER A 1 129 ? 12.394  -15.599 2.436   1.00 0.42  ? 129 SER A N    1  
ATOM 1898  C CA   . SER A 1 129 ? 12.166  -16.599 3.456   1.00 0.44  ? 129 SER A CA   1  
ATOM 1899  C C    . SER A 1 129 ? 11.062  -17.566 3.023   1.00 0.41  ? 129 SER A C    1  
ATOM 1900  O O    . SER A 1 129 ? 11.331  -18.754 2.839   1.00 0.44  ? 129 SER A O    1  
ATOM 1901  C CB   . SER A 1 129 ? 11.859  -15.938 4.797   1.00 0.48  ? 129 SER A CB   1  
ATOM 1902  O OG   . SER A 1 129 ? 12.921  -15.088 5.192   1.00 1.23  ? 129 SER A OG   1  
ATOM 1903  H H    . SER A 1 129 ? 12.072  -14.690 2.576   1.00 0.48  ? 129 SER A H    1  
ATOM 1904  H HA   . SER A 1 129 ? 13.085  -17.163 3.554   1.00 0.46  ? 129 SER A HA   1  
ATOM 1905  H HB2  . SER A 1 129 ? 10.959  -15.348 4.707   1.00 0.81  ? 129 SER A HB2  1  
ATOM 1906  H HB3  . SER A 1 129 ? 11.718  -16.702 5.548   1.00 1.00  ? 129 SER A HB3  1  
ATOM 1907  H HG   . SER A 1 129 ? 13.764  -15.513 4.983   1.00 1.52  ? 129 SER A HG   1  
ATOM 1908  N N    . PRO A 1 130 ? 9.799   -17.112 2.846   1.00 0.37  ? 130 PRO A N    1  
ATOM 1909  C CA   . PRO A 1 130 ? 8.753   -17.952 2.321   1.00 0.36  ? 130 PRO A CA   1  
ATOM 1910  C C    . PRO A 1 130 ? 8.390   -17.588 0.887   1.00 0.32  ? 130 PRO A C    1  
ATOM 1911  O O    . PRO A 1 130 ? 8.076   -16.442 0.602   1.00 0.27  ? 130 PRO A O    1  
ATOM 1912  C CB   . PRO A 1 130 ? 7.576   -17.588 3.238   1.00 0.37  ? 130 PRO A CB   1  
ATOM 1913  C CG   . PRO A 1 130 ? 7.935   -16.255 3.850   1.00 0.37  ? 130 PRO A CG   1  
ATOM 1914  C CD   . PRO A 1 130 ? 9.225   -15.818 3.202   1.00 0.37  ? 130 PRO A CD   1  
ATOM 1915  H HA   . PRO A 1 130 ? 8.982   -18.999 2.403   1.00 0.40  ? 130 PRO A HA   1  
ATOM 1916  H HB2  . PRO A 1 130 ? 6.674   -17.516 2.647   1.00 0.35  ? 130 PRO A HB2  1  
ATOM 1917  H HB3  . PRO A 1 130 ? 7.451   -18.344 3.993   1.00 0.44  ? 130 PRO A HB3  1  
ATOM 1918  H HG2  . PRO A 1 130 ? 7.155   -15.538 3.648   1.00 0.37  ? 130 PRO A HG2  1  
ATOM 1919  H HG3  . PRO A 1 130 ? 8.073   -16.369 4.917   1.00 0.41  ? 130 PRO A HG3  1  
ATOM 1920  H HD2  . PRO A 1 130 ? 9.025   -15.217 2.324   1.00 0.35  ? 130 PRO A HD2  1  
ATOM 1921  H HD3  . PRO A 1 130 ? 9.844   -15.285 3.892   1.00 0.40  ? 130 PRO A HD3  1  
ATOM 1922  N N    . TYR A 1 131 ? 8.418   -18.548 -0.014  1.00 0.33  ? 131 TYR A N    1  
ATOM 1923  C CA   . TYR A 1 131 ? 7.803   -18.355 -1.314  1.00 0.32  ? 131 TYR A CA   1  
ATOM 1924  C C    . TYR A 1 131 ? 6.331   -18.045 -1.100  1.00 0.30  ? 131 TYR A C    1  
ATOM 1925  O O    . TYR A 1 131 ? 5.524   -18.946 -0.851  1.00 0.32  ? 131 TYR A O    1  
ATOM 1926  C CB   . TYR A 1 131 ? 7.982   -19.595 -2.200  1.00 0.36  ? 131 TYR A CB   1  
ATOM 1927  C CG   . TYR A 1 131 ? 7.419   -19.449 -3.601  1.00 0.45  ? 131 TYR A CG   1  
ATOM 1928  C CD1  . TYR A 1 131 ? 6.059   -19.605 -3.849  1.00 0.78  ? 131 TYR A CD1  1  
ATOM 1929  C CD2  . TYR A 1 131 ? 8.249   -19.152 -4.674  1.00 1.00  ? 131 TYR A CD2  1  
ATOM 1930  C CE1  . TYR A 1 131 ? 5.544   -19.470 -5.124  1.00 0.87  ? 131 TYR A CE1  1  
ATOM 1931  C CE2  . TYR A 1 131 ? 7.740   -19.016 -5.953  1.00 1.14  ? 131 TYR A CE2  1  
ATOM 1932  C CZ   . TYR A 1 131 ? 6.387   -19.171 -6.172  1.00 0.81  ? 131 TYR A CZ   1  
ATOM 1933  O OH   . TYR A 1 131 ? 5.878   -19.029 -7.445  1.00 1.00  ? 131 TYR A OH   1  
ATOM 1934  H H    . TYR A 1 131 ? 8.897   -19.367 0.175   1.00 0.36  ? 131 TYR A H    1  
ATOM 1935  H HA   . TYR A 1 131 ? 8.278   -17.504 -1.785  1.00 0.31  ? 131 TYR A HA   1  
ATOM 1936  H HB2  . TYR A 1 131 ? 9.038   -19.801 -2.293  1.00 0.39  ? 131 TYR A HB2  1  
ATOM 1937  H HB3  . TYR A 1 131 ? 7.496   -20.438 -1.731  1.00 0.43  ? 131 TYR A HB3  1  
ATOM 1938  H HD1  . TYR A 1 131 ? 5.399   -19.833 -3.024  1.00 1.27  ? 131 TYR A HD1  1  
ATOM 1939  H HD2  . TYR A 1 131 ? 9.308   -19.031 -4.499  1.00 1.48  ? 131 TYR A HD2  1  
ATOM 1940  H HE1  . TYR A 1 131 ? 4.486   -19.595 -5.294  1.00 1.32  ? 131 TYR A HE1  1  
ATOM 1941  H HE2  . TYR A 1 131 ? 8.404   -18.783 -6.771  1.00 1.69  ? 131 TYR A HE2  1  
ATOM 1942  H HH   . TYR A 1 131 ? 6.436   -19.512 -8.069  1.00 1.33  ? 131 TYR A HH   1  
ATOM 1943  N N    . ILE A 1 132 ? 6.009   -16.759 -1.132  1.00 0.27  ? 132 ILE A N    1  
ATOM 1944  C CA   . ILE A 1 132 ? 4.660   -16.305 -0.877  1.00 0.26  ? 132 ILE A CA   1  
ATOM 1945  C C    . ILE A 1 132 ? 3.729   -16.796 -1.983  1.00 0.25  ? 132 ILE A C    1  
ATOM 1946  O O    . ILE A 1 132 ? 4.063   -16.694 -3.158  1.00 0.25  ? 132 ILE A O    1  
ATOM 1947  C CB   . ILE A 1 132 ? 4.587   -14.760 -0.803  1.00 0.25  ? 132 ILE A CB   1  
ATOM 1948  C CG1  . ILE A 1 132 ? 5.620   -14.186 0.166   1.00 0.39  ? 132 ILE A CG1  1  
ATOM 1949  C CG2  . ILE A 1 132 ? 3.193   -14.322 -0.399  1.00 0.26  ? 132 ILE A CG2  1  
ATOM 1950  C CD1  . ILE A 1 132 ? 5.563   -14.761 1.552   1.00 0.23  ? 132 ILE A CD1  1  
ATOM 1951  H H    . ILE A 1 132 ? 6.702   -16.100 -1.316  1.00 0.27  ? 132 ILE A H    1  
ATOM 1952  H HA   . ILE A 1 132 ? 4.338   -16.710 0.070   1.00 0.27  ? 132 ILE A HA   1  
ATOM 1953  H HB   . ILE A 1 132 ? 4.799   -14.376 -1.783  1.00 0.23  ? 132 ILE A HB   1  
ATOM 1954  H HG12 . ILE A 1 132 ? 6.608   -14.368 -0.222  1.00 0.58  ? 132 ILE A HG12 1  
ATOM 1955  H HG13 . ILE A 1 132 ? 5.467   -13.117 0.255   1.00 0.64  ? 132 ILE A HG13 1  
ATOM 1956  H HG21 . ILE A 1 132 ? 3.134   -13.246 -0.412  1.00 1.06  ? 132 ILE A HG21 1  
ATOM 1957  H HG22 . ILE A 1 132 ? 2.982   -14.685 0.599   1.00 1.06  ? 132 ILE A HG22 1  
ATOM 1958  H HG23 . ILE A 1 132 ? 2.476   -14.734 -1.092  1.00 1.01  ? 132 ILE A HG23 1  
ATOM 1959  H HD11 . ILE A 1 132 ? 5.696   -15.829 1.499   1.00 0.99  ? 132 ILE A HD11 1  
ATOM 1960  H HD12 . ILE A 1 132 ? 4.608   -14.531 2.003   1.00 1.02  ? 132 ILE A HD12 1  
ATOM 1961  H HD13 . ILE A 1 132 ? 6.360   -14.329 2.138   1.00 1.05  ? 132 ILE A HD13 1  
ATOM 1962  N N    . PRO A 1 133 ? 2.570   -17.369 -1.616  1.00 0.27  ? 133 PRO A N    1  
ATOM 1963  C CA   . PRO A 1 133 ? 1.584   -17.853 -2.587  1.00 0.28  ? 133 PRO A CA   1  
ATOM 1964  C C    . PRO A 1 133 ? 1.169   -16.773 -3.584  1.00 0.26  ? 133 PRO A C    1  
ATOM 1965  O O    . PRO A 1 133 ? 1.022   -15.599 -3.226  1.00 0.26  ? 133 PRO A O    1  
ATOM 1966  C CB   . PRO A 1 133 ? 0.389   -18.259 -1.718  1.00 0.34  ? 133 PRO A CB   1  
ATOM 1967  C CG   . PRO A 1 133 ? 0.967   -18.526 -0.372  1.00 0.61  ? 133 PRO A CG   1  
ATOM 1968  C CD   . PRO A 1 133 ? 2.135   -17.596 -0.228  1.00 0.31  ? 133 PRO A CD   1  
ATOM 1969  H HA   . PRO A 1 133 ? 1.950   -18.716 -3.127  1.00 0.29  ? 133 PRO A HA   1  
ATOM 1970  H HB2  . PRO A 1 133 ? -0.330  -17.454 -1.687  1.00 0.49  ? 133 PRO A HB2  1  
ATOM 1971  H HB3  . PRO A 1 133 ? -0.074  -19.146 -2.129  1.00 0.43  ? 133 PRO A HB3  1  
ATOM 1972  H HG2  . PRO A 1 133 ? 0.229   -18.322 0.390   1.00 0.97  ? 133 PRO A HG2  1  
ATOM 1973  H HG3  . PRO A 1 133 ? 1.296   -19.552 -0.310  1.00 1.03  ? 133 PRO A HG3  1  
ATOM 1974  H HD2  . PRO A 1 133 ? 1.825   -16.670 0.234   1.00 0.37  ? 133 PRO A HD2  1  
ATOM 1975  H HD3  . PRO A 1 133 ? 2.920   -18.063 0.349   1.00 0.50  ? 133 PRO A HD3  1  
ATOM 1976  N N    . PRO A 1 134 ? 0.998   -17.153 -4.860  1.00 0.27  ? 134 PRO A N    1  
ATOM 1977  C CA   . PRO A 1 134 ? 0.582   -16.225 -5.906  1.00 0.25  ? 134 PRO A CA   1  
ATOM 1978  C C    . PRO A 1 134 ? -0.732  -15.532 -5.577  1.00 0.27  ? 134 PRO A C    1  
ATOM 1979  O O    . PRO A 1 134 ? -1.652  -16.147 -5.037  1.00 0.32  ? 134 PRO A O    1  
ATOM 1980  C CB   . PRO A 1 134 ? 0.424   -17.107 -7.146  1.00 0.29  ? 134 PRO A CB   1  
ATOM 1981  C CG   . PRO A 1 134 ? 1.277   -18.297 -6.877  1.00 0.52  ? 134 PRO A CG   1  
ATOM 1982  C CD   . PRO A 1 134 ? 1.229   -18.509 -5.388  1.00 0.33  ? 134 PRO A CD   1  
ATOM 1983  H HA   . PRO A 1 134 ? 1.341   -15.478 -6.090  1.00 0.23  ? 134 PRO A HA   1  
ATOM 1984  H HB2  . PRO A 1 134 ? -0.614  -17.381 -7.266  1.00 0.50  ? 134 PRO A HB2  1  
ATOM 1985  H HB3  . PRO A 1 134 ? 0.761   -16.562 -8.018  1.00 0.43  ? 134 PRO A HB3  1  
ATOM 1986  H HG2  . PRO A 1 134 ? 0.880   -19.160 -7.393  1.00 0.89  ? 134 PRO A HG2  1  
ATOM 1987  H HG3  . PRO A 1 134 ? 2.289   -18.101 -7.197  1.00 0.83  ? 134 PRO A HG3  1  
ATOM 1988  H HD2  . PRO A 1 134 ? 0.412   -19.166 -5.128  1.00 0.43  ? 134 PRO A HD2  1  
ATOM 1989  H HD3  . PRO A 1 134 ? 2.167   -18.907 -5.033  1.00 0.41  ? 134 PRO A HD3  1  
ATOM 1990  N N    . HIS A 1 135 ? -0.783  -14.241 -5.908  1.00 0.26  ? 135 HIS A N    1  
ATOM 1991  C CA   . HIS A 1 135 ? -1.946  -13.368 -5.676  1.00 0.31  ? 135 HIS A CA   1  
ATOM 1992  C C    . HIS A 1 135 ? -2.512  -13.485 -4.262  1.00 0.32  ? 135 HIS A C    1  
ATOM 1993  O O    . HIS A 1 135 ? -3.698  -13.255 -4.038  1.00 0.44  ? 135 HIS A O    1  
ATOM 1994  C CB   . HIS A 1 135 ? -3.043  -13.565 -6.740  1.00 0.41  ? 135 HIS A CB   1  
ATOM 1995  C CG   . HIS A 1 135 ? -3.708  -14.910 -6.777  1.00 0.87  ? 135 HIS A CG   1  
ATOM 1996  N ND1  . HIS A 1 135 ? -4.829  -15.221 -6.039  1.00 1.81  ? 135 HIS A ND1  1  
ATOM 1997  C CD2  . HIS A 1 135 ? -3.423  -16.014 -7.503  1.00 1.64  ? 135 HIS A CD2  1  
ATOM 1998  C CE1  . HIS A 1 135 ? -5.197  -16.458 -6.304  1.00 2.38  ? 135 HIS A CE1  1  
ATOM 1999  N NE2  . HIS A 1 135 ? -4.362  -16.963 -7.193  1.00 2.25  ? 135 HIS A NE2  1  
ATOM 2000  H H    . HIS A 1 135 ? 0.007   -13.847 -6.330  1.00 0.26  ? 135 HIS A H    1  
ATOM 2001  H HA   . HIS A 1 135 ? -1.579  -12.355 -5.778  1.00 0.31  ? 135 HIS A HA   1  
ATOM 2002  H HB2  . HIS A 1 135 ? -3.813  -12.831 -6.580  1.00 1.01  ? 135 HIS A HB2  1  
ATOM 2003  H HB3  . HIS A 1 135 ? -2.600  -13.393 -7.710  1.00 1.01  ? 135 HIS A HB3  1  
ATOM 2004  H HD1  . HIS A 1 135 ? -5.297  -14.614 -5.410  1.00 2.34  ? 135 HIS A HD1  1  
ATOM 2005  H HD2  . HIS A 1 135 ? -2.607  -16.127 -8.202  1.00 2.21  ? 135 HIS A HD2  1  
ATOM 2006  H HE1  . HIS A 1 135 ? -6.045  -16.969 -5.875  1.00 3.19  ? 135 HIS A HE1  1  
ATOM 2007  H HE2  . HIS A 1 135 ? -4.537  -17.771 -7.730  1.00 2.82  ? 135 HIS A HE2  1  
ATOM 2008  N N    . ALA A 1 136 ? -1.654  -13.817 -3.310  1.00 0.24  ? 136 ALA A N    1  
ATOM 2009  C CA   . ALA A 1 136 ? -2.024  -13.746 -1.906  1.00 0.24  ? 136 ALA A CA   1  
ATOM 2010  C C    . ALA A 1 136 ? -1.767  -12.332 -1.414  1.00 0.21  ? 136 ALA A C    1  
ATOM 2011  O O    . ALA A 1 136 ? -0.717  -11.760 -1.693  1.00 0.22  ? 136 ALA A O    1  
ATOM 2012  C CB   . ALA A 1 136 ? -1.243  -14.760 -1.078  1.00 0.26  ? 136 ALA A CB   1  
ATOM 2013  H H    . ALA A 1 136 ? -0.750  -14.106 -3.558  1.00 0.22  ? 136 ALA A H    1  
ATOM 2014  H HA   . ALA A 1 136 ? -3.079  -13.968 -1.822  1.00 0.28  ? 136 ALA A HA   1  
ATOM 2015  H HB1  . ALA A 1 136 ? -0.184  -14.568 -1.177  1.00 0.98  ? 136 ALA A HB1  1  
ATOM 2016  H HB2  . ALA A 1 136 ? -1.462  -15.757 -1.432  1.00 1.04  ? 136 ALA A HB2  1  
ATOM 2017  H HB3  . ALA A 1 136 ? -1.529  -14.676 -0.041  1.00 1.04  ? 136 ALA A HB3  1  
ATOM 2018  N N    . ALA A 1 137 ? -2.707  -11.760 -0.693  1.00 0.18  ? 137 ALA A N    1  
ATOM 2019  C CA   . ALA A 1 137 ? -2.611  -10.352 -0.347  1.00 0.19  ? 137 ALA A CA   1  
ATOM 2020  C C    . ALA A 1 137 ? -1.623  -10.154 0.796   1.00 0.16  ? 137 ALA A C    1  
ATOM 2021  O O    . ALA A 1 137 ? -1.843  -10.615 1.916   1.00 0.20  ? 137 ALA A O    1  
ATOM 2022  C CB   . ALA A 1 137 ? -3.982  -9.781  -0.005  1.00 0.22  ? 137 ALA A CB   1  
ATOM 2023  H H    . ALA A 1 137 ? -3.454  -12.300 -0.349  1.00 0.18  ? 137 ALA A H    1  
ATOM 2024  H HA   . ALA A 1 137 ? -2.241  -9.830  -1.222  1.00 0.21  ? 137 ALA A HA   1  
ATOM 2025  H HB1  . ALA A 1 137 ? -3.880  -8.747  0.287   1.00 1.03  ? 137 ALA A HB1  1  
ATOM 2026  H HB2  . ALA A 1 137 ? -4.417  -10.341 0.805   1.00 1.05  ? 137 ALA A HB2  1  
ATOM 2027  H HB3  . ALA A 1 137 ? -4.623  -9.849  -0.871  1.00 1.04  ? 137 ALA A HB3  1  
ATOM 2028  N N    . LEU A 1 138 ? -0.521  -9.494  0.494   1.00 0.13  ? 138 LEU A N    1  
ATOM 2029  C CA   . LEU A 1 138 ? 0.537   -9.278  1.463   1.00 0.12  ? 138 LEU A CA   1  
ATOM 2030  C C    . LEU A 1 138 ? 0.301   -7.972  2.210   1.00 0.13  ? 138 LEU A C    1  
ATOM 2031  O O    . LEU A 1 138 ? 0.040   -6.941  1.597   1.00 0.15  ? 138 LEU A O    1  
ATOM 2032  C CB   . LEU A 1 138 ? 1.891   -9.237  0.755   1.00 0.13  ? 138 LEU A CB   1  
ATOM 2033  C CG   . LEU A 1 138 ? 2.964   -10.132 1.363   1.00 0.15  ? 138 LEU A CG   1  
ATOM 2034  C CD1  . LEU A 1 138 ? 2.468   -11.557 1.445   1.00 0.22  ? 138 LEU A CD1  1  
ATOM 2035  C CD2  . LEU A 1 138 ? 4.245   -10.056 0.555   1.00 0.19  ? 138 LEU A CD2  1  
ATOM 2036  H H    . LEU A 1 138 ? -0.415  -9.133  -0.411  1.00 0.13  ? 138 LEU A H    1  
ATOM 2037  H HA   . LEU A 1 138 ? 0.529   -10.104 2.160   1.00 0.12  ? 138 LEU A HA   1  
ATOM 2038  H HB2  . LEU A 1 138 ? 1.744   -9.528  -0.273  1.00 0.16  ? 138 LEU A HB2  1  
ATOM 2039  H HB3  . LEU A 1 138 ? 2.253   -8.219  0.773   1.00 0.19  ? 138 LEU A HB3  1  
ATOM 2040  H HG   . LEU A 1 138 ? 3.181   -9.797  2.362   1.00 0.19  ? 138 LEU A HG   1  
ATOM 2041  H HD11 . LEU A 1 138 ? 2.243   -11.914 0.453   1.00 1.05  ? 138 LEU A HD11 1  
ATOM 2042  H HD12 . LEU A 1 138 ? 1.575   -11.588 2.051   1.00 1.06  ? 138 LEU A HD12 1  
ATOM 2043  H HD13 . LEU A 1 138 ? 3.229   -12.181 1.889   1.00 1.01  ? 138 LEU A HD13 1  
ATOM 2044  H HD21 . LEU A 1 138 ? 4.997   -10.685 1.008   1.00 0.98  ? 138 LEU A HD21 1  
ATOM 2045  H HD22 . LEU A 1 138 ? 4.595   -9.035  0.532   1.00 0.93  ? 138 LEU A HD22 1  
ATOM 2046  H HD23 . LEU A 1 138 ? 4.053   -10.392 -0.455  1.00 1.01  ? 138 LEU A HD23 1  
ATOM 2047  N N    . CYS A 1 139 ? 0.399   -8.010  3.526   1.00 0.13  ? 139 CYS A N    1  
ATOM 2048  C CA   . CYS A 1 139 ? 0.226   -6.813  4.328   1.00 0.14  ? 139 CYS A CA   1  
ATOM 2049  C C    . CYS A 1 139 ? 1.532   -6.487  5.032   1.00 0.13  ? 139 CYS A C    1  
ATOM 2050  O O    . CYS A 1 139 ? 1.875   -7.083  6.045   1.00 0.14  ? 139 CYS A O    1  
ATOM 2051  C CB   . CYS A 1 139 ? -0.889  -7.028  5.346   1.00 0.18  ? 139 CYS A CB   1  
ATOM 2052  S SG   . CYS A 1 139 ? -1.567  -5.507  6.045   1.00 1.20  ? 139 CYS A SG   1  
ATOM 2053  H H    . CYS A 1 139 ? 0.599   -8.864  3.972   1.00 0.14  ? 139 CYS A H    1  
ATOM 2054  H HA   . CYS A 1 139 ? -0.037  -5.996  3.671   1.00 0.16  ? 139 CYS A HA   1  
ATOM 2055  H HB2  . CYS A 1 139 ? -1.700  -7.564  4.879   1.00 0.82  ? 139 CYS A HB2  1  
ATOM 2056  H HB3  . CYS A 1 139 ? -0.500  -7.617  6.159   1.00 0.80  ? 139 CYS A HB3  1  
ATOM 2057  H HG   . CYS A 1 139 ? -2.726  -5.270  5.445   1.00 1.82  ? 139 CYS A HG   1  
ATOM 2058  N N    . LEU A 1 140 ? 2.259   -5.543  4.486   1.00 0.13  ? 140 LEU A N    1  
ATOM 2059  C CA   . LEU A 1 140 ? 3.603   -5.260  4.945   1.00 0.14  ? 140 LEU A CA   1  
ATOM 2060  C C    . LEU A 1 140 ? 3.698   -3.891  5.591   1.00 0.13  ? 140 LEU A C    1  
ATOM 2061  O O    . LEU A 1 140 ? 3.142   -2.916  5.097   1.00 0.12  ? 140 LEU A O    1  
ATOM 2062  C CB   . LEU A 1 140 ? 4.579   -5.377  3.783   1.00 0.17  ? 140 LEU A CB   1  
ATOM 2063  C CG   . LEU A 1 140 ? 4.210   -4.570  2.550   1.00 0.17  ? 140 LEU A CG   1  
ATOM 2064  C CD1  . LEU A 1 140 ? 5.065   -3.320  2.492   1.00 0.26  ? 140 LEU A CD1  1  
ATOM 2065  C CD2  . LEU A 1 140 ? 4.375   -5.408  1.292   1.00 0.32  ? 140 LEU A CD2  1  
ATOM 2066  H H    . LEU A 1 140 ? 1.879   -5.012  3.747   1.00 0.14  ? 140 LEU A H    1  
ATOM 2067  H HA   . LEU A 1 140 ? 3.859   -6.007  5.684   1.00 0.16  ? 140 LEU A HA   1  
ATOM 2068  H HB2  . LEU A 1 140 ? 5.543   -5.036  4.127   1.00 0.18  ? 140 LEU A HB2  1  
ATOM 2069  H HB3  . LEU A 1 140 ? 4.658   -6.415  3.503   1.00 0.21  ? 140 LEU A HB3  1  
ATOM 2070  H HG   . LEU A 1 140 ? 3.172   -4.270  2.626   1.00 0.24  ? 140 LEU A HG   1  
ATOM 2071  H HD11 . LEU A 1 140 ? 4.805   -2.739  1.622   1.00 1.15  ? 140 LEU A HD11 1  
ATOM 2072  H HD12 . LEU A 1 140 ? 6.107   -3.606  2.442   1.00 1.03  ? 140 LEU A HD12 1  
ATOM 2073  H HD13 . LEU A 1 140 ? 4.900   -2.733  3.384   1.00 1.00  ? 140 LEU A HD13 1  
ATOM 2074  H HD21 . LEU A 1 140 ? 4.086   -4.826  0.430   1.00 1.03  ? 140 LEU A HD21 1  
ATOM 2075  H HD22 . LEU A 1 140 ? 3.747   -6.286  1.360   1.00 1.08  ? 140 LEU A HD22 1  
ATOM 2076  H HD23 . LEU A 1 140 ? 5.407   -5.710  1.193   1.00 1.04  ? 140 LEU A HD23 1  
ATOM 2077  N N    . GLU A 1 141 ? 4.391   -3.836  6.708   1.00 0.14  ? 141 GLU A N    1  
ATOM 2078  C CA   . GLU A 1 141 ? 4.546   -2.609  7.456   1.00 0.13  ? 141 GLU A CA   1  
ATOM 2079  C C    . GLU A 1 141 ? 5.947   -2.055  7.226   1.00 0.12  ? 141 GLU A C    1  
ATOM 2080  O O    . GLU A 1 141 ? 6.930   -2.664  7.647   1.00 0.15  ? 141 GLU A O    1  
ATOM 2081  C CB   . GLU A 1 141 ? 4.293   -2.923  8.927   1.00 0.18  ? 141 GLU A CB   1  
ATOM 2082  C CG   . GLU A 1 141 ? 4.417   -1.753  9.877   1.00 0.26  ? 141 GLU A CG   1  
ATOM 2083  C CD   . GLU A 1 141 ? 4.157   -2.193  11.303  1.00 0.30  ? 141 GLU A CD   1  
ATOM 2084  O OE1  . GLU A 1 141 ? 3.162   -2.919  11.532  1.00 1.00  ? 141 GLU A OE1  1  
ATOM 2085  O OE2  . GLU A 1 141 ? 4.960   -1.860  12.191  1.00 1.05  ? 141 GLU A OE2  1  
ATOM 2086  H H    . GLU A 1 141 ? 4.835   -4.650  7.035   1.00 0.18  ? 141 GLU A H    1  
ATOM 2087  H HA   . GLU A 1 141 ? 3.814   -1.900  7.106   1.00 0.13  ? 141 GLU A HA   1  
ATOM 2088  H HB2  . GLU A 1 141 ? 3.295   -3.323  9.022   1.00 0.30  ? 141 GLU A HB2  1  
ATOM 2089  H HB3  . GLU A 1 141 ? 4.996   -3.683  9.239   1.00 0.24  ? 141 GLU A HB3  1  
ATOM 2090  H HG2  . GLU A 1 141 ? 5.420   -1.343  9.807   1.00 0.38  ? 141 GLU A HG2  1  
ATOM 2091  H HG3  . GLU A 1 141 ? 3.693   -0.999  9.606   1.00 0.41  ? 141 GLU A HG3  1  
ATOM 2092  N N    . VAL A 1 142 ? 6.040   -0.932  6.528   1.00 0.12  ? 142 VAL A N    1  
ATOM 2093  C CA   . VAL A 1 142 ? 7.331   -0.393  6.139   1.00 0.12  ? 142 VAL A CA   1  
ATOM 2094  C C    . VAL A 1 142 ? 7.654   0.939   6.816   1.00 0.12  ? 142 VAL A C    1  
ATOM 2095  O O    . VAL A 1 142 ? 6.954   1.938   6.645   1.00 0.15  ? 142 VAL A O    1  
ATOM 2096  C CB   . VAL A 1 142 ? 7.449   -0.245  4.607   1.00 0.14  ? 142 VAL A CB   1  
ATOM 2097  C CG1  . VAL A 1 142 ? 7.744   -1.590  3.968   1.00 0.19  ? 142 VAL A CG1  1  
ATOM 2098  C CG2  . VAL A 1 142 ? 6.178   0.348   4.011   1.00 0.19  ? 142 VAL A CG2  1  
ATOM 2099  H H    . VAL A 1 142 ? 5.222   -0.459  6.259   1.00 0.15  ? 142 VAL A H    1  
ATOM 2100  H HA   . VAL A 1 142 ? 8.075   -1.113  6.448   1.00 0.12  ? 142 VAL A HA   1  
ATOM 2101  H HB   . VAL A 1 142 ? 8.269   0.420   4.392   1.00 0.17  ? 142 VAL A HB   1  
ATOM 2102  H HG11 . VAL A 1 142 ? 7.848   -1.466  2.901   1.00 0.97  ? 142 VAL A HG11 1  
ATOM 2103  H HG12 . VAL A 1 142 ? 6.931   -2.274  4.174   1.00 0.99  ? 142 VAL A HG12 1  
ATOM 2104  H HG13 . VAL A 1 142 ? 8.662   -1.989  4.374   1.00 1.08  ? 142 VAL A HG13 1  
ATOM 2105  H HG21 . VAL A 1 142 ? 5.343   -0.305  4.218   1.00 0.98  ? 142 VAL A HG21 1  
ATOM 2106  H HG22 . VAL A 1 142 ? 6.298   0.450   2.944   1.00 1.01  ? 142 VAL A HG22 1  
ATOM 2107  H HG23 . VAL A 1 142 ? 5.992   1.321   4.447   1.00 1.02  ? 142 VAL A HG23 1  
ATOM 2108  N N    . THR A 1 143 ? 8.717   0.913   7.608   1.00 0.13  ? 143 THR A N    1  
ATOM 2109  C CA   . THR A 1 143 ? 9.288   2.104   8.216   1.00 0.13  ? 143 THR A CA   1  
ATOM 2110  C C    . THR A 1 143 ? 10.320  2.729   7.289   1.00 0.12  ? 143 THR A C    1  
ATOM 2111  O O    . THR A 1 143 ? 11.399  2.172   7.090   1.00 0.15  ? 143 THR A O    1  
ATOM 2112  C CB   . THR A 1 143 ? 10.005  1.746   9.535   1.00 0.17  ? 143 THR A CB   1  
ATOM 2113  O OG1  . THR A 1 143 ? 9.296   0.696   10.209  1.00 0.28  ? 143 THR A OG1  1  
ATOM 2114  C CG2  . THR A 1 143 ? 10.100  2.963   10.442  1.00 0.22  ? 143 THR A CG2  1  
ATOM 2115  H H    . THR A 1 143 ? 9.115   0.039   7.820   1.00 0.15  ? 143 THR A H    1  
ATOM 2116  H HA   . THR A 1 143 ? 8.504   2.821   8.420   1.00 0.14  ? 143 THR A HA   1  
ATOM 2117  H HB   . THR A 1 143 ? 11.017  1.408   9.303   1.00 0.16  ? 143 THR A HB   1  
ATOM 2118  H HG1  . THR A 1 143 ? 9.012   1.005   11.084  1.00 0.69  ? 143 THR A HG1  1  
ATOM 2119  H HG21 . THR A 1 143 ? 10.721  3.712   9.971   1.00 0.99  ? 143 THR A HG21 1  
ATOM 2120  H HG22 . THR A 1 143 ? 10.536  2.675   11.388  1.00 1.00  ? 143 THR A HG22 1  
ATOM 2121  H HG23 . THR A 1 143 ? 9.111   3.364   10.607  1.00 1.09  ? 143 THR A HG23 1  
ATOM 2122  N N    . LEU A 1 144 ? 9.990   3.870   6.716   1.00 0.13  ? 144 LEU A N    1  
ATOM 2123  C CA   . LEU A 1 144 ? 10.963  4.630   5.953   1.00 0.12  ? 144 LEU A CA   1  
ATOM 2124  C C    . LEU A 1 144 ? 11.801  5.436   6.920   1.00 0.12  ? 144 LEU A C    1  
ATOM 2125  O O    . LEU A 1 144 ? 11.429  6.532   7.315   1.00 0.14  ? 144 LEU A O    1  
ATOM 2126  C CB   . LEU A 1 144 ? 10.258  5.541   4.946   1.00 0.14  ? 144 LEU A CB   1  
ATOM 2127  C CG   . LEU A 1 144 ? 11.168  6.403   4.076   1.00 0.12  ? 144 LEU A CG   1  
ATOM 2128  C CD1  . LEU A 1 144 ? 12.089  5.537   3.228   1.00 0.15  ? 144 LEU A CD1  1  
ATOM 2129  C CD2  . LEU A 1 144 ? 10.324  7.309   3.194   1.00 0.13  ? 144 LEU A CD2  1  
ATOM 2130  H H    . LEU A 1 144 ? 9.074   4.219   6.817   1.00 0.16  ? 144 LEU A H    1  
ATOM 2131  H HA   . LEU A 1 144 ? 11.610  3.938   5.434   1.00 0.14  ? 144 LEU A HA   1  
ATOM 2132  H HB2  . LEU A 1 144 ? 9.663   4.921   4.296   1.00 0.16  ? 144 LEU A HB2  1  
ATOM 2133  H HB3  . LEU A 1 144 ? 9.593   6.197   5.494   1.00 0.15  ? 144 LEU A HB3  1  
ATOM 2134  H HG   . LEU A 1 144 ? 11.781  7.025   4.710   1.00 0.12  ? 144 LEU A HG   1  
ATOM 2135  H HD11 . LEU A 1 144 ? 12.717  4.940   3.874   1.00 0.98  ? 144 LEU A HD11 1  
ATOM 2136  H HD12 . LEU A 1 144 ? 12.709  6.167   2.607   1.00 0.99  ? 144 LEU A HD12 1  
ATOM 2137  H HD13 . LEU A 1 144 ? 11.495  4.888   2.600   1.00 1.07  ? 144 LEU A HD13 1  
ATOM 2138  H HD21 . LEU A 1 144 ? 9.712   7.946   3.816   1.00 1.01  ? 144 LEU A HD21 1  
ATOM 2139  H HD22 . LEU A 1 144 ? 9.690   6.707   2.562   1.00 1.04  ? 144 LEU A HD22 1  
ATOM 2140  H HD23 . LEU A 1 144 ? 10.971  7.918   2.581   1.00 1.02  ? 144 LEU A HD23 1  
ATOM 2141  N N    . LYS A 1 145 ? 12.920  4.864   7.321   1.00 0.14  ? 145 LYS A N    1  
ATOM 2142  C CA   . LYS A 1 145 ? 13.715  5.436   8.389   1.00 0.17  ? 145 LYS A CA   1  
ATOM 2143  C C    . LYS A 1 145 ? 14.741  6.406   7.835   1.00 0.16  ? 145 LYS A C    1  
ATOM 2144  O O    . LYS A 1 145 ? 15.116  7.375   8.492   1.00 0.21  ? 145 LYS A O    1  
ATOM 2145  C CB   . LYS A 1 145 ? 14.426  4.327   9.165   1.00 0.26  ? 145 LYS A CB   1  
ATOM 2146  C CG   . LYS A 1 145 ? 13.554  3.113   9.436   1.00 0.40  ? 145 LYS A CG   1  
ATOM 2147  C CD   . LYS A 1 145 ? 14.341  2.013   10.125  1.00 0.60  ? 145 LYS A CD   1  
ATOM 2148  C CE   . LYS A 1 145 ? 15.486  1.551   9.249   1.00 0.38  ? 145 LYS A CE   1  
ATOM 2149  N NZ   . LYS A 1 145 ? 16.491  0.748   10.007  1.00 1.08  ? 145 LYS A NZ   1  
ATOM 2150  H H    . LYS A 1 145 ? 13.223  4.038   6.880   1.00 0.17  ? 145 LYS A H    1  
ATOM 2151  H HA   . LYS A 1 145 ? 13.053  5.965   9.055   1.00 0.21  ? 145 LYS A HA   1  
ATOM 2152  H HB2  . LYS A 1 145 ? 15.291  4.006   8.606   1.00 0.26  ? 145 LYS A HB2  1  
ATOM 2153  H HB3  . LYS A 1 145 ? 14.749  4.723   10.115  1.00 0.32  ? 145 LYS A HB3  1  
ATOM 2154  H HG2  . LYS A 1 145 ? 12.730  3.406   10.067  1.00 0.63  ? 145 LYS A HG2  1  
ATOM 2155  H HG3  . LYS A 1 145 ? 13.179  2.739   8.497   1.00 0.65  ? 145 LYS A HG3  1  
ATOM 2156  H HD2  . LYS A 1 145 ? 14.736  2.388   11.057  1.00 1.02  ? 145 LYS A HD2  1  
ATOM 2157  H HD3  . LYS A 1 145 ? 13.682  1.173   10.315  1.00 1.10  ? 145 LYS A HD3  1  
ATOM 2158  H HE2  . LYS A 1 145 ? 15.067  0.944   8.458   1.00 0.84  ? 145 LYS A HE2  1  
ATOM 2159  H HE3  . LYS A 1 145 ? 15.971  2.417   8.820   1.00 0.96  ? 145 LYS A HE3  1  
ATOM 2160  H HZ1  . LYS A 1 145 ? 16.159  -0.235  10.113  1.00 1.58  ? 145 LYS A HZ1  1  
ATOM 2161  H HZ2  . LYS A 1 145 ? 16.637  1.156   10.953  1.00 1.69  ? 145 LYS A HZ2  1  
ATOM 2162  H HZ3  . LYS A 1 145 ? 17.409  0.745   9.503   1.00 1.60  ? 145 LYS A HZ3  1  
ATOM 2163  N N    . THR A 1 146 ? 15.208  6.143   6.629   1.00 0.16  ? 146 THR A N    1  
ATOM 2164  C CA   . THR A 1 146 ? 16.255  6.953   6.049   1.00 0.19  ? 146 THR A CA   1  
ATOM 2165  C C    . THR A 1 146 ? 16.124  7.024   4.536   1.00 0.17  ? 146 THR A C    1  
ATOM 2166  O O    . THR A 1 146 ? 15.611  6.103   3.901   1.00 0.16  ? 146 THR A O    1  
ATOM 2167  C CB   . THR A 1 146 ? 17.642  6.372   6.388   1.00 0.25  ? 146 THR A CB   1  
ATOM 2168  O OG1  . THR A 1 146 ? 17.689  5.977   7.767   1.00 0.25  ? 146 THR A OG1  1  
ATOM 2169  C CG2  . THR A 1 146 ? 18.753  7.376   6.115   1.00 0.37  ? 146 THR A CG2  1  
ATOM 2170  H H    . THR A 1 146 ? 14.849  5.384   6.121   1.00 0.19  ? 146 THR A H    1  
ATOM 2171  H HA   . THR A 1 146 ? 16.180  7.941   6.461   1.00 0.22  ? 146 THR A HA   1  
ATOM 2172  H HB   . THR A 1 146 ? 17.802  5.500   5.761   1.00 0.29  ? 146 THR A HB   1  
ATOM 2173  H HG1  . THR A 1 146 ? 17.069  6.520   8.273   1.00 0.44  ? 146 THR A HG1  1  
ATOM 2174  H HG21 . THR A 1 146 ? 18.629  8.238   6.756   1.00 1.12  ? 146 THR A HG21 1  
ATOM 2175  H HG22 . THR A 1 146 ? 18.708  7.688   5.079   1.00 1.08  ? 146 THR A HG22 1  
ATOM 2176  H HG23 . THR A 1 146 ? 19.708  6.915   6.312   1.00 1.06  ? 146 THR A HG23 1  
ATOM 2177  N N    . ALA A 1 147 ? 16.594  8.122   3.972   1.00 0.20  ? 147 ALA A N    1  
ATOM 2178  C CA   . ALA A 1 147 ? 16.689  8.270   2.536   1.00 0.19  ? 147 ALA A CA   1  
ATOM 2179  C C    . ALA A 1 147 ? 17.987  8.968   2.190   1.00 0.22  ? 147 ALA A C    1  
ATOM 2180  O O    . ALA A 1 147 ? 18.286  10.022  2.747   1.00 0.25  ? 147 ALA A O    1  
ATOM 2181  C CB   . ALA A 1 147 ? 15.505  9.065   2.011   1.00 0.21  ? 147 ALA A CB   1  
ATOM 2182  H H    . ALA A 1 147 ? 16.898  8.860   4.542   1.00 0.24  ? 147 ALA A H    1  
ATOM 2183  H HA   . ALA A 1 147 ? 16.679  7.288   2.091   1.00 0.19  ? 147 ALA A HA   1  
ATOM 2184  H HB1  . ALA A 1 147 ? 14.586  8.565   2.285   1.00 0.96  ? 147 ALA A HB1  1  
ATOM 2185  H HB2  . ALA A 1 147 ? 15.568  9.140   0.936   1.00 0.98  ? 147 ALA A HB2  1  
ATOM 2186  H HB3  . ALA A 1 147 ? 15.519  10.055  2.443   1.00 0.99  ? 147 ALA A HB3  1  
ATOM 2187  N N    . VAL A 1 148 ? 18.767  8.387   1.287   1.00 0.24  ? 148 VAL A N    1  
ATOM 2188  C CA   . VAL A 1 148 ? 20.037  8.991   0.910   1.00 0.31  ? 148 VAL A CA   1  
ATOM 2189  C C    . VAL A 1 148 ? 20.176  9.022   -0.603  1.00 0.34  ? 148 VAL A C    1  
ATOM 2190  O O    . VAL A 1 148 ? 19.722  8.114   -1.302  1.00 0.36  ? 148 VAL A O    1  
ATOM 2191  C CB   . VAL A 1 148 ? 21.252  8.265   1.547   1.00 0.42  ? 148 VAL A CB   1  
ATOM 2192  C CG1  . VAL A 1 148 ? 21.106  8.193   3.057   1.00 0.92  ? 148 VAL A CG1  1  
ATOM 2193  C CG2  . VAL A 1 148 ? 21.432  6.870   0.979   1.00 0.75  ? 148 VAL A CG2  1  
ATOM 2194  H H    . VAL A 1 148 ? 18.482  7.542   0.855   1.00 0.24  ? 148 VAL A H    1  
ATOM 2195  H HA   . VAL A 1 148 ? 20.028  10.011  1.270   1.00 0.36  ? 148 VAL A HA   1  
ATOM 2196  H HB   . VAL A 1 148 ? 22.142  8.838   1.323   1.00 0.93  ? 148 VAL A HB   1  
ATOM 2197  H HG11 . VAL A 1 148 ? 20.188  7.675   3.303   1.00 1.58  ? 148 VAL A HG11 1  
ATOM 2198  H HG12 . VAL A 1 148 ? 21.078  9.190   3.465   1.00 1.62  ? 148 VAL A HG12 1  
ATOM 2199  H HG13 . VAL A 1 148 ? 21.946  7.656   3.474   1.00 1.28  ? 148 VAL A HG13 1  
ATOM 2200  H HG21 . VAL A 1 148 ? 21.608  6.934   -0.084  1.00 1.27  ? 148 VAL A HG21 1  
ATOM 2201  H HG22 . VAL A 1 148 ? 20.539  6.292   1.163   1.00 1.35  ? 148 VAL A HG22 1  
ATOM 2202  H HG23 . VAL A 1 148 ? 22.275  6.392   1.456   1.00 1.29  ? 148 VAL A HG23 1  
ATOM 2203  N N    . ASP A 1 149 ? 20.804  10.063  -1.107  1.00 0.44  ? 149 ASP A N    1  
ATOM 2204  C CA   . ASP A 1 149 ? 20.894  10.266  -2.540  1.00 0.52  ? 149 ASP A CA   1  
ATOM 2205  C C    . ASP A 1 149 ? 22.168  9.633   -3.080  1.00 0.66  ? 149 ASP A C    1  
ATOM 2206  O O    . ASP A 1 149 ? 23.274  10.015  -2.697  1.00 0.79  ? 149 ASP A O    1  
ATOM 2207  C CB   . ASP A 1 149 ? 20.843  11.760  -2.862  1.00 0.68  ? 149 ASP A CB   1  
ATOM 2208  C CG   . ASP A 1 149 ? 21.168  12.070  -4.310  1.00 1.41  ? 149 ASP A CG   1  
ATOM 2209  O OD1  . ASP A 1 149 ? 20.856  11.246  -5.197  1.00 2.27  ? 149 ASP A OD1  1  
ATOM 2210  O OD2  . ASP A 1 149 ? 21.746  13.146  -4.567  1.00 1.61  ? 149 ASP A OD2  1  
ATOM 2211  H H    . ASP A 1 149 ? 21.247  10.698  -0.504  1.00 0.52  ? 149 ASP A H    1  
ATOM 2212  H HA   . ASP A 1 149 ? 20.036  9.780   -2.996  1.00 0.43  ? 149 ASP A HA   1  
ATOM 2213  H HB2  . ASP A 1 149 ? 19.846  12.127  -2.651  1.00 0.86  ? 149 ASP A HB2  1  
ATOM 2214  H HB3  . ASP A 1 149 ? 21.552  12.278  -2.234  1.00 1.18  ? 149 ASP A HB3  1  
ATOM 2215  N N    . LEU A 1 150 ? 22.011  8.665   -3.967  1.00 0.68  ? 150 LEU A N    1  
ATOM 2216  C CA   . LEU A 1 150 ? 23.144  7.897   -4.462  1.00 0.89  ? 150 LEU A CA   1  
ATOM 2217  C C    . LEU A 1 150 ? 22.966  7.612   -5.948  1.00 0.96  ? 150 LEU A C    1  
ATOM 2218  O O    . LEU A 1 150 ? 23.722  6.850   -6.549  1.00 1.38  ? 150 LEU A O    1  
ATOM 2219  C CB   . LEU A 1 150 ? 23.258  6.581   -3.676  1.00 1.00  ? 150 LEU A CB   1  
ATOM 2220  C CG   . LEU A 1 150 ? 24.596  5.850   -3.801  1.00 1.09  ? 150 LEU A CG   1  
ATOM 2221  C CD1  . LEU A 1 150 ? 25.705  6.643   -3.125  1.00 1.81  ? 150 LEU A CD1  1  
ATOM 2222  C CD2  . LEU A 1 150 ? 24.495  4.451   -3.206  1.00 1.97  ? 150 LEU A CD2  1  
ATOM 2223  H H    . LEU A 1 150 ? 21.113  8.467   -4.307  1.00 0.59  ? 150 LEU A H    1  
ATOM 2224  H HA   . LEU A 1 150 ? 24.040  8.481   -4.317  1.00 1.01  ? 150 LEU A HA   1  
ATOM 2225  H HB2  . LEU A 1 150 ? 23.084  6.797   -2.631  1.00 1.42  ? 150 LEU A HB2  1  
ATOM 2226  H HB3  . LEU A 1 150 ? 22.477  5.915   -4.017  1.00 1.50  ? 150 LEU A HB3  1  
ATOM 2227  H HG   . LEU A 1 150 ? 24.847  5.749   -4.848  1.00 1.50  ? 150 LEU A HG   1  
ATOM 2228  H HD11 . LEU A 1 150 ? 25.505  6.716   -2.064  1.00 2.37  ? 150 LEU A HD11 1  
ATOM 2229  H HD12 . LEU A 1 150 ? 25.748  7.634   -3.551  1.00 2.20  ? 150 LEU A HD12 1  
ATOM 2230  H HD13 . LEU A 1 150 ? 26.649  6.144   -3.278  1.00 2.36  ? 150 LEU A HD13 1  
ATOM 2231  H HD21 . LEU A 1 150 ? 23.737  3.892   -3.734  1.00 2.50  ? 150 LEU A HD21 1  
ATOM 2232  H HD22 . LEU A 1 150 ? 24.228  4.521   -2.163  1.00 2.46  ? 150 LEU A HD22 1  
ATOM 2233  H HD23 . LEU A 1 150 ? 25.446  3.948   -3.302  1.00 2.44  ? 150 LEU A HD23 1  
ATOM 2234  N N    . GLU A 1 151 ? 21.978  8.259   -6.544  1.00 0.72  ? 151 GLU A N    1  
ATOM 2235  C CA   . GLU A 1 151 ? 21.621  7.989   -7.923  1.00 0.79  ? 151 GLU A CA   1  
ATOM 2236  C C    . GLU A 1 151 ? 21.886  9.216   -8.784  1.00 1.44  ? 151 GLU A C    1  
ATOM 2237  O O    . GLU A 1 151 ? 21.164  10.210  -8.715  1.00 2.14  ? 151 GLU A O    1  
ATOM 2238  C CB   . GLU A 1 151 ? 20.150  7.574   -7.992  1.00 0.57  ? 151 GLU A CB   1  
ATOM 2239  C CG   . GLU A 1 151 ? 19.670  7.163   -9.368  1.00 0.60  ? 151 GLU A CG   1  
ATOM 2240  C CD   . GLU A 1 151 ? 20.673  6.276   -10.079 1.00 0.92  ? 151 GLU A CD   1  
ATOM 2241  O OE1  . GLU A 1 151 ? 20.626  5.044   -9.887  1.00 1.57  ? 151 GLU A OE1  1  
ATOM 2242  O OE2  . GLU A 1 151 ? 21.538  6.822   -10.805 1.00 1.32  ? 151 GLU A OE2  1  
ATOM 2243  H H    . GLU A 1 151 ? 21.492  8.954   -6.052  1.00 0.72  ? 151 GLU A H    1  
ATOM 2244  H HA   . GLU A 1 151 ? 22.236  7.172   -8.273  1.00 1.12  ? 151 GLU A HA   1  
ATOM 2245  H HB2  . GLU A 1 151 ? 19.997  6.740   -7.326  1.00 0.95  ? 151 GLU A HB2  1  
ATOM 2246  H HB3  . GLU A 1 151 ? 19.544  8.402   -7.658  1.00 1.07  ? 151 GLU A HB3  1  
ATOM 2247  H HG2  . GLU A 1 151 ? 18.728  6.620   -9.260  1.00 0.93  ? 151 GLU A HG2  1  
ATOM 2248  H HG3  . GLU A 1 151 ? 19.512  8.054   -9.955  1.00 0.97  ? 151 GLU A HG3  1  
ATOM 2249  N N    . HIS A 1 152 ? 22.954  9.153   -9.563  1.00 2.00  ? 152 HIS A N    1  
ATOM 2250  C CA   . HIS A 1 152 ? 23.346  10.265  -10.419 1.00 2.74  ? 152 HIS A CA   1  
ATOM 2251  C C    . HIS A 1 152 ? 23.900  9.739   -11.741 1.00 3.34  ? 152 HIS A C    1  
ATOM 2252  O O    . HIS A 1 152 ? 24.558  10.472  -12.480 1.00 4.01  ? 152 HIS A O    1  
ATOM 2253  C CB   . HIS A 1 152 ? 24.423  11.124  -9.735  1.00 3.58  ? 152 HIS A CB   1  
ATOM 2254  C CG   . HIS A 1 152 ? 24.085  11.563  -8.342  1.00 4.23  ? 152 HIS A CG   1  
ATOM 2255  N ND1  . HIS A 1 152 ? 24.561  10.915  -7.225  1.00 4.97  ? 152 HIS A ND1  1  
ATOM 2256  C CD2  . HIS A 1 152 ? 23.336  12.594  -7.888  1.00 4.78  ? 152 HIS A CD2  1  
ATOM 2257  C CE1  . HIS A 1 152 ? 24.121  11.527  -6.144  1.00 5.79  ? 152 HIS A CE1  1  
ATOM 2258  N NE2  . HIS A 1 152 ? 23.375  12.549  -6.514  1.00 5.71  ? 152 HIS A NE2  1  
ATOM 2259  H H    . HIS A 1 152 ? 23.490  8.335   -9.566  1.00 2.34  ? 152 HIS A H    1  
ATOM 2260  H HA   . HIS A 1 152 ? 22.474  10.870  -10.613 1.00 2.87  ? 152 HIS A HA   1  
ATOM 2261  H HB2  . HIS A 1 152 ? 25.341  10.561  -9.686  1.00 3.90  ? 152 HIS A HB2  1  
ATOM 2262  H HB3  . HIS A 1 152 ? 24.588  12.011  -10.330 1.00 4.03  ? 152 HIS A HB3  1  
ATOM 2263  H HD1  . HIS A 1 152 ? 25.133  10.108  -7.226  1.00 5.15  ? 152 HIS A HD1  1  
ATOM 2264  H HD2  . HIS A 1 152 ? 22.800  13.314  -8.492  1.00 4.83  ? 152 HIS A HD2  1  
ATOM 2265  H HE1  . HIS A 1 152 ? 24.330  11.236  -5.125  1.00 6.63  ? 152 HIS A HE1  1  
ATOM 2266  H HE2  . HIS A 1 152 ? 22.734  13.011  -5.915  1.00 6.40  ? 152 HIS A HE2  1  
ATOM 2267  N N    . HIS A 1 153 ? 23.624  8.473   -12.046 1.00 3.70  ? 153 HIS A N    1  
ATOM 2268  C CA   . HIS A 1 153 ? 24.221  7.830   -13.214 1.00 4.77  ? 153 HIS A CA   1  
ATOM 2269  C C    . HIS A 1 153 ? 23.167  7.527   -14.272 1.00 5.09  ? 153 HIS A C    1  
ATOM 2270  O O    . HIS A 1 153 ? 22.026  7.198   -13.949 1.00 5.37  ? 153 HIS A O    1  
ATOM 2271  C CB   . HIS A 1 153 ? 24.975  6.541   -12.824 1.00 5.63  ? 153 HIS A CB   1  
ATOM 2272  C CG   . HIS A 1 153 ? 24.125  5.488   -12.167 1.00 6.19  ? 153 HIS A CG   1  
ATOM 2273  N ND1  . HIS A 1 153 ? 23.339  4.607   -12.871 1.00 6.78  ? 153 HIS A ND1  1  
ATOM 2274  C CD2  . HIS A 1 153 ? 23.943  5.183   -10.863 1.00 6.64  ? 153 HIS A CD2  1  
ATOM 2275  C CE1  . HIS A 1 153 ? 22.705  3.817   -12.032 1.00 7.48  ? 153 HIS A CE1  1  
ATOM 2276  N NE2  . HIS A 1 153 ? 23.046  4.141   -10.798 1.00 7.41  ? 153 HIS A NE2  1  
ATOM 2277  H H    . HIS A 1 153 ? 22.967  7.973   -11.501 1.00 3.55  ? 153 HIS A H    1  
ATOM 2278  H HA   . HIS A 1 153 ? 24.928  8.529   -13.638 1.00 5.10  ? 153 HIS A HA   1  
ATOM 2279  H HB2  . HIS A 1 153 ? 25.404  6.106   -13.713 1.00 5.99  ? 153 HIS A HB2  1  
ATOM 2280  H HB3  . HIS A 1 153 ? 25.773  6.796   -12.141 1.00 5.91  ? 153 HIS A HB3  1  
ATOM 2281  H HD1  . HIS A 1 153 ? 23.260  4.564   -13.843 1.00 6.89  ? 153 HIS A HD1  1  
ATOM 2282  H HD2  . HIS A 1 153 ? 24.414  5.672   -10.021 1.00 6.66  ? 153 HIS A HD2  1  
ATOM 2283  H HE1  . HIS A 1 153 ? 22.021  3.028   -12.308 1.00 8.19  ? 153 HIS A HE1  1  
ATOM 2284  H HE2  . HIS A 1 153 ? 22.465  3.974   -10.023 1.00 7.98  ? 153 HIS A HE2  1  
ATOM 2285  N N    . HIS A 1 154 ? 23.569  7.639   -15.536 1.00 5.42  ? 154 HIS A N    1  
ATOM 2286  C CA   . HIS A 1 154 ? 22.682  7.408   -16.676 1.00 6.05  ? 154 HIS A CA   1  
ATOM 2287  C C    . HIS A 1 154 ? 21.555  8.438   -16.735 1.00 6.57  ? 154 HIS A C    1  
ATOM 2288  O O    . HIS A 1 154 ? 21.552  9.429   -16.002 1.00 7.00  ? 154 HIS A O    1  
ATOM 2289  C CB   . HIS A 1 154 ? 22.086  5.992   -16.648 1.00 6.58  ? 154 HIS A CB   1  
ATOM 2290  C CG   . HIS A 1 154 ? 23.001  4.920   -17.149 1.00 7.19  ? 154 HIS A CG   1  
ATOM 2291  N ND1  . HIS A 1 154 ? 22.932  3.613   -16.719 1.00 7.60  ? 154 HIS A ND1  1  
ATOM 2292  C CD2  . HIS A 1 154 ? 23.984  4.955   -18.080 1.00 7.78  ? 154 HIS A CD2  1  
ATOM 2293  C CE1  . HIS A 1 154 ? 23.831  2.893   -17.364 1.00 8.35  ? 154 HIS A CE1  1  
ATOM 2294  N NE2  . HIS A 1 154 ? 24.482  3.681   -18.201 1.00 8.46  ? 154 HIS A NE2  1  
ATOM 2295  H H    . HIS A 1 154 ? 24.502  7.903   -15.715 1.00 5.45  ? 154 HIS A H    1  
ATOM 2296  H HA   . HIS A 1 154 ? 23.279  7.509   -17.570 1.00 6.12  ? 154 HIS A HA   1  
ATOM 2297  H HB2  . HIS A 1 154 ? 21.822  5.743   -15.634 1.00 6.69  ? 154 HIS A HB2  1  
ATOM 2298  H HB3  . HIS A 1 154 ? 21.194  5.977   -17.257 1.00 6.79  ? 154 HIS A HB3  1  
ATOM 2299  H HD1  . HIS A 1 154 ? 22.295  3.255   -16.052 1.00 7.56  ? 154 HIS A HD1  1  
ATOM 2300  H HD2  . HIS A 1 154 ? 24.303  5.823   -18.640 1.00 7.91  ? 154 HIS A HD2  1  
ATOM 2301  H HE1  . HIS A 1 154 ? 24.003  1.836   -17.235 1.00 8.95  ? 154 HIS A HE1  1  
ATOM 2302  H HE2  . HIS A 1 154 ? 25.013  3.360   -18.967 1.00 9.08  ? 154 HIS A HE2  1  
ATOM 2303  N N    . HIS A 1 155 ? 20.623  8.195   -17.647 1.00 6.86  ? 155 HIS A N    1  
ATOM 2304  C CA   . HIS A 1 155 ? 19.441  9.029   -17.824 1.00 7.69  ? 155 HIS A CA   1  
ATOM 2305  C C    . HIS A 1 155 ? 18.503  8.316   -18.788 1.00 8.40  ? 155 HIS A C    1  
ATOM 2306  O O    . HIS A 1 155 ? 18.910  7.344   -19.426 1.00 8.69  ? 155 HIS A O    1  
ATOM 2307  C CB   . HIS A 1 155 ? 19.814  10.425  -18.362 1.00 7.95  ? 155 HIS A CB   1  
ATOM 2308  C CG   . HIS A 1 155 ? 20.469  10.429  -19.716 1.00 8.17  ? 155 HIS A CG   1  
ATOM 2309  N ND1  . HIS A 1 155 ? 21.789  10.766  -19.917 1.00 8.40  ? 155 HIS A ND1  1  
ATOM 2310  C CD2  . HIS A 1 155 ? 19.970  10.152  -20.944 1.00 8.48  ? 155 HIS A CD2  1  
ATOM 2311  C CE1  . HIS A 1 155 ? 22.069  10.696  -21.203 1.00 8.78  ? 155 HIS A CE1  1  
ATOM 2312  N NE2  . HIS A 1 155 ? 20.983  10.328  -21.849 1.00 8.83  ? 155 HIS A NE2  1  
ATOM 2313  H H    . HIS A 1 155 ? 20.729  7.414   -18.230 1.00 6.72  ? 155 HIS A H    1  
ATOM 2314  H HA   . HIS A 1 155 ? 18.952  9.130   -16.867 1.00 7.92  ? 155 HIS A HA   1  
ATOM 2315  H HB2  . HIS A 1 155 ? 18.919  11.022  -18.433 1.00 8.01  ? 155 HIS A HB2  1  
ATOM 2316  H HB3  . HIS A 1 155 ? 20.494  10.896  -17.664 1.00 8.23  ? 155 HIS A HB3  1  
ATOM 2317  H HD1  . HIS A 1 155 ? 22.432  11.030  -19.214 1.00 8.44  ? 155 HIS A HD1  1  
ATOM 2318  H HD2  . HIS A 1 155 ? 18.958  9.847   -21.169 1.00 8.62  ? 155 HIS A HD2  1  
ATOM 2319  H HE1  . HIS A 1 155 ? 23.033  10.898  -21.648 1.00 9.16  ? 155 HIS A HE1  1  
ATOM 2320  H HE2  . HIS A 1 155 ? 20.867  10.373  -22.832 1.00 9.24  ? 155 HIS A HE2  1  
ATOM 2321  N N    . HIS A 1 156 ? 17.270  8.783   -18.908 1.00 8.92  ? 156 HIS A N    1  
ATOM 2322  C CA   . HIS A 1 156 ? 16.344  8.189   -19.862 1.00 9.83  ? 156 HIS A CA   1  
ATOM 2323  C C    . HIS A 1 156 ? 15.402  9.240   -20.438 1.00 10.27 ? 156 HIS A C    1  
ATOM 2324  O O    . HIS A 1 156 ? 14.989  10.173  -19.743 1.00 10.47 ? 156 HIS A O    1  
ATOM 2325  C CB   . HIS A 1 156 ? 15.557  7.019   -19.237 1.00 10.32 ? 156 HIS A CB   1  
ATOM 2326  C CG   . HIS A 1 156 ? 14.451  7.404   -18.291 1.00 10.97 ? 156 HIS A CG   1  
ATOM 2327  N ND1  . HIS A 1 156 ? 14.556  7.314   -16.917 1.00 11.47 ? 156 HIS A ND1  1  
ATOM 2328  C CD2  . HIS A 1 156 ? 13.191  7.836   -18.539 1.00 11.42 ? 156 HIS A CD2  1  
ATOM 2329  C CE1  . HIS A 1 156 ? 13.407  7.670   -16.365 1.00 12.17 ? 156 HIS A CE1  1  
ATOM 2330  N NE2  . HIS A 1 156 ? 12.566  7.994   -17.329 1.00 12.15 ? 156 HIS A NE2  1  
ATOM 2331  H H    . HIS A 1 156 ? 16.981  9.551   -18.356 1.00 8.83  ? 156 HIS A H    1  
ATOM 2332  H HA   . HIS A 1 156 ? 16.939  7.799   -20.676 1.00 10.10 ? 156 HIS A HA   1  
ATOM 2333  H HB2  . HIS A 1 156 ? 15.110  6.439   -20.033 1.00 10.37 ? 156 HIS A HB2  1  
ATOM 2334  H HB3  . HIS A 1 156 ? 16.247  6.387   -18.697 1.00 10.38 ? 156 HIS A HB3  1  
ATOM 2335  H HD1  . HIS A 1 156 ? 15.353  7.009   -16.413 1.00 11.46 ? 156 HIS A HD1  1  
ATOM 2336  H HD2  . HIS A 1 156 ? 12.760  8.018   -19.513 1.00 11.38 ? 156 HIS A HD2  1  
ATOM 2337  H HE1  . HIS A 1 156 ? 13.194  7.692   -15.305 1.00 12.78 ? 156 HIS A HE1  1  
ATOM 2338  H HE2  . HIS A 1 156 ? 11.586  8.088   -17.211 1.00 12.73 ? 156 HIS A HE2  1  
ATOM 2339  N N    . HIS A 1 157 ? 15.078  9.084   -21.707 1.00 10.63 ? 157 HIS A N    1  
ATOM 2340  C CA   . HIS A 1 157 ? 14.182  10.001  -22.392 1.00 11.28 ? 157 HIS A CA   1  
ATOM 2341  C C    . HIS A 1 157 ? 13.490  9.264   -23.532 1.00 11.64 ? 157 HIS A C    1  
ATOM 2342  O O    . HIS A 1 157 ? 12.637  8.404   -23.239 1.00 11.96 ? 157 HIS A O    1  
ATOM 2343  C CB   . HIS A 1 157 ? 14.970  11.209  -22.926 1.00 11.62 ? 157 HIS A CB   1  
ATOM 2344  C CG   . HIS A 1 157 ? 14.116  12.289  -23.525 1.00 12.24 ? 157 HIS A CG   1  
ATOM 2345  N ND1  . HIS A 1 157 ? 13.766  12.310  -24.856 1.00 12.87 ? 157 HIS A ND1  1  
ATOM 2346  C CD2  . HIS A 1 157 ? 13.559  13.392  -22.974 1.00 12.51 ? 157 HIS A CD2  1  
ATOM 2347  C CE1  . HIS A 1 157 ? 13.032  13.377  -25.099 1.00 13.46 ? 157 HIS A CE1  1  
ATOM 2348  N NE2  . HIS A 1 157 ? 12.892  14.052  -23.977 1.00 13.27 ? 157 HIS A NE2  1  
ATOM 2349  O OXT  . HIS A 1 157 ? 13.833  9.514   -24.702 1.00 11.78 ? 157 HIS A OXT  1  
ATOM 2350  H H    . HIS A 1 157 ? 15.447  8.323   -22.205 1.00 10.60 ? 157 HIS A H    1  
ATOM 2351  H HA   . HIS A 1 157 ? 13.441  10.337  -21.686 1.00 11.48 ? 157 HIS A HA   1  
ATOM 2352  H HB2  . HIS A 1 157 ? 15.534  11.647  -22.117 1.00 11.48 ? 157 HIS A HB2  1  
ATOM 2353  H HB3  . HIS A 1 157 ? 15.658  10.870  -23.689 1.00 11.78 ? 157 HIS A HB3  1  
ATOM 2354  H HD1  . HIS A 1 157 ? 14.015  11.629  -25.527 1.00 12.99 ? 157 HIS A HD1  1  
ATOM 2355  H HD2  . HIS A 1 157 ? 13.620  13.691  -21.938 1.00 12.31 ? 157 HIS A HD2  1  
ATOM 2356  H HE1  . HIS A 1 157 ? 12.608  13.644  -26.057 1.00 14.11 ? 157 HIS A HE1  1  
ATOM 2357  H HE2  . HIS A 1 157 ? 12.264  14.804  -23.848 1.00 13.71 ? 157 HIS A HE2  1  
ATOM 2358  N N    . MET A 1 1   ? -32.286 3.778   -43.924 1.00 49.39 ? 1   MET A N    2  
ATOM 2359  C CA   . MET A 1 1   ? -32.664 4.847   -42.976 1.00 49.13 ? 1   MET A CA   2  
ATOM 2360  C C    . MET A 1 1   ? -33.916 4.454   -42.208 1.00 48.56 ? 1   MET A C    2  
ATOM 2361  O O    . MET A 1 1   ? -34.997 4.339   -42.782 1.00 48.67 ? 1   MET A O    2  
ATOM 2362  C CB   . MET A 1 1   ? -32.915 6.177   -43.703 1.00 49.37 ? 1   MET A CB   2  
ATOM 2363  C CG   . MET A 1 1   ? -31.704 6.732   -44.443 1.00 49.76 ? 1   MET A CG   2  
ATOM 2364  S SD   . MET A 1 1   ? -31.250 5.759   -45.899 1.00 50.09 ? 1   MET A SD   2  
ATOM 2365  C CE   . MET A 1 1   ? -29.859 6.701   -46.520 1.00 50.23 ? 1   MET A CE   2  
ATOM 2366  H H1   . MET A 1 1   ? -32.207 2.867   -43.420 1.00 49.42 ? 1   MET A H1   2  
ATOM 2367  H H2   . MET A 1 1   ? -31.369 3.998   -44.361 1.00 49.34 ? 1   MET A H2   2  
ATOM 2368  H H3   . MET A 1 1   ? -33.002 3.687   -44.673 1.00 49.65 ? 1   MET A H3   2  
ATOM 2369  H HA   . MET A 1 1   ? -31.851 4.976   -42.272 1.00 49.25 ? 1   MET A HA   2  
ATOM 2370  H HB2  . MET A 1 1   ? -33.709 6.034   -44.417 1.00 49.42 ? 1   MET A HB2  2  
ATOM 2371  H HB3  . MET A 1 1   ? -33.232 6.912   -42.975 1.00 49.25 ? 1   MET A HB3  2  
ATOM 2372  H HG2  . MET A 1 1   ? -31.924 7.739   -44.760 1.00 49.89 ? 1   MET A HG2  2  
ATOM 2373  H HG3  . MET A 1 1   ? -30.862 6.750   -43.761 1.00 49.76 ? 1   MET A HG3  2  
ATOM 2374  H HE1  . MET A 1 1   ? -30.174 7.714   -46.729 1.00 50.46 ? 1   MET A HE1  2  
ATOM 2375  H HE2  . MET A 1 1   ? -29.496 6.244   -47.427 1.00 50.28 ? 1   MET A HE2  2  
ATOM 2376  H HE3  . MET A 1 1   ? -29.071 6.710   -45.783 1.00 50.08 ? 1   MET A HE3  2  
ATOM 2377  N N    . GLY A 1 2   ? -33.758 4.238   -40.913 1.00 47.99 ? 2   GLY A N    2  
ATOM 2378  C CA   . GLY A 1 2   ? -34.886 3.915   -40.064 1.00 47.44 ? 2   GLY A CA   2  
ATOM 2379  C C    . GLY A 1 2   ? -35.187 5.044   -39.111 1.00 46.69 ? 2   GLY A C    2  
ATOM 2380  O O    . GLY A 1 2   ? -36.307 5.183   -38.624 1.00 46.54 ? 2   GLY A O    2  
ATOM 2381  H H    . GLY A 1 2   ? -32.856 4.304   -40.520 1.00 47.97 ? 2   GLY A H    2  
ATOM 2382  H HA2  . GLY A 1 2   ? -35.752 3.732   -40.682 1.00 47.53 ? 2   GLY A HA2  2  
ATOM 2383  H HA3  . GLY A 1 2   ? -34.659 3.026   -39.494 1.00 47.53 ? 2   GLY A HA3  2  
ATOM 2384  N N    . GLN A 1 3   ? -34.169 5.859   -38.859 1.00 46.26 ? 3   GLN A N    2  
ATOM 2385  C CA   . GLN A 1 3   ? -34.295 7.016   -37.992 1.00 45.58 ? 3   GLN A CA   2  
ATOM 2386  C C    . GLN A 1 3   ? -33.989 8.291   -38.786 1.00 45.14 ? 3   GLN A C    2  
ATOM 2387  O O    . GLN A 1 3   ? -32.859 8.782   -38.776 1.00 45.18 ? 3   GLN A O    2  
ATOM 2388  C CB   . GLN A 1 3   ? -33.340 6.869   -36.801 1.00 45.54 ? 3   GLN A CB   2  
ATOM 2389  C CG   . GLN A 1 3   ? -33.447 7.974   -35.766 1.00 45.20 ? 3   GLN A CG   2  
ATOM 2390  C CD   . GLN A 1 3   ? -34.840 8.108   -35.191 1.00 45.11 ? 3   GLN A CD   2  
ATOM 2391  O OE1  . GLN A 1 3   ? -35.185 7.457   -34.206 1.00 45.20 ? 3   GLN A OE1  2  
ATOM 2392  N NE2  . GLN A 1 3   ? -35.643 8.960   -35.803 1.00 45.01 ? 3   GLN A NE2  2  
ATOM 2393  H H    . GLN A 1 3   ? -33.296 5.669   -39.266 1.00 46.44 ? 3   GLN A H    2  
ATOM 2394  H HA   . GLN A 1 3   ? -35.312 7.061   -37.631 1.00 45.45 ? 3   GLN A HA   2  
ATOM 2395  H HB2  . GLN A 1 3   ? -33.542 5.928   -36.312 1.00 45.96 ? 3   GLN A HB2  2  
ATOM 2396  H HB3  . GLN A 1 3   ? -32.326 6.855   -37.174 1.00 45.41 ? 3   GLN A HB3  2  
ATOM 2397  H HG2  . GLN A 1 3   ? -32.762 7.761   -34.958 1.00 45.03 ? 3   GLN A HG2  2  
ATOM 2398  H HG3  . GLN A 1 3   ? -33.173 8.912   -36.230 1.00 45.22 ? 3   GLN A HG3  2  
ATOM 2399  H HE21 . GLN A 1 3   ? -35.292 9.450   -36.575 1.00 44.98 ? 3   GLN A HE21 2  
ATOM 2400  H HE22 . GLN A 1 3   ? -36.557 9.075   -35.454 1.00 44.99 ? 3   GLN A HE22 2  
ATOM 2401  N N    . PRO A 1 4   ? -34.988 8.805   -39.530 1.00 44.78 ? 4   PRO A N    2  
ATOM 2402  C CA   . PRO A 1 4   ? -34.823 9.978   -40.403 1.00 44.40 ? 4   PRO A CA   2  
ATOM 2403  C C    . PRO A 1 4   ? -34.395 11.261  -39.669 1.00 43.91 ? 4   PRO A C    2  
ATOM 2404  O O    . PRO A 1 4   ? -33.385 11.860  -40.041 1.00 43.73 ? 4   PRO A O    2  
ATOM 2405  C CB   . PRO A 1 4   ? -36.196 10.145  -41.068 1.00 44.25 ? 4   PRO A CB   2  
ATOM 2406  C CG   . PRO A 1 4   ? -36.862 8.820   -40.910 1.00 44.46 ? 4   PRO A CG   2  
ATOM 2407  C CD   . PRO A 1 4   ? -36.354 8.258   -39.614 1.00 44.80 ? 4   PRO A CD   2  
ATOM 2408  H HA   . PRO A 1 4   ? -34.092 9.773   -41.172 1.00 44.62 ? 4   PRO A HA   2  
ATOM 2409  H HB2  . PRO A 1 4   ? -36.748 10.925  -40.565 1.00 43.90 ? 4   PRO A HB2  2  
ATOM 2410  H HB3  . PRO A 1 4   ? -36.068 10.402  -42.110 1.00 44.42 ? 4   PRO A HB3  2  
ATOM 2411  H HG2  . PRO A 1 4   ? -37.934 8.951   -40.867 1.00 44.24 ? 4   PRO A HG2  2  
ATOM 2412  H HG3  . PRO A 1 4   ? -36.595 8.172   -41.731 1.00 44.66 ? 4   PRO A HG3  2  
ATOM 2413  H HD2  . PRO A 1 4   ? -36.959 8.602   -38.790 1.00 44.65 ? 4   PRO A HD2  2  
ATOM 2414  H HD3  . PRO A 1 4   ? -36.334 7.180   -39.652 1.00 45.22 ? 4   PRO A HD3  2  
ATOM 2415  N N    . PRO A 1 5   ? -35.136 11.735  -38.638 1.00 43.76 ? 5   PRO A N    2  
ATOM 2416  C CA   . PRO A 1 5   ? -34.755 12.953  -37.925 1.00 43.36 ? 5   PRO A CA   2  
ATOM 2417  C C    . PRO A 1 5   ? -33.529 12.737  -37.047 1.00 42.76 ? 5   PRO A C    2  
ATOM 2418  O O    . PRO A 1 5   ? -33.523 11.875  -36.170 1.00 42.58 ? 5   PRO A O    2  
ATOM 2419  C CB   . PRO A 1 5   ? -35.980 13.286  -37.056 1.00 43.41 ? 5   PRO A CB   2  
ATOM 2420  C CG   . PRO A 1 5   ? -37.062 12.367  -37.513 1.00 43.89 ? 5   PRO A CG   2  
ATOM 2421  C CD   . PRO A 1 5   ? -36.370 11.164  -38.080 1.00 44.02 ? 5   PRO A CD   2  
ATOM 2422  H HA   . PRO A 1 5   ? -34.567 13.767  -38.608 1.00 43.54 ? 5   PRO A HA   2  
ATOM 2423  H HB2  . PRO A 1 5   ? -35.738 13.120  -36.017 1.00 42.99 ? 5   PRO A HB2  2  
ATOM 2424  H HB3  . PRO A 1 5   ? -36.254 14.320  -37.204 1.00 43.59 ? 5   PRO A HB3  2  
ATOM 2425  H HG2  . PRO A 1 5   ? -37.682 12.084  -36.675 1.00 43.87 ? 5   PRO A HG2  2  
ATOM 2426  H HG3  . PRO A 1 5   ? -37.659 12.852  -38.274 1.00 44.19 ? 5   PRO A HG3  2  
ATOM 2427  H HD2  . PRO A 1 5   ? -36.150 10.450  -37.299 1.00 43.91 ? 5   PRO A HD2  2  
ATOM 2428  H HD3  . PRO A 1 5   ? -36.971 10.711  -38.854 1.00 44.45 ? 5   PRO A HD3  2  
ATOM 2429  N N    . ALA A 1 6   ? -32.498 13.536  -37.283 1.00 42.50 ? 6   ALA A N    2  
ATOM 2430  C CA   . ALA A 1 6   ? -31.282 13.483  -36.481 1.00 41.97 ? 6   ALA A CA   2  
ATOM 2431  C C    . ALA A 1 6   ? -31.437 14.337  -35.229 1.00 41.42 ? 6   ALA A C    2  
ATOM 2432  O O    . ALA A 1 6   ? -30.520 14.453  -34.413 1.00 41.39 ? 6   ALA A O    2  
ATOM 2433  C CB   . ALA A 1 6   ? -30.090 13.954  -37.304 1.00 42.03 ? 6   ALA A CB   2  
ATOM 2434  H H    . ALA A 1 6   ? -32.549 14.171  -38.031 1.00 42.71 ? 6   ALA A H    2  
ATOM 2435  H HA   . ALA A 1 6   ? -31.113 12.455  -36.190 1.00 42.00 ? 6   ALA A HA   2  
ATOM 2436  H HB1  . ALA A 1 6   ? -30.244 14.980  -37.608 1.00 42.08 ? 6   ALA A HB1  2  
ATOM 2437  H HB2  . ALA A 1 6   ? -29.986 13.331  -38.184 1.00 42.08 ? 6   ALA A HB2  2  
ATOM 2438  H HB3  . ALA A 1 6   ? -29.192 13.887  -36.708 1.00 42.02 ? 6   ALA A HB3  2  
ATOM 2439  N N    . GLU A 1 7   ? -32.624 14.911  -35.081 1.00 41.05 ? 7   GLU A N    2  
ATOM 2440  C CA   . GLU A 1 7   ? -32.919 15.833  -33.992 1.00 40.56 ? 7   GLU A CA   2  
ATOM 2441  C C    . GLU A 1 7   ? -33.272 15.086  -32.708 1.00 40.16 ? 7   GLU A C    2  
ATOM 2442  O O    . GLU A 1 7   ? -33.371 15.686  -31.643 1.00 40.13 ? 7   GLU A O    2  
ATOM 2443  C CB   . GLU A 1 7   ? -34.064 16.758  -34.409 1.00 40.61 ? 7   GLU A CB   2  
ATOM 2444  C CG   . GLU A 1 7   ? -33.788 17.491  -35.711 1.00 40.78 ? 7   GLU A CG   2  
ATOM 2445  C CD   . GLU A 1 7   ? -34.958 18.325  -36.174 1.00 41.03 ? 7   GLU A CD   2  
ATOM 2446  O OE1  . GLU A 1 7   ? -35.835 17.789  -36.882 1.00 41.50 ? 7   GLU A OE1  2  
ATOM 2447  O OE2  . GLU A 1 7   ? -35.011 19.526  -35.838 1.00 40.82 ? 7   GLU A OE2  2  
ATOM 2448  H H    . GLU A 1 7   ? -33.327 14.709  -35.730 1.00 41.14 ? 7   GLU A H    2  
ATOM 2449  H HA   . GLU A 1 7   ? -32.039 16.428  -33.813 1.00 40.51 ? 7   GLU A HA   2  
ATOM 2450  H HB2  . GLU A 1 7   ? -34.965 16.173  -34.529 1.00 40.72 ? 7   GLU A HB2  2  
ATOM 2451  H HB3  . GLU A 1 7   ? -34.220 17.493  -33.634 1.00 40.47 ? 7   GLU A HB3  2  
ATOM 2452  H HG2  . GLU A 1 7   ? -32.937 18.142  -35.571 1.00 40.98 ? 7   GLU A HG2  2  
ATOM 2453  H HG3  . GLU A 1 7   ? -33.558 16.765  -36.477 1.00 40.58 ? 7   GLU A HG3  2  
ATOM 2454  N N    . GLU A 1 8   ? -33.434 13.766  -32.807 1.00 39.89 ? 8   GLU A N    2  
ATOM 2455  C CA   . GLU A 1 8   ? -33.744 12.943  -31.639 1.00 39.55 ? 8   GLU A CA   2  
ATOM 2456  C C    . GLU A 1 8   ? -32.463 12.493  -30.941 1.00 39.08 ? 8   GLU A C    2  
ATOM 2457  O O    . GLU A 1 8   ? -32.451 11.490  -30.226 1.00 38.77 ? 8   GLU A O    2  
ATOM 2458  C CB   . GLU A 1 8   ? -34.580 11.718  -32.035 1.00 39.61 ? 8   GLU A CB   2  
ATOM 2459  C CG   . GLU A 1 8   ? -36.067 11.998  -32.179 1.00 39.77 ? 8   GLU A CG   2  
ATOM 2460  C CD   . GLU A 1 8   ? -36.877 10.746  -32.477 1.00 40.05 ? 8   GLU A CD   2  
ATOM 2461  O OE1  . GLU A 1 8   ? -36.905 9.827   -31.626 1.00 40.04 ? 8   GLU A OE1  2  
ATOM 2462  O OE2  . GLU A 1 8   ? -37.506 10.683  -33.555 1.00 40.33 ? 8   GLU A OE2  2  
ATOM 2463  H H    . GLU A 1 8   ? -33.330 13.335  -33.681 1.00 39.97 ? 8   GLU A H    2  
ATOM 2464  H HA   . GLU A 1 8   ? -34.314 13.551  -30.952 1.00 39.67 ? 8   GLU A HA   2  
ATOM 2465  H HB2  . GLU A 1 8   ? -34.216 11.344  -32.981 1.00 39.61 ? 8   GLU A HB2  2  
ATOM 2466  H HB3  . GLU A 1 8   ? -34.449 10.951  -31.284 1.00 39.59 ? 8   GLU A HB3  2  
ATOM 2467  H HG2  . GLU A 1 8   ? -36.429 12.433  -31.260 1.00 39.75 ? 8   GLU A HG2  2  
ATOM 2468  H HG3  . GLU A 1 8   ? -36.210 12.701  -32.987 1.00 39.76 ? 8   GLU A HG3  2  
ATOM 2469  N N    . ALA A 1 9   ? -31.388 13.240  -31.157 1.00 39.09 ? 9   ALA A N    2  
ATOM 2470  C CA   . ALA A 1 9   ? -30.111 12.949  -30.526 1.00 38.75 ? 9   ALA A CA   2  
ATOM 2471  C C    . ALA A 1 9   ? -29.242 14.197  -30.482 1.00 38.56 ? 9   ALA A C    2  
ATOM 2472  O O    . ALA A 1 9   ? -29.078 14.885  -31.492 1.00 38.67 ? 9   ALA A O    2  
ATOM 2473  C CB   . ALA A 1 9   ? -29.390 11.825  -31.262 1.00 38.76 ? 9   ALA A CB   2  
ATOM 2474  H H    . ALA A 1 9   ? -31.456 14.015  -31.755 1.00 39.39 ? 9   ALA A H    2  
ATOM 2475  H HA   . ALA A 1 9   ? -30.306 12.624  -29.511 1.00 38.69 ? 9   ALA A HA   2  
ATOM 2476  H HB1  . ALA A 1 9   ? -29.156 12.147  -32.268 1.00 38.80 ? 9   ALA A HB1  2  
ATOM 2477  H HB2  . ALA A 1 9   ? -30.025 10.953  -31.302 1.00 38.76 ? 9   ALA A HB2  2  
ATOM 2478  H HB3  . ALA A 1 9   ? -28.474 11.580  -30.741 1.00 38.78 ? 9   ALA A HB3  2  
ATOM 2479  N N    . GLU A 1 10  ? -28.705 14.491  -29.308 1.00 38.35 ? 10  GLU A N    2  
ATOM 2480  C CA   . GLU A 1 10  ? -27.798 15.611  -29.131 1.00 38.21 ? 10  GLU A CA   2  
ATOM 2481  C C    . GLU A 1 10  ? -26.840 15.317  -27.991 1.00 37.73 ? 10  GLU A C    2  
ATOM 2482  O O    . GLU A 1 10  ? -27.243 15.193  -26.834 1.00 37.49 ? 10  GLU A O    2  
ATOM 2483  C CB   . GLU A 1 10  ? -28.549 16.928  -28.876 1.00 38.40 ? 10  GLU A CB   2  
ATOM 2484  C CG   . GLU A 1 10  ? -29.613 16.847  -27.795 1.00 38.59 ? 10  GLU A CG   2  
ATOM 2485  C CD   . GLU A 1 10  ? -29.959 18.203  -27.215 1.00 38.73 ? 10  GLU A CD   2  
ATOM 2486  O OE1  . GLU A 1 10  ? -30.589 19.014  -27.927 1.00 38.82 ? 10  GLU A OE1  2  
ATOM 2487  O OE2  . GLU A 1 10  ? -29.609 18.470  -26.046 1.00 38.81 ? 10  GLU A OE2  2  
ATOM 2488  H H    . GLU A 1 10  ? -28.907 13.924  -28.533 1.00 38.34 ? 10  GLU A H    2  
ATOM 2489  H HA   . GLU A 1 10  ? -27.224 15.707  -30.041 1.00 38.39 ? 10  GLU A HA   2  
ATOM 2490  H HB2  . GLU A 1 10  ? -27.833 17.681  -28.582 1.00 38.43 ? 10  GLU A HB2  2  
ATOM 2491  H HB3  . GLU A 1 10  ? -29.025 17.238  -29.796 1.00 38.43 ? 10  GLU A HB3  2  
ATOM 2492  H HG2  . GLU A 1 10  ? -30.506 16.414  -28.217 1.00 38.64 ? 10  GLU A HG2  2  
ATOM 2493  H HG3  . GLU A 1 10  ? -29.248 16.214  -26.998 1.00 38.66 ? 10  GLU A HG3  2  
ATOM 2494  N N    . GLN A 1 11  ? -25.574 15.175  -28.329 1.00 37.65 ? 11  GLN A N    2  
ATOM 2495  C CA   . GLN A 1 11  ? -24.560 14.845  -27.351 1.00 37.26 ? 11  GLN A CA   2  
ATOM 2496  C C    . GLN A 1 11  ? -23.223 15.483  -27.726 1.00 36.82 ? 11  GLN A C    2  
ATOM 2497  O O    . GLN A 1 11  ? -22.400 14.894  -28.422 1.00 36.78 ? 11  GLN A O    2  
ATOM 2498  C CB   . GLN A 1 11  ? -24.446 13.314  -27.167 1.00 37.34 ? 11  GLN A CB   2  
ATOM 2499  C CG   . GLN A 1 11  ? -23.986 12.506  -28.389 1.00 37.71 ? 11  GLN A CG   2  
ATOM 2500  C CD   . GLN A 1 11  ? -24.849 12.680  -29.625 1.00 37.79 ? 11  GLN A CD   2  
ATOM 2501  O OE1  . GLN A 1 11  ? -25.848 11.984  -29.803 1.00 37.58 ? 11  GLN A OE1  2  
ATOM 2502  N NE2  . GLN A 1 11  ? -24.444 13.588  -30.504 1.00 38.16 ? 11  GLN A NE2  2  
ATOM 2503  H H    . GLN A 1 11  ? -25.311 15.296  -29.266 1.00 37.91 ? 11  GLN A H    2  
ATOM 2504  H HA   . GLN A 1 11  ? -24.876 15.275  -26.413 1.00 37.29 ? 11  GLN A HA   2  
ATOM 2505  H HB2  . GLN A 1 11  ? -23.745 13.121  -26.369 1.00 37.36 ? 11  GLN A HB2  2  
ATOM 2506  H HB3  . GLN A 1 11  ? -25.413 12.940  -26.867 1.00 37.16 ? 11  GLN A HB3  2  
ATOM 2507  H HG2  . GLN A 1 11  ? -22.981 12.802  -28.636 1.00 37.78 ? 11  GLN A HG2  2  
ATOM 2508  H HG3  . GLN A 1 11  ? -23.992 11.460  -28.120 1.00 37.94 ? 11  GLN A HG3  2  
ATOM 2509  H HE21 . GLN A 1 11  ? -23.616 14.087  -30.311 1.00 38.35 ? 11  GLN A HE21 2  
ATOM 2510  H HE22 . GLN A 1 11  ? -24.982 13.722  -31.317 1.00 38.26 ? 11  GLN A HE22 2  
ATOM 2511  N N    . PRO A 1 12  ? -23.016 16.733  -27.295 1.00 36.56 ? 12  PRO A N    2  
ATOM 2512  C CA   . PRO A 1 12  ? -21.793 17.469  -27.571 1.00 36.18 ? 12  PRO A CA   2  
ATOM 2513  C C    . PRO A 1 12  ? -20.671 17.117  -26.593 1.00 35.97 ? 12  PRO A C    2  
ATOM 2514  O O    . PRO A 1 12  ? -19.792 16.317  -26.910 1.00 36.19 ? 12  PRO A O    2  
ATOM 2515  C CB   . PRO A 1 12  ? -22.210 18.943  -27.422 1.00 36.06 ? 12  PRO A CB   2  
ATOM 2516  C CG   . PRO A 1 12  ? -23.652 18.932  -27.002 1.00 36.50 ? 12  PRO A CG   2  
ATOM 2517  C CD   . PRO A 1 12  ? -23.960 17.538  -26.525 1.00 36.70 ? 12  PRO A CD   2  
ATOM 2518  H HA   . PRO A 1 12  ? -21.451 17.289  -28.580 1.00 36.21 ? 12  PRO A HA   2  
ATOM 2519  H HB2  . PRO A 1 12  ? -21.590 19.415  -26.675 1.00 35.77 ? 12  PRO A HB2  2  
ATOM 2520  H HB3  . PRO A 1 12  ? -22.083 19.447  -28.369 1.00 36.04 ? 12  PRO A HB3  2  
ATOM 2521  H HG2  . PRO A 1 12  ? -23.803 19.641  -26.201 1.00 36.44 ? 12  PRO A HG2  2  
ATOM 2522  H HG3  . PRO A 1 12  ? -24.278 19.185  -27.846 1.00 36.79 ? 12  PRO A HG3  2  
ATOM 2523  H HD2  . PRO A 1 12  ? -23.776 17.447  -25.464 1.00 36.66 ? 12  PRO A HD2  2  
ATOM 2524  H HD3  . PRO A 1 12  ? -24.979 17.269  -26.762 1.00 37.04 ? 12  PRO A HD3  2  
ATOM 2525  N N    . GLY A 1 13  ? -20.722 17.695  -25.395 1.00 35.61 ? 13  GLY A N    2  
ATOM 2526  C CA   . GLY A 1 13  ? -19.706 17.421  -24.394 1.00 35.47 ? 13  GLY A CA   2  
ATOM 2527  C C    . GLY A 1 13  ? -20.234 17.583  -22.986 1.00 35.16 ? 13  GLY A C    2  
ATOM 2528  O O    . GLY A 1 13  ? -19.648 18.295  -22.173 1.00 35.17 ? 13  GLY A O    2  
ATOM 2529  H H    . GLY A 1 13  ? -21.446 18.329  -25.192 1.00 35.50 ? 13  GLY A H    2  
ATOM 2530  H HA2  . GLY A 1 13  ? -19.353 16.407  -24.519 1.00 35.46 ? 13  GLY A HA2  2  
ATOM 2531  H HA3  . GLY A 1 13  ? -18.882 18.101  -24.541 1.00 35.66 ? 13  GLY A HA3  2  
ATOM 2532  N N    . ALA A 1 14  ? -21.333 16.907  -22.692 1.00 34.97 ? 14  ALA A N    2  
ATOM 2533  C CA   . ALA A 1 14  ? -21.980 17.014  -21.388 1.00 34.74 ? 14  ALA A CA   2  
ATOM 2534  C C    . ALA A 1 14  ? -21.329 16.085  -20.361 1.00 34.24 ? 14  ALA A C    2  
ATOM 2535  O O    . ALA A 1 14  ? -21.995 15.583  -19.456 1.00 34.14 ? 14  ALA A O    2  
ATOM 2536  C CB   . ALA A 1 14  ? -23.466 16.700  -21.519 1.00 35.03 ? 14  ALA A CB   2  
ATOM 2537  H H    . ALA A 1 14  ? -21.724 16.320  -23.371 1.00 35.02 ? 14  ALA A H    2  
ATOM 2538  H HA   . ALA A 1 14  ? -21.880 18.038  -21.051 1.00 34.81 ? 14  ALA A HA   2  
ATOM 2539  H HB1  . ALA A 1 14  ? -23.909 17.354  -22.257 1.00 35.15 ? 14  ALA A HB1  2  
ATOM 2540  H HB2  . ALA A 1 14  ? -23.950 16.853  -20.566 1.00 35.06 ? 14  ALA A HB2  2  
ATOM 2541  H HB3  . ALA A 1 14  ? -23.589 15.673  -21.827 1.00 35.13 ? 14  ALA A HB3  2  
ATOM 2542  N N    . LEU A 1 15  ? -20.029 15.874  -20.495 1.00 34.01 ? 15  LEU A N    2  
ATOM 2543  C CA   . LEU A 1 15  ? -19.295 15.013  -19.576 1.00 33.60 ? 15  LEU A CA   2  
ATOM 2544  C C    . LEU A 1 15  ? -18.667 15.838  -18.459 1.00 33.26 ? 15  LEU A C    2  
ATOM 2545  O O    . LEU A 1 15  ? -17.665 16.526  -18.672 1.00 33.39 ? 15  LEU A O    2  
ATOM 2546  C CB   . LEU A 1 15  ? -18.204 14.209  -20.304 1.00 33.42 ? 15  LEU A CB   2  
ATOM 2547  C CG   . LEU A 1 15  ? -18.696 13.080  -21.221 1.00 33.48 ? 15  LEU A CG   2  
ATOM 2548  C CD1  . LEU A 1 15  ? -19.353 13.637  -22.478 1.00 33.70 ? 15  LEU A CD1  2  
ATOM 2549  C CD2  . LEU A 1 15  ? -17.538 12.151  -21.571 1.00 33.25 ? 15  LEU A CD2  2  
ATOM 2550  H H    . LEU A 1 15  ? -19.544 16.324  -21.217 1.00 34.17 ? 15  LEU A H    2  
ATOM 2551  H HA   . LEU A 1 15  ? -20.003 14.323  -19.138 1.00 33.74 ? 15  LEU A HA   2  
ATOM 2552  H HB2  . LEU A 1 15  ? -17.622 14.896  -20.900 1.00 33.66 ? 15  LEU A HB2  2  
ATOM 2553  H HB3  . LEU A 1 15  ? -17.555 13.773  -19.558 1.00 33.10 ? 15  LEU A HB3  2  
ATOM 2554  H HG   . LEU A 1 15  ? -19.438 12.499  -20.691 1.00 33.61 ? 15  LEU A HG   2  
ATOM 2555  H HD11 . LEU A 1 15  ? -19.692 12.824  -23.102 1.00 33.68 ? 15  LEU A HD11 2  
ATOM 2556  H HD12 . LEU A 1 15  ? -18.641 14.238  -23.024 1.00 33.80 ? 15  LEU A HD12 2  
ATOM 2557  H HD13 . LEU A 1 15  ? -20.198 14.249  -22.200 1.00 33.84 ? 15  LEU A HD13 2  
ATOM 2558  H HD21 . LEU A 1 15  ? -17.141 11.716  -20.667 1.00 33.24 ? 15  LEU A HD21 2  
ATOM 2559  H HD22 . LEU A 1 15  ? -16.762 12.712  -22.070 1.00 33.21 ? 15  LEU A HD22 2  
ATOM 2560  H HD23 . LEU A 1 15  ? -17.889 11.364  -22.225 1.00 33.20 ? 15  LEU A HD23 2  
ATOM 2561  N N    . ALA A 1 16  ? -19.275 15.786  -17.281 1.00 32.89 ? 16  ALA A N    2  
ATOM 2562  C CA   . ALA A 1 16  ? -18.756 16.482  -16.116 1.00 32.59 ? 16  ALA A CA   2  
ATOM 2563  C C    . ALA A 1 16  ? -18.020 15.499  -15.217 1.00 31.98 ? 16  ALA A C    2  
ATOM 2564  O O    . ALA A 1 16  ? -18.641 14.708  -14.502 1.00 31.63 ? 16  ALA A O    2  
ATOM 2565  C CB   . ALA A 1 16  ? -19.881 17.176  -15.349 1.00 32.80 ? 16  ALA A CB   2  
ATOM 2566  H H    . ALA A 1 16  ? -20.103 15.257  -17.193 1.00 32.86 ? 16  ALA A H    2  
ATOM 2567  H HA   . ALA A 1 16  ? -18.056 17.235  -16.459 1.00 32.73 ? 16  ALA A HA   2  
ATOM 2568  H HB1  . ALA A 1 16  ? -20.391 17.871  -16.000 1.00 32.95 ? 16  ALA A HB1  2  
ATOM 2569  H HB2  . ALA A 1 16  ? -19.471 17.711  -14.503 1.00 32.85 ? 16  ALA A HB2  2  
ATOM 2570  H HB3  . ALA A 1 16  ? -20.583 16.434  -14.995 1.00 32.80 ? 16  ALA A HB3  2  
ATOM 2571  N N    . ARG A 1 17  ? -16.700 15.532  -15.280 1.00 31.94 ? 17  ARG A N    2  
ATOM 2572  C CA   . ARG A 1 17  ? -15.867 14.610  -14.524 1.00 31.46 ? 17  ARG A CA   2  
ATOM 2573  C C    . ARG A 1 17  ? -14.655 15.334  -13.945 1.00 31.11 ? 17  ARG A C    2  
ATOM 2574  O O    . ARG A 1 17  ? -14.608 16.564  -13.924 1.00 31.11 ? 17  ARG A O    2  
ATOM 2575  C CB   . ARG A 1 17  ? -15.409 13.465  -15.428 1.00 31.72 ? 17  ARG A CB   2  
ATOM 2576  C CG   . ARG A 1 17  ? -14.693 13.933  -16.681 1.00 31.75 ? 17  ARG A CG   2  
ATOM 2577  C CD   . ARG A 1 17  ? -14.136 12.763  -17.472 1.00 31.70 ? 17  ARG A CD   2  
ATOM 2578  N NE   . ARG A 1 17  ? -15.173 11.793  -17.852 1.00 31.67 ? 17  ARG A NE   2  
ATOM 2579  C CZ   . ARG A 1 17  ? -14.965 10.777  -18.689 1.00 31.67 ? 17  ARG A CZ   2  
ATOM 2580  N NH1  . ARG A 1 17  ? -13.763 10.579  -19.212 1.00 31.70 ? 17  ARG A NH1  2  
ATOM 2581  N NH2  . ARG A 1 17  ? -15.961 9.951   -18.989 1.00 31.71 ? 17  ARG A NH2  2  
ATOM 2582  H H    . ARG A 1 17  ? -16.269 16.203  -15.848 1.00 32.30 ? 17  ARG A H    2  
ATOM 2583  H HA   . ARG A 1 17  ? -16.459 14.207  -13.716 1.00 31.22 ? 17  ARG A HA   2  
ATOM 2584  H HB2  . ARG A 1 17  ? -14.736 12.832  -14.869 1.00 31.77 ? 17  ARG A HB2  2  
ATOM 2585  H HB3  . ARG A 1 17  ? -16.271 12.887  -15.726 1.00 31.94 ? 17  ARG A HB3  2  
ATOM 2586  H HG2  . ARG A 1 17  ? -15.389 14.477  -17.303 1.00 31.83 ? 17  ARG A HG2  2  
ATOM 2587  H HG3  . ARG A 1 17  ? -13.879 14.583  -16.393 1.00 31.82 ? 17  ARG A HG3  2  
ATOM 2588  H HD2  . ARG A 1 17  ? -13.671 13.147  -18.365 1.00 31.64 ? 17  ARG A HD2  2  
ATOM 2589  H HD3  . ARG A 1 17  ? -13.393 12.263  -16.867 1.00 31.84 ? 17  ARG A HD3  2  
ATOM 2590  H HE   . ARG A 1 17  ? -16.070 11.910  -17.458 1.00 31.70 ? 17  ARG A HE   2  
ATOM 2591  H HH11 . ARG A 1 17  ? -13.003 11.192  -18.980 1.00 31.72 ? 17  ARG A HH11 2  
ATOM 2592  H HH12 . ARG A 1 17  ? -13.602 9.803   -19.836 1.00 31.76 ? 17  ARG A HH12 2  
ATOM 2593  H HH21 . ARG A 1 17  ? -16.874 10.090  -18.583 1.00 31.75 ? 17  ARG A HH21 2  
ATOM 2594  H HH22 . ARG A 1 17  ? -15.813 9.191   -19.628 1.00 31.77 ? 17  ARG A HH22 2  
ATOM 2595  N N    . GLU A 1 18  ? -13.687 14.562  -13.473 1.00 30.90 ? 18  GLU A N    2  
ATOM 2596  C CA   . GLU A 1 18  ? -12.458 15.107  -12.915 1.00 30.62 ? 18  GLU A CA   2  
ATOM 2597  C C    . GLU A 1 18  ? -11.538 15.608  -14.025 1.00 30.39 ? 18  GLU A C    2  
ATOM 2598  O O    . GLU A 1 18  ? -11.137 14.846  -14.908 1.00 30.35 ? 18  GLU A O    2  
ATOM 2599  C CB   . GLU A 1 18  ? -11.758 14.032  -12.081 1.00 30.67 ? 18  GLU A CB   2  
ATOM 2600  C CG   . GLU A 1 18  ? -10.437 14.472  -11.474 1.00 30.69 ? 18  GLU A CG   2  
ATOM 2601  C CD   . GLU A 1 18  ? -9.797  13.374  -10.654 1.00 30.90 ? 18  GLU A CD   2  
ATOM 2602  O OE1  . GLU A 1 18  ? -9.079  12.532  -11.238 1.00 31.24 ? 18  GLU A OE1  2  
ATOM 2603  O OE2  . GLU A 1 18  ? -10.024 13.332  -9.426  1.00 30.81 ? 18  GLU A OE2  2  
ATOM 2604  H H    . GLU A 1 18  ? -13.800 13.590  -13.499 1.00 30.99 ? 18  GLU A H    2  
ATOM 2605  H HA   . GLU A 1 18  ? -12.720 15.936  -12.275 1.00 30.62 ? 18  GLU A HA   2  
ATOM 2606  H HB2  . GLU A 1 18  ? -12.416 13.737  -11.278 1.00 30.69 ? 18  GLU A HB2  2  
ATOM 2607  H HB3  . GLU A 1 18  ? -11.571 13.174  -12.710 1.00 30.77 ? 18  GLU A HB3  2  
ATOM 2608  H HG2  . GLU A 1 18  ? -9.762  14.744  -12.271 1.00 30.69 ? 18  GLU A HG2  2  
ATOM 2609  H HG3  . GLU A 1 18  ? -10.609 15.327  -10.838 1.00 30.64 ? 18  GLU A HG3  2  
ATOM 2610  N N    . PHE A 1 19  ? -11.232 16.896  -13.989 1.00 30.33 ? 19  PHE A N    2  
ATOM 2611  C CA   . PHE A 1 19  ? -10.367 17.499  -14.990 1.00 30.21 ? 19  PHE A CA   2  
ATOM 2612  C C    . PHE A 1 19  ? -9.118  18.086  -14.338 1.00 29.75 ? 19  PHE A C    2  
ATOM 2613  O O    . PHE A 1 19  ? -8.220  18.574  -15.023 1.00 29.69 ? 19  PHE A O    2  
ATOM 2614  C CB   . PHE A 1 19  ? -11.119 18.597  -15.756 1.00 30.57 ? 19  PHE A CB   2  
ATOM 2615  C CG   . PHE A 1 19  ? -11.567 19.738  -14.885 1.00 30.68 ? 19  PHE A CG   2  
ATOM 2616  C CD1  . PHE A 1 19  ? -12.783 19.685  -14.218 1.00 31.05 ? 19  PHE A CD1  2  
ATOM 2617  C CD2  . PHE A 1 19  ? -10.783 20.870  -14.749 1.00 30.51 ? 19  PHE A CD2  2  
ATOM 2618  C CE1  . PHE A 1 19  ? -13.206 20.741  -13.433 1.00 31.24 ? 19  PHE A CE1  2  
ATOM 2619  C CE2  . PHE A 1 19  ? -11.198 21.925  -13.963 1.00 30.71 ? 19  PHE A CE2  2  
ATOM 2620  C CZ   . PHE A 1 19  ? -12.380 21.830  -13.248 1.00 31.07 ? 19  PHE A CZ   2  
ATOM 2621  H H    . PHE A 1 19  ? -11.600 17.454  -13.274 1.00 30.42 ? 19  PHE A H    2  
ATOM 2622  H HA   . PHE A 1 19  ? -10.071 16.726  -15.681 1.00 30.28 ? 19  PHE A HA   2  
ATOM 2623  H HB2  . PHE A 1 19  ? -10.470 18.997  -16.519 1.00 30.83 ? 19  PHE A HB2  2  
ATOM 2624  H HB3  . PHE A 1 19  ? -11.996 18.168  -16.221 1.00 30.59 ? 19  PHE A HB3  2  
ATOM 2625  H HD1  . PHE A 1 19  ? -13.402 18.806  -14.315 1.00 31.23 ? 19  PHE A HD1  2  
ATOM 2626  H HD2  . PHE A 1 19  ? -9.832  20.921  -15.261 1.00 30.27 ? 19  PHE A HD2  2  
ATOM 2627  H HE1  . PHE A 1 19  ? -14.155 20.689  -12.920 1.00 31.57 ? 19  PHE A HE1  2  
ATOM 2628  H HE2  . PHE A 1 19  ? -10.576 22.802  -13.865 1.00 30.63 ? 19  PHE A HE2  2  
ATOM 2629  H HZ   . PHE A 1 19  ? -12.695 22.637  -12.606 1.00 31.29 ? 19  PHE A HZ   2  
ATOM 2630  N N    . LEU A 1 20  ? -9.066  18.026  -13.016 1.00 29.50 ? 20  LEU A N    2  
ATOM 2631  C CA   . LEU A 1 20  ? -7.987  18.647  -12.270 1.00 29.16 ? 20  LEU A CA   2  
ATOM 2632  C C    . LEU A 1 20  ? -7.303  17.618  -11.384 1.00 28.50 ? 20  LEU A C    2  
ATOM 2633  O O    . LEU A 1 20  ? -7.861  16.558  -11.110 1.00 28.35 ? 20  LEU A O    2  
ATOM 2634  C CB   . LEU A 1 20  ? -8.506  19.825  -11.428 1.00 29.33 ? 20  LEU A CB   2  
ATOM 2635  C CG   . LEU A 1 20  ? -9.500  19.484  -10.310 1.00 29.60 ? 20  LEU A CG   2  
ATOM 2636  C CD1  . LEU A 1 20  ? -9.587  20.636  -9.319  1.00 29.57 ? 20  LEU A CD1  2  
ATOM 2637  C CD2  . LEU A 1 20  ? -10.883 19.178  -10.874 1.00 29.85 ? 20  LEU A CD2  2  
ATOM 2638  H H    . LEU A 1 20  ? -9.752  17.523  -12.530 1.00 29.61 ? 20  LEU A H    2  
ATOM 2639  H HA   . LEU A 1 20  ? -7.267  19.018  -12.984 1.00 29.36 ? 20  LEU A HA   2  
ATOM 2640  H HB2  . LEU A 1 20  ? -7.655  20.314  -10.977 1.00 29.39 ? 20  LEU A HB2  2  
ATOM 2641  H HB3  . LEU A 1 20  ? -8.985  20.526  -12.095 1.00 29.28 ? 20  LEU A HB3  2  
ATOM 2642  H HG   . LEU A 1 20  ? -9.152  18.612  -9.783  1.00 29.74 ? 20  LEU A HG   2  
ATOM 2643  H HD11 . LEU A 1 20  ? -8.615  20.802  -8.877  1.00 29.64 ? 20  LEU A HD11 2  
ATOM 2644  H HD12 . LEU A 1 20  ? -10.297 20.393  -8.543  1.00 29.62 ? 20  LEU A HD12 2  
ATOM 2645  H HD13 . LEU A 1 20  ? -9.905  21.532  -9.833  1.00 29.51 ? 20  LEU A HD13 2  
ATOM 2646  H HD21 . LEU A 1 20  ? -11.543 18.879  -10.072 1.00 29.89 ? 20  LEU A HD21 2  
ATOM 2647  H HD22 . LEU A 1 20  ? -10.808 18.377  -11.596 1.00 29.82 ? 20  LEU A HD22 2  
ATOM 2648  H HD23 . LEU A 1 20  ? -11.279 20.059  -11.357 1.00 30.10 ? 20  LEU A HD23 2  
ATOM 2649  N N    . ALA A 1 21  ? -6.098  17.937  -10.940 1.00 28.20 ? 21  ALA A N    2  
ATOM 2650  C CA   . ALA A 1 21  ? -5.309  17.013  -10.140 1.00 27.66 ? 21  ALA A CA   2  
ATOM 2651  C C    . ALA A 1 21  ? -5.508  17.275  -8.652  1.00 27.05 ? 21  ALA A C    2  
ATOM 2652  O O    . ALA A 1 21  ? -5.345  16.365  -7.831  1.00 26.92 ? 21  ALA A O    2  
ATOM 2653  C CB   . ALA A 1 21  ? -3.838  17.139  -10.507 1.00 27.59 ? 21  ALA A CB   2  
ATOM 2654  H H    . ALA A 1 21  ? -5.729  18.826  -11.151 1.00 28.40 ? 21  ALA A H    2  
ATOM 2655  H HA   . ALA A 1 21  ? -5.635  16.007  -10.368 1.00 27.85 ? 21  ALA A HA   2  
ATOM 2656  H HB1  . ALA A 1 21  ? -3.503  18.144  -10.293 1.00 27.65 ? 21  ALA A HB1  2  
ATOM 2657  H HB2  . ALA A 1 21  ? -3.706  16.934  -11.561 1.00 27.51 ? 21  ALA A HB2  2  
ATOM 2658  H HB3  . ALA A 1 21  ? -3.259  16.436  -9.926  1.00 27.66 ? 21  ALA A HB3  2  
ATOM 2659  N N    . ALA A 1 22  ? -5.860  18.527  -8.329  1.00 26.78 ? 22  ALA A N    2  
ATOM 2660  C CA   . ALA A 1 22  ? -6.093  18.974  -6.950  1.00 26.29 ? 22  ALA A CA   2  
ATOM 2661  C C    . ALA A 1 22  ? -4.786  19.097  -6.167  1.00 25.93 ? 22  ALA A C    2  
ATOM 2662  O O    . ALA A 1 22  ? -3.839  18.335  -6.378  1.00 26.15 ? 22  ALA A O    2  
ATOM 2663  C CB   . ALA A 1 22  ? -7.080  18.063  -6.221  1.00 26.23 ? 22  ALA A CB   2  
ATOM 2664  H H    . ALA A 1 22  ? -5.959  19.182  -9.051  1.00 26.97 ? 22  ALA A H    2  
ATOM 2665  H HA   . ALA A 1 22  ? -6.541  19.960  -7.006  1.00 26.35 ? 22  ALA A HA   2  
ATOM 2666  H HB1  . ALA A 1 22  ? -6.635  17.088  -6.085  1.00 26.24 ? 22  ALA A HB1  2  
ATOM 2667  H HB2  . ALA A 1 22  ? -7.983  17.966  -6.807  1.00 26.16 ? 22  ALA A HB2  2  
ATOM 2668  H HB3  . ALA A 1 22  ? -7.321  18.487  -5.258  1.00 26.35 ? 22  ALA A HB3  2  
ATOM 2669  N N    . MET A 1 23  ? -4.738  20.078  -5.276  1.00 25.45 ? 23  MET A N    2  
ATOM 2670  C CA   . MET A 1 23  ? -3.553  20.322  -4.463  1.00 25.17 ? 23  MET A CA   2  
ATOM 2671  C C    . MET A 1 23  ? -3.693  19.643  -3.110  1.00 24.29 ? 23  MET A C    2  
ATOM 2672  O O    . MET A 1 23  ? -2.764  18.987  -2.629  1.00 24.04 ? 23  MET A O    2  
ATOM 2673  C CB   . MET A 1 23  ? -3.325  21.823  -4.268  1.00 25.82 ? 23  MET A CB   2  
ATOM 2674  C CG   . MET A 1 23  ? -2.998  22.565  -5.553  1.00 26.18 ? 23  MET A CG   2  
ATOM 2675  S SD   . MET A 1 23  ? -1.480  21.972  -6.332  1.00 26.73 ? 23  MET A SD   2  
ATOM 2676  C CE   . MET A 1 23  ? -1.412  23.016  -7.785  1.00 27.47 ? 23  MET A CE   2  
ATOM 2677  H H    . MET A 1 23  ? -5.532  20.651  -5.156  1.00 25.35 ? 23  MET A H    2  
ATOM 2678  H HA   . MET A 1 23  ? -2.704  19.902  -4.977  1.00 25.23 ? 23  MET A HA   2  
ATOM 2679  H HB2  . MET A 1 23  ? -4.217  22.261  -3.844  1.00 26.04 ? 23  MET A HB2  2  
ATOM 2680  H HB3  . MET A 1 23  ? -2.504  21.962  -3.577  1.00 25.92 ? 23  MET A HB3  2  
ATOM 2681  H HG2  . MET A 1 23  ? -3.815  22.432  -6.245  1.00 26.11 ? 23  MET A HG2  2  
ATOM 2682  H HG3  . MET A 1 23  ? -2.885  23.614  -5.328  1.00 26.28 ? 23  MET A HG3  2  
ATOM 2683  H HE1  . MET A 1 23  ? -1.332  24.048  -7.481  1.00 27.66 ? 23  MET A HE1  2  
ATOM 2684  H HE2  . MET A 1 23  ? -2.313  22.881  -8.365  1.00 27.63 ? 23  MET A HE2  2  
ATOM 2685  H HE3  . MET A 1 23  ? -0.552  22.747  -8.380  1.00 27.66 ? 23  MET A HE3  2  
ATOM 2686  N N    . GLU A 1 24  ? -4.856  19.815  -2.501  1.00 23.92 ? 24  GLU A N    2  
ATOM 2687  C CA   . GLU A 1 24  ? -5.166  19.175  -1.232  1.00 23.15 ? 24  GLU A CA   2  
ATOM 2688  C C    . GLU A 1 24  ? -6.673  19.059  -1.070  1.00 22.22 ? 24  GLU A C    2  
ATOM 2689  O O    . GLU A 1 24  ? -7.362  20.058  -0.851  1.00 22.21 ? 24  GLU A O    2  
ATOM 2690  C CB   . GLU A 1 24  ? -4.565  19.959  -0.061  1.00 23.57 ? 24  GLU A CB   2  
ATOM 2691  C CG   . GLU A 1 24  ? -4.783  19.297  1.293   1.00 23.67 ? 24  GLU A CG   2  
ATOM 2692  C CD   . GLU A 1 24  ? -4.110  20.046  2.423   1.00 24.03 ? 24  GLU A CD   2  
ATOM 2693  O OE1  . GLU A 1 24  ? -2.909  19.802  2.671   1.00 24.41 ? 24  GLU A OE1  2  
ATOM 2694  O OE2  . GLU A 1 24  ? -4.778  20.884  3.067   1.00 24.02 ? 24  GLU A OE2  2  
ATOM 2695  H H    . GLU A 1 24  ? -5.532  20.393  -2.918  1.00 24.25 ? 24  GLU A H    2  
ATOM 2696  H HA   . GLU A 1 24  ? -4.739  18.180  -1.249  1.00 23.03 ? 24  GLU A HA   2  
ATOM 2697  H HB2  . GLU A 1 24  ? -3.504  20.067  -0.221  1.00 24.07 ? 24  GLU A HB2  2  
ATOM 2698  H HB3  . GLU A 1 24  ? -5.017  20.939  -0.031  1.00 23.42 ? 24  GLU A HB3  2  
ATOM 2699  H HG2  . GLU A 1 24  ? -5.844  19.255  1.493   1.00 23.64 ? 24  GLU A HG2  2  
ATOM 2700  H HG3  . GLU A 1 24  ? -4.386  18.293  1.259   1.00 23.64 ? 24  GLU A HG3  2  
ATOM 2701  N N    . PRO A 1 25  ? -7.203  17.841  -1.203  1.00 21.54 ? 25  PRO A N    2  
ATOM 2702  C CA   . PRO A 1 25  ? -8.634  17.580  -1.086  1.00 20.70 ? 25  PRO A CA   2  
ATOM 2703  C C    . PRO A 1 25  ? -9.116  17.677  0.356   1.00 19.96 ? 25  PRO A C    2  
ATOM 2704  O O    . PRO A 1 25  ? -8.453  17.197  1.277   1.00 19.79 ? 25  PRO A O    2  
ATOM 2705  C CB   . PRO A 1 25  ? -8.797  16.143  -1.603  1.00 20.35 ? 25  PRO A CB   2  
ATOM 2706  C CG   . PRO A 1 25  ? -7.471  15.759  -2.174  1.00 20.99 ? 25  PRO A CG   2  
ATOM 2707  C CD   . PRO A 1 25  ? -6.453  16.613  -1.479  1.00 21.63 ? 25  PRO A CD   2  
ATOM 2708  H HA   . PRO A 1 25  ? -9.209  18.255  -1.700  1.00 20.98 ? 25  PRO A HA   2  
ATOM 2709  H HB2  . PRO A 1 25  ? -9.071  15.496  -0.783  1.00 19.62 ? 25  PRO A HB2  2  
ATOM 2710  H HB3  . PRO A 1 25  ? -9.570  16.120  -2.356  1.00 20.49 ? 25  PRO A HB3  2  
ATOM 2711  H HG2  . PRO A 1 25  ? -7.279  14.714  -1.980  1.00 20.64 ? 25  PRO A HG2  2  
ATOM 2712  H HG3  . PRO A 1 25  ? -7.459  15.951  -3.236  1.00 21.44 ? 25  PRO A HG3  2  
ATOM 2713  H HD2  . PRO A 1 25  ? -6.127  16.144  -0.563  1.00 21.43 ? 25  PRO A HD2  2  
ATOM 2714  H HD3  . PRO A 1 25  ? -5.612  16.810  -2.128  1.00 22.40 ? 25  PRO A HD3  2  
ATOM 2715  N N    . GLU A 1 26  ? -10.267 18.307  0.544   1.00 19.63 ? 26  GLU A N    2  
ATOM 2716  C CA   . GLU A 1 26  ? -10.858 18.438  1.867   1.00 19.01 ? 26  GLU A CA   2  
ATOM 2717  C C    . GLU A 1 26  ? -11.562 17.143  2.265   1.00 17.82 ? 26  GLU A C    2  
ATOM 2718  O O    . GLU A 1 26  ? -12.299 16.557  1.470   1.00 17.39 ? 26  GLU A O    2  
ATOM 2719  C CB   . GLU A 1 26  ? -11.832 19.620  1.896   1.00 19.23 ? 26  GLU A CB   2  
ATOM 2720  C CG   . GLU A 1 26  ? -11.165 20.952  1.600   1.00 19.90 ? 26  GLU A CG   2  
ATOM 2721  C CD   . GLU A 1 26  ? -12.127 22.117  1.669   1.00 20.41 ? 26  GLU A CD   2  
ATOM 2722  O OE1  . GLU A 1 26  ? -12.293 22.687  2.767   1.00 20.67 ? 26  GLU A OE1  2  
ATOM 2723  O OE2  . GLU A 1 26  ? -12.710 22.477  0.626   1.00 20.64 ? 26  GLU A OE2  2  
ATOM 2724  H H    . GLU A 1 26  ? -10.732 18.690  -0.226  1.00 19.90 ? 26  GLU A H    2  
ATOM 2725  H HA   . GLU A 1 26  ? -10.058 18.625  2.568   1.00 19.36 ? 26  GLU A HA   2  
ATOM 2726  H HB2  . GLU A 1 26  ? -12.606 19.457  1.159   1.00 19.06 ? 26  GLU A HB2  2  
ATOM 2727  H HB3  . GLU A 1 26  ? -12.284 19.678  2.875   1.00 19.19 ? 26  GLU A HB3  2  
ATOM 2728  H HG2  . GLU A 1 26  ? -10.378 21.114  2.320   1.00 20.16 ? 26  GLU A HG2  2  
ATOM 2729  H HG3  . GLU A 1 26  ? -10.741 20.914  0.608   1.00 19.91 ? 26  GLU A HG3  2  
ATOM 2730  N N    . PRO A 1 27  ? -11.319 16.675  3.498   1.00 17.38 ? 27  PRO A N    2  
ATOM 2731  C CA   . PRO A 1 27  ? -11.850 15.397  3.986   1.00 16.31 ? 27  PRO A CA   2  
ATOM 2732  C C    . PRO A 1 27  ? -13.375 15.347  4.015   1.00 15.58 ? 27  PRO A C    2  
ATOM 2733  O O    . PRO A 1 27  ? -14.022 16.066  4.778   1.00 15.74 ? 27  PRO A O    2  
ATOM 2734  C CB   . PRO A 1 27  ? -11.289 15.286  5.408   1.00 16.33 ? 27  PRO A CB   2  
ATOM 2735  C CG   . PRO A 1 27  ? -10.138 16.232  5.448   1.00 17.43 ? 27  PRO A CG   2  
ATOM 2736  C CD   . PRO A 1 27  ? -10.498 17.351  4.517   1.00 18.02 ? 27  PRO A CD   2  
ATOM 2737  H HA   . PRO A 1 27  ? -11.483 14.573  3.391   1.00 16.18 ? 27  PRO A HA   2  
ATOM 2738  H HB2  . PRO A 1 27  ? -12.051 15.562  6.123   1.00 15.88 ? 27  PRO A HB2  2  
ATOM 2739  H HB3  . PRO A 1 27  ? -10.969 14.273  5.588   1.00 16.16 ? 27  PRO A HB3  2  
ATOM 2740  H HG2  . PRO A 1 27  ? -10.005 16.605  6.453   1.00 17.52 ? 27  PRO A HG2  2  
ATOM 2741  H HG3  . PRO A 1 27  ? -9.241  15.734  5.110   1.00 17.81 ? 27  PRO A HG3  2  
ATOM 2742  H HD2  . PRO A 1 27  ? -11.069 18.109  5.036   1.00 18.21 ? 27  PRO A HD2  2  
ATOM 2743  H HD3  . PRO A 1 27  ? -9.610  17.779  4.076   1.00 18.75 ? 27  PRO A HD3  2  
ATOM 2744  N N    . ALA A 1 28  ? -13.942 14.507  3.165   1.00 14.93 ? 28  ALA A N    2  
ATOM 2745  C CA   . ALA A 1 28  ? -15.375 14.281  3.153   1.00 14.31 ? 28  ALA A CA   2  
ATOM 2746  C C    . ALA A 1 28  ? -15.672 12.813  3.430   1.00 13.28 ? 28  ALA A C    2  
ATOM 2747  O O    . ALA A 1 28  ? -15.132 11.930  2.763   1.00 12.82 ? 28  ALA A O    2  
ATOM 2748  C CB   . ALA A 1 28  ? -15.969 14.704  1.820   1.00 14.27 ? 28  ALA A CB   2  
ATOM 2749  H H    . ALA A 1 28  ? -13.381 14.019  2.528   1.00 14.96 ? 28  ALA A H    2  
ATOM 2750  H HA   . ALA A 1 28  ? -15.821 14.887  3.932   1.00 14.81 ? 28  ALA A HA   2  
ATOM 2751  H HB1  . ALA A 1 28  ? -15.775 15.752  1.655   1.00 14.09 ? 28  ALA A HB1  2  
ATOM 2752  H HB2  . ALA A 1 28  ? -17.034 14.533  1.831   1.00 14.39 ? 28  ALA A HB2  2  
ATOM 2753  H HB3  . ALA A 1 28  ? -15.518 14.129  1.026   1.00 14.46 ? 28  ALA A HB3  2  
ATOM 2754  N N    . PRO A 1 29  ? -16.526 12.532  4.425   1.00 13.06 ? 29  PRO A N    2  
ATOM 2755  C CA   . PRO A 1 29  ? -16.867 11.159  4.813   1.00 12.21 ? 29  PRO A CA   2  
ATOM 2756  C C    . PRO A 1 29  ? -17.619 10.411  3.716   1.00 11.34 ? 29  PRO A C    2  
ATOM 2757  O O    . PRO A 1 29  ? -18.634 10.896  3.207   1.00 11.36 ? 29  PRO A O    2  
ATOM 2758  C CB   . PRO A 1 29  ? -17.777 11.339  6.036   1.00 12.51 ? 29  PRO A CB   2  
ATOM 2759  C CG   . PRO A 1 29  ? -17.551 12.739  6.492   1.00 13.50 ? 29  PRO A CG   2  
ATOM 2760  C CD   . PRO A 1 29  ? -17.221 13.522  5.256   1.00 13.81 ? 29  PRO A CD   2  
ATOM 2761  H HA   . PRO A 1 29  ? -15.987 10.598  5.095   1.00 12.20 ? 29  PRO A HA   2  
ATOM 2762  H HB2  . PRO A 1 29  ? -18.805 11.182  5.745   1.00 12.17 ? 29  PRO A HB2  2  
ATOM 2763  H HB3  . PRO A 1 29  ? -17.503 10.626  6.800   1.00 12.53 ? 29  PRO A HB3  2  
ATOM 2764  H HG2  . PRO A 1 29  ? -18.447 13.125  6.954   1.00 13.63 ? 29  PRO A HG2  2  
ATOM 2765  H HG3  . PRO A 1 29  ? -16.724 12.769  7.186   1.00 13.98 ? 29  PRO A HG3  2  
ATOM 2766  H HD2  . PRO A 1 29  ? -18.123 13.870  4.773   1.00 13.93 ? 29  PRO A HD2  2  
ATOM 2767  H HD3  . PRO A 1 29  ? -16.569 14.350  5.492   1.00 14.55 ? 29  PRO A HD3  2  
ATOM 2768  N N    . ALA A 1 30  ? -17.124 9.223   3.375   1.00 10.76 ? 30  ALA A N    2  
ATOM 2769  C CA   . ALA A 1 30  ? -17.743 8.376   2.358   1.00 10.06 ? 30  ALA A CA   2  
ATOM 2770  C C    . ALA A 1 30  ? -17.098 6.982   2.326   1.00 8.93  ? 30  ALA A C    2  
ATOM 2771  O O    . ALA A 1 30  ? -17.799 5.976   2.477   1.00 8.35  ? 30  ALA A O    2  
ATOM 2772  C CB   . ALA A 1 30  ? -17.686 9.027   0.979   1.00 10.54 ? 30  ALA A CB   2  
ATOM 2773  H H    . ALA A 1 30  ? -16.314 8.904   3.823   1.00 10.95 ? 30  ALA A H    2  
ATOM 2774  H HA   . ALA A 1 30  ? -18.783 8.261   2.626   1.00 10.23 ? 30  ALA A HA   2  
ATOM 2775  H HB1  . ALA A 1 30  ? -18.224 8.415   0.271   1.00 10.55 ? 30  ALA A HB1  2  
ATOM 2776  H HB2  . ALA A 1 30  ? -16.657 9.118   0.668   1.00 10.83 ? 30  ALA A HB2  2  
ATOM 2777  H HB3  . ALA A 1 30  ? -18.137 10.009  1.024   1.00 10.80 ? 30  ALA A HB3  2  
ATOM 2778  N N    . PRO A 1 31  ? -15.759 6.879   2.127   1.00 8.82  ? 31  PRO A N    2  
ATOM 2779  C CA   . PRO A 1 31  ? -15.078 5.583   2.085   1.00 7.95  ? 31  PRO A CA   2  
ATOM 2780  C C    . PRO A 1 31  ? -14.780 5.032   3.478   1.00 6.75  ? 31  PRO A C    2  
ATOM 2781  O O    . PRO A 1 31  ? -14.918 5.734   4.481   1.00 6.83  ? 31  PRO A O    2  
ATOM 2782  C CB   . PRO A 1 31  ? -13.782 5.900   1.351   1.00 8.63  ? 31  PRO A CB   2  
ATOM 2783  C CG   . PRO A 1 31  ? -13.475 7.303   1.738   1.00 9.60  ? 31  PRO A CG   2  
ATOM 2784  C CD   . PRO A 1 31  ? -14.806 7.993   1.914   1.00 9.77  ? 31  PRO A CD   2  
ATOM 2785  H HA   . PRO A 1 31  ? -15.645 4.857   1.524   1.00 7.98  ? 31  PRO A HA   2  
ATOM 2786  H HB2  . PRO A 1 31  ? -13.005 5.220   1.673   1.00 8.18  ? 31  PRO A HB2  2  
ATOM 2787  H HB3  . PRO A 1 31  ? -13.932 5.807   0.286   1.00 9.06  ? 31  PRO A HB3  2  
ATOM 2788  H HG2  . PRO A 1 31  ? -12.925 7.312   2.665   1.00 9.59  ? 31  PRO A HG2  2  
ATOM 2789  H HG3  . PRO A 1 31  ? -12.905 7.781   0.955   1.00 10.36 ? 31  PRO A HG3  2  
ATOM 2790  H HD2  . PRO A 1 31  ? -14.784 8.646   2.775   1.00 9.88  ? 31  PRO A HD2  2  
ATOM 2791  H HD3  . PRO A 1 31  ? -15.060 8.551   1.025   1.00 10.60 ? 31  PRO A HD3  2  
ATOM 2792  N N    . ALA A 1 32  ? -14.376 3.771   3.529   1.00 5.86  ? 32  ALA A N    2  
ATOM 2793  C CA   . ALA A 1 32  ? -14.042 3.126   4.788   1.00 4.75  ? 32  ALA A CA   2  
ATOM 2794  C C    . ALA A 1 32  ? -12.572 3.361   5.138   1.00 3.89  ? 32  ALA A C    2  
ATOM 2795  O O    . ALA A 1 32  ? -11.724 3.423   4.251   1.00 3.98  ? 32  ALA A O    2  
ATOM 2796  C CB   . ALA A 1 32  ? -14.337 1.635   4.705   1.00 4.57  ? 32  ALA A CB   2  
ATOM 2797  H H    . ALA A 1 32  ? -14.292 3.265   2.698   1.00 6.11  ? 32  ALA A H    2  
ATOM 2798  H HA   . ALA A 1 32  ? -14.665 3.554   5.561   1.00 5.11  ? 32  ALA A HA   2  
ATOM 2799  H HB1  . ALA A 1 32  ? -15.379 1.487   4.461   1.00 4.83  ? 32  ALA A HB1  2  
ATOM 2800  H HB2  . ALA A 1 32  ? -14.119 1.170   5.656   1.00 4.63  ? 32  ALA A HB2  2  
ATOM 2801  H HB3  . ALA A 1 32  ? -13.721 1.191   3.939   1.00 4.62  ? 32  ALA A HB3  2  
ATOM 2802  N N    . PRO A 1 33  ? -12.255 3.493   6.437   1.00 3.62  ? 33  PRO A N    2  
ATOM 2803  C CA   . PRO A 1 33  ? -10.880 3.735   6.913   1.00 3.45  ? 33  PRO A CA   2  
ATOM 2804  C C    . PRO A 1 33  ? -9.912  2.602   6.562   1.00 2.48  ? 33  PRO A C    2  
ATOM 2805  O O    . PRO A 1 33  ? -8.693  2.774   6.628   1.00 3.06  ? 33  PRO A O    2  
ATOM 2806  C CB   . PRO A 1 33  ? -11.037 3.840   8.436   1.00 4.15  ? 33  PRO A CB   2  
ATOM 2807  C CG   . PRO A 1 33  ? -12.476 4.155   8.651   1.00 4.47  ? 33  PRO A CG   2  
ATOM 2808  C CD   . PRO A 1 33  ? -13.212 3.449   7.551   1.00 4.26  ? 33  PRO A CD   2  
ATOM 2809  H HA   . PRO A 1 33  ? -10.491 4.668   6.525   1.00 4.15  ? 33  PRO A HA   2  
ATOM 2810  H HB2  . PRO A 1 33  ? -10.766 2.900   8.891   1.00 4.01  ? 33  PRO A HB2  2  
ATOM 2811  H HB3  . PRO A 1 33  ? -10.401 4.626   8.815   1.00 4.98  ? 33  PRO A HB3  2  
ATOM 2812  H HG2  . PRO A 1 33  ? -12.796 3.785   9.617   1.00 4.40  ? 33  PRO A HG2  2  
ATOM 2813  H HG3  . PRO A 1 33  ? -12.633 5.221   8.583   1.00 5.36  ? 33  PRO A HG3  2  
ATOM 2814  H HD2  . PRO A 1 33  ? -13.431 2.430   7.835   1.00 4.15  ? 33  PRO A HD2  2  
ATOM 2815  H HD3  . PRO A 1 33  ? -14.118 3.979   7.299   1.00 5.11  ? 33  PRO A HD3  2  
ATOM 2816  N N    . GLU A 1 34  ? -10.454 1.443   6.205   1.00 1.57  ? 34  GLU A N    2  
ATOM 2817  C CA   . GLU A 1 34  ? -9.629  0.314   5.800   1.00 1.27  ? 34  GLU A CA   2  
ATOM 2818  C C    . GLU A 1 34  ? -9.518  0.236   4.283   1.00 1.08  ? 34  GLU A C    2  
ATOM 2819  O O    . GLU A 1 34  ? -8.880  -0.663  3.737   1.00 1.44  ? 34  GLU A O    2  
ATOM 2820  C CB   . GLU A 1 34  ? -10.171 -0.990  6.384   1.00 2.01  ? 34  GLU A CB   2  
ATOM 2821  C CG   . GLU A 1 34  ? -9.972  -1.091  7.891   1.00 2.68  ? 34  GLU A CG   2  
ATOM 2822  C CD   . GLU A 1 34  ? -8.508  -1.210  8.298   1.00 3.58  ? 34  GLU A CD   2  
ATOM 2823  O OE1  . GLU A 1 34  ? -7.656  -0.482  7.741   1.00 4.13  ? 34  GLU A OE1  2  
ATOM 2824  O OE2  . GLU A 1 34  ? -8.211  -2.022  9.196   1.00 4.13  ? 34  GLU A OE2  2  
ATOM 2825  H H    . GLU A 1 34  ? -11.427 1.345   6.219   1.00 1.90  ? 34  GLU A H    2  
ATOM 2826  H HA   . GLU A 1 34  ? -8.638  0.480   6.202   1.00 1.85  ? 34  GLU A HA   2  
ATOM 2827  H HB2  . GLU A 1 34  ? -11.229 -1.053  6.175   1.00 2.33  ? 34  GLU A HB2  2  
ATOM 2828  H HB3  . GLU A 1 34  ? -9.668  -1.824  5.918   1.00 2.63  ? 34  GLU A HB3  2  
ATOM 2829  H HG2  . GLU A 1 34  ? -10.382 -0.206  8.352   1.00 3.03  ? 34  GLU A HG2  2  
ATOM 2830  H HG3  . GLU A 1 34  ? -10.503 -1.960  8.252   1.00 2.92  ? 34  GLU A HG3  2  
ATOM 2831  N N    . GLU A 1 35  ? -10.145 1.186   3.607   1.00 1.01  ? 35  GLU A N    2  
ATOM 2832  C CA   . GLU A 1 35  ? -9.932  1.372   2.187   1.00 0.87  ? 35  GLU A CA   2  
ATOM 2833  C C    . GLU A 1 35  ? -8.953  2.516   2.002   1.00 0.73  ? 35  GLU A C    2  
ATOM 2834  O O    . GLU A 1 35  ? -9.347  3.649   1.727   1.00 0.89  ? 35  GLU A O    2  
ATOM 2835  C CB   . GLU A 1 35  ? -11.240 1.672   1.454   1.00 1.09  ? 35  GLU A CB   2  
ATOM 2836  C CG   . GLU A 1 35  ? -11.722 0.540   0.560   1.00 1.72  ? 35  GLU A CG   2  
ATOM 2837  C CD   . GLU A 1 35  ? -12.107 -0.708  1.331   1.00 1.94  ? 35  GLU A CD   2  
ATOM 2838  O OE1  . GLU A 1 35  ? -13.258 -0.785  1.800   1.00 2.36  ? 35  GLU A OE1  2  
ATOM 2839  O OE2  . GLU A 1 35  ? -11.270 -1.630  1.443   1.00 2.45  ? 35  GLU A OE2  2  
ATOM 2840  H H    . GLU A 1 35  ? -10.749 1.797   4.081   1.00 1.36  ? 35  GLU A H    2  
ATOM 2841  H HA   . GLU A 1 35  ? -9.495  0.466   1.790   1.00 0.87  ? 35  GLU A HA   2  
ATOM 2842  H HB2  . GLU A 1 35  ? -12.009 1.873   2.187   1.00 1.33  ? 35  GLU A HB2  2  
ATOM 2843  H HB3  . GLU A 1 35  ? -11.099 2.551   0.844   1.00 1.44  ? 35  GLU A HB3  2  
ATOM 2844  H HG2  . GLU A 1 35  ? -12.583 0.880   0.003   1.00 2.41  ? 35  GLU A HG2  2  
ATOM 2845  H HG3  . GLU A 1 35  ? -10.930 0.289   -0.130  1.00 2.23  ? 35  GLU A HG3  2  
ATOM 2846  N N    . TRP A 1 36  ? -7.679  2.219   2.203   1.00 0.53  ? 36  TRP A N    2  
ATOM 2847  C CA   . TRP A 1 36  ? -6.650  3.245   2.200   1.00 0.45  ? 36  TRP A CA   2  
ATOM 2848  C C    . TRP A 1 36  ? -6.402  3.747   0.787   1.00 0.46  ? 36  TRP A C    2  
ATOM 2849  O O    . TRP A 1 36  ? -7.072  3.334   -0.163  1.00 0.52  ? 36  TRP A O    2  
ATOM 2850  C CB   . TRP A 1 36  ? -5.332  2.714   2.773   1.00 0.38  ? 36  TRP A CB   2  
ATOM 2851  C CG   . TRP A 1 36  ? -5.476  1.617   3.785   1.00 0.34  ? 36  TRP A CG   2  
ATOM 2852  C CD1  . TRP A 1 36  ? -6.391  1.521   4.798   1.00 0.39  ? 36  TRP A CD1  2  
ATOM 2853  C CD2  . TRP A 1 36  ? -4.644  0.460   3.892   1.00 0.27  ? 36  TRP A CD2  2  
ATOM 2854  N NE1  . TRP A 1 36  ? -6.195  0.356   5.504   1.00 0.36  ? 36  TRP A NE1  2  
ATOM 2855  C CE2  . TRP A 1 36  ? -5.117  -0.307  4.969   1.00 0.28  ? 36  TRP A CE2  2  
ATOM 2856  C CE3  . TRP A 1 36  ? -3.540  -0.001  3.170   1.00 0.21  ? 36  TRP A CE3  2  
ATOM 2857  C CZ2  . TRP A 1 36  ? -4.521  -1.513  5.338   1.00 0.24  ? 36  TRP A CZ2  2  
ATOM 2858  C CZ3  . TRP A 1 36  ? -2.961  -1.186  3.540   1.00 0.17  ? 36  TRP A CZ3  2  
ATOM 2859  C CH2  . TRP A 1 36  ? -3.445  -1.930  4.609   1.00 0.19  ? 36  TRP A CH2  2  
ATOM 2860  H H    . TRP A 1 36  ? -7.426  1.286   2.371   1.00 0.51  ? 36  TRP A H    2  
ATOM 2861  H HA   . TRP A 1 36  ? -6.996  4.068   2.809   1.00 0.53  ? 36  TRP A HA   2  
ATOM 2862  H HB2  . TRP A 1 36  ? -4.732  2.333   1.964   1.00 0.38  ? 36  TRP A HB2  2  
ATOM 2863  H HB3  . TRP A 1 36  ? -4.804  3.531   3.244   1.00 0.44  ? 36  TRP A HB3  2  
ATOM 2864  H HD1  . TRP A 1 36  ? -7.163  2.252   4.989   1.00 0.46  ? 36  TRP A HD1  2  
ATOM 2865  H HE1  . TRP A 1 36  ? -6.742  0.050   6.271   1.00 0.39  ? 36  TRP A HE1  2  
ATOM 2866  H HE3  . TRP A 1 36  ? -3.137  0.551   2.330   1.00 0.21  ? 36  TRP A HE3  2  
ATOM 2867  H HZ2  . TRP A 1 36  ? -4.877  -2.102  6.165   1.00 0.27  ? 36  TRP A HZ2  2  
ATOM 2868  H HZ3  . TRP A 1 36  ? -2.107  -1.553  2.994   1.00 0.16  ? 36  TRP A HZ3  2  
ATOM 2869  H HH2  . TRP A 1 36  ? -2.949  -2.860  4.848   1.00 0.19  ? 36  TRP A HH2  2  
ATOM 2870  N N    . LEU A 1 37  ? -5.416  4.616   0.656   1.00 0.43  ? 37  LEU A N    2  
ATOM 2871  C CA   . LEU A 1 37  ? -5.061  5.164   -0.636  1.00 0.42  ? 37  LEU A CA   2  
ATOM 2872  C C    . LEU A 1 37  ? -4.441  4.082   -1.494  1.00 0.37  ? 37  LEU A C    2  
ATOM 2873  O O    . LEU A 1 37  ? -3.340  3.604   -1.202  1.00 0.35  ? 37  LEU A O    2  
ATOM 2874  C CB   . LEU A 1 37  ? -4.061  6.305   -0.466  1.00 0.45  ? 37  LEU A CB   2  
ATOM 2875  C CG   . LEU A 1 37  ? -3.758  7.102   -1.737  1.00 0.46  ? 37  LEU A CG   2  
ATOM 2876  C CD1  . LEU A 1 37  ? -5.007  7.811   -2.234  1.00 0.49  ? 37  LEU A CD1  2  
ATOM 2877  C CD2  . LEU A 1 37  ? -2.637  8.095   -1.480  1.00 0.50  ? 37  LEU A CD2  2  
ATOM 2878  H H    . LEU A 1 37  ? -4.909  4.887   1.448   1.00 0.43  ? 37  LEU A H    2  
ATOM 2879  H HA   . LEU A 1 37  ? -5.957  5.537   -1.112  1.00 0.46  ? 37  LEU A HA   2  
ATOM 2880  H HB2  . LEU A 1 37  ? -4.443  6.976   0.277   1.00 0.51  ? 37  LEU A HB2  2  
ATOM 2881  H HB3  . LEU A 1 37  ? -3.132  5.892   -0.106  1.00 0.45  ? 37  LEU A HB3  2  
ATOM 2882  H HG   . LEU A 1 37  ? -3.429  6.419   -2.510  1.00 0.43  ? 37  LEU A HG   2  
ATOM 2883  H HD11 . LEU A 1 37  ? -5.365  8.486   -1.473  1.00 1.11  ? 37  LEU A HD11 2  
ATOM 2884  H HD12 . LEU A 1 37  ? -5.771  7.081   -2.455  1.00 1.17  ? 37  LEU A HD12 2  
ATOM 2885  H HD13 . LEU A 1 37  ? -4.774  8.367   -3.129  1.00 1.09  ? 37  LEU A HD13 2  
ATOM 2886  H HD21 . LEU A 1 37  ? -2.429  8.646   -2.385  1.00 1.16  ? 37  LEU A HD21 2  
ATOM 2887  H HD22 . LEU A 1 37  ? -1.749  7.563   -1.169  1.00 1.19  ? 37  LEU A HD22 2  
ATOM 2888  H HD23 . LEU A 1 37  ? -2.936  8.782   -0.702  1.00 1.05  ? 37  LEU A HD23 2  
ATOM 2889  N N    . ASP A 1 38  ? -5.154  3.671   -2.530  1.00 0.38  ? 38  ASP A N    2  
ATOM 2890  C CA   . ASP A 1 38  ? -4.594  2.723   -3.469  1.00 0.41  ? 38  ASP A CA   2  
ATOM 2891  C C    . ASP A 1 38  ? -3.602  3.429   -4.367  1.00 0.39  ? 38  ASP A C    2  
ATOM 2892  O O    . ASP A 1 38  ? -3.905  4.464   -4.962  1.00 0.44  ? 38  ASP A O    2  
ATOM 2893  C CB   . ASP A 1 38  ? -5.662  2.026   -4.307  1.00 0.56  ? 38  ASP A CB   2  
ATOM 2894  C CG   . ASP A 1 38  ? -5.099  0.800   -5.004  1.00 1.78  ? 38  ASP A CG   2  
ATOM 2895  O OD1  . ASP A 1 38  ? -4.520  0.934   -6.097  1.00 2.14  ? 38  ASP A OD1  2  
ATOM 2896  O OD2  . ASP A 1 38  ? -5.240  -0.307  -4.471  1.00 2.51  ? 38  ASP A OD2  2  
ATOM 2897  H H    . ASP A 1 38  ? -6.069  3.998   -2.649  1.00 0.43  ? 38  ASP A H    2  
ATOM 2898  H HA   . ASP A 1 38  ? -4.066  1.979   -2.905  1.00 0.44  ? 38  ASP A HA   2  
ATOM 2899  H HB2  . ASP A 1 38  ? -6.477  1.717   -3.668  1.00 0.96  ? 38  ASP A HB2  2  
ATOM 2900  H HB3  . ASP A 1 38  ? -6.032  2.707   -5.057  1.00 0.85  ? 38  ASP A HB3  2  
ATOM 2901  N N    . ILE A 1 39  ? -2.423  2.854   -4.447  1.00 0.38  ? 39  ILE A N    2  
ATOM 2902  C CA   . ILE A 1 39  ? -1.316  3.429   -5.181  1.00 0.38  ? 39  ILE A CA   2  
ATOM 2903  C C    . ILE A 1 39  ? -1.624  3.482   -6.674  1.00 0.39  ? 39  ILE A C    2  
ATOM 2904  O O    . ILE A 1 39  ? -1.074  4.303   -7.411  1.00 0.46  ? 39  ILE A O    2  
ATOM 2905  C CB   . ILE A 1 39  ? -0.037  2.607   -4.915  1.00 0.39  ? 39  ILE A CB   2  
ATOM 2906  C CG1  . ILE A 1 39  ? 0.181   2.486   -3.397  1.00 0.40  ? 39  ILE A CG1  2  
ATOM 2907  C CG2  . ILE A 1 39  ? 1.168   3.227   -5.602  1.00 0.41  ? 39  ILE A CG2  2  
ATOM 2908  C CD1  . ILE A 1 39  ? 1.563   2.012   -2.996  1.00 0.43  ? 39  ILE A CD1  2  
ATOM 2909  H H    . ILE A 1 39  ? -2.290  1.991   -3.990  1.00 0.43  ? 39  ILE A H    2  
ATOM 2910  H HA   . ILE A 1 39  ? -1.157  4.431   -4.818  1.00 0.40  ? 39  ILE A HA   2  
ATOM 2911  H HB   . ILE A 1 39  ? -0.181  1.621   -5.326  1.00 0.42  ? 39  ILE A HB   2  
ATOM 2912  H HG12 . ILE A 1 39  ? 0.008   3.444   -2.936  1.00 0.38  ? 39  ILE A HG12 2  
ATOM 2913  H HG13 . ILE A 1 39  ? -0.535  1.778   -3.002  1.00 0.45  ? 39  ILE A HG13 2  
ATOM 2914  H HG21 . ILE A 1 39  ? 1.345   4.214   -5.201  1.00 1.04  ? 39  ILE A HG21 2  
ATOM 2915  H HG22 . ILE A 1 39  ? 0.979   3.297   -6.663  1.00 1.05  ? 39  ILE A HG22 2  
ATOM 2916  H HG23 . ILE A 1 39  ? 2.037   2.608   -5.431  1.00 0.96  ? 39  ILE A HG23 2  
ATOM 2917  H HD11 . ILE A 1 39  ? 1.734   1.022   -3.396  1.00 1.14  ? 39  ILE A HD11 2  
ATOM 2918  H HD12 . ILE A 1 39  ? 1.633   1.982   -1.920  1.00 1.00  ? 39  ILE A HD12 2  
ATOM 2919  H HD13 . ILE A 1 39  ? 2.307   2.692   -3.385  1.00 1.15  ? 39  ILE A HD13 2  
ATOM 2920  N N    . LEU A 1 40  ? -2.526  2.620   -7.107  1.00 0.39  ? 40  LEU A N    2  
ATOM 2921  C CA   . LEU A 1 40  ? -2.956  2.603   -8.491  1.00 0.49  ? 40  LEU A CA   2  
ATOM 2922  C C    . LEU A 1 40  ? -4.435  2.955   -8.584  1.00 0.49  ? 40  LEU A C    2  
ATOM 2923  O O    . LEU A 1 40  ? -4.989  3.105   -9.673  1.00 0.62  ? 40  LEU A O    2  
ATOM 2924  C CB   . LEU A 1 40  ? -2.702  1.224   -9.099  1.00 0.56  ? 40  LEU A CB   2  
ATOM 2925  C CG   . LEU A 1 40  ? -1.259  0.718   -8.991  1.00 0.59  ? 40  LEU A CG   2  
ATOM 2926  C CD1  . LEU A 1 40  ? -1.139  -0.660  -9.613  1.00 0.62  ? 40  LEU A CD1  2  
ATOM 2927  C CD2  . LEU A 1 40  ? -0.299  1.689   -9.663  1.00 0.72  ? 40  LEU A CD2  2  
ATOM 2928  H H    . LEU A 1 40  ? -2.923  1.978   -6.473  1.00 0.39  ? 40  LEU A H    2  
ATOM 2929  H HA   . LEU A 1 40  ? -2.384  3.338   -9.028  1.00 0.60  ? 40  LEU A HA   2  
ATOM 2930  H HB2  . LEU A 1 40  ? -3.349  0.514   -8.603  1.00 0.66  ? 40  LEU A HB2  2  
ATOM 2931  H HB3  . LEU A 1 40  ? -2.970  1.263   -10.143 1.00 0.72  ? 40  LEU A HB3  2  
ATOM 2932  H HG   . LEU A 1 40  ? -0.985  0.639   -7.945  1.00 0.82  ? 40  LEU A HG   2  
ATOM 2933  H HD11 . LEU A 1 40  ? -1.434  -0.613  -10.651 1.00 1.21  ? 40  LEU A HD11 2  
ATOM 2934  H HD12 . LEU A 1 40  ? -1.784  -1.349  -9.087  1.00 1.27  ? 40  LEU A HD12 2  
ATOM 2935  H HD13 . LEU A 1 40  ? -0.117  -0.999  -9.545  1.00 1.08  ? 40  LEU A HD13 2  
ATOM 2936  H HD21 . LEU A 1 40  ? -0.379  2.658   -9.192  1.00 1.43  ? 40  LEU A HD21 2  
ATOM 2937  H HD22 . LEU A 1 40  ? -0.551  1.775   -10.711 1.00 1.27  ? 40  LEU A HD22 2  
ATOM 2938  H HD23 . LEU A 1 40  ? 0.713   1.322   -9.564  1.00 1.06  ? 40  LEU A HD23 2  
ATOM 2939  N N    . GLY A 1 41  ? -5.061  3.091   -7.422  1.00 0.43  ? 41  GLY A N    2  
ATOM 2940  C CA   . GLY A 1 41  ? -6.487  3.329   -7.347  1.00 0.51  ? 41  GLY A CA   2  
ATOM 2941  C C    . GLY A 1 41  ? -7.298  2.120   -7.779  1.00 0.45  ? 41  GLY A C    2  
ATOM 2942  O O    . GLY A 1 41  ? -8.483  2.241   -8.091  1.00 0.52  ? 41  GLY A O    2  
ATOM 2943  H H    . GLY A 1 41  ? -4.537  3.026   -6.593  1.00 0.38  ? 41  GLY A H    2  
ATOM 2944  H HA2  . GLY A 1 41  ? -6.747  3.577   -6.328  1.00 0.54  ? 41  GLY A HA2  2  
ATOM 2945  H HA3  . GLY A 1 41  ? -6.734  4.162   -7.978  1.00 0.65  ? 41  GLY A HA3  2  
ATOM 2946  N N    . ASN A 1 42  ? -6.665  0.946   -7.788  1.00 0.39  ? 42  ASN A N    2  
ATOM 2947  C CA   . ASN A 1 42  ? -7.337  -0.260  -8.271  1.00 0.42  ? 42  ASN A CA   2  
ATOM 2948  C C    . ASN A 1 42  ? -7.904  -1.115  -7.133  1.00 0.43  ? 42  ASN A C    2  
ATOM 2949  O O    . ASN A 1 42  ? -8.925  -1.779  -7.307  1.00 0.56  ? 42  ASN A O    2  
ATOM 2950  C CB   . ASN A 1 42  ? -6.431  -1.088  -9.209  1.00 0.49  ? 42  ASN A CB   2  
ATOM 2951  C CG   . ASN A 1 42  ? -5.310  -1.892  -8.552  1.00 0.55  ? 42  ASN A CG   2  
ATOM 2952  O OD1  . ASN A 1 42  ? -4.955  -2.960  -9.044  1.00 0.95  ? 42  ASN A OD1  2  
ATOM 2953  N ND2  . ASN A 1 42  ? -4.712  -1.400  -7.479  1.00 0.44  ? 42  ASN A ND2  2  
ATOM 2954  H H    . ASN A 1 42  ? -5.732  0.902   -7.469  1.00 0.39  ? 42  ASN A H    2  
ATOM 2955  H HA   . ASN A 1 42  ? -8.181  0.084   -8.852  1.00 0.49  ? 42  ASN A HA   2  
ATOM 2956  H HB2  . ASN A 1 42  ? -7.052  -1.786  -9.738  1.00 0.69  ? 42  ASN A HB2  2  
ATOM 2957  H HB3  . ASN A 1 42  ? -5.984  -0.415  -9.928  1.00 0.57  ? 42  ASN A HB3  2  
ATOM 2958  H HD21 . ASN A 1 42  ? -5.008  -0.534  -7.129  1.00 0.54  ? 42  ASN A HD21 2  
ATOM 2959  H HD22 . ASN A 1 42  ? -3.981  -1.918  -7.087  1.00 0.56  ? 42  ASN A HD22 2  
ATOM 2960  N N    . GLY A 1 43  ? -7.261  -1.100  -5.971  1.00 0.40  ? 43  GLY A N    2  
ATOM 2961  C CA   . GLY A 1 43  ? -7.811  -1.793  -4.813  1.00 0.50  ? 43  GLY A CA   2  
ATOM 2962  C C    . GLY A 1 43  ? -6.927  -2.932  -4.354  1.00 0.45  ? 43  GLY A C    2  
ATOM 2963  O O    . GLY A 1 43  ? -7.223  -3.610  -3.373  1.00 0.72  ? 43  GLY A O    2  
ATOM 2964  H H    . GLY A 1 43  ? -6.393  -0.633  -5.893  1.00 0.39  ? 43  GLY A H    2  
ATOM 2965  H HA2  . GLY A 1 43  ? -7.919  -1.087  -4.003  1.00 0.60  ? 43  GLY A HA2  2  
ATOM 2966  H HA3  . GLY A 1 43  ? -8.786  -2.181  -5.069  1.00 0.58  ? 43  GLY A HA3  2  
ATOM 2967  N N    . LEU A 1 44  ? -5.831  -3.126  -5.068  1.00 0.29  ? 44  LEU A N    2  
ATOM 2968  C CA   . LEU A 1 44  ? -4.905  -4.221  -4.800  1.00 0.36  ? 44  LEU A CA   2  
ATOM 2969  C C    . LEU A 1 44  ? -3.712  -3.734  -3.991  1.00 0.25  ? 44  LEU A C    2  
ATOM 2970  O O    . LEU A 1 44  ? -3.162  -4.462  -3.167  1.00 0.27  ? 44  LEU A O    2  
ATOM 2971  C CB   . LEU A 1 44  ? -4.397  -4.822  -6.120  1.00 0.60  ? 44  LEU A CB   2  
ATOM 2972  C CG   . LEU A 1 44  ? -5.386  -5.702  -6.895  1.00 0.51  ? 44  LEU A CG   2  
ATOM 2973  C CD1  . LEU A 1 44  ? -6.660  -4.949  -7.246  1.00 1.46  ? 44  LEU A CD1  2  
ATOM 2974  C CD2  . LEU A 1 44  ? -4.724  -6.245  -8.150  1.00 1.56  ? 44  LEU A CD2  2  
ATOM 2975  H H    . LEU A 1 44  ? -5.637  -2.512  -5.803  1.00 0.39  ? 44  LEU A H    2  
ATOM 2976  H HA   . LEU A 1 44  ? -5.429  -4.983  -4.242  1.00 0.47  ? 44  LEU A HA   2  
ATOM 2977  H HB2  . LEU A 1 44  ? -4.101  -4.009  -6.766  1.00 1.23  ? 44  LEU A HB2  2  
ATOM 2978  H HB3  . LEU A 1 44  ? -3.521  -5.416  -5.900  1.00 1.12  ? 44  LEU A HB3  2  
ATOM 2979  H HG   . LEU A 1 44  ? -5.656  -6.535  -6.278  1.00 0.99  ? 44  LEU A HG   2  
ATOM 2980  H HD11 . LEU A 1 44  ? -6.430  -4.158  -7.946  1.00 1.90  ? 44  LEU A HD11 2  
ATOM 2981  H HD12 . LEU A 1 44  ? -7.076  -4.516  -6.347  1.00 2.02  ? 44  LEU A HD12 2  
ATOM 2982  H HD13 . LEU A 1 44  ? -7.377  -5.626  -7.687  1.00 2.09  ? 44  LEU A HD13 2  
ATOM 2983  H HD21 . LEU A 1 44  ? -3.884  -6.865  -7.875  1.00 2.16  ? 44  LEU A HD21 2  
ATOM 2984  H HD22 . LEU A 1 44  ? -4.381  -5.423  -8.761  1.00 1.97  ? 44  LEU A HD22 2  
ATOM 2985  H HD23 . LEU A 1 44  ? -5.439  -6.835  -8.710  1.00 2.15  ? 44  LEU A HD23 2  
ATOM 2986  N N    . LEU A 1 45  ? -3.303  -2.515  -4.276  1.00 0.23  ? 45  LEU A N    2  
ATOM 2987  C CA   . LEU A 1 45  ? -2.087  -1.947  -3.723  1.00 0.22  ? 45  LEU A CA   2  
ATOM 2988  C C    . LEU A 1 45  ? -2.375  -0.652  -2.967  1.00 0.22  ? 45  LEU A C    2  
ATOM 2989  O O    . LEU A 1 45  ? -2.539  0.395   -3.575  1.00 0.32  ? 45  LEU A O    2  
ATOM 2990  C CB   . LEU A 1 45  ? -1.121  -1.715  -4.876  1.00 0.30  ? 45  LEU A CB   2  
ATOM 2991  C CG   . LEU A 1 45  ? 0.088   -0.856  -4.567  1.00 0.26  ? 45  LEU A CG   2  
ATOM 2992  C CD1  . LEU A 1 45  ? 0.845   -1.416  -3.380  1.00 0.28  ? 45  LEU A CD1  2  
ATOM 2993  C CD2  . LEU A 1 45  ? 0.965   -0.778  -5.798  1.00 0.31  ? 45  LEU A CD2  2  
ATOM 2994  H H    . LEU A 1 45  ? -3.856  -1.957  -4.856  1.00 0.26  ? 45  LEU A H    2  
ATOM 2995  H HA   . LEU A 1 45  ? -1.655  -2.663  -3.042  1.00 0.22  ? 45  LEU A HA   2  
ATOM 2996  H HB2  . LEU A 1 45  ? -0.771  -2.680  -5.213  1.00 0.43  ? 45  LEU A HB2  2  
ATOM 2997  H HB3  . LEU A 1 45  ? -1.666  -1.252  -5.684  1.00 0.42  ? 45  LEU A HB3  2  
ATOM 2998  H HG   . LEU A 1 45  ? -0.235  0.146   -4.319  1.00 0.29  ? 45  LEU A HG   2  
ATOM 2999  H HD11 . LEU A 1 45  ? 1.203   -2.406  -3.616  1.00 1.00  ? 45  LEU A HD11 2  
ATOM 3000  H HD12 . LEU A 1 45  ? 0.183   -1.465  -2.527  1.00 1.01  ? 45  LEU A HD12 2  
ATOM 3001  H HD13 . LEU A 1 45  ? 1.682   -0.774  -3.149  1.00 1.12  ? 45  LEU A HD13 2  
ATOM 3002  H HD21 . LEU A 1 45  ? 1.357   -1.760  -6.021  1.00 0.96  ? 45  LEU A HD21 2  
ATOM 3003  H HD22 . LEU A 1 45  ? 1.776   -0.090  -5.625  1.00 1.12  ? 45  LEU A HD22 2  
ATOM 3004  H HD23 . LEU A 1 45  ? 0.366   -0.432  -6.631  1.00 1.10  ? 45  LEU A HD23 2  
ATOM 3005  N N    . ARG A 1 46  ? -2.420  -0.713  -1.646  1.00 0.20  ? 46  ARG A N    2  
ATOM 3006  C CA   . ARG A 1 46  ? -2.859  0.435   -0.853  1.00 0.22  ? 46  ARG A CA   2  
ATOM 3007  C C    . ARG A 1 46  ? -1.925  0.691   0.321   1.00 0.19  ? 46  ARG A C    2  
ATOM 3008  O O    . ARG A 1 46  ? -1.485  -0.247  0.976   1.00 0.19  ? 46  ARG A O    2  
ATOM 3009  C CB   . ARG A 1 46  ? -4.264  0.173   -0.334  1.00 0.25  ? 46  ARG A CB   2  
ATOM 3010  C CG   . ARG A 1 46  ? -5.210  -0.297  -1.421  1.00 0.36  ? 46  ARG A CG   2  
ATOM 3011  C CD   . ARG A 1 46  ? -6.595  -0.558  -0.877  1.00 0.37  ? 46  ARG A CD   2  
ATOM 3012  N NE   . ARG A 1 46  ? -6.576  -1.607  0.142   1.00 0.54  ? 46  ARG A NE   2  
ATOM 3013  C CZ   . ARG A 1 46  ? -7.642  -1.959  0.853   1.00 0.75  ? 46  ARG A CZ   2  
ATOM 3014  N NH1  . ARG A 1 46  ? -8.803  -1.361  0.632   1.00 1.14  ? 46  ARG A NH1  2  
ATOM 3015  N NH2  . ARG A 1 46  ? -7.557  -2.919  1.772   1.00 0.99  ? 46  ARG A NH2  2  
ATOM 3016  H H    . ARG A 1 46  ? -2.153  -1.544  -1.192  1.00 0.20  ? 46  ARG A H    2  
ATOM 3017  H HA   . ARG A 1 46  ? -2.876  1.311   -1.492  1.00 0.25  ? 46  ARG A HA   2  
ATOM 3018  H HB2  . ARG A 1 46  ? -4.214  -0.588  0.432   1.00 0.30  ? 46  ARG A HB2  2  
ATOM 3019  H HB3  . ARG A 1 46  ? -4.657  1.082   0.094   1.00 0.35  ? 46  ARG A HB3  2  
ATOM 3020  H HG2  . ARG A 1 46  ? -5.263  0.457   -2.193  1.00 0.50  ? 46  ARG A HG2  2  
ATOM 3021  H HG3  . ARG A 1 46  ? -4.823  -1.215  -1.843  1.00 0.49  ? 46  ARG A HG3  2  
ATOM 3022  H HD2  . ARG A 1 46  ? -6.977  0.356   -0.442  1.00 0.47  ? 46  ARG A HD2  2  
ATOM 3023  H HD3  . ARG A 1 46  ? -7.237  -0.868  -1.689  1.00 0.51  ? 46  ARG A HD3  2  
ATOM 3024  H HE   . ARG A 1 46  ? -5.719  -2.064  0.299   1.00 0.87  ? 46  ARG A HE   2  
ATOM 3025  H HH11 . ARG A 1 46  ? -8.876  -0.652  -0.068  1.00 1.24  ? 46  ARG A HH11 2  
ATOM 3026  H HH12 . ARG A 1 46  ? -9.622  -1.615  1.170   1.00 1.49  ? 46  ARG A HH12 2  
ATOM 3027  H HH21 . ARG A 1 46  ? -6.688  -3.392  1.934   1.00 1.18  ? 46  ARG A HH21 2  
ATOM 3028  H HH22 . ARG A 1 46  ? -8.365  -3.168  2.312   1.00 1.21  ? 46  ARG A HH22 2  
ATOM 3029  N N    . LYS A 1 47  ? -1.657  1.962   0.601   1.00 0.20  ? 47  LYS A N    2  
ATOM 3030  C CA   . LYS A 1 47  ? -0.737  2.347   1.665   1.00 0.17  ? 47  LYS A CA   2  
ATOM 3031  C C    . LYS A 1 47  ? -1.492  3.019   2.817   1.00 0.18  ? 47  LYS A C    2  
ATOM 3032  O O    . LYS A 1 47  ? -2.188  4.015   2.612   1.00 0.22  ? 47  LYS A O    2  
ATOM 3033  C CB   . LYS A 1 47  ? 0.306   3.319   1.103   1.00 0.23  ? 47  LYS A CB   2  
ATOM 3034  C CG   . LYS A 1 47  ? 1.571   3.409   1.933   1.00 0.25  ? 47  LYS A CG   2  
ATOM 3035  C CD   . LYS A 1 47  ? 2.281   4.734   1.734   1.00 0.32  ? 47  LYS A CD   2  
ATOM 3036  C CE   . LYS A 1 47  ? 1.559   5.862   2.468   1.00 0.20  ? 47  LYS A CE   2  
ATOM 3037  N NZ   . LYS A 1 47  ? 2.465   6.985   2.841   1.00 0.35  ? 47  LYS A NZ   2  
ATOM 3038  H H    . LYS A 1 47  ? -2.093  2.666   0.075   1.00 0.22  ? 47  LYS A H    2  
ATOM 3039  H HA   . LYS A 1 47  ? -0.239  1.461   2.033   1.00 0.15  ? 47  LYS A HA   2  
ATOM 3040  H HB2  . LYS A 1 47  ? 0.577   3.007   0.105   1.00 0.31  ? 47  LYS A HB2  2  
ATOM 3041  H HB3  . LYS A 1 47  ? -0.133  4.303   1.054   1.00 0.27  ? 47  LYS A HB3  2  
ATOM 3042  H HG2  . LYS A 1 47  ? 1.317   3.303   2.977   1.00 0.25  ? 47  LYS A HG2  2  
ATOM 3043  H HG3  . LYS A 1 47  ? 2.239   2.610   1.642   1.00 0.31  ? 47  LYS A HG3  2  
ATOM 3044  H HD2  . LYS A 1 47  ? 3.289   4.646   2.097   1.00 0.45  ? 47  LYS A HD2  2  
ATOM 3045  H HD3  . LYS A 1 47  ? 2.299   4.959   0.677   1.00 0.45  ? 47  LYS A HD3  2  
ATOM 3046  H HE2  . LYS A 1 47  ? 0.781   6.244   1.820   1.00 0.39  ? 47  LYS A HE2  2  
ATOM 3047  H HE3  . LYS A 1 47  ? 1.110   5.459   3.362   1.00 0.35  ? 47  LYS A HE3  2  
ATOM 3048  H HZ1  . LYS A 1 47  ? 1.913   7.778   3.222   1.00 1.00  ? 47  LYS A HZ1  2  
ATOM 3049  H HZ2  . LYS A 1 47  ? 2.995   7.316   2.011   1.00 1.12  ? 47  LYS A HZ2  2  
ATOM 3050  H HZ3  . LYS A 1 47  ? 3.145   6.671   3.577   1.00 1.03  ? 47  LYS A HZ3  2  
ATOM 3051  N N    . LYS A 1 48  ? -1.355  2.474   4.023   1.00 0.16  ? 48  LYS A N    2  
ATOM 3052  C CA   . LYS A 1 48  ? -1.944  3.086   5.214   1.00 0.18  ? 48  LYS A CA   2  
ATOM 3053  C C    . LYS A 1 48  ? -0.877  3.799   6.025   1.00 0.17  ? 48  LYS A C    2  
ATOM 3054  O O    . LYS A 1 48  ? 0.067   3.172   6.505   1.00 0.22  ? 48  LYS A O    2  
ATOM 3055  C CB   . LYS A 1 48  ? -2.610  2.039   6.114   1.00 0.25  ? 48  LYS A CB   2  
ATOM 3056  C CG   . LYS A 1 48  ? -3.265  2.640   7.359   1.00 0.32  ? 48  LYS A CG   2  
ATOM 3057  C CD   . LYS A 1 48  ? -3.181  1.708   8.561   1.00 0.69  ? 48  LYS A CD   2  
ATOM 3058  C CE   . LYS A 1 48  ? -4.032  0.466   8.387   1.00 0.52  ? 48  LYS A CE   2  
ATOM 3059  N NZ   . LYS A 1 48  ? -5.480  0.747   8.588   1.00 1.07  ? 48  LYS A NZ   2  
ATOM 3060  H H    . LYS A 1 48  ? -0.853  1.633   4.116   1.00 0.15  ? 48  LYS A H    2  
ATOM 3061  H HA   . LYS A 1 48  ? -2.685  3.803   4.892   1.00 0.21  ? 48  LYS A HA   2  
ATOM 3062  H HB2  . LYS A 1 48  ? -3.368  1.521   5.547   1.00 0.30  ? 48  LYS A HB2  2  
ATOM 3063  H HB3  . LYS A 1 48  ? -1.861  1.329   6.433   1.00 0.28  ? 48  LYS A HB3  2  
ATOM 3064  H HG2  . LYS A 1 48  ? -2.762  3.564   7.604   1.00 0.51  ? 48  LYS A HG2  2  
ATOM 3065  H HG3  . LYS A 1 48  ? -4.305  2.845   7.143   1.00 0.53  ? 48  LYS A HG3  2  
ATOM 3066  H HD2  . LYS A 1 48  ? -2.155  1.406   8.697   1.00 1.29  ? 48  LYS A HD2  2  
ATOM 3067  H HD3  . LYS A 1 48  ? -3.518  2.240   9.440   1.00 1.29  ? 48  LYS A HD3  2  
ATOM 3068  H HE2  . LYS A 1 48  ? -3.878  0.090   7.392   1.00 1.14  ? 48  LYS A HE2  2  
ATOM 3069  H HE3  . LYS A 1 48  ? -3.714  -0.276  9.106   1.00 0.96  ? 48  LYS A HE3  2  
ATOM 3070  H HZ1  . LYS A 1 48  ? -6.057  -0.065  8.267   1.00 1.56  ? 48  LYS A HZ1  2  
ATOM 3071  H HZ2  . LYS A 1 48  ? -5.764  1.591   8.058   1.00 1.60  ? 48  LYS A HZ2  2  
ATOM 3072  H HZ3  . LYS A 1 48  ? -5.671  0.904   9.601   1.00 1.65  ? 48  LYS A HZ3  2  
ATOM 3073  N N    . THR A 1 49  ? -1.031  5.095   6.186   1.00 0.18  ? 49  THR A N    2  
ATOM 3074  C CA   . THR A 1 49  ? -0.133  5.863   7.018   1.00 0.20  ? 49  THR A CA   2  
ATOM 3075  C C    . THR A 1 49  ? -0.448  5.642   8.492   1.00 0.21  ? 49  THR A C    2  
ATOM 3076  O O    . THR A 1 49  ? -1.361  6.258   9.039   1.00 0.29  ? 49  THR A O    2  
ATOM 3077  C CB   . THR A 1 49  ? -0.235  7.358   6.682   1.00 0.25  ? 49  THR A CB   2  
ATOM 3078  O OG1  . THR A 1 49  ? -1.597  7.691   6.379   1.00 0.33  ? 49  THR A OG1  2  
ATOM 3079  C CG2  . THR A 1 49  ? 0.653   7.710   5.502   1.00 0.25  ? 49  THR A CG2  2  
ATOM 3080  H H    . THR A 1 49  ? -1.772  5.555   5.739   1.00 0.21  ? 49  THR A H    2  
ATOM 3081  H HA   . THR A 1 49  ? 0.882   5.539   6.822   1.00 0.19  ? 49  THR A HA   2  
ATOM 3082  H HB   . THR A 1 49  ? 0.088   7.928   7.542   1.00 0.28  ? 49  THR A HB   2  
ATOM 3083  H HG1  . THR A 1 49  ? -1.786  8.578   6.691   1.00 0.68  ? 49  THR A HG1  2  
ATOM 3084  H HG21 . THR A 1 49  ? 0.535   8.756   5.261   1.00 1.03  ? 49  THR A HG21 2  
ATOM 3085  H HG22 . THR A 1 49  ? 0.375   7.110   4.647   1.00 1.01  ? 49  THR A HG22 2  
ATOM 3086  H HG23 . THR A 1 49  ? 1.685   7.513   5.757   1.00 1.03  ? 49  THR A HG23 2  
ATOM 3087  N N    . LEU A 1 50  ? 0.282   4.723   9.116   1.00 0.18  ? 50  LEU A N    2  
ATOM 3088  C CA   . LEU A 1 50  ? 0.161   4.508   10.552  1.00 0.21  ? 50  LEU A CA   2  
ATOM 3089  C C    . LEU A 1 50  ? 0.595   5.791   11.239  1.00 0.23  ? 50  LEU A C    2  
ATOM 3090  O O    . LEU A 1 50  ? -0.063  6.320   12.133  1.00 0.28  ? 50  LEU A O    2  
ATOM 3091  C CB   . LEU A 1 50  ? 1.083   3.375   11.002  1.00 0.21  ? 50  LEU A CB   2  
ATOM 3092  C CG   . LEU A 1 50  ? 1.074   2.138   10.113  1.00 0.20  ? 50  LEU A CG   2  
ATOM 3093  C CD1  . LEU A 1 50  ? 2.288   1.276   10.399  1.00 0.21  ? 50  LEU A CD1  2  
ATOM 3094  C CD2  . LEU A 1 50  ? -0.205  1.352   10.322  1.00 0.24  ? 50  LEU A CD2  2  
ATOM 3095  H H    . LEU A 1 50  ? 0.929   4.190   8.602   1.00 0.15  ? 50  LEU A H    2  
ATOM 3096  H HA   . LEU A 1 50  ? -0.873  4.270   10.786  1.00 0.23  ? 50  LEU A HA   2  
ATOM 3097  H HB2  . LEU A 1 50  ? 2.093   3.757   11.039  1.00 0.21  ? 50  LEU A HB2  2  
ATOM 3098  H HB3  . LEU A 1 50  ? 0.792   3.077   11.997  1.00 0.25  ? 50  LEU A HB3  2  
ATOM 3099  H HG   . LEU A 1 50  ? 1.117   2.448   9.077   1.00 0.17  ? 50  LEU A HG   2  
ATOM 3100  H HD11 . LEU A 1 50  ? 2.291   0.986   11.438  1.00 1.02  ? 50  LEU A HD11 2  
ATOM 3101  H HD12 . LEU A 1 50  ? 3.184   1.841   10.178  1.00 1.05  ? 50  LEU A HD12 2  
ATOM 3102  H HD13 . LEU A 1 50  ? 2.257   0.394   9.777   1.00 1.04  ? 50  LEU A HD13 2  
ATOM 3103  H HD21 . LEU A 1 50  ? -1.049  1.962   10.035  1.00 1.01  ? 50  LEU A HD21 2  
ATOM 3104  H HD22 . LEU A 1 50  ? -0.292  1.085   11.363  1.00 1.02  ? 50  LEU A HD22 2  
ATOM 3105  H HD23 . LEU A 1 50  ? -0.181  0.457   9.719   1.00 1.06  ? 50  LEU A HD23 2  
ATOM 3106  N N    . VAL A 1 51  ? 1.752   6.241   10.790  1.00 0.23  ? 51  VAL A N    2  
ATOM 3107  C CA   . VAL A 1 51  ? 2.310   7.540   11.111  1.00 0.27  ? 51  VAL A CA   2  
ATOM 3108  C C    . VAL A 1 51  ? 2.930   8.063   9.850   1.00 0.24  ? 51  VAL A C    2  
ATOM 3109  O O    . VAL A 1 51  ? 3.706   7.351   9.239   1.00 0.23  ? 51  VAL A O    2  
ATOM 3110  C CB   . VAL A 1 51  ? 3.427   7.455   12.156  1.00 0.30  ? 51  VAL A CB   2  
ATOM 3111  C CG1  . VAL A 1 51  ? 3.999   8.831   12.457  1.00 0.36  ? 51  VAL A CG1  2  
ATOM 3112  C CG2  . VAL A 1 51  ? 2.925   6.791   13.418  1.00 0.36  ? 51  VAL A CG2  2  
ATOM 3113  H H    . VAL A 1 51  ? 2.270   5.657   10.189  1.00 0.21  ? 51  VAL A H    2  
ATOM 3114  H HA   . VAL A 1 51  ? 1.529   8.201   11.458  1.00 0.33  ? 51  VAL A HA   2  
ATOM 3115  H HB   . VAL A 1 51  ? 4.216   6.848   11.733  1.00 0.26  ? 51  VAL A HB   2  
ATOM 3116  H HG11 . VAL A 1 51  ? 4.403   9.257   11.550  1.00 1.03  ? 51  VAL A HG11 2  
ATOM 3117  H HG12 . VAL A 1 51  ? 4.784   8.742   13.194  1.00 1.08  ? 51  VAL A HG12 2  
ATOM 3118  H HG13 . VAL A 1 51  ? 3.216   9.470   12.839  1.00 1.14  ? 51  VAL A HG13 2  
ATOM 3119  H HG21 . VAL A 1 51  ? 3.695   6.825   14.173  1.00 0.96  ? 51  VAL A HG21 2  
ATOM 3120  H HG22 . VAL A 1 51  ? 2.671   5.763   13.205  1.00 1.11  ? 51  VAL A HG22 2  
ATOM 3121  H HG23 . VAL A 1 51  ? 2.049   7.316   13.766  1.00 1.06  ? 51  VAL A HG23 2  
ATOM 3122  N N    . PRO A 1 52  ? 2.577   9.260   9.412   1.00 0.29  ? 52  PRO A N    2  
ATOM 3123  C CA   . PRO A 1 52  ? 3.145   9.851   8.222   1.00 0.32  ? 52  PRO A CA   2  
ATOM 3124  C C    . PRO A 1 52  ? 4.172   10.946  8.506   1.00 0.34  ? 52  PRO A C    2  
ATOM 3125  O O    . PRO A 1 52  ? 3.964   12.116  8.183   1.00 0.54  ? 52  PRO A O    2  
ATOM 3126  C CB   . PRO A 1 52  ? 1.891   10.401  7.585   1.00 0.41  ? 52  PRO A CB   2  
ATOM 3127  C CG   . PRO A 1 52  ? 1.046   10.868  8.742   1.00 0.46  ? 52  PRO A CG   2  
ATOM 3128  C CD   . PRO A 1 52  ? 1.521   10.112  9.964   1.00 0.37  ? 52  PRO A CD   2  
ATOM 3129  H HA   . PRO A 1 52  ? 3.582   9.105   7.579   1.00 0.32  ? 52  PRO A HA   2  
ATOM 3130  H HB2  . PRO A 1 52  ? 2.140   11.209  6.911   1.00 0.45  ? 52  PRO A HB2  2  
ATOM 3131  H HB3  . PRO A 1 52  ? 1.412   9.599   7.048   1.00 0.45  ? 52  PRO A HB3  2  
ATOM 3132  H HG2  . PRO A 1 52  ? 1.182   11.926  8.889   1.00 0.51  ? 52  PRO A HG2  2  
ATOM 3133  H HG3  . PRO A 1 52  ? 0.007   10.647  8.547   1.00 0.56  ? 52  PRO A HG3  2  
ATOM 3134  H HD2  . PRO A 1 52  ? 1.914   10.795  10.704  1.00 0.39  ? 52  PRO A HD2  2  
ATOM 3135  H HD3  . PRO A 1 52  ? 0.722   9.516   10.380  1.00 0.41  ? 52  PRO A HD3  2  
ATOM 3136  N N    . GLY A 1 53  ? 5.275   10.545  9.121   1.00 0.24  ? 53  GLY A N    2  
ATOM 3137  C CA   . GLY A 1 53  ? 6.391   11.442  9.332   1.00 0.28  ? 53  GLY A CA   2  
ATOM 3138  C C    . GLY A 1 53  ? 6.117   12.535  10.347  1.00 0.29  ? 53  GLY A C    2  
ATOM 3139  O O    . GLY A 1 53  ? 5.030   12.609  10.927  1.00 0.55  ? 53  GLY A O    2  
ATOM 3140  H H    . GLY A 1 53  ? 5.338   9.616   9.420   1.00 0.26  ? 53  GLY A H    2  
ATOM 3141  H HA2  . GLY A 1 53  ? 7.238   10.866  9.667   1.00 0.34  ? 53  GLY A HA2  2  
ATOM 3142  H HA3  . GLY A 1 53  ? 6.640   11.903  8.386   1.00 0.35  ? 53  GLY A HA3  2  
ATOM 3143  N N    . PRO A 1 54  ? 7.125   13.376  10.616  1.00 0.52  ? 54  PRO A N    2  
ATOM 3144  C CA   . PRO A 1 54  ? 6.975   14.561  11.444  1.00 0.67  ? 54  PRO A CA   2  
ATOM 3145  C C    . PRO A 1 54  ? 6.586   15.776  10.600  1.00 0.78  ? 54  PRO A C    2  
ATOM 3146  O O    . PRO A 1 54  ? 6.689   15.732  9.375   1.00 1.20  ? 54  PRO A O    2  
ATOM 3147  C CB   . PRO A 1 54  ? 8.373   14.734  12.029  1.00 1.03  ? 54  PRO A CB   2  
ATOM 3148  C CG   . PRO A 1 54  ? 9.302   14.192  10.986  1.00 1.42  ? 54  PRO A CG   2  
ATOM 3149  C CD   . PRO A 1 54  ? 8.509   13.230  10.133  1.00 0.91  ? 54  PRO A CD   2  
ATOM 3150  H HA   . PRO A 1 54  ? 6.253   14.414  12.236  1.00 0.63  ? 54  PRO A HA   2  
ATOM 3151  H HB2  . PRO A 1 54  ? 8.557   15.783  12.214  1.00 1.19  ? 54  PRO A HB2  2  
ATOM 3152  H HB3  . PRO A 1 54  ? 8.452   14.181  12.950  1.00 1.08  ? 54  PRO A HB3  2  
ATOM 3153  H HG2  . PRO A 1 54  ? 9.678   15.002  10.381  1.00 1.91  ? 54  PRO A HG2  2  
ATOM 3154  H HG3  . PRO A 1 54  ? 10.122  13.676  11.465  1.00 1.81  ? 54  PRO A HG3  2  
ATOM 3155  H HD2  . PRO A 1 54  ? 8.583   13.504  9.091   1.00 1.01  ? 54  PRO A HD2  2  
ATOM 3156  H HD3  . PRO A 1 54  ? 8.864   12.219  10.281  1.00 0.97  ? 54  PRO A HD3  2  
ATOM 3157  N N    . PRO A 1 55  ? 6.115   16.864  11.231  1.00 0.97  ? 55  PRO A N    2  
ATOM 3158  C CA   . PRO A 1 55  ? 5.749   18.089  10.511  1.00 1.24  ? 55  PRO A CA   2  
ATOM 3159  C C    . PRO A 1 55  ? 6.937   18.687  9.762   1.00 0.93  ? 55  PRO A C    2  
ATOM 3160  O O    . PRO A 1 55  ? 7.841   19.262  10.370  1.00 1.20  ? 55  PRO A O    2  
ATOM 3161  C CB   . PRO A 1 55  ? 5.288   19.045  11.618  1.00 1.81  ? 55  PRO A CB   2  
ATOM 3162  C CG   . PRO A 1 55  ? 4.971   18.169  12.784  1.00 2.04  ? 55  PRO A CG   2  
ATOM 3163  C CD   . PRO A 1 55  ? 5.898   16.991  12.680  1.00 1.47  ? 55  PRO A CD   2  
ATOM 3164  H HA   . PRO A 1 55  ? 4.937   17.917  9.819   1.00 1.48  ? 55  PRO A HA   2  
ATOM 3165  H HB2  . PRO A 1 55  ? 6.086   19.735  11.851  1.00 1.86  ? 55  PRO A HB2  2  
ATOM 3166  H HB3  . PRO A 1 55  ? 4.418   19.592  11.286  1.00 2.24  ? 55  PRO A HB3  2  
ATOM 3167  H HG2  . PRO A 1 55  ? 5.148   18.706  13.705  1.00 2.40  ? 55  PRO A HG2  2  
ATOM 3168  H HG3  . PRO A 1 55  ? 3.944   17.843  12.729  1.00 2.53  ? 55  PRO A HG3  2  
ATOM 3169  H HD2  . PRO A 1 55  ? 6.826   17.193  13.189  1.00 1.54  ? 55  PRO A HD2  2  
ATOM 3170  H HD3  . PRO A 1 55  ? 5.429   16.103  13.080  1.00 1.66  ? 55  PRO A HD3  2  
ATOM 3171  N N    . GLY A 1 56  ? 6.935   18.532  8.448   1.00 0.98  ? 56  GLY A N    2  
ATOM 3172  C CA   . GLY A 1 56  ? 8.019   19.044  7.636   1.00 0.82  ? 56  GLY A CA   2  
ATOM 3173  C C    . GLY A 1 56  ? 8.956   17.945  7.182   1.00 0.64  ? 56  GLY A C    2  
ATOM 3174  O O    . GLY A 1 56  ? 10.179  18.105  7.206   1.00 0.69  ? 56  GLY A O    2  
ATOM 3175  H H    . GLY A 1 56  ? 6.188   18.052  8.020   1.00 1.42  ? 56  GLY A H    2  
ATOM 3176  H HA2  . GLY A 1 56  ? 7.601   19.531  6.766   1.00 0.98  ? 56  GLY A HA2  2  
ATOM 3177  H HA3  . GLY A 1 56  ? 8.579   19.769  8.207   1.00 0.83  ? 56  GLY A HA3  2  
ATOM 3178  N N    . SER A 1 57  ? 8.383   16.822  6.777   1.00 0.52  ? 57  SER A N    2  
ATOM 3179  C CA   . SER A 1 57  ? 9.145   15.708  6.265   1.00 0.40  ? 57  SER A CA   2  
ATOM 3180  C C    . SER A 1 57  ? 9.453   15.905  4.782   1.00 0.34  ? 57  SER A C    2  
ATOM 3181  O O    . SER A 1 57  ? 9.346   17.012  4.255   1.00 0.43  ? 57  SER A O    2  
ATOM 3182  C CB   . SER A 1 57  ? 8.343   14.429  6.487   1.00 0.40  ? 57  SER A CB   2  
ATOM 3183  O OG   . SER A 1 57  ? 6.955   14.667  6.304   1.00 0.99  ? 57  SER A OG   2  
ATOM 3184  H H    . SER A 1 57  ? 7.409   16.730  6.824   1.00 0.56  ? 57  SER A H    2  
ATOM 3185  H HA   . SER A 1 57  ? 10.070  15.648  6.816   1.00 0.47  ? 57  SER A HA   2  
ATOM 3186  H HB2  . SER A 1 57  ? 8.662   13.688  5.779   1.00 0.55  ? 57  SER A HB2  2  
ATOM 3187  H HB3  . SER A 1 57  ? 8.510   14.065  7.490   1.00 0.66  ? 57  SER A HB3  2  
ATOM 3188  H HG   . SER A 1 57  ? 6.672   14.315  5.439   1.00 1.36  ? 57  SER A HG   2  
ATOM 3189  N N    . SER A 1 58  ? 9.853   14.833  4.119   1.00 0.28  ? 58  SER A N    2  
ATOM 3190  C CA   . SER A 1 58  ? 10.113  14.865  2.695   1.00 0.30  ? 58  SER A CA   2  
ATOM 3191  C C    . SER A 1 58  ? 9.880   13.480  2.125   1.00 0.27  ? 58  SER A C    2  
ATOM 3192  O O    . SER A 1 58  ? 10.268  12.486  2.737   1.00 0.38  ? 58  SER A O    2  
ATOM 3193  C CB   . SER A 1 58  ? 11.551  15.320  2.423   1.00 0.38  ? 58  SER A CB   2  
ATOM 3194  O OG   . SER A 1 58  ? 11.758  15.622  1.056   1.00 1.28  ? 58  SER A OG   2  
ATOM 3195  H H    . SER A 1 58  ? 9.976   13.987  4.600   1.00 0.31  ? 58  SER A H    2  
ATOM 3196  H HA   . SER A 1 58  ? 9.421   15.560  2.241   1.00 0.36  ? 58  SER A HA   2  
ATOM 3197  H HB2  . SER A 1 58  ? 11.758  16.205  3.003   1.00 0.97  ? 58  SER A HB2  2  
ATOM 3198  H HB3  . SER A 1 58  ? 12.233  14.532  2.713   1.00 0.87  ? 58  SER A HB3  2  
ATOM 3199  H HG   . SER A 1 58  ? 12.295  16.422  0.988   1.00 1.82  ? 58  SER A HG   2  
ATOM 3200  N N    . ARG A 1 59  ? 9.210   13.415  0.990   1.00 0.32  ? 59  ARG A N    2  
ATOM 3201  C CA   . ARG A 1 59  ? 8.950   12.149  0.336   1.00 0.30  ? 59  ARG A CA   2  
ATOM 3202  C C    . ARG A 1 59  ? 10.053  11.855  -0.672  1.00 0.27  ? 59  ARG A C    2  
ATOM 3203  O O    . ARG A 1 59  ? 10.166  12.527  -1.700  1.00 0.34  ? 59  ARG A O    2  
ATOM 3204  C CB   . ARG A 1 59  ? 7.573   12.181  -0.328  1.00 0.42  ? 59  ARG A CB   2  
ATOM 3205  C CG   . ARG A 1 59  ? 6.472   12.546  0.656   1.00 0.64  ? 59  ARG A CG   2  
ATOM 3206  C CD   . ARG A 1 59  ? 5.079   12.508  0.050   1.00 0.68  ? 59  ARG A CD   2  
ATOM 3207  N NE   . ARG A 1 59  ? 4.073   12.695  1.095   1.00 1.41  ? 59  ARG A NE   2  
ATOM 3208  C CZ   . ARG A 1 59  ? 2.847   13.185  0.915   1.00 1.81  ? 59  ARG A CZ   2  
ATOM 3209  N NH1  . ARG A 1 59  ? 2.419   13.524  -0.294  1.00 1.78  ? 59  ARG A NH1  2  
ATOM 3210  N NH2  . ARG A 1 59  ? 2.047   13.316  1.967   1.00 2.81  ? 59  ARG A NH2  2  
ATOM 3211  H H    . ARG A 1 59  ? 8.880   14.240  0.577   1.00 0.44  ? 59  ARG A H    2  
ATOM 3212  H HA   . ARG A 1 59  ? 8.962   11.376  1.092   1.00 0.30  ? 59  ARG A HA   2  
ATOM 3213  H HB2  . ARG A 1 59  ? 7.581   12.915  -1.125  1.00 0.93  ? 59  ARG A HB2  2  
ATOM 3214  H HB3  . ARG A 1 59  ? 7.358   11.205  -0.738  1.00 0.91  ? 59  ARG A HB3  2  
ATOM 3215  H HG2  . ARG A 1 59  ? 6.507   11.854  1.481   1.00 1.11  ? 59  ARG A HG2  2  
ATOM 3216  H HG3  . ARG A 1 59  ? 6.664   13.544  1.025   1.00 1.15  ? 59  ARG A HG3  2  
ATOM 3217  H HD2  . ARG A 1 59  ? 4.989   13.298  -0.682  1.00 1.27  ? 59  ARG A HD2  2  
ATOM 3218  H HD3  . ARG A 1 59  ? 4.927   11.550  -0.423  1.00 1.12  ? 59  ARG A HD3  2  
ATOM 3219  H HE   . ARG A 1 59  ? 4.343   12.443  2.021   1.00 2.07  ? 59  ARG A HE   2  
ATOM 3220  H HH11 . ARG A 1 59  ? 3.018   13.408  -1.087  1.00 1.77  ? 59  ARG A HH11 2  
ATOM 3221  H HH12 . ARG A 1 59  ? 1.500   13.902  -0.419  1.00 2.29  ? 59  ARG A HH12 2  
ATOM 3222  H HH21 . ARG A 1 59  ? 2.379   13.046  2.878   1.00 3.39  ? 59  ARG A HH21 2  
ATOM 3223  H HH22 . ARG A 1 59  ? 1.116   13.688  1.866   1.00 3.15  ? 59  ARG A HH22 2  
ATOM 3224  N N    . PRO A 1 60  ? 10.911  10.869  -0.353  1.00 0.23  ? 60  PRO A N    2  
ATOM 3225  C CA   . PRO A 1 60  ? 12.084  10.508  -1.160  1.00 0.26  ? 60  PRO A CA   2  
ATOM 3226  C C    . PRO A 1 60  ? 11.797  10.385  -2.653  1.00 0.26  ? 60  PRO A C    2  
ATOM 3227  O O    . PRO A 1 60  ? 10.746  9.892   -3.065  1.00 0.28  ? 60  PRO A O    2  
ATOM 3228  C CB   . PRO A 1 60  ? 12.514  9.145   -0.598  1.00 0.30  ? 60  PRO A CB   2  
ATOM 3229  C CG   . PRO A 1 60  ? 11.435  8.744   0.357   1.00 0.28  ? 60  PRO A CG   2  
ATOM 3230  C CD   . PRO A 1 60  ? 10.825  10.022  0.839   1.00 0.21  ? 60  PRO A CD   2  
ATOM 3231  H HA   . PRO A 1 60  ? 12.883  11.215  -1.014  1.00 0.32  ? 60  PRO A HA   2  
ATOM 3232  H HB2  . PRO A 1 60  ? 12.608  8.436   -1.406  1.00 0.41  ? 60  PRO A HB2  2  
ATOM 3233  H HB3  . PRO A 1 60  ? 13.462  9.248   -0.093  1.00 0.42  ? 60  PRO A HB3  2  
ATOM 3234  H HG2  . PRO A 1 60  ? 10.697  8.143   -0.153  1.00 0.43  ? 60  PRO A HG2  2  
ATOM 3235  H HG3  . PRO A 1 60  ? 11.864  8.196   1.183   1.00 0.41  ? 60  PRO A HG3  2  
ATOM 3236  H HD2  . PRO A 1 60  ? 9.800   9.869   1.148   1.00 0.24  ? 60  PRO A HD2  2  
ATOM 3237  H HD3  . PRO A 1 60  ? 11.409  10.435  1.648   1.00 0.24  ? 60  PRO A HD3  2  
ATOM 3238  N N    . VAL A 1 61  ? 12.759  10.819  -3.457  1.00 0.29  ? 61  VAL A N    2  
ATOM 3239  C CA   . VAL A 1 61  ? 12.629  10.753  -4.903  1.00 0.31  ? 61  VAL A CA   2  
ATOM 3240  C C    . VAL A 1 61  ? 13.165  9.415   -5.408  1.00 0.28  ? 61  VAL A C    2  
ATOM 3241  O O    . VAL A 1 61  ? 14.015  8.792   -4.770  1.00 0.27  ? 61  VAL A O    2  
ATOM 3242  C CB   . VAL A 1 61  ? 13.391  11.908  -5.599  1.00 0.40  ? 61  VAL A CB   2  
ATOM 3243  C CG1  . VAL A 1 61  ? 13.048  11.982  -7.080  1.00 0.81  ? 61  VAL A CG1  2  
ATOM 3244  C CG2  . VAL A 1 61  ? 13.104  13.237  -4.917  1.00 0.88  ? 61  VAL A CG2  2  
ATOM 3245  H H    . VAL A 1 61  ? 13.585  11.195  -3.062  1.00 0.32  ? 61  VAL A H    2  
ATOM 3246  H HA   . VAL A 1 61  ? 11.580  10.831  -5.153  1.00 0.33  ? 61  VAL A HA   2  
ATOM 3247  H HB   . VAL A 1 61  ? 14.449  11.707  -5.514  1.00 0.80  ? 61  VAL A HB   2  
ATOM 3248  H HG11 . VAL A 1 61  ? 13.592  12.794  -7.536  1.00 1.44  ? 61  VAL A HG11 2  
ATOM 3249  H HG12 . VAL A 1 61  ? 11.987  12.148  -7.198  1.00 1.46  ? 61  VAL A HG12 2  
ATOM 3250  H HG13 . VAL A 1 61  ? 13.321  11.053  -7.559  1.00 1.30  ? 61  VAL A HG13 2  
ATOM 3251  H HG21 . VAL A 1 61  ? 13.468  13.203  -3.900  1.00 1.45  ? 61  VAL A HG21 2  
ATOM 3252  H HG22 . VAL A 1 61  ? 12.040  13.416  -4.911  1.00 1.40  ? 61  VAL A HG22 2  
ATOM 3253  H HG23 . VAL A 1 61  ? 13.601  14.032  -5.451  1.00 1.47  ? 61  VAL A HG23 2  
ATOM 3254  N N    . LYS A 1 62  ? 12.658  8.967   -6.541  1.00 0.27  ? 62  LYS A N    2  
ATOM 3255  C CA   . LYS A 1 62  ? 13.098  7.717   -7.124  1.00 0.27  ? 62  LYS A CA   2  
ATOM 3256  C C    . LYS A 1 62  ? 14.524  7.823   -7.619  1.00 0.25  ? 62  LYS A C    2  
ATOM 3257  O O    . LYS A 1 62  ? 14.846  8.620   -8.502  1.00 0.31  ? 62  LYS A O    2  
ATOM 3258  C CB   . LYS A 1 62  ? 12.148  7.263   -8.228  1.00 0.30  ? 62  LYS A CB   2  
ATOM 3259  C CG   . LYS A 1 62  ? 10.838  6.734   -7.675  1.00 0.37  ? 62  LYS A CG   2  
ATOM 3260  C CD   . LYS A 1 62  ? 10.002  6.060   -8.743  1.00 0.41  ? 62  LYS A CD   2  
ATOM 3261  C CE   . LYS A 1 62  ? 9.018   5.084   -8.121  1.00 0.60  ? 62  LYS A CE   2  
ATOM 3262  N NZ   . LYS A 1 62  ? 8.315   4.272   -9.144  1.00 1.17  ? 62  LYS A NZ   2  
ATOM 3263  H H    . LYS A 1 62  ? 11.987  9.494   -6.999  1.00 0.30  ? 62  LYS A H    2  
ATOM 3264  H HA   . LYS A 1 62  ? 13.082  6.978   -6.342  1.00 0.29  ? 62  LYS A HA   2  
ATOM 3265  H HB2  . LYS A 1 62  ? 11.937  8.098   -8.879  1.00 0.33  ? 62  LYS A HB2  2  
ATOM 3266  H HB3  . LYS A 1 62  ? 12.620  6.476   -8.799  1.00 0.37  ? 62  LYS A HB3  2  
ATOM 3267  H HG2  . LYS A 1 62  ? 11.056  6.015   -6.900  1.00 0.54  ? 62  LYS A HG2  2  
ATOM 3268  H HG3  . LYS A 1 62  ? 10.278  7.558   -7.257  1.00 0.52  ? 62  LYS A HG3  2  
ATOM 3269  H HD2  . LYS A 1 62  ? 9.455   6.813   -9.290  1.00 0.61  ? 62  LYS A HD2  2  
ATOM 3270  H HD3  . LYS A 1 62  ? 10.656  5.523   -9.416  1.00 0.58  ? 62  LYS A HD3  2  
ATOM 3271  H HE2  . LYS A 1 62  ? 9.556   4.421   -7.460  1.00 1.06  ? 62  LYS A HE2  2  
ATOM 3272  H HE3  . LYS A 1 62  ? 8.287   5.641   -7.553  1.00 0.90  ? 62  LYS A HE3  2  
ATOM 3273  H HZ1  . LYS A 1 62  ? 7.527   4.821   -9.558  1.00 1.64  ? 62  LYS A HZ1  2  
ATOM 3274  H HZ2  . LYS A 1 62  ? 7.937   3.405   -8.709  1.00 1.67  ? 62  LYS A HZ2  2  
ATOM 3275  H HZ3  . LYS A 1 62  ? 8.975   4.006   -9.901  1.00 1.71  ? 62  LYS A HZ3  2  
ATOM 3276  N N    . GLY A 1 63  ? 15.372  7.020   -7.009  1.00 0.25  ? 63  GLY A N    2  
ATOM 3277  C CA   . GLY A 1 63  ? 16.780  7.059   -7.281  1.00 0.27  ? 63  GLY A CA   2  
ATOM 3278  C C    . GLY A 1 63  ? 17.564  7.025   -5.997  1.00 0.30  ? 63  GLY A C    2  
ATOM 3279  O O    . GLY A 1 63  ? 18.703  6.565   -5.959  1.00 0.42  ? 63  GLY A O    2  
ATOM 3280  H H    . GLY A 1 63  ? 15.028  6.373   -6.356  1.00 0.30  ? 63  GLY A H    2  
ATOM 3281  H HA2  . GLY A 1 63  ? 17.052  6.206   -7.889  1.00 0.29  ? 63  GLY A HA2  2  
ATOM 3282  H HA3  . GLY A 1 63  ? 17.016  7.966   -7.815  1.00 0.28  ? 63  GLY A HA3  2  
ATOM 3283  N N    . GLN A 1 64  ? 16.950  7.518   -4.928  1.00 0.26  ? 64  GLN A N    2  
ATOM 3284  C CA   . GLN A 1 64  ? 17.588  7.466   -3.622  1.00 0.28  ? 64  GLN A CA   2  
ATOM 3285  C C    . GLN A 1 64  ? 17.505  6.051   -3.084  1.00 0.24  ? 64  GLN A C    2  
ATOM 3286  O O    . GLN A 1 64  ? 16.493  5.372   -3.266  1.00 0.24  ? 64  GLN A O    2  
ATOM 3287  C CB   . GLN A 1 64  ? 16.931  8.414   -2.606  1.00 0.30  ? 64  GLN A CB   2  
ATOM 3288  C CG   . GLN A 1 64  ? 16.310  9.688   -3.168  1.00 0.36  ? 64  GLN A CG   2  
ATOM 3289  C CD   . GLN A 1 64  ? 17.280  10.626  -3.876  1.00 0.44  ? 64  GLN A CD   2  
ATOM 3290  O OE1  . GLN A 1 64  ? 17.122  11.845  -3.804  1.00 0.59  ? 64  GLN A OE1  2  
ATOM 3291  N NE2  . GLN A 1 64  ? 18.240  10.089  -4.607  1.00 0.43  ? 64  GLN A NE2  2  
ATOM 3292  H H    . GLN A 1 64  ? 16.049  7.920   -5.023  1.00 0.26  ? 64  GLN A H    2  
ATOM 3293  H HA   . GLN A 1 64  ? 18.627  7.737   -3.740  1.00 0.33  ? 64  GLN A HA   2  
ATOM 3294  H HB2  . GLN A 1 64  ? 16.148  7.870   -2.093  1.00 0.29  ? 64  GLN A HB2  2  
ATOM 3295  H HB3  . GLN A 1 64  ? 17.684  8.704   -1.881  1.00 0.37  ? 64  GLN A HB3  2  
ATOM 3296  H HG2  . GLN A 1 64  ? 15.532  9.405   -3.861  1.00 0.35  ? 64  GLN A HG2  2  
ATOM 3297  H HG3  . GLN A 1 64  ? 15.865  10.234  -2.348  1.00 0.40  ? 64  GLN A HG3  2  
ATOM 3298  H HE21 . GLN A 1 64  ? 18.285  9.115   -4.671  1.00 0.43  ? 64  GLN A HE21 2  
ATOM 3299  H HE22 . GLN A 1 64  ? 18.881  10.700  -5.052  1.00 0.50  ? 64  GLN A HE22 2  
ATOM 3300  N N    . VAL A 1 65  ? 18.557  5.594   -2.441  1.00 0.28  ? 65  VAL A N    2  
ATOM 3301  C CA   . VAL A 1 65  ? 18.473  4.348   -1.725  1.00 0.31  ? 65  VAL A CA   2  
ATOM 3302  C C    . VAL A 1 65  ? 17.949  4.658   -0.332  1.00 0.25  ? 65  VAL A C    2  
ATOM 3303  O O    . VAL A 1 65  ? 18.449  5.551   0.353   1.00 0.32  ? 65  VAL A O    2  
ATOM 3304  C CB   . VAL A 1 65  ? 19.814  3.571   -1.667  1.00 0.49  ? 65  VAL A CB   2  
ATOM 3305  C CG1  . VAL A 1 65  ? 20.420  3.445   -3.055  1.00 1.22  ? 65  VAL A CG1  2  
ATOM 3306  C CG2  . VAL A 1 65  ? 20.795  4.210   -0.704  1.00 1.05  ? 65  VAL A CG2  2  
ATOM 3307  H H    . VAL A 1 65  ? 19.385  6.122   -2.416  1.00 0.35  ? 65  VAL A H    2  
ATOM 3308  H HA   . VAL A 1 65  ? 17.742  3.732   -2.235  1.00 0.32  ? 65  VAL A HA   2  
ATOM 3309  H HB   . VAL A 1 65  ? 19.601  2.573   -1.312  1.00 1.34  ? 65  VAL A HB   2  
ATOM 3310  H HG11 . VAL A 1 65  ? 20.620  4.430   -3.451  1.00 1.66  ? 65  VAL A HG11 2  
ATOM 3311  H HG12 . VAL A 1 65  ? 19.729  2.929   -3.704  1.00 1.83  ? 65  VAL A HG12 2  
ATOM 3312  H HG13 . VAL A 1 65  ? 21.343  2.886   -2.993  1.00 1.86  ? 65  VAL A HG13 2  
ATOM 3313  H HG21 . VAL A 1 65  ? 21.725  3.662   -0.725  1.00 1.67  ? 65  VAL A HG21 2  
ATOM 3314  H HG22 . VAL A 1 65  ? 20.380  4.178   0.296   1.00 1.64  ? 65  VAL A HG22 2  
ATOM 3315  H HG23 . VAL A 1 65  ? 20.971  5.235   -0.992  1.00 1.65  ? 65  VAL A HG23 2  
ATOM 3316  N N    . VAL A 1 66  ? 16.900  3.981   0.053   1.00 0.19  ? 66  VAL A N    2  
ATOM 3317  C CA   . VAL A 1 66  ? 16.227  4.289   1.295   1.00 0.15  ? 66  VAL A CA   2  
ATOM 3318  C C    . VAL A 1 66  ? 16.234  3.087   2.202   1.00 0.16  ? 66  VAL A C    2  
ATOM 3319  O O    . VAL A 1 66  ? 16.202  1.949   1.733   1.00 0.21  ? 66  VAL A O    2  
ATOM 3320  C CB   . VAL A 1 66  ? 14.774  4.750   1.051   1.00 0.17  ? 66  VAL A CB   2  
ATOM 3321  C CG1  . VAL A 1 66  ? 14.727  6.003   0.186   1.00 0.18  ? 66  VAL A CG1  2  
ATOM 3322  C CG2  . VAL A 1 66  ? 13.957  3.654   0.400   1.00 0.25  ? 66  VAL A CG2  2  
ATOM 3323  H H    . VAL A 1 66  ? 16.574  3.243   -0.504  1.00 0.24  ? 66  VAL A H    2  
ATOM 3324  H HA   . VAL A 1 66  ? 16.763  5.089   1.786   1.00 0.15  ? 66  VAL A HA   2  
ATOM 3325  H HB   . VAL A 1 66  ? 14.330  4.981   2.010   1.00 0.21  ? 66  VAL A HB   2  
ATOM 3326  H HG11 . VAL A 1 66  ? 15.244  6.805   0.683   1.00 1.04  ? 66  VAL A HG11 2  
ATOM 3327  H HG12 . VAL A 1 66  ? 13.698  6.288   0.022   1.00 1.01  ? 66  VAL A HG12 2  
ATOM 3328  H HG13 . VAL A 1 66  ? 15.200  5.803   -0.763  1.00 1.02  ? 66  VAL A HG13 2  
ATOM 3329  H HG21 . VAL A 1 66  ? 13.973  2.775   1.028   1.00 1.07  ? 66  VAL A HG21 2  
ATOM 3330  H HG22 . VAL A 1 66  ? 14.380  3.419   -0.565  1.00 1.07  ? 66  VAL A HG22 2  
ATOM 3331  H HG23 . VAL A 1 66  ? 12.940  3.991   0.275   1.00 1.00  ? 66  VAL A HG23 2  
ATOM 3332  N N    . THR A 1 67  ? 16.314  3.342   3.492   1.00 0.13  ? 67  THR A N    2  
ATOM 3333  C CA   . THR A 1 67  ? 16.271  2.281   4.459   1.00 0.15  ? 67  THR A CA   2  
ATOM 3334  C C    . THR A 1 67  ? 14.863  2.119   4.989   1.00 0.16  ? 67  THR A C    2  
ATOM 3335  O O    . THR A 1 67  ? 14.343  2.989   5.697   1.00 0.21  ? 67  THR A O    2  
ATOM 3336  C CB   . THR A 1 67  ? 17.223  2.556   5.629   1.00 0.20  ? 67  THR A CB   2  
ATOM 3337  O OG1  . THR A 1 67  ? 16.985  3.864   6.158   1.00 0.29  ? 67  THR A OG1  2  
ATOM 3338  C CG2  . THR A 1 67  ? 18.672  2.437   5.199   1.00 0.27  ? 67  THR A CG2  2  
ATOM 3339  H H    . THR A 1 67  ? 16.393  4.271   3.800   1.00 0.14  ? 67  THR A H    2  
ATOM 3340  H HA   . THR A 1 67  ? 16.573  1.365   3.973   1.00 0.15  ? 67  THR A HA   2  
ATOM 3341  H HB   . THR A 1 67  ? 17.033  1.825   6.399   1.00 0.27  ? 67  THR A HB   2  
ATOM 3342  H HG1  . THR A 1 67  ? 16.061  3.937   6.409   1.00 0.56  ? 67  THR A HG1  2  
ATOM 3343  H HG21 . THR A 1 67  ? 18.883  3.175   4.440   1.00 1.03  ? 67  THR A HG21 2  
ATOM 3344  H HG22 . THR A 1 67  ? 18.850  1.448   4.799   1.00 1.06  ? 67  THR A HG22 2  
ATOM 3345  H HG23 . THR A 1 67  ? 19.309  2.604   6.051   1.00 1.04  ? 67  THR A HG23 2  
ATOM 3346  N N    . VAL A 1 68  ? 14.250  1.013   4.647   1.00 0.15  ? 68  VAL A N    2  
ATOM 3347  C CA   . VAL A 1 68  ? 12.932  0.708   5.143   1.00 0.15  ? 68  VAL A CA   2  
ATOM 3348  C C    . VAL A 1 68  ? 12.987  -0.466  6.098   1.00 0.15  ? 68  VAL A C    2  
ATOM 3349  O O    . VAL A 1 68  ? 13.754  -1.389  5.908   1.00 0.17  ? 68  VAL A O    2  
ATOM 3350  C CB   . VAL A 1 68  ? 11.925  0.396   4.009   1.00 0.16  ? 68  VAL A CB   2  
ATOM 3351  C CG1  . VAL A 1 68  ? 11.480  1.677   3.317   1.00 0.18  ? 68  VAL A CG1  2  
ATOM 3352  C CG2  . VAL A 1 68  ? 12.527  -0.563  2.997   1.00 0.19  ? 68  VAL A CG2  2  
ATOM 3353  H H    . VAL A 1 68  ? 14.696  0.381   4.035   1.00 0.15  ? 68  VAL A H    2  
ATOM 3354  H HA   . VAL A 1 68  ? 12.585  1.576   5.671   1.00 0.15  ? 68  VAL A HA   2  
ATOM 3355  H HB   . VAL A 1 68  ? 11.056  -0.080  4.442   1.00 0.17  ? 68  VAL A HB   2  
ATOM 3356  H HG11 . VAL A 1 68  ? 11.042  2.347   4.040   1.00 1.00  ? 68  VAL A HG11 2  
ATOM 3357  H HG12 . VAL A 1 68  ? 10.751  1.440   2.557   1.00 1.05  ? 68  VAL A HG12 2  
ATOM 3358  H HG13 . VAL A 1 68  ? 12.335  2.153   2.857   1.00 1.02  ? 68  VAL A HG13 2  
ATOM 3359  H HG21 . VAL A 1 68  ? 12.766  -1.497  3.484   1.00 1.04  ? 68  VAL A HG21 2  
ATOM 3360  H HG22 . VAL A 1 68  ? 13.426  -0.132  2.583   1.00 1.04  ? 68  VAL A HG22 2  
ATOM 3361  H HG23 . VAL A 1 68  ? 11.815  -0.742  2.204   1.00 1.02  ? 68  VAL A HG23 2  
ATOM 3362  N N    . HIS A 1 69  ? 12.181  -0.435  7.126   1.00 0.14  ? 69  HIS A N    2  
ATOM 3363  C CA   . HIS A 1 69  ? 12.044  -1.598  7.968   1.00 0.15  ? 69  HIS A CA   2  
ATOM 3364  C C    . HIS A 1 69  ? 10.762  -2.279  7.573   1.00 0.14  ? 69  HIS A C    2  
ATOM 3365  O O    . HIS A 1 69  ? 9.687   -1.732  7.777   1.00 0.15  ? 69  HIS A O    2  
ATOM 3366  C CB   . HIS A 1 69  ? 12.007  -1.234  9.468   1.00 0.15  ? 69  HIS A CB   2  
ATOM 3367  C CG   . HIS A 1 69  ? 11.728  -2.425  10.363  1.00 0.15  ? 69  HIS A CG   2  
ATOM 3368  N ND1  . HIS A 1 69  ? 12.075  -2.509  11.698  1.00 0.19  ? 69  HIS A ND1  2  
ATOM 3369  C CD2  . HIS A 1 69  ? 11.122  -3.599  10.079  1.00 0.18  ? 69  HIS A CD2  2  
ATOM 3370  C CE1  . HIS A 1 69  ? 11.692  -3.691  12.167  1.00 0.18  ? 69  HIS A CE1  2  
ATOM 3371  N NE2  . HIS A 1 69  ? 11.117  -4.359  11.206  1.00 0.18  ? 69  HIS A NE2  2  
ATOM 3372  H H    . HIS A 1 69  ? 11.665  0.378   7.319   1.00 0.14  ? 69  HIS A H    2  
ATOM 3373  H HA   . HIS A 1 69  ? 12.875  -2.261  7.776   1.00 0.16  ? 69  HIS A HA   2  
ATOM 3374  H HB2  . HIS A 1 69  ? 12.958  -0.809  9.750   1.00 0.17  ? 69  HIS A HB2  2  
ATOM 3375  H HB3  . HIS A 1 69  ? 11.230  -0.501  9.632   1.00 0.16  ? 69  HIS A HB3  2  
ATOM 3376  H HD1  . HIS A 1 69  ? 12.505  -1.797  12.237  1.00 0.27  ? 69  HIS A HD1  2  
ATOM 3377  H HD2  . HIS A 1 69  ? 10.693  -3.869  9.121   1.00 0.23  ? 69  HIS A HD2  2  
ATOM 3378  H HE1  . HIS A 1 69  ? 11.813  -4.050  13.168  1.00 0.21  ? 69  HIS A HE1  2  
ATOM 3379  H HE2  . HIS A 1 69  ? 10.591  -5.175  11.332  1.00 0.29  ? 69  HIS A HE2  2  
ATOM 3380  N N    . LEU A 1 70  ? 10.865  -3.473  7.024   1.00 0.15  ? 70  LEU A N    2  
ATOM 3381  C CA   . LEU A 1 70  ? 9.670   -4.175  6.635   1.00 0.16  ? 70  LEU A CA   2  
ATOM 3382  C C    . LEU A 1 70  ? 9.483   -5.432  7.458   1.00 0.15  ? 70  LEU A C    2  
ATOM 3383  O O    . LEU A 1 70  ? 10.424  -6.168  7.745   1.00 0.21  ? 70  LEU A O    2  
ATOM 3384  C CB   . LEU A 1 70  ? 9.639   -4.510  5.140   1.00 0.21  ? 70  LEU A CB   2  
ATOM 3385  C CG   . LEU A 1 70  ? 10.087  -5.922  4.761   1.00 0.31  ? 70  LEU A CG   2  
ATOM 3386  C CD1  . LEU A 1 70  ? 9.654   -6.247  3.338   1.00 0.39  ? 70  LEU A CD1  2  
ATOM 3387  C CD2  . LEU A 1 70  ? 11.594  -6.078  4.890   1.00 0.38  ? 70  LEU A CD2  2  
ATOM 3388  H H    . LEU A 1 70  ? 11.748  -3.894  6.912   1.00 0.18  ? 70  LEU A H    2  
ATOM 3389  H HA   . LEU A 1 70  ? 8.848   -3.517  6.846   1.00 0.15  ? 70  LEU A HA   2  
ATOM 3390  H HB2  . LEU A 1 70  ? 8.622   -4.382  4.802   1.00 0.25  ? 70  LEU A HB2  2  
ATOM 3391  H HB3  . LEU A 1 70  ? 10.267  -3.803  4.619   1.00 0.21  ? 70  LEU A HB3  2  
ATOM 3392  H HG   . LEU A 1 70  ? 9.610   -6.625  5.433   1.00 0.39  ? 70  LEU A HG   2  
ATOM 3393  H HD11 . LEU A 1 70  ? 8.576   -6.226  3.276   1.00 1.02  ? 70  LEU A HD11 2  
ATOM 3394  H HD12 . LEU A 1 70  ? 10.011  -7.230  3.070   1.00 1.09  ? 70  LEU A HD12 2  
ATOM 3395  H HD13 . LEU A 1 70  ? 10.070  -5.516  2.660   1.00 1.11  ? 70  LEU A HD13 2  
ATOM 3396  H HD21 . LEU A 1 70  ? 11.871  -7.092  4.640   1.00 1.13  ? 70  LEU A HD21 2  
ATOM 3397  H HD22 . LEU A 1 70  ? 11.892  -5.865  5.905   1.00 1.06  ? 70  LEU A HD22 2  
ATOM 3398  H HD23 . LEU A 1 70  ? 12.087  -5.393  4.217   1.00 1.10  ? 70  LEU A HD23 2  
ATOM 3399  N N    . GLN A 1 71  ? 8.264   -5.611  7.886   1.00 0.13  ? 71  GLN A N    2  
ATOM 3400  C CA   . GLN A 1 71  ? 7.805   -6.870  8.422   1.00 0.14  ? 71  GLN A CA   2  
ATOM 3401  C C    . GLN A 1 71  ? 6.480   -7.125  7.780   1.00 0.14  ? 71  GLN A C    2  
ATOM 3402  O O    . GLN A 1 71  ? 5.511   -6.394  7.994   1.00 0.14  ? 71  GLN A O    2  
ATOM 3403  C CB   . GLN A 1 71  ? 7.636   -6.843  9.935   1.00 0.15  ? 71  GLN A CB   2  
ATOM 3404  C CG   . GLN A 1 71  ? 8.527   -5.849  10.652  1.00 0.15  ? 71  GLN A CG   2  
ATOM 3405  C CD   . GLN A 1 71  ? 7.889   -4.490  10.815  1.00 0.16  ? 71  GLN A CD   2  
ATOM 3406  O OE1  . GLN A 1 71  ? 8.222   -3.740  11.729  1.00 0.27  ? 71  GLN A OE1  2  
ATOM 3407  N NE2  . GLN A 1 71  ? 6.949   -4.183  9.954   1.00 0.18  ? 71  GLN A NE2  2  
ATOM 3408  H H    . GLN A 1 71  ? 7.635   -4.862  7.829   1.00 0.15  ? 71  GLN A H    2  
ATOM 3409  H HA   . GLN A 1 71  ? 8.490   -7.657  8.134   1.00 0.14  ? 71  GLN A HA   2  
ATOM 3410  H HB2  . GLN A 1 71  ? 6.610   -6.600  10.140  1.00 0.17  ? 71  GLN A HB2  2  
ATOM 3411  H HB3  . GLN A 1 71  ? 7.853   -7.824  10.326  1.00 0.17  ? 71  GLN A HB3  2  
ATOM 3412  H HG2  . GLN A 1 71  ? 8.766   -6.235  11.631  1.00 0.20  ? 71  GLN A HG2  2  
ATOM 3413  H HG3  . GLN A 1 71  ? 9.436   -5.735  10.084  1.00 0.15  ? 71  GLN A HG3  2  
ATOM 3414  H HE21 . GLN A 1 71  ? 6.704   -4.844  9.269   1.00 0.26  ? 71  GLN A HE21 2  
ATOM 3415  H HE22 . GLN A 1 71  ? 6.547   -3.294  10.016  1.00 0.18  ? 71  GLN A HE22 2  
ATOM 3416  N N    . THR A 1 72  ? 6.456   -8.138  6.982   1.00 0.15  ? 72  THR A N    2  
ATOM 3417  C CA   . THR A 1 72  ? 5.356   -8.371  6.108   1.00 0.16  ? 72  THR A CA   2  
ATOM 3418  C C    . THR A 1 72  ? 4.491   -9.507  6.601   1.00 0.16  ? 72  THR A C    2  
ATOM 3419  O O    . THR A 1 72  ? 4.990   -10.575 6.948   1.00 0.17  ? 72  THR A O    2  
ATOM 3420  C CB   . THR A 1 72  ? 5.887   -8.682  4.719   1.00 0.17  ? 72  THR A CB   2  
ATOM 3421  O OG1  . THR A 1 72  ? 6.698   -7.599  4.248   1.00 0.19  ? 72  THR A OG1  2  
ATOM 3422  C CG2  . THR A 1 72  ? 4.755   -8.930  3.765   1.00 0.19  ? 72  THR A CG2  2  
ATOM 3423  H H    . THR A 1 72  ? 7.215   -8.755  6.976   1.00 0.17  ? 72  THR A H    2  
ATOM 3424  H HA   . THR A 1 72  ? 4.765   -7.473  6.054   1.00 0.17  ? 72  THR A HA   2  
ATOM 3425  H HB   . THR A 1 72  ? 6.489   -9.572  4.783   1.00 0.18  ? 72  THR A HB   2  
ATOM 3426  H HG1  . THR A 1 72  ? 7.548   -7.940  3.956   1.00 0.55  ? 72  THR A HG1  2  
ATOM 3427  H HG21 . THR A 1 72  ? 4.132   -8.051  3.727   1.00 1.04  ? 72  THR A HG21 2  
ATOM 3428  H HG22 . THR A 1 72  ? 4.179   -9.774  4.115   1.00 1.00  ? 72  THR A HG22 2  
ATOM 3429  H HG23 . THR A 1 72  ? 5.152   -9.138  2.784   1.00 1.00  ? 72  THR A HG23 2  
ATOM 3430  N N    . SER A 1 73  ? 3.199   -9.263  6.618   1.00 0.17  ? 73  SER A N    2  
ATOM 3431  C CA   . SER A 1 73  ? 2.239   -10.230 7.080   1.00 0.17  ? 73  SER A CA   2  
ATOM 3432  C C    . SER A 1 73  ? 1.427   -10.729 5.898   1.00 0.15  ? 73  SER A C    2  
ATOM 3433  O O    . SER A 1 73  ? 1.325   -10.060 4.873   1.00 0.26  ? 73  SER A O    2  
ATOM 3434  C CB   . SER A 1 73  ? 1.306   -9.584  8.111   1.00 0.23  ? 73  SER A CB   2  
ATOM 3435  O OG   . SER A 1 73  ? 1.907   -8.434  8.694   1.00 1.06  ? 73  SER A OG   2  
ATOM 3436  H H    . SER A 1 73  ? 2.876   -8.403  6.281   1.00 0.20  ? 73  SER A H    2  
ATOM 3437  H HA   . SER A 1 73  ? 2.770   -11.059 7.530   1.00 0.18  ? 73  SER A HA   2  
ATOM 3438  H HB2  . SER A 1 73  ? 0.388   -9.287  7.626   1.00 0.96  ? 73  SER A HB2  2  
ATOM 3439  H HB3  . SER A 1 73  ? 1.087   -10.296 8.892   1.00 1.03  ? 73  SER A HB3  2  
ATOM 3440  H HG   . SER A 1 73  ? 1.991   -7.747  8.020   1.00 1.54  ? 73  SER A HG   2  
ATOM 3441  N N    . LEU A 1 74  ? 0.871   -11.903 6.044   1.00 0.19  ? 74  LEU A N    2  
ATOM 3442  C CA   . LEU A 1 74  ? -0.018  -12.461 5.053   1.00 0.18  ? 74  LEU A CA   2  
ATOM 3443  C C    . LEU A 1 74  ? -1.404  -11.872 5.217   1.00 0.19  ? 74  LEU A C    2  
ATOM 3444  O O    . LEU A 1 74  ? -1.692  -11.243 6.234   1.00 0.21  ? 74  LEU A O    2  
ATOM 3445  C CB   . LEU A 1 74  ? -0.062  -13.978 5.197   1.00 0.22  ? 74  LEU A CB   2  
ATOM 3446  C CG   . LEU A 1 74  ? 1.226   -14.692 4.812   1.00 0.38  ? 74  LEU A CG   2  
ATOM 3447  C CD1  . LEU A 1 74  ? 0.964   -16.168 4.560   1.00 0.84  ? 74  LEU A CD1  2  
ATOM 3448  C CD2  . LEU A 1 74  ? 1.865   -14.026 3.599   1.00 0.72  ? 74  LEU A CD2  2  
ATOM 3449  H H    . LEU A 1 74  ? 1.077   -12.429 6.845   1.00 0.34  ? 74  LEU A H    2  
ATOM 3450  H HA   . LEU A 1 74  ? 0.363   -12.210 4.075   1.00 0.18  ? 74  LEU A HA   2  
ATOM 3451  H HB2  . LEU A 1 74  ? -0.270  -14.203 6.232   1.00 0.30  ? 74  LEU A HB2  2  
ATOM 3452  H HB3  . LEU A 1 74  ? -0.862  -14.363 4.596   1.00 0.20  ? 74  LEU A HB3  2  
ATOM 3453  H HG   . LEU A 1 74  ? 1.923   -14.618 5.636   1.00 0.97  ? 74  LEU A HG   2  
ATOM 3454  H HD11 . LEU A 1 74  ? 1.892   -16.664 4.320   1.00 1.51  ? 74  LEU A HD11 2  
ATOM 3455  H HD12 . LEU A 1 74  ? 0.272   -16.280 3.736   1.00 1.44  ? 74  LEU A HD12 2  
ATOM 3456  H HD13 . LEU A 1 74  ? 0.538   -16.610 5.448   1.00 1.32  ? 74  LEU A HD13 2  
ATOM 3457  H HD21 . LEU A 1 74  ? 1.180   -14.058 2.763   1.00 1.44  ? 74  LEU A HD21 2  
ATOM 3458  H HD22 . LEU A 1 74  ? 2.776   -14.544 3.340   1.00 1.33  ? 74  LEU A HD22 2  
ATOM 3459  H HD23 . LEU A 1 74  ? 2.094   -12.993 3.840   1.00 1.28  ? 74  LEU A HD23 2  
ATOM 3460  N N    . GLU A 1 75  ? -2.248  -12.059 4.210   1.00 0.21  ? 75  GLU A N    2  
ATOM 3461  C CA   . GLU A 1 75  ? -3.647  -11.645 4.276   1.00 0.26  ? 75  GLU A CA   2  
ATOM 3462  C C    . GLU A 1 75  ? -4.339  -12.223 5.512   1.00 0.32  ? 75  GLU A C    2  
ATOM 3463  O O    . GLU A 1 75  ? -5.364  -11.710 5.965   1.00 0.39  ? 75  GLU A O    2  
ATOM 3464  C CB   . GLU A 1 75  ? -4.381  -12.093 3.013   1.00 0.30  ? 75  GLU A CB   2  
ATOM 3465  C CG   . GLU A 1 75  ? -4.160  -13.557 2.667   1.00 0.34  ? 75  GLU A CG   2  
ATOM 3466  C CD   . GLU A 1 75  ? -4.878  -13.965 1.400   1.00 0.67  ? 75  GLU A CD   2  
ATOM 3467  O OE1  . GLU A 1 75  ? -4.774  -13.239 0.394   1.00 0.82  ? 75  GLU A OE1  2  
ATOM 3468  O OE2  . GLU A 1 75  ? -5.562  -15.009 1.416   1.00 1.14  ? 75  GLU A OE2  2  
ATOM 3469  H H    . GLU A 1 75  ? -1.917  -12.465 3.382   1.00 0.21  ? 75  GLU A H    2  
ATOM 3470  H HA   . GLU A 1 75  ? -3.668  -10.568 4.326   1.00 0.27  ? 75  GLU A HA   2  
ATOM 3471  H HB2  . GLU A 1 75  ? -5.442  -11.931 3.146   1.00 0.37  ? 75  GLU A HB2  2  
ATOM 3472  H HB3  . GLU A 1 75  ? -4.037  -11.496 2.185   1.00 0.29  ? 75  GLU A HB3  2  
ATOM 3473  H HG2  . GLU A 1 75  ? -3.102  -13.728 2.533   1.00 0.47  ? 75  GLU A HG2  2  
ATOM 3474  H HG3  . GLU A 1 75  ? -4.521  -14.165 3.482   1.00 0.54  ? 75  GLU A HG3  2  
ATOM 3475  N N    . ASN A 1 76  ? -3.764  -13.297 6.051   1.00 0.34  ? 76  ASN A N    2  
ATOM 3476  C CA   . ASN A 1 76  ? -4.314  -13.963 7.227   1.00 0.41  ? 76  ASN A CA   2  
ATOM 3477  C C    . ASN A 1 76  ? -3.708  -13.386 8.504   1.00 0.39  ? 76  ASN A C    2  
ATOM 3478  O O    . ASN A 1 76  ? -4.144  -13.709 9.608   1.00 0.51  ? 76  ASN A O    2  
ATOM 3479  C CB   . ASN A 1 76  ? -4.050  -15.473 7.160   1.00 0.50  ? 76  ASN A CB   2  
ATOM 3480  C CG   . ASN A 1 76  ? -4.487  -16.079 5.846   1.00 1.13  ? 76  ASN A CG   2  
ATOM 3481  O OD1  . ASN A 1 76  ? -5.661  -16.402 5.655   1.00 2.14  ? 76  ASN A OD1  2  
ATOM 3482  N ND2  . ASN A 1 76  ? -3.539  -16.256 4.937   1.00 1.13  ? 76  ASN A ND2  2  
ATOM 3483  H H    . ASN A 1 76  ? -2.947  -13.650 5.641   1.00 0.32  ? 76  ASN A H    2  
ATOM 3484  H HA   . ASN A 1 76  ? -5.379  -13.793 7.239   1.00 0.47  ? 76  ASN A HA   2  
ATOM 3485  H HB2  . ASN A 1 76  ? -2.992  -15.655 7.283   1.00 1.21  ? 76  ASN A HB2  2  
ATOM 3486  H HB3  . ASN A 1 76  ? -4.592  -15.964 7.957   1.00 1.00  ? 76  ASN A HB3  2  
ATOM 3487  H HD21 . ASN A 1 76  ? -2.626  -15.997 5.168   1.00 0.98  ? 76  ASN A HD21 2  
ATOM 3488  H HD22 . ASN A 1 76  ? -3.797  -16.629 4.067   1.00 1.79  ? 76  ASN A HD22 2  
ATOM 3489  N N    . GLY A 1 77  ? -2.698  -12.534 8.349   1.00 0.30  ? 77  GLY A N    2  
ATOM 3490  C CA   . GLY A 1 77  ? -2.055  -11.915 9.498   1.00 0.32  ? 77  GLY A CA   2  
ATOM 3491  C C    . GLY A 1 77  ? -0.679  -12.492 9.781   1.00 0.32  ? 77  GLY A C    2  
ATOM 3492  O O    . GLY A 1 77  ? 0.075   -11.953 10.586  1.00 0.51  ? 77  GLY A O    2  
ATOM 3493  H H    . GLY A 1 77  ? -2.392  -12.309 7.443   1.00 0.27  ? 77  GLY A H    2  
ATOM 3494  H HA2  . GLY A 1 77  ? -1.956  -10.855 9.310   1.00 0.32  ? 77  GLY A HA2  2  
ATOM 3495  H HA3  . GLY A 1 77  ? -2.677  -12.060 10.366  1.00 0.38  ? 77  GLY A HA3  2  
ATOM 3496  N N    . THR A 1 78  ? -0.349  -13.573 9.093   1.00 0.28  ? 78  THR A N    2  
ATOM 3497  C CA   . THR A 1 78  ? 0.893   -14.295 9.329   1.00 0.28  ? 78  THR A CA   2  
ATOM 3498  C C    . THR A 1 78  ? 2.096   -13.544 8.773   1.00 0.23  ? 78  THR A C    2  
ATOM 3499  O O    . THR A 1 78  ? 2.269   -13.454 7.564   1.00 0.21  ? 78  THR A O    2  
ATOM 3500  C CB   . THR A 1 78  ? 0.833   -15.686 8.673   1.00 0.34  ? 78  THR A CB   2  
ATOM 3501  O OG1  . THR A 1 78  ? -0.465  -16.253 8.873   1.00 0.46  ? 78  THR A OG1  2  
ATOM 3502  C CG2  . THR A 1 78  ? 1.888   -16.615 9.253   1.00 0.39  ? 78  THR A CG2  2  
ATOM 3503  H H    . THR A 1 78  ? -0.962  -13.904 8.409   1.00 0.39  ? 78  THR A H    2  
ATOM 3504  H HA   . THR A 1 78  ? 1.017   -14.416 10.388  1.00 0.32  ? 78  THR A HA   2  
ATOM 3505  H HB   . THR A 1 78  ? 1.013   -15.576 7.614   1.00 0.33  ? 78  THR A HB   2  
ATOM 3506  H HG1  . THR A 1 78  ? -0.666  -16.264 9.823   1.00 0.91  ? 78  THR A HG1  2  
ATOM 3507  H HG21 . THR A 1 78  ? 1.824   -17.579 8.768   1.00 1.16  ? 78  THR A HG21 2  
ATOM 3508  H HG22 . THR A 1 78  ? 1.720   -16.733 10.313  1.00 1.12  ? 78  THR A HG22 2  
ATOM 3509  H HG23 . THR A 1 78  ? 2.868   -16.194 9.087   1.00 0.98  ? 78  THR A HG23 2  
ATOM 3510  N N    . ARG A 1 79  ? 2.923   -13.011 9.652   1.00 0.24  ? 79  ARG A N    2  
ATOM 3511  C CA   . ARG A 1 79  ? 4.125   -12.314 9.228   1.00 0.22  ? 79  ARG A CA   2  
ATOM 3512  C C    . ARG A 1 79  ? 5.187   -13.303 8.792   1.00 0.24  ? 79  ARG A C    2  
ATOM 3513  O O    . ARG A 1 79  ? 5.563   -14.206 9.538   1.00 0.33  ? 79  ARG A O    2  
ATOM 3514  C CB   . ARG A 1 79  ? 4.633   -11.395 10.324  1.00 0.25  ? 79  ARG A CB   2  
ATOM 3515  C CG   . ARG A 1 79  ? 3.710   -10.217 10.537  1.00 0.25  ? 79  ARG A CG   2  
ATOM 3516  C CD   . ARG A 1 79  ? 4.493   -8.972  10.900  1.00 0.28  ? 79  ARG A CD   2  
ATOM 3517  N NE   . ARG A 1 79  ? 3.663   -7.764  10.891  1.00 0.33  ? 79  ARG A NE   2  
ATOM 3518  C CZ   . ARG A 1 79  ? 4.065   -6.583  11.367  1.00 0.38  ? 79  ARG A CZ   2  
ATOM 3519  N NH1  . ARG A 1 79  ? 5.251   -6.471  11.948  1.00 0.42  ? 79  ARG A NH1  2  
ATOM 3520  N NH2  . ARG A 1 79  ? 3.283   -5.514  11.263  1.00 0.47  ? 79  ARG A NH2  2  
ATOM 3521  H H    . ARG A 1 79  ? 2.731   -13.097 10.613  1.00 0.27  ? 79  ARG A H    2  
ATOM 3522  H HA   . ARG A 1 79  ? 3.866   -11.704 8.371   1.00 0.19  ? 79  ARG A HA   2  
ATOM 3523  H HB2  . ARG A 1 79  ? 4.702   -11.952 11.247  1.00 0.29  ? 79  ARG A HB2  2  
ATOM 3524  H HB3  . ARG A 1 79  ? 5.611   -11.023 10.056  1.00 0.25  ? 79  ARG A HB3  2  
ATOM 3525  H HG2  . ARG A 1 79  ? 3.154   -10.043 9.623   1.00 0.23  ? 79  ARG A HG2  2  
ATOM 3526  H HG3  . ARG A 1 79  ? 3.024   -10.452 11.338  1.00 0.29  ? 79  ARG A HG3  2  
ATOM 3527  H HD2  . ARG A 1 79  ? 4.910   -9.103  11.885  1.00 0.34  ? 79  ARG A HD2  2  
ATOM 3528  H HD3  . ARG A 1 79  ? 5.297   -8.850  10.179  1.00 0.31  ? 79  ARG A HD3  2  
ATOM 3529  H HE   . ARG A 1 79  ? 2.769   -7.838  10.481  1.00 0.39  ? 79  ARG A HE   2  
ATOM 3530  H HH11 . ARG A 1 79  ? 5.846   -7.273  12.034  1.00 0.43  ? 79  ARG A HH11 2  
ATOM 3531  H HH12 . ARG A 1 79  ? 5.555   -5.583  12.307  1.00 0.49  ? 79  ARG A HH12 2  
ATOM 3532  H HH21 . ARG A 1 79  ? 2.384   -5.587  10.839  1.00 0.54  ? 79  ARG A HH21 2  
ATOM 3533  H HH22 . ARG A 1 79  ? 3.608   -4.612  11.602  1.00 0.51  ? 79  ARG A HH22 2  
ATOM 3534  N N    . VAL A 1 80  ? 5.650   -13.119 7.569   1.00 0.20  ? 80  VAL A N    2  
ATOM 3535  C CA   . VAL A 1 80  ? 6.479   -14.107 6.898   1.00 0.22  ? 80  VAL A CA   2  
ATOM 3536  C C    . VAL A 1 80  ? 7.908   -13.625 6.675   1.00 0.21  ? 80  VAL A C    2  
ATOM 3537  O O    . VAL A 1 80  ? 8.774   -14.396 6.256   1.00 0.27  ? 80  VAL A O    2  
ATOM 3538  C CB   . VAL A 1 80  ? 5.861   -14.481 5.538   1.00 0.23  ? 80  VAL A CB   2  
ATOM 3539  C CG1  . VAL A 1 80  ? 4.491   -15.099 5.728   1.00 0.26  ? 80  VAL A CG1  2  
ATOM 3540  C CG2  . VAL A 1 80  ? 5.773   -13.264 4.632   1.00 0.22  ? 80  VAL A CG2  2  
ATOM 3541  H H    . VAL A 1 80  ? 5.413   -12.290 7.097   1.00 0.20  ? 80  VAL A H    2  
ATOM 3542  H HA   . VAL A 1 80  ? 6.498   -14.991 7.508   1.00 0.26  ? 80  VAL A HA   2  
ATOM 3543  H HB   . VAL A 1 80  ? 6.496   -15.208 5.067   1.00 0.27  ? 80  VAL A HB   2  
ATOM 3544  H HG11 . VAL A 1 80  ? 4.088   -15.380 4.768   1.00 0.98  ? 80  VAL A HG11 2  
ATOM 3545  H HG12 . VAL A 1 80  ? 3.834   -14.377 6.195   1.00 1.06  ? 80  VAL A HG12 2  
ATOM 3546  H HG13 . VAL A 1 80  ? 4.574   -15.971 6.355   1.00 1.01  ? 80  VAL A HG13 2  
ATOM 3547  H HG21 . VAL A 1 80  ? 5.135   -12.522 5.087   1.00 0.95  ? 80  VAL A HG21 2  
ATOM 3548  H HG22 . VAL A 1 80  ? 5.364   -13.557 3.677   1.00 1.01  ? 80  VAL A HG22 2  
ATOM 3549  H HG23 . VAL A 1 80  ? 6.761   -12.848 4.489   1.00 1.03  ? 80  VAL A HG23 2  
ATOM 3550  N N    . GLN A 1 81  ? 8.147   -12.352 6.933   1.00 0.18  ? 81  GLN A N    2  
ATOM 3551  C CA   . GLN A 1 81  ? 9.456   -11.763 6.696   1.00 0.19  ? 81  GLN A CA   2  
ATOM 3552  C C    . GLN A 1 81  ? 9.615   -10.493 7.517   1.00 0.19  ? 81  GLN A C    2  
ATOM 3553  O O    . GLN A 1 81  ? 8.716   -9.650  7.538   1.00 0.26  ? 81  GLN A O    2  
ATOM 3554  C CB   . GLN A 1 81  ? 9.634   -11.465 5.200   1.00 0.23  ? 81  GLN A CB   2  
ATOM 3555  C CG   . GLN A 1 81  ? 8.557   -10.555 4.621   1.00 0.23  ? 81  GLN A CG   2  
ATOM 3556  C CD   . GLN A 1 81  ? 8.588   -10.495 3.109   1.00 0.37  ? 81  GLN A CD   2  
ATOM 3557  O OE1  . GLN A 1 81  ? 9.282   -9.672  2.514   1.00 0.59  ? 81  GLN A OE1  2  
ATOM 3558  N NE2  . GLN A 1 81  ? 7.810   -11.356 2.479   1.00 0.50  ? 81  GLN A NE2  2  
ATOM 3559  H H    . GLN A 1 81  ? 7.431   -11.793 7.301   1.00 0.17  ? 81  GLN A H    2  
ATOM 3560  H HA   . GLN A 1 81  ? 10.206  -12.476 7.007   1.00 0.21  ? 81  GLN A HA   2  
ATOM 3561  H HB2  . GLN A 1 81  ? 10.591  -10.989 5.051   1.00 0.26  ? 81  GLN A HB2  2  
ATOM 3562  H HB3  . GLN A 1 81  ? 9.614   -12.398 4.656   1.00 0.24  ? 81  GLN A HB3  2  
ATOM 3563  H HG2  . GLN A 1 81  ? 7.588   -10.923 4.923   1.00 0.20  ? 81  GLN A HG2  2  
ATOM 3564  H HG3  . GLN A 1 81  ? 8.695   -9.561  5.011   1.00 0.25  ? 81  GLN A HG3  2  
ATOM 3565  H HE21 . GLN A 1 81  ? 7.266   -11.972 3.017   1.00 0.63  ? 81  GLN A HE21 2  
ATOM 3566  H HE22 . GLN A 1 81  ? 7.822   -11.357 1.501   1.00 0.59  ? 81  GLN A HE22 2  
ATOM 3567  N N    . GLU A 1 82  ? 10.743  -10.366 8.199   1.00 0.24  ? 82  GLU A N    2  
ATOM 3568  C CA   . GLU A 1 82  ? 10.993  -9.209  9.041   1.00 0.24  ? 82  GLU A CA   2  
ATOM 3569  C C    . GLU A 1 82  ? 12.443  -8.769  8.930   1.00 0.25  ? 82  GLU A C    2  
ATOM 3570  O O    . GLU A 1 82  ? 13.363  -9.524  9.255   1.00 0.41  ? 82  GLU A O    2  
ATOM 3571  C CB   . GLU A 1 82  ? 10.648  -9.527  10.493  1.00 0.35  ? 82  GLU A CB   2  
ATOM 3572  C CG   . GLU A 1 82  ? 10.748  -8.330  11.417  1.00 0.44  ? 82  GLU A CG   2  
ATOM 3573  C CD   . GLU A 1 82  ? 10.130  -8.586  12.776  1.00 0.82  ? 82  GLU A CD   2  
ATOM 3574  O OE1  . GLU A 1 82  ? 9.275   -9.490  12.884  1.00 1.21  ? 82  GLU A OE1  2  
ATOM 3575  O OE2  . GLU A 1 82  ? 10.487  -7.881  13.739  1.00 1.34  ? 82  GLU A OE2  2  
ATOM 3576  H H    . GLU A 1 82  ? 11.425  -11.065 8.137   1.00 0.35  ? 82  GLU A H    2  
ATOM 3577  H HA   . GLU A 1 82  ? 10.358  -8.406  8.697   1.00 0.24  ? 82  GLU A HA   2  
ATOM 3578  H HB2  . GLU A 1 82  ? 9.637   -9.908  10.541  1.00 0.43  ? 82  GLU A HB2  2  
ATOM 3579  H HB3  . GLU A 1 82  ? 11.323  -10.282 10.851  1.00 0.37  ? 82  GLU A HB3  2  
ATOM 3580  H HG2  . GLU A 1 82  ? 11.791  -8.082  11.554  1.00 0.68  ? 82  GLU A HG2  2  
ATOM 3581  H HG3  . GLU A 1 82  ? 10.240  -7.500  10.955  1.00 0.57  ? 82  GLU A HG3  2  
ATOM 3582  N N    . GLU A 1 83  ? 12.635  -7.551  8.464   1.00 0.22  ? 83  GLU A N    2  
ATOM 3583  C CA   . GLU A 1 83  ? 13.958  -6.984  8.301   1.00 0.26  ? 83  GLU A CA   2  
ATOM 3584  C C    . GLU A 1 83  ? 13.975  -5.536  8.775   1.00 0.23  ? 83  GLU A C    2  
ATOM 3585  O O    . GLU A 1 83  ? 13.223  -4.695  8.281   1.00 0.24  ? 83  GLU A O    2  
ATOM 3586  C CB   . GLU A 1 83  ? 14.410  -7.123  6.838   1.00 0.39  ? 83  GLU A CB   2  
ATOM 3587  C CG   . GLU A 1 83  ? 15.318  -6.010  6.338   1.00 1.20  ? 83  GLU A CG   2  
ATOM 3588  C CD   . GLU A 1 83  ? 16.070  -6.404  5.082   1.00 1.73  ? 83  GLU A CD   2  
ATOM 3589  O OE1  . GLU A 1 83  ? 15.476  -6.360  3.988   1.00 2.59  ? 83  GLU A OE1  2  
ATOM 3590  O OE2  . GLU A 1 83  ? 17.255  -6.785  5.189   1.00 1.69  ? 83  GLU A OE2  2  
ATOM 3591  H H    . GLU A 1 83  ? 11.852  -7.007  8.212   1.00 0.26  ? 83  GLU A H    2  
ATOM 3592  H HA   . GLU A 1 83  ? 14.627  -7.547  8.934   1.00 0.31  ? 83  GLU A HA   2  
ATOM 3593  H HB2  . GLU A 1 83  ? 14.942  -8.058  6.727   1.00 1.15  ? 83  GLU A HB2  2  
ATOM 3594  H HB3  . GLU A 1 83  ? 13.533  -7.148  6.207   1.00 1.13  ? 83  GLU A HB3  2  
ATOM 3595  H HG2  . GLU A 1 83  ? 14.705  -5.141  6.121   1.00 1.73  ? 83  GLU A HG2  2  
ATOM 3596  H HG3  . GLU A 1 83  ? 16.033  -5.764  7.108   1.00 1.68  ? 83  GLU A HG3  2  
ATOM 3597  N N    . PRO A 1 84  ? 14.837  -5.245  9.762   1.00 0.23  ? 84  PRO A N    2  
ATOM 3598  C CA   . PRO A 1 84  ? 14.906  -3.939  10.419  1.00 0.21  ? 84  PRO A CA   2  
ATOM 3599  C C    . PRO A 1 84  ? 15.490  -2.849  9.531   1.00 0.19  ? 84  PRO A C    2  
ATOM 3600  O O    . PRO A 1 84  ? 15.374  -1.660  9.840   1.00 0.20  ? 84  PRO A O    2  
ATOM 3601  C CB   . PRO A 1 84  ? 15.821  -4.177  11.632  1.00 0.25  ? 84  PRO A CB   2  
ATOM 3602  C CG   . PRO A 1 84  ? 16.014  -5.656  11.714  1.00 0.50  ? 84  PRO A CG   2  
ATOM 3603  C CD   . PRO A 1 84  ? 15.821  -6.179  10.322  1.00 0.31  ? 84  PRO A CD   2  
ATOM 3604  H HA   . PRO A 1 84  ? 13.931  -3.626  10.761  1.00 0.20  ? 84  PRO A HA   2  
ATOM 3605  H HB2  . PRO A 1 84  ? 16.761  -3.671  11.476  1.00 0.45  ? 84  PRO A HB2  2  
ATOM 3606  H HB3  . PRO A 1 84  ? 15.346  -3.793  12.524  1.00 0.41  ? 84  PRO A HB3  2  
ATOM 3607  H HG2  . PRO A 1 84  ? 17.014  -5.879  12.060  1.00 0.90  ? 84  PRO A HG2  2  
ATOM 3608  H HG3  . PRO A 1 84  ? 15.283  -6.088  12.382  1.00 0.88  ? 84  PRO A HG3  2  
ATOM 3609  H HD2  . PRO A 1 84  ? 16.749  -6.139  9.772   1.00 0.47  ? 84  PRO A HD2  2  
ATOM 3610  H HD3  . PRO A 1 84  ? 15.432  -7.186  10.343  1.00 0.50  ? 84  PRO A HD3  2  
ATOM 3611  N N    . GLU A 1 85  ? 16.105  -3.241  8.427   1.00 0.20  ? 85  GLU A N    2  
ATOM 3612  C CA   . GLU A 1 85  ? 16.715  -2.271  7.536   1.00 0.22  ? 85  GLU A CA   2  
ATOM 3613  C C    . GLU A 1 85  ? 16.956  -2.848  6.158   1.00 0.24  ? 85  GLU A C    2  
ATOM 3614  O O    . GLU A 1 85  ? 17.854  -3.659  5.938   1.00 0.35  ? 85  GLU A O    2  
ATOM 3615  C CB   . GLU A 1 85  ? 18.016  -1.732  8.130   1.00 0.31  ? 85  GLU A CB   2  
ATOM 3616  C CG   . GLU A 1 85  ? 18.640  -0.606  7.325   1.00 0.34  ? 85  GLU A CG   2  
ATOM 3617  C CD   . GLU A 1 85  ? 19.598  0.215   8.155   1.00 0.90  ? 85  GLU A CD   2  
ATOM 3618  O OE1  . GLU A 1 85  ? 19.148  1.164   8.831   1.00 1.37  ? 85  GLU A OE1  2  
ATOM 3619  O OE2  . GLU A 1 85  ? 20.812  -0.079  8.111   1.00 1.30  ? 85  GLU A OE2  2  
ATOM 3620  H H    . GLU A 1 85  ? 16.135  -4.196  8.201   1.00 0.23  ? 85  GLU A H    2  
ATOM 3621  H HA   . GLU A 1 85  ? 16.013  -1.453  7.429   1.00 0.23  ? 85  GLU A HA   2  
ATOM 3622  H HB2  . GLU A 1 85  ? 17.818  -1.368  9.127   1.00 0.43  ? 85  GLU A HB2  2  
ATOM 3623  H HB3  . GLU A 1 85  ? 18.728  -2.541  8.190   1.00 0.36  ? 85  GLU A HB3  2  
ATOM 3624  H HG2  . GLU A 1 85  ? 19.179  -1.028  6.490   1.00 0.68  ? 85  GLU A HG2  2  
ATOM 3625  H HG3  . GLU A 1 85  ? 17.855  0.040   6.962   1.00 0.66  ? 85  GLU A HG3  2  
ATOM 3626  N N    . LEU A 1 86  ? 16.114  -2.410  5.255   1.00 0.23  ? 86  LEU A N    2  
ATOM 3627  C CA   . LEU A 1 86  ? 16.166  -2.769  3.865   1.00 0.24  ? 86  LEU A CA   2  
ATOM 3628  C C    . LEU A 1 86  ? 16.480  -1.533  3.037   1.00 0.23  ? 86  LEU A C    2  
ATOM 3629  O O    . LEU A 1 86  ? 15.658  -0.630  2.935   1.00 0.25  ? 86  LEU A O    2  
ATOM 3630  C CB   . LEU A 1 86  ? 14.806  -3.336  3.449   1.00 0.26  ? 86  LEU A CB   2  
ATOM 3631  C CG   . LEU A 1 86  ? 14.578  -3.453  1.948   1.00 0.33  ? 86  LEU A CG   2  
ATOM 3632  C CD1  . LEU A 1 86  ? 15.577  -4.414  1.343   1.00 0.38  ? 86  LEU A CD1  2  
ATOM 3633  C CD2  . LEU A 1 86  ? 13.154  -3.899  1.647   1.00 0.38  ? 86  LEU A CD2  2  
ATOM 3634  H H    . LEU A 1 86  ? 15.396  -1.809  5.547   1.00 0.29  ? 86  LEU A H    2  
ATOM 3635  H HA   . LEU A 1 86  ? 16.931  -3.513  3.724   1.00 0.26  ? 86  LEU A HA   2  
ATOM 3636  H HB2  . LEU A 1 86  ? 14.703  -4.320  3.879   1.00 0.27  ? 86  LEU A HB2  2  
ATOM 3637  H HB3  . LEU A 1 86  ? 14.036  -2.699  3.857   1.00 0.27  ? 86  LEU A HB3  2  
ATOM 3638  H HG   . LEU A 1 86  ? 14.731  -2.482  1.503   1.00 0.35  ? 86  LEU A HG   2  
ATOM 3639  H HD11 . LEU A 1 86  ? 15.472  -5.378  1.817   1.00 1.08  ? 86  LEU A HD11 2  
ATOM 3640  H HD12 . LEU A 1 86  ? 16.576  -4.039  1.505   1.00 1.14  ? 86  LEU A HD12 2  
ATOM 3641  H HD13 . LEU A 1 86  ? 15.391  -4.510  0.285   1.00 1.05  ? 86  LEU A HD13 2  
ATOM 3642  H HD21 . LEU A 1 86  ? 12.456  -3.169  2.028   1.00 1.08  ? 86  LEU A HD21 2  
ATOM 3643  H HD22 . LEU A 1 86  ? 12.968  -4.852  2.117   1.00 1.04  ? 86  LEU A HD22 2  
ATOM 3644  H HD23 . LEU A 1 86  ? 13.025  -3.996  0.577   1.00 0.99  ? 86  LEU A HD23 2  
ATOM 3645  N N    . VAL A 1 87  ? 17.666  -1.471  2.469   1.00 0.24  ? 87  VAL A N    2  
ATOM 3646  C CA   . VAL A 1 87  ? 18.031  -0.335  1.643   1.00 0.22  ? 87  VAL A CA   2  
ATOM 3647  C C    . VAL A 1 87  ? 17.985  -0.734  0.168   1.00 0.21  ? 87  VAL A C    2  
ATOM 3648  O O    . VAL A 1 87  ? 18.501  -1.783  -0.220  1.00 0.28  ? 87  VAL A O    2  
ATOM 3649  C CB   . VAL A 1 87  ? 19.423  0.222   2.026   1.00 0.27  ? 87  VAL A CB   2  
ATOM 3650  C CG1  . VAL A 1 87  ? 20.528  -0.777  1.731   1.00 1.00  ? 87  VAL A CG1  2  
ATOM 3651  C CG2  . VAL A 1 87  ? 19.688  1.548   1.331   1.00 0.94  ? 87  VAL A CG2  2  
ATOM 3652  H H    . VAL A 1 87  ? 18.302  -2.206  2.593   1.00 0.29  ? 87  VAL A H    2  
ATOM 3653  H HA   . VAL A 1 87  ? 17.294  0.446   1.819   1.00 0.20  ? 87  VAL A HA   2  
ATOM 3654  H HB   . VAL A 1 87  ? 19.424  0.405   3.091   1.00 0.79  ? 87  VAL A HB   2  
ATOM 3655  H HG11 . VAL A 1 87  ? 20.542  -0.992  0.673   1.00 1.46  ? 87  VAL A HG11 2  
ATOM 3656  H HG12 . VAL A 1 87  ? 20.344  -1.686  2.281   1.00 1.48  ? 87  VAL A HG12 2  
ATOM 3657  H HG13 . VAL A 1 87  ? 21.480  -0.362  2.028   1.00 1.59  ? 87  VAL A HG13 2  
ATOM 3658  H HG21 . VAL A 1 87  ? 20.680  1.895   1.583   1.00 1.54  ? 87  VAL A HG21 2  
ATOM 3659  H HG22 . VAL A 1 87  ? 18.960  2.277   1.657   1.00 1.50  ? 87  VAL A HG22 2  
ATOM 3660  H HG23 . VAL A 1 87  ? 19.614  1.419   0.260   1.00 1.54  ? 87  VAL A HG23 2  
ATOM 3661  N N    . PHE A 1 88  ? 17.333  0.079   -0.644  1.00 0.17  ? 88  PHE A N    2  
ATOM 3662  C CA   . PHE A 1 88  ? 17.146  -0.254  -2.053  1.00 0.19  ? 88  PHE A CA   2  
ATOM 3663  C C    . PHE A 1 88  ? 17.047  0.999   -2.902  1.00 0.20  ? 88  PHE A C    2  
ATOM 3664  O O    . PHE A 1 88  ? 16.734  2.076   -2.394  1.00 0.23  ? 88  PHE A O    2  
ATOM 3665  C CB   . PHE A 1 88  ? 15.886  -1.099  -2.229  1.00 0.21  ? 88  PHE A CB   2  
ATOM 3666  C CG   . PHE A 1 88  ? 14.614  -0.364  -1.926  1.00 0.18  ? 88  PHE A CG   2  
ATOM 3667  C CD1  . PHE A 1 88  ? 14.153  -0.272  -0.624  1.00 0.19  ? 88  PHE A CD1  2  
ATOM 3668  C CD2  . PHE A 1 88  ? 13.885  0.239   -2.937  1.00 0.17  ? 88  PHE A CD2  2  
ATOM 3669  C CE1  . PHE A 1 88  ? 12.993  0.409   -0.333  1.00 0.17  ? 88  PHE A CE1  2  
ATOM 3670  C CE2  . PHE A 1 88  ? 12.725  0.926   -2.651  1.00 0.16  ? 88  PHE A CE2  2  
ATOM 3671  C CZ   . PHE A 1 88  ? 12.250  0.976   -1.388  1.00 0.15  ? 88  PHE A CZ   2  
ATOM 3672  H H    . PHE A 1 88  ? 16.961  0.919   -0.290  1.00 0.18  ? 88  PHE A H    2  
ATOM 3673  H HA   . PHE A 1 88  ? 17.994  -0.827  -2.386  1.00 0.21  ? 88  PHE A HA   2  
ATOM 3674  H HB2  . PHE A 1 88  ? 15.834  -1.440  -3.252  1.00 0.25  ? 88  PHE A HB2  2  
ATOM 3675  H HB3  . PHE A 1 88  ? 15.941  -1.956  -1.572  1.00 0.24  ? 88  PHE A HB3  2  
ATOM 3676  H HD1  . PHE A 1 88  ? 14.713  -0.743  0.172   1.00 0.21  ? 88  PHE A HD1  2  
ATOM 3677  H HD2  . PHE A 1 88  ? 14.234  0.173   -3.956  1.00 0.18  ? 88  PHE A HD2  2  
ATOM 3678  H HE1  . PHE A 1 88  ? 12.643  0.474   0.685   1.00 0.19  ? 88  PHE A HE1  2  
ATOM 3679  H HE2  . PHE A 1 88  ? 12.163  1.390   -3.449  1.00 0.16  ? 88  PHE A HE2  2  
ATOM 3680  H HZ   . PHE A 1 88  ? 11.327  1.492   -1.182  1.00 0.15  ? 88  PHE A HZ   2  
ATOM 3681  N N    . THR A 1 89  ? 17.315  0.845   -4.190  1.00 0.23  ? 89  THR A N    2  
ATOM 3682  C CA   . THR A 1 89  ? 17.206  1.941   -5.136  1.00 0.25  ? 89  THR A CA   2  
ATOM 3683  C C    . THR A 1 89  ? 15.738  2.197   -5.480  1.00 0.21  ? 89  THR A C    2  
ATOM 3684  O O    . THR A 1 89  ? 15.092  1.375   -6.132  1.00 0.22  ? 89  THR A O    2  
ATOM 3685  C CB   . THR A 1 89  ? 17.992  1.629   -6.424  1.00 0.33  ? 89  THR A CB   2  
ATOM 3686  O OG1  . THR A 1 89  ? 19.287  1.108   -6.089  1.00 0.42  ? 89  THR A OG1  2  
ATOM 3687  C CG2  . THR A 1 89  ? 18.156  2.883   -7.269  1.00 0.37  ? 89  THR A CG2  2  
ATOM 3688  H H    . THR A 1 89  ? 17.598  -0.043  -4.515  1.00 0.28  ? 89  THR A H    2  
ATOM 3689  H HA   . THR A 1 89  ? 17.626  2.828   -4.682  1.00 0.26  ? 89  THR A HA   2  
ATOM 3690  H HB   . THR A 1 89  ? 17.447  0.891   -6.996  1.00 0.33  ? 89  THR A HB   2  
ATOM 3691  H HG1  . THR A 1 89  ? 19.244  0.146   -6.057  1.00 0.78  ? 89  THR A HG1  2  
ATOM 3692  H HG21 . THR A 1 89  ? 18.671  3.638   -6.694  1.00 1.05  ? 89  THR A HG21 2  
ATOM 3693  H HG22 . THR A 1 89  ? 17.184  3.252   -7.558  1.00 1.02  ? 89  THR A HG22 2  
ATOM 3694  H HG23 . THR A 1 89  ? 18.730  2.648   -8.154  1.00 1.07  ? 89  THR A HG23 2  
ATOM 3695  N N    . LEU A 1 90  ? 15.211  3.318   -5.003  1.00 0.19  ? 90  LEU A N    2  
ATOM 3696  C CA   . LEU A 1 90  ? 13.828  3.695   -5.274  1.00 0.16  ? 90  LEU A CA   2  
ATOM 3697  C C    . LEU A 1 90  ? 13.610  3.891   -6.772  1.00 0.15  ? 90  LEU A C    2  
ATOM 3698  O O    . LEU A 1 90  ? 14.430  4.515   -7.440  1.00 0.18  ? 90  LEU A O    2  
ATOM 3699  C CB   . LEU A 1 90  ? 13.486  4.991   -4.536  1.00 0.16  ? 90  LEU A CB   2  
ATOM 3700  C CG   . LEU A 1 90  ? 11.996  5.294   -4.426  1.00 0.34  ? 90  LEU A CG   2  
ATOM 3701  C CD1  . LEU A 1 90  ? 11.276  4.152   -3.736  1.00 0.60  ? 90  LEU A CD1  2  
ATOM 3702  C CD2  . LEU A 1 90  ? 11.774  6.597   -3.679  1.00 0.60  ? 90  LEU A CD2  2  
ATOM 3703  H H    . LEU A 1 90  ? 15.769  3.909   -4.447  1.00 0.20  ? 90  LEU A H    2  
ATOM 3704  H HA   . LEU A 1 90  ? 13.178  2.906   -4.920  1.00 0.17  ? 90  LEU A HA   2  
ATOM 3705  H HB2  . LEU A 1 90  ? 13.907  4.947   -3.556  1.00 0.37  ? 90  LEU A HB2  2  
ATOM 3706  H HB3  . LEU A 1 90  ? 13.948  5.803   -5.055  1.00 0.39  ? 90  LEU A HB3  2  
ATOM 3707  H HG   . LEU A 1 90  ? 11.582  5.402   -5.417  1.00 0.78  ? 90  LEU A HG   2  
ATOM 3708  H HD11 . LEU A 1 90  ? 11.646  4.049   -2.727  1.00 1.17  ? 90  LEU A HD11 2  
ATOM 3709  H HD12 . LEU A 1 90  ? 11.450  3.236   -4.281  1.00 1.31  ? 90  LEU A HD12 2  
ATOM 3710  H HD13 . LEU A 1 90  ? 10.214  4.361   -3.713  1.00 1.19  ? 90  LEU A HD13 2  
ATOM 3711  H HD21 . LEU A 1 90  ? 10.723  6.840   -3.684  1.00 1.19  ? 90  LEU A HD21 2  
ATOM 3712  H HD22 . LEU A 1 90  ? 12.327  7.389   -4.162  1.00 1.33  ? 90  LEU A HD22 2  
ATOM 3713  H HD23 . LEU A 1 90  ? 12.113  6.489   -2.659  1.00 1.18  ? 90  LEU A HD23 2  
ATOM 3714  N N    . GLY A 1 91  ? 12.532  3.336   -7.300  1.00 0.20  ? 91  GLY A N    2  
ATOM 3715  C CA   . GLY A 1 91  ? 12.199  3.543   -8.693  1.00 0.23  ? 91  GLY A CA   2  
ATOM 3716  C C    . GLY A 1 91  ? 12.930  2.592   -9.610  1.00 0.26  ? 91  GLY A C    2  
ATOM 3717  O O    . GLY A 1 91  ? 12.796  2.665   -10.833 1.00 0.37  ? 91  GLY A O    2  
ATOM 3718  H H    . GLY A 1 91  ? 11.964  2.751   -6.747  1.00 0.24  ? 91  GLY A H    2  
ATOM 3719  H HA2  . GLY A 1 91  ? 11.136  3.401   -8.822  1.00 0.26  ? 91  GLY A HA2  2  
ATOM 3720  H HA3  . GLY A 1 91  ? 12.452  4.558   -8.965  1.00 0.24  ? 91  GLY A HA3  2  
ATOM 3721  N N    . ASP A 1 92  ? 13.689  1.684   -9.019  1.00 0.27  ? 92  ASP A N    2  
ATOM 3722  C CA   . ASP A 1 92  ? 14.514  0.761   -9.784  1.00 0.32  ? 92  ASP A CA   2  
ATOM 3723  C C    . ASP A 1 92  ? 13.904  -0.625  -9.756  1.00 0.30  ? 92  ASP A C    2  
ATOM 3724  O O    . ASP A 1 92  ? 14.395  -1.548  -10.410 1.00 0.37  ? 92  ASP A O    2  
ATOM 3725  C CB   . ASP A 1 92  ? 15.938  0.733   -9.216  1.00 0.42  ? 92  ASP A CB   2  
ATOM 3726  C CG   . ASP A 1 92  ? 16.913  -0.046  -10.077 1.00 0.59  ? 92  ASP A CG   2  
ATOM 3727  O OD1  . ASP A 1 92  ? 17.388  0.507   -11.090 1.00 0.93  ? 92  ASP A OD1  2  
ATOM 3728  O OD2  . ASP A 1 92  ? 17.225  -1.203  -9.733  1.00 0.82  ? 92  ASP A OD2  2  
ATOM 3729  H H    . ASP A 1 92  ? 13.685  1.623   -8.037  1.00 0.29  ? 92  ASP A H    2  
ATOM 3730  H HA   . ASP A 1 92  ? 14.544  1.103   -10.800 1.00 0.38  ? 92  ASP A HA   2  
ATOM 3731  H HB2  . ASP A 1 92  ? 16.303  1.746   -9.129  1.00 0.47  ? 92  ASP A HB2  2  
ATOM 3732  H HB3  . ASP A 1 92  ? 15.917  0.282   -8.235  1.00 0.43  ? 92  ASP A HB3  2  
ATOM 3733  N N    . CYS A 1 93  ? 12.800  -0.752  -9.018  1.00 0.28  ? 93  CYS A N    2  
ATOM 3734  C CA   . CYS A 1 93  ? 12.196  -2.050  -8.766  1.00 0.27  ? 93  CYS A CA   2  
ATOM 3735  C C    . CYS A 1 93  ? 13.210  -2.932  -8.061  1.00 0.26  ? 93  CYS A C    2  
ATOM 3736  O O    . CYS A 1 93  ? 13.260  -4.145  -8.271  1.00 0.31  ? 93  CYS A O    2  
ATOM 3737  C CB   . CYS A 1 93  ? 11.738  -2.709  -10.069 1.00 0.38  ? 93  CYS A CB   2  
ATOM 3738  S SG   . CYS A 1 93  ? 10.702  -1.654  -11.106 1.00 0.62  ? 93  CYS A SG   2  
ATOM 3739  H H    . CYS A 1 93  ? 12.383  0.054   -8.633  1.00 0.30  ? 93  CYS A H    2  
ATOM 3740  H HA   . CYS A 1 93  ? 11.345  -1.903  -8.117  1.00 0.26  ? 93  CYS A HA   2  
ATOM 3741  H HB2  . CYS A 1 93  ? 12.607  -2.987  -10.647 1.00 0.68  ? 93  CYS A HB2  2  
ATOM 3742  H HB3  . CYS A 1 93  ? 11.169  -3.597  -9.829  1.00 0.47  ? 93  CYS A HB3  2  
ATOM 3743  H HG   . CYS A 1 93  ? 9.429   -1.955  -10.857 1.00 1.55  ? 93  CYS A HG   2  
ATOM 3744  N N    . ASP A 1 94  ? 14.006  -2.307  -7.196  1.00 0.27  ? 94  ASP A N    2  
ATOM 3745  C CA   . ASP A 1 94  ? 15.045  -3.001  -6.460  1.00 0.33  ? 94  ASP A CA   2  
ATOM 3746  C C    . ASP A 1 94  ? 14.387  -3.841  -5.371  1.00 0.33  ? 94  ASP A C    2  
ATOM 3747  O O    . ASP A 1 94  ? 15.035  -4.581  -4.630  1.00 0.48  ? 94  ASP A O    2  
ATOM 3748  C CB   . ASP A 1 94  ? 16.000  -1.964  -5.862  1.00 0.41  ? 94  ASP A CB   2  
ATOM 3749  C CG   . ASP A 1 94  ? 17.419  -2.468  -5.709  1.00 0.65  ? 94  ASP A CG   2  
ATOM 3750  O OD1  . ASP A 1 94  ? 17.845  -3.327  -6.512  1.00 0.96  ? 94  ASP A OD1  2  
ATOM 3751  O OD2  . ASP A 1 94  ? 18.135  -1.957  -4.823  1.00 1.33  ? 94  ASP A OD2  2  
ATOM 3752  H H    . ASP A 1 94  ? 13.880  -1.346  -7.037  1.00 0.28  ? 94  ASP A H    2  
ATOM 3753  H HA   . ASP A 1 94  ? 15.577  -3.640  -7.145  1.00 0.37  ? 94  ASP A HA   2  
ATOM 3754  H HB2  . ASP A 1 94  ? 16.018  -1.096  -6.505  1.00 0.64  ? 94  ASP A HB2  2  
ATOM 3755  H HB3  . ASP A 1 94  ? 15.635  -1.671  -4.888  1.00 0.46  ? 94  ASP A HB3  2  
ATOM 3756  N N    . VAL A 1 95  ? 13.067  -3.700  -5.310  1.00 0.23  ? 95  VAL A N    2  
ATOM 3757  C CA   . VAL A 1 95  ? 12.220  -4.378  -4.347  1.00 0.21  ? 95  VAL A CA   2  
ATOM 3758  C C    . VAL A 1 95  ? 10.938  -4.836  -5.024  1.00 0.20  ? 95  VAL A C    2  
ATOM 3759  O O    . VAL A 1 95  ? 10.906  -5.037  -6.236  1.00 0.22  ? 95  VAL A O    2  
ATOM 3760  C CB   . VAL A 1 95  ? 11.848  -3.428  -3.198  1.00 0.20  ? 95  VAL A CB   2  
ATOM 3761  C CG1  . VAL A 1 95  ? 13.028  -3.226  -2.276  1.00 0.23  ? 95  VAL A CG1  2  
ATOM 3762  C CG2  . VAL A 1 95  ? 11.367  -2.092  -3.756  1.00 0.19  ? 95  VAL A CG2  2  
ATOM 3763  H H    . VAL A 1 95  ? 12.640  -3.107  -5.964  1.00 0.25  ? 95  VAL A H    2  
ATOM 3764  H HA   . VAL A 1 95  ? 12.754  -5.229  -3.949  1.00 0.23  ? 95  VAL A HA   2  
ATOM 3765  H HB   . VAL A 1 95  ? 11.043  -3.868  -2.633  1.00 0.20  ? 95  VAL A HB   2  
ATOM 3766  H HG11 . VAL A 1 95  ? 13.332  -4.179  -1.866  1.00 0.99  ? 95  VAL A HG11 2  
ATOM 3767  H HG12 . VAL A 1 95  ? 12.747  -2.557  -1.476  1.00 1.04  ? 95  VAL A HG12 2  
ATOM 3768  H HG13 . VAL A 1 95  ? 13.845  -2.798  -2.838  1.00 0.98  ? 95  VAL A HG13 2  
ATOM 3769  H HG21 . VAL A 1 95  ? 11.173  -1.410  -2.943  1.00 1.08  ? 95  VAL A HG21 2  
ATOM 3770  H HG22 . VAL A 1 95  ? 10.459  -2.242  -4.324  1.00 1.02  ? 95  VAL A HG22 2  
ATOM 3771  H HG23 . VAL A 1 95  ? 12.131  -1.674  -4.403  1.00 1.01  ? 95  VAL A HG23 2  
ATOM 3772  N N    . ILE A 1 96  ? 9.878   -4.973  -4.243  1.00 0.19  ? 96  ILE A N    2  
ATOM 3773  C CA   . ILE A 1 96  ? 8.578   -5.249  -4.790  1.00 0.19  ? 96  ILE A CA   2  
ATOM 3774  C C    . ILE A 1 96  ? 7.985   -3.929  -5.225  1.00 0.16  ? 96  ILE A C    2  
ATOM 3775  O O    . ILE A 1 96  ? 8.136   -2.920  -4.532  1.00 0.15  ? 96  ILE A O    2  
ATOM 3776  C CB   . ILE A 1 96  ? 7.658   -5.949  -3.769  1.00 0.22  ? 96  ILE A CB   2  
ATOM 3777  C CG1  . ILE A 1 96  ? 7.475   -5.089  -2.513  1.00 0.25  ? 96  ILE A CG1  2  
ATOM 3778  C CG2  . ILE A 1 96  ? 8.230   -7.309  -3.401  1.00 0.26  ? 96  ILE A CG2  2  
ATOM 3779  C CD1  . ILE A 1 96  ? 6.542   -5.697  -1.486  1.00 0.29  ? 96  ILE A CD1  2  
ATOM 3780  H H    . ILE A 1 96  ? 9.964   -4.833  -3.284  1.00 0.21  ? 96  ILE A H    2  
ATOM 3781  H HA   . ILE A 1 96  ? 8.698   -5.890  -5.654  1.00 0.21  ? 96  ILE A HA   2  
ATOM 3782  H HB   . ILE A 1 96  ? 6.697   -6.105  -4.235  1.00 0.22  ? 96  ILE A HB   2  
ATOM 3783  H HG12 . ILE A 1 96  ? 8.436   -4.947  -2.040  1.00 0.27  ? 96  ILE A HG12 2  
ATOM 3784  H HG13 . ILE A 1 96  ? 7.074   -4.126  -2.796  1.00 0.24  ? 96  ILE A HG13 2  
ATOM 3785  H HG21 . ILE A 1 96  ? 9.213   -7.185  -2.971  1.00 1.03  ? 96  ILE A HG21 2  
ATOM 3786  H HG22 . ILE A 1 96  ? 8.300   -7.921  -4.289  1.00 1.06  ? 96  ILE A HG22 2  
ATOM 3787  H HG23 . ILE A 1 96  ? 7.581   -7.789  -2.684  1.00 1.05  ? 96  ILE A HG23 2  
ATOM 3788  H HD11 . ILE A 1 96  ? 5.565   -5.834  -1.924  1.00 1.00  ? 96  ILE A HD11 2  
ATOM 3789  H HD12 . ILE A 1 96  ? 6.465   -5.038  -0.637  1.00 1.02  ? 96  ILE A HD12 2  
ATOM 3790  H HD13 . ILE A 1 96  ? 6.931   -6.653  -1.166  1.00 0.98  ? 96  ILE A HD13 2  
ATOM 3791  N N    . GLN A 1 97  ? 7.352   -3.920  -6.377  1.00 0.17  ? 97  GLN A N    2  
ATOM 3792  C CA   . GLN A 1 97  ? 6.876   -2.677  -6.968  1.00 0.17  ? 97  GLN A CA   2  
ATOM 3793  C C    . GLN A 1 97  ? 5.927   -1.949  -6.023  1.00 0.16  ? 97  GLN A C    2  
ATOM 3794  O O    . GLN A 1 97  ? 5.873   -0.722  -6.013  1.00 0.16  ? 97  GLN A O    2  
ATOM 3795  C CB   . GLN A 1 97  ? 6.194   -2.930  -8.305  1.00 0.19  ? 97  GLN A CB   2  
ATOM 3796  C CG   . GLN A 1 97  ? 6.108   -1.678  -9.160  1.00 0.25  ? 97  GLN A CG   2  
ATOM 3797  C CD   . GLN A 1 97  ? 7.450   -1.286  -9.766  1.00 0.31  ? 97  GLN A CD   2  
ATOM 3798  O OE1  . GLN A 1 97  ? 7.767   -1.665  -10.891 1.00 0.40  ? 97  GLN A OE1  2  
ATOM 3799  N NE2  . GLN A 1 97  ? 8.270   -0.558  -9.018  1.00 0.32  ? 97  GLN A NE2  2  
ATOM 3800  H H    . GLN A 1 97  ? 7.210   -4.765  -6.844  1.00 0.19  ? 97  GLN A H    2  
ATOM 3801  H HA   . GLN A 1 97  ? 7.738   -2.048  -7.132  1.00 0.17  ? 97  GLN A HA   2  
ATOM 3802  H HB2  . GLN A 1 97  ? 6.752   -3.679  -8.846  1.00 0.23  ? 97  GLN A HB2  2  
ATOM 3803  H HB3  . GLN A 1 97  ? 5.191   -3.292  -8.129  1.00 0.21  ? 97  GLN A HB3  2  
ATOM 3804  H HG2  . GLN A 1 97  ? 5.407   -1.853  -9.961  1.00 0.29  ? 97  GLN A HG2  2  
ATOM 3805  H HG3  . GLN A 1 97  ? 5.757   -0.866  -8.544  1.00 0.29  ? 97  GLN A HG3  2  
ATOM 3806  H HE21 . GLN A 1 97  ? 7.987   -0.309  -8.110  1.00 0.29  ? 97  GLN A HE21 2  
ATOM 3807  H HE22 . GLN A 1 97  ? 9.131   -0.290  -9.404  1.00 0.39  ? 97  GLN A HE22 2  
ATOM 3808  N N    . ALA A 1 98  ? 5.199   -2.715  -5.219  1.00 0.17  ? 98  ALA A N    2  
ATOM 3809  C CA   . ALA A 1 98  ? 4.335   -2.152  -4.189  1.00 0.18  ? 98  ALA A CA   2  
ATOM 3810  C C    . ALA A 1 98  ? 5.111   -1.206  -3.290  1.00 0.17  ? 98  ALA A C    2  
ATOM 3811  O O    . ALA A 1 98  ? 4.688   -0.082  -3.034  1.00 0.20  ? 98  ALA A O    2  
ATOM 3812  C CB   . ALA A 1 98  ? 3.750   -3.265  -3.353  1.00 0.20  ? 98  ALA A CB   2  
ATOM 3813  H H    . ALA A 1 98  ? 5.246   -3.692  -5.320  1.00 0.18  ? 98  ALA A H    2  
ATOM 3814  H HA   . ALA A 1 98  ? 3.530   -1.615  -4.668  1.00 0.19  ? 98  ALA A HA   2  
ATOM 3815  H HB1  . ALA A 1 98  ? 3.162   -2.840  -2.552  1.00 1.08  ? 98  ALA A HB1  2  
ATOM 3816  H HB2  . ALA A 1 98  ? 4.550   -3.861  -2.937  1.00 1.01  ? 98  ALA A HB2  2  
ATOM 3817  H HB3  . ALA A 1 98  ? 3.121   -3.888  -3.968  1.00 1.00  ? 98  ALA A HB3  2  
ATOM 3818  N N    . LEU A 1 99  ? 6.263   -1.672  -2.837  1.00 0.17  ? 99  LEU A N    2  
ATOM 3819  C CA   . LEU A 1 99  ? 7.094   -0.901  -1.921  1.00 0.17  ? 99  LEU A CA   2  
ATOM 3820  C C    . LEU A 1 99  ? 7.759   0.251   -2.650  1.00 0.15  ? 99  LEU A C    2  
ATOM 3821  O O    . LEU A 1 99  ? 7.883   1.354   -2.123  1.00 0.15  ? 99  LEU A O    2  
ATOM 3822  C CB   . LEU A 1 99  ? 8.171   -1.772  -1.289  1.00 0.19  ? 99  LEU A CB   2  
ATOM 3823  C CG   . LEU A 1 99  ? 9.069   -1.031  -0.298  1.00 0.18  ? 99  LEU A CG   2  
ATOM 3824  C CD1  . LEU A 1 99  ? 8.235   -0.391  0.800   1.00 0.21  ? 99  LEU A CD1  2  
ATOM 3825  C CD2  . LEU A 1 99  ? 10.105  -1.964  0.301   1.00 0.22  ? 99  LEU A CD2  2  
ATOM 3826  H H    . LEU A 1 99  ? 6.570   -2.552  -3.144  1.00 0.19  ? 99  LEU A H    2  
ATOM 3827  H HA   . LEU A 1 99  ? 6.463   -0.513  -1.147  1.00 0.17  ? 99  LEU A HA   2  
ATOM 3828  H HB2  . LEU A 1 99  ? 7.693   -2.595  -0.776  1.00 0.23  ? 99  LEU A HB2  2  
ATOM 3829  H HB3  . LEU A 1 99  ? 8.790   -2.166  -2.084  1.00 0.21  ? 99  LEU A HB3  2  
ATOM 3830  H HG   . LEU A 1 99  ? 9.592   -0.242  -0.820  1.00 0.15  ? 99  LEU A HG   2  
ATOM 3831  H HD11 . LEU A 1 99  ? 8.883   0.149   1.476   1.00 1.03  ? 99  LEU A HD11 2  
ATOM 3832  H HD12 . LEU A 1 99  ? 7.707   -1.159  1.346   1.00 1.02  ? 99  LEU A HD12 2  
ATOM 3833  H HD13 . LEU A 1 99  ? 7.524   0.293   0.360   1.00 1.06  ? 99  LEU A HD13 2  
ATOM 3834  H HD21 . LEU A 1 99  ? 10.724  -2.367  -0.486  1.00 0.97  ? 99  LEU A HD21 2  
ATOM 3835  H HD22 . LEU A 1 99  ? 9.608   -2.770  0.820   1.00 1.01  ? 99  LEU A HD22 2  
ATOM 3836  H HD23 . LEU A 1 99  ? 10.721  -1.412  0.998   1.00 1.07  ? 99  LEU A HD23 2  
ATOM 3837  N N    . ASP A 1 100 ? 8.160   -0.027  -3.877  1.00 0.15  ? 100 ASP A N    2  
ATOM 3838  C CA   . ASP A 1 100 ? 8.891   0.922   -4.703  1.00 0.16  ? 100 ASP A CA   2  
ATOM 3839  C C    . ASP A 1 100 ? 8.035   2.156   -4.946  1.00 0.15  ? 100 ASP A C    2  
ATOM 3840  O O    . ASP A 1 100 ? 8.542   3.264   -5.106  1.00 0.16  ? 100 ASP A O    2  
ATOM 3841  C CB   . ASP A 1 100 ? 9.269   0.235   -6.021  1.00 0.17  ? 100 ASP A CB   2  
ATOM 3842  C CG   . ASP A 1 100 ? 10.029  1.129   -6.981  1.00 0.20  ? 100 ASP A CG   2  
ATOM 3843  O OD1  . ASP A 1 100 ? 9.377   1.934   -7.677  1.00 0.26  ? 100 ASP A OD1  2  
ATOM 3844  O OD2  . ASP A 1 100 ? 11.277  1.061   -7.012  1.00 0.21  ? 100 ASP A OD2  2  
ATOM 3845  H H    . ASP A 1 100 ? 7.934   -0.899  -4.254  1.00 0.16  ? 100 ASP A H    2  
ATOM 3846  H HA   . ASP A 1 100 ? 9.789   1.208   -4.177  1.00 0.16  ? 100 ASP A HA   2  
ATOM 3847  H HB2  . ASP A 1 100 ? 9.890   -0.617  -5.800  1.00 0.19  ? 100 ASP A HB2  2  
ATOM 3848  H HB3  . ASP A 1 100 ? 8.370   -0.108  -6.509  1.00 0.16  ? 100 ASP A HB3  2  
ATOM 3849  N N    . LEU A 1 101 ? 6.726   1.945   -4.964  1.00 0.16  ? 101 LEU A N    2  
ATOM 3850  C CA   . LEU A 1 101 ? 5.769   3.022   -5.116  1.00 0.16  ? 101 LEU A CA   2  
ATOM 3851  C C    . LEU A 1 101 ? 5.352   3.603   -3.760  1.00 0.15  ? 101 LEU A C    2  
ATOM 3852  O O    . LEU A 1 101 ? 5.123   4.810   -3.632  1.00 0.16  ? 101 LEU A O    2  
ATOM 3853  C CB   . LEU A 1 101 ? 4.549   2.498   -5.868  1.00 0.19  ? 101 LEU A CB   2  
ATOM 3854  C CG   . LEU A 1 101 ? 4.833   1.901   -7.247  1.00 0.22  ? 101 LEU A CG   2  
ATOM 3855  C CD1  . LEU A 1 101 ? 3.551   1.383   -7.878  1.00 0.25  ? 101 LEU A CD1  2  
ATOM 3856  C CD2  . LEU A 1 101 ? 5.501   2.925   -8.147  1.00 0.25  ? 101 LEU A CD2  2  
ATOM 3857  H H    . LEU A 1 101 ? 6.391   1.028   -4.879  1.00 0.16  ? 101 LEU A H    2  
ATOM 3858  H HA   . LEU A 1 101 ? 6.239   3.802   -5.694  1.00 0.17  ? 101 LEU A HA   2  
ATOM 3859  H HB2  . LEU A 1 101 ? 4.080   1.739   -5.263  1.00 0.20  ? 101 LEU A HB2  2  
ATOM 3860  H HB3  . LEU A 1 101 ? 3.857   3.306   -5.988  1.00 0.19  ? 101 LEU A HB3  2  
ATOM 3861  H HG   . LEU A 1 101 ? 5.511   1.065   -7.134  1.00 0.23  ? 101 LEU A HG   2  
ATOM 3862  H HD11 . LEU A 1 101 ? 3.765   0.996   -8.863  1.00 0.87  ? 101 LEU A HD11 2  
ATOM 3863  H HD12 . LEU A 1 101 ? 2.835   2.188   -7.955  1.00 1.03  ? 101 LEU A HD12 2  
ATOM 3864  H HD13 . LEU A 1 101 ? 3.142   0.596   -7.264  1.00 1.01  ? 101 LEU A HD13 2  
ATOM 3865  H HD21 . LEU A 1 101 ? 6.426   3.251   -7.693  1.00 1.01  ? 101 LEU A HD21 2  
ATOM 3866  H HD22 . LEU A 1 101 ? 4.847   3.772   -8.279  1.00 1.02  ? 101 LEU A HD22 2  
ATOM 3867  H HD23 . LEU A 1 101 ? 5.713   2.477   -9.107  1.00 1.06  ? 101 LEU A HD23 2  
ATOM 3868  N N    . SER A 1 102 ? 5.267   2.743   -2.751  1.00 0.15  ? 102 SER A N    2  
ATOM 3869  C CA   . SER A 1 102 ? 4.803   3.140   -1.431  1.00 0.17  ? 102 SER A CA   2  
ATOM 3870  C C    . SER A 1 102 ? 5.742   4.161   -0.797  1.00 0.15  ? 102 SER A C    2  
ATOM 3871  O O    . SER A 1 102 ? 5.299   5.075   -0.108  1.00 0.18  ? 102 SER A O    2  
ATOM 3872  C CB   . SER A 1 102 ? 4.681   1.908   -0.529  1.00 0.23  ? 102 SER A CB   2  
ATOM 3873  O OG   . SER A 1 102 ? 4.336   2.267   0.799   1.00 1.01  ? 102 SER A OG   2  
ATOM 3874  H H    . SER A 1 102 ? 5.526   1.813   -2.893  1.00 0.15  ? 102 SER A H    2  
ATOM 3875  H HA   . SER A 1 102 ? 3.826   3.584   -1.547  1.00 0.20  ? 102 SER A HA   2  
ATOM 3876  H HB2  . SER A 1 102 ? 3.917   1.256   -0.923  1.00 0.79  ? 102 SER A HB2  2  
ATOM 3877  H HB3  . SER A 1 102 ? 5.627   1.384   -0.513  1.00 1.05  ? 102 SER A HB3  2  
ATOM 3878  H HG   . SER A 1 102 ? 4.982   2.892   1.141   1.00 1.53  ? 102 SER A HG   2  
ATOM 3879  N N    . VAL A 1 103 ? 7.032   4.001   -1.045  1.00 0.15  ? 103 VAL A N    2  
ATOM 3880  C CA   . VAL A 1 103 ? 8.041   4.857   -0.440  1.00 0.16  ? 103 VAL A CA   2  
ATOM 3881  C C    . VAL A 1 103 ? 7.898   6.323   -0.852  1.00 0.16  ? 103 VAL A C    2  
ATOM 3882  O O    . VAL A 1 103 ? 7.779   7.181   0.009   1.00 0.18  ? 103 VAL A O    2  
ATOM 3883  C CB   . VAL A 1 103 ? 9.444   4.352   -0.776  1.00 0.18  ? 103 VAL A CB   2  
ATOM 3884  C CG1  . VAL A 1 103 ? 10.505  5.381   -0.408  1.00 0.21  ? 103 VAL A CG1  2  
ATOM 3885  C CG2  . VAL A 1 103 ? 9.710   3.039   -0.060  1.00 0.19  ? 103 VAL A CG2  2  
ATOM 3886  H H    . VAL A 1 103 ? 7.317   3.283   -1.653  1.00 0.15  ? 103 VAL A H    2  
ATOM 3887  H HA   . VAL A 1 103 ? 7.919   4.791   0.623   1.00 0.17  ? 103 VAL A HA   2  
ATOM 3888  H HB   . VAL A 1 103 ? 9.475   4.175   -1.844  1.00 0.18  ? 103 VAL A HB   2  
ATOM 3889  H HG11 . VAL A 1 103 ? 10.522  5.515   0.664   1.00 1.02  ? 103 VAL A HG11 2  
ATOM 3890  H HG12 . VAL A 1 103 ? 10.274  6.321   -0.884  1.00 1.06  ? 103 VAL A HG12 2  
ATOM 3891  H HG13 . VAL A 1 103 ? 11.471  5.036   -0.744  1.00 1.00  ? 103 VAL A HG13 2  
ATOM 3892  H HG21 . VAL A 1 103 ? 10.770  2.848   -0.052  1.00 1.03  ? 103 VAL A HG21 2  
ATOM 3893  H HG22 . VAL A 1 103 ? 9.200   2.237   -0.576  1.00 1.00  ? 103 VAL A HG22 2  
ATOM 3894  H HG23 . VAL A 1 103 ? 9.347   3.100   0.956   1.00 1.03  ? 103 VAL A HG23 2  
ATOM 3895  N N    . PRO A 1 104 ? 7.902   6.646   -2.161  1.00 0.17  ? 104 PRO A N    2  
ATOM 3896  C CA   . PRO A 1 104 ? 7.683   8.024   -2.621  1.00 0.21  ? 104 PRO A CA   2  
ATOM 3897  C C    . PRO A 1 104 ? 6.281   8.529   -2.279  1.00 0.19  ? 104 PRO A C    2  
ATOM 3898  O O    . PRO A 1 104 ? 6.021   9.733   -2.264  1.00 0.22  ? 104 PRO A O    2  
ATOM 3899  C CB   . PRO A 1 104 ? 7.879   7.941   -4.139  1.00 0.27  ? 104 PRO A CB   2  
ATOM 3900  C CG   . PRO A 1 104 ? 7.694   6.502   -4.474  1.00 0.21  ? 104 PRO A CG   2  
ATOM 3901  C CD   . PRO A 1 104 ? 8.174   5.737   -3.284  1.00 0.17  ? 104 PRO A CD   2  
ATOM 3902  H HA   . PRO A 1 104 ? 8.416   8.699   -2.197  1.00 0.24  ? 104 PRO A HA   2  
ATOM 3903  H HB2  . PRO A 1 104 ? 7.150   8.560   -4.636  1.00 0.38  ? 104 PRO A HB2  2  
ATOM 3904  H HB3  . PRO A 1 104 ? 8.873   8.274   -4.392  1.00 0.41  ? 104 PRO A HB3  2  
ATOM 3905  H HG2  . PRO A 1 104 ? 6.651   6.294   -4.657  1.00 0.31  ? 104 PRO A HG2  2  
ATOM 3906  H HG3  . PRO A 1 104 ? 8.286   6.245   -5.335  1.00 0.33  ? 104 PRO A HG3  2  
ATOM 3907  H HD2  . PRO A 1 104 ? 7.632   4.809   -3.181  1.00 0.16  ? 104 PRO A HD2  2  
ATOM 3908  H HD3  . PRO A 1 104 ? 9.231   5.542   -3.370  1.00 0.20  ? 104 PRO A HD3  2  
ATOM 3909  N N    . LEU A 1 105 ? 5.376   7.598   -2.017  1.00 0.18  ? 105 LEU A N    2  
ATOM 3910  C CA   . LEU A 1 105 ? 4.045   7.945   -1.539  1.00 0.19  ? 105 LEU A CA   2  
ATOM 3911  C C    . LEU A 1 105 ? 4.042   8.183   -0.032  1.00 0.22  ? 105 LEU A C    2  
ATOM 3912  O O    . LEU A 1 105 ? 3.071   8.692   0.527   1.00 0.32  ? 105 LEU A O    2  
ATOM 3913  C CB   . LEU A 1 105 ? 3.058   6.831   -1.875  1.00 0.18  ? 105 LEU A CB   2  
ATOM 3914  C CG   . LEU A 1 105 ? 2.532   6.833   -3.307  1.00 0.25  ? 105 LEU A CG   2  
ATOM 3915  C CD1  . LEU A 1 105 ? 1.371   5.868   -3.442  1.00 0.53  ? 105 LEU A CD1  2  
ATOM 3916  C CD2  . LEU A 1 105 ? 2.105   8.230   -3.728  1.00 0.64  ? 105 LEU A CD2  2  
ATOM 3917  H H    . LEU A 1 105 ? 5.602   6.650   -2.169  1.00 0.18  ? 105 LEU A H    2  
ATOM 3918  H HA   . LEU A 1 105 ? 3.739   8.850   -2.038  1.00 0.22  ? 105 LEU A HA   2  
ATOM 3919  H HB2  . LEU A 1 105 ? 3.562   5.884   -1.704  1.00 0.15  ? 105 LEU A HB2  2  
ATOM 3920  H HB3  . LEU A 1 105 ? 2.218   6.903   -1.201  1.00 0.22  ? 105 LEU A HB3  2  
ATOM 3921  H HG   . LEU A 1 105 ? 3.317   6.505   -3.968  1.00 0.63  ? 105 LEU A HG   2  
ATOM 3922  H HD11 . LEU A 1 105 ? 0.591   6.139   -2.745  1.00 1.26  ? 105 LEU A HD11 2  
ATOM 3923  H HD12 . LEU A 1 105 ? 1.714   4.867   -3.230  1.00 1.14  ? 105 LEU A HD12 2  
ATOM 3924  H HD13 . LEU A 1 105 ? 0.985   5.910   -4.451  1.00 1.09  ? 105 LEU A HD13 2  
ATOM 3925  H HD21 . LEU A 1 105 ? 2.961   8.888   -3.716  1.00 1.17  ? 105 LEU A HD21 2  
ATOM 3926  H HD22 . LEU A 1 105 ? 1.357   8.599   -3.041  1.00 1.35  ? 105 LEU A HD22 2  
ATOM 3927  H HD23 . LEU A 1 105 ? 1.693   8.194   -4.724  1.00 1.29  ? 105 LEU A HD23 2  
ATOM 3928  N N    . MET A 1 106 ? 5.114   7.779   0.621   1.00 0.20  ? 106 MET A N    2  
ATOM 3929  C CA   . MET A 1 106 ? 5.234   7.914   2.059   1.00 0.24  ? 106 MET A CA   2  
ATOM 3930  C C    . MET A 1 106 ? 6.230   9.020   2.418   1.00 0.21  ? 106 MET A C    2  
ATOM 3931  O O    . MET A 1 106 ? 7.119   9.349   1.633   1.00 0.26  ? 106 MET A O    2  
ATOM 3932  C CB   . MET A 1 106 ? 5.652   6.557   2.651   1.00 0.33  ? 106 MET A CB   2  
ATOM 3933  C CG   . MET A 1 106 ? 7.092   6.487   3.123   1.00 0.53  ? 106 MET A CG   2  
ATOM 3934  S SD   . MET A 1 106 ? 7.678   4.788   3.297   1.00 0.78  ? 106 MET A SD   2  
ATOM 3935  C CE   . MET A 1 106 ? 6.570   4.175   4.556   1.00 0.54  ? 106 MET A CE   2  
ATOM 3936  H H    . MET A 1 106 ? 5.849   7.359   0.121   1.00 0.21  ? 106 MET A H    2  
ATOM 3937  H HA   . MET A 1 106 ? 4.262   8.182   2.447   1.00 0.30  ? 106 MET A HA   2  
ATOM 3938  H HB2  . MET A 1 106 ? 5.015   6.339   3.494   1.00 0.74  ? 106 MET A HB2  2  
ATOM 3939  H HB3  . MET A 1 106 ? 5.506   5.792   1.902   1.00 0.76  ? 106 MET A HB3  2  
ATOM 3940  H HG2  . MET A 1 106 ? 7.718   7.002   2.412   1.00 0.87  ? 106 MET A HG2  2  
ATOM 3941  H HG3  . MET A 1 106 ? 7.153   6.980   4.088   1.00 0.79  ? 106 MET A HG3  2  
ATOM 3942  H HE1  . MET A 1 106 ? 5.552   4.248   4.204   1.00 1.31  ? 106 MET A HE1  2  
ATOM 3943  H HE2  . MET A 1 106 ? 6.684   4.766   5.455   1.00 1.14  ? 106 MET A HE2  2  
ATOM 3944  H HE3  . MET A 1 106 ? 6.804   3.144   4.769   1.00 1.28  ? 106 MET A HE3  2  
ATOM 3945  N N    . ASP A 1 107 ? 6.067   9.605   3.595   1.00 0.18  ? 107 ASP A N    2  
ATOM 3946  C CA   . ASP A 1 107 ? 6.956   10.666  4.046   1.00 0.18  ? 107 ASP A CA   2  
ATOM 3947  C C    . ASP A 1 107 ? 8.135   10.085  4.803   1.00 0.14  ? 107 ASP A C    2  
ATOM 3948  O O    . ASP A 1 107 ? 8.043   9.001   5.388   1.00 0.13  ? 107 ASP A O    2  
ATOM 3949  C CB   . ASP A 1 107 ? 6.211   11.662  4.942   1.00 0.25  ? 107 ASP A CB   2  
ATOM 3950  C CG   . ASP A 1 107 ? 5.395   12.668  4.157   1.00 0.56  ? 107 ASP A CG   2  
ATOM 3951  O OD1  . ASP A 1 107 ? 4.293   12.300  3.691   1.00 0.92  ? 107 ASP A OD1  2  
ATOM 3952  O OD2  . ASP A 1 107 ? 5.839   13.826  4.010   1.00 0.97  ? 107 ASP A OD2  2  
ATOM 3953  H H    . ASP A 1 107 ? 5.332   9.307   4.187   1.00 0.20  ? 107 ASP A H    2  
ATOM 3954  H HA   . ASP A 1 107 ? 7.325   11.183  3.172   1.00 0.21  ? 107 ASP A HA   2  
ATOM 3955  H HB2  . ASP A 1 107 ? 5.542   11.121  5.595   1.00 0.58  ? 107 ASP A HB2  2  
ATOM 3956  H HB3  . ASP A 1 107 ? 6.930   12.201  5.542   1.00 0.60  ? 107 ASP A HB3  2  
ATOM 3957  N N    . VAL A 1 108 ? 9.254   10.794  4.785   1.00 0.16  ? 108 VAL A N    2  
ATOM 3958  C CA   . VAL A 1 108 ? 10.425  10.350  5.514   1.00 0.16  ? 108 VAL A CA   2  
ATOM 3959  C C    . VAL A 1 108 ? 10.131  10.317  7.006   1.00 0.15  ? 108 VAL A C    2  
ATOM 3960  O O    . VAL A 1 108 ? 9.636   11.278  7.596   1.00 0.19  ? 108 VAL A O    2  
ATOM 3961  C CB   . VAL A 1 108 ? 11.671  11.229  5.218   1.00 0.21  ? 108 VAL A CB   2  
ATOM 3962  C CG1  . VAL A 1 108 ? 11.703  12.501  6.056   1.00 0.68  ? 108 VAL A CG1  2  
ATOM 3963  C CG2  . VAL A 1 108 ? 12.945  10.427  5.418   1.00 0.80  ? 108 VAL A CG2  2  
ATOM 3964  H H    . VAL A 1 108 ? 9.292   11.622  4.261   1.00 0.20  ? 108 VAL A H    2  
ATOM 3965  H HA   . VAL A 1 108 ? 10.646  9.337   5.192   1.00 0.16  ? 108 VAL A HA   2  
ATOM 3966  H HB   . VAL A 1 108 ? 11.623  11.522  4.181   1.00 0.63  ? 108 VAL A HB   2  
ATOM 3967  H HG11 . VAL A 1 108 ? 12.003  12.258  7.064   1.00 1.22  ? 108 VAL A HG11 2  
ATOM 3968  H HG12 . VAL A 1 108 ? 10.721  12.946  6.075   1.00 1.47  ? 108 VAL A HG12 2  
ATOM 3969  H HG13 . VAL A 1 108 ? 12.407  13.198  5.627   1.00 1.26  ? 108 VAL A HG13 2  
ATOM 3970  H HG21 . VAL A 1 108 ? 12.995  10.079  6.438   1.00 1.43  ? 108 VAL A HG21 2  
ATOM 3971  H HG22 . VAL A 1 108 ? 13.799  11.053  5.210   1.00 1.43  ? 108 VAL A HG22 2  
ATOM 3972  H HG23 . VAL A 1 108 ? 12.946  9.581   4.749   1.00 1.25  ? 108 VAL A HG23 2  
ATOM 3973  N N    . GLY A 1 109 ? 10.392  9.172   7.590   1.00 0.15  ? 109 GLY A N    2  
ATOM 3974  C CA   . GLY A 1 109 ? 10.210  9.001   9.015   1.00 0.17  ? 109 GLY A CA   2  
ATOM 3975  C C    . GLY A 1 109 ? 8.848   8.439   9.374   1.00 0.18  ? 109 GLY A C    2  
ATOM 3976  O O    . GLY A 1 109 ? 8.460   8.452   10.542  1.00 0.28  ? 109 GLY A O    2  
ATOM 3977  H H    . GLY A 1 109 ? 10.706  8.423   7.039   1.00 0.16  ? 109 GLY A H    2  
ATOM 3978  H HA2  . GLY A 1 109 ? 10.971  8.331   9.385   1.00 0.18  ? 109 GLY A HA2  2  
ATOM 3979  H HA3  . GLY A 1 109 ? 10.328  9.960   9.495   1.00 0.18  ? 109 GLY A HA3  2  
ATOM 3980  N N    . GLU A 1 110 ? 8.117   7.947   8.380   1.00 0.13  ? 110 GLU A N    2  
ATOM 3981  C CA   . GLU A 1 110 ? 6.790   7.416   8.624   1.00 0.13  ? 110 GLU A CA   2  
ATOM 3982  C C    . GLU A 1 110 ? 6.816   5.898   8.657   1.00 0.10  ? 110 GLU A C    2  
ATOM 3983  O O    . GLU A 1 110 ? 7.816   5.272   8.302   1.00 0.12  ? 110 GLU A O    2  
ATOM 3984  C CB   . GLU A 1 110 ? 5.788   7.902   7.568   1.00 0.17  ? 110 GLU A CB   2  
ATOM 3985  C CG   . GLU A 1 110 ? 5.746   7.098   6.281   1.00 0.20  ? 110 GLU A CG   2  
ATOM 3986  C CD   . GLU A 1 110 ? 4.470   7.347   5.486   1.00 0.27  ? 110 GLU A CD   2  
ATOM 3987  O OE1  . GLU A 1 110 ? 4.161   8.521   5.184   1.00 0.41  ? 110 GLU A OE1  2  
ATOM 3988  O OE2  . GLU A 1 110 ? 3.758   6.376   5.171   1.00 0.39  ? 110 GLU A OE2  2  
ATOM 3989  H H    . GLU A 1 110 ? 8.473   7.937   7.469   1.00 0.13  ? 110 GLU A H    2  
ATOM 3990  H HA   . GLU A 1 110 ? 6.473   7.776   9.592   1.00 0.15  ? 110 GLU A HA   2  
ATOM 3991  H HB2  . GLU A 1 110 ? 4.799   7.867   8.002   1.00 0.18  ? 110 GLU A HB2  2  
ATOM 3992  H HB3  . GLU A 1 110 ? 6.021   8.928   7.316   1.00 0.23  ? 110 GLU A HB3  2  
ATOM 3993  H HG2  . GLU A 1 110 ? 6.595   7.374   5.673   1.00 0.25  ? 110 GLU A HG2  2  
ATOM 3994  H HG3  . GLU A 1 110 ? 5.805   6.046   6.525   1.00 0.20  ? 110 GLU A HG3  2  
ATOM 3995  N N    . THR A 1 111 ? 5.720   5.312   9.103   1.00 0.10  ? 111 THR A N    2  
ATOM 3996  C CA   . THR A 1 111 ? 5.562   3.882   9.073   1.00 0.11  ? 111 THR A CA   2  
ATOM 3997  C C    . THR A 1 111 ? 4.230   3.582   8.429   1.00 0.11  ? 111 THR A C    2  
ATOM 3998  O O    . THR A 1 111 ? 3.191   4.039   8.906   1.00 0.12  ? 111 THR A O    2  
ATOM 3999  C CB   . THR A 1 111 ? 5.629   3.266   10.485  1.00 0.16  ? 111 THR A CB   2  
ATOM 4000  O OG1  . THR A 1 111 ? 6.745   3.814   11.196  1.00 0.22  ? 111 THR A OG1  2  
ATOM 4001  C CG2  . THR A 1 111 ? 5.775   1.751   10.410  1.00 0.19  ? 111 THR A CG2  2  
ATOM 4002  H H    . THR A 1 111 ? 4.971   5.861   9.425   1.00 0.12  ? 111 THR A H    2  
ATOM 4003  H HA   . THR A 1 111 ? 6.348   3.466   8.471   1.00 0.14  ? 111 THR A HA   2  
ATOM 4004  H HB   . THR A 1 111 ? 4.718   3.504   11.015  1.00 0.17  ? 111 THR A HB   2  
ATOM 4005  H HG1  . THR A 1 111 ? 7.249   4.388   10.607  1.00 0.27  ? 111 THR A HG1  2  
ATOM 4006  H HG21 . THR A 1 111 ? 6.701   1.499   9.910   1.00 1.07  ? 111 THR A HG21 2  
ATOM 4007  H HG22 . THR A 1 111 ? 4.946   1.340   9.857   1.00 1.02  ? 111 THR A HG22 2  
ATOM 4008  H HG23 . THR A 1 111 ? 5.779   1.339   11.409  1.00 1.01  ? 111 THR A HG23 2  
ATOM 4009  N N    . ALA A 1 112 ? 4.258   2.874   7.320   1.00 0.12  ? 112 ALA A N    2  
ATOM 4010  C CA   . ALA A 1 112 ? 3.048   2.608   6.580   1.00 0.13  ? 112 ALA A CA   2  
ATOM 4011  C C    . ALA A 1 112 ? 2.793   1.122   6.474   1.00 0.12  ? 112 ALA A C    2  
ATOM 4012  O O    . ALA A 1 112 ? 3.708   0.338   6.241   1.00 0.13  ? 112 ALA A O    2  
ATOM 4013  C CB   . ALA A 1 112 ? 3.127   3.226   5.196   1.00 0.18  ? 112 ALA A CB   2  
ATOM 4014  H H    . ALA A 1 112 ? 5.116   2.523   6.990   1.00 0.14  ? 112 ALA A H    2  
ATOM 4015  H HA   . ALA A 1 112 ? 2.224   3.067   7.104   1.00 0.14  ? 112 ALA A HA   2  
ATOM 4016  H HB1  . ALA A 1 112 ? 3.953   2.792   4.650   1.00 1.00  ? 112 ALA A HB1  2  
ATOM 4017  H HB2  . ALA A 1 112 ? 3.277   4.293   5.286   1.00 0.96  ? 112 ALA A HB2  2  
ATOM 4018  H HB3  . ALA A 1 112 ? 2.206   3.037   4.666   1.00 0.95  ? 112 ALA A HB3  2  
ATOM 4019  N N    . MET A 1 113 ? 1.547   0.742   6.653   1.00 0.12  ? 113 MET A N    2  
ATOM 4020  C CA   . MET A 1 113 ? 1.139   -0.622  6.415   1.00 0.12  ? 113 MET A CA   2  
ATOM 4021  C C    . MET A 1 113 ? 0.532   -0.672  5.036   1.00 0.12  ? 113 MET A C    2  
ATOM 4022  O O    . MET A 1 113 ? -0.471  -0.019  4.772   1.00 0.14  ? 113 MET A O    2  
ATOM 4023  C CB   . MET A 1 113 ? 0.122   -1.089  7.460   1.00 0.16  ? 113 MET A CB   2  
ATOM 4024  C CG   . MET A 1 113 ? -0.700  -2.292  7.011   1.00 0.25  ? 113 MET A CG   2  
ATOM 4025  S SD   . MET A 1 113 ? -1.879  -2.844  8.258   1.00 0.53  ? 113 MET A SD   2  
ATOM 4026  C CE   . MET A 1 113 ? -0.796  -3.743  9.361   1.00 1.32  ? 113 MET A CE   2  
ATOM 4027  H H    . MET A 1 113 ? 0.872   1.409   6.909   1.00 0.13  ? 113 MET A H    2  
ATOM 4028  H HA   . MET A 1 113 ? 2.020   -1.256  6.450   1.00 0.13  ? 113 MET A HA   2  
ATOM 4029  H HB2  . MET A 1 113 ? 0.650   -1.357  8.365   1.00 0.19  ? 113 MET A HB2  2  
ATOM 4030  H HB3  . MET A 1 113 ? -0.554  -0.277  7.676   1.00 0.18  ? 113 MET A HB3  2  
ATOM 4031  H HG2  . MET A 1 113 ? -1.248  -2.027  6.118   1.00 0.27  ? 113 MET A HG2  2  
ATOM 4032  H HG3  . MET A 1 113 ? -0.026  -3.107  6.787   1.00 0.25  ? 113 MET A HG3  2  
ATOM 4033  H HE1  . MET A 1 113 ? -0.302  -4.533  8.813   1.00 1.94  ? 113 MET A HE1  2  
ATOM 4034  H HE2  . MET A 1 113 ? -1.376  -4.173  10.164  1.00 1.89  ? 113 MET A HE2  2  
ATOM 4035  H HE3  . MET A 1 113 ? -0.055  -3.071  9.767   1.00 1.90  ? 113 MET A HE3  2  
ATOM 4036  N N    . VAL A 1 114 ? 1.146   -1.416  4.154   1.00 0.12  ? 114 VAL A N    2  
ATOM 4037  C CA   . VAL A 1 114 ? 0.698   -1.468  2.786   1.00 0.12  ? 114 VAL A CA   2  
ATOM 4038  C C    . VAL A 1 114 ? 0.182   -2.841  2.467   1.00 0.13  ? 114 VAL A C    2  
ATOM 4039  O O    . VAL A 1 114 ? 0.851   -3.842  2.723   1.00 0.16  ? 114 VAL A O    2  
ATOM 4040  C CB   . VAL A 1 114 ? 1.839   -1.137  1.812   1.00 0.15  ? 114 VAL A CB   2  
ATOM 4041  C CG1  . VAL A 1 114 ? 1.326   -0.838  0.410   1.00 0.18  ? 114 VAL A CG1  2  
ATOM 4042  C CG2  . VAL A 1 114 ? 2.663   0.008   2.349   1.00 0.17  ? 114 VAL A CG2  2  
ATOM 4043  H H    . VAL A 1 114 ? 1.933   -1.945  4.424   1.00 0.12  ? 114 VAL A H    2  
ATOM 4044  H HA   . VAL A 1 114 ? -0.097  -0.747  2.659   1.00 0.13  ? 114 VAL A HA   2  
ATOM 4045  H HB   . VAL A 1 114 ? 2.470   -2.001  1.749   1.00 0.16  ? 114 VAL A HB   2  
ATOM 4046  H HG11 . VAL A 1 114 ? 0.742   -1.674  0.053   1.00 1.06  ? 114 VAL A HG11 2  
ATOM 4047  H HG12 . VAL A 1 114 ? 2.164   -0.676  -0.251  1.00 1.03  ? 114 VAL A HG12 2  
ATOM 4048  H HG13 . VAL A 1 114 ? 0.709   0.051   0.434   1.00 1.01  ? 114 VAL A HG13 2  
ATOM 4049  H HG21 . VAL A 1 114 ? 2.035   0.880   2.444   1.00 0.97  ? 114 VAL A HG21 2  
ATOM 4050  H HG22 . VAL A 1 114 ? 3.476   0.216   1.674   1.00 0.98  ? 114 VAL A HG22 2  
ATOM 4051  H HG23 . VAL A 1 114 ? 3.053   -0.263  3.318   1.00 0.95  ? 114 VAL A HG23 2  
ATOM 4052  N N    . THR A 1 115 ? -1.002  -2.895  1.926   1.00 0.14  ? 115 THR A N    2  
ATOM 4053  C CA   . THR A 1 115 ? -1.512  -4.136  1.454   1.00 0.14  ? 115 THR A CA   2  
ATOM 4054  C C    . THR A 1 115 ? -1.429  -4.137  -0.046  1.00 0.13  ? 115 THR A C    2  
ATOM 4055  O O    . THR A 1 115 ? -2.071  -3.338  -0.729  1.00 0.16  ? 115 THR A O    2  
ATOM 4056  C CB   . THR A 1 115 ? -2.947  -4.416  1.912   1.00 0.17  ? 115 THR A CB   2  
ATOM 4057  O OG1  . THR A 1 115 ? -3.018  -4.365  3.336   1.00 0.21  ? 115 THR A OG1  2  
ATOM 4058  C CG2  . THR A 1 115 ? -3.374  -5.790  1.455   1.00 0.20  ? 115 THR A CG2  2  
ATOM 4059  H H    . THR A 1 115 ? -1.525  -2.073  1.804   1.00 0.16  ? 115 THR A H    2  
ATOM 4060  H HA   . THR A 1 115 ? -0.872  -4.921  1.835   1.00 0.15  ? 115 THR A HA   2  
ATOM 4061  H HB   . THR A 1 115 ? -3.611  -3.680  1.486   1.00 0.18  ? 115 THR A HB   2  
ATOM 4062  H HG1  . THR A 1 115 ? -2.138  -4.490  3.703   1.00 0.68  ? 115 THR A HG1  2  
ATOM 4063  H HG21 . THR A 1 115 ? -4.414  -5.936  1.690   1.00 1.03  ? 115 THR A HG21 2  
ATOM 4064  H HG22 . THR A 1 115 ? -2.777  -6.528  1.968   1.00 1.00  ? 115 THR A HG22 2  
ATOM 4065  H HG23 . THR A 1 115 ? -3.221  -5.875  0.390   1.00 1.02  ? 115 THR A HG23 2  
ATOM 4066  N N    . ALA A 1 116 ? -0.592  -5.007  -0.529  1.00 0.12  ? 116 ALA A N    2  
ATOM 4067  C CA   . ALA A 1 116 ? -0.356  -5.155  -1.939  1.00 0.13  ? 116 ALA A CA   2  
ATOM 4068  C C    . ALA A 1 116 ? -0.673  -6.565  -2.335  1.00 0.12  ? 116 ALA A C    2  
ATOM 4069  O O    . ALA A 1 116 ? -0.424  -7.498  -1.571  1.00 0.13  ? 116 ALA A O    2  
ATOM 4070  C CB   . ALA A 1 116 ? 1.082   -4.830  -2.268  1.00 0.15  ? 116 ALA A CB   2  
ATOM 4071  H H    . ALA A 1 116 ? -0.115  -5.598  0.101   1.00 0.13  ? 116 ALA A H    2  
ATOM 4072  H HA   . ALA A 1 116 ? -0.994  -4.475  -2.486  1.00 0.14  ? 116 ALA A HA   2  
ATOM 4073  H HB1  . ALA A 1 116 ? 1.291   -3.808  -1.989  1.00 1.01  ? 116 ALA A HB1  2  
ATOM 4074  H HB2  . ALA A 1 116 ? 1.247   -4.956  -3.327  1.00 0.97  ? 116 ALA A HB2  2  
ATOM 4075  H HB3  . ALA A 1 116 ? 1.735   -5.492  -1.720  1.00 0.99  ? 116 ALA A HB3  2  
ATOM 4076  N N    . ASP A 1 117 ? -1.255  -6.726  -3.499  1.00 0.13  ? 117 ASP A N    2  
ATOM 4077  C CA   . ASP A 1 117 ? -1.499  -8.053  -4.012  1.00 0.13  ? 117 ASP A CA   2  
ATOM 4078  C C    . ASP A 1 117 ? -0.187  -8.810  -4.109  1.00 0.11  ? 117 ASP A C    2  
ATOM 4079  O O    . ASP A 1 117 ? 0.881   -8.214  -4.231  1.00 0.12  ? 117 ASP A O    2  
ATOM 4080  C CB   . ASP A 1 117 ? -2.136  -8.008  -5.397  1.00 0.16  ? 117 ASP A CB   2  
ATOM 4081  C CG   . ASP A 1 117 ? -2.866  -9.289  -5.750  1.00 0.20  ? 117 ASP A CG   2  
ATOM 4082  O OD1  . ASP A 1 117 ? -2.193  -10.301 -6.049  1.00 0.50  ? 117 ASP A OD1  2  
ATOM 4083  O OD2  . ASP A 1 117 ? -4.110  -9.283  -5.760  1.00 0.58  ? 117 ASP A OD2  2  
ATOM 4084  H H    . ASP A 1 117 ? -1.546  -5.937  -4.009  1.00 0.15  ? 117 ASP A H    2  
ATOM 4085  H HA   . ASP A 1 117 ? -2.150  -8.568  -3.328  1.00 0.14  ? 117 ASP A HA   2  
ATOM 4086  H HB2  . ASP A 1 117 ? -2.824  -7.184  -5.463  1.00 0.20  ? 117 ASP A HB2  2  
ATOM 4087  H HB3  . ASP A 1 117 ? -1.356  -7.865  -6.117  1.00 0.16  ? 117 ASP A HB3  2  
ATOM 4088  N N    . SER A 1 118 ? -0.298  -10.116 -4.086  1.00 0.13  ? 118 SER A N    2  
ATOM 4089  C CA   . SER A 1 118 ? 0.817   -11.017 -4.266  1.00 0.16  ? 118 SER A CA   2  
ATOM 4090  C C    . SER A 1 118 ? 1.656   -10.603 -5.466  1.00 0.13  ? 118 SER A C    2  
ATOM 4091  O O    . SER A 1 118 ? 2.876   -10.585 -5.424  1.00 0.15  ? 118 SER A O    2  
ATOM 4092  C CB   . SER A 1 118 ? 0.223   -12.382 -4.541  1.00 0.27  ? 118 SER A CB   2  
ATOM 4093  O OG   . SER A 1 118 ? -0.620  -12.319 -5.678  1.00 0.82  ? 118 SER A OG   2  
ATOM 4094  H H    . SER A 1 118 ? -1.177  -10.502 -3.921  1.00 0.16  ? 118 SER A H    2  
ATOM 4095  H HA   . SER A 1 118 ? 1.414   -11.044 -3.368  1.00 0.20  ? 118 SER A HA   2  
ATOM 4096  H HB2  . SER A 1 118 ? 0.998   -13.092 -4.738  1.00 0.43  ? 118 SER A HB2  2  
ATOM 4097  H HB3  . SER A 1 118 ? -0.363  -12.703 -3.692  1.00 0.38  ? 118 SER A HB3  2  
ATOM 4098  H HG   . SER A 1 118 ? -1.212  -11.546 -5.609  1.00 1.04  ? 118 SER A HG   2  
ATOM 4099  N N    . LYS A 1 119 ? 0.970   -10.260 -6.526  1.00 0.13  ? 119 LYS A N    2  
ATOM 4100  C CA   . LYS A 1 119 ? 1.588   -9.882  -7.777  1.00 0.14  ? 119 LYS A CA   2  
ATOM 4101  C C    . LYS A 1 119 ? 2.504   -8.660  -7.621  1.00 0.14  ? 119 LYS A C    2  
ATOM 4102  O O    . LYS A 1 119 ? 3.488   -8.526  -8.345  1.00 0.18  ? 119 LYS A O    2  
ATOM 4103  C CB   . LYS A 1 119 ? 0.475   -9.621  -8.778  1.00 0.17  ? 119 LYS A CB   2  
ATOM 4104  C CG   . LYS A 1 119 ? -0.570  -8.674  -8.247  1.00 0.19  ? 119 LYS A CG   2  
ATOM 4105  C CD   . LYS A 1 119 ? -1.690  -8.456  -9.241  1.00 0.29  ? 119 LYS A CD   2  
ATOM 4106  C CE   . LYS A 1 119 ? -2.670  -9.614  -9.234  1.00 0.38  ? 119 LYS A CE   2  
ATOM 4107  N NZ   . LYS A 1 119 ? -3.644  -9.506  -10.352 1.00 0.81  ? 119 LYS A NZ   2  
ATOM 4108  H H    . LYS A 1 119 ? -0.007  -10.267 -6.470  1.00 0.13  ? 119 LYS A H    2  
ATOM 4109  H HA   . LYS A 1 119 ? 2.178   -10.716 -8.126  1.00 0.17  ? 119 LYS A HA   2  
ATOM 4110  H HB2  . LYS A 1 119 ? 0.893   -9.182  -9.666  1.00 0.19  ? 119 LYS A HB2  2  
ATOM 4111  H HB3  . LYS A 1 119 ? -0.005  -10.566 -9.022  1.00 0.21  ? 119 LYS A HB3  2  
ATOM 4112  H HG2  . LYS A 1 119 ? -0.986  -9.086  -7.337  1.00 0.18  ? 119 LYS A HG2  2  
ATOM 4113  H HG3  . LYS A 1 119 ? -0.099  -7.730  -8.029  1.00 0.20  ? 119 LYS A HG3  2  
ATOM 4114  H HD2  . LYS A 1 119 ? -2.218  -7.549  -8.985  1.00 0.33  ? 119 LYS A HD2  2  
ATOM 4115  H HD3  . LYS A 1 119 ? -1.267  -8.360  -10.230 1.00 0.34  ? 119 LYS A HD3  2  
ATOM 4116  H HE2  . LYS A 1 119 ? -2.120  -10.543 -9.323  1.00 0.57  ? 119 LYS A HE2  2  
ATOM 4117  H HE3  . LYS A 1 119 ? -3.209  -9.606  -8.297  1.00 0.72  ? 119 LYS A HE3  2  
ATOM 4118  H HZ1  . LYS A 1 119 ? -3.165  -9.687  -11.260 1.00 1.31  ? 119 LYS A HZ1  2  
ATOM 4119  H HZ2  . LYS A 1 119 ? -4.053  -8.548  -10.378 1.00 1.31  ? 119 LYS A HZ2  2  
ATOM 4120  H HZ3  . LYS A 1 119 ? -4.414  -10.199 -10.231 1.00 1.43  ? 119 LYS A HZ3  2  
ATOM 4121  N N    . TYR A 1 120 ? 2.200   -7.781  -6.661  1.00 0.13  ? 120 TYR A N    2  
ATOM 4122  C CA   . TYR A 1 120 ? 3.051   -6.621  -6.405  1.00 0.15  ? 120 TYR A CA   2  
ATOM 4123  C C    . TYR A 1 120 ? 4.028   -6.936  -5.297  1.00 0.15  ? 120 TYR A C    2  
ATOM 4124  O O    . TYR A 1 120 ? 4.823   -6.090  -4.883  1.00 0.19  ? 120 TYR A O    2  
ATOM 4125  C CB   . TYR A 1 120 ? 2.214   -5.398  -6.029  1.00 0.16  ? 120 TYR A CB   2  
ATOM 4126  C CG   . TYR A 1 120 ? 1.261   -4.980  -7.104  1.00 0.20  ? 120 TYR A CG   2  
ATOM 4127  C CD1  . TYR A 1 120 ? -0.010  -5.517  -7.158  1.00 0.23  ? 120 TYR A CD1  2  
ATOM 4128  C CD2  . TYR A 1 120 ? 1.639   -4.065  -8.070  1.00 0.28  ? 120 TYR A CD2  2  
ATOM 4129  C CE1  . TYR A 1 120 ? -0.893  -5.161  -8.152  1.00 0.30  ? 120 TYR A CE1  2  
ATOM 4130  C CE2  . TYR A 1 120 ? 0.768   -3.700  -9.076  1.00 0.34  ? 120 TYR A CE2  2  
ATOM 4131  C CZ   . TYR A 1 120 ? -0.498  -4.249  -9.111  1.00 0.34  ? 120 TYR A CZ   2  
ATOM 4132  O OH   . TYR A 1 120 ? -1.366  -3.897  -10.118 1.00 0.42  ? 120 TYR A OH   2  
ATOM 4133  H H    . TYR A 1 120 ? 1.400   -7.922  -6.103  1.00 0.12  ? 120 TYR A H    2  
ATOM 4134  H HA   . TYR A 1 120 ? 3.604   -6.414  -7.305  1.00 0.17  ? 120 TYR A HA   2  
ATOM 4135  H HB2  . TYR A 1 120 ? 1.634   -5.621  -5.146  1.00 0.16  ? 120 TYR A HB2  2  
ATOM 4136  H HB3  . TYR A 1 120 ? 2.872   -4.567  -5.826  1.00 0.18  ? 120 TYR A HB3  2  
ATOM 4137  H HD1  . TYR A 1 120 ? -0.306  -6.226  -6.405  1.00 0.25  ? 120 TYR A HD1  2  
ATOM 4138  H HD2  . TYR A 1 120 ? 2.636   -3.640  -8.028  1.00 0.32  ? 120 TYR A HD2  2  
ATOM 4139  H HE1  . TYR A 1 120 ? -1.885  -5.599  -8.174  1.00 0.35  ? 120 TYR A HE1  2  
ATOM 4140  H HE2  . TYR A 1 120 ? 1.075   -2.986  -9.824  1.00 0.41  ? 120 TYR A HE2  2  
ATOM 4141  H HH   . TYR A 1 120 ? -0.886  -3.856  -10.949 1.00 1.04  ? 120 TYR A HH   2  
ATOM 4142  N N    . CYS A 1 121 ? 3.958   -8.167  -4.838  1.00 0.14  ? 121 CYS A N    2  
ATOM 4143  C CA   . CYS A 1 121 ? 4.786   -8.639  -3.756  1.00 0.15  ? 121 CYS A CA   2  
ATOM 4144  C C    . CYS A 1 121 ? 5.596   -9.853  -4.201  1.00 0.16  ? 121 CYS A C    2  
ATOM 4145  O O    . CYS A 1 121 ? 6.678   -9.695  -4.757  1.00 0.18  ? 121 CYS A O    2  
ATOM 4146  C CB   . CYS A 1 121 ? 3.910   -8.960  -2.555  1.00 0.14  ? 121 CYS A CB   2  
ATOM 4147  S SG   . CYS A 1 121 ? 3.122   -7.506  -1.826  1.00 0.16  ? 121 CYS A SG   2  
ATOM 4148  H H    . CYS A 1 121 ? 3.320   -8.790  -5.254  1.00 0.14  ? 121 CYS A H    2  
ATOM 4149  H HA   . CYS A 1 121 ? 5.467   -7.841  -3.492  1.00 0.16  ? 121 CYS A HA   2  
ATOM 4150  H HB2  . CYS A 1 121 ? 3.128   -9.634  -2.867  1.00 0.14  ? 121 CYS A HB2  2  
ATOM 4151  H HB3  . CYS A 1 121 ? 4.502   -9.437  -1.791  1.00 0.15  ? 121 CYS A HB3  2  
ATOM 4152  H HG   . CYS A 1 121 ? 4.076   -6.713  -1.362  1.00 0.87  ? 121 CYS A HG   2  
ATOM 4153  N N    . TYR A 1 122 ? 5.078   -11.067 -3.984  1.00 0.16  ? 122 TYR A N    2  
ATOM 4154  C CA   . TYR A 1 122 ? 5.777   -12.266 -4.423  1.00 0.18  ? 122 TYR A CA   2  
ATOM 4155  C C    . TYR A 1 122 ? 4.806   -13.375 -4.826  1.00 0.18  ? 122 TYR A C    2  
ATOM 4156  O O    . TYR A 1 122 ? 5.086   -14.531 -4.561  1.00 0.20  ? 122 TYR A O    2  
ATOM 4157  C CB   . TYR A 1 122 ? 6.691   -12.816 -3.318  1.00 0.19  ? 122 TYR A CB   2  
ATOM 4158  C CG   . TYR A 1 122 ? 7.428   -11.775 -2.500  1.00 0.20  ? 122 TYR A CG   2  
ATOM 4159  C CD1  . TYR A 1 122 ? 8.683   -11.325 -2.883  1.00 0.21  ? 122 TYR A CD1  2  
ATOM 4160  C CD2  . TYR A 1 122 ? 6.873   -11.256 -1.337  1.00 0.19  ? 122 TYR A CD2  2  
ATOM 4161  C CE1  . TYR A 1 122 ? 9.365   -10.386 -2.132  1.00 0.23  ? 122 TYR A CE1  2  
ATOM 4162  C CE2  . TYR A 1 122 ? 7.545   -10.320 -0.582  1.00 0.20  ? 122 TYR A CE2  2  
ATOM 4163  C CZ   . TYR A 1 122 ? 8.794   -9.885  -0.982  1.00 0.22  ? 122 TYR A CZ   2  
ATOM 4164  O OH   . TYR A 1 122 ? 9.473   -8.951  -0.232  1.00 0.24  ? 122 TYR A OH   2  
ATOM 4165  H H    . TYR A 1 122 ? 4.223   -11.156 -3.520  1.00 0.15  ? 122 TYR A H    2  
ATOM 4166  H HA   . TYR A 1 122 ? 6.384   -12.005 -5.280  1.00 0.19  ? 122 TYR A HA   2  
ATOM 4167  H HB2  . TYR A 1 122 ? 6.110   -13.427 -2.644  1.00 0.20  ? 122 TYR A HB2  2  
ATOM 4168  H HB3  . TYR A 1 122 ? 7.439   -13.443 -3.786  1.00 0.22  ? 122 TYR A HB3  2  
ATOM 4169  H HD1  . TYR A 1 122 ? 9.130   -11.716 -3.785  1.00 0.23  ? 122 TYR A HD1  2  
ATOM 4170  H HD2  . TYR A 1 122 ? 5.896   -11.598 -1.020  1.00 0.19  ? 122 TYR A HD2  2  
ATOM 4171  H HE1  . TYR A 1 122 ? 10.339  -10.053 -2.447  1.00 0.25  ? 122 TYR A HE1  2  
ATOM 4172  H HE2  . TYR A 1 122 ? 7.092   -9.932  0.317   1.00 0.21  ? 122 TYR A HE2  2  
ATOM 4173  H HH   . TYR A 1 122 ? 9.388   -9.164  0.706   1.00 0.96  ? 122 TYR A HH   2  
ATOM 4174  N N    . GLY A 1 123 ? 3.678   -13.040 -5.466  1.00 0.19  ? 123 GLY A N    2  
ATOM 4175  C CA   . GLY A 1 123 ? 2.749   -14.068 -5.920  1.00 0.21  ? 123 GLY A CA   2  
ATOM 4176  C C    . GLY A 1 123 ? 3.417   -15.141 -6.765  1.00 0.21  ? 123 GLY A C    2  
ATOM 4177  O O    . GLY A 1 123 ? 3.788   -16.186 -6.250  1.00 0.25  ? 123 GLY A O    2  
ATOM 4178  H H    . GLY A 1 123 ? 3.449   -12.086 -5.607  1.00 0.20  ? 123 GLY A H    2  
ATOM 4179  H HA2  . GLY A 1 123 ? 2.299   -14.536 -5.056  1.00 0.24  ? 123 GLY A HA2  2  
ATOM 4180  H HA3  . GLY A 1 123 ? 1.969   -13.600 -6.506  1.00 0.25  ? 123 GLY A HA3  2  
ATOM 4181  N N    . PRO A 1 124 ? 3.599   -14.914 -8.068  1.00 0.25  ? 124 PRO A N    2  
ATOM 4182  C CA   . PRO A 1 124 ? 4.284   -15.865 -8.945  1.00 0.30  ? 124 PRO A CA   2  
ATOM 4183  C C    . PRO A 1 124 ? 5.800   -15.770 -8.805  1.00 0.30  ? 124 PRO A C    2  
ATOM 4184  O O    . PRO A 1 124 ? 6.550   -16.388 -9.559  1.00 0.34  ? 124 PRO A O    2  
ATOM 4185  C CB   . PRO A 1 124 ? 3.855   -15.433 -10.357 1.00 0.37  ? 124 PRO A CB   2  
ATOM 4186  C CG   . PRO A 1 124 ? 2.905   -14.287 -10.177 1.00 0.58  ? 124 PRO A CG   2  
ATOM 4187  C CD   . PRO A 1 124 ? 3.153   -13.734 -8.807  1.00 0.32  ? 124 PRO A CD   2  
ATOM 4188  H HA   . PRO A 1 124 ? 3.966   -16.879 -8.759  1.00 0.33  ? 124 PRO A HA   2  
ATOM 4189  H HB2  . PRO A 1 124 ? 4.730   -15.134 -10.917 1.00 0.46  ? 124 PRO A HB2  2  
ATOM 4190  H HB3  . PRO A 1 124 ? 3.376   -16.264 -10.853 1.00 0.45  ? 124 PRO A HB3  2  
ATOM 4191  H HG2  . PRO A 1 124 ? 3.100   -13.530 -10.923 1.00 0.90  ? 124 PRO A HG2  2  
ATOM 4192  H HG3  . PRO A 1 124 ? 1.887   -14.638 -10.259 1.00 0.87  ? 124 PRO A HG3  2  
ATOM 4193  H HD2  . PRO A 1 124 ? 3.926   -12.979 -8.836  1.00 0.40  ? 124 PRO A HD2  2  
ATOM 4194  H HD3  . PRO A 1 124 ? 2.244   -13.332 -8.385  1.00 0.38  ? 124 PRO A HD3  2  
ATOM 4195  N N    . GLN A 1 125 ? 6.241   -14.981 -7.833  1.00 0.27  ? 125 GLN A N    2  
ATOM 4196  C CA   . GLN A 1 125 ? 7.649   -14.693 -7.654  1.00 0.30  ? 125 GLN A CA   2  
ATOM 4197  C C    . GLN A 1 125 ? 8.211   -15.476 -6.481  1.00 0.32  ? 125 GLN A C    2  
ATOM 4198  O O    . GLN A 1 125 ? 9.269   -16.095 -6.575  1.00 0.39  ? 125 GLN A O    2  
ATOM 4199  C CB   . GLN A 1 125 ? 7.827   -13.199 -7.403  1.00 0.30  ? 125 GLN A CB   2  
ATOM 4200  C CG   . GLN A 1 125 ? 7.124   -12.336 -8.434  1.00 0.33  ? 125 GLN A CG   2  
ATOM 4201  C CD   . GLN A 1 125 ? 7.159   -10.870 -8.073  1.00 0.35  ? 125 GLN A CD   2  
ATOM 4202  O OE1  . GLN A 1 125 ? 8.096   -10.156 -8.425  1.00 0.65  ? 125 GLN A OE1  2  
ATOM 4203  N NE2  . GLN A 1 125 ? 6.125   -10.411 -7.387  1.00 0.29  ? 125 GLN A NE2  2  
ATOM 4204  H H    . GLN A 1 125 ? 5.596   -14.613 -7.193  1.00 0.24  ? 125 GLN A H    2  
ATOM 4205  H HA   . GLN A 1 125 ? 8.173   -14.969 -8.555  1.00 0.34  ? 125 GLN A HA   2  
ATOM 4206  H HB2  . GLN A 1 125 ? 7.430   -12.956 -6.427  1.00 0.33  ? 125 GLN A HB2  2  
ATOM 4207  H HB3  . GLN A 1 125 ? 8.883   -12.961 -7.424  1.00 0.36  ? 125 GLN A HB3  2  
ATOM 4208  H HG2  . GLN A 1 125 ? 7.602   -12.474 -9.386  1.00 0.39  ? 125 GLN A HG2  2  
ATOM 4209  H HG3  . GLN A 1 125 ? 6.092   -12.651 -8.500  1.00 0.38  ? 125 GLN A HG3  2  
ATOM 4210  H HE21 . GLN A 1 125 ? 5.407   -11.034 -7.161  1.00 0.45  ? 125 GLN A HE21 2  
ATOM 4211  H HE22 . GLN A 1 125 ? 6.132   -9.472  -7.110  1.00 0.29  ? 125 GLN A HE22 2  
ATOM 4212  N N    . GLY A 1 126 ? 7.478   -15.436 -5.381  1.00 0.27  ? 126 GLY A N    2  
ATOM 4213  C CA   . GLY A 1 126 ? 7.936   -16.014 -4.146  1.00 0.27  ? 126 GLY A CA   2  
ATOM 4214  C C    . GLY A 1 126 ? 8.890   -15.109 -3.413  1.00 0.28  ? 126 GLY A C    2  
ATOM 4215  O O    . GLY A 1 126 ? 9.713   -14.417 -4.019  1.00 0.30  ? 126 GLY A O    2  
ATOM 4216  H H    . GLY A 1 126 ? 6.595   -15.012 -5.409  1.00 0.24  ? 126 GLY A H    2  
ATOM 4217  H HA2  . GLY A 1 126 ? 7.076   -16.182 -3.511  1.00 0.25  ? 126 GLY A HA2  2  
ATOM 4218  H HA3  . GLY A 1 126 ? 8.417   -16.955 -4.344  1.00 0.30  ? 126 GLY A HA3  2  
ATOM 4219  N N    . SER A 1 127 ? 8.763   -15.102 -2.105  1.00 0.27  ? 127 SER A N    2  
ATOM 4220  C CA   . SER A 1 127 ? 9.516   -14.196 -1.270  1.00 0.28  ? 127 SER A CA   2  
ATOM 4221  C C    . SER A 1 127 ? 10.835  -14.798 -0.793  1.00 0.32  ? 127 SER A C    2  
ATOM 4222  O O    . SER A 1 127 ? 11.021  -16.015 -0.797  1.00 0.33  ? 127 SER A O    2  
ATOM 4223  C CB   . SER A 1 127 ? 8.641   -13.755 -0.086  1.00 0.27  ? 127 SER A CB   2  
ATOM 4224  O OG   . SER A 1 127 ? 9.395   -13.143 0.944   1.00 0.30  ? 127 SER A OG   2  
ATOM 4225  H H    . SER A 1 127 ? 8.108   -15.689 -1.696  1.00 0.26  ? 127 SER A H    2  
ATOM 4226  H HA   . SER A 1 127 ? 9.741   -13.344 -1.865  1.00 0.29  ? 127 SER A HA   2  
ATOM 4227  H HB2  . SER A 1 127 ? 7.901   -13.050 -0.429  1.00 0.25  ? 127 SER A HB2  2  
ATOM 4228  H HB3  . SER A 1 127 ? 8.124   -14.617 0.317   1.00 0.27  ? 127 SER A HB3  2  
ATOM 4229  H HG   . SER A 1 127 ? 9.437   -13.732 1.701   1.00 0.90  ? 127 SER A HG   2  
ATOM 4230  N N    . ARG A 1 128 ? 11.742  -13.902 -0.402  1.00 0.38  ? 128 ARG A N    2  
ATOM 4231  C CA   . ARG A 1 128 ? 13.097  -14.248 0.019   1.00 0.42  ? 128 ARG A CA   2  
ATOM 4232  C C    . ARG A 1 128 ? 13.113  -15.380 1.044   1.00 0.42  ? 128 ARG A C    2  
ATOM 4233  O O    . ARG A 1 128 ? 13.797  -16.385 0.852   1.00 0.52  ? 128 ARG A O    2  
ATOM 4234  C CB   . ARG A 1 128 ? 13.786  -13.001 0.591   1.00 0.52  ? 128 ARG A CB   2  
ATOM 4235  C CG   . ARG A 1 128 ? 12.976  -12.296 1.672   1.00 1.12  ? 128 ARG A CG   2  
ATOM 4236  C CD   . ARG A 1 128 ? 13.749  -11.153 2.304   1.00 1.41  ? 128 ARG A CD   2  
ATOM 4237  N NE   . ARG A 1 128 ? 13.998  -10.063 1.367   1.00 1.81  ? 128 ARG A NE   2  
ATOM 4238  C CZ   . ARG A 1 128 ? 14.459  -8.871  1.733   1.00 2.33  ? 128 ARG A CZ   2  
ATOM 4239  N NH1  . ARG A 1 128 ? 14.761  -8.641  3.006   1.00 2.45  ? 128 ARG A NH1  2  
ATOM 4240  N NH2  . ARG A 1 128 ? 14.638  -7.917  0.826   1.00 3.17  ? 128 ARG A NH2  2  
ATOM 4241  H H    . ARG A 1 128 ? 11.482  -12.959 -0.396  1.00 0.44  ? 128 ARG A H    2  
ATOM 4242  H HA   . ARG A 1 128 ? 13.643  -14.570 -0.856  1.00 0.43  ? 128 ARG A HA   2  
ATOM 4243  H HB2  . ARG A 1 128 ? 14.736  -13.288 1.015   1.00 0.97  ? 128 ARG A HB2  2  
ATOM 4244  H HB3  . ARG A 1 128 ? 13.959  -12.301 -0.212  1.00 1.07  ? 128 ARG A HB3  2  
ATOM 4245  H HG2  . ARG A 1 128 ? 12.073  -11.902 1.230   1.00 1.62  ? 128 ARG A HG2  2  
ATOM 4246  H HG3  . ARG A 1 128 ? 12.718  -13.012 2.439   1.00 1.72  ? 128 ARG A HG3  2  
ATOM 4247  H HD2  . ARG A 1 128 ? 13.181  -10.773 3.141   1.00 1.89  ? 128 ARG A HD2  2  
ATOM 4248  H HD3  . ARG A 1 128 ? 14.698  -11.531 2.659   1.00 1.87  ? 128 ARG A HD3  2  
ATOM 4249  H HE   . ARG A 1 128 ? 13.803  -10.226 0.420   1.00 2.16  ? 128 ARG A HE   2  
ATOM 4250  H HH11 . ARG A 1 128 ? 14.652  -9.366  3.694   1.00 2.38  ? 128 ARG A HH11 2  
ATOM 4251  H HH12 . ARG A 1 128 ? 15.096  -7.724  3.297   1.00 2.95  ? 128 ARG A HH12 2  
ATOM 4252  H HH21 . ARG A 1 128 ? 14.423  -8.087  -0.135  1.00 3.53  ? 128 ARG A HH21 2  
ATOM 4253  H HH22 . ARG A 1 128 ? 15.002  -7.024  1.106   1.00 3.61  ? 128 ARG A HH22 2  
ATOM 4254  N N    . SER A 1 129 ? 12.370  -15.215 2.125   1.00 0.42  ? 129 SER A N    2  
ATOM 4255  C CA   . SER A 1 129 ? 12.295  -16.239 3.142   1.00 0.44  ? 129 SER A CA   2  
ATOM 4256  C C    . SER A 1 129 ? 11.272  -17.309 2.732   1.00 0.41  ? 129 SER A C    2  
ATOM 4257  O O    . SER A 1 129 ? 11.648  -18.459 2.517   1.00 0.44  ? 129 SER A O    2  
ATOM 4258  C CB   . SER A 1 129 ? 11.966  -15.614 4.504   1.00 0.48  ? 129 SER A CB   2  
ATOM 4259  O OG   . SER A 1 129 ? 12.717  -14.427 4.706   1.00 1.23  ? 129 SER A OG   2  
ATOM 4260  H H    . SER A 1 129 ? 11.870  -14.387 2.243   1.00 0.48  ? 129 SER A H    2  
ATOM 4261  H HA   . SER A 1 129 ? 13.268  -16.705 3.200   1.00 0.46  ? 129 SER A HA   2  
ATOM 4262  H HB2  . SER A 1 129 ? 10.914  -15.373 4.540   1.00 0.81  ? 129 SER A HB2  2  
ATOM 4263  H HB3  . SER A 1 129 ? 12.205  -16.314 5.289   1.00 1.00  ? 129 SER A HB3  2  
ATOM 4264  H HG   . SER A 1 129 ? 13.629  -14.656 4.930   1.00 1.52  ? 129 SER A HG   2  
ATOM 4265  N N    . PRO A 1 130 ? 9.966   -16.978 2.604   1.00 0.37  ? 130 PRO A N    2  
ATOM 4266  C CA   . PRO A 1 130 ? 8.972   -17.907 2.104   1.00 0.36  ? 130 PRO A CA   2  
ATOM 4267  C C    . PRO A 1 130 ? 8.551   -17.588 0.675   1.00 0.32  ? 130 PRO A C    2  
ATOM 4268  O O    . PRO A 1 130 ? 8.165   -16.465 0.386   1.00 0.27  ? 130 PRO A O    2  
ATOM 4269  C CB   . PRO A 1 130 ? 7.782   -17.624 3.040   1.00 0.37  ? 130 PRO A CB   2  
ATOM 4270  C CG   . PRO A 1 130 ? 8.063   -16.283 3.668   1.00 0.37  ? 130 PRO A CG   2  
ATOM 4271  C CD   . PRO A 1 130 ? 9.296   -15.741 2.992   1.00 0.37  ? 130 PRO A CD   2  
ATOM 4272  H HA   . PRO A 1 130 ? 9.278   -18.937 2.190   1.00 0.40  ? 130 PRO A HA   2  
ATOM 4273  H HB2  . PRO A 1 130 ? 6.871   -17.597 2.460   1.00 0.35  ? 130 PRO A HB2  2  
ATOM 4274  H HB3  . PRO A 1 130 ? 7.706   -18.396 3.783   1.00 0.44  ? 130 PRO A HB3  2  
ATOM 4275  H HG2  . PRO A 1 130 ? 7.225   -15.620 3.505   1.00 0.37  ? 130 PRO A HG2  2  
ATOM 4276  H HG3  . PRO A 1 130 ? 8.242   -16.404 4.726   1.00 0.41  ? 130 PRO A HG3  2  
ATOM 4277  H HD2  . PRO A 1 130 ? 9.028   -15.154 2.124   1.00 0.35  ? 130 PRO A HD2  2  
ATOM 4278  H HD3  . PRO A 1 130 ? 9.888   -15.164 3.673   1.00 0.40  ? 130 PRO A HD3  2  
ATOM 4279  N N    . TYR A 1 131 ? 8.621   -18.557 -0.216  1.00 0.33  ? 131 TYR A N    2  
ATOM 4280  C CA   . TYR A 1 131 ? 7.923   -18.448 -1.484  1.00 0.32  ? 131 TYR A CA   2  
ATOM 4281  C C    . TYR A 1 131 ? 6.448   -18.192 -1.208  1.00 0.30  ? 131 TYR A C    2  
ATOM 4282  O O    . TYR A 1 131 ? 5.696   -19.108 -0.876  1.00 0.32  ? 131 TYR A O    2  
ATOM 4283  C CB   . TYR A 1 131 ? 8.116   -19.717 -2.323  1.00 0.36  ? 131 TYR A CB   2  
ATOM 4284  C CG   . TYR A 1 131 ? 7.098   -19.895 -3.436  1.00 0.45  ? 131 TYR A CG   2  
ATOM 4285  C CD1  . TYR A 1 131 ? 7.177   -19.130 -4.594  1.00 1.00  ? 131 TYR A CD1  2  
ATOM 4286  C CD2  . TYR A 1 131 ? 6.061   -20.814 -3.328  1.00 0.78  ? 131 TYR A CD2  2  
ATOM 4287  C CE1  . TYR A 1 131 ? 6.254   -19.278 -5.612  1.00 1.14  ? 131 TYR A CE1  2  
ATOM 4288  C CE2  . TYR A 1 131 ? 5.131   -20.964 -4.342  1.00 0.87  ? 131 TYR A CE2  2  
ATOM 4289  C CZ   . TYR A 1 131 ? 5.231   -20.247 -5.467  1.00 0.81  ? 131 TYR A CZ   2  
ATOM 4290  O OH   . TYR A 1 131 ? 4.302   -20.330 -6.479  1.00 1.00  ? 131 TYR A OH   2  
ATOM 4291  H H    . TYR A 1 131 ? 9.189   -19.322 -0.046  1.00 0.36  ? 131 TYR A H    2  
ATOM 4292  H HA   . TYR A 1 131 ? 8.332   -17.602 -2.018  1.00 0.31  ? 131 TYR A HA   2  
ATOM 4293  H HB2  . TYR A 1 131 ? 9.095   -19.687 -2.779  1.00 0.39  ? 131 TYR A HB2  2  
ATOM 4294  H HB3  . TYR A 1 131 ? 8.054   -20.579 -1.675  1.00 0.43  ? 131 TYR A HB3  2  
ATOM 4295  H HD1  . TYR A 1 131 ? 7.980   -18.416 -4.696  1.00 1.48  ? 131 TYR A HD1  2  
ATOM 4296  H HD2  . TYR A 1 131 ? 5.982   -21.416 -2.436  1.00 1.27  ? 131 TYR A HD2  2  
ATOM 4297  H HE1  . TYR A 1 131 ? 6.335   -18.676 -6.506  1.00 1.69  ? 131 TYR A HE1  2  
ATOM 4298  H HE2  . TYR A 1 131 ? 4.335   -21.687 -4.244  1.00 1.32  ? 131 TYR A HE2  2  
ATOM 4299  H HH   . TYR A 1 131 ? 3.417   -20.182 -6.110  1.00 1.33  ? 131 TYR A HH   2  
ATOM 4300  N N    . ILE A 1 132 ? 6.063   -16.926 -1.266  1.00 0.27  ? 132 ILE A N    2  
ATOM 4301  C CA   . ILE A 1 132 ? 4.688   -16.547 -1.030  1.00 0.26  ? 132 ILE A CA   2  
ATOM 4302  C C    . ILE A 1 132 ? 3.814   -17.097 -2.151  1.00 0.25  ? 132 ILE A C    2  
ATOM 4303  O O    . ILE A 1 132 ? 4.072   -16.829 -3.320  1.00 0.25  ? 132 ILE A O    2  
ATOM 4304  C CB   . ILE A 1 132 ? 4.527   -15.011 -0.950  1.00 0.25  ? 132 ILE A CB   2  
ATOM 4305  C CG1  . ILE A 1 132 ? 5.522   -14.378 0.020   1.00 0.39  ? 132 ILE A CG1  2  
ATOM 4306  C CG2  . ILE A 1 132 ? 3.116   -14.654 -0.535  1.00 0.26  ? 132 ILE A CG2  2  
ATOM 4307  C CD1  . ILE A 1 132 ? 5.531   -14.972 1.406   1.00 0.23  ? 132 ILE A CD1  2  
ATOM 4308  H H    . ILE A 1 132 ? 6.722   -16.230 -1.454  1.00 0.27  ? 132 ILE A H    2  
ATOM 4309  H HA   . ILE A 1 132 ? 4.375   -16.979 -0.093  1.00 0.27  ? 132 ILE A HA   2  
ATOM 4310  H HB   . ILE A 1 132 ? 4.713   -14.607 -1.931  1.00 0.23  ? 132 ILE A HB   2  
ATOM 4311  H HG12 . ILE A 1 132 ? 6.518   -14.481 -0.384  1.00 0.58  ? 132 ILE A HG12 2  
ATOM 4312  H HG13 . ILE A 1 132 ? 5.292   -13.325 0.120   1.00 0.64  ? 132 ILE A HG13 2  
ATOM 4313  H HG21 . ILE A 1 132 ? 2.418   -15.070 -1.243  1.00 1.06  ? 132 ILE A HG21 2  
ATOM 4314  H HG22 . ILE A 1 132 ? 3.012   -13.582 -0.507  1.00 1.06  ? 132 ILE A HG22 2  
ATOM 4315  H HG23 . ILE A 1 132 ? 2.923   -15.064 0.447   1.00 1.01  ? 132 ILE A HG23 2  
ATOM 4316  H HD11 . ILE A 1 132 ? 5.698   -16.036 1.343   1.00 0.99  ? 132 ILE A HD11 2  
ATOM 4317  H HD12 . ILE A 1 132 ? 4.585   -14.777 1.890   1.00 1.02  ? 132 ILE A HD12 2  
ATOM 4318  H HD13 . ILE A 1 132 ? 6.331   -14.515 1.972   1.00 1.05  ? 132 ILE A HD13 2  
ATOM 4319  N N    . PRO A 1 133 ? 2.798   -17.905 -1.811  1.00 0.27  ? 133 PRO A N    2  
ATOM 4320  C CA   . PRO A 1 133 ? 1.900   -18.493 -2.807  1.00 0.28  ? 133 PRO A CA   2  
ATOM 4321  C C    . PRO A 1 133 ? 1.241   -17.427 -3.683  1.00 0.26  ? 133 PRO A C    2  
ATOM 4322  O O    . PRO A 1 133 ? 0.828   -16.376 -3.183  1.00 0.26  ? 133 PRO A O    2  
ATOM 4323  C CB   . PRO A 1 133 ? 0.849   -19.218 -1.961  1.00 0.34  ? 133 PRO A CB   2  
ATOM 4324  C CG   . PRO A 1 133 ? 1.513   -19.467 -0.650  1.00 0.61  ? 133 PRO A CG   2  
ATOM 4325  C CD   . PRO A 1 133 ? 2.453   -18.314 -0.437  1.00 0.31  ? 133 PRO A CD   2  
ATOM 4326  H HA   . PRO A 1 133 ? 2.418   -19.202 -3.433  1.00 0.29  ? 133 PRO A HA   2  
ATOM 4327  H HB2  . PRO A 1 133 ? -0.021  -18.588 -1.849  1.00 0.49  ? 133 PRO A HB2  2  
ATOM 4328  H HB3  . PRO A 1 133 ? 0.570   -20.142 -2.443  1.00 0.43  ? 133 PRO A HB3  2  
ATOM 4329  H HG2  . PRO A 1 133 ? 0.772   -19.498 0.136   1.00 0.97  ? 133 PRO A HG2  2  
ATOM 4330  H HG3  . PRO A 1 133 ? 2.064   -20.398 -0.685  1.00 1.03  ? 133 PRO A HG3  2  
ATOM 4331  H HD2  . PRO A 1 133 ? 1.957   -17.514 0.094   1.00 0.37  ? 133 PRO A HD2  2  
ATOM 4332  H HD3  . PRO A 1 133 ? 3.331   -18.638 0.103   1.00 0.50  ? 133 PRO A HD3  2  
ATOM 4333  N N    . PRO A 1 134 ? 1.150   -17.671 -5.004  1.00 0.27  ? 134 PRO A N    2  
ATOM 4334  C CA   . PRO A 1 134 ? 0.562   -16.716 -5.936  1.00 0.25  ? 134 PRO A CA   2  
ATOM 4335  C C    . PRO A 1 134 ? -0.858  -16.328 -5.564  1.00 0.27  ? 134 PRO A C    2  
ATOM 4336  O O    . PRO A 1 134 ? -1.714  -17.177 -5.306  1.00 0.32  ? 134 PRO A O    2  
ATOM 4337  C CB   . PRO A 1 134 ? 0.594   -17.428 -7.285  1.00 0.29  ? 134 PRO A CB   2  
ATOM 4338  C CG   . PRO A 1 134 ? 1.656   -18.464 -7.138  1.00 0.52  ? 134 PRO A CG   2  
ATOM 4339  C CD   . PRO A 1 134 ? 1.625   -18.883 -5.691  1.00 0.33  ? 134 PRO A CD   2  
ATOM 4340  H HA   . PRO A 1 134 ? 1.160   -15.818 -5.996  1.00 0.23  ? 134 PRO A HA   2  
ATOM 4341  H HB2  . PRO A 1 134 ? -0.369  -17.875 -7.481  1.00 0.50  ? 134 PRO A HB2  2  
ATOM 4342  H HB3  . PRO A 1 134 ? 0.835   -16.709 -8.065  1.00 0.43  ? 134 PRO A HB3  2  
ATOM 4343  H HG2  . PRO A 1 134 ? 1.438   -19.309 -7.777  1.00 0.89  ? 134 PRO A HG2  2  
ATOM 4344  H HG3  . PRO A 1 134 ? 2.619   -18.041 -7.387  1.00 0.83  ? 134 PRO A HG3  2  
ATOM 4345  H HD2  . PRO A 1 134 ? 0.934   -19.699 -5.548  1.00 0.43  ? 134 PRO A HD2  2  
ATOM 4346  H HD3  . PRO A 1 134 ? 2.614   -19.159 -5.354  1.00 0.41  ? 134 PRO A HD3  2  
ATOM 4347  N N    . HIS A 1 135 ? -1.061  -15.027 -5.546  1.00 0.26  ? 135 HIS A N    2  
ATOM 4348  C CA   . HIS A 1 135 ? -2.325  -14.389 -5.196  1.00 0.31  ? 135 HIS A CA   2  
ATOM 4349  C C    . HIS A 1 135 ? -2.614  -14.428 -3.701  1.00 0.32  ? 135 HIS A C    2  
ATOM 4350  O O    . HIS A 1 135 ? -3.768  -14.316 -3.281  1.00 0.44  ? 135 HIS A O    2  
ATOM 4351  C CB   . HIS A 1 135 ? -3.511  -14.945 -5.984  1.00 0.41  ? 135 HIS A CB   2  
ATOM 4352  C CG   . HIS A 1 135 ? -3.672  -14.354 -7.352  1.00 0.87  ? 135 HIS A CG   2  
ATOM 4353  N ND1  . HIS A 1 135 ? -3.500  -15.073 -8.516  1.00 1.81  ? 135 HIS A ND1  2  
ATOM 4354  C CD2  . HIS A 1 135 ? -4.033  -13.105 -7.737  1.00 1.64  ? 135 HIS A CD2  2  
ATOM 4355  C CE1  . HIS A 1 135 ? -3.743  -14.294 -9.551  1.00 2.38  ? 135 HIS A CE1  2  
ATOM 4356  N NE2  . HIS A 1 135 ? -4.074  -13.094 -9.111  1.00 2.25  ? 135 HIS A NE2  2  
ATOM 4357  H H    . HIS A 1 135 ? -0.306  -14.443 -5.783  1.00 0.26  ? 135 HIS A H    2  
ATOM 4358  H HA   . HIS A 1 135 ? -2.187  -13.347 -5.466  1.00 0.31  ? 135 HIS A HA   2  
ATOM 4359  H HB2  . HIS A 1 135 ? -3.387  -16.010 -6.096  1.00 1.01  ? 135 HIS A HB2  2  
ATOM 4360  H HB3  . HIS A 1 135 ? -4.416  -14.748 -5.429  1.00 1.01  ? 135 HIS A HB3  2  
ATOM 4361  H HD1  . HIS A 1 135 ? -3.237  -16.016 -8.576  1.00 2.34  ? 135 HIS A HD1  2  
ATOM 4362  H HD2  . HIS A 1 135 ? -4.246  -12.272 -7.083  1.00 2.21  ? 135 HIS A HD2  2  
ATOM 4363  H HE1  . HIS A 1 135 ? -3.682  -14.589 -10.589 1.00 3.19  ? 135 HIS A HE1  2  
ATOM 4364  H HE2  . HIS A 1 135 ? -4.558  -12.421 -9.650  1.00 2.82  ? 135 HIS A HE2  2  
ATOM 4365  N N    . ALA A 1 136 ? -1.573  -14.551 -2.897  1.00 0.24  ? 136 ALA A N    2  
ATOM 4366  C CA   . ALA A 1 136 ? -1.705  -14.312 -1.476  1.00 0.24  ? 136 ALA A CA   2  
ATOM 4367  C C    . ALA A 1 136 ? -1.439  -12.843 -1.214  1.00 0.21  ? 136 ALA A C    2  
ATOM 4368  O O    . ALA A 1 136 ? -0.336  -12.356 -1.463  1.00 0.22  ? 136 ALA A O    2  
ATOM 4369  C CB   . ALA A 1 136 ? -0.748  -15.182 -0.684  1.00 0.26  ? 136 ALA A CB   2  
ATOM 4370  H H    . ALA A 1 136 ? -0.695  -14.797 -3.264  1.00 0.22  ? 136 ALA A H    2  
ATOM 4371  H HA   . ALA A 1 136 ? -2.719  -14.550 -1.181  1.00 0.28  ? 136 ALA A HA   2  
ATOM 4372  H HB1  . ALA A 1 136 ? -0.918  -15.038 0.374   1.00 0.98  ? 136 ALA A HB1  2  
ATOM 4373  H HB2  . ALA A 1 136 ? 0.269   -14.904 -0.926  1.00 1.04  ? 136 ALA A HB2  2  
ATOM 4374  H HB3  . ALA A 1 136 ? -0.909  -16.218 -0.940  1.00 1.04  ? 136 ALA A HB3  2  
ATOM 4375  N N    . ALA A 1 137 ? -2.444  -12.127 -0.736  1.00 0.18  ? 137 ALA A N    2  
ATOM 4376  C CA   . ALA A 1 137 ? -2.326  -10.691 -0.573  1.00 0.19  ? 137 ALA A CA   2  
ATOM 4377  C C    . ALA A 1 137 ? -1.415  -10.374 0.597   1.00 0.16  ? 137 ALA A C    2  
ATOM 4378  O O    . ALA A 1 137 ? -1.537  -10.961 1.673   1.00 0.20  ? 137 ALA A O    2  
ATOM 4379  C CB   . ALA A 1 137 ? -3.695  -10.050 -0.392  1.00 0.22  ? 137 ALA A CB   2  
ATOM 4380  H H    . ALA A 1 137 ? -3.281  -12.578 -0.476  1.00 0.18  ? 137 ALA A H    2  
ATOM 4381  H HA   . ALA A 1 137 ? -1.886  -10.295 -1.475  1.00 0.21  ? 137 ALA A HA   2  
ATOM 4382  H HB1  . ALA A 1 137 ? -4.137  -10.394 0.529   1.00 1.03  ? 137 ALA A HB1  2  
ATOM 4383  H HB2  . ALA A 1 137 ? -4.332  -10.327 -1.219  1.00 1.05  ? 137 ALA A HB2  2  
ATOM 4384  H HB3  . ALA A 1 137 ? -3.591  -8.976  -0.363  1.00 1.04  ? 137 ALA A HB3  2  
ATOM 4385  N N    . LEU A 1 138 ? -0.485  -9.465  0.374   1.00 0.13  ? 138 LEU A N    2  
ATOM 4386  C CA   . LEU A 1 138 ? 0.541   -9.187  1.354   1.00 0.12  ? 138 LEU A CA   2  
ATOM 4387  C C    . LEU A 1 138 ? 0.276   -7.883  2.095   1.00 0.13  ? 138 LEU A C    2  
ATOM 4388  O O    . LEU A 1 138 ? -0.011  -6.853  1.485   1.00 0.15  ? 138 LEU A O    2  
ATOM 4389  C CB   . LEU A 1 138 ? 1.908   -9.136  0.683   1.00 0.13  ? 138 LEU A CB   2  
ATOM 4390  C CG   . LEU A 1 138 ? 2.938   -10.100 1.266   1.00 0.15  ? 138 LEU A CG   2  
ATOM 4391  C CD1  . LEU A 1 138 ? 2.432   -11.524 1.192   1.00 0.22  ? 138 LEU A CD1  2  
ATOM 4392  C CD2  . LEU A 1 138 ? 4.266   -9.964  0.550   1.00 0.19  ? 138 LEU A CD2  2  
ATOM 4393  H H    . LEU A 1 138 ? -0.494  -8.959  -0.470  1.00 0.13  ? 138 LEU A H    2  
ATOM 4394  H HA   . LEU A 1 138 ? 0.536   -9.999  2.058   1.00 0.12  ? 138 LEU A HA   2  
ATOM 4395  H HB2  . LEU A 1 138 ? 1.784   -9.359  -0.367  1.00 0.16  ? 138 LEU A HB2  2  
ATOM 4396  H HB3  . LEU A 1 138 ? 2.296   -8.133  0.777   1.00 0.19  ? 138 LEU A HB3  2  
ATOM 4397  H HG   . LEU A 1 138 ? 3.095   -9.859  2.304   1.00 0.19  ? 138 LEU A HG   2  
ATOM 4398  H HD11 . LEU A 1 138 ? 2.205   -11.774 0.167   1.00 1.05  ? 138 LEU A HD11 2  
ATOM 4399  H HD12 . LEU A 1 138 ? 1.539   -11.616 1.792   1.00 1.06  ? 138 LEU A HD12 2  
ATOM 4400  H HD13 . LEU A 1 138 ? 3.190   -12.193 1.569   1.00 1.01  ? 138 LEU A HD13 2  
ATOM 4401  H HD21 . LEU A 1 138 ? 4.654   -8.966  0.696   1.00 0.98  ? 138 LEU A HD21 2  
ATOM 4402  H HD22 . LEU A 1 138 ? 4.124   -10.142 -0.506  1.00 0.93  ? 138 LEU A HD22 2  
ATOM 4403  H HD23 . LEU A 1 138 ? 4.967   -10.684 0.946   1.00 1.01  ? 138 LEU A HD23 2  
ATOM 4404  N N    . CYS A 1 139 ? 0.383   -7.935  3.411   1.00 0.13  ? 139 CYS A N    2  
ATOM 4405  C CA   . CYS A 1 139 ? 0.224   -6.753  4.237   1.00 0.14  ? 139 CYS A CA   2  
ATOM 4406  C C    . CYS A 1 139 ? 1.536   -6.468  4.955   1.00 0.13  ? 139 CYS A C    2  
ATOM 4407  O O    . CYS A 1 139 ? 1.861   -7.091  5.965   1.00 0.14  ? 139 CYS A O    2  
ATOM 4408  C CB   . CYS A 1 139 ? -0.895  -6.964  5.251   1.00 0.18  ? 139 CYS A CB   2  
ATOM 4409  S SG   . CYS A 1 139 ? -1.560  -5.436  5.957   1.00 1.20  ? 139 CYS A SG   2  
ATOM 4410  H H    . CYS A 1 139 ? 0.583   -8.796  3.842   1.00 0.14  ? 139 CYS A H    2  
ATOM 4411  H HA   . CYS A 1 139 ? -0.020  -5.921  3.596   1.00 0.16  ? 139 CYS A HA   2  
ATOM 4412  H HB2  . CYS A 1 139 ? -1.708  -7.496  4.777   1.00 0.82  ? 139 CYS A HB2  2  
ATOM 4413  H HB3  . CYS A 1 139 ? -0.509  -7.558  6.061   1.00 0.80  ? 139 CYS A HB3  2  
ATOM 4414  H HG   . CYS A 1 139 ? -2.866  -5.418  5.730   1.00 1.82  ? 139 CYS A HG   2  
ATOM 4415  N N    . LEU A 1 140 ? 2.280   -5.524  4.430   1.00 0.13  ? 140 LEU A N    2  
ATOM 4416  C CA   . LEU A 1 140 ? 3.632   -5.268  4.888   1.00 0.14  ? 140 LEU A CA   2  
ATOM 4417  C C    . LEU A 1 140 ? 3.742   -3.917  5.581   1.00 0.13  ? 140 LEU A C    2  
ATOM 4418  O O    . LEU A 1 140 ? 3.183   -2.932  5.123   1.00 0.12  ? 140 LEU A O    2  
ATOM 4419  C CB   . LEU A 1 140 ? 4.588   -5.336  3.708   1.00 0.17  ? 140 LEU A CB   2  
ATOM 4420  C CG   . LEU A 1 140 ? 4.234   -4.416  2.554   1.00 0.17  ? 140 LEU A CG   2  
ATOM 4421  C CD1  . LEU A 1 140 ? 5.159   -3.210  2.548   1.00 0.26  ? 140 LEU A CD1  2  
ATOM 4422  C CD2  . LEU A 1 140 ? 4.306   -5.158  1.233   1.00 0.32  ? 140 LEU A CD2  2  
ATOM 4423  H H    . LEU A 1 140 ? 1.905   -4.972  3.705   1.00 0.14  ? 140 LEU A H    2  
ATOM 4424  H HA   . LEU A 1 140 ? 3.892   -6.043  5.592   1.00 0.16  ? 140 LEU A HA   2  
ATOM 4425  H HB2  . LEU A 1 140 ? 5.571   -5.068  4.060   1.00 0.18  ? 140 LEU A HB2  2  
ATOM 4426  H HB3  . LEU A 1 140 ? 4.612   -6.351  3.341   1.00 0.21  ? 140 LEU A HB3  2  
ATOM 4427  H HG   . LEU A 1 140 ? 3.217   -4.066  2.690   1.00 0.24  ? 140 LEU A HG   2  
ATOM 4428  H HD11 . LEU A 1 140 ? 5.078   -2.689  3.493   1.00 1.15  ? 140 LEU A HD11 2  
ATOM 4429  H HD12 . LEU A 1 140 ? 4.885   -2.547  1.743   1.00 1.03  ? 140 LEU A HD12 2  
ATOM 4430  H HD13 . LEU A 1 140 ? 6.179   -3.545  2.414   1.00 1.00  ? 140 LEU A HD13 2  
ATOM 4431  H HD21 . LEU A 1 140 ? 4.054   -4.483  0.428   1.00 1.03  ? 140 LEU A HD21 2  
ATOM 4432  H HD22 . LEU A 1 140 ? 3.608   -5.982  1.243   1.00 1.08  ? 140 LEU A HD22 2  
ATOM 4433  H HD23 . LEU A 1 140 ? 5.308   -5.536  1.085   1.00 1.04  ? 140 LEU A HD23 2  
ATOM 4434  N N    . GLU A 1 141 ? 4.453   -3.876  6.690   1.00 0.14  ? 141 GLU A N    2  
ATOM 4435  C CA   . GLU A 1 141 ? 4.608   -2.649  7.443   1.00 0.13  ? 141 GLU A CA   2  
ATOM 4436  C C    . GLU A 1 141 ? 6.023   -2.124  7.244   1.00 0.12  ? 141 GLU A C    2  
ATOM 4437  O O    . GLU A 1 141 ? 6.990   -2.798  7.596   1.00 0.15  ? 141 GLU A O    2  
ATOM 4438  C CB   . GLU A 1 141 ? 4.305   -2.938  8.911   1.00 0.18  ? 141 GLU A CB   2  
ATOM 4439  C CG   . GLU A 1 141 ? 4.470   -1.757  9.846   1.00 0.26  ? 141 GLU A CG   2  
ATOM 4440  C CD   . GLU A 1 141 ? 4.016   -2.114  11.247  1.00 0.30  ? 141 GLU A CD   2  
ATOM 4441  O OE1  . GLU A 1 141 ? 4.502   -3.128  11.795  1.00 1.05  ? 141 GLU A OE1  2  
ATOM 4442  O OE2  . GLU A 1 141 ? 3.150   -1.410  11.798  1.00 1.00  ? 141 GLU A OE2  2  
ATOM 4443  H H    . GLU A 1 141 ? 4.919   -4.685  7.001   1.00 0.18  ? 141 GLU A H    2  
ATOM 4444  H HA   . GLU A 1 141 ? 3.903   -1.923  7.066   1.00 0.13  ? 141 GLU A HA   2  
ATOM 4445  H HB2  . GLU A 1 141 ? 3.284   -3.279  8.988   1.00 0.30  ? 141 GLU A HB2  2  
ATOM 4446  H HB3  . GLU A 1 141 ? 4.959   -3.729  9.248   1.00 0.24  ? 141 GLU A HB3  2  
ATOM 4447  H HG2  . GLU A 1 141 ? 5.514   -1.464  9.868   1.00 0.38  ? 141 GLU A HG2  2  
ATOM 4448  H HG3  . GLU A 1 141 ? 3.868   -0.938  9.482   1.00 0.41  ? 141 GLU A HG3  2  
ATOM 4449  N N    . VAL A 1 142 ? 6.144   -0.954  6.634   1.00 0.12  ? 142 VAL A N    2  
ATOM 4450  C CA   . VAL A 1 142 ? 7.449   -0.407  6.302   1.00 0.12  ? 142 VAL A CA   2  
ATOM 4451  C C    . VAL A 1 142 ? 7.738   0.905   7.022   1.00 0.12  ? 142 VAL A C    2  
ATOM 4452  O O    . VAL A 1 142 ? 6.992   1.877   6.908   1.00 0.15  ? 142 VAL A O    2  
ATOM 4453  C CB   . VAL A 1 142 ? 7.620   -0.206  4.780   1.00 0.14  ? 142 VAL A CB   2  
ATOM 4454  C CG1  . VAL A 1 142 ? 7.856   -1.541  4.098   1.00 0.19  ? 142 VAL A CG1  2  
ATOM 4455  C CG2  . VAL A 1 142 ? 6.403   0.488   4.178   1.00 0.19  ? 142 VAL A CG2  2  
ATOM 4456  H H    . VAL A 1 142 ? 5.334   -0.446  6.398   1.00 0.15  ? 142 VAL A H    2  
ATOM 4457  H HA   . VAL A 1 142 ? 8.184   -1.134  6.618   1.00 0.12  ? 142 VAL A HA   2  
ATOM 4458  H HB   . VAL A 1 142 ? 8.486   0.418   4.613   1.00 0.17  ? 142 VAL A HB   2  
ATOM 4459  H HG11 . VAL A 1 142 ? 7.021   -2.198  4.291   1.00 0.97  ? 142 VAL A HG11 2  
ATOM 4460  H HG12 . VAL A 1 142 ? 8.763   -1.988  4.483   1.00 0.99  ? 142 VAL A HG12 2  
ATOM 4461  H HG13 . VAL A 1 142 ? 7.955   -1.387  3.035   1.00 1.08  ? 142 VAL A HG13 2  
ATOM 4462  H HG21 . VAL A 1 142 ? 6.569   0.649   3.121   1.00 0.98  ? 142 VAL A HG21 2  
ATOM 4463  H HG22 . VAL A 1 142 ? 6.251   1.438   4.668   1.00 1.01  ? 142 VAL A HG22 2  
ATOM 4464  H HG23 . VAL A 1 142 ? 5.529   -0.134  4.315   1.00 1.02  ? 142 VAL A HG23 2  
ATOM 4465  N N    . THR A 1 143 ? 8.811   0.896   7.794   1.00 0.13  ? 143 THR A N    2  
ATOM 4466  C CA   . THR A 1 143 ? 9.356   2.101   8.404   1.00 0.13  ? 143 THR A CA   2  
ATOM 4467  C C    . THR A 1 143 ? 10.358  2.769   7.475   1.00 0.12  ? 143 THR A C    2  
ATOM 4468  O O    . THR A 1 143 ? 11.456  2.248   7.273   1.00 0.15  ? 143 THR A O    2  
ATOM 4469  C CB   . THR A 1 143 ? 10.105  1.761   9.706   1.00 0.17  ? 143 THR A CB   2  
ATOM 4470  O OG1  . THR A 1 143 ? 9.423   0.710   10.393  1.00 0.28  ? 143 THR A OG1  2  
ATOM 4471  C CG2  . THR A 1 143 ? 10.218  2.983   10.610  1.00 0.22  ? 143 THR A CG2  2  
ATOM 4472  H H    . THR A 1 143 ? 9.229   0.031   8.002   1.00 0.15  ? 143 THR A H    2  
ATOM 4473  H HA   . THR A 1 143 ? 8.551   2.787   8.627   1.00 0.14  ? 143 THR A HA   2  
ATOM 4474  H HB   . THR A 1 143 ? 11.112  1.429   9.447   1.00 0.16  ? 143 THR A HB   2  
ATOM 4475  H HG1  . THR A 1 143 ? 9.044   1.050   11.218  1.00 0.69  ? 143 THR A HG1  2  
ATOM 4476  H HG21 . THR A 1 143 ? 9.235   3.388   10.796  1.00 0.99  ? 143 THR A HG21 2  
ATOM 4477  H HG22 . THR A 1 143 ? 10.833  3.732   10.130  1.00 1.00  ? 143 THR A HG22 2  
ATOM 4478  H HG23 . THR A 1 143 ? 10.673  2.697   11.547  1.00 1.09  ? 143 THR A HG23 2  
ATOM 4479  N N    . LEU A 1 144 ? 9.998   3.907   6.909   1.00 0.13  ? 144 LEU A N    2  
ATOM 4480  C CA   . LEU A 1 144 ? 10.958  4.680   6.141   1.00 0.12  ? 144 LEU A CA   2  
ATOM 4481  C C    . LEU A 1 144 ? 11.796  5.497   7.096   1.00 0.12  ? 144 LEU A C    2  
ATOM 4482  O O    . LEU A 1 144 ? 11.412  6.584   7.517   1.00 0.14  ? 144 LEU A O    2  
ATOM 4483  C CB   . LEU A 1 144 ? 10.272  5.588   5.123   1.00 0.14  ? 144 LEU A CB   2  
ATOM 4484  C CG   . LEU A 1 144 ? 11.220  6.413   4.253   1.00 0.12  ? 144 LEU A CG   2  
ATOM 4485  C CD1  . LEU A 1 144 ? 12.144  5.504   3.458   1.00 0.15  ? 144 LEU A CD1  2  
ATOM 4486  C CD2  . LEU A 1 144 ? 10.427  7.319   3.327   1.00 0.13  ? 144 LEU A CD2  2  
ATOM 4487  H H    . LEU A 1 144 ? 9.081   4.243   7.025   1.00 0.16  ? 144 LEU A H    2  
ATOM 4488  H HA   . LEU A 1 144 ? 11.607  3.986   5.630   1.00 0.14  ? 144 LEU A HA   2  
ATOM 4489  H HB2  . LEU A 1 144 ? 9.664   4.974   4.476   1.00 0.16  ? 144 LEU A HB2  2  
ATOM 4490  H HB3  . LEU A 1 144 ? 9.626   6.270   5.657   1.00 0.15  ? 144 LEU A HB3  2  
ATOM 4491  H HG   . LEU A 1 144 ? 11.833  7.034   4.888   1.00 0.12  ? 144 LEU A HG   2  
ATOM 4492  H HD11 . LEU A 1 144 ? 11.558  4.856   2.823   1.00 0.98  ? 144 LEU A HD11 2  
ATOM 4493  H HD12 . LEU A 1 144 ? 12.729  4.905   4.141   1.00 0.99  ? 144 LEU A HD12 2  
ATOM 4494  H HD13 . LEU A 1 144 ? 12.805  6.104   2.849   1.00 1.07  ? 144 LEU A HD13 2  
ATOM 4495  H HD21 . LEU A 1 144 ? 9.791   6.720   2.691   1.00 1.01  ? 144 LEU A HD21 2  
ATOM 4496  H HD22 . LEU A 1 144 ? 11.106  7.897   2.718   1.00 1.04  ? 144 LEU A HD22 2  
ATOM 4497  H HD23 . LEU A 1 144 ? 9.816   7.986   3.916   1.00 1.02  ? 144 LEU A HD23 2  
ATOM 4498  N N    . LYS A 1 145 ? 12.935  4.946   7.451   1.00 0.14  ? 145 LYS A N    2  
ATOM 4499  C CA   . LYS A 1 145 ? 13.757  5.517   8.497   1.00 0.17  ? 145 LYS A CA   2  
ATOM 4500  C C    . LYS A 1 145 ? 14.734  6.529   7.924   1.00 0.16  ? 145 LYS A C    2  
ATOM 4501  O O    . LYS A 1 145 ? 15.186  7.432   8.626   1.00 0.21  ? 145 LYS A O    2  
ATOM 4502  C CB   . LYS A 1 145 ? 14.514  4.409   9.235   1.00 0.26  ? 145 LYS A CB   2  
ATOM 4503  C CG   . LYS A 1 145 ? 13.658  3.188   9.550   1.00 0.40  ? 145 LYS A CG   2  
ATOM 4504  C CD   . LYS A 1 145 ? 14.478  2.070   10.174  1.00 0.60  ? 145 LYS A CD   2  
ATOM 4505  C CE   . LYS A 1 145 ? 15.586  1.625   9.240   1.00 0.38  ? 145 LYS A CE   2  
ATOM 4506  N NZ   . LYS A 1 145 ? 16.642  0.846   9.951   1.00 1.08  ? 145 LYS A NZ   2  
ATOM 4507  H H    . LYS A 1 145 ? 13.230  4.129   6.993   1.00 0.17  ? 145 LYS A H    2  
ATOM 4508  H HA   . LYS A 1 145 ? 13.106  6.018   9.194   1.00 0.21  ? 145 LYS A HA   2  
ATOM 4509  H HB2  . LYS A 1 145 ? 15.355  4.094   8.633   1.00 0.26  ? 145 LYS A HB2  2  
ATOM 4510  H HB3  . LYS A 1 145 ? 14.879  4.808   10.168  1.00 0.32  ? 145 LYS A HB3  2  
ATOM 4511  H HG2  . LYS A 1 145 ? 12.879  3.473   10.237  1.00 0.63  ? 145 LYS A HG2  2  
ATOM 4512  H HG3  . LYS A 1 145 ? 13.218  2.828   8.632   1.00 0.65  ? 145 LYS A HG3  2  
ATOM 4513  H HD2  . LYS A 1 145 ? 14.916  2.422   11.094  1.00 1.02  ? 145 LYS A HD2  2  
ATOM 4514  H HD3  . LYS A 1 145 ? 13.826  1.223   10.375  1.00 1.10  ? 145 LYS A HD3  2  
ATOM 4515  H HE2  . LYS A 1 145 ? 15.143  1.008   8.470   1.00 0.84  ? 145 LYS A HE2  2  
ATOM 4516  H HE3  . LYS A 1 145 ? 16.035  2.497   8.785   1.00 0.96  ? 145 LYS A HE3  2  
ATOM 4517  H HZ1  . LYS A 1 145 ? 17.509  0.797   9.368   1.00 1.58  ? 145 LYS A HZ1  2  
ATOM 4518  H HZ2  . LYS A 1 145 ? 16.313  -0.123  10.140  1.00 1.69  ? 145 LYS A HZ2  2  
ATOM 4519  H HZ3  . LYS A 1 145 ? 16.880  1.302   10.860  1.00 1.60  ? 145 LYS A HZ3  2  
ATOM 4520  N N    . THR A 1 146 ? 15.066  6.380   6.651   1.00 0.16  ? 146 THR A N    2  
ATOM 4521  C CA   . THR A 1 146 ? 16.057  7.238   6.025   1.00 0.19  ? 146 THR A CA   2  
ATOM 4522  C C    . THR A 1 146 ? 15.934  7.204   4.506   1.00 0.17  ? 146 THR A C    2  
ATOM 4523  O O    . THR A 1 146 ? 15.553  6.184   3.929   1.00 0.16  ? 146 THR A O    2  
ATOM 4524  C CB   . THR A 1 146 ? 17.490  6.789   6.387   1.00 0.25  ? 146 THR A CB   2  
ATOM 4525  O OG1  . THR A 1 146 ? 17.625  6.618   7.807   1.00 0.25  ? 146 THR A OG1  2  
ATOM 4526  C CG2  . THR A 1 146 ? 18.528  7.798   5.912   1.00 0.37  ? 146 THR A CG2  2  
ATOM 4527  H H    . THR A 1 146 ? 14.631  5.682   6.118   1.00 0.19  ? 146 THR A H    2  
ATOM 4528  H HA   . THR A 1 146 ? 15.905  8.245   6.379   1.00 0.22  ? 146 THR A HA   2  
ATOM 4529  H HB   . THR A 1 146 ? 17.675  5.842   5.888   1.00 0.29  ? 146 THR A HB   2  
ATOM 4530  H HG1  . THR A 1 146 ? 16.825  6.944   8.249   1.00 0.44  ? 146 THR A HG1  2  
ATOM 4531  H HG21 . THR A 1 146 ? 18.366  8.742   6.412   1.00 1.12  ? 146 THR A HG21 2  
ATOM 4532  H HG22 . THR A 1 146 ? 18.435  7.935   4.847   1.00 1.08  ? 146 THR A HG22 2  
ATOM 4533  H HG23 . THR A 1 146 ? 19.517  7.433   6.144   1.00 1.06  ? 146 THR A HG23 2  
ATOM 4534  N N    . ALA A 1 147 ? 16.255  8.323   3.869   1.00 0.20  ? 147 ALA A N    2  
ATOM 4535  C CA   . ALA A 1 147 ? 16.418  8.362   2.432   1.00 0.19  ? 147 ALA A CA   2  
ATOM 4536  C C    . ALA A 1 147 ? 17.798  8.908   2.100   1.00 0.22  ? 147 ALA A C    2  
ATOM 4537  O O    . ALA A 1 147 ? 18.182  9.965   2.594   1.00 0.25  ? 147 ALA A O    2  
ATOM 4538  C CB   . ALA A 1 147 ? 15.333  9.217   1.795   1.00 0.21  ? 147 ALA A CB   2  
ATOM 4539  H H    . ALA A 1 147 ? 16.392  9.146   4.384   1.00 0.24  ? 147 ALA A H    2  
ATOM 4540  H HA   . ALA A 1 147 ? 16.336  7.355   2.057   1.00 0.19  ? 147 ALA A HA   2  
ATOM 4541  H HB1  . ALA A 1 147 ? 15.451  9.207   0.721   1.00 0.96  ? 147 ALA A HB1  2  
ATOM 4542  H HB2  . ALA A 1 147 ? 15.417  10.230  2.157   1.00 0.98  ? 147 ALA A HB2  2  
ATOM 4543  H HB3  . ALA A 1 147 ? 14.361  8.820   2.053   1.00 0.99  ? 147 ALA A HB3  2  
ATOM 4544  N N    . VAL A 1 148 ? 18.544  8.188   1.276   1.00 0.24  ? 148 VAL A N    2  
ATOM 4545  C CA   . VAL A 1 148 ? 19.887  8.584   0.921   1.00 0.31  ? 148 VAL A CA   2  
ATOM 4546  C C    . VAL A 1 148 ? 19.978  8.787   -0.576  1.00 0.34  ? 148 VAL A C    2  
ATOM 4547  O O    . VAL A 1 148 ? 19.726  7.870   -1.355  1.00 0.36  ? 148 VAL A O    2  
ATOM 4548  C CB   . VAL A 1 148 ? 20.915  7.518   1.335   1.00 0.42  ? 148 VAL A CB   2  
ATOM 4549  C CG1  . VAL A 1 148 ? 22.316  8.036   1.119   1.00 0.92  ? 148 VAL A CG1  2  
ATOM 4550  C CG2  . VAL A 1 148 ? 20.711  7.078   2.780   1.00 0.75  ? 148 VAL A CG2  2  
ATOM 4551  H H    . VAL A 1 148 ? 18.189  7.360   0.891   1.00 0.24  ? 148 VAL A H    2  
ATOM 4552  H HA   . VAL A 1 148 ? 20.118  9.510   1.427   1.00 0.36  ? 148 VAL A HA   2  
ATOM 4553  H HB   . VAL A 1 148 ? 20.775  6.666   0.694   1.00 0.93  ? 148 VAL A HB   2  
ATOM 4554  H HG11 . VAL A 1 148 ? 22.431  8.318   0.087   1.00 1.58  ? 148 VAL A HG11 2  
ATOM 4555  H HG12 . VAL A 1 148 ? 23.026  7.263   1.367   1.00 1.62  ? 148 VAL A HG12 2  
ATOM 4556  H HG13 . VAL A 1 148 ? 22.477  8.894   1.751   1.00 1.28  ? 148 VAL A HG13 2  
ATOM 4557  H HG21 . VAL A 1 148 ? 19.721  6.660   2.894   1.00 1.27  ? 148 VAL A HG21 2  
ATOM 4558  H HG22 . VAL A 1 148 ? 20.817  7.932   3.434   1.00 1.35  ? 148 VAL A HG22 2  
ATOM 4559  H HG23 . VAL A 1 148 ? 21.449  6.334   3.036   1.00 1.29  ? 148 VAL A HG23 2  
ATOM 4560  N N    . ASP A 1 149 ? 20.345  9.981   -0.979  1.00 0.44  ? 149 ASP A N    2  
ATOM 4561  C CA   . ASP A 1 149 ? 20.422  10.290  -2.384  1.00 0.52  ? 149 ASP A CA   2  
ATOM 4562  C C    . ASP A 1 149 ? 21.656  9.633   -2.961  1.00 0.66  ? 149 ASP A C    2  
ATOM 4563  O O    . ASP A 1 149 ? 22.783  9.956   -2.585  1.00 0.79  ? 149 ASP A O    2  
ATOM 4564  C CB   . ASP A 1 149 ? 20.451  11.794  -2.596  1.00 0.68  ? 149 ASP A CB   2  
ATOM 4565  C CG   . ASP A 1 149 ? 20.889  12.180  -3.999  1.00 1.41  ? 149 ASP A CG   2  
ATOM 4566  O OD1  . ASP A 1 149 ? 20.464  11.510  -4.965  1.00 2.27  ? 149 ASP A OD1  2  
ATOM 4567  O OD2  . ASP A 1 149 ? 21.660  13.152  -4.148  1.00 1.61  ? 149 ASP A OD2  2  
ATOM 4568  H H    . ASP A 1 149 ? 20.617  10.645  -0.321  1.00 0.52  ? 149 ASP A H    2  
ATOM 4569  H HA   . ASP A 1 149 ? 19.542  9.880   -2.861  1.00 0.43  ? 149 ASP A HA   2  
ATOM 4570  H HB2  . ASP A 1 149 ? 19.455  12.184  -2.426  1.00 0.86  ? 149 ASP A HB2  2  
ATOM 4571  H HB3  . ASP A 1 149 ? 21.133  12.229  -1.884  1.00 1.18  ? 149 ASP A HB3  2  
ATOM 4572  N N    . LEU A 1 150 ? 21.432  8.713   -3.873  1.00 0.68  ? 150 LEU A N    2  
ATOM 4573  C CA   . LEU A 1 150 ? 22.493  7.860   -4.348  1.00 0.89  ? 150 LEU A CA   2  
ATOM 4574  C C    . LEU A 1 150 ? 22.182  7.405   -5.762  1.00 0.96  ? 150 LEU A C    2  
ATOM 4575  O O    . LEU A 1 150 ? 22.679  6.382   -6.230  1.00 1.38  ? 150 LEU A O    2  
ATOM 4576  C CB   . LEU A 1 150 ? 22.615  6.677   -3.391  1.00 1.00  ? 150 LEU A CB   2  
ATOM 4577  C CG   . LEU A 1 150 ? 23.924  5.892   -3.429  1.00 1.09  ? 150 LEU A CG   2  
ATOM 4578  C CD1  . LEU A 1 150 ? 25.124  6.821   -3.553  1.00 1.81  ? 150 LEU A CD1  2  
ATOM 4579  C CD2  . LEU A 1 150 ? 24.028  5.070   -2.161  1.00 1.97  ? 150 LEU A CD2  2  
ATOM 4580  H H    . LEU A 1 150 ? 20.528  8.604   -4.233  1.00 0.59  ? 150 LEU A H    2  
ATOM 4581  H HA   . LEU A 1 150 ? 23.409  8.427   -4.343  1.00 1.01  ? 150 LEU A HA   2  
ATOM 4582  H HB2  . LEU A 1 150 ? 22.481  7.045   -2.385  1.00 1.42  ? 150 LEU A HB2  2  
ATOM 4583  H HB3  . LEU A 1 150 ? 21.809  5.991   -3.608  1.00 1.50  ? 150 LEU A HB3  2  
ATOM 4584  H HG   . LEU A 1 150 ? 23.921  5.221   -4.272  1.00 1.50  ? 150 LEU A HG   2  
ATOM 4585  H HD11 . LEU A 1 150 ? 25.086  7.566   -2.771  1.00 2.37  ? 150 LEU A HD11 2  
ATOM 4586  H HD12 . LEU A 1 150 ? 25.114  7.307   -4.518  1.00 2.20  ? 150 LEU A HD12 2  
ATOM 4587  H HD13 . LEU A 1 150 ? 26.033  6.245   -3.454  1.00 2.36  ? 150 LEU A HD13 2  
ATOM 4588  H HD21 . LEU A 1 150 ? 23.870  5.720   -1.309  1.00 2.50  ? 150 LEU A HD21 2  
ATOM 4589  H HD22 . LEU A 1 150 ? 25.007  4.622   -2.098  1.00 2.46  ? 150 LEU A HD22 2  
ATOM 4590  H HD23 . LEU A 1 150 ? 23.273  4.298   -2.169  1.00 2.44  ? 150 LEU A HD23 2  
ATOM 4591  N N    . GLU A 1 151 ? 21.345  8.193   -6.431  1.00 0.72  ? 151 GLU A N    2  
ATOM 4592  C CA   . GLU A 1 151 ? 20.981  7.940   -7.814  1.00 0.79  ? 151 GLU A CA   2  
ATOM 4593  C C    . GLU A 1 151 ? 22.181  8.286   -8.689  1.00 1.44  ? 151 GLU A C    2  
ATOM 4594  O O    . GLU A 1 151 ? 23.099  7.480   -8.829  1.00 2.14  ? 151 GLU A O    2  
ATOM 4595  C CB   . GLU A 1 151 ? 19.750  8.792   -8.191  1.00 0.57  ? 151 GLU A CB   2  
ATOM 4596  C CG   . GLU A 1 151 ? 18.950  8.293   -9.390  1.00 0.60  ? 151 GLU A CG   2  
ATOM 4597  C CD   . GLU A 1 151 ? 19.765  8.243   -10.667 1.00 0.92  ? 151 GLU A CD   2  
ATOM 4598  O OE1  . GLU A 1 151 ? 20.042  9.309   -11.250 1.00 1.32  ? 151 GLU A OE1  2  
ATOM 4599  O OE2  . GLU A 1 151 ? 20.112  7.121   -11.104 1.00 1.57  ? 151 GLU A OE2  2  
ATOM 4600  H H    . GLU A 1 151 ? 20.976  8.979   -5.982  1.00 0.72  ? 151 GLU A H    2  
ATOM 4601  H HA   . GLU A 1 151 ? 20.746  6.890   -7.921  1.00 1.12  ? 151 GLU A HA   2  
ATOM 4602  H HB2  . GLU A 1 151 ? 19.082  8.831   -7.341  1.00 0.95  ? 151 GLU A HB2  2  
ATOM 4603  H HB3  . GLU A 1 151 ? 20.086  9.795   -8.410  1.00 1.07  ? 151 GLU A HB3  2  
ATOM 4604  H HG2  . GLU A 1 151 ? 18.568  7.303   -9.173  1.00 0.93  ? 151 GLU A HG2  2  
ATOM 4605  H HG3  . GLU A 1 151 ? 18.115  8.966   -9.542  1.00 0.97  ? 151 GLU A HG3  2  
ATOM 4606  N N    . HIS A 1 152 ? 22.169  9.509   -9.223  1.00 2.00  ? 152 HIS A N    2  
ATOM 4607  C CA   . HIS A 1 152 ? 23.276  10.063  -10.004 1.00 2.74  ? 152 HIS A CA   2  
ATOM 4608  C C    . HIS A 1 152 ? 23.931  9.006   -10.886 1.00 3.34  ? 152 HIS A C    2  
ATOM 4609  O O    . HIS A 1 152 ? 25.071  8.614   -10.647 1.00 4.01  ? 152 HIS A O    2  
ATOM 4610  C CB   . HIS A 1 152 ? 24.328  10.697  -9.082  1.00 3.58  ? 152 HIS A CB   2  
ATOM 4611  C CG   . HIS A 1 152 ? 23.766  11.696  -8.117  1.00 4.23  ? 152 HIS A CG   2  
ATOM 4612  N ND1  . HIS A 1 152 ? 23.488  13.003  -8.453  1.00 4.97  ? 152 HIS A ND1  2  
ATOM 4613  C CD2  . HIS A 1 152 ? 23.421  11.566  -6.813  1.00 4.78  ? 152 HIS A CD2  2  
ATOM 4614  C CE1  . HIS A 1 152 ? 23.001  13.632  -7.399  1.00 5.79  ? 152 HIS A CE1  2  
ATOM 4615  N NE2  . HIS A 1 152 ? 22.947  12.782  -6.392  1.00 5.71  ? 152 HIS A NE2  2  
ATOM 4616  H H    . HIS A 1 152 ? 21.363  10.056  -9.108  1.00 2.34  ? 152 HIS A H    2  
ATOM 4617  H HA   . HIS A 1 152 ? 22.869  10.832  -10.643 1.00 2.87  ? 152 HIS A HA   2  
ATOM 4618  H HB2  . HIS A 1 152 ? 24.809  9.920   -8.509  1.00 3.90  ? 152 HIS A HB2  2  
ATOM 4619  H HB3  . HIS A 1 152 ? 25.068  11.201  -9.685  1.00 4.03  ? 152 HIS A HB3  2  
ATOM 4620  H HD1  . HIS A 1 152 ? 23.624  13.413  -9.342  1.00 5.15  ? 152 HIS A HD1  2  
ATOM 4621  H HD2  . HIS A 1 152 ? 23.503  10.668  -6.216  1.00 4.83  ? 152 HIS A HD2  2  
ATOM 4622  H HE1  . HIS A 1 152 ? 22.689  14.665  -7.367  1.00 6.63  ? 152 HIS A HE1  2  
ATOM 4623  H HE2  . HIS A 1 152 ? 22.435  12.934  -5.553  1.00 6.40  ? 152 HIS A HE2  2  
ATOM 4624  N N    . HIS A 1 153 ? 23.203  8.540   -11.898 1.00 3.70  ? 153 HIS A N    2  
ATOM 4625  C CA   . HIS A 1 153 ? 23.717  7.506   -12.808 1.00 4.77  ? 153 HIS A CA   2  
ATOM 4626  C C    . HIS A 1 153 ? 24.878  8.013   -13.673 1.00 5.09  ? 153 HIS A C    2  
ATOM 4627  O O    . HIS A 1 153 ? 25.327  7.326   -14.589 1.00 5.37  ? 153 HIS A O    2  
ATOM 4628  C CB   . HIS A 1 153 ? 22.598  6.924   -13.693 1.00 5.63  ? 153 HIS A CB   2  
ATOM 4629  C CG   . HIS A 1 153 ? 21.691  7.943   -14.322 1.00 6.19  ? 153 HIS A CG   2  
ATOM 4630  N ND1  . HIS A 1 153 ? 22.068  8.750   -15.372 1.00 6.78  ? 153 HIS A ND1  2  
ATOM 4631  C CD2  . HIS A 1 153 ? 20.408  8.274   -14.040 1.00 6.64  ? 153 HIS A CD2  2  
ATOM 4632  C CE1  . HIS A 1 153 ? 21.058  9.533   -15.708 1.00 7.48  ? 153 HIS A CE1  2  
ATOM 4633  N NE2  . HIS A 1 153 ? 20.039  9.267   -14.915 1.00 7.41  ? 153 HIS A NE2  2  
ATOM 4634  H H    . HIS A 1 153 ? 22.283  8.869   -12.015 1.00 3.55  ? 153 HIS A H    2  
ATOM 4635  H HA   . HIS A 1 153 ? 24.100  6.710   -12.186 1.00 5.10  ? 153 HIS A HA   2  
ATOM 4636  H HB2  . HIS A 1 153 ? 23.047  6.352   -14.490 1.00 5.99  ? 153 HIS A HB2  2  
ATOM 4637  H HB3  . HIS A 1 153 ? 21.989  6.266   -13.091 1.00 5.91  ? 153 HIS A HB3  2  
ATOM 4638  H HD1  . HIS A 1 153 ? 22.952  8.757   -15.804 1.00 6.89  ? 153 HIS A HD1  2  
ATOM 4639  H HD2  . HIS A 1 153 ? 19.787  7.838   -13.265 1.00 6.66  ? 153 HIS A HD2  2  
ATOM 4640  H HE1  . HIS A 1 153 ? 21.067  10.271  -16.499 1.00 8.19  ? 153 HIS A HE1  2  
ATOM 4641  H HE2  . HIS A 1 153 ? 19.250  9.855   -14.802 1.00 7.98  ? 153 HIS A HE2  2  
ATOM 4642  N N    . HIS A 1 154 ? 25.365  9.206   -13.368 1.00 5.42  ? 154 HIS A N    2  
ATOM 4643  C CA   . HIS A 1 154 ? 26.538  9.759   -14.026 1.00 6.05  ? 154 HIS A CA   2  
ATOM 4644  C C    . HIS A 1 154 ? 27.802  9.244   -13.350 1.00 6.57  ? 154 HIS A C    2  
ATOM 4645  O O    . HIS A 1 154 ? 28.245  9.793   -12.345 1.00 7.00  ? 154 HIS A O    2  
ATOM 4646  C CB   . HIS A 1 154 ? 26.501  11.293  -13.975 1.00 6.58  ? 154 HIS A CB   2  
ATOM 4647  C CG   . HIS A 1 154 ? 27.663  11.961  -14.649 1.00 7.19  ? 154 HIS A CG   2  
ATOM 4648  N ND1  . HIS A 1 154 ? 28.796  12.365  -13.975 1.00 7.60  ? 154 HIS A ND1  2  
ATOM 4649  C CD2  . HIS A 1 154 ? 27.862  12.297  -15.945 1.00 7.78  ? 154 HIS A CD2  2  
ATOM 4650  C CE1  . HIS A 1 154 ? 29.635  12.924  -14.825 1.00 8.35  ? 154 HIS A CE1  2  
ATOM 4651  N NE2  . HIS A 1 154 ? 29.095  12.889  -16.027 1.00 8.46  ? 154 HIS A NE2  2  
ATOM 4652  H H    . HIS A 1 154 ? 24.923  9.730   -12.669 1.00 5.45  ? 154 HIS A H    2  
ATOM 4653  H HA   . HIS A 1 154 ? 26.531  9.434   -15.055 1.00 6.12  ? 154 HIS A HA   2  
ATOM 4654  H HB2  . HIS A 1 154 ? 25.599  11.637  -14.454 1.00 6.69  ? 154 HIS A HB2  2  
ATOM 4655  H HB3  . HIS A 1 154 ? 26.493  11.609  -12.940 1.00 6.79  ? 154 HIS A HB3  2  
ATOM 4656  H HD1  . HIS A 1 154 ? 28.961  12.261  -13.004 1.00 7.56  ? 154 HIS A HD1  2  
ATOM 4657  H HD2  . HIS A 1 154 ? 27.175  12.134  -16.763 1.00 7.91  ? 154 HIS A HD2  2  
ATOM 4658  H HE1  . HIS A 1 154 ? 30.602  13.333  -14.579 1.00 8.95  ? 154 HIS A HE1  2  
ATOM 4659  H HE2  . HIS A 1 154 ? 29.432  13.391  -16.812 1.00 9.08  ? 154 HIS A HE2  2  
ATOM 4660  N N    . HIS A 1 155 ? 28.361  8.168   -13.881 1.00 6.86  ? 155 HIS A N    2  
ATOM 4661  C CA   . HIS A 1 155 ? 29.608  7.628   -13.357 1.00 7.69  ? 155 HIS A CA   2  
ATOM 4662  C C    . HIS A 1 155 ? 30.514  7.159   -14.493 1.00 8.40  ? 155 HIS A C    2  
ATOM 4663  O O    . HIS A 1 155 ? 30.044  6.571   -15.467 1.00 8.69  ? 155 HIS A O    2  
ATOM 4664  C CB   . HIS A 1 155 ? 29.345  6.494   -12.347 1.00 7.95  ? 155 HIS A CB   2  
ATOM 4665  C CG   . HIS A 1 155 ? 28.563  5.325   -12.877 1.00 8.17  ? 155 HIS A CG   2  
ATOM 4666  N ND1  . HIS A 1 155 ? 27.285  5.015   -12.455 1.00 8.40  ? 155 HIS A ND1  2  
ATOM 4667  C CD2  . HIS A 1 155 ? 28.898  4.364   -13.770 1.00 8.48  ? 155 HIS A CD2  2  
ATOM 4668  C CE1  . HIS A 1 155 ? 26.873  3.922   -13.072 1.00 8.78  ? 155 HIS A CE1  2  
ATOM 4669  N NE2  . HIS A 1 155 ? 27.834  3.509   -13.873 1.00 8.83  ? 155 HIS A NE2  2  
ATOM 4670  H H    . HIS A 1 155 ? 27.924  7.725   -14.641 1.00 6.72  ? 155 HIS A H    2  
ATOM 4671  H HA   . HIS A 1 155 ? 30.110  8.433   -12.843 1.00 7.92  ? 155 HIS A HA   2  
ATOM 4672  H HB2  . HIS A 1 155 ? 30.292  6.117   -11.997 1.00 8.01  ? 155 HIS A HB2  2  
ATOM 4673  H HB3  . HIS A 1 155 ? 28.800  6.901   -11.506 1.00 8.23  ? 155 HIS A HB3  2  
ATOM 4674  H HD1  . HIS A 1 155 ? 26.755  5.520   -11.785 1.00 8.44  ? 155 HIS A HD1  2  
ATOM 4675  H HD2  . HIS A 1 155 ? 29.833  4.292   -14.307 1.00 8.62  ? 155 HIS A HD2  2  
ATOM 4676  H HE1  . HIS A 1 155 ? 25.912  3.446   -12.941 1.00 9.16  ? 155 HIS A HE1  2  
ATOM 4677  H HE2  . HIS A 1 155 ? 27.851  2.633   -14.336 1.00 9.24  ? 155 HIS A HE2  2  
ATOM 4678  N N    . HIS A 1 156 ? 31.806  7.444   -14.367 1.00 8.92  ? 156 HIS A N    2  
ATOM 4679  C CA   . HIS A 1 156 ? 32.788  7.072   -15.382 1.00 9.83  ? 156 HIS A CA   2  
ATOM 4680  C C    . HIS A 1 156 ? 34.196  7.189   -14.813 1.00 10.27 ? 156 HIS A C    2  
ATOM 4681  O O    . HIS A 1 156 ? 34.590  8.256   -14.347 1.00 10.47 ? 156 HIS A O    2  
ATOM 4682  C CB   . HIS A 1 156 ? 32.649  7.976   -16.619 1.00 10.32 ? 156 HIS A CB   2  
ATOM 4683  C CG   . HIS A 1 156 ? 33.615  7.664   -17.727 1.00 10.97 ? 156 HIS A CG   2  
ATOM 4684  N ND1  . HIS A 1 156 ? 34.826  8.304   -17.875 1.00 11.47 ? 156 HIS A ND1  2  
ATOM 4685  C CD2  . HIS A 1 156 ? 33.532  6.783   -18.751 1.00 11.42 ? 156 HIS A CD2  2  
ATOM 4686  C CE1  . HIS A 1 156 ? 35.444  7.834   -18.943 1.00 12.17 ? 156 HIS A CE1  2  
ATOM 4687  N NE2  . HIS A 1 156 ? 34.680  6.909   -19.493 1.00 12.15 ? 156 HIS A NE2  2  
ATOM 4688  H H    . HIS A 1 156 ? 32.113  7.921   -13.567 1.00 8.83  ? 156 HIS A H    2  
ATOM 4689  H HA   . HIS A 1 156 ? 32.606  6.048   -15.669 1.00 10.10 ? 156 HIS A HA   2  
ATOM 4690  H HB2  . HIS A 1 156 ? 31.651  7.871   -17.018 1.00 10.37 ? 156 HIS A HB2  2  
ATOM 4691  H HB3  . HIS A 1 156 ? 32.804  9.004   -16.323 1.00 10.38 ? 156 HIS A HB3  2  
ATOM 4692  H HD1  . HIS A 1 156 ? 35.186  9.001   -17.283 1.00 11.46 ? 156 HIS A HD1  2  
ATOM 4693  H HD2  . HIS A 1 156 ? 32.712  6.110   -18.950 1.00 11.38 ? 156 HIS A HD2  2  
ATOM 4694  H HE1  . HIS A 1 156 ? 36.415  8.149   -19.301 1.00 12.78 ? 156 HIS A HE1  2  
ATOM 4695  H HE2  . HIS A 1 156 ? 34.811  6.539   -20.401 1.00 12.73 ? 156 HIS A HE2  2  
ATOM 4696  N N    . HIS A 1 157 ? 34.942  6.095   -14.829 1.00 10.63 ? 157 HIS A N    2  
ATOM 4697  C CA   . HIS A 1 157 ? 36.332  6.123   -14.389 1.00 11.28 ? 157 HIS A CA   2  
ATOM 4698  C C    . HIS A 1 157 ? 37.261  6.087   -15.593 1.00 11.64 ? 157 HIS A C    2  
ATOM 4699  O O    . HIS A 1 157 ? 37.906  5.039   -15.816 1.00 11.96 ? 157 HIS A O    2  
ATOM 4700  C CB   . HIS A 1 157 ? 36.647  4.943   -13.462 1.00 11.62 ? 157 HIS A CB   2  
ATOM 4701  C CG   . HIS A 1 157 ? 35.829  4.902   -12.208 1.00 12.24 ? 157 HIS A CG   2  
ATOM 4702  N ND1  . HIS A 1 157 ? 35.524  3.729   -11.559 1.00 12.87 ? 157 HIS A ND1  2  
ATOM 4703  C CD2  . HIS A 1 157 ? 35.258  5.891   -11.482 1.00 12.51 ? 157 HIS A CD2  2  
ATOM 4704  C CE1  . HIS A 1 157 ? 34.798  3.993   -10.491 1.00 13.46 ? 157 HIS A CE1  2  
ATOM 4705  N NE2  . HIS A 1 157 ? 34.624  5.299   -10.417 1.00 13.27 ? 157 HIS A NE2  2  
ATOM 4706  O OXT  . HIS A 1 157 ? 37.315  7.099   -16.321 1.00 11.78 ? 157 HIS A OXT  2  
ATOM 4707  H H    . HIS A 1 157 ? 34.552  5.248   -15.140 1.00 10.60 ? 157 HIS A H    2  
ATOM 4708  H HA   . HIS A 1 157 ? 36.490  7.047   -13.854 1.00 11.48 ? 157 HIS A HA   2  
ATOM 4709  H HB2  . HIS A 1 157 ? 36.475  4.022   -13.997 1.00 11.48 ? 157 HIS A HB2  2  
ATOM 4710  H HB3  . HIS A 1 157 ? 37.687  4.995   -13.175 1.00 11.78 ? 157 HIS A HB3  2  
ATOM 4711  H HD1  . HIS A 1 157 ? 35.808  2.823   -11.840 1.00 12.99 ? 157 HIS A HD1  2  
ATOM 4712  H HD2  . HIS A 1 157 ? 35.293  6.948   -11.699 1.00 12.31 ? 157 HIS A HD2  2  
ATOM 4713  H HE1  . HIS A 1 157 ? 34.414  3.263   -9.793  1.00 14.11 ? 157 HIS A HE1  2  
ATOM 4714  H HE2  . HIS A 1 157 ? 33.976  5.742   -9.824  1.00 13.71 ? 157 HIS A HE2  2  
ATOM 4715  N N    . MET A 1 1   ? -37.465 -11.030 -26.293 1.00 49.39 ? 1   MET A N    3  
ATOM 4716  C CA   . MET A 1 1   ? -38.020 -11.564 -25.029 1.00 49.13 ? 1   MET A CA   3  
ATOM 4717  C C    . MET A 1 1   ? -36.889 -11.902 -24.066 1.00 48.56 ? 1   MET A C    3  
ATOM 4718  O O    . MET A 1 1   ? -35.733 -11.983 -24.481 1.00 48.67 ? 1   MET A O    3  
ATOM 4719  C CB   . MET A 1 1   ? -38.863 -12.813 -25.310 1.00 49.37 ? 1   MET A CB   3  
ATOM 4720  C CG   . MET A 1 1   ? -40.065 -12.540 -26.201 1.00 49.76 ? 1   MET A CG   3  
ATOM 4721  S SD   . MET A 1 1   ? -41.017 -14.025 -26.581 1.00 50.09 ? 1   MET A SD   3  
ATOM 4722  C CE   . MET A 1 1   ? -42.327 -13.333 -27.588 1.00 50.23 ? 1   MET A CE   3  
ATOM 4723  H H1   . MET A 1 1   ? -36.846 -11.741 -26.740 1.00 49.42 ? 1   MET A H1   3  
ATOM 4724  H H2   . MET A 1 1   ? -36.899 -10.175 -26.105 1.00 49.34 ? 1   MET A H2   3  
ATOM 4725  H H3   . MET A 1 1   ? -38.231 -10.788 -26.959 1.00 49.65 ? 1   MET A H3   3  
ATOM 4726  H HA   . MET A 1 1   ? -38.647 -10.805 -24.581 1.00 49.25 ? 1   MET A HA   3  
ATOM 4727  H HB2  . MET A 1 1   ? -38.241 -13.551 -25.797 1.00 49.42 ? 1   MET A HB2  3  
ATOM 4728  H HB3  . MET A 1 1   ? -39.218 -13.213 -24.372 1.00 49.25 ? 1   MET A HB3  3  
ATOM 4729  H HG2  . MET A 1 1   ? -40.713 -11.839 -25.699 1.00 49.89 ? 1   MET A HG2  3  
ATOM 4730  H HG3  . MET A 1 1   ? -39.718 -12.106 -27.127 1.00 49.76 ? 1   MET A HG3  3  
ATOM 4731  H HE1  . MET A 1 1   ? -43.006 -14.118 -27.890 1.00 50.46 ? 1   MET A HE1  3  
ATOM 4732  H HE2  . MET A 1 1   ? -41.901 -12.870 -28.464 1.00 50.28 ? 1   MET A HE2  3  
ATOM 4733  H HE3  . MET A 1 1   ? -42.867 -12.593 -27.016 1.00 50.08 ? 1   MET A HE3  3  
ATOM 4734  N N    . GLY A 1 2   ? -37.216 -12.101 -22.791 1.00 47.99 ? 2   GLY A N    3  
ATOM 4735  C CA   . GLY A 1 2   ? -36.188 -12.342 -21.797 1.00 47.44 ? 2   GLY A CA   3  
ATOM 4736  C C    . GLY A 1 2   ? -36.251 -13.735 -21.200 1.00 46.69 ? 2   GLY A C    3  
ATOM 4737  O O    . GLY A 1 2   ? -35.247 -14.451 -21.172 1.00 46.54 ? 2   GLY A O    3  
ATOM 4738  H H    . GLY A 1 2   ? -38.161 -12.088 -22.525 1.00 47.97 ? 2   GLY A H    3  
ATOM 4739  H HA2  . GLY A 1 2   ? -35.221 -12.209 -22.260 1.00 47.53 ? 2   GLY A HA2  3  
ATOM 4740  H HA3  . GLY A 1 2   ? -36.293 -11.618 -21.003 1.00 47.53 ? 2   GLY A HA3  3  
ATOM 4741  N N    . GLN A 1 3   ? -37.423 -14.115 -20.709 1.00 46.26 ? 3   GLN A N    3  
ATOM 4742  C CA   . GLN A 1 3   ? -37.607 -15.417 -20.080 1.00 45.58 ? 3   GLN A CA   3  
ATOM 4743  C C    . GLN A 1 3   ? -38.354 -16.364 -21.010 1.00 45.14 ? 3   GLN A C    3  
ATOM 4744  O O    . GLN A 1 3   ? -39.065 -15.918 -21.910 1.00 45.18 ? 3   GLN A O    3  
ATOM 4745  C CB   . GLN A 1 3   ? -38.385 -15.274 -18.767 1.00 45.54 ? 3   GLN A CB   3  
ATOM 4746  C CG   . GLN A 1 3   ? -37.691 -14.412 -17.727 1.00 45.20 ? 3   GLN A CG   3  
ATOM 4747  C CD   . GLN A 1 3   ? -38.454 -14.367 -16.420 1.00 45.11 ? 3   GLN A CD   3  
ATOM 4748  O OE1  . GLN A 1 3   ? -38.238 -15.196 -15.536 1.00 45.20 ? 3   GLN A OE1  3  
ATOM 4749  N NE2  . GLN A 1 3   ? -39.358 -13.410 -16.293 1.00 45.01 ? 3   GLN A NE2  3  
ATOM 4750  H H    . GLN A 1 3   ? -38.189 -13.514 -20.782 1.00 46.44 ? 3   GLN A H    3  
ATOM 4751  H HA   . GLN A 1 3   ? -36.630 -15.828 -19.870 1.00 45.45 ? 3   GLN A HA   3  
ATOM 4752  H HB2  . GLN A 1 3   ? -39.347 -14.837 -18.983 1.00 45.96 ? 3   GLN A HB2  3  
ATOM 4753  H HB3  . GLN A 1 3   ? -38.538 -16.256 -18.342 1.00 45.41 ? 3   GLN A HB3  3  
ATOM 4754  H HG2  . GLN A 1 3   ? -36.706 -14.815 -17.538 1.00 45.03 ? 3   GLN A HG2  3  
ATOM 4755  H HG3  . GLN A 1 3   ? -37.601 -13.406 -18.110 1.00 45.22 ? 3   GLN A HG3  3  
ATOM 4756  H HE21 . GLN A 1 3   ? -39.483 -12.784 -17.040 1.00 44.98 ? 3   GLN A HE21 3  
ATOM 4757  H HE22 . GLN A 1 3   ? -39.856 -13.355 -15.451 1.00 44.99 ? 3   GLN A HE22 3  
ATOM 4758  N N    . PRO A 1 4   ? -38.178 -17.686 -20.818 1.00 44.78 ? 4   PRO A N    3  
ATOM 4759  C CA   . PRO A 1 4   ? -38.933 -18.710 -21.551 1.00 44.40 ? 4   PRO A CA   3  
ATOM 4760  C C    . PRO A 1 4   ? -40.459 -18.499 -21.509 1.00 43.91 ? 4   PRO A C    3  
ATOM 4761  O O    . PRO A 1 4   ? -41.105 -18.539 -22.557 1.00 43.73 ? 4   PRO A O    3  
ATOM 4762  C CB   . PRO A 1 4   ? -38.536 -20.018 -20.862 1.00 44.25 ? 4   PRO A CB   3  
ATOM 4763  C CG   . PRO A 1 4   ? -37.196 -19.748 -20.284 1.00 44.46 ? 4   PRO A CG   3  
ATOM 4764  C CD   . PRO A 1 4   ? -37.190 -18.292 -19.899 1.00 44.80 ? 4   PRO A CD   3  
ATOM 4765  H HA   . PRO A 1 4   ? -38.620 -18.746 -22.585 1.00 44.62 ? 4   PRO A HA   3  
ATOM 4766  H HB2  . PRO A 1 4   ? -39.258 -20.258 -20.093 1.00 43.90 ? 4   PRO A HB2  3  
ATOM 4767  H HB3  . PRO A 1 4   ? -38.497 -20.813 -21.588 1.00 44.42 ? 4   PRO A HB3  3  
ATOM 4768  H HG2  . PRO A 1 4   ? -37.044 -20.366 -19.411 1.00 44.24 ? 4   PRO A HG2  3  
ATOM 4769  H HG3  . PRO A 1 4   ? -36.431 -19.944 -21.020 1.00 44.66 ? 4   PRO A HG3  3  
ATOM 4770  H HD2  . PRO A 1 4   ? -37.497 -18.173 -18.871 1.00 44.65 ? 4   PRO A HD2  3  
ATOM 4771  H HD3  . PRO A 1 4   ? -36.209 -17.867 -20.052 1.00 45.22 ? 4   PRO A HD3  3  
ATOM 4772  N N    . PRO A 1 5   ? -41.077 -18.288 -20.319 1.00 43.76 ? 5   PRO A N    3  
ATOM 4773  C CA   . PRO A 1 5   ? -42.511 -17.997 -20.242 1.00 43.36 ? 5   PRO A CA   3  
ATOM 4774  C C    . PRO A 1 5   ? -42.839 -16.597 -20.758 1.00 42.76 ? 5   PRO A C    3  
ATOM 4775  O O    . PRO A 1 5   ? -42.323 -15.598 -20.254 1.00 42.58 ? 5   PRO A O    3  
ATOM 4776  C CB   . PRO A 1 5   ? -42.837 -18.097 -18.742 1.00 43.41 ? 5   PRO A CB   3  
ATOM 4777  C CG   . PRO A 1 5   ? -41.635 -18.715 -18.111 1.00 43.89 ? 5   PRO A CG   3  
ATOM 4778  C CD   . PRO A 1 5   ? -40.474 -18.336 -18.980 1.00 44.02 ? 5   PRO A CD   3  
ATOM 4779  H HA   . PRO A 1 5   ? -43.093 -18.726 -20.788 1.00 43.54 ? 5   PRO A HA   3  
ATOM 4780  H HB2  . PRO A 1 5   ? -43.025 -17.108 -18.348 1.00 42.99 ? 5   PRO A HB2  3  
ATOM 4781  H HB3  . PRO A 1 5   ? -43.714 -18.716 -18.603 1.00 43.59 ? 5   PRO A HB3  3  
ATOM 4782  H HG2  . PRO A 1 5   ? -41.500 -18.324 -17.115 1.00 43.87 ? 5   PRO A HG2  3  
ATOM 4783  H HG3  . PRO A 1 5   ? -41.746 -19.789 -18.083 1.00 44.19 ? 5   PRO A HG3  3  
ATOM 4784  H HD2  . PRO A 1 5   ? -40.085 -17.370 -18.694 1.00 43.91 ? 5   PRO A HD2  3  
ATOM 4785  H HD3  . PRO A 1 5   ? -39.703 -19.090 -18.934 1.00 44.45 ? 5   PRO A HD3  3  
ATOM 4786  N N    . ALA A 1 6   ? -43.709 -16.541 -21.752 1.00 42.50 ? 6   ALA A N    3  
ATOM 4787  C CA   . ALA A 1 6   ? -44.143 -15.277 -22.335 1.00 41.97 ? 6   ALA A CA   3  
ATOM 4788  C C    . ALA A 1 6   ? -45.562 -14.962 -21.880 1.00 41.42 ? 6   ALA A C    3  
ATOM 4789  O O    . ALA A 1 6   ? -46.232 -14.078 -22.418 1.00 41.39 ? 6   ALA A O    3  
ATOM 4790  C CB   . ALA A 1 6   ? -44.059 -15.342 -23.857 1.00 42.03 ? 6   ALA A CB   3  
ATOM 4791  H H    . ALA A 1 6   ? -44.080 -17.381 -22.108 1.00 42.71 ? 6   ALA A H    3  
ATOM 4792  H HA   . ALA A 1 6   ? -43.480 -14.498 -21.986 1.00 42.00 ? 6   ALA A HA   3  
ATOM 4793  H HB1  . ALA A 1 6   ? -44.678 -16.151 -24.217 1.00 42.08 ? 6   ALA A HB1  3  
ATOM 4794  H HB2  . ALA A 1 6   ? -43.035 -15.514 -24.155 1.00 42.08 ? 6   ALA A HB2  3  
ATOM 4795  H HB3  . ALA A 1 6   ? -44.404 -14.409 -24.277 1.00 42.02 ? 6   ALA A HB3  3  
ATOM 4796  N N    . GLU A 1 7   ? -46.007 -15.701 -20.875 1.00 41.05 ? 7   GLU A N    3  
ATOM 4797  C CA   . GLU A 1 7   ? -47.346 -15.538 -20.326 1.00 40.56 ? 7   GLU A CA   3  
ATOM 4798  C C    . GLU A 1 7   ? -47.334 -14.487 -19.213 1.00 40.16 ? 7   GLU A C    3  
ATOM 4799  O O    . GLU A 1 7   ? -48.370 -13.936 -18.843 1.00 40.13 ? 7   GLU A O    3  
ATOM 4800  C CB   . GLU A 1 7   ? -47.849 -16.889 -19.796 1.00 40.61 ? 7   GLU A CB   3  
ATOM 4801  C CG   . GLU A 1 7   ? -49.322 -16.912 -19.425 1.00 40.78 ? 7   GLU A CG   3  
ATOM 4802  C CD   . GLU A 1 7   ? -49.778 -18.288 -18.972 1.00 41.03 ? 7   GLU A CD   3  
ATOM 4803  O OE1  . GLU A 1 7   ? -49.479 -18.673 -17.819 1.00 40.82 ? 7   GLU A OE1  3  
ATOM 4804  O OE2  . GLU A 1 7   ? -50.430 -18.999 -19.763 1.00 41.50 ? 7   GLU A OE2  3  
ATOM 4805  H H    . GLU A 1 7   ? -45.417 -16.381 -20.491 1.00 41.14 ? 7   GLU A H    3  
ATOM 4806  H HA   . GLU A 1 7   ? -47.997 -15.204 -21.121 1.00 40.51 ? 7   GLU A HA   3  
ATOM 4807  H HB2  . GLU A 1 7   ? -47.682 -17.642 -20.552 1.00 40.72 ? 7   GLU A HB2  3  
ATOM 4808  H HB3  . GLU A 1 7   ? -47.280 -17.150 -18.916 1.00 40.47 ? 7   GLU A HB3  3  
ATOM 4809  H HG2  . GLU A 1 7   ? -49.492 -16.206 -18.624 1.00 40.98 ? 7   GLU A HG2  3  
ATOM 4810  H HG3  . GLU A 1 7   ? -49.901 -16.620 -20.290 1.00 40.58 ? 7   GLU A HG3  3  
ATOM 4811  N N    . GLU A 1 8   ? -46.140 -14.194 -18.707 1.00 39.89 ? 8   GLU A N    3  
ATOM 4812  C CA   . GLU A 1 8   ? -45.981 -13.241 -17.618 1.00 39.55 ? 8   GLU A CA   3  
ATOM 4813  C C    . GLU A 1 8   ? -45.758 -11.830 -18.156 1.00 39.08 ? 8   GLU A C    3  
ATOM 4814  O O    . GLU A 1 8   ? -44.777 -11.563 -18.855 1.00 38.77 ? 8   GLU A O    3  
ATOM 4815  C CB   . GLU A 1 8   ? -44.808 -13.649 -16.726 1.00 39.61 ? 8   GLU A CB   3  
ATOM 4816  C CG   . GLU A 1 8   ? -44.901 -15.076 -16.203 1.00 39.77 ? 8   GLU A CG   3  
ATOM 4817  C CD   . GLU A 1 8   ? -46.165 -15.331 -15.406 1.00 40.05 ? 8   GLU A CD   3  
ATOM 4818  O OE1  . GLU A 1 8   ? -46.270 -14.815 -14.275 1.00 40.33 ? 8   GLU A OE1  3  
ATOM 4819  O OE2  . GLU A 1 8   ? -47.058 -16.047 -15.901 1.00 40.04 ? 8   GLU A OE2  3  
ATOM 4820  H H    . GLU A 1 8   ? -45.346 -14.627 -19.079 1.00 39.97 ? 8   GLU A H    3  
ATOM 4821  H HA   . GLU A 1 8   ? -46.886 -13.249 -17.033 1.00 39.67 ? 8   GLU A HA   3  
ATOM 4822  H HB2  . GLU A 1 8   ? -43.893 -13.559 -17.292 1.00 39.61 ? 8   GLU A HB2  3  
ATOM 4823  H HB3  . GLU A 1 8   ? -44.766 -12.979 -15.879 1.00 39.59 ? 8   GLU A HB3  3  
ATOM 4824  H HG2  . GLU A 1 8   ? -44.883 -15.754 -17.044 1.00 39.75 ? 8   GLU A HG2  3  
ATOM 4825  H HG3  . GLU A 1 8   ? -44.048 -15.268 -15.569 1.00 39.76 ? 8   GLU A HG3  3  
ATOM 4826  N N    . ALA A 1 9   ? -46.676 -10.934 -17.829 1.00 39.09 ? 9   ALA A N    3  
ATOM 4827  C CA   . ALA A 1 9   ? -46.585 -9.550  -18.268 1.00 38.75 ? 9   ALA A CA   3  
ATOM 4828  C C    . ALA A 1 9   ? -45.907 -8.689  -17.209 1.00 38.56 ? 9   ALA A C    3  
ATOM 4829  O O    . ALA A 1 9   ? -46.294 -8.704  -16.038 1.00 38.67 ? 9   ALA A O    3  
ATOM 4830  C CB   . ALA A 1 9   ? -47.971 -9.007  -18.598 1.00 38.76 ? 9   ALA A CB   3  
ATOM 4831  H H    . ALA A 1 9   ? -47.440 -11.213 -17.271 1.00 39.39 ? 9   ALA A H    3  
ATOM 4832  H HA   . ALA A 1 9   ? -45.990 -9.526  -19.169 1.00 38.69 ? 9   ALA A HA   3  
ATOM 4833  H HB1  . ALA A 1 9   ? -47.885 -7.997  -18.967 1.00 38.80 ? 9   ALA A HB1  3  
ATOM 4834  H HB2  . ALA A 1 9   ? -48.586 -9.015  -17.707 1.00 38.76 ? 9   ALA A HB2  3  
ATOM 4835  H HB3  . ALA A 1 9   ? -48.427 -9.628  -19.354 1.00 38.78 ? 9   ALA A HB3  3  
ATOM 4836  N N    . GLU A 1 10  ? -44.886 -7.950  -17.630 1.00 38.35 ? 10  GLU A N    3  
ATOM 4837  C CA   . GLU A 1 10  ? -44.148 -7.064  -16.740 1.00 38.21 ? 10  GLU A CA   3  
ATOM 4838  C C    . GLU A 1 10  ? -43.808 -5.768  -17.470 1.00 37.73 ? 10  GLU A C    3  
ATOM 4839  O O    . GLU A 1 10  ? -42.856 -5.072  -17.119 1.00 37.49 ? 10  GLU A O    3  
ATOM 4840  C CB   . GLU A 1 10  ? -42.862 -7.743  -16.250 1.00 38.40 ? 10  GLU A CB   3  
ATOM 4841  C CG   . GLU A 1 10  ? -41.930 -8.172  -17.371 1.00 38.59 ? 10  GLU A CG   3  
ATOM 4842  C CD   . GLU A 1 10  ? -40.592 -8.657  -16.861 1.00 38.73 ? 10  GLU A CD   3  
ATOM 4843  O OE1  . GLU A 1 10  ? -39.703 -7.815  -16.616 1.00 38.82 ? 10  GLU A OE1  3  
ATOM 4844  O OE2  . GLU A 1 10  ? -40.427 -9.883  -16.688 1.00 38.81 ? 10  GLU A OE2  3  
ATOM 4845  H H    . GLU A 1 10  ? -44.614 -8.000  -18.568 1.00 38.34 ? 10  GLU A H    3  
ATOM 4846  H HA   . GLU A 1 10  ? -44.779 -6.839  -15.894 1.00 38.39 ? 10  GLU A HA   3  
ATOM 4847  H HB2  . GLU A 1 10  ? -42.326 -7.056  -15.613 1.00 38.43 ? 10  GLU A HB2  3  
ATOM 4848  H HB3  . GLU A 1 10  ? -43.127 -8.620  -15.678 1.00 38.43 ? 10  GLU A HB3  3  
ATOM 4849  H HG2  . GLU A 1 10  ? -42.399 -8.973  -17.922 1.00 38.64 ? 10  GLU A HG2  3  
ATOM 4850  H HG3  . GLU A 1 10  ? -41.766 -7.331  -18.029 1.00 38.66 ? 10  GLU A HG3  3  
ATOM 4851  N N    . GLN A 1 11  ? -44.616 -5.432  -18.467 1.00 37.65 ? 11  GLN A N    3  
ATOM 4852  C CA   . GLN A 1 11  ? -44.303 -4.320  -19.345 1.00 37.26 ? 11  GLN A CA   3  
ATOM 4853  C C    . GLN A 1 11  ? -45.063 -3.057  -18.929 1.00 36.82 ? 11  GLN A C    3  
ATOM 4854  O O    . GLN A 1 11  ? -46.292 -3.043  -18.843 1.00 36.78 ? 11  GLN A O    3  
ATOM 4855  C CB   . GLN A 1 11  ? -44.590 -4.683  -20.807 1.00 37.34 ? 11  GLN A CB   3  
ATOM 4856  C CG   . GLN A 1 11  ? -46.049 -4.968  -21.110 1.00 37.71 ? 11  GLN A CG   3  
ATOM 4857  C CD   . GLN A 1 11  ? -46.267 -5.370  -22.556 1.00 37.79 ? 11  GLN A CD   3  
ATOM 4858  O OE1  . GLN A 1 11  ? -46.428 -4.520  -23.430 1.00 37.58 ? 11  GLN A OE1  3  
ATOM 4859  N NE2  . GLN A 1 11  ? -46.305 -6.667  -22.813 1.00 38.16 ? 11  GLN A NE2  3  
ATOM 4860  H H    . GLN A 1 11  ? -45.464 -5.916  -18.582 1.00 37.91 ? 11  GLN A H    3  
ATOM 4861  H HA   . GLN A 1 11  ? -43.243 -4.122  -19.243 1.00 37.29 ? 11  GLN A HA   3  
ATOM 4862  H HB2  . GLN A 1 11  ? -44.273 -3.863  -21.435 1.00 37.36 ? 11  GLN A HB2  3  
ATOM 4863  H HB3  . GLN A 1 11  ? -44.014 -5.560  -21.063 1.00 37.16 ? 11  GLN A HB3  3  
ATOM 4864  H HG2  . GLN A 1 11  ? -46.385 -5.773  -20.474 1.00 37.78 ? 11  GLN A HG2  3  
ATOM 4865  H HG3  . GLN A 1 11  ? -46.630 -4.080  -20.905 1.00 37.94 ? 11  GLN A HG3  3  
ATOM 4866  H HE21 . GLN A 1 11  ? -46.195 -7.290  -22.065 1.00 38.35 ? 11  GLN A HE21 3  
ATOM 4867  H HE22 . GLN A 1 11  ? -46.455 -6.950  -23.739 1.00 38.26 ? 11  GLN A HE22 3  
ATOM 4868  N N    . PRO A 1 12  ? -44.311 -1.999  -18.619 1.00 36.56 ? 12  PRO A N    3  
ATOM 4869  C CA   . PRO A 1 12  ? -44.866 -0.703  -18.217 1.00 36.18 ? 12  PRO A CA   3  
ATOM 4870  C C    . PRO A 1 12  ? -45.699 -0.058  -19.319 1.00 35.97 ? 12  PRO A C    3  
ATOM 4871  O O    . PRO A 1 12  ? -46.894 0.193   -19.141 1.00 36.19 ? 12  PRO A O    3  
ATOM 4872  C CB   . PRO A 1 12  ? -43.624 0.147   -17.923 1.00 36.06 ? 12  PRO A CB   3  
ATOM 4873  C CG   . PRO A 1 12  ? -42.529 -0.841  -17.706 1.00 36.50 ? 12  PRO A CG   3  
ATOM 4874  C CD   . PRO A 1 12  ? -42.847 -1.996  -18.603 1.00 36.70 ? 12  PRO A CD   3  
ATOM 4875  H HA   . PRO A 1 12  ? -45.464 -0.790  -17.322 1.00 36.21 ? 12  PRO A HA   3  
ATOM 4876  H HB2  . PRO A 1 12  ? -43.418 0.791   -18.766 1.00 35.77 ? 12  PRO A HB2  3  
ATOM 4877  H HB3  . PRO A 1 12  ? -43.798 0.745   -17.040 1.00 36.04 ? 12  PRO A HB3  3  
ATOM 4878  H HG2  . PRO A 1 12  ? -41.579 -0.406  -17.976 1.00 36.44 ? 12  PRO A HG2  3  
ATOM 4879  H HG3  . PRO A 1 12  ? -42.521 -1.161  -16.675 1.00 36.79 ? 12  PRO A HG3  3  
ATOM 4880  H HD2  . PRO A 1 12  ? -42.452 -1.828  -19.594 1.00 36.66 ? 12  PRO A HD2  3  
ATOM 4881  H HD3  . PRO A 1 12  ? -42.467 -2.923  -18.191 1.00 37.04 ? 12  PRO A HD3  3  
ATOM 4882  N N    . GLY A 1 13  ? -45.061 0.207   -20.454 1.00 35.61 ? 13  GLY A N    3  
ATOM 4883  C CA   . GLY A 1 13  ? -45.748 0.810   -21.581 1.00 35.47 ? 13  GLY A CA   3  
ATOM 4884  C C    . GLY A 1 13  ? -44.787 1.505   -22.517 1.00 35.16 ? 13  GLY A C    3  
ATOM 4885  O O    . GLY A 1 13  ? -44.266 2.572   -22.187 1.00 35.17 ? 13  GLY A O    3  
ATOM 4886  H H    . GLY A 1 13  ? -44.104 0.004   -20.522 1.00 35.50 ? 13  GLY A H    3  
ATOM 4887  H HA2  . GLY A 1 13  ? -46.273 0.036   -22.123 1.00 35.46 ? 13  GLY A HA2  3  
ATOM 4888  H HA3  . GLY A 1 13  ? -46.463 1.531   -21.213 1.00 35.66 ? 13  GLY A HA3  3  
ATOM 4889  N N    . ALA A 1 14  ? -44.560 0.903   -23.685 1.00 34.97 ? 14  ALA A N    3  
ATOM 4890  C CA   . ALA A 1 14  ? -43.561 1.387   -24.634 1.00 34.74 ? 14  ALA A CA   3  
ATOM 4891  C C    . ALA A 1 14  ? -42.187 1.386   -23.979 1.00 34.24 ? 14  ALA A C    3  
ATOM 4892  O O    . ALA A 1 14  ? -41.617 2.442   -23.697 1.00 34.14 ? 14  ALA A O    3  
ATOM 4893  C CB   . ALA A 1 14  ? -43.911 2.779   -25.158 1.00 35.03 ? 14  ALA A CB   3  
ATOM 4894  H H    . ALA A 1 14  ? -45.081 0.099   -23.914 1.00 35.02 ? 14  ALA A H    3  
ATOM 4895  H HA   . ALA A 1 14  ? -43.544 0.702   -25.473 1.00 34.81 ? 14  ALA A HA   3  
ATOM 4896  H HB1  . ALA A 1 14  ? -43.185 3.081   -25.897 1.00 35.15 ? 14  ALA A HB1  3  
ATOM 4897  H HB2  . ALA A 1 14  ? -43.903 3.484   -24.338 1.00 35.06 ? 14  ALA A HB2  3  
ATOM 4898  H HB3  . ALA A 1 14  ? -44.893 2.759   -25.604 1.00 35.13 ? 14  ALA A HB3  3  
ATOM 4899  N N    . LEU A 1 15  ? -41.677 0.175   -23.733 1.00 34.01 ? 15  LEU A N    3  
ATOM 4900  C CA   . LEU A 1 15  ? -40.425 -0.027  -23.006 1.00 33.60 ? 15  LEU A CA   3  
ATOM 4901  C C    . LEU A 1 15  ? -40.596 0.353   -21.537 1.00 33.26 ? 15  LEU A C    3  
ATOM 4902  O O    . LEU A 1 15  ? -41.719 0.462   -21.043 1.00 33.39 ? 15  LEU A O    3  
ATOM 4903  C CB   . LEU A 1 15  ? -39.279 0.777   -23.640 1.00 33.42 ? 15  LEU A CB   3  
ATOM 4904  C CG   . LEU A 1 15  ? -38.932 0.388   -25.080 1.00 33.48 ? 15  LEU A CG   3  
ATOM 4905  C CD1  . LEU A 1 15  ? -37.878 1.333   -25.649 1.00 33.70 ? 15  LEU A CD1  3  
ATOM 4906  C CD2  . LEU A 1 15  ? -38.453 -1.055  -25.130 1.00 33.25 ? 15  LEU A CD2  3  
ATOM 4907  H H    . LEU A 1 15  ? -42.169 -0.610  -24.045 1.00 34.17 ? 15  LEU A H    3  
ATOM 4908  H HA   . LEU A 1 15  ? -40.182 -1.077  -23.059 1.00 33.74 ? 15  LEU A HA   3  
ATOM 4909  H HB2  . LEU A 1 15  ? -39.551 1.823   -23.625 1.00 33.66 ? 15  LEU A HB2  3  
ATOM 4910  H HB3  . LEU A 1 15  ? -38.397 0.643   -23.033 1.00 33.10 ? 15  LEU A HB3  3  
ATOM 4911  H HG   . LEU A 1 15  ? -39.818 0.470   -25.693 1.00 33.61 ? 15  LEU A HG   3  
ATOM 4912  H HD11 . LEU A 1 15  ? -36.981 1.280   -25.049 1.00 33.68 ? 15  LEU A HD11 3  
ATOM 4913  H HD12 . LEU A 1 15  ? -38.259 2.346   -25.636 1.00 33.80 ? 15  LEU A HD12 3  
ATOM 4914  H HD13 . LEU A 1 15  ? -37.649 1.050   -26.666 1.00 33.84 ? 15  LEU A HD13 3  
ATOM 4915  H HD21 . LEU A 1 15  ? -37.573 -1.163  -24.515 1.00 33.24 ? 15  LEU A HD21 3  
ATOM 4916  H HD22 . LEU A 1 15  ? -38.218 -1.327  -26.149 1.00 33.21 ? 15  LEU A HD22 3  
ATOM 4917  H HD23 . LEU A 1 15  ? -39.233 -1.705  -24.757 1.00 33.20 ? 15  LEU A HD23 3  
ATOM 4918  N N    . ALA A 1 16  ? -39.482 0.508   -20.840 1.00 32.89 ? 16  ALA A N    3  
ATOM 4919  C CA   . ALA A 1 16  ? -39.492 0.989   -19.472 1.00 32.59 ? 16  ALA A CA   3  
ATOM 4920  C C    . ALA A 1 16  ? -38.712 2.287   -19.407 1.00 31.98 ? 16  ALA A C    3  
ATOM 4921  O O    . ALA A 1 16  ? -37.514 2.312   -19.699 1.00 31.63 ? 16  ALA A O    3  
ATOM 4922  C CB   . ALA A 1 16  ? -38.896 -0.045  -18.526 1.00 32.80 ? 16  ALA A CB   3  
ATOM 4923  H H    . ALA A 1 16  ? -38.622 0.304   -21.262 1.00 32.86 ? 16  ALA A H    3  
ATOM 4924  H HA   . ALA A 1 16  ? -40.518 1.178   -19.184 1.00 32.73 ? 16  ALA A HA   3  
ATOM 4925  H HB1  . ALA A 1 16  ? -39.468 -0.960  -18.584 1.00 32.95 ? 16  ALA A HB1  3  
ATOM 4926  H HB2  . ALA A 1 16  ? -38.923 0.334   -17.514 1.00 32.85 ? 16  ALA A HB2  3  
ATOM 4927  H HB3  . ALA A 1 16  ? -37.872 -0.243  -18.809 1.00 32.80 ? 16  ALA A HB3  3  
ATOM 4928  N N    . ARG A 1 17  ? -39.388 3.367   -19.061 1.00 31.94 ? 17  ARG A N    3  
ATOM 4929  C CA   . ARG A 1 17  ? -38.768 4.682   -19.085 1.00 31.46 ? 17  ARG A CA   3  
ATOM 4930  C C    . ARG A 1 17  ? -39.267 5.552   -17.949 1.00 31.11 ? 17  ARG A C    3  
ATOM 4931  O O    . ARG A 1 17  ? -39.351 6.777   -18.077 1.00 31.11 ? 17  ARG A O    3  
ATOM 4932  C CB   . ARG A 1 17  ? -39.020 5.355   -20.435 1.00 31.72 ? 17  ARG A CB   3  
ATOM 4933  C CG   . ARG A 1 17  ? -38.021 4.928   -21.499 1.00 31.75 ? 17  ARG A CG   3  
ATOM 4934  C CD   . ARG A 1 17  ? -36.625 5.416   -21.144 1.00 31.70 ? 17  ARG A CD   3  
ATOM 4935  N NE   . ARG A 1 17  ? -35.587 4.805   -21.970 1.00 31.67 ? 17  ARG A NE   3  
ATOM 4936  C CZ   . ARG A 1 17  ? -34.285 4.850   -21.673 1.00 31.67 ? 17  ARG A CZ   3  
ATOM 4937  N NH1  . ARG A 1 17  ? -33.864 5.571   -20.639 1.00 31.70 ? 17  ARG A NH1  3  
ATOM 4938  N NH2  . ARG A 1 17  ? -33.404 4.201   -22.428 1.00 31.71 ? 17  ARG A NH2  3  
ATOM 4939  H H    . ARG A 1 17  ? -40.330 3.281   -18.772 1.00 32.30 ? 17  ARG A H    3  
ATOM 4940  H HA   . ARG A 1 17  ? -37.703 4.542   -18.964 1.00 31.22 ? 17  ARG A HA   3  
ATOM 4941  H HB2  . ARG A 1 17  ? -40.015 5.100   -20.773 1.00 31.77 ? 17  ARG A HB2  3  
ATOM 4942  H HB3  . ARG A 1 17  ? -38.952 6.425   -20.312 1.00 31.94 ? 17  ARG A HB3  3  
ATOM 4943  H HG2  . ARG A 1 17  ? -38.013 3.851   -21.558 1.00 31.83 ? 17  ARG A HG2  3  
ATOM 4944  H HG3  . ARG A 1 17  ? -38.311 5.343   -22.451 1.00 31.82 ? 17  ARG A HG3  3  
ATOM 4945  H HD2  . ARG A 1 17  ? -36.588 6.488   -21.277 1.00 31.64 ? 17  ARG A HD2  3  
ATOM 4946  H HD3  . ARG A 1 17  ? -36.432 5.180   -20.109 1.00 31.84 ? 17  ARG A HD3  3  
ATOM 4947  H HE   . ARG A 1 17  ? -35.876 4.318   -22.769 1.00 31.70 ? 17  ARG A HE   3  
ATOM 4948  H HH11 . ARG A 1 17  ? -34.524 6.091   -20.081 1.00 31.72 ? 17  ARG A HH11 3  
ATOM 4949  H HH12 . ARG A 1 17  ? -32.883 5.601   -20.405 1.00 31.76 ? 17  ARG A HH12 3  
ATOM 4950  H HH21 . ARG A 1 17  ? -33.708 3.679   -23.229 1.00 31.75 ? 17  ARG A HH21 3  
ATOM 4951  H HH22 . ARG A 1 17  ? -32.421 4.226   -22.198 1.00 31.77 ? 17  ARG A HH22 3  
ATOM 4952  N N    . GLU A 1 18  ? -39.581 4.913   -16.833 1.00 30.90 ? 18  GLU A N    3  
ATOM 4953  C CA   . GLU A 1 18  ? -39.963 5.626   -15.629 1.00 30.62 ? 18  GLU A CA   3  
ATOM 4954  C C    . GLU A 1 18  ? -38.756 6.369   -15.065 1.00 30.39 ? 18  GLU A C    3  
ATOM 4955  O O    . GLU A 1 18  ? -37.964 5.812   -14.307 1.00 30.35 ? 18  GLU A O    3  
ATOM 4956  C CB   . GLU A 1 18  ? -40.541 4.673   -14.570 1.00 30.67 ? 18  GLU A CB   3  
ATOM 4957  C CG   . GLU A 1 18  ? -41.858 4.016   -14.964 1.00 30.69 ? 18  GLU A CG   3  
ATOM 4958  C CD   . GLU A 1 18  ? -41.699 2.904   -15.986 1.00 30.90 ? 18  GLU A CD   3  
ATOM 4959  O OE1  . GLU A 1 18  ? -41.769 3.189   -17.202 1.00 31.24 ? 18  GLU A OE1  3  
ATOM 4960  O OE2  . GLU A 1 18  ? -41.532 1.740   -15.572 1.00 30.81 ? 18  GLU A OE2  3  
ATOM 4961  H H    . GLU A 1 18  ? -39.568 3.934   -16.823 1.00 30.99 ? 18  GLU A H    3  
ATOM 4962  H HA   . GLU A 1 18  ? -40.719 6.350   -15.903 1.00 30.62 ? 18  GLU A HA   3  
ATOM 4963  H HB2  . GLU A 1 18  ? -39.820 3.892   -14.379 1.00 30.69 ? 18  GLU A HB2  3  
ATOM 4964  H HB3  . GLU A 1 18  ? -40.702 5.228   -13.657 1.00 30.77 ? 18  GLU A HB3  3  
ATOM 4965  H HG2  . GLU A 1 18  ? -42.313 3.598   -14.077 1.00 30.69 ? 18  GLU A HG2  3  
ATOM 4966  H HG3  . GLU A 1 18  ? -42.510 4.773   -15.375 1.00 30.64 ? 18  GLU A HG3  3  
ATOM 4967  N N    . PHE A 1 19  ? -38.611 7.628   -15.469 1.00 30.33 ? 19  PHE A N    3  
ATOM 4968  C CA   . PHE A 1 19  ? -37.523 8.475   -14.992 1.00 30.21 ? 19  PHE A CA   3  
ATOM 4969  C C    . PHE A 1 19  ? -37.678 8.766   -13.502 1.00 29.75 ? 19  PHE A C    3  
ATOM 4970  O O    . PHE A 1 19  ? -36.732 9.192   -12.837 1.00 29.69 ? 19  PHE A O    3  
ATOM 4971  C CB   . PHE A 1 19  ? -37.469 9.784   -15.796 1.00 30.57 ? 19  PHE A CB   3  
ATOM 4972  C CG   . PHE A 1 19  ? -38.718 10.623  -15.704 1.00 30.68 ? 19  PHE A CG   3  
ATOM 4973  C CD1  . PHE A 1 19  ? -39.842 10.296  -16.445 1.00 30.51 ? 19  PHE A CD1  3  
ATOM 4974  C CD2  . PHE A 1 19  ? -38.766 11.734  -14.878 1.00 31.05 ? 19  PHE A CD2  3  
ATOM 4975  C CE1  . PHE A 1 19  ? -40.989 11.062  -16.363 1.00 30.71 ? 19  PHE A CE1  3  
ATOM 4976  C CE2  . PHE A 1 19  ? -39.909 12.503  -14.793 1.00 31.24 ? 19  PHE A CE2  3  
ATOM 4977  C CZ   . PHE A 1 19  ? -41.020 12.171  -15.534 1.00 31.07 ? 19  PHE A CZ   3  
ATOM 4978  H H    . PHE A 1 19  ? -39.240 7.987   -16.130 1.00 30.42 ? 19  PHE A H    3  
ATOM 4979  H HA   . PHE A 1 19  ? -36.600 7.937   -15.143 1.00 30.28 ? 19  PHE A HA   3  
ATOM 4980  H HB2  . PHE A 1 19  ? -36.644 10.381  -15.436 1.00 30.83 ? 19  PHE A HB2  3  
ATOM 4981  H HB3  . PHE A 1 19  ? -37.302 9.547   -16.835 1.00 30.59 ? 19  PHE A HB3  3  
ATOM 4982  H HD1  . PHE A 1 19  ? -39.816 9.430   -17.091 1.00 30.27 ? 19  PHE A HD1  3  
ATOM 4983  H HD2  . PHE A 1 19  ? -37.896 11.997  -14.296 1.00 31.23 ? 19  PHE A HD2  3  
ATOM 4984  H HE1  . PHE A 1 19  ? -41.858 10.798  -16.946 1.00 30.63 ? 19  PHE A HE1  3  
ATOM 4985  H HE2  . PHE A 1 19  ? -39.932 13.364  -14.143 1.00 31.57 ? 19  PHE A HE2  3  
ATOM 4986  H HZ   . PHE A 1 19  ? -41.913 12.772  -15.465 1.00 31.29 ? 19  PHE A HZ   3  
ATOM 4987  N N    . LEU A 1 20  ? -38.879 8.537   -12.986 1.00 29.50 ? 20  LEU A N    3  
ATOM 4988  C CA   . LEU A 1 20  ? -39.143 8.679   -11.566 1.00 29.16 ? 20  LEU A CA   3  
ATOM 4989  C C    . LEU A 1 20  ? -38.769 7.393   -10.841 1.00 28.50 ? 20  LEU A C    3  
ATOM 4990  O O    . LEU A 1 20  ? -39.630 6.584   -10.491 1.00 28.35 ? 20  LEU A O    3  
ATOM 4991  C CB   . LEU A 1 20  ? -40.619 9.008   -11.330 1.00 29.33 ? 20  LEU A CB   3  
ATOM 4992  C CG   . LEU A 1 20  ? -41.099 10.317  -11.953 1.00 29.60 ? 20  LEU A CG   3  
ATOM 4993  C CD1  . LEU A 1 20  ? -42.603 10.464  -11.789 1.00 29.57 ? 20  LEU A CD1  3  
ATOM 4994  C CD2  . LEU A 1 20  ? -40.373 11.500  -11.331 1.00 29.85 ? 20  LEU A CD2  3  
ATOM 4995  H H    . LEU A 1 20  ? -39.602 8.256   -13.578 1.00 29.61 ? 20  LEU A H    3  
ATOM 4996  H HA   . LEU A 1 20  ? -38.531 9.485   -11.188 1.00 29.36 ? 20  LEU A HA   3  
ATOM 4997  H HB2  . LEU A 1 20  ? -41.211 8.203   -11.741 1.00 29.39 ? 20  LEU A HB2  3  
ATOM 4998  H HB3  . LEU A 1 20  ? -40.793 9.053   -10.266 1.00 29.28 ? 20  LEU A HB3  3  
ATOM 4999  H HG   . LEU A 1 20  ? -40.878 10.306  -13.010 1.00 29.74 ? 20  LEU A HG   3  
ATOM 5000  H HD11 . LEU A 1 20  ? -42.932 11.374  -12.269 1.00 29.64 ? 20  LEU A HD11 3  
ATOM 5001  H HD12 . LEU A 1 20  ? -42.852 10.500  -10.737 1.00 29.62 ? 20  LEU A HD12 3  
ATOM 5002  H HD13 . LEU A 1 20  ? -43.096 9.617   -12.244 1.00 29.51 ? 20  LEU A HD13 3  
ATOM 5003  H HD21 . LEU A 1 20  ? -39.317 11.422  -11.541 1.00 29.89 ? 20  LEU A HD21 3  
ATOM 5004  H HD22 . LEU A 1 20  ? -40.528 11.498  -10.261 1.00 29.82 ? 20  LEU A HD22 3  
ATOM 5005  H HD23 . LEU A 1 20  ? -40.758 12.417  -11.750 1.00 30.10 ? 20  LEU A HD23 3  
ATOM 5006  N N    . ALA A 1 21  ? -37.478 7.192   -10.665 1.00 28.20 ? 21  ALA A N    3  
ATOM 5007  C CA   . ALA A 1 21  ? -36.975 6.005   -10.003 1.00 27.66 ? 21  ALA A CA   3  
ATOM 5008  C C    . ALA A 1 21  ? -35.807 6.361   -9.105  1.00 27.05 ? 21  ALA A C    3  
ATOM 5009  O O    . ALA A 1 21  ? -34.860 7.021   -9.537  1.00 26.92 ? 21  ALA A O    3  
ATOM 5010  C CB   . ALA A 1 21  ? -36.558 4.962   -11.033 1.00 27.59 ? 21  ALA A CB   3  
ATOM 5011  H H    . ALA A 1 21  ? -36.840 7.864   -10.988 1.00 28.40 ? 21  ALA A H    3  
ATOM 5012  H HA   . ALA A 1 21  ? -37.771 5.594   -9.399  1.00 27.85 ? 21  ALA A HA   3  
ATOM 5013  H HB1  . ALA A 1 21  ? -37.401 4.719   -11.664 1.00 27.65 ? 21  ALA A HB1  3  
ATOM 5014  H HB2  . ALA A 1 21  ? -36.216 4.071   -10.527 1.00 27.51 ? 21  ALA A HB2  3  
ATOM 5015  H HB3  . ALA A 1 21  ? -35.756 5.358   -11.640 1.00 27.66 ? 21  ALA A HB3  3  
ATOM 5016  N N    . ALA A 1 22  ? -35.895 5.945   -7.851  1.00 26.78 ? 22  ALA A N    3  
ATOM 5017  C CA   . ALA A 1 22  ? -34.832 6.186   -6.887  1.00 26.29 ? 22  ALA A CA   3  
ATOM 5018  C C    . ALA A 1 22  ? -33.580 5.403   -7.259  1.00 25.93 ? 22  ALA A C    3  
ATOM 5019  O O    . ALA A 1 22  ? -33.527 4.178   -7.101  1.00 26.15 ? 22  ALA A O    3  
ATOM 5020  C CB   . ALA A 1 22  ? -35.288 5.824   -5.478  1.00 26.23 ? 22  ALA A CB   3  
ATOM 5021  H H    . ALA A 1 22  ? -36.703 5.470   -7.561  1.00 26.97 ? 22  ALA A H    3  
ATOM 5022  H HA   . ALA A 1 22  ? -34.601 7.241   -6.907  1.00 26.35 ? 22  ALA A HA   3  
ATOM 5023  H HB1  . ALA A 1 22  ? -36.203 6.351   -5.246  1.00 26.24 ? 22  ALA A HB1  3  
ATOM 5024  H HB2  . ALA A 1 22  ? -34.524 6.105   -4.769  1.00 26.16 ? 22  ALA A HB2  3  
ATOM 5025  H HB3  . ALA A 1 22  ? -35.461 4.759   -5.418  1.00 26.35 ? 22  ALA A HB3  3  
ATOM 5026  N N    . MET A 1 23  ? -32.579 6.109   -7.758  1.00 25.45 ? 23  MET A N    3  
ATOM 5027  C CA   . MET A 1 23  ? -31.327 5.484   -8.155  1.00 25.17 ? 23  MET A CA   3  
ATOM 5028  C C    . MET A 1 23  ? -30.407 5.328   -6.953  1.00 24.29 ? 23  MET A C    3  
ATOM 5029  O O    . MET A 1 23  ? -29.370 5.982   -6.839  1.00 24.04 ? 23  MET A O    3  
ATOM 5030  C CB   . MET A 1 23  ? -30.648 6.284   -9.271  1.00 25.82 ? 23  MET A CB   3  
ATOM 5031  C CG   . MET A 1 23  ? -31.425 6.266   -10.578 1.00 26.18 ? 23  MET A CG   3  
ATOM 5032  S SD   . MET A 1 23  ? -30.597 7.168   -11.899 1.00 26.73 ? 23  MET A SD   3  
ATOM 5033  C CE   . MET A 1 23  ? -31.715 6.825   -13.255 1.00 27.47 ? 23  MET A CE   3  
ATOM 5034  H H    . MET A 1 23  ? -32.680 7.086   -7.856  1.00 25.35 ? 23  MET A H    3  
ATOM 5035  H HA   . MET A 1 23  ? -31.562 4.498   -8.528  1.00 25.23 ? 23  MET A HA   3  
ATOM 5036  H HB2  . MET A 1 23  ? -30.548 7.311   -8.954  1.00 26.04 ? 23  MET A HB2  3  
ATOM 5037  H HB3  . MET A 1 23  ? -29.665 5.872   -9.453  1.00 25.92 ? 23  MET A HB3  3  
ATOM 5038  H HG2  . MET A 1 23  ? -31.555 5.243   -10.893 1.00 26.11 ? 23  MET A HG2  3  
ATOM 5039  H HG3  . MET A 1 23  ? -32.393 6.714   -10.409 1.00 26.28 ? 23  MET A HG3  3  
ATOM 5040  H HE1  . MET A 1 23  ? -31.772 5.758   -13.410 1.00 27.66 ? 23  MET A HE1  3  
ATOM 5041  H HE2  . MET A 1 23  ? -31.354 7.303   -14.152 1.00 27.63 ? 23  MET A HE2  3  
ATOM 5042  H HE3  . MET A 1 23  ? -32.699 7.207   -13.015 1.00 27.66 ? 23  MET A HE3  3  
ATOM 5043  N N    . GLU A 1 24  ? -30.827 4.466   -6.045  1.00 23.92 ? 24  GLU A N    3  
ATOM 5044  C CA   . GLU A 1 24  ? -30.059 4.144   -4.861  1.00 23.15 ? 24  GLU A CA   3  
ATOM 5045  C C    . GLU A 1 24  ? -30.028 2.629   -4.692  1.00 22.22 ? 24  GLU A C    3  
ATOM 5046  O O    . GLU A 1 24  ? -30.958 2.042   -4.133  1.00 22.21 ? 24  GLU A O    3  
ATOM 5047  C CB   . GLU A 1 24  ? -30.674 4.816   -3.625  1.00 23.57 ? 24  GLU A CB   3  
ATOM 5048  C CG   . GLU A 1 24  ? -29.803 4.722   -2.381  1.00 23.67 ? 24  GLU A CG   3  
ATOM 5049  C CD   . GLU A 1 24  ? -28.467 5.409   -2.564  1.00 24.03 ? 24  GLU A CD   3  
ATOM 5050  O OE1  . GLU A 1 24  ? -28.405 6.649   -2.426  1.00 24.41 ? 24  GLU A OE1  3  
ATOM 5051  O OE2  . GLU A 1 24  ? -27.467 4.713   -2.838  1.00 24.02 ? 24  GLU A OE2  3  
ATOM 5052  H H    . GLU A 1 24  ? -31.694 4.025   -6.179  1.00 24.25 ? 24  GLU A H    3  
ATOM 5053  H HA   . GLU A 1 24  ? -29.053 4.506   -5.002  1.00 23.03 ? 24  GLU A HA   3  
ATOM 5054  H HB2  . GLU A 1 24  ? -30.839 5.861   -3.842  1.00 24.07 ? 24  GLU A HB2  3  
ATOM 5055  H HB3  . GLU A 1 24  ? -31.625 4.349   -3.407  1.00 23.42 ? 24  GLU A HB3  3  
ATOM 5056  H HG2  . GLU A 1 24  ? -30.320 5.188   -1.556  1.00 23.64 ? 24  GLU A HG2  3  
ATOM 5057  H HG3  . GLU A 1 24  ? -29.629 3.680   -2.154  1.00 23.64 ? 24  GLU A HG3  3  
ATOM 5058  N N    . PRO A 1 25  ? -28.983 1.974   -5.221  1.00 21.54 ? 25  PRO A N    3  
ATOM 5059  C CA   . PRO A 1 25  ? -28.874 0.515   -5.203  1.00 20.70 ? 25  PRO A CA   3  
ATOM 5060  C C    . PRO A 1 25  ? -28.769 -0.037  -3.790  1.00 19.96 ? 25  PRO A C    3  
ATOM 5061  O O    . PRO A 1 25  ? -28.078 0.529   -2.941  1.00 19.79 ? 25  PRO A O    3  
ATOM 5062  C CB   . PRO A 1 25  ? -27.590 0.234   -5.993  1.00 20.35 ? 25  PRO A CB   3  
ATOM 5063  C CG   . PRO A 1 25  ? -26.806 1.498   -5.919  1.00 20.99 ? 25  PRO A CG   3  
ATOM 5064  C CD   . PRO A 1 25  ? -27.818 2.607   -5.867  1.00 21.63 ? 25  PRO A CD   3  
ATOM 5065  H HA   . PRO A 1 25  ? -29.715 0.053   -5.701  1.00 20.98 ? 25  PRO A HA   3  
ATOM 5066  H HB2  . PRO A 1 25  ? -27.057 -0.587  -5.540  1.00 19.62 ? 25  PRO A HB2  3  
ATOM 5067  H HB3  . PRO A 1 25  ? -27.842 -0.012  -7.014  1.00 20.49 ? 25  PRO A HB3  3  
ATOM 5068  H HG2  . PRO A 1 25  ? -26.199 1.500   -5.026  1.00 20.64 ? 25  PRO A HG2  3  
ATOM 5069  H HG3  . PRO A 1 25  ? -26.186 1.598   -6.798  1.00 21.44 ? 25  PRO A HG3  3  
ATOM 5070  H HD2  . PRO A 1 25  ? -27.448 3.429   -5.273  1.00 21.43 ? 25  PRO A HD2  3  
ATOM 5071  H HD3  . PRO A 1 25  ? -28.065 2.942   -6.863  1.00 22.40 ? 25  PRO A HD3  3  
ATOM 5072  N N    . GLU A 1 26  ? -29.484 -1.129  -3.546  1.00 19.63 ? 26  GLU A N    3  
ATOM 5073  C CA   . GLU A 1 26  ? -29.441 -1.814  -2.260  1.00 19.01 ? 26  GLU A CA   3  
ATOM 5074  C C    . GLU A 1 26  ? -28.005 -2.210  -1.921  1.00 17.82 ? 26  GLU A C    3  
ATOM 5075  O O    . GLU A 1 26  ? -27.280 -2.734  -2.771  1.00 17.39 ? 26  GLU A O    3  
ATOM 5076  C CB   . GLU A 1 26  ? -30.363 -3.044  -2.289  1.00 19.23 ? 26  GLU A CB   3  
ATOM 5077  C CG   . GLU A 1 26  ? -30.071 -4.015  -3.424  1.00 19.90 ? 26  GLU A CG   3  
ATOM 5078  C CD   . GLU A 1 26  ? -31.114 -5.106  -3.540  1.00 20.41 ? 26  GLU A CD   3  
ATOM 5079  O OE1  . GLU A 1 26  ? -31.002 -6.120  -2.824  1.00 20.64 ? 26  GLU A OE1  3  
ATOM 5080  O OE2  . GLU A 1 26  ? -32.057 -4.953  -4.350  1.00 20.67 ? 26  GLU A OE2  3  
ATOM 5081  H H    . GLU A 1 26  ? -30.055 -1.487  -4.253  1.00 19.90 ? 26  GLU A H    3  
ATOM 5082  H HA   . GLU A 1 26  ? -29.796 -1.125  -1.507  1.00 19.36 ? 26  GLU A HA   3  
ATOM 5083  H HB2  . GLU A 1 26  ? -30.256 -3.581  -1.358  1.00 19.06 ? 26  GLU A HB2  3  
ATOM 5084  H HB3  . GLU A 1 26  ? -31.386 -2.711  -2.384  1.00 19.19 ? 26  GLU A HB3  3  
ATOM 5085  H HG2  . GLU A 1 26  ? -30.039 -3.467  -4.353  1.00 20.16 ? 26  GLU A HG2  3  
ATOM 5086  H HG3  . GLU A 1 26  ? -29.110 -4.476  -3.246  1.00 19.91 ? 26  GLU A HG3  3  
ATOM 5087  N N    . PRO A 1 27  ? -27.570 -1.921  -0.685  1.00 17.38 ? 27  PRO A N    3  
ATOM 5088  C CA   . PRO A 1 27  ? -26.197 -2.177  -0.241  1.00 16.31 ? 27  PRO A CA   3  
ATOM 5089  C C    . PRO A 1 27  ? -25.778 -3.628  -0.437  1.00 15.58 ? 27  PRO A C    3  
ATOM 5090  O O    . PRO A 1 27  ? -26.474 -4.554  -0.017  1.00 15.74 ? 27  PRO A O    3  
ATOM 5091  C CB   . PRO A 1 27  ? -26.226 -1.822  1.247   1.00 16.33 ? 27  PRO A CB   3  
ATOM 5092  C CG   . PRO A 1 27  ? -27.369 -0.880  1.391   1.00 17.43 ? 27  PRO A CG   3  
ATOM 5093  C CD   . PRO A 1 27  ? -28.386 -1.315  0.377   1.00 18.02 ? 27  PRO A CD   3  
ATOM 5094  H HA   . PRO A 1 27  ? -25.496 -1.535  -0.750  1.00 16.18 ? 27  PRO A HA   3  
ATOM 5095  H HB2  . PRO A 1 27  ? -26.376 -2.719  1.831   1.00 15.88 ? 27  PRO A HB2  3  
ATOM 5096  H HB3  . PRO A 1 27  ? -25.291 -1.356  1.527   1.00 16.16 ? 27  PRO A HB3  3  
ATOM 5097  H HG2  . PRO A 1 27  ? -27.778 -0.951  2.387   1.00 17.52 ? 27  PRO A HG2  3  
ATOM 5098  H HG3  . PRO A 1 27  ? -27.043 0.130   1.186   1.00 17.81 ? 27  PRO A HG3  3  
ATOM 5099  H HD2  . PRO A 1 27  ? -29.058 -2.043  0.807   1.00 18.21 ? 27  PRO A HD2  3  
ATOM 5100  H HD3  . PRO A 1 27  ? -28.936 -0.466  0.001   1.00 18.75 ? 27  PRO A HD3  3  
ATOM 5101  N N    . ALA A 1 28  ? -24.635 -3.812  -1.078  1.00 14.93 ? 28  ALA A N    3  
ATOM 5102  C CA   . ALA A 1 28  ? -24.129 -5.143  -1.358  1.00 14.31 ? 28  ALA A CA   3  
ATOM 5103  C C    . ALA A 1 28  ? -23.235 -5.637  -0.225  1.00 13.28 ? 28  ALA A C    3  
ATOM 5104  O O    . ALA A 1 28  ? -22.564 -4.840  0.433   1.00 12.82 ? 28  ALA A O    3  
ATOM 5105  C CB   . ALA A 1 28  ? -23.357 -5.147  -2.668  1.00 14.27 ? 28  ALA A CB   3  
ATOM 5106  H H    . ALA A 1 28  ? -24.118 -3.029  -1.366  1.00 14.96 ? 28  ALA A H    3  
ATOM 5107  H HA   . ALA A 1 28  ? -24.975 -5.806  -1.459  1.00 14.81 ? 28  ALA A HA   3  
ATOM 5108  H HB1  . ALA A 1 28  ? -22.501 -4.494  -2.582  1.00 14.09 ? 28  ALA A HB1  3  
ATOM 5109  H HB2  . ALA A 1 28  ? -23.998 -4.801  -3.466  1.00 14.39 ? 28  ALA A HB2  3  
ATOM 5110  H HB3  . ALA A 1 28  ? -23.021 -6.152  -2.882  1.00 14.46 ? 28  ALA A HB3  3  
ATOM 5111  N N    . PRO A 1 29  ? -23.234 -6.957  0.031   1.00 13.06 ? 29  PRO A N    3  
ATOM 5112  C CA   . PRO A 1 29  ? -22.339 -7.567  1.016   1.00 12.21 ? 29  PRO A CA   3  
ATOM 5113  C C    . PRO A 1 29  ? -20.878 -7.392  0.632   1.00 11.34 ? 29  PRO A C    3  
ATOM 5114  O O    . PRO A 1 29  ? -20.473 -7.720  -0.486  1.00 11.36 ? 29  PRO A O    3  
ATOM 5115  C CB   . PRO A 1 29  ? -22.722 -9.051  0.999   1.00 12.51 ? 29  PRO A CB   3  
ATOM 5116  C CG   . PRO A 1 29  ? -23.441 -9.258  -0.289  1.00 13.50 ? 29  PRO A CG   3  
ATOM 5117  C CD   . PRO A 1 29  ? -24.111 -7.951  -0.608  1.00 13.81 ? 29  PRO A CD   3  
ATOM 5118  H HA   . PRO A 1 29  ? -22.495 -7.167  2.005   1.00 12.20 ? 29  PRO A HA   3  
ATOM 5119  H HB2  . PRO A 1 29  ? -21.826 -9.654  1.049   1.00 12.17 ? 29  PRO A HB2  3  
ATOM 5120  H HB3  . PRO A 1 29  ? -23.356 -9.272  1.844   1.00 12.53 ? 29  PRO A HB3  3  
ATOM 5121  H HG2  . PRO A 1 29  ? -22.735 -9.519  -1.064  1.00 13.63 ? 29  PRO A HG2  3  
ATOM 5122  H HG3  . PRO A 1 29  ? -24.178 -10.039 -0.176  1.00 13.98 ? 29  PRO A HG3  3  
ATOM 5123  H HD2  . PRO A 1 29  ? -24.155 -7.797  -1.677  1.00 13.93 ? 29  PRO A HD2  3  
ATOM 5124  H HD3  . PRO A 1 29  ? -25.101 -7.921  -0.179  1.00 14.55 ? 29  PRO A HD3  3  
ATOM 5125  N N    . ALA A 1 30  ? -20.092 -6.883  1.565   1.00 10.76 ? 30  ALA A N    3  
ATOM 5126  C CA   . ALA A 1 30  ? -18.681 -6.637  1.311   1.00 10.06 ? 30  ALA A CA   3  
ATOM 5127  C C    . ALA A 1 30  ? -17.883 -6.540  2.608   1.00 8.93  ? 30  ALA A C    3  
ATOM 5128  O O    . ALA A 1 30  ? -17.495 -5.444  3.020   1.00 8.35  ? 30  ALA A O    3  
ATOM 5129  C CB   . ALA A 1 30  ? -18.492 -5.373  0.474   1.00 10.54 ? 30  ALA A CB   3  
ATOM 5130  H H    . ALA A 1 30  ? -20.466 -6.687  2.453   1.00 10.95 ? 30  ALA A H    3  
ATOM 5131  H HA   . ALA A 1 30  ? -18.306 -7.472  0.739   1.00 10.23 ? 30  ALA A HA   3  
ATOM 5132  H HB1  . ALA A 1 30  ? -19.069 -5.455  -0.433  1.00 10.55 ? 30  ALA A HB1  3  
ATOM 5133  H HB2  . ALA A 1 30  ? -17.446 -5.260  0.226   1.00 10.83 ? 30  ALA A HB2  3  
ATOM 5134  H HB3  . ALA A 1 30  ? -18.823 -4.514  1.036   1.00 10.80 ? 30  ALA A HB3  3  
ATOM 5135  N N    . PRO A 1 31  ? -17.693 -7.673  3.307   1.00 8.82  ? 31  PRO A N    3  
ATOM 5136  C CA   . PRO A 1 31  ? -16.768 -7.755  4.440   1.00 7.95  ? 31  PRO A CA   3  
ATOM 5137  C C    . PRO A 1 31  ? -15.385 -7.221  4.077   1.00 6.75  ? 31  PRO A C    3  
ATOM 5138  O O    . PRO A 1 31  ? -14.602 -7.899  3.408   1.00 6.83  ? 31  PRO A O    3  
ATOM 5139  C CB   . PRO A 1 31  ? -16.699 -9.255  4.743   1.00 8.63  ? 31  PRO A CB   3  
ATOM 5140  C CG   . PRO A 1 31  ? -17.985 -9.812  4.240   1.00 9.60  ? 31  PRO A CG   3  
ATOM 5141  C CD   . PRO A 1 31  ? -18.409 -8.946  3.083   1.00 9.77  ? 31  PRO A CD   3  
ATOM 5142  H HA   . PRO A 1 31  ? -17.148 -7.224  5.303   1.00 7.98  ? 31  PRO A HA   3  
ATOM 5143  H HB2  . PRO A 1 31  ? -15.853 -9.691  4.231   1.00 8.18  ? 31  PRO A HB2  3  
ATOM 5144  H HB3  . PRO A 1 31  ? -16.597 -9.403  5.807   1.00 9.06  ? 31  PRO A HB3  3  
ATOM 5145  H HG2  . PRO A 1 31  ? -17.839 -10.828 3.912   1.00 9.59  ? 31  PRO A HG2  3  
ATOM 5146  H HG3  . PRO A 1 31  ? -18.727 -9.774  5.024   1.00 10.36 ? 31  PRO A HG3  3  
ATOM 5147  H HD2  . PRO A 1 31  ? -18.119 -9.391  2.147   1.00 9.88  ? 31  PRO A HD2  3  
ATOM 5148  H HD3  . PRO A 1 31  ? -19.477 -8.792  3.108   1.00 10.60 ? 31  PRO A HD3  3  
ATOM 5149  N N    . ALA A 1 32  ? -15.105 -5.995  4.489   1.00 5.86  ? 32  ALA A N    3  
ATOM 5150  C CA   . ALA A 1 32  ? -13.852 -5.345  4.157   1.00 4.75  ? 32  ALA A CA   3  
ATOM 5151  C C    . ALA A 1 32  ? -12.981 -5.191  5.397   1.00 3.89  ? 32  ALA A C    3  
ATOM 5152  O O    . ALA A 1 32  ? -13.483 -4.866  6.474   1.00 3.98  ? 32  ALA A O    3  
ATOM 5153  C CB   . ALA A 1 32  ? -14.117 -3.989  3.522   1.00 4.57  ? 32  ALA A CB   3  
ATOM 5154  H H    . ALA A 1 32  ? -15.760 -5.515  5.039   1.00 6.11  ? 32  ALA A H    3  
ATOM 5155  H HA   . ALA A 1 32  ? -13.337 -5.965  3.435   1.00 5.11  ? 32  ALA A HA   3  
ATOM 5156  H HB1  . ALA A 1 32  ? -14.631 -3.356  4.227   1.00 4.83  ? 32  ALA A HB1  3  
ATOM 5157  H HB2  . ALA A 1 32  ? -14.729 -4.115  2.639   1.00 4.63  ? 32  ALA A HB2  3  
ATOM 5158  H HB3  . ALA A 1 32  ? -13.178 -3.531  3.243   1.00 4.62  ? 32  ALA A HB3  3  
ATOM 5159  N N    . PRO A 1 33  ? -11.670 -5.432  5.267   1.00 3.62  ? 33  PRO A N    3  
ATOM 5160  C CA   . PRO A 1 33  ? -10.720 -5.273  6.377   1.00 3.45  ? 33  PRO A CA   3  
ATOM 5161  C C    . PRO A 1 33  ? -10.656 -3.830  6.875   1.00 2.48  ? 33  PRO A C    3  
ATOM 5162  O O    . PRO A 1 33  ? -10.680 -3.575  8.078   1.00 3.06  ? 33  PRO A O    3  
ATOM 5163  C CB   . PRO A 1 33  ? -9.376  -5.683  5.762   1.00 4.15  ? 33  PRO A CB   3  
ATOM 5164  C CG   . PRO A 1 33  ? -9.569  -5.548  4.290   1.00 4.47  ? 33  PRO A CG   3  
ATOM 5165  C CD   . PRO A 1 33  ? -11.006 -5.886  4.034   1.00 4.26  ? 33  PRO A CD   3  
ATOM 5166  H HA   . PRO A 1 33  ? -10.959 -5.929  7.204   1.00 4.15  ? 33  PRO A HA   3  
ATOM 5167  H HB2  . PRO A 1 33  ? -8.598  -5.026  6.121   1.00 4.01  ? 33  PRO A HB2  3  
ATOM 5168  H HB3  . PRO A 1 33  ? -9.149  -6.703  6.037   1.00 4.98  ? 33  PRO A HB3  3  
ATOM 5169  H HG2  . PRO A 1 33  ? -9.363  -4.531  3.988   1.00 4.40  ? 33  PRO A HG2  3  
ATOM 5170  H HG3  . PRO A 1 33  ? -8.919  -6.235  3.769   1.00 5.36  ? 33  PRO A HG3  3  
ATOM 5171  H HD2  . PRO A 1 33  ? -11.374 -5.343  3.175   1.00 4.15  ? 33  PRO A HD2  3  
ATOM 5172  H HD3  . PRO A 1 33  ? -11.129 -6.949  3.895   1.00 5.11  ? 33  PRO A HD3  3  
ATOM 5173  N N    . GLU A 1 34  ? -10.594 -2.897  5.930   1.00 1.57  ? 34  GLU A N    3  
ATOM 5174  C CA   . GLU A 1 34  ? -10.474 -1.477  6.232   1.00 1.27  ? 34  GLU A CA   3  
ATOM 5175  C C    . GLU A 1 34  ? -10.418 -0.694  4.922   1.00 1.08  ? 34  GLU A C    3  
ATOM 5176  O O    . GLU A 1 34  ? -11.243 0.187   4.678   1.00 1.44  ? 34  GLU A O    3  
ATOM 5177  C CB   . GLU A 1 34  ? -9.217  -1.222  7.072   1.00 2.01  ? 34  GLU A CB   3  
ATOM 5178  C CG   . GLU A 1 34  ? -9.126  0.181   7.646   1.00 2.68  ? 34  GLU A CG   3  
ATOM 5179  C CD   . GLU A 1 34  ? -8.025  0.308   8.678   1.00 3.58  ? 34  GLU A CD   3  
ATOM 5180  O OE1  . GLU A 1 34  ? -6.880  -0.083  8.381   1.00 4.13  ? 34  GLU A OE1  3  
ATOM 5181  O OE2  . GLU A 1 34  ? -8.297  0.804   9.785   1.00 4.13  ? 34  GLU A OE2  3  
ATOM 5182  H H    . GLU A 1 34  ? -10.643 -3.173  4.993   1.00 1.90  ? 34  GLU A H    3  
ATOM 5183  H HA   . GLU A 1 34  ? -11.348 -1.173  6.789   1.00 1.85  ? 34  GLU A HA   3  
ATOM 5184  H HB2  . GLU A 1 34  ? -9.200  -1.923  7.894   1.00 2.33  ? 34  GLU A HB2  3  
ATOM 5185  H HB3  . GLU A 1 34  ? -8.348  -1.389  6.452   1.00 2.63  ? 34  GLU A HB3  3  
ATOM 5186  H HG2  . GLU A 1 34  ? -8.931  0.873   6.843   1.00 3.03  ? 34  GLU A HG2  3  
ATOM 5187  H HG3  . GLU A 1 34  ? -10.069 0.427   8.114   1.00 2.92  ? 34  GLU A HG3  3  
ATOM 5188  N N    . GLU A 1 35  ? -9.447  -1.073  4.076   1.00 1.01  ? 35  GLU A N    3  
ATOM 5189  C CA   . GLU A 1 35  ? -9.299  -0.543  2.714   1.00 0.87  ? 35  GLU A CA   3  
ATOM 5190  C C    . GLU A 1 35  ? -8.863  0.922   2.704   1.00 0.73  ? 35  GLU A C    3  
ATOM 5191  O O    . GLU A 1 35  ? -9.618  1.821   3.059   1.00 0.89  ? 35  GLU A O    3  
ATOM 5192  C CB   . GLU A 1 35  ? -10.589 -0.733  1.914   1.00 1.09  ? 35  GLU A CB   3  
ATOM 5193  C CG   . GLU A 1 35  ? -11.063 -2.179  1.888   1.00 1.72  ? 35  GLU A CG   3  
ATOM 5194  C CD   . GLU A 1 35  ? -12.024 -2.462  0.758   1.00 1.94  ? 35  GLU A CD   3  
ATOM 5195  O OE1  . GLU A 1 35  ? -13.196 -2.040  0.869   1.00 2.36  ? 35  GLU A OE1  3  
ATOM 5196  O OE2  . GLU A 1 35  ? -11.618 -3.103  -0.231  1.00 2.45  ? 35  GLU A OE2  3  
ATOM 5197  H H    . GLU A 1 35  ? -8.798  -1.736  4.387   1.00 1.36  ? 35  GLU A H    3  
ATOM 5198  H HA   . GLU A 1 35  ? -8.521  -1.120  2.236   1.00 0.87  ? 35  GLU A HA   3  
ATOM 5199  H HB2  . GLU A 1 35  ? -11.367 -0.127  2.356   1.00 1.33  ? 35  GLU A HB2  3  
ATOM 5200  H HB3  . GLU A 1 35  ? -10.426 -0.410  0.897   1.00 1.44  ? 35  GLU A HB3  3  
ATOM 5201  H HG2  . GLU A 1 35  ? -10.203 -2.822  1.779   1.00 2.41  ? 35  GLU A HG2  3  
ATOM 5202  H HG3  . GLU A 1 35  ? -11.557 -2.396  2.823   1.00 2.23  ? 35  GLU A HG3  3  
ATOM 5203  N N    . TRP A 1 36  ? -7.627  1.147   2.276   1.00 0.53  ? 36  TRP A N    3  
ATOM 5204  C CA   . TRP A 1 36  ? -7.033  2.474   2.306   1.00 0.45  ? 36  TRP A CA   3  
ATOM 5205  C C    . TRP A 1 36  ? -6.876  3.025   0.891   1.00 0.46  ? 36  TRP A C    3  
ATOM 5206  O O    . TRP A 1 36  ? -7.566  2.593   -0.035  1.00 0.52  ? 36  TRP A O    3  
ATOM 5207  C CB   . TRP A 1 36  ? -5.664  2.402   2.984   1.00 0.38  ? 36  TRP A CB   3  
ATOM 5208  C CG   . TRP A 1 36  ? -5.605  1.370   4.065   1.00 0.34  ? 36  TRP A CG   3  
ATOM 5209  C CD1  . TRP A 1 36  ? -6.392  1.305   5.177   1.00 0.39  ? 36  TRP A CD1  3  
ATOM 5210  C CD2  . TRP A 1 36  ? -4.718  0.248   4.132   1.00 0.27  ? 36  TRP A CD2  3  
ATOM 5211  N NE1  . TRP A 1 36  ? -6.055  0.206   5.925   1.00 0.36  ? 36  TRP A NE1  3  
ATOM 5212  C CE2  . TRP A 1 36  ? -5.029  -0.457  5.312   1.00 0.28  ? 36  TRP A CE2  3  
ATOM 5213  C CE3  . TRP A 1 36  ? -3.689  -0.231  3.317   1.00 0.21  ? 36  TRP A CE3  3  
ATOM 5214  C CZ2  . TRP A 1 36  ? -4.352  -1.614  5.687   1.00 0.24  ? 36  TRP A CZ2  3  
ATOM 5215  C CZ3  . TRP A 1 36  ? -3.028  -1.371  3.691   1.00 0.17  ? 36  TRP A CZ3  3  
ATOM 5216  C CH2  . TRP A 1 36  ? -3.353  -2.054  4.863   1.00 0.19  ? 36  TRP A CH2  3  
ATOM 5217  H H    . TRP A 1 36  ? -7.099  0.399   1.937   1.00 0.51  ? 36  TRP A H    3  
ATOM 5218  H HA   . TRP A 1 36  ? -7.682  3.125   2.874   1.00 0.53  ? 36  TRP A HA   3  
ATOM 5219  H HB2  . TRP A 1 36  ? -4.916  2.159   2.247   1.00 0.38  ? 36  TRP A HB2  3  
ATOM 5220  H HB3  . TRP A 1 36  ? -5.433  3.362   3.425   1.00 0.44  ? 36  TRP A HB3  3  
ATOM 5221  H HD1  . TRP A 1 36  ? -7.169  2.015   5.413   1.00 0.46  ? 36  TRP A HD1  3  
ATOM 5222  H HE1  . TRP A 1 36  ? -6.485  -0.057  6.781   1.00 0.39  ? 36  TRP A HE1  3  
ATOM 5223  H HE3  . TRP A 1 36  ? -3.402  0.275   2.403   1.00 0.21  ? 36  TRP A HE3  3  
ATOM 5224  H HZ2  . TRP A 1 36  ? -4.593  -2.154  6.594   1.00 0.27  ? 36  TRP A HZ2  3  
ATOM 5225  H HZ3  . TRP A 1 36  ? -2.230  -1.750  3.071   1.00 0.16  ? 36  TRP A HZ3  3  
ATOM 5226  H HH2  . TRP A 1 36  ? -2.797  -2.954  5.098   1.00 0.19  ? 36  TRP A HH2  3  
ATOM 5227  N N    . LEU A 1 37  ? -5.957  3.971   0.743   1.00 0.43  ? 37  LEU A N    3  
ATOM 5228  C CA   . LEU A 1 37  ? -5.647  4.579   -0.548  1.00 0.42  ? 37  LEU A CA   3  
ATOM 5229  C C    . LEU A 1 37  ? -4.938  3.580   -1.448  1.00 0.37  ? 37  LEU A C    3  
ATOM 5230  O O    . LEU A 1 37  ? -3.853  3.106   -1.109  1.00 0.35  ? 37  LEU A O    3  
ATOM 5231  C CB   . LEU A 1 37  ? -4.737  5.792   -0.336  1.00 0.45  ? 37  LEU A CB   3  
ATOM 5232  C CG   . LEU A 1 37  ? -4.286  6.514   -1.606  1.00 0.46  ? 37  LEU A CG   3  
ATOM 5233  C CD1  . LEU A 1 37  ? -5.462  7.195   -2.282  1.00 0.49  ? 37  LEU A CD1  3  
ATOM 5234  C CD2  . LEU A 1 37  ? -3.195  7.523   -1.281  1.00 0.50  ? 37  LEU A CD2  3  
ATOM 5235  H H    . LEU A 1 37  ? -5.459  4.271   1.531   1.00 0.43  ? 37  LEU A H    3  
ATOM 5236  H HA   . LEU A 1 37  ? -6.568  4.896   -1.013  1.00 0.46  ? 37  LEU A HA   3  
ATOM 5237  H HB2  . LEU A 1 37  ? -5.260  6.498   0.285   1.00 0.51  ? 37  LEU A HB2  3  
ATOM 5238  H HB3  . LEU A 1 37  ? -3.855  5.463   0.192   1.00 0.45  ? 37  LEU A HB3  3  
ATOM 5239  H HG   . LEU A 1 37  ? -3.878  5.790   -2.297  1.00 0.43  ? 37  LEU A HG   3  
ATOM 5240  H HD11 . LEU A 1 37  ? -6.211  6.458   -2.532  1.00 1.11  ? 37  LEU A HD11 3  
ATOM 5241  H HD12 . LEU A 1 37  ? -5.125  7.688   -3.180  1.00 1.17  ? 37  LEU A HD12 3  
ATOM 5242  H HD13 . LEU A 1 37  ? -5.886  7.923   -1.608  1.00 1.09  ? 37  LEU A HD13 3  
ATOM 5243  H HD21 . LEU A 1 37  ? -2.811  7.947   -2.198  1.00 1.16  ? 37  LEU A HD21 3  
ATOM 5244  H HD22 . LEU A 1 37  ? -2.396  7.029   -0.749  1.00 1.19  ? 37  LEU A HD22 3  
ATOM 5245  H HD23 . LEU A 1 37  ? -3.606  8.310   -0.665  1.00 1.05  ? 37  LEU A HD23 3  
ATOM 5246  N N    . ASP A 1 38  ? -5.545  3.249   -2.582  1.00 0.38  ? 38  ASP A N    3  
ATOM 5247  C CA   . ASP A 1 38  ? -4.913  2.338   -3.518  1.00 0.41  ? 38  ASP A CA   3  
ATOM 5248  C C    . ASP A 1 38  ? -3.896  3.075   -4.367  1.00 0.39  ? 38  ASP A C    3  
ATOM 5249  O O    . ASP A 1 38  ? -4.190  4.111   -4.962  1.00 0.44  ? 38  ASP A O    3  
ATOM 5250  C CB   . ASP A 1 38  ? -5.923  1.624   -4.410  1.00 0.56  ? 38  ASP A CB   3  
ATOM 5251  C CG   . ASP A 1 38  ? -5.309  0.397   -5.053  1.00 1.78  ? 38  ASP A CG   3  
ATOM 5252  O OD1  . ASP A 1 38  ? -4.660  0.531   -6.104  1.00 2.14  ? 38  ASP A OD1  3  
ATOM 5253  O OD2  . ASP A 1 38  ? -5.464  -0.713  -4.514  1.00 2.51  ? 38  ASP A OD2  3  
ATOM 5254  H H    . ASP A 1 38  ? -6.430  3.626   -2.793  1.00 0.43  ? 38  ASP A H    3  
ATOM 5255  H HA   . ASP A 1 38  ? -4.388  1.597   -2.944  1.00 0.44  ? 38  ASP A HA   3  
ATOM 5256  H HB2  . ASP A 1 38  ? -6.774  1.317   -3.820  1.00 0.96  ? 38  ASP A HB2  3  
ATOM 5257  H HB3  . ASP A 1 38  ? -6.248  2.293   -5.193  1.00 0.85  ? 38  ASP A HB3  3  
ATOM 5258  N N    . ILE A 1 39  ? -2.706  2.512   -4.417  1.00 0.38  ? 39  ILE A N    3  
ATOM 5259  C CA   . ILE A 1 39  ? -1.579  3.104   -5.109  1.00 0.38  ? 39  ILE A CA   3  
ATOM 5260  C C    . ILE A 1 39  ? -1.829  3.165   -6.615  1.00 0.39  ? 39  ILE A C    3  
ATOM 5261  O O    . ILE A 1 39  ? -1.274  4.009   -7.320  1.00 0.46  ? 39  ILE A O    3  
ATOM 5262  C CB   . ILE A 1 39  ? -0.298  2.296   -4.805  1.00 0.39  ? 39  ILE A CB   3  
ATOM 5263  C CG1  . ILE A 1 39  ? -0.101  2.197   -3.282  1.00 0.40  ? 39  ILE A CG1  3  
ATOM 5264  C CG2  . ILE A 1 39  ? 0.917   2.909   -5.487  1.00 0.41  ? 39  ILE A CG2  3  
ATOM 5265  C CD1  . ILE A 1 39  ? 1.307   1.822   -2.859  1.00 0.43  ? 39  ILE A CD1  3  
ATOM 5266  H H    . ILE A 1 39  ? -2.582  1.645   -3.966  1.00 0.43  ? 39  ILE A H    3  
ATOM 5267  H HA   . ILE A 1 39  ? -1.444  4.107   -4.732  1.00 0.40  ? 39  ILE A HA   3  
ATOM 5268  H HB   . ILE A 1 39  ? -0.431  1.299   -5.199  1.00 0.42  ? 39  ILE A HB   3  
ATOM 5269  H HG12 . ILE A 1 39  ? -0.350  3.141   -2.830  1.00 0.38  ? 39  ILE A HG12 3  
ATOM 5270  H HG13 . ILE A 1 39  ? -0.769  1.441   -2.898  1.00 0.45  ? 39  ILE A HG13 3  
ATOM 5271  H HG21 . ILE A 1 39  ? 0.760   2.923   -6.555  1.00 1.04  ? 39  ILE A HG21 3  
ATOM 5272  H HG22 . ILE A 1 39  ? 1.790   2.317   -5.261  1.00 1.05  ? 39  ILE A HG22 3  
ATOM 5273  H HG23 . ILE A 1 39  ? 1.062   3.918   -5.129  1.00 0.96  ? 39  ILE A HG23 3  
ATOM 5274  H HD11 . ILE A 1 39  ? 1.370   1.802   -1.780  1.00 1.14  ? 39  ILE A HD11 3  
ATOM 5275  H HD12 . ILE A 1 39  ? 2.004   2.549   -3.247  1.00 1.00  ? 39  ILE A HD12 3  
ATOM 5276  H HD13 . ILE A 1 39  ? 1.551   0.845   -3.251  1.00 1.15  ? 39  ILE A HD13 3  
ATOM 5277  N N    . LEU A 1 40  ? -2.687  2.277   -7.098  1.00 0.39  ? 40  LEU A N    3  
ATOM 5278  C CA   . LEU A 1 40  ? -3.041  2.254   -8.511  1.00 0.49  ? 40  LEU A CA   3  
ATOM 5279  C C    . LEU A 1 40  ? -4.541  2.457   -8.688  1.00 0.49  ? 40  LEU A C    3  
ATOM 5280  O O    . LEU A 1 40  ? -5.055  2.468   -9.810  1.00 0.62  ? 40  LEU A O    3  
ATOM 5281  C CB   . LEU A 1 40  ? -2.613  0.931   -9.149  1.00 0.56  ? 40  LEU A CB   3  
ATOM 5282  C CG   . LEU A 1 40  ? -1.122  0.603   -9.046  1.00 0.59  ? 40  LEU A CG   3  
ATOM 5283  C CD1  . LEU A 1 40  ? -0.831  -0.726  -9.717  1.00 0.62  ? 40  LEU A CD1  3  
ATOM 5284  C CD2  . LEU A 1 40  ? -0.285  1.704   -9.676  1.00 0.72  ? 40  LEU A CD2  3  
ATOM 5285  H H    . LEU A 1 40  ? -3.099  1.621   -6.483  1.00 0.39  ? 40  LEU A H    3  
ATOM 5286  H HA   . LEU A 1 40  ? -2.524  3.063   -8.994  1.00 0.60  ? 40  LEU A HA   3  
ATOM 5287  H HB2  . LEU A 1 40  ? -3.168  0.132   -8.677  1.00 0.66  ? 40  LEU A HB2  3  
ATOM 5288  H HB3  . LEU A 1 40  ? -2.879  0.961   -10.196 1.00 0.72  ? 40  LEU A HB3  3  
ATOM 5289  H HG   . LEU A 1 40  ? -0.845  0.519   -8.003  1.00 0.82  ? 40  LEU A HG   3  
ATOM 5290  H HD11 . LEU A 1 40  ? 0.222   -0.951  -9.633  1.00 1.21  ? 40  LEU A HD11 3  
ATOM 5291  H HD12 . LEU A 1 40  ? -1.102  -0.667  -10.759 1.00 1.27  ? 40  LEU A HD12 3  
ATOM 5292  H HD13 . LEU A 1 40  ? -1.407  -1.505  -9.240  1.00 1.08  ? 40  LEU A HD13 3  
ATOM 5293  H HD21 . LEU A 1 40  ? -0.527  1.782   -10.727 1.00 1.43  ? 40  LEU A HD21 3  
ATOM 5294  H HD22 . LEU A 1 40  ? 0.763   1.471   -9.563  1.00 1.27  ? 40  LEU A HD22 3  
ATOM 5295  H HD23 . LEU A 1 40  ? -0.501  2.643   -9.186  1.00 1.06  ? 40  LEU A HD23 3  
ATOM 5296  N N    . GLY A 1 41  ? -5.229  2.627   -7.567  1.00 0.43  ? 41  GLY A N    3  
ATOM 5297  C CA   . GLY A 1 41  ? -6.674  2.718   -7.566  1.00 0.51  ? 41  GLY A CA   3  
ATOM 5298  C C    . GLY A 1 41  ? -7.332  1.440   -8.053  1.00 0.45  ? 41  GLY A C    3  
ATOM 5299  O O    . GLY A 1 41  ? -8.483  1.455   -8.490  1.00 0.52  ? 41  GLY A O    3  
ATOM 5300  H H    . GLY A 1 41  ? -4.743  2.694   -6.720  1.00 0.38  ? 41  GLY A H    3  
ATOM 5301  H HA2  . GLY A 1 41  ? -7.008  2.915   -6.559  1.00 0.54  ? 41  GLY A HA2  3  
ATOM 5302  H HA3  . GLY A 1 41  ? -6.972  3.533   -8.195  1.00 0.65  ? 41  GLY A HA3  3  
ATOM 5303  N N    . ASN A 1 42  ? -6.606  0.327   -7.964  1.00 0.39  ? 42  ASN A N    3  
ATOM 5304  C CA   . ASN A 1 42  ? -7.112  -0.946  -8.472  1.00 0.42  ? 42  ASN A CA   3  
ATOM 5305  C C    . ASN A 1 42  ? -7.803  -1.769  -7.381  1.00 0.43  ? 42  ASN A C    3  
ATOM 5306  O O    . ASN A 1 42  ? -8.708  -2.551  -7.670  1.00 0.56  ? 42  ASN A O    3  
ATOM 5307  C CB   . ASN A 1 42  ? -6.009  -1.761  -9.183  1.00 0.49  ? 42  ASN A CB   3  
ATOM 5308  C CG   . ASN A 1 42  ? -5.013  -2.492  -8.280  1.00 0.55  ? 42  ASN A CG   3  
ATOM 5309  O OD1  . ASN A 1 42  ? -4.554  -3.579  -8.623  1.00 0.95  ? 42  ASN A OD1  3  
ATOM 5310  N ND2  . ASN A 1 42  ? -4.631  -1.917  -7.155  1.00 0.44  ? 42  ASN A ND2  3  
ATOM 5311  H H    . ASN A 1 42  ? -5.707  0.374   -7.557  1.00 0.39  ? 42  ASN A H    3  
ATOM 5312  H HA   . ASN A 1 42  ? -7.862  -0.700  -9.208  1.00 0.49  ? 42  ASN A HA   3  
ATOM 5313  H HB2  . ASN A 1 42  ? -6.484  -2.497  -9.801  1.00 0.69  ? 42  ASN A HB2  3  
ATOM 5314  H HB3  . ASN A 1 42  ? -5.449  -1.087  -9.817  1.00 0.57  ? 42  ASN A HB3  3  
ATOM 5315  H HD21 . ASN A 1 42  ? -5.000  -1.037  -6.923  1.00 0.54  ? 42  ASN A HD21 3  
ATOM 5316  H HD22 . ASN A 1 42  ? -3.974  -2.383  -6.604  1.00 0.56  ? 42  ASN A HD22 3  
ATOM 5317  N N    . GLY A 1 43  ? -7.391  -1.586  -6.137  1.00 0.40  ? 43  GLY A N    3  
ATOM 5318  C CA   . GLY A 1 43  ? -8.061  -2.243  -5.026  1.00 0.50  ? 43  GLY A CA   3  
ATOM 5319  C C    . GLY A 1 43  ? -7.218  -3.345  -4.426  1.00 0.45  ? 43  GLY A C    3  
ATOM 5320  O O    . GLY A 1 43  ? -7.612  -3.986  -3.454  1.00 0.72  ? 43  GLY A O    3  
ATOM 5321  H H    . GLY A 1 43  ? -6.606  -1.019  -5.960  1.00 0.39  ? 43  GLY A H    3  
ATOM 5322  H HA2  . GLY A 1 43  ? -8.271  -1.510  -4.263  1.00 0.60  ? 43  GLY A HA2  3  
ATOM 5323  H HA3  . GLY A 1 43  ? -8.992  -2.662  -5.378  1.00 0.58  ? 43  GLY A HA3  3  
ATOM 5324  N N    . LEU A 1 44  ? -6.047  -3.547  -5.002  1.00 0.29  ? 44  LEU A N    3  
ATOM 5325  C CA   . LEU A 1 44  ? -5.159  -4.625  -4.590  1.00 0.36  ? 44  LEU A CA   3  
ATOM 5326  C C    . LEU A 1 44  ? -3.984  -4.093  -3.788  1.00 0.25  ? 44  LEU A C    3  
ATOM 5327  O O    . LEU A 1 44  ? -3.451  -4.775  -2.917  1.00 0.27  ? 44  LEU A O    3  
ATOM 5328  C CB   . LEU A 1 44  ? -4.626  -5.369  -5.821  1.00 0.60  ? 44  LEU A CB   3  
ATOM 5329  C CG   . LEU A 1 44  ? -5.614  -6.303  -6.521  1.00 0.51  ? 44  LEU A CG   3  
ATOM 5330  C CD1  . LEU A 1 44  ? -6.748  -5.533  -7.186  1.00 1.46  ? 44  LEU A CD1  3  
ATOM 5331  C CD2  . LEU A 1 44  ? -4.899  -7.171  -7.537  1.00 1.56  ? 44  LEU A CD2  3  
ATOM 5332  H H    . LEU A 1 44  ? -5.767  -2.948  -5.724  1.00 0.39  ? 44  LEU A H    3  
ATOM 5333  H HA   . LEU A 1 44  ? -5.725  -5.313  -3.980  1.00 0.47  ? 44  LEU A HA   3  
ATOM 5334  H HB2  . LEU A 1 44  ? -4.296  -4.631  -6.539  1.00 1.23  ? 44  LEU A HB2  3  
ATOM 5335  H HB3  . LEU A 1 44  ? -3.768  -5.952  -5.517  1.00 1.12  ? 44  LEU A HB3  3  
ATOM 5336  H HG   . LEU A 1 44  ? -6.044  -6.947  -5.785  1.00 0.99  ? 44  LEU A HG   3  
ATOM 5337  H HD11 . LEU A 1 44  ? -6.337  -4.845  -7.910  1.00 1.90  ? 44  LEU A HD11 3  
ATOM 5338  H HD12 . LEU A 1 44  ? -7.296  -4.983  -6.435  1.00 2.02  ? 44  LEU A HD12 3  
ATOM 5339  H HD13 . LEU A 1 44  ? -7.411  -6.228  -7.682  1.00 2.09  ? 44  LEU A HD13 3  
ATOM 5340  H HD21 . LEU A 1 44  ? -4.171  -7.790  -7.033  1.00 2.16  ? 44  LEU A HD21 3  
ATOM 5341  H HD22 . LEU A 1 44  ? -4.398  -6.542  -8.258  1.00 1.97  ? 44  LEU A HD22 3  
ATOM 5342  H HD23 . LEU A 1 44  ? -5.618  -7.799  -8.044  1.00 2.15  ? 44  LEU A HD23 3  
ATOM 5343  N N    . LEU A 1 45  ? -3.577  -2.880  -4.116  1.00 0.23  ? 45  LEU A N    3  
ATOM 5344  C CA   . LEU A 1 45  ? -2.355  -2.286  -3.589  1.00 0.22  ? 45  LEU A CA   3  
ATOM 5345  C C    . LEU A 1 45  ? -2.640  -0.966  -2.865  1.00 0.22  ? 45  LEU A C    3  
ATOM 5346  O O    . LEU A 1 45  ? -2.809  0.062   -3.502  1.00 0.32  ? 45  LEU A O    3  
ATOM 5347  C CB   . LEU A 1 45  ? -1.394  -2.099  -4.764  1.00 0.30  ? 45  LEU A CB   3  
ATOM 5348  C CG   . LEU A 1 45  ? -0.209  -1.169  -4.549  1.00 0.26  ? 45  LEU A CG   3  
ATOM 5349  C CD1  . LEU A 1 45  ? 0.638   -1.618  -3.375  1.00 0.28  ? 45  LEU A CD1  3  
ATOM 5350  C CD2  . LEU A 1 45  ? 0.621   -1.120  -5.815  1.00 0.31  ? 45  LEU A CD2  3  
ATOM 5351  H H    . LEU A 1 45  ? -4.138  -2.340  -4.711  1.00 0.26  ? 45  LEU A H    3  
ATOM 5352  H HA   . LEU A 1 45  ? -1.917  -2.981  -2.888  1.00 0.22  ? 45  LEU A HA   3  
ATOM 5353  H HB2  . LEU A 1 45  ? -1.004  -3.070  -5.029  1.00 0.43  ? 45  LEU A HB2  3  
ATOM 5354  H HB3  . LEU A 1 45  ? -1.965  -1.731  -5.601  1.00 0.42  ? 45  LEU A HB3  3  
ATOM 5355  H HG   . LEU A 1 45  ? -0.568  -0.169  -4.344  1.00 0.29  ? 45  LEU A HG   3  
ATOM 5356  H HD11 . LEU A 1 45  ? 0.025   -1.658  -2.487  1.00 1.00  ? 45  LEU A HD11 3  
ATOM 5357  H HD12 . LEU A 1 45  ? 1.443   -0.917  -3.228  1.00 1.01  ? 45  LEU A HD12 3  
ATOM 5358  H HD13 . LEU A 1 45  ? 1.043   -2.598  -3.579  1.00 1.12  ? 45  LEU A HD13 3  
ATOM 5359  H HD21 . LEU A 1 45  ? 1.463   -0.463  -5.671  1.00 0.96  ? 45  LEU A HD21 3  
ATOM 5360  H HD22 . LEU A 1 45  ? 0.011   -0.755  -6.628  1.00 1.12  ? 45  LEU A HD22 3  
ATOM 5361  H HD23 . LEU A 1 45  ? 0.974   -2.114  -6.047  1.00 1.10  ? 45  LEU A HD23 3  
ATOM 5362  N N    . ARG A 1 46  ? -2.676  -0.992  -1.535  1.00 0.20  ? 46  ARG A N    3  
ATOM 5363  C CA   . ARG A 1 46  ? -3.077  0.185   -0.759  1.00 0.22  ? 46  ARG A CA   3  
ATOM 5364  C C    . ARG A 1 46  ? -2.131  0.464   0.400   1.00 0.19  ? 46  ARG A C    3  
ATOM 5365  O O    . ARG A 1 46  ? -1.689  -0.455  1.076   1.00 0.19  ? 46  ARG A O    3  
ATOM 5366  C CB   . ARG A 1 46  ? -4.490  -0.018  -0.230  1.00 0.25  ? 46  ARG A CB   3  
ATOM 5367  C CG   . ARG A 1 46  ? -5.514  -0.008  -1.339  1.00 0.36  ? 46  ARG A CG   3  
ATOM 5368  C CD   . ARG A 1 46  ? -6.854  -0.553  -0.896  1.00 0.37  ? 46  ARG A CD   3  
ATOM 5369  N NE   . ARG A 1 46  ? -6.764  -1.957  -0.498  1.00 0.54  ? 46  ARG A NE   3  
ATOM 5370  C CZ   . ARG A 1 46  ? -7.812  -2.770  -0.383  1.00 0.75  ? 46  ARG A CZ   3  
ATOM 5371  N NH1  . ARG A 1 46  ? -9.022  -2.344  -0.725  1.00 1.14  ? 46  ARG A NH1  3  
ATOM 5372  N NH2  . ARG A 1 46  ? -7.644  -4.010  0.054   1.00 0.99  ? 46  ARG A NH2  3  
ATOM 5373  H H    . ARG A 1 46  ? -2.429  -1.821  -1.064  1.00 0.20  ? 46  ARG A H    3  
ATOM 5374  H HA   . ARG A 1 46  ? -3.077  1.041   -1.423  1.00 0.25  ? 46  ARG A HA   3  
ATOM 5375  H HB2  . ARG A 1 46  ? -4.543  -0.966  0.285   1.00 0.30  ? 46  ARG A HB2  3  
ATOM 5376  H HB3  . ARG A 1 46  ? -4.725  0.777   0.462   1.00 0.35  ? 46  ARG A HB3  3  
ATOM 5377  H HG2  . ARG A 1 46  ? -5.642  1.007   -1.666  1.00 0.50  ? 46  ARG A HG2  3  
ATOM 5378  H HG3  . ARG A 1 46  ? -5.141  -0.601  -2.160  1.00 0.49  ? 46  ARG A HG3  3  
ATOM 5379  H HD2  . ARG A 1 46  ? -7.206  0.029   -0.056  1.00 0.47  ? 46  ARG A HD2  3  
ATOM 5380  H HD3  . ARG A 1 46  ? -7.551  -0.458  -1.716  1.00 0.51  ? 46  ARG A HD3  3  
ATOM 5381  H HE   . ARG A 1 46  ? -5.871  -2.308  -0.290  1.00 0.87  ? 46  ARG A HE   3  
ATOM 5382  H HH11 . ARG A 1 46  ? -9.149  -1.415  -1.068  1.00 1.24  ? 46  ARG A HH11 3  
ATOM 5383  H HH12 . ARG A 1 46  ? -9.824  -2.956  -0.645  1.00 1.49  ? 46  ARG A HH12 3  
ATOM 5384  H HH21 . ARG A 1 46  ? -6.727  -4.340  0.304   1.00 1.18  ? 46  ARG A HH21 3  
ATOM 5385  H HH22 . ARG A 1 46  ? -8.434  -4.630  0.134   1.00 1.21  ? 46  ARG A HH22 3  
ATOM 5386  N N    . LYS A 1 47  ? -1.862  1.742   0.639   1.00 0.20  ? 47  LYS A N    3  
ATOM 5387  C CA   . LYS A 1 47  ? -0.919  2.163   1.671   1.00 0.17  ? 47  LYS A CA   3  
ATOM 5388  C C    . LYS A 1 47  ? -1.642  2.924   2.785   1.00 0.18  ? 47  LYS A C    3  
ATOM 5389  O O    . LYS A 1 47  ? -2.355  3.894   2.513   1.00 0.22  ? 47  LYS A O    3  
ATOM 5390  C CB   . LYS A 1 47  ? 0.139   3.076   1.042   1.00 0.23  ? 47  LYS A CB   3  
ATOM 5391  C CG   . LYS A 1 47  ? 1.385   3.246   1.890   1.00 0.25  ? 47  LYS A CG   3  
ATOM 5392  C CD   . LYS A 1 47  ? 2.081   4.564   1.619   1.00 0.32  ? 47  LYS A CD   3  
ATOM 5393  C CE   . LYS A 1 47  ? 1.387   5.715   2.346   1.00 0.20  ? 47  LYS A CE   3  
ATOM 5394  N NZ   . LYS A 1 47  ? 2.332   6.805   2.729   1.00 0.35  ? 47  LYS A NZ   3  
ATOM 5395  H H    . LYS A 1 47  ? -2.315  2.431   0.105   1.00 0.22  ? 47  LYS A H    3  
ATOM 5396  H HA   . LYS A 1 47  ? -0.440  1.288   2.087   1.00 0.15  ? 47  LYS A HA   3  
ATOM 5397  H HB2  . LYS A 1 47  ? 0.435   2.667   0.086   1.00 0.31  ? 47  LYS A HB2  3  
ATOM 5398  H HB3  . LYS A 1 47  ? -0.296  4.051   0.883   1.00 0.27  ? 47  LYS A HB3  3  
ATOM 5399  H HG2  . LYS A 1 47  ? 1.111   3.207   2.932   1.00 0.25  ? 47  LYS A HG2  3  
ATOM 5400  H HG3  . LYS A 1 47  ? 2.071   2.441   1.666   1.00 0.31  ? 47  LYS A HG3  3  
ATOM 5401  H HD2  . LYS A 1 47  ? 3.100   4.490   1.947   1.00 0.45  ? 47  LYS A HD2  3  
ATOM 5402  H HD3  . LYS A 1 47  ? 2.058   4.759   0.556   1.00 0.45  ? 47  LYS A HD3  3  
ATOM 5403  H HE2  . LYS A 1 47  ? 0.629   6.127   1.692   1.00 0.39  ? 47  LYS A HE2  3  
ATOM 5404  H HE3  . LYS A 1 47  ? 0.915   5.324   3.236   1.00 0.35  ? 47  LYS A HE3  3  
ATOM 5405  H HZ1  . LYS A 1 47  ? 2.876   7.127   1.902   1.00 1.00  ? 47  LYS A HZ1  3  
ATOM 5406  H HZ2  . LYS A 1 47  ? 3.001   6.468   3.460   1.00 1.12  ? 47  LYS A HZ2  3  
ATOM 5407  H HZ3  . LYS A 1 47  ? 1.805   7.617   3.114   1.00 1.03  ? 47  LYS A HZ3  3  
ATOM 5408  N N    . LYS A 1 48  ? -1.469  2.489   4.032   1.00 0.16  ? 48  LYS A N    3  
ATOM 5409  C CA   . LYS A 1 48  ? -2.032  3.215   5.169   1.00 0.18  ? 48  LYS A CA   3  
ATOM 5410  C C    . LYS A 1 48  ? -0.932  3.831   6.017   1.00 0.17  ? 48  LYS A C    3  
ATOM 5411  O O    . LYS A 1 48  ? -0.002  3.142   6.433   1.00 0.22  ? 48  LYS A O    3  
ATOM 5412  C CB   . LYS A 1 48  ? -2.897  2.312   6.055   1.00 0.25  ? 48  LYS A CB   3  
ATOM 5413  C CG   . LYS A 1 48  ? -3.511  3.061   7.228   1.00 0.32  ? 48  LYS A CG   3  
ATOM 5414  C CD   . LYS A 1 48  ? -4.493  2.215   8.023   1.00 0.69  ? 48  LYS A CD   3  
ATOM 5415  C CE   . LYS A 1 48  ? -3.807  1.103   8.805   1.00 0.52  ? 48  LYS A CE   3  
ATOM 5416  N NZ   . LYS A 1 48  ? -4.734  0.498   9.801   1.00 1.07  ? 48  LYS A NZ   3  
ATOM 5417  H H    . LYS A 1 48  ? -0.960  1.663   4.194   1.00 0.15  ? 48  LYS A H    3  
ATOM 5418  H HA   . LYS A 1 48  ? -2.647  4.010   4.777   1.00 0.21  ? 48  LYS A HA   3  
ATOM 5419  H HB2  . LYS A 1 48  ? -3.694  1.894   5.456   1.00 0.30  ? 48  LYS A HB2  3  
ATOM 5420  H HB3  . LYS A 1 48  ? -2.287  1.509   6.444   1.00 0.28  ? 48  LYS A HB3  3  
ATOM 5421  H HG2  . LYS A 1 48  ? -2.718  3.376   7.886   1.00 0.51  ? 48  LYS A HG2  3  
ATOM 5422  H HG3  . LYS A 1 48  ? -4.027  3.933   6.851   1.00 0.53  ? 48  LYS A HG3  3  
ATOM 5423  H HD2  . LYS A 1 48  ? -5.017  2.853   8.718   1.00 1.29  ? 48  LYS A HD2  3  
ATOM 5424  H HD3  . LYS A 1 48  ? -5.202  1.773   7.336   1.00 1.29  ? 48  LYS A HD3  3  
ATOM 5425  H HE2  . LYS A 1 48  ? -3.469  0.333   8.111   1.00 1.14  ? 48  LYS A HE2  3  
ATOM 5426  H HE3  . LYS A 1 48  ? -2.956  1.518   9.327   1.00 0.96  ? 48  LYS A HE3  3  
ATOM 5427  H HZ1  . LYS A 1 48  ? -4.291  -0.331  10.255  1.00 1.56  ? 48  LYS A HZ1  3  
ATOM 5428  H HZ2  . LYS A 1 48  ? -5.620  0.195   9.334   1.00 1.60  ? 48  LYS A HZ2  3  
ATOM 5429  H HZ3  . LYS A 1 48  ? -4.968  1.194   10.539  1.00 1.65  ? 48  LYS A HZ3  3  
ATOM 5430  N N    . THR A 1 49  ? -1.056  5.118   6.289   1.00 0.18  ? 49  THR A N    3  
ATOM 5431  C CA   . THR A 1 49  ? -0.112  5.815   7.141   1.00 0.20  ? 49  THR A CA   3  
ATOM 5432  C C    . THR A 1 49  ? -0.473  5.631   8.607   1.00 0.21  ? 49  THR A C    3  
ATOM 5433  O O    . THR A 1 49  ? -1.431  6.234   9.098   1.00 0.29  ? 49  THR A O    3  
ATOM 5434  C CB   . THR A 1 49  ? -0.081  7.322   6.822   1.00 0.25  ? 49  THR A CB   3  
ATOM 5435  O OG1  . THR A 1 49  ? -1.419  7.836   6.757   1.00 0.33  ? 49  THR A OG1  3  
ATOM 5436  C CG2  . THR A 1 49  ? 0.636   7.586   5.509   1.00 0.25  ? 49  THR A CG2  3  
ATOM 5437  H H    . THR A 1 49  ? -1.819  5.616   5.913   1.00 0.21  ? 49  THR A H    3  
ATOM 5438  H HA   . THR A 1 49  ? 0.873   5.406   6.965   1.00 0.19  ? 49  THR A HA   3  
ATOM 5439  H HB   . THR A 1 49  ? 0.451   7.832   7.614   1.00 0.28  ? 49  THR A HB   3  
ATOM 5440  H HG1  . THR A 1 49  ? -1.861  7.676   7.604   1.00 0.68  ? 49  THR A HG1  3  
ATOM 5441  H HG21 . THR A 1 49  ? 1.654   7.234   5.582   1.00 1.03  ? 49  THR A HG21 3  
ATOM 5442  H HG22 . THR A 1 49  ? 0.635   8.645   5.306   1.00 1.01  ? 49  THR A HG22 3  
ATOM 5443  H HG23 . THR A 1 49  ? 0.131   7.066   4.710   1.00 1.03  ? 49  THR A HG23 3  
ATOM 5444  N N    . LEU A 1 50  ? 0.268   4.776   9.292   1.00 0.18  ? 50  LEU A N    3  
ATOM 5445  C CA   . LEU A 1 50  ? 0.152   4.671   10.738  1.00 0.21  ? 50  LEU A CA   3  
ATOM 5446  C C    . LEU A 1 50  ? 0.622   5.992   11.313  1.00 0.23  ? 50  LEU A C    3  
ATOM 5447  O O    . LEU A 1 50  ? -0.061  6.651   12.100  1.00 0.28  ? 50  LEU A O    3  
ATOM 5448  C CB   . LEU A 1 50  ? 1.041   3.539   11.251  1.00 0.21  ? 50  LEU A CB   3  
ATOM 5449  C CG   . LEU A 1 50  ? 1.041   2.275   10.393  1.00 0.20  ? 50  LEU A CG   3  
ATOM 5450  C CD1  . LEU A 1 50  ? 2.227   1.397   10.751  1.00 0.21  ? 50  LEU A CD1  3  
ATOM 5451  C CD2  . LEU A 1 50  ? -0.257  1.511   10.561  1.00 0.24  ? 50  LEU A CD2  3  
ATOM 5452  H H    . LEU A 1 50  ? 0.921   4.216   8.819   1.00 0.15  ? 50  LEU A H    3  
ATOM 5453  H HA   . LEU A 1 50  ? -0.881  4.495   11.001  1.00 0.23  ? 50  LEU A HA   3  
ATOM 5454  H HB2  . LEU A 1 50  ? 2.054   3.907   11.315  1.00 0.21  ? 50  LEU A HB2  3  
ATOM 5455  H HB3  . LEU A 1 50  ? 0.709   3.272   12.242  1.00 0.25  ? 50  LEU A HB3  3  
ATOM 5456  H HG   . LEU A 1 50  ? 1.135   2.553   9.354   1.00 0.17  ? 50  LEU A HG   3  
ATOM 5457  H HD11 . LEU A 1 50  ? 2.226   0.514   10.129  1.00 1.02  ? 50  LEU A HD11 3  
ATOM 5458  H HD12 . LEU A 1 50  ? 2.162   1.109   11.789  1.00 1.05  ? 50  LEU A HD12 3  
ATOM 5459  H HD13 . LEU A 1 50  ? 3.142   1.952   10.587  1.00 1.04  ? 50  LEU A HD13 3  
ATOM 5460  H HD21 . LEU A 1 50  ? -1.086  2.150   10.295  1.00 1.01  ? 50  LEU A HD21 3  
ATOM 5461  H HD22 . LEU A 1 50  ? -0.359  1.196   11.588  1.00 1.02  ? 50  LEU A HD22 3  
ATOM 5462  H HD23 . LEU A 1 50  ? -0.248  0.647   9.915   1.00 1.06  ? 50  LEU A HD23 3  
ATOM 5463  N N    . VAL A 1 51  ? 1.813   6.351   10.885  1.00 0.23  ? 51  VAL A N    3  
ATOM 5464  C CA   . VAL A 1 51  ? 2.367   7.674   11.066  1.00 0.27  ? 51  VAL A CA   3  
ATOM 5465  C C    . VAL A 1 51  ? 2.902   8.092   9.727   1.00 0.24  ? 51  VAL A C    3  
ATOM 5466  O O    . VAL A 1 51  ? 3.558   7.291   9.081   1.00 0.23  ? 51  VAL A O    3  
ATOM 5467  C CB   . VAL A 1 51  ? 3.528   7.681   12.065  1.00 0.30  ? 51  VAL A CB   3  
ATOM 5468  C CG1  . VAL A 1 51  ? 4.138   9.071   12.202  1.00 0.36  ? 51  VAL A CG1  3  
ATOM 5469  C CG2  . VAL A 1 51  ? 3.071   7.164   13.410  1.00 0.36  ? 51  VAL A CG2  3  
ATOM 5470  H H    . VAL A 1 51  ? 2.359   5.684   10.409  1.00 0.21  ? 51  VAL A H    3  
ATOM 5471  H HA   . VAL A 1 51  ? 1.591   8.351   11.394  1.00 0.33  ? 51  VAL A HA   3  
ATOM 5472  H HB   . VAL A 1 51  ? 4.287   7.022   11.678  1.00 0.26  ? 51  VAL A HB   3  
ATOM 5473  H HG11 . VAL A 1 51  ? 3.381   9.765   12.537  1.00 1.03  ? 51  VAL A HG11 3  
ATOM 5474  H HG12 . VAL A 1 51  ? 4.524   9.390   11.245  1.00 1.08  ? 51  VAL A HG12 3  
ATOM 5475  H HG13 . VAL A 1 51  ? 4.942   9.039   12.923  1.00 1.14  ? 51  VAL A HG13 3  
ATOM 5476  H HG21 . VAL A 1 51  ? 2.732   6.145   13.304  1.00 0.96  ? 51  VAL A HG21 3  
ATOM 5477  H HG22 . VAL A 1 51  ? 2.258   7.780   13.767  1.00 1.11  ? 51  VAL A HG22 3  
ATOM 5478  H HG23 . VAL A 1 51  ? 3.889   7.201   14.109  1.00 1.06  ? 51  VAL A HG23 3  
ATOM 5479  N N    . PRO A 1 52  ? 2.595   9.296   9.260   1.00 0.29  ? 52  PRO A N    3  
ATOM 5480  C CA   . PRO A 1 52  ? 3.090   9.799   8.001   1.00 0.32  ? 52  PRO A CA   3  
ATOM 5481  C C    . PRO A 1 52  ? 4.199   10.830  8.166   1.00 0.34  ? 52  PRO A C    3  
ATOM 5482  O O    . PRO A 1 52  ? 4.135   11.937  7.624   1.00 0.54  ? 52  PRO A O    3  
ATOM 5483  C CB   . PRO A 1 52  ? 1.826   10.408  7.451   1.00 0.41  ? 52  PRO A CB   3  
ATOM 5484  C CG   . PRO A 1 52  ? 1.122   10.982  8.650   1.00 0.46  ? 52  PRO A CG   3  
ATOM 5485  C CD   . PRO A 1 52  ? 1.678   10.264  9.865   1.00 0.37  ? 52  PRO A CD   3  
ATOM 5486  H HA   . PRO A 1 52  ? 3.423   9.002   7.353   1.00 0.32  ? 52  PRO A HA   3  
ATOM 5487  H HB2  . PRO A 1 52  ? 2.069   11.168  6.722   1.00 0.45  ? 52  PRO A HB2  3  
ATOM 5488  H HB3  . PRO A 1 52  ? 1.253   9.621   7.001   1.00 0.45  ? 52  PRO A HB3  3  
ATOM 5489  H HG2  . PRO A 1 52  ? 1.324   12.041  8.720   1.00 0.51  ? 52  PRO A HG2  3  
ATOM 5490  H HG3  . PRO A 1 52  ? 0.061   10.807  8.564   1.00 0.56  ? 52  PRO A HG3  3  
ATOM 5491  H HD2  . PRO A 1 52  ? 2.209   10.954  10.505  1.00 0.39  ? 52  PRO A HD2  3  
ATOM 5492  H HD3  . PRO A 1 52  ? 0.890   9.766   10.407  1.00 0.41  ? 52  PRO A HD3  3  
ATOM 5493  N N    . GLY A 1 53  ? 5.221   10.437  8.911   1.00 0.24  ? 53  GLY A N    3  
ATOM 5494  C CA   . GLY A 1 53  ? 6.368   11.286  9.132   1.00 0.28  ? 53  GLY A CA   3  
ATOM 5495  C C    . GLY A 1 53  ? 6.097   12.390  10.132  1.00 0.29  ? 53  GLY A C    3  
ATOM 5496  O O    . GLY A 1 53  ? 4.956   12.587  10.553  1.00 0.55  ? 53  GLY A O    3  
ATOM 5497  H H    . GLY A 1 53  ? 5.200   9.544   9.304   1.00 0.26  ? 53  GLY A H    3  
ATOM 5498  H HA2  . GLY A 1 53  ? 7.183   10.678  9.498   1.00 0.34  ? 53  GLY A HA2  3  
ATOM 5499  H HA3  . GLY A 1 53  ? 6.659   11.731  8.194   1.00 0.35  ? 53  GLY A HA3  3  
ATOM 5500  N N    . PRO A 1 54  ? 7.143   13.103  10.562  1.00 0.52  ? 54  PRO A N    3  
ATOM 5501  C CA   . PRO A 1 54  ? 6.995   14.292  11.394  1.00 0.67  ? 54  PRO A CA   3  
ATOM 5502  C C    . PRO A 1 54  ? 6.470   15.458  10.561  1.00 0.78  ? 54  PRO A C    3  
ATOM 5503  O O    . PRO A 1 54  ? 6.725   15.514  9.356   1.00 1.20  ? 54  PRO A O    3  
ATOM 5504  C CB   . PRO A 1 54  ? 8.425   14.579  11.894  1.00 1.03  ? 54  PRO A CB   3  
ATOM 5505  C CG   . PRO A 1 54  ? 9.255   13.409  11.463  1.00 1.42  ? 54  PRO A CG   3  
ATOM 5506  C CD   . PRO A 1 54  ? 8.553   12.804  10.283  1.00 0.91  ? 54  PRO A CD   3  
ATOM 5507  H HA   . PRO A 1 54  ? 6.337   14.114  12.232  1.00 0.63  ? 54  PRO A HA   3  
ATOM 5508  H HB2  . PRO A 1 54  ? 8.784   15.496  11.449  1.00 1.19  ? 54  PRO A HB2  3  
ATOM 5509  H HB3  . PRO A 1 54  ? 8.418   14.678  12.968  1.00 1.08  ? 54  PRO A HB3  3  
ATOM 5510  H HG2  . PRO A 1 54  ? 10.242  13.747  11.178  1.00 1.91  ? 54  PRO A HG2  3  
ATOM 5511  H HG3  . PRO A 1 54  ? 9.322   12.692  12.267  1.00 1.81  ? 54  PRO A HG3  3  
ATOM 5512  H HD2  . PRO A 1 54  ? 8.875   13.275  9.365   1.00 1.01  ? 54  PRO A HD2  3  
ATOM 5513  H HD3  . PRO A 1 54  ? 8.721   11.740  10.245  1.00 0.97  ? 54  PRO A HD3  3  
ATOM 5514  N N    . PRO A 1 55  ? 5.722   16.392  11.175  1.00 0.97  ? 55  PRO A N    3  
ATOM 5515  C CA   . PRO A 1 55  ? 5.192   17.563  10.467  1.00 1.24  ? 55  PRO A CA   3  
ATOM 5516  C C    . PRO A 1 55  ? 6.281   18.277  9.672   1.00 0.93  ? 55  PRO A C    3  
ATOM 5517  O O    . PRO A 1 55  ? 7.241   18.798  10.241  1.00 1.20  ? 55  PRO A O    3  
ATOM 5518  C CB   . PRO A 1 55  ? 4.666   18.449  11.596  1.00 1.81  ? 55  PRO A CB   3  
ATOM 5519  C CG   . PRO A 1 55  ? 4.328   17.495  12.692  1.00 2.04  ? 55  PRO A CG   3  
ATOM 5520  C CD   . PRO A 1 55  ? 5.335   16.383  12.597  1.00 1.47  ? 55  PRO A CD   3  
ATOM 5521  H HA   . PRO A 1 55  ? 4.382   17.293  9.804   1.00 1.48  ? 55  PRO A HA   3  
ATOM 5522  H HB2  . PRO A 1 55  ? 5.434   19.144  11.900  1.00 1.86  ? 55  PRO A HB2  3  
ATOM 5523  H HB3  . PRO A 1 55  ? 3.793   18.989  11.259  1.00 2.24  ? 55  PRO A HB3  3  
ATOM 5524  H HG2  . PRO A 1 55  ? 4.409   17.991  13.647  1.00 2.40  ? 55  PRO A HG2  3  
ATOM 5525  H HG3  . PRO A 1 55  ? 3.329   17.109  12.552  1.00 2.53  ? 55  PRO A HG3  3  
ATOM 5526  H HD2  . PRO A 1 55  ? 6.187   16.591  13.227  1.00 1.54  ? 55  PRO A HD2  3  
ATOM 5527  H HD3  . PRO A 1 55  ? 4.884   15.440  12.868  1.00 1.66  ? 55  PRO A HD3  3  
ATOM 5528  N N    . GLY A 1 56  ? 6.141   18.273  8.355   1.00 0.98  ? 56  GLY A N    3  
ATOM 5529  C CA   . GLY A 1 56  ? 7.169   18.836  7.508   1.00 0.82  ? 56  GLY A CA   3  
ATOM 5530  C C    . GLY A 1 56  ? 8.174   17.787  7.072   1.00 0.64  ? 56  GLY A C    3  
ATOM 5531  O O    . GLY A 1 56  ? 9.383   17.982  7.192   1.00 0.69  ? 56  GLY A O    3  
ATOM 5532  H H    . GLY A 1 56  ? 5.337   17.878  7.956   1.00 1.42  ? 56  GLY A H    3  
ATOM 5533  H HA2  . GLY A 1 56  ? 6.706   19.268  6.633   1.00 0.98  ? 56  GLY A HA2  3  
ATOM 5534  H HA3  . GLY A 1 56  ? 7.687   19.611  8.053   1.00 0.83  ? 56  GLY A HA3  3  
ATOM 5535  N N    . SER A 1 57  ? 7.668   16.671  6.575   1.00 0.52  ? 57  SER A N    3  
ATOM 5536  C CA   . SER A 1 57  ? 8.501   15.562  6.161   1.00 0.40  ? 57  SER A CA   3  
ATOM 5537  C C    . SER A 1 57  ? 9.067   15.768  4.764   1.00 0.34  ? 57  SER A C    3  
ATOM 5538  O O    . SER A 1 57  ? 8.683   16.691  4.042   1.00 0.43  ? 57  SER A O    3  
ATOM 5539  C CB   . SER A 1 57  ? 7.668   14.290  6.191   1.00 0.40  ? 57  SER A CB   3  
ATOM 5540  O OG   . SER A 1 57  ? 6.298   14.590  5.969   1.00 0.99  ? 57  SER A OG   3  
ATOM 5541  H H    . SER A 1 57  ? 6.700   16.579  6.487   1.00 0.56  ? 57  SER A H    3  
ATOM 5542  H HA   . SER A 1 57  ? 9.314   15.470  6.864   1.00 0.47  ? 57  SER A HA   3  
ATOM 5543  H HB2  . SER A 1 57  ? 8.012   13.628  5.402   1.00 0.55  ? 57  SER A HB2  3  
ATOM 5544  H HB3  . SER A 1 57  ? 7.775   13.808  7.149   1.00 0.66  ? 57  SER A HB3  3  
ATOM 5545  H HG   . SER A 1 57  ? 6.046   14.306  5.074   1.00 1.36  ? 57  SER A HG   3  
ATOM 5546  N N    . SER A 1 58  ? 9.982   14.893  4.391   1.00 0.28  ? 58  SER A N    3  
ATOM 5547  C CA   . SER A 1 58  ? 10.543  14.888  3.056   1.00 0.30  ? 58  SER A CA   3  
ATOM 5548  C C    . SER A 1 58  ? 10.178  13.581  2.374   1.00 0.27  ? 58  SER A C    3  
ATOM 5549  O O    . SER A 1 58  ? 10.278  12.523  2.978   1.00 0.38  ? 58  SER A O    3  
ATOM 5550  C CB   . SER A 1 58  ? 12.061  15.024  3.125   1.00 0.38  ? 58  SER A CB   3  
ATOM 5551  O OG   . SER A 1 58  ? 12.441  16.219  3.796   1.00 1.28  ? 58  SER A OG   3  
ATOM 5552  H H    . SER A 1 58  ? 10.282  14.214  5.030   1.00 0.31  ? 58  SER A H    3  
ATOM 5553  H HA   . SER A 1 58  ? 10.128  15.715  2.501   1.00 0.36  ? 58  SER A HA   3  
ATOM 5554  H HB2  . SER A 1 58  ? 12.467  14.177  3.659   1.00 0.97  ? 58  SER A HB2  3  
ATOM 5555  H HB3  . SER A 1 58  ? 12.462  15.042  2.124   1.00 0.87  ? 58  SER A HB3  3  
ATOM 5556  H HG   . SER A 1 58  ? 12.772  16.002  4.682   1.00 1.82  ? 58  SER A HG   3  
ATOM 5557  N N    . ARG A 1 59  ? 9.722   13.645  1.146   1.00 0.32  ? 59  ARG A N    3  
ATOM 5558  C CA   . ARG A 1 59  ? 9.409   12.435  0.407   1.00 0.30  ? 59  ARG A CA   3  
ATOM 5559  C C    . ARG A 1 59  ? 10.546  12.080  -0.539  1.00 0.27  ? 59  ARG A C    3  
ATOM 5560  O O    . ARG A 1 59  ? 10.857  12.831  -1.466  1.00 0.34  ? 59  ARG A O    3  
ATOM 5561  C CB   . ARG A 1 59  ? 8.090   12.598  -0.336  1.00 0.42  ? 59  ARG A CB   3  
ATOM 5562  C CG   . ARG A 1 59  ? 6.893   12.556  0.591   1.00 0.64  ? 59  ARG A CG   3  
ATOM 5563  C CD   . ARG A 1 59  ? 5.587   12.780  -0.147  1.00 0.68  ? 59  ARG A CD   3  
ATOM 5564  N NE   . ARG A 1 59  ? 4.462   12.824  0.780   1.00 1.41  ? 59  ARG A NE   3  
ATOM 5565  C CZ   . ARG A 1 59  ? 3.371   13.560  0.614   1.00 1.81  ? 59  ARG A CZ   3  
ATOM 5566  N NH1  . ARG A 1 59  ? 3.240   14.340  -0.451  1.00 1.78  ? 59  ARG A NH1  3  
ATOM 5567  N NH2  . ARG A 1 59  ? 2.429   13.543  1.545   1.00 2.81  ? 59  ARG A NH2  3  
ATOM 5568  H H    . ARG A 1 59  ? 9.584   14.520  0.723   1.00 0.44  ? 59  ARG A H    3  
ATOM 5569  H HA   . ARG A 1 59  ? 9.305   11.635  1.127   1.00 0.30  ? 59  ARG A HA   3  
ATOM 5570  H HB2  . ARG A 1 59  ? 8.093   13.554  -0.838  1.00 0.93  ? 59  ARG A HB2  3  
ATOM 5571  H HB3  . ARG A 1 59  ? 7.990   11.805  -1.067  1.00 0.91  ? 59  ARG A HB3  3  
ATOM 5572  H HG2  . ARG A 1 59  ? 6.858   11.587  1.068   1.00 1.11  ? 59  ARG A HG2  3  
ATOM 5573  H HG3  . ARG A 1 59  ? 7.008   13.322  1.344   1.00 1.15  ? 59  ARG A HG3  3  
ATOM 5574  H HD2  . ARG A 1 59  ? 5.641   13.717  -0.683  1.00 1.27  ? 59  ARG A HD2  3  
ATOM 5575  H HD3  . ARG A 1 59  ? 5.437   11.969  -0.845  1.00 1.12  ? 59  ARG A HD3  3  
ATOM 5576  H HE   . ARG A 1 59  ? 4.533   12.274  1.603   1.00 2.07  ? 59  ARG A HE   3  
ATOM 5577  H HH11 . ARG A 1 59  ? 3.971   14.385  -1.144  1.00 1.77  ? 59  ARG A HH11 3  
ATOM 5578  H HH12 . ARG A 1 59  ? 2.405   14.892  -0.573  1.00 2.29  ? 59  ARG A HH12 3  
ATOM 5579  H HH21 . ARG A 1 59  ? 2.556   12.979  2.370   1.00 3.39  ? 59  ARG A HH21 3  
ATOM 5580  H HH22 . ARG A 1 59  ? 1.591   14.079  1.427   1.00 3.15  ? 59  ARG A HH22 3  
ATOM 5581  N N    . PRO A 1 60  ? 11.218  10.949  -0.269  1.00 0.23  ? 60  PRO A N    3  
ATOM 5582  C CA   . PRO A 1 60  ? 12.350  10.470  -1.071  1.00 0.26  ? 60  PRO A CA   3  
ATOM 5583  C C    . PRO A 1 60  ? 12.030  10.349  -2.560  1.00 0.26  ? 60  PRO A C    3  
ATOM 5584  O O    . PRO A 1 60  ? 10.910  10.010  -2.944  1.00 0.28  ? 60  PRO A O    3  
ATOM 5585  C CB   . PRO A 1 60  ? 12.659  9.083   -0.485  1.00 0.30  ? 60  PRO A CB   3  
ATOM 5586  C CG   . PRO A 1 60  ? 11.479  8.737   0.355   1.00 0.28  ? 60  PRO A CG   3  
ATOM 5587  C CD   . PRO A 1 60  ? 10.953  10.046  0.865   1.00 0.21  ? 60  PRO A CD   3  
ATOM 5588  H HA   . PRO A 1 60  ? 13.210  11.108  -0.944  1.00 0.32  ? 60  PRO A HA   3  
ATOM 5589  H HB2  . PRO A 1 60  ? 12.793  8.374   -1.287  1.00 0.41  ? 60  PRO A HB2  3  
ATOM 5590  H HB3  . PRO A 1 60  ? 13.560  9.137   0.107   1.00 0.42  ? 60  PRO A HB3  3  
ATOM 5591  H HG2  . PRO A 1 60  ? 10.733  8.236   -0.244  1.00 0.43  ? 60  PRO A HG2  3  
ATOM 5592  H HG3  . PRO A 1 60  ? 11.786  8.111   1.179   1.00 0.41  ? 60  PRO A HG3  3  
ATOM 5593  H HD2  . PRO A 1 60  ? 9.898   9.976   1.083   1.00 0.24  ? 60  PRO A HD2  3  
ATOM 5594  H HD3  . PRO A 1 60  ? 11.504  10.357  1.740   1.00 0.24  ? 60  PRO A HD3  3  
ATOM 5595  N N    . VAL A 1 61  ? 13.027  10.619  -3.391  1.00 0.29  ? 61  VAL A N    3  
ATOM 5596  C CA   . VAL A 1 61  ? 12.866  10.529  -4.830  1.00 0.31  ? 61  VAL A CA   3  
ATOM 5597  C C    . VAL A 1 61  ? 13.384  9.183   -5.313  1.00 0.28  ? 61  VAL A C    3  
ATOM 5598  O O    . VAL A 1 61  ? 14.257  8.581   -4.685  1.00 0.27  ? 61  VAL A O    3  
ATOM 5599  C CB   . VAL A 1 61  ? 13.626  11.658  -5.558  1.00 0.40  ? 61  VAL A CB   3  
ATOM 5600  C CG1  . VAL A 1 61  ? 13.266  11.698  -7.036  1.00 0.81  ? 61  VAL A CG1  3  
ATOM 5601  C CG2  . VAL A 1 61  ? 13.344  13.002  -4.905  1.00 0.88  ? 61  VAL A CG2  3  
ATOM 5602  H H    . VAL A 1 61  ? 13.899  10.867  -3.028  1.00 0.32  ? 61  VAL A H    3  
ATOM 5603  H HA   . VAL A 1 61  ? 11.813  10.614  -5.063  1.00 0.33  ? 61  VAL A HA   3  
ATOM 5604  H HB   . VAL A 1 61  ? 14.683  11.458  -5.479  1.00 0.80  ? 61  VAL A HB   3  
ATOM 5605  H HG11 . VAL A 1 61  ? 12.200  11.838  -7.143  1.00 1.44  ? 61  VAL A HG11 3  
ATOM 5606  H HG12 . VAL A 1 61  ? 13.553  10.767  -7.501  1.00 1.46  ? 61  VAL A HG12 3  
ATOM 5607  H HG13 . VAL A 1 61  ? 13.785  12.515  -7.513  1.00 1.30  ? 61  VAL A HG13 3  
ATOM 5608  H HG21 . VAL A 1 61  ? 13.679  12.977  -3.878  1.00 1.45  ? 61  VAL A HG21 3  
ATOM 5609  H HG22 . VAL A 1 61  ? 12.283  13.199  -4.934  1.00 1.40  ? 61  VAL A HG22 3  
ATOM 5610  H HG23 . VAL A 1 61  ? 13.872  13.779  -5.438  1.00 1.47  ? 61  VAL A HG23 3  
ATOM 5611  N N    . LYS A 1 62  ? 12.844  8.708   -6.413  1.00 0.27  ? 62  LYS A N    3  
ATOM 5612  C CA   . LYS A 1 62  ? 13.285  7.459   -6.992  1.00 0.27  ? 62  LYS A CA   3  
ATOM 5613  C C    . LYS A 1 62  ? 14.666  7.634   -7.600  1.00 0.25  ? 62  LYS A C    3  
ATOM 5614  O O    . LYS A 1 62  ? 14.877  8.460   -8.485  1.00 0.31  ? 62  LYS A O    3  
ATOM 5615  C CB   . LYS A 1 62  ? 12.278  6.966   -8.032  1.00 0.30  ? 62  LYS A CB   3  
ATOM 5616  C CG   . LYS A 1 62  ? 10.970  6.476   -7.420  1.00 0.37  ? 62  LYS A CG   3  
ATOM 5617  C CD   . LYS A 1 62  ? 10.007  5.972   -8.477  1.00 0.41  ? 62  LYS A CD   3  
ATOM 5618  C CE   . LYS A 1 62  ? 8.847   5.222   -7.846  1.00 0.60  ? 62  LYS A CE   3  
ATOM 5619  N NZ   . LYS A 1 62  ? 7.997   4.559   -8.866  1.00 1.17  ? 62  LYS A NZ   3  
ATOM 5620  H H    . LYS A 1 62  ? 12.147  9.222   -6.860  1.00 0.30  ? 62  LYS A H    3  
ATOM 5621  H HA   . LYS A 1 62  ? 13.362  6.726   -6.188  1.00 0.29  ? 62  LYS A HA   3  
ATOM 5622  H HB2  . LYS A 1 62  ? 12.051  7.776   -8.709  1.00 0.33  ? 62  LYS A HB2  3  
ATOM 5623  H HB3  . LYS A 1 62  ? 12.721  6.153   -8.588  1.00 0.37  ? 62  LYS A HB3  3  
ATOM 5624  H HG2  . LYS A 1 62  ? 11.187  5.668   -6.736  1.00 0.54  ? 62  LYS A HG2  3  
ATOM 5625  H HG3  . LYS A 1 62  ? 10.506  7.289   -6.880  1.00 0.52  ? 62  LYS A HG3  3  
ATOM 5626  H HD2  . LYS A 1 62  ? 9.622   6.814   -9.033  1.00 0.61  ? 62  LYS A HD2  3  
ATOM 5627  H HD3  . LYS A 1 62  ? 10.534  5.307   -9.145  1.00 0.58  ? 62  LYS A HD3  3  
ATOM 5628  H HE2  . LYS A 1 62  ? 9.241   4.472   -7.175  1.00 1.06  ? 62  LYS A HE2  3  
ATOM 5629  H HE3  . LYS A 1 62  ? 8.245   5.923   -7.287  1.00 0.90  ? 62  LYS A HE3  3  
ATOM 5630  H HZ1  . LYS A 1 62  ? 7.238   4.025   -8.407  1.00 1.64  ? 62  LYS A HZ1  3  
ATOM 5631  H HZ2  . LYS A 1 62  ? 8.567   3.896   -9.440  1.00 1.67  ? 62  LYS A HZ2  3  
ATOM 5632  H HZ3  . LYS A 1 62  ? 7.573   5.272   -9.499  1.00 1.71  ? 62  LYS A HZ3  3  
ATOM 5633  N N    . GLY A 1 63  ? 15.594  6.846   -7.099  1.00 0.25  ? 63  GLY A N    3  
ATOM 5634  C CA   . GLY A 1 63  ? 16.981  6.992   -7.451  1.00 0.27  ? 63  GLY A CA   3  
ATOM 5635  C C    . GLY A 1 63  ? 17.823  7.047   -6.203  1.00 0.30  ? 63  GLY A C    3  
ATOM 5636  O O    . GLY A 1 63  ? 18.997  6.687   -6.206  1.00 0.42  ? 63  GLY A O    3  
ATOM 5637  H H    . GLY A 1 63  ? 15.327  6.136   -6.481  1.00 0.30  ? 63  GLY A H    3  
ATOM 5638  H HA2  . GLY A 1 63  ? 17.289  6.150   -8.055  1.00 0.29  ? 63  GLY A HA2  3  
ATOM 5639  H HA3  . GLY A 1 63  ? 17.115  7.904   -8.010  1.00 0.28  ? 63  GLY A HA3  3  
ATOM 5640  N N    . GLN A 1 64  ? 17.210  7.506   -5.124  1.00 0.26  ? 64  GLN A N    3  
ATOM 5641  C CA   . GLN A 1 64  ? 17.871  7.538   -3.832  1.00 0.28  ? 64  GLN A CA   3  
ATOM 5642  C C    . GLN A 1 64  ? 17.682  6.194   -3.164  1.00 0.24  ? 64  GLN A C    3  
ATOM 5643  O O    . GLN A 1 64  ? 16.608  5.594   -3.264  1.00 0.24  ? 64  GLN A O    3  
ATOM 5644  C CB   . GLN A 1 64  ? 17.303  8.649   -2.934  1.00 0.30  ? 64  GLN A CB   3  
ATOM 5645  C CG   . GLN A 1 64  ? 16.750  9.879   -3.656  1.00 0.36  ? 64  GLN A CG   3  
ATOM 5646  C CD   . GLN A 1 64  ? 17.732  10.625  -4.560  1.00 0.44  ? 64  GLN A CD   3  
ATOM 5647  O OE1  . GLN A 1 64  ? 17.638  11.842  -4.699  1.00 0.59  ? 64  GLN A OE1  3  
ATOM 5648  N NE2  . GLN A 1 64  ? 18.637  9.925   -5.217  1.00 0.43  ? 64  GLN A NE2  3  
ATOM 5649  H H    . GLN A 1 64  ? 16.281  7.826   -5.196  1.00 0.26  ? 64  GLN A H    3  
ATOM 5650  H HA   . GLN A 1 64  ? 18.927  7.707   -3.978  1.00 0.33  ? 64  GLN A HA   3  
ATOM 5651  H HB2  . GLN A 1 64  ? 16.496  8.228   -2.342  1.00 0.29  ? 64  GLN A HB2  3  
ATOM 5652  H HB3  . GLN A 1 64  ? 18.093  8.979   -2.266  1.00 0.37  ? 64  GLN A HB3  3  
ATOM 5653  H HG2  . GLN A 1 64  ? 15.905  9.571   -4.251  1.00 0.35  ? 64  GLN A HG2  3  
ATOM 5654  H HG3  . GLN A 1 64  ? 16.410  10.575  -2.904  1.00 0.40  ? 64  GLN A HG3  3  
ATOM 5655  H HE21 . GLN A 1 64  ? 18.650  8.953   -5.099  1.00 0.43  ? 64  GLN A HE21 3  
ATOM 5656  H HE22 . GLN A 1 64  ? 19.252  10.411  -5.808  1.00 0.50  ? 64  GLN A HE22 3  
ATOM 5657  N N    . VAL A 1 65  ? 18.719  5.702   -2.513  1.00 0.28  ? 65  VAL A N    3  
ATOM 5658  C CA   . VAL A 1 65  ? 18.584  4.473   -1.775  1.00 0.31  ? 65  VAL A CA   3  
ATOM 5659  C C    . VAL A 1 65  ? 18.065  4.811   -0.387  1.00 0.25  ? 65  VAL A C    3  
ATOM 5660  O O    . VAL A 1 65  ? 18.555  5.721   0.281   1.00 0.32  ? 65  VAL A O    3  
ATOM 5661  C CB   . VAL A 1 65  ? 19.891  3.640   -1.715  1.00 0.49  ? 65  VAL A CB   3  
ATOM 5662  C CG1  . VAL A 1 65  ? 20.477  3.458   -3.107  1.00 1.22  ? 65  VAL A CG1  3  
ATOM 5663  C CG2  . VAL A 1 65  ? 20.909  4.247   -0.772  1.00 1.05  ? 65  VAL A CG2  3  
ATOM 5664  H H    . VAL A 1 65  ? 19.571  6.191   -2.505  1.00 0.35  ? 65  VAL A H    3  
ATOM 5665  H HA   . VAL A 1 65  ? 17.832  3.880   -2.276  1.00 0.32  ? 65  VAL A HA   3  
ATOM 5666  H HB   . VAL A 1 65  ? 19.638  2.658   -1.339  1.00 1.34  ? 65  VAL A HB   3  
ATOM 5667  H HG11 . VAL A 1 65  ? 20.686  4.423   -3.540  1.00 1.66  ? 65  VAL A HG11 3  
ATOM 5668  H HG12 . VAL A 1 65  ? 19.767  2.931   -3.726  1.00 1.83  ? 65  VAL A HG12 3  
ATOM 5669  H HG13 . VAL A 1 65  ? 21.391  2.884   -3.041  1.00 1.86  ? 65  VAL A HG13 3  
ATOM 5670  H HG21 . VAL A 1 65  ? 20.535  4.176   0.241   1.00 1.67  ? 65  VAL A HG21 3  
ATOM 5671  H HG22 . VAL A 1 65  ? 21.066  5.284   -1.027  1.00 1.64  ? 65  VAL A HG22 3  
ATOM 5672  H HG23 . VAL A 1 65  ? 21.839  3.708   -0.850  1.00 1.65  ? 65  VAL A HG23 3  
ATOM 5673  N N    . VAL A 1 66  ? 17.021  4.128   -0.003  1.00 0.19  ? 66  VAL A N    3  
ATOM 5674  C CA   . VAL A 1 66  ? 16.304  4.450   1.214   1.00 0.15  ? 66  VAL A CA   3  
ATOM 5675  C C    . VAL A 1 66  ? 16.214  3.241   2.120   1.00 0.16  ? 66  VAL A C    3  
ATOM 5676  O O    . VAL A 1 66  ? 16.131  2.108   1.646   1.00 0.21  ? 66  VAL A O    3  
ATOM 5677  C CB   . VAL A 1 66  ? 14.883  4.963   0.898   1.00 0.17  ? 66  VAL A CB   3  
ATOM 5678  C CG1  . VAL A 1 66  ? 14.935  6.249   0.091   1.00 0.18  ? 66  VAL A CG1  3  
ATOM 5679  C CG2  . VAL A 1 66  ? 14.089  3.925   0.128   1.00 0.25  ? 66  VAL A CG2  3  
ATOM 5680  H H    . VAL A 1 66  ? 16.719  3.381   -0.551  1.00 0.24  ? 66  VAL A H    3  
ATOM 5681  H HA   . VAL A 1 66  ? 16.838  5.231   1.735   1.00 0.15  ? 66  VAL A HA   3  
ATOM 5682  H HB   . VAL A 1 66  ? 14.379  5.162   1.834   1.00 0.21  ? 66  VAL A HB   3  
ATOM 5683  H HG11 . VAL A 1 66  ? 15.567  6.105   -0.773  1.00 1.04  ? 66  VAL A HG11 3  
ATOM 5684  H HG12 . VAL A 1 66  ? 15.329  7.042   0.699   1.00 1.01  ? 66  VAL A HG12 3  
ATOM 5685  H HG13 . VAL A 1 66  ? 13.938  6.507   -0.233  1.00 1.02  ? 66  VAL A HG13 3  
ATOM 5686  H HG21 . VAL A 1 66  ? 14.249  2.952   0.568   1.00 1.07  ? 66  VAL A HG21 3  
ATOM 5687  H HG22 . VAL A 1 66  ? 14.414  3.919   -0.905  1.00 1.07  ? 66  VAL A HG22 3  
ATOM 5688  H HG23 . VAL A 1 66  ? 13.041  4.174   0.171   1.00 1.00  ? 66  VAL A HG23 3  
ATOM 5689  N N    . THR A 1 67  ? 16.242  3.484   3.417   1.00 0.13  ? 67  THR A N    3  
ATOM 5690  C CA   . THR A 1 67  ? 16.160  2.418   4.387   1.00 0.15  ? 67  THR A CA   3  
ATOM 5691  C C    . THR A 1 67  ? 14.730  2.230   4.852   1.00 0.16  ? 67  THR A C    3  
ATOM 5692  O O    . THR A 1 67  ? 14.157  3.103   5.514   1.00 0.21  ? 67  THR A O    3  
ATOM 5693  C CB   . THR A 1 67  ? 17.041  2.697   5.617   1.00 0.20  ? 67  THR A CB   3  
ATOM 5694  O OG1  . THR A 1 67  ? 16.739  3.983   6.158   1.00 0.29  ? 67  THR A OG1  3  
ATOM 5695  C CG2  . THR A 1 67  ? 18.517  2.624   5.277   1.00 0.27  ? 67  THR A CG2  3  
ATOM 5696  H H    . THR A 1 67  ? 16.302  4.412   3.731   1.00 0.14  ? 67  THR A H    3  
ATOM 5697  H HA   . THR A 1 67  ? 16.504  1.508   3.918   1.00 0.15  ? 67  THR A HA   3  
ATOM 5698  H HB   . THR A 1 67  ? 16.823  1.948   6.360   1.00 0.27  ? 67  THR A HB   3  
ATOM 5699  H HG1  . THR A 1 67  ? 17.451  4.262   6.748   1.00 0.56  ? 67  THR A HG1  3  
ATOM 5700  H HG21 . THR A 1 67  ? 18.731  3.282   4.451   1.00 1.03  ? 67  THR A HG21 3  
ATOM 5701  H HG22 . THR A 1 67  ? 18.772  1.611   5.014   1.00 1.06  ? 67  THR A HG22 3  
ATOM 5702  H HG23 . THR A 1 67  ? 19.093  2.927   6.140   1.00 1.04  ? 67  THR A HG23 3  
ATOM 5703  N N    . VAL A 1 68  ? 14.150  1.103   4.510   1.00 0.15  ? 68  VAL A N    3  
ATOM 5704  C CA   . VAL A 1 68  ? 12.846  0.774   5.033   1.00 0.15  ? 68  VAL A CA   3  
ATOM 5705  C C    . VAL A 1 68  ? 12.958  -0.384  6.002   1.00 0.15  ? 68  VAL A C    3  
ATOM 5706  O O    . VAL A 1 68  ? 13.769  -1.278  5.818   1.00 0.17  ? 68  VAL A O    3  
ATOM 5707  C CB   . VAL A 1 68  ? 11.819  0.419   3.933   1.00 0.16  ? 68  VAL A CB   3  
ATOM 5708  C CG1  . VAL A 1 68  ? 11.523  1.626   3.061   1.00 0.18  ? 68  VAL A CG1  3  
ATOM 5709  C CG2  . VAL A 1 68  ? 12.307  -0.746  3.088   1.00 0.19  ? 68  VAL A CG2  3  
ATOM 5710  H H    . VAL A 1 68  ? 14.602  0.485   3.891   1.00 0.15  ? 68  VAL A H    3  
ATOM 5711  H HA   . VAL A 1 68  ? 12.488  1.641   5.561   1.00 0.15  ? 68  VAL A HA   3  
ATOM 5712  H HB   . VAL A 1 68  ? 10.896  0.117   4.416   1.00 0.17  ? 68  VAL A HB   3  
ATOM 5713  H HG11 . VAL A 1 68  ? 11.105  2.414   3.669   1.00 1.00  ? 68  VAL A HG11 3  
ATOM 5714  H HG12 . VAL A 1 68  ? 10.817  1.350   2.291   1.00 1.05  ? 68  VAL A HG12 3  
ATOM 5715  H HG13 . VAL A 1 68  ? 12.438  1.972   2.603   1.00 1.02  ? 68  VAL A HG13 3  
ATOM 5716  H HG21 . VAL A 1 68  ? 11.587  -0.954  2.311   1.00 1.04  ? 68  VAL A HG21 3  
ATOM 5717  H HG22 . VAL A 1 68  ? 12.423  -1.617  3.716   1.00 1.04  ? 68  VAL A HG22 3  
ATOM 5718  H HG23 . VAL A 1 68  ? 13.256  -0.491  2.644   1.00 1.02  ? 68  VAL A HG23 3  
ATOM 5719  N N    . HIS A 1 69  ? 12.166  -0.359  7.042   1.00 0.14  ? 69  HIS A N    3  
ATOM 5720  C CA   . HIS A 1 69  ? 12.033  -1.520  7.883   1.00 0.15  ? 69  HIS A CA   3  
ATOM 5721  C C    . HIS A 1 69  ? 10.741  -2.184  7.501   1.00 0.14  ? 69  HIS A C    3  
ATOM 5722  O O    . HIS A 1 69  ? 9.679   -1.612  7.689   1.00 0.15  ? 69  HIS A O    3  
ATOM 5723  C CB   . HIS A 1 69  ? 12.009  -1.154  9.384   1.00 0.15  ? 69  HIS A CB   3  
ATOM 5724  C CG   . HIS A 1 69  ? 11.717  -2.339  10.278  1.00 0.15  ? 69  HIS A CG   3  
ATOM 5725  N ND1  . HIS A 1 69  ? 12.172  -2.478  11.572  1.00 0.19  ? 69  HIS A ND1  3  
ATOM 5726  C CD2  . HIS A 1 69  ? 11.002  -3.454  10.028  1.00 0.18  ? 69  HIS A CD2  3  
ATOM 5727  C CE1  . HIS A 1 69  ? 11.741  -3.640  12.054  1.00 0.18  ? 69  HIS A CE1  3  
ATOM 5728  N NE2  . HIS A 1 69  ? 11.036  -4.236  11.136  1.00 0.18  ? 69  HIS A NE2  3  
ATOM 5729  H H    . HIS A 1 69  ? 11.655  0.457   7.247   1.00 0.14  ? 69  HIS A H    3  
ATOM 5730  H HA   . HIS A 1 69  ? 12.857  -2.192  7.683   1.00 0.16  ? 69  HIS A HA   3  
ATOM 5731  H HB2  . HIS A 1 69  ? 12.968  -0.747  9.664   1.00 0.17  ? 69  HIS A HB2  3  
ATOM 5732  H HB3  . HIS A 1 69  ? 11.243  -0.413  9.555   1.00 0.16  ? 69  HIS A HB3  3  
ATOM 5733  H HD1  . HIS A 1 69  ? 12.719  -1.822  12.071  1.00 0.27  ? 69  HIS A HD1  3  
ATOM 5734  H HD2  . HIS A 1 69  ? 10.487  -3.676  9.102   1.00 0.23  ? 69  HIS A HD2  3  
ATOM 5735  H HE1  . HIS A 1 69  ? 11.926  -4.037  13.028  1.00 0.21  ? 69  HIS A HE1  3  
ATOM 5736  H HE2  . HIS A 1 69  ? 10.488  -5.032  11.281  1.00 0.29  ? 69  HIS A HE2  3  
ATOM 5737  N N    . LEU A 1 70  ? 10.818  -3.391  6.990   1.00 0.15  ? 70  LEU A N    3  
ATOM 5738  C CA   . LEU A 1 70  ? 9.607   -4.081  6.644   1.00 0.16  ? 70  LEU A CA   3  
ATOM 5739  C C    . LEU A 1 70  ? 9.464   -5.360  7.441   1.00 0.15  ? 70  LEU A C    3  
ATOM 5740  O O    . LEU A 1 70  ? 10.428  -6.079  7.692   1.00 0.21  ? 70  LEU A O    3  
ATOM 5741  C CB   . LEU A 1 70  ? 9.504   -4.378  5.143   1.00 0.21  ? 70  LEU A CB   3  
ATOM 5742  C CG   . LEU A 1 70  ? 9.976   -5.760  4.698   1.00 0.31  ? 70  LEU A CG   3  
ATOM 5743  C CD1  . LEU A 1 70  ? 9.527   -6.037  3.273   1.00 0.39  ? 70  LEU A CD1  3  
ATOM 5744  C CD2  . LEU A 1 70  ? 11.487  -5.876  4.792   1.00 0.38  ? 70  LEU A CD2  3  
ATOM 5745  H H    . LEU A 1 70  ? 11.689  -3.826  6.870   1.00 0.18  ? 70  LEU A H    3  
ATOM 5746  H HA   . LEU A 1 70  ? 8.795   -3.432  6.916   1.00 0.15  ? 70  LEU A HA   3  
ATOM 5747  H HB2  . LEU A 1 70  ? 8.469   -4.275  4.862   1.00 0.25  ? 70  LEU A HB2  3  
ATOM 5748  H HB3  . LEU A 1 70  ? 10.079  -3.640  4.611   1.00 0.21  ? 70  LEU A HB3  3  
ATOM 5749  H HG   . LEU A 1 70  ? 9.535   -6.504  5.347   1.00 0.39  ? 70  LEU A HG   3  
ATOM 5750  H HD11 . LEU A 1 70  ? 9.960   -5.302  2.610   1.00 1.02  ? 70  LEU A HD11 3  
ATOM 5751  H HD12 . LEU A 1 70  ? 8.450   -5.981  3.220   1.00 1.09  ? 70  LEU A HD12 3  
ATOM 5752  H HD13 . LEU A 1 70  ? 9.852   -7.025  2.980   1.00 1.11  ? 70  LEU A HD13 3  
ATOM 5753  H HD21 . LEU A 1 70  ? 11.797  -5.696  5.811   1.00 1.13  ? 70  LEU A HD21 3  
ATOM 5754  H HD22 . LEU A 1 70  ? 11.944  -5.145  4.141   1.00 1.06  ? 70  LEU A HD22 3  
ATOM 5755  H HD23 . LEU A 1 70  ? 11.787  -6.868  4.493   1.00 1.10  ? 70  LEU A HD23 3  
ATOM 5756  N N    . GLN A 1 71  ? 8.261   -5.587  7.888   1.00 0.13  ? 71  GLN A N    3  
ATOM 5757  C CA   . GLN A 1 71  ? 7.857   -6.875  8.396   1.00 0.14  ? 71  GLN A CA   3  
ATOM 5758  C C    . GLN A 1 71  ? 6.543   -7.174  7.748   1.00 0.14  ? 71  GLN A C    3  
ATOM 5759  O O    . GLN A 1 71  ? 5.549   -6.478  7.961   1.00 0.14  ? 71  GLN A O    3  
ATOM 5760  C CB   . GLN A 1 71  ? 7.701   -6.909  9.908   1.00 0.15  ? 71  GLN A CB   3  
ATOM 5761  C CG   . GLN A 1 71  ? 8.548   -5.903  10.646  1.00 0.15  ? 71  GLN A CG   3  
ATOM 5762  C CD   . GLN A 1 71  ? 7.848   -4.587  10.861  1.00 0.16  ? 71  GLN A CD   3  
ATOM 5763  O OE1  . GLN A 1 71  ? 8.138   -3.875  11.820  1.00 0.27  ? 71  GLN A OE1  3  
ATOM 5764  N NE2  . GLN A 1 71  ? 6.905   -4.268  9.997   1.00 0.18  ? 71  GLN A NE2  3  
ATOM 5765  H H    . GLN A 1 71  ? 7.605   -4.859  7.853   1.00 0.15  ? 71  GLN A H    3  
ATOM 5766  H HA   . GLN A 1 71  ? 8.581   -7.617  8.081   1.00 0.14  ? 71  GLN A HA   3  
ATOM 5767  H HB2  . GLN A 1 71  ? 6.667   -6.725  10.134  1.00 0.17  ? 71  GLN A HB2  3  
ATOM 5768  H HB3  . GLN A 1 71  ? 7.972   -7.892  10.263  1.00 0.17  ? 71  GLN A HB3  3  
ATOM 5769  H HG2  . GLN A 1 71  ? 8.819   -6.311  11.606  1.00 0.20  ? 71  GLN A HG2  3  
ATOM 5770  H HG3  . GLN A 1 71  ? 9.445   -5.725  10.070  1.00 0.15  ? 71  GLN A HG3  3  
ATOM 5771  H HE21 . GLN A 1 71  ? 6.698   -4.901  9.270   1.00 0.26  ? 71  GLN A HE21 3  
ATOM 5772  H HE22 . GLN A 1 71  ? 6.464   -3.402  10.096  1.00 0.18  ? 71  GLN A HE22 3  
ATOM 5773  N N    . THR A 1 72  ? 6.559   -8.184  6.946   1.00 0.15  ? 72  THR A N    3  
ATOM 5774  C CA   . THR A 1 72  ? 5.487   -8.430  6.040   1.00 0.16  ? 72  THR A CA   3  
ATOM 5775  C C    . THR A 1 72  ? 4.589   -9.532  6.537   1.00 0.16  ? 72  THR A C    3  
ATOM 5776  O O    . THR A 1 72  ? 5.045   -10.631 6.839   1.00 0.17  ? 72  THR A O    3  
ATOM 5777  C CB   . THR A 1 72  ? 6.053   -8.799  4.680   1.00 0.17  ? 72  THR A CB   3  
ATOM 5778  O OG1  . THR A 1 72  ? 6.914   -7.755  4.219   1.00 0.19  ? 72  THR A OG1  3  
ATOM 5779  C CG2  . THR A 1 72  ? 4.943   -9.021  3.689   1.00 0.19  ? 72  THR A CG2  3  
ATOM 5780  H H    . THR A 1 72  ? 7.322   -8.793  6.966   1.00 0.17  ? 72  THR A H    3  
ATOM 5781  H HA   . THR A 1 72  ? 4.915   -7.522  5.935   1.00 0.17  ? 72  THR A HA   3  
ATOM 5782  H HB   . THR A 1 72  ? 6.622   -9.707  4.785   1.00 0.18  ? 72  THR A HB   3  
ATOM 5783  H HG1  . THR A 1 72  ? 7.206   -7.953  3.326   1.00 0.55  ? 72  THR A HG1  3  
ATOM 5784  H HG21 . THR A 1 72  ? 4.302   -9.812  4.045   1.00 1.04  ? 72  THR A HG21 3  
ATOM 5785  H HG22 . THR A 1 72  ? 5.367   -9.294  2.736   1.00 1.00  ? 72  THR A HG22 3  
ATOM 5786  H HG23 . THR A 1 72  ? 4.374   -8.109  3.590   1.00 1.00  ? 72  THR A HG23 3  
ATOM 5787  N N    . SER A 1 73  ? 3.314   -9.231  6.610   1.00 0.17  ? 73  SER A N    3  
ATOM 5788  C CA   . SER A 1 73  ? 2.339   -10.178 7.068   1.00 0.17  ? 73  SER A CA   3  
ATOM 5789  C C    . SER A 1 73  ? 1.549   -10.697 5.891   1.00 0.15  ? 73  SER A C    3  
ATOM 5790  O O    . SER A 1 73  ? 1.408   -10.027 4.872   1.00 0.26  ? 73  SER A O    3  
ATOM 5791  C CB   . SER A 1 73  ? 1.388   -9.509  8.064   1.00 0.23  ? 73  SER A CB   3  
ATOM 5792  O OG   . SER A 1 73  ? 0.564   -10.454 8.725   1.00 1.06  ? 73  SER A OG   3  
ATOM 5793  H H    . SER A 1 73  ? 3.012   -8.337  6.330   1.00 0.20  ? 73  SER A H    3  
ATOM 5794  H HA   . SER A 1 73  ? 2.857   -11.003 7.547   1.00 0.18  ? 73  SER A HA   3  
ATOM 5795  H HB2  . SER A 1 73  ? 1.957   -8.968  8.801   1.00 0.96  ? 73  SER A HB2  3  
ATOM 5796  H HB3  . SER A 1 73  ? 0.754   -8.819  7.528   1.00 1.03  ? 73  SER A HB3  3  
ATOM 5797  H HG   . SER A 1 73  ? -0.283  -10.517 8.266   1.00 1.54  ? 73  SER A HG   3  
ATOM 5798  N N    . LEU A 1 74  ? 1.058   -11.897 6.033   1.00 0.19  ? 74  LEU A N    3  
ATOM 5799  C CA   . LEU A 1 74  ? 0.176   -12.480 5.056   1.00 0.18  ? 74  LEU A CA   3  
ATOM 5800  C C    . LEU A 1 74  ? -1.240  -11.994 5.286   1.00 0.19  ? 74  LEU A C    3  
ATOM 5801  O O    . LEU A 1 74  ? -1.543  -11.448 6.347   1.00 0.21  ? 74  LEU A O    3  
ATOM 5802  C CB   . LEU A 1 74  ? 0.229   -13.999 5.151   1.00 0.22  ? 74  LEU A CB   3  
ATOM 5803  C CG   . LEU A 1 74  ? 1.555   -14.626 4.724   1.00 0.38  ? 74  LEU A CG   3  
ATOM 5804  C CD1  . LEU A 1 74  ? 1.365   -16.095 4.375   1.00 0.84  ? 74  LEU A CD1  3  
ATOM 5805  C CD2  . LEU A 1 74  ? 2.166   -13.852 3.561   1.00 0.72  ? 74  LEU A CD2  3  
ATOM 5806  H H    . LEU A 1 74  ? 1.312   -12.422 6.823   1.00 0.34  ? 74  LEU A H    3  
ATOM 5807  H HA   . LEU A 1 74  ? 0.504   -12.173 4.076   1.00 0.18  ? 74  LEU A HA   3  
ATOM 5808  H HB2  . LEU A 1 74  ? 0.044   -14.272 6.182   1.00 0.30  ? 74  LEU A HB2  3  
ATOM 5809  H HB3  . LEU A 1 74  ? -0.555  -14.406 4.544   1.00 0.20  ? 74  LEU A HB3  3  
ATOM 5810  H HG   . LEU A 1 74  ? 2.245   -14.575 5.554   1.00 0.97  ? 74  LEU A HG   3  
ATOM 5811  H HD11 . LEU A 1 74  ? 0.990   -16.627 5.239   1.00 1.51  ? 74  LEU A HD11 3  
ATOM 5812  H HD12 . LEU A 1 74  ? 2.311   -16.518 4.075   1.00 1.44  ? 74  LEU A HD12 3  
ATOM 5813  H HD13 . LEU A 1 74  ? 0.657   -16.184 3.565   1.00 1.32  ? 74  LEU A HD13 3  
ATOM 5814  H HD21 . LEU A 1 74  ? 2.348   -12.828 3.869   1.00 1.44  ? 74  LEU A HD21 3  
ATOM 5815  H HD22 . LEU A 1 74  ? 1.488   -13.859 2.724   1.00 1.33  ? 74  LEU A HD22 3  
ATOM 5816  H HD23 . LEU A 1 74  ? 3.101   -14.309 3.273   1.00 1.28  ? 74  LEU A HD23 3  
ATOM 5817  N N    . GLU A 1 75  ? -2.097  -12.193 4.295   1.00 0.21  ? 75  GLU A N    3  
ATOM 5818  C CA   . GLU A 1 75  ? -3.518  -11.880 4.420   1.00 0.26  ? 75  GLU A CA   3  
ATOM 5819  C C    . GLU A 1 75  ? -4.123  -12.610 5.624   1.00 0.32  ? 75  GLU A C    3  
ATOM 5820  O O    . GLU A 1 75  ? -5.114  -12.174 6.205   1.00 0.39  ? 75  GLU A O    3  
ATOM 5821  C CB   . GLU A 1 75  ? -4.253  -12.280 3.136   1.00 0.30  ? 75  GLU A CB   3  
ATOM 5822  C CG   . GLU A 1 75  ? -4.050  -13.733 2.743   1.00 0.34  ? 75  GLU A CG   3  
ATOM 5823  C CD   . GLU A 1 75  ? -4.761  -14.090 1.456   1.00 0.67  ? 75  GLU A CD   3  
ATOM 5824  O OE1  . GLU A 1 75  ? -4.233  -13.768 0.374   1.00 0.82  ? 75  GLU A OE1  3  
ATOM 5825  O OE2  . GLU A 1 75  ? -5.855  -14.686 1.525   1.00 1.14  ? 75  GLU A OE2  3  
ATOM 5826  H H    . GLU A 1 75  ? -1.765  -12.545 3.441   1.00 0.21  ? 75  GLU A H    3  
ATOM 5827  H HA   . GLU A 1 75  ? -3.609  -10.810 4.559   1.00 0.27  ? 75  GLU A HA   3  
ATOM 5828  H HB2  . GLU A 1 75  ? -5.311  -12.111 3.274   1.00 0.37  ? 75  GLU A HB2  3  
ATOM 5829  H HB3  . GLU A 1 75  ? -3.900  -11.659 2.328   1.00 0.29  ? 75  GLU A HB3  3  
ATOM 5830  H HG2  . GLU A 1 75  ? -2.994  -13.914 2.619   1.00 0.47  ? 75  GLU A HG2  3  
ATOM 5831  H HG3  . GLU A 1 75  ? -4.433  -14.358 3.534   1.00 0.54  ? 75  GLU A HG3  3  
ATOM 5832  N N    . ASN A 1 76  ? -3.488  -13.718 5.996   1.00 0.34  ? 76  ASN A N    3  
ATOM 5833  C CA   . ASN A 1 76  ? -3.938  -14.543 7.114   1.00 0.41  ? 76  ASN A CA   3  
ATOM 5834  C C    . ASN A 1 76  ? -3.490  -13.954 8.451   1.00 0.39  ? 76  ASN A C    3  
ATOM 5835  O O    . ASN A 1 76  ? -3.968  -14.362 9.509   1.00 0.51  ? 76  ASN A O    3  
ATOM 5836  C CB   . ASN A 1 76  ? -3.391  -15.971 6.975   1.00 0.50  ? 76  ASN A CB   3  
ATOM 5837  C CG   . ASN A 1 76  ? -3.803  -16.638 5.672   1.00 1.13  ? 76  ASN A CG   3  
ATOM 5838  O OD1  . ASN A 1 76  ? -4.859  -17.265 5.588   1.00 2.14  ? 76  ASN A OD1  3  
ATOM 5839  N ND2  . ASN A 1 76  ? -2.953  -16.536 4.655   1.00 1.13  ? 76  ASN A ND2  3  
ATOM 5840  H H    . ASN A 1 76  ? -2.698  -13.991 5.492   1.00 0.32  ? 76  ASN A H    3  
ATOM 5841  H HA   . ASN A 1 76  ? -5.014  -14.577 7.092   1.00 0.47  ? 76  ASN A HA   3  
ATOM 5842  H HB2  . ASN A 1 76  ? -2.314  -15.938 7.015   1.00 1.21  ? 76  ASN A HB2  3  
ATOM 5843  H HB3  . ASN A 1 76  ? -3.758  -16.569 7.795   1.00 1.00  ? 76  ASN A HB3  3  
ATOM 5844  H HD21 . ASN A 1 76  ? -2.115  -16.053 4.797   1.00 0.98  ? 76  ASN A HD21 3  
ATOM 5845  H HD22 . ASN A 1 76  ? -3.211  -16.933 3.796   1.00 1.79  ? 76  ASN A HD22 3  
ATOM 5846  N N    . GLY A 1 77  ? -2.578  -12.989 8.402   1.00 0.30  ? 77  GLY A N    3  
ATOM 5847  C CA   . GLY A 1 77  ? -2.051  -12.404 9.622   1.00 0.32  ? 77  GLY A CA   3  
ATOM 5848  C C    . GLY A 1 77  ? -0.725  -13.018 10.020  1.00 0.32  ? 77  GLY A C    3  
ATOM 5849  O O    . GLY A 1 77  ? -0.288  -12.907 11.165  1.00 0.51  ? 77  GLY A O    3  
ATOM 5850  H H    . GLY A 1 77  ? -2.274  -12.656 7.528   1.00 0.27  ? 77  GLY A H    3  
ATOM 5851  H HA2  . GLY A 1 77  ? -1.918  -11.341 9.473   1.00 0.32  ? 77  GLY A HA2  3  
ATOM 5852  H HA3  . GLY A 1 77  ? -2.765  -12.562 10.418  1.00 0.38  ? 77  GLY A HA3  3  
ATOM 5853  N N    . THR A 1 78  ? -0.087  -13.681 9.071   1.00 0.28  ? 78  THR A N    3  
ATOM 5854  C CA   . THR A 1 78  ? 1.173   -14.357 9.325   1.00 0.28  ? 78  THR A CA   3  
ATOM 5855  C C    . THR A 1 78  ? 2.351   -13.561 8.788   1.00 0.23  ? 78  THR A C    3  
ATOM 5856  O O    . THR A 1 78  ? 2.527   -13.445 7.579   1.00 0.21  ? 78  THR A O    3  
ATOM 5857  C CB   . THR A 1 78  ? 1.158   -15.755 8.687   1.00 0.34  ? 78  THR A CB   3  
ATOM 5858  O OG1  . THR A 1 78  ? -0.076  -16.409 9.007   1.00 0.46  ? 78  THR A OG1  3  
ATOM 5859  C CG2  . THR A 1 78  ? 2.328   -16.590 9.185   1.00 0.39  ? 78  THR A CG2  3  
ATOM 5860  H H    . THR A 1 78  ? -0.478  -13.727 8.179   1.00 0.39  ? 78  THR A H    3  
ATOM 5861  H HA   . THR A 1 78  ? 1.287   -14.464 10.386  1.00 0.32  ? 78  THR A HA   3  
ATOM 5862  H HB   . THR A 1 78  ? 1.238   -15.650 7.616   1.00 0.33  ? 78  THR A HB   3  
ATOM 5863  H HG1  . THR A 1 78  ? -0.362  -16.939 8.249   1.00 0.91  ? 78  THR A HG1  3  
ATOM 5864  H HG21 . THR A 1 78  ? 2.280   -16.674 10.260  1.00 1.16  ? 78  THR A HG21 3  
ATOM 5865  H HG22 . THR A 1 78  ? 3.253   -16.115 8.901   1.00 1.12  ? 78  THR A HG22 3  
ATOM 5866  H HG23 . THR A 1 78  ? 2.279   -17.575 8.745   1.00 0.98  ? 78  THR A HG23 3  
ATOM 5867  N N    . ARG A 1 79  ? 3.155   -13.007 9.684   1.00 0.24  ? 79  ARG A N    3  
ATOM 5868  C CA   . ARG A 1 79  ? 4.335   -12.268 9.268   1.00 0.22  ? 79  ARG A CA   3  
ATOM 5869  C C    . ARG A 1 79  ? 5.418   -13.229 8.812   1.00 0.24  ? 79  ARG A C    3  
ATOM 5870  O O    . ARG A 1 79  ? 5.939   -14.025 9.589   1.00 0.33  ? 79  ARG A O    3  
ATOM 5871  C CB   . ARG A 1 79  ? 4.830   -11.351 10.379  1.00 0.25  ? 79  ARG A CB   3  
ATOM 5872  C CG   . ARG A 1 79  ? 3.870   -10.209 10.634  1.00 0.25  ? 79  ARG A CG   3  
ATOM 5873  C CD   . ARG A 1 79  ? 4.607   -8.919  10.948  1.00 0.28  ? 79  ARG A CD   3  
ATOM 5874  N NE   . ARG A 1 79  ? 3.692   -7.771  11.040  1.00 0.33  ? 79  ARG A NE   3  
ATOM 5875  C CZ   . ARG A 1 79  ? 4.047   -6.548  11.458  1.00 0.38  ? 79  ARG A CZ   3  
ATOM 5876  N NH1  . ARG A 1 79  ? 5.252   -6.330  11.960  1.00 0.42  ? 79  ARG A NH1  3  
ATOM 5877  N NH2  . ARG A 1 79  ? 3.178   -5.546  11.421  1.00 0.47  ? 79  ARG A NH2  3  
ATOM 5878  H H    . ARG A 1 79  ? 2.959   -13.106 10.640  1.00 0.27  ? 79  ARG A H    3  
ATOM 5879  H HA   . ARG A 1 79  ? 4.053   -11.658 8.421   1.00 0.19  ? 79  ARG A HA   3  
ATOM 5880  H HB2  . ARG A 1 79  ? 4.935   -11.923 11.290  1.00 0.29  ? 79  ARG A HB2  3  
ATOM 5881  H HB3  . ARG A 1 79  ? 5.787   -10.940 10.102  1.00 0.25  ? 79  ARG A HB3  3  
ATOM 5882  H HG2  . ARG A 1 79  ? 3.261   -10.067 9.751   1.00 0.23  ? 79  ARG A HG2  3  
ATOM 5883  H HG3  . ARG A 1 79  ? 3.239   -10.466 11.471  1.00 0.29  ? 79  ARG A HG3  3  
ATOM 5884  H HD2  . ARG A 1 79  ? 5.121   -9.039  11.888  1.00 0.34  ? 79  ARG A HD2  3  
ATOM 5885  H HD3  . ARG A 1 79  ? 5.330   -8.735  10.158  1.00 0.31  ? 79  ARG A HD3  3  
ATOM 5886  H HE   . ARG A 1 79  ? 2.761   -7.916  10.745  1.00 0.39  ? 79  ARG A HE   3  
ATOM 5887  H HH11 . ARG A 1 79  ? 5.914   -7.084  12.047  1.00 0.43  ? 79  ARG A HH11 3  
ATOM 5888  H HH12 . ARG A 1 79  ? 5.514   -5.398  12.245  1.00 0.49  ? 79  ARG A HH12 3  
ATOM 5889  H HH21 . ARG A 1 79  ? 2.246   -5.692  11.086  1.00 0.54  ? 79  ARG A HH21 3  
ATOM 5890  H HH22 . ARG A 1 79  ? 3.461   -4.623  11.727  1.00 0.51  ? 79  ARG A HH22 3  
ATOM 5891  N N    . VAL A 1 80  ? 5.742   -13.140 7.535   1.00 0.20  ? 80  VAL A N    3  
ATOM 5892  C CA   . VAL A 1 80  ? 6.578   -14.124 6.878   1.00 0.22  ? 80  VAL A CA   3  
ATOM 5893  C C    . VAL A 1 80  ? 8.011   -13.660 6.759   1.00 0.21  ? 80  VAL A C    3  
ATOM 5894  O O    . VAL A 1 80  ? 8.902   -14.439 6.420   1.00 0.27  ? 80  VAL A O    3  
ATOM 5895  C CB   . VAL A 1 80  ? 6.027   -14.427 5.479   1.00 0.23  ? 80  VAL A CB   3  
ATOM 5896  C CG1  . VAL A 1 80  ? 4.658   -15.054 5.590   1.00 0.26  ? 80  VAL A CG1  3  
ATOM 5897  C CG2  . VAL A 1 80  ? 5.980   -13.165 4.622   1.00 0.22  ? 80  VAL A CG2  3  
ATOM 5898  H H    . VAL A 1 80  ? 5.408   -12.374 7.012   1.00 0.20  ? 80  VAL A H    3  
ATOM 5899  H HA   . VAL A 1 80  ? 6.547   -15.032 7.456   1.00 0.26  ? 80  VAL A HA   3  
ATOM 5900  H HB   . VAL A 1 80  ? 6.680   -15.133 5.003   1.00 0.27  ? 80  VAL A HB   3  
ATOM 5901  H HG11 . VAL A 1 80  ? 3.996   -14.372 6.103   1.00 0.98  ? 80  VAL A HG11 3  
ATOM 5902  H HG12 . VAL A 1 80  ? 4.727   -15.976 6.146   1.00 1.06  ? 80  VAL A HG12 3  
ATOM 5903  H HG13 . VAL A 1 80  ? 4.270   -15.253 4.602   1.00 1.01  ? 80  VAL A HG13 3  
ATOM 5904  H HG21 . VAL A 1 80  ? 5.358   -12.426 5.106   1.00 0.95  ? 80  VAL A HG21 3  
ATOM 5905  H HG22 . VAL A 1 80  ? 5.571   -13.403 3.652   1.00 1.01  ? 80  VAL A HG22 3  
ATOM 5906  H HG23 . VAL A 1 80  ? 6.980   -12.774 4.505   1.00 1.03  ? 80  VAL A HG23 3  
ATOM 5907  N N    . GLN A 1 81  ? 8.232   -12.389 7.028   1.00 0.18  ? 81  GLN A N    3  
ATOM 5908  C CA   . GLN A 1 81  ? 9.550   -11.817 6.904   1.00 0.19  ? 81  GLN A CA   3  
ATOM 5909  C C    . GLN A 1 81  ? 9.646   -10.543 7.723   1.00 0.19  ? 81  GLN A C    3  
ATOM 5910  O O    . GLN A 1 81  ? 8.723   -9.729  7.724   1.00 0.26  ? 81  GLN A O    3  
ATOM 5911  C CB   . GLN A 1 81  ? 9.867   -11.528 5.430   1.00 0.23  ? 81  GLN A CB   3  
ATOM 5912  C CG   . GLN A 1 81  ? 8.956   -10.487 4.793   1.00 0.23  ? 81  GLN A CG   3  
ATOM 5913  C CD   . GLN A 1 81  ? 9.301   -10.218 3.350   1.00 0.37  ? 81  GLN A CD   3  
ATOM 5914  O OE1  . GLN A 1 81  ? 10.173  -9.405  3.043   1.00 0.59  ? 81  GLN A OE1  3  
ATOM 5915  N NE2  . GLN A 1 81  ? 8.598   -10.887 2.454   1.00 0.50  ? 81  GLN A NE2  3  
ATOM 5916  H H    . GLN A 1 81  ? 7.491   -11.826 7.331   1.00 0.17  ? 81  GLN A H    3  
ATOM 5917  H HA   . GLN A 1 81  ? 10.262  -12.536 7.284   1.00 0.21  ? 81  GLN A HA   3  
ATOM 5918  H HB2  . GLN A 1 81  ? 10.883  -11.176 5.356   1.00 0.26  ? 81  GLN A HB2  3  
ATOM 5919  H HB3  . GLN A 1 81  ? 9.769   -12.443 4.868   1.00 0.24  ? 81  GLN A HB3  3  
ATOM 5920  H HG2  . GLN A 1 81  ? 7.937   -10.850 4.827   1.00 0.20  ? 81  GLN A HG2  3  
ATOM 5921  H HG3  . GLN A 1 81  ? 9.030   -9.566  5.351   1.00 0.25  ? 81  GLN A HG3  3  
ATOM 5922  H HE21 . GLN A 1 81  ? 7.909   -11.509 2.778   1.00 0.63  ? 81  GLN A HE21 3  
ATOM 5923  H HE22 . GLN A 1 81  ? 8.782   -10.726 1.504   1.00 0.59  ? 81  GLN A HE22 3  
ATOM 5924  N N    . GLU A 1 82  ? 10.742  -10.391 8.439   1.00 0.24  ? 82  GLU A N    3  
ATOM 5925  C CA   . GLU A 1 82  ? 11.017  -9.159  9.148   1.00 0.24  ? 82  GLU A CA   3  
ATOM 5926  C C    . GLU A 1 82  ? 12.449  -8.730  8.898   1.00 0.25  ? 82  GLU A C    3  
ATOM 5927  O O    . GLU A 1 82  ? 13.390  -9.487  9.142   1.00 0.41  ? 82  GLU A O    3  
ATOM 5928  C CB   . GLU A 1 82  ? 10.775  -9.296  10.651  1.00 0.35  ? 82  GLU A CB   3  
ATOM 5929  C CG   . GLU A 1 82  ? 11.103  -8.023  11.411  1.00 0.44  ? 82  GLU A CG   3  
ATOM 5930  C CD   . GLU A 1 82  ? 10.846  -8.136  12.891  1.00 0.82  ? 82  GLU A CD   3  
ATOM 5931  O OE1  . GLU A 1 82  ? 9.703   -7.890  13.315  1.00 1.34  ? 82  GLU A OE1  3  
ATOM 5932  O OE2  . GLU A 1 82  ? 11.782  -8.496  13.630  1.00 1.21  ? 82  GLU A OE2  3  
ATOM 5933  H H    . GLU A 1 82  ? 11.390  -11.127 8.489   1.00 0.35  ? 82  GLU A H    3  
ATOM 5934  H HA   . GLU A 1 82  ? 10.356  -8.400  8.754   1.00 0.24  ? 82  GLU A HA   3  
ATOM 5935  H HB2  . GLU A 1 82  ? 9.734   -9.539  10.825  1.00 0.43  ? 82  GLU A HB2  3  
ATOM 5936  H HB3  . GLU A 1 82  ? 11.394  -10.092 11.036  1.00 0.37  ? 82  GLU A HB3  3  
ATOM 5937  H HG2  . GLU A 1 82  ? 12.147  -7.792  11.263  1.00 0.68  ? 82  GLU A HG2  3  
ATOM 5938  H HG3  . GLU A 1 82  ? 10.498  -7.217  11.016  1.00 0.57  ? 82  GLU A HG3  3  
ATOM 5939  N N    . GLU A 1 83  ? 12.596  -7.521  8.404   1.00 0.22  ? 83  GLU A N    3  
ATOM 5940  C CA   . GLU A 1 83  ? 13.893  -6.961  8.123   1.00 0.26  ? 83  GLU A CA   3  
ATOM 5941  C C    . GLU A 1 83  ? 13.940  -5.516  8.592   1.00 0.23  ? 83  GLU A C    3  
ATOM 5942  O O    . GLU A 1 83  ? 13.182  -4.661  8.130   1.00 0.24  ? 83  GLU A O    3  
ATOM 5943  C CB   . GLU A 1 83  ? 14.200  -7.129  6.630   1.00 0.39  ? 83  GLU A CB   3  
ATOM 5944  C CG   . GLU A 1 83  ? 15.126  -6.088  6.034   1.00 1.20  ? 83  GLU A CG   3  
ATOM 5945  C CD   . GLU A 1 83  ? 15.756  -6.568  4.743   1.00 1.73  ? 83  GLU A CD   3  
ATOM 5946  O OE1  . GLU A 1 83  ? 15.037  -6.660  3.722   1.00 2.59  ? 83  GLU A OE1  3  
ATOM 5947  O OE2  . GLU A 1 83  ? 16.972  -6.833  4.735   1.00 1.69  ? 83  GLU A OE2  3  
ATOM 5948  H H    . GLU A 1 83  ? 11.796  -6.981  8.212   1.00 0.26  ? 83  GLU A H    3  
ATOM 5949  H HA   . GLU A 1 83  ? 14.615  -7.519  8.701   1.00 0.31  ? 83  GLU A HA   3  
ATOM 5950  H HB2  . GLU A 1 83  ? 14.656  -8.094  6.484   1.00 1.15  ? 83  GLU A HB2  3  
ATOM 5951  H HB3  . GLU A 1 83  ? 13.267  -7.102  6.085   1.00 1.13  ? 83  GLU A HB3  3  
ATOM 5952  H HG2  . GLU A 1 83  ? 14.551  -5.191  5.830   1.00 1.73  ? 83  GLU A HG2  3  
ATOM 5953  H HG3  . GLU A 1 83  ? 15.907  -5.867  6.741   1.00 1.68  ? 83  GLU A HG3  3  
ATOM 5954  N N    . PRO A 1 84  ? 14.821  -5.248  9.562   1.00 0.23  ? 84  PRO A N    3  
ATOM 5955  C CA   . PRO A 1 84  ? 14.867  -3.969  10.268  1.00 0.21  ? 84  PRO A CA   3  
ATOM 5956  C C    . PRO A 1 84  ? 15.410  -2.837  9.415   1.00 0.19  ? 84  PRO A C    3  
ATOM 5957  O O    . PRO A 1 84  ? 15.254  -1.664  9.758   1.00 0.20  ? 84  PRO A O    3  
ATOM 5958  C CB   . PRO A 1 84  ? 15.800  -4.248  11.445  1.00 0.25  ? 84  PRO A CB   3  
ATOM 5959  C CG   . PRO A 1 84  ? 16.693  -5.338  10.965  1.00 0.50  ? 84  PRO A CG   3  
ATOM 5960  C CD   . PRO A 1 84  ? 15.856  -6.184  10.046  1.00 0.31  ? 84  PRO A CD   3  
ATOM 5961  H HA   . PRO A 1 84  ? 13.892  -3.692  10.641  1.00 0.20  ? 84  PRO A HA   3  
ATOM 5962  H HB2  . PRO A 1 84  ? 16.360  -3.355  11.684  1.00 0.45  ? 84  PRO A HB2  3  
ATOM 5963  H HB3  . PRO A 1 84  ? 15.223  -4.559  12.301  1.00 0.41  ? 84  PRO A HB3  3  
ATOM 5964  H HG2  . PRO A 1 84  ? 17.532  -4.918  10.430  1.00 0.90  ? 84  PRO A HG2  3  
ATOM 5965  H HG3  . PRO A 1 84  ? 17.039  -5.926  11.804  1.00 0.88  ? 84  PRO A HG3  3  
ATOM 5966  H HD2  . PRO A 1 84  ? 16.452  -6.552  9.225   1.00 0.47  ? 84  PRO A HD2  3  
ATOM 5967  H HD3  . PRO A 1 84  ? 15.413  -7.004  10.589  1.00 0.50  ? 84  PRO A HD3  3  
ATOM 5968  N N    . GLU A 1 85  ? 16.030  -3.184  8.302   1.00 0.20  ? 85  GLU A N    3  
ATOM 5969  C CA   . GLU A 1 85  ? 16.596  -2.185  7.425   1.00 0.22  ? 85  GLU A CA   3  
ATOM 5970  C C    . GLU A 1 85  ? 16.916  -2.770  6.075   1.00 0.24  ? 85  GLU A C    3  
ATOM 5971  O O    . GLU A 1 85  ? 17.809  -3.600  5.916   1.00 0.35  ? 85  GLU A O    3  
ATOM 5972  C CB   . GLU A 1 85  ? 17.836  -1.544  8.048   1.00 0.31  ? 85  GLU A CB   3  
ATOM 5973  C CG   . GLU A 1 85  ? 18.361  -0.353  7.267   1.00 0.34  ? 85  GLU A CG   3  
ATOM 5974  C CD   . GLU A 1 85  ? 19.289  0.512   8.089   1.00 0.90  ? 85  GLU A CD   3  
ATOM 5975  O OE1  . GLU A 1 85  ? 18.786  1.230   8.980   1.00 1.37  ? 85  GLU A OE1  3  
ATOM 5976  O OE2  . GLU A 1 85  ? 20.510  0.480   7.853   1.00 1.30  ? 85  GLU A OE2  3  
ATOM 5977  H H    . GLU A 1 85  ? 16.087  -4.134  8.055   1.00 0.23  ? 85  GLU A H    3  
ATOM 5978  H HA   . GLU A 1 85  ? 15.842  -1.424  7.277   1.00 0.23  ? 85  GLU A HA   3  
ATOM 5979  H HB2  . GLU A 1 85  ? 17.595  -1.216  9.048   1.00 0.43  ? 85  GLU A HB2  3  
ATOM 5980  H HB3  . GLU A 1 85  ? 18.620  -2.285  8.100   1.00 0.36  ? 85  GLU A HB3  3  
ATOM 5981  H HG2  . GLU A 1 85  ? 18.899  -0.714  6.403   1.00 0.68  ? 85  GLU A HG2  3  
ATOM 5982  H HG3  . GLU A 1 85  ? 17.525  0.250   6.942   1.00 0.66  ? 85  GLU A HG3  3  
ATOM 5983  N N    . LEU A 1 86  ? 16.140  -2.322  5.123   1.00 0.23  ? 86  LEU A N    3  
ATOM 5984  C CA   . LEU A 1 86  ? 16.276  -2.692  3.746   1.00 0.24  ? 86  LEU A CA   3  
ATOM 5985  C C    . LEU A 1 86  ? 16.512  -1.438  2.921   1.00 0.23  ? 86  LEU A C    3  
ATOM 5986  O O    . LEU A 1 86  ? 15.591  -0.657  2.683   1.00 0.25  ? 86  LEU A O    3  
ATOM 5987  C CB   . LEU A 1 86  ? 15.000  -3.394  3.293   1.00 0.26  ? 86  LEU A CB   3  
ATOM 5988  C CG   . LEU A 1 86  ? 14.906  -3.677  1.803   1.00 0.33  ? 86  LEU A CG   3  
ATOM 5989  C CD1  . LEU A 1 86  ? 16.077  -4.528  1.329   1.00 0.38  ? 86  LEU A CD1  3  
ATOM 5990  C CD2  . LEU A 1 86  ? 13.588  -4.364  1.487   1.00 0.38  ? 86  LEU A CD2  3  
ATOM 5991  H H    . LEU A 1 86  ? 15.416  -1.706  5.369   1.00 0.29  ? 86  LEU A H    3  
ATOM 5992  H HA   . LEU A 1 86  ? 17.115  -3.359  3.648   1.00 0.26  ? 86  LEU A HA   3  
ATOM 5993  H HB2  . LEU A 1 86  ? 14.918  -4.324  3.823   1.00 0.27  ? 86  LEU A HB2  3  
ATOM 5994  H HB3  . LEU A 1 86  ? 14.163  -2.773  3.569   1.00 0.27  ? 86  LEU A HB3  3  
ATOM 5995  H HG   . LEU A 1 86  ? 14.934  -2.736  1.281   1.00 0.35  ? 86  LEU A HG   3  
ATOM 5996  H HD11 . LEU A 1 86  ? 15.992  -4.698  0.265   1.00 1.08  ? 86  LEU A HD11 3  
ATOM 5997  H HD12 . LEU A 1 86  ? 16.068  -5.475  1.847   1.00 1.14  ? 86  LEU A HD12 3  
ATOM 5998  H HD13 . LEU A 1 86  ? 17.003  -4.012  1.536   1.00 1.05  ? 86  LEU A HD13 3  
ATOM 5999  H HD21 . LEU A 1 86  ? 12.769  -3.705  1.733   1.00 1.08  ? 86  LEU A HD21 3  
ATOM 6000  H HD22 . LEU A 1 86  ? 13.509  -5.271  2.072   1.00 1.04  ? 86  LEU A HD22 3  
ATOM 6001  H HD23 . LEU A 1 86  ? 13.553  -4.609  0.436   1.00 0.99  ? 86  LEU A HD23 3  
ATOM 6002  N N    . VAL A 1 87  ? 17.750  -1.230  2.526   1.00 0.24  ? 87  VAL A N    3  
ATOM 6003  C CA   . VAL A 1 87  ? 18.102  -0.069  1.735   1.00 0.22  ? 87  VAL A CA   3  
ATOM 6004  C C    . VAL A 1 87  ? 18.150  -0.445  0.256   1.00 0.21  ? 87  VAL A C    3  
ATOM 6005  O O    . VAL A 1 87  ? 18.837  -1.388  -0.138  1.00 0.28  ? 87  VAL A O    3  
ATOM 6006  C CB   . VAL A 1 87  ? 19.447  0.540   2.196   1.00 0.27  ? 87  VAL A CB   3  
ATOM 6007  C CG1  . VAL A 1 87  ? 20.581  -0.462  2.081   1.00 1.00  ? 87  VAL A CG1  3  
ATOM 6008  C CG2  . VAL A 1 87  ? 19.769  1.800   1.416   1.00 0.94  ? 87  VAL A CG2  3  
ATOM 6009  H H    . VAL A 1 87  ? 18.443  -1.877  2.764   1.00 0.29  ? 87  VAL A H    3  
ATOM 6010  H HA   . VAL A 1 87  ? 17.325  0.679   1.883   1.00 0.20  ? 87  VAL A HA   3  
ATOM 6011  H HB   . VAL A 1 87  ? 19.351  0.807   3.236   1.00 0.79  ? 87  VAL A HB   3  
ATOM 6012  H HG11 . VAL A 1 87  ? 20.702  -0.743  1.047   1.00 1.46  ? 87  VAL A HG11 3  
ATOM 6013  H HG12 . VAL A 1 87  ? 20.351  -1.337  2.669   1.00 1.48  ? 87  VAL A HG12 3  
ATOM 6014  H HG13 . VAL A 1 87  ? 21.495  -0.014  2.442   1.00 1.59  ? 87  VAL A HG13 3  
ATOM 6015  H HG21 . VAL A 1 87  ? 18.993  2.533   1.579   1.00 1.54  ? 87  VAL A HG21 3  
ATOM 6016  H HG22 . VAL A 1 87  ? 19.829  1.565   0.363   1.00 1.50  ? 87  VAL A HG22 3  
ATOM 6017  H HG23 . VAL A 1 87  ? 20.716  2.196   1.753   1.00 1.54  ? 87  VAL A HG23 3  
ATOM 6018  N N    . PHE A 1 88  ? 17.400  0.286   -0.551  1.00 0.17  ? 88  PHE A N    3  
ATOM 6019  C CA   . PHE A 1 88  ? 17.228  -0.057  -1.955  1.00 0.19  ? 88  PHE A CA   3  
ATOM 6020  C C    . PHE A 1 88  ? 17.068  1.190   -2.802  1.00 0.20  ? 88  PHE A C    3  
ATOM 6021  O O    . PHE A 1 88  ? 16.710  2.256   -2.295  1.00 0.23  ? 88  PHE A O    3  
ATOM 6022  C CB   . PHE A 1 88  ? 16.007  -0.958  -2.119  1.00 0.21  ? 88  PHE A CB   3  
ATOM 6023  C CG   . PHE A 1 88  ? 14.697  -0.276  -1.825  1.00 0.18  ? 88  PHE A CG   3  
ATOM 6024  C CD1  . PHE A 1 88  ? 14.237  -0.159  -0.522  1.00 0.19  ? 88  PHE A CD1  3  
ATOM 6025  C CD2  . PHE A 1 88  ? 13.935  0.256   -2.854  1.00 0.17  ? 88  PHE A CD2  3  
ATOM 6026  C CE1  . PHE A 1 88  ? 13.042  0.475   -0.249  1.00 0.17  ? 88  PHE A CE1  3  
ATOM 6027  C CE2  . PHE A 1 88  ? 12.742  0.895   -2.586  1.00 0.16  ? 88  PHE A CE2  3  
ATOM 6028  C CZ   . PHE A 1 88  ? 12.267  0.955   -1.287  1.00 0.15  ? 88  PHE A CZ   3  
ATOM 6029  H H    . PHE A 1 88  ? 16.946  1.080   -0.194  1.00 0.18  ? 88  PHE A H    3  
ATOM 6030  H HA   . PHE A 1 88  ? 18.100  -0.591  -2.293  1.00 0.21  ? 88  PHE A HA   3  
ATOM 6031  H HB2  . PHE A 1 88  ? 15.975  -1.318  -3.132  1.00 0.25  ? 88  PHE A HB2  3  
ATOM 6032  H HB3  . PHE A 1 88  ? 16.100  -1.799  -1.448  1.00 0.24  ? 88  PHE A HB3  3  
ATOM 6033  H HD1  . PHE A 1 88  ? 14.819  -0.575  0.286   1.00 0.21  ? 88  PHE A HD1  3  
ATOM 6034  H HD2  . PHE A 1 88  ? 14.284  0.170   -3.873  1.00 0.18  ? 88  PHE A HD2  3  
ATOM 6035  H HE1  . PHE A 1 88  ? 12.695  0.559   0.769   1.00 0.19  ? 88  PHE A HE1  3  
ATOM 6036  H HE2  . PHE A 1 88  ? 12.156  1.303   -3.401  1.00 0.16  ? 88  PHE A HE2  3  
ATOM 6037  H HZ   . PHE A 1 88  ? 11.317  1.424   -1.085  1.00 0.15  ? 88  PHE A HZ   3  
ATOM 6038  N N    . THR A 1 89  ? 17.322  1.048   -4.090  1.00 0.23  ? 89  THR A N    3  
ATOM 6039  C CA   . THR A 1 89  ? 17.190  2.150   -5.016  1.00 0.25  ? 89  THR A CA   3  
ATOM 6040  C C    . THR A 1 89  ? 15.727  2.338   -5.405  1.00 0.21  ? 89  THR A C    3  
ATOM 6041  O O    . THR A 1 89  ? 15.140  1.492   -6.085  1.00 0.22  ? 89  THR A O    3  
ATOM 6042  C CB   . THR A 1 89  ? 18.041  1.905   -6.272  1.00 0.33  ? 89  THR A CB   3  
ATOM 6043  O OG1  . THR A 1 89  ? 19.292  1.311   -5.898  1.00 0.42  ? 89  THR A OG1  3  
ATOM 6044  C CG2  . THR A 1 89  ? 18.293  3.211   -7.014  1.00 0.37  ? 89  THR A CG2  3  
ATOM 6045  H H    . THR A 1 89  ? 17.605  0.171   -4.430  1.00 0.28  ? 89  THR A H    3  
ATOM 6046  H HA   . THR A 1 89  ? 17.548  3.048   -4.531  1.00 0.26  ? 89  THR A HA   3  
ATOM 6047  H HB   . THR A 1 89  ? 17.508  1.229   -6.926  1.00 0.33  ? 89  THR A HB   3  
ATOM 6048  H HG1  . THR A 1 89  ? 19.155  0.371   -5.717  1.00 0.78  ? 89  THR A HG1  3  
ATOM 6049  H HG21 . THR A 1 89  ? 17.352  3.621   -7.347  1.00 1.05  ? 89  THR A HG21 3  
ATOM 6050  H HG22 . THR A 1 89  ? 18.930  3.027   -7.868  1.00 1.02  ? 89  THR A HG22 3  
ATOM 6051  H HG23 . THR A 1 89  ? 18.777  3.916   -6.351  1.00 1.07  ? 89  THR A HG23 3  
ATOM 6052  N N    . LEU A 1 90  ? 15.136  3.431   -4.932  1.00 0.19  ? 90  LEU A N    3  
ATOM 6053  C CA   . LEU A 1 90  ? 13.744  3.748   -5.230  1.00 0.16  ? 90  LEU A CA   3  
ATOM 6054  C C    . LEU A 1 90  ? 13.518  3.852   -6.737  1.00 0.15  ? 90  LEU A C    3  
ATOM 6055  O O    . LEU A 1 90  ? 14.314  4.465   -7.445  1.00 0.18  ? 90  LEU A O    3  
ATOM 6056  C CB   . LEU A 1 90  ? 13.352  5.070   -4.570  1.00 0.16  ? 90  LEU A CB   3  
ATOM 6057  C CG   . LEU A 1 90  ? 11.849  5.290   -4.420  1.00 0.34  ? 90  LEU A CG   3  
ATOM 6058  C CD1  . LEU A 1 90  ? 11.216  4.108   -3.704  1.00 0.60  ? 90  LEU A CD1  3  
ATOM 6059  C CD2  . LEU A 1 90  ? 11.573  6.582   -3.663  1.00 0.60  ? 90  LEU A CD2  3  
ATOM 6060  H H    . LEU A 1 90  ? 15.649  4.034   -4.354  1.00 0.20  ? 90  LEU A H    3  
ATOM 6061  H HA   . LEU A 1 90  ? 13.121  2.958   -4.830  1.00 0.17  ? 90  LEU A HA   3  
ATOM 6062  H HB2  . LEU A 1 90  ? 13.803  5.124   -3.600  1.00 0.37  ? 90  LEU A HB2  3  
ATOM 6063  H HB3  . LEU A 1 90  ? 13.749  5.871   -5.167  1.00 0.39  ? 90  LEU A HB3  3  
ATOM 6064  H HG   . LEU A 1 90  ? 11.400  5.368   -5.402  1.00 0.78  ? 90  LEU A HG   3  
ATOM 6065  H HD11 . LEU A 1 90  ? 11.419  3.199   -4.252  1.00 1.17  ? 90  LEU A HD11 3  
ATOM 6066  H HD12 . LEU A 1 90  ? 10.150  4.257   -3.641  1.00 1.31  ? 90  LEU A HD12 3  
ATOM 6067  H HD13 . LEU A 1 90  ? 11.631  4.026   -2.709  1.00 1.19  ? 90  LEU A HD13 3  
ATOM 6068  H HD21 . LEU A 1 90  ? 12.005  7.414   -4.199  1.00 1.19  ? 90  LEU A HD21 3  
ATOM 6069  H HD22 . LEU A 1 90  ? 12.012  6.522   -2.677  1.00 1.33  ? 90  LEU A HD22 3  
ATOM 6070  H HD23 . LEU A 1 90  ? 10.508  6.726   -3.573  1.00 1.18  ? 90  LEU A HD23 3  
ATOM 6071  N N    . GLY A 1 91  ? 12.448  3.240   -7.222  1.00 0.20  ? 91  GLY A N    3  
ATOM 6072  C CA   . GLY A 1 91  ? 12.089  3.358   -8.624  1.00 0.23  ? 91  GLY A CA   3  
ATOM 6073  C C    . GLY A 1 91  ? 12.990  2.543   -9.518  1.00 0.26  ? 91  GLY A C    3  
ATOM 6074  O O    . GLY A 1 91  ? 12.965  2.681   -10.742 1.00 0.37  ? 91  GLY A O    3  
ATOM 6075  H H    . GLY A 1 91  ? 11.906  2.666   -6.630  1.00 0.24  ? 91  GLY A H    3  
ATOM 6076  H HA2  . GLY A 1 91  ? 11.072  3.021   -8.754  1.00 0.26  ? 91  GLY A HA2  3  
ATOM 6077  H HA3  . GLY A 1 91  ? 12.154  4.395   -8.915  1.00 0.24  ? 91  GLY A HA3  3  
ATOM 6078  N N    . ASP A 1 92  ? 13.785  1.685   -8.910  1.00 0.27  ? 92  ASP A N    3  
ATOM 6079  C CA   . ASP A 1 92  ? 14.711  0.859   -9.660  1.00 0.32  ? 92  ASP A CA   3  
ATOM 6080  C C    . ASP A 1 92  ? 14.279  -0.589  -9.561  1.00 0.30  ? 92  ASP A C    3  
ATOM 6081  O O    . ASP A 1 92  ? 14.980  -1.496  -10.010 1.00 0.37  ? 92  ASP A O    3  
ATOM 6082  C CB   . ASP A 1 92  ? 16.138  1.065   -9.140  1.00 0.42  ? 92  ASP A CB   3  
ATOM 6083  C CG   . ASP A 1 92  ? 17.192  0.503   -10.074 1.00 0.59  ? 92  ASP A CG   3  
ATOM 6084  O OD1  . ASP A 1 92  ? 17.150  0.809   -11.283 1.00 0.93  ? 92  ASP A OD1  3  
ATOM 6085  O OD2  . ASP A 1 92  ? 18.046  -0.280  -9.604  1.00 0.82  ? 92  ASP A OD2  3  
ATOM 6086  H H    . ASP A 1 92  ? 13.741  1.595   -7.929  1.00 0.29  ? 92  ASP A H    3  
ATOM 6087  H HA   . ASP A 1 92  ? 14.662  1.156   -10.686 1.00 0.38  ? 92  ASP A HA   3  
ATOM 6088  H HB2  . ASP A 1 92  ? 16.324  2.128   -9.023  1.00 0.47  ? 92  ASP A HB2  3  
ATOM 6089  H HB3  . ASP A 1 92  ? 16.237  0.581   -8.179  1.00 0.43  ? 92  ASP A HB3  3  
ATOM 6090  N N    . CYS A 1 93  ? 13.085  -0.784  -8.987  1.00 0.28  ? 93  CYS A N    3  
ATOM 6091  C CA   . CYS A 1 93  ? 12.526  -2.112  -8.779  1.00 0.27  ? 93  CYS A CA   3  
ATOM 6092  C C    . CYS A 1 93  ? 13.498  -2.962  -7.979  1.00 0.26  ? 93  CYS A C    3  
ATOM 6093  O O    . CYS A 1 93  ? 13.579  -4.179  -8.155  1.00 0.31  ? 93  CYS A O    3  
ATOM 6094  C CB   . CYS A 1 93  ? 12.219  -2.781  -10.115 1.00 0.38  ? 93  CYS A CB   3  
ATOM 6095  S SG   . CYS A 1 93  ? 11.176  -1.785  -11.211 1.00 0.62  ? 93  CYS A SG   3  
ATOM 6096  H H    . CYS A 1 93  ? 12.560  -0.001  -8.699  1.00 0.30  ? 93  CYS A H    3  
ATOM 6097  H HA   . CYS A 1 93  ? 11.611  -2.005  -8.215  1.00 0.26  ? 93  CYS A HA   3  
ATOM 6098  H HB2  . CYS A 1 93  ? 13.151  -2.980  -10.627 1.00 0.68  ? 93  CYS A HB2  3  
ATOM 6099  H HB3  . CYS A 1 93  ? 11.708  -3.718  -9.927  1.00 0.47  ? 93  CYS A HB3  3  
ATOM 6100  H HG   . CYS A 1 93  ? 11.892  -1.490  -12.290 1.00 1.55  ? 93  CYS A HG   3  
ATOM 6101  N N    . ASP A 1 94  ? 14.216  -2.302  -7.076  1.00 0.27  ? 94  ASP A N    3  
ATOM 6102  C CA   . ASP A 1 94  ? 15.197  -2.967  -6.246  1.00 0.33  ? 94  ASP A CA   3  
ATOM 6103  C C    . ASP A 1 94  ? 14.470  -3.888  -5.273  1.00 0.33  ? 94  ASP A C    3  
ATOM 6104  O O    . ASP A 1 94  ? 15.050  -4.779  -4.648  1.00 0.48  ? 94  ASP A O    3  
ATOM 6105  C CB   . ASP A 1 94  ? 16.001  -1.921  -5.483  1.00 0.41  ? 94  ASP A CB   3  
ATOM 6106  C CG   . ASP A 1 94  ? 17.456  -2.295  -5.293  1.00 0.65  ? 94  ASP A CG   3  
ATOM 6107  O OD1  . ASP A 1 94  ? 17.717  -3.474  -4.955  1.00 0.96  ? 94  ASP A OD1  3  
ATOM 6108  O OD2  . ASP A 1 94  ? 18.336  -1.428  -5.466  1.00 1.33  ? 94  ASP A OD2  3  
ATOM 6109  H H    . ASP A 1 94  ? 14.083  -1.335  -6.967  1.00 0.28  ? 94  ASP A H    3  
ATOM 6110  H HA   . ASP A 1 94  ? 15.844  -3.537  -6.883  1.00 0.37  ? 94  ASP A HA   3  
ATOM 6111  H HB2  . ASP A 1 94  ? 15.963  -0.986  -6.020  1.00 0.64  ? 94  ASP A HB2  3  
ATOM 6112  H HB3  . ASP A 1 94  ? 15.554  -1.786  -4.512  1.00 0.46  ? 94  ASP A HB3  3  
ATOM 6113  N N    . VAL A 1 95  ? 13.170  -3.654  -5.186  1.00 0.23  ? 95  VAL A N    3  
ATOM 6114  C CA   . VAL A 1 95  ? 12.285  -4.353  -4.271  1.00 0.21  ? 95  VAL A CA   3  
ATOM 6115  C C    . VAL A 1 95  ? 11.017  -4.796  -4.988  1.00 0.20  ? 95  VAL A C    3  
ATOM 6116  O O    . VAL A 1 95  ? 10.995  -4.917  -6.213  1.00 0.22  ? 95  VAL A O    3  
ATOM 6117  C CB   . VAL A 1 95  ? 11.894  -3.427  -3.109  1.00 0.20  ? 95  VAL A CB   3  
ATOM 6118  C CG1  . VAL A 1 95  ? 13.079  -3.202  -2.202  1.00 0.23  ? 95  VAL A CG1  3  
ATOM 6119  C CG2  . VAL A 1 95  ? 11.373  -2.101  -3.651  1.00 0.19  ? 95  VAL A CG2  3  
ATOM 6120  H H    . VAL A 1 95  ? 12.784  -2.976  -5.780  1.00 0.25  ? 95  VAL A H    3  
ATOM 6121  H HA   . VAL A 1 95  ? 12.805  -5.214  -3.874  1.00 0.23  ? 95  VAL A HA   3  
ATOM 6122  H HB   . VAL A 1 95  ? 11.107  -3.898  -2.538  1.00 0.20  ? 95  VAL A HB   3  
ATOM 6123  H HG11 . VAL A 1 95  ? 13.397  -4.145  -1.787  1.00 0.99  ? 95  VAL A HG11 3  
ATOM 6124  H HG12 . VAL A 1 95  ? 12.799  -2.530  -1.406  1.00 1.04  ? 95  VAL A HG12 3  
ATOM 6125  H HG13 . VAL A 1 95  ? 13.887  -2.769  -2.775  1.00 0.98  ? 95  VAL A HG13 3  
ATOM 6126  H HG21 . VAL A 1 95  ? 10.465  -2.274  -4.208  1.00 1.08  ? 95  VAL A HG21 3  
ATOM 6127  H HG22 . VAL A 1 95  ? 12.118  -1.664  -4.307  1.00 1.02  ? 95  VAL A HG22 3  
ATOM 6128  H HG23 . VAL A 1 95  ? 11.172  -1.427  -2.831  1.00 1.01  ? 95  VAL A HG23 3  
ATOM 6129  N N    . ILE A 1 96  ? 9.953   -5.005  -4.225  1.00 0.19  ? 96  ILE A N    3  
ATOM 6130  C CA   . ILE A 1 96  ? 8.674   -5.332  -4.793  1.00 0.19  ? 96  ILE A CA   3  
ATOM 6131  C C    . ILE A 1 96  ? 8.011   -4.038  -5.210  1.00 0.16  ? 96  ILE A C    3  
ATOM 6132  O O    . ILE A 1 96  ? 8.118   -3.032  -4.506  1.00 0.15  ? 96  ILE A O    3  
ATOM 6133  C CB   . ILE A 1 96  ? 7.783   -6.104  -3.796  1.00 0.22  ? 96  ILE A CB   3  
ATOM 6134  C CG1  . ILE A 1 96  ? 7.512   -5.267  -2.542  1.00 0.25  ? 96  ILE A CG1  3  
ATOM 6135  C CG2  . ILE A 1 96  ? 8.450   -7.422  -3.427  1.00 0.26  ? 96  ILE A CG2  3  
ATOM 6136  C CD1  . ILE A 1 96  ? 6.589   -5.945  -1.552  1.00 0.29  ? 96  ILE A CD1  3  
ATOM 6137  H H    . ILE A 1 96  ? 10.019  -4.885  -3.262  1.00 0.21  ? 96  ILE A H    3  
ATOM 6138  H HA   . ILE A 1 96  ? 8.835   -5.949  -5.667  1.00 0.21  ? 96  ILE A HA   3  
ATOM 6139  H HB   . ILE A 1 96  ? 6.846   -6.327  -4.284  1.00 0.22  ? 96  ILE A HB   3  
ATOM 6140  H HG12 . ILE A 1 96  ? 8.447   -5.069  -2.038  1.00 0.27  ? 96  ILE A HG12 3  
ATOM 6141  H HG13 . ILE A 1 96  ? 7.057   -4.326  -2.833  1.00 0.24  ? 96  ILE A HG13 3  
ATOM 6142  H HG21 . ILE A 1 96  ? 7.824   -7.964  -2.735  1.00 1.03  ? 96  ILE A HG21 3  
ATOM 6143  H HG22 . ILE A 1 96  ? 9.407   -7.228  -2.968  1.00 1.06  ? 96  ILE A HG22 3  
ATOM 6144  H HG23 . ILE A 1 96  ? 8.594   -8.014  -4.319  1.00 1.05  ? 96  ILE A HG23 3  
ATOM 6145  H HD11 . ILE A 1 96  ? 6.426   -5.296  -0.706  1.00 1.00  ? 96  ILE A HD11 3  
ATOM 6146  H HD12 . ILE A 1 96  ? 7.037   -6.872  -1.217  1.00 1.02  ? 96  ILE A HD12 3  
ATOM 6147  H HD13 . ILE A 1 96  ? 5.644   -6.155  -2.031  1.00 0.98  ? 96  ILE A HD13 3  
ATOM 6148  N N    . GLN A 1 97  ? 7.360   -4.046  -6.352  1.00 0.17  ? 97  GLN A N    3  
ATOM 6149  C CA   . GLN A 1 97  ? 6.820   -2.820  -6.922  1.00 0.17  ? 97  GLN A CA   3  
ATOM 6150  C C    . GLN A 1 97  ? 5.841   -2.152  -5.955  1.00 0.16  ? 97  GLN A C    3  
ATOM 6151  O O    . GLN A 1 97  ? 5.725   -0.928  -5.936  1.00 0.16  ? 97  GLN A O    3  
ATOM 6152  C CB   . GLN A 1 97  ? 6.142   -3.093  -8.260  1.00 0.19  ? 97  GLN A CB   3  
ATOM 6153  C CG   . GLN A 1 97  ? 6.194   -1.906  -9.209  1.00 0.25  ? 97  GLN A CG   3  
ATOM 6154  C CD   . GLN A 1 97  ? 7.553   -1.745  -9.874  1.00 0.31  ? 97  GLN A CD   3  
ATOM 6155  O OE1  . GLN A 1 97  ? 7.785   -2.289  -10.953 1.00 0.40  ? 97  GLN A OE1  3  
ATOM 6156  N NE2  . GLN A 1 97  ? 8.464   -1.011  -9.237  1.00 0.32  ? 97  GLN A NE2  3  
ATOM 6157  H H    . GLN A 1 97  ? 7.248   -4.892  -6.823  1.00 0.19  ? 97  GLN A H    3  
ATOM 6158  H HA   . GLN A 1 97  ? 7.650   -2.146  -7.083  1.00 0.17  ? 97  GLN A HA   3  
ATOM 6159  H HB2  . GLN A 1 97  ? 6.632   -3.931  -8.735  1.00 0.23  ? 97  GLN A HB2  3  
ATOM 6160  H HB3  . GLN A 1 97  ? 5.107   -3.340  -8.083  1.00 0.21  ? 97  GLN A HB3  3  
ATOM 6161  H HG2  . GLN A 1 97  ? 5.448   -2.045  -9.975  1.00 0.29  ? 97  GLN A HG2  3  
ATOM 6162  H HG3  . GLN A 1 97  ? 5.970   -1.008  -8.650  1.00 0.29  ? 97  GLN A HG3  3  
ATOM 6163  H HE21 . GLN A 1 97  ? 8.229   -0.612  -8.371  1.00 0.29  ? 97  GLN A HE21 3  
ATOM 6164  H HE22 . GLN A 1 97  ? 9.337   -0.886  -9.668  1.00 0.39  ? 97  GLN A HE22 3  
ATOM 6165  N N    . ALA A 1 98  ? 5.156   -2.958  -5.140  1.00 0.17  ? 98  ALA A N    3  
ATOM 6166  C CA   . ALA A 1 98  ? 4.276   -2.432  -4.096  1.00 0.18  ? 98  ALA A CA   3  
ATOM 6167  C C    . ALA A 1 98  ? 5.033   -1.468  -3.198  1.00 0.17  ? 98  ALA A C    3  
ATOM 6168  O O    . ALA A 1 98  ? 4.562   -0.373  -2.892  1.00 0.20  ? 98  ALA A O    3  
ATOM 6169  C CB   . ALA A 1 98  ? 3.715   -3.569  -3.256  1.00 0.20  ? 98  ALA A CB   3  
ATOM 6170  H H    . ALA A 1 98  ? 5.246   -3.932  -5.245  1.00 0.18  ? 98  ALA A H    3  
ATOM 6171  H HA   . ALA A 1 98  ? 3.454   -1.911  -4.567  1.00 0.19  ? 98  ALA A HA   3  
ATOM 6172  H HB1  . ALA A 1 98  ? 3.118   -4.213  -3.877  1.00 1.08  ? 98  ALA A HB1  3  
ATOM 6173  H HB2  . ALA A 1 98  ? 3.101   -3.164  -2.463  1.00 1.01  ? 98  ALA A HB2  3  
ATOM 6174  H HB3  . ALA A 1 98  ? 4.530   -4.134  -2.826  1.00 1.00  ? 98  ALA A HB3  3  
ATOM 6175  N N    . LEU A 1 99  ? 6.225   -1.876  -2.811  1.00 0.17  ? 99  LEU A N    3  
ATOM 6176  C CA   . LEU A 1 99  ? 7.046   -1.079  -1.907  1.00 0.17  ? 99  LEU A CA   3  
ATOM 6177  C C    . LEU A 1 99  ? 7.707   0.064   -2.652  1.00 0.15  ? 99  LEU A C    3  
ATOM 6178  O O    . LEU A 1 99  ? 7.801   1.183   -2.147  1.00 0.15  ? 99  LEU A O    3  
ATOM 6179  C CB   . LEU A 1 99  ? 8.122   -1.917  -1.228  1.00 0.19  ? 99  LEU A CB   3  
ATOM 6180  C CG   . LEU A 1 99  ? 9.022   -1.127  -0.270  1.00 0.18  ? 99  LEU A CG   3  
ATOM 6181  C CD1  . LEU A 1 99  ? 8.195   -0.500  0.845   1.00 0.21  ? 99  LEU A CD1  3  
ATOM 6182  C CD2  . LEU A 1 99  ? 10.106  -2.018  0.310   1.00 0.22  ? 99  LEU A CD2  3  
ATOM 6183  H H    . LEU A 1 99  ? 6.570   -2.726  -3.169  1.00 0.19  ? 99  LEU A H    3  
ATOM 6184  H HA   . LEU A 1 99  ? 6.397   -0.673  -1.152  1.00 0.17  ? 99  LEU A HA   3  
ATOM 6185  H HB2  . LEU A 1 99  ? 7.641   -2.713  -0.676  1.00 0.23  ? 99  LEU A HB2  3  
ATOM 6186  H HB3  . LEU A 1 99  ? 8.746   -2.353  -1.995  1.00 0.21  ? 99  LEU A HB3  3  
ATOM 6187  H HG   . LEU A 1 99  ? 9.503   -0.326  -0.817  1.00 0.15  ? 99  LEU A HG   3  
ATOM 6188  H HD11 . LEU A 1 99  ? 7.422   0.121   0.415   1.00 1.03  ? 99  LEU A HD11 3  
ATOM 6189  H HD12 . LEU A 1 99  ? 8.833   0.106   1.474   1.00 1.02  ? 99  LEU A HD12 3  
ATOM 6190  H HD13 . LEU A 1 99  ? 7.740   -1.279  1.440   1.00 1.06  ? 99  LEU A HD13 3  
ATOM 6191  H HD21 . LEU A 1 99  ? 10.722  -2.403  -0.489  1.00 0.97  ? 99  LEU A HD21 3  
ATOM 6192  H HD22 . LEU A 1 99  ? 9.649   -2.838  0.842   1.00 1.01  ? 99  LEU A HD22 3  
ATOM 6193  H HD23 . LEU A 1 99  ? 10.715  -1.440  0.990   1.00 1.07  ? 99  LEU A HD23 3  
ATOM 6194  N N    . ASP A 1 100 ? 8.133   -0.231  -3.868  1.00 0.15  ? 100 ASP A N    3  
ATOM 6195  C CA   . ASP A 1 100 ? 8.868   0.715   -4.688  1.00 0.16  ? 100 ASP A CA   3  
ATOM 6196  C C    . ASP A 1 100 ? 8.001   1.933   -4.962  1.00 0.15  ? 100 ASP A C    3  
ATOM 6197  O O    . ASP A 1 100 ? 8.494   3.044   -5.150  1.00 0.16  ? 100 ASP A O    3  
ATOM 6198  C CB   . ASP A 1 100 ? 9.287   0.027   -5.991  1.00 0.17  ? 100 ASP A CB   3  
ATOM 6199  C CG   . ASP A 1 100 ? 10.111  0.911   -6.903  1.00 0.20  ? 100 ASP A CG   3  
ATOM 6200  O OD1  . ASP A 1 100 ? 11.357  0.910   -6.782  1.00 0.21  ? 100 ASP A OD1  3  
ATOM 6201  O OD2  . ASP A 1 100 ? 9.512   1.633   -7.724  1.00 0.26  ? 100 ASP A OD2  3  
ATOM 6202  H H    . ASP A 1 100 ? 7.925   -1.114  -4.239  1.00 0.16  ? 100 ASP A H    3  
ATOM 6203  H HA   . ASP A 1 100 ? 9.746   1.022   -4.143  1.00 0.16  ? 100 ASP A HA   3  
ATOM 6204  H HB2  . ASP A 1 100 ? 9.876   -0.844  -5.747  1.00 0.19  ? 100 ASP A HB2  3  
ATOM 6205  H HB3  . ASP A 1 100 ? 8.405   -0.287  -6.521  1.00 0.16  ? 100 ASP A HB3  3  
ATOM 6206  N N    . LEU A 1 101 ? 6.698   1.706   -4.972  1.00 0.16  ? 101 LEU A N    3  
ATOM 6207  C CA   . LEU A 1 101 ? 5.732   2.767   -5.143  1.00 0.16  ? 101 LEU A CA   3  
ATOM 6208  C C    . LEU A 1 101 ? 5.298   3.366   -3.801  1.00 0.15  ? 101 LEU A C    3  
ATOM 6209  O O    . LEU A 1 101 ? 5.048   4.569   -3.699  1.00 0.16  ? 101 LEU A O    3  
ATOM 6210  C CB   . LEU A 1 101 ? 4.519   2.222   -5.892  1.00 0.19  ? 101 LEU A CB   3  
ATOM 6211  C CG   . LEU A 1 101 ? 4.816   1.584   -7.251  1.00 0.22  ? 101 LEU A CG   3  
ATOM 6212  C CD1  . LEU A 1 101 ? 3.536   1.061   -7.885  1.00 0.25  ? 101 LEU A CD1  3  
ATOM 6213  C CD2  . LEU A 1 101 ? 5.515   2.574   -8.169  1.00 0.25  ? 101 LEU A CD2  3  
ATOM 6214  H H    . LEU A 1 101 ? 6.375   0.785   -4.872  1.00 0.16  ? 101 LEU A H    3  
ATOM 6215  H HA   . LEU A 1 101 ? 6.199   3.540   -5.730  1.00 0.17  ? 101 LEU A HA   3  
ATOM 6216  H HB2  . LEU A 1 101 ? 4.045   1.477   -5.269  1.00 0.20  ? 101 LEU A HB2  3  
ATOM 6217  H HB3  . LEU A 1 101 ? 3.833   3.026   -6.038  1.00 0.19  ? 101 LEU A HB3  3  
ATOM 6218  H HG   . LEU A 1 101 ? 5.477   0.742   -7.106  1.00 0.23  ? 101 LEU A HG   3  
ATOM 6219  H HD11 . LEU A 1 101 ? 3.769   0.564   -8.814  1.00 0.87  ? 101 LEU A HD11 3  
ATOM 6220  H HD12 . LEU A 1 101 ? 2.864   1.885   -8.075  1.00 1.03  ? 101 LEU A HD12 3  
ATOM 6221  H HD13 . LEU A 1 101 ? 3.062   0.361   -7.211  1.00 1.01  ? 101 LEU A HD13 3  
ATOM 6222  H HD21 . LEU A 1 101 ? 5.689   2.116   -9.131  1.00 1.01  ? 101 LEU A HD21 3  
ATOM 6223  H HD22 . LEU A 1 101 ? 6.463   2.858   -7.733  1.00 1.02  ? 101 LEU A HD22 3  
ATOM 6224  H HD23 . LEU A 1 101 ? 4.899   3.452   -8.290  1.00 1.06  ? 101 LEU A HD23 3  
ATOM 6225  N N    . SER A 1 102 ? 5.215   2.528   -2.776  1.00 0.15  ? 102 SER A N    3  
ATOM 6226  C CA   . SER A 1 102 ? 4.714   2.948   -1.476  1.00 0.17  ? 102 SER A CA   3  
ATOM 6227  C C    . SER A 1 102 ? 5.623   3.997   -0.845  1.00 0.15  ? 102 SER A C    3  
ATOM 6228  O O    . SER A 1 102 ? 5.155   4.915   -0.176  1.00 0.18  ? 102 SER A O    3  
ATOM 6229  C CB   . SER A 1 102 ? 4.586   1.735   -0.549  1.00 0.23  ? 102 SER A CB   3  
ATOM 6230  O OG   . SER A 1 102 ? 4.206   2.120   0.760   1.00 1.01  ? 102 SER A OG   3  
ATOM 6231  H H    . SER A 1 102 ? 5.502   1.602   -2.891  1.00 0.15  ? 102 SER A H    3  
ATOM 6232  H HA   . SER A 1 102 ? 3.733   3.377   -1.625  1.00 0.20  ? 102 SER A HA   3  
ATOM 6233  H HB2  . SER A 1 102 ? 3.838   1.062   -0.945  1.00 0.79  ? 102 SER A HB2  3  
ATOM 6234  H HB3  . SER A 1 102 ? 5.536   1.223   -0.499  1.00 1.05  ? 102 SER A HB3  3  
ATOM 6235  H HG   . SER A 1 102 ? 4.903   2.649   1.154   1.00 1.53  ? 102 SER A HG   3  
ATOM 6236  N N    . VAL A 1 103 ? 6.919   3.858   -1.074  1.00 0.15  ? 103 VAL A N    3  
ATOM 6237  C CA   . VAL A 1 103 ? 7.910   4.739   -0.472  1.00 0.16  ? 103 VAL A CA   3  
ATOM 6238  C C    . VAL A 1 103 ? 7.757   6.194   -0.924  1.00 0.16  ? 103 VAL A C    3  
ATOM 6239  O O    . VAL A 1 103 ? 7.632   7.081   -0.090  1.00 0.18  ? 103 VAL A O    3  
ATOM 6240  C CB   . VAL A 1 103 ? 9.325   4.254   -0.780  1.00 0.18  ? 103 VAL A CB   3  
ATOM 6241  C CG1  . VAL A 1 103 ? 10.371  5.281   -0.358  1.00 0.21  ? 103 VAL A CG1  3  
ATOM 6242  C CG2  . VAL A 1 103 ? 9.579   2.928   -0.088  1.00 0.19  ? 103 VAL A CG2  3  
ATOM 6243  H H    . VAL A 1 103 ? 7.222   3.139   -1.669  1.00 0.15  ? 103 VAL A H    3  
ATOM 6244  H HA   . VAL A 1 103 ? 7.774   4.695   0.592   1.00 0.17  ? 103 VAL A HA   3  
ATOM 6245  H HB   . VAL A 1 103 ? 9.389   4.102   -1.850  1.00 0.18  ? 103 VAL A HB   3  
ATOM 6246  H HG11 . VAL A 1 103 ? 10.354  5.396   0.716   1.00 1.02  ? 103 VAL A HG11 3  
ATOM 6247  H HG12 . VAL A 1 103 ? 10.148  6.230   -0.825  1.00 1.06  ? 103 VAL A HG12 3  
ATOM 6248  H HG13 . VAL A 1 103 ? 11.348  4.947   -0.670  1.00 1.00  ? 103 VAL A HG13 3  
ATOM 6249  H HG21 . VAL A 1 103 ? 10.640  2.753   -0.031  1.00 1.03  ? 103 VAL A HG21 3  
ATOM 6250  H HG22 . VAL A 1 103 ? 9.110   2.134   -0.650  1.00 1.00  ? 103 VAL A HG22 3  
ATOM 6251  H HG23 . VAL A 1 103 ? 9.164   2.956   0.909   1.00 1.03  ? 103 VAL A HG23 3  
ATOM 6252  N N    . PRO A 1 104 ? 7.769   6.472   -2.243  1.00 0.17  ? 104 PRO A N    3  
ATOM 6253  C CA   . PRO A 1 104 ? 7.550   7.832   -2.749  1.00 0.21  ? 104 PRO A CA   3  
ATOM 6254  C C    . PRO A 1 104 ? 6.156   8.349   -2.403  1.00 0.19  ? 104 PRO A C    3  
ATOM 6255  O O    . PRO A 1 104 ? 5.917   9.557   -2.386  1.00 0.22  ? 104 PRO A O    3  
ATOM 6256  C CB   . PRO A 1 104 ? 7.720   7.692   -4.264  1.00 0.27  ? 104 PRO A CB   3  
ATOM 6257  C CG   . PRO A 1 104 ? 7.534   6.244   -4.544  1.00 0.21  ? 104 PRO A CG   3  
ATOM 6258  C CD   . PRO A 1 104 ? 8.039   5.523   -3.335  1.00 0.17  ? 104 PRO A CD   3  
ATOM 6259  H HA   . PRO A 1 104 ? 8.288   8.518   -2.362  1.00 0.24  ? 104 PRO A HA   3  
ATOM 6260  H HB2  . PRO A 1 104 ? 6.978   8.291   -4.769  1.00 0.38  ? 104 PRO A HB2  3  
ATOM 6261  H HB3  . PRO A 1 104 ? 8.708   8.021   -4.543  1.00 0.41  ? 104 PRO A HB3  3  
ATOM 6262  H HG2  . PRO A 1 104 ? 6.487   6.030   -4.702  1.00 0.31  ? 104 PRO A HG2  3  
ATOM 6263  H HG3  . PRO A 1 104 ? 8.108   5.962   -5.406  1.00 0.33  ? 104 PRO A HG3  3  
ATOM 6264  H HD2  . PRO A 1 104 ? 7.504   4.595   -3.194  1.00 0.16  ? 104 PRO A HD2  3  
ATOM 6265  H HD3  . PRO A 1 104 ? 9.098   5.334   -3.426  1.00 0.20  ? 104 PRO A HD3  3  
ATOM 6266  N N    . LEU A 1 105 ? 5.241   7.423   -2.144  1.00 0.18  ? 105 LEU A N    3  
ATOM 6267  C CA   . LEU A 1 105 ? 3.907   7.770   -1.669  1.00 0.19  ? 105 LEU A CA   3  
ATOM 6268  C C    . LEU A 1 105 ? 3.904   8.025   -0.164  1.00 0.22  ? 105 LEU A C    3  
ATOM 6269  O O    . LEU A 1 105 ? 2.923   8.514   0.398   1.00 0.32  ? 105 LEU A O    3  
ATOM 6270  C CB   . LEU A 1 105 ? 2.934   6.642   -1.986  1.00 0.18  ? 105 LEU A CB   3  
ATOM 6271  C CG   . LEU A 1 105 ? 2.455   6.569   -3.433  1.00 0.25  ? 105 LEU A CG   3  
ATOM 6272  C CD1  . LEU A 1 105 ? 1.210   5.705   -3.528  1.00 0.53  ? 105 LEU A CD1  3  
ATOM 6273  C CD2  . LEU A 1 105 ? 2.186   7.963   -3.988  1.00 0.64  ? 105 LEU A CD2  3  
ATOM 6274  H H    . LEU A 1 105 ? 5.464   6.477   -2.294  1.00 0.18  ? 105 LEU A H    3  
ATOM 6275  H HA   . LEU A 1 105 ? 3.588   8.666   -2.179  1.00 0.22  ? 105 LEU A HA   3  
ATOM 6276  H HB2  . LEU A 1 105 ? 3.430   5.704   -1.749  1.00 0.15  ? 105 LEU A HB2  3  
ATOM 6277  H HB3  . LEU A 1 105 ? 2.071   6.746   -1.347  1.00 0.22  ? 105 LEU A HB3  3  
ATOM 6278  H HG   . LEU A 1 105 ? 3.225   6.109   -4.034  1.00 0.63  ? 105 LEU A HG   3  
ATOM 6279  H HD11 . LEU A 1 105 ? 0.843   5.710   -4.544  1.00 1.26  ? 105 LEU A HD11 3  
ATOM 6280  H HD12 . LEU A 1 105 ? 0.448   6.096   -2.868  1.00 1.14  ? 105 LEU A HD12 3  
ATOM 6281  H HD13 . LEU A 1 105 ? 1.453   4.694   -3.238  1.00 1.09  ? 105 LEU A HD13 3  
ATOM 6282  H HD21 . LEU A 1 105 ? 1.789   7.884   -4.987  1.00 1.17  ? 105 LEU A HD21 3  
ATOM 6283  H HD22 . LEU A 1 105 ? 3.106   8.526   -4.010  1.00 1.35  ? 105 LEU A HD22 3  
ATOM 6284  H HD23 . LEU A 1 105 ? 1.471   8.469   -3.356  1.00 1.29  ? 105 LEU A HD23 3  
ATOM 6285  N N    . MET A 1 106 ? 4.983   7.642   0.488   1.00 0.20  ? 106 MET A N    3  
ATOM 6286  C CA   . MET A 1 106 ? 5.124   7.819   1.923   1.00 0.24  ? 106 MET A CA   3  
ATOM 6287  C C    . MET A 1 106 ? 6.110   8.953   2.239   1.00 0.21  ? 106 MET A C    3  
ATOM 6288  O O    . MET A 1 106 ? 6.944   9.315   1.409   1.00 0.26  ? 106 MET A O    3  
ATOM 6289  C CB   . MET A 1 106 ? 5.567   6.485   2.549   1.00 0.33  ? 106 MET A CB   3  
ATOM 6290  C CG   . MET A 1 106 ? 6.986   6.470   3.081   1.00 0.53  ? 106 MET A CG   3  
ATOM 6291  S SD   . MET A 1 106 ? 7.639   4.791   3.263   1.00 0.78  ? 106 MET A SD   3  
ATOM 6292  C CE   . MET A 1 106 ? 6.508   4.110   4.464   1.00 0.54  ? 106 MET A CE   3  
ATOM 6293  H H    . MET A 1 106 ? 5.711   7.206   -0.007  1.00 0.21  ? 106 MET A H    3  
ATOM 6294  H HA   . MET A 1 106 ? 4.154   8.082   2.317   1.00 0.30  ? 106 MET A HA   3  
ATOM 6295  H HB2  . MET A 1 106 ? 4.904   6.255   3.368   1.00 0.74  ? 106 MET A HB2  3  
ATOM 6296  H HB3  . MET A 1 106 ? 5.478   5.704   1.805   1.00 0.76  ? 106 MET A HB3  3  
ATOM 6297  H HG2  . MET A 1 106 ? 7.619   7.027   2.404   1.00 0.87  ? 106 MET A HG2  3  
ATOM 6298  H HG3  . MET A 1 106 ? 6.983   6.953   4.054   1.00 0.79  ? 106 MET A HG3  3  
ATOM 6299  H HE1  . MET A 1 106 ? 6.806   3.101   4.699   1.00 1.31  ? 106 MET A HE1  3  
ATOM 6300  H HE2  . MET A 1 106 ? 5.508   4.111   4.054   1.00 1.14  ? 106 MET A HE2  3  
ATOM 6301  H HE3  . MET A 1 106 ? 6.530   4.709   5.360   1.00 1.28  ? 106 MET A HE3  3  
ATOM 6302  N N    . ASP A 1 107 ? 5.990   9.528   3.428   1.00 0.18  ? 107 ASP A N    3  
ATOM 6303  C CA   . ASP A 1 107 ? 6.858   10.622  3.850   1.00 0.18  ? 107 ASP A CA   3  
ATOM 6304  C C    . ASP A 1 107 ? 8.011   10.085  4.687   1.00 0.14  ? 107 ASP A C    3  
ATOM 6305  O O    . ASP A 1 107 ? 7.902   9.025   5.311   1.00 0.13  ? 107 ASP A O    3  
ATOM 6306  C CB   . ASP A 1 107 ? 6.056   11.653  4.656   1.00 0.25  ? 107 ASP A CB   3  
ATOM 6307  C CG   . ASP A 1 107 ? 5.176   12.545  3.795   1.00 0.56  ? 107 ASP A CG   3  
ATOM 6308  O OD1  . ASP A 1 107 ? 4.109   12.085  3.338   1.00 0.92  ? 107 ASP A OD1  3  
ATOM 6309  O OD2  . ASP A 1 107 ? 5.544   13.726  3.579   1.00 0.97  ? 107 ASP A OD2  3  
ATOM 6310  H H    . ASP A 1 107 ? 5.302   9.196   4.060   1.00 0.20  ? 107 ASP A H    3  
ATOM 6311  H HA   . ASP A 1 107 ? 7.267   11.098  2.965   1.00 0.21  ? 107 ASP A HA   3  
ATOM 6312  H HB2  . ASP A 1 107 ? 5.420   11.132  5.355   1.00 0.58  ? 107 ASP A HB2  3  
ATOM 6313  H HB3  . ASP A 1 107 ? 6.743   12.280  5.208   1.00 0.60  ? 107 ASP A HB3  3  
ATOM 6314  N N    . VAL A 1 108 ? 9.128   10.799  4.690   1.00 0.16  ? 108 VAL A N    3  
ATOM 6315  C CA   . VAL A 1 108 ? 10.292  10.350  5.433   1.00 0.16  ? 108 VAL A CA   3  
ATOM 6316  C C    . VAL A 1 108 ? 9.999   10.318  6.924   1.00 0.15  ? 108 VAL A C    3  
ATOM 6317  O O    . VAL A 1 108 ? 9.442   11.261  7.496   1.00 0.19  ? 108 VAL A O    3  
ATOM 6318  C CB   . VAL A 1 108 ? 11.552  11.206  5.134   1.00 0.21  ? 108 VAL A CB   3  
ATOM 6319  C CG1  . VAL A 1 108 ? 11.823  12.254  6.207   1.00 0.68  ? 108 VAL A CG1  3  
ATOM 6320  C CG2  . VAL A 1 108 ? 12.763  10.309  4.943   1.00 0.80  ? 108 VAL A CG2  3  
ATOM 6321  H H    . VAL A 1 108 ? 9.177   11.631  4.173   1.00 0.20  ? 108 VAL A H    3  
ATOM 6322  H HA   . VAL A 1 108 ? 10.503  9.338   5.117   1.00 0.16  ? 108 VAL A HA   3  
ATOM 6323  H HB   . VAL A 1 108 ? 11.376  11.731  4.207   1.00 0.63  ? 108 VAL A HB   3  
ATOM 6324  H HG11 . VAL A 1 108 ? 12.071  11.761  7.136   1.00 1.22  ? 108 VAL A HG11 3  
ATOM 6325  H HG12 . VAL A 1 108 ? 10.944  12.862  6.350   1.00 1.47  ? 108 VAL A HG12 3  
ATOM 6326  H HG13 . VAL A 1 108 ? 12.648  12.878  5.899   1.00 1.26  ? 108 VAL A HG13 3  
ATOM 6327  H HG21 . VAL A 1 108 ? 13.626  10.911  4.702   1.00 1.43  ? 108 VAL A HG21 3  
ATOM 6328  H HG22 . VAL A 1 108 ? 12.571  9.612   4.140   1.00 1.43  ? 108 VAL A HG22 3  
ATOM 6329  H HG23 . VAL A 1 108 ? 12.951  9.762   5.855   1.00 1.25  ? 108 VAL A HG23 3  
ATOM 6330  N N    . GLY A 1 109 ? 10.320  9.194   7.518   1.00 0.15  ? 109 GLY A N    3  
ATOM 6331  C CA   . GLY A 1 109 ? 10.156  9.025   8.942   1.00 0.17  ? 109 GLY A CA   3  
ATOM 6332  C C    . GLY A 1 109 ? 8.828   8.396   9.297   1.00 0.18  ? 109 GLY A C    3  
ATOM 6333  O O    . GLY A 1 109 ? 8.472   8.316   10.476  1.00 0.28  ? 109 GLY A O    3  
ATOM 6334  H H    . GLY A 1 109 ? 10.657  8.454   6.970   1.00 0.16  ? 109 GLY A H    3  
ATOM 6335  H HA2  . GLY A 1 109 ? 10.954  8.400   9.314   1.00 0.18  ? 109 GLY A HA2  3  
ATOM 6336  H HA3  . GLY A 1 109 ? 10.223  9.993   9.417   1.00 0.18  ? 109 GLY A HA3  3  
ATOM 6337  N N    . GLU A 1 110 ? 8.080   7.952   8.291   1.00 0.13  ? 110 GLU A N    3  
ATOM 6338  C CA   . GLU A 1 110 ? 6.763   7.396   8.542   1.00 0.13  ? 110 GLU A CA   3  
ATOM 6339  C C    . GLU A 1 110 ? 6.800   5.882   8.601   1.00 0.10  ? 110 GLU A C    3  
ATOM 6340  O O    . GLU A 1 110 ? 7.785   5.245   8.216   1.00 0.12  ? 110 GLU A O    3  
ATOM 6341  C CB   . GLU A 1 110 ? 5.742   7.844   7.485   1.00 0.17  ? 110 GLU A CB   3  
ATOM 6342  C CG   . GLU A 1 110 ? 5.692   7.015   6.215   1.00 0.20  ? 110 GLU A CG   3  
ATOM 6343  C CD   . GLU A 1 110 ? 4.431   7.287   5.403   1.00 0.27  ? 110 GLU A CD   3  
ATOM 6344  O OE1  . GLU A 1 110 ? 4.160   8.463   5.074   1.00 0.41  ? 110 GLU A OE1  3  
ATOM 6345  O OE2  . GLU A 1 110 ? 3.699   6.329   5.099   1.00 0.39  ? 110 GLU A OE2  3  
ATOM 6346  H H    . GLU A 1 110 ? 8.416   8.002   7.370   1.00 0.13  ? 110 GLU A H    3  
ATOM 6347  H HA   . GLU A 1 110 ? 6.440   7.764   9.505   1.00 0.15  ? 110 GLU A HA   3  
ATOM 6348  H HB2  . GLU A 1 110 ? 4.762   7.804   7.932   1.00 0.18  ? 110 GLU A HB2  3  
ATOM 6349  H HB3  . GLU A 1 110 ? 5.957   8.867   7.208   1.00 0.23  ? 110 GLU A HB3  3  
ATOM 6350  H HG2  . GLU A 1 110 ? 6.550   7.252   5.610   1.00 0.25  ? 110 GLU A HG2  3  
ATOM 6351  H HG3  . GLU A 1 110 ? 5.713   5.968   6.481   1.00 0.20  ? 110 GLU A HG3  3  
ATOM 6352  N N    . THR A 1 111 ? 5.719   5.314   9.092   1.00 0.10  ? 111 THR A N    3  
ATOM 6353  C CA   . THR A 1 111 ? 5.533   3.891   9.072   1.00 0.11  ? 111 THR A CA   3  
ATOM 6354  C C    . THR A 1 111 ? 4.185   3.608   8.438   1.00 0.11  ? 111 THR A C    3  
ATOM 6355  O O    . THR A 1 111 ? 3.152   4.059   8.935   1.00 0.12  ? 111 THR A O    3  
ATOM 6356  C CB   . THR A 1 111 ? 5.610   3.286   10.487  1.00 0.16  ? 111 THR A CB   3  
ATOM 6357  O OG1  . THR A 1 111 ? 6.766   3.801   11.164  1.00 0.22  ? 111 THR A OG1  3  
ATOM 6358  C CG2  . THR A 1 111 ? 5.706   1.768   10.421  1.00 0.19  ? 111 THR A CG2  3  
ATOM 6359  H H    . THR A 1 111 ? 5.000   5.878   9.453   1.00 0.12  ? 111 THR A H    3  
ATOM 6360  H HA   . THR A 1 111 ? 6.308   3.459   8.466   1.00 0.14  ? 111 THR A HA   3  
ATOM 6361  H HB   . THR A 1 111 ? 4.721   3.558   11.038  1.00 0.17  ? 111 THR A HB   3  
ATOM 6362  H HG1  . THR A 1 111 ? 7.146   4.513   10.639  1.00 0.27  ? 111 THR A HG1  3  
ATOM 6363  H HG21 . THR A 1 111 ? 5.785   1.366   11.420  1.00 1.07  ? 111 THR A HG21 3  
ATOM 6364  H HG22 . THR A 1 111 ? 6.578   1.487   9.848   1.00 1.02  ? 111 THR A HG22 3  
ATOM 6365  H HG23 . THR A 1 111 ? 4.821   1.375   9.942   1.00 1.01  ? 111 THR A HG23 3  
ATOM 6366  N N    . ALA A 1 112 ? 4.200   2.914   7.316   1.00 0.12  ? 112 ALA A N    3  
ATOM 6367  C CA   . ALA A 1 112 ? 2.986   2.661   6.582   1.00 0.13  ? 112 ALA A CA   3  
ATOM 6368  C C    . ALA A 1 112 ? 2.743   1.178   6.467   1.00 0.12  ? 112 ALA A C    3  
ATOM 6369  O O    . ALA A 1 112 ? 3.662   0.406   6.213   1.00 0.13  ? 112 ALA A O    3  
ATOM 6370  C CB   . ALA A 1 112 ? 3.059   3.290   5.203   1.00 0.18  ? 112 ALA A CB   3  
ATOM 6371  H H    . ALA A 1 112 ? 5.049   2.553   6.975   1.00 0.14  ? 112 ALA A H    3  
ATOM 6372  H HA   . ALA A 1 112 ? 2.164   3.113   7.119   1.00 0.14  ? 112 ALA A HA   3  
ATOM 6373  H HB1  . ALA A 1 112 ? 3.307   4.338   5.300   1.00 1.00  ? 112 ALA A HB1  3  
ATOM 6374  H HB2  . ALA A 1 112 ? 2.104   3.191   4.709   1.00 0.96  ? 112 ALA A HB2  3  
ATOM 6375  H HB3  . ALA A 1 112 ? 3.819   2.792   4.621   1.00 0.95  ? 112 ALA A HB3  3  
ATOM 6376  N N    . MET A 1 113 ? 1.510   0.786   6.661   1.00 0.12  ? 113 MET A N    3  
ATOM 6377  C CA   . MET A 1 113 ? 1.130   -0.588  6.474   1.00 0.12  ? 113 MET A CA   3  
ATOM 6378  C C    . MET A 1 113 ? 0.433   -0.691  5.133   1.00 0.12  ? 113 MET A C    3  
ATOM 6379  O O    . MET A 1 113 ? -0.595  -0.052  4.917   1.00 0.14  ? 113 MET A O    3  
ATOM 6380  C CB   . MET A 1 113 ? 0.217   -1.056  7.606   1.00 0.16  ? 113 MET A CB   3  
ATOM 6381  C CG   . MET A 1 113 ? -0.397  -2.418  7.355   1.00 0.25  ? 113 MET A CG   3  
ATOM 6382  S SD   . MET A 1 113 ? -1.094  -3.163  8.840   1.00 0.53  ? 113 MET A SD   3  
ATOM 6383  C CE   . MET A 1 113 ? -2.525  -2.126  9.085   1.00 1.32  ? 113 MET A CE   3  
ATOM 6384  H H    . MET A 1 113 ? 0.822   1.448   6.896   1.00 0.13  ? 113 MET A H    3  
ATOM 6385  H HA   . MET A 1 113 ? 2.032   -1.194  6.463   1.00 0.13  ? 113 MET A HA   3  
ATOM 6386  H HB2  . MET A 1 113 ? 0.792   -1.107  8.518   1.00 0.19  ? 113 MET A HB2  3  
ATOM 6387  H HB3  . MET A 1 113 ? -0.583  -0.339  7.731   1.00 0.18  ? 113 MET A HB3  3  
ATOM 6388  H HG2  . MET A 1 113 ? -1.195  -2.298  6.633   1.00 0.27  ? 113 MET A HG2  3  
ATOM 6389  H HG3  . MET A 1 113 ? 0.359   -3.076  6.953   1.00 0.25  ? 113 MET A HG3  3  
ATOM 6390  H HE1  . MET A 1 113 ? -3.036  -2.425  9.987   1.00 1.94  ? 113 MET A HE1  3  
ATOM 6391  H HE2  . MET A 1 113 ? -3.193  -2.230  8.242   1.00 1.89  ? 113 MET A HE2  3  
ATOM 6392  H HE3  . MET A 1 113 ? -2.213  -1.096  9.171   1.00 1.90  ? 113 MET A HE3  3  
ATOM 6393  N N    . VAL A 1 114 ? 1.009   -1.461  4.234   1.00 0.12  ? 114 VAL A N    3  
ATOM 6394  C CA   . VAL A 1 114 ? 0.503   -1.565  2.879   1.00 0.12  ? 114 VAL A CA   3  
ATOM 6395  C C    . VAL A 1 114 ? -0.042  -2.947  2.638   1.00 0.13  ? 114 VAL A C    3  
ATOM 6396  O O    . VAL A 1 114 ? 0.583   -3.930  3.025   1.00 0.16  ? 114 VAL A O    3  
ATOM 6397  C CB   . VAL A 1 114 ? 1.625   -1.311  1.858   1.00 0.15  ? 114 VAL A CB   3  
ATOM 6398  C CG1  . VAL A 1 114 ? 1.092   -1.109  0.445   1.00 0.18  ? 114 VAL A CG1  3  
ATOM 6399  C CG2  . VAL A 1 114 ? 2.461   -0.135  2.297   1.00 0.17  ? 114 VAL A CG2  3  
ATOM 6400  H H    . VAL A 1 114 ? 1.815   -1.978  4.484   1.00 0.12  ? 114 VAL A H    3  
ATOM 6401  H HA   . VAL A 1 114 ? -0.271  -0.830  2.739   1.00 0.13  ? 114 VAL A HA   3  
ATOM 6402  H HB   . VAL A 1 114 ? 2.252   -2.178  1.845   1.00 0.16  ? 114 VAL A HB   3  
ATOM 6403  H HG11 . VAL A 1 114 ? 0.502   -1.965  0.153   1.00 1.06  ? 114 VAL A HG11 3  
ATOM 6404  H HG12 . VAL A 1 114 ? 1.917   -0.989  -0.240  1.00 1.03  ? 114 VAL A HG12 3  
ATOM 6405  H HG13 . VAL A 1 114 ? 0.472   -0.221  0.418   1.00 1.01  ? 114 VAL A HG13 3  
ATOM 6406  H HG21 . VAL A 1 114 ? 2.895   -0.352  3.262   1.00 0.97  ? 114 VAL A HG21 3  
ATOM 6407  H HG22 . VAL A 1 114 ? 1.829   0.736   2.372   1.00 0.98  ? 114 VAL A HG22 3  
ATOM 6408  H HG23 . VAL A 1 114 ? 3.244   0.040   1.579   1.00 0.95  ? 114 VAL A HG23 3  
ATOM 6409  N N    . THR A 1 115 ? -1.193  -3.043  2.013   1.00 0.14  ? 115 THR A N    3  
ATOM 6410  C CA   . THR A 1 115 ? -1.660  -4.324  1.599   1.00 0.14  ? 115 THR A CA   3  
ATOM 6411  C C    . THR A 1 115 ? -1.697  -4.352  0.093   1.00 0.13  ? 115 THR A C    3  
ATOM 6412  O O    . THR A 1 115 ? -2.452  -3.622  -0.553  1.00 0.16  ? 115 THR A O    3  
ATOM 6413  C CB   . THR A 1 115 ? -3.020  -4.680  2.207   1.00 0.17  ? 115 THR A CB   3  
ATOM 6414  O OG1  . THR A 1 115 ? -2.944  -4.579  3.631   1.00 0.21  ? 115 THR A OG1  3  
ATOM 6415  C CG2  . THR A 1 115 ? -3.395  -6.092  1.836   1.00 0.20  ? 115 THR A CG2  3  
ATOM 6416  H H    . THR A 1 115 ? -1.722  -2.235  1.797   1.00 0.16  ? 115 THR A H    3  
ATOM 6417  H HA   . THR A 1 115 ? -0.938  -5.059  1.934   1.00 0.15  ? 115 THR A HA   3  
ATOM 6418  H HB   . THR A 1 115 ? -3.771  -4.002  1.837   1.00 0.18  ? 115 THR A HB   3  
ATOM 6419  H HG1  . THR A 1 115 ? -2.019  -4.536  3.897   1.00 0.68  ? 115 THR A HG1  3  
ATOM 6420  H HG21 . THR A 1 115 ? -4.390  -6.307  2.192   1.00 1.03  ? 115 THR A HG21 3  
ATOM 6421  H HG22 . THR A 1 115 ? -2.690  -6.773  2.294   1.00 1.00  ? 115 THR A HG22 3  
ATOM 6422  H HG23 . THR A 1 115 ? -3.359  -6.196  0.763   1.00 1.02  ? 115 THR A HG23 3  
ATOM 6423  N N    . ALA A 1 116 ? -0.823  -5.171  -0.433  1.00 0.12  ? 116 ALA A N    3  
ATOM 6424  C CA   . ALA A 1 116 ? -0.620  -5.313  -1.858  1.00 0.13  ? 116 ALA A CA   3  
ATOM 6425  C C    . ALA A 1 116 ? -0.773  -6.760  -2.251  1.00 0.12  ? 116 ALA A C    3  
ATOM 6426  O O    . ALA A 1 116 ? -0.282  -7.646  -1.557  1.00 0.13  ? 116 ALA A O    3  
ATOM 6427  C CB   . ALA A 1 116 ? 0.759   -4.817  -2.234  1.00 0.15  ? 116 ALA A CB   3  
ATOM 6428  H H    . ALA A 1 116 ? -0.279  -5.719  0.183   1.00 0.13  ? 116 ALA A H    3  
ATOM 6429  H HA   . ALA A 1 116 ? -1.346  -4.718  -2.386  1.00 0.14  ? 116 ALA A HA   3  
ATOM 6430  H HB1  . ALA A 1 116 ? 0.853   -3.779  -1.954  1.00 1.01  ? 116 ALA A HB1  3  
ATOM 6431  H HB2  . ALA A 1 116 ? 0.901   -4.919  -3.299  1.00 0.97  ? 116 ALA A HB2  3  
ATOM 6432  H HB3  . ALA A 1 116 ? 1.503   -5.400  -1.713  1.00 0.99  ? 116 ALA A HB3  3  
ATOM 6433  N N    . ASP A 1 117 ? -1.469  -7.003  -3.349  1.00 0.13  ? 117 ASP A N    3  
ATOM 6434  C CA   . ASP A 1 117 ? -1.574  -8.345  -3.887  1.00 0.13  ? 117 ASP A CA   3  
ATOM 6435  C C    . ASP A 1 117 ? -0.179  -8.921  -4.063  1.00 0.11  ? 117 ASP A C    3  
ATOM 6436  O O    . ASP A 1 117 ? 0.776   -8.180  -4.313  1.00 0.12  ? 117 ASP A O    3  
ATOM 6437  C CB   . ASP A 1 117 ? -2.282  -8.340  -5.232  1.00 0.16  ? 117 ASP A CB   3  
ATOM 6438  C CG   . ASP A 1 117 ? -2.710  -9.735  -5.666  1.00 0.20  ? 117 ASP A CG   3  
ATOM 6439  O OD1  . ASP A 1 117 ? -1.845  -10.523 -6.089  1.00 0.50  ? 117 ASP A OD1  3  
ATOM 6440  O OD2  . ASP A 1 117 ? -3.922  -10.043 -5.578  1.00 0.58  ? 117 ASP A OD2  3  
ATOM 6441  H H    . ASP A 1 117 ? -1.930  -6.267  -3.799  1.00 0.15  ? 117 ASP A H    3  
ATOM 6442  H HA   . ASP A 1 117 ? -2.124  -8.953  -3.194  1.00 0.14  ? 117 ASP A HA   3  
ATOM 6443  H HB2  . ASP A 1 117 ? -3.147  -7.695  -5.192  1.00 0.20  ? 117 ASP A HB2  3  
ATOM 6444  H HB3  . ASP A 1 117 ? -1.600  -7.956  -5.968  1.00 0.16  ? 117 ASP A HB3  3  
ATOM 6445  N N    . SER A 1 118 ? -0.059  -10.227 -3.934  1.00 0.13  ? 118 SER A N    3  
ATOM 6446  C CA   . SER A 1 118 ? 1.220   -10.897 -4.080  1.00 0.16  ? 118 SER A CA   3  
ATOM 6447  C C    . SER A 1 118 ? 1.838   -10.574 -5.440  1.00 0.13  ? 118 SER A C    3  
ATOM 6448  O O    . SER A 1 118 ? 3.046   -10.561 -5.597  1.00 0.15  ? 118 SER A O    3  
ATOM 6449  C CB   . SER A 1 118 ? 1.030   -12.402 -3.924  1.00 0.27  ? 118 SER A CB   3  
ATOM 6450  O OG   . SER A 1 118 ? 2.220   -13.044 -3.514  1.00 0.82  ? 118 SER A OG   3  
ATOM 6451  H H    . SER A 1 118 ? -0.851  -10.760 -3.728  1.00 0.16  ? 118 SER A H    3  
ATOM 6452  H HA   . SER A 1 118 ? 1.875   -10.539 -3.301  1.00 0.20  ? 118 SER A HA   3  
ATOM 6453  H HB2  . SER A 1 118 ? 0.267   -12.589 -3.183  1.00 0.43  ? 118 SER A HB2  3  
ATOM 6454  H HB3  . SER A 1 118 ? 0.719   -12.818 -4.873  1.00 0.38  ? 118 SER A HB3  3  
ATOM 6455  H HG   . SER A 1 118 ? 2.014   -13.941 -3.220  1.00 1.04  ? 118 SER A HG   3  
ATOM 6456  N N    . LYS A 1 119 ? 1.003   -10.294 -6.423  1.00 0.13  ? 119 LYS A N    3  
ATOM 6457  C CA   . LYS A 1 119 ? 1.478   -9.873  -7.737  1.00 0.14  ? 119 LYS A CA   3  
ATOM 6458  C C    . LYS A 1 119 ? 2.396   -8.647  -7.637  1.00 0.14  ? 119 LYS A C    3  
ATOM 6459  O O    . LYS A 1 119 ? 3.300   -8.474  -8.455  1.00 0.18  ? 119 LYS A O    3  
ATOM 6460  C CB   . LYS A 1 119 ? 0.296   -9.572  -8.651  1.00 0.17  ? 119 LYS A CB   3  
ATOM 6461  C CG   . LYS A 1 119 ? -0.700  -8.621  -8.050  1.00 0.19  ? 119 LYS A CG   3  
ATOM 6462  C CD   . LYS A 1 119 ? -1.793  -8.271  -9.044  1.00 0.29  ? 119 LYS A CD   3  
ATOM 6463  C CE   . LYS A 1 119 ? -2.660  -9.472  -9.382  1.00 0.38  ? 119 LYS A CE   3  
ATOM 6464  N NZ   . LYS A 1 119 ? -3.597  -9.187  -10.505 1.00 0.81  ? 119 LYS A NZ   3  
ATOM 6465  H H    . LYS A 1 119 ? 0.037   -10.377 -6.265  1.00 0.13  ? 119 LYS A H    3  
ATOM 6466  H HA   . LYS A 1 119 ? 2.042   -10.691 -8.159  1.00 0.17  ? 119 LYS A HA   3  
ATOM 6467  H HB2  . LYS A 1 119 ? 0.662   -9.117  -9.551  1.00 0.19  ? 119 LYS A HB2  3  
ATOM 6468  H HB3  . LYS A 1 119 ? -0.211  -10.500 -8.891  1.00 0.21  ? 119 LYS A HB3  3  
ATOM 6469  H HG2  . LYS A 1 119 ? -1.148  -9.081  -7.175  1.00 0.18  ? 119 LYS A HG2  3  
ATOM 6470  H HG3  . LYS A 1 119 ? -0.185  -7.720  -7.759  1.00 0.20  ? 119 LYS A HG3  3  
ATOM 6471  H HD2  . LYS A 1 119 ? -2.417  -7.504  -8.609  1.00 0.33  ? 119 LYS A HD2  3  
ATOM 6472  H HD3  . LYS A 1 119 ? -1.337  -7.896  -9.950  1.00 0.34  ? 119 LYS A HD3  3  
ATOM 6473  H HE2  . LYS A 1 119 ? -2.016  -10.298 -9.654  1.00 0.57  ? 119 LYS A HE2  3  
ATOM 6474  H HE3  . LYS A 1 119 ? -3.233  -9.742  -8.506  1.00 0.72  ? 119 LYS A HE3  3  
ATOM 6475  H HZ1  . LYS A 1 119 ? -4.337  -9.920  -10.552 1.00 1.31  ? 119 LYS A HZ1  3  
ATOM 6476  H HZ2  . LYS A 1 119 ? -3.080  -9.179  -11.413 1.00 1.31  ? 119 LYS A HZ2  3  
ATOM 6477  H HZ3  . LYS A 1 119 ? -4.047  -8.254  -10.373 1.00 1.43  ? 119 LYS A HZ3  3  
ATOM 6478  N N    . TYR A 1 120 ? 2.171   -7.800  -6.630  1.00 0.13  ? 120 TYR A N    3  
ATOM 6479  C CA   . TYR A 1 120 ? 3.032   -6.648  -6.398  1.00 0.15  ? 120 TYR A CA   3  
ATOM 6480  C C    . TYR A 1 120 ? 4.095   -6.985  -5.370  1.00 0.15  ? 120 TYR A C    3  
ATOM 6481  O O    . TYR A 1 120 ? 4.944   -6.156  -5.032  1.00 0.19  ? 120 TYR A O    3  
ATOM 6482  C CB   . TYR A 1 120 ? 2.212   -5.456  -5.904  1.00 0.16  ? 120 TYR A CB   3  
ATOM 6483  C CG   . TYR A 1 120 ? 1.093   -5.074  -6.822  1.00 0.20  ? 120 TYR A CG   3  
ATOM 6484  C CD1  . TYR A 1 120 ? 1.301   -4.167  -7.839  1.00 0.28  ? 120 TYR A CD1  3  
ATOM 6485  C CD2  . TYR A 1 120 ? -0.163  -5.638  -6.678  1.00 0.23  ? 120 TYR A CD2  3  
ATOM 6486  C CE1  . TYR A 1 120 ? 0.275   -3.830  -8.705  1.00 0.34  ? 120 TYR A CE1  3  
ATOM 6487  C CE2  . TYR A 1 120 ? -1.196  -5.309  -7.528  1.00 0.30  ? 120 TYR A CE2  3  
ATOM 6488  C CZ   . TYR A 1 120 ? -0.974  -4.403  -8.545  1.00 0.34  ? 120 TYR A CZ   3  
ATOM 6489  O OH   . TYR A 1 120 ? -1.995  -4.079  -9.410  1.00 0.42  ? 120 TYR A OH   3  
ATOM 6490  H H    . TYR A 1 120 ? 1.405   -7.954  -6.021  1.00 0.12  ? 120 TYR A H    3  
ATOM 6491  H HA   . TYR A 1 120 ? 3.512   -6.395  -7.325  1.00 0.17  ? 120 TYR A HA   3  
ATOM 6492  H HB2  . TYR A 1 120 ? 1.780   -5.698  -4.948  1.00 0.16  ? 120 TYR A HB2  3  
ATOM 6493  H HB3  . TYR A 1 120 ? 2.862   -4.600  -5.798  1.00 0.18  ? 120 TYR A HB3  3  
ATOM 6494  H HD1  . TYR A 1 120 ? 2.285   -3.718  -7.947  1.00 0.32  ? 120 TYR A HD1  3  
ATOM 6495  H HD2  . TYR A 1 120 ? -0.327  -6.345  -5.880  1.00 0.25  ? 120 TYR A HD2  3  
ATOM 6496  H HE1  . TYR A 1 120 ? 0.453   -3.121  -9.498  1.00 0.41  ? 120 TYR A HE1  3  
ATOM 6497  H HE2  . TYR A 1 120 ? -2.167  -5.768  -7.397  1.00 0.35  ? 120 TYR A HE2  3  
ATOM 6498  H HH   . TYR A 1 120 ? -2.814  -3.937  -8.914  1.00 1.04  ? 120 TYR A HH   3  
ATOM 6499  N N    . CYS A 1 121 ? 4.044   -8.215  -4.899  1.00 0.14  ? 121 CYS A N    3  
ATOM 6500  C CA   . CYS A 1 121 ? 4.905   -8.671  -3.831  1.00 0.15  ? 121 CYS A CA   3  
ATOM 6501  C C    . CYS A 1 121 ? 5.721   -9.880  -4.279  1.00 0.16  ? 121 CYS A C    3  
ATOM 6502  O O    . CYS A 1 121 ? 6.814   -9.715  -4.804  1.00 0.18  ? 121 CYS A O    3  
ATOM 6503  C CB   . CYS A 1 121 ? 4.065   -8.999  -2.604  1.00 0.14  ? 121 CYS A CB   3  
ATOM 6504  S SG   . CYS A 1 121 ? 3.050   -7.613  -2.037  1.00 0.16  ? 121 CYS A SG   3  
ATOM 6505  H H    . CYS A 1 121 ? 3.409   -8.848  -5.298  1.00 0.14  ? 121 CYS A H    3  
ATOM 6506  H HA   . CYS A 1 121 ? 5.583   -7.869  -3.586  1.00 0.16  ? 121 CYS A HA   3  
ATOM 6507  H HB2  . CYS A 1 121 ? 3.404   -9.819  -2.842  1.00 0.14  ? 121 CYS A HB2  3  
ATOM 6508  H HB3  . CYS A 1 121 ? 4.716   -9.290  -1.793  1.00 0.15  ? 121 CYS A HB3  3  
ATOM 6509  H HG   . CYS A 1 121 ? 1.816   -7.800  -2.492  1.00 0.87  ? 121 CYS A HG   3  
ATOM 6510  N N    . TYR A 1 122 ? 5.196   -11.096 -4.091  1.00 0.16  ? 122 TYR A N    3  
ATOM 6511  C CA   . TYR A 1 122 ? 5.896   -12.294 -4.547  1.00 0.18  ? 122 TYR A CA   3  
ATOM 6512  C C    . TYR A 1 122 ? 4.926   -13.365 -5.064  1.00 0.18  ? 122 TYR A C    3  
ATOM 6513  O O    . TYR A 1 122 ? 5.138   -14.541 -4.807  1.00 0.20  ? 122 TYR A O    3  
ATOM 6514  C CB   . TYR A 1 122 ? 6.750   -12.910 -3.425  1.00 0.19  ? 122 TYR A CB   3  
ATOM 6515  C CG   . TYR A 1 122 ? 7.543   -11.920 -2.595  1.00 0.20  ? 122 TYR A CG   3  
ATOM 6516  C CD1  . TYR A 1 122 ? 8.824   -11.537 -2.979  1.00 0.21  ? 122 TYR A CD1  3  
ATOM 6517  C CD2  . TYR A 1 122 ? 7.021   -11.382 -1.424  1.00 0.19  ? 122 TYR A CD2  3  
ATOM 6518  C CE1  . TYR A 1 122 ? 9.559   -10.647 -2.221  1.00 0.23  ? 122 TYR A CE1  3  
ATOM 6519  C CE2  . TYR A 1 122 ? 7.749   -10.494 -0.664  1.00 0.20  ? 122 TYR A CE2  3  
ATOM 6520  C CZ   . TYR A 1 122 ? 9.018   -10.129 -1.065  1.00 0.22  ? 122 TYR A CZ   3  
ATOM 6521  O OH   . TYR A 1 122 ? 9.755   -9.256  -0.301  1.00 0.24  ? 122 TYR A OH   3  
ATOM 6522  H H    . TYR A 1 122 ? 4.331   -11.187 -3.637  1.00 0.15  ? 122 TYR A H    3  
ATOM 6523  H HA   . TYR A 1 122 ? 6.549   -12.002 -5.356  1.00 0.19  ? 122 TYR A HA   3  
ATOM 6524  H HB2  . TYR A 1 122 ? 6.118   -13.475 -2.759  1.00 0.20  ? 122 TYR A HB2  3  
ATOM 6525  H HB3  . TYR A 1 122 ? 7.457   -13.590 -3.879  1.00 0.22  ? 122 TYR A HB3  3  
ATOM 6526  H HD1  . TYR A 1 122 ? 9.247   -11.945 -3.885  1.00 0.23  ? 122 TYR A HD1  3  
ATOM 6527  H HD2  . TYR A 1 122 ? 6.029   -11.669 -1.103  1.00 0.19  ? 122 TYR A HD2  3  
ATOM 6528  H HE1  . TYR A 1 122 ? 10.551  -10.364 -2.533  1.00 0.25  ? 122 TYR A HE1  3  
ATOM 6529  H HE2  . TYR A 1 122 ? 7.321   -10.088 0.239   1.00 0.21  ? 122 TYR A HE2  3  
ATOM 6530  H HH   . TYR A 1 122 ? 10.322  -8.721  -0.878  1.00 0.96  ? 122 TYR A HH   3  
ATOM 6531  N N    . GLY A 1 123 ? 3.887   -12.966 -5.803  1.00 0.19  ? 123 GLY A N    3  
ATOM 6532  C CA   . GLY A 1 123 ? 2.921   -13.921 -6.341  1.00 0.21  ? 123 GLY A CA   3  
ATOM 6533  C C    . GLY A 1 123 ? 3.552   -15.069 -7.114  1.00 0.21  ? 123 GLY A C    3  
ATOM 6534  O O    . GLY A 1 123 ? 3.730   -16.161 -6.579  1.00 0.25  ? 123 GLY A O    3  
ATOM 6535  H H    . GLY A 1 123 ? 3.735   -11.997 -5.947  1.00 0.20  ? 123 GLY A H    3  
ATOM 6536  H HA2  . GLY A 1 123 ? 2.347   -14.332 -5.521  1.00 0.24  ? 123 GLY A HA2  3  
ATOM 6537  H HA3  . GLY A 1 123 ? 2.245   -13.391 -6.997  1.00 0.25  ? 123 GLY A HA3  3  
ATOM 6538  N N    . PRO A 1 124 ? 3.877   -14.868 -8.392  1.00 0.25  ? 124 PRO A N    3  
ATOM 6539  C CA   . PRO A 1 124 ? 4.590   -15.860 -9.184  1.00 0.30  ? 124 PRO A CA   3  
ATOM 6540  C C    . PRO A 1 124 ? 6.093   -15.775 -8.942  1.00 0.30  ? 124 PRO A C    3  
ATOM 6541  O O    . PRO A 1 124 ? 6.894   -16.350 -9.683  1.00 0.34  ? 124 PRO A O    3  
ATOM 6542  C CB   . PRO A 1 124 ? 4.259   -15.479 -10.637 1.00 0.37  ? 124 PRO A CB   3  
ATOM 6543  C CG   . PRO A 1 124 ? 3.422   -14.235 -10.573 1.00 0.58  ? 124 PRO A CG   3  
ATOM 6544  C CD   . PRO A 1 124 ? 3.560   -13.678 -9.182  1.00 0.32  ? 124 PRO A CD   3  
ATOM 6545  H HA   . PRO A 1 124 ? 4.243   -16.864 -8.976  1.00 0.33  ? 124 PRO A HA   3  
ATOM 6546  H HB2  . PRO A 1 124 ? 5.176   -15.300 -11.177 1.00 0.46  ? 124 PRO A HB2  3  
ATOM 6547  H HB3  . PRO A 1 124 ? 3.719   -16.288 -11.107 1.00 0.45  ? 124 PRO A HB3  3  
ATOM 6548  H HG2  . PRO A 1 124 ? 3.780   -13.518 -11.296 1.00 0.90  ? 124 PRO A HG2  3  
ATOM 6549  H HG3  . PRO A 1 124 ? 2.391   -14.482 -10.775 1.00 0.87  ? 124 PRO A HG3  3  
ATOM 6550  H HD2  . PRO A 1 124 ? 4.365   -12.959 -9.139  1.00 0.40  ? 124 PRO A HD2  3  
ATOM 6551  H HD3  . PRO A 1 124 ? 2.632   -13.232 -8.857  1.00 0.38  ? 124 PRO A HD3  3  
ATOM 6552  N N    . GLN A 1 125 ? 6.460   -15.040 -7.903  1.00 0.27  ? 125 GLN A N    3  
ATOM 6553  C CA   . GLN A 1 125 ? 7.862   -14.774 -7.616  1.00 0.30  ? 125 GLN A CA   3  
ATOM 6554  C C    . GLN A 1 125 ? 8.313   -15.619 -6.439  1.00 0.32  ? 125 GLN A C    3  
ATOM 6555  O O    . GLN A 1 125 ? 9.315   -16.332 -6.500  1.00 0.39  ? 125 GLN A O    3  
ATOM 6556  C CB   . GLN A 1 125 ? 8.057   -13.295 -7.293  1.00 0.30  ? 125 GLN A CB   3  
ATOM 6557  C CG   . GLN A 1 125 ? 7.196   -12.364 -8.130  1.00 0.33  ? 125 GLN A CG   3  
ATOM 6558  C CD   . GLN A 1 125 ? 7.234   -10.943 -7.617  1.00 0.35  ? 125 GLN A CD   3  
ATOM 6559  O OE1  . GLN A 1 125 ? 8.264   -10.480 -7.132  1.00 0.65  ? 125 GLN A OE1  3  
ATOM 6560  N NE2  . GLN A 1 125 ? 6.102   -10.257 -7.685  1.00 0.29  ? 125 GLN A NE2  3  
ATOM 6561  H H    . GLN A 1 125 ? 5.770   -14.702 -7.285  1.00 0.24  ? 125 GLN A H    3  
ATOM 6562  H HA   . GLN A 1 125 ? 8.444   -15.030 -8.489  1.00 0.34  ? 125 GLN A HA   3  
ATOM 6563  H HB2  . GLN A 1 125 ? 7.819   -13.130 -6.252  1.00 0.33  ? 125 GLN A HB2  3  
ATOM 6564  H HB3  . GLN A 1 125 ? 9.091   -13.038 -7.460  1.00 0.36  ? 125 GLN A HB3  3  
ATOM 6565  H HG2  . GLN A 1 125 ? 7.563   -12.370 -9.146  1.00 0.39  ? 125 GLN A HG2  3  
ATOM 6566  H HG3  . GLN A 1 125 ? 6.176   -12.715 -8.110  1.00 0.38  ? 125 GLN A HG3  3  
ATOM 6567  H HE21 . GLN A 1 125 ? 5.318   -10.694 -8.077  1.00 0.45  ? 125 GLN A HE21 3  
ATOM 6568  H HE22 . GLN A 1 125 ? 6.087   -9.354  -7.307  1.00 0.29  ? 125 GLN A HE22 3  
ATOM 6569  N N    . GLY A 1 126 ? 7.536   -15.529 -5.372  1.00 0.27  ? 126 GLY A N    3  
ATOM 6570  C CA   . GLY A 1 126 ? 7.869   -16.168 -4.127  1.00 0.27  ? 126 GLY A CA   3  
ATOM 6571  C C    . GLY A 1 126 ? 8.863   -15.366 -3.324  1.00 0.28  ? 126 GLY A C    3  
ATOM 6572  O O    . GLY A 1 126 ? 9.785   -14.762 -3.874  1.00 0.30  ? 126 GLY A O    3  
ATOM 6573  H H    . GLY A 1 126 ? 6.700   -15.022 -5.434  1.00 0.24  ? 126 GLY A H    3  
ATOM 6574  H HA2  . GLY A 1 126 ? 6.963   -16.265 -3.545  1.00 0.25  ? 126 GLY A HA2  3  
ATOM 6575  H HA3  . GLY A 1 126 ? 8.273   -17.145 -4.319  1.00 0.30  ? 126 GLY A HA3  3  
ATOM 6576  N N    . SER A 1 127 ? 8.668   -15.358 -2.026  1.00 0.27  ? 127 SER A N    3  
ATOM 6577  C CA   . SER A 1 127 ? 9.492   -14.568 -1.138  1.00 0.28  ? 127 SER A CA   3  
ATOM 6578  C C    . SER A 1 127 ? 10.691  -15.361 -0.613  1.00 0.32  ? 127 SER A C    3  
ATOM 6579  O O    . SER A 1 127 ? 10.660  -16.587 -0.537  1.00 0.33  ? 127 SER A O    3  
ATOM 6580  C CB   . SER A 1 127 ? 8.627   -14.031 0.015   1.00 0.27  ? 127 SER A CB   3  
ATOM 6581  O OG   . SER A 1 127 ? 9.408   -13.453 1.045   1.00 0.30  ? 127 SER A OG   3  
ATOM 6582  H H    . SER A 1 127 ? 7.925   -15.866 -1.660  1.00 0.26  ? 127 SER A H    3  
ATOM 6583  H HA   . SER A 1 127 ? 9.854   -13.745 -1.707  1.00 0.29  ? 127 SER A HA   3  
ATOM 6584  H HB2  . SER A 1 127 ? 7.957   -13.277 -0.364  1.00 0.25  ? 127 SER A HB2  3  
ATOM 6585  H HB3  . SER A 1 127 ? 8.034   -14.838 0.420   1.00 0.27  ? 127 SER A HB3  3  
ATOM 6586  H HG   . SER A 1 127 ? 9.891   -12.700 0.693   1.00 0.90  ? 127 SER A HG   3  
ATOM 6587  N N    . ARG A 1 128 ? 11.753  -14.615 -0.300  1.00 0.38  ? 128 ARG A N    3  
ATOM 6588  C CA   . ARG A 1 128 ? 13.026  -15.155 0.185   1.00 0.42  ? 128 ARG A CA   3  
ATOM 6589  C C    . ARG A 1 128 ? 12.862  -16.198 1.291   1.00 0.42  ? 128 ARG A C    3  
ATOM 6590  O O    . ARG A 1 128 ? 13.482  -17.261 1.233   1.00 0.52  ? 128 ARG A O    3  
ATOM 6591  C CB   . ARG A 1 128 ? 13.922  -14.001 0.658   1.00 0.52  ? 128 ARG A CB   3  
ATOM 6592  C CG   . ARG A 1 128 ? 13.176  -12.909 1.414   1.00 1.12  ? 128 ARG A CG   3  
ATOM 6593  C CD   . ARG A 1 128 ? 14.076  -11.729 1.743   1.00 1.41  ? 128 ARG A CD   3  
ATOM 6594  N NE   . ARG A 1 128 ? 13.313  -10.604 2.290   1.00 1.81  ? 128 ARG A NE   3  
ATOM 6595  C CZ   . ARG A 1 128 ? 13.850  -9.444  2.669   1.00 2.33  ? 128 ARG A CZ   3  
ATOM 6596  N NH1  . ARG A 1 128 ? 15.157  -9.237  2.584   1.00 2.45  ? 128 ARG A NH1  3  
ATOM 6597  N NH2  . ARG A 1 128 ? 13.074  -8.475  3.135   1.00 3.17  ? 128 ARG A NH2  3  
ATOM 6598  H H    . ARG A 1 128 ? 11.686  -13.649 -0.432  1.00 0.44  ? 128 ARG A H    3  
ATOM 6599  H HA   . ARG A 1 128 ? 13.508  -15.634 -0.654  1.00 0.43  ? 128 ARG A HA   3  
ATOM 6600  H HB2  . ARG A 1 128 ? 14.686  -14.398 1.310   1.00 0.97  ? 128 ARG A HB2  3  
ATOM 6601  H HB3  . ARG A 1 128 ? 14.393  -13.554 -0.202  1.00 1.07  ? 128 ARG A HB3  3  
ATOM 6602  H HG2  . ARG A 1 128 ? 12.358  -12.561 0.804   1.00 1.62  ? 128 ARG A HG2  3  
ATOM 6603  H HG3  . ARG A 1 128 ? 12.789  -13.319 2.336   1.00 1.72  ? 128 ARG A HG3  3  
ATOM 6604  H HD2  . ARG A 1 128 ? 14.812  -12.044 2.470   1.00 1.89  ? 128 ARG A HD2  3  
ATOM 6605  H HD3  . ARG A 1 128 ? 14.578  -11.408 0.842   1.00 1.87  ? 128 ARG A HD3  3  
ATOM 6606  H HE   . ARG A 1 128 ? 12.340  -10.722 2.371   1.00 2.16  ? 128 ARG A HE   3  
ATOM 6607  H HH11 . ARG A 1 128 ? 15.765  -9.952  2.231   1.00 2.38  ? 128 ARG A HH11 3  
ATOM 6608  H HH12 . ARG A 1 128 ? 15.546  -8.352  2.880   1.00 2.95  ? 128 ARG A HH12 3  
ATOM 6609  H HH21 . ARG A 1 128 ? 12.081  -8.608  3.205   1.00 3.53  ? 128 ARG A HH21 3  
ATOM 6610  H HH22 . ARG A 1 128 ? 13.486  -7.596  3.423   1.00 3.61  ? 128 ARG A HH22 3  
ATOM 6611  N N    . SER A 1 129 ? 12.060  -15.901 2.303   1.00 0.42  ? 129 SER A N    3  
ATOM 6612  C CA   . SER A 1 129 ? 11.815  -16.877 3.349   1.00 0.44  ? 129 SER A CA   3  
ATOM 6613  C C    . SER A 1 129 ? 10.744  -17.870 2.894   1.00 0.41  ? 129 SER A C    3  
ATOM 6614  O O    . SER A 1 129 ? 11.042  -19.052 2.719   1.00 0.44  ? 129 SER A O    3  
ATOM 6615  C CB   . SER A 1 129 ? 11.447  -16.198 4.671   1.00 0.48  ? 129 SER A CB   3  
ATOM 6616  O OG   . SER A 1 129 ? 12.471  -15.311 5.085   1.00 1.23  ? 129 SER A OG   3  
ATOM 6617  H H    . SER A 1 129 ? 11.630  -15.026 2.345   1.00 0.48  ? 129 SER A H    3  
ATOM 6618  H HA   . SER A 1 129 ? 12.738  -17.426 3.492   1.00 0.46  ? 129 SER A HA   3  
ATOM 6619  H HB2  . SER A 1 129 ? 10.532  -15.637 4.543   1.00 0.81  ? 129 SER A HB2  3  
ATOM 6620  H HB3  . SER A 1 129 ? 11.303  -16.952 5.431   1.00 1.00  ? 129 SER A HB3  3  
ATOM 6621  H HG   . SER A 1 129 ? 13.242  -15.822 5.356   1.00 1.52  ? 129 SER A HG   3  
ATOM 6622  N N    . PRO A 1 130 ? 9.479   -17.441 2.689   1.00 0.37  ? 130 PRO A N    3  
ATOM 6623  C CA   . PRO A 1 130 ? 8.464   -18.285 2.112   1.00 0.36  ? 130 PRO A CA   3  
ATOM 6624  C C    . PRO A 1 130 ? 8.133   -17.884 0.681   1.00 0.32  ? 130 PRO A C    3  
ATOM 6625  O O    . PRO A 1 130 ? 7.834   -16.725 0.422   1.00 0.27  ? 130 PRO A O    3  
ATOM 6626  C CB   . PRO A 1 130 ? 7.252   -17.969 3.000   1.00 0.37  ? 130 PRO A CB   3  
ATOM 6627  C CG   . PRO A 1 130 ? 7.582   -16.669 3.685   1.00 0.37  ? 130 PRO A CG   3  
ATOM 6628  C CD   . PRO A 1 130 ? 8.867   -16.176 3.076   1.00 0.37  ? 130 PRO A CD   3  
ATOM 6629  H HA   . PRO A 1 130 ? 8.715   -19.330 2.173   1.00 0.40  ? 130 PRO A HA   3  
ATOM 6630  H HB2  . PRO A 1 130 ? 6.373   -17.871 2.380   1.00 0.35  ? 130 PRO A HB2  3  
ATOM 6631  H HB3  . PRO A 1 130 ? 7.105   -18.762 3.710   1.00 0.44  ? 130 PRO A HB3  3  
ATOM 6632  H HG2  . PRO A 1 130 ? 6.789   -15.957 3.517   1.00 0.37  ? 130 PRO A HG2  3  
ATOM 6633  H HG3  . PRO A 1 130 ? 7.711   -16.837 4.744   1.00 0.41  ? 130 PRO A HG3  3  
ATOM 6634  H HD2  . PRO A 1 130 ? 8.669   -15.554 2.213   1.00 0.35  ? 130 PRO A HD2  3  
ATOM 6635  H HD3  . PRO A 1 130 ? 9.465   -15.654 3.798   1.00 0.40  ? 130 PRO A HD3  3  
ATOM 6636  N N    . TYR A 1 131 ? 8.179   -18.821 -0.245  1.00 0.33  ? 131 TYR A N    3  
ATOM 6637  C CA   . TYR A 1 131 ? 7.568   -18.598 -1.543  1.00 0.32  ? 131 TYR A CA   3  
ATOM 6638  C C    . TYR A 1 131 ? 6.106   -18.240 -1.317  1.00 0.30  ? 131 TYR A C    3  
ATOM 6639  O O    . TYR A 1 131 ? 5.278   -19.108 -1.060  1.00 0.32  ? 131 TYR A O    3  
ATOM 6640  C CB   . TYR A 1 131 ? 7.698   -19.839 -2.445  1.00 0.36  ? 131 TYR A CB   3  
ATOM 6641  C CG   . TYR A 1 131 ? 7.028   -19.685 -3.802  1.00 0.45  ? 131 TYR A CG   3  
ATOM 6642  C CD1  . TYR A 1 131 ? 5.668   -19.920 -3.962  1.00 0.78  ? 131 TYR A CD1  3  
ATOM 6643  C CD2  . TYR A 1 131 ? 7.764   -19.320 -4.925  1.00 1.00  ? 131 TYR A CD2  3  
ATOM 6644  C CE1  . TYR A 1 131 ? 5.062   -19.801 -5.203  1.00 0.87  ? 131 TYR A CE1  3  
ATOM 6645  C CE2  . TYR A 1 131 ? 7.168   -19.196 -6.163  1.00 1.14  ? 131 TYR A CE2  3  
ATOM 6646  C CZ   . TYR A 1 131 ? 5.782   -19.371 -6.273  1.00 0.81  ? 131 TYR A CZ   3  
ATOM 6647  O OH   . TYR A 1 131 ? 5.228   -19.325 -7.536  1.00 1.00  ? 131 TYR A OH   3  
ATOM 6648  H H    . TYR A 1 131 ? 8.679   -19.639 -0.076  1.00 0.36  ? 131 TYR A H    3  
ATOM 6649  H HA   . TYR A 1 131 ? 8.068   -17.762 -2.008  1.00 0.31  ? 131 TYR A HA   3  
ATOM 6650  H HB2  . TYR A 1 131 ? 8.749   -20.035 -2.615  1.00 0.39  ? 131 TYR A HB2  3  
ATOM 6651  H HB3  . TYR A 1 131 ? 7.256   -20.684 -1.946  1.00 0.43  ? 131 TYR A HB3  3  
ATOM 6652  H HD1  . TYR A 1 131 ? 5.078   -20.204 -3.101  1.00 1.27  ? 131 TYR A HD1  3  
ATOM 6653  H HD2  . TYR A 1 131 ? 8.820   -19.130 -4.817  1.00 1.48  ? 131 TYR A HD2  3  
ATOM 6654  H HE1  . TYR A 1 131 ? 4.005   -19.989 -5.307  1.00 1.32  ? 131 TYR A HE1  3  
ATOM 6655  H HE2  . TYR A 1 131 ? 7.760   -18.909 -7.018  1.00 1.69  ? 131 TYR A HE2  3  
ATOM 6656  H HH   . TYR A 1 131 ? 5.763   -19.791 -8.181  1.00 1.33  ? 131 TYR A HH   3  
ATOM 6657  N N    . ILE A 1 132 ? 5.822   -16.944 -1.335  1.00 0.27  ? 132 ILE A N    3  
ATOM 6658  C CA   . ILE A 1 132 ? 4.483   -16.464 -1.087  1.00 0.26  ? 132 ILE A CA   3  
ATOM 6659  C C    . ILE A 1 132 ? 3.566   -16.909 -2.216  1.00 0.25  ? 132 ILE A C    3  
ATOM 6660  O O    . ILE A 1 132 ? 3.875   -16.684 -3.384  1.00 0.25  ? 132 ILE A O    3  
ATOM 6661  C CB   . ILE A 1 132 ? 4.435   -14.922 -0.979  1.00 0.25  ? 132 ILE A CB   3  
ATOM 6662  C CG1  . ILE A 1 132 ? 5.439   -14.373 0.032   1.00 0.39  ? 132 ILE A CG1  3  
ATOM 6663  C CG2  . ILE A 1 132 ? 3.037   -14.471 -0.616  1.00 0.26  ? 132 ILE A CG2  3  
ATOM 6664  C CD1  . ILE A 1 132 ? 5.378   -15.007 1.392   1.00 0.23  ? 132 ILE A CD1  3  
ATOM 6665  H H    . ILE A 1 132 ? 6.533   -16.300 -1.504  1.00 0.27  ? 132 ILE A H    3  
ATOM 6666  H HA   . ILE A 1 132 ? 4.140   -16.888 -0.155  1.00 0.27  ? 132 ILE A HA   3  
ATOM 6667  H HB   . ILE A 1 132 ? 4.683   -14.519 -1.947  1.00 0.23  ? 132 ILE A HB   3  
ATOM 6668  H HG12 . ILE A 1 132 ? 6.436   -14.521 -0.350  1.00 0.58  ? 132 ILE A HG12 3  
ATOM 6669  H HG13 . ILE A 1 132 ? 5.259   -13.310 0.159   1.00 0.64  ? 132 ILE A HG13 3  
ATOM 6670  H HG21 . ILE A 1 132 ? 3.020   -13.400 -0.512  1.00 1.06  ? 132 ILE A HG21 3  
ATOM 6671  H HG22 . ILE A 1 132 ? 2.747   -14.934 0.319   1.00 1.06  ? 132 ILE A HG22 3  
ATOM 6672  H HG23 . ILE A 1 132 ? 2.354   -14.770 -1.395  1.00 1.01  ? 132 ILE A HG23 3  
ATOM 6673  H HD11 . ILE A 1 132 ? 4.444   -14.754 1.870   1.00 0.99  ? 132 ILE A HD11 3  
ATOM 6674  H HD12 . ILE A 1 132 ? 6.202   -14.639 1.985   1.00 1.02  ? 132 ILE A HD12 3  
ATOM 6675  H HD13 . ILE A 1 132 ? 5.458   -16.079 1.288   1.00 1.05  ? 132 ILE A HD13 3  
ATOM 6676  N N    . PRO A 1 133 ? 2.446   -17.572 -1.885  1.00 0.27  ? 133 PRO A N    3  
ATOM 6677  C CA   . PRO A 1 133 ? 1.460   -18.011 -2.880  1.00 0.28  ? 133 PRO A CA   3  
ATOM 6678  C C    . PRO A 1 133 ? 1.023   -16.873 -3.800  1.00 0.26  ? 133 PRO A C    3  
ATOM 6679  O O    . PRO A 1 133 ? 0.943   -15.712 -3.378  1.00 0.26  ? 133 PRO A O    3  
ATOM 6680  C CB   . PRO A 1 133 ? 0.283   -18.491 -2.026  1.00 0.34  ? 133 PRO A CB   3  
ATOM 6681  C CG   . PRO A 1 133 ? 0.898   -18.898 -0.735  1.00 0.61  ? 133 PRO A CG   3  
ATOM 6682  C CD   . PRO A 1 133 ? 2.059   -17.965 -0.518  1.00 0.31  ? 133 PRO A CD   3  
ATOM 6683  H HA   . PRO A 1 133 ? 1.836   -18.834 -3.473  1.00 0.29  ? 133 PRO A HA   3  
ATOM 6684  H HB2  . PRO A 1 133 ? -0.423  -17.683 -1.892  1.00 0.49  ? 133 PRO A HB2  3  
ATOM 6685  H HB3  . PRO A 1 133 ? -0.204  -19.325 -2.512  1.00 0.43  ? 133 PRO A HB3  3  
ATOM 6686  H HG2  . PRO A 1 133 ? 0.177   -18.796 0.063   1.00 0.97  ? 133 PRO A HG2  3  
ATOM 6687  H HG3  . PRO A 1 133 ? 1.244   -19.921 -0.800  1.00 1.03  ? 133 PRO A HG3  3  
ATOM 6688  H HD2  . PRO A 1 133 ? 1.751   -17.103 0.054   1.00 0.37  ? 133 PRO A HD2  3  
ATOM 6689  H HD3  . PRO A 1 133 ? 2.869   -18.478 -0.020  1.00 0.50  ? 133 PRO A HD3  3  
ATOM 6690  N N    . PRO A 1 134 ? 0.751   -17.178 -5.080  1.00 0.27  ? 134 PRO A N    3  
ATOM 6691  C CA   . PRO A 1 134 ? 0.357   -16.165 -6.049  1.00 0.25  ? 134 PRO A CA   3  
ATOM 6692  C C    . PRO A 1 134 ? -0.970  -15.520 -5.684  1.00 0.27  ? 134 PRO A C    3  
ATOM 6693  O O    . PRO A 1 134 ? -1.929  -16.203 -5.323  1.00 0.32  ? 134 PRO A O    3  
ATOM 6694  C CB   . PRO A 1 134 ? 0.248   -16.931 -7.370  1.00 0.29  ? 134 PRO A CB   3  
ATOM 6695  C CG   . PRO A 1 134 ? 0.031   -18.350 -6.965  1.00 0.52  ? 134 PRO A CG   3  
ATOM 6696  C CD   . PRO A 1 134 ? 0.789   -18.528 -5.676  1.00 0.33  ? 134 PRO A CD   3  
ATOM 6697  H HA   . PRO A 1 134 ? 1.111   -15.394 -6.138  1.00 0.23  ? 134 PRO A HA   3  
ATOM 6698  H HB2  . PRO A 1 134 ? -0.582  -16.539 -7.946  1.00 0.50  ? 134 PRO A HB2  3  
ATOM 6699  H HB3  . PRO A 1 134 ? 1.164   -16.816 -7.930  1.00 0.43  ? 134 PRO A HB3  3  
ATOM 6700  H HG2  . PRO A 1 134 ? -1.022  -18.528 -6.807  1.00 0.89  ? 134 PRO A HG2  3  
ATOM 6701  H HG3  . PRO A 1 134 ? 0.419   -19.014 -7.724  1.00 0.83  ? 134 PRO A HG3  3  
ATOM 6702  H HD2  . PRO A 1 134 ? 0.291   -19.244 -5.042  1.00 0.43  ? 134 PRO A HD2  3  
ATOM 6703  H HD3  . PRO A 1 134 ? 1.806   -18.836 -5.872  1.00 0.41  ? 134 PRO A HD3  3  
ATOM 6704  N N    . HIS A 1 135 ? -0.988  -14.194 -5.754  1.00 0.26  ? 135 HIS A N    3  
ATOM 6705  C CA   . HIS A 1 135 ? -2.179  -13.385 -5.466  1.00 0.31  ? 135 HIS A CA   3  
ATOM 6706  C C    . HIS A 1 135 ? -2.514  -13.363 -3.976  1.00 0.32  ? 135 HIS A C    3  
ATOM 6707  O O    . HIS A 1 135 ? -3.563  -12.859 -3.587  1.00 0.44  ? 135 HIS A O    3  
ATOM 6708  C CB   . HIS A 1 135 ? -3.402  -13.863 -6.258  1.00 0.41  ? 135 HIS A CB   3  
ATOM 6709  C CG   . HIS A 1 135 ? -3.244  -13.768 -7.740  1.00 0.87  ? 135 HIS A CG   3  
ATOM 6710  N ND1  . HIS A 1 135 ? -3.663  -14.757 -8.597  1.00 1.81  ? 135 HIS A ND1  3  
ATOM 6711  C CD2  . HIS A 1 135 ? -2.708  -12.800 -8.517  1.00 1.64  ? 135 HIS A CD2  3  
ATOM 6712  C CE1  . HIS A 1 135 ? -3.391  -14.404 -9.837  1.00 2.38  ? 135 HIS A CE1  3  
ATOM 6713  N NE2  . HIS A 1 135 ? -2.813  -13.220 -9.819  1.00 2.25  ? 135 HIS A NE2  3  
ATOM 6714  H H    . HIS A 1 135 ? -0.158  -13.733 -6.008  1.00 0.26  ? 135 HIS A H    3  
ATOM 6715  H HA   . HIS A 1 135 ? -1.946  -12.375 -5.773  1.00 0.31  ? 135 HIS A HA   3  
ATOM 6716  H HB2  . HIS A 1 135 ? -3.593  -14.898 -6.012  1.00 1.01  ? 135 HIS A HB2  3  
ATOM 6717  H HB3  . HIS A 1 135 ? -4.258  -13.267 -5.976  1.00 1.01  ? 135 HIS A HB3  3  
ATOM 6718  H HD1  . HIS A 1 135 ? -4.118  -15.593 -8.335  1.00 2.34  ? 135 HIS A HD1  3  
ATOM 6719  H HD2  . HIS A 1 135 ? -2.272  -11.871 -8.174  1.00 2.21  ? 135 HIS A HD2  3  
ATOM 6720  H HE1  . HIS A 1 135 ? -3.607  -14.987 -10.719 1.00 3.19  ? 135 HIS A HE1  3  
ATOM 6721  H HE2  . HIS A 1 135 ? -2.694  -12.642 -10.613 1.00 2.82  ? 135 HIS A HE2  3  
ATOM 6722  N N    . ALA A 1 136 ? -1.634  -13.903 -3.143  1.00 0.24  ? 136 ALA A N    3  
ATOM 6723  C CA   . ALA A 1 136 ? -1.827  -13.822 -1.702  1.00 0.24  ? 136 ALA A CA   3  
ATOM 6724  C C    . ALA A 1 136 ? -1.623  -12.384 -1.263  1.00 0.21  ? 136 ALA A C    3  
ATOM 6725  O O    . ALA A 1 136 ? -0.558  -11.812 -1.494  1.00 0.22  ? 136 ALA A O    3  
ATOM 6726  C CB   . ALA A 1 136 ? -0.868  -14.746 -0.965  1.00 0.26  ? 136 ALA A CB   3  
ATOM 6727  H H    . ALA A 1 136 ? -0.837  -14.349 -3.499  1.00 0.22  ? 136 ALA A H    3  
ATOM 6728  H HA   . ALA A 1 136 ? -2.840  -14.125 -1.478  1.00 0.28  ? 136 ALA A HA   3  
ATOM 6729  H HB1  . ALA A 1 136 ? -1.044  -14.672 0.097   1.00 0.98  ? 136 ALA A HB1  3  
ATOM 6730  H HB2  . ALA A 1 136 ? 0.150   -14.455 -1.183  1.00 1.04  ? 136 ALA A HB2  3  
ATOM 6731  H HB3  . ALA A 1 136 ? -1.027  -15.765 -1.286  1.00 1.04  ? 136 ALA A HB3  3  
ATOM 6732  N N    . ALA A 1 137 ? -2.624  -11.796 -0.638  1.00 0.18  ? 137 ALA A N    3  
ATOM 6733  C CA   . ALA A 1 137 ? -2.570  -10.380 -0.325  1.00 0.19  ? 137 ALA A CA   3  
ATOM 6734  C C    . ALA A 1 137 ? -1.606  -10.132 0.819   1.00 0.16  ? 137 ALA A C    3  
ATOM 6735  O O    . ALA A 1 137 ? -1.836  -10.546 1.955   1.00 0.20  ? 137 ALA A O    3  
ATOM 6736  C CB   . ALA A 1 137 ? -3.953  -9.842  0.011   1.00 0.22  ? 137 ALA A CB   3  
ATOM 6737  H H    . ALA A 1 137 ? -3.404  -12.335 -0.356  1.00 0.18  ? 137 ALA A H    3  
ATOM 6738  H HA   . ALA A 1 137 ? -2.209  -9.861  -1.206  1.00 0.21  ? 137 ALA A HA   3  
ATOM 6739  H HB1  . ALA A 1 137 ? -3.902  -8.769  0.129   1.00 1.03  ? 137 ALA A HB1  3  
ATOM 6740  H HB2  . ALA A 1 137 ? -4.300  -10.286 0.931   1.00 1.05  ? 137 ALA A HB2  3  
ATOM 6741  H HB3  . ALA A 1 137 ? -4.636  -10.085 -0.788  1.00 1.04  ? 137 ALA A HB3  3  
ATOM 6742  N N    . LEU A 1 138 ? -0.521  -9.462  0.501   1.00 0.13  ? 138 LEU A N    3  
ATOM 6743  C CA   . LEU A 1 138 ? 0.522   -9.189  1.462   1.00 0.12  ? 138 LEU A CA   3  
ATOM 6744  C C    . LEU A 1 138 ? 0.251   -7.881  2.173   1.00 0.13  ? 138 LEU A C    3  
ATOM 6745  O O    . LEU A 1 138 ? -0.034  -6.870  1.541   1.00 0.15  ? 138 LEU A O    3  
ATOM 6746  C CB   . LEU A 1 138 ? 1.874   -9.121  0.761   1.00 0.13  ? 138 LEU A CB   3  
ATOM 6747  C CG   . LEU A 1 138 ? 2.869   -10.179 1.211   1.00 0.15  ? 138 LEU A CG   3  
ATOM 6748  C CD1  . LEU A 1 138 ? 2.262   -11.552 1.051   1.00 0.22  ? 138 LEU A CD1  3  
ATOM 6749  C CD2  . LEU A 1 138 ? 4.164   -10.066 0.435   1.00 0.19  ? 138 LEU A CD2  3  
ATOM 6750  H H    . LEU A 1 138 ? -0.416  -9.134  -0.415  1.00 0.13  ? 138 LEU A H    3  
ATOM 6751  H HA   . LEU A 1 138 ? 0.536   -9.995  2.176   1.00 0.12  ? 138 LEU A HA   3  
ATOM 6752  H HB2  . LEU A 1 138 ? 1.710   -9.236  -0.302  1.00 0.16  ? 138 LEU A HB2  3  
ATOM 6753  H HB3  . LEU A 1 138 ? 2.305   -8.149  0.941   1.00 0.19  ? 138 LEU A HB3  3  
ATOM 6754  H HG   . LEU A 1 138 ? 3.089   -10.034 2.252   1.00 0.19  ? 138 LEU A HG   3  
ATOM 6755  H HD11 . LEU A 1 138 ? 2.002   -11.711 0.015   1.00 1.05  ? 138 LEU A HD11 3  
ATOM 6756  H HD12 . LEU A 1 138 ? 1.375   -11.617 1.661   1.00 1.06  ? 138 LEU A HD12 3  
ATOM 6757  H HD13 . LEU A 1 138 ? 2.974   -12.298 1.365   1.00 1.01  ? 138 LEU A HD13 3  
ATOM 6758  H HD21 . LEU A 1 138 ? 4.858   -10.817 0.780   1.00 0.98  ? 138 LEU A HD21 3  
ATOM 6759  H HD22 . LEU A 1 138 ? 4.589   -9.083  0.588   1.00 0.93  ? 138 LEU A HD22 3  
ATOM 6760  H HD23 . LEU A 1 138 ? 3.966   -10.213 -0.617  1.00 1.01  ? 138 LEU A HD23 3  
ATOM 6761  N N    . CYS A 1 139 ? 0.349   -7.901  3.481   1.00 0.13  ? 139 CYS A N    3  
ATOM 6762  C CA   . CYS A 1 139 ? 0.173   -6.702  4.265   1.00 0.14  ? 139 CYS A CA   3  
ATOM 6763  C C    . CYS A 1 139 ? 1.435   -6.445  5.074   1.00 0.13  ? 139 CYS A C    3  
ATOM 6764  O O    . CYS A 1 139 ? 1.696   -7.086  6.091   1.00 0.14  ? 139 CYS A O    3  
ATOM 6765  C CB   . CYS A 1 139 ? -1.070  -6.825  5.144   1.00 0.18  ? 139 CYS A CB   3  
ATOM 6766  S SG   . CYS A 1 139 ? -1.282  -5.493  6.343   1.00 1.20  ? 139 CYS A SG   3  
ATOM 6767  H H    . CYS A 1 139 ? 0.562   -8.746  3.935   1.00 0.14  ? 139 CYS A H    3  
ATOM 6768  H HA   . CYS A 1 139 ? 0.036   -5.881  3.577   1.00 0.16  ? 139 CYS A HA   3  
ATOM 6769  H HB2  . CYS A 1 139 ? -1.940  -6.824  4.504   1.00 0.82  ? 139 CYS A HB2  3  
ATOM 6770  H HB3  . CYS A 1 139 ? -1.037  -7.758  5.680   1.00 0.80  ? 139 CYS A HB3  3  
ATOM 6771  H HG   . CYS A 1 139 ? -2.552  -5.107  6.298   1.00 1.82  ? 139 CYS A HG   3  
ATOM 6772  N N    . LEU A 1 140 ? 2.228   -5.521  4.574   1.00 0.13  ? 140 LEU A N    3  
ATOM 6773  C CA   . LEU A 1 140 ? 3.559   -5.263  5.095   1.00 0.14  ? 140 LEU A CA   3  
ATOM 6774  C C    . LEU A 1 140 ? 3.649   -3.896  5.745   1.00 0.13  ? 140 LEU A C    3  
ATOM 6775  O O    . LEU A 1 140 ? 3.119   -2.913  5.234   1.00 0.12  ? 140 LEU A O    3  
ATOM 6776  C CB   . LEU A 1 140 ? 4.588   -5.382  3.974   1.00 0.17  ? 140 LEU A CB   3  
ATOM 6777  C CG   . LEU A 1 140 ? 4.287   -4.564  2.721   1.00 0.17  ? 140 LEU A CG   3  
ATOM 6778  C CD1  . LEU A 1 140 ? 5.127   -3.297  2.700   1.00 0.26  ? 140 LEU A CD1  3  
ATOM 6779  C CD2  . LEU A 1 140 ? 4.524   -5.397  1.473   1.00 0.32  ? 140 LEU A CD2  3  
ATOM 6780  H H    . LEU A 1 140 ? 1.901   -4.988  3.818   1.00 0.14  ? 140 LEU A H    3  
ATOM 6781  H HA   . LEU A 1 140 ? 3.771   -6.012  5.841   1.00 0.16  ? 140 LEU A HA   3  
ATOM 6782  H HB2  . LEU A 1 140 ? 5.538   -5.055  4.365   1.00 0.18  ? 140 LEU A HB2  3  
ATOM 6783  H HB3  . LEU A 1 140 ? 4.668   -6.420  3.689   1.00 0.21  ? 140 LEU A HB3  3  
ATOM 6784  H HG   . LEU A 1 140 ? 3.244   -4.272  2.739   1.00 0.24  ? 140 LEU A HG   3  
ATOM 6785  H HD11 . LEU A 1 140 ? 4.901   -2.702  3.572   1.00 1.15  ? 140 LEU A HD11 3  
ATOM 6786  H HD12 . LEU A 1 140 ? 4.907   -2.731  1.809   1.00 1.03  ? 140 LEU A HD12 3  
ATOM 6787  H HD13 . LEU A 1 140 ? 6.174   -3.562  2.711   1.00 1.00  ? 140 LEU A HD13 3  
ATOM 6788  H HD21 . LEU A 1 140 ? 3.847   -6.239  1.471   1.00 1.03  ? 140 LEU A HD21 3  
ATOM 6789  H HD22 . LEU A 1 140 ? 5.542   -5.755  1.466   1.00 1.08  ? 140 LEU A HD22 3  
ATOM 6790  H HD23 . LEU A 1 140 ? 4.347   -4.794  0.596   1.00 1.04  ? 140 LEU A HD23 3  
ATOM 6791  N N    . GLU A 1 141 ? 4.310   -3.852  6.882   1.00 0.14  ? 141 GLU A N    3  
ATOM 6792  C CA   . GLU A 1 141 ? 4.496   -2.620  7.619   1.00 0.13  ? 141 GLU A CA   3  
ATOM 6793  C C    . GLU A 1 141 ? 5.914   -2.094  7.373   1.00 0.12  ? 141 GLU A C    3  
ATOM 6794  O O    . GLU A 1 141 ? 6.891   -2.761  7.709   1.00 0.15  ? 141 GLU A O    3  
ATOM 6795  C CB   . GLU A 1 141 ? 4.245   -2.915  9.099   1.00 0.18  ? 141 GLU A CB   3  
ATOM 6796  C CG   . GLU A 1 141 ? 4.532   -1.772  10.053  1.00 0.26  ? 141 GLU A CG   3  
ATOM 6797  C CD   . GLU A 1 141 ? 4.225   -2.166  11.484  1.00 0.30  ? 141 GLU A CD   3  
ATOM 6798  O OE1  . GLU A 1 141 ? 4.672   -3.246  11.918  1.00 1.00  ? 141 GLU A OE1  3  
ATOM 6799  O OE2  . GLU A 1 141 ? 3.556   -1.379  12.191  1.00 1.05  ? 141 GLU A OE2  3  
ATOM 6800  H H    . GLU A 1 141 ? 4.705   -4.680  7.238   1.00 0.18  ? 141 GLU A H    3  
ATOM 6801  H HA   . GLU A 1 141 ? 3.774   -1.898  7.266   1.00 0.13  ? 141 GLU A HA   3  
ATOM 6802  H HB2  . GLU A 1 141 ? 3.209   -3.193  9.220   1.00 0.30  ? 141 GLU A HB2  3  
ATOM 6803  H HB3  . GLU A 1 141 ? 4.861   -3.755  9.388   1.00 0.24  ? 141 GLU A HB3  3  
ATOM 6804  H HG2  . GLU A 1 141 ? 5.578   -1.500  9.977   1.00 0.38  ? 141 GLU A HG2  3  
ATOM 6805  H HG3  . GLU A 1 141 ? 3.916   -0.926  9.787   1.00 0.41  ? 141 GLU A HG3  3  
ATOM 6806  N N    . VAL A 1 142 ? 6.027   -0.929  6.741   1.00 0.12  ? 142 VAL A N    3  
ATOM 6807  C CA   . VAL A 1 142 ? 7.327   -0.383  6.382   1.00 0.12  ? 142 VAL A CA   3  
ATOM 6808  C C    . VAL A 1 142 ? 7.622   0.944   7.081   1.00 0.12  ? 142 VAL A C    3  
ATOM 6809  O O    . VAL A 1 142 ? 6.871   1.912   6.962   1.00 0.15  ? 142 VAL A O    3  
ATOM 6810  C CB   . VAL A 1 142 ? 7.470   -0.204  4.854   1.00 0.14  ? 142 VAL A CB   3  
ATOM 6811  C CG1  . VAL A 1 142 ? 7.724   -1.544  4.188   1.00 0.19  ? 142 VAL A CG1  3  
ATOM 6812  C CG2  . VAL A 1 142 ? 6.230   0.451   4.255   1.00 0.19  ? 142 VAL A CG2  3  
ATOM 6813  H H    . VAL A 1 142 ? 5.217   -0.426  6.505   1.00 0.15  ? 142 VAL A H    3  
ATOM 6814  H HA   . VAL A 1 142 ? 8.071   -1.103  6.696   1.00 0.12  ? 142 VAL A HA   3  
ATOM 6815  H HB   . VAL A 1 142 ? 8.320   0.436   4.662   1.00 0.17  ? 142 VAL A HB   3  
ATOM 6816  H HG11 . VAL A 1 142 ? 7.825   -1.399  3.123   1.00 0.97  ? 142 VAL A HG11 3  
ATOM 6817  H HG12 . VAL A 1 142 ? 6.894   -2.207  4.384   1.00 0.99  ? 142 VAL A HG12 3  
ATOM 6818  H HG13 . VAL A 1 142 ? 8.633   -1.976  4.581   1.00 1.08  ? 142 VAL A HG13 3  
ATOM 6819  H HG21 . VAL A 1 142 ? 5.364   -0.158  4.466   1.00 0.98  ? 142 VAL A HG21 3  
ATOM 6820  H HG22 . VAL A 1 142 ? 6.351   0.544   3.186   1.00 1.01  ? 142 VAL A HG22 3  
ATOM 6821  H HG23 . VAL A 1 142 ? 6.095   1.431   4.688   1.00 1.02  ? 142 VAL A HG23 3  
ATOM 6822  N N    . THR A 1 143 ? 8.710   0.957   7.828   1.00 0.13  ? 143 THR A N    3  
ATOM 6823  C CA   . THR A 1 143 ? 9.233   2.174   8.422   1.00 0.13  ? 143 THR A CA   3  
ATOM 6824  C C    . THR A 1 143 ? 10.272  2.807   7.501   1.00 0.12  ? 143 THR A C    3  
ATOM 6825  O O    . THR A 1 143 ? 11.363  2.267   7.335   1.00 0.15  ? 143 THR A O    3  
ATOM 6826  C CB   . THR A 1 143 ? 9.915   1.882   9.774   1.00 0.17  ? 143 THR A CB   3  
ATOM 6827  O OG1  . THR A 1 143 ? 9.137   0.937   10.524  1.00 0.28  ? 143 THR A OG1  3  
ATOM 6828  C CG2  . THR A 1 143 ? 10.083  3.160   10.582  1.00 0.22  ? 143 THR A CG2  3  
ATOM 6829  H H    . THR A 1 143 ? 9.165   0.106   8.010   1.00 0.15  ? 143 THR A H    3  
ATOM 6830  H HA   . THR A 1 143 ? 8.420   2.865   8.582   1.00 0.14  ? 143 THR A HA   3  
ATOM 6831  H HB   . THR A 1 143 ? 10.903  1.464   9.583   1.00 0.16  ? 143 THR A HB   3  
ATOM 6832  H HG1  . THR A 1 143 ? 8.562   1.408   11.137  1.00 0.69  ? 143 THR A HG1  3  
ATOM 6833  H HG21 . THR A 1 143 ? 10.676  3.869   10.021  1.00 0.99  ? 143 THR A HG21 3  
ATOM 6834  H HG22 . THR A 1 143 ? 10.579  2.934   11.514  1.00 1.00  ? 143 THR A HG22 3  
ATOM 6835  H HG23 . THR A 1 143 ? 9.111   3.585   10.785  1.00 1.09  ? 143 THR A HG23 3  
ATOM 6836  N N    . LEU A 1 144 ? 9.936   3.927   6.890   1.00 0.13  ? 144 LEU A N    3  
ATOM 6837  C CA   . LEU A 1 144 ? 10.913  4.677   6.122   1.00 0.12  ? 144 LEU A CA   3  
ATOM 6838  C C    . LEU A 1 144 ? 11.724  5.524   7.075   1.00 0.12  ? 144 LEU A C    3  
ATOM 6839  O O    . LEU A 1 144 ? 11.295  6.588   7.503   1.00 0.14  ? 144 LEU A O    3  
ATOM 6840  C CB   . LEU A 1 144 ? 10.235  5.555   5.075   1.00 0.14  ? 144 LEU A CB   3  
ATOM 6841  C CG   . LEU A 1 144 ? 11.188  6.386   4.215   1.00 0.12  ? 144 LEU A CG   3  
ATOM 6842  C CD1  . LEU A 1 144 ? 12.095  5.482   3.400   1.00 0.15  ? 144 LEU A CD1  3  
ATOM 6843  C CD2  . LEU A 1 144 ? 10.406  7.316   3.308   1.00 0.13  ? 144 LEU A CD2  3  
ATOM 6844  H H    . LEU A 1 144 ? 9.016   4.264   6.970   1.00 0.16  ? 144 LEU A H    3  
ATOM 6845  H HA   . LEU A 1 144 ? 11.578  3.978   5.633   1.00 0.14  ? 144 LEU A HA   3  
ATOM 6846  H HB2  . LEU A 1 144 ? 9.657   4.917   4.422   1.00 0.16  ? 144 LEU A HB2  3  
ATOM 6847  H HB3  . LEU A 1 144 ? 9.562   6.229   5.580   1.00 0.15  ? 144 LEU A HB3  3  
ATOM 6848  H HG   . LEU A 1 144 ? 11.807  6.987   4.862   1.00 0.12  ? 144 LEU A HG   3  
ATOM 6849  H HD11 . LEU A 1 144 ? 12.751  6.083   2.789   1.00 0.98  ? 144 LEU A HD11 3  
ATOM 6850  H HD12 . LEU A 1 144 ? 11.494  4.845   2.766   1.00 0.99  ? 144 LEU A HD12 3  
ATOM 6851  H HD13 . LEU A 1 144 ? 12.686  4.870   4.067   1.00 1.07  ? 144 LEU A HD13 3  
ATOM 6852  H HD21 . LEU A 1 144 ? 11.091  7.959   2.776   1.00 1.01  ? 144 LEU A HD21 3  
ATOM 6853  H HD22 . LEU A 1 144 ? 9.732   7.917   3.901   1.00 1.04  ? 144 LEU A HD22 3  
ATOM 6854  H HD23 . LEU A 1 144 ? 9.838   6.732   2.600   1.00 1.02  ? 144 LEU A HD23 3  
ATOM 6855  N N    . LYS A 1 145 ? 12.890  5.026   7.416   1.00 0.14  ? 145 LYS A N    3  
ATOM 6856  C CA   . LYS A 1 145 ? 13.685  5.621   8.470   1.00 0.17  ? 145 LYS A CA   3  
ATOM 6857  C C    . LYS A 1 145 ? 14.697  6.596   7.896   1.00 0.16  ? 145 LYS A C    3  
ATOM 6858  O O    . LYS A 1 145 ? 15.107  7.549   8.559   1.00 0.21  ? 145 LYS A O    3  
ATOM 6859  C CB   . LYS A 1 145 ? 14.400  4.522   9.254   1.00 0.26  ? 145 LYS A CB   3  
ATOM 6860  C CG   . LYS A 1 145 ? 13.513  3.321   9.538   1.00 0.40  ? 145 LYS A CG   3  
ATOM 6861  C CD   . LYS A 1 145 ? 14.284  2.192   10.193  1.00 0.60  ? 145 LYS A CD   3  
ATOM 6862  C CE   . LYS A 1 145 ? 15.358  1.657   9.266   1.00 0.38  ? 145 LYS A CE   3  
ATOM 6863  N NZ   . LYS A 1 145 ? 16.347  0.820   9.992   1.00 1.08  ? 145 LYS A NZ   3  
ATOM 6864  H H    . LYS A 1 145 ? 13.228  4.239   6.938   1.00 0.17  ? 145 LYS A H    3  
ATOM 6865  H HA   . LYS A 1 145 ? 13.021  6.150   9.134   1.00 0.21  ? 145 LYS A HA   3  
ATOM 6866  H HB2  . LYS A 1 145 ? 15.258  4.189   8.691   1.00 0.26  ? 145 LYS A HB2  3  
ATOM 6867  H HB3  . LYS A 1 145 ? 14.730  4.926   10.200  1.00 0.32  ? 145 LYS A HB3  3  
ATOM 6868  H HG2  . LYS A 1 145 ? 12.711  3.622   10.191  1.00 0.63  ? 145 LYS A HG2  3  
ATOM 6869  H HG3  . LYS A 1 145 ? 13.106  2.966   8.602   1.00 0.65  ? 145 LYS A HG3  3  
ATOM 6870  H HD2  . LYS A 1 145 ? 14.747  2.556   11.099  1.00 1.02  ? 145 LYS A HD2  3  
ATOM 6871  H HD3  . LYS A 1 145 ? 13.596  1.389   10.431  1.00 1.10  ? 145 LYS A HD3  3  
ATOM 6872  H HE2  . LYS A 1 145 ? 14.874  1.058   8.508   1.00 0.84  ? 145 LYS A HE2  3  
ATOM 6873  H HE3  . LYS A 1 145 ? 15.868  2.488   8.795   1.00 0.96  ? 145 LYS A HE3  3  
ATOM 6874  H HZ1  . LYS A 1 145 ? 16.578  1.259   10.913  1.00 1.58  ? 145 LYS A HZ1  3  
ATOM 6875  H HZ2  . LYS A 1 145 ? 17.230  0.743   9.435   1.00 1.69  ? 145 LYS A HZ2  3  
ATOM 6876  H HZ3  . LYS A 1 145 ? 15.965  -0.134  10.155  1.00 1.60  ? 145 LYS A HZ3  3  
ATOM 6877  N N    . THR A 1 146 ? 15.107  6.356   6.659   1.00 0.16  ? 146 THR A N    3  
ATOM 6878  C CA   . THR A 1 146 ? 16.117  7.190   6.031   1.00 0.19  ? 146 THR A CA   3  
ATOM 6879  C C    . THR A 1 146 ? 15.978  7.187   4.517   1.00 0.17  ? 146 THR A C    3  
ATOM 6880  O O    . THR A 1 146 ? 15.499  6.218   3.927   1.00 0.16  ? 146 THR A O    3  
ATOM 6881  C CB   . THR A 1 146 ? 17.537  6.699   6.386   1.00 0.25  ? 146 THR A CB   3  
ATOM 6882  O OG1  . THR A 1 146 ? 17.622  6.425   7.790   1.00 0.25  ? 146 THR A OG1  3  
ATOM 6883  C CG2  . THR A 1 146 ? 18.597  7.729   6.014   1.00 0.37  ? 146 THR A CG2  3  
ATOM 6884  H H    . THR A 1 146 ? 14.725  5.603   6.157   1.00 0.19  ? 146 THR A H    3  
ATOM 6885  H HA   . THR A 1 146 ? 15.994  8.190   6.395   1.00 0.22  ? 146 THR A HA   3  
ATOM 6886  H HB   . THR A 1 146 ? 17.723  5.787   5.827   1.00 0.29  ? 146 THR A HB   3  
ATOM 6887  H HG1  . THR A 1 146 ? 16.902  6.881   8.242   1.00 0.44  ? 146 THR A HG1  3  
ATOM 6888  H HG21 . THR A 1 146 ? 18.558  7.917   4.950   1.00 1.12  ? 146 THR A HG21 3  
ATOM 6889  H HG22 . THR A 1 146 ? 19.574  7.358   6.278   1.00 1.08  ? 146 THR A HG22 3  
ATOM 6890  H HG23 . THR A 1 146 ? 18.404  8.648   6.550   1.00 1.06  ? 146 THR A HG23 3  
ATOM 6891  N N    . ALA A 1 147 ? 16.401  8.279   3.903   1.00 0.20  ? 147 ALA A N    3  
ATOM 6892  C CA   . ALA A 1 147 ? 16.506  8.368   2.460   1.00 0.19  ? 147 ALA A CA   3  
ATOM 6893  C C    . ALA A 1 147 ? 17.803  9.066   2.100   1.00 0.22  ? 147 ALA A C    3  
ATOM 6894  O O    . ALA A 1 147 ? 18.086  10.143  2.625   1.00 0.25  ? 147 ALA A O    3  
ATOM 6895  C CB   . ALA A 1 147 ? 15.318  9.125   1.884   1.00 0.21  ? 147 ALA A CB   3  
ATOM 6896  H H    . ALA A 1 147 ? 16.663  9.057   4.443   1.00 0.24  ? 147 ALA A H    3  
ATOM 6897  H HA   . ALA A 1 147 ? 16.515  7.368   2.061   1.00 0.19  ? 147 ALA A HA   3  
ATOM 6898  H HB1  . ALA A 1 147 ? 15.270  10.112  2.319   1.00 0.96  ? 147 ALA A HB1  3  
ATOM 6899  H HB2  . ALA A 1 147 ? 14.406  8.590   2.105   1.00 0.98  ? 147 ALA A HB2  3  
ATOM 6900  H HB3  . ALA A 1 147 ? 15.435  9.209   0.815   1.00 0.99  ? 147 ALA A HB3  3  
ATOM 6901  N N    . VAL A 1 148 ? 18.600  8.465   1.223   1.00 0.24  ? 148 VAL A N    3  
ATOM 6902  C CA   . VAL A 1 148 ? 19.875  9.064   0.855   1.00 0.31  ? 148 VAL A CA   3  
ATOM 6903  C C    . VAL A 1 148 ? 20.071  9.006   -0.646  1.00 0.34  ? 148 VAL A C    3  
ATOM 6904  O O    . VAL A 1 148 ? 19.878  7.966   -1.275  1.00 0.36  ? 148 VAL A O    3  
ATOM 6905  C CB   . VAL A 1 148 ? 21.083  8.412   1.580   1.00 0.42  ? 148 VAL A CB   3  
ATOM 6906  C CG1  . VAL A 1 148 ? 20.954  8.586   3.086   1.00 0.92  ? 148 VAL A CG1  3  
ATOM 6907  C CG2  . VAL A 1 148 ? 21.217  6.937   1.237   1.00 0.75  ? 148 VAL A CG2  3  
ATOM 6908  H H    . VAL A 1 148 ? 18.323  7.612   0.792   1.00 0.24  ? 148 VAL A H    3  
ATOM 6909  H HA   . VAL A 1 148 ? 19.837  10.104  1.148   1.00 0.36  ? 148 VAL A HA   3  
ATOM 6910  H HB   . VAL A 1 148 ? 21.984  8.915   1.254   1.00 0.93  ? 148 VAL A HB   3  
ATOM 6911  H HG11 . VAL A 1 148 ? 21.797  8.126   3.576   1.00 1.58  ? 148 VAL A HG11 3  
ATOM 6912  H HG12 . VAL A 1 148 ? 20.038  8.117   3.424   1.00 1.62  ? 148 VAL A HG12 3  
ATOM 6913  H HG13 . VAL A 1 148 ? 20.928  9.639   3.326   1.00 1.28  ? 148 VAL A HG13 3  
ATOM 6914  H HG21 . VAL A 1 148 ? 21.301  6.825   0.167   1.00 1.27  ? 148 VAL A HG21 3  
ATOM 6915  H HG22 . VAL A 1 148 ? 20.345  6.405   1.590   1.00 1.35  ? 148 VAL A HG22 3  
ATOM 6916  H HG23 . VAL A 1 148 ? 22.100  6.536   1.713   1.00 1.29  ? 148 VAL A HG23 3  
ATOM 6917  N N    . ASP A 1 149 ? 20.426  10.135  -1.221  1.00 0.44  ? 149 ASP A N    3  
ATOM 6918  C CA   . ASP A 1 149 ? 20.582  10.224  -2.651  1.00 0.52  ? 149 ASP A CA   3  
ATOM 6919  C C    . ASP A 1 149 ? 21.858  9.507   -3.064  1.00 0.66  ? 149 ASP A C    3  
ATOM 6920  O O    . ASP A 1 149 ? 22.901  9.652   -2.424  1.00 0.79  ? 149 ASP A O    3  
ATOM 6921  C CB   . ASP A 1 149 ? 20.574  11.690  -3.100  1.00 0.68  ? 149 ASP A CB   3  
ATOM 6922  C CG   . ASP A 1 149 ? 21.940  12.344  -3.040  1.00 1.41  ? 149 ASP A CG   3  
ATOM 6923  O OD1  . ASP A 1 149 ? 22.350  12.778  -1.942  1.00 1.61  ? 149 ASP A OD1  3  
ATOM 6924  O OD2  . ASP A 1 149 ? 22.610  12.439  -4.094  1.00 2.27  ? 149 ASP A OD2  3  
ATOM 6925  H H    . ASP A 1 149 ? 20.606  10.922  -0.668  1.00 0.52  ? 149 ASP A H    3  
ATOM 6926  H HA   . ASP A 1 149 ? 19.742  9.715   -3.104  1.00 0.43  ? 149 ASP A HA   3  
ATOM 6927  H HB2  . ASP A 1 149 ? 20.203  11.745  -4.113  1.00 0.86  ? 149 ASP A HB2  3  
ATOM 6928  H HB3  . ASP A 1 149 ? 19.907  12.244  -2.455  1.00 1.18  ? 149 ASP A HB3  3  
ATOM 6929  N N    . LEU A 1 150 ? 21.758  8.693   -4.096  1.00 0.68  ? 150 LEU A N    3  
ATOM 6930  C CA   . LEU A 1 150 ? 22.889  7.909   -4.554  1.00 0.89  ? 150 LEU A CA   3  
ATOM 6931  C C    . LEU A 1 150 ? 22.638  7.437   -5.984  1.00 0.96  ? 150 LEU A C    3  
ATOM 6932  O O    . LEU A 1 150 ? 23.205  6.442   -6.435  1.00 1.38  ? 150 LEU A O    3  
ATOM 6933  C CB   . LEU A 1 150 ? 23.102  6.711   -3.623  1.00 1.00  ? 150 LEU A CB   3  
ATOM 6934  C CG   . LEU A 1 150 ? 24.521  6.151   -3.599  1.00 1.09  ? 150 LEU A CG   3  
ATOM 6935  C CD1  . LEU A 1 150 ? 25.474  7.170   -2.997  1.00 1.81  ? 150 LEU A CD1  3  
ATOM 6936  C CD2  . LEU A 1 150 ? 24.566  4.856   -2.810  1.00 1.97  ? 150 LEU A CD2  3  
ATOM 6937  H H    . LEU A 1 150 ? 20.902  8.608   -4.557  1.00 0.59  ? 150 LEU A H    3  
ATOM 6938  H HA   . LEU A 1 150 ? 23.762  8.537   -4.531  1.00 1.01  ? 150 LEU A HA   3  
ATOM 6939  H HB2  . LEU A 1 150 ? 22.840  7.011   -2.619  1.00 1.42  ? 150 LEU A HB2  3  
ATOM 6940  H HB3  . LEU A 1 150 ? 22.433  5.919   -3.931  1.00 1.50  ? 150 LEU A HB3  3  
ATOM 6941  H HG   . LEU A 1 150 ? 24.840  5.942   -4.610  1.00 1.50  ? 150 LEU A HG   3  
ATOM 6942  H HD11 . LEU A 1 150 ? 26.475  6.765   -2.985  1.00 2.37  ? 150 LEU A HD11 3  
ATOM 6943  H HD12 . LEU A 1 150 ? 25.165  7.397   -1.987  1.00 2.20  ? 150 LEU A HD12 3  
ATOM 6944  H HD13 . LEU A 1 150 ? 25.458  8.072   -3.590  1.00 2.36  ? 150 LEU A HD13 3  
ATOM 6945  H HD21 . LEU A 1 150 ? 24.280  5.049   -1.788  1.00 2.50  ? 150 LEU A HD21 3  
ATOM 6946  H HD22 . LEU A 1 150 ? 25.571  4.459   -2.835  1.00 2.46  ? 150 LEU A HD22 3  
ATOM 6947  H HD23 . LEU A 1 150 ? 23.885  4.143   -3.248  1.00 2.44  ? 150 LEU A HD23 3  
ATOM 6948  N N    . GLU A 1 151 ? 21.809  8.186   -6.702  1.00 0.72  ? 151 GLU A N    3  
ATOM 6949  C CA   . GLU A 1 151 ? 21.370  7.793   -8.037  1.00 0.79  ? 151 GLU A CA   3  
ATOM 6950  C C    . GLU A 1 151 ? 22.518  7.956   -9.036  1.00 1.44  ? 151 GLU A C    3  
ATOM 6951  O O    . GLU A 1 151 ? 23.085  6.968   -9.504  1.00 2.14  ? 151 GLU A O    3  
ATOM 6952  C CB   . GLU A 1 151 ? 20.144  8.627   -8.441  1.00 0.57  ? 151 GLU A CB   3  
ATOM 6953  C CG   . GLU A 1 151 ? 19.464  8.165   -9.714  1.00 0.60  ? 151 GLU A CG   3  
ATOM 6954  C CD   . GLU A 1 151 ? 19.431  9.265   -10.749 1.00 0.92  ? 151 GLU A CD   3  
ATOM 6955  O OE1  . GLU A 1 151 ? 20.435  9.424   -11.465 1.00 1.32  ? 151 GLU A OE1  3  
ATOM 6956  O OE2  . GLU A 1 151 ? 18.423  10.003  -10.822 1.00 1.57  ? 151 GLU A OE2  3  
ATOM 6957  H H    . GLU A 1 151 ? 21.507  9.045   -6.333  1.00 0.72  ? 151 GLU A H    3  
ATOM 6958  H HA   . GLU A 1 151 ? 21.090  6.751   -7.999  1.00 1.12  ? 151 GLU A HA   3  
ATOM 6959  H HB2  . GLU A 1 151 ? 19.421  8.579   -7.640  1.00 0.95  ? 151 GLU A HB2  3  
ATOM 6960  H HB3  . GLU A 1 151 ? 20.450  9.655   -8.574  1.00 1.07  ? 151 GLU A HB3  3  
ATOM 6961  H HG2  . GLU A 1 151 ? 20.012  7.325   -10.116 1.00 0.93  ? 151 GLU A HG2  3  
ATOM 6962  H HG3  . GLU A 1 151 ? 18.443  7.860   -9.483  1.00 0.97  ? 151 GLU A HG3  3  
ATOM 6963  N N    . HIS A 1 152 ? 22.850  9.210   -9.348  1.00 2.00  ? 152 HIS A N    3  
ATOM 6964  C CA   . HIS A 1 152 ? 24.055  9.558   -10.119 1.00 2.74  ? 152 HIS A CA   3  
ATOM 6965  C C    . HIS A 1 152 ? 23.988  9.122   -11.586 1.00 3.34  ? 152 HIS A C    3  
ATOM 6966  O O    . HIS A 1 152 ? 24.865  9.476   -12.375 1.00 4.01  ? 152 HIS A O    3  
ATOM 6967  C CB   . HIS A 1 152 ? 25.315  8.960   -9.476  1.00 3.58  ? 152 HIS A CB   3  
ATOM 6968  C CG   . HIS A 1 152 ? 25.682  9.554   -8.146  1.00 4.23  ? 152 HIS A CG   3  
ATOM 6969  N ND1  . HIS A 1 152 ? 26.957  9.499   -7.626  1.00 4.97  ? 152 HIS A ND1  3  
ATOM 6970  C CD2  . HIS A 1 152 ? 24.934  10.205  -7.219  1.00 4.78  ? 152 HIS A CD2  3  
ATOM 6971  C CE1  . HIS A 1 152 ? 26.975  10.083  -6.443  1.00 5.79  ? 152 HIS A CE1  3  
ATOM 6972  N NE2  . HIS A 1 152 ? 25.764  10.521  -6.174  1.00 5.71  ? 152 HIS A NE2  3  
ATOM 6973  H H    . HIS A 1 152 ? 22.253  9.935   -9.059  1.00 2.34  ? 152 HIS A H    3  
ATOM 6974  H HA   . HIS A 1 152 ? 24.145  10.632  -10.095 1.00 2.87  ? 152 HIS A HA   3  
ATOM 6975  H HB2  . HIS A 1 152 ? 25.163  7.900   -9.331  1.00 3.90  ? 152 HIS A HB2  3  
ATOM 6976  H HB3  . HIS A 1 152 ? 26.151  9.106   -10.146 1.00 4.03  ? 152 HIS A HB3  3  
ATOM 6977  H HD1  . HIS A 1 152 ? 27.744  9.106   -8.069  1.00 5.15  ? 152 HIS A HD1  3  
ATOM 6978  H HD2  . HIS A 1 152 ? 23.881  10.438  -7.292  1.00 4.83  ? 152 HIS A HD2  3  
ATOM 6979  H HE1  . HIS A 1 152 ? 27.838  10.188  -5.804  1.00 6.63  ? 152 HIS A HE1  3  
ATOM 6980  H HE2  . HIS A 1 152 ? 25.471  10.881  -5.294  1.00 6.40  ? 152 HIS A HE2  3  
ATOM 6981  N N    . HIS A 1 153 ? 22.962  8.376   -11.970 1.00 3.70  ? 153 HIS A N    3  
ATOM 6982  C CA   . HIS A 1 153 ? 22.878  7.878   -13.336 1.00 4.77  ? 153 HIS A CA   3  
ATOM 6983  C C    . HIS A 1 153 ? 22.182  8.896   -14.233 1.00 5.09  ? 153 HIS A C    3  
ATOM 6984  O O    . HIS A 1 153 ? 21.023  8.734   -14.609 1.00 5.37  ? 153 HIS A O    3  
ATOM 6985  C CB   . HIS A 1 153 ? 22.153  6.525   -13.394 1.00 5.63  ? 153 HIS A CB   3  
ATOM 6986  C CG   . HIS A 1 153 ? 22.261  5.830   -14.727 1.00 6.19  ? 153 HIS A CG   3  
ATOM 6987  N ND1  . HIS A 1 153 ? 21.758  4.568   -14.965 1.00 6.78  ? 153 HIS A ND1  3  
ATOM 6988  C CD2  . HIS A 1 153 ? 22.818  6.229   -15.900 1.00 6.64  ? 153 HIS A CD2  3  
ATOM 6989  C CE1  . HIS A 1 153 ? 22.003  4.222   -16.215 1.00 7.48  ? 153 HIS A CE1  3  
ATOM 6990  N NE2  . HIS A 1 153 ? 22.644  5.213   -16.802 1.00 7.41  ? 153 HIS A NE2  3  
ATOM 6991  H H    . HIS A 1 153 ? 22.243  8.175   -11.333 1.00 3.55  ? 153 HIS A H    3  
ATOM 6992  H HA   . HIS A 1 153 ? 23.888  7.747   -13.690 1.00 5.10  ? 153 HIS A HA   3  
ATOM 6993  H HB2  . HIS A 1 153 ? 22.570  5.871   -12.644 1.00 5.99  ? 153 HIS A HB2  3  
ATOM 6994  H HB3  . HIS A 1 153 ? 21.105  6.681   -13.182 1.00 5.91  ? 153 HIS A HB3  3  
ATOM 6995  H HD1  . HIS A 1 153 ? 21.284  4.004   -14.306 1.00 6.89  ? 153 HIS A HD1  3  
ATOM 6996  H HD2  . HIS A 1 153 ? 23.304  7.177   -16.089 1.00 6.66  ? 153 HIS A HD2  3  
ATOM 6997  H HE1  . HIS A 1 153 ? 21.716  3.289   -16.680 1.00 8.19  ? 153 HIS A HE1  3  
ATOM 6998  H HE2  . HIS A 1 153 ? 23.035  5.183   -17.718 1.00 7.98  ? 153 HIS A HE2  3  
ATOM 6999  N N    . HIS A 1 154 ? 22.897  9.961   -14.548 1.00 5.42  ? 154 HIS A N    3  
ATOM 7000  C CA   . HIS A 1 154 ? 22.409  10.957  -15.491 1.00 6.05  ? 154 HIS A CA   3  
ATOM 7001  C C    . HIS A 1 154 ? 23.319  10.984  -16.710 1.00 6.57  ? 154 HIS A C    3  
ATOM 7002  O O    . HIS A 1 154 ? 22.914  11.383  -17.800 1.00 7.00  ? 154 HIS A O    3  
ATOM 7003  C CB   . HIS A 1 154 ? 22.332  12.337  -14.833 1.00 6.58  ? 154 HIS A CB   3  
ATOM 7004  C CG   . HIS A 1 154 ? 21.396  12.374  -13.664 1.00 7.19  ? 154 HIS A CG   3  
ATOM 7005  N ND1  . HIS A 1 154 ? 21.731  12.921  -12.447 1.00 7.60  ? 154 HIS A ND1  3  
ATOM 7006  C CD2  . HIS A 1 154 ? 20.133  11.906  -13.526 1.00 7.78  ? 154 HIS A CD2  3  
ATOM 7007  C CE1  . HIS A 1 154 ? 20.719  12.779  -11.611 1.00 8.35  ? 154 HIS A CE1  3  
ATOM 7008  N NE2  . HIS A 1 154 ? 19.733  12.161  -12.237 1.00 8.46  ? 154 HIS A NE2  3  
ATOM 7009  H H    . HIS A 1 154 ? 23.774  10.088  -14.125 1.00 5.45  ? 154 HIS A H    3  
ATOM 7010  H HA   . HIS A 1 154 ? 21.421  10.660  -15.807 1.00 6.12  ? 154 HIS A HA   3  
ATOM 7011  H HB2  . HIS A 1 154 ? 23.315  12.619  -14.484 1.00 6.69  ? 154 HIS A HB2  3  
ATOM 7012  H HB3  . HIS A 1 154 ? 21.990  13.059  -15.561 1.00 6.79  ? 154 HIS A HB3  3  
ATOM 7013  H HD1  . HIS A 1 154 ? 22.595  13.351  -12.225 1.00 7.56  ? 154 HIS A HD1  3  
ATOM 7014  H HD2  . HIS A 1 154 ? 19.547  11.418  -14.293 1.00 7.91  ? 154 HIS A HD2  3  
ATOM 7015  H HE1  . HIS A 1 154 ? 20.701  13.110  -10.585 1.00 8.95  ? 154 HIS A HE1  3  
ATOM 7016  H HE2  . HIS A 1 154 ? 19.024  11.657  -11.774 1.00 9.08  ? 154 HIS A HE2  3  
ATOM 7017  N N    . HIS A 1 155 ? 24.555  10.548  -16.504 1.00 6.86  ? 155 HIS A N    3  
ATOM 7018  C CA   . HIS A 1 155 ? 25.509  10.357  -17.588 1.00 7.69  ? 155 HIS A CA   3  
ATOM 7019  C C    . HIS A 1 155 ? 26.419  9.187   -17.249 1.00 8.40  ? 155 HIS A C    3  
ATOM 7020  O O    . HIS A 1 155 ? 26.552  8.839   -16.075 1.00 8.69  ? 155 HIS A O    3  
ATOM 7021  C CB   . HIS A 1 155 ? 26.330  11.624  -17.861 1.00 7.95  ? 155 HIS A CB   3  
ATOM 7022  C CG   . HIS A 1 155 ? 25.585  12.663  -18.642 1.00 8.17  ? 155 HIS A CG   3  
ATOM 7023  N ND1  . HIS A 1 155 ? 25.314  12.536  -19.988 1.00 8.40  ? 155 HIS A ND1  3  
ATOM 7024  C CD2  . HIS A 1 155 ? 25.047  13.846  -18.262 1.00 8.48  ? 155 HIS A CD2  3  
ATOM 7025  C CE1  . HIS A 1 155 ? 24.643  13.595  -20.400 1.00 8.78  ? 155 HIS A CE1  3  
ATOM 7026  N NE2  . HIS A 1 155 ? 24.462  14.404  -19.373 1.00 8.83  ? 155 HIS A NE2  3  
ATOM 7027  H H    . HIS A 1 155 ? 24.833  10.325  -15.592 1.00 6.72  ? 155 HIS A H    3  
ATOM 7028  H HA   . HIS A 1 155 ? 24.943  10.105  -18.474 1.00 7.92  ? 155 HIS A HA   3  
ATOM 7029  H HB2  . HIS A 1 155 ? 26.624  12.066  -16.921 1.00 8.01  ? 155 HIS A HB2  3  
ATOM 7030  H HB3  . HIS A 1 155 ? 27.212  11.359  -18.421 1.00 8.23  ? 155 HIS A HB3  3  
ATOM 7031  H HD1  . HIS A 1 155 ? 25.569  11.774  -20.558 1.00 8.44  ? 155 HIS A HD1  3  
ATOM 7032  H HD2  . HIS A 1 155 ? 25.085  14.279  -17.271 1.00 8.62  ? 155 HIS A HD2  3  
ATOM 7033  H HE1  . HIS A 1 155 ? 24.299  13.772  -21.408 1.00 9.16  ? 155 HIS A HE1  3  
ATOM 7034  H HE2  . HIS A 1 155 ? 23.826  15.156  -19.360 1.00 9.24  ? 155 HIS A HE2  3  
ATOM 7035  N N    . HIS A 1 156 ? 27.047  8.611   -18.277 1.00 8.92  ? 156 HIS A N    3  
ATOM 7036  C CA   . HIS A 1 156 ? 27.778  7.342   -18.166 1.00 9.83  ? 156 HIS A CA   3  
ATOM 7037  C C    . HIS A 1 156 ? 26.786  6.192   -18.046 1.00 10.27 ? 156 HIS A C    3  
ATOM 7038  O O    . HIS A 1 156 ? 25.876  6.232   -17.218 1.00 10.47 ? 156 HIS A O    3  
ATOM 7039  C CB   . HIS A 1 156 ? 28.777  7.327   -17.000 1.00 10.32 ? 156 HIS A CB   3  
ATOM 7040  C CG   . HIS A 1 156 ? 29.971  8.197   -17.228 1.00 10.97 ? 156 HIS A CG   3  
ATOM 7041  N ND1  . HIS A 1 156 ? 31.195  7.706   -17.626 1.00 11.47 ? 156 HIS A ND1  3  
ATOM 7042  C CD2  . HIS A 1 156 ? 30.121  9.537   -17.117 1.00 11.42 ? 156 HIS A CD2  3  
ATOM 7043  C CE1  . HIS A 1 156 ? 32.046  8.708   -17.749 1.00 12.17 ? 156 HIS A CE1  3  
ATOM 7044  N NE2  . HIS A 1 156 ? 31.420  9.827   -17.442 1.00 12.15 ? 156 HIS A NE2  3  
ATOM 7045  H H    . HIS A 1 156 ? 26.994  9.044   -19.159 1.00 8.83  ? 156 HIS A H    3  
ATOM 7046  H HA   . HIS A 1 156 ? 28.325  7.211   -19.091 1.00 10.10 ? 156 HIS A HA   3  
ATOM 7047  H HB2  . HIS A 1 156 ? 28.285  7.674   -16.101 1.00 10.37 ? 156 HIS A HB2  3  
ATOM 7048  H HB3  . HIS A 1 156 ? 29.129  6.318   -16.845 1.00 10.38 ? 156 HIS A HB3  3  
ATOM 7049  H HD1  . HIS A 1 156 ? 31.411  6.760   -17.794 1.00 11.46 ? 156 HIS A HD1  3  
ATOM 7050  H HD2  . HIS A 1 156 ? 29.362  10.244  -16.816 1.00 11.38 ? 156 HIS A HD2  3  
ATOM 7051  H HE1  . HIS A 1 156 ? 33.081  8.625   -18.046 1.00 12.78 ? 156 HIS A HE1  3  
ATOM 7052  H HE2  . HIS A 1 156 ? 31.770  10.735  -17.623 1.00 12.73 ? 156 HIS A HE2  3  
ATOM 7053  N N    . HIS A 1 157 ? 26.986  5.170   -18.876 1.00 10.63 ? 157 HIS A N    3  
ATOM 7054  C CA   . HIS A 1 157 ? 26.005  4.098   -19.070 1.00 11.28 ? 157 HIS A CA   3  
ATOM 7055  C C    . HIS A 1 157 ? 24.790  4.661   -19.797 1.00 11.64 ? 157 HIS A C    3  
ATOM 7056  O O    . HIS A 1 157 ? 23.845  5.116   -19.120 1.00 11.96 ? 157 HIS A O    3  
ATOM 7057  C CB   . HIS A 1 157 ? 25.564  3.441   -17.750 1.00 11.62 ? 157 HIS A CB   3  
ATOM 7058  C CG   . HIS A 1 157 ? 26.661  2.771   -16.986 1.00 12.24 ? 157 HIS A CG   3  
ATOM 7059  N ND1  . HIS A 1 157 ? 27.304  1.642   -17.431 1.00 12.87 ? 157 HIS A ND1  3  
ATOM 7060  C CD2  . HIS A 1 157 ? 27.220  3.075   -15.792 1.00 12.51 ? 157 HIS A CD2  3  
ATOM 7061  C CE1  . HIS A 1 157 ? 28.211  1.278   -16.545 1.00 13.46 ? 157 HIS A CE1  3  
ATOM 7062  N NE2  . HIS A 1 157 ? 28.182  2.128   -15.535 1.00 13.27 ? 157 HIS A NE2  3  
ATOM 7063  O OXT  . HIS A 1 157 ? 24.805  4.679   -21.044 1.00 11.78 ? 157 HIS A OXT  3  
ATOM 7064  H H    . HIS A 1 157 ? 27.825  5.137   -19.390 1.00 10.60 ? 157 HIS A H    3  
ATOM 7065  H HA   . HIS A 1 157 ? 26.466  3.346   -19.700 1.00 11.48 ? 157 HIS A HA   3  
ATOM 7066  H HB2  . HIS A 1 157 ? 25.132  4.194   -17.109 1.00 11.48 ? 157 HIS A HB2  3  
ATOM 7067  H HB3  . HIS A 1 157 ? 24.816  2.694   -17.966 1.00 11.78 ? 157 HIS A HB3  3  
ATOM 7068  H HD1  . HIS A 1 157 ? 27.116  1.168   -18.278 1.00 12.99 ? 157 HIS A HD1  3  
ATOM 7069  H HD2  . HIS A 1 157 ? 26.947  3.900   -15.146 1.00 12.31 ? 157 HIS A HD2  3  
ATOM 7070  H HE1  . HIS A 1 157 ? 28.862  0.421   -16.625 1.00 14.11 ? 157 HIS A HE1  3  
ATOM 7071  H HE2  . HIS A 1 157 ? 28.559  1.943   -14.642 1.00 13.71 ? 157 HIS A HE2  3  
ATOM 7072  N N    . MET A 1 1   ? -28.215 43.402  -33.228 1.00 49.39 ? 1   MET A N    4  
ATOM 7073  C CA   . MET A 1 1   ? -27.518 42.125  -32.958 1.00 49.13 ? 1   MET A CA   4  
ATOM 7074  C C    . MET A 1 1   ? -28.044 41.488  -31.679 1.00 48.56 ? 1   MET A C    4  
ATOM 7075  O O    . MET A 1 1   ? -28.161 40.267  -31.587 1.00 48.67 ? 1   MET A O    4  
ATOM 7076  C CB   . MET A 1 1   ? -26.002 42.343  -32.844 1.00 49.37 ? 1   MET A CB   4  
ATOM 7077  C CG   . MET A 1 1   ? -25.344 42.848  -34.123 1.00 49.76 ? 1   MET A CG   4  
ATOM 7078  S SD   . MET A 1 1   ? -25.778 44.555  -34.524 1.00 50.09 ? 1   MET A SD   4  
ATOM 7079  C CE   . MET A 1 1   ? -25.006 45.429  -33.161 1.00 50.23 ? 1   MET A CE   4  
ATOM 7080  H H1   . MET A 1 1   ? -27.878 43.817  -34.116 1.00 49.42 ? 1   MET A H1   4  
ATOM 7081  H H2   . MET A 1 1   ? -28.040 44.080  -32.454 1.00 49.34 ? 1   MET A H2   4  
ATOM 7082  H H3   . MET A 1 1   ? -29.247 43.238  -33.304 1.00 49.65 ? 1   MET A H3   4  
ATOM 7083  H HA   . MET A 1 1   ? -27.714 41.454  -33.783 1.00 49.25 ? 1   MET A HA   4  
ATOM 7084  H HB2  . MET A 1 1   ? -25.812 43.062  -32.061 1.00 49.42 ? 1   MET A HB2  4  
ATOM 7085  H HB3  . MET A 1 1   ? -25.539 41.405  -32.572 1.00 49.25 ? 1   MET A HB3  4  
ATOM 7086  H HG2  . MET A 1 1   ? -24.272 42.789  -34.005 1.00 49.89 ? 1   MET A HG2  4  
ATOM 7087  H HG3  . MET A 1 1   ? -25.648 42.214  -34.944 1.00 49.76 ? 1   MET A HG3  4  
ATOM 7088  H HE1  . MET A 1 1   ? -25.365 45.028  -32.226 1.00 50.46 ? 1   MET A HE1  4  
ATOM 7089  H HE2  . MET A 1 1   ? -25.261 46.477  -33.218 1.00 50.28 ? 1   MET A HE2  4  
ATOM 7090  H HE3  . MET A 1 1   ? -23.933 45.310  -33.218 1.00 50.08 ? 1   MET A HE3  4  
ATOM 7091  N N    . GLY A 1 2   ? -28.366 42.321  -30.696 1.00 47.99 ? 2   GLY A N    4  
ATOM 7092  C CA   . GLY A 1 2   ? -28.856 41.824  -29.429 1.00 47.44 ? 2   GLY A CA   4  
ATOM 7093  C C    . GLY A 1 2   ? -27.743 41.238  -28.584 1.00 46.69 ? 2   GLY A C    4  
ATOM 7094  O O    . GLY A 1 2   ? -27.177 41.919  -27.727 1.00 46.54 ? 2   GLY A O    4  
ATOM 7095  H H    . GLY A 1 2   ? -28.266 43.292  -30.833 1.00 47.97 ? 2   GLY A H    4  
ATOM 7096  H HA2  . GLY A 1 2   ? -29.319 42.637  -28.888 1.00 47.53 ? 2   GLY A HA2  4  
ATOM 7097  H HA3  . GLY A 1 2   ? -29.596 41.060  -29.614 1.00 47.53 ? 2   GLY A HA3  4  
ATOM 7098  N N    . GLN A 1 3   ? -27.417 39.982  -28.841 1.00 46.26 ? 3   GLN A N    4  
ATOM 7099  C CA   . GLN A 1 3   ? -26.354 39.309  -28.113 1.00 45.58 ? 3   GLN A CA   4  
ATOM 7100  C C    . GLN A 1 3   ? -25.549 38.438  -29.068 1.00 45.14 ? 3   GLN A C    4  
ATOM 7101  O O    . GLN A 1 3   ? -25.868 37.268  -29.288 1.00 45.18 ? 3   GLN A O    4  
ATOM 7102  C CB   . GLN A 1 3   ? -26.944 38.476  -26.979 1.00 45.54 ? 3   GLN A CB   4  
ATOM 7103  C CG   . GLN A 1 3   ? -26.023 38.318  -25.781 1.00 45.20 ? 3   GLN A CG   4  
ATOM 7104  C CD   . GLN A 1 3   ? -26.763 37.797  -24.564 1.00 45.11 ? 3   GLN A CD   4  
ATOM 7105  O OE1  . GLN A 1 3   ? -27.963 38.033  -24.408 1.00 45.20 ? 3   GLN A OE1  4  
ATOM 7106  N NE2  . GLN A 1 3   ? -26.057 37.121  -23.682 1.00 45.01 ? 3   GLN A NE2  4  
ATOM 7107  H H    . GLN A 1 3   ? -27.897 39.495  -29.549 1.00 46.44 ? 3   GLN A H    4  
ATOM 7108  H HA   . GLN A 1 3   ? -25.703 40.065  -27.698 1.00 45.45 ? 3   GLN A HA   4  
ATOM 7109  H HB2  . GLN A 1 3   ? -27.855 38.946  -26.645 1.00 45.96 ? 3   GLN A HB2  4  
ATOM 7110  H HB3  . GLN A 1 3   ? -27.178 37.491  -27.357 1.00 45.41 ? 3   GLN A HB3  4  
ATOM 7111  H HG2  . GLN A 1 3   ? -25.238 37.620  -26.034 1.00 45.03 ? 3   GLN A HG2  4  
ATOM 7112  H HG3  . GLN A 1 3   ? -25.592 39.277  -25.542 1.00 45.22 ? 3   GLN A HG3  4  
ATOM 7113  H HE21 . GLN A 1 3   ? -25.097 36.992  -23.854 1.00 44.98 ? 3   GLN A HE21 4  
ATOM 7114  H HE22 . GLN A 1 3   ? -26.518 36.775  -22.886 1.00 44.99 ? 3   GLN A HE22 4  
ATOM 7115  N N    . PRO A 1 4   ? -24.511 39.024  -29.682 1.00 44.78 ? 4   PRO A N    4  
ATOM 7116  C CA   . PRO A 1 4   ? -23.677 38.331  -30.659 1.00 44.40 ? 4   PRO A CA   4  
ATOM 7117  C C    . PRO A 1 4   ? -22.645 37.424  -29.993 1.00 43.91 ? 4   PRO A C    4  
ATOM 7118  O O    . PRO A 1 4   ? -22.459 37.478  -28.776 1.00 43.73 ? 4   PRO A O    4  
ATOM 7119  C CB   . PRO A 1 4   ? -23.000 39.485  -31.395 1.00 44.25 ? 4   PRO A CB   4  
ATOM 7120  C CG   . PRO A 1 4   ? -22.883 40.566  -30.377 1.00 44.46 ? 4   PRO A CG   4  
ATOM 7121  C CD   . PRO A 1 4   ? -24.065 40.414  -29.458 1.00 44.80 ? 4   PRO A CD   4  
ATOM 7122  H HA   . PRO A 1 4   ? -24.274 37.755  -31.351 1.00 44.62 ? 4   PRO A HA   4  
ATOM 7123  H HB2  . PRO A 1 4   ? -22.030 39.169  -31.749 1.00 43.90 ? 4   PRO A HB2  4  
ATOM 7124  H HB3  . PRO A 1 4   ? -23.614 39.792  -32.232 1.00 44.42 ? 4   PRO A HB3  4  
ATOM 7125  H HG2  . PRO A 1 4   ? -21.964 40.451  -29.823 1.00 44.24 ? 4   PRO A HG2  4  
ATOM 7126  H HG3  . PRO A 1 4   ? -22.910 41.531  -30.862 1.00 44.66 ? 4   PRO A HG3  4  
ATOM 7127  H HD2  . PRO A 1 4   ? -23.764 40.559  -28.431 1.00 44.65 ? 4   PRO A HD2  4  
ATOM 7128  H HD3  . PRO A 1 4   ? -24.843 41.115  -29.727 1.00 45.22 ? 4   PRO A HD3  4  
ATOM 7129  N N    . PRO A 1 5   ? -21.974 36.567  -30.781 1.00 43.76 ? 5   PRO A N    4  
ATOM 7130  C CA   . PRO A 1 5   ? -20.933 35.673  -30.270 1.00 43.36 ? 5   PRO A CA   4  
ATOM 7131  C C    . PRO A 1 5   ? -19.820 36.427  -29.552 1.00 42.76 ? 5   PRO A C    4  
ATOM 7132  O O    . PRO A 1 5   ? -19.212 37.345  -30.111 1.00 42.58 ? 5   PRO A O    4  
ATOM 7133  C CB   . PRO A 1 5   ? -20.378 34.999  -31.527 1.00 43.41 ? 5   PRO A CB   4  
ATOM 7134  C CG   . PRO A 1 5   ? -21.476 35.093  -32.523 1.00 43.89 ? 5   PRO A CG   4  
ATOM 7135  C CD   . PRO A 1 5   ? -22.186 36.385  -32.229 1.00 44.02 ? 5   PRO A CD   4  
ATOM 7136  H HA   . PRO A 1 5   ? -21.347 34.926  -29.608 1.00 43.54 ? 5   PRO A HA   4  
ATOM 7137  H HB2  . PRO A 1 5   ? -19.497 35.525  -31.860 1.00 42.99 ? 5   PRO A HB2  4  
ATOM 7138  H HB3  . PRO A 1 5   ? -20.131 33.971  -31.310 1.00 43.59 ? 5   PRO A HB3  4  
ATOM 7139  H HG2  . PRO A 1 5   ? -21.063 35.108  -33.522 1.00 43.87 ? 5   PRO A HG2  4  
ATOM 7140  H HG3  . PRO A 1 5   ? -22.150 34.257  -32.406 1.00 44.19 ? 5   PRO A HG3  4  
ATOM 7141  H HD2  . PRO A 1 5   ? -21.742 37.194  -32.789 1.00 43.91 ? 5   PRO A HD2  4  
ATOM 7142  H HD3  . PRO A 1 5   ? -23.238 36.297  -32.456 1.00 44.45 ? 5   PRO A HD3  4  
ATOM 7143  N N    . ALA A 1 6   ? -19.574 36.045  -28.311 1.00 42.50 ? 6   ALA A N    4  
ATOM 7144  C CA   . ALA A 1 6   ? -18.494 36.622  -27.535 1.00 41.97 ? 6   ALA A CA   4  
ATOM 7145  C C    . ALA A 1 6   ? -17.275 35.718  -27.614 1.00 41.42 ? 6   ALA A C    4  
ATOM 7146  O O    . ALA A 1 6   ? -17.375 34.512  -27.393 1.00 41.39 ? 6   ALA A O    4  
ATOM 7147  C CB   . ALA A 1 6   ? -18.920 36.822  -26.086 1.00 42.03 ? 6   ALA A CB   4  
ATOM 7148  H H    . ALA A 1 6   ? -20.125 35.341  -27.911 1.00 42.71 ? 6   ALA A H    4  
ATOM 7149  H HA   . ALA A 1 6   ? -18.247 37.588  -27.961 1.00 42.00 ? 6   ALA A HA   4  
ATOM 7150  H HB1  . ALA A 1 6   ? -18.137 37.335  -25.545 1.00 42.08 ? 6   ALA A HB1  4  
ATOM 7151  H HB2  . ALA A 1 6   ? -19.097 35.859  -25.629 1.00 42.08 ? 6   ALA A HB2  4  
ATOM 7152  H HB3  . ALA A 1 6   ? -19.828 37.408  -26.053 1.00 42.02 ? 6   ALA A HB3  4  
ATOM 7153  N N    . GLU A 1 7   ? -16.132 36.292  -27.946 1.00 41.05 ? 7   GLU A N    4  
ATOM 7154  C CA   . GLU A 1 7   ? -14.914 35.512  -28.077 1.00 40.56 ? 7   GLU A CA   4  
ATOM 7155  C C    . GLU A 1 7   ? -14.332 35.222  -26.699 1.00 40.16 ? 7   GLU A C    4  
ATOM 7156  O O    . GLU A 1 7   ? -13.821 34.131  -26.448 1.00 40.13 ? 7   GLU A O    4  
ATOM 7157  C CB   . GLU A 1 7   ? -13.907 36.242  -28.968 1.00 40.61 ? 7   GLU A CB   4  
ATOM 7158  C CG   . GLU A 1 7   ? -12.718 35.389  -29.371 1.00 40.78 ? 7   GLU A CG   4  
ATOM 7159  C CD   . GLU A 1 7   ? -12.195 35.749  -30.745 1.00 41.03 ? 7   GLU A CD   4  
ATOM 7160  O OE1  . GLU A 1 7   ? -12.779 35.279  -31.748 1.00 41.50 ? 7   GLU A OE1  4  
ATOM 7161  O OE2  . GLU A 1 7   ? -11.213 36.513  -30.835 1.00 40.82 ? 7   GLU A OE2  4  
ATOM 7162  H H    . GLU A 1 7   ? -16.108 37.258  -28.109 1.00 41.14 ? 7   GLU A H    4  
ATOM 7163  H HA   . GLU A 1 7   ? -15.177 34.573  -28.542 1.00 40.51 ? 7   GLU A HA   4  
ATOM 7164  H HB2  . GLU A 1 7   ? -14.409 36.568  -29.869 1.00 40.72 ? 7   GLU A HB2  4  
ATOM 7165  H HB3  . GLU A 1 7   ? -13.539 37.108  -28.438 1.00 40.47 ? 7   GLU A HB3  4  
ATOM 7166  H HG2  . GLU A 1 7   ? -11.924 35.535  -28.651 1.00 40.98 ? 7   GLU A HG2  4  
ATOM 7167  H HG3  . GLU A 1 7   ? -13.016 34.352  -29.374 1.00 40.58 ? 7   GLU A HG3  4  
ATOM 7168  N N    . GLU A 1 8   ? -14.436 36.195  -25.804 1.00 39.89 ? 8   GLU A N    4  
ATOM 7169  C CA   . GLU A 1 8   ? -14.037 36.003  -24.417 1.00 39.55 ? 8   GLU A CA   4  
ATOM 7170  C C    . GLU A 1 8   ? -14.746 37.014  -23.520 1.00 39.08 ? 8   GLU A C    4  
ATOM 7171  O O    . GLU A 1 8   ? -14.972 36.751  -22.338 1.00 38.77 ? 8   GLU A O    4  
ATOM 7172  C CB   . GLU A 1 8   ? -12.517 36.111  -24.268 1.00 39.61 ? 8   GLU A CB   4  
ATOM 7173  C CG   . GLU A 1 8   ? -11.994 35.482  -22.987 1.00 39.77 ? 8   GLU A CG   4  
ATOM 7174  C CD   . GLU A 1 8   ? -10.484 35.417  -22.932 1.00 40.05 ? 8   GLU A CD   4  
ATOM 7175  O OE1  . GLU A 1 8   ? -9.887  34.636  -23.702 1.00 40.04 ? 8   GLU A OE1  4  
ATOM 7176  O OE2  . GLU A 1 8   ? -9.884  36.156  -22.124 1.00 40.33 ? 8   GLU A OE2  4  
ATOM 7177  H H    . GLU A 1 8   ? -14.796 37.064  -26.086 1.00 39.97 ? 8   GLU A H    4  
ATOM 7178  H HA   . GLU A 1 8   ? -14.345 35.009  -24.123 1.00 39.67 ? 8   GLU A HA   4  
ATOM 7179  H HB2  . GLU A 1 8   ? -12.047 35.616  -25.105 1.00 39.61 ? 8   GLU A HB2  4  
ATOM 7180  H HB3  . GLU A 1 8   ? -12.237 37.153  -24.272 1.00 39.59 ? 8   GLU A HB3  4  
ATOM 7181  H HG2  . GLU A 1 8   ? -12.345 36.060  -22.146 1.00 39.75 ? 8   GLU A HG2  4  
ATOM 7182  H HG3  . GLU A 1 8   ? -12.383 34.477  -22.916 1.00 39.76 ? 8   GLU A HG3  4  
ATOM 7183  N N    . ALA A 1 9   ? -15.111 38.159  -24.108 1.00 39.09 ? 9   ALA A N    4  
ATOM 7184  C CA   . ALA A 1 9   ? -15.825 39.225  -23.399 1.00 38.75 ? 9   ALA A CA   4  
ATOM 7185  C C    . ALA A 1 9   ? -14.958 39.834  -22.297 1.00 38.56 ? 9   ALA A C    4  
ATOM 7186  O O    . ALA A 1 9   ? -14.229 40.799  -22.536 1.00 38.67 ? 9   ALA A O    4  
ATOM 7187  C CB   . ALA A 1 9   ? -17.159 38.724  -22.838 1.00 38.76 ? 9   ALA A CB   4  
ATOM 7188  H H    . ALA A 1 9   ? -14.880 38.300  -25.051 1.00 39.39 ? 9   ALA A H    4  
ATOM 7189  H HA   . ALA A 1 9   ? -16.042 39.999  -24.123 1.00 38.69 ? 9   ALA A HA   4  
ATOM 7190  H HB1  . ALA A 1 9   ? -16.978 37.945  -22.111 1.00 38.80 ? 9   ALA A HB1  4  
ATOM 7191  H HB2  . ALA A 1 9   ? -17.767 38.327  -23.641 1.00 38.76 ? 9   ALA A HB2  4  
ATOM 7192  H HB3  . ALA A 1 9   ? -17.683 39.542  -22.365 1.00 38.78 ? 9   ALA A HB3  4  
ATOM 7193  N N    . GLU A 1 10  ? -15.024 39.261  -21.101 1.00 38.35 ? 10  GLU A N    4  
ATOM 7194  C CA   . GLU A 1 10  ? -14.229 39.746  -19.981 1.00 38.21 ? 10  GLU A CA   4  
ATOM 7195  C C    . GLU A 1 10  ? -14.160 38.700  -18.872 1.00 37.73 ? 10  GLU A C    4  
ATOM 7196  O O    . GLU A 1 10  ? -13.073 38.284  -18.471 1.00 37.49 ? 10  GLU A O    4  
ATOM 7197  C CB   . GLU A 1 10  ? -14.802 41.050  -19.417 1.00 38.40 ? 10  GLU A CB   4  
ATOM 7198  C CG   . GLU A 1 10  ? -13.864 41.745  -18.442 1.00 38.59 ? 10  GLU A CG   4  
ATOM 7199  C CD   . GLU A 1 10  ? -14.554 42.823  -17.635 1.00 38.73 ? 10  GLU A CD   4  
ATOM 7200  O OE1  . GLU A 1 10  ? -14.692 43.953  -18.140 1.00 38.82 ? 10  GLU A OE1  4  
ATOM 7201  O OE2  . GLU A 1 10  ? -14.958 42.536  -16.489 1.00 38.81 ? 10  GLU A OE2  4  
ATOM 7202  H H    . GLU A 1 10  ? -15.606 38.482  -20.976 1.00 38.34 ? 10  GLU A H    4  
ATOM 7203  H HA   . GLU A 1 10  ? -13.231 39.931  -20.344 1.00 38.39 ? 10  GLU A HA   4  
ATOM 7204  H HB2  . GLU A 1 10  ? -15.001 41.727  -20.235 1.00 38.43 ? 10  GLU A HB2  4  
ATOM 7205  H HB3  . GLU A 1 10  ? -15.726 40.834  -18.902 1.00 38.43 ? 10  GLU A HB3  4  
ATOM 7206  H HG2  . GLU A 1 10  ? -13.460 41.009  -17.763 1.00 38.64 ? 10  GLU A HG2  4  
ATOM 7207  H HG3  . GLU A 1 10  ? -13.057 42.196  -19.001 1.00 38.66 ? 10  GLU A HG3  4  
ATOM 7208  N N    . GLN A 1 11  ? -15.321 38.272  -18.375 1.00 37.65 ? 11  GLN A N    4  
ATOM 7209  C CA   . GLN A 1 11  ? -15.372 37.324  -17.264 1.00 37.26 ? 11  GLN A CA   4  
ATOM 7210  C C    . GLN A 1 11  ? -16.025 36.002  -17.681 1.00 36.82 ? 11  GLN A C    4  
ATOM 7211  O O    . GLN A 1 11  ? -17.207 35.780  -17.426 1.00 36.78 ? 11  GLN A O    4  
ATOM 7212  C CB   . GLN A 1 11  ? -16.157 37.922  -16.088 1.00 37.34 ? 11  GLN A CB   4  
ATOM 7213  C CG   . GLN A 1 11  ? -15.696 39.312  -15.667 1.00 37.71 ? 11  GLN A CG   4  
ATOM 7214  C CD   . GLN A 1 11  ? -14.282 39.339  -15.123 1.00 37.79 ? 11  GLN A CD   4  
ATOM 7215  O OE1  . GLN A 1 11  ? -13.802 38.362  -14.545 1.00 37.58 ? 11  GLN A OE1  4  
ATOM 7216  N NE2  . GLN A 1 11  ? -13.610 40.465  -15.286 1.00 38.16 ? 11  GLN A NE2  4  
ATOM 7217  H H    . GLN A 1 11  ? -16.164 38.604  -18.762 1.00 37.91 ? 11  GLN A H    4  
ATOM 7218  H HA   . GLN A 1 11  ? -14.359 37.129  -16.945 1.00 37.29 ? 11  GLN A HA   4  
ATOM 7219  H HB2  . GLN A 1 11  ? -17.199 37.985  -16.363 1.00 37.36 ? 11  GLN A HB2  4  
ATOM 7220  H HB3  . GLN A 1 11  ? -16.060 37.264  -15.237 1.00 37.16 ? 11  GLN A HB3  4  
ATOM 7221  H HG2  . GLN A 1 11  ? -15.743 39.966  -16.527 1.00 37.78 ? 11  GLN A HG2  4  
ATOM 7222  H HG3  . GLN A 1 11  ? -16.366 39.681  -14.904 1.00 37.94 ? 11  GLN A HG3  4  
ATOM 7223  H HE21 . GLN A 1 11  ? -14.066 41.217  -15.744 1.00 38.35 ? 11  GLN A HE21 4  
ATOM 7224  H HE22 . GLN A 1 11  ? -12.695 40.512  -14.946 1.00 38.26 ? 11  GLN A HE22 4  
ATOM 7225  N N    . PRO A 1 12  ? -15.277 35.115  -18.357 1.00 36.56 ? 12  PRO A N    4  
ATOM 7226  C CA   . PRO A 1 12  ? -15.768 33.796  -18.726 1.00 36.18 ? 12  PRO A CA   4  
ATOM 7227  C C    . PRO A 1 12  ? -15.367 32.729  -17.709 1.00 35.97 ? 12  PRO A C    4  
ATOM 7228  O O    . PRO A 1 12  ? -15.663 31.543  -17.875 1.00 36.19 ? 12  PRO A O    4  
ATOM 7229  C CB   . PRO A 1 12  ? -15.074 33.561  -20.064 1.00 36.06 ? 12  PRO A CB   4  
ATOM 7230  C CG   . PRO A 1 12  ? -13.777 34.311  -19.975 1.00 36.50 ? 12  PRO A CG   4  
ATOM 7231  C CD   . PRO A 1 12  ? -13.913 35.328  -18.861 1.00 36.70 ? 12  PRO A CD   4  
ATOM 7232  H HA   . PRO A 1 12  ? -16.839 33.790  -18.861 1.00 36.21 ? 12  PRO A HA   4  
ATOM 7233  H HB2  . PRO A 1 12  ? -14.908 32.502  -20.205 1.00 35.77 ? 12  PRO A HB2  4  
ATOM 7234  H HB3  . PRO A 1 12  ? -15.693 33.942  -20.864 1.00 36.04 ? 12  PRO A HB3  4  
ATOM 7235  H HG2  . PRO A 1 12  ? -12.976 33.623  -19.750 1.00 36.44 ? 12  PRO A HG2  4  
ATOM 7236  H HG3  . PRO A 1 12  ? -13.584 34.812  -20.911 1.00 36.79 ? 12  PRO A HG3  4  
ATOM 7237  H HD2  . PRO A 1 12  ? -13.182 35.139  -18.088 1.00 36.66 ? 12  PRO A HD2  4  
ATOM 7238  H HD3  . PRO A 1 12  ? -13.800 36.329  -19.250 1.00 37.04 ? 12  PRO A HD3  4  
ATOM 7239  N N    . GLY A 1 13  ? -14.697 33.168  -16.655 1.00 35.61 ? 13  GLY A N    4  
ATOM 7240  C CA   . GLY A 1 13  ? -14.225 32.262  -15.628 1.00 35.47 ? 13  GLY A CA   4  
ATOM 7241  C C    . GLY A 1 13  ? -13.554 33.013  -14.496 1.00 35.16 ? 13  GLY A C    4  
ATOM 7242  O O    . GLY A 1 13  ? -13.996 34.106  -14.137 1.00 35.17 ? 13  GLY A O    4  
ATOM 7243  H H    . GLY A 1 13  ? -14.523 34.129  -16.566 1.00 35.50 ? 13  GLY A H    4  
ATOM 7244  H HA2  . GLY A 1 13  ? -15.064 31.707  -15.236 1.00 35.46 ? 13  GLY A HA2  4  
ATOM 7245  H HA3  . GLY A 1 13  ? -13.518 31.575  -16.065 1.00 35.66 ? 13  GLY A HA3  4  
ATOM 7246  N N    . ALA A 1 14  ? -12.477 32.436  -13.954 1.00 34.97 ? 14  ALA A N    4  
ATOM 7247  C CA   . ALA A 1 14  ? -11.730 33.040  -12.847 1.00 34.74 ? 14  ALA A CA   4  
ATOM 7248  C C    . ALA A 1 14  ? -12.617 33.206  -11.619 1.00 34.24 ? 14  ALA A C    4  
ATOM 7249  O O    . ALA A 1 14  ? -13.202 34.269  -11.390 1.00 34.14 ? 14  ALA A O    4  
ATOM 7250  C CB   . ALA A 1 14  ? -11.121 34.376  -13.261 1.00 35.03 ? 14  ALA A CB   4  
ATOM 7251  H H    . ALA A 1 14  ? -12.179 31.569  -14.305 1.00 35.02 ? 14  ALA A H    4  
ATOM 7252  H HA   . ALA A 1 14  ? -10.918 32.368  -12.595 1.00 34.81 ? 14  ALA A HA   4  
ATOM 7253  H HB1  . ALA A 1 14  ? -10.528 34.772  -12.448 1.00 35.15 ? 14  ALA A HB1  4  
ATOM 7254  H HB2  . ALA A 1 14  ? -11.913 35.071  -13.499 1.00 35.06 ? 14  ALA A HB2  4  
ATOM 7255  H HB3  . ALA A 1 14  ? -10.493 34.234  -14.129 1.00 35.13 ? 14  ALA A HB3  4  
ATOM 7256  N N    . LEU A 1 15  ? -12.717 32.141  -10.838 1.00 34.01 ? 15  LEU A N    4  
ATOM 7257  C CA   . LEU A 1 15  ? -13.604 32.119  -9.682  1.00 33.60 ? 15  LEU A CA   4  
ATOM 7258  C C    . LEU A 1 15  ? -12.866 32.561  -8.423  1.00 33.26 ? 15  LEU A C    4  
ATOM 7259  O O    . LEU A 1 15  ? -13.486 33.038  -7.472  1.00 33.39 ? 15  LEU A O    4  
ATOM 7260  C CB   . LEU A 1 15  ? -14.212 30.722  -9.483  1.00 33.42 ? 15  LEU A CB   4  
ATOM 7261  C CG   . LEU A 1 15  ? -15.339 30.333  -10.459 1.00 33.48 ? 15  LEU A CG   4  
ATOM 7262  C CD1  . LEU A 1 15  ? -14.821 30.192  -11.884 1.00 33.70 ? 15  LEU A CD1  4  
ATOM 7263  C CD2  . LEU A 1 15  ? -16.017 29.045  -10.006 1.00 33.25 ? 15  LEU A CD2  4  
ATOM 7264  H H    . LEU A 1 15  ? -12.170 31.350  -11.041 1.00 34.17 ? 15  LEU A H    4  
ATOM 7265  H HA   . LEU A 1 15  ? -14.401 32.820  -9.875  1.00 33.74 ? 15  LEU A HA   4  
ATOM 7266  H HB2  . LEU A 1 15  ? -13.418 29.997  -9.578  1.00 33.66 ? 15  LEU A HB2  4  
ATOM 7267  H HB3  . LEU A 1 15  ? -14.605 30.668  -8.479  1.00 33.10 ? 15  LEU A HB3  4  
ATOM 7268  H HG   . LEU A 1 15  ? -16.085 31.116  -10.460 1.00 33.61 ? 15  LEU A HG   4  
ATOM 7269  H HD11 . LEU A 1 15  ? -15.636 29.917  -12.538 1.00 33.68 ? 15  LEU A HD11 4  
ATOM 7270  H HD12 . LEU A 1 15  ? -14.060 29.427  -11.918 1.00 33.80 ? 15  LEU A HD12 4  
ATOM 7271  H HD13 . LEU A 1 15  ? -14.400 31.132  -12.210 1.00 33.84 ? 15  LEU A HD13 4  
ATOM 7272  H HD21 . LEU A 1 15  ? -16.470 29.201  -9.038  1.00 33.24 ? 15  LEU A HD21 4  
ATOM 7273  H HD22 . LEU A 1 15  ? -15.283 28.256  -9.936  1.00 33.21 ? 15  LEU A HD22 4  
ATOM 7274  H HD23 . LEU A 1 15  ? -16.777 28.769  -10.718 1.00 33.20 ? 15  LEU A HD23 4  
ATOM 7275  N N    . ALA A 1 16  ? -11.543 32.379  -8.423  1.00 32.89 ? 16  ALA A N    4  
ATOM 7276  C CA   . ALA A 1 16  ? -10.678 32.839  -7.328  1.00 32.59 ? 16  ALA A CA   4  
ATOM 7277  C C    . ALA A 1 16  ? -11.089 32.235  -5.981  1.00 31.98 ? 16  ALA A C    4  
ATOM 7278  O O    . ALA A 1 16  ? -10.850 32.821  -4.919  1.00 31.63 ? 16  ALA A O    4  
ATOM 7279  C CB   . ALA A 1 16  ? -10.689 34.365  -7.253  1.00 32.80 ? 16  ALA A CB   4  
ATOM 7280  H H    . ALA A 1 16  ? -11.133 31.921  -9.186  1.00 32.86 ? 16  ALA A H    4  
ATOM 7281  H HA   . ALA A 1 16  ? -9.668  32.522  -7.552  1.00 32.73 ? 16  ALA A HA   4  
ATOM 7282  H HB1  . ALA A 1 16  ? -11.683 34.703  -7.002  1.00 32.95 ? 16  ALA A HB1  4  
ATOM 7283  H HB2  . ALA A 1 16  ? -10.399 34.780  -8.208  1.00 32.85 ? 16  ALA A HB2  4  
ATOM 7284  H HB3  . ALA A 1 16  ? -9.997  34.694  -6.491  1.00 32.80 ? 16  ALA A HB3  4  
ATOM 7285  N N    . ARG A 1 17  ? -11.662 31.042  -6.023  1.00 31.94 ? 17  ARG A N    4  
ATOM 7286  C CA   . ARG A 1 17  ? -12.180 30.393  -4.824  1.00 31.46 ? 17  ARG A CA   4  
ATOM 7287  C C    . ARG A 1 17  ? -11.105 29.515  -4.173  1.00 31.11 ? 17  ARG A C    4  
ATOM 7288  O O    . ARG A 1 17  ? -11.410 28.572  -3.448  1.00 31.11 ? 17  ARG A O    4  
ATOM 7289  C CB   . ARG A 1 17  ? -13.430 29.572  -5.184  1.00 31.72 ? 17  ARG A CB   4  
ATOM 7290  C CG   . ARG A 1 17  ? -14.269 29.149  -3.985  1.00 31.75 ? 17  ARG A CG   4  
ATOM 7291  C CD   . ARG A 1 17  ? -14.592 30.336  -3.091  1.00 31.70 ? 17  ARG A CD   4  
ATOM 7292  N NE   . ARG A 1 17  ? -15.441 29.973  -1.960  1.00 31.67 ? 17  ARG A NE   4  
ATOM 7293  C CZ   . ARG A 1 17  ? -15.036 30.001  -0.688  1.00 31.67 ? 17  ARG A CZ   4  
ATOM 7294  N NH1  . ARG A 1 17  ? -13.762 30.235  -0.406  1.00 31.70 ? 17  ARG A NH1  4  
ATOM 7295  N NH2  . ARG A 1 17  ? -15.899 29.768  0.291   1.00 31.71 ? 17  ARG A NH2  4  
ATOM 7296  H H    . ARG A 1 17  ? -11.731 30.577  -6.887  1.00 32.30 ? 17  ARG A H    4  
ATOM 7297  H HA   . ARG A 1 17  ? -12.459 31.168  -4.126  1.00 31.22 ? 17  ARG A HA   4  
ATOM 7298  H HB2  . ARG A 1 17  ? -14.053 30.163  -5.836  1.00 31.77 ? 17  ARG A HB2  4  
ATOM 7299  H HB3  . ARG A 1 17  ? -13.120 28.680  -5.712  1.00 31.94 ? 17  ARG A HB3  4  
ATOM 7300  H HG2  . ARG A 1 17  ? -15.192 28.718  -4.340  1.00 31.83 ? 17  ARG A HG2  4  
ATOM 7301  H HG3  . ARG A 1 17  ? -13.722 28.414  -3.413  1.00 31.82 ? 17  ARG A HG3  4  
ATOM 7302  H HD2  . ARG A 1 17  ? -13.668 30.745  -2.712  1.00 31.64 ? 17  ARG A HD2  4  
ATOM 7303  H HD3  . ARG A 1 17  ? -15.098 31.085  -3.682  1.00 31.84 ? 17  ARG A HD3  4  
ATOM 7304  H HE   . ARG A 1 17  ? -16.376 29.732  -2.159  1.00 31.70 ? 17  ARG A HE   4  
ATOM 7305  H HH11 . ARG A 1 17  ? -13.105 30.382  -1.142  1.00 31.72 ? 17  ARG A HH11 4  
ATOM 7306  H HH12 . ARG A 1 17  ? -13.454 30.279  0.551   1.00 31.76 ? 17  ARG A HH12 4  
ATOM 7307  H HH21 . ARG A 1 17  ? -16.864 29.572  0.080   1.00 31.75 ? 17  ARG A HH21 4  
ATOM 7308  H HH22 . ARG A 1 17  ? -15.598 29.781  1.249   1.00 31.77 ? 17  ARG A HH22 4  
ATOM 7309  N N    . GLU A 1 18  ? -9.846  29.870  -4.415  1.00 30.90 ? 18  GLU A N    4  
ATOM 7310  C CA   . GLU A 1 18  ? -8.706  29.123  -3.893  1.00 30.62 ? 18  GLU A CA   4  
ATOM 7311  C C    . GLU A 1 18  ? -8.723  29.070  -2.358  1.00 30.39 ? 18  GLU A C    4  
ATOM 7312  O O    . GLU A 1 18  ? -9.044  28.040  -1.768  1.00 30.35 ? 18  GLU A O    4  
ATOM 7313  C CB   . GLU A 1 18  ? -7.404  29.761  -4.395  1.00 30.67 ? 18  GLU A CB   4  
ATOM 7314  C CG   . GLU A 1 18  ? -6.147  28.998  -4.008  1.00 30.69 ? 18  GLU A CG   4  
ATOM 7315  C CD   . GLU A 1 18  ? -6.129  27.574  -4.520  1.00 30.90 ? 18  GLU A CD   4  
ATOM 7316  O OE1  . GLU A 1 18  ? -6.361  27.366  -5.731  1.00 31.24 ? 18  GLU A OE1  4  
ATOM 7317  O OE2  . GLU A 1 18  ? -5.879  26.657  -3.714  1.00 30.81 ? 18  GLU A OE2  4  
ATOM 7318  H H    . GLU A 1 18  ? -9.678  30.656  -4.974  1.00 30.99 ? 18  GLU A H    4  
ATOM 7319  H HA   . GLU A 1 18  ? -8.770  28.117  -4.275  1.00 30.62 ? 18  GLU A HA   4  
ATOM 7320  H HB2  . GLU A 1 18  ? -7.441  29.824  -5.472  1.00 30.69 ? 18  GLU A HB2  4  
ATOM 7321  H HB3  . GLU A 1 18  ? -7.327  30.761  -3.991  1.00 30.77 ? 18  GLU A HB3  4  
ATOM 7322  H HG2  . GLU A 1 18  ? -5.288  29.516  -4.407  1.00 30.69 ? 18  GLU A HG2  4  
ATOM 7323  H HG3  . GLU A 1 18  ? -6.080  28.975  -2.930  1.00 30.64 ? 18  GLU A HG3  4  
ATOM 7324  N N    . PHE A 1 19  ? -8.368  30.177  -1.713  1.00 30.33 ? 19  PHE A N    4  
ATOM 7325  C CA   . PHE A 1 19  ? -8.385  30.240  -0.248  1.00 30.21 ? 19  PHE A CA   4  
ATOM 7326  C C    . PHE A 1 19  ? -8.743  31.639  0.252   1.00 29.75 ? 19  PHE A C    4  
ATOM 7327  O O    . PHE A 1 19  ? -8.630  31.929  1.441   1.00 29.69 ? 19  PHE A O    4  
ATOM 7328  C CB   . PHE A 1 19  ? -7.026  29.816  0.328   1.00 30.57 ? 19  PHE A CB   4  
ATOM 7329  C CG   . PHE A 1 19  ? -5.883  30.737  -0.015  1.00 30.68 ? 19  PHE A CG   4  
ATOM 7330  C CD1  . PHE A 1 19  ? -5.225  30.619  -1.230  1.00 30.51 ? 19  PHE A CD1  4  
ATOM 7331  C CD2  . PHE A 1 19  ? -5.471  31.720  0.869   1.00 31.05 ? 19  PHE A CD2  4  
ATOM 7332  C CE1  . PHE A 1 19  ? -4.179  31.460  -1.550  1.00 30.71 ? 19  PHE A CE1  4  
ATOM 7333  C CE2  . PHE A 1 19  ? -4.424  32.564  0.554   1.00 31.24 ? 19  PHE A CE2  4  
ATOM 7334  C CZ   . PHE A 1 19  ? -3.774  32.434  -0.638  1.00 31.07 ? 19  PHE A CZ   4  
ATOM 7335  H H    . PHE A 1 19  ? -8.062  30.951  -2.224  1.00 30.42 ? 19  PHE A H    4  
ATOM 7336  H HA   . PHE A 1 19  ? -9.138  29.549  0.101   1.00 30.28 ? 19  PHE A HA   4  
ATOM 7337  H HB2  . PHE A 1 19  ? -7.104  29.785  1.403   1.00 30.83 ? 19  PHE A HB2  4  
ATOM 7338  H HB3  . PHE A 1 19  ? -6.783  28.830  -0.039  1.00 30.59 ? 19  PHE A HB3  4  
ATOM 7339  H HD1  . PHE A 1 19  ? -5.539  29.859  -1.932  1.00 30.27 ? 19  PHE A HD1  4  
ATOM 7340  H HD2  . PHE A 1 19  ? -5.975  31.823  1.817   1.00 31.23 ? 19  PHE A HD2  4  
ATOM 7341  H HE1  . PHE A 1 19  ? -3.673  31.355  -2.497  1.00 30.63 ? 19  PHE A HE1  4  
ATOM 7342  H HE2  . PHE A 1 19  ? -4.116  33.328  1.252   1.00 31.57 ? 19  PHE A HE2  4  
ATOM 7343  H HZ   . PHE A 1 19  ? -2.953  33.095  -0.878  1.00 31.29 ? 19  PHE A HZ   4  
ATOM 7344  N N    . LEU A 1 20  ? -9.206  32.487  -0.656  1.00 29.50 ? 20  LEU A N    4  
ATOM 7345  C CA   . LEU A 1 20  ? -9.415  33.898  -0.345  1.00 29.16 ? 20  LEU A CA   4  
ATOM 7346  C C    . LEU A 1 20  ? -10.733 34.114  0.387   1.00 28.50 ? 20  LEU A C    4  
ATOM 7347  O O    . LEU A 1 20  ? -10.750 34.579  1.527   1.00 28.35 ? 20  LEU A O    4  
ATOM 7348  C CB   . LEU A 1 20  ? -9.373  34.749  -1.623  1.00 29.33 ? 20  LEU A CB   4  
ATOM 7349  C CG   . LEU A 1 20  ? -8.025  34.792  -2.354  1.00 29.60 ? 20  LEU A CG   4  
ATOM 7350  C CD1  . LEU A 1 20  ? -7.763  33.492  -3.105  1.00 29.57 ? 20  LEU A CD1  4  
ATOM 7351  C CD2  . LEU A 1 20  ? -7.985  35.975  -3.306  1.00 29.85 ? 20  LEU A CD2  4  
ATOM 7352  H H    . LEU A 1 20  ? -9.434  32.157  -1.543  1.00 29.61 ? 20  LEU A H    4  
ATOM 7353  H HA   . LEU A 1 20  ? -8.612  34.211  0.304   1.00 29.36 ? 20  LEU A HA   4  
ATOM 7354  H HB2  . LEU A 1 20  ? -10.113 34.364  -2.307  1.00 29.39 ? 20  LEU A HB2  4  
ATOM 7355  H HB3  . LEU A 1 20  ? -9.643  35.761  -1.363  1.00 29.28 ? 20  LEU A HB3  4  
ATOM 7356  H HG   . LEU A 1 20  ? -7.237  34.923  -1.628  1.00 29.74 ? 20  LEU A HG   4  
ATOM 7357  H HD11 . LEU A 1 20  ? -6.824  33.564  -3.632  1.00 29.64 ? 20  LEU A HD11 4  
ATOM 7358  H HD12 . LEU A 1 20  ? -8.560  33.315  -3.810  1.00 29.62 ? 20  LEU A HD12 4  
ATOM 7359  H HD13 . LEU A 1 20  ? -7.718  32.675  -2.401  1.00 29.51 ? 20  LEU A HD13 4  
ATOM 7360  H HD21 . LEU A 1 20  ? -8.133  36.888  -2.749  1.00 29.89 ? 20  LEU A HD21 4  
ATOM 7361  H HD22 . LEU A 1 20  ? -8.770  35.874  -4.043  1.00 29.82 ? 20  LEU A HD22 4  
ATOM 7362  H HD23 . LEU A 1 20  ? -7.028  36.009  -3.803  1.00 30.10 ? 20  LEU A HD23 4  
ATOM 7363  N N    . ALA A 1 21  ? -11.834 33.787  -0.276  1.00 28.20 ? 21  ALA A N    4  
ATOM 7364  C CA   . ALA A 1 21  ? -13.154 33.936  0.320   1.00 27.66 ? 21  ALA A CA   4  
ATOM 7365  C C    . ALA A 1 21  ? -13.297 33.019  1.530   1.00 27.05 ? 21  ALA A C    4  
ATOM 7366  O O    . ALA A 1 21  ? -12.754 31.911  1.550   1.00 26.92 ? 21  ALA A O    4  
ATOM 7367  C CB   . ALA A 1 21  ? -14.241 33.646  -0.708  1.00 27.59 ? 21  ALA A CB   4  
ATOM 7368  H H    . ALA A 1 21  ? -11.758 33.438  -1.182  1.00 28.40 ? 21  ALA A H    4  
ATOM 7369  H HA   . ALA A 1 21  ? -13.257 34.964  0.647   1.00 27.85 ? 21  ALA A HA   4  
ATOM 7370  H HB1  . ALA A 1 21  ? -15.214 33.794  -0.261  1.00 27.65 ? 21  ALA A HB1  4  
ATOM 7371  H HB2  . ALA A 1 21  ? -14.153 32.623  -1.042  1.00 27.51 ? 21  ALA A HB2  4  
ATOM 7372  H HB3  . ALA A 1 21  ? -14.129 34.311  -1.552  1.00 27.66 ? 21  ALA A HB3  4  
ATOM 7373  N N    . ALA A 1 22  ? -14.033 33.480  2.529   1.00 26.78 ? 22  ALA A N    4  
ATOM 7374  C CA   . ALA A 1 22  ? -14.159 32.762  3.786   1.00 26.29 ? 22  ALA A CA   4  
ATOM 7375  C C    . ALA A 1 22  ? -15.222 31.672  3.709   1.00 25.93 ? 22  ALA A C    4  
ATOM 7376  O O    . ALA A 1 22  ? -15.893 31.513  2.682   1.00 26.15 ? 22  ALA A O    4  
ATOM 7377  C CB   . ALA A 1 22  ? -14.480 33.729  4.916   1.00 26.23 ? 22  ALA A CB   4  
ATOM 7378  H H    . ALA A 1 22  ? -14.520 34.330  2.413   1.00 26.97 ? 22  ALA A H    4  
ATOM 7379  H HA   . ALA A 1 22  ? -13.202 32.303  3.999   1.00 26.35 ? 22  ALA A HA   4  
ATOM 7380  H HB1  . ALA A 1 22  ? -14.547 33.184  5.846   1.00 26.24 ? 22  ALA A HB1  4  
ATOM 7381  H HB2  . ALA A 1 22  ? -15.423 34.214  4.714   1.00 26.16 ? 22  ALA A HB2  4  
ATOM 7382  H HB3  . ALA A 1 22  ? -13.700 34.474  4.991   1.00 26.35 ? 22  ALA A HB3  4  
ATOM 7383  N N    . MET A 1 23  ? -15.363 30.940  4.815   1.00 25.45 ? 23  MET A N    4  
ATOM 7384  C CA   . MET A 1 23  ? -16.304 29.829  4.934   1.00 25.17 ? 23  MET A CA   4  
ATOM 7385  C C    . MET A 1 23  ? -16.020 28.745  3.899   1.00 24.29 ? 23  MET A C    4  
ATOM 7386  O O    . MET A 1 23  ? -16.685 28.658  2.866   1.00 24.04 ? 23  MET A O    4  
ATOM 7387  C CB   . MET A 1 23  ? -17.762 30.309  4.839   1.00 25.82 ? 23  MET A CB   4  
ATOM 7388  C CG   . MET A 1 23  ? -18.781 29.206  5.101   1.00 26.18 ? 23  MET A CG   4  
ATOM 7389  S SD   . MET A 1 23  ? -20.477 29.811  5.188   1.00 26.73 ? 23  MET A SD   4  
ATOM 7390  C CE   . MET A 1 23  ? -20.369 30.905  6.602   1.00 27.47 ? 23  MET A CE   4  
ATOM 7391  H H    . MET A 1 23  ? -14.806 31.161  5.594   1.00 25.35 ? 23  MET A H    4  
ATOM 7392  H HA   . MET A 1 23  ? -16.156 29.394  5.912   1.00 25.23 ? 23  MET A HA   4  
ATOM 7393  H HB2  . MET A 1 23  ? -17.918 31.096  5.561   1.00 26.04 ? 23  MET A HB2  4  
ATOM 7394  H HB3  . MET A 1 23  ? -17.934 30.703  3.847   1.00 25.92 ? 23  MET A HB3  4  
ATOM 7395  H HG2  . MET A 1 23  ? -18.716 28.485  4.303   1.00 26.11 ? 23  MET A HG2  4  
ATOM 7396  H HG3  . MET A 1 23  ? -18.537 28.726  6.037   1.00 26.28 ? 23  MET A HG3  4  
ATOM 7397  H HE1  . MET A 1 23  ? -21.331 31.369  6.775   1.00 27.66 ? 23  MET A HE1  4  
ATOM 7398  H HE2  . MET A 1 23  ? -19.629 31.670  6.411   1.00 27.63 ? 23  MET A HE2  4  
ATOM 7399  H HE3  . MET A 1 23  ? -20.083 30.336  7.475   1.00 27.66 ? 23  MET A HE3  4  
ATOM 7400  N N    . GLU A 1 24  ? -14.998 27.949  4.174   1.00 23.92 ? 24  GLU A N    4  
ATOM 7401  C CA   . GLU A 1 24  ? -14.650 26.812  3.335   1.00 23.15 ? 24  GLU A CA   4  
ATOM 7402  C C    . GLU A 1 24  ? -13.662 25.928  4.091   1.00 22.22 ? 24  GLU A C    4  
ATOM 7403  O O    . GLU A 1 24  ? -12.520 26.324  4.324   1.00 22.21 ? 24  GLU A O    4  
ATOM 7404  C CB   . GLU A 1 24  ? -14.048 27.285  2.009   1.00 23.57 ? 24  GLU A CB   4  
ATOM 7405  C CG   . GLU A 1 24  ? -14.178 26.267  0.886   1.00 23.67 ? 24  GLU A CG   4  
ATOM 7406  C CD   . GLU A 1 24  ? -15.628 25.951  0.552   1.00 24.03 ? 24  GLU A CD   4  
ATOM 7407  O OE1  . GLU A 1 24  ? -16.244 26.709  -0.228  1.00 24.41 ? 24  GLU A OE1  4  
ATOM 7408  O OE2  . GLU A 1 24  ? -16.160 24.948  1.076   1.00 24.02 ? 24  GLU A OE2  4  
ATOM 7409  H H    . GLU A 1 24  ? -14.452 28.136  4.967   1.00 24.25 ? 24  GLU A H    4  
ATOM 7410  H HA   . GLU A 1 24  ? -15.553 26.250  3.139   1.00 23.03 ? 24  GLU A HA   4  
ATOM 7411  H HB2  . GLU A 1 24  ? -14.549 28.192  1.701   1.00 24.07 ? 24  GLU A HB2  4  
ATOM 7412  H HB3  . GLU A 1 24  ? -12.998 27.495  2.157   1.00 23.42 ? 24  GLU A HB3  4  
ATOM 7413  H HG2  . GLU A 1 24  ? -13.700 26.663  0.004   1.00 23.64 ? 24  GLU A HG2  4  
ATOM 7414  H HG3  . GLU A 1 24  ? -13.685 25.353  1.182   1.00 23.64 ? 24  GLU A HG3  4  
ATOM 7415  N N    . PRO A 1 25  ? -14.106 24.735  4.513   1.00 21.54 ? 25  PRO A N    4  
ATOM 7416  C CA   . PRO A 1 25  ? -13.313 23.836  5.360   1.00 20.70 ? 25  PRO A CA   4  
ATOM 7417  C C    . PRO A 1 25  ? -12.071 23.290  4.660   1.00 19.96 ? 25  PRO A C    4  
ATOM 7418  O O    . PRO A 1 25  ? -12.091 23.002  3.462   1.00 19.79 ? 25  PRO A O    4  
ATOM 7419  C CB   . PRO A 1 25  ? -14.280 22.687  5.680   1.00 20.35 ? 25  PRO A CB   4  
ATOM 7420  C CG   . PRO A 1 25  ? -15.635 23.194  5.318   1.00 20.99 ? 25  PRO A CG   4  
ATOM 7421  C CD   . PRO A 1 25  ? -15.421 24.162  4.195   1.00 21.63 ? 25  PRO A CD   4  
ATOM 7422  H HA   . PRO A 1 25  ? -13.018 24.323  6.278   1.00 20.98 ? 25  PRO A HA   4  
ATOM 7423  H HB2  . PRO A 1 25  ? -14.016 21.822  5.089   1.00 19.62 ? 25  PRO A HB2  4  
ATOM 7424  H HB3  . PRO A 1 25  ? -14.217 22.442  6.729   1.00 20.49 ? 25  PRO A HB3  4  
ATOM 7425  H HG2  . PRO A 1 25  ? -16.261 22.374  4.992   1.00 20.64 ? 25  PRO A HG2  4  
ATOM 7426  H HG3  . PRO A 1 25  ? -16.082 23.692  6.165   1.00 21.44 ? 25  PRO A HG3  4  
ATOM 7427  H HD2  . PRO A 1 25  ? -15.399 23.642  3.249   1.00 21.43 ? 25  PRO A HD2  4  
ATOM 7428  H HD3  . PRO A 1 25  ? -16.186 24.924  4.194   1.00 22.40 ? 25  PRO A HD3  4  
ATOM 7429  N N    . GLU A 1 26  ? -10.991 23.148  5.421   1.00 19.63 ? 26  GLU A N    4  
ATOM 7430  C CA   . GLU A 1 26  ? -9.754  22.569  4.910   1.00 19.01 ? 26  GLU A CA   4  
ATOM 7431  C C    . GLU A 1 26  ? -9.957  21.092  4.588   1.00 17.82 ? 26  GLU A C    4  
ATOM 7432  O O    . GLU A 1 26  ? -10.698 20.402  5.287   1.00 17.39 ? 26  GLU A O    4  
ATOM 7433  C CB   . GLU A 1 26  ? -8.630  22.700  5.942   1.00 19.23 ? 26  GLU A CB   4  
ATOM 7434  C CG   . GLU A 1 26  ? -8.464  24.095  6.518   1.00 19.90 ? 26  GLU A CG   4  
ATOM 7435  C CD   . GLU A 1 26  ? -8.170  25.143  5.462   1.00 20.41 ? 26  GLU A CD   4  
ATOM 7436  O OE1  . GLU A 1 26  ? -7.081  25.092  4.850   1.00 20.64 ? 26  GLU A OE1  4  
ATOM 7437  O OE2  . GLU A 1 26  ? -9.022  26.025  5.249   1.00 20.67 ? 26  GLU A OE2  4  
ATOM 7438  H H    . GLU A 1 26  ? -11.025 23.447  6.351   1.00 19.90 ? 26  GLU A H    4  
ATOM 7439  H HA   . GLU A 1 26  ? -9.479  23.096  4.009   1.00 19.36 ? 26  GLU A HA   4  
ATOM 7440  H HB2  . GLU A 1 26  ? -8.831  22.024  6.759   1.00 19.06 ? 26  GLU A HB2  4  
ATOM 7441  H HB3  . GLU A 1 26  ? -7.697  22.416  5.477   1.00 19.19 ? 26  GLU A HB3  4  
ATOM 7442  H HG2  . GLU A 1 26  ? -9.375  24.368  7.030   1.00 20.16 ? 26  GLU A HG2  4  
ATOM 7443  H HG3  . GLU A 1 26  ? -7.648  24.079  7.224   1.00 19.91 ? 26  GLU A HG3  4  
ATOM 7444  N N    . PRO A 1 27  ? -9.314  20.588  3.528   1.00 17.38 ? 27  PRO A N    4  
ATOM 7445  C CA   . PRO A 1 27  ? -9.348  19.160  3.204   1.00 16.31 ? 27  PRO A CA   4  
ATOM 7446  C C    . PRO A 1 27  ? -8.647  18.328  4.276   1.00 15.58 ? 27  PRO A C    4  
ATOM 7447  O O    . PRO A 1 27  ? -7.491  18.587  4.618   1.00 15.74 ? 27  PRO A O    4  
ATOM 7448  C CB   . PRO A 1 27  ? -8.605  19.069  1.868   1.00 16.33 ? 27  PRO A CB   4  
ATOM 7449  C CG   . PRO A 1 27  ? -7.765  20.299  1.805   1.00 17.43 ? 27  PRO A CG   4  
ATOM 7450  C CD   . PRO A 1 27  ? -8.511  21.359  2.566   1.00 18.02 ? 27  PRO A CD   4  
ATOM 7451  H HA   . PRO A 1 27  ? -10.361 18.805  3.082   1.00 16.18 ? 27  PRO A HA   4  
ATOM 7452  H HB2  . PRO A 1 27  ? -7.999  18.176  1.853   1.00 15.88 ? 27  PRO A HB2  4  
ATOM 7453  H HB3  . PRO A 1 27  ? -9.320  19.038  1.060   1.00 16.16 ? 27  PRO A HB3  4  
ATOM 7454  H HG2  . PRO A 1 27  ? -6.809  20.110  2.268   1.00 17.52 ? 27  PRO A HG2  4  
ATOM 7455  H HG3  . PRO A 1 27  ? -7.632  20.599  0.776   1.00 17.81 ? 27  PRO A HG3  4  
ATOM 7456  H HD2  . PRO A 1 27  ? -7.821  22.015  3.080   1.00 18.21 ? 27  PRO A HD2  4  
ATOM 7457  H HD3  . PRO A 1 27  ? -9.145  21.926  1.900   1.00 18.75 ? 27  PRO A HD3  4  
ATOM 7458  N N    . ALA A 1 28  ? -9.347  17.343  4.819   1.00 14.93 ? 28  ALA A N    4  
ATOM 7459  C CA   . ALA A 1 28  ? -8.805  16.540  5.907   1.00 14.31 ? 28  ALA A CA   4  
ATOM 7460  C C    . ALA A 1 28  ? -8.605  15.096  5.475   1.00 13.28 ? 28  ALA A C    4  
ATOM 7461  O O    . ALA A 1 28  ? -9.550  14.425  5.053   1.00 12.82 ? 28  ALA A O    4  
ATOM 7462  C CB   . ALA A 1 28  ? -9.714  16.596  7.125   1.00 14.27 ? 28  ALA A CB   4  
ATOM 7463  H H    . ALA A 1 28  ? -10.243 17.134  4.465   1.00 14.96 ? 28  ALA A H    4  
ATOM 7464  H HA   . ALA A 1 28  ? -7.847  16.958  6.182   1.00 14.81 ? 28  ALA A HA   4  
ATOM 7465  H HB1  . ALA A 1 28  ? -10.666 16.153  6.880   1.00 14.09 ? 28  ALA A HB1  4  
ATOM 7466  H HB2  . ALA A 1 28  ? -9.860  17.625  7.419   1.00 14.39 ? 28  ALA A HB2  4  
ATOM 7467  H HB3  . ALA A 1 28  ? -9.259  16.049  7.938   1.00 14.46 ? 28  ALA A HB3  4  
ATOM 7468  N N    . PRO A 1 29  ? -7.361  14.609  5.544   1.00 13.06 ? 29  PRO A N    4  
ATOM 7469  C CA   . PRO A 1 29  ? -7.047  13.209  5.273   1.00 12.21 ? 29  PRO A CA   4  
ATOM 7470  C C    . PRO A 1 29  ? -7.624  12.290  6.339   1.00 11.34 ? 29  PRO A C    4  
ATOM 7471  O O    . PRO A 1 29  ? -7.412  12.492  7.535   1.00 11.36 ? 29  PRO A O    4  
ATOM 7472  C CB   . PRO A 1 29  ? -5.512  13.168  5.311   1.00 12.51 ? 29  PRO A CB   4  
ATOM 7473  C CG   . PRO A 1 29  ? -5.078  14.590  5.203   1.00 13.50 ? 29  PRO A CG   4  
ATOM 7474  C CD   . PRO A 1 29  ? -6.159  15.385  5.867   1.00 13.81 ? 29  PRO A CD   4  
ATOM 7475  H HA   . PRO A 1 29  ? -7.399  12.897  4.305   1.00 12.20 ? 29  PRO A HA   4  
ATOM 7476  H HB2  . PRO A 1 29  ? -5.190  12.730  6.244   1.00 12.17 ? 29  PRO A HB2  4  
ATOM 7477  H HB3  . PRO A 1 29  ? -5.141  12.576  4.484   1.00 12.53 ? 29  PRO A HB3  4  
ATOM 7478  H HG2  . PRO A 1 29  ? -4.136  14.729  5.716   1.00 13.63 ? 29  PRO A HG2  4  
ATOM 7479  H HG3  . PRO A 1 29  ? -4.989  14.872  4.165   1.00 13.98 ? 29  PRO A HG3  4  
ATOM 7480  H HD2  . PRO A 1 29  ? -5.995  15.427  6.935   1.00 13.93 ? 29  PRO A HD2  4  
ATOM 7481  H HD3  . PRO A 1 29  ? -6.215  16.378  5.448   1.00 14.55 ? 29  PRO A HD3  4  
ATOM 7482  N N    . ALA A 1 30  ? -8.357  11.282  5.903   1.00 10.76 ? 30  ALA A N    4  
ATOM 7483  C CA   . ALA A 1 30  ? -8.919  10.310  6.821   1.00 10.06 ? 30  ALA A CA   4  
ATOM 7484  C C    . ALA A 1 30  ? -8.555  8.889   6.411   1.00 8.93  ? 30  ALA A C    4  
ATOM 7485  O O    . ALA A 1 30  ? -9.331  8.205   5.742   1.00 8.35  ? 30  ALA A O    4  
ATOM 7486  C CB   . ALA A 1 30  ? -10.430 10.474  6.918   1.00 10.54 ? 30  ALA A CB   4  
ATOM 7487  H H    . ALA A 1 30  ? -8.544  11.201  4.940   1.00 10.95 ? 30  ALA A H    4  
ATOM 7488  H HA   . ALA A 1 30  ? -8.504  10.504  7.799   1.00 10.23 ? 30  ALA A HA   4  
ATOM 7489  H HB1  . ALA A 1 30  ? -10.880 10.218  5.971   1.00 10.55 ? 30  ALA A HB1  4  
ATOM 7490  H HB2  . ALA A 1 30  ? -10.667 11.499  7.166   1.00 10.83 ? 30  ALA A HB2  4  
ATOM 7491  H HB3  . ALA A 1 30  ? -10.813 9.821   7.688   1.00 10.80 ? 30  ALA A HB3  4  
ATOM 7492  N N    . PRO A 1 31  ? -7.339  8.443   6.759   1.00 8.82  ? 31  PRO A N    4  
ATOM 7493  C CA   . PRO A 1 31  ? -6.919  7.053   6.561   1.00 7.95  ? 31  PRO A CA   4  
ATOM 7494  C C    . PRO A 1 31  ? -7.785  6.086   7.364   1.00 6.75  ? 31  PRO A C    4  
ATOM 7495  O O    . PRO A 1 31  ? -7.673  6.006   8.588   1.00 6.83  ? 31  PRO A O    4  
ATOM 7496  C CB   . PRO A 1 31  ? -5.471  7.028   7.077   1.00 8.63  ? 31  PRO A CB   4  
ATOM 7497  C CG   . PRO A 1 31  ? -5.350  8.236   7.948   1.00 9.60  ? 31  PRO A CG   4  
ATOM 7498  C CD   . PRO A 1 31  ? -6.267  9.261   7.351   1.00 9.77  ? 31  PRO A CD   4  
ATOM 7499  H HA   . PRO A 1 31  ? -6.940  6.774   5.518   1.00 7.98  ? 31  PRO A HA   4  
ATOM 7500  H HB2  . PRO A 1 31  ? -5.300  6.120   7.636   1.00 8.18  ? 31  PRO A HB2  4  
ATOM 7501  H HB3  . PRO A 1 31  ? -4.788  7.075   6.242   1.00 9.06  ? 31  PRO A HB3  4  
ATOM 7502  H HG2  . PRO A 1 31  ? -5.658  7.997   8.954   1.00 9.59  ? 31  PRO A HG2  4  
ATOM 7503  H HG3  . PRO A 1 31  ? -4.332  8.595   7.941   1.00 10.36 ? 31  PRO A HG3  4  
ATOM 7504  H HD2  . PRO A 1 31  ? -6.659  9.915   8.115   1.00 9.88  ? 31  PRO A HD2  4  
ATOM 7505  H HD3  . PRO A 1 31  ? -5.751  9.830   6.593   1.00 10.60 ? 31  PRO A HD3  4  
ATOM 7506  N N    . ALA A 1 32  ? -8.671  5.379   6.677   1.00 5.86  ? 32  ALA A N    4  
ATOM 7507  C CA   . ALA A 1 32  ? -9.529  4.409   7.331   1.00 4.75  ? 32  ALA A CA   4  
ATOM 7508  C C    . ALA A 1 32  ? -8.710  3.203   7.760   1.00 3.89  ? 32  ALA A C    4  
ATOM 7509  O O    . ALA A 1 32  ? -7.825  2.766   7.029   1.00 3.98  ? 32  ALA A O    4  
ATOM 7510  C CB   . ALA A 1 32  ? -10.666 3.990   6.409   1.00 4.57  ? 32  ALA A CB   4  
ATOM 7511  H H    . ALA A 1 32  ? -8.742  5.506   5.709   1.00 6.11  ? 32  ALA A H    4  
ATOM 7512  H HA   . ALA A 1 32  ? -9.953  4.879   8.208   1.00 5.11  ? 32  ALA A HA   4  
ATOM 7513  H HB1  . ALA A 1 32  ? -11.237 4.861   6.124   1.00 4.83  ? 32  ALA A HB1  4  
ATOM 7514  H HB2  . ALA A 1 32  ? -11.308 3.290   6.922   1.00 4.63  ? 32  ALA A HB2  4  
ATOM 7515  H HB3  . ALA A 1 32  ? -10.256 3.520   5.525   1.00 4.62  ? 32  ALA A HB3  4  
ATOM 7516  N N    . PRO A 1 33  ? -8.974  2.663   8.954   1.00 3.62  ? 33  PRO A N    4  
ATOM 7517  C CA   . PRO A 1 33  ? -8.220  1.525   9.493   1.00 3.45  ? 33  PRO A CA   4  
ATOM 7518  C C    . PRO A 1 33  ? -8.390  0.254   8.663   1.00 2.48  ? 33  PRO A C    4  
ATOM 7519  O O    . PRO A 1 33  ? -7.508  -0.609  8.641   1.00 3.06  ? 33  PRO A O    4  
ATOM 7520  C CB   . PRO A 1 33  ? -8.817  1.328   10.891  1.00 4.15  ? 33  PRO A CB   4  
ATOM 7521  C CG   . PRO A 1 33  ? -10.155 1.983   10.838  1.00 4.47  ? 33  PRO A CG   4  
ATOM 7522  C CD   . PRO A 1 33  ? -10.014 3.131   9.885   1.00 4.26  ? 33  PRO A CD   4  
ATOM 7523  H HA   . PRO A 1 33  ? -7.169  1.756   9.579   1.00 4.15  ? 33  PRO A HA   4  
ATOM 7524  H HB2  . PRO A 1 33  ? -8.903  0.271   11.098  1.00 4.01  ? 33  PRO A HB2  4  
ATOM 7525  H HB3  . PRO A 1 33  ? -8.177  1.793   11.626  1.00 4.98  ? 33  PRO A HB3  4  
ATOM 7526  H HG2  . PRO A 1 33  ? -10.894 1.284   10.475  1.00 4.40  ? 33  PRO A HG2  4  
ATOM 7527  H HG3  . PRO A 1 33  ? -10.427 2.344   11.818  1.00 5.36  ? 33  PRO A HG3  4  
ATOM 7528  H HD2  . PRO A 1 33  ? -10.944 3.312   9.366   1.00 4.15  ? 33  PRO A HD2  4  
ATOM 7529  H HD3  . PRO A 1 33  ? -9.692  4.017   10.408  1.00 5.11  ? 33  PRO A HD3  4  
ATOM 7530  N N    . GLU A 1 34  ? -9.515  0.162   7.965   1.00 1.57  ? 34  GLU A N    4  
ATOM 7531  C CA   . GLU A 1 34  ? -9.881  -1.042  7.237   1.00 1.27  ? 34  GLU A CA   4  
ATOM 7532  C C    . GLU A 1 34  ? -9.492  -0.937  5.756   1.00 1.08  ? 34  GLU A C    4  
ATOM 7533  O O    . GLU A 1 34  ? -8.615  -1.664  5.287   1.00 1.44  ? 34  GLU A O    4  
ATOM 7534  C CB   . GLU A 1 34  ? -11.385 -1.284  7.397   1.00 2.01  ? 34  GLU A CB   4  
ATOM 7535  C CG   . GLU A 1 34  ? -11.871 -2.603  6.832   1.00 2.68  ? 34  GLU A CG   4  
ATOM 7536  C CD   . GLU A 1 34  ? -13.290 -2.912  7.258   1.00 3.58  ? 34  GLU A CD   4  
ATOM 7537  O OE1  . GLU A 1 34  ? -13.495 -3.335  8.412   1.00 4.13  ? 34  GLU A OE1  4  
ATOM 7538  O OE2  . GLU A 1 34  ? -14.213 -2.727  6.435   1.00 4.13  ? 34  GLU A OE2  4  
ATOM 7539  H H    . GLU A 1 34  ? -10.114 0.934   7.934   1.00 1.90  ? 34  GLU A H    4  
ATOM 7540  H HA   . GLU A 1 34  ? -9.345  -1.870  7.677   1.00 1.85  ? 34  GLU A HA   4  
ATOM 7541  H HB2  . GLU A 1 34  ? -11.630 -1.258  8.449   1.00 2.33  ? 34  GLU A HB2  4  
ATOM 7542  H HB3  . GLU A 1 34  ? -11.917 -0.486  6.898   1.00 2.63  ? 34  GLU A HB3  4  
ATOM 7543  H HG2  . GLU A 1 34  ? -11.834 -2.555  5.754   1.00 3.03  ? 34  GLU A HG2  4  
ATOM 7544  H HG3  . GLU A 1 34  ? -11.223 -3.393  7.180   1.00 2.92  ? 34  GLU A HG3  4  
ATOM 7545  N N    . GLU A 1 35  ? -10.135 -0.021  5.039   1.00 1.01  ? 35  GLU A N    4  
ATOM 7546  C CA   . GLU A 1 35  ? -9.872  0.183   3.617   1.00 0.87  ? 35  GLU A CA   4  
ATOM 7547  C C    . GLU A 1 35  ? -9.115  1.488   3.417   1.00 0.73  ? 35  GLU A C    4  
ATOM 7548  O O    . GLU A 1 35  ? -9.603  2.555   3.785   1.00 0.89  ? 35  GLU A O    4  
ATOM 7549  C CB   . GLU A 1 35  ? -11.194 0.207   2.843   1.00 1.09  ? 35  GLU A CB   4  
ATOM 7550  C CG   . GLU A 1 35  ? -11.991 -1.084  2.966   1.00 1.72  ? 35  GLU A CG   4  
ATOM 7551  C CD   . GLU A 1 35  ? -11.279 -2.271  2.348   1.00 1.94  ? 35  GLU A CD   4  
ATOM 7552  O OE1  . GLU A 1 35  ? -10.507 -2.951  3.052   1.00 2.36  ? 35  GLU A OE1  4  
ATOM 7553  O OE2  . GLU A 1 35  ? -11.471 -2.513  1.140   1.00 2.45  ? 35  GLU A OE2  4  
ATOM 7554  H H    . GLU A 1 35  ? -10.799 0.546   5.479   1.00 1.36  ? 35  GLU A H    4  
ATOM 7555  H HA   . GLU A 1 35  ? -9.264  -0.635  3.260   1.00 0.87  ? 35  GLU A HA   4  
ATOM 7556  H HB2  . GLU A 1 35  ? -11.802 1.016   3.221   1.00 1.33  ? 35  GLU A HB2  4  
ATOM 7557  H HB3  . GLU A 1 35  ? -10.986 0.380   1.797   1.00 1.44  ? 35  GLU A HB3  4  
ATOM 7558  H HG2  . GLU A 1 35  ? -12.158 -1.290  4.012   1.00 2.41  ? 35  GLU A HG2  4  
ATOM 7559  H HG3  . GLU A 1 35  ? -12.939 -0.953  2.469   1.00 2.23  ? 35  GLU A HG3  4  
ATOM 7560  N N    . TRP A 1 36  ? -7.919  1.403   2.843   1.00 0.53  ? 36  TRP A N    4  
ATOM 7561  C CA   . TRP A 1 36  ? -7.026  2.556   2.791   1.00 0.45  ? 36  TRP A CA   4  
ATOM 7562  C C    . TRP A 1 36  ? -6.895  3.118   1.380   1.00 0.46  ? 36  TRP A C    4  
ATOM 7563  O O    . TRP A 1 36  ? -7.664  2.783   0.479   1.00 0.52  ? 36  TRP A O    4  
ATOM 7564  C CB   . TRP A 1 36  ? -5.628  2.181   3.288   1.00 0.38  ? 36  TRP A CB   4  
ATOM 7565  C CG   . TRP A 1 36  ? -5.599  1.055   4.270   1.00 0.34  ? 36  TRP A CG   4  
ATOM 7566  C CD1  . TRP A 1 36  ? -6.431  0.852   5.333   1.00 0.39  ? 36  TRP A CD1  4  
ATOM 7567  C CD2  . TRP A 1 36  ? -4.661  -0.017  4.291   1.00 0.27  ? 36  TRP A CD2  4  
ATOM 7568  N NE1  . TRP A 1 36  ? -6.079  -0.295  5.998   1.00 0.36  ? 36  TRP A NE1  4  
ATOM 7569  C CE2  . TRP A 1 36  ? -4.990  -0.841  5.381   1.00 0.28  ? 36  TRP A CE2  4  
ATOM 7570  C CE3  . TRP A 1 36  ? -3.572  -0.362  3.489   1.00 0.21  ? 36  TRP A CE3  4  
ATOM 7571  C CZ2  . TRP A 1 36  ? -4.277  -1.990  5.684   1.00 0.24  ? 36  TRP A CZ2  4  
ATOM 7572  C CZ3  . TRP A 1 36  ? -2.868  -1.495  3.798   1.00 0.17  ? 36  TRP A CZ3  4  
ATOM 7573  C CH2  . TRP A 1 36  ? -3.217  -2.296  4.884   1.00 0.19  ? 36  TRP A CH2  4  
ATOM 7574  H H    . TRP A 1 36  ? -7.633  0.552   2.455   1.00 0.51  ? 36  TRP A H    4  
ATOM 7575  H HA   . TRP A 1 36  ? -7.432  3.322   3.436   1.00 0.53  ? 36  TRP A HA   4  
ATOM 7576  H HB2  . TRP A 1 36  ? -5.021  1.894   2.441   1.00 0.38  ? 36  TRP A HB2  4  
ATOM 7577  H HB3  . TRP A 1 36  ? -5.183  3.045   3.760   1.00 0.44  ? 36  TRP A HB3  4  
ATOM 7578  H HD1  . TRP A 1 36  ? -7.255  1.501   5.592   1.00 0.46  ? 36  TRP A HD1  4  
ATOM 7579  H HE1  . TRP A 1 36  ? -6.536  -0.660  6.789   1.00 0.39  ? 36  TRP A HE1  4  
ATOM 7580  H HE3  . TRP A 1 36  ? -3.269  0.242   2.640   1.00 0.21  ? 36  TRP A HE3  4  
ATOM 7581  H HZ2  . TRP A 1 36  ? -4.533  -2.616  6.524   1.00 0.27  ? 36  TRP A HZ2  4  
ATOM 7582  H HZ3  . TRP A 1 36  ? -2.022  -1.772  3.189   1.00 0.16  ? 36  TRP A HZ3  4  
ATOM 7583  H HH2  . TRP A 1 36  ? -2.627  -3.181  5.078   1.00 0.19  ? 36  TRP A HH2  4  
ATOM 7584  N N    . LEU A 1 37  ? -5.882  3.963   1.210   1.00 0.43  ? 37  LEU A N    4  
ATOM 7585  C CA   . LEU A 1 37  ? -5.609  4.639   -0.051  1.00 0.42  ? 37  LEU A CA   4  
ATOM 7586  C C    . LEU A 1 37  ? -4.932  3.706   -1.040  1.00 0.37  ? 37  LEU A C    4  
ATOM 7587  O O    . LEU A 1 37  ? -3.886  3.130   -0.742  1.00 0.35  ? 37  LEU A O    4  
ATOM 7588  C CB   . LEU A 1 37  ? -4.694  5.838   0.197   1.00 0.45  ? 37  LEU A CB   4  
ATOM 7589  C CG   . LEU A 1 37  ? -4.378  6.687   -1.037  1.00 0.46  ? 37  LEU A CG   4  
ATOM 7590  C CD1  . LEU A 1 37  ? -5.630  7.367   -1.560  1.00 0.49  ? 37  LEU A CD1  4  
ATOM 7591  C CD2  . LEU A 1 37  ? -3.310  7.720   -0.720  1.00 0.50  ? 37  LEU A CD2  4  
ATOM 7592  H H    . LEU A 1 37  ? -5.287  4.138   1.970   1.00 0.43  ? 37  LEU A H    4  
ATOM 7593  H HA   . LEU A 1 37  ? -6.545  4.984   -0.466  1.00 0.46  ? 37  LEU A HA   4  
ATOM 7594  H HB2  . LEU A 1 37  ? -5.157  6.466   0.933   1.00 0.51  ? 37  LEU A HB2  4  
ATOM 7595  H HB3  . LEU A 1 37  ? -3.759  5.473   0.601   1.00 0.45  ? 37  LEU A HB3  4  
ATOM 7596  H HG   . LEU A 1 37  ? -4.000  6.046   -1.816  1.00 0.43  ? 37  LEU A HG   4  
ATOM 7597  H HD11 . LEU A 1 37  ? -6.054  7.984   -0.782  1.00 1.11  ? 37  LEU A HD11 4  
ATOM 7598  H HD12 . LEU A 1 37  ? -6.348  6.618   -1.861  1.00 1.17  ? 37  LEU A HD12 4  
ATOM 7599  H HD13 . LEU A 1 37  ? -5.373  7.984   -2.409  1.00 1.09  ? 37  LEU A HD13 4  
ATOM 7600  H HD21 . LEU A 1 37  ? -2.406  7.219   -0.406  1.00 1.16  ? 37  LEU A HD21 4  
ATOM 7601  H HD22 . LEU A 1 37  ? -3.659  8.365   0.072   1.00 1.19  ? 37  LEU A HD22 4  
ATOM 7602  H HD23 . LEU A 1 37  ? -3.108  8.308   -1.603  1.00 1.05  ? 37  LEU A HD23 4  
ATOM 7603  N N    . ASP A 1 38  ? -5.523  3.575   -2.215  1.00 0.38  ? 38  ASP A N    4  
ATOM 7604  C CA   . ASP A 1 38  ? -4.930  2.777   -3.275  1.00 0.41  ? 38  ASP A CA   4  
ATOM 7605  C C    . ASP A 1 38  ? -3.796  3.519   -3.946  1.00 0.39  ? 38  ASP A C    4  
ATOM 7606  O O    . ASP A 1 38  ? -3.973  4.628   -4.450  1.00 0.44  ? 38  ASP A O    4  
ATOM 7607  C CB   . ASP A 1 38  ? -5.964  2.395   -4.321  1.00 0.56  ? 38  ASP A CB   4  
ATOM 7608  C CG   . ASP A 1 38  ? -6.271  0.926   -4.303  1.00 1.78  ? 38  ASP A CG   4  
ATOM 7609  O OD1  . ASP A 1 38  ? -5.474  0.142   -4.851  1.00 2.14  ? 38  ASP A OD1  4  
ATOM 7610  O OD2  . ASP A 1 38  ? -7.315  0.553   -3.725  1.00 2.51  ? 38  ASP A OD2  4  
ATOM 7611  H H    . ASP A 1 38  ? -6.378  4.027   -2.375  1.00 0.43  ? 38  ASP A H    4  
ATOM 7612  H HA   . ASP A 1 38  ? -4.537  1.875   -2.828  1.00 0.44  ? 38  ASP A HA   4  
ATOM 7613  H HB2  . ASP A 1 38  ? -6.876  2.941   -4.140  1.00 0.96  ? 38  ASP A HB2  4  
ATOM 7614  H HB3  . ASP A 1 38  ? -5.581  2.644   -5.302  1.00 0.85  ? 38  ASP A HB3  4  
ATOM 7615  N N    . ILE A 1 39  ? -2.633  2.895   -3.948  1.00 0.38  ? 39  ILE A N    4  
ATOM 7616  C CA   . ILE A 1 39  ? -1.460  3.443   -4.600  1.00 0.38  ? 39  ILE A CA   4  
ATOM 7617  C C    . ILE A 1 39  ? -1.686  3.583   -6.102  1.00 0.39  ? 39  ILE A C    4  
ATOM 7618  O O    . ILE A 1 39  ? -1.311  4.587   -6.702  1.00 0.46  ? 39  ILE A O    4  
ATOM 7619  C CB   . ILE A 1 39  ? -0.227  2.553   -4.330  1.00 0.39  ? 39  ILE A CB   4  
ATOM 7620  C CG1  . ILE A 1 39  ? -0.041  2.394   -2.815  1.00 0.40  ? 39  ILE A CG1  4  
ATOM 7621  C CG2  . ILE A 1 39  ? 1.018   3.130   -4.990  1.00 0.41  ? 39  ILE A CG2  4  
ATOM 7622  C CD1  . ILE A 1 39  ? 1.325   1.880   -2.401  1.00 0.43  ? 39  ILE A CD1  4  
ATOM 7623  H H    . ILE A 1 39  ? -2.555  2.038   -3.474  1.00 0.43  ? 39  ILE A H    4  
ATOM 7624  H HA   . ILE A 1 39  ? -1.272  4.420   -4.182  1.00 0.40  ? 39  ILE A HA   4  
ATOM 7625  H HB   . ILE A 1 39  ? -0.412  1.584   -4.764  1.00 0.42  ? 39  ILE A HB   4  
ATOM 7626  H HG12 . ILE A 1 39  ? -0.205  3.344   -2.339  1.00 0.38  ? 39  ILE A HG12 4  
ATOM 7627  H HG13 . ILE A 1 39  ? -0.778  1.692   -2.452  1.00 0.45  ? 39  ILE A HG13 4  
ATOM 7628  H HG21 . ILE A 1 39  ? 0.868   3.175   -6.058  1.00 1.04  ? 39  ILE A HG21 4  
ATOM 7629  H HG22 . ILE A 1 39  ? 1.867   2.497   -4.771  1.00 1.05  ? 39  ILE A HG22 4  
ATOM 7630  H HG23 . ILE A 1 39  ? 1.200   4.124   -4.610  1.00 0.96  ? 39  ILE A HG23 4  
ATOM 7631  H HD11 . ILE A 1 39  ? 1.493   0.908   -2.841  1.00 1.14  ? 39  ILE A HD11 4  
ATOM 7632  H HD12 . ILE A 1 39  ? 1.365   1.798   -1.323  1.00 1.00  ? 39  ILE A HD12 4  
ATOM 7633  H HD13 . ILE A 1 39  ? 2.088   2.565   -2.737  1.00 1.15  ? 39  ILE A HD13 4  
ATOM 7634  N N    . LEU A 1 40  ? -2.320  2.584   -6.703  1.00 0.39  ? 40  LEU A N    4  
ATOM 7635  C CA   . LEU A 1 40  ? -2.574  2.610   -8.137  1.00 0.49  ? 40  LEU A CA   4  
ATOM 7636  C C    . LEU A 1 40  ? -4.062  2.718   -8.436  1.00 0.49  ? 40  LEU A C    4  
ATOM 7637  O O    . LEU A 1 40  ? -4.470  2.750   -9.597  1.00 0.62  ? 40  LEU A O    4  
ATOM 7638  C CB   . LEU A 1 40  ? -1.984  1.369   -8.802  1.00 0.56  ? 40  LEU A CB   4  
ATOM 7639  C CG   . LEU A 1 40  ? -0.467  1.209   -8.658  1.00 0.59  ? 40  LEU A CG   4  
ATOM 7640  C CD1  . LEU A 1 40  ? -0.008  -0.065  -9.347  1.00 0.62  ? 40  LEU A CD1  4  
ATOM 7641  C CD2  . LEU A 1 40  ? 0.259   2.416   -9.239  1.00 0.72  ? 40  LEU A CD2  4  
ATOM 7642  H H    . LEU A 1 40  ? -2.614  1.815   -6.175  1.00 0.39  ? 40  LEU A H    4  
ATOM 7643  H HA   . LEU A 1 40  ? -2.087  3.479   -8.535  1.00 0.60  ? 40  LEU A HA   4  
ATOM 7644  H HB2  . LEU A 1 40  ? -2.459  0.500   -8.373  1.00 0.66  ? 40  LEU A HB2  4  
ATOM 7645  H HB3  . LEU A 1 40  ? -2.220  1.402   -9.856  1.00 0.72  ? 40  LEU A HB3  4  
ATOM 7646  H HG   . LEU A 1 40  ? -0.214  1.135   -7.608  1.00 0.82  ? 40  LEU A HG   4  
ATOM 7647  H HD11 . LEU A 1 40  ? 1.066   -0.160  -9.254  1.00 1.21  ? 40  LEU A HD11 4  
ATOM 7648  H HD12 . LEU A 1 40  ? -0.276  -0.026  -10.392 1.00 1.27  ? 40  LEU A HD12 4  
ATOM 7649  H HD13 . LEU A 1 40  ? -0.486  -0.917  -8.885  1.00 1.08  ? 40  LEU A HD13 4  
ATOM 7650  H HD21 . LEU A 1 40  ? -0.050  3.310   -8.717  1.00 1.43  ? 40  LEU A HD21 4  
ATOM 7651  H HD22 . LEU A 1 40  ? 0.015   2.509   -10.288 1.00 1.27  ? 40  LEU A HD22 4  
ATOM 7652  H HD23 . LEU A 1 40  ? 1.325   2.283   -9.128  1.00 1.06  ? 40  LEU A HD23 4  
ATOM 7653  N N    . GLY A 1 41  ? -4.869  2.784   -7.384  1.00 0.43  ? 41  GLY A N    4  
ATOM 7654  C CA   . GLY A 1 41  ? -6.308  2.863   -7.552  1.00 0.51  ? 41  GLY A CA   4  
ATOM 7655  C C    . GLY A 1 41  ? -6.870  1.574   -8.099  1.00 0.45  ? 41  GLY A C    4  
ATOM 7656  O O    . GLY A 1 41  ? -7.922  1.555   -8.736  1.00 0.52  ? 41  GLY A O    4  
ATOM 7657  H H    . GLY A 1 41  ? -4.484  2.779   -6.486  1.00 0.38  ? 41  GLY A H    4  
ATOM 7658  H HA2  . GLY A 1 41  ? -6.764  3.068   -6.595  1.00 0.54  ? 41  GLY A HA2  4  
ATOM 7659  H HA3  . GLY A 1 41  ? -6.539  3.666   -8.233  1.00 0.65  ? 41  GLY A HA3  4  
ATOM 7660  N N    . ASN A 1 42  ? -6.140  0.493   -7.868  1.00 0.39  ? 42  ASN A N    4  
ATOM 7661  C CA   . ASN A 1 42  ? -6.531  -0.814  -8.384  1.00 0.42  ? 42  ASN A CA   4  
ATOM 7662  C C    . ASN A 1 42  ? -7.273  -1.673  -7.355  1.00 0.43  ? 42  ASN A C    4  
ATOM 7663  O O    . ASN A 1 42  ? -8.033  -2.561  -7.725  1.00 0.56  ? 42  ASN A O    4  
ATOM 7664  C CB   . ASN A 1 42  ? -5.319  -1.570  -8.947  1.00 0.49  ? 42  ASN A CB   4  
ATOM 7665  C CG   . ASN A 1 42  ? -4.051  -1.502  -8.099  1.00 0.55  ? 42  ASN A CG   4  
ATOM 7666  O OD1  . ASN A 1 42  ? -2.952  -1.608  -8.629  1.00 0.95  ? 42  ASN A OD1  4  
ATOM 7667  N ND2  . ASN A 1 42  ? -4.172  -1.311  -6.796  1.00 0.44  ? 42  ASN A ND2  4  
ATOM 7668  H H    . ASN A 1 42  ? -5.300  0.587   -7.362  1.00 0.39  ? 42  ASN A H    4  
ATOM 7669  H HA   . ASN A 1 42  ? -7.212  -0.630  -9.203  1.00 0.49  ? 42  ASN A HA   4  
ATOM 7670  H HB2  . ASN A 1 42  ? -5.586  -2.605  -9.060  1.00 0.69  ? 42  ASN A HB2  4  
ATOM 7671  H HB3  . ASN A 1 42  ? -5.087  -1.161  -9.919  1.00 0.57  ? 42  ASN A HB3  4  
ATOM 7672  H HD21 . ASN A 1 42  ? -5.071  -1.217  -6.418  1.00 0.54  ? 42  ASN A HD21 4  
ATOM 7673  H HD22 . ASN A 1 42  ? -3.352  -1.262  -6.262  1.00 0.56  ? 42  ASN A HD22 4  
ATOM 7674  N N    . GLY A 1 43  ? -7.048  -1.416  -6.077  1.00 0.40  ? 43  GLY A N    4  
ATOM 7675  C CA   . GLY A 1 43  ? -7.735  -2.149  -5.027  1.00 0.50  ? 43  GLY A CA   4  
ATOM 7676  C C    . GLY A 1 43  ? -6.858  -3.207  -4.395  1.00 0.45  ? 43  GLY A C    4  
ATOM 7677  O O    . GLY A 1 43  ? -7.121  -3.668  -3.286  1.00 0.72  ? 43  GLY A O    4  
ATOM 7678  H H    . GLY A 1 43  ? -6.400  -0.709  -5.827  1.00 0.39  ? 43  GLY A H    4  
ATOM 7679  H HA2  . GLY A 1 43  ? -8.040  -1.450  -4.260  1.00 0.60  ? 43  GLY A HA2  4  
ATOM 7680  H HA3  . GLY A 1 43  ? -8.613  -2.621  -5.441  1.00 0.58  ? 43  GLY A HA3  4  
ATOM 7681  N N    . LEU A 1 44  ? -5.805  -3.585  -5.102  1.00 0.29  ? 44  LEU A N    4  
ATOM 7682  C CA   . LEU A 1 44  ? -4.908  -4.631  -4.635  1.00 0.36  ? 44  LEU A CA   4  
ATOM 7683  C C    . LEU A 1 44  ? -3.782  -4.035  -3.804  1.00 0.25  ? 44  LEU A C    4  
ATOM 7684  O O    . LEU A 1 44  ? -3.228  -4.695  -2.929  1.00 0.27  ? 44  LEU A O    4  
ATOM 7685  C CB   . LEU A 1 44  ? -4.302  -5.417  -5.820  1.00 0.60  ? 44  LEU A CB   4  
ATOM 7686  C CG   . LEU A 1 44  ? -5.281  -6.234  -6.674  1.00 0.51  ? 44  LEU A CG   4  
ATOM 7687  C CD1  . LEU A 1 44  ? -6.091  -7.178  -5.803  1.00 1.46  ? 44  LEU A CD1  4  
ATOM 7688  C CD2  . LEU A 1 44  ? -6.191  -5.324  -7.493  1.00 1.56  ? 44  LEU A CD2  4  
ATOM 7689  H H    . LEU A 1 44  ? -5.626  -3.150  -5.961  1.00 0.39  ? 44  LEU A H    4  
ATOM 7690  H HA   . LEU A 1 44  ? -5.478  -5.308  -4.018  1.00 0.47  ? 44  LEU A HA   4  
ATOM 7691  H HB2  . LEU A 1 44  ? -3.803  -4.713  -6.472  1.00 1.23  ? 44  LEU A HB2  4  
ATOM 7692  H HB3  . LEU A 1 44  ? -3.559  -6.092  -5.424  1.00 1.12  ? 44  LEU A HB3  4  
ATOM 7693  H HG   . LEU A 1 44  ? -4.711  -6.841  -7.366  1.00 0.99  ? 44  LEU A HG   4  
ATOM 7694  H HD11 . LEU A 1 44  ? -6.652  -6.606  -5.078  1.00 1.90  ? 44  LEU A HD11 4  
ATOM 7695  H HD12 . LEU A 1 44  ? -5.421  -7.852  -5.291  1.00 2.02  ? 44  LEU A HD12 4  
ATOM 7696  H HD13 . LEU A 1 44  ? -6.770  -7.746  -6.421  1.00 2.09  ? 44  LEU A HD13 4  
ATOM 7697  H HD21 . LEU A 1 44  ? -6.864  -5.926  -8.084  1.00 2.16  ? 44  LEU A HD21 4  
ATOM 7698  H HD22 . LEU A 1 44  ? -5.590  -4.708  -8.145  1.00 1.97  ? 44  LEU A HD22 4  
ATOM 7699  H HD23 . LEU A 1 44  ? -6.763  -4.694  -6.827  1.00 2.15  ? 44  LEU A HD23 4  
ATOM 7700  N N    . LEU A 1 45  ? -3.435  -2.794  -4.109  1.00 0.23  ? 45  LEU A N    4  
ATOM 7701  C CA   . LEU A 1 45  ? -2.268  -2.154  -3.527  1.00 0.22  ? 45  LEU A CA   4  
ATOM 7702  C C    . LEU A 1 45  ? -2.632  -0.853  -2.803  1.00 0.22  ? 45  LEU A C    4  
ATOM 7703  O O    . LEU A 1 45  ? -2.955  0.148   -3.442  1.00 0.32  ? 45  LEU A O    4  
ATOM 7704  C CB   . LEU A 1 45  ? -1.251  -1.916  -4.634  1.00 0.30  ? 45  LEU A CB   4  
ATOM 7705  C CG   . LEU A 1 45  ? -0.104  -0.977  -4.286  1.00 0.26  ? 45  LEU A CG   4  
ATOM 7706  C CD1  . LEU A 1 45  ? 0.647   -1.485  -3.068  1.00 0.28  ? 45  LEU A CD1  4  
ATOM 7707  C CD2  . LEU A 1 45  ? 0.825   -0.832  -5.477  1.00 0.31  ? 45  LEU A CD2  4  
ATOM 7708  H H    . LEU A 1 45  ? -4.006  -2.278  -4.719  1.00 0.26  ? 45  LEU A H    4  
ATOM 7709  H HA   . LEU A 1 45  ? -1.843  -2.839  -2.808  1.00 0.22  ? 45  LEU A HA   4  
ATOM 7710  H HB2  . LEU A 1 45  ? -0.832  -2.871  -4.911  1.00 0.43  ? 45  LEU A HB2  4  
ATOM 7711  H HB3  . LEU A 1 45  ? -1.769  -1.518  -5.489  1.00 0.42  ? 45  LEU A HB3  4  
ATOM 7712  H HG   . LEU A 1 45  ? -0.504  -0.003  -4.052  1.00 0.29  ? 45  LEU A HG   4  
ATOM 7713  H HD11 . LEU A 1 45  ? 1.441   -0.796  -2.825  1.00 1.00  ? 45  LEU A HD11 4  
ATOM 7714  H HD12 . LEU A 1 45  ? 1.066   -2.457  -3.283  1.00 1.01  ? 45  LEU A HD12 4  
ATOM 7715  H HD13 . LEU A 1 45  ? -0.036  -1.563  -2.231  1.00 1.12  ? 45  LEU A HD13 4  
ATOM 7716  H HD21 . LEU A 1 45  ? 1.223   -1.801  -5.738  1.00 0.96  ? 45  LEU A HD21 4  
ATOM 7717  H HD22 . LEU A 1 45  ? 1.634   -0.164  -5.222  1.00 1.12  ? 45  LEU A HD22 4  
ATOM 7718  H HD23 . LEU A 1 45  ? 0.271   -0.429  -6.314  1.00 1.10  ? 45  LEU A HD23 4  
ATOM 7719  N N    . ARG A 1 46  ? -2.556  -0.867  -1.472  1.00 0.20  ? 46  ARG A N    4  
ATOM 7720  C CA   . ARG A 1 46  ? -3.006  0.270   -0.661  1.00 0.22  ? 46  ARG A CA   4  
ATOM 7721  C C    . ARG A 1 46  ? -2.062  0.550   0.503   1.00 0.19  ? 46  ARG A C    4  
ATOM 7722  O O    . ARG A 1 46  ? -1.582  -0.375  1.151   1.00 0.19  ? 46  ARG A O    4  
ATOM 7723  C CB   . ARG A 1 46  ? -4.406  -0.021  -0.139  1.00 0.25  ? 46  ARG A CB   4  
ATOM 7724  C CG   . ARG A 1 46  ? -5.373  -0.360  -1.260  1.00 0.36  ? 46  ARG A CG   4  
ATOM 7725  C CD   . ARG A 1 46  ? -6.773  -0.627  -0.762  1.00 0.37  ? 46  ARG A CD   4  
ATOM 7726  N NE   . ARG A 1 46  ? -6.798  -1.652  0.276   1.00 0.54  ? 46  ARG A NE   4  
ATOM 7727  C CZ   . ARG A 1 46  ? -7.917  -2.131  0.801   1.00 0.75  ? 46  ARG A CZ   4  
ATOM 7728  N NH1  . ARG A 1 46  ? -9.088  -1.758  0.304   1.00 1.14  ? 46  ARG A NH1  4  
ATOM 7729  N NH2  . ARG A 1 46  ? -7.869  -3.004  1.803   1.00 0.99  ? 46  ARG A NH2  4  
ATOM 7730  H H    . ARG A 1 46  ? -2.198  -1.665  -1.022  1.00 0.20  ? 46  ARG A H    4  
ATOM 7731  H HA   . ARG A 1 46  ? -3.048  1.147   -1.293  1.00 0.25  ? 46  ARG A HA   4  
ATOM 7732  H HB2  . ARG A 1 46  ? -4.357  -0.857  0.544   1.00 0.30  ? 46  ARG A HB2  4  
ATOM 7733  H HB3  . ARG A 1 46  ? -4.774  0.846   0.388   1.00 0.35  ? 46  ARG A HB3  4  
ATOM 7734  H HG2  . ARG A 1 46  ? -5.403  0.467   -1.947  1.00 0.50  ? 46  ARG A HG2  4  
ATOM 7735  H HG3  . ARG A 1 46  ? -5.011  -1.237  -1.774  1.00 0.49  ? 46  ARG A HG3  4  
ATOM 7736  H HD2  . ARG A 1 46  ? -7.181  0.289   -0.367  1.00 0.47  ? 46  ARG A HD2  4  
ATOM 7737  H HD3  . ARG A 1 46  ? -7.378  -0.959  -1.594  1.00 0.51  ? 46  ARG A HD3  4  
ATOM 7738  H HE   . ARG A 1 46  ? -5.934  -1.982  0.606   1.00 0.87  ? 46  ARG A HE   4  
ATOM 7739  H HH11 . ARG A 1 46  ? -9.128  -1.115  -0.462  1.00 1.24  ? 46  ARG A HH11 4  
ATOM 7740  H HH12 . ARG A 1 46  ? -9.950  -2.136  0.685   1.00 1.49  ? 46  ARG A HH12 4  
ATOM 7741  H HH21 . ARG A 1 46  ? -6.987  -3.311  2.162   1.00 1.18  ? 46  ARG A HH21 4  
ATOM 7742  H HH22 . ARG A 1 46  ? -8.725  -3.344  2.219   1.00 1.21  ? 46  ARG A HH22 4  
ATOM 7743  N N    . LYS A 1 47  ? -1.832  1.830   0.776   1.00 0.20  ? 47  LYS A N    4  
ATOM 7744  C CA   . LYS A 1 47  ? -0.897  2.267   1.809   1.00 0.17  ? 47  LYS A CA   4  
ATOM 7745  C C    . LYS A 1 47  ? -1.655  2.952   2.951   1.00 0.18  ? 47  LYS A C    4  
ATOM 7746  O O    . LYS A 1 47  ? -2.385  3.918   2.721   1.00 0.22  ? 47  LYS A O    4  
ATOM 7747  C CB   . LYS A 1 47  ? 0.103   3.260   1.189   1.00 0.23  ? 47  LYS A CB   4  
ATOM 7748  C CG   . LYS A 1 47  ? 1.430   3.361   1.924   1.00 0.25  ? 47  LYS A CG   4  
ATOM 7749  C CD   . LYS A 1 47  ? 2.149   4.668   1.625   1.00 0.32  ? 47  LYS A CD   4  
ATOM 7750  C CE   . LYS A 1 47  ? 1.558   5.834   2.419   1.00 0.20  ? 47  LYS A CE   4  
ATOM 7751  N NZ   . LYS A 1 47  ? 2.544   6.932   2.658   1.00 0.35  ? 47  LYS A NZ   4  
ATOM 7752  H H    . LYS A 1 47  ? -2.319  2.511   0.270   1.00 0.22  ? 47  LYS A H    4  
ATOM 7753  H HA   . LYS A 1 47  ? -0.367  1.406   2.191   1.00 0.15  ? 47  LYS A HA   4  
ATOM 7754  H HB2  . LYS A 1 47  ? 0.308   2.958   0.173   1.00 0.31  ? 47  LYS A HB2  4  
ATOM 7755  H HB3  . LYS A 1 47  ? -0.347  4.239   1.176   1.00 0.27  ? 47  LYS A HB3  4  
ATOM 7756  H HG2  . LYS A 1 47  ? 1.255   3.296   2.985   1.00 0.25  ? 47  LYS A HG2  4  
ATOM 7757  H HG3  . LYS A 1 47  ? 2.068   2.544   1.611   1.00 0.31  ? 47  LYS A HG3  4  
ATOM 7758  H HD2  . LYS A 1 47  ? 3.188   4.551   1.875   1.00 0.45  ? 47  LYS A HD2  4  
ATOM 7759  H HD3  . LYS A 1 47  ? 2.055   4.880   0.571   1.00 0.45  ? 47  LYS A HD3  4  
ATOM 7760  H HE2  . LYS A 1 47  ? 0.718   6.238   1.870   1.00 0.39  ? 47  LYS A HE2  4  
ATOM 7761  H HE3  . LYS A 1 47  ? 1.212   5.459   3.371   1.00 0.35  ? 47  LYS A HE3  4  
ATOM 7762  H HZ1  . LYS A 1 47  ? 2.060   7.773   3.032   1.00 1.00  ? 47  LYS A HZ1  4  
ATOM 7763  H HZ2  . LYS A 1 47  ? 3.028   7.189   1.774   1.00 1.12  ? 47  LYS A HZ2  4  
ATOM 7764  H HZ3  . LYS A 1 47  ? 3.264   6.631   3.362   1.00 1.03  ? 47  LYS A HZ3  4  
ATOM 7765  N N    . LYS A 1 48  ? -1.489  2.453   4.172   1.00 0.16  ? 48  LYS A N    4  
ATOM 7766  C CA   . LYS A 1 48  ? -2.116  3.066   5.344   1.00 0.18  ? 48  LYS A CA   4  
ATOM 7767  C C    . LYS A 1 48  ? -1.071  3.731   6.227   1.00 0.17  ? 48  LYS A C    4  
ATOM 7768  O O    . LYS A 1 48  ? -0.226  3.059   6.818   1.00 0.22  ? 48  LYS A O    4  
ATOM 7769  C CB   . LYS A 1 48  ? -2.885  2.022   6.159   1.00 0.25  ? 48  LYS A CB   4  
ATOM 7770  C CG   . LYS A 1 48  ? -3.502  2.565   7.441   1.00 0.32  ? 48  LYS A CG   4  
ATOM 7771  C CD   . LYS A 1 48  ? -4.238  1.480   8.215   1.00 0.69  ? 48  LYS A CD   4  
ATOM 7772  C CE   . LYS A 1 48  ? -3.335  0.290   8.506   1.00 0.52  ? 48  LYS A CE   4  
ATOM 7773  N NZ   . LYS A 1 48  ? -4.044  -0.789  9.245   1.00 1.07  ? 48  LYS A NZ   4  
ATOM 7774  H H    . LYS A 1 48  ? -0.943  1.641   4.290   1.00 0.15  ? 48  LYS A H    4  
ATOM 7775  H HA   . LYS A 1 48  ? -2.808  3.818   4.994   1.00 0.21  ? 48  LYS A HA   4  
ATOM 7776  H HB2  . LYS A 1 48  ? -3.680  1.622   5.547   1.00 0.30  ? 48  LYS A HB2  4  
ATOM 7777  H HB3  . LYS A 1 48  ? -2.211  1.220   6.422   1.00 0.28  ? 48  LYS A HB3  4  
ATOM 7778  H HG2  . LYS A 1 48  ? -2.715  2.965   8.061   1.00 0.51  ? 48  LYS A HG2  4  
ATOM 7779  H HG3  . LYS A 1 48  ? -4.199  3.351   7.188   1.00 0.53  ? 48  LYS A HG3  4  
ATOM 7780  H HD2  . LYS A 1 48  ? -4.583  1.894   9.151   1.00 1.29  ? 48  LYS A HD2  4  
ATOM 7781  H HD3  . LYS A 1 48  ? -5.085  1.147   7.632   1.00 1.29  ? 48  LYS A HD3  4  
ATOM 7782  H HE2  . LYS A 1 48  ? -2.970  -0.104  7.571   1.00 1.14  ? 48  LYS A HE2  4  
ATOM 7783  H HE3  . LYS A 1 48  ? -2.497  0.627   9.099   1.00 0.96  ? 48  LYS A HE3  4  
ATOM 7784  H HZ1  . LYS A 1 48  ? -5.006  -0.917  8.871   1.00 1.56  ? 48  LYS A HZ1  4  
ATOM 7785  H HZ2  . LYS A 1 48  ? -4.100  -0.549  10.261  1.00 1.60  ? 48  LYS A HZ2  4  
ATOM 7786  H HZ3  . LYS A 1 48  ? -3.523  -1.686  9.150   1.00 1.65  ? 48  LYS A HZ3  4  
ATOM 7787  N N    . THR A 1 49  ? -1.133  5.049   6.319   1.00 0.18  ? 49  THR A N    4  
ATOM 7788  C CA   . THR A 1 49  ? -0.221  5.801   7.160   1.00 0.20  ? 49  THR A CA   4  
ATOM 7789  C C    . THR A 1 49  ? -0.569  5.643   8.634   1.00 0.21  ? 49  THR A C    4  
ATOM 7790  O O    . THR A 1 49  ? -1.510  6.267   9.129   1.00 0.29  ? 49  THR A O    4  
ATOM 7791  C CB   . THR A 1 49  ? -0.246  7.294   6.789   1.00 0.25  ? 49  THR A CB   4  
ATOM 7792  O OG1  . THR A 1 49  ? -1.602  7.722   6.594   1.00 0.33  ? 49  THR A OG1  4  
ATOM 7793  C CG2  . THR A 1 49  ? 0.562   7.553   5.528   1.00 0.25  ? 49  THR A CG2  4  
ATOM 7794  H H    . THR A 1 49  ? -1.815  5.535   5.809   1.00 0.21  ? 49  THR A H    4  
ATOM 7795  H HA   . THR A 1 49  ? 0.780   5.425   6.993   1.00 0.19  ? 49  THR A HA   4  
ATOM 7796  H HB   . THR A 1 49  ? 0.191   7.859   7.603   1.00 0.28  ? 49  THR A HB   4  
ATOM 7797  H HG1  . THR A 1 49  ? -2.056  7.739   7.446   1.00 0.68  ? 49  THR A HG1  4  
ATOM 7798  H HG21 . THR A 1 49  ? 0.126   7.007   4.704   1.00 1.03  ? 49  THR A HG21 4  
ATOM 7799  H HG22 . THR A 1 49  ? 1.580   7.224   5.680   1.00 1.01  ? 49  THR A HG22 4  
ATOM 7800  H HG23 . THR A 1 49  ? 0.554   8.610   5.306   1.00 1.03  ? 49  THR A HG23 4  
ATOM 7801  N N    . LEU A 1 50  ? 0.173   4.782   9.320   1.00 0.18  ? 50  LEU A N    4  
ATOM 7802  C CA   . LEU A 1 50  ? 0.045   4.649   10.764  1.00 0.21  ? 50  LEU A CA   4  
ATOM 7803  C C    . LEU A 1 50  ? 0.507   5.954   11.383  1.00 0.23  ? 50  LEU A C    4  
ATOM 7804  O O    . LEU A 1 50  ? -0.156  6.554   12.229  1.00 0.28  ? 50  LEU A O    4  
ATOM 7805  C CB   . LEU A 1 50  ? 0.930   3.506   11.254  1.00 0.21  ? 50  LEU A CB   4  
ATOM 7806  C CG   . LEU A 1 50  ? 0.921   2.257   10.371  1.00 0.20  ? 50  LEU A CG   4  
ATOM 7807  C CD1  . LEU A 1 50  ? 2.115   1.390   10.698  1.00 0.21  ? 50  LEU A CD1  4  
ATOM 7808  C CD2  . LEU A 1 50  ? -0.372  1.483   10.556  1.00 0.24  ? 50  LEU A CD2  4  
ATOM 7809  H H    . LEU A 1 50  ? 0.834   4.231   8.844   1.00 0.15  ? 50  LEU A H    4  
ATOM 7810  H HA   . LEU A 1 50  ? -0.988  4.458   11.013  1.00 0.23  ? 50  LEU A HA   4  
ATOM 7811  H HB2  . LEU A 1 50  ? 1.946   3.867   11.323  1.00 0.21  ? 50  LEU A HB2  4  
ATOM 7812  H HB3  . LEU A 1 50  ? 0.599   3.221   12.241  1.00 0.25  ? 50  LEU A HB3  4  
ATOM 7813  H HG   . LEU A 1 50  ? 0.995   2.550   9.330   1.00 0.17  ? 50  LEU A HG   4  
ATOM 7814  H HD11 . LEU A 1 50  ? 2.082   1.112   11.741  1.00 1.02  ? 50  LEU A HD11 4  
ATOM 7815  H HD12 . LEU A 1 50  ? 3.022   1.949   10.502  1.00 1.05  ? 50  LEU A HD12 4  
ATOM 7816  H HD13 . LEU A 1 50  ? 2.097   0.502   10.085  1.00 1.04  ? 50  LEU A HD13 4  
ATOM 7817  H HD21 . LEU A 1 50  ? -0.487  1.221   11.597  1.00 1.01  ? 50  LEU A HD21 4  
ATOM 7818  H HD22 . LEU A 1 50  ? -0.339  0.586   9.958   1.00 1.02  ? 50  LEU A HD22 4  
ATOM 7819  H HD23 . LEU A 1 50  ? -1.202  2.096   10.245  1.00 1.06  ? 50  LEU A HD23 4  
ATOM 7820  N N    . VAL A 1 51  ? 1.679   6.360   10.920  1.00 0.23  ? 51  VAL A N    4  
ATOM 7821  C CA   . VAL A 1 51  ? 2.257   7.662   11.192  1.00 0.27  ? 51  VAL A CA   4  
ATOM 7822  C C    . VAL A 1 51  ? 2.822   8.165   9.891   1.00 0.24  ? 51  VAL A C    4  
ATOM 7823  O O    . VAL A 1 51  ? 3.570   7.443   9.255   1.00 0.23  ? 51  VAL A O    4  
ATOM 7824  C CB   . VAL A 1 51  ? 3.411   7.576   12.198  1.00 0.30  ? 51  VAL A CB   4  
ATOM 7825  C CG1  . VAL A 1 51  ? 4.005   8.951   12.477  1.00 0.36  ? 51  VAL A CG1  4  
ATOM 7826  C CG2  . VAL A 1 51  ? 2.957   6.916   13.481  1.00 0.36  ? 51  VAL A CG2  4  
ATOM 7827  H H    . VAL A 1 51  ? 2.186   5.744   10.342  1.00 0.21  ? 51  VAL A H    4  
ATOM 7828  H HA   . VAL A 1 51  ? 1.494   8.332   11.558  1.00 0.33  ? 51  VAL A HA   4  
ATOM 7829  H HB   . VAL A 1 51  ? 4.181   6.967   11.747  1.00 0.26  ? 51  VAL A HB   4  
ATOM 7830  H HG11 . VAL A 1 51  ? 3.241   9.597   12.884  1.00 1.03  ? 51  VAL A HG11 4  
ATOM 7831  H HG12 . VAL A 1 51  ? 4.385   9.373   11.559  1.00 1.08  ? 51  VAL A HG12 4  
ATOM 7832  H HG13 . VAL A 1 51  ? 4.810   8.854   13.190  1.00 1.14  ? 51  VAL A HG13 4  
ATOM 7833  H HG21 . VAL A 1 51  ? 2.610   5.919   13.266  1.00 0.96  ? 51  VAL A HG21 4  
ATOM 7834  H HG22 . VAL A 1 51  ? 2.151   7.493   13.910  1.00 1.11  ? 51  VAL A HG22 4  
ATOM 7835  H HG23 . VAL A 1 51  ? 3.780   6.872   14.175  1.00 1.06  ? 51  VAL A HG23 4  
ATOM 7836  N N    . PRO A 1 52  ? 2.449   9.363   9.453   1.00 0.29  ? 52  PRO A N    4  
ATOM 7837  C CA   . PRO A 1 52  ? 2.888   9.916   8.182   1.00 0.32  ? 52  PRO A CA   4  
ATOM 7838  C C    . PRO A 1 52  ? 3.964   10.998  8.316   1.00 0.34  ? 52  PRO A C    4  
ATOM 7839  O O    . PRO A 1 52  ? 3.774   12.148  7.904   1.00 0.54  ? 52  PRO A O    4  
ATOM 7840  C CB   . PRO A 1 52  ? 1.571   10.488  7.699   1.00 0.41  ? 52  PRO A CB   4  
ATOM 7841  C CG   . PRO A 1 52  ? 0.933   11.049  8.938   1.00 0.46  ? 52  PRO A CG   4  
ATOM 7842  C CD   . PRO A 1 52  ? 1.494   10.266  10.103  1.00 0.37  ? 52  PRO A CD   4  
ATOM 7843  H HA   . PRO A 1 52  ? 3.228   9.145   7.501   1.00 0.32  ? 52  PRO A HA   4  
ATOM 7844  H HB2  . PRO A 1 52  ? 1.746   11.249  6.952   1.00 0.45  ? 52  PRO A HB2  4  
ATOM 7845  H HB3  . PRO A 1 52  ? 0.981   9.686   7.289   1.00 0.45  ? 52  PRO A HB3  4  
ATOM 7846  H HG2  . PRO A 1 52  ? 1.185   12.094  9.039   1.00 0.51  ? 52  PRO A HG2  4  
ATOM 7847  H HG3  . PRO A 1 52  ? -0.138  10.926  8.886   1.00 0.56  ? 52  PRO A HG3  4  
ATOM 7848  H HD2  . PRO A 1 52  ? 1.994   10.923  10.798  1.00 0.39  ? 52  PRO A HD2  4  
ATOM 7849  H HD3  . PRO A 1 52  ? 0.713   9.708   10.598  1.00 0.41  ? 52  PRO A HD3  4  
ATOM 7850  N N    . GLY A 1 53  ? 5.100   10.608  8.876   1.00 0.24  ? 53  GLY A N    4  
ATOM 7851  C CA   . GLY A 1 53  ? 6.227   11.512  9.007   1.00 0.28  ? 53  GLY A CA   4  
ATOM 7852  C C    . GLY A 1 53  ? 6.038   12.569  10.081  1.00 0.29  ? 53  GLY A C    4  
ATOM 7853  O O    . GLY A 1 53  ? 4.925   12.797  10.558  1.00 0.55  ? 53  GLY A O    4  
ATOM 7854  H H    . GLY A 1 53  ? 5.182   9.684   9.181   1.00 0.26  ? 53  GLY A H    4  
ATOM 7855  H HA2  . GLY A 1 53  ? 7.111   10.933  9.240   1.00 0.34  ? 53  GLY A HA2  4  
ATOM 7856  H HA3  . GLY A 1 53  ? 6.382   12.006  8.059   1.00 0.35  ? 53  GLY A HA3  4  
ATOM 7857  N N    . PRO A 1 54  ? 7.136   13.215  10.499  1.00 0.52  ? 54  PRO A N    4  
ATOM 7858  C CA   . PRO A 1 54  ? 7.092   14.342  11.431  1.00 0.67  ? 54  PRO A CA   4  
ATOM 7859  C C    . PRO A 1 54  ? 6.712   15.640  10.711  1.00 0.78  ? 54  PRO A C    4  
ATOM 7860  O O    . PRO A 1 54  ? 6.632   15.661  9.481   1.00 1.20  ? 54  PRO A O    4  
ATOM 7861  C CB   . PRO A 1 54  ? 8.533   14.403  11.946  1.00 1.03  ? 54  PRO A CB   4  
ATOM 7862  C CG   . PRO A 1 54  ? 9.356   13.908  10.809  1.00 1.42  ? 54  PRO A CG   4  
ATOM 7863  C CD   . PRO A 1 54  ? 8.515   12.884  10.096  1.00 0.91  ? 54  PRO A CD   4  
ATOM 7864  H HA   . PRO A 1 54  ? 6.411   14.161  12.250  1.00 0.63  ? 54  PRO A HA   4  
ATOM 7865  H HB2  . PRO A 1 54  ? 8.784   15.421  12.206  1.00 1.19  ? 54  PRO A HB2  4  
ATOM 7866  H HB3  . PRO A 1 54  ? 8.637   13.766  12.814  1.00 1.08  ? 54  PRO A HB3  4  
ATOM 7867  H HG2  . PRO A 1 54  ? 9.593   14.726  10.145  1.00 1.91  ? 54  PRO A HG2  4  
ATOM 7868  H HG3  . PRO A 1 54  ? 10.262  13.453  11.182  1.00 1.81  ? 54  PRO A HG3  4  
ATOM 7869  H HD2  . PRO A 1 54  ? 8.636   12.975  9.026   1.00 1.01  ? 54  PRO A HD2  4  
ATOM 7870  H HD3  . PRO A 1 54  ? 8.781   11.889  10.419  1.00 0.97  ? 54  PRO A HD3  4  
ATOM 7871  N N    . PRO A 1 55  ? 6.470   16.740  11.451  1.00 0.97  ? 55  PRO A N    4  
ATOM 7872  C CA   . PRO A 1 55  ? 6.161   18.053  10.858  1.00 1.24  ? 55  PRO A CA   4  
ATOM 7873  C C    . PRO A 1 55  ? 7.367   18.688  10.147  1.00 0.93  ? 55  PRO A C    4  
ATOM 7874  O O    . PRO A 1 55  ? 7.673   19.865  10.351  1.00 1.20  ? 55  PRO A O    4  
ATOM 7875  C CB   . PRO A 1 55  ? 5.753   18.911  12.069  1.00 1.81  ? 55  PRO A CB   4  
ATOM 7876  C CG   . PRO A 1 55  ? 5.523   17.948  13.185  1.00 2.04  ? 55  PRO A CG   4  
ATOM 7877  C CD   . PRO A 1 55  ? 6.441   16.794  12.921  1.00 1.47  ? 55  PRO A CD   4  
ATOM 7878  H HA   . PRO A 1 55  ? 5.333   17.986  10.167  1.00 1.48  ? 55  PRO A HA   4  
ATOM 7879  H HB2  . PRO A 1 55  ? 6.549   19.600  12.303  1.00 1.86  ? 55  PRO A HB2  4  
ATOM 7880  H HB3  . PRO A 1 55  ? 4.855   19.462  11.835  1.00 2.24  ? 55  PRO A HB3  4  
ATOM 7881  H HG2  . PRO A 1 55  ? 5.768   18.415  14.129  1.00 2.40  ? 55  PRO A HG2  4  
ATOM 7882  H HG3  . PRO A 1 55  ? 4.494   17.620  13.182  1.00 2.53  ? 55  PRO A HG3  4  
ATOM 7883  H HD2  . PRO A 1 55  ? 7.423   16.993  13.323  1.00 1.54  ? 55  PRO A HD2  4  
ATOM 7884  H HD3  . PRO A 1 55  ? 6.036   15.881  13.335  1.00 1.66  ? 55  PRO A HD3  4  
ATOM 7885  N N    . GLY A 1 56  ? 8.032   17.906  9.306   1.00 0.98  ? 56  GLY A N    4  
ATOM 7886  C CA   . GLY A 1 56  ? 9.190   18.391  8.582   1.00 0.82  ? 56  GLY A CA   4  
ATOM 7887  C C    . GLY A 1 56  ? 9.910   17.268  7.866   1.00 0.64  ? 56  GLY A C    4  
ATOM 7888  O O    . GLY A 1 56  ? 11.136  17.175  7.917   1.00 0.69  ? 56  GLY A O    4  
ATOM 7889  H H    . GLY A 1 56  ? 7.732   16.977  9.178   1.00 1.42  ? 56  GLY A H    4  
ATOM 7890  H HA2  . GLY A 1 56  ? 8.869   19.125  7.856   1.00 0.98  ? 56  GLY A HA2  4  
ATOM 7891  H HA3  . GLY A 1 56  ? 9.871   18.857  9.278   1.00 0.83  ? 56  GLY A HA3  4  
ATOM 7892  N N    . SER A 1 57  ? 9.143   16.395  7.222   1.00 0.52  ? 57  SER A N    4  
ATOM 7893  C CA   . SER A 1 57  ? 9.693   15.271  6.507   1.00 0.40  ? 57  SER A CA   4  
ATOM 7894  C C    . SER A 1 57  ? 9.862   15.585  5.024   1.00 0.34  ? 57  SER A C    4  
ATOM 7895  O O    . SER A 1 57  ? 9.649   16.716  4.580   1.00 0.43  ? 57  SER A O    4  
ATOM 7896  C CB   . SER A 1 57  ? 8.763   14.079  6.687   1.00 0.40  ? 57  SER A CB   4  
ATOM 7897  O OG   . SER A 1 57  ? 7.428   14.512  6.900   1.00 0.99  ? 57  SER A OG   4  
ATOM 7898  H H    . SER A 1 57  ? 8.169   16.504  7.229   1.00 0.56  ? 57  SER A H    4  
ATOM 7899  H HA   . SER A 1 57  ? 10.656  15.037  6.932   1.00 0.47  ? 57  SER A HA   4  
ATOM 7900  H HB2  . SER A 1 57  ? 8.788   13.478  5.795   1.00 0.55  ? 57  SER A HB2  4  
ATOM 7901  H HB3  . SER A 1 57  ? 9.084   13.490  7.535   1.00 0.66  ? 57  SER A HB3  4  
ATOM 7902  H HG   . SER A 1 57  ? 6.834   14.008  6.333   1.00 1.36  ? 57  SER A HG   4  
ATOM 7903  N N    . SER A 1 58  ? 10.253  14.573  4.271   1.00 0.28  ? 58  SER A N    4  
ATOM 7904  C CA   . SER A 1 58  ? 10.401  14.681  2.833   1.00 0.30  ? 58  SER A CA   4  
ATOM 7905  C C    . SER A 1 58  ? 10.172  13.307  2.232   1.00 0.27  ? 58  SER A C    4  
ATOM 7906  O O    . SER A 1 58  ? 10.636  12.317  2.783   1.00 0.38  ? 58  SER A O    4  
ATOM 7907  C CB   . SER A 1 58  ? 11.808  15.190  2.482   1.00 0.38  ? 58  SER A CB   4  
ATOM 7908  O OG   . SER A 1 58  ? 11.948  15.443  1.094   1.00 1.28  ? 58  SER A OG   4  
ATOM 7909  H H    . SER A 1 58  ? 10.445  13.712  4.699   1.00 0.31  ? 58  SER A H    4  
ATOM 7910  H HA   . SER A 1 58  ? 9.657   15.370  2.459   1.00 0.36  ? 58  SER A HA   4  
ATOM 7911  H HB2  . SER A 1 58  ? 12.001  16.104  3.019   1.00 0.97  ? 58  SER A HB2  4  
ATOM 7912  H HB3  . SER A 1 58  ? 12.535  14.443  2.774   1.00 0.87  ? 58  SER A HB3  4  
ATOM 7913  H HG   . SER A 1 58  ? 12.837  15.774  0.916   1.00 1.82  ? 58  SER A HG   4  
ATOM 7914  N N    . ARG A 1 59  ? 9.435   13.228  1.144   1.00 0.32  ? 59  ARG A N    4  
ATOM 7915  C CA   . ARG A 1 59  ? 9.213   11.947  0.494   1.00 0.30  ? 59  ARG A CA   4  
ATOM 7916  C C    . ARG A 1 59  ? 10.270  11.704  -0.574  1.00 0.27  ? 59  ARG A C    4  
ATOM 7917  O O    . ARG A 1 59  ? 10.350  12.438  -1.564  1.00 0.34  ? 59  ARG A O    4  
ATOM 7918  C CB   . ARG A 1 59  ? 7.793   11.852  -0.078  1.00 0.42  ? 59  ARG A CB   4  
ATOM 7919  C CG   . ARG A 1 59  ? 7.292   13.121  -0.745  1.00 0.64  ? 59  ARG A CG   4  
ATOM 7920  C CD   . ARG A 1 59  ? 5.809   13.018  -1.067  1.00 0.68  ? 59  ARG A CD   4  
ATOM 7921  N NE   . ARG A 1 59  ? 5.013   12.765  0.138   1.00 1.41  ? 59  ARG A NE   4  
ATOM 7922  C CZ   . ARG A 1 59  ? 3.731   12.386  0.131   1.00 1.81  ? 59  ARG A CZ   4  
ATOM 7923  N NH1  . ARG A 1 59  ? 3.093   12.195  -1.013  1.00 1.78  ? 59  ARG A NH1  4  
ATOM 7924  N NH2  . ARG A 1 59  ? 3.088   12.180  1.271   1.00 2.81  ? 59  ARG A NH2  4  
ATOM 7925  H H    . ARG A 1 59  ? 9.040   14.037  0.765   1.00 0.44  ? 59  ARG A H    4  
ATOM 7926  H HA   . ARG A 1 59  ? 9.327   11.186  1.252   1.00 0.30  ? 59  ARG A HA   4  
ATOM 7927  H HB2  . ARG A 1 59  ? 7.770   11.055  -0.812  1.00 0.93  ? 59  ARG A HB2  4  
ATOM 7928  H HB3  . ARG A 1 59  ? 7.113   11.605  0.729   1.00 0.91  ? 59  ARG A HB3  4  
ATOM 7929  H HG2  . ARG A 1 59  ? 7.451   13.955  -0.075  1.00 1.11  ? 59  ARG A HG2  4  
ATOM 7930  H HG3  . ARG A 1 59  ? 7.841   13.280  -1.661  1.00 1.15  ? 59  ARG A HG3  4  
ATOM 7931  H HD2  . ARG A 1 59  ? 5.485   13.949  -1.514  1.00 1.27  ? 59  ARG A HD2  4  
ATOM 7932  H HD3  . ARG A 1 59  ? 5.658   12.209  -1.768  1.00 1.12  ? 59  ARG A HD3  4  
ATOM 7933  H HE   . ARG A 1 59  ? 5.467   12.886  1.014   1.00 2.07  ? 59  ARG A HE   4  
ATOM 7934  H HH11 . ARG A 1 59  ? 3.568   12.329  -1.889  1.00 1.77  ? 59  ARG A HH11 4  
ATOM 7935  H HH12 . ARG A 1 59  ? 2.125   11.918  -1.010  1.00 2.29  ? 59  ARG A HH12 4  
ATOM 7936  H HH21 . ARG A 1 59  ? 3.569   12.310  2.157   1.00 3.39  ? 59  ARG A HH21 4  
ATOM 7937  H HH22 . ARG A 1 59  ? 2.130   11.894  1.267   1.00 3.15  ? 59  ARG A HH22 4  
ATOM 7938  N N    . PRO A 1 60  ? 11.127  10.691  -0.343  1.00 0.23  ? 60  PRO A N    4  
ATOM 7939  C CA   . PRO A 1 60  ? 12.229  10.329  -1.240  1.00 0.26  ? 60  PRO A CA   4  
ATOM 7940  C C    . PRO A 1 60  ? 11.819  10.234  -2.705  1.00 0.26  ? 60  PRO A C    4  
ATOM 7941  O O    . PRO A 1 60  ? 10.730  9.762   -3.041  1.00 0.28  ? 60  PRO A O    4  
ATOM 7942  C CB   . PRO A 1 60  ? 12.681  8.948   -0.737  1.00 0.30  ? 60  PRO A CB   4  
ATOM 7943  C CG   . PRO A 1 60  ? 11.680  8.544   0.296   1.00 0.28  ? 60  PRO A CG   4  
ATOM 7944  C CD   . PRO A 1 60  ? 11.113  9.818   0.838   1.00 0.21  ? 60  PRO A CD   4  
ATOM 7945  H HA   . PRO A 1 60  ? 13.050  11.025  -1.146  1.00 0.32  ? 60  PRO A HA   4  
ATOM 7946  H HB2  . PRO A 1 60  ? 12.697  8.252   -1.564  1.00 0.41  ? 60  PRO A HB2  4  
ATOM 7947  H HB3  . PRO A 1 60  ? 13.669  9.029   -0.312  1.00 0.42  ? 60  PRO A HB3  4  
ATOM 7948  H HG2  . PRO A 1 60  ? 10.900  7.946   -0.158  1.00 0.43  ? 60  PRO A HG2  4  
ATOM 7949  H HG3  . PRO A 1 60  ? 12.171  7.989   1.080   1.00 0.41  ? 60  PRO A HG3  4  
ATOM 7950  H HD2  . PRO A 1 60  ? 10.111  9.666   1.213   1.00 0.24  ? 60  PRO A HD2  4  
ATOM 7951  H HD3  . PRO A 1 60  ? 11.751  10.213  1.616   1.00 0.24  ? 60  PRO A HD3  4  
ATOM 7952  N N    . VAL A 1 61  ? 12.710  10.678  -3.572  1.00 0.29  ? 61  VAL A N    4  
ATOM 7953  C CA   . VAL A 1 61  ? 12.473  10.638  -5.001  1.00 0.31  ? 61  VAL A CA   4  
ATOM 7954  C C    . VAL A 1 61  ? 13.027  9.337   -5.577  1.00 0.28  ? 61  VAL A C    4  
ATOM 7955  O O    . VAL A 1 61  ? 13.909  8.717   -4.983  1.00 0.27  ? 61  VAL A O    4  
ATOM 7956  C CB   . VAL A 1 61  ? 13.141  11.841  -5.703  1.00 0.40  ? 61  VAL A CB   4  
ATOM 7957  C CG1  . VAL A 1 61  ? 12.708  11.951  -7.158  1.00 0.81  ? 61  VAL A CG1  4  
ATOM 7958  C CG2  . VAL A 1 61  ? 12.844  13.133  -4.956  1.00 0.88  ? 61  VAL A CG2  4  
ATOM 7959  H H    . VAL A 1 61  ? 13.557  11.036  -3.242  1.00 0.32  ? 61  VAL A H    4  
ATOM 7960  H HA   . VAL A 1 61  ? 11.408  10.680  -5.171  1.00 0.33  ? 61  VAL A HA   4  
ATOM 7961  H HB   . VAL A 1 61  ? 14.209  11.688  -5.687  1.00 0.80  ? 61  VAL A HB   4  
ATOM 7962  H HG11 . VAL A 1 61  ? 13.041  11.078  -7.701  1.00 1.44  ? 61  VAL A HG11 4  
ATOM 7963  H HG12 . VAL A 1 61  ? 13.144  12.837  -7.594  1.00 1.46  ? 61  VAL A HG12 4  
ATOM 7964  H HG13 . VAL A 1 61  ? 11.630  12.018  -7.209  1.00 1.30  ? 61  VAL A HG13 4  
ATOM 7965  H HG21 . VAL A 1 61  ? 11.777  13.303  -4.930  1.00 1.45  ? 61  VAL A HG21 4  
ATOM 7966  H HG22 . VAL A 1 61  ? 13.325  13.956  -5.462  1.00 1.40  ? 61  VAL A HG22 4  
ATOM 7967  H HG23 . VAL A 1 61  ? 13.223  13.062  -3.948  1.00 1.47  ? 61  VAL A HG23 4  
ATOM 7968  N N    . LYS A 1 62  ? 12.506  8.918   -6.721  1.00 0.27  ? 62  LYS A N    4  
ATOM 7969  C CA   . LYS A 1 62  ? 12.990  7.723   -7.384  1.00 0.27  ? 62  LYS A CA   4  
ATOM 7970  C C    . LYS A 1 62  ? 14.434  7.905   -7.801  1.00 0.25  ? 62  LYS A C    4  
ATOM 7971  O O    . LYS A 1 62  ? 14.748  8.718   -8.673  1.00 0.31  ? 62  LYS A O    4  
ATOM 7972  C CB   . LYS A 1 62  ? 12.133  7.365   -8.594  1.00 0.30  ? 62  LYS A CB   4  
ATOM 7973  C CG   . LYS A 1 62  ? 10.867  6.604   -8.240  1.00 0.37  ? 62  LYS A CG   4  
ATOM 7974  C CD   . LYS A 1 62  ? 10.186  6.095   -9.494  1.00 0.41  ? 62  LYS A CD   4  
ATOM 7975  C CE   . LYS A 1 62  ? 9.143   5.035   -9.185  1.00 0.60  ? 62  LYS A CE   4  
ATOM 7976  N NZ   . LYS A 1 62  ? 8.523   4.503   -10.426 1.00 1.17  ? 62  LYS A NZ   4  
ATOM 7977  H H    . LYS A 1 62  ? 11.798  9.437   -7.135  1.00 0.30  ? 62  LYS A H    4  
ATOM 7978  H HA   . LYS A 1 62  ? 12.943  6.914   -6.675  1.00 0.29  ? 62  LYS A HA   4  
ATOM 7979  H HB2  . LYS A 1 62  ? 11.850  8.276   -9.102  1.00 0.33  ? 62  LYS A HB2  4  
ATOM 7980  H HB3  . LYS A 1 62  ? 12.716  6.756   -9.267  1.00 0.37  ? 62  LYS A HB3  4  
ATOM 7981  H HG2  . LYS A 1 62  ? 11.124  5.764   -7.608  1.00 0.54  ? 62  LYS A HG2  4  
ATOM 7982  H HG3  . LYS A 1 62  ? 10.193  7.260   -7.713  1.00 0.52  ? 62  LYS A HG3  4  
ATOM 7983  H HD2  . LYS A 1 62  ? 9.704   6.922   -9.990  1.00 0.61  ? 62  LYS A HD2  4  
ATOM 7984  H HD3  . LYS A 1 62  ? 10.933  5.670   -10.148 1.00 0.58  ? 62  LYS A HD3  4  
ATOM 7985  H HE2  . LYS A 1 62  ? 9.617   4.226   -8.651  1.00 1.06  ? 62  LYS A HE2  4  
ATOM 7986  H HE3  . LYS A 1 62  ? 8.372   5.471   -8.567  1.00 0.90  ? 62  LYS A HE3  4  
ATOM 7987  H HZ1  . LYS A 1 62  ? 9.265   4.218   -11.101 1.00 1.64  ? 62  LYS A HZ1  4  
ATOM 7988  H HZ2  . LYS A 1 62  ? 7.921   5.228   -10.871 1.00 1.67  ? 62  LYS A HZ2  4  
ATOM 7989  H HZ3  . LYS A 1 62  ? 7.938   3.673   -10.207 1.00 1.71  ? 62  LYS A HZ3  4  
ATOM 7990  N N    . GLY A 1 63  ? 15.297  7.153   -7.149  1.00 0.25  ? 63  GLY A N    4  
ATOM 7991  C CA   . GLY A 1 63  ? 16.709  7.267   -7.371  1.00 0.27  ? 63  GLY A CA   4  
ATOM 7992  C C    . GLY A 1 63  ? 17.452  7.231   -6.064  1.00 0.30  ? 63  GLY A C    4  
ATOM 7993  O O    . GLY A 1 63  ? 18.552  6.699   -5.973  1.00 0.42  ? 63  GLY A O    4  
ATOM 7994  H H    . GLY A 1 63  ? 14.962  6.496   -6.496  1.00 0.30  ? 63  GLY A H    4  
ATOM 7995  H HA2  . GLY A 1 63  ? 17.040  6.447   -7.989  1.00 0.29  ? 63  GLY A HA2  4  
ATOM 7996  H HA3  . GLY A 1 63  ? 16.917  8.199   -7.874  1.00 0.28  ? 63  GLY A HA3  4  
ATOM 7997  N N    . GLN A 1 64  ? 16.834  7.776   -5.028  1.00 0.26  ? 64  GLN A N    4  
ATOM 7998  C CA   . GLN A 1 64  ? 17.466  7.797   -3.717  1.00 0.28  ? 64  GLN A CA   4  
ATOM 7999  C C    . GLN A 1 64  ? 17.407  6.407   -3.122  1.00 0.24  ? 64  GLN A C    4  
ATOM 8000  O O    . GLN A 1 64  ? 16.399  5.719   -3.266  1.00 0.24  ? 64  GLN A O    4  
ATOM 8001  C CB   . GLN A 1 64  ? 16.773  8.783   -2.768  1.00 0.30  ? 64  GLN A CB   4  
ATOM 8002  C CG   . GLN A 1 64  ? 16.072  9.952   -3.447  1.00 0.36  ? 64  GLN A CG   4  
ATOM 8003  C CD   . GLN A 1 64  ? 16.982  10.888  -4.244  1.00 0.44  ? 64  GLN A CD   4  
ATOM 8004  O OE1  . GLN A 1 64  ? 16.713  12.081  -4.328  1.00 0.59  ? 64  GLN A OE1  4  
ATOM 8005  N NE2  . GLN A 1 64  ? 18.030  10.364  -4.867  1.00 0.43  ? 64  GLN A NE2  4  
ATOM 8006  H H    . GLN A 1 64  ? 15.926  8.154   -5.146  1.00 0.26  ? 64  GLN A H    4  
ATOM 8007  H HA   . GLN A 1 64  ? 18.498  8.088   -3.840  1.00 0.33  ? 64  GLN A HA   4  
ATOM 8008  H HB2  . GLN A 1 64  ? 16.030  8.241   -2.196  1.00 0.29  ? 64  GLN A HB2  4  
ATOM 8009  H HB3  . GLN A 1 64  ? 17.516  9.188   -2.092  1.00 0.37  ? 64  GLN A HB3  4  
ATOM 8010  H HG2  . GLN A 1 64  ? 15.325  9.547   -4.113  1.00 0.35  ? 64  GLN A HG2  4  
ATOM 8011  H HG3  . GLN A 1 64  ? 15.576  10.535  -2.684  1.00 0.40  ? 64  GLN A HG3  4  
ATOM 8012  H HE21 . GLN A 1 64  ? 18.180  9.398   -4.793  1.00 0.43  ? 64  GLN A HE21 4  
ATOM 8013  H HE22 . GLN A 1 64  ? 18.604  10.964  -5.388  1.00 0.50  ? 64  GLN A HE22 4  
ATOM 8014  N N    . VAL A 1 65  ? 18.479  5.976   -2.480  1.00 0.28  ? 65  VAL A N    4  
ATOM 8015  C CA   . VAL A 1 65  ? 18.432  4.710   -1.783  1.00 0.31  ? 65  VAL A CA   4  
ATOM 8016  C C    . VAL A 1 65  ? 17.953  4.980   -0.367  1.00 0.25  ? 65  VAL A C    4  
ATOM 8017  O O    . VAL A 1 65  ? 18.398  5.923   0.293   1.00 0.32  ? 65  VAL A O    4  
ATOM 8018  C CB   . VAL A 1 65  ? 19.773  3.923   -1.788  1.00 0.49  ? 65  VAL A CB   4  
ATOM 8019  C CG1  . VAL A 1 65  ? 20.425  3.961   -3.162  1.00 1.22  ? 65  VAL A CG1  4  
ATOM 8020  C CG2  . VAL A 1 65  ? 20.728  4.407   -0.713  1.00 1.05  ? 65  VAL A CG2  4  
ATOM 8021  H H    . VAL A 1 65  ? 19.290  6.525   -2.449  1.00 0.35  ? 65  VAL A H    4  
ATOM 8022  H HA   . VAL A 1 65  ? 17.684  4.100   -2.281  1.00 0.32  ? 65  VAL A HA   4  
ATOM 8023  H HB   . VAL A 1 65  ? 19.542  2.889   -1.576  1.00 1.34  ? 65  VAL A HB   4  
ATOM 8024  H HG11 . VAL A 1 65  ? 19.747  3.545   -3.893  1.00 1.66  ? 65  VAL A HG11 4  
ATOM 8025  H HG12 . VAL A 1 65  ? 21.335  3.382   -3.146  1.00 1.83  ? 65  VAL A HG12 4  
ATOM 8026  H HG13 . VAL A 1 65  ? 20.652  4.984   -3.424  1.00 1.86  ? 65  VAL A HG13 4  
ATOM 8027  H HG21 . VAL A 1 65  ? 20.308  4.189   0.260   1.00 1.67  ? 65  VAL A HG21 4  
ATOM 8028  H HG22 . VAL A 1 65  ? 20.872  5.474   -0.811  1.00 1.64  ? 65  VAL A HG22 4  
ATOM 8029  H HG23 . VAL A 1 65  ? 21.676  3.902   -0.815  1.00 1.65  ? 65  VAL A HG23 4  
ATOM 8030  N N    . VAL A 1 66  ? 16.989  4.208   0.060   1.00 0.19  ? 66  VAL A N    4  
ATOM 8031  C CA   . VAL A 1 66  ? 16.316  4.461   1.315   1.00 0.15  ? 66  VAL A CA   4  
ATOM 8032  C C    . VAL A 1 66  ? 16.282  3.210   2.166   1.00 0.16  ? 66  VAL A C    4  
ATOM 8033  O O    . VAL A 1 66  ? 16.268  2.095   1.646   1.00 0.21  ? 66  VAL A O    4  
ATOM 8034  C CB   . VAL A 1 66  ? 14.875  4.963   1.082   1.00 0.17  ? 66  VAL A CB   4  
ATOM 8035  C CG1  . VAL A 1 66  ? 14.862  6.218   0.221   1.00 0.18  ? 66  VAL A CG1  4  
ATOM 8036  C CG2  . VAL A 1 66  ? 14.020  3.896   0.425   1.00 0.25  ? 66  VAL A CG2  4  
ATOM 8037  H H    . VAL A 1 66  ? 16.719  3.442   -0.478  1.00 0.24  ? 66  VAL A H    4  
ATOM 8038  H HA   . VAL A 1 66  ? 16.860  5.224   1.847   1.00 0.15  ? 66  VAL A HA   4  
ATOM 8039  H HB   . VAL A 1 66  ? 14.447  5.202   2.045   1.00 0.21  ? 66  VAL A HB   4  
ATOM 8040  H HG11 . VAL A 1 66  ? 15.232  5.981   -0.766  1.00 1.04  ? 66  VAL A HG11 4  
ATOM 8041  H HG12 . VAL A 1 66  ? 15.491  6.969   0.668   1.00 1.01  ? 66  VAL A HG12 4  
ATOM 8042  H HG13 . VAL A 1 66  ? 13.851  6.591   0.146   1.00 1.02  ? 66  VAL A HG13 4  
ATOM 8043  H HG21 . VAL A 1 66  ? 13.003  4.244   0.359   1.00 1.07  ? 66  VAL A HG21 4  
ATOM 8044  H HG22 . VAL A 1 66  ? 14.059  2.988   1.009   1.00 1.07  ? 66  VAL A HG22 4  
ATOM 8045  H HG23 . VAL A 1 66  ? 14.397  3.702   -0.572  1.00 1.00  ? 66  VAL A HG23 4  
ATOM 8046  N N    . THR A 1 67  ? 16.296  3.402   3.469   1.00 0.13  ? 67  THR A N    4  
ATOM 8047  C CA   . THR A 1 67  ? 16.220  2.294   4.385   1.00 0.15  ? 67  THR A CA   4  
ATOM 8048  C C    . THR A 1 67  ? 14.801  2.128   4.881   1.00 0.16  ? 67  THR A C    4  
ATOM 8049  O O    . THR A 1 67  ? 14.267  2.992   5.585   1.00 0.21  ? 67  THR A O    4  
ATOM 8050  C CB   . THR A 1 67  ? 17.153  2.489   5.591   1.00 0.20  ? 67  THR A CB   4  
ATOM 8051  O OG1  . THR A 1 67  ? 16.943  3.780   6.159   1.00 0.29  ? 67  THR A OG1  4  
ATOM 8052  C CG2  . THR A 1 67  ? 18.608  2.343   5.191   1.00 0.27  ? 67  THR A CG2  4  
ATOM 8053  H H    . THR A 1 67  ? 16.346  4.317   3.823   1.00 0.14  ? 67  THR A H    4  
ATOM 8054  H HA   . THR A 1 67  ? 16.518  1.401   3.858   1.00 0.15  ? 67  THR A HA   4  
ATOM 8055  H HB   . THR A 1 67  ? 16.919  1.737   6.330   1.00 0.27  ? 67  THR A HB   4  
ATOM 8056  H HG1  . THR A 1 67  ? 17.681  3.999   6.736   1.00 0.56  ? 67  THR A HG1  4  
ATOM 8057  H HG21 . THR A 1 67  ? 18.770  1.361   4.775   1.00 1.03  ? 67  THR A HG21 4  
ATOM 8058  H HG22 . THR A 1 67  ? 19.231  2.473   6.065   1.00 1.06  ? 67  THR A HG22 4  
ATOM 8059  H HG23 . THR A 1 67  ? 18.855  3.095   4.456   1.00 1.04  ? 67  THR A HG23 4  
ATOM 8060  N N    . VAL A 1 68  ? 14.173  1.036   4.503   1.00 0.15  ? 68  VAL A N    4  
ATOM 8061  C CA   . VAL A 1 68  ? 12.872  0.736   5.033   1.00 0.15  ? 68  VAL A CA   4  
ATOM 8062  C C    . VAL A 1 68  ? 12.946  -0.458  5.951   1.00 0.15  ? 68  VAL A C    4  
ATOM 8063  O O    . VAL A 1 68  ? 13.720  -1.380  5.731   1.00 0.17  ? 68  VAL A O    4  
ATOM 8064  C CB   . VAL A 1 68  ? 11.812  0.464   3.944   1.00 0.16  ? 68  VAL A CB   4  
ATOM 8065  C CG1  . VAL A 1 68  ? 11.508  1.728   3.160   1.00 0.18  ? 68  VAL A CG1  4  
ATOM 8066  C CG2  . VAL A 1 68  ? 12.264  -0.645  3.007   1.00 0.19  ? 68  VAL A CG2  4  
ATOM 8067  H H    . VAL A 1 68  ? 14.589  0.428   3.847   1.00 0.15  ? 68  VAL A H    4  
ATOM 8068  H HA   . VAL A 1 68  ? 12.559  1.591   5.603   1.00 0.15  ? 68  VAL A HA   4  
ATOM 8069  H HB   . VAL A 1 68  ? 10.898  0.142   4.434   1.00 0.17  ? 68  VAL A HB   4  
ATOM 8070  H HG11 . VAL A 1 68  ? 10.784  1.503   2.391   1.00 1.00  ? 68  VAL A HG11 4  
ATOM 8071  H HG12 . VAL A 1 68  ? 12.414  2.095   2.705   1.00 1.05  ? 68  VAL A HG12 4  
ATOM 8072  H HG13 . VAL A 1 68  ? 11.106  2.478   3.825   1.00 1.02  ? 68  VAL A HG13 4  
ATOM 8073  H HG21 . VAL A 1 68  ? 11.505  -0.811  2.256   1.00 1.04  ? 68  VAL A HG21 4  
ATOM 8074  H HG22 . VAL A 1 68  ? 12.417  -1.554  3.570   1.00 1.04  ? 68  VAL A HG22 4  
ATOM 8075  H HG23 . VAL A 1 68  ? 13.187  -0.358  2.527   1.00 1.02  ? 68  VAL A HG23 4  
ATOM 8076  N N    . HIS A 1 69  ? 12.159  -0.430  6.990   1.00 0.14  ? 69  HIS A N    4  
ATOM 8077  C CA   . HIS A 1 69  ? 11.993  -1.595  7.813   1.00 0.15  ? 69  HIS A CA   4  
ATOM 8078  C C    . HIS A 1 69  ? 10.670  -2.214  7.447   1.00 0.14  ? 69  HIS A C    4  
ATOM 8079  O O    . HIS A 1 69  ? 9.631   -1.603  7.648   1.00 0.15  ? 69  HIS A O    4  
ATOM 8080  C CB   . HIS A 1 69  ? 12.015  -1.247  9.317   1.00 0.15  ? 69  HIS A CB   4  
ATOM 8081  C CG   . HIS A 1 69  ? 11.749  -2.439  10.201  1.00 0.15  ? 69  HIS A CG   4  
ATOM 8082  N ND1  . HIS A 1 69  ? 12.205  -2.572  11.490  1.00 0.19  ? 69  HIS A ND1  4  
ATOM 8083  C CD2  . HIS A 1 69  ? 11.043  -3.560  9.953   1.00 0.18  ? 69  HIS A CD2  4  
ATOM 8084  C CE1  . HIS A 1 69  ? 11.777  -3.729  11.980  1.00 0.18  ? 69  HIS A CE1  4  
ATOM 8085  N NE2  . HIS A 1 69  ? 11.078  -4.338  11.066  1.00 0.18  ? 69  HIS A NE2  4  
ATOM 8086  H H    . HIS A 1 69  ? 11.668  0.394   7.205   1.00 0.14  ? 69  HIS A H    4  
ATOM 8087  H HA   . HIS A 1 69  ? 12.792  -2.288  7.587   1.00 0.16  ? 69  HIS A HA   4  
ATOM 8088  H HB2  . HIS A 1 69  ? 12.982  -0.843  9.572   1.00 0.17  ? 69  HIS A HB2  4  
ATOM 8089  H HB3  . HIS A 1 69  ? 11.255  -0.507  9.520   1.00 0.16  ? 69  HIS A HB3  4  
ATOM 8090  H HD1  . HIS A 1 69  ? 12.771  -1.919  11.976  1.00 0.27  ? 69  HIS A HD1  4  
ATOM 8091  H HD2  . HIS A 1 69  ? 10.541  -3.794  9.020   1.00 0.23  ? 69  HIS A HD2  4  
ATOM 8092  H HE1  . HIS A 1 69  ? 11.945  -4.105  12.963  1.00 0.21  ? 69  HIS A HE1  4  
ATOM 8093  H HE2  . HIS A 1 69  ? 10.480  -5.093  11.241  1.00 0.29  ? 69  HIS A HE2  4  
ATOM 8094  N N    . LEU A 1 70  ? 10.695  -3.424  6.937   1.00 0.15  ? 70  LEU A N    4  
ATOM 8095  C CA   . LEU A 1 70  ? 9.460   -4.079  6.619   1.00 0.16  ? 70  LEU A CA   4  
ATOM 8096  C C    . LEU A 1 70  ? 9.335   -5.381  7.382   1.00 0.15  ? 70  LEU A C    4  
ATOM 8097  O O    . LEU A 1 70  ? 10.285  -6.148  7.522   1.00 0.21  ? 70  LEU A O    4  
ATOM 8098  C CB   . LEU A 1 70  ? 9.293   -4.313  5.114   1.00 0.21  ? 70  LEU A CB   4  
ATOM 8099  C CG   . LEU A 1 70  ? 9.703   -5.686  4.592   1.00 0.31  ? 70  LEU A CG   4  
ATOM 8100  C CD1  . LEU A 1 70  ? 9.181   -5.886  3.176   1.00 0.39  ? 70  LEU A CD1  4  
ATOM 8101  C CD2  . LEU A 1 70  ? 11.212  -5.846  4.612   1.00 0.38  ? 70  LEU A CD2  4  
ATOM 8102  H H    . LEU A 1 70  ? 11.550  -3.892  6.805   1.00 0.18  ? 70  LEU A H    4  
ATOM 8103  H HA   . LEU A 1 70  ? 8.670   -3.422  6.948   1.00 0.15  ? 70  LEU A HA   4  
ATOM 8104  H HB2  . LEU A 1 70  ? 8.252   -4.165  4.875   1.00 0.25  ? 70  LEU A HB2  4  
ATOM 8105  H HB3  . LEU A 1 70  ? 9.873   -3.569  4.593   1.00 0.21  ? 70  LEU A HB3  4  
ATOM 8106  H HG   . LEU A 1 70  ? 9.268   -6.443  5.234   1.00 0.39  ? 70  LEU A HG   4  
ATOM 8107  H HD11 . LEU A 1 70  ? 9.600   -5.130  2.528   1.00 1.02  ? 70  LEU A HD11 4  
ATOM 8108  H HD12 . LEU A 1 70  ? 8.104   -5.805  3.177   1.00 1.09  ? 70  LEU A HD12 4  
ATOM 8109  H HD13 . LEU A 1 70  ? 9.468   -6.865  2.821   1.00 1.11  ? 70  LEU A HD13 4  
ATOM 8110  H HD21 . LEU A 1 70  ? 11.470  -6.847  4.303   1.00 1.13  ? 70  LEU A HD21 4  
ATOM 8111  H HD22 . LEU A 1 70  ? 11.579  -5.671  5.612   1.00 1.06  ? 70  LEU A HD22 4  
ATOM 8112  H HD23 . LEU A 1 70  ? 11.660  -5.134  3.934   1.00 1.10  ? 70  LEU A HD23 4  
ATOM 8113  N N    . GLN A 1 71  ? 8.171   -5.576  7.928   1.00 0.13  ? 71  GLN A N    4  
ATOM 8114  C CA   . GLN A 1 71  ? 7.770   -6.855  8.464   1.00 0.14  ? 71  GLN A CA   4  
ATOM 8115  C C    . GLN A 1 71  ? 6.469   -7.161  7.813   1.00 0.14  ? 71  GLN A C    4  
ATOM 8116  O O    . GLN A 1 71  ? 5.474   -6.457  8.002   1.00 0.14  ? 71  GLN A O    4  
ATOM 8117  C CB   . GLN A 1 71  ? 7.604   -6.848  9.970   1.00 0.15  ? 71  GLN A CB   4  
ATOM 8118  C CG   . GLN A 1 71  ? 8.497   -5.860  10.687  1.00 0.15  ? 71  GLN A CG   4  
ATOM 8119  C CD   . GLN A 1 71  ? 7.841   -4.518  10.889  1.00 0.16  ? 71  GLN A CD   4  
ATOM 8120  O OE1  . GLN A 1 71  ? 8.192   -3.778  11.806  1.00 0.27  ? 71  GLN A OE1  4  
ATOM 8121  N NE2  . GLN A 1 71  ? 6.865   -4.213  10.061  1.00 0.18  ? 71  GLN A NE2  4  
ATOM 8122  H H    . GLN A 1 71  ? 7.538   -4.830  7.948   1.00 0.15  ? 71  GLN A H    4  
ATOM 8123  H HA   . GLN A 1 71  ? 8.490   -7.609  8.171   1.00 0.14  ? 71  GLN A HA   4  
ATOM 8124  H HB2  . GLN A 1 71  ? 6.578   -6.609  10.183  1.00 0.17  ? 71  GLN A HB2  4  
ATOM 8125  H HB3  . GLN A 1 71  ? 7.824   -7.832  10.351  1.00 0.17  ? 71  GLN A HB3  4  
ATOM 8126  H HG2  . GLN A 1 71  ? 8.761   -6.264  11.650  1.00 0.20  ? 71  GLN A HG2  4  
ATOM 8127  H HG3  . GLN A 1 71  ? 9.394   -5.719  10.102  1.00 0.15  ? 71  GLN A HG3  4  
ATOM 8128  H HE21 . GLN A 1 71  ? 6.611   -4.868  9.370   1.00 0.26  ? 71  GLN A HE21 4  
ATOM 8129  H HE22 . GLN A 1 71  ? 6.445   -3.338  10.155  1.00 0.18  ? 71  GLN A HE22 4  
ATOM 8130  N N    . THR A 1 72  ? 6.497   -8.178  7.025   1.00 0.15  ? 72  THR A N    4  
ATOM 8131  C CA   . THR A 1 72  ? 5.458   -8.414  6.088   1.00 0.16  ? 72  THR A CA   4  
ATOM 8132  C C    . THR A 1 72  ? 4.582   -9.557  6.528   1.00 0.16  ? 72  THR A C    4  
ATOM 8133  O O    . THR A 1 72  ? 5.063   -10.665 6.762   1.00 0.17  ? 72  THR A O    4  
ATOM 8134  C CB   . THR A 1 72  ? 6.079   -8.717  4.736   1.00 0.17  ? 72  THR A CB   4  
ATOM 8135  O OG1  . THR A 1 72  ? 6.944   -7.643  4.358   1.00 0.19  ? 72  THR A OG1  4  
ATOM 8136  C CG2  . THR A 1 72  ? 5.017   -8.908  3.691   1.00 0.19  ? 72  THR A CG2  4  
ATOM 8137  H H    . THR A 1 72  ? 7.252   -8.801  7.079   1.00 0.17  ? 72  THR A H    4  
ATOM 8138  H HA   . THR A 1 72  ? 4.866   -7.514  6.005   1.00 0.17  ? 72  THR A HA   4  
ATOM 8139  H HB   . THR A 1 72  ? 6.655   -9.622  4.825   1.00 0.18  ? 72  THR A HB   4  
ATOM 8140  H HG1  . THR A 1 72  ? 7.603   -7.960  3.734   1.00 0.55  ? 72  THR A HG1  4  
ATOM 8141  H HG21 . THR A 1 72  ? 5.483   -9.077  2.732   1.00 1.04  ? 72  THR A HG21 4  
ATOM 8142  H HG22 . THR A 1 72  ? 4.405   -8.020  3.649   1.00 1.00  ? 72  THR A HG22 4  
ATOM 8143  H HG23 . THR A 1 72  ? 4.407   -9.757  3.955   1.00 1.00  ? 72  THR A HG23 4  
ATOM 8144  N N    . SER A 1 73  ? 3.305   -9.286  6.643   1.00 0.17  ? 73  SER A N    4  
ATOM 8145  C CA   . SER A 1 73  ? 2.367   -10.274 7.080   1.00 0.17  ? 73  SER A CA   4  
ATOM 8146  C C    . SER A 1 73  ? 1.567   -10.767 5.896   1.00 0.15  ? 73  SER A C    4  
ATOM 8147  O O    . SER A 1 73  ? 1.652   -10.222 4.793   1.00 0.26  ? 73  SER A O    4  
ATOM 8148  C CB   . SER A 1 73  ? 1.437   -9.675  8.129   1.00 0.23  ? 73  SER A CB   4  
ATOM 8149  O OG   . SER A 1 73  ? 2.025   -8.531  8.731   1.00 1.06  ? 73  SER A OG   4  
ATOM 8150  H H    . SER A 1 73  ? 2.974   -8.392  6.404   1.00 0.20  ? 73  SER A H    4  
ATOM 8151  H HA   . SER A 1 73  ? 2.914   -11.101 7.510   1.00 0.18  ? 73  SER A HA   4  
ATOM 8152  H HB2  . SER A 1 73  ? 0.506   -9.377  7.654   1.00 0.96  ? 73  SER A HB2  4  
ATOM 8153  H HB3  . SER A 1 73  ? 1.236   -10.410 8.895   1.00 1.03  ? 73  SER A HB3  4  
ATOM 8154  H HG   . SER A 1 73  ? 2.041   -7.812  8.087   1.00 1.54  ? 73  SER A HG   4  
ATOM 8155  N N    . LEU A 1 74  ? 0.805   -11.799 6.126   1.00 0.19  ? 74  LEU A N    4  
ATOM 8156  C CA   . LEU A 1 74  ? -0.040  -12.360 5.115   1.00 0.18  ? 74  LEU A CA   4  
ATOM 8157  C C    . LEU A 1 74  ? -1.439  -11.814 5.276   1.00 0.19  ? 74  LEU A C    4  
ATOM 8158  O O    . LEU A 1 74  ? -1.756  -11.232 6.313   1.00 0.21  ? 74  LEU A O    4  
ATOM 8159  C CB   . LEU A 1 74  ? -0.028  -13.880 5.231   1.00 0.22  ? 74  LEU A CB   4  
ATOM 8160  C CG   . LEU A 1 74  ? 1.280   -14.547 4.817   1.00 0.38  ? 74  LEU A CG   4  
ATOM 8161  C CD1  . LEU A 1 74  ? 1.075   -16.036 4.578   1.00 0.84  ? 74  LEU A CD1  4  
ATOM 8162  C CD2  . LEU A 1 74  ? 1.845   -13.867 3.583   1.00 0.72  ? 74  LEU A CD2  4  
ATOM 8163  H H    . LEU A 1 74  ? 0.816   -12.204 7.015   1.00 0.34  ? 74  LEU A H    4  
ATOM 8164  H HA   . LEU A 1 74  ? 0.347   -12.068 4.151   1.00 0.18  ? 74  LEU A HA   4  
ATOM 8165  H HB2  . LEU A 1 74  ? -0.218  -14.135 6.264   1.00 0.30  ? 74  LEU A HB2  4  
ATOM 8166  H HB3  . LEU A 1 74  ? -0.821  -14.278 4.632   1.00 0.20  ? 74  LEU A HB3  4  
ATOM 8167  H HG   . LEU A 1 74  ? 1.999   -14.434 5.617   1.00 0.97  ? 74  LEU A HG   4  
ATOM 8168  H HD11 . LEU A 1 74  ? 0.727   -16.502 5.487   1.00 1.51  ? 74  LEU A HD11 4  
ATOM 8169  H HD12 . LEU A 1 74  ? 2.011   -16.487 4.276   1.00 1.44  ? 74  LEU A HD12 4  
ATOM 8170  H HD13 . LEU A 1 74  ? 0.341   -16.177 3.799   1.00 1.32  ? 74  LEU A HD13 4  
ATOM 8171  H HD21 . LEU A 1 74  ? 2.088   -12.838 3.820   1.00 1.44  ? 74  LEU A HD21 4  
ATOM 8172  H HD22 . LEU A 1 74  ? 1.107   -13.890 2.794   1.00 1.33  ? 74  LEU A HD22 4  
ATOM 8173  H HD23 . LEU A 1 74  ? 2.737   -14.382 3.261   1.00 1.28  ? 74  LEU A HD23 4  
ATOM 8174  N N    . GLU A 1 75  ? -2.271  -11.990 4.261   1.00 0.21  ? 75  GLU A N    4  
ATOM 8175  C CA   . GLU A 1 75  ? -3.655  -11.542 4.331   1.00 0.26  ? 75  GLU A CA   4  
ATOM 8176  C C    . GLU A 1 75  ? -4.382  -12.215 5.491   1.00 0.32  ? 75  GLU A C    4  
ATOM 8177  O O    . GLU A 1 75  ? -5.436  -11.755 5.926   1.00 0.39  ? 75  GLU A O    4  
ATOM 8178  C CB   . GLU A 1 75  ? -4.385  -11.814 3.015   1.00 0.30  ? 75  GLU A CB   4  
ATOM 8179  C CG   . GLU A 1 75  ? -4.420  -13.276 2.601   1.00 0.34  ? 75  GLU A CG   4  
ATOM 8180  C CD   . GLU A 1 75  ? -5.153  -13.484 1.290   1.00 0.67  ? 75  GLU A CD   4  
ATOM 8181  O OE1  . GLU A 1 75  ? -6.400  -13.572 1.304   1.00 1.14  ? 75  GLU A OE1  4  
ATOM 8182  O OE2  . GLU A 1 75  ? -4.485  -13.554 0.236   1.00 0.82  ? 75  GLU A OE2  4  
ATOM 8183  H H    . GLU A 1 75  ? -1.943  -12.404 3.434   1.00 0.21  ? 75  GLU A H    4  
ATOM 8184  H HA   . GLU A 1 75  ? -3.638  -10.475 4.502   1.00 0.27  ? 75  GLU A HA   4  
ATOM 8185  H HB2  . GLU A 1 75  ? -5.404  -11.471 3.110   1.00 0.37  ? 75  GLU A HB2  4  
ATOM 8186  H HB3  . GLU A 1 75  ? -3.899  -11.253 2.233   1.00 0.29  ? 75  GLU A HB3  4  
ATOM 8187  H HG2  . GLU A 1 75  ? -3.405  -13.633 2.495   1.00 0.47  ? 75  GLU A HG2  4  
ATOM 8188  H HG3  . GLU A 1 75  ? -4.922  -13.841 3.372   1.00 0.54  ? 75  GLU A HG3  4  
ATOM 8189  N N    . ASN A 1 76  ? -3.801  -13.303 6.004   1.00 0.34  ? 76  ASN A N    4  
ATOM 8190  C CA   . ASN A 1 76  ? -4.390  -14.019 7.127   1.00 0.41  ? 76  ASN A CA   4  
ATOM 8191  C C    . ASN A 1 76  ? -3.784  -13.550 8.453   1.00 0.39  ? 76  ASN A C    4  
ATOM 8192  O O    . ASN A 1 76  ? -4.334  -13.820 9.519   1.00 0.51  ? 76  ASN A O    4  
ATOM 8193  C CB   . ASN A 1 76  ? -4.210  -15.536 6.968   1.00 0.50  ? 76  ASN A CB   4  
ATOM 8194  C CG   . ASN A 1 76  ? -2.770  -15.991 7.121   1.00 1.13  ? 76  ASN A CG   4  
ATOM 8195  O OD1  . ASN A 1 76  ? -2.280  -16.168 8.230   1.00 2.14  ? 76  ASN A OD1  4  
ATOM 8196  N ND2  . ASN A 1 76  ? -2.092  -16.222 6.008   1.00 1.13  ? 76  ASN A ND2  4  
ATOM 8197  H H    . ASN A 1 76  ? -2.957  -13.619 5.619   1.00 0.32  ? 76  ASN A H    4  
ATOM 8198  H HA   . ASN A 1 76  ? -5.445  -13.795 7.137   1.00 0.47  ? 76  ASN A HA   4  
ATOM 8199  H HB2  . ASN A 1 76  ? -4.808  -16.044 7.710   1.00 1.21  ? 76  ASN A HB2  4  
ATOM 8200  H HB3  . ASN A 1 76  ? -4.549  -15.823 5.984   1.00 1.00  ? 76  ASN A HB3  4  
ATOM 8201  H HD21 . ASN A 1 76  ? -2.547  -16.091 5.151   1.00 0.98  ? 76  ASN A HD21 4  
ATOM 8202  H HD22 . ASN A 1 76  ? -1.167  -16.536 6.091   1.00 1.79  ? 76  ASN A HD22 4  
ATOM 8203  N N    . GLY A 1 77  ? -2.661  -12.838 8.381   1.00 0.30  ? 77  GLY A N    4  
ATOM 8204  C CA   . GLY A 1 77  ? -2.037  -12.317 9.588   1.00 0.32  ? 77  GLY A CA   4  
ATOM 8205  C C    . GLY A 1 77  ? -0.599  -12.777 9.788   1.00 0.32  ? 77  GLY A C    4  
ATOM 8206  O O    . GLY A 1 77  ? 0.177   -12.110 10.471  1.00 0.51  ? 77  GLY A O    4  
ATOM 8207  H H    . GLY A 1 77  ? -2.273  -12.639 7.505   1.00 0.27  ? 77  GLY A H    4  
ATOM 8208  H HA2  . GLY A 1 77  ? -2.050  -11.237 9.543   1.00 0.32  ? 77  GLY A HA2  4  
ATOM 8209  H HA3  . GLY A 1 77  ? -2.620  -12.634 10.439  1.00 0.38  ? 77  GLY A HA3  4  
ATOM 8210  N N    . THR A 1 78  ? -0.241  -13.914 9.204   1.00 0.28  ? 78  THR A N    4  
ATOM 8211  C CA   . THR A 1 78  ? 1.085   -14.499 9.405   1.00 0.28  ? 78  THR A CA   4  
ATOM 8212  C C    . THR A 1 78  ? 2.201   -13.661 8.788   1.00 0.23  ? 78  THR A C    4  
ATOM 8213  O O    . THR A 1 78  ? 2.270   -13.502 7.575   1.00 0.21  ? 78  THR A O    4  
ATOM 8214  C CB   . THR A 1 78  ? 1.148   -15.931 8.840   1.00 0.34  ? 78  THR A CB   4  
ATOM 8215  O OG1  . THR A 1 78  ? 0.136   -16.733 9.458   1.00 0.46  ? 78  THR A OG1  4  
ATOM 8216  C CG2  . THR A 1 78  ? 2.512   -16.563 9.086   1.00 0.39  ? 78  THR A CG2  4  
ATOM 8217  H H    . THR A 1 78  ? -0.888  -14.384 8.642   1.00 0.39  ? 78  THR A H    4  
ATOM 8218  H HA   . THR A 1 78  ? 1.252   -14.555 10.457  1.00 0.32  ? 78  THR A HA   4  
ATOM 8219  H HB   . THR A 1 78  ? 0.969   -15.891 7.774   1.00 0.33  ? 78  THR A HB   4  
ATOM 8220  H HG1  . THR A 1 78  ? 0.222   -16.676 10.423  1.00 0.91  ? 78  THR A HG1  4  
ATOM 8221  H HG21 . THR A 1 78  ? 2.687   -16.632 10.149  1.00 1.16  ? 78  THR A HG21 4  
ATOM 8222  H HG22 . THR A 1 78  ? 3.279   -15.952 8.634   1.00 1.12  ? 78  THR A HG22 4  
ATOM 8223  H HG23 . THR A 1 78  ? 2.536   -17.551 8.650   1.00 0.98  ? 78  THR A HG23 4  
ATOM 8224  N N    . ARG A 1 79  ? 3.072   -13.125 9.635   1.00 0.24  ? 79  ARG A N    4  
ATOM 8225  C CA   . ARG A 1 79  ? 4.226   -12.373 9.164   1.00 0.22  ? 79  ARG A CA   4  
ATOM 8226  C C    . ARG A 1 79  ? 5.312   -13.314 8.682   1.00 0.24  ? 79  ARG A C    4  
ATOM 8227  O O    . ARG A 1 79  ? 5.846   -14.120 9.437   1.00 0.33  ? 79  ARG A O    4  
ATOM 8228  C CB   . ARG A 1 79  ? 4.750   -11.442 10.246  1.00 0.25  ? 79  ARG A CB   4  
ATOM 8229  C CG   . ARG A 1 79  ? 3.815   -10.281 10.500  1.00 0.25  ? 79  ARG A CG   4  
ATOM 8230  C CD   . ARG A 1 79  ? 4.574   -9.061  10.982  1.00 0.28  ? 79  ARG A CD   4  
ATOM 8231  N NE   . ARG A 1 79  ? 3.744   -7.853  10.983  1.00 0.33  ? 79  ARG A NE   4  
ATOM 8232  C CZ   . ARG A 1 79  ? 4.139   -6.677  11.491  1.00 0.38  ? 79  ARG A CZ   4  
ATOM 8233  N NH1  . ARG A 1 79  ? 5.303   -6.580  12.111  1.00 0.42  ? 79  ARG A NH1  4  
ATOM 8234  N NH2  . ARG A 1 79  ? 3.362   -5.605  11.394  1.00 0.47  ? 79  ARG A NH2  4  
ATOM 8235  H H    . ARG A 1 79  ? 2.941   -13.251 10.599  1.00 0.27  ? 79  ARG A H    4  
ATOM 8236  H HA   . ARG A 1 79  ? 3.909   -11.769 8.323   1.00 0.19  ? 79  ARG A HA   4  
ATOM 8237  H HB2  . ARG A 1 79  ? 4.868   -11.996 11.165  1.00 0.29  ? 79  ARG A HB2  4  
ATOM 8238  H HB3  . ARG A 1 79  ? 5.706   -11.047 9.941   1.00 0.25  ? 79  ARG A HB3  4  
ATOM 8239  H HG2  . ARG A 1 79  ? 3.301   -10.037 9.579   1.00 0.23  ? 79  ARG A HG2  4  
ATOM 8240  H HG3  . ARG A 1 79  ? 3.093   -10.572 11.248  1.00 0.29  ? 79  ARG A HG3  4  
ATOM 8241  H HD2  . ARG A 1 79  ? 4.923   -9.249  11.987  1.00 0.34  ? 79  ARG A HD2  4  
ATOM 8242  H HD3  . ARG A 1 79  ? 5.424   -8.905  10.325  1.00 0.31  ? 79  ARG A HD3  4  
ATOM 8243  H HE   . ARG A 1 79  ? 2.858   -7.921  10.555  1.00 0.39  ? 79  ARG A HE   4  
ATOM 8244  H HH11 . ARG A 1 79  ? 5.898   -7.388  12.204  1.00 0.43  ? 79  ARG A HH11 4  
ATOM 8245  H HH12 . ARG A 1 79  ? 5.600   -5.698  12.493  1.00 0.49  ? 79  ARG A HH12 4  
ATOM 8246  H HH21 . ARG A 1 79  ? 2.474   -5.662  10.943  1.00 0.54  ? 79  ARG A HH21 4  
ATOM 8247  H HH22 . ARG A 1 79  ? 3.679   -4.713  11.769  1.00 0.51  ? 79  ARG A HH22 4  
ATOM 8248  N N    . VAL A 1 80  ? 5.625   -13.184 7.412   1.00 0.20  ? 80  VAL A N    4  
ATOM 8249  C CA   . VAL A 1 80  ? 6.492   -14.119 6.724   1.00 0.22  ? 80  VAL A CA   4  
ATOM 8250  C C    . VAL A 1 80  ? 7.931   -13.630 6.670   1.00 0.21  ? 80  VAL A C    4  
ATOM 8251  O O    . VAL A 1 80  ? 8.827   -14.366 6.254   1.00 0.27  ? 80  VAL A O    4  
ATOM 8252  C CB   . VAL A 1 80  ? 5.985   -14.357 5.294   1.00 0.23  ? 80  VAL A CB   4  
ATOM 8253  C CG1  . VAL A 1 80  ? 4.589   -14.952 5.330   1.00 0.26  ? 80  VAL A CG1  4  
ATOM 8254  C CG2  . VAL A 1 80  ? 6.004   -13.064 4.484   1.00 0.22  ? 80  VAL A CG2  4  
ATOM 8255  H H    . VAL A 1 80  ? 5.259   -12.420 6.914   1.00 0.20  ? 80  VAL A H    4  
ATOM 8256  H HA   . VAL A 1 80  ? 6.456   -15.060 7.253   1.00 0.26  ? 80  VAL A HA   4  
ATOM 8257  H HB   . VAL A 1 80  ? 6.639   -15.064 4.816   1.00 0.27  ? 80  VAL A HB   4  
ATOM 8258  H HG11 . VAL A 1 80  ? 4.608   -15.880 5.880   1.00 0.98  ? 80  VAL A HG11 4  
ATOM 8259  H HG12 . VAL A 1 80  ? 4.250   -15.137 4.322   1.00 1.06  ? 80  VAL A HG12 4  
ATOM 8260  H HG13 . VAL A 1 80  ? 3.915   -14.258 5.814   1.00 1.01  ? 80  VAL A HG13 4  
ATOM 8261  H HG21 . VAL A 1 80  ? 7.014   -12.678 4.445   1.00 0.95  ? 80  VAL A HG21 4  
ATOM 8262  H HG22 . VAL A 1 80  ? 5.359   -12.333 4.949   1.00 1.01  ? 80  VAL A HG22 4  
ATOM 8263  H HG23 . VAL A 1 80  ? 5.657   -13.262 3.482   1.00 1.03  ? 80  VAL A HG23 4  
ATOM 8264  N N    . GLN A 1 81  ? 8.146   -12.386 7.070   1.00 0.18  ? 81  GLN A N    4  
ATOM 8265  C CA   . GLN A 1 81  ? 9.470   -11.796 7.011   1.00 0.19  ? 81  GLN A CA   4  
ATOM 8266  C C    . GLN A 1 81  ? 9.537   -10.526 7.851   1.00 0.19  ? 81  GLN A C    4  
ATOM 8267  O O    . GLN A 1 81  ? 8.678   -9.653  7.732   1.00 0.26  ? 81  GLN A O    4  
ATOM 8268  C CB   . GLN A 1 81  ? 9.847   -11.499 5.550   1.00 0.23  ? 81  GLN A CB   4  
ATOM 8269  C CG   . GLN A 1 81  ? 8.929   -10.500 4.853   1.00 0.23  ? 81  GLN A CG   4  
ATOM 8270  C CD   . GLN A 1 81  ? 9.238   -10.357 3.379   1.00 0.37  ? 81  GLN A CD   4  
ATOM 8271  O OE1  . GLN A 1 81  ? 10.106  -9.584  2.978   1.00 0.59  ? 81  GLN A OE1  4  
ATOM 8272  N NE2  . GLN A 1 81  ? 8.500   -11.093 2.564   1.00 0.50  ? 81  GLN A NE2  4  
ATOM 8273  H H    . GLN A 1 81  ? 7.397   -11.858 7.421   1.00 0.17  ? 81  GLN A H    4  
ATOM 8274  H HA   . GLN A 1 81  ? 10.171  -12.515 7.412   1.00 0.21  ? 81  GLN A HA   4  
ATOM 8275  H HB2  . GLN A 1 81  ? 10.852  -11.108 5.524   1.00 0.26  ? 81  GLN A HB2  4  
ATOM 8276  H HB3  . GLN A 1 81  ? 9.815   -12.422 4.993   1.00 0.24  ? 81  GLN A HB3  4  
ATOM 8277  H HG2  . GLN A 1 81  ? 7.909   -10.849 4.943   1.00 0.20  ? 81  GLN A HG2  4  
ATOM 8278  H HG3  . GLN A 1 81  ? 9.025   -9.534  5.327   1.00 0.25  ? 81  GLN A HG3  4  
ATOM 8279  H HE21 . GLN A 1 81  ? 7.818   -11.672 2.958   1.00 0.63  ? 81  GLN A HE21 4  
ATOM 8280  H HE22 . GLN A 1 81  ? 8.664   -11.028 1.601   1.00 0.59  ? 81  GLN A HE22 4  
ATOM 8281  N N    . GLU A 1 82  ? 10.535  -10.443 8.719   1.00 0.24  ? 82  GLU A N    4  
ATOM 8282  C CA   . GLU A 1 82  ? 10.793  -9.222  9.467   1.00 0.24  ? 82  GLU A CA   4  
ATOM 8283  C C    . GLU A 1 82  ? 12.214  -8.752  9.192   1.00 0.25  ? 82  GLU A C    4  
ATOM 8284  O O    . GLU A 1 82  ? 13.184  -9.380  9.609   1.00 0.41  ? 82  GLU A O    4  
ATOM 8285  C CB   . GLU A 1 82  ? 10.574  -9.408  10.973  1.00 0.35  ? 82  GLU A CB   4  
ATOM 8286  C CG   . GLU A 1 82  ? 10.886  -8.154  11.771  1.00 0.44  ? 82  GLU A CG   4  
ATOM 8287  C CD   . GLU A 1 82  ? 10.394  -8.218  13.199  1.00 0.82  ? 82  GLU A CD   4  
ATOM 8288  O OE1  . GLU A 1 82  ? 11.078  -8.822  14.048  1.00 1.21  ? 82  GLU A OE1  4  
ATOM 8289  O OE2  . GLU A 1 82  ? 9.319   -7.642  13.479  1.00 1.34  ? 82  GLU A OE2  4  
ATOM 8290  H H    . GLU A 1 82  ? 11.125  -11.223 8.856   1.00 0.35  ? 82  GLU A H    4  
ATOM 8291  H HA   . GLU A 1 82  ? 10.107  -8.468  9.105   1.00 0.24  ? 82  GLU A HA   4  
ATOM 8292  H HB2  . GLU A 1 82  ? 9.544   -9.680  11.154  1.00 0.43  ? 82  GLU A HB2  4  
ATOM 8293  H HB3  . GLU A 1 82  ? 11.216  -10.194 11.325  1.00 0.37  ? 82  GLU A HB3  4  
ATOM 8294  H HG2  . GLU A 1 82  ? 11.957  -8.012  11.784  1.00 0.68  ? 82  GLU A HG2  4  
ATOM 8295  H HG3  . GLU A 1 82  ? 10.421  -7.315  11.282  1.00 0.57  ? 82  GLU A HG3  4  
ATOM 8296  N N    . GLU A 1 83  ? 12.321  -7.657  8.467   1.00 0.22  ? 83  GLU A N    4  
ATOM 8297  C CA   . GLU A 1 83  ? 13.607  -7.116  8.078   1.00 0.26  ? 83  GLU A CA   4  
ATOM 8298  C C    . GLU A 1 83  ? 13.723  -5.662  8.512   1.00 0.23  ? 83  GLU A C    4  
ATOM 8299  O O    . GLU A 1 83  ? 12.992  -4.789  8.039   1.00 0.24  ? 83  GLU A O    4  
ATOM 8300  C CB   . GLU A 1 83  ? 13.783  -7.298  6.568   1.00 0.39  ? 83  GLU A CB   4  
ATOM 8301  C CG   . GLU A 1 83  ? 14.765  -6.352  5.902   1.00 1.20  ? 83  GLU A CG   4  
ATOM 8302  C CD   . GLU A 1 83  ? 15.144  -6.835  4.519   1.00 1.73  ? 83  GLU A CD   4  
ATOM 8303  O OE1  . GLU A 1 83  ? 14.337  -6.670  3.581   1.00 2.59  ? 83  GLU A OE1  4  
ATOM 8304  O OE2  . GLU A 1 83  ? 16.264  -7.353  4.355   1.00 1.69  ? 83  GLU A OE2  4  
ATOM 8305  H H    . GLU A 1 83  ? 11.503  -7.193  8.175   1.00 0.26  ? 83  GLU A H    4  
ATOM 8306  H HA   . GLU A 1 83  ? 14.366  -7.683  8.597   1.00 0.31  ? 83  GLU A HA   4  
ATOM 8307  H HB2  . GLU A 1 83  ? 14.116  -8.305  6.381   1.00 1.15  ? 83  GLU A HB2  4  
ATOM 8308  H HB3  . GLU A 1 83  ? 12.822  -7.162  6.097   1.00 1.13  ? 83  GLU A HB3  4  
ATOM 8309  H HG2  . GLU A 1 83  ? 14.299  -5.379  5.817   1.00 1.73  ? 83  GLU A HG2  4  
ATOM 8310  H HG3  . GLU A 1 83  ? 15.655  -6.279  6.502   1.00 1.68  ? 83  GLU A HG3  4  
ATOM 8311  N N    . PRO A 1 84  ? 14.641  -5.401  9.454   1.00 0.23  ? 84  PRO A N    4  
ATOM 8312  C CA   . PRO A 1 84  ? 14.773  -4.098  10.109  1.00 0.21  ? 84  PRO A CA   4  
ATOM 8313  C C    . PRO A 1 84  ? 15.337  -3.018  9.201   1.00 0.19  ? 84  PRO A C    4  
ATOM 8314  O O    . PRO A 1 84  ? 15.222  -1.826  9.500   1.00 0.20  ? 84  PRO A O    4  
ATOM 8315  C CB   . PRO A 1 84  ? 15.736  -4.373  11.262  1.00 0.25  ? 84  PRO A CB   4  
ATOM 8316  C CG   . PRO A 1 84  ? 16.541  -5.543  10.815  1.00 0.50  ? 84  PRO A CG   4  
ATOM 8317  C CD   . PRO A 1 84  ? 15.629  -6.375  9.959   1.00 0.31  ? 84  PRO A CD   4  
ATOM 8318  H HA   . PRO A 1 84  ? 13.825  -3.764  10.507  1.00 0.20  ? 84  PRO A HA   4  
ATOM 8319  H HB2  . PRO A 1 84  ? 16.356  -3.506  11.430  1.00 0.45  ? 84  PRO A HB2  4  
ATOM 8320  H HB3  . PRO A 1 84  ? 15.175  -4.600  12.157  1.00 0.41  ? 84  PRO A HB3  4  
ATOM 8321  H HG2  . PRO A 1 84  ? 17.390  -5.205  10.239  1.00 0.90  ? 84  PRO A HG2  4  
ATOM 8322  H HG3  . PRO A 1 84  ? 16.869  -6.111  11.673  1.00 0.88  ? 84  PRO A HG3  4  
ATOM 8323  H HD2  . PRO A 1 84  ? 16.178  -6.822  9.146   1.00 0.47  ? 84  PRO A HD2  4  
ATOM 8324  H HD3  . PRO A 1 84  ? 15.147  -7.135  10.554  1.00 0.50  ? 84  PRO A HD3  4  
ATOM 8325  N N    . GLU A 1 85  ? 15.933  -3.422  8.090   1.00 0.20  ? 85  GLU A N    4  
ATOM 8326  C CA   . GLU A 1 85  ? 16.547  -2.465  7.192   1.00 0.22  ? 85  GLU A CA   4  
ATOM 8327  C C    . GLU A 1 85  ? 16.799  -3.050  5.827   1.00 0.24  ? 85  GLU A C    4  
ATOM 8328  O O    . GLU A 1 85  ? 17.661  -3.902  5.629   1.00 0.35  ? 85  GLU A O    4  
ATOM 8329  C CB   . GLU A 1 85  ? 17.838  -1.922  7.789   1.00 0.31  ? 85  GLU A CB   4  
ATOM 8330  C CG   . GLU A 1 85  ? 18.452  -0.796  6.982   1.00 0.34  ? 85  GLU A CG   4  
ATOM 8331  C CD   . GLU A 1 85  ? 19.453  -0.011  7.787   1.00 0.90  ? 85  GLU A CD   4  
ATOM 8332  O OE1  . GLU A 1 85  ? 19.041  0.868   8.567   1.00 1.37  ? 85  GLU A OE1  4  
ATOM 8333  O OE2  . GLU A 1 85  ? 20.663  -0.272  7.630   1.00 1.30  ? 85  GLU A OE2  4  
ATOM 8334  H H    . GLU A 1 85  ? 15.948  -4.377  7.865   1.00 0.23  ? 85  GLU A H    4  
ATOM 8335  H HA   . GLU A 1 85  ? 15.851  -1.648  7.062   1.00 0.23  ? 85  GLU A HA   4  
ATOM 8336  H HB2  . GLU A 1 85  ? 17.634  -1.554  8.785   1.00 0.43  ? 85  GLU A HB2  4  
ATOM 8337  H HB3  . GLU A 1 85  ? 18.558  -2.724  7.853   1.00 0.36  ? 85  GLU A HB3  4  
ATOM 8338  H HG2  . GLU A 1 85  ? 18.949  -1.214  6.119   1.00 0.68  ? 85  GLU A HG2  4  
ATOM 8339  H HG3  . GLU A 1 85  ? 17.665  -0.130  6.660   1.00 0.66  ? 85  GLU A HG3  4  
ATOM 8340  N N    . LEU A 1 86  ? 16.004  -2.568  4.908   1.00 0.23  ? 86  LEU A N    4  
ATOM 8341  C CA   . LEU A 1 86  ? 16.113  -2.883  3.517   1.00 0.24  ? 86  LEU A CA   4  
ATOM 8342  C C    . LEU A 1 86  ? 16.394  -1.604  2.748   1.00 0.23  ? 86  LEU A C    4  
ATOM 8343  O O    . LEU A 1 86  ? 15.521  -0.747  2.611   1.00 0.25  ? 86  LEU A O    4  
ATOM 8344  C CB   . LEU A 1 86  ? 14.808  -3.515  3.054   1.00 0.26  ? 86  LEU A CB   4  
ATOM 8345  C CG   . LEU A 1 86  ? 14.711  -3.802  1.568   1.00 0.33  ? 86  LEU A CG   4  
ATOM 8346  C CD1  . LEU A 1 86  ? 15.865  -4.673  1.103   1.00 0.38  ? 86  LEU A CD1  4  
ATOM 8347  C CD2  . LEU A 1 86  ? 13.382  -4.470  1.255   1.00 0.38  ? 86  LEU A CD2  4  
ATOM 8348  H H    . LEU A 1 86  ? 15.281  -1.965  5.187   1.00 0.29  ? 86  LEU A H    4  
ATOM 8349  H HA   . LEU A 1 86  ? 16.925  -3.580  3.379   1.00 0.26  ? 86  LEU A HA   4  
ATOM 8350  H HB2  . LEU A 1 86  ? 14.670  -4.438  3.588   1.00 0.27  ? 86  LEU A HB2  4  
ATOM 8351  H HB3  . LEU A 1 86  ? 14.002  -2.849  3.318   1.00 0.27  ? 86  LEU A HB3  4  
ATOM 8352  H HG   . LEU A 1 86  ? 14.755  -2.864  1.040   1.00 0.35  ? 86  LEU A HG   4  
ATOM 8353  H HD11 . LEU A 1 86  ? 15.774  -4.851  0.043   1.00 1.08  ? 86  LEU A HD11 4  
ATOM 8354  H HD12 . LEU A 1 86  ? 15.840  -5.615  1.631   1.00 1.14  ? 86  LEU A HD12 4  
ATOM 8355  H HD13 . LEU A 1 86  ? 16.800  -4.171  1.305   1.00 1.05  ? 86  LEU A HD13 4  
ATOM 8356  H HD21 . LEU A 1 86  ? 13.356  -4.747  0.213   1.00 1.08  ? 86  LEU A HD21 4  
ATOM 8357  H HD22 . LEU A 1 86  ? 12.576  -3.784  1.465   1.00 1.04  ? 86  LEU A HD22 4  
ATOM 8358  H HD23 . LEU A 1 86  ? 13.274  -5.354  1.869   1.00 0.99  ? 86  LEU A HD23 4  
ATOM 8359  N N    . VAL A 1 87  ? 17.624  -1.452  2.301   1.00 0.24  ? 87  VAL A N    4  
ATOM 8360  C CA   . VAL A 1 87  ? 18.006  -0.273  1.547   1.00 0.22  ? 87  VAL A CA   4  
ATOM 8361  C C    . VAL A 1 87  ? 18.021  -0.595  0.053   1.00 0.21  ? 87  VAL A C    4  
ATOM 8362  O O    . VAL A 1 87  ? 18.589  -1.607  -0.371  1.00 0.28  ? 87  VAL A O    4  
ATOM 8363  C CB   . VAL A 1 87  ? 19.385  0.267   2.002   1.00 0.27  ? 87  VAL A CB   4  
ATOM 8364  C CG1  . VAL A 1 87  ? 20.493  -0.741  1.744   1.00 1.00  ? 87  VAL A CG1  4  
ATOM 8365  C CG2  . VAL A 1 87  ? 19.701  1.590   1.326   1.00 0.94  ? 87  VAL A CG2  4  
ATOM 8366  H H    . VAL A 1 87  ? 18.290  -2.150  2.477   1.00 0.29  ? 87  VAL A H    4  
ATOM 8367  H HA   . VAL A 1 87  ? 17.260  0.498   1.739   1.00 0.20  ? 87  VAL A HA   4  
ATOM 8368  H HB   . VAL A 1 87  ? 19.338  0.442   3.066   1.00 0.79  ? 87  VAL A HB   4  
ATOM 8369  H HG11 . VAL A 1 87  ? 21.435  -0.332  2.075   1.00 1.46  ? 87  VAL A HG11 4  
ATOM 8370  H HG12 . VAL A 1 87  ? 20.542  -0.951  0.685   1.00 1.48  ? 87  VAL A HG12 4  
ATOM 8371  H HG13 . VAL A 1 87  ? 20.283  -1.652  2.284   1.00 1.59  ? 87  VAL A HG13 4  
ATOM 8372  H HG21 . VAL A 1 87  ? 20.685  1.919   1.627   1.00 1.54  ? 87  VAL A HG21 4  
ATOM 8373  H HG22 . VAL A 1 87  ? 18.969  2.328   1.620   1.00 1.50  ? 87  VAL A HG22 4  
ATOM 8374  H HG23 . VAL A 1 87  ? 19.675  1.462   0.253   1.00 1.54  ? 87  VAL A HG23 4  
ATOM 8375  N N    . PHE A 1 88  ? 17.381  0.245   -0.739  1.00 0.17  ? 88  PHE A N    4  
ATOM 8376  C CA   . PHE A 1 88  ? 17.254  -0.002  -2.171  1.00 0.19  ? 88  PHE A CA   4  
ATOM 8377  C C    . PHE A 1 88  ? 17.136  1.304   -2.928  1.00 0.20  ? 88  PHE A C    4  
ATOM 8378  O O    . PHE A 1 88  ? 16.755  2.327   -2.360  1.00 0.23  ? 88  PHE A O    4  
ATOM 8379  C CB   . PHE A 1 88  ? 16.024  -0.866  -2.451  1.00 0.21  ? 88  PHE A CB   4  
ATOM 8380  C CG   . PHE A 1 88  ? 14.729  -0.193  -2.118  1.00 0.18  ? 88  PHE A CG   4  
ATOM 8381  C CD1  . PHE A 1 88  ? 14.300  -0.109  -0.805  1.00 0.19  ? 88  PHE A CD1  4  
ATOM 8382  C CD2  . PHE A 1 88  ? 13.943  0.350   -3.117  1.00 0.17  ? 88  PHE A CD2  4  
ATOM 8383  C CE1  . PHE A 1 88  ? 13.111  0.516   -0.494  1.00 0.17  ? 88  PHE A CE1  4  
ATOM 8384  C CE2  . PHE A 1 88  ? 12.758  0.975   -2.818  1.00 0.16  ? 88  PHE A CE2  4  
ATOM 8385  C CZ   . PHE A 1 88  ? 12.333  1.048   -1.506  1.00 0.15  ? 88  PHE A CZ   4  
ATOM 8386  H H    . PHE A 1 88  ? 16.975  1.056   -0.351  1.00 0.18  ? 88  PHE A H    4  
ATOM 8387  H HA   . PHE A 1 88  ? 18.130  -0.527  -2.512  1.00 0.21  ? 88  PHE A HA   4  
ATOM 8388  H HB2  . PHE A 1 88  ? 16.001  -1.126  -3.499  1.00 0.25  ? 88  PHE A HB2  4  
ATOM 8389  H HB3  . PHE A 1 88  ? 16.089  -1.769  -1.862  1.00 0.24  ? 88  PHE A HB3  4  
ATOM 8390  H HD1  . PHE A 1 88  ? 14.907  -0.535  -0.020  1.00 0.21  ? 88  PHE A HD1  4  
ATOM 8391  H HD2  . PHE A 1 88  ? 14.274  0.287   -4.143  1.00 0.18  ? 88  PHE A HD2  4  
ATOM 8392  H HE1  . PHE A 1 88  ? 12.784  0.580   0.533   1.00 0.19  ? 88  PHE A HE1  4  
ATOM 8393  H HE2  . PHE A 1 88  ? 12.153  1.390   -3.613  1.00 0.16  ? 88  PHE A HE2  4  
ATOM 8394  H HZ   . PHE A 1 88  ? 11.395  1.524   -1.275  1.00 0.15  ? 88  PHE A HZ   4  
ATOM 8395  N N    . THR A 1 89  ? 17.468  1.259   -4.203  1.00 0.23  ? 89  THR A N    4  
ATOM 8396  C CA   . THR A 1 89  ? 17.300  2.401   -5.071  1.00 0.25  ? 89  THR A CA   4  
ATOM 8397  C C    . THR A 1 89  ? 15.828  2.545   -5.454  1.00 0.21  ? 89  THR A C    4  
ATOM 8398  O O    . THR A 1 89  ? 15.257  1.667   -6.105  1.00 0.22  ? 89  THR A O    4  
ATOM 8399  C CB   . THR A 1 89  ? 18.162  2.246   -6.337  1.00 0.33  ? 89  THR A CB   4  
ATOM 8400  O OG1  . THR A 1 89  ? 19.501  1.875   -5.963  1.00 0.42  ? 89  THR A OG1  4  
ATOM 8401  C CG2  . THR A 1 89  ? 18.192  3.537   -7.145  1.00 0.37  ? 89  THR A CG2  4  
ATOM 8402  H H    . THR A 1 89  ? 17.841  0.427   -4.574  1.00 0.28  ? 89  THR A H    4  
ATOM 8403  H HA   . THR A 1 89  ? 17.618  3.284   -4.537  1.00 0.26  ? 89  THR A HA   4  
ATOM 8404  H HB   . THR A 1 89  ? 17.735  1.466   -6.949  1.00 0.33  ? 89  THR A HB   4  
ATOM 8405  H HG1  . THR A 1 89  ? 19.494  0.973   -5.612  1.00 0.78  ? 89  THR A HG1  4  
ATOM 8406  H HG21 . THR A 1 89  ? 18.622  4.326   -6.547  1.00 1.05  ? 89  THR A HG21 4  
ATOM 8407  H HG22 . THR A 1 89  ? 17.186  3.808   -7.428  1.00 1.02  ? 89  THR A HG22 4  
ATOM 8408  H HG23 . THR A 1 89  ? 18.790  3.394   -8.035  1.00 1.07  ? 89  THR A HG23 4  
ATOM 8409  N N    . LEU A 1 90  ? 15.211  3.631   -5.002  1.00 0.19  ? 90  LEU A N    4  
ATOM 8410  C CA   . LEU A 1 90  ? 13.799  3.888   -5.264  1.00 0.16  ? 90  LEU A CA   4  
ATOM 8411  C C    . LEU A 1 90  ? 13.515  3.953   -6.757  1.00 0.15  ? 90  LEU A C    4  
ATOM 8412  O O    . LEU A 1 90  ? 14.176  4.679   -7.491  1.00 0.18  ? 90  LEU A O    4  
ATOM 8413  C CB   . LEU A 1 90  ? 13.369  5.200   -4.614  1.00 0.16  ? 90  LEU A CB   4  
ATOM 8414  C CG   . LEU A 1 90  ? 11.860  5.407   -4.540  1.00 0.34  ? 90  LEU A CG   4  
ATOM 8415  C CD1  . LEU A 1 90  ? 11.203  4.200   -3.905  1.00 0.60  ? 90  LEU A CD1  4  
ATOM 8416  C CD2  . LEU A 1 90  ? 11.540  6.672   -3.762  1.00 0.60  ? 90  LEU A CD2  4  
ATOM 8417  H H    . LEU A 1 90  ? 15.717  4.275   -4.460  1.00 0.20  ? 90  LEU A H    4  
ATOM 8418  H HA   . LEU A 1 90  ? 13.223  3.083   -4.833  1.00 0.17  ? 90  LEU A HA   4  
ATOM 8419  H HB2  . LEU A 1 90  ? 13.776  5.240   -3.622  1.00 0.37  ? 90  LEU A HB2  4  
ATOM 8420  H HB3  . LEU A 1 90  ? 13.784  6.012   -5.180  1.00 0.39  ? 90  LEU A HB3  4  
ATOM 8421  H HG   . LEU A 1 90  ? 11.465  5.516   -5.540  1.00 0.78  ? 90  LEU A HG   4  
ATOM 8422  H HD11 . LEU A 1 90  ? 10.130  4.323   -3.924  1.00 1.17  ? 90  LEU A HD11 4  
ATOM 8423  H HD12 . LEU A 1 90  ? 11.538  4.102   -2.882  1.00 1.31  ? 90  LEU A HD12 4  
ATOM 8424  H HD13 . LEU A 1 90  ? 11.472  3.313   -4.458  1.00 1.19  ? 90  LEU A HD13 4  
ATOM 8425  H HD21 . LEU A 1 90  ? 11.911  6.579   -2.754  1.00 1.19  ? 90  LEU A HD21 4  
ATOM 8426  H HD22 . LEU A 1 90  ? 10.471  6.822   -3.741  1.00 1.33  ? 90  LEU A HD22 4  
ATOM 8427  H HD23 . LEU A 1 90  ? 12.009  7.517   -4.243  1.00 1.18  ? 90  LEU A HD23 4  
ATOM 8428  N N    . GLY A 1 91  ? 12.539  3.178   -7.201  1.00 0.20  ? 91  GLY A N    4  
ATOM 8429  C CA   . GLY A 1 91  ? 12.117  3.230   -8.583  1.00 0.23  ? 91  GLY A CA   4  
ATOM 8430  C C    . GLY A 1 91  ? 12.991  2.395   -9.480  1.00 0.26  ? 91  GLY A C    4  
ATOM 8431  O O    . GLY A 1 91  ? 12.811  2.379   -10.700 1.00 0.37  ? 91  GLY A O    4  
ATOM 8432  H H    . GLY A 1 91  ? 12.105  2.541   -6.587  1.00 0.24  ? 91  GLY A H    4  
ATOM 8433  H HA2  . GLY A 1 91  ? 11.100  2.872   -8.654  1.00 0.26  ? 91  GLY A HA2  4  
ATOM 8434  H HA3  . GLY A 1 91  ? 12.148  4.245   -8.915  1.00 0.24  ? 91  GLY A HA3  4  
ATOM 8435  N N    . ASP A 1 92  ? 13.930  1.691   -8.871  1.00 0.27  ? 92  ASP A N    4  
ATOM 8436  C CA   . ASP A 1 92  ? 14.791  0.784   -9.605  1.00 0.32  ? 92  ASP A CA   4  
ATOM 8437  C C    . ASP A 1 92  ? 14.129  -0.575  -9.634  1.00 0.30  ? 92  ASP A C    4  
ATOM 8438  O O    . ASP A 1 92  ? 14.586  -1.503  -10.302 1.00 0.37  ? 92  ASP A O    4  
ATOM 8439  C CB   . ASP A 1 92  ? 16.182  0.713   -8.951  1.00 0.42  ? 92  ASP A CB   4  
ATOM 8440  C CG   . ASP A 1 92  ? 17.178  -0.121  -9.739  1.00 0.59  ? 92  ASP A CG   4  
ATOM 8441  O OD1  . ASP A 1 92  ? 17.704  0.374   -10.760 1.00 0.93  ? 92  ASP A OD1  4  
ATOM 8442  O OD2  . ASP A 1 92  ? 17.412  -1.285  -9.357  1.00 0.82  ? 92  ASP A OD2  4  
ATOM 8443  H H    . ASP A 1 92  ? 14.035  1.774   -7.895  1.00 0.29  ? 92  ASP A H    4  
ATOM 8444  H HA   . ASP A 1 92  ? 14.879  1.142   -10.609 1.00 0.38  ? 92  ASP A HA   4  
ATOM 8445  H HB2  . ASP A 1 92  ? 16.584  1.717   -8.859  1.00 0.47  ? 92  ASP A HB2  4  
ATOM 8446  H HB3  . ASP A 1 92  ? 16.085  0.282   -7.964  1.00 0.43  ? 92  ASP A HB3  4  
ATOM 8447  N N    . CYS A 1 93  ? 13.001  -0.659  -8.922  1.00 0.28  ? 93  CYS A N    4  
ATOM 8448  C CA   . CYS A 1 93  ? 12.271  -1.906  -8.772  1.00 0.27  ? 93  CYS A CA   4  
ATOM 8449  C C    . CYS A 1 93  ? 13.179  -2.969  -8.178  1.00 0.26  ? 93  CYS A C    4  
ATOM 8450  O O    . CYS A 1 93  ? 13.042  -4.159  -8.471  1.00 0.31  ? 93  CYS A O    4  
ATOM 8451  C CB   . CYS A 1 93  ? 11.726  -2.372  -10.119 1.00 0.38  ? 93  CYS A CB   4  
ATOM 8452  S SG   . CYS A 1 93  ? 10.881  -1.076  -11.056 1.00 0.62  ? 93  CYS A SG   4  
ATOM 8453  H H    . CYS A 1 93  ? 12.642  0.160   -8.494  1.00 0.30  ? 93  CYS A H    4  
ATOM 8454  H HA   . CYS A 1 93  ? 11.448  -1.733  -8.095  1.00 0.26  ? 93  CYS A HA   4  
ATOM 8455  H HB2  . CYS A 1 93  ? 12.545  -2.738  -10.722 1.00 0.68  ? 93  CYS A HB2  4  
ATOM 8456  H HB3  . CYS A 1 93  ? 11.018  -3.174  -9.949  1.00 0.47  ? 93  CYS A HB3  4  
ATOM 8457  H HG   . CYS A 1 93  ? 11.521  0.068   -10.840 1.00 1.55  ? 93  CYS A HG   4  
ATOM 8458  N N    . ASP A 1 94  ? 14.097  -2.529  -7.322  1.00 0.27  ? 94  ASP A N    4  
ATOM 8459  C CA   . ASP A 1 94  ? 15.024  -3.440  -6.683  1.00 0.33  ? 94  ASP A CA   4  
ATOM 8460  C C    . ASP A 1 94  ? 14.260  -4.319  -5.711  1.00 0.33  ? 94  ASP A C    4  
ATOM 8461  O O    . ASP A 1 94  ? 14.673  -5.424  -5.364  1.00 0.48  ? 94  ASP A O    4  
ATOM 8462  C CB   . ASP A 1 94  ? 16.118  -2.662  -5.952  1.00 0.41  ? 94  ASP A CB   4  
ATOM 8463  C CG   . ASP A 1 94  ? 17.110  -3.573  -5.260  1.00 0.65  ? 94  ASP A CG   4  
ATOM 8464  O OD1  . ASP A 1 94  ? 17.892  -4.248  -5.961  1.00 0.96  ? 94  ASP A OD1  4  
ATOM 8465  O OD2  . ASP A 1 94  ? 17.125  -3.605  -4.012  1.00 1.33  ? 94  ASP A OD2  4  
ATOM 8466  H H    . ASP A 1 94  ? 14.147  -1.569  -7.117  1.00 0.28  ? 94  ASP A H    4  
ATOM 8467  H HA   . ASP A 1 94  ? 15.468  -4.048  -7.447  1.00 0.37  ? 94  ASP A HA   4  
ATOM 8468  H HB2  . ASP A 1 94  ? 16.655  -2.054  -6.665  1.00 0.64  ? 94  ASP A HB2  4  
ATOM 8469  H HB3  . ASP A 1 94  ? 15.662  -2.021  -5.209  1.00 0.46  ? 94  ASP A HB3  4  
ATOM 8470  N N    . VAL A 1 95  ? 13.108  -3.809  -5.329  1.00 0.23  ? 95  VAL A N    4  
ATOM 8471  C CA   . VAL A 1 95  ? 12.255  -4.427  -4.337  1.00 0.21  ? 95  VAL A CA   4  
ATOM 8472  C C    . VAL A 1 95  ? 10.954  -4.901  -4.962  1.00 0.20  ? 95  VAL A C    4  
ATOM 8473  O O    . VAL A 1 95  ? 10.875  -5.110  -6.172  1.00 0.22  ? 95  VAL A O    4  
ATOM 8474  C CB   . VAL A 1 95  ? 11.936  -3.410  -3.236  1.00 0.20  ? 95  VAL A CB   4  
ATOM 8475  C CG1  . VAL A 1 95  ? 13.162  -3.170  -2.387  1.00 0.23  ? 95  VAL A CG1  4  
ATOM 8476  C CG2  . VAL A 1 95  ? 11.463  -2.103  -3.858  1.00 0.19  ? 95  VAL A CG2  4  
ATOM 8477  H H    . VAL A 1 95  ? 12.810  -2.973  -5.755  1.00 0.25  ? 95  VAL A H    4  
ATOM 8478  H HA   . VAL A 1 95  ? 12.776  -5.265  -3.900  1.00 0.23  ? 95  VAL A HA   4  
ATOM 8479  H HB   . VAL A 1 95  ? 11.147  -3.804  -2.612  1.00 0.20  ? 95  VAL A HB   4  
ATOM 8480  H HG11 . VAL A 1 95  ? 13.429  -4.080  -1.875  1.00 0.99  ? 95  VAL A HG11 4  
ATOM 8481  H HG12 . VAL A 1 95  ? 12.955  -2.395  -1.666  1.00 1.04  ? 95  VAL A HG12 4  
ATOM 8482  H HG13 . VAL A 1 95  ? 13.978  -2.862  -3.024  1.00 0.98  ? 95  VAL A HG13 4  
ATOM 8483  H HG21 . VAL A 1 95  ? 11.297  -1.371  -3.082  1.00 1.08  ? 95  VAL A HG21 4  
ATOM 8484  H HG22 . VAL A 1 95  ? 10.543  -2.272  -4.396  1.00 1.02  ? 95  VAL A HG22 4  
ATOM 8485  H HG23 . VAL A 1 95  ? 12.219  -1.739  -4.543  1.00 1.01  ? 95  VAL A HG23 4  
ATOM 8486  N N    . ILE A 1 96  ? 9.935   -5.067  -4.134  1.00 0.19  ? 96  ILE A N    4  
ATOM 8487  C CA   . ILE A 1 96  ? 8.622   -5.374  -4.621  1.00 0.19  ? 96  ILE A CA   4  
ATOM 8488  C C    . ILE A 1 96  ? 8.016   -4.082  -5.129  1.00 0.16  ? 96  ILE A C    4  
ATOM 8489  O O    . ILE A 1 96  ? 8.182   -3.029  -4.511  1.00 0.15  ? 96  ILE A O    4  
ATOM 8490  C CB   . ILE A 1 96  ? 7.732   -6.014  -3.529  1.00 0.22  ? 96  ILE A CB   4  
ATOM 8491  C CG1  . ILE A 1 96  ? 7.595   -5.089  -2.316  1.00 0.25  ? 96  ILE A CG1  4  
ATOM 8492  C CG2  . ILE A 1 96  ? 8.309   -7.356  -3.105  1.00 0.26  ? 96  ILE A CG2  4  
ATOM 8493  C CD1  . ILE A 1 96  ? 6.699   -5.636  -1.227  1.00 0.29  ? 96  ILE A CD1  4  
ATOM 8494  H H    . ILE A 1 96  ? 10.064  -4.938  -3.180  1.00 0.21  ? 96  ILE A H    4  
ATOM 8495  H HA   . ILE A 1 96  ? 8.721   -6.067  -5.446  1.00 0.21  ? 96  ILE A HA   4  
ATOM 8496  H HB   . ILE A 1 96  ? 6.753   -6.192  -3.949  1.00 0.22  ? 96  ILE A HB   4  
ATOM 8497  H HG12 . ILE A 1 96  ? 8.571   -4.921  -1.887  1.00 0.27  ? 96  ILE A HG12 4  
ATOM 8498  H HG13 . ILE A 1 96  ? 7.184   -4.145  -2.639  1.00 0.24  ? 96  ILE A HG13 4  
ATOM 8499  H HG21 . ILE A 1 96  ? 9.300   -7.212  -2.700  1.00 1.03  ? 96  ILE A HG21 4  
ATOM 8500  H HG22 . ILE A 1 96  ? 8.364   -8.012  -3.962  1.00 1.06  ? 96  ILE A HG22 4  
ATOM 8501  H HG23 . ILE A 1 96  ? 7.674   -7.798  -2.354  1.00 1.05  ? 96  ILE A HG23 4  
ATOM 8502  H HD11 . ILE A 1 96  ? 7.105   -6.569  -0.862  1.00 1.00  ? 96  ILE A HD11 4  
ATOM 8503  H HD12 . ILE A 1 96  ? 5.711   -5.807  -1.628  1.00 1.02  ? 96  ILE A HD12 4  
ATOM 8504  H HD13 . ILE A 1 96  ? 6.644   -4.926  -0.415  1.00 0.98  ? 96  ILE A HD13 4  
ATOM 8505  N N    . GLN A 1 97  ? 7.364   -4.149  -6.266  1.00 0.17  ? 97  GLN A N    4  
ATOM 8506  C CA   . GLN A 1 97  ? 6.860   -2.950  -6.923  1.00 0.17  ? 97  GLN A CA   4  
ATOM 8507  C C    . GLN A 1 97  ? 5.919   -2.182  -6.000  1.00 0.16  ? 97  GLN A C    4  
ATOM 8508  O O    . GLN A 1 97  ? 5.838   -0.957  -6.062  1.00 0.16  ? 97  GLN A O    4  
ATOM 8509  C CB   . GLN A 1 97  ? 6.151   -3.293  -8.229  1.00 0.19  ? 97  GLN A CB   4  
ATOM 8510  C CG   . GLN A 1 97  ? 6.214   -2.155  -9.231  1.00 0.25  ? 97  GLN A CG   4  
ATOM 8511  C CD   . GLN A 1 97  ? 7.598   -1.988  -9.836  1.00 0.31  ? 97  GLN A CD   4  
ATOM 8512  O OE1  . GLN A 1 97  ? 7.887   -2.547  -10.897 1.00 0.40  ? 97  GLN A OE1  4  
ATOM 8513  N NE2  . GLN A 1 97  ? 8.480   -1.255  -9.161  1.00 0.32  ? 97  GLN A NE2  4  
ATOM 8514  H H    . GLN A 1 97  ? 7.228   -5.022  -6.679  1.00 0.19  ? 97  GLN A H    4  
ATOM 8515  H HA   . GLN A 1 97  ? 7.709   -2.320  -7.147  1.00 0.17  ? 97  GLN A HA   4  
ATOM 8516  H HB2  . GLN A 1 97  ? 6.618   -4.163  -8.666  1.00 0.23  ? 97  GLN A HB2  4  
ATOM 8517  H HB3  . GLN A 1 97  ? 5.113   -3.512  -8.026  1.00 0.21  ? 97  GLN A HB3  4  
ATOM 8518  H HG2  . GLN A 1 97  ? 5.511   -2.353  -10.026 1.00 0.29  ? 97  GLN A HG2  4  
ATOM 8519  H HG3  . GLN A 1 97  ? 5.944   -1.239  -8.730  1.00 0.29  ? 97  GLN A HG3  4  
ATOM 8520  H HE21 . GLN A 1 97  ? 8.212   -0.858  -8.302  1.00 0.29  ? 97  GLN A HE21 4  
ATOM 8521  H HE22 . GLN A 1 97  ? 9.372   -1.130  -9.557  1.00 0.39  ? 97  GLN A HE22 4  
ATOM 8522  N N    . ALA A 1 98  ? 5.234   -2.917  -5.131  1.00 0.17  ? 98  ALA A N    4  
ATOM 8523  C CA   . ALA A 1 98  ? 4.374   -2.315  -4.118  1.00 0.18  ? 98  ALA A CA   4  
ATOM 8524  C C    . ALA A 1 98  ? 5.160   -1.345  -3.250  1.00 0.17  ? 98  ALA A C    4  
ATOM 8525  O O    . ALA A 1 98  ? 4.731   -0.221  -3.010  1.00 0.20  ? 98  ALA A O    4  
ATOM 8526  C CB   . ALA A 1 98  ? 3.767   -3.396  -3.247  1.00 0.20  ? 98  ALA A CB   4  
ATOM 8527  H H    . ALA A 1 98  ? 5.309   -3.895  -5.170  1.00 0.18  ? 98  ALA A H    4  
ATOM 8528  H HA   . ALA A 1 98  ? 3.577   -1.786  -4.616  1.00 0.19  ? 98  ALA A HA   4  
ATOM 8529  H HB1  . ALA A 1 98  ? 3.184   -2.938  -2.462  1.00 1.08  ? 98  ALA A HB1  4  
ATOM 8530  H HB2  . ALA A 1 98  ? 4.553   -3.996  -2.810  1.00 1.01  ? 98  ALA A HB2  4  
ATOM 8531  H HB3  . ALA A 1 98  ? 3.125   -4.026  -3.847  1.00 1.00  ? 98  ALA A HB3  4  
ATOM 8532  N N    . LEU A 1 99  ? 6.325   -1.789  -2.803  1.00 0.17  ? 99  LEU A N    4  
ATOM 8533  C CA   . LEU A 1 99  ? 7.178   -0.978  -1.950  1.00 0.17  ? 99  LEU A CA   4  
ATOM 8534  C C    . LEU A 1 99  ? 7.796   0.162   -2.737  1.00 0.15  ? 99  LEU A C    4  
ATOM 8535  O O    . LEU A 1 99  ? 7.881   1.293   -2.261  1.00 0.15  ? 99  LEU A O    4  
ATOM 8536  C CB   . LEU A 1 99  ? 8.297   -1.819  -1.348  1.00 0.19  ? 99  LEU A CB   4  
ATOM 8537  C CG   . LEU A 1 99  ? 9.203   -1.057  -0.377  1.00 0.18  ? 99  LEU A CG   4  
ATOM 8538  C CD1  . LEU A 1 99  ? 8.387   -0.477  0.768   1.00 0.21  ? 99  LEU A CD1  4  
ATOM 8539  C CD2  . LEU A 1 99  ? 10.305  -1.953  0.155   1.00 0.22  ? 99  LEU A CD2  4  
ATOM 8540  H H    . LEU A 1 99  ? 6.622   -2.685  -3.067  1.00 0.19  ? 99  LEU A H    4  
ATOM 8541  H HA   . LEU A 1 99  ? 6.574   -0.579  -1.158  1.00 0.17  ? 99  LEU A HA   4  
ATOM 8542  H HB2  . LEU A 1 99  ? 7.856   -2.657  -0.826  1.00 0.23  ? 99  LEU A HB2  4  
ATOM 8543  H HB3  . LEU A 1 99  ? 8.906   -2.195  -2.161  1.00 0.21  ? 99  LEU A HB3  4  
ATOM 8544  H HG   . LEU A 1 99  ? 9.666   -0.234  -0.902  1.00 0.15  ? 99  LEU A HG   4  
ATOM 8545  H HD11 . LEU A 1 99  ? 7.673   0.232   0.378   1.00 1.03  ? 99  LEU A HD11 4  
ATOM 8546  H HD12 . LEU A 1 99  ? 9.047   0.021   1.464   1.00 1.02  ? 99  LEU A HD12 4  
ATOM 8547  H HD13 . LEU A 1 99  ? 7.860   -1.271  1.276   1.00 1.06  ? 99  LEU A HD13 4  
ATOM 8548  H HD21 . LEU A 1 99  ? 9.870   -2.803  0.658   1.00 0.97  ? 99  LEU A HD21 4  
ATOM 8549  H HD22 . LEU A 1 99  ? 10.913  -1.392  0.852   1.00 1.01  ? 99  LEU A HD22 4  
ATOM 8550  H HD23 . LEU A 1 99  ? 10.920  -2.292  -0.666  1.00 1.07  ? 99  LEU A HD23 4  
ATOM 8551  N N    . ASP A 1 100 ? 8.195   -0.158  -3.956  1.00 0.15  ? 100 ASP A N    4  
ATOM 8552  C CA   . ASP A 1 100 ? 8.920   0.764   -4.816  1.00 0.16  ? 100 ASP A CA   4  
ATOM 8553  C C    . ASP A 1 100 ? 8.069   1.995   -5.093  1.00 0.15  ? 100 ASP A C    4  
ATOM 8554  O O    . ASP A 1 100 ? 8.578   3.095   -5.294  1.00 0.16  ? 100 ASP A O    4  
ATOM 8555  C CB   . ASP A 1 100 ? 9.290   0.033   -6.111  1.00 0.17  ? 100 ASP A CB   4  
ATOM 8556  C CG   . ASP A 1 100 ? 10.136  0.852   -7.054  1.00 0.20  ? 100 ASP A CG   4  
ATOM 8557  O OD1  . ASP A 1 100 ? 11.375  0.842   -6.909  1.00 0.21  ? 100 ASP A OD1  4  
ATOM 8558  O OD2  . ASP A 1 100 ? 9.557   1.540   -7.919  1.00 0.26  ? 100 ASP A OD2  4  
ATOM 8559  H H    . ASP A 1 100 ? 7.971   -1.045  -4.302  1.00 0.16  ? 100 ASP A H    4  
ATOM 8560  H HA   . ASP A 1 100 ? 9.823   1.067   -4.309  1.00 0.16  ? 100 ASP A HA   4  
ATOM 8561  H HB2  . ASP A 1 100 ? 9.848   -0.853  -5.860  1.00 0.19  ? 100 ASP A HB2  4  
ATOM 8562  H HB3  . ASP A 1 100 ? 8.388   -0.258  -6.622  1.00 0.16  ? 100 ASP A HB3  4  
ATOM 8563  N N    . LEU A 1 101 ? 6.763   1.790   -5.102  1.00 0.16  ? 101 LEU A N    4  
ATOM 8564  C CA   . LEU A 1 101 ? 5.812   2.871   -5.260  1.00 0.16  ? 101 LEU A CA   4  
ATOM 8565  C C    . LEU A 1 101 ? 5.362   3.460   -3.912  1.00 0.15  ? 101 LEU A C    4  
ATOM 8566  O O    . LEU A 1 101 ? 5.091   4.663   -3.801  1.00 0.16  ? 101 LEU A O    4  
ATOM 8567  C CB   . LEU A 1 101 ? 4.613   2.350   -6.039  1.00 0.19  ? 101 LEU A CB   4  
ATOM 8568  C CG   . LEU A 1 101 ? 4.933   1.794   -7.433  1.00 0.22  ? 101 LEU A CG   4  
ATOM 8569  C CD1  . LEU A 1 101 ? 3.662   1.320   -8.128  1.00 0.25  ? 101 LEU A CD1  4  
ATOM 8570  C CD2  . LEU A 1 101 ? 5.662   2.832   -8.279  1.00 0.25  ? 101 LEU A CD2  4  
ATOM 8571  H H    . LEU A 1 101 ? 6.426   0.877   -5.016  1.00 0.16  ? 101 LEU A H    4  
ATOM 8572  H HA   . LEU A 1 101 ? 6.291   3.650   -5.830  1.00 0.17  ? 101 LEU A HA   4  
ATOM 8573  H HB2  . LEU A 1 101 ? 4.152   1.565   -5.458  1.00 0.20  ? 101 LEU A HB2  4  
ATOM 8574  H HB3  . LEU A 1 101 ? 3.912   3.150   -6.144  1.00 0.19  ? 101 LEU A HB3  4  
ATOM 8575  H HG   . LEU A 1 101 ? 5.584   0.939   -7.324  1.00 0.23  ? 101 LEU A HG   4  
ATOM 8576  H HD11 . LEU A 1 101 ? 3.206   0.530   -7.548  1.00 0.87  ? 101 LEU A HD11 4  
ATOM 8577  H HD12 . LEU A 1 101 ? 3.907   0.946   -9.112  1.00 1.03  ? 101 LEU A HD12 4  
ATOM 8578  H HD13 . LEU A 1 101 ? 2.970   2.143   -8.219  1.00 1.01  ? 101 LEU A HD13 4  
ATOM 8579  H HD21 . LEU A 1 101 ? 6.595   3.093   -7.801  1.00 1.01  ? 101 LEU A HD21 4  
ATOM 8580  H HD22 . LEU A 1 101 ? 5.049   3.716   -8.377  1.00 1.02  ? 101 LEU A HD22 4  
ATOM 8581  H HD23 . LEU A 1 101 ? 5.864   2.422   -9.258  1.00 1.06  ? 101 LEU A HD23 4  
ATOM 8582  N N    . SER A 1 102 ? 5.280   2.617   -2.888  1.00 0.15  ? 102 SER A N    4  
ATOM 8583  C CA   . SER A 1 102 ? 4.786   3.040   -1.586  1.00 0.17  ? 102 SER A CA   4  
ATOM 8584  C C    . SER A 1 102 ? 5.722   4.054   -0.948  1.00 0.15  ? 102 SER A C    4  
ATOM 8585  O O    . SER A 1 102 ? 5.284   4.939   -0.220  1.00 0.18  ? 102 SER A O    4  
ATOM 8586  C CB   . SER A 1 102 ? 4.620   1.834   -0.660  1.00 0.23  ? 102 SER A CB   4  
ATOM 8587  O OG   . SER A 1 102 ? 4.205   2.230   0.633   1.00 1.01  ? 102 SER A OG   4  
ATOM 8588  H H    . SER A 1 102 ? 5.559   1.688   -3.007  1.00 0.15  ? 102 SER A H    4  
ATOM 8589  H HA   . SER A 1 102 ? 3.823   3.502   -1.734  1.00 0.20  ? 102 SER A HA   4  
ATOM 8590  H HB2  . SER A 1 102 ? 3.877   1.166   -1.073  1.00 0.79  ? 102 SER A HB2  4  
ATOM 8591  H HB3  . SER A 1 102 ? 5.564   1.314   -0.578  1.00 1.05  ? 102 SER A HB3  4  
ATOM 8592  H HG   . SER A 1 102 ? 4.826   2.875   0.983   1.00 1.53  ? 102 SER A HG   4  
ATOM 8593  N N    . VAL A 1 103 ? 7.005   3.916   -1.233  1.00 0.15  ? 103 VAL A N    4  
ATOM 8594  C CA   . VAL A 1 103 ? 8.025   4.772   -0.650  1.00 0.16  ? 103 VAL A CA   4  
ATOM 8595  C C    . VAL A 1 103 ? 7.912   6.223   -1.110  1.00 0.16  ? 103 VAL A C    4  
ATOM 8596  O O    . VAL A 1 103 ? 7.900   7.115   -0.280  1.00 0.18  ? 103 VAL A O    4  
ATOM 8597  C CB   . VAL A 1 103 ? 9.423   4.253   -0.963  1.00 0.18  ? 103 VAL A CB   4  
ATOM 8598  C CG1  . VAL A 1 103 ? 10.492  5.258   -0.551  1.00 0.21  ? 103 VAL A CG1  4  
ATOM 8599  C CG2  . VAL A 1 103 ? 9.651   2.932   -0.265  1.00 0.19  ? 103 VAL A CG2  4  
ATOM 8600  H H    . VAL A 1 103 ? 7.278   3.210   -1.859  1.00 0.15  ? 103 VAL A H    4  
ATOM 8601  H HA   . VAL A 1 103 ? 7.899   4.742   0.417   1.00 0.17  ? 103 VAL A HA   4  
ATOM 8602  H HB   . VAL A 1 103 ? 9.477   4.096   -2.031  1.00 0.18  ? 103 VAL A HB   4  
ATOM 8603  H HG11 . VAL A 1 103 ? 10.313  6.198   -1.052  1.00 1.02  ? 103 VAL A HG11 4  
ATOM 8604  H HG12 . VAL A 1 103 ? 11.466  4.883   -0.828  1.00 1.06  ? 103 VAL A HG12 4  
ATOM 8605  H HG13 . VAL A 1 103 ? 10.454  5.409   0.518   1.00 1.00  ? 103 VAL A HG13 4  
ATOM 8606  H HG21 . VAL A 1 103 ? 9.185   2.957   0.708   1.00 1.03  ? 103 VAL A HG21 4  
ATOM 8607  H HG22 . VAL A 1 103 ? 10.709  2.771   -0.147  1.00 1.00  ? 103 VAL A HG22 4  
ATOM 8608  H HG23 . VAL A 1 103 ? 9.222   2.135   -0.853  1.00 1.03  ? 103 VAL A HG23 4  
ATOM 8609  N N    . PRO A 1 104 ? 7.868   6.500   -2.426  1.00 0.17  ? 104 PRO A N    4  
ATOM 8610  C CA   . PRO A 1 104 ? 7.662   7.866   -2.918  1.00 0.21  ? 104 PRO A CA   4  
ATOM 8611  C C    . PRO A 1 104 ? 6.304   8.430   -2.499  1.00 0.19  ? 104 PRO A C    4  
ATOM 8612  O O    . PRO A 1 104 ? 6.087   9.641   -2.517  1.00 0.22  ? 104 PRO A O    4  
ATOM 8613  C CB   . PRO A 1 104 ? 7.760   7.734   -4.439  1.00 0.27  ? 104 PRO A CB   4  
ATOM 8614  C CG   . PRO A 1 104 ? 7.568   6.286   -4.726  1.00 0.21  ? 104 PRO A CG   4  
ATOM 8615  C CD   . PRO A 1 104 ? 8.083   5.552   -3.528  1.00 0.17  ? 104 PRO A CD   4  
ATOM 8616  H HA   . PRO A 1 104 ? 8.441   8.524   -2.562  1.00 0.24  ? 104 PRO A HA   4  
ATOM 8617  H HB2  . PRO A 1 104 ? 6.992   8.335   -4.905  1.00 0.38  ? 104 PRO A HB2  4  
ATOM 8618  H HB3  . PRO A 1 104 ? 8.732   8.069   -4.763  1.00 0.41  ? 104 PRO A HB3  4  
ATOM 8619  H HG2  . PRO A 1 104 ? 6.520   6.075   -4.877  1.00 0.31  ? 104 PRO A HG2  4  
ATOM 8620  H HG3  . PRO A 1 104 ? 8.134   6.008   -5.594  1.00 0.33  ? 104 PRO A HG3  4  
ATOM 8621  H HD2  . PRO A 1 104 ? 7.530   4.639   -3.376  1.00 0.16  ? 104 PRO A HD2  4  
ATOM 8622  H HD3  . PRO A 1 104 ? 9.134   5.336   -3.646  1.00 0.20  ? 104 PRO A HD3  4  
ATOM 8623  N N    . LEU A 1 105 ? 5.383   7.537   -2.149  1.00 0.18  ? 105 LEU A N    4  
ATOM 8624  C CA   . LEU A 1 105 ? 4.114   7.934   -1.541  1.00 0.19  ? 105 LEU A CA   4  
ATOM 8625  C C    . LEU A 1 105 ? 4.268   8.147   -0.033  1.00 0.22  ? 105 LEU A C    4  
ATOM 8626  O O    . LEU A 1 105 ? 3.392   8.705   0.631   1.00 0.32  ? 105 LEU A O    4  
ATOM 8627  C CB   . LEU A 1 105 ? 3.067   6.854   -1.789  1.00 0.18  ? 105 LEU A CB   4  
ATOM 8628  C CG   . LEU A 1 105 ? 2.446   6.844   -3.184  1.00 0.25  ? 105 LEU A CG   4  
ATOM 8629  C CD1  . LEU A 1 105 ? 1.188   5.994   -3.190  1.00 0.53  ? 105 LEU A CD1  4  
ATOM 8630  C CD2  . LEU A 1 105 ? 2.138   8.261   -3.651  1.00 0.64  ? 105 LEU A CD2  4  
ATOM 8631  H H    . LEU A 1 105 ? 5.551   6.580   -2.330  1.00 0.18  ? 105 LEU A H    4  
ATOM 8632  H HA   . LEU A 1 105 ? 3.790   8.855   -1.999  1.00 0.22  ? 105 LEU A HA   4  
ATOM 8633  H HB2  . LEU A 1 105 ? 3.549   5.890   -1.627  1.00 0.15  ? 105 LEU A HB2  4  
ATOM 8634  H HB3  . LEU A 1 105 ? 2.277   6.970   -1.064  1.00 0.22  ? 105 LEU A HB3  4  
ATOM 8635  H HG   . LEU A 1 105 ? 3.146   6.403   -3.878  1.00 0.63  ? 105 LEU A HG   4  
ATOM 8636  H HD11 . LEU A 1 105 ? 0.467   6.417   -2.506  1.00 1.26  ? 105 LEU A HD11 4  
ATOM 8637  H HD12 . LEU A 1 105 ? 1.431   4.988   -2.880  1.00 1.14  ? 105 LEU A HD12 4  
ATOM 8638  H HD13 . LEU A 1 105 ? 0.770   5.972   -4.186  1.00 1.09  ? 105 LEU A HD13 4  
ATOM 8639  H HD21 . LEU A 1 105 ? 3.058   8.823   -3.723  1.00 1.17  ? 105 LEU A HD21 4  
ATOM 8640  H HD22 . LEU A 1 105 ? 1.480   8.740   -2.941  1.00 1.35  ? 105 LEU A HD22 4  
ATOM 8641  H HD23 . LEU A 1 105 ? 1.660   8.226   -4.618  1.00 1.29  ? 105 LEU A HD23 4  
ATOM 8642  N N    . MET A 1 106 ? 5.361   7.632   0.487   1.00 0.20  ? 106 MET A N    4  
ATOM 8643  C CA   . MET A 1 106 ? 5.704   7.691   1.899   1.00 0.24  ? 106 MET A CA   4  
ATOM 8644  C C    . MET A 1 106 ? 6.644   8.859   2.201   1.00 0.21  ? 106 MET A C    4  
ATOM 8645  O O    . MET A 1 106 ? 7.544   9.157   1.425   1.00 0.26  ? 106 MET A O    4  
ATOM 8646  C CB   . MET A 1 106 ? 6.372   6.364   2.249   1.00 0.33  ? 106 MET A CB   4  
ATOM 8647  C CG   . MET A 1 106 ? 7.028   6.304   3.603   1.00 0.53  ? 106 MET A CG   4  
ATOM 8648  S SD   . MET A 1 106 ? 7.516   4.623   4.032   1.00 0.78  ? 106 MET A SD   4  
ATOM 8649  C CE   . MET A 1 106 ? 5.948   3.783   3.866   1.00 0.54  ? 106 MET A CE   4  
ATOM 8650  H H    . MET A 1 106 ? 5.975   7.160   -0.109  1.00 0.21  ? 106 MET A H    4  
ATOM 8651  H HA   . MET A 1 106 ? 4.800   7.800   2.473   1.00 0.30  ? 106 MET A HA   4  
ATOM 8652  H HB2  . MET A 1 106 ? 5.629   5.584   2.203   1.00 0.74  ? 106 MET A HB2  4  
ATOM 8653  H HB3  . MET A 1 106 ? 7.129   6.164   1.507   1.00 0.76  ? 106 MET A HB3  4  
ATOM 8654  H HG2  . MET A 1 106 ? 7.905   6.937   3.594   1.00 0.87  ? 106 MET A HG2  4  
ATOM 8655  H HG3  . MET A 1 106 ? 6.324   6.665   4.343   1.00 0.79  ? 106 MET A HG3  4  
ATOM 8656  H HE1  . MET A 1 106 ? 5.606   3.858   2.845   1.00 1.31  ? 106 MET A HE1  4  
ATOM 8657  H HE2  . MET A 1 106 ? 5.223   4.243   4.519   1.00 1.14  ? 106 MET A HE2  4  
ATOM 8658  H HE3  . MET A 1 106 ? 6.069   2.743   4.128   1.00 1.28  ? 106 MET A HE3  4  
ATOM 8659  N N    . ASP A 1 107 ? 6.437   9.510   3.338   1.00 0.18  ? 107 ASP A N    4  
ATOM 8660  C CA   . ASP A 1 107 ? 7.319   10.592  3.751   1.00 0.18  ? 107 ASP A CA   4  
ATOM 8661  C C    . ASP A 1 107 ? 8.375   10.063  4.703   1.00 0.14  ? 107 ASP A C    4  
ATOM 8662  O O    . ASP A 1 107 ? 8.150   9.080   5.415   1.00 0.13  ? 107 ASP A O    4  
ATOM 8663  C CB   . ASP A 1 107 ? 6.547   11.743  4.409   1.00 0.25  ? 107 ASP A CB   4  
ATOM 8664  C CG   . ASP A 1 107 ? 5.789   12.594  3.406   1.00 0.56  ? 107 ASP A CG   4  
ATOM 8665  O OD1  . ASP A 1 107 ? 6.434   13.321  2.622   1.00 0.97  ? 107 ASP A OD1  4  
ATOM 8666  O OD2  . ASP A 1 107 ? 4.539   12.532  3.383   1.00 0.92  ? 107 ASP A OD2  4  
ATOM 8667  H H    . ASP A 1 107 ? 5.682   9.242   3.926   1.00 0.20  ? 107 ASP A H    4  
ATOM 8668  H HA   . ASP A 1 107 ? 7.811   10.964  2.865   1.00 0.21  ? 107 ASP A HA   4  
ATOM 8669  H HB2  . ASP A 1 107 ? 5.838   11.336  5.113   1.00 0.58  ? 107 ASP A HB2  4  
ATOM 8670  H HB3  . ASP A 1 107 ? 7.243   12.377  4.937   1.00 0.60  ? 107 ASP A HB3  4  
ATOM 8671  N N    . VAL A 1 108 ? 9.540   10.701  4.704   1.00 0.16  ? 108 VAL A N    4  
ATOM 8672  C CA   . VAL A 1 108 ? 10.634  10.261  5.557   1.00 0.16  ? 108 VAL A CA   4  
ATOM 8673  C C    . VAL A 1 108 ? 10.223  10.303  7.020   1.00 0.15  ? 108 VAL A C    4  
ATOM 8674  O O    . VAL A 1 108 ? 9.796   11.339  7.533   1.00 0.19  ? 108 VAL A O    4  
ATOM 8675  C CB   . VAL A 1 108 ? 11.918  11.106  5.335   1.00 0.21  ? 108 VAL A CB   4  
ATOM 8676  C CG1  . VAL A 1 108 ? 12.843  11.062  6.545   1.00 0.68  ? 108 VAL A CG1  4  
ATOM 8677  C CG2  . VAL A 1 108 ? 12.663  10.620  4.100   1.00 0.80  ? 108 VAL A CG2  4  
ATOM 8678  H H    . VAL A 1 108 ? 9.664   11.481  4.119   1.00 0.20  ? 108 VAL A H    4  
ATOM 8679  H HA   . VAL A 1 108 ? 10.859  9.238   5.291   1.00 0.16  ? 108 VAL A HA   4  
ATOM 8680  H HB   . VAL A 1 108 ? 11.626  12.132  5.171   1.00 0.63  ? 108 VAL A HB   4  
ATOM 8681  H HG11 . VAL A 1 108 ? 12.326  11.469  7.405   1.00 1.22  ? 108 VAL A HG11 4  
ATOM 8682  H HG12 . VAL A 1 108 ? 13.725  11.653  6.343   1.00 1.47  ? 108 VAL A HG12 4  
ATOM 8683  H HG13 . VAL A 1 108 ? 13.128  10.040  6.745   1.00 1.26  ? 108 VAL A HG13 4  
ATOM 8684  H HG21 . VAL A 1 108 ? 13.583  11.175  3.992   1.00 1.43  ? 108 VAL A HG21 4  
ATOM 8685  H HG22 . VAL A 1 108 ? 12.048  10.774  3.225   1.00 1.43  ? 108 VAL A HG22 4  
ATOM 8686  H HG23 . VAL A 1 108 ? 12.886  9.568   4.201   1.00 1.25  ? 108 VAL A HG23 4  
ATOM 8687  N N    . GLY A 1 109 ? 10.354  9.168   7.679   1.00 0.15  ? 109 GLY A N    4  
ATOM 8688  C CA   . GLY A 1 109 ? 10.069  9.095   9.092   1.00 0.17  ? 109 GLY A CA   4  
ATOM 8689  C C    . GLY A 1 109 ? 8.667   8.600   9.383   1.00 0.18  ? 109 GLY A C    4  
ATOM 8690  O O    . GLY A 1 109 ? 8.180   8.745   10.504  1.00 0.28  ? 109 GLY A O    4  
ATOM 8691  H H    . GLY A 1 109 ? 10.634  8.361   7.191   1.00 0.16  ? 109 GLY A H    4  
ATOM 8692  H HA2  . GLY A 1 109 ? 10.778  8.427   9.558   1.00 0.18  ? 109 GLY A HA2  4  
ATOM 8693  H HA3  . GLY A 1 109 ? 10.186  10.079  9.520   1.00 0.18  ? 109 GLY A HA3  4  
ATOM 8694  N N    . GLU A 1 110 ? 7.994   8.034   8.386   1.00 0.13  ? 110 GLU A N    4  
ATOM 8695  C CA   . GLU A 1 110 ? 6.663   7.496   8.612   1.00 0.13  ? 110 GLU A CA   4  
ATOM 8696  C C    . GLU A 1 110 ? 6.705   5.978   8.681   1.00 0.10  ? 110 GLU A C    4  
ATOM 8697  O O    . GLU A 1 110 ? 7.721   5.351   8.370   1.00 0.12  ? 110 GLU A O    4  
ATOM 8698  C CB   . GLU A 1 110 ? 5.664   7.946   7.536   1.00 0.17  ? 110 GLU A CB   4  
ATOM 8699  C CG   . GLU A 1 110 ? 5.680   7.125   6.269   1.00 0.20  ? 110 GLU A CG   4  
ATOM 8700  C CD   . GLU A 1 110 ? 4.519   7.433   5.328   1.00 0.27  ? 110 GLU A CD   4  
ATOM 8701  O OE1  . GLU A 1 110 ? 4.387   8.592   4.897   1.00 0.41  ? 110 GLU A OE1  4  
ATOM 8702  O OE2  . GLU A 1 110 ? 3.758   6.500   4.982   1.00 0.39  ? 110 GLU A OE2  4  
ATOM 8703  H H    . GLU A 1 110 ? 8.390   7.982   7.491   1.00 0.13  ? 110 GLU A H    4  
ATOM 8704  H HA   . GLU A 1 110 ? 6.325   7.866   9.571   1.00 0.15  ? 110 GLU A HA   4  
ATOM 8705  H HB2  . GLU A 1 110 ? 4.671   7.885   7.954   1.00 0.18  ? 110 GLU A HB2  4  
ATOM 8706  H HB3  . GLU A 1 110 ? 5.876   8.974   7.276   1.00 0.23  ? 110 GLU A HB3  4  
ATOM 8707  H HG2  . GLU A 1 110 ? 6.600   7.320   5.746   1.00 0.25  ? 110 GLU A HG2  4  
ATOM 8708  H HG3  . GLU A 1 110 ? 5.633   6.081   6.537   1.00 0.20  ? 110 GLU A HG3  4  
ATOM 8709  N N    . THR A 1 111 ? 5.608   5.400   9.119   1.00 0.10  ? 111 THR A N    4  
ATOM 8710  C CA   . THR A 1 111 ? 5.459   3.972   9.132   1.00 0.11  ? 111 THR A CA   4  
ATOM 8711  C C    . THR A 1 111 ? 4.100   3.641   8.560   1.00 0.11  ? 111 THR A C    4  
ATOM 8712  O O    . THR A 1 111 ? 3.078   4.078   9.092   1.00 0.12  ? 111 THR A O    4  
ATOM 8713  C CB   . THR A 1 111 ? 5.600   3.398   10.554  1.00 0.16  ? 111 THR A CB   4  
ATOM 8714  O OG1  . THR A 1 111 ? 6.777   3.934   11.168  1.00 0.22  ? 111 THR A OG1  4  
ATOM 8715  C CG2  . THR A 1 111 ? 5.701   1.878   10.519  1.00 0.19  ? 111 THR A CG2  4  
ATOM 8716  H H    . THR A 1 111 ? 4.852   5.956   9.415   1.00 0.12  ? 111 THR A H    4  
ATOM 8717  H HA   . THR A 1 111 ? 6.225   3.548   8.504   1.00 0.14  ? 111 THR A HA   4  
ATOM 8718  H HB   . THR A 1 111 ? 4.734   3.680   11.137  1.00 0.17  ? 111 THR A HB   4  
ATOM 8719  H HG1  . THR A 1 111 ? 7.225   4.516   10.544  1.00 0.27  ? 111 THR A HG1  4  
ATOM 8720  H HG21 . THR A 1 111 ? 6.555   1.589   9.925   1.00 1.07  ? 111 THR A HG21 4  
ATOM 8721  H HG22 . THR A 1 111 ? 4.803   1.466   10.084  1.00 1.02  ? 111 THR A HG22 4  
ATOM 8722  H HG23 . THR A 1 111 ? 5.818   1.504   11.523  1.00 1.01  ? 111 THR A HG23 4  
ATOM 8723  N N    . ALA A 1 112 ? 4.085   2.922   7.457   1.00 0.12  ? 112 ALA A N    4  
ATOM 8724  C CA   . ALA A 1 112 ? 2.845   2.634   6.776   1.00 0.13  ? 112 ALA A CA   4  
ATOM 8725  C C    . ALA A 1 112 ? 2.646   1.146   6.632   1.00 0.12  ? 112 ALA A C    4  
ATOM 8726  O O    . ALA A 1 112 ? 3.587   0.401   6.381   1.00 0.13  ? 112 ALA A O    4  
ATOM 8727  C CB   . ALA A 1 112 ? 2.815   3.307   5.411   1.00 0.18  ? 112 ALA A CB   4  
ATOM 8728  H H    . ALA A 1 112 ? 4.928   2.560   7.100   1.00 0.14  ? 112 ALA A H    4  
ATOM 8729  H HA   . ALA A 1 112 ? 2.035   3.040   7.366   1.00 0.14  ? 112 ALA A HA   4  
ATOM 8730  H HB1  . ALA A 1 112 ? 3.590   2.891   4.788   1.00 1.00  ? 112 ALA A HB1  4  
ATOM 8731  H HB2  . ALA A 1 112 ? 2.977   4.369   5.529   1.00 0.96  ? 112 ALA A HB2  4  
ATOM 8732  H HB3  . ALA A 1 112 ? 1.853   3.140   4.950   1.00 0.95  ? 112 ALA A HB3  4  
ATOM 8733  N N    . MET A 1 113 ? 1.418   0.723   6.802   1.00 0.12  ? 113 MET A N    4  
ATOM 8734  C CA   . MET A 1 113 ? 1.057   -0.651  6.559   1.00 0.12  ? 113 MET A CA   4  
ATOM 8735  C C    . MET A 1 113 ? 0.454   -0.719  5.176   1.00 0.12  ? 113 MET A C    4  
ATOM 8736  O O    . MET A 1 113 ? -0.551  -0.069  4.904   1.00 0.14  ? 113 MET A O    4  
ATOM 8737  C CB   . MET A 1 113 ? 0.055   -1.135  7.609   1.00 0.16  ? 113 MET A CB   4  
ATOM 8738  C CG   . MET A 1 113 ? -0.644  -2.434  7.242   1.00 0.25  ? 113 MET A CG   4  
ATOM 8739  S SD   . MET A 1 113 ? -1.825  -2.955  8.500   1.00 0.53  ? 113 MET A SD   4  
ATOM 8740  C CE   . MET A 1 113 ? -2.420  -4.485  7.786   1.00 1.32  ? 113 MET A CE   4  
ATOM 8741  H H    . MET A 1 113 ? 0.721   1.365   7.064   1.00 0.13  ? 113 MET A H    4  
ATOM 8742  H HA   . MET A 1 113 ? 1.953   -1.260  6.597   1.00 0.13  ? 113 MET A HA   4  
ATOM 8743  H HB2  . MET A 1 113 ? 0.573   -1.283  8.546   1.00 0.19  ? 113 MET A HB2  4  
ATOM 8744  H HB3  . MET A 1 113 ? -0.699  -0.373  7.742   1.00 0.18  ? 113 MET A HB3  4  
ATOM 8745  H HG2  . MET A 1 113 ? -1.172  -2.281  6.314   1.00 0.27  ? 113 MET A HG2  4  
ATOM 8746  H HG3  . MET A 1 113 ? 0.093   -3.213  7.109   1.00 0.25  ? 113 MET A HG3  4  
ATOM 8747  H HE1  . MET A 1 113 ? -3.196  -4.895  8.412   1.00 1.94  ? 113 MET A HE1  4  
ATOM 8748  H HE2  . MET A 1 113 ? -1.604  -5.189  7.715   1.00 1.89  ? 113 MET A HE2  4  
ATOM 8749  H HE3  . MET A 1 113 ? -2.816  -4.292  6.800   1.00 1.90  ? 113 MET A HE3  4  
ATOM 8750  N N    . VAL A 1 114 ? 1.084   -1.462  4.296   1.00 0.12  ? 114 VAL A N    4  
ATOM 8751  C CA   . VAL A 1 114 ? 0.644   -1.524  2.922   1.00 0.12  ? 114 VAL A CA   4  
ATOM 8752  C C    . VAL A 1 114 ? 0.167   -2.916  2.608   1.00 0.13  ? 114 VAL A C    4  
ATOM 8753  O O    . VAL A 1 114 ? 0.845   -3.897  2.916   1.00 0.16  ? 114 VAL A O    4  
ATOM 8754  C CB   . VAL A 1 114 ? 1.784   -1.163  1.956   1.00 0.15  ? 114 VAL A CB   4  
ATOM 8755  C CG1  . VAL A 1 114 ? 1.271   -0.861  0.554   1.00 0.18  ? 114 VAL A CG1  4  
ATOM 8756  C CG2  . VAL A 1 114 ? 2.583   -0.006  2.504   1.00 0.17  ? 114 VAL A CG2  4  
ATOM 8757  H H    . VAL A 1 114 ? 1.875   -1.986  4.572   1.00 0.12  ? 114 VAL A H    4  
ATOM 8758  H HA   . VAL A 1 114 ? -0.165  -0.824  2.788   1.00 0.13  ? 114 VAL A HA   4  
ATOM 8759  H HB   . VAL A 1 114 ? 2.432   -2.014  1.888   1.00 0.16  ? 114 VAL A HB   4  
ATOM 8760  H HG11 . VAL A 1 114 ? 0.621   0.002   0.585   1.00 1.06  ? 114 VAL A HG11 4  
ATOM 8761  H HG12 . VAL A 1 114 ? 0.723   -1.712  0.179   1.00 1.03  ? 114 VAL A HG12 4  
ATOM 8762  H HG13 . VAL A 1 114 ? 2.109   -0.659  -0.098  1.00 1.01  ? 114 VAL A HG13 4  
ATOM 8763  H HG21 . VAL A 1 114 ? 1.933   0.847   2.629   1.00 0.97  ? 114 VAL A HG21 4  
ATOM 8764  H HG22 . VAL A 1 114 ? 3.378   0.238   1.818   1.00 0.98  ? 114 VAL A HG22 4  
ATOM 8765  H HG23 . VAL A 1 114 ? 2.997   -0.286  3.460   1.00 0.95  ? 114 VAL A HG23 4  
ATOM 8766  N N    . THR A 1 115 ? -1.002  -3.016  2.029   1.00 0.14  ? 115 THR A N    4  
ATOM 8767  C CA   . THR A 1 115 ? -1.456  -4.288  1.571   1.00 0.14  ? 115 THR A CA   4  
ATOM 8768  C C    . THR A 1 115 ? -1.415  -4.311  0.066   1.00 0.13  ? 115 THR A C    4  
ATOM 8769  O O    . THR A 1 115 ? -2.105  -3.547  -0.612  1.00 0.16  ? 115 THR A O    4  
ATOM 8770  C CB   . THR A 1 115 ? -2.851  -4.647  2.086   1.00 0.17  ? 115 THR A CB   4  
ATOM 8771  O OG1  . THR A 1 115 ? -2.823  -4.708  3.511   1.00 0.21  ? 115 THR A OG1  4  
ATOM 8772  C CG2  . THR A 1 115 ? -3.272  -5.993  1.546   1.00 0.20  ? 115 THR A CG2  4  
ATOM 8773  H H    . THR A 1 115 ? -1.554  -2.216  1.885   1.00 0.16  ? 115 THR A H    4  
ATOM 8774  H HA   . THR A 1 115 ? -0.762  -5.030  1.942   1.00 0.15  ? 115 THR A HA   4  
ATOM 8775  H HB   . THR A 1 115 ? -3.560  -3.896  1.766   1.00 0.18  ? 115 THR A HB   4  
ATOM 8776  H HG1  . THR A 1 115 ? -1.913  -4.825  3.803   1.00 0.68  ? 115 THR A HG1  4  
ATOM 8777  H HG21 . THR A 1 115 ? -4.252  -6.242  1.918   1.00 1.03  ? 115 THR A HG21 4  
ATOM 8778  H HG22 . THR A 1 115 ? -2.558  -6.734  1.872   1.00 1.00  ? 115 THR A HG22 4  
ATOM 8779  H HG23 . THR A 1 115 ? -3.288  -5.956  0.468   1.00 1.02  ? 115 THR A HG23 4  
ATOM 8780  N N    . ALA A 1 116 ? -0.552  -5.159  -0.430  1.00 0.12  ? 116 ALA A N    4  
ATOM 8781  C CA   . ALA A 1 116 ? -0.334  -5.308  -1.848  1.00 0.13  ? 116 ALA A CA   4  
ATOM 8782  C C    . ALA A 1 116 ? -0.531  -6.742  -2.252  1.00 0.12  ? 116 ALA A C    4  
ATOM 8783  O O    . ALA A 1 116 ? -0.041  -7.650  -1.583  1.00 0.13  ? 116 ALA A O    4  
ATOM 8784  C CB   . ALA A 1 116 ? 1.066   -4.860  -2.206  1.00 0.15  ? 116 ALA A CB   4  
ATOM 8785  H H    . ALA A 1 116 ? -0.038  -5.721  0.195   1.00 0.13  ? 116 ALA A H    4  
ATOM 8786  H HA   . ALA A 1 116 ? -1.034  -4.689  -2.382  1.00 0.14  ? 116 ALA A HA   4  
ATOM 8787  H HB1  . ALA A 1 116 ? 1.215   -3.840  -1.885  1.00 1.01  ? 116 ALA A HB1  4  
ATOM 8788  H HB2  . ALA A 1 116 ? 1.201   -4.925  -3.276  1.00 0.97  ? 116 ALA A HB2  4  
ATOM 8789  H HB3  . ALA A 1 116 ? 1.786   -5.500  -1.715  1.00 0.99  ? 116 ALA A HB3  4  
ATOM 8790  N N    . ASP A 1 117 ? -1.257  -6.946  -3.332  1.00 0.13  ? 117 ASP A N    4  
ATOM 8791  C CA   . ASP A 1 117 ? -1.402  -8.273  -3.896  1.00 0.13  ? 117 ASP A CA   4  
ATOM 8792  C C    . ASP A 1 117 ? -0.019  -8.869  -4.100  1.00 0.11  ? 117 ASP A C    4  
ATOM 8793  O O    . ASP A 1 117 ? 0.930   -8.141  -4.383  1.00 0.12  ? 117 ASP A O    4  
ATOM 8794  C CB   . ASP A 1 117 ? -2.113  -8.205  -5.239  1.00 0.16  ? 117 ASP A CB   4  
ATOM 8795  C CG   . ASP A 1 117 ? -2.580  -9.564  -5.740  1.00 0.20  ? 117 ASP A CG   4  
ATOM 8796  O OD1  . ASP A 1 117 ? -1.725  -10.452 -5.963  1.00 0.50  ? 117 ASP A OD1  4  
ATOM 8797  O OD2  . ASP A 1 117 ? -3.789  -9.727  -5.976  1.00 0.58  ? 117 ASP A OD2  4  
ATOM 8798  H H    . ASP A 1 117 ? -1.714  -6.187  -3.755  1.00 0.15  ? 117 ASP A H    4  
ATOM 8799  H HA   . ASP A 1 117 ? -1.962  -8.884  -3.215  1.00 0.14  ? 117 ASP A HA   4  
ATOM 8800  H HB2  . ASP A 1 117 ? -2.958  -7.543  -5.171  1.00 0.20  ? 117 ASP A HB2  4  
ATOM 8801  H HB3  . ASP A 1 117 ? -1.422  -7.806  -5.958  1.00 0.16  ? 117 ASP A HB3  4  
ATOM 8802  N N    . SER A 1 118 ? 0.097   -10.176 -3.961  1.00 0.13  ? 118 SER A N    4  
ATOM 8803  C CA   . SER A 1 118 ? 1.376   -10.845 -4.103  1.00 0.16  ? 118 SER A CA   4  
ATOM 8804  C C    . SER A 1 118 ? 1.968   -10.563 -5.488  1.00 0.13  ? 118 SER A C    4  
ATOM 8805  O O    . SER A 1 118 ? 3.178   -10.589 -5.679  1.00 0.15  ? 118 SER A O    4  
ATOM 8806  C CB   . SER A 1 118 ? 1.208   -12.346 -3.883  1.00 0.27  ? 118 SER A CB   4  
ATOM 8807  O OG   . SER A 1 118 ? 2.398   -12.928 -3.383  1.00 0.82  ? 118 SER A OG   4  
ATOM 8808  H H    . SER A 1 118 ? -0.697  -10.705 -3.761  1.00 0.16  ? 118 SER A H    4  
ATOM 8809  H HA   . SER A 1 118 ? 2.045   -10.451 -3.351  1.00 0.20  ? 118 SER A HA   4  
ATOM 8810  H HB2  . SER A 1 118 ? 0.414   -12.517 -3.172  1.00 0.43  ? 118 SER A HB2  4  
ATOM 8811  H HB3  . SER A 1 118 ? 0.955   -12.816 -4.822  1.00 0.38  ? 118 SER A HB3  4  
ATOM 8812  H HG   . SER A 1 118 ? 2.218   -13.828 -3.083  1.00 1.04  ? 118 SER A HG   4  
ATOM 8813  N N    . LYS A 1 119 ? 1.111   -10.273 -6.451  1.00 0.13  ? 119 LYS A N    4  
ATOM 8814  C CA   . LYS A 1 119 ? 1.561   -9.853  -7.773  1.00 0.14  ? 119 LYS A CA   4  
ATOM 8815  C C    . LYS A 1 119 ? 2.494   -8.633  -7.684  1.00 0.14  ? 119 LYS A C    4  
ATOM 8816  O O    . LYS A 1 119 ? 3.375   -8.456  -8.524  1.00 0.18  ? 119 LYS A O    4  
ATOM 8817  C CB   . LYS A 1 119 ? 0.364   -9.529  -8.667  1.00 0.17  ? 119 LYS A CB   4  
ATOM 8818  C CG   . LYS A 1 119 ? -0.614  -8.563  -8.042  1.00 0.19  ? 119 LYS A CG   4  
ATOM 8819  C CD   . LYS A 1 119 ? -1.685  -8.113  -9.028  1.00 0.29  ? 119 LYS A CD   4  
ATOM 8820  C CE   . LYS A 1 119 ? -2.591  -9.258  -9.462  1.00 0.38  ? 119 LYS A CE   4  
ATOM 8821  N NZ   . LYS A 1 119 ? -3.846  -9.328  -8.660  1.00 0.81  ? 119 LYS A NZ   4  
ATOM 8822  H H    . LYS A 1 119 ? 0.150   -10.347 -6.270  1.00 0.13  ? 119 LYS A H    4  
ATOM 8823  H HA   . LYS A 1 119 ? 2.110   -10.676 -8.210  1.00 0.17  ? 119 LYS A HA   4  
ATOM 8824  H HB2  . LYS A 1 119 ? 0.727   -9.077  -9.570  1.00 0.19  ? 119 LYS A HB2  4  
ATOM 8825  H HB3  . LYS A 1 119 ? -0.157  -10.447 -8.906  1.00 0.21  ? 119 LYS A HB3  4  
ATOM 8826  H HG2  . LYS A 1 119 ? -1.092  -9.043  -7.201  1.00 0.18  ? 119 LYS A HG2  4  
ATOM 8827  H HG3  . LYS A 1 119 ? -0.067  -7.698  -7.697  1.00 0.20  ? 119 LYS A HG3  4  
ATOM 8828  H HD2  . LYS A 1 119 ? -2.290  -7.355  -8.553  1.00 0.33  ? 119 LYS A HD2  4  
ATOM 8829  H HD3  . LYS A 1 119 ? -1.203  -7.694  -9.901  1.00 0.34  ? 119 LYS A HD3  4  
ATOM 8830  H HE2  . LYS A 1 119 ? -2.850  -9.118  -10.501 1.00 0.57  ? 119 LYS A HE2  4  
ATOM 8831  H HE3  . LYS A 1 119 ? -2.051  -10.188 -9.347  1.00 0.72  ? 119 LYS A HE3  4  
ATOM 8832  H HZ1  . LYS A 1 119 ? -3.632  -9.428  -7.644  1.00 1.31  ? 119 LYS A HZ1  4  
ATOM 8833  H HZ2  . LYS A 1 119 ? -4.420  -10.146 -8.962  1.00 1.31  ? 119 LYS A HZ2  4  
ATOM 8834  H HZ3  . LYS A 1 119 ? -4.409  -8.461  -8.804  1.00 1.43  ? 119 LYS A HZ3  4  
ATOM 8835  N N    . TYR A 1 120 ? 2.297   -7.792  -6.665  1.00 0.13  ? 120 TYR A N    4  
ATOM 8836  C CA   . TYR A 1 120 ? 3.180   -6.651  -6.430  1.00 0.15  ? 120 TYR A CA   4  
ATOM 8837  C C    . TYR A 1 120 ? 4.201   -6.988  -5.357  1.00 0.15  ? 120 TYR A C    4  
ATOM 8838  O O    . TYR A 1 120 ? 5.023   -6.154  -4.973  1.00 0.19  ? 120 TYR A O    4  
ATOM 8839  C CB   . TYR A 1 120 ? 2.378   -5.417  -6.010  1.00 0.16  ? 120 TYR A CB   4  
ATOM 8840  C CG   . TYR A 1 120 ? 1.436   -4.917  -7.066  1.00 0.20  ? 120 TYR A CG   4  
ATOM 8841  C CD1  . TYR A 1 120 ? 0.135   -5.386  -7.137  1.00 0.23  ? 120 TYR A CD1  4  
ATOM 8842  C CD2  . TYR A 1 120 ? 1.846   -3.972  -7.992  1.00 0.28  ? 120 TYR A CD2  4  
ATOM 8843  C CE1  . TYR A 1 120 ? -0.733  -4.928  -8.107  1.00 0.30  ? 120 TYR A CE1  4  
ATOM 8844  C CE2  . TYR A 1 120 ? 0.987   -3.509  -8.963  1.00 0.34  ? 120 TYR A CE2  4  
ATOM 8845  C CZ   . TYR A 1 120 ? -0.304  -3.995  -9.019  1.00 0.34  ? 120 TYR A CZ   4  
ATOM 8846  O OH   . TYR A 1 120 ? -1.165  -3.531  -9.983  1.00 0.42  ? 120 TYR A OH   4  
ATOM 8847  H H    . TYR A 1 120 ? 1.542   -7.942  -6.047  1.00 0.12  ? 120 TYR A H    4  
ATOM 8848  H HA   . TYR A 1 120 ? 3.701   -6.443  -7.346  1.00 0.17  ? 120 TYR A HA   4  
ATOM 8849  H HB2  . TYR A 1 120 ? 1.788   -5.657  -5.139  1.00 0.16  ? 120 TYR A HB2  4  
ATOM 8850  H HB3  . TYR A 1 120 ? 3.061   -4.617  -5.769  1.00 0.18  ? 120 TYR A HB3  4  
ATOM 8851  H HD1  . TYR A 1 120 ? -0.195  -6.127  -6.422  1.00 0.25  ? 120 TYR A HD1  4  
ATOM 8852  H HD2  . TYR A 1 120 ? 2.858   -3.596  -7.946  1.00 0.32  ? 120 TYR A HD2  4  
ATOM 8853  H HE1  . TYR A 1 120 ? -1.743  -5.303  -8.145  1.00 0.35  ? 120 TYR A HE1  4  
ATOM 8854  H HE2  . TYR A 1 120 ? 1.328   -2.769  -9.673  1.00 0.41  ? 120 TYR A HE2  4  
ATOM 8855  H HH   . TYR A 1 120 ? -2.035  -3.368  -9.590  1.00 1.04  ? 120 TYR A HH   4  
ATOM 8856  N N    . CYS A 1 121 ? 4.145   -8.224  -4.898  1.00 0.14  ? 121 CYS A N    4  
ATOM 8857  C CA   . CYS A 1 121 ? 5.009   -8.695  -3.833  1.00 0.15  ? 121 CYS A CA   4  
ATOM 8858  C C    . CYS A 1 121 ? 5.800   -9.917  -4.282  1.00 0.16  ? 121 CYS A C    4  
ATOM 8859  O O    . CYS A 1 121 ? 6.881   -9.776  -4.849  1.00 0.18  ? 121 CYS A O    4  
ATOM 8860  C CB   . CYS A 1 121 ? 4.188   -9.008  -2.588  1.00 0.14  ? 121 CYS A CB   4  
ATOM 8861  S SG   . CYS A 1 121 ? 3.245   -7.597  -1.971  1.00 0.16  ? 121 CYS A SG   4  
ATOM 8862  H H    . CYS A 1 121 ? 3.503   -8.849  -5.304  1.00 0.14  ? 121 CYS A H    4  
ATOM 8863  H HA   . CYS A 1 121 ? 5.704   -7.903  -3.602  1.00 0.16  ? 121 CYS A HA   4  
ATOM 8864  H HB2  . CYS A 1 121 ? 3.489   -9.803  -2.812  1.00 0.14  ? 121 CYS A HB2  4  
ATOM 8865  H HB3  . CYS A 1 121 ? 4.853   -9.333  -1.798  1.00 0.15  ? 121 CYS A HB3  4  
ATOM 8866  H HG   . CYS A 1 121 ? 1.957   -7.838  -2.185  1.00 0.87  ? 121 CYS A HG   4  
ATOM 8867  N N    . TYR A 1 122 ? 5.268   -11.120 -4.043  1.00 0.16  ? 122 TYR A N    4  
ATOM 8868  C CA   . TYR A 1 122 ? 5.947   -12.336 -4.472  1.00 0.18  ? 122 TYR A CA   4  
ATOM 8869  C C    . TYR A 1 122 ? 4.964   -13.399 -4.980  1.00 0.18  ? 122 TYR A C    4  
ATOM 8870  O O    . TYR A 1 122 ? 5.124   -14.565 -4.655  1.00 0.20  ? 122 TYR A O    4  
ATOM 8871  C CB   . TYR A 1 122 ? 6.754   -12.942 -3.317  1.00 0.19  ? 122 TYR A CB   4  
ATOM 8872  C CG   . TYR A 1 122 ? 7.543   -11.949 -2.490  1.00 0.20  ? 122 TYR A CG   4  
ATOM 8873  C CD1  . TYR A 1 122 ? 8.805   -11.525 -2.890  1.00 0.21  ? 122 TYR A CD1  4  
ATOM 8874  C CD2  . TYR A 1 122 ? 7.020   -11.429 -1.312  1.00 0.19  ? 122 TYR A CD2  4  
ATOM 8875  C CE1  . TYR A 1 122 ? 9.518   -10.617 -2.142  1.00 0.23  ? 122 TYR A CE1  4  
ATOM 8876  C CE2  . TYR A 1 122 ? 7.730   -10.518 -0.561  1.00 0.20  ? 122 TYR A CE2  4  
ATOM 8877  C CZ   . TYR A 1 122 ? 8.998   -10.143 -0.968  1.00 0.22  ? 122 TYR A CZ   4  
ATOM 8878  O OH   . TYR A 1 122 ? 9.687   -9.206  -0.235  1.00 0.24  ? 122 TYR A OH   4  
ATOM 8879  H H    . TYR A 1 122 ? 4.416   -11.187 -3.557  1.00 0.15  ? 122 TYR A H    4  
ATOM 8880  H HA   . TYR A 1 122 ? 6.622   -12.073 -5.271  1.00 0.19  ? 122 TYR A HA   4  
ATOM 8881  H HB2  . TYR A 1 122 ? 6.087   -13.473 -2.655  1.00 0.20  ? 122 TYR A HB2  4  
ATOM 8882  H HB3  . TYR A 1 122 ? 7.457   -13.649 -3.734  1.00 0.22  ? 122 TYR A HB3  4  
ATOM 8883  H HD1  . TYR A 1 122 ? 9.228   -11.911 -3.805  1.00 0.23  ? 122 TYR A HD1  4  
ATOM 8884  H HD2  . TYR A 1 122 ? 6.041   -11.746 -0.987  1.00 0.19  ? 122 TYR A HD2  4  
ATOM 8885  H HE1  . TYR A 1 122 ? 10.494  -10.304 -2.471  1.00 0.25  ? 122 TYR A HE1  4  
ATOM 8886  H HE2  . TYR A 1 122 ? 7.309   -10.126 0.353   1.00 0.21  ? 122 TYR A HE2  4  
ATOM 8887  H HH   . TYR A 1 122 ? 9.672   -9.468  0.689   1.00 0.96  ? 122 TYR A HH   4  
ATOM 8888  N N    . GLY A 1 123 ? 3.963   -13.003 -5.772  1.00 0.19  ? 123 GLY A N    4  
ATOM 8889  C CA   . GLY A 1 123 ? 2.998   -13.962 -6.309  1.00 0.21  ? 123 GLY A CA   4  
ATOM 8890  C C    . GLY A 1 123 ? 3.644   -15.152 -7.001  1.00 0.21  ? 123 GLY A C    4  
ATOM 8891  O O    . GLY A 1 123 ? 3.841   -16.196 -6.390  1.00 0.25  ? 123 GLY A O    4  
ATOM 8892  H H    . GLY A 1 123 ? 3.839   -12.039 -5.956  1.00 0.20  ? 123 GLY A H    4  
ATOM 8893  H HA2  . GLY A 1 123 ? 2.385   -14.326 -5.499  1.00 0.24  ? 123 GLY A HA2  4  
ATOM 8894  H HA3  . GLY A 1 123 ? 2.363   -13.450 -7.019  1.00 0.25  ? 123 GLY A HA3  4  
ATOM 8895  N N    . PRO A 1 124 ? 3.966   -15.036 -8.291  1.00 0.25  ? 124 PRO A N    4  
ATOM 8896  C CA   . PRO A 1 124 ? 4.693   -16.074 -9.015  1.00 0.30  ? 124 PRO A CA   4  
ATOM 8897  C C    . PRO A 1 124 ? 6.193   -15.966 -8.769  1.00 0.30  ? 124 PRO A C    4  
ATOM 8898  O O    . PRO A 1 124 ? 6.999   -16.591 -9.455  1.00 0.34  ? 124 PRO A O    4  
ATOM 8899  C CB   . PRO A 1 124 ? 4.372   -15.786 -10.492 1.00 0.37  ? 124 PRO A CB   4  
ATOM 8900  C CG   . PRO A 1 124 ? 3.466   -14.591 -10.499 1.00 0.58  ? 124 PRO A CG   4  
ATOM 8901  C CD   . PRO A 1 124 ? 3.628   -13.917 -9.165  1.00 0.32  ? 124 PRO A CD   4  
ATOM 8902  H HA   . PRO A 1 124 ? 4.350   -17.064 -8.749  1.00 0.33  ? 124 PRO A HA   4  
ATOM 8903  H HB2  . PRO A 1 124 ? 5.288   -15.581 -11.022 1.00 0.46  ? 124 PRO A HB2  4  
ATOM 8904  H HB3  . PRO A 1 124 ? 3.885   -16.645 -10.930 1.00 0.45  ? 124 PRO A HB3  4  
ATOM 8905  H HG2  . PRO A 1 124 ? 3.758   -13.919 -11.294 1.00 0.90  ? 124 PRO A HG2  4  
ATOM 8906  H HG3  . PRO A 1 124 ? 2.443   -14.911 -10.637 1.00 0.87  ? 124 PRO A HG3  4  
ATOM 8907  H HD2  . PRO A 1 124 ? 4.431   -13.194 -9.199  1.00 0.40  ? 124 PRO A HD2  4  
ATOM 8908  H HD3  . PRO A 1 124 ? 2.705   -13.450 -8.858  1.00 0.38  ? 124 PRO A HD3  4  
ATOM 8909  N N    . GLN A 1 125 ? 6.555   -15.153 -7.788  1.00 0.27  ? 125 GLN A N    4  
ATOM 8910  C CA   . GLN A 1 125 ? 7.946   -14.867 -7.495  1.00 0.30  ? 125 GLN A CA   4  
ATOM 8911  C C    . GLN A 1 125 ? 8.387   -15.643 -6.271  1.00 0.32  ? 125 GLN A C    4  
ATOM 8912  O O    . GLN A 1 125 ? 9.437   -16.286 -6.260  1.00 0.39  ? 125 GLN A O    4  
ATOM 8913  C CB   . GLN A 1 125 ? 8.101   -13.373 -7.247  1.00 0.30  ? 125 GLN A CB   4  
ATOM 8914  C CG   . GLN A 1 125 ? 7.528   -12.531 -8.369  1.00 0.33  ? 125 GLN A CG   4  
ATOM 8915  C CD   . GLN A 1 125 ? 7.453   -11.061 -8.014  1.00 0.35  ? 125 GLN A CD   4  
ATOM 8916  O OE1  . GLN A 1 125 ? 8.407   -10.312 -8.212  1.00 0.65  ? 125 GLN A OE1  4  
ATOM 8917  N NE2  . GLN A 1 125 ? 6.305   -10.632 -7.509  1.00 0.29  ? 125 GLN A NE2  4  
ATOM 8918  H H    . GLN A 1 125 ? 5.864   -14.753 -7.219  1.00 0.24  ? 125 GLN A H    4  
ATOM 8919  H HA   . GLN A 1 125 ? 8.544   -15.157 -8.344  1.00 0.34  ? 125 GLN A HA   4  
ATOM 8920  H HB2  . GLN A 1 125 ? 7.592   -13.116 -6.329  1.00 0.33  ? 125 GLN A HB2  4  
ATOM 8921  H HB3  . GLN A 1 125 ? 9.149   -13.139 -7.148  1.00 0.36  ? 125 GLN A HB3  4  
ATOM 8922  H HG2  . GLN A 1 125 ? 8.149   -12.649 -9.238  1.00 0.39  ? 125 GLN A HG2  4  
ATOM 8923  H HG3  . GLN A 1 125 ? 6.532   -12.884 -8.592  1.00 0.38  ? 125 GLN A HG3  4  
ATOM 8924  H HE21 . GLN A 1 125 ? 5.578   -11.274 -7.404  1.00 0.45  ? 125 GLN A HE21 4  
ATOM 8925  H HE22 . GLN A 1 125 ? 6.240   -9.690  -7.244  1.00 0.29  ? 125 GLN A HE22 4  
ATOM 8926  N N    . GLY A 1 126 ? 7.550   -15.585 -5.249  1.00 0.27  ? 126 GLY A N    4  
ATOM 8927  C CA   . GLY A 1 126 ? 7.863   -16.183 -3.980  1.00 0.27  ? 126 GLY A CA   4  
ATOM 8928  C C    . GLY A 1 126 ? 8.820   -15.344 -3.177  1.00 0.28  ? 126 GLY A C    4  
ATOM 8929  O O    . GLY A 1 126 ? 9.710   -14.691 -3.720  1.00 0.30  ? 126 GLY A O    4  
ATOM 8930  H H    . GLY A 1 126 ? 6.691   -15.130 -5.360  1.00 0.24  ? 126 GLY A H    4  
ATOM 8931  H HA2  . GLY A 1 126 ? 6.946   -16.283 -3.415  1.00 0.25  ? 126 GLY A HA2  4  
ATOM 8932  H HA3  . GLY A 1 126 ? 8.288   -17.159 -4.136  1.00 0.30  ? 126 GLY A HA3  4  
ATOM 8933  N N    . SER A 1 127 ? 8.618   -15.351 -1.882  1.00 0.27  ? 127 SER A N    4  
ATOM 8934  C CA   . SER A 1 127 ? 9.394   -14.524 -0.989  1.00 0.28  ? 127 SER A CA   4  
ATOM 8935  C C    . SER A 1 127 ? 10.633  -15.246 -0.470  1.00 0.32  ? 127 SER A C    4  
ATOM 8936  O O    . SER A 1 127 ? 10.710  -16.473 -0.497  1.00 0.33  ? 127 SER A O    4  
ATOM 8937  C CB   . SER A 1 127 ? 8.498   -14.041 0.163   1.00 0.27  ? 127 SER A CB   4  
ATOM 8938  O OG   . SER A 1 127 ? 9.244   -13.549 1.263   1.00 0.30  ? 127 SER A OG   4  
ATOM 8939  H H    . SER A 1 127 ? 7.903   -15.901 -1.522  1.00 0.26  ? 127 SER A H    4  
ATOM 8940  H HA   . SER A 1 127 ? 9.712   -13.683 -1.550  1.00 0.29  ? 127 SER A HA   4  
ATOM 8941  H HB2  . SER A 1 127 ? 7.861   -13.246 -0.193  1.00 0.25  ? 127 SER A HB2  4  
ATOM 8942  H HB3  . SER A 1 127 ? 7.870   -14.858 0.491   1.00 0.27  ? 127 SER A HB3  4  
ATOM 8943  H HG   . SER A 1 127 ? 9.043   -14.076 2.040   1.00 0.90  ? 127 SER A HG   4  
ATOM 8944  N N    . ARG A 1 128 ? 11.604  -14.443 -0.022  1.00 0.38  ? 128 ARG A N    4  
ATOM 8945  C CA   . ARG A 1 128 ? 12.898  -14.928 0.449   1.00 0.42  ? 128 ARG A CA   4  
ATOM 8946  C C    . ARG A 1 128 ? 12.751  -16.099 1.410   1.00 0.42  ? 128 ARG A C    4  
ATOM 8947  O O    . ARG A 1 128 ? 13.323  -17.164 1.190   1.00 0.52  ? 128 ARG A O    4  
ATOM 8948  C CB   . ARG A 1 128 ? 13.657  -13.789 1.133   1.00 0.52  ? 128 ARG A CB   4  
ATOM 8949  C CG   . ARG A 1 128 ? 14.142  -12.713 0.173   1.00 1.12  ? 128 ARG A CG   4  
ATOM 8950  C CD   . ARG A 1 128 ? 14.725  -11.521 0.916   1.00 1.41  ? 128 ARG A CD   4  
ATOM 8951  N NE   . ARG A 1 128 ? 13.696  -10.696 1.554   1.00 1.81  ? 128 ARG A NE   4  
ATOM 8952  C CZ   . ARG A 1 128 ? 13.951  -9.550  2.188   1.00 2.33  ? 128 ARG A CZ   4  
ATOM 8953  N NH1  . ARG A 1 128 ? 15.203  -9.132  2.334   1.00 2.45  ? 128 ARG A NH1  4  
ATOM 8954  N NH2  . ARG A 1 128 ? 12.963  -8.827  2.695   1.00 3.17  ? 128 ARG A NH2  4  
ATOM 8955  H H    . ARG A 1 128 ? 11.437  -13.479 -0.008  1.00 0.44  ? 128 ARG A H    4  
ATOM 8956  H HA   . ARG A 1 128 ? 13.463  -15.253 -0.411  1.00 0.43  ? 128 ARG A HA   4  
ATOM 8957  H HB2  . ARG A 1 128 ? 13.007  -13.325 1.859   1.00 0.97  ? 128 ARG A HB2  4  
ATOM 8958  H HB3  . ARG A 1 128 ? 14.517  -14.201 1.644   1.00 1.07  ? 128 ARG A HB3  4  
ATOM 8959  H HG2  . ARG A 1 128 ? 14.904  -13.131 -0.467  1.00 1.62  ? 128 ARG A HG2  4  
ATOM 8960  H HG3  . ARG A 1 128 ? 13.308  -12.380 -0.427  1.00 1.72  ? 128 ARG A HG3  4  
ATOM 8961  H HD2  . ARG A 1 128 ? 15.396  -11.887 1.678   1.00 1.89  ? 128 ARG A HD2  4  
ATOM 8962  H HD3  . ARG A 1 128 ? 15.279  -10.912 0.217   1.00 1.87  ? 128 ARG A HD3  4  
ATOM 8963  H HE   . ARG A 1 128 ? 12.769  -11.001 1.485   1.00 2.16  ? 128 ARG A HE   4  
ATOM 8964  H HH11 . ARG A 1 128 ? 15.963  -9.670  1.971   1.00 2.38  ? 128 ARG A HH11 4  
ATOM 8965  H HH12 . ARG A 1 128 ? 15.392  -8.262  2.820   1.00 2.95  ? 128 ARG A HH12 4  
ATOM 8966  H HH21 . ARG A 1 128 ? 12.009  -9.132  2.610   1.00 3.53  ? 128 ARG A HH21 4  
ATOM 8967  H HH22 . ARG A 1 128 ? 13.171  -7.953  3.165   1.00 3.61  ? 128 ARG A HH22 4  
ATOM 8968  N N    . SER A 1 129 ? 11.986  -15.903 2.474   1.00 0.42  ? 129 SER A N    4  
ATOM 8969  C CA   . SER A 1 129 ? 11.788  -16.963 3.445   1.00 0.44  ? 129 SER A CA   4  
ATOM 8970  C C    . SER A 1 129 ? 10.718  -17.943 2.947   1.00 0.41  ? 129 SER A C    4  
ATOM 8971  O O    . SER A 1 129 ? 11.021  -19.113 2.727   1.00 0.44  ? 129 SER A O    4  
ATOM 8972  C CB   . SER A 1 129 ? 11.447  -16.387 4.827   1.00 0.48  ? 129 SER A CB   4  
ATOM 8973  O OG   . SER A 1 129 ? 11.409  -17.405 5.811   1.00 1.23  ? 129 SER A OG   4  
ATOM 8974  H H    . SER A 1 129 ? 11.546  -15.039 2.600   1.00 0.48  ? 129 SER A H    4  
ATOM 8975  H HA   . SER A 1 129 ? 12.725  -17.503 3.518   1.00 0.46  ? 129 SER A HA   4  
ATOM 8976  H HB2  . SER A 1 129 ? 12.194  -15.661 5.108   1.00 0.81  ? 129 SER A HB2  4  
ATOM 8977  H HB3  . SER A 1 129 ? 10.480  -15.907 4.784   1.00 1.00  ? 129 SER A HB3  4  
ATOM 8978  H HG   . SER A 1 129 ? 11.855  -18.194 5.476   1.00 1.52  ? 129 SER A HG   4  
ATOM 8979  N N    . PRO A 1 130 ? 9.453   -17.512 2.756   1.00 0.37  ? 130 PRO A N    4  
ATOM 8980  C CA   . PRO A 1 130 ? 8.434   -18.346 2.166   1.00 0.36  ? 130 PRO A CA   4  
ATOM 8981  C C    . PRO A 1 130 ? 8.112   -17.933 0.740   1.00 0.32  ? 130 PRO A C    4  
ATOM 8982  O O    . PRO A 1 130 ? 7.821   -16.773 0.485   1.00 0.27  ? 130 PRO A O    4  
ATOM 8983  C CB   . PRO A 1 130 ? 7.218   -18.028 3.049   1.00 0.37  ? 130 PRO A CB   4  
ATOM 8984  C CG   . PRO A 1 130 ? 7.540   -16.720 3.728   1.00 0.37  ? 130 PRO A CG   4  
ATOM 8985  C CD   . PRO A 1 130 ? 8.849   -16.243 3.151   1.00 0.37  ? 130 PRO A CD   4  
ATOM 8986  H HA   . PRO A 1 130 ? 8.669   -19.397 2.220   1.00 0.40  ? 130 PRO A HA   4  
ATOM 8987  H HB2  . PRO A 1 130 ? 6.340   -17.935 2.425   1.00 0.35  ? 130 PRO A HB2  4  
ATOM 8988  H HB3  . PRO A 1 130 ? 7.066   -18.815 3.763   1.00 0.44  ? 130 PRO A HB3  4  
ATOM 8989  H HG2  . PRO A 1 130 ? 6.758   -16.002 3.523   1.00 0.37  ? 130 PRO A HG2  4  
ATOM 8990  H HG3  . PRO A 1 130 ? 7.636   -16.872 4.792   1.00 0.41  ? 130 PRO A HG3  4  
ATOM 8991  H HD2  . PRO A 1 130 ? 8.679   -15.604 2.295   1.00 0.35  ? 130 PRO A HD2  4  
ATOM 8992  H HD3  . PRO A 1 130 ? 9.437   -15.739 3.891   1.00 0.40  ? 130 PRO A HD3  4  
ATOM 8993  N N    . TYR A 1 131 ? 8.161   -18.862 -0.189  1.00 0.33  ? 131 TYR A N    4  
ATOM 8994  C CA   . TYR A 1 131 ? 7.538   -18.644 -1.480  1.00 0.32  ? 131 TYR A CA   4  
ATOM 8995  C C    . TYR A 1 131 ? 6.071   -18.304 -1.253  1.00 0.30  ? 131 TYR A C    4  
ATOM 8996  O O    . TYR A 1 131 ? 5.249   -19.181 -0.985  1.00 0.32  ? 131 TYR A O    4  
ATOM 8997  C CB   . TYR A 1 131 ? 7.684   -19.880 -2.376  1.00 0.36  ? 131 TYR A CB   4  
ATOM 8998  C CG   . TYR A 1 131 ? 6.915   -19.801 -3.685  1.00 0.45  ? 131 TYR A CG   4  
ATOM 8999  C CD1  . TYR A 1 131 ? 5.594   -20.234 -3.766  1.00 0.78  ? 131 TYR A CD1  4  
ATOM 9000  C CD2  . TYR A 1 131 ? 7.499   -19.278 -4.832  1.00 1.00  ? 131 TYR A CD2  4  
ATOM 9001  C CE1  . TYR A 1 131 ? 4.888   -20.158 -4.950  1.00 0.87  ? 131 TYR A CE1  4  
ATOM 9002  C CE2  . TYR A 1 131 ? 6.797   -19.200 -6.021  1.00 1.14  ? 131 TYR A CE2  4  
ATOM 9003  C CZ   . TYR A 1 131 ? 5.489   -19.635 -6.074  1.00 0.81  ? 131 TYR A CZ   4  
ATOM 9004  O OH   . TYR A 1 131 ? 4.788   -19.557 -7.257  1.00 1.00  ? 131 TYR A OH   4  
ATOM 9005  H H    . TYR A 1 131 ? 8.669   -19.671 -0.028  1.00 0.36  ? 131 TYR A H    4  
ATOM 9006  H HA   . TYR A 1 131 ? 8.028   -17.800 -1.946  1.00 0.31  ? 131 TYR A HA   4  
ATOM 9007  H HB2  . TYR A 1 131 ? 8.728   -20.008 -2.617  1.00 0.39  ? 131 TYR A HB2  4  
ATOM 9008  H HB3  . TYR A 1 131 ? 7.335   -20.747 -1.836  1.00 0.43  ? 131 TYR A HB3  4  
ATOM 9009  H HD1  . TYR A 1 131 ? 5.121   -20.641 -2.884  1.00 1.27  ? 131 TYR A HD1  4  
ATOM 9010  H HD2  . TYR A 1 131 ? 8.524   -18.935 -4.790  1.00 1.48  ? 131 TYR A HD2  4  
ATOM 9011  H HE1  . TYR A 1 131 ? 3.865   -20.497 -4.986  1.00 1.32  ? 131 TYR A HE1  4  
ATOM 9012  H HE2  . TYR A 1 131 ? 7.271   -18.790 -6.900  1.00 1.69  ? 131 TYR A HE2  4  
ATOM 9013  H HH   . TYR A 1 131 ? 5.378   -19.766 -7.989  1.00 1.33  ? 131 TYR A HH   4  
ATOM 9014  N N    . ILE A 1 132 ? 5.770   -17.013 -1.279  1.00 0.27  ? 132 ILE A N    4  
ATOM 9015  C CA   . ILE A 1 132 ? 4.421   -16.548 -1.057  1.00 0.26  ? 132 ILE A CA   4  
ATOM 9016  C C    . ILE A 1 132 ? 3.520   -17.003 -2.200  1.00 0.25  ? 132 ILE A C    4  
ATOM 9017  O O    . ILE A 1 132 ? 3.850   -16.796 -3.363  1.00 0.25  ? 132 ILE A O    4  
ATOM 9018  C CB   . ILE A 1 132 ? 4.365   -15.010 -0.956  1.00 0.25  ? 132 ILE A CB   4  
ATOM 9019  C CG1  . ILE A 1 132 ? 5.374   -14.465 0.051   1.00 0.39  ? 132 ILE A CG1  4  
ATOM 9020  C CG2  . ILE A 1 132 ? 2.966   -14.562 -0.580  1.00 0.26  ? 132 ILE A CG2  4  
ATOM 9021  C CD1  . ILE A 1 132 ? 5.288   -15.071 1.423   1.00 0.23  ? 132 ILE A CD1  4  
ATOM 9022  H H    . ILE A 1 132 ? 6.478   -16.358 -1.435  1.00 0.27  ? 132 ILE A H    4  
ATOM 9023  H HA   . ILE A 1 132 ? 4.065   -16.968 -0.129  1.00 0.27  ? 132 ILE A HA   4  
ATOM 9024  H HB   . ILE A 1 132 ? 4.606   -14.610 -1.926  1.00 0.23  ? 132 ILE A HB   4  
ATOM 9025  H HG12 . ILE A 1 132 ? 6.370   -14.641 -0.320  1.00 0.58  ? 132 ILE A HG12 4  
ATOM 9026  H HG13 . ILE A 1 132 ? 5.220   -13.397 0.159   1.00 0.64  ? 132 ILE A HG13 4  
ATOM 9027  H HG21 . ILE A 1 132 ? 2.939   -13.486 -0.514  1.00 1.06  ? 132 ILE A HG21 4  
ATOM 9028  H HG22 . ILE A 1 132 ? 2.703   -14.990 0.380   1.00 1.06  ? 132 ILE A HG22 4  
ATOM 9029  H HG23 . ILE A 1 132 ? 2.268   -14.898 -1.330  1.00 1.01  ? 132 ILE A HG23 4  
ATOM 9030  H HD11 . ILE A 1 132 ? 5.410   -16.140 1.349   1.00 0.99  ? 132 ILE A HD11 4  
ATOM 9031  H HD12 . ILE A 1 132 ? 4.331   -14.839 1.863   1.00 1.02  ? 132 ILE A HD12 4  
ATOM 9032  H HD13 . ILE A 1 132 ? 6.081   -14.659 2.032   1.00 1.05  ? 132 ILE A HD13 4  
ATOM 9033  N N    . PRO A 1 133 ? 2.386   -17.642 -1.880  1.00 0.27  ? 133 PRO A N    4  
ATOM 9034  C CA   . PRO A 1 133 ? 1.421   -18.089 -2.888  1.00 0.28  ? 133 PRO A CA   4  
ATOM 9035  C C    . PRO A 1 133 ? 0.971   -16.948 -3.801  1.00 0.26  ? 133 PRO A C    4  
ATOM 9036  O O    . PRO A 1 133 ? 0.764   -15.812 -3.351  1.00 0.26  ? 133 PRO A O    4  
ATOM 9037  C CB   . PRO A 1 133 ? 0.238   -18.623 -2.065  1.00 0.34  ? 133 PRO A CB   4  
ATOM 9038  C CG   . PRO A 1 133 ? 0.473   -18.152 -0.667  1.00 0.61  ? 133 PRO A CG   4  
ATOM 9039  C CD   . PRO A 1 133 ? 1.958   -18.000 -0.521  1.00 0.31  ? 133 PRO A CD   4  
ATOM 9040  H HA   . PRO A 1 133 ? 1.825   -18.886 -3.493  1.00 0.29  ? 133 PRO A HA   4  
ATOM 9041  H HB2  . PRO A 1 133 ? -0.685  -18.230 -2.462  1.00 0.49  ? 133 PRO A HB2  4  
ATOM 9042  H HB3  . PRO A 1 133 ? 0.222   -19.701 -2.117  1.00 0.43  ? 133 PRO A HB3  4  
ATOM 9043  H HG2  . PRO A 1 133 ? -0.017  -17.204 -0.512  1.00 0.97  ? 133 PRO A HG2  4  
ATOM 9044  H HG3  . PRO A 1 133 ? 0.103   -18.888 0.032   1.00 1.03  ? 133 PRO A HG3  4  
ATOM 9045  H HD2  . PRO A 1 133 ? 2.193   -17.211 0.180   1.00 0.37  ? 133 PRO A HD2  4  
ATOM 9046  H HD3  . PRO A 1 133 ? 2.405   -18.932 -0.208  1.00 0.50  ? 133 PRO A HD3  4  
ATOM 9047  N N    . PRO A 1 134 ? 0.843   -17.232 -5.104  1.00 0.27  ? 134 PRO A N    4  
ATOM 9048  C CA   . PRO A 1 134 ? 0.410   -16.248 -6.088  1.00 0.25  ? 134 PRO A CA   4  
ATOM 9049  C C    . PRO A 1 134 ? -0.891  -15.559 -5.704  1.00 0.27  ? 134 PRO A C    4  
ATOM 9050  O O    . PRO A 1 134 ? -1.879  -16.207 -5.355  1.00 0.32  ? 134 PRO A O    4  
ATOM 9051  C CB   . PRO A 1 134 ? 0.212   -17.067 -7.357  1.00 0.29  ? 134 PRO A CB   4  
ATOM 9052  C CG   . PRO A 1 134 ? 1.124   -18.232 -7.197  1.00 0.52  ? 134 PRO A CG   4  
ATOM 9053  C CD   . PRO A 1 134 ? 1.145   -18.536 -5.725  1.00 0.33  ? 134 PRO A CD   4  
ATOM 9054  H HA   . PRO A 1 134 ? 1.173   -15.503 -6.256  1.00 0.23  ? 134 PRO A HA   4  
ATOM 9055  H HB2  . PRO A 1 134 ? -0.821  -17.378 -7.431  1.00 0.50  ? 134 PRO A HB2  4  
ATOM 9056  H HB3  . PRO A 1 134 ? 0.479   -16.468 -8.216  1.00 0.43  ? 134 PRO A HB3  4  
ATOM 9057  H HG2  . PRO A 1 134 ? 0.739   -19.075 -7.749  1.00 0.89  ? 134 PRO A HG2  4  
ATOM 9058  H HG3  . PRO A 1 134 ? 2.114   -17.974 -7.543  1.00 0.83  ? 134 PRO A HG3  4  
ATOM 9059  H HD2  . PRO A 1 134 ? 0.390   -19.269 -5.479  1.00 0.43  ? 134 PRO A HD2  4  
ATOM 9060  H HD3  . PRO A 1 134 ? 2.123   -18.884 -5.425  1.00 0.41  ? 134 PRO A HD3  4  
ATOM 9061  N N    . HIS A 1 135 ? -0.858  -14.231 -5.750  1.00 0.26  ? 135 HIS A N    4  
ATOM 9062  C CA   . HIS A 1 135 ? -2.034  -13.389 -5.503  1.00 0.31  ? 135 HIS A CA   4  
ATOM 9063  C C    . HIS A 1 135 ? -2.470  -13.409 -4.041  1.00 0.32  ? 135 HIS A C    4  
ATOM 9064  O O    . HIS A 1 135 ? -3.581  -12.997 -3.714  1.00 0.44  ? 135 HIS A O    4  
ATOM 9065  C CB   . HIS A 1 135 ? -3.211  -13.777 -6.412  1.00 0.41  ? 135 HIS A CB   4  
ATOM 9066  C CG   . HIS A 1 135 ? -2.965  -13.501 -7.861  1.00 0.87  ? 135 HIS A CG   4  
ATOM 9067  N ND1  . HIS A 1 135 ? -3.781  -13.963 -8.866  1.00 1.81  ? 135 HIS A ND1  4  
ATOM 9068  C CD2  . HIS A 1 135 ? -1.977  -12.806 -8.472  1.00 1.64  ? 135 HIS A CD2  4  
ATOM 9069  C CE1  . HIS A 1 135 ? -3.309  -13.568 -10.031 1.00 2.38  ? 135 HIS A CE1  4  
ATOM 9070  N NE2  . HIS A 1 135 ? -2.211  -12.862 -9.825  1.00 2.25  ? 135 HIS A NE2  4  
ATOM 9071  H H    . HIS A 1 135 ? -0.002  -13.794 -5.958  1.00 0.26  ? 135 HIS A H    4  
ATOM 9072  H HA   . HIS A 1 135 ? -1.746  -12.376 -5.746  1.00 0.31  ? 135 HIS A HA   4  
ATOM 9073  H HB2  . HIS A 1 135 ? -3.410  -14.833 -6.302  1.00 1.01  ? 135 HIS A HB2  4  
ATOM 9074  H HB3  . HIS A 1 135 ? -4.085  -13.218 -6.112  1.00 1.01  ? 135 HIS A HB3  4  
ATOM 9075  H HD1  . HIS A 1 135 ? -4.607  -14.499 -8.743  1.00 2.34  ? 135 HIS A HD1  4  
ATOM 9076  H HD2  . HIS A 1 135 ? -1.163  -12.290 -7.981  1.00 2.21  ? 135 HIS A HD2  4  
ATOM 9077  H HE1  . HIS A 1 135 ? -3.748  -13.782 -10.996 1.00 3.19  ? 135 HIS A HE1  4  
ATOM 9078  H HE2  . HIS A 1 135 ? -1.523  -12.695 -10.518 1.00 2.82  ? 135 HIS A HE2  4  
ATOM 9079  N N    . ALA A 1 136 ? -1.602  -13.883 -3.158  1.00 0.24  ? 136 ALA A N    4  
ATOM 9080  C CA   . ALA A 1 136 ? -1.855  -13.759 -1.731  1.00 0.24  ? 136 ALA A CA   4  
ATOM 9081  C C    . ALA A 1 136 ? -1.582  -12.325 -1.306  1.00 0.21  ? 136 ALA A C    4  
ATOM 9082  O O    . ALA A 1 136 ? -0.488  -11.810 -1.525  1.00 0.22  ? 136 ALA A O    4  
ATOM 9083  C CB   . ALA A 1 136 ? -0.990  -14.727 -0.936  1.00 0.26  ? 136 ALA A CB   4  
ATOM 9084  H H    . ALA A 1 136 ? -0.777  -14.316 -3.467  1.00 0.22  ? 136 ALA A H    4  
ATOM 9085  H HA   . ALA A 1 136 ? -2.895  -13.992 -1.545  1.00 0.28  ? 136 ALA A HA   4  
ATOM 9086  H HB1  . ALA A 1 136 ? -1.234  -14.651 0.113   1.00 0.98  ? 136 ALA A HB1  4  
ATOM 9087  H HB2  . ALA A 1 136 ? 0.050   -14.481 -1.082  1.00 1.04  ? 136 ALA A HB2  4  
ATOM 9088  H HB3  . ALA A 1 136 ? -1.171  -15.738 -1.276  1.00 1.04  ? 136 ALA A HB3  4  
ATOM 9089  N N    . ALA A 1 137 ? -2.564  -11.680 -0.709  1.00 0.18  ? 137 ALA A N    4  
ATOM 9090  C CA   . ALA A 1 137 ? -2.443  -10.265 -0.397  1.00 0.19  ? 137 ALA A CA   4  
ATOM 9091  C C    . ALA A 1 137 ? -1.505  -10.063 0.783   1.00 0.16  ? 137 ALA A C    4  
ATOM 9092  O O    . ALA A 1 137 ? -1.760  -10.533 1.890   1.00 0.20  ? 137 ALA A O    4  
ATOM 9093  C CB   . ALA A 1 137 ? -3.813  -9.655  -0.134  1.00 0.22  ? 137 ALA A CB   4  
ATOM 9094  H H    . ALA A 1 137 ? -3.374  -12.170 -0.440  1.00 0.18  ? 137 ALA A H    4  
ATOM 9095  H HA   . ALA A 1 137 ? -2.020  -9.775  -1.263  1.00 0.21  ? 137 ALA A HA   4  
ATOM 9096  H HB1  . ALA A 1 137 ? -4.404  -9.700  -1.037  1.00 1.03  ? 137 ALA A HB1  4  
ATOM 9097  H HB2  . ALA A 1 137 ? -3.700  -8.626  0.171   1.00 1.05  ? 137 ALA A HB2  4  
ATOM 9098  H HB3  . ALA A 1 137 ? -4.311  -10.208 0.642   1.00 1.04  ? 137 ALA A HB3  4  
ATOM 9099  N N    . LEU A 1 138 ? -0.401  -9.396  0.519   1.00 0.13  ? 138 LEU A N    4  
ATOM 9100  C CA   . LEU A 1 138 ? 0.615   -9.172  1.521   1.00 0.12  ? 138 LEU A CA   4  
ATOM 9101  C C    . LEU A 1 138 ? 0.346   -7.900  2.290   1.00 0.13  ? 138 LEU A C    4  
ATOM 9102  O O    . LEU A 1 138 ? 0.013   -6.873  1.705   1.00 0.15  ? 138 LEU A O    4  
ATOM 9103  C CB   . LEU A 1 138 ? 1.990   -9.089  0.875   1.00 0.13  ? 138 LEU A CB   4  
ATOM 9104  C CG   . LEU A 1 138 ? 2.936   -10.204 1.284   1.00 0.15  ? 138 LEU A CG   4  
ATOM 9105  C CD1  . LEU A 1 138 ? 2.302   -11.547 1.008   1.00 0.22  ? 138 LEU A CD1  4  
ATOM 9106  C CD2  . LEU A 1 138 ? 4.268   -10.081 0.566   1.00 0.19  ? 138 LEU A CD2  4  
ATOM 9107  H H    . LEU A 1 138 ? -0.266  -9.039  -0.383  1.00 0.13  ? 138 LEU A H    4  
ATOM 9108  H HA   . LEU A 1 138 ? 0.600   -10.010 2.199   1.00 0.12  ? 138 LEU A HA   4  
ATOM 9109  H HB2  . LEU A 1 138 ? 1.869   -9.114  -0.197  1.00 0.16  ? 138 LEU A HB2  4  
ATOM 9110  H HB3  . LEU A 1 138 ? 2.438   -8.149  1.148   1.00 0.19  ? 138 LEU A HB3  4  
ATOM 9111  H HG   . LEU A 1 138 ? 3.115   -10.135 2.343   1.00 0.19  ? 138 LEU A HG   4  
ATOM 9112  H HD11 . LEU A 1 138 ? 2.966   -12.331 1.332   1.00 1.05  ? 138 LEU A HD11 4  
ATOM 9113  H HD12 . LEU A 1 138 ? 2.115   -11.642 -0.051  1.00 1.06  ? 138 LEU A HD12 4  
ATOM 9114  H HD13 . LEU A 1 138 ? 1.369   -11.615 1.549   1.00 1.01  ? 138 LEU A HD13 4  
ATOM 9115  H HD21 . LEU A 1 138 ? 4.107   -10.139 -0.501  1.00 0.98  ? 138 LEU A HD21 4  
ATOM 9116  H HD22 . LEU A 1 138 ? 4.922   -10.882 0.876   1.00 0.93  ? 138 LEU A HD22 4  
ATOM 9117  H HD23 . LEU A 1 138 ? 4.722   -9.130  0.808   1.00 1.01  ? 138 LEU A HD23 4  
ATOM 9118  N N    . CYS A 1 139 ? 0.499   -7.958  3.600   1.00 0.13  ? 139 CYS A N    4  
ATOM 9119  C CA   . CYS A 1 139 ? 0.333   -6.773  4.408   1.00 0.14  ? 139 CYS A CA   4  
ATOM 9120  C C    . CYS A 1 139 ? 1.623   -6.463  5.148   1.00 0.13  ? 139 CYS A C    4  
ATOM 9121  O O    . CYS A 1 139 ? 1.932   -7.039  6.192   1.00 0.14  ? 139 CYS A O    4  
ATOM 9122  C CB   . CYS A 1 139 ? -0.859  -6.941  5.353   1.00 0.18  ? 139 CYS A CB   4  
ATOM 9123  S SG   . CYS A 1 139 ? -0.724  -8.245  6.584   1.00 1.20  ? 139 CYS A SG   4  
ATOM 9124  H H    . CYS A 1 139 ? 0.742   -8.810  4.028   1.00 0.14  ? 139 CYS A H    4  
ATOM 9125  H HA   . CYS A 1 139 ? 0.126   -5.953  3.735   1.00 0.16  ? 139 CYS A HA   4  
ATOM 9126  H HB2  . CYS A 1 139 ? -1.036  -6.016  5.878   1.00 0.82  ? 139 CYS A HB2  4  
ATOM 9127  H HB3  . CYS A 1 139 ? -1.710  -7.179  4.757   1.00 0.80  ? 139 CYS A HB3  4  
ATOM 9128  H HG   . CYS A 1 139 ? -1.741  -9.083  6.408   1.00 1.82  ? 139 CYS A HG   4  
ATOM 9129  N N    . LEU A 1 140 ? 2.377   -5.541  4.589   1.00 0.13  ? 140 LEU A N    4  
ATOM 9130  C CA   . LEU A 1 140 ? 3.702   -5.236  5.086   1.00 0.14  ? 140 LEU A CA   4  
ATOM 9131  C C    . LEU A 1 140 ? 3.754   -3.867  5.737   1.00 0.13  ? 140 LEU A C    4  
ATOM 9132  O O    . LEU A 1 140 ? 3.228   -2.894  5.210   1.00 0.12  ? 140 LEU A O    4  
ATOM 9133  C CB   . LEU A 1 140 ? 4.726   -5.316  3.957   1.00 0.17  ? 140 LEU A CB   4  
ATOM 9134  C CG   . LEU A 1 140 ? 4.365   -4.553  2.684   1.00 0.17  ? 140 LEU A CG   4  
ATOM 9135  C CD1  . LEU A 1 140 ? 5.466   -3.565  2.344   1.00 0.26  ? 140 LEU A CD1  4  
ATOM 9136  C CD2  . LEU A 1 140 ? 4.143   -5.519  1.531   1.00 0.32  ? 140 LEU A CD2  4  
ATOM 9137  H H    . LEU A 1 140 ? 2.032   -5.045  3.812   1.00 0.14  ? 140 LEU A H    4  
ATOM 9138  H HA   . LEU A 1 140 ? 3.950   -5.980  5.827   1.00 0.16  ? 140 LEU A HA   4  
ATOM 9139  H HB2  . LEU A 1 140 ? 5.659   -4.922  4.329   1.00 0.18  ? 140 LEU A HB2  4  
ATOM 9140  H HB3  . LEU A 1 140 ? 4.868   -6.357  3.701   1.00 0.21  ? 140 LEU A HB3  4  
ATOM 9141  H HG   . LEU A 1 140 ? 3.450   -4.003  2.843   1.00 0.24  ? 140 LEU A HG   4  
ATOM 9142  H HD11 . LEU A 1 140 ? 6.391   -4.100  2.187   1.00 1.15  ? 140 LEU A HD11 4  
ATOM 9143  H HD12 . LEU A 1 140 ? 5.590   -2.867  3.162   1.00 1.03  ? 140 LEU A HD12 4  
ATOM 9144  H HD13 . LEU A 1 140 ? 5.205   -3.028  1.446   1.00 1.00  ? 140 LEU A HD13 4  
ATOM 9145  H HD21 . LEU A 1 140 ? 5.040   -6.096  1.367   1.00 1.03  ? 140 LEU A HD21 4  
ATOM 9146  H HD22 . LEU A 1 140 ? 3.906   -4.961  0.637   1.00 1.08  ? 140 LEU A HD22 4  
ATOM 9147  H HD23 . LEU A 1 140 ? 3.326   -6.182  1.769   1.00 1.04  ? 140 LEU A HD23 4  
ATOM 9148  N N    . GLU A 1 141 ? 4.386   -3.813  6.891   1.00 0.14  ? 141 GLU A N    4  
ATOM 9149  C CA   . GLU A 1 141 ? 4.530   -2.577  7.632   1.00 0.13  ? 141 GLU A CA   4  
ATOM 9150  C C    . GLU A 1 141 ? 5.930   -2.018  7.402   1.00 0.12  ? 141 GLU A C    4  
ATOM 9151  O O    . GLU A 1 141 ? 6.920   -2.619  7.817   1.00 0.15  ? 141 GLU A O    4  
ATOM 9152  C CB   . GLU A 1 141 ? 4.263   -2.869  9.108   1.00 0.18  ? 141 GLU A CB   4  
ATOM 9153  C CG   . GLU A 1 141 ? 4.468   -1.700  10.053  1.00 0.26  ? 141 GLU A CG   4  
ATOM 9154  C CD   . GLU A 1 141 ? 4.110   -2.072  11.480  1.00 0.30  ? 141 GLU A CD   4  
ATOM 9155  O OE1  . GLU A 1 141 ? 4.506   -3.173  11.928  1.00 1.05  ? 141 GLU A OE1  4  
ATOM 9156  O OE2  . GLU A 1 141 ? 3.416   -1.282  12.149  1.00 1.00  ? 141 GLU A OE2  4  
ATOM 9157  H H    . GLU A 1 141 ? 4.783   -4.632  7.255   1.00 0.18  ? 141 GLU A H    4  
ATOM 9158  H HA   . GLU A 1 141 ? 3.800   -1.874  7.266   1.00 0.13  ? 141 GLU A HA   4  
ATOM 9159  H HB2  . GLU A 1 141 ? 3.243   -3.201  9.212   1.00 0.30  ? 141 GLU A HB2  4  
ATOM 9160  H HB3  . GLU A 1 141 ? 4.917   -3.670  9.421   1.00 0.24  ? 141 GLU A HB3  4  
ATOM 9161  H HG2  . GLU A 1 141 ? 5.509   -1.396  10.016  1.00 0.38  ? 141 GLU A HG2  4  
ATOM 9162  H HG3  . GLU A 1 141 ? 3.840   -0.881  9.739   1.00 0.41  ? 141 GLU A HG3  4  
ATOM 9163  N N    . VAL A 1 142 ? 6.008   -0.895  6.702   1.00 0.12  ? 142 VAL A N    4  
ATOM 9164  C CA   . VAL A 1 142 ? 7.288   -0.335  6.295   1.00 0.12  ? 142 VAL A CA   4  
ATOM 9165  C C    . VAL A 1 142 ? 7.607   0.984   7.001   1.00 0.12  ? 142 VAL A C    4  
ATOM 9166  O O    . VAL A 1 142 ? 6.882   1.974   6.876   1.00 0.15  ? 142 VAL A O    4  
ATOM 9167  C CB   . VAL A 1 142 ? 7.360   -0.133  4.767   1.00 0.14  ? 142 VAL A CB   4  
ATOM 9168  C CG1  . VAL A 1 142 ? 7.741   -1.431  4.089   1.00 0.19  ? 142 VAL A CG1  4  
ATOM 9169  C CG2  . VAL A 1 142 ? 6.031   0.356   4.222   1.00 0.19  ? 142 VAL A CG2  4  
ATOM 9170  H H    . VAL A 1 142 ? 5.180   -0.428  6.455   1.00 0.15  ? 142 VAL A H    4  
ATOM 9171  H HA   . VAL A 1 142 ? 8.047   -1.057  6.562   1.00 0.12  ? 142 VAL A HA   4  
ATOM 9172  H HB   . VAL A 1 142 ? 8.116   0.605   4.548   1.00 0.17  ? 142 VAL A HB   4  
ATOM 9173  H HG11 . VAL A 1 142 ? 8.694   -1.769  4.468   1.00 0.97  ? 142 VAL A HG11 4  
ATOM 9174  H HG12 . VAL A 1 142 ? 7.809   -1.275  3.021   1.00 0.99  ? 142 VAL A HG12 4  
ATOM 9175  H HG13 . VAL A 1 142 ? 6.988   -2.176  4.297   1.00 1.08  ? 142 VAL A HG13 4  
ATOM 9176  H HG21 . VAL A 1 142 ? 5.285   -0.411  4.358   1.00 0.98  ? 142 VAL A HG21 4  
ATOM 9177  H HG22 . VAL A 1 142 ? 6.135   0.577   3.170   1.00 1.01  ? 142 VAL A HG22 4  
ATOM 9178  H HG23 . VAL A 1 142 ? 5.731   1.246   4.752   1.00 1.02  ? 142 VAL A HG23 4  
ATOM 9179  N N    . THR A 1 143 ? 8.682   0.958   7.774   1.00 0.13  ? 143 THR A N    4  
ATOM 9180  C CA   . THR A 1 143 ? 9.238   2.149   8.392   1.00 0.13  ? 143 THR A CA   4  
ATOM 9181  C C    . THR A 1 143 ? 10.268  2.796   7.476   1.00 0.12  ? 143 THR A C    4  
ATOM 9182  O O    . THR A 1 143 ? 11.313  2.210   7.206   1.00 0.15  ? 143 THR A O    4  
ATOM 9183  C CB   . THR A 1 143 ? 9.944   1.800   9.715   1.00 0.17  ? 143 THR A CB   4  
ATOM 9184  O OG1  . THR A 1 143 ? 9.162   0.852   10.452  1.00 0.28  ? 143 THR A OG1  4  
ATOM 9185  C CG2  . THR A 1 143 ? 10.164  3.049   10.557  1.00 0.22  ? 143 THR A CG2  4  
ATOM 9186  H H    . THR A 1 143 ? 9.105   0.088   7.958   1.00 0.15  ? 143 THR A H    4  
ATOM 9187  H HA   . THR A 1 143 ? 8.442   2.849   8.593   1.00 0.14  ? 143 THR A HA   4  
ATOM 9188  H HB   . THR A 1 143 ? 10.916  1.363   9.484   1.00 0.16  ? 143 THR A HB   4  
ATOM 9189  H HG1  . THR A 1 143 ? 8.367   1.281   10.779  1.00 0.69  ? 143 THR A HG1  4  
ATOM 9190  H HG21 . THR A 1 143 ? 10.847  3.715   10.047  1.00 0.99  ? 143 THR A HG21 4  
ATOM 9191  H HG22 . THR A 1 143 ? 10.582  2.768   11.514  1.00 1.00  ? 143 THR A HG22 4  
ATOM 9192  H HG23 . THR A 1 143 ? 9.220   3.551   10.710  1.00 1.09  ? 143 THR A HG23 4  
ATOM 9193  N N    . LEU A 1 144 ? 9.976   3.989   6.990   1.00 0.13  ? 144 LEU A N    4  
ATOM 9194  C CA   . LEU A 1 144 ? 10.961  4.747   6.236   1.00 0.12  ? 144 LEU A CA   4  
ATOM 9195  C C    . LEU A 1 144 ? 11.823  5.531   7.202   1.00 0.12  ? 144 LEU A C    4  
ATOM 9196  O O    . LEU A 1 144 ? 11.449  6.610   7.653   1.00 0.14  ? 144 LEU A O    4  
ATOM 9197  C CB   . LEU A 1 144 ? 10.284  5.681   5.233   1.00 0.14  ? 144 LEU A CB   4  
ATOM 9198  C CG   . LEU A 1 144 ? 11.231  6.475   4.326   1.00 0.12  ? 144 LEU A CG   4  
ATOM 9199  C CD1  . LEU A 1 144 ? 12.123  5.541   3.524   1.00 0.15  ? 144 LEU A CD1  4  
ATOM 9200  C CD2  . LEU A 1 144 ? 10.440  7.374   3.396   1.00 0.13  ? 144 LEU A CD2  4  
ATOM 9201  H H    . LEU A 1 144 ? 9.082   4.371   7.143   1.00 0.16  ? 144 LEU A H    4  
ATOM 9202  H HA   . LEU A 1 144 ? 11.594  4.046   5.710   1.00 0.14  ? 144 LEU A HA   4  
ATOM 9203  H HB2  . LEU A 1 144 ? 9.635   5.085   4.605   1.00 0.16  ? 144 LEU A HB2  4  
ATOM 9204  H HB3  . LEU A 1 144 ? 9.674   6.381   5.788   1.00 0.15  ? 144 LEU A HB3  4  
ATOM 9205  H HG   . LEU A 1 144 ? 11.867  7.099   4.936   1.00 0.12  ? 144 LEU A HG   4  
ATOM 9206  H HD11 . LEU A 1 144 ? 12.755  4.984   4.199   1.00 0.98  ? 144 LEU A HD11 4  
ATOM 9207  H HD12 . LEU A 1 144 ? 12.736  6.121   2.850   1.00 0.99  ? 144 LEU A HD12 4  
ATOM 9208  H HD13 . LEU A 1 144 ? 11.509  4.858   2.956   1.00 1.07  ? 144 LEU A HD13 4  
ATOM 9209  H HD21 . LEU A 1 144 ? 9.831   8.049   3.978   1.00 1.01  ? 144 LEU A HD21 4  
ATOM 9210  H HD22 . LEU A 1 144 ? 9.804   6.770   2.764   1.00 1.04  ? 144 LEU A HD22 4  
ATOM 9211  H HD23 . LEU A 1 144 ? 11.121  7.944   2.782   1.00 1.02  ? 144 LEU A HD23 4  
ATOM 9212  N N    . LYS A 1 145 ? 12.965  4.962   7.536   1.00 0.14  ? 145 LYS A N    4  
ATOM 9213  C CA   . LYS A 1 145 ? 13.807  5.505   8.586   1.00 0.17  ? 145 LYS A CA   4  
ATOM 9214  C C    . LYS A 1 145 ? 14.829  6.473   8.012   1.00 0.16  ? 145 LYS A C    4  
ATOM 9215  O O    . LYS A 1 145 ? 15.250  7.415   8.682   1.00 0.21  ? 145 LYS A O    4  
ATOM 9216  C CB   . LYS A 1 145 ? 14.521  4.367   9.311   1.00 0.26  ? 145 LYS A CB   4  
ATOM 9217  C CG   . LYS A 1 145 ? 13.625  3.176   9.601   1.00 0.40  ? 145 LYS A CG   4  
ATOM 9218  C CD   . LYS A 1 145 ? 14.421  2.004   10.149  1.00 0.60  ? 145 LYS A CD   4  
ATOM 9219  C CE   . LYS A 1 145 ? 15.433  1.506   9.132   1.00 0.38  ? 145 LYS A CE   4  
ATOM 9220  N NZ   . LYS A 1 145 ? 16.478  0.645   9.758   1.00 1.08  ? 145 LYS A NZ   4  
ATOM 9221  H H    . LYS A 1 145 ? 13.254  4.152   7.056   1.00 0.17  ? 145 LYS A H    4  
ATOM 9222  H HA   . LYS A 1 145 ? 13.176  6.030   9.285   1.00 0.21  ? 145 LYS A HA   4  
ATOM 9223  H HB2  . LYS A 1 145 ? 15.351  4.032   8.708   1.00 0.26  ? 145 LYS A HB2  4  
ATOM 9224  H HB3  . LYS A 1 145 ? 14.894  4.740   10.252  1.00 0.32  ? 145 LYS A HB3  4  
ATOM 9225  H HG2  . LYS A 1 145 ? 12.879  3.463   10.325  1.00 0.63  ? 145 LYS A HG2  4  
ATOM 9226  H HG3  . LYS A 1 145 ? 13.144  2.874   8.682   1.00 0.65  ? 145 LYS A HG3  4  
ATOM 9227  H HD2  . LYS A 1 145 ? 14.943  2.314   11.042  1.00 1.02  ? 145 LYS A HD2  4  
ATOM 9228  H HD3  . LYS A 1 145 ? 13.739  1.194   10.387  1.00 1.10  ? 145 LYS A HD3  4  
ATOM 9229  H HE2  . LYS A 1 145 ? 14.901  0.929   8.386   1.00 0.84  ? 145 LYS A HE2  4  
ATOM 9230  H HE3  . LYS A 1 145 ? 15.907  2.356   8.659   1.00 0.96  ? 145 LYS A HE3  4  
ATOM 9231  H HZ1  . LYS A 1 145 ? 17.315  0.582   9.134   1.00 1.58  ? 145 LYS A HZ1  4  
ATOM 9232  H HZ2  . LYS A 1 145 ? 16.106  -0.315  9.920   1.00 1.69  ? 145 LYS A HZ2  4  
ATOM 9233  H HZ3  . LYS A 1 145 ? 16.773  1.046   10.676  1.00 1.60  ? 145 LYS A HZ3  4  
ATOM 9234  N N    . THR A 1 146 ? 15.241  6.233   6.774   1.00 0.16  ? 146 THR A N    4  
ATOM 9235  C CA   . THR A 1 146 ? 16.249  7.066   6.141   1.00 0.19  ? 146 THR A CA   4  
ATOM 9236  C C    . THR A 1 146 ? 16.079  7.081   4.629   1.00 0.17  ? 146 THR A C    4  
ATOM 9237  O O    . THR A 1 146 ? 15.630  6.100   4.036   1.00 0.16  ? 146 THR A O    4  
ATOM 9238  C CB   . THR A 1 146 ? 17.670  6.564   6.474   1.00 0.25  ? 146 THR A CB   4  
ATOM 9239  O OG1  . THR A 1 146 ? 17.794  6.359   7.887   1.00 0.25  ? 146 THR A OG1  4  
ATOM 9240  C CG2  . THR A 1 146 ? 18.737  7.549   6.018   1.00 0.37  ? 146 THR A CG2  4  
ATOM 9241  H H    . THR A 1 146 ? 14.861  5.478   6.273   1.00 0.19  ? 146 THR A H    4  
ATOM 9242  H HA   . THR A 1 146 ? 16.135  8.067   6.519   1.00 0.22  ? 146 THR A HA   4  
ATOM 9243  H HB   . THR A 1 146 ? 17.826  5.622   5.957   1.00 0.29  ? 146 THR A HB   4  
ATOM 9244  H HG1  . THR A 1 146 ? 17.027  6.748   8.330   1.00 0.44  ? 146 THR A HG1  4  
ATOM 9245  H HG21 . THR A 1 146 ? 18.622  8.475   6.557   1.00 1.12  ? 146 THR A HG21 4  
ATOM 9246  H HG22 . THR A 1 146 ? 18.630  7.734   4.957   1.00 1.08  ? 146 THR A HG22 4  
ATOM 9247  H HG23 . THR A 1 146 ? 19.715  7.136   6.213   1.00 1.06  ? 146 THR A HG23 4  
ATOM 9248  N N    . ALA A 1 147 ? 16.428  8.202   4.019   1.00 0.20  ? 147 ALA A N    4  
ATOM 9249  C CA   . ALA A 1 147 ? 16.467  8.317   2.573   1.00 0.19  ? 147 ALA A CA   4  
ATOM 9250  C C    . ALA A 1 147 ? 17.670  9.147   2.170   1.00 0.22  ? 147 ALA A C    4  
ATOM 9251  O O    . ALA A 1 147 ? 17.860  10.243  2.693   1.00 0.25  ? 147 ALA A O    4  
ATOM 9252  C CB   . ALA A 1 147 ? 15.195  8.964   2.057   1.00 0.21  ? 147 ALA A CB   4  
ATOM 9253  H H    . ALA A 1 147 ? 16.672  8.983   4.564   1.00 0.24  ? 147 ALA A H    4  
ATOM 9254  H HA   . ALA A 1 147 ? 16.554  7.326   2.153   1.00 0.19  ? 147 ALA A HA   4  
ATOM 9255  H HB1  . ALA A 1 147 ? 15.255  9.064   0.983   1.00 0.96  ? 147 ALA A HB1  4  
ATOM 9256  H HB2  . ALA A 1 147 ? 15.078  9.939   2.505   1.00 0.98  ? 147 ALA A HB2  4  
ATOM 9257  H HB3  . ALA A 1 147 ? 14.347  8.346   2.312   1.00 0.99  ? 147 ALA A HB3  4  
ATOM 9258  N N    . VAL A 1 148 ? 18.489  8.649   1.250   1.00 0.24  ? 148 VAL A N    4  
ATOM 9259  C CA   . VAL A 1 148 ? 19.678  9.395   0.868   1.00 0.31  ? 148 VAL A CA   4  
ATOM 9260  C C    . VAL A 1 148 ? 19.781  9.552   -0.634  1.00 0.34  ? 148 VAL A C    4  
ATOM 9261  O O    . VAL A 1 148 ? 19.555  8.610   -1.398  1.00 0.36  ? 148 VAL A O    4  
ATOM 9262  C CB   . VAL A 1 148 ? 20.983  8.775   1.405   1.00 0.42  ? 148 VAL A CB   4  
ATOM 9263  C CG1  . VAL A 1 148 ? 20.984  8.779   2.928   1.00 0.92  ? 148 VAL A CG1  4  
ATOM 9264  C CG2  . VAL A 1 148 ? 21.192  7.365   0.883   1.00 0.75  ? 148 VAL A CG2  4  
ATOM 9265  H H    . VAL A 1 148 ? 18.286  7.779   0.812   1.00 0.24  ? 148 VAL A H    4  
ATOM 9266  H HA   . VAL A 1 148 ? 19.584  10.381  1.302   1.00 0.36  ? 148 VAL A HA   4  
ATOM 9267  H HB   . VAL A 1 148 ? 21.807  9.389   1.053   1.00 0.93  ? 148 VAL A HB   4  
ATOM 9268  H HG11 . VAL A 1 148 ? 20.882  9.793   3.286   1.00 1.58  ? 148 VAL A HG11 4  
ATOM 9269  H HG12 . VAL A 1 148 ? 21.911  8.359   3.289   1.00 1.62  ? 148 VAL A HG12 4  
ATOM 9270  H HG13 . VAL A 1 148 ? 20.153  8.185   3.289   1.00 1.28  ? 148 VAL A HG13 4  
ATOM 9271  H HG21 . VAL A 1 148 ? 21.297  7.392   -0.190  1.00 1.27  ? 148 VAL A HG21 4  
ATOM 9272  H HG22 . VAL A 1 148 ? 20.340  6.755   1.146   1.00 1.35  ? 148 VAL A HG22 4  
ATOM 9273  H HG23 . VAL A 1 148 ? 22.086  6.946   1.320   1.00 1.29  ? 148 VAL A HG23 4  
ATOM 9274  N N    . ASP A 1 149 ? 20.119  10.756  -1.053  1.00 0.44  ? 149 ASP A N    4  
ATOM 9275  C CA   . ASP A 1 149 ? 20.238  11.060  -2.450  1.00 0.52  ? 149 ASP A CA   4  
ATOM 9276  C C    . ASP A 1 149 ? 21.649  10.792  -2.946  1.00 0.66  ? 149 ASP A C    4  
ATOM 9277  O O    . ASP A 1 149 ? 22.618  11.404  -2.497  1.00 0.79  ? 149 ASP A O    4  
ATOM 9278  C CB   . ASP A 1 149 ? 19.856  12.516  -2.699  1.00 0.68  ? 149 ASP A CB   4  
ATOM 9279  C CG   . ASP A 1 149 ? 20.660  13.501  -1.869  1.00 1.41  ? 149 ASP A CG   4  
ATOM 9280  O OD1  . ASP A 1 149 ? 20.555  13.463  -0.626  1.00 2.27  ? 149 ASP A OD1  4  
ATOM 9281  O OD2  . ASP A 1 149 ? 21.415  14.309  -2.459  1.00 1.61  ? 149 ASP A OD2  4  
ATOM 9282  H H    . ASP A 1 149 ? 20.287  11.470  -0.403  1.00 0.52  ? 149 ASP A H    4  
ATOM 9283  H HA   . ASP A 1 149 ? 19.550  10.416  -2.982  1.00 0.43  ? 149 ASP A HA   4  
ATOM 9284  H HB2  . ASP A 1 149 ? 20.024  12.736  -3.730  1.00 0.86  ? 149 ASP A HB2  4  
ATOM 9285  H HB3  . ASP A 1 149 ? 18.810  12.648  -2.472  1.00 1.18  ? 149 ASP A HB3  4  
ATOM 9286  N N    . LEU A 1 150 ? 21.751  9.845   -3.859  1.00 0.68  ? 150 LEU A N    4  
ATOM 9287  C CA   . LEU A 1 150 ? 22.998  9.535   -4.520  1.00 0.89  ? 150 LEU A CA   4  
ATOM 9288  C C    . LEU A 1 150 ? 22.704  8.835   -5.830  1.00 0.96  ? 150 LEU A C    4  
ATOM 9289  O O    . LEU A 1 150 ? 23.347  9.073   -6.849  1.00 1.38  ? 150 LEU A O    4  
ATOM 9290  C CB   . LEU A 1 150 ? 23.880  8.672   -3.619  1.00 1.00  ? 150 LEU A CB   4  
ATOM 9291  C CG   . LEU A 1 150 ? 23.514  7.184   -3.499  1.00 1.09  ? 150 LEU A CG   4  
ATOM 9292  C CD1  . LEU A 1 150 ? 24.667  6.404   -2.881  1.00 1.81  ? 150 LEU A CD1  4  
ATOM 9293  C CD2  . LEU A 1 150 ? 22.262  7.009   -2.653  1.00 1.97  ? 150 LEU A CD2  4  
ATOM 9294  H H    . LEU A 1 150 ? 20.970  9.323   -4.080  1.00 0.59  ? 150 LEU A H    4  
ATOM 9295  H HA   . LEU A 1 150 ? 23.491  10.455  -4.722  1.00 1.01  ? 150 LEU A HA   4  
ATOM 9296  H HB2  . LEU A 1 150 ? 24.896  8.744   -3.968  1.00 1.42  ? 150 LEU A HB2  4  
ATOM 9297  H HB3  . LEU A 1 150 ? 23.823  9.101   -2.633  1.00 1.50  ? 150 LEU A HB3  4  
ATOM 9298  H HG   . LEU A 1 150 ? 23.320  6.779   -4.483  1.00 1.50  ? 150 LEU A HG   4  
ATOM 9299  H HD11 . LEU A 1 150 ? 24.416  5.354   -2.842  1.00 2.37  ? 150 LEU A HD11 4  
ATOM 9300  H HD12 . LEU A 1 150 ? 24.849  6.766   -1.881  1.00 2.20  ? 150 LEU A HD12 4  
ATOM 9301  H HD13 . LEU A 1 150 ? 25.558  6.540   -3.478  1.00 2.36  ? 150 LEU A HD13 4  
ATOM 9302  H HD21 . LEU A 1 150 ? 22.441  7.400   -1.662  1.00 2.50  ? 150 LEU A HD21 4  
ATOM 9303  H HD22 . LEU A 1 150 ? 22.016  5.960   -2.586  1.00 2.46  ? 150 LEU A HD22 4  
ATOM 9304  H HD23 . LEU A 1 150 ? 21.438  7.544   -3.107  1.00 2.44  ? 150 LEU A HD23 4  
ATOM 9305  N N    . GLU A 1 151 ? 21.681  8.006   -5.765  1.00 0.72  ? 151 GLU A N    4  
ATOM 9306  C CA   . GLU A 1 151 ? 21.185  7.226   -6.893  1.00 0.79  ? 151 GLU A CA   4  
ATOM 9307  C C    . GLU A 1 151 ? 22.260  6.276   -7.426  1.00 1.44  ? 151 GLU A C    4  
ATOM 9308  O O    . GLU A 1 151 ? 23.294  6.072   -6.789  1.00 2.14  ? 151 GLU A O    4  
ATOM 9309  C CB   . GLU A 1 151 ? 20.664  8.146   -7.995  1.00 0.57  ? 151 GLU A CB   4  
ATOM 9310  C CG   . GLU A 1 151 ? 19.689  7.464   -8.939  1.00 0.60  ? 151 GLU A CG   4  
ATOM 9311  C CD   . GLU A 1 151 ? 19.567  8.192   -10.250 1.00 0.92  ? 151 GLU A CD   4  
ATOM 9312  O OE1  . GLU A 1 151 ? 20.577  8.262   -10.974 1.00 1.32  ? 151 GLU A OE1  4  
ATOM 9313  O OE2  . GLU A 1 151 ? 18.481  8.712   -10.551 1.00 1.57  ? 151 GLU A OE2  4  
ATOM 9314  H H    . GLU A 1 151 ? 21.245  7.905   -4.905  1.00 0.72  ? 151 GLU A H    4  
ATOM 9315  H HA   . GLU A 1 151 ? 20.363  6.629   -6.529  1.00 1.12  ? 151 GLU A HA   4  
ATOM 9316  H HB2  . GLU A 1 151 ? 20.163  8.987   -7.537  1.00 0.95  ? 151 GLU A HB2  4  
ATOM 9317  H HB3  . GLU A 1 151 ? 21.501  8.507   -8.574  1.00 1.07  ? 151 GLU A HB3  4  
ATOM 9318  H HG2  . GLU A 1 151 ? 20.042  6.464   -9.127  1.00 0.93  ? 151 GLU A HG2  4  
ATOM 9319  H HG3  . GLU A 1 151 ? 18.709  7.419   -8.471  1.00 0.97  ? 151 GLU A HG3  4  
ATOM 9320  N N    . HIS A 1 152 ? 22.008  5.677   -8.581  1.00 2.00  ? 152 HIS A N    4  
ATOM 9321  C CA   . HIS A 1 152 ? 22.909  4.674   -9.121  1.00 2.74  ? 152 HIS A CA   4  
ATOM 9322  C C    . HIS A 1 152 ? 22.824  4.631   -10.650 1.00 3.34  ? 152 HIS A C    4  
ATOM 9323  O O    . HIS A 1 152 ? 23.342  3.710   -11.283 1.00 4.01  ? 152 HIS A O    4  
ATOM 9324  C CB   . HIS A 1 152 ? 22.548  3.308   -8.522  1.00 3.58  ? 152 HIS A CB   4  
ATOM 9325  C CG   . HIS A 1 152 ? 23.636  2.284   -8.629  1.00 4.23  ? 152 HIS A CG   4  
ATOM 9326  N ND1  . HIS A 1 152 ? 23.394  0.927   -8.669  1.00 4.97  ? 152 HIS A ND1  4  
ATOM 9327  C CD2  . HIS A 1 152 ? 24.982  2.426   -8.683  1.00 4.78  ? 152 HIS A CD2  4  
ATOM 9328  C CE1  . HIS A 1 152 ? 24.541  0.281   -8.749  1.00 5.79  ? 152 HIS A CE1  4  
ATOM 9329  N NE2  . HIS A 1 152 ? 25.520  1.166   -8.760  1.00 5.71  ? 152 HIS A NE2  4  
ATOM 9330  H H    . HIS A 1 152 ? 21.196  5.917   -9.078  1.00 2.34  ? 152 HIS A H    4  
ATOM 9331  H HA   . HIS A 1 152 ? 23.913  4.934   -8.830  1.00 2.87  ? 152 HIS A HA   4  
ATOM 9332  H HB2  . HIS A 1 152 ? 22.312  3.436   -7.476  1.00 3.90  ? 152 HIS A HB2  4  
ATOM 9333  H HB3  . HIS A 1 152 ? 21.677  2.921   -9.033  1.00 4.03  ? 152 HIS A HB3  4  
ATOM 9334  H HD1  . HIS A 1 152 ? 22.507  0.497   -8.626  1.00 5.15  ? 152 HIS A HD1  4  
ATOM 9335  H HD2  . HIS A 1 152 ? 25.528  3.359   -8.670  1.00 4.83  ? 152 HIS A HD2  4  
ATOM 9336  H HE1  . HIS A 1 152 ? 24.657  -0.792  -8.790  1.00 6.63  ? 152 HIS A HE1  4  
ATOM 9337  H HE2  . HIS A 1 152 ? 26.467  0.960   -8.943  1.00 6.40  ? 152 HIS A HE2  4  
ATOM 9338  N N    . HIS A 1 153 ? 22.193  5.637   -11.249 1.00 3.70  ? 153 HIS A N    4  
ATOM 9339  C CA   . HIS A 1 153 ? 21.997  5.646   -12.696 1.00 4.77  ? 153 HIS A CA   4  
ATOM 9340  C C    . HIS A 1 153 ? 23.077  6.488   -13.380 1.00 5.09  ? 153 HIS A C    4  
ATOM 9341  O O    . HIS A 1 153 ? 22.838  7.625   -13.784 1.00 5.37  ? 153 HIS A O    4  
ATOM 9342  C CB   . HIS A 1 153 ? 20.596  6.161   -13.054 1.00 5.63  ? 153 HIS A CB   4  
ATOM 9343  C CG   . HIS A 1 153 ? 20.113  5.733   -14.413 1.00 6.19  ? 153 HIS A CG   4  
ATOM 9344  N ND1  . HIS A 1 153 ? 19.930  6.601   -15.467 1.00 6.78  ? 153 HIS A ND1  4  
ATOM 9345  C CD2  . HIS A 1 153 ? 19.742  4.513   -14.871 1.00 6.64  ? 153 HIS A CD2  4  
ATOM 9346  C CE1  . HIS A 1 153 ? 19.466  5.935   -16.510 1.00 7.48  ? 153 HIS A CE1  4  
ATOM 9347  N NE2  . HIS A 1 153 ? 19.343  4.666   -16.176 1.00 7.41  ? 153 HIS A NE2  4  
ATOM 9348  H H    . HIS A 1 153 ? 21.872  6.397   -10.715 1.00 3.55  ? 153 HIS A H    4  
ATOM 9349  H HA   . HIS A 1 153 ? 22.090  4.627   -13.042 1.00 5.10  ? 153 HIS A HA   4  
ATOM 9350  H HB2  . HIS A 1 153 ? 19.887  5.791   -12.324 1.00 5.99  ? 153 HIS A HB2  4  
ATOM 9351  H HB3  . HIS A 1 153 ? 20.602  7.240   -13.025 1.00 5.91  ? 153 HIS A HB3  4  
ATOM 9352  H HD1  . HIS A 1 153 ? 20.093  7.576   -15.451 1.00 6.89  ? 153 HIS A HD1  4  
ATOM 9353  H HD2  . HIS A 1 153 ? 19.761  3.587   -14.311 1.00 6.66  ? 153 HIS A HD2  4  
ATOM 9354  H HE1  . HIS A 1 153 ? 19.222  6.360   -17.476 1.00 8.19  ? 153 HIS A HE1  4  
ATOM 9355  H HE2  . HIS A 1 153 ? 18.787  4.015   -16.670 1.00 7.98  ? 153 HIS A HE2  4  
ATOM 9356  N N    . HIS A 1 154 ? 24.275  5.915   -13.459 1.00 5.42  ? 154 HIS A N    4  
ATOM 9357  C CA   . HIS A 1 154 ? 25.424  6.526   -14.138 1.00 6.05  ? 154 HIS A CA   4  
ATOM 9358  C C    . HIS A 1 154 ? 25.905  7.807   -13.450 1.00 6.57  ? 154 HIS A C    4  
ATOM 9359  O O    . HIS A 1 154 ? 26.619  7.753   -12.450 1.00 7.00  ? 154 HIS A O    4  
ATOM 9360  C CB   . HIS A 1 154 ? 25.131  6.811   -15.619 1.00 6.58  ? 154 HIS A CB   4  
ATOM 9361  C CG   . HIS A 1 154 ? 24.883  5.586   -16.441 1.00 7.19  ? 154 HIS A CG   4  
ATOM 9362  N ND1  . HIS A 1 154 ? 23.809  5.461   -17.292 1.00 7.60  ? 154 HIS A ND1  4  
ATOM 9363  C CD2  . HIS A 1 154 ? 25.586  4.438   -16.551 1.00 7.78  ? 154 HIS A CD2  4  
ATOM 9364  C CE1  . HIS A 1 154 ? 23.855  4.284   -17.886 1.00 8.35  ? 154 HIS A CE1  4  
ATOM 9365  N NE2  . HIS A 1 154 ? 24.930  3.645   -17.456 1.00 8.46  ? 154 HIS A NE2  4  
ATOM 9366  H H    . HIS A 1 154 ? 24.398  5.043   -13.027 1.00 5.45  ? 154 HIS A H    4  
ATOM 9367  H HA   . HIS A 1 154 ? 26.228  5.809   -14.090 1.00 6.12  ? 154 HIS A HA   4  
ATOM 9368  H HB2  . HIS A 1 154 ? 24.250  7.438   -15.687 1.00 6.69  ? 154 HIS A HB2  4  
ATOM 9369  H HB3  . HIS A 1 154 ? 25.972  7.336   -16.050 1.00 6.79  ? 154 HIS A HB3  4  
ATOM 9370  H HD1  . HIS A 1 154 ? 23.104  6.141   -17.432 1.00 7.56  ? 154 HIS A HD1  4  
ATOM 9371  H HD2  . HIS A 1 154 ? 26.492  4.190   -16.020 1.00 7.91  ? 154 HIS A HD2  4  
ATOM 9372  H HE1  . HIS A 1 154 ? 23.139  3.912   -18.606 1.00 8.95  ? 154 HIS A HE1  4  
ATOM 9373  H HE2  . HIS A 1 154 ? 25.109  2.685   -17.598 1.00 9.08  ? 154 HIS A HE2  4  
ATOM 9374  N N    . HIS A 1 155 ? 25.501  8.956   -13.982 1.00 6.86  ? 155 HIS A N    4  
ATOM 9375  C CA   . HIS A 1 155 ? 26.030  10.239  -13.534 1.00 7.69  ? 155 HIS A CA   4  
ATOM 9376  C C    . HIS A 1 155 ? 24.918  11.229  -13.258 1.00 8.40  ? 155 HIS A C    4  
ATOM 9377  O O    . HIS A 1 155 ? 23.829  11.129  -13.815 1.00 8.69  ? 155 HIS A O    4  
ATOM 9378  C CB   . HIS A 1 155 ? 26.967  10.847  -14.586 1.00 7.95  ? 155 HIS A CB   4  
ATOM 9379  C CG   . HIS A 1 155 ? 28.417  10.545  -14.371 1.00 8.17  ? 155 HIS A CG   4  
ATOM 9380  N ND1  . HIS A 1 155 ? 29.335  11.501  -13.978 1.00 8.40  ? 155 HIS A ND1  4  
ATOM 9381  C CD2  . HIS A 1 155 ? 29.110  9.388   -14.490 1.00 8.48  ? 155 HIS A CD2  4  
ATOM 9382  C CE1  . HIS A 1 155 ? 30.526  10.943  -13.871 1.00 8.78  ? 155 HIS A CE1  4  
ATOM 9383  N NE2  . HIS A 1 155 ? 30.415  9.665   -14.175 1.00 8.83  ? 155 HIS A NE2  4  
ATOM 9384  H H    . HIS A 1 155 ? 24.809  8.942   -14.678 1.00 6.72  ? 155 HIS A H    4  
ATOM 9385  H HA   . HIS A 1 155 ? 26.588  10.075  -12.625 1.00 7.92  ? 155 HIS A HA   4  
ATOM 9386  H HB2  . HIS A 1 155 ? 26.692  10.468  -15.560 1.00 8.01  ? 155 HIS A HB2  4  
ATOM 9387  H HB3  . HIS A 1 155 ? 26.848  11.920  -14.580 1.00 8.23  ? 155 HIS A HB3  4  
ATOM 9388  H HD1  . HIS A 1 155 ? 29.144  12.458  -13.818 1.00 8.44  ? 155 HIS A HD1  4  
ATOM 9389  H HD2  . HIS A 1 155 ? 28.708  8.426   -14.779 1.00 8.62  ? 155 HIS A HD2  4  
ATOM 9390  H HE1  . HIS A 1 155 ? 31.435  11.447  -13.577 1.00 9.16  ? 155 HIS A HE1  4  
ATOM 9391  H HE2  . HIS A 1 155 ? 31.167  9.030   -14.237 1.00 9.24  ? 155 HIS A HE2  4  
ATOM 9392  N N    . HIS A 1 156 ? 25.203  12.172  -12.380 1.00 8.92  ? 156 HIS A N    4  
ATOM 9393  C CA   . HIS A 1 156 ? 24.340  13.327  -12.178 1.00 9.83  ? 156 HIS A CA   4  
ATOM 9394  C C    . HIS A 1 156 ? 25.141  14.571  -12.507 1.00 10.27 ? 156 HIS A C    4  
ATOM 9395  O O    . HIS A 1 156 ? 24.679  15.465  -13.211 1.00 10.47 ? 156 HIS A O    4  
ATOM 9396  C CB   . HIS A 1 156 ? 23.806  13.381  -10.744 1.00 10.32 ? 156 HIS A CB   4  
ATOM 9397  C CG   . HIS A 1 156 ? 22.717  12.383  -10.482 1.00 10.97 ? 156 HIS A CG   4  
ATOM 9398  N ND1  . HIS A 1 156 ? 21.554  12.685  -9.804  1.00 11.47 ? 156 HIS A ND1  4  
ATOM 9399  C CD2  . HIS A 1 156 ? 22.619  11.078  -10.823 1.00 11.42 ? 156 HIS A CD2  4  
ATOM 9400  C CE1  . HIS A 1 156 ? 20.794  11.607  -9.745  1.00 12.17 ? 156 HIS A CE1  4  
ATOM 9401  N NE2  . HIS A 1 156 ? 21.420  10.622  -10.357 1.00 12.15 ? 156 HIS A NE2  4  
ATOM 9402  H H    . HIS A 1 156 ? 26.036  12.101  -11.856 1.00 8.83  ? 156 HIS A H    4  
ATOM 9403  H HA   . HIS A 1 156 ? 23.512  13.247  -12.867 1.00 10.10 ? 156 HIS A HA   4  
ATOM 9404  H HB2  . HIS A 1 156 ? 24.616  13.181  -10.059 1.00 10.37 ? 156 HIS A HB2  4  
ATOM 9405  H HB3  . HIS A 1 156 ? 23.411  14.367  -10.551 1.00 10.38 ? 156 HIS A HB3  4  
ATOM 9406  H HD1  . HIS A 1 156 ? 21.313  13.566  -9.423  1.00 11.46 ? 156 HIS A HD1  4  
ATOM 9407  H HD2  . HIS A 1 156 ? 23.352  10.503  -11.373 1.00 11.38 ? 156 HIS A HD2  4  
ATOM 9408  H HE1  . HIS A 1 156 ? 19.826  11.541  -9.270  1.00 12.78 ? 156 HIS A HE1  4  
ATOM 9409  H HE2  . HIS A 1 156 ? 20.996  9.762   -10.629 1.00 12.73 ? 156 HIS A HE2  4  
ATOM 9410  N N    . HIS A 1 157 ? 26.353  14.593  -11.990 1.00 10.63 ? 157 HIS A N    4  
ATOM 9411  C CA   . HIS A 1 157 ? 27.375  15.530  -12.414 1.00 11.28 ? 157 HIS A CA   4  
ATOM 9412  C C    . HIS A 1 157 ? 28.663  14.755  -12.631 1.00 11.64 ? 157 HIS A C    4  
ATOM 9413  O O    . HIS A 1 157 ? 28.923  14.351  -13.782 1.00 11.96 ? 157 HIS A O    4  
ATOM 9414  C CB   . HIS A 1 157 ? 27.586  16.655  -11.392 1.00 11.62 ? 157 HIS A CB   4  
ATOM 9415  C CG   . HIS A 1 157 ? 26.693  17.839  -11.611 1.00 12.24 ? 157 HIS A CG   4  
ATOM 9416  N ND1  . HIS A 1 157 ? 27.171  19.080  -11.969 1.00 12.87 ? 157 HIS A ND1  4  
ATOM 9417  C CD2  . HIS A 1 157 ? 25.346  17.966  -11.545 1.00 12.51 ? 157 HIS A CD2  4  
ATOM 9418  C CE1  . HIS A 1 157 ? 26.159  19.913  -12.113 1.00 13.46 ? 157 HIS A CE1  4  
ATOM 9419  N NE2  . HIS A 1 157 ? 25.038  19.265  -11.863 1.00 13.27 ? 157 HIS A NE2  4  
ATOM 9420  O OXT  . HIS A 1 157 ? 29.362  14.478  -11.637 1.00 11.78 ? 157 HIS A OXT  4  
ATOM 9421  H H    . HIS A 1 157 ? 26.581  13.938  -11.290 1.00 10.60 ? 157 HIS A H    4  
ATOM 9422  H HA   . HIS A 1 157 ? 27.060  15.954  -13.356 1.00 11.48 ? 157 HIS A HA   4  
ATOM 9423  H HB2  . HIS A 1 157 ? 27.400  16.273  -10.397 1.00 11.48 ? 157 HIS A HB2  4  
ATOM 9424  H HB3  . HIS A 1 157 ? 28.607  16.993  -11.455 1.00 11.78 ? 157 HIS A HB3  4  
ATOM 9425  H HD1  . HIS A 1 157 ? 28.120  19.315  -12.095 1.00 12.99 ? 157 HIS A HD1  4  
ATOM 9426  H HD2  . HIS A 1 157 ? 24.642  17.184  -11.292 1.00 12.31 ? 157 HIS A HD2  4  
ATOM 9427  H HE1  . HIS A 1 157 ? 26.234  20.952  -12.396 1.00 14.11 ? 157 HIS A HE1  4  
ATOM 9428  H HE2  . HIS A 1 157 ? 24.144  19.575  -12.142 1.00 13.71 ? 157 HIS A HE2  4  
ATOM 9429  N N    . MET A 1 1   ? -13.930 -10.139 2.335   1.00 49.39 ? 1   MET A N    5  
ATOM 9430  C CA   . MET A 1 1   ? -14.883 -10.365 3.445   1.00 49.13 ? 1   MET A CA   5  
ATOM 9431  C C    . MET A 1 1   ? -14.359 -11.456 4.363   1.00 48.56 ? 1   MET A C    5  
ATOM 9432  O O    . MET A 1 1   ? -13.713 -12.399 3.908   1.00 48.67 ? 1   MET A O    5  
ATOM 9433  C CB   . MET A 1 1   ? -16.263 -10.764 2.907   1.00 49.37 ? 1   MET A CB   5  
ATOM 9434  C CG   . MET A 1 1   ? -16.976 -9.673  2.125   1.00 49.76 ? 1   MET A CG   5  
ATOM 9435  S SD   . MET A 1 1   ? -16.210 -9.322  0.529   1.00 50.09 ? 1   MET A SD   5  
ATOM 9436  C CE   . MET A 1 1   ? -17.353 -8.115  -0.130  1.00 50.23 ? 1   MET A CE   5  
ATOM 9437  H H1   . MET A 1 1   ? -14.235 -9.336  1.746   1.00 49.42 ? 1   MET A H1   5  
ATOM 9438  H H2   . MET A 1 1   ? -13.873 -10.990 1.737   1.00 49.34 ? 1   MET A H2   5  
ATOM 9439  H H3   . MET A 1 1   ? -12.980 -9.939  2.717   1.00 49.65 ? 1   MET A H3   5  
ATOM 9440  H HA   . MET A 1 1   ? -14.973 -9.448  4.009   1.00 49.25 ? 1   MET A HA   5  
ATOM 9441  H HB2  . MET A 1 1   ? -16.146 -11.615 2.256   1.00 49.42 ? 1   MET A HB2  5  
ATOM 9442  H HB3  . MET A 1 1   ? -16.890 -11.047 3.740   1.00 49.25 ? 1   MET A HB3  5  
ATOM 9443  H HG2  . MET A 1 1   ? -17.994 -9.985  1.955   1.00 49.89 ? 1   MET A HG2  5  
ATOM 9444  H HG3  . MET A 1 1   ? -16.971 -8.769  2.715   1.00 49.76 ? 1   MET A HG3  5  
ATOM 9445  H HE1  . MET A 1 1   ? -18.347 -8.536  -0.150  1.00 50.46 ? 1   MET A HE1  5  
ATOM 9446  H HE2  . MET A 1 1   ? -17.053 -7.851  -1.133  1.00 50.28 ? 1   MET A HE2  5  
ATOM 9447  H HE3  . MET A 1 1   ? -17.345 -7.238  0.495   1.00 50.08 ? 1   MET A HE3  5  
ATOM 9448  N N    . GLY A 1 2   ? -14.653 -11.336 5.648   1.00 47.99 ? 2   GLY A N    5  
ATOM 9449  C CA   . GLY A 1 2   ? -14.108 -12.262 6.620   1.00 47.44 ? 2   GLY A CA   5  
ATOM 9450  C C    . GLY A 1 2   ? -15.162 -13.145 7.249   1.00 46.69 ? 2   GLY A C    5  
ATOM 9451  O O    . GLY A 1 2   ? -15.161 -13.355 8.461   1.00 46.54 ? 2   GLY A O    5  
ATOM 9452  H H    . GLY A 1 2   ? -15.247 -10.605 5.943   1.00 47.97 ? 2   GLY A H    5  
ATOM 9453  H HA2  . GLY A 1 2   ? -13.379 -12.890 6.130   1.00 47.53 ? 2   GLY A HA2  5  
ATOM 9454  H HA3  . GLY A 1 2   ? -13.615 -11.698 7.396   1.00 47.53 ? 2   GLY A HA3  5  
ATOM 9455  N N    . GLN A 1 3   ? -16.067 -13.658 6.425   1.00 46.26 ? 3   GLN A N    5  
ATOM 9456  C CA   . GLN A 1 3   ? -17.084 -14.594 6.885   1.00 45.58 ? 3   GLN A CA   5  
ATOM 9457  C C    . GLN A 1 3   ? -17.739 -15.311 5.695   1.00 45.14 ? 3   GLN A C    5  
ATOM 9458  O O    . GLN A 1 3   ? -17.776 -16.538 5.677   1.00 45.18 ? 3   GLN A O    5  
ATOM 9459  C CB   . GLN A 1 3   ? -18.135 -13.891 7.764   1.00 45.54 ? 3   GLN A CB   5  
ATOM 9460  C CG   . GLN A 1 3   ? -18.915 -14.846 8.658   1.00 45.20 ? 3   GLN A CG   5  
ATOM 9461  C CD   . GLN A 1 3   ? -19.995 -15.613 7.921   1.00 45.11 ? 3   GLN A CD   5  
ATOM 9462  O OE1  . GLN A 1 3   ? -20.622 -15.097 6.996   1.00 45.20 ? 3   GLN A OE1  5  
ATOM 9463  N NE2  . GLN A 1 3   ? -20.200 -16.859 8.307   1.00 45.01 ? 3   GLN A NE2  5  
ATOM 9464  H H    . GLN A 1 3   ? -16.048 -13.402 5.481   1.00 46.44 ? 3   GLN A H    5  
ATOM 9465  H HA   . GLN A 1 3   ? -16.580 -15.336 7.486   1.00 45.45 ? 3   GLN A HA   5  
ATOM 9466  H HB2  . GLN A 1 3   ? -17.639 -13.167 8.394   1.00 45.96 ? 3   GLN A HB2  5  
ATOM 9467  H HB3  . GLN A 1 3   ? -18.839 -13.379 7.122   1.00 45.41 ? 3   GLN A HB3  5  
ATOM 9468  H HG2  . GLN A 1 3   ? -18.224 -15.557 9.087   1.00 45.03 ? 3   GLN A HG2  5  
ATOM 9469  H HG3  . GLN A 1 3   ? -19.378 -14.276 9.451   1.00 45.22 ? 3   GLN A HG3  5  
ATOM 9470  H HE21 . GLN A 1 3   ? -19.647 -17.213 9.039   1.00 44.98 ? 3   GLN A HE21 5  
ATOM 9471  H HE22 . GLN A 1 3   ? -20.888 -17.380 7.846   1.00 44.99 ? 3   GLN A HE22 5  
ATOM 9472  N N    . PRO A 1 4   ? -18.274 -14.569 4.689   1.00 44.78 ? 4   PRO A N    5  
ATOM 9473  C CA   . PRO A 1 4   ? -18.873 -15.185 3.491   1.00 44.40 ? 4   PRO A CA   5  
ATOM 9474  C C    . PRO A 1 4   ? -17.995 -16.275 2.840   1.00 43.91 ? 4   PRO A C    5  
ATOM 9475  O O    . PRO A 1 4   ? -18.491 -17.370 2.572   1.00 43.73 ? 4   PRO A O    5  
ATOM 9476  C CB   . PRO A 1 4   ? -19.082 -14.003 2.548   1.00 44.25 ? 4   PRO A CB   5  
ATOM 9477  C CG   . PRO A 1 4   ? -19.278 -12.841 3.457   1.00 44.46 ? 4   PRO A CG   5  
ATOM 9478  C CD   . PRO A 1 4   ? -18.390 -13.094 4.647   1.00 44.80 ? 4   PRO A CD   5  
ATOM 9479  H HA   . PRO A 1 4   ? -19.836 -15.619 3.726   1.00 44.62 ? 4   PRO A HA   5  
ATOM 9480  H HB2  . PRO A 1 4   ? -18.210 -13.880 1.921   1.00 43.90 ? 4   PRO A HB2  5  
ATOM 9481  H HB3  . PRO A 1 4   ? -19.954 -14.176 1.935   1.00 44.42 ? 4   PRO A HB3  5  
ATOM 9482  H HG2  . PRO A 1 4   ? -18.986 -11.929 2.959   1.00 44.24 ? 4   PRO A HG2  5  
ATOM 9483  H HG3  . PRO A 1 4   ? -20.311 -12.788 3.766   1.00 44.66 ? 4   PRO A HG3  5  
ATOM 9484  H HD2  . PRO A 1 4   ? -17.423 -12.635 4.502   1.00 44.65 ? 4   PRO A HD2  5  
ATOM 9485  H HD3  . PRO A 1 4   ? -18.854 -12.717 5.547   1.00 45.22 ? 4   PRO A HD3  5  
ATOM 9486  N N    . PRO A 1 5   ? -16.694 -16.013 2.557   1.00 43.76 ? 5   PRO A N    5  
ATOM 9487  C CA   . PRO A 1 5   ? -15.795 -17.049 2.036   1.00 43.36 ? 5   PRO A CA   5  
ATOM 9488  C C    . PRO A 1 5   ? -15.444 -18.072 3.112   1.00 42.76 ? 5   PRO A C    5  
ATOM 9489  O O    . PRO A 1 5   ? -14.957 -17.712 4.185   1.00 42.58 ? 5   PRO A O    5  
ATOM 9490  C CB   . PRO A 1 5   ? -14.540 -16.274 1.594   1.00 43.41 ? 5   PRO A CB   5  
ATOM 9491  C CG   . PRO A 1 5   ? -14.916 -14.830 1.657   1.00 43.89 ? 5   PRO A CG   5  
ATOM 9492  C CD   . PRO A 1 5   ? -15.991 -14.730 2.695   1.00 44.02 ? 5   PRO A CD   5  
ATOM 9493  H HA   . PRO A 1 5   ? -16.229 -17.559 1.187   1.00 43.54 ? 5   PRO A HA   5  
ATOM 9494  H HB2  . PRO A 1 5   ? -13.723 -16.495 2.265   1.00 42.99 ? 5   PRO A HB2  5  
ATOM 9495  H HB3  . PRO A 1 5   ? -14.271 -16.566 0.589   1.00 43.59 ? 5   PRO A HB3  5  
ATOM 9496  H HG2  . PRO A 1 5   ? -14.057 -14.241 1.947   1.00 43.87 ? 5   PRO A HG2  5  
ATOM 9497  H HG3  . PRO A 1 5   ? -15.288 -14.503 0.696   1.00 44.19 ? 5   PRO A HG3  5  
ATOM 9498  H HD2  . PRO A 1 5   ? -15.557 -14.626 3.681   1.00 43.91 ? 5   PRO A HD2  5  
ATOM 9499  H HD3  . PRO A 1 5   ? -16.649 -13.902 2.480   1.00 44.45 ? 5   PRO A HD3  5  
ATOM 9500  N N    . ALA A 1 6   ? -15.696 -19.342 2.828   1.00 42.50 ? 6   ALA A N    5  
ATOM 9501  C CA   . ALA A 1 6   ? -15.472 -20.390 3.809   1.00 41.97 ? 6   ALA A CA   5  
ATOM 9502  C C    . ALA A 1 6   ? -14.806 -21.603 3.170   1.00 41.42 ? 6   ALA A C    5  
ATOM 9503  O O    . ALA A 1 6   ? -15.053 -21.917 2.004   1.00 41.39 ? 6   ALA A O    5  
ATOM 9504  C CB   . ALA A 1 6   ? -16.791 -20.790 4.456   1.00 42.03 ? 6   ALA A CB   5  
ATOM 9505  H H    . ALA A 1 6   ? -16.028 -19.582 1.937   1.00 42.71 ? 6   ALA A H    5  
ATOM 9506  H HA   . ALA A 1 6   ? -14.823 -19.993 4.575   1.00 42.00 ? 6   ALA A HA   5  
ATOM 9507  H HB1  . ALA A 1 6   ? -17.262 -19.918 4.886   1.00 42.08 ? 6   ALA A HB1  5  
ATOM 9508  H HB2  . ALA A 1 6   ? -16.606 -21.518 5.233   1.00 42.08 ? 6   ALA A HB2  5  
ATOM 9509  H HB3  . ALA A 1 6   ? -17.440 -21.220 3.708   1.00 42.02 ? 6   ALA A HB3  5  
ATOM 9510  N N    . GLU A 1 7   ? -13.964 -22.273 3.945   1.00 41.05 ? 7   GLU A N    5  
ATOM 9511  C CA   . GLU A 1 7   ? -13.266 -23.468 3.489   1.00 40.56 ? 7   GLU A CA   5  
ATOM 9512  C C    . GLU A 1 7   ? -13.870 -24.700 4.155   1.00 40.16 ? 7   GLU A C    5  
ATOM 9513  O O    . GLU A 1 7   ? -14.309 -24.644 5.303   1.00 40.13 ? 7   GLU A O    5  
ATOM 9514  C CB   . GLU A 1 7   ? -11.767 -23.351 3.809   1.00 40.61 ? 7   GLU A CB   5  
ATOM 9515  C CG   . GLU A 1 7   ? -10.942 -24.593 3.491   1.00 40.78 ? 7   GLU A CG   5  
ATOM 9516  C CD   . GLU A 1 7   ? -11.002 -24.997 2.029   1.00 41.03 ? 7   GLU A CD   5  
ATOM 9517  O OE1  . GLU A 1 7   ? -10.178 -24.497 1.235   1.00 40.82 ? 7   GLU A OE1  5  
ATOM 9518  O OE2  . GLU A 1 7   ? -11.867 -25.830 1.674   1.00 41.50 ? 7   GLU A OE2  5  
ATOM 9519  H H    . GLU A 1 7   ? -13.812 -21.958 4.862   1.00 41.14 ? 7   GLU A H    5  
ATOM 9520  H HA   . GLU A 1 7   ? -13.398 -23.546 2.421   1.00 40.51 ? 7   GLU A HA   5  
ATOM 9521  H HB2  . GLU A 1 7   ? -11.360 -22.529 3.241   1.00 40.72 ? 7   GLU A HB2  5  
ATOM 9522  H HB3  . GLU A 1 7   ? -11.656 -23.134 4.863   1.00 40.47 ? 7   GLU A HB3  5  
ATOM 9523  H HG2  . GLU A 1 7   ? -9.914  -24.398 3.750   1.00 40.98 ? 7   GLU A HG2  5  
ATOM 9524  H HG3  . GLU A 1 7   ? -11.308 -25.414 4.092   1.00 40.58 ? 7   GLU A HG3  5  
ATOM 9525  N N    . GLU A 1 8   ? -13.883 -25.808 3.434   1.00 39.89 ? 8   GLU A N    5  
ATOM 9526  C CA   . GLU A 1 8   ? -14.504 -27.037 3.917   1.00 39.55 ? 8   GLU A CA   5  
ATOM 9527  C C    . GLU A 1 8   ? -13.489 -27.908 4.644   1.00 39.08 ? 8   GLU A C    5  
ATOM 9528  O O    . GLU A 1 8   ? -13.841 -28.927 5.235   1.00 38.77 ? 8   GLU A O    5  
ATOM 9529  C CB   . GLU A 1 8   ? -15.103 -27.817 2.747   1.00 39.61 ? 8   GLU A CB   5  
ATOM 9530  C CG   . GLU A 1 8   ? -16.115 -27.025 1.935   1.00 39.77 ? 8   GLU A CG   5  
ATOM 9531  C CD   . GLU A 1 8   ? -16.533 -27.756 0.677   1.00 40.05 ? 8   GLU A CD   5  
ATOM 9532  O OE1  . GLU A 1 8   ? -15.724 -27.841 -0.270  1.00 40.04 ? 8   GLU A OE1  5  
ATOM 9533  O OE2  . GLU A 1 8   ? -17.689 -28.228 0.627   1.00 40.33 ? 8   GLU A OE2  5  
ATOM 9534  H H    . GLU A 1 8   ? -13.446 -25.808 2.551   1.00 39.97 ? 8   GLU A H    5  
ATOM 9535  H HA   . GLU A 1 8   ? -15.291 -26.768 4.605   1.00 39.67 ? 8   GLU A HA   5  
ATOM 9536  H HB2  . GLU A 1 8   ? -14.303 -28.121 2.086   1.00 39.61 ? 8   GLU A HB2  5  
ATOM 9537  H HB3  . GLU A 1 8   ? -15.592 -28.698 3.134   1.00 39.59 ? 8   GLU A HB3  5  
ATOM 9538  H HG2  . GLU A 1 8   ? -16.989 -26.849 2.543   1.00 39.75 ? 8   GLU A HG2  5  
ATOM 9539  H HG3  . GLU A 1 8   ? -15.674 -26.079 1.654   1.00 39.76 ? 8   GLU A HG3  5  
ATOM 9540  N N    . ALA A 1 9   ? -12.227 -27.508 4.585   1.00 39.09 ? 9   ALA A N    5  
ATOM 9541  C CA   . ALA A 1 9   ? -11.160 -28.252 5.243   1.00 38.75 ? 9   ALA A CA   5  
ATOM 9542  C C    . ALA A 1 9   ? -11.183 -28.015 6.748   1.00 38.56 ? 9   ALA A C    5  
ATOM 9543  O O    . ALA A 1 9   ? -10.787 -28.881 7.524   1.00 38.67 ? 9   ALA A O    5  
ATOM 9544  C CB   . ALA A 1 9   ? -9.802  -27.866 4.666   1.00 38.76 ? 9   ALA A CB   5  
ATOM 9545  H H    . ALA A 1 9   ? -12.007 -26.697 4.080   1.00 39.39 ? 9   ALA A H    5  
ATOM 9546  H HA   . ALA A 1 9   ? -11.324 -29.304 5.051   1.00 38.69 ? 9   ALA A HA   5  
ATOM 9547  H HB1  . ALA A 1 9   ? -9.029  -28.438 5.161   1.00 38.80 ? 9   ALA A HB1  5  
ATOM 9548  H HB2  . ALA A 1 9   ? -9.628  -26.814 4.829   1.00 38.76 ? 9   ALA A HB2  5  
ATOM 9549  H HB3  . ALA A 1 9   ? -9.782  -28.075 3.605   1.00 38.78 ? 9   ALA A HB3  5  
ATOM 9550  N N    . GLU A 1 10  ? -11.664 -26.834 7.136   1.00 38.35 ? 10  GLU A N    5  
ATOM 9551  C CA   . GLU A 1 10  ? -11.743 -26.416 8.537   1.00 38.21 ? 10  GLU A CA   5  
ATOM 9552  C C    . GLU A 1 10  ? -10.360 -26.315 9.176   1.00 37.73 ? 10  GLU A C    5  
ATOM 9553  O O    . GLU A 1 10  ? -9.811  -27.300 9.675   1.00 37.49 ? 10  GLU A O    5  
ATOM 9554  C CB   . GLU A 1 10  ? -12.639 -27.343 9.366   1.00 38.40 ? 10  GLU A CB   5  
ATOM 9555  C CG   . GLU A 1 10  ? -12.698 -26.963 10.842  1.00 38.59 ? 10  GLU A CG   5  
ATOM 9556  C CD   . GLU A 1 10  ? -13.357 -25.615 11.089  1.00 38.73 ? 10  GLU A CD   5  
ATOM 9557  O OE1  . GLU A 1 10  ? -12.890 -24.607 10.518  1.00 38.81 ? 10  GLU A OE1  5  
ATOM 9558  O OE2  . GLU A 1 10  ? -14.349 -25.554 11.854  1.00 38.82 ? 10  GLU A OE2  5  
ATOM 9559  H H    . GLU A 1 10  ? -11.981 -26.215 6.450   1.00 38.34 ? 10  GLU A H    5  
ATOM 9560  H HA   . GLU A 1 10  ? -12.182 -25.428 8.544   1.00 38.39 ? 10  GLU A HA   5  
ATOM 9561  H HB2  . GLU A 1 10  ? -13.643 -27.312 8.967   1.00 38.43 ? 10  GLU A HB2  5  
ATOM 9562  H HB3  . GLU A 1 10  ? -12.261 -28.352 9.292   1.00 38.43 ? 10  GLU A HB3  5  
ATOM 9563  H HG2  . GLU A 1 10  ? -13.254 -27.723 11.372  1.00 38.64 ? 10  GLU A HG2  5  
ATOM 9564  H HG3  . GLU A 1 10  ? -11.688 -26.928 11.227  1.00 38.66 ? 10  GLU A HG3  5  
ATOM 9565  N N    . GLN A 1 11  ? -9.801  -25.116 9.134   1.00 37.65 ? 11  GLN A N    5  
ATOM 9566  C CA   . GLN A 1 11  ? -8.546  -24.807 9.807   1.00 37.26 ? 11  GLN A CA   5  
ATOM 9567  C C    . GLN A 1 11  ? -8.291  -23.302 9.787   1.00 36.82 ? 11  GLN A C    5  
ATOM 9568  O O    . GLN A 1 11  ? -7.556  -22.792 8.943   1.00 36.78 ? 11  GLN A O    5  
ATOM 9569  C CB   . GLN A 1 11  ? -7.356  -25.562 9.194   1.00 37.34 ? 11  GLN A CB   5  
ATOM 9570  C CG   . GLN A 1 11  ? -7.326  -25.572 7.674   1.00 37.71 ? 11  GLN A CG   5  
ATOM 9571  C CD   . GLN A 1 11  ? -6.051  -26.181 7.128   1.00 37.79 ? 11  GLN A CD   5  
ATOM 9572  O OE1  . GLN A 1 11  ? -5.087  -25.476 6.833   1.00 37.58 ? 11  GLN A OE1  5  
ATOM 9573  N NE2  . GLN A 1 11  ? -6.018  -27.499 7.032   1.00 38.16 ? 11  GLN A NE2  5  
ATOM 9574  H H    . GLN A 1 11  ? -10.259 -24.400 8.639   1.00 37.91 ? 11  GLN A H    5  
ATOM 9575  H HA   . GLN A 1 11  ? -8.654  -25.116 10.838  1.00 37.29 ? 11  GLN A HA   5  
ATOM 9576  H HB2  . GLN A 1 11  ? -6.442  -25.105 9.544   1.00 37.36 ? 11  GLN A HB2  5  
ATOM 9577  H HB3  . GLN A 1 11  ? -7.382  -26.587 9.538   1.00 37.16 ? 11  GLN A HB3  5  
ATOM 9578  H HG2  . GLN A 1 11  ? -8.165  -26.146 7.312   1.00 37.78 ? 11  GLN A HG2  5  
ATOM 9579  H HG3  . GLN A 1 11  ? -7.406  -24.553 7.318   1.00 37.94 ? 11  GLN A HG3  5  
ATOM 9580  H HE21 . GLN A 1 11  ? -6.813  -28.008 7.324   1.00 38.35 ? 11  GLN A HE21 5  
ATOM 9581  H HE22 . GLN A 1 11  ? -5.207  -27.917 6.681   1.00 38.26 ? 11  GLN A HE22 5  
ATOM 9582  N N    . PRO A 1 12  ? -8.958  -22.561 10.684  1.00 36.56 ? 12  PRO A N    5  
ATOM 9583  C CA   . PRO A 1 12  ? -8.746  -21.127 10.835  1.00 36.18 ? 12  PRO A CA   5  
ATOM 9584  C C    . PRO A 1 12  ? -7.618  -20.812 11.817  1.00 35.97 ? 12  PRO A C    5  
ATOM 9585  O O    . PRO A 1 12  ? -6.992  -21.719 12.371  1.00 36.19 ? 12  PRO A O    5  
ATOM 9586  C CB   . PRO A 1 12  ? -10.091 -20.653 11.381  1.00 36.06 ? 12  PRO A CB   5  
ATOM 9587  C CG   . PRO A 1 12  ? -10.602 -21.802 12.187  1.00 36.50 ? 12  PRO A CG   5  
ATOM 9588  C CD   . PRO A 1 12  ? -9.997  -23.058 11.604  1.00 36.70 ? 12  PRO A CD   5  
ATOM 9589  H HA   . PRO A 1 12  ? -8.547  -20.653 9.886   1.00 36.21 ? 12  PRO A HA   5  
ATOM 9590  H HB2  . PRO A 1 12  ? -9.944  -19.774 11.994  1.00 35.77 ? 12  PRO A HB2  5  
ATOM 9591  H HB3  . PRO A 1 12  ? -10.755 -20.420 10.561  1.00 36.04 ? 12  PRO A HB3  5  
ATOM 9592  H HG2  . PRO A 1 12  ? -10.299 -21.688 13.217  1.00 36.44 ? 12  PRO A HG2  5  
ATOM 9593  H HG3  . PRO A 1 12  ? -11.680 -21.844 12.120  1.00 36.79 ? 12  PRO A HG3  5  
ATOM 9594  H HD2  . PRO A 1 12  ? -9.560  -23.661 12.387  1.00 36.66 ? 12  PRO A HD2  5  
ATOM 9595  H HD3  . PRO A 1 12  ? -10.747 -23.623 11.067  1.00 37.04 ? 12  PRO A HD3  5  
ATOM 9596  N N    . GLY A 1 13  ? -7.363  -19.529 12.025  1.00 35.61 ? 13  GLY A N    5  
ATOM 9597  C CA   . GLY A 1 13  ? -6.341  -19.123 12.967  1.00 35.47 ? 13  GLY A CA   5  
ATOM 9598  C C    . GLY A 1 13  ? -6.793  -19.293 14.401  1.00 35.16 ? 13  GLY A C    5  
ATOM 9599  O O    . GLY A 1 13  ? -7.875  -18.836 14.775  1.00 35.17 ? 13  GLY A O    5  
ATOM 9600  H H    . GLY A 1 13  ? -7.872  -18.853 11.534  1.00 35.50 ? 13  GLY A H    5  
ATOM 9601  H HA2  . GLY A 1 13  ? -5.458  -19.722 12.803  1.00 35.46 ? 13  GLY A HA2  5  
ATOM 9602  H HA3  . GLY A 1 13  ? -6.099  -18.084 12.798  1.00 35.66 ? 13  GLY A HA3  5  
ATOM 9603  N N    . ALA A 1 14  ? -5.971  -19.950 15.201  1.00 34.97 ? 14  ALA A N    5  
ATOM 9604  C CA   . ALA A 1 14  ? -6.308  -20.221 16.591  1.00 34.74 ? 14  ALA A CA   5  
ATOM 9605  C C    . ALA A 1 14  ? -5.750  -19.141 17.507  1.00 34.24 ? 14  ALA A C    5  
ATOM 9606  O O    . ALA A 1 14  ? -4.539  -18.965 17.603  1.00 34.14 ? 14  ALA A O    5  
ATOM 9607  C CB   . ALA A 1 14  ? -5.775  -21.585 17.007  1.00 35.03 ? 14  ALA A CB   5  
ATOM 9608  H H    . ALA A 1 14  ? -5.106  -20.255 14.852  1.00 35.02 ? 14  ALA A H    5  
ATOM 9609  H HA   . ALA A 1 14  ? -7.385  -20.236 16.675  1.00 34.81 ? 14  ALA A HA   5  
ATOM 9610  H HB1  . ALA A 1 14  ? -4.695  -21.581 16.955  1.00 35.15 ? 14  ALA A HB1  5  
ATOM 9611  H HB2  . ALA A 1 14  ? -6.163  -22.344 16.342  1.00 35.06 ? 14  ALA A HB2  5  
ATOM 9612  H HB3  . ALA A 1 14  ? -6.083  -21.798 18.019  1.00 35.13 ? 14  ALA A HB3  5  
ATOM 9613  N N    . LEU A 1 15  ? -6.633  -18.416 18.174  1.00 34.01 ? 15  LEU A N    5  
ATOM 9614  C CA   . LEU A 1 15  ? -6.220  -17.388 19.120  1.00 33.60 ? 15  LEU A CA   5  
ATOM 9615  C C    . LEU A 1 15  ? -6.971  -17.558 20.432  1.00 33.26 ? 15  LEU A C    5  
ATOM 9616  O O    . LEU A 1 15  ? -7.824  -18.440 20.542  1.00 33.39 ? 15  LEU A O    5  
ATOM 9617  C CB   . LEU A 1 15  ? -6.426  -15.983 18.524  1.00 33.42 ? 15  LEU A CB   5  
ATOM 9618  C CG   . LEU A 1 15  ? -7.843  -15.645 18.038  1.00 33.48 ? 15  LEU A CG   5  
ATOM 9619  C CD1  . LEU A 1 15  ? -8.717  -15.156 19.183  1.00 33.70 ? 15  LEU A CD1  5  
ATOM 9620  C CD2  . LEU A 1 15  ? -7.783  -14.601 16.933  1.00 33.25 ? 15  LEU A CD2  5  
ATOM 9621  H H    . LEU A 1 15  ? -7.595  -18.584 18.037  1.00 34.17 ? 15  LEU A H    5  
ATOM 9622  H HA   . LEU A 1 15  ? -5.165  -17.531 19.313  1.00 33.74 ? 15  LEU A HA   5  
ATOM 9623  H HB2  . LEU A 1 15  ? -6.152  -15.260 19.277  1.00 33.66 ? 15  LEU A HB2  5  
ATOM 9624  H HB3  . LEU A 1 15  ? -5.751  -15.873 17.689  1.00 33.10 ? 15  LEU A HB3  5  
ATOM 9625  H HG   . LEU A 1 15  ? -8.297  -16.536 17.631  1.00 33.61 ? 15  LEU A HG   5  
ATOM 9626  H HD11 . LEU A 1 15  ? -9.708  -14.939 18.813  1.00 33.68 ? 15  LEU A HD11 5  
ATOM 9627  H HD12 . LEU A 1 15  ? -8.287  -14.257 19.604  1.00 33.80 ? 15  LEU A HD12 5  
ATOM 9628  H HD13 . LEU A 1 15  ? -8.775  -15.918 19.946  1.00 33.84 ? 15  LEU A HD13 5  
ATOM 9629  H HD21 . LEU A 1 15  ? -7.276  -13.720 17.298  1.00 33.24 ? 15  LEU A HD21 5  
ATOM 9630  H HD22 . LEU A 1 15  ? -8.786  -14.341 16.631  1.00 33.21 ? 15  LEU A HD22 5  
ATOM 9631  H HD23 . LEU A 1 15  ? -7.243  -15.001 16.087  1.00 33.20 ? 15  LEU A HD23 5  
ATOM 9632  N N    . ALA A 1 16  ? -6.646  -16.721 21.416  1.00 32.89 ? 16  ALA A N    5  
ATOM 9633  C CA   . ALA A 1 16  ? -7.257  -16.793 22.741  1.00 32.59 ? 16  ALA A CA   5  
ATOM 9634  C C    . ALA A 1 16  ? -6.935  -18.126 23.404  1.00 31.98 ? 16  ALA A C    5  
ATOM 9635  O O    . ALA A 1 16  ? -7.718  -19.075 23.357  1.00 31.63 ? 16  ALA A O    5  
ATOM 9636  C CB   . ALA A 1 16  ? -8.767  -16.564 22.677  1.00 32.80 ? 16  ALA A CB   5  
ATOM 9637  H H    . ALA A 1 16  ? -5.957  -16.043 21.249  1.00 32.86 ? 16  ALA A H    5  
ATOM 9638  H HA   . ALA A 1 16  ? -6.824  -16.004 23.342  1.00 32.73 ? 16  ALA A HA   5  
ATOM 9639  H HB1  . ALA A 1 16  ? -9.221  -17.332 22.067  1.00 32.95 ? 16  ALA A HB1  5  
ATOM 9640  H HB2  . ALA A 1 16  ? -8.973  -15.595 22.245  1.00 32.85 ? 16  ALA A HB2  5  
ATOM 9641  H HB3  . ALA A 1 16  ? -9.182  -16.607 23.676  1.00 32.80 ? 16  ALA A HB3  5  
ATOM 9642  N N    . ARG A 1 17  ? -5.760  -18.194 24.002  1.00 31.94 ? 17  ARG A N    5  
ATOM 9643  C CA   . ARG A 1 17  ? -5.285  -19.417 24.621  1.00 31.46 ? 17  ARG A CA   5  
ATOM 9644  C C    . ARG A 1 17  ? -4.777  -19.122 26.019  1.00 31.11 ? 17  ARG A C    5  
ATOM 9645  O O    . ARG A 1 17  ? -4.412  -17.985 26.324  1.00 31.11 ? 17  ARG A O    5  
ATOM 9646  C CB   . ARG A 1 17  ? -4.168  -20.040 23.776  1.00 31.72 ? 17  ARG A CB   5  
ATOM 9647  C CG   . ARG A 1 17  ? -2.986  -19.113 23.556  1.00 31.75 ? 17  ARG A CG   5  
ATOM 9648  C CD   . ARG A 1 17  ? -1.977  -19.706 22.586  1.00 31.70 ? 17  ARG A CD   5  
ATOM 9649  N NE   . ARG A 1 17  ? -2.501  -19.792 21.220  1.00 31.67 ? 17  ARG A NE   5  
ATOM 9650  C CZ   . ARG A 1 17  ? -1.734  -19.731 20.129  1.00 31.67 ? 17  ARG A CZ   5  
ATOM 9651  N NH1  . ARG A 1 17  ? -0.416  -19.612 20.249  1.00 31.70 ? 17  ARG A NH1  5  
ATOM 9652  N NH2  . ARG A 1 17  ? -2.284  -19.783 18.921  1.00 31.71 ? 17  ARG A NH2  5  
ATOM 9653  H H    . ARG A 1 17  ? -5.195  -17.393 24.037  1.00 32.30 ? 17  ARG A H    5  
ATOM 9654  H HA   . ARG A 1 17  ? -6.112  -20.107 24.682  1.00 31.22 ? 17  ARG A HA   5  
ATOM 9655  H HB2  . ARG A 1 17  ? -3.812  -20.929 24.273  1.00 31.77 ? 17  ARG A HB2  5  
ATOM 9656  H HB3  . ARG A 1 17  ? -4.567  -20.314 22.811  1.00 31.94 ? 17  ARG A HB3  5  
ATOM 9657  H HG2  . ARG A 1 17  ? -3.346  -18.175 23.159  1.00 31.83 ? 17  ARG A HG2  5  
ATOM 9658  H HG3  . ARG A 1 17  ? -2.500  -18.941 24.504  1.00 31.82 ? 17  ARG A HG3  5  
ATOM 9659  H HD2  . ARG A 1 17  ? -1.097  -19.081 22.580  1.00 31.64 ? 17  ARG A HD2  5  
ATOM 9660  H HD3  . ARG A 1 17  ? -1.710  -20.699 22.924  1.00 31.84 ? 17  ARG A HD3  5  
ATOM 9661  H HE   . ARG A 1 17  ? -3.481  -19.896 21.113  1.00 31.70 ? 17  ARG A HE   5  
ATOM 9662  H HH11 . ARG A 1 17  ? 0.011   -19.568 21.163  1.00 31.72 ? 17  ARG A HH11 5  
ATOM 9663  H HH12 . ARG A 1 17  ? 0.166   -19.566 19.430  1.00 31.76 ? 17  ARG A HH12 5  
ATOM 9664  H HH21 . ARG A 1 17  ? -3.280  -19.872 18.818  1.00 31.75 ? 17  ARG A HH21 5  
ATOM 9665  H HH22 . ARG A 1 17  ? -1.705  -19.727 18.097  1.00 31.77 ? 17  ARG A HH22 5  
ATOM 9666  N N    . GLU A 1 18  ? -4.760  -20.128 26.873  1.00 30.90 ? 18  GLU A N    5  
ATOM 9667  C CA   . GLU A 1 18  ? -4.239  -19.948 28.216  1.00 30.62 ? 18  GLU A CA   5  
ATOM 9668  C C    . GLU A 1 18  ? -2.733  -20.177 28.232  1.00 30.39 ? 18  GLU A C    5  
ATOM 9669  O O    . GLU A 1 18  ? -2.244  -21.245 28.600  1.00 30.35 ? 18  GLU A O    5  
ATOM 9670  C CB   . GLU A 1 18  ? -4.952  -20.852 29.223  1.00 30.67 ? 18  GLU A CB   5  
ATOM 9671  C CG   . GLU A 1 18  ? -5.098  -22.299 28.789  1.00 30.69 ? 18  GLU A CG   5  
ATOM 9672  C CD   . GLU A 1 18  ? -5.763  -23.141 29.851  1.00 30.90 ? 18  GLU A CD   5  
ATOM 9673  O OE1  . GLU A 1 18  ? -6.266  -22.571 30.839  1.00 31.24 ? 18  GLU A OE1  5  
ATOM 9674  O OE2  . GLU A 1 18  ? -5.784  -24.383 29.708  1.00 30.81 ? 18  GLU A OE2  5  
ATOM 9675  H H    . GLU A 1 18  ? -5.092  -21.007 26.592  1.00 30.99 ? 18  GLU A H    5  
ATOM 9676  H HA   . GLU A 1 18  ? -4.423  -18.918 28.491  1.00 30.62 ? 18  GLU A HA   5  
ATOM 9677  H HB2  . GLU A 1 18  ? -4.398  -20.838 30.150  1.00 30.69 ? 18  GLU A HB2  5  
ATOM 9678  H HB3  . GLU A 1 18  ? -5.940  -20.454 29.403  1.00 30.77 ? 18  GLU A HB3  5  
ATOM 9679  H HG2  . GLU A 1 18  ? -5.697  -22.336 27.892  1.00 30.69 ? 18  GLU A HG2  5  
ATOM 9680  H HG3  . GLU A 1 18  ? -4.118  -22.706 28.586  1.00 30.64 ? 18  GLU A HG3  5  
ATOM 9681  N N    . PHE A 1 19  ? -2.011  -19.168 27.782  1.00 30.33 ? 19  PHE A N    5  
ATOM 9682  C CA   . PHE A 1 19  ? -0.565  -19.216 27.732  1.00 30.21 ? 19  PHE A CA   5  
ATOM 9683  C C    . PHE A 1 19  ? 0.008   -17.870 28.156  1.00 29.75 ? 19  PHE A C    5  
ATOM 9684  O O    . PHE A 1 19  ? -0.607  -16.828 27.935  1.00 29.69 ? 19  PHE A O    5  
ATOM 9685  C CB   . PHE A 1 19  ? -0.097  -19.581 26.319  1.00 30.57 ? 19  PHE A CB   5  
ATOM 9686  C CG   . PHE A 1 19  ? 1.397   -19.662 26.181  1.00 30.68 ? 19  PHE A CG   5  
ATOM 9687  C CD1  . PHE A 1 19  ? 2.106   -20.674 26.807  1.00 31.05 ? 19  PHE A CD1  5  
ATOM 9688  C CD2  . PHE A 1 19  ? 2.090   -18.734 25.418  1.00 30.51 ? 19  PHE A CD2  5  
ATOM 9689  C CE1  . PHE A 1 19  ? 3.478   -20.759 26.676  1.00 31.24 ? 19  PHE A CE1  5  
ATOM 9690  C CE2  . PHE A 1 19  ? 3.462   -18.813 25.285  1.00 30.71 ? 19  PHE A CE2  5  
ATOM 9691  C CZ   . PHE A 1 19  ? 4.161   -19.800 25.935  1.00 31.07 ? 19  PHE A CZ   5  
ATOM 9692  H H    . PHE A 1 19  ? -2.467  -18.357 27.469  1.00 30.42 ? 19  PHE A H    5  
ATOM 9693  H HA   . PHE A 1 19  ? -0.231  -19.973 28.424  1.00 30.28 ? 19  PHE A HA   5  
ATOM 9694  H HB2  . PHE A 1 19  ? -0.508  -20.541 26.048  1.00 30.83 ? 19  PHE A HB2  5  
ATOM 9695  H HB3  . PHE A 1 19  ? -0.457  -18.834 25.627  1.00 30.59 ? 19  PHE A HB3  5  
ATOM 9696  H HD1  . PHE A 1 19  ? 1.572   -21.400 27.405  1.00 31.23 ? 19  PHE A HD1  5  
ATOM 9697  H HD2  . PHE A 1 19  ? 1.547   -17.939 24.924  1.00 30.27 ? 19  PHE A HD2  5  
ATOM 9698  H HE1  . PHE A 1 19  ? 4.019   -21.554 27.168  1.00 31.57 ? 19  PHE A HE1  5  
ATOM 9699  H HE2  . PHE A 1 19  ? 3.991   -18.082 24.690  1.00 30.63 ? 19  PHE A HE2  5  
ATOM 9700  H HZ   . PHE A 1 19  ? 5.234   -19.850 25.841  1.00 31.29 ? 19  PHE A HZ   5  
ATOM 9701  N N    . LEU A 1 20  ? 1.173   -17.900 28.781  1.00 29.50 ? 20  LEU A N    5  
ATOM 9702  C CA   . LEU A 1 20  ? 1.827   -16.685 29.232  1.00 29.16 ? 20  LEU A CA   5  
ATOM 9703  C C    . LEU A 1 20  ? 2.365   -15.904 28.038  1.00 28.50 ? 20  LEU A C    5  
ATOM 9704  O O    . LEU A 1 20  ? 3.379   -16.277 27.444  1.00 28.35 ? 20  LEU A O    5  
ATOM 9705  C CB   . LEU A 1 20  ? 2.963   -17.023 30.198  1.00 29.33 ? 20  LEU A CB   5  
ATOM 9706  C CG   . LEU A 1 20  ? 2.569   -17.920 31.371  1.00 29.60 ? 20  LEU A CG   5  
ATOM 9707  C CD1  . LEU A 1 20  ? 3.774   -18.182 32.265  1.00 29.57 ? 20  LEU A CD1  5  
ATOM 9708  C CD2  . LEU A 1 20  ? 1.423   -17.295 32.163  1.00 29.85 ? 20  LEU A CD2  5  
ATOM 9709  H H    . LEU A 1 20  ? 1.609   -18.763 28.937  1.00 29.61 ? 20  LEU A H    5  
ATOM 9710  H HA   . LEU A 1 20  ? 1.094   -16.083 29.746  1.00 29.36 ? 20  LEU A HA   5  
ATOM 9711  H HB2  . LEU A 1 20  ? 3.749   -17.515 29.642  1.00 29.39 ? 20  LEU A HB2  5  
ATOM 9712  H HB3  . LEU A 1 20  ? 3.353   -16.100 30.597  1.00 29.28 ? 20  LEU A HB3  5  
ATOM 9713  H HG   . LEU A 1 20  ? 2.230   -18.870 30.984  1.00 29.74 ? 20  LEU A HG   5  
ATOM 9714  H HD11 . LEU A 1 20  ? 4.177   -17.240 32.609  1.00 29.64 ? 20  LEU A HD11 5  
ATOM 9715  H HD12 . LEU A 1 20  ? 4.530   -18.711 31.703  1.00 29.62 ? 20  LEU A HD12 5  
ATOM 9716  H HD13 . LEU A 1 20  ? 3.475   -18.778 33.115  1.00 29.51 ? 20  LEU A HD13 5  
ATOM 9717  H HD21 . LEU A 1 20  ? 0.580   -17.130 31.504  1.00 29.89 ? 20  LEU A HD21 5  
ATOM 9718  H HD22 . LEU A 1 20  ? 1.742   -16.352 32.576  1.00 29.82 ? 20  LEU A HD22 5  
ATOM 9719  H HD23 . LEU A 1 20  ? 1.126   -17.958 32.962  1.00 30.10 ? 20  LEU A HD23 5  
ATOM 9720  N N    . ALA A 1 21  ? 1.672   -14.839 27.672  1.00 28.20 ? 21  ALA A N    5  
ATOM 9721  C CA   . ALA A 1 21  ? 2.068   -14.028 26.532  1.00 27.66 ? 21  ALA A CA   5  
ATOM 9722  C C    . ALA A 1 21  ? 3.261   -13.139 26.879  1.00 27.05 ? 21  ALA A C    5  
ATOM 9723  O O    . ALA A 1 21  ? 3.127   -11.922 27.033  1.00 26.92 ? 21  ALA A O    5  
ATOM 9724  C CB   . ALA A 1 21  ? 0.891   -13.193 26.045  1.00 27.59 ? 21  ALA A CB   5  
ATOM 9725  H H    . ALA A 1 21  ? 0.865   -14.592 28.179  1.00 28.40 ? 21  ALA A H    5  
ATOM 9726  H HA   . ALA A 1 21  ? 2.359   -14.700 25.735  1.00 27.85 ? 21  ALA A HA   5  
ATOM 9727  H HB1  . ALA A 1 21  ? 0.082   -13.846 25.750  1.00 27.65 ? 21  ALA A HB1  5  
ATOM 9728  H HB2  . ALA A 1 21  ? 1.197   -12.591 25.201  1.00 27.51 ? 21  ALA A HB2  5  
ATOM 9729  H HB3  . ALA A 1 21  ? 0.557   -12.547 26.843  1.00 27.66 ? 21  ALA A HB3  5  
ATOM 9730  N N    . ALA A 1 22  ? 4.423   -13.764 27.036  1.00 26.78 ? 22  ALA A N    5  
ATOM 9731  C CA   . ALA A 1 22  ? 5.646   -13.046 27.361  1.00 26.29 ? 22  ALA A CA   5  
ATOM 9732  C C    . ALA A 1 22  ? 6.376   -12.610 26.095  1.00 25.93 ? 22  ALA A C    5  
ATOM 9733  O O    . ALA A 1 22  ? 6.958   -11.530 26.044  1.00 26.15 ? 22  ALA A O    5  
ATOM 9734  C CB   . ALA A 1 22  ? 6.550   -13.918 28.226  1.00 26.23 ? 22  ALA A CB   5  
ATOM 9735  H H    . ALA A 1 22  ? 4.449   -14.743 26.956  1.00 26.97 ? 22  ALA A H    5  
ATOM 9736  H HA   . ALA A 1 22  ? 5.376   -12.167 27.930  1.00 26.35 ? 22  ALA A HA   5  
ATOM 9737  H HB1  . ALA A 1 22  ? 7.414   -13.349 28.540  1.00 26.24 ? 22  ALA A HB1  5  
ATOM 9738  H HB2  . ALA A 1 22  ? 6.873   -14.776 27.656  1.00 26.16 ? 22  ALA A HB2  5  
ATOM 9739  H HB3  . ALA A 1 22  ? 6.003   -14.252 29.097  1.00 26.35 ? 22  ALA A HB3  5  
ATOM 9740  N N    . MET A 1 23  ? 6.335   -13.453 25.069  1.00 25.45 ? 23  MET A N    5  
ATOM 9741  C CA   . MET A 1 23  ? 7.016   -13.151 23.818  1.00 25.17 ? 23  MET A CA   5  
ATOM 9742  C C    . MET A 1 23  ? 6.026   -13.110 22.660  1.00 24.29 ? 23  MET A C    5  
ATOM 9743  O O    . MET A 1 23  ? 6.414   -13.146 21.492  1.00 24.04 ? 23  MET A O    5  
ATOM 9744  C CB   . MET A 1 23  ? 8.113   -14.182 23.541  1.00 25.82 ? 23  MET A CB   5  
ATOM 9745  C CG   . MET A 1 23  ? 9.239   -14.176 24.569  1.00 26.18 ? 23  MET A CG   5  
ATOM 9746  S SD   . MET A 1 23  ? 10.563  -15.333 24.167  1.00 26.73 ? 23  MET A SD   5  
ATOM 9747  C CE   . MET A 1 23  ? 11.124  -14.673 22.597  1.00 27.47 ? 23  MET A CE   5  
ATOM 9748  H H    . MET A 1 23  ? 5.839   -14.293 25.157  1.00 25.35 ? 23  MET A H    5  
ATOM 9749  H HA   . MET A 1 23  ? 7.467   -12.174 23.917  1.00 25.23 ? 23  MET A HA   5  
ATOM 9750  H HB2  . MET A 1 23  ? 7.669   -15.165 23.533  1.00 26.04 ? 23  MET A HB2  5  
ATOM 9751  H HB3  . MET A 1 23  ? 8.540   -13.982 22.570  1.00 25.92 ? 23  MET A HB3  5  
ATOM 9752  H HG2  . MET A 1 23  ? 9.657   -13.182 24.624  1.00 26.11 ? 23  MET A HG2  5  
ATOM 9753  H HG3  . MET A 1 23  ? 8.830   -14.446 25.531  1.00 26.28 ? 23  MET A HG3  5  
ATOM 9754  H HE1  . MET A 1 23  ? 11.944  -15.271 22.223  1.00 27.66 ? 23  MET A HE1  5  
ATOM 9755  H HE2  . MET A 1 23  ? 11.459  -13.655 22.731  1.00 27.63 ? 23  MET A HE2  5  
ATOM 9756  H HE3  . MET A 1 23  ? 10.310  -14.694 21.889  1.00 27.66 ? 23  MET A HE3  5  
ATOM 9757  N N    . GLU A 1 24  ? 4.742   -13.031 22.992  1.00 23.92 ? 24  GLU A N    5  
ATOM 9758  C CA   . GLU A 1 24  ? 3.697   -12.896 21.985  1.00 23.15 ? 24  GLU A CA   5  
ATOM 9759  C C    . GLU A 1 24  ? 2.640   -11.898 22.438  1.00 22.22 ? 24  GLU A C    5  
ATOM 9760  O O    . GLU A 1 24  ? 1.988   -12.105 23.456  1.00 22.21 ? 24  GLU A O    5  
ATOM 9761  C CB   . GLU A 1 24  ? 3.008   -14.234 21.691  1.00 23.57 ? 24  GLU A CB   5  
ATOM 9762  C CG   . GLU A 1 24  ? 3.895   -15.285 21.049  1.00 23.67 ? 24  GLU A CG   5  
ATOM 9763  C CD   . GLU A 1 24  ? 3.082   -16.420 20.463  1.00 24.03 ? 24  GLU A CD   5  
ATOM 9764  O OE1  . GLU A 1 24  ? 2.637   -17.298 21.237  1.00 24.02 ? 24  GLU A OE1  5  
ATOM 9765  O OE2  . GLU A 1 24  ? 2.907   -16.463 19.232  1.00 24.41 ? 24  GLU A OE2  5  
ATOM 9766  H H    . GLU A 1 24  ? 4.490   -13.054 23.939  1.00 24.25 ? 24  GLU A H    5  
ATOM 9767  H HA   . GLU A 1 24  ? 4.155   -12.527 21.080  1.00 23.03 ? 24  GLU A HA   5  
ATOM 9768  H HB2  . GLU A 1 24  ? 2.628   -14.638 22.618  1.00 24.07 ? 24  GLU A HB2  5  
ATOM 9769  H HB3  . GLU A 1 24  ? 2.176   -14.051 21.029  1.00 23.42 ? 24  GLU A HB3  5  
ATOM 9770  H HG2  . GLU A 1 24  ? 4.475   -14.827 20.261  1.00 23.64 ? 24  GLU A HG2  5  
ATOM 9771  H HG3  . GLU A 1 24  ? 4.560   -15.688 21.800  1.00 23.64 ? 24  GLU A HG3  5  
ATOM 9772  N N    . PRO A 1 25  ? 2.478   -10.792 21.708  1.00 21.54 ? 25  PRO A N    5  
ATOM 9773  C CA   . PRO A 1 25  ? 1.391   -9.850  21.944  1.00 20.70 ? 25  PRO A CA   5  
ATOM 9774  C C    . PRO A 1 25  ? 0.085   -10.357 21.341  1.00 19.96 ? 25  PRO A C    5  
ATOM 9775  O O    . PRO A 1 25  ? 0.099   -11.220 20.456  1.00 19.79 ? 25  PRO A O    5  
ATOM 9776  C CB   . PRO A 1 25  ? 1.850   -8.565  21.229  1.00 20.35 ? 25  PRO A CB   5  
ATOM 9777  C CG   . PRO A 1 25  ? 3.226   -8.851  20.709  1.00 20.99 ? 25  PRO A CG   5  
ATOM 9778  C CD   . PRO A 1 25  ? 3.340   -10.346 20.613  1.00 21.63 ? 25  PRO A CD   5  
ATOM 9779  H HA   . PRO A 1 25  ? 1.252   -9.656  22.998  1.00 20.98 ? 25  PRO A HA   5  
ATOM 9780  H HB2  . PRO A 1 25  ? 1.167   -8.338  20.424  1.00 19.62 ? 25  PRO A HB2  5  
ATOM 9781  H HB3  . PRO A 1 25  ? 1.861   -7.747  21.934  1.00 20.49 ? 25  PRO A HB3  5  
ATOM 9782  H HG2  . PRO A 1 25  ? 3.349   -8.404  19.733  1.00 20.64 ? 25  PRO A HG2  5  
ATOM 9783  H HG3  . PRO A 1 25  ? 3.964   -8.463  21.396  1.00 21.44 ? 25  PRO A HG3  5  
ATOM 9784  H HD2  . PRO A 1 25  ? 2.974   -10.695 19.658  1.00 21.43 ? 25  PRO A HD2  5  
ATOM 9785  H HD3  . PRO A 1 25  ? 4.362   -10.660 20.769  1.00 22.40 ? 25  PRO A HD3  5  
ATOM 9786  N N    . GLU A 1 26  ? -1.035  -9.839  21.830  1.00 19.63 ? 26  GLU A N    5  
ATOM 9787  C CA   . GLU A 1 26  ? -2.342  -10.194 21.292  1.00 19.01 ? 26  GLU A CA   5  
ATOM 9788  C C    . GLU A 1 26  ? -2.394  -9.942  19.787  1.00 17.82 ? 26  GLU A C    5  
ATOM 9789  O O    . GLU A 1 26  ? -1.821  -8.967  19.295  1.00 17.39 ? 26  GLU A O    5  
ATOM 9790  C CB   . GLU A 1 26  ? -3.459  -9.401  21.982  1.00 19.23 ? 26  GLU A CB   5  
ATOM 9791  C CG   . GLU A 1 26  ? -3.592  -9.673  23.474  1.00 19.90 ? 26  GLU A CG   5  
ATOM 9792  C CD   . GLU A 1 26  ? -2.649  -8.832  24.316  1.00 20.41 ? 26  GLU A CD   5  
ATOM 9793  O OE1  . GLU A 1 26  ? -1.457  -9.194  24.411  1.00 20.64 ? 26  GLU A OE1  5  
ATOM 9794  O OE2  . GLU A 1 26  ? -3.090  -7.809  24.876  1.00 20.67 ? 26  GLU A OE2  5  
ATOM 9795  H H    . GLU A 1 26  ? -0.984  -9.214  22.592  1.00 19.90 ? 26  GLU A H    5  
ATOM 9796  H HA   . GLU A 1 26  ? -2.498  -11.246 21.473  1.00 19.36 ? 26  GLU A HA   5  
ATOM 9797  H HB2  . GLU A 1 26  ? -3.265  -8.347  21.852  1.00 19.06 ? 26  GLU A HB2  5  
ATOM 9798  H HB3  . GLU A 1 26  ? -4.400  -9.644  21.510  1.00 19.19 ? 26  GLU A HB3  5  
ATOM 9799  H HG2  . GLU A 1 26  ? -4.607  -9.458  23.775  1.00 20.16 ? 26  GLU A HG2  5  
ATOM 9800  H HG3  . GLU A 1 26  ? -3.380  -10.717 23.655  1.00 19.91 ? 26  GLU A HG3  5  
ATOM 9801  N N    . PRO A 1 27  ? -3.072  -10.825 19.042  1.00 17.38 ? 27  PRO A N    5  
ATOM 9802  C CA   . PRO A 1 27  ? -3.198  -10.709 17.584  1.00 16.31 ? 27  PRO A CA   5  
ATOM 9803  C C    . PRO A 1 27  ? -3.883  -9.411  17.165  1.00 15.58 ? 27  PRO A C    5  
ATOM 9804  O O    . PRO A 1 27  ? -5.069  -9.205  17.432  1.00 15.74 ? 27  PRO A O    5  
ATOM 9805  C CB   . PRO A 1 27  ? -4.060  -11.914 17.194  1.00 16.33 ? 27  PRO A CB   5  
ATOM 9806  C CG   . PRO A 1 27  ? -3.934  -12.865 18.335  1.00 17.43 ? 27  PRO A CG   5  
ATOM 9807  C CD   . PRO A 1 27  ? -3.770  -12.014 19.559  1.00 18.02 ? 27  PRO A CD   5  
ATOM 9808  H HA   . PRO A 1 27  ? -2.235  -10.778 17.096  1.00 16.18 ? 27  PRO A HA   5  
ATOM 9809  H HB2  . PRO A 1 27  ? -5.082  -11.595 17.054  1.00 15.88 ? 27  PRO A HB2  5  
ATOM 9810  H HB3  . PRO A 1 27  ? -3.684  -12.345 16.279  1.00 16.16 ? 27  PRO A HB3  5  
ATOM 9811  H HG2  . PRO A 1 27  ? -4.828  -13.466 18.414  1.00 17.52 ? 27  PRO A HG2  5  
ATOM 9812  H HG3  . PRO A 1 27  ? -3.066  -13.496 18.198  1.00 17.81 ? 27  PRO A HG3  5  
ATOM 9813  H HD2  . PRO A 1 27  ? -4.736  -11.750 19.967  1.00 18.21 ? 27  PRO A HD2  5  
ATOM 9814  H HD3  . PRO A 1 27  ? -3.171  -12.523 20.298  1.00 18.75 ? 27  PRO A HD3  5  
ATOM 9815  N N    . ALA A 1 28  ? -3.121  -8.536  16.525  1.00 14.93 ? 28  ALA A N    5  
ATOM 9816  C CA   . ALA A 1 28  ? -3.642  -7.262  16.054  1.00 14.31 ? 28  ALA A CA   5  
ATOM 9817  C C    . ALA A 1 28  ? -4.417  -7.448  14.755  1.00 13.28 ? 28  ALA A C    5  
ATOM 9818  O O    . ALA A 1 28  ? -4.088  -8.321  13.951  1.00 12.82 ? 28  ALA A O    5  
ATOM 9819  C CB   . ALA A 1 28  ? -2.499  -6.278  15.852  1.00 14.27 ? 28  ALA A CB   5  
ATOM 9820  H H    . ALA A 1 28  ? -2.182  -8.754  16.359  1.00 14.96 ? 28  ALA A H    5  
ATOM 9821  H HA   . ALA A 1 28  ? -4.304  -6.866  16.809  1.00 14.81 ? 28  ALA A HA   5  
ATOM 9822  H HB1  . ALA A 1 28  ? -1.815  -6.668  15.113  1.00 14.09 ? 28  ALA A HB1  5  
ATOM 9823  H HB2  . ALA A 1 28  ? -1.976  -6.134  16.786  1.00 14.39 ? 28  ALA A HB2  5  
ATOM 9824  H HB3  . ALA A 1 28  ? -2.894  -5.331  15.512  1.00 14.46 ? 28  ALA A HB3  5  
ATOM 9825  N N    . PRO A 1 29  ? -5.464  -6.639  14.540  1.00 13.06 ? 29  PRO A N    5  
ATOM 9826  C CA   . PRO A 1 29  ? -6.273  -6.704  13.323  1.00 12.21 ? 29  PRO A CA   5  
ATOM 9827  C C    . PRO A 1 29  ? -5.494  -6.255  12.090  1.00 11.34 ? 29  PRO A C    5  
ATOM 9828  O O    . PRO A 1 29  ? -4.881  -5.188  12.082  1.00 11.36 ? 29  PRO A O    5  
ATOM 9829  C CB   . PRO A 1 29  ? -7.437  -5.740  13.595  1.00 12.51 ? 29  PRO A CB   5  
ATOM 9830  C CG   . PRO A 1 29  ? -7.384  -5.447  15.058  1.00 13.50 ? 29  PRO A CG   5  
ATOM 9831  C CD   . PRO A 1 29  ? -5.949  -5.605  15.464  1.00 13.81 ? 29  PRO A CD   5  
ATOM 9832  H HA   . PRO A 1 29  ? -6.657  -7.699  13.159  1.00 12.20 ? 29  PRO A HA   5  
ATOM 9833  H HB2  . PRO A 1 29  ? -7.304  -4.842  13.008  1.00 12.17 ? 29  PRO A HB2  5  
ATOM 9834  H HB3  . PRO A 1 29  ? -8.367  -6.215  13.324  1.00 12.53 ? 29  PRO A HB3  5  
ATOM 9835  H HG2  . PRO A 1 29  ? -7.715  -4.436  15.242  1.00 13.63 ? 29  PRO A HG2  5  
ATOM 9836  H HG3  . PRO A 1 29  ? -8.006  -6.150  15.593  1.00 13.98 ? 29  PRO A HG3  5  
ATOM 9837  H HD2  . PRO A 1 29  ? -5.409  -4.680  15.329  1.00 13.93 ? 29  PRO A HD2  5  
ATOM 9838  H HD3  . PRO A 1 29  ? -5.879  -5.943  16.488  1.00 14.55 ? 29  PRO A HD3  5  
ATOM 9839  N N    . ALA A 1 30  ? -5.513  -7.077  11.056  1.00 10.76 ? 30  ALA A N    5  
ATOM 9840  C CA   . ALA A 1 30  ? -4.853  -6.734  9.807   1.00 10.06 ? 30  ALA A CA   5  
ATOM 9841  C C    . ALA A 1 30  ? -5.826  -6.085  8.815   1.00 8.93  ? 30  ALA A C    5  
ATOM 9842  O O    . ALA A 1 30  ? -5.532  -5.019  8.275   1.00 8.35  ? 30  ALA A O    5  
ATOM 9843  C CB   . ALA A 1 30  ? -4.184  -7.958  9.197   1.00 10.54 ? 30  ALA A CB   5  
ATOM 9844  H H    . ALA A 1 30  ? -5.972  -7.936  11.136  1.00 10.95 ? 30  ALA A H    5  
ATOM 9845  H HA   . ALA A 1 30  ? -4.081  -6.018  10.043  1.00 10.23 ? 30  ALA A HA   5  
ATOM 9846  H HB1  . ALA A 1 30  ? -3.519  -8.401  9.923   1.00 10.55 ? 30  ALA A HB1  5  
ATOM 9847  H HB2  . ALA A 1 30  ? -3.623  -7.664  8.323   1.00 10.83 ? 30  ALA A HB2  5  
ATOM 9848  H HB3  . ALA A 1 30  ? -4.941  -8.677  8.915   1.00 10.80 ? 30  ALA A HB3  5  
ATOM 9849  N N    . PRO A 1 31  ? -6.996  -6.706  8.543   1.00 8.82  ? 31  PRO A N    5  
ATOM 9850  C CA   . PRO A 1 31  ? -7.994  -6.114  7.660   1.00 7.95  ? 31  PRO A CA   5  
ATOM 9851  C C    . PRO A 1 31  ? -8.741  -4.974  8.340   1.00 6.75  ? 31  PRO A C    5  
ATOM 9852  O O    . PRO A 1 31  ? -9.585  -5.201  9.209   1.00 6.83  ? 31  PRO A O    5  
ATOM 9853  C CB   . PRO A 1 31  ? -8.956  -7.272  7.340   1.00 8.63  ? 31  PRO A CB   5  
ATOM 9854  C CG   . PRO A 1 31  ? -8.328  -8.494  7.929   1.00 9.60  ? 31  PRO A CG   5  
ATOM 9855  C CD   . PRO A 1 31  ? -7.442  -8.014  9.041   1.00 9.77  ? 31  PRO A CD   5  
ATOM 9856  H HA   . PRO A 1 31  ? -7.546  -5.750  6.749   1.00 7.98  ? 31  PRO A HA   5  
ATOM 9857  H HB2  . PRO A 1 31  ? -9.920  -7.073  7.785   1.00 8.18  ? 31  PRO A HB2  5  
ATOM 9858  H HB3  . PRO A 1 31  ? -9.062  -7.363  6.270   1.00 9.06  ? 31  PRO A HB3  5  
ATOM 9859  H HG2  . PRO A 1 31  ? -9.093  -9.148  8.316   1.00 9.59  ? 31  PRO A HG2  5  
ATOM 9860  H HG3  . PRO A 1 31  ? -7.742  -9.003  7.176   1.00 10.36 ? 31  PRO A HG3  5  
ATOM 9861  H HD2  . PRO A 1 31  ? -8.001  -7.911  9.959   1.00 9.88  ? 31  PRO A HD2  5  
ATOM 9862  H HD3  . PRO A 1 31  ? -6.604  -8.681  9.175   1.00 10.60 ? 31  PRO A HD3  5  
ATOM 9863  N N    . ALA A 1 32  ? -8.399  -3.750  7.969   1.00 5.86  ? 32  ALA A N    5  
ATOM 9864  C CA   . ALA A 1 32  ? -9.072  -2.574  8.494   1.00 4.75  ? 32  ALA A CA   5  
ATOM 9865  C C    . ALA A 1 32  ? -10.498 -2.504  7.968   1.00 3.89  ? 32  ALA A C    5  
ATOM 9866  O O    . ALA A 1 32  ? -10.768 -2.928  6.842   1.00 3.98  ? 32  ALA A O    5  
ATOM 9867  C CB   . ALA A 1 32  ? -8.302  -1.316  8.125   1.00 4.57  ? 32  ALA A CB   5  
ATOM 9868  H H    . ALA A 1 32  ? -7.671  -3.635  7.325   1.00 6.11  ? 32  ALA A H    5  
ATOM 9869  H HA   . ALA A 1 32  ? -9.097  -2.654  9.572   1.00 5.11  ? 32  ALA A HA   5  
ATOM 9870  H HB1  . ALA A 1 32  ? -7.309  -1.365  8.551   1.00 4.83  ? 32  ALA A HB1  5  
ATOM 9871  H HB2  . ALA A 1 32  ? -8.817  -0.451  8.513   1.00 4.63  ? 32  ALA A HB2  5  
ATOM 9872  H HB3  . ALA A 1 32  ? -8.230  -1.241  7.050   1.00 4.62  ? 32  ALA A HB3  5  
ATOM 9873  N N    . PRO A 1 33  ? -11.430 -1.970  8.773   1.00 3.62  ? 33  PRO A N    5  
ATOM 9874  C CA   . PRO A 1 33  ? -12.842 -1.883  8.394   1.00 3.45  ? 33  PRO A CA   5  
ATOM 9875  C C    . PRO A 1 33  ? -13.121 -0.759  7.400   1.00 2.48  ? 33  PRO A C    5  
ATOM 9876  O O    . PRO A 1 33  ? -14.256 -0.584  6.952   1.00 3.06  ? 33  PRO A O    5  
ATOM 9877  C CB   . PRO A 1 33  ? -13.541 -1.607  9.726   1.00 4.15  ? 33  PRO A CB   5  
ATOM 9878  C CG   . PRO A 1 33  ? -12.528 -0.872  10.534  1.00 4.47  ? 33  PRO A CG   5  
ATOM 9879  C CD   . PRO A 1 33  ? -11.187 -1.422  10.126  1.00 4.26  ? 33  PRO A CD   5  
ATOM 9880  H HA   . PRO A 1 33  ? -13.200 -2.817  7.986   1.00 4.15  ? 33  PRO A HA   5  
ATOM 9881  H HB2  . PRO A 1 33  ? -14.423 -1.006  9.555   1.00 4.01  ? 33  PRO A HB2  5  
ATOM 9882  H HB3  . PRO A 1 33  ? -13.817 -2.542  10.193  1.00 4.98  ? 33  PRO A HB3  5  
ATOM 9883  H HG2  . PRO A 1 33  ? -12.583 0.184   10.316  1.00 4.40  ? 33  PRO A HG2  5  
ATOM 9884  H HG3  . PRO A 1 33  ? -12.699 -1.048  11.586  1.00 5.36  ? 33  PRO A HG3  5  
ATOM 9885  H HD2  . PRO A 1 33  ? -10.451 -0.631  10.094  1.00 4.15  ? 33  PRO A HD2  5  
ATOM 9886  H HD3  . PRO A 1 33  ? -10.875 -2.202  10.806  1.00 5.11  ? 33  PRO A HD3  5  
ATOM 9887  N N    . GLU A 1 34  ? -12.086 -0.001  7.060   1.00 1.57  ? 34  GLU A N    5  
ATOM 9888  C CA   . GLU A 1 34  ? -12.222 1.102   6.126   1.00 1.27  ? 34  GLU A CA   5  
ATOM 9889  C C    . GLU A 1 34  ? -11.147 1.013   5.048   1.00 1.08  ? 34  GLU A C    5  
ATOM 9890  O O    . GLU A 1 34  ? -10.056 0.489   5.286   1.00 1.44  ? 34  GLU A O    5  
ATOM 9891  C CB   . GLU A 1 34  ? -12.154 2.449   6.860   1.00 2.01  ? 34  GLU A CB   5  
ATOM 9892  C CG   . GLU A 1 34  ? -13.244 2.614   7.908   1.00 2.68  ? 34  GLU A CG   5  
ATOM 9893  C CD   . GLU A 1 34  ? -13.241 3.980   8.563   1.00 3.58  ? 34  GLU A CD   5  
ATOM 9894  O OE1  . GLU A 1 34  ? -12.375 4.226   9.428   1.00 4.13  ? 34  GLU A OE1  5  
ATOM 9895  O OE2  . GLU A 1 34  ? -14.091 4.821   8.199   1.00 4.13  ? 34  GLU A OE2  5  
ATOM 9896  H H    . GLU A 1 34  ? -11.204 -0.204  7.433   1.00 1.90  ? 34  GLU A H    5  
ATOM 9897  H HA   . GLU A 1 34  ? -13.188 1.011   5.654   1.00 1.85  ? 34  GLU A HA   5  
ATOM 9898  H HB2  . GLU A 1 34  ? -11.196 2.531   7.350   1.00 2.33  ? 34  GLU A HB2  5  
ATOM 9899  H HB3  . GLU A 1 34  ? -12.252 3.248   6.141   1.00 2.63  ? 34  GLU A HB3  5  
ATOM 9900  H HG2  . GLU A 1 34  ? -14.203 2.460   7.437   1.00 3.03  ? 34  GLU A HG2  5  
ATOM 9901  H HG3  . GLU A 1 34  ? -13.098 1.868   8.674   1.00 2.92  ? 34  GLU A HG3  5  
ATOM 9902  N N    . GLU A 1 35  ? -11.467 1.523   3.869   1.00 1.01  ? 35  GLU A N    5  
ATOM 9903  C CA   . GLU A 1 35  ? -10.593 1.411   2.709   1.00 0.87  ? 35  GLU A CA   5  
ATOM 9904  C C    . GLU A 1 35  ? -9.501  2.477   2.728   1.00 0.73  ? 35  GLU A C    5  
ATOM 9905  O O    . GLU A 1 35  ? -9.782  3.658   2.935   1.00 0.89  ? 35  GLU A O    5  
ATOM 9906  C CB   . GLU A 1 35  ? -11.425 1.546   1.432   1.00 1.09  ? 35  GLU A CB   5  
ATOM 9907  C CG   . GLU A 1 35  ? -12.522 0.503   1.304   1.00 1.72  ? 35  GLU A CG   5  
ATOM 9908  C CD   . GLU A 1 35  ? -11.985 -0.850  0.899   1.00 1.94  ? 35  GLU A CD   5  
ATOM 9909  O OE1  . GLU A 1 35  ? -11.455 -1.577  1.763   1.00 2.36  ? 35  GLU A OE1  5  
ATOM 9910  O OE2  . GLU A 1 35  ? -12.074 -1.185  -0.300  1.00 2.45  ? 35  GLU A OE2  5  
ATOM 9911  H H    . GLU A 1 35  ? -12.318 2.000   3.775   1.00 1.36  ? 35  GLU A H    5  
ATOM 9912  H HA   . GLU A 1 35  ? -10.131 0.436   2.728   1.00 0.87  ? 35  GLU A HA   5  
ATOM 9913  H HB2  . GLU A 1 35  ? -11.880 2.523   1.414   1.00 1.33  ? 35  GLU A HB2  5  
ATOM 9914  H HB3  . GLU A 1 35  ? -10.769 1.447   0.579   1.00 1.44  ? 35  GLU A HB3  5  
ATOM 9915  H HG2  . GLU A 1 35  ? -13.024 0.404   2.257   1.00 2.41  ? 35  GLU A HG2  5  
ATOM 9916  H HG3  . GLU A 1 35  ? -13.230 0.834   0.558   1.00 2.23  ? 35  GLU A HG3  5  
ATOM 9917  N N    . TRP A 1 36  ? -8.255  2.054   2.521   1.00 0.53  ? 36  TRP A N    5  
ATOM 9918  C CA   . TRP A 1 36  ? -7.135  2.991   2.445   1.00 0.45  ? 36  TRP A CA   5  
ATOM 9919  C C    . TRP A 1 36  ? -7.008  3.566   1.033   1.00 0.46  ? 36  TRP A C    5  
ATOM 9920  O O    . TRP A 1 36  ? -7.882  3.382   0.184   1.00 0.52  ? 36  TRP A O    5  
ATOM 9921  C CB   . TRP A 1 36  ? -5.798  2.319   2.798   1.00 0.38  ? 36  TRP A CB   5  
ATOM 9922  C CG   . TRP A 1 36  ? -5.856  1.257   3.848   1.00 0.34  ? 36  TRP A CG   5  
ATOM 9923  C CD1  . TRP A 1 36  ? -6.776  1.101   4.841   1.00 0.39  ? 36  TRP A CD1  5  
ATOM 9924  C CD2  . TRP A 1 36  ? -4.909  0.200   4.007   1.00 0.27  ? 36  TRP A CD2  5  
ATOM 9925  N NE1  . TRP A 1 36  ? -6.470  -0.009  5.593   1.00 0.36  ? 36  TRP A NE1  5  
ATOM 9926  C CE2  . TRP A 1 36  ? -5.321  -0.572  5.101   1.00 0.28  ? 36  TRP A CE2  5  
ATOM 9927  C CE3  . TRP A 1 36  ? -3.749  -0.169  3.320   1.00 0.21  ? 36  TRP A CE3  5  
ATOM 9928  C CZ2  . TRP A 1 36  ? -4.612  -1.692  5.523   1.00 0.24  ? 36  TRP A CZ2  5  
ATOM 9929  C CZ3  . TRP A 1 36  ? -3.058  -1.272  3.741   1.00 0.17  ? 36  TRP A CZ3  5  
ATOM 9930  C CH2  . TRP A 1 36  ? -3.483  -2.023  4.828   1.00 0.19  ? 36  TRP A CH2  5  
ATOM 9931  H H    . TRP A 1 36  ? -8.082  1.093   2.445   1.00 0.51  ? 36  TRP A H    5  
ATOM 9932  H HA   . TRP A 1 36  ? -7.323  3.799   3.137   1.00 0.53  ? 36  TRP A HA   5  
ATOM 9933  H HB2  . TRP A 1 36  ? -5.396  1.863   1.909   1.00 0.38  ? 36  TRP A HB2  5  
ATOM 9934  H HB3  . TRP A 1 36  ? -5.110  3.081   3.139   1.00 0.44  ? 36  TRP A HB3  5  
ATOM 9935  H HD1  . TRP A 1 36  ? -7.625  1.749   4.992   1.00 0.46  ? 36  TRP A HD1  5  
ATOM 9936  H HE1  . TRP A 1 36  ? -6.990  -0.336  6.359   1.00 0.39  ? 36  TRP A HE1  5  
ATOM 9937  H HE3  . TRP A 1 36  ? -3.384  0.396   2.469   1.00 0.21  ? 36  TRP A HE3  5  
ATOM 9938  H HZ2  . TRP A 1 36  ? -4.923  -2.280  6.366   1.00 0.27  ? 36  TRP A HZ2  5  
ATOM 9939  H HZ3  . TRP A 1 36  ? -2.161  -1.566  3.221   1.00 0.16  ? 36  TRP A HZ3  5  
ATOM 9940  H HH2  . TRP A 1 36  ? -2.900  -2.894  5.107   1.00 0.19  ? 36  TRP A HH2  5  
ATOM 9941  N N    . LEU A 1 37  ? -5.895  4.247   0.790   1.00 0.43  ? 37  LEU A N    5  
ATOM 9942  C CA   . LEU A 1 37  ? -5.593  4.796   -0.521  1.00 0.42  ? 37  LEU A CA   5  
ATOM 9943  C C    . LEU A 1 37  ? -4.963  3.729   -1.403  1.00 0.37  ? 37  LEU A C    5  
ATOM 9944  O O    . LEU A 1 37  ? -3.869  3.242   -1.104  1.00 0.35  ? 37  LEU A O    5  
ATOM 9945  C CB   . LEU A 1 37  ? -4.626  5.975   -0.377  1.00 0.45  ? 37  LEU A CB   5  
ATOM 9946  C CG   . LEU A 1 37  ? -4.238  6.675   -1.680  1.00 0.46  ? 37  LEU A CG   5  
ATOM 9947  C CD1  . LEU A 1 37  ? -5.430  7.407   -2.268  1.00 0.49  ? 37  LEU A CD1  5  
ATOM 9948  C CD2  . LEU A 1 37  ? -3.081  7.637   -1.445  1.00 0.50  ? 37  LEU A CD2  5  
ATOM 9949  H H    . LEU A 1 37  ? -5.249  4.376   1.517   1.00 0.43  ? 37  LEU A H    5  
ATOM 9950  H HA   . LEU A 1 37  ? -6.511  5.138   -0.970  1.00 0.46  ? 37  LEU A HA   5  
ATOM 9951  H HB2  . LEU A 1 37  ? -5.080  6.704   0.272   1.00 0.51  ? 37  LEU A HB2  5  
ATOM 9952  H HB3  . LEU A 1 37  ? -3.722  5.616   0.092   1.00 0.45  ? 37  LEU A HB3  5  
ATOM 9953  H HG   . LEU A 1 37  ? -3.917  5.935   -2.397  1.00 0.43  ? 37  LEU A HG   5  
ATOM 9954  H HD11 . LEU A 1 37  ? -5.140  7.884   -3.193  1.00 1.11  ? 37  LEU A HD11 5  
ATOM 9955  H HD12 . LEU A 1 37  ? -5.769  8.156   -1.568  1.00 1.17  ? 37  LEU A HD12 5  
ATOM 9956  H HD13 . LEU A 1 37  ? -6.226  6.703   -2.459  1.00 1.09  ? 37  LEU A HD13 5  
ATOM 9957  H HD21 . LEU A 1 37  ? -2.788  8.085   -2.383  1.00 1.16  ? 37  LEU A HD21 5  
ATOM 9958  H HD22 . LEU A 1 37  ? -2.243  7.099   -1.026  1.00 1.19  ? 37  LEU A HD22 5  
ATOM 9959  H HD23 . LEU A 1 37  ? -3.391  8.411   -0.759  1.00 1.05  ? 37  LEU A HD23 5  
ATOM 9960  N N    . ASP A 1 38  ? -5.646  3.345   -2.478  1.00 0.38  ? 38  ASP A N    5  
ATOM 9961  C CA   . ASP A 1 38  ? -5.056  2.408   -3.421  1.00 0.41  ? 38  ASP A CA   5  
ATOM 9962  C C    . ASP A 1 38  ? -4.080  3.148   -4.314  1.00 0.39  ? 38  ASP A C    5  
ATOM 9963  O O    . ASP A 1 38  ? -4.442  4.113   -4.988  1.00 0.44  ? 38  ASP A O    5  
ATOM 9964  C CB   . ASP A 1 38  ? -6.099  1.671   -4.267  1.00 0.56  ? 38  ASP A CB   5  
ATOM 9965  C CG   . ASP A 1 38  ? -5.521  0.417   -4.899  1.00 1.78  ? 38  ASP A CG   5  
ATOM 9966  O OD1  . ASP A 1 38  ? -4.934  0.506   -5.990  1.00 2.14  ? 38  ASP A OD1  5  
ATOM 9967  O OD2  . ASP A 1 38  ? -5.658  -0.672  -4.318  1.00 2.51  ? 38  ASP A OD2  5  
ATOM 9968  H H    . ASP A 1 38  ? -6.546  3.696   -2.638  1.00 0.43  ? 38  ASP A H    5  
ATOM 9969  H HA   . ASP A 1 38  ? -4.503  1.680   -2.851  1.00 0.44  ? 38  ASP A HA   5  
ATOM 9970  H HB2  . ASP A 1 38  ? -6.936  1.390   -3.647  1.00 0.96  ? 38  ASP A HB2  5  
ATOM 9971  H HB3  . ASP A 1 38  ? -6.441  2.320   -5.061  1.00 0.85  ? 38  ASP A HB3  5  
ATOM 9972  N N    . ILE A 1 39  ? -2.842  2.692   -4.292  1.00 0.38  ? 39  ILE A N    5  
ATOM 9973  C CA   . ILE A 1 39  ? -1.755  3.305   -5.033  1.00 0.38  ? 39  ILE A CA   5  
ATOM 9974  C C    . ILE A 1 39  ? -2.052  3.293   -6.524  1.00 0.39  ? 39  ILE A C    5  
ATOM 9975  O O    . ILE A 1 39  ? -1.724  4.236   -7.248  1.00 0.46  ? 39  ILE A O    5  
ATOM 9976  C CB   . ILE A 1 39  ? -0.432  2.556   -4.767  1.00 0.39  ? 39  ILE A CB   5  
ATOM 9977  C CG1  . ILE A 1 39  ? -0.205  2.420   -3.256  1.00 0.40  ? 39  ILE A CG1  5  
ATOM 9978  C CG2  . ILE A 1 39  ? 0.734   3.260   -5.444  1.00 0.41  ? 39  ILE A CG2  5  
ATOM 9979  C CD1  . ILE A 1 39  ? 1.164   1.881   -2.884  1.00 0.43  ? 39  ILE A CD1  5  
ATOM 9980  H H    . ILE A 1 39  ? -2.649  1.891   -3.755  1.00 0.43  ? 39  ILE A H    5  
ATOM 9981  H HA   . ILE A 1 39  ? -1.647  4.327   -4.700  1.00 0.40  ? 39  ILE A HA   5  
ATOM 9982  H HB   . ILE A 1 39  ? -0.516  1.571   -5.196  1.00 0.42  ? 39  ILE A HB   5  
ATOM 9983  H HG12 . ILE A 1 39  ? -0.323  3.385   -2.789  1.00 0.38  ? 39  ILE A HG12 5  
ATOM 9984  H HG13 . ILE A 1 39  ? -0.948  1.741   -2.854  1.00 0.45  ? 39  ILE A HG13 5  
ATOM 9985  H HG21 . ILE A 1 39  ? 1.648   2.730   -5.224  1.00 1.04  ? 39  ILE A HG21 5  
ATOM 9986  H HG22 . ILE A 1 39  ? 0.807   4.272   -5.076  1.00 1.05  ? 39  ILE A HG22 5  
ATOM 9987  H HG23 . ILE A 1 39  ? 0.572   3.274   -6.511  1.00 0.96  ? 39  ILE A HG23 5  
ATOM 9988  H HD11 . ILE A 1 39  ? 1.284   0.894   -3.303  1.00 1.14  ? 39  ILE A HD11 5  
ATOM 9989  H HD12 . ILE A 1 39  ? 1.251   1.827   -1.808  1.00 1.00  ? 39  ILE A HD12 5  
ATOM 9990  H HD13 . ILE A 1 39  ? 1.931   2.534   -3.275  1.00 1.15  ? 39  ILE A HD13 5  
ATOM 9991  N N    . LEU A 1 40  ? -2.695  2.227   -6.973  1.00 0.39  ? 40  LEU A N    5  
ATOM 9992  C CA   . LEU A 1 40  ? -3.054  2.105   -8.373  1.00 0.49  ? 40  LEU A CA   5  
ATOM 9993  C C    . LEU A 1 40  ? -4.527  2.409   -8.574  1.00 0.49  ? 40  LEU A C    5  
ATOM 9994  O O    . LEU A 1 40  ? -5.024  2.424   -9.701  1.00 0.62  ? 40  LEU A O    5  
ATOM 9995  C CB   . LEU A 1 40  ? -2.713  0.717   -8.905  1.00 0.56  ? 40  LEU A CB   5  
ATOM 9996  C CG   . LEU A 1 40  ? -1.217  0.405   -8.979  1.00 0.59  ? 40  LEU A CG   5  
ATOM 9997  C CD1  . LEU A 1 40  ? -0.993  -0.982  -9.540  1.00 0.62  ? 40  LEU A CD1  5  
ATOM 9998  C CD2  . LEU A 1 40  ? -0.487  1.439   -9.825  1.00 0.72  ? 40  LEU A CD2  5  
ATOM 9999  H H    . LEU A 1 40  ? -2.951  1.515   -6.345  1.00 0.39  ? 40  LEU A H    5  
ATOM 10000 H HA   . LEU A 1 40  ? -2.481  2.821   -8.909  1.00 0.60  ? 40  LEU A HA   5  
ATOM 10001 H HB2  . LEU A 1 40  ? -3.186  -0.016  -8.264  1.00 0.66  ? 40  LEU A HB2  5  
ATOM 10002 H HB3  . LEU A 1 40  ? -3.129  0.625   -9.895  1.00 0.72  ? 40  LEU A HB3  5  
ATOM 10003 H HG   . LEU A 1 40  ? -0.801  0.434   -7.984  1.00 0.82  ? 40  LEU A HG   5  
ATOM 10004 H HD11 . LEU A 1 40  ? -1.418  -1.041  -10.530 1.00 1.21  ? 40  LEU A HD11 5  
ATOM 10005 H HD12 . LEU A 1 40  ? -1.468  -1.709  -8.898  1.00 1.27  ? 40  LEU A HD12 5  
ATOM 10006 H HD13 . LEU A 1 40  ? 0.068   -1.183  -9.590  1.00 1.08  ? 40  LEU A HD13 5  
ATOM 10007 H HD21 . LEU A 1 40  ? -0.948  1.496   -10.799 1.00 1.43  ? 40  LEU A HD21 5  
ATOM 10008 H HD22 . LEU A 1 40  ? 0.547   1.147   -9.933  1.00 1.27  ? 40  LEU A HD22 5  
ATOM 10009 H HD23 . LEU A 1 40  ? -0.541  2.404   -9.344  1.00 1.06  ? 40  LEU A HD23 5  
ATOM 10010 N N    . GLY A 1 41  ? -5.213  2.651   -7.467  1.00 0.43  ? 41  GLY A N    5  
ATOM 10011 C CA   . GLY A 1 41  ? -6.642  2.884   -7.494  1.00 0.51  ? 41  GLY A CA   5  
ATOM 10012 C C    . GLY A 1 41  ? -7.392  1.699   -8.063  1.00 0.45  ? 41  GLY A C    5  
ATOM 10013 O O    . GLY A 1 41  ? -8.467  1.850   -8.644  1.00 0.52  ? 41  GLY A O    5  
ATOM 10014 H H    . GLY A 1 41  ? -4.736  2.661   -6.609  1.00 0.38  ? 41  GLY A H    5  
ATOM 10015 H HA2  . GLY A 1 41  ? -6.986  3.066   -6.487  1.00 0.54  ? 41  GLY A HA2  5  
ATOM 10016 H HA3  . GLY A 1 41  ? -6.843  3.754   -8.094  1.00 0.65  ? 41  GLY A HA3  5  
ATOM 10017 N N    . ASN A 1 42  ? -6.813  0.514   -7.906  1.00 0.39  ? 42  ASN A N    5  
ATOM 10018 C CA   . ASN A 1 42  ? -7.394  -0.688  -8.489  1.00 0.42  ? 42  ASN A CA   5  
ATOM 10019 C C    . ASN A 1 42  ? -7.941  -1.665  -7.433  1.00 0.43  ? 42  ASN A C    5  
ATOM 10020 O O    . ASN A 1 42  ? -8.810  -2.482  -7.742  1.00 0.56  ? 42  ASN A O    5  
ATOM 10021 C CB   . ASN A 1 42  ? -6.404  -1.372  -9.446  1.00 0.49  ? 42  ASN A CB   5  
ATOM 10022 C CG   . ASN A 1 42  ? -5.203  -2.052  -8.801  1.00 0.55  ? 42  ASN A CG   5  
ATOM 10023 O OD1  . ASN A 1 42  ? -4.697  -3.038  -9.337  1.00 0.95  ? 42  ASN A OD1  5  
ATOM 10024 N ND2  . ASN A 1 42  ? -4.720  -1.550  -7.671  1.00 0.44  ? 42  ASN A ND2  5  
ATOM 10025 H H    . ASN A 1 42  ? -5.962  0.460   -7.407  1.00 0.39  ? 42  ASN A H    5  
ATOM 10026 H HA   . ASN A 1 42  ? -8.238  -0.358  -9.078  1.00 0.49  ? 42  ASN A HA   5  
ATOM 10027 H HB2  . ASN A 1 42  ? -6.938  -2.118  -9.995  1.00 0.69  ? 42  ASN A HB2  5  
ATOM 10028 H HB3  . ASN A 1 42  ? -6.035  -0.631  -10.142 1.00 0.57  ? 42  ASN A HB3  5  
ATOM 10029 H HD21 . ASN A 1 42  ? -5.151  -0.759  -7.283  1.00 0.54  ? 42  ASN A HD21 5  
ATOM 10030 H HD22 . ASN A 1 42  ? -3.936  -1.984  -7.275  1.00 0.56  ? 42  ASN A HD22 5  
ATOM 10031 N N    . GLY A 1 43  ? -7.447  -1.595  -6.202  1.00 0.40  ? 43  GLY A N    5  
ATOM 10032 C CA   . GLY A 1 43  ? -8.101  -2.312  -5.113  1.00 0.50  ? 43  GLY A CA   5  
ATOM 10033 C C    . GLY A 1 43  ? -7.322  -3.509  -4.593  1.00 0.45  ? 43  GLY A C    5  
ATOM 10034 O O    . GLY A 1 43  ? -7.916  -4.484  -4.131  1.00 0.72  ? 43  GLY A O    5  
ATOM 10035 H H    . GLY A 1 43  ? -6.630  -1.065  -6.025  1.00 0.39  ? 43  GLY A H    5  
ATOM 10036 H HA2  . GLY A 1 43  ? -8.253  -1.623  -4.293  1.00 0.60  ? 43  GLY A HA2  5  
ATOM 10037 H HA3  . GLY A 1 43  ? -9.066  -2.651  -5.457  1.00 0.58  ? 43  GLY A HA3  5  
ATOM 10038 N N    . LEU A 1 44  ? -6.002  -3.442  -4.661  1.00 0.29  ? 44  LEU A N    5  
ATOM 10039 C CA   . LEU A 1 44  ? -5.154  -4.495  -4.100  1.00 0.36  ? 44  LEU A CA   5  
ATOM 10040 C C    . LEU A 1 44  ? -3.802  -3.931  -3.672  1.00 0.25  ? 44  LEU A C    5  
ATOM 10041 O O    . LEU A 1 44  ? -3.000  -4.622  -3.056  1.00 0.27  ? 44  LEU A O    5  
ATOM 10042 C CB   . LEU A 1 44  ? -4.965  -5.703  -5.061  1.00 0.60  ? 44  LEU A CB   5  
ATOM 10043 C CG   . LEU A 1 44  ? -4.704  -5.427  -6.554  1.00 0.51  ? 44  LEU A CG   5  
ATOM 10044 C CD1  . LEU A 1 44  ? -5.980  -5.013  -7.262  1.00 1.46  ? 44  LEU A CD1  5  
ATOM 10045 C CD2  . LEU A 1 44  ? -3.627  -4.377  -6.746  1.00 1.56  ? 44  LEU A CD2  5  
ATOM 10046 H H    . LEU A 1 44  ? -5.588  -2.657  -5.077  1.00 0.39  ? 44  LEU A H    5  
ATOM 10047 H HA   . LEU A 1 44  ? -5.658  -4.849  -3.211  1.00 0.47  ? 44  LEU A HA   5  
ATOM 10048 H HB2  . LEU A 1 44  ? -4.135  -6.285  -4.695  1.00 1.23  ? 44  LEU A HB2  5  
ATOM 10049 H HB3  . LEU A 1 44  ? -5.850  -6.313  -4.996  1.00 1.12  ? 44  LEU A HB3  5  
ATOM 10050 H HG   . LEU A 1 44  ? -4.359  -6.342  -7.017  1.00 0.99  ? 44  LEU A HG   5  
ATOM 10051 H HD11 . LEU A 1 44  ? -5.772  -4.858  -8.311  1.00 1.90  ? 44  LEU A HD11 5  
ATOM 10052 H HD12 . LEU A 1 44  ? -6.350  -4.096  -6.827  1.00 2.02  ? 44  LEU A HD12 5  
ATOM 10053 H HD13 . LEU A 1 44  ? -6.722  -5.791  -7.154  1.00 2.09  ? 44  LEU A HD13 5  
ATOM 10054 H HD21 . LEU A 1 44  ? -2.696  -4.737  -6.337  1.00 2.16  ? 44  LEU A HD21 5  
ATOM 10055 H HD22 . LEU A 1 44  ? -3.916  -3.470  -6.234  1.00 1.97  ? 44  LEU A HD22 5  
ATOM 10056 H HD23 . LEU A 1 44  ? -3.507  -4.172  -7.800  1.00 2.15  ? 44  LEU A HD23 5  
ATOM 10057 N N    . LEU A 1 45  ? -3.552  -2.684  -4.041  1.00 0.23  ? 45  LEU A N    5  
ATOM 10058 C CA   . LEU A 1 45  ? -2.333  -1.987  -3.661  1.00 0.22  ? 45  LEU A CA   5  
ATOM 10059 C C    . LEU A 1 45  ? -2.675  -0.749  -2.844  1.00 0.22  ? 45  LEU A C    5  
ATOM 10060 O O    . LEU A 1 45  ? -3.005  0.277   -3.410  1.00 0.32  ? 45  LEU A O    5  
ATOM 10061 C CB   . LEU A 1 45  ? -1.581  -1.553  -4.923  1.00 0.30  ? 45  LEU A CB   5  
ATOM 10062 C CG   . LEU A 1 45  ? -0.170  -1.026  -4.692  1.00 0.26  ? 45  LEU A CG   5  
ATOM 10063 C CD1  . LEU A 1 45  ? 0.488   -1.761  -3.534  1.00 0.28  ? 45  LEU A CD1  5  
ATOM 10064 C CD2  . LEU A 1 45  ? 0.649   -1.190  -5.958  1.00 0.31  ? 45  LEU A CD2  5  
ATOM 10065 H H    . LEU A 1 45  ? -4.209  -2.218  -4.584  1.00 0.26  ? 45  LEU A H    5  
ATOM 10066 H HA   . LEU A 1 45  ? -1.714  -2.654  -3.079  1.00 0.22  ? 45  LEU A HA   5  
ATOM 10067 H HB2  . LEU A 1 45  ? -1.536  -2.374  -5.615  1.00 0.43  ? 45  LEU A HB2  5  
ATOM 10068 H HB3  . LEU A 1 45  ? -2.151  -0.765  -5.384  1.00 0.42  ? 45  LEU A HB3  5  
ATOM 10069 H HG   . LEU A 1 45  ? -0.216  0.024   -4.451  1.00 0.29  ? 45  LEU A HG   5  
ATOM 10070 H HD11 . LEU A 1 45  ? 1.446   -1.310  -3.318  1.00 1.00  ? 45  LEU A HD11 5  
ATOM 10071 H HD12 . LEU A 1 45  ? 0.631   -2.797  -3.801  1.00 1.01  ? 45  LEU A HD12 5  
ATOM 10072 H HD13 . LEU A 1 45  ? -0.148  -1.698  -2.659  1.00 1.12  ? 45  LEU A HD13 5  
ATOM 10073 H HD21 . LEU A 1 45  ? 1.636   -0.776  -5.805  1.00 0.96  ? 45  LEU A HD21 5  
ATOM 10074 H HD22 . LEU A 1 45  ? 0.159   -0.675  -6.772  1.00 1.12  ? 45  LEU A HD22 5  
ATOM 10075 H HD23 . LEU A 1 45  ? 0.733   -2.241  -6.196  1.00 1.10  ? 45  LEU A HD23 5  
ATOM 10076 N N    . ARG A 1 46  ? -2.576  -0.815  -1.526  1.00 0.20  ? 46  ARG A N    5  
ATOM 10077 C CA   . ARG A 1 46  ? -3.073  0.286   -0.698  1.00 0.22  ? 46  ARG A CA   5  
ATOM 10078 C C    . ARG A 1 46  ? -2.136  0.597   0.464   1.00 0.19  ? 46  ARG A C    5  
ATOM 10079 O O    . ARG A 1 46  ? -1.665  -0.310  1.140   1.00 0.19  ? 46  ARG A O    5  
ATOM 10080 C CB   . ARG A 1 46  ? -4.462  -0.065  -0.170  1.00 0.25  ? 46  ARG A CB   5  
ATOM 10081 C CG   . ARG A 1 46  ? -5.393  -0.563  -1.261  1.00 0.36  ? 46  ARG A CG   5  
ATOM 10082 C CD   . ARG A 1 46  ? -6.786  -0.839  -0.743  1.00 0.37  ? 46  ARG A CD   5  
ATOM 10083 N NE   . ARG A 1 46  ? -6.775  -1.753  0.402   1.00 0.54  ? 46  ARG A NE   5  
ATOM 10084 C CZ   . ARG A 1 46  ? -7.874  -2.077  1.088   1.00 0.75  ? 46  ARG A CZ   5  
ATOM 10085 N NH1  . ARG A 1 46  ? -9.051  -1.648  0.666   1.00 1.14  ? 46  ARG A NH1  5  
ATOM 10086 N NH2  . ARG A 1 46  ? -7.808  -2.840  2.171   1.00 0.99  ? 46  ARG A NH2  5  
ATOM 10087 H H    . ARG A 1 46  ? -2.174  -1.607  -1.104  1.00 0.20  ? 46  ARG A H    5  
ATOM 10088 H HA   . ARG A 1 46  ? -3.154  1.164   -1.325  1.00 0.25  ? 46  ARG A HA   5  
ATOM 10089 H HB2  . ARG A 1 46  ? -4.369  -0.836  0.580   1.00 0.30  ? 46  ARG A HB2  5  
ATOM 10090 H HB3  . ARG A 1 46  ? -4.898  0.815   0.275   1.00 0.35  ? 46  ARG A HB3  5  
ATOM 10091 H HG2  . ARG A 1 46  ? -5.443  0.185   -2.039  1.00 0.50  ? 46  ARG A HG2  5  
ATOM 10092 H HG3  . ARG A 1 46  ? -4.987  -1.475  -1.669  1.00 0.49  ? 46  ARG A HG3  5  
ATOM 10093 H HD2  . ARG A 1 46  ? -7.238  0.094   -0.443  1.00 0.47  ? 46  ARG A HD2  5  
ATOM 10094 H HD3  . ARG A 1 46  ? -7.371  -1.280  -1.536  1.00 0.51  ? 46  ARG A HD3  5  
ATOM 10095 H HE   . ARG A 1 46  ? -5.903  -2.119  0.679   1.00 0.87  ? 46  ARG A HE   5  
ATOM 10096 H HH11 . ARG A 1 46  ? -9.118  -1.093  -0.169  1.00 1.24  ? 46  ARG A HH11 5  
ATOM 10097 H HH12 . ARG A 1 46  ? -9.896  -1.872  1.181   1.00 1.49  ? 46  ARG A HH12 5  
ATOM 10098 H HH21 . ARG A 1 46  ? -6.921  -3.194  2.497   1.00 1.18  ? 46  ARG A HH21 5  
ATOM 10099 H HH22 . ARG A 1 46  ? -8.646  -3.072  2.672   1.00 1.21  ? 46  ARG A HH22 5  
ATOM 10100 N N    . LYS A 1 47  ? -1.903  1.886   0.703   1.00 0.20  ? 47  LYS A N    5  
ATOM 10101 C CA   . LYS A 1 47  ? -0.989  2.336   1.747   1.00 0.17  ? 47  LYS A CA   5  
ATOM 10102 C C    . LYS A 1 47  ? -1.764  3.045   2.866   1.00 0.18  ? 47  LYS A C    5  
ATOM 10103 O O    . LYS A 1 47  ? -2.501  3.996   2.602   1.00 0.22  ? 47  LYS A O    5  
ATOM 10104 C CB   . LYS A 1 47  ? 0.033   3.309   1.141   1.00 0.23  ? 47  LYS A CB   5  
ATOM 10105 C CG   . LYS A 1 47  ? 1.309   3.450   1.953   1.00 0.25  ? 47  LYS A CG   5  
ATOM 10106 C CD   . LYS A 1 47  ? 2.024   4.765   1.683   1.00 0.32  ? 47  LYS A CD   5  
ATOM 10107 C CE   . LYS A 1 47  ? 1.361   5.914   2.442   1.00 0.20  ? 47  LYS A CE   5  
ATOM 10108 N NZ   . LYS A 1 47  ? 2.321   6.987   2.839   1.00 0.35  ? 47  LYS A NZ   5  
ATOM 10109 H H    . LYS A 1 47  ? -2.365  2.558   0.160   1.00 0.22  ? 47  LYS A H    5  
ATOM 10110 H HA   . LYS A 1 47  ? -0.473  1.476   2.152   1.00 0.15  ? 47  LYS A HA   5  
ATOM 10111 H HB2  . LYS A 1 47  ? 0.300   2.966   0.152   1.00 0.31  ? 47  LYS A HB2  5  
ATOM 10112 H HB3  . LYS A 1 47  ? -0.425  4.282   1.058   1.00 0.27  ? 47  LYS A HB3  5  
ATOM 10113 H HG2  . LYS A 1 47  ? 1.061   3.401   3.001   1.00 0.25  ? 47  LYS A HG2  5  
ATOM 10114 H HG3  . LYS A 1 47  ? 1.974   2.636   1.699   1.00 0.31  ? 47  LYS A HG3  5  
ATOM 10115 H HD2  . LYS A 1 47  ? 3.050   4.668   1.988   1.00 0.45  ? 47  LYS A HD2  5  
ATOM 10116 H HD3  . LYS A 1 47  ? 1.982   4.976   0.625   1.00 0.45  ? 47  LYS A HD3  5  
ATOM 10117 H HE2  . LYS A 1 47  ? 0.597   6.349   1.811   1.00 0.39  ? 47  LYS A HE2  5  
ATOM 10118 H HE3  . LYS A 1 47  ? 0.899   5.512   3.331   1.00 0.35  ? 47  LYS A HE3  5  
ATOM 10119 H HZ1  . LYS A 1 47  ? 2.966   6.643   3.591   1.00 1.00  ? 47  LYS A HZ1  5  
ATOM 10120 H HZ2  . LYS A 1 47  ? 1.805   7.811   3.205   1.00 1.12  ? 47  LYS A HZ2  5  
ATOM 10121 H HZ3  . LYS A 1 47  ? 2.889   7.287   2.019   1.00 1.03  ? 47  LYS A HZ3  5  
ATOM 10122 N N    . LYS A 1 48  ? -1.607  2.580   4.105   1.00 0.16  ? 48  LYS A N    5  
ATOM 10123 C CA   . LYS A 1 48  ? -2.246  3.221   5.253   1.00 0.18  ? 48  LYS A CA   5  
ATOM 10124 C C    . LYS A 1 48  ? -1.200  3.848   6.165   1.00 0.17  ? 48  LYS A C    5  
ATOM 10125 O O    . LYS A 1 48  ? -0.352  3.153   6.725   1.00 0.22  ? 48  LYS A O    5  
ATOM 10126 C CB   . LYS A 1 48  ? -3.097  2.217   6.044   1.00 0.25  ? 48  LYS A CB   5  
ATOM 10127 C CG   . LYS A 1 48  ? -3.776  2.827   7.264   1.00 0.32  ? 48  LYS A CG   5  
ATOM 10128 C CD   . LYS A 1 48  ? -4.879  1.926   7.821   1.00 0.69  ? 48  LYS A CD   5  
ATOM 10129 C CE   . LYS A 1 48  ? -4.340  0.674   8.505   1.00 0.52  ? 48  LYS A CE   5  
ATOM 10130 N NZ   . LYS A 1 48  ? -3.659  0.985   9.791   1.00 1.07  ? 48  LYS A NZ   5  
ATOM 10131 H H    . LYS A 1 48  ? -1.050  1.783   4.254   1.00 0.15  ? 48  LYS A H    5  
ATOM 10132 H HA   . LYS A 1 48  ? -2.887  4.003   4.876   1.00 0.21  ? 48  LYS A HA   5  
ATOM 10133 H HB2  . LYS A 1 48  ? -3.864  1.820   5.393   1.00 0.30  ? 48  LYS A HB2  5  
ATOM 10134 H HB3  . LYS A 1 48  ? -2.467  1.406   6.377   1.00 0.28  ? 48  LYS A HB3  5  
ATOM 10135 H HG2  . LYS A 1 48  ? -3.032  2.982   8.032   1.00 0.51  ? 48  LYS A HG2  5  
ATOM 10136 H HG3  . LYS A 1 48  ? -4.205  3.778   6.980   1.00 0.53  ? 48  LYS A HG3  5  
ATOM 10137 H HD2  . LYS A 1 48  ? -5.453  2.490   8.538   1.00 1.29  ? 48  LYS A HD2  5  
ATOM 10138 H HD3  . LYS A 1 48  ? -5.525  1.628   7.006   1.00 1.29  ? 48  LYS A HD3  5  
ATOM 10139 H HE2  . LYS A 1 48  ? -5.166  0.009   8.701   1.00 1.14  ? 48  LYS A HE2  5  
ATOM 10140 H HE3  . LYS A 1 48  ? -3.640  0.187   7.842   1.00 0.96  ? 48  LYS A HE3  5  
ATOM 10141 H HZ1  . LYS A 1 48  ? -3.381  0.106   10.277  1.00 1.56  ? 48  LYS A HZ1  5  
ATOM 10142 H HZ2  . LYS A 1 48  ? -4.302  1.520   10.416  1.00 1.60  ? 48  LYS A HZ2  5  
ATOM 10143 H HZ3  . LYS A 1 48  ? -2.810  1.556   9.620   1.00 1.65  ? 48  LYS A HZ3  5  
ATOM 10144 N N    . THR A 1 49  ? -1.262  5.161   6.311   1.00 0.18  ? 49  THR A N    5  
ATOM 10145 C CA   . THR A 1 49  ? -0.333  5.878   7.167   1.00 0.20  ? 49  THR A CA   5  
ATOM 10146 C C    . THR A 1 49  ? -0.648  5.649   8.638   1.00 0.21  ? 49  THR A C    5  
ATOM 10147 O O    . THR A 1 49  ? -1.641  6.162   9.156   1.00 0.29  ? 49  THR A O    5  
ATOM 10148 C CB   . THR A 1 49  ? -0.357  7.393   6.879   1.00 0.25  ? 49  THR A CB   5  
ATOM 10149 O OG1  . THR A 1 49  ? -1.709  7.874   6.885   1.00 0.33  ? 49  THR A OG1  5  
ATOM 10150 C CG2  . THR A 1 49  ? 0.291   7.705   5.541   1.00 0.25  ? 49  THR A CG2  5  
ATOM 10151 H H    . THR A 1 49  ? -1.954  5.668   5.825   1.00 0.21  ? 49  THR A H    5  
ATOM 10152 H HA   . THR A 1 49  ? 0.661   5.512   6.961   1.00 0.19  ? 49  THR A HA   5  
ATOM 10153 H HB   . THR A 1 49  ? 0.200   7.899   7.658   1.00 0.28  ? 49  THR A HB   5  
ATOM 10154 H HG1  . THR A 1 49  ? -2.127  7.639   7.727   1.00 0.68  ? 49  THR A HG1  5  
ATOM 10155 H HG21 . THR A 1 49  ? -0.212  7.152   4.761   1.00 1.03  ? 49  THR A HG21 5  
ATOM 10156 H HG22 . THR A 1 49  ? 1.332   7.421   5.573   1.00 1.01  ? 49  THR A HG22 5  
ATOM 10157 H HG23 . THR A 1 49  ? 0.212   8.762   5.343   1.00 1.03  ? 49  THR A HG23 5  
ATOM 10158 N N    . LEU A 1 50  ? 0.182   4.853   9.297   1.00 0.18  ? 50  LEU A N    5  
ATOM 10159 C CA   . LEU A 1 50  ? 0.111   4.719   10.743  1.00 0.21  ? 50  LEU A CA   5  
ATOM 10160 C C    . LEU A 1 50  ? 0.559   6.043   11.328  1.00 0.23  ? 50  LEU A C    5  
ATOM 10161 O O    . LEU A 1 50  ? -0.113  6.663   12.149  1.00 0.28  ? 50  LEU A O    5  
ATOM 10162 C CB   . LEU A 1 50  ? 1.044   3.607   11.225  1.00 0.21  ? 50  LEU A CB   5  
ATOM 10163 C CG   . LEU A 1 50  ? 1.034   2.333   10.380  1.00 0.20  ? 50  LEU A CG   5  
ATOM 10164 C CD1  . LEU A 1 50  ? 2.203   1.446   10.763  1.00 0.21  ? 50  LEU A CD1  5  
ATOM 10165 C CD2  . LEU A 1 50  ? -0.278  1.594   10.548  1.00 0.24  ? 50  LEU A CD2  5  
ATOM 10166 H H    . LEU A 1 50  ? 0.868   4.354   8.799   1.00 0.15  ? 50  LEU A H    5  
ATOM 10167 H HA   . LEU A 1 50  ? -0.908  4.508   11.029  1.00 0.23  ? 50  LEU A HA   5  
ATOM 10168 H HB2  . LEU A 1 50  ? 2.050   3.995   11.240  1.00 0.21  ? 50  LEU A HB2  5  
ATOM 10169 H HB3  . LEU A 1 50  ? 0.762   3.343   12.234  1.00 0.25  ? 50  LEU A HB3  5  
ATOM 10170 H HG   . LEU A 1 50  ? 1.140   2.594   9.336   1.00 0.17  ? 50  LEU A HG   5  
ATOM 10171 H HD11 . LEU A 1 50  ? 2.137   1.191   11.811  1.00 1.02  ? 50  LEU A HD11 5  
ATOM 10172 H HD12 . LEU A 1 50  ? 3.130   1.976   10.577  1.00 1.05  ? 50  LEU A HD12 5  
ATOM 10173 H HD13 . LEU A 1 50  ? 2.179   0.545   10.169  1.00 1.04  ? 50  LEU A HD13 5  
ATOM 10174 H HD21 . LEU A 1 50  ? -0.380  1.273   11.573  1.00 1.01  ? 50  LEU A HD21 5  
ATOM 10175 H HD22 . LEU A 1 50  ? -0.295  0.736   9.894   1.00 1.02  ? 50  LEU A HD22 5  
ATOM 10176 H HD23 . LEU A 1 50  ? -1.092  2.257   10.297  1.00 1.06  ? 50  LEU A HD23 5  
ATOM 10177 N N    . VAL A 1 51  ? 1.721   6.451   10.857  1.00 0.23  ? 51  VAL A N    5  
ATOM 10178 C CA   . VAL A 1 51  ? 2.250   7.780   11.062  1.00 0.27  ? 51  VAL A CA   5  
ATOM 10179 C C    . VAL A 1 51  ? 2.696   8.265   9.707   1.00 0.24  ? 51  VAL A C    5  
ATOM 10180 O O    . VAL A 1 51  ? 3.261   7.478   8.963   1.00 0.23  ? 51  VAL A O    5  
ATOM 10181 C CB   . VAL A 1 51  ? 3.462   7.765   12.009  1.00 0.30  ? 51  VAL A CB   5  
ATOM 10182 C CG1  . VAL A 1 51  ? 4.046   9.158   12.186  1.00 0.36  ? 51  VAL A CG1  5  
ATOM 10183 C CG2  . VAL A 1 51  ? 3.086   7.164   13.350  1.00 0.36  ? 51  VAL A CG2  5  
ATOM 10184 H H    . VAL A 1 51  ? 2.256   5.817   10.324  1.00 0.21  ? 51  VAL A H    5  
ATOM 10185 H HA   . VAL A 1 51  ? 1.477   8.419   11.458  1.00 0.33  ? 51  VAL A HA   5  
ATOM 10186 H HB   . VAL A 1 51  ? 4.215   7.144   11.555  1.00 0.26  ? 51  VAL A HB   5  
ATOM 10187 H HG11 . VAL A 1 51  ? 4.397   9.522   11.233  1.00 1.03  ? 51  VAL A HG11 5  
ATOM 10188 H HG12 . VAL A 1 51  ? 4.870   9.116   12.882  1.00 1.08  ? 51  VAL A HG12 5  
ATOM 10189 H HG13 . VAL A 1 51  ? 3.286   9.824   12.569  1.00 1.14  ? 51  VAL A HG13 5  
ATOM 10190 H HG21 . VAL A 1 51  ? 2.323   7.773   13.813  1.00 0.96  ? 51  VAL A HG21 5  
ATOM 10191 H HG22 . VAL A 1 51  ? 3.956   7.126   13.986  1.00 1.11  ? 51  VAL A HG22 5  
ATOM 10192 H HG23 . VAL A 1 51  ? 2.704   6.168   13.197  1.00 1.06  ? 51  VAL A HG23 5  
ATOM 10193 N N    . PRO A 1 52  ? 2.394   9.504   9.325   1.00 0.29  ? 52  PRO A N    5  
ATOM 10194 C CA   . PRO A 1 52  ? 2.789   10.052  8.042   1.00 0.32  ? 52  PRO A CA   5  
ATOM 10195 C C    . PRO A 1 52  ? 3.886   11.116  8.135   1.00 0.34  ? 52  PRO A C    5  
ATOM 10196 O O    . PRO A 1 52  ? 3.735   12.227  7.626   1.00 0.54  ? 52  PRO A O    5  
ATOM 10197 C CB   . PRO A 1 52  ? 1.464   10.649  7.616   1.00 0.41  ? 52  PRO A CB   5  
ATOM 10198 C CG   . PRO A 1 52  ? 0.852   11.173  8.893   1.00 0.46  ? 52  PRO A CG   5  
ATOM 10199 C CD   . PRO A 1 52  ? 1.545   10.458  10.034  1.00 0.37  ? 52  PRO A CD   5  
ATOM 10200 H HA   . PRO A 1 52  ? 3.083   9.281   7.344   1.00 0.32  ? 52  PRO A HA   5  
ATOM 10201 H HB2  . PRO A 1 52  ? 1.627   11.433  6.892   1.00 0.45  ? 52  PRO A HB2  5  
ATOM 10202 H HB3  . PRO A 1 52  ? 0.868   9.861   7.191   1.00 0.45  ? 52  PRO A HB3  5  
ATOM 10203 H HG2  . PRO A 1 52  ? 1.019   12.234  8.967   1.00 0.51  ? 52  PRO A HG2  5  
ATOM 10204 H HG3  . PRO A 1 52  ? -0.206  10.957  8.906   1.00 0.56  ? 52  PRO A HG3  5  
ATOM 10205 H HD2  . PRO A 1 52  ? 2.138   11.150  10.615  1.00 0.39  ? 52  PRO A HD2  5  
ATOM 10206 H HD3  . PRO A 1 52  ? 0.825   9.949   10.659  1.00 0.41  ? 52  PRO A HD3  5  
ATOM 10207 N N    . GLY A 1 53  ? 4.992   10.754  8.779   1.00 0.24  ? 53  GLY A N    5  
ATOM 10208 C CA   . GLY A 1 53  ? 6.145   11.623  8.844   1.00 0.28  ? 53  GLY A CA   5  
ATOM 10209 C C    . GLY A 1 53  ? 6.012   12.717  9.878   1.00 0.29  ? 53  GLY A C    5  
ATOM 10210 O O    . GLY A 1 53  ? 4.905   13.050  10.304  1.00 0.55  ? 53  GLY A O    5  
ATOM 10211 H H    . GLY A 1 53  ? 5.032   9.872   9.201   1.00 0.26  ? 53  GLY A H    5  
ATOM 10212 H HA2  . GLY A 1 53  ? 7.014   11.026  9.082   1.00 0.34  ? 53  GLY A HA2  5  
ATOM 10213 H HA3  . GLY A 1 53  ? 6.292   12.077  7.876   1.00 0.35  ? 53  GLY A HA3  5  
ATOM 10214 N N    . PRO A 1 54  ? 7.141   13.271  10.334  1.00 0.52  ? 54  PRO A N    5  
ATOM 10215 C CA   . PRO A 1 54  ? 7.146   14.461  11.174  1.00 0.67  ? 54  PRO A CA   5  
ATOM 10216 C C    . PRO A 1 54  ? 6.653   15.663  10.376  1.00 0.78  ? 54  PRO A C    5  
ATOM 10217 O O    . PRO A 1 54  ? 6.628   15.621  9.146   1.00 1.20  ? 54  PRO A O    5  
ATOM 10218 C CB   . PRO A 1 54  ? 8.623   14.636  11.564  1.00 1.03  ? 54  PRO A CB   5  
ATOM 10219 C CG   . PRO A 1 54  ? 9.275   13.337  11.223  1.00 1.42  ? 54  PRO A CG   5  
ATOM 10220 C CD   . PRO A 1 54  ? 8.496   12.776  10.072  1.00 0.91  ? 54  PRO A CD   5  
ATOM 10221 H HA   . PRO A 1 54  ? 6.542   14.334  12.062  1.00 0.63  ? 54  PRO A HA   5  
ATOM 10222 H HB2  . PRO A 1 54  ? 9.050   15.451  10.998  1.00 1.19  ? 54  PRO A HB2  5  
ATOM 10223 H HB3  . PRO A 1 54  ? 8.698   14.847  12.620  1.00 1.08  ? 54  PRO A HB3  5  
ATOM 10224 H HG2  . PRO A 1 54  ? 10.302  13.505  10.935  1.00 1.91  ? 54  PRO A HG2  5  
ATOM 10225 H HG3  . PRO A 1 54  ? 9.227   12.668  12.070  1.00 1.81  ? 54  PRO A HG3  5  
ATOM 10226 H HD2  . PRO A 1 54  ? 8.875   13.157  9.135   1.00 1.01  ? 54  PRO A HD2  5  
ATOM 10227 H HD3  . PRO A 1 54  ? 8.525   11.697  10.085  1.00 0.97  ? 54  PRO A HD3  5  
ATOM 10228 N N    . PRO A 1 55  ? 6.263   16.755  11.049  1.00 0.97  ? 55  PRO A N    5  
ATOM 10229 C CA   . PRO A 1 55  ? 5.781   17.968  10.376  1.00 1.24  ? 55  PRO A CA   5  
ATOM 10230 C C    . PRO A 1 55  ? 6.804   18.557  9.402   1.00 0.93  ? 55  PRO A C    5  
ATOM 10231 O O    . PRO A 1 55  ? 6.481   19.443  8.610   1.00 1.20  ? 55  PRO A O    5  
ATOM 10232 C CB   . PRO A 1 55  ? 5.515   18.936  11.531  1.00 1.81  ? 55  PRO A CB   5  
ATOM 10233 C CG   . PRO A 1 55  ? 5.324   18.061  12.722  1.00 2.04  ? 55  PRO A CG   5  
ATOM 10234 C CD   . PRO A 1 55  ? 6.235   16.889  12.515  1.00 1.47  ? 55  PRO A CD   5  
ATOM 10235 H HA   . PRO A 1 55  ? 4.858   17.780  9.844   1.00 1.48  ? 55  PRO A HA   5  
ATOM 10236 H HB2  . PRO A 1 55  ? 6.363   19.595  11.653  1.00 1.86  ? 55  PRO A HB2  5  
ATOM 10237 H HB3  . PRO A 1 55  ? 4.628   19.515  11.319  1.00 2.24  ? 55  PRO A HB3  5  
ATOM 10238 H HG2  . PRO A 1 55  ? 5.597   18.596  13.620  1.00 2.40  ? 55  PRO A HG2  5  
ATOM 10239 H HG3  . PRO A 1 55  ? 4.299   17.735  12.774  1.00 2.53  ? 55  PRO A HG3  5  
ATOM 10240 H HD2  . PRO A 1 55  ? 7.220   17.100  12.903  1.00 1.54  ? 55  PRO A HD2  5  
ATOM 10241 H HD3  . PRO A 1 55  ? 5.825   16.001  12.978  1.00 1.66  ? 55  PRO A HD3  5  
ATOM 10242 N N    . GLY A 1 56  ? 8.034   18.060  9.467   1.00 0.98  ? 56  GLY A N    5  
ATOM 10243 C CA   . GLY A 1 56  ? 9.061   18.479  8.538   1.00 0.82  ? 56  GLY A CA   5  
ATOM 10244 C C    . GLY A 1 56  ? 9.714   17.301  7.844   1.00 0.64  ? 56  GLY A C    5  
ATOM 10245 O O    . GLY A 1 56  ? 10.936  17.150  7.877   1.00 0.69  ? 56  GLY A O    5  
ATOM 10246 H H    . GLY A 1 56  ? 8.243   17.394  10.152  1.00 1.42  ? 56  GLY A H    5  
ATOM 10247 H HA2  . GLY A 1 56  ? 8.615   19.122  7.791   1.00 0.98  ? 56  GLY A HA2  5  
ATOM 10248 H HA3  . GLY A 1 56  ? 9.817   19.034  9.075   1.00 0.83  ? 56  GLY A HA3  5  
ATOM 10249 N N    . SER A 1 57  ? 8.898   16.451  7.234   1.00 0.52  ? 57  SER A N    5  
ATOM 10250 C CA   . SER A 1 57  ? 9.380   15.300  6.512   1.00 0.40  ? 57  SER A CA   5  
ATOM 10251 C C    . SER A 1 57  ? 9.764   15.660  5.083   1.00 0.34  ? 57  SER A C    5  
ATOM 10252 O O    . SER A 1 57  ? 9.776   16.831  4.694   1.00 0.43  ? 57  SER A O    5  
ATOM 10253 C CB   . SER A 1 57  ? 8.281   14.246  6.493   1.00 0.40  ? 57  SER A CB   5  
ATOM 10254 O OG   . SER A 1 57  ? 7.036   14.837  6.160   1.00 0.99  ? 57  SER A OG   5  
ATOM 10255 H H    . SER A 1 57  ? 7.930   16.588  7.279   1.00 0.56  ? 57  SER A H    5  
ATOM 10256 H HA   . SER A 1 57  ? 10.242  14.905  7.029   1.00 0.47  ? 57  SER A HA   5  
ATOM 10257 H HB2  . SER A 1 57  ? 8.523   13.505  5.753   1.00 0.55  ? 57  SER A HB2  5  
ATOM 10258 H HB3  . SER A 1 57  ? 8.203   13.782  7.463   1.00 0.66  ? 57  SER A HB3  5  
ATOM 10259 H HG   . SER A 1 57  ? 6.575   14.287  5.503   1.00 1.36  ? 57  SER A HG   5  
ATOM 10260 N N    . SER A 1 58  ? 10.063  14.632  4.311   1.00 0.28  ? 58  SER A N    5  
ATOM 10261 C CA   . SER A 1 58  ? 10.410  14.769  2.913   1.00 0.30  ? 58  SER A CA   5  
ATOM 10262 C C    . SER A 1 58  ? 10.179  13.427  2.240   1.00 0.27  ? 58  SER A C    5  
ATOM 10263 O O    . SER A 1 58  ? 10.602  12.398  2.758   1.00 0.38  ? 58  SER A O    5  
ATOM 10264 C CB   . SER A 1 58  ? 11.876  15.194  2.765   1.00 0.38  ? 58  SER A CB   5  
ATOM 10265 O OG   . SER A 1 58  ? 12.197  15.490  1.416   1.00 1.28  ? 58  SER A OG   5  
ATOM 10266 H H    . SER A 1 58  ? 10.037  13.735  4.696   1.00 0.31  ? 58  SER A H    5  
ATOM 10267 H HA   . SER A 1 58  ? 9.767   15.515  2.468   1.00 0.36  ? 58  SER A HA   5  
ATOM 10268 H HB2  . SER A 1 58  ? 12.058  16.073  3.364   1.00 0.97  ? 58  SER A HB2  5  
ATOM 10269 H HB3  . SER A 1 58  ? 12.513  14.389  3.103   1.00 0.87  ? 58  SER A HB3  5  
ATOM 10270 H HG   . SER A 1 58  ? 11.763  16.321  1.159   1.00 1.82  ? 58  SER A HG   5  
ATOM 10271 N N    . ARG A 1 59  ? 9.480   13.424  1.121   1.00 0.32  ? 59  ARG A N    5  
ATOM 10272 C CA   . ARG A 1 59  ? 9.211   12.183  0.411   1.00 0.30  ? 59  ARG A CA   5  
ATOM 10273 C C    . ARG A 1 59  ? 10.310  11.907  -0.606  1.00 0.27  ? 59  ARG A C    5  
ATOM 10274 O O    . ARG A 1 59  ? 10.478  12.661  -1.570  1.00 0.34  ? 59  ARG A O    5  
ATOM 10275 C CB   . ARG A 1 59  ? 7.850   12.245  -0.277  1.00 0.42  ? 59  ARG A CB   5  
ATOM 10276 C CG   . ARG A 1 59  ? 6.726   12.626  0.668   1.00 0.64  ? 59  ARG A CG   5  
ATOM 10277 C CD   . ARG A 1 59  ? 5.377   12.654  -0.033  1.00 0.68  ? 59  ARG A CD   5  
ATOM 10278 N NE   . ARG A 1 59  ? 4.291   12.986  0.897   1.00 1.41  ? 59  ARG A NE   5  
ATOM 10279 C CZ   . ARG A 1 59  ? 3.135   13.552  0.542   1.00 1.81  ? 59  ARG A CZ   5  
ATOM 10280 N NH1  . ARG A 1 59  ? 2.883   13.797  -0.738  1.00 1.78  ? 59  ARG A NH1  5  
ATOM 10281 N NH2  . ARG A 1 59  ? 2.219   13.846  1.468   1.00 2.81  ? 59  ARG A NH2  5  
ATOM 10282 H H    . ARG A 1 59  ? 9.131   14.266  0.767   1.00 0.44  ? 59  ARG A H    5  
ATOM 10283 H HA   . ARG A 1 59  ? 9.201   11.386  1.138   1.00 0.30  ? 59  ARG A HA   5  
ATOM 10284 H HB2  . ARG A 1 59  ? 7.892   12.978  -1.074  1.00 0.93  ? 59  ARG A HB2  5  
ATOM 10285 H HB3  . ARG A 1 59  ? 7.627   11.272  -0.693  1.00 0.91  ? 59  ARG A HB3  5  
ATOM 10286 H HG2  . ARG A 1 59  ? 6.690   11.910  1.473   1.00 1.11  ? 59  ARG A HG2  5  
ATOM 10287 H HG3  . ARG A 1 59  ? 6.927   13.607  1.072   1.00 1.15  ? 59  ARG A HG3  5  
ATOM 10288 H HD2  . ARG A 1 59  ? 5.411   13.394  -0.819  1.00 1.27  ? 59  ARG A HD2  5  
ATOM 10289 H HD3  . ARG A 1 59  ? 5.186   11.681  -0.463  1.00 1.12  ? 59  ARG A HD3  5  
ATOM 10290 H HE   . ARG A 1 59  ? 4.446   12.780  1.863   1.00 2.07  ? 59  ARG A HE   5  
ATOM 10291 H HH11 . ARG A 1 59  ? 3.561   13.561  -1.436  1.00 1.77  ? 59  ARG A HH11 5  
ATOM 10292 H HH12 . ARG A 1 59  ? 2.019   14.232  -1.014  1.00 2.29  ? 59  ARG A HH12 5  
ATOM 10293 H HH21 . ARG A 1 59  ? 2.404   13.655  2.444   1.00 3.39  ? 59  ARG A HH21 5  
ATOM 10294 H HH22 . ARG A 1 59  ? 1.346   14.261  1.204   1.00 3.15  ? 59  ARG A HH22 5  
ATOM 10295 N N    . PRO A 1 60  ? 11.099  10.841  -0.370  1.00 0.23  ? 60  PRO A N    5  
ATOM 10296 C CA   . PRO A 1 60  ? 12.220  10.444  -1.236  1.00 0.26  ? 60  PRO A CA   5  
ATOM 10297 C C    . PRO A 1 60  ? 11.879  10.415  -2.727  1.00 0.26  ? 60  PRO A C    5  
ATOM 10298 O O    . PRO A 1 60  ? 10.732  10.196  -3.124  1.00 0.28  ? 60  PRO A O    5  
ATOM 10299 C CB   . PRO A 1 60  ? 12.568  9.027   -0.754  1.00 0.30  ? 60  PRO A CB   5  
ATOM 10300 C CG   . PRO A 1 60  ? 11.484  8.648   0.199   1.00 0.28  ? 60  PRO A CG   5  
ATOM 10301 C CD   . PRO A 1 60  ? 10.988  9.935   0.779   1.00 0.21  ? 60  PRO A CD   5  
ATOM 10302 H HA   . PRO A 1 60  ? 13.072  11.089  -1.083  1.00 0.32  ? 60  PRO A HA   5  
ATOM 10303 H HB2  . PRO A 1 60  ? 12.597  8.357   -1.602  1.00 0.41  ? 60  PRO A HB2  5  
ATOM 10304 H HB3  . PRO A 1 60  ? 13.533  9.038   -0.268  1.00 0.42  ? 60  PRO A HB3  5  
ATOM 10305 H HG2  . PRO A 1 60  ? 10.689  8.143   -0.331  1.00 0.43  ? 60  PRO A HG2  5  
ATOM 10306 H HG3  . PRO A 1 60  ? 11.882  8.013   0.977   1.00 0.41  ? 60  PRO A HG3  5  
ATOM 10307 H HD2  . PRO A 1 60  ? 9.966   9.837   1.122   1.00 0.24  ? 60  PRO A HD2  5  
ATOM 10308 H HD3  . PRO A 1 60  ? 11.628  10.257  1.586   1.00 0.24  ? 60  PRO A HD3  5  
ATOM 10309 N N    . VAL A 1 61  ? 12.902  10.619  -3.544  1.00 0.29  ? 61  VAL A N    5  
ATOM 10310 C CA   . VAL A 1 61  ? 12.749  10.632  -4.991  1.00 0.31  ? 61  VAL A CA   5  
ATOM 10311 C C    . VAL A 1 61  ? 13.246  9.317   -5.573  1.00 0.28  ? 61  VAL A C    5  
ATOM 10312 O O    . VAL A 1 61  ? 14.121  8.669   -4.995  1.00 0.27  ? 61  VAL A O    5  
ATOM 10313 C CB   . VAL A 1 61  ? 13.543  11.794  -5.630  1.00 0.40  ? 61  VAL A CB   5  
ATOM 10314 C CG1  . VAL A 1 61  ? 13.158  11.990  -7.088  1.00 0.81  ? 61  VAL A CG1  5  
ATOM 10315 C CG2  . VAL A 1 61  ? 13.344  13.078  -4.842  1.00 0.88  ? 61  VAL A CG2  5  
ATOM 10316 H H    . VAL A 1 61  ? 13.796  10.748  -3.162  1.00 0.32  ? 61  VAL A H    5  
ATOM 10317 H HA   . VAL A 1 61  ? 11.701  10.754  -5.224  1.00 0.33  ? 61  VAL A HA   5  
ATOM 10318 H HB   . VAL A 1 61  ? 14.589  11.537  -5.600  1.00 0.80  ? 61  VAL A HB   5  
ATOM 10319 H HG11 . VAL A 1 61  ? 13.370  11.088  -7.642  1.00 1.44  ? 61  VAL A HG11 5  
ATOM 10320 H HG12 . VAL A 1 61  ? 13.727  12.810  -7.505  1.00 1.46  ? 61  VAL A HG12 5  
ATOM 10321 H HG13 . VAL A 1 61  ? 12.104  12.213  -7.156  1.00 1.30  ? 61  VAL A HG13 5  
ATOM 10322 H HG21 . VAL A 1 61  ? 13.959  13.861  -5.262  1.00 1.45  ? 61  VAL A HG21 5  
ATOM 10323 H HG22 . VAL A 1 61  ? 13.623  12.913  -3.813  1.00 1.40  ? 61  VAL A HG22 5  
ATOM 10324 H HG23 . VAL A 1 61  ? 12.305  13.370  -4.891  1.00 1.47  ? 61  VAL A HG23 5  
ATOM 10325 N N    . LYS A 1 62  ? 12.685  8.918   -6.704  1.00 0.27  ? 62  LYS A N    5  
ATOM 10326 C CA   . LYS A 1 62  ? 13.121  7.707   -7.379  1.00 0.27  ? 62  LYS A CA   5  
ATOM 10327 C C    . LYS A 1 62  ? 14.552  7.840   -7.849  1.00 0.25  ? 62  LYS A C    5  
ATOM 10328 O O    . LYS A 1 62  ? 14.870  8.596   -8.768  1.00 0.31  ? 62  LYS A O    5  
ATOM 10329 C CB   . LYS A 1 62  ? 12.178  7.320   -8.513  1.00 0.30  ? 62  LYS A CB   5  
ATOM 10330 C CG   . LYS A 1 62  ? 10.873  6.744   -7.996  1.00 0.37  ? 62  LYS A CG   5  
ATOM 10331 C CD   . LYS A 1 62  ? 10.197  5.873   -9.031  1.00 0.41  ? 62  LYS A CD   5  
ATOM 10332 C CE   . LYS A 1 62  ? 9.122   5.013   -8.388  1.00 0.60  ? 62  LYS A CE   5  
ATOM 10333 N NZ   . LYS A 1 62  ? 8.663   3.921   -9.281  1.00 1.17  ? 62  LYS A NZ   5  
ATOM 10334 H H    . LYS A 1 62  ? 11.969  9.451   -7.089  1.00 0.30  ? 62  LYS A H    5  
ATOM 10335 H HA   . LYS A 1 62  ? 13.104  6.917   -6.653  1.00 0.29  ? 62  LYS A HA   5  
ATOM 10336 H HB2  . LYS A 1 62  ? 11.957  8.193   -9.109  1.00 0.33  ? 62  LYS A HB2  5  
ATOM 10337 H HB3  . LYS A 1 62  ? 12.658  6.576   -9.133  1.00 0.37  ? 62  LYS A HB3  5  
ATOM 10338 H HG2  . LYS A 1 62  ? 11.076  6.148   -7.119  1.00 0.54  ? 62  LYS A HG2  5  
ATOM 10339 H HG3  . LYS A 1 62  ? 10.209  7.556   -7.735  1.00 0.52  ? 62  LYS A HG3  5  
ATOM 10340 H HD2  . LYS A 1 62  ? 9.748   6.506   -9.776  1.00 0.61  ? 62  LYS A HD2  5  
ATOM 10341 H HD3  . LYS A 1 62  ? 10.934  5.232   -9.491  1.00 0.58  ? 62  LYS A HD3  5  
ATOM 10342 H HE2  . LYS A 1 62  ? 9.523   4.578   -7.485  1.00 1.06  ? 62  LYS A HE2  5  
ATOM 10343 H HE3  . LYS A 1 62  ? 8.280   5.643   -8.135  1.00 0.90  ? 62  LYS A HE3  5  
ATOM 10344 H HZ1  . LYS A 1 62  ? 7.743   4.166   -9.707  1.00 1.64  ? 62  LYS A HZ1  5  
ATOM 10345 H HZ2  . LYS A 1 62  ? 8.570   3.033   -8.734  1.00 1.67  ? 62  LYS A HZ2  5  
ATOM 10346 H HZ3  . LYS A 1 62  ? 9.352   3.763   -10.046 1.00 1.71  ? 62  LYS A HZ3  5  
ATOM 10347 N N    . GLY A 1 63  ? 15.407  7.104   -7.165  1.00 0.25  ? 63  GLY A N    5  
ATOM 10348 C CA   . GLY A 1 63  ? 16.821  7.177   -7.384  1.00 0.27  ? 63  GLY A CA   5  
ATOM 10349 C C    . GLY A 1 63  ? 17.552  7.128   -6.069  1.00 0.30  ? 63  GLY A C    5  
ATOM 10350 O O    . GLY A 1 63  ? 18.658  6.598   -5.972  1.00 0.42  ? 63  GLY A O    5  
ATOM 10351 H H    . GLY A 1 63  ? 15.060  6.481   -6.487  1.00 0.30  ? 63  GLY A H    5  
ATOM 10352 H HA2  . GLY A 1 63  ? 17.132  6.344   -7.997  1.00 0.29  ? 63  GLY A HA2  5  
ATOM 10353 H HA3  . GLY A 1 63  ? 17.056  8.099   -7.887  1.00 0.28  ? 63  GLY A HA3  5  
ATOM 10354 N N    . GLN A 1 64  ? 16.920  7.663   -5.034  1.00 0.26  ? 64  GLN A N    5  
ATOM 10355 C CA   . GLN A 1 64  ? 17.545  7.688   -3.724  1.00 0.28  ? 64  GLN A CA   5  
ATOM 10356 C C    . GLN A 1 64  ? 17.573  6.287   -3.138  1.00 0.24  ? 64  GLN A C    5  
ATOM 10357 O O    . GLN A 1 64  ? 16.624  5.514   -3.285  1.00 0.24  ? 64  GLN A O    5  
ATOM 10358 C CB   . GLN A 1 64  ? 16.822  8.633   -2.757  1.00 0.30  ? 64  GLN A CB   5  
ATOM 10359 C CG   . GLN A 1 64  ? 16.298  9.940   -3.358  1.00 0.36  ? 64  GLN A CG   5  
ATOM 10360 C CD   . GLN A 1 64  ? 17.331  10.823  -4.057  1.00 0.44  ? 64  GLN A CD   5  
ATOM 10361 O OE1  . GLN A 1 64  ? 17.223  12.049  -4.012  1.00 0.59  ? 64  GLN A OE1  5  
ATOM 10362 N NE2  . GLN A 1 64  ? 18.290  10.240  -4.751  1.00 0.43  ? 64  GLN A NE2  5  
ATOM 10363 H H    . GLN A 1 64  ? 16.014  8.037   -5.152  1.00 0.26  ? 64  GLN A H    5  
ATOM 10364 H HA   . GLN A 1 64  ? 18.563  8.025   -3.851  1.00 0.33  ? 64  GLN A HA   5  
ATOM 10365 H HB2  . GLN A 1 64  ? 15.975  8.106   -2.337  1.00 0.29  ? 64  GLN A HB2  5  
ATOM 10366 H HB3  . GLN A 1 64  ? 17.507  8.885   -1.954  1.00 0.37  ? 64  GLN A HB3  5  
ATOM 10367 H HG2  . GLN A 1 64  ? 15.528  9.691   -4.070  1.00 0.35  ? 64  GLN A HG2  5  
ATOM 10368 H HG3  . GLN A 1 64  ? 15.861  10.519  -2.559  1.00 0.40  ? 64  GLN A HG3  5  
ATOM 10369 H HE21 . GLN A 1 64  ? 18.301  9.264   -4.797  1.00 0.43  ? 64  GLN A HE21 5  
ATOM 10370 H HE22 . GLN A 1 64  ? 18.961  10.820  -5.192  1.00 0.50  ? 64  GLN A HE22 5  
ATOM 10371 N N    . VAL A 1 65  ? 18.672  5.964   -2.493  1.00 0.28  ? 65  VAL A N    5  
ATOM 10372 C CA   . VAL A 1 65  ? 18.802  4.709   -1.790  1.00 0.31  ? 65  VAL A CA   5  
ATOM 10373 C C    . VAL A 1 65  ? 18.203  4.867   -0.400  1.00 0.25  ? 65  VAL A C    5  
ATOM 10374 O O    . VAL A 1 65  ? 18.632  5.719   0.377   1.00 0.32  ? 65  VAL A O    5  
ATOM 10375 C CB   . VAL A 1 65  ? 20.280  4.269   -1.710  1.00 0.49  ? 65  VAL A CB   5  
ATOM 10376 C CG1  . VAL A 1 65  ? 20.453  3.071   -0.801  1.00 1.22  ? 65  VAL A CG1  5  
ATOM 10377 C CG2  . VAL A 1 65  ? 20.807  3.941   -3.096  1.00 1.05  ? 65  VAL A CG2  5  
ATOM 10378 H H    . VAL A 1 65  ? 19.418  6.603   -2.470  1.00 0.35  ? 65  VAL A H    5  
ATOM 10379 H HA   . VAL A 1 65  ? 18.244  3.959   -2.332  1.00 0.32  ? 65  VAL A HA   5  
ATOM 10380 H HB   . VAL A 1 65  ? 20.859  5.087   -1.311  1.00 1.34  ? 65  VAL A HB   5  
ATOM 10381 H HG11 . VAL A 1 65  ? 21.492  2.776   -0.787  1.00 1.66  ? 65  VAL A HG11 5  
ATOM 10382 H HG12 . VAL A 1 65  ? 19.849  2.252   -1.164  1.00 1.83  ? 65  VAL A HG12 5  
ATOM 10383 H HG13 . VAL A 1 65  ? 20.140  3.334   0.199   1.00 1.86  ? 65  VAL A HG13 5  
ATOM 10384 H HG21 . VAL A 1 65  ? 20.713  4.808   -3.730  1.00 1.67  ? 65  VAL A HG21 5  
ATOM 10385 H HG22 . VAL A 1 65  ? 20.234  3.124   -3.512  1.00 1.64  ? 65  VAL A HG22 5  
ATOM 10386 H HG23 . VAL A 1 65  ? 21.845  3.653   -3.028  1.00 1.65  ? 65  VAL A HG23 5  
ATOM 10387 N N    . VAL A 1 66  ? 17.191  4.076   -0.103  1.00 0.19  ? 66  VAL A N    5  
ATOM 10388 C CA   . VAL A 1 66  ? 16.410  4.268   1.108   1.00 0.15  ? 66  VAL A CA   5  
ATOM 10389 C C    . VAL A 1 66  ? 16.366  3.014   1.965   1.00 0.16  ? 66  VAL A C    5  
ATOM 10390 O O    . VAL A 1 66  ? 16.410  1.898   1.449   1.00 0.21  ? 66  VAL A O    5  
ATOM 10391 C CB   . VAL A 1 66  ? 14.965  4.708   0.782   1.00 0.17  ? 66  VAL A CB   5  
ATOM 10392 C CG1  . VAL A 1 66  ? 14.953  6.041   0.053   1.00 0.18  ? 66  VAL A CG1  5  
ATOM 10393 C CG2  . VAL A 1 66  ? 14.249  3.662   -0.052  1.00 0.25  ? 66  VAL A CG2  5  
ATOM 10394 H H    . VAL A 1 66  ? 16.971  3.334   -0.706  1.00 0.24  ? 66  VAL A H    5  
ATOM 10395 H HA   . VAL A 1 66  ? 16.874  5.051   1.678   1.00 0.15  ? 66  VAL A HA   5  
ATOM 10396 H HB   . VAL A 1 66  ? 14.435  4.827   1.715   1.00 0.21  ? 66  VAL A HB   5  
ATOM 10397 H HG11 . VAL A 1 66  ? 15.350  6.808   0.698   1.00 1.04  ? 66  VAL A HG11 5  
ATOM 10398 H HG12 . VAL A 1 66  ? 13.940  6.293   -0.223  1.00 1.01  ? 66  VAL A HG12 5  
ATOM 10399 H HG13 . VAL A 1 66  ? 15.561  5.968   -0.836  1.00 1.02  ? 66  VAL A HG13 5  
ATOM 10400 H HG21 . VAL A 1 66  ? 14.301  2.706   0.448   1.00 1.07  ? 66  VAL A HG21 5  
ATOM 10401 H HG22 . VAL A 1 66  ? 14.721  3.592   -1.021  1.00 1.07  ? 66  VAL A HG22 5  
ATOM 10402 H HG23 . VAL A 1 66  ? 13.217  3.949   -0.176  1.00 1.00  ? 66  VAL A HG23 5  
ATOM 10403 N N    . THR A 1 67  ? 16.295  3.209   3.274   1.00 0.13  ? 67  THR A N    5  
ATOM 10404 C CA   . THR A 1 67  ? 16.147  2.106   4.207   1.00 0.15  ? 67  THR A CA   5  
ATOM 10405 C C    . THR A 1 67  ? 14.711  2.008   4.686   1.00 0.16  ? 67  THR A C    5  
ATOM 10406 O O    . THR A 1 67  ? 14.187  2.927   5.330   1.00 0.21  ? 67  THR A O    5  
ATOM 10407 C CB   . THR A 1 67  ? 17.047  2.266   5.445   1.00 0.20  ? 67  THR A CB   5  
ATOM 10408 O OG1  . THR A 1 67  ? 16.862  3.561   6.024   1.00 0.29  ? 67  THR A OG1  5  
ATOM 10409 C CG2  . THR A 1 67  ? 18.509  2.073   5.110   1.00 0.27  ? 67  THR A CG2  5  
ATOM 10410 H H    . THR A 1 67  ? 16.333  4.128   3.625   1.00 0.14  ? 67  THR A H    5  
ATOM 10411 H HA   . THR A 1 67  ? 16.418  1.188   3.701   1.00 0.15  ? 67  THR A HA   5  
ATOM 10412 H HB   . THR A 1 67  ? 16.763  1.515   6.172   1.00 0.27  ? 67  THR A HB   5  
ATOM 10413 H HG1  . THR A 1 67  ? 17.338  3.604   6.859   1.00 0.56  ? 67  THR A HG1  5  
ATOM 10414 H HG21 . THR A 1 67  ? 19.096  2.228   6.003   1.00 1.03  ? 67  THR A HG21 5  
ATOM 10415 H HG22 . THR A 1 67  ? 18.803  2.783   4.352   1.00 1.06  ? 67  THR A HG22 5  
ATOM 10416 H HG23 . THR A 1 67  ? 18.664  1.070   4.747   1.00 1.04  ? 67  THR A HG23 5  
ATOM 10417 N N    . VAL A 1 68  ? 14.066  0.909   4.367   1.00 0.15  ? 68  VAL A N    5  
ATOM 10418 C CA   . VAL A 1 68  ? 12.761  0.642   4.915   1.00 0.15  ? 68  VAL A CA   5  
ATOM 10419 C C    . VAL A 1 68  ? 12.831  -0.522  5.878   1.00 0.15  ? 68  VAL A C    5  
ATOM 10420 O O    . VAL A 1 68  ? 13.606  -1.451  5.692   1.00 0.17  ? 68  VAL A O    5  
ATOM 10421 C CB   . VAL A 1 68  ? 11.690  0.351   3.839   1.00 0.16  ? 68  VAL A CB   5  
ATOM 10422 C CG1  . VAL A 1 68  ? 11.381  1.600   3.036   1.00 0.18  ? 68  VAL A CG1  5  
ATOM 10423 C CG2  . VAL A 1 68  ? 12.135  -0.771  2.919   1.00 0.19  ? 68  VAL A CG2  5  
ATOM 10424 H H    . VAL A 1 68  ? 14.479  0.262   3.748   1.00 0.15  ? 68  VAL A H    5  
ATOM 10425 H HA   . VAL A 1 68  ? 12.461  1.519   5.458   1.00 0.15  ? 68  VAL A HA   5  
ATOM 10426 H HB   . VAL A 1 68  ? 10.779  0.036   4.340   1.00 0.17  ? 68  VAL A HB   5  
ATOM 10427 H HG11 . VAL A 1 68  ? 10.622  1.376   2.301   1.00 1.00  ? 68  VAL A HG11 5  
ATOM 10428 H HG12 . VAL A 1 68  ? 12.276  1.939   2.536   1.00 1.05  ? 68  VAL A HG12 5  
ATOM 10429 H HG13 . VAL A 1 68  ? 11.023  2.375   3.699   1.00 1.02  ? 68  VAL A HG13 5  
ATOM 10430 H HG21 . VAL A 1 68  ? 13.061  -0.493  2.436   1.00 1.04  ? 68  VAL A HG21 5  
ATOM 10431 H HG22 . VAL A 1 68  ? 11.377  -0.944  2.169   1.00 1.04  ? 68  VAL A HG22 5  
ATOM 10432 H HG23 . VAL A 1 68  ? 12.284  -1.672  3.493   1.00 1.02  ? 68  VAL A HG23 5  
ATOM 10433 N N    . HIS A 1 69  ? 12.041  -0.459  6.917   1.00 0.14  ? 69  HIS A N    5  
ATOM 10434 C CA   . HIS A 1 69  ? 11.858  -1.606  7.770   1.00 0.15  ? 69  HIS A CA   5  
ATOM 10435 C C    . HIS A 1 69  ? 10.530  -2.216  7.405   1.00 0.14  ? 69  HIS A C    5  
ATOM 10436 O O    . HIS A 1 69  ? 9.506   -1.563  7.525   1.00 0.15  ? 69  HIS A O    5  
ATOM 10437 C CB   . HIS A 1 69  ? 11.863  -1.228  9.262   1.00 0.15  ? 69  HIS A CB   5  
ATOM 10438 C CG   . HIS A 1 69  ? 11.570  -2.400  10.173  1.00 0.15  ? 69  HIS A CG   5  
ATOM 10439 N ND1  . HIS A 1 69  ? 11.815  -2.418  11.529  1.00 0.19  ? 69  HIS A ND1  5  
ATOM 10440 C CD2  . HIS A 1 69  ? 11.042  -3.609  9.889   1.00 0.18  ? 69  HIS A CD2  5  
ATOM 10441 C CE1  . HIS A 1 69  ? 11.435  -3.591  12.020  1.00 0.18  ? 69  HIS A CE1  5  
ATOM 10442 N NE2  . HIS A 1 69  ? 10.973  -4.326  11.044  1.00 0.18  ? 69  HIS A NE2  5  
ATOM 10443 H H    . HIS A 1 69  ? 11.561  0.378   7.111   1.00 0.14  ? 69  HIS A H    5  
ATOM 10444 H HA   . HIS A 1 69  ? 12.651  -2.318  7.571   1.00 0.16  ? 69  HIS A HA   5  
ATOM 10445 H HB2  . HIS A 1 69  ? 12.831  -0.822  9.521   1.00 0.17  ? 69  HIS A HB2  5  
ATOM 10446 H HB3  . HIS A 1 69  ? 11.105  -0.476  9.440   1.00 0.16  ? 69  HIS A HB3  5  
ATOM 10447 H HD1  . HIS A 1 69  ? 12.195  -1.675  12.060  1.00 0.27  ? 69  HIS A HD1  5  
ATOM 10448 H HD2  . HIS A 1 69  ? 10.692  -3.928  8.914   1.00 0.23  ? 69  HIS A HD2  5  
ATOM 10449 H HE1  . HIS A 1 69  ? 11.464  -3.889  13.045  1.00 0.21  ? 69  HIS A HE1  5  
ATOM 10450 H HE2  . HIS A 1 69  ? 10.487  -5.169  11.158  1.00 0.29  ? 69  HIS A HE2  5  
ATOM 10451 N N    . LEU A 1 70  ? 10.535  -3.461  6.983   1.00 0.15  ? 70  LEU A N    5  
ATOM 10452 C CA   . LEU A 1 70  ? 9.292   -4.096  6.643   1.00 0.16  ? 70  LEU A CA   5  
ATOM 10453 C C    . LEU A 1 70  ? 9.129   -5.386  7.414   1.00 0.15  ? 70  LEU A C    5  
ATOM 10454 O O    . LEU A 1 70  ? 10.065  -6.162  7.584   1.00 0.21  ? 70  LEU A O    5  
ATOM 10455 C CB   . LEU A 1 70  ? 9.154   -4.342  5.134   1.00 0.21  ? 70  LEU A CB   5  
ATOM 10456 C CG   . LEU A 1 70  ? 9.592   -5.716  4.638   1.00 0.31  ? 70  LEU A CG   5  
ATOM 10457 C CD1  . LEU A 1 70  ? 9.129   -5.930  3.205   1.00 0.39  ? 70  LEU A CD1  5  
ATOM 10458 C CD2  . LEU A 1 70  ? 11.102  -5.878  4.728   1.00 0.38  ? 70  LEU A CD2  5  
ATOM 10459 H H    . LEU A 1 70  ? 11.373  -3.973  6.951   1.00 0.18  ? 70  LEU A H    5  
ATOM 10460 H HA   . LEU A 1 70  ? 8.508   -3.428  6.948   1.00 0.15  ? 70  LEU A HA   5  
ATOM 10461 H HB2  . LEU A 1 70  ? 8.113   -4.211  4.874   1.00 0.25  ? 70  LEU A HB2  5  
ATOM 10462 H HB3  . LEU A 1 70  ? 9.735   -3.594  4.614   1.00 0.21  ? 70  LEU A HB3  5  
ATOM 10463 H HG   . LEU A 1 70  ? 9.130   -6.469  5.268   1.00 0.39  ? 70  LEU A HG   5  
ATOM 10464 H HD11 . LEU A 1 70  ? 8.052   -5.849  3.160   1.00 1.02  ? 70  LEU A HD11 5  
ATOM 10465 H HD12 . LEU A 1 70  ? 9.427   -6.912  2.873   1.00 1.09  ? 70  LEU A HD12 5  
ATOM 10466 H HD13 . LEU A 1 70  ? 9.574   -5.183  2.564   1.00 1.11  ? 70  LEU A HD13 5  
ATOM 10467 H HD21 . LEU A 1 70  ? 11.417  -5.731  5.751   1.00 1.13  ? 70  LEU A HD21 5  
ATOM 10468 H HD22 . LEU A 1 70  ? 11.582  -5.146  4.093   1.00 1.06  ? 70  LEU A HD22 5  
ATOM 10469 H HD23 . LEU A 1 70  ? 11.374  -6.870  4.408   1.00 1.10  ? 70  LEU A HD23 5  
ATOM 10470 N N    . GLN A 1 71  ? 7.951   -5.561  7.934   1.00 0.13  ? 71  GLN A N    5  
ATOM 10471 C CA   . GLN A 1 71  ? 7.544   -6.821  8.505   1.00 0.14  ? 71  GLN A CA   5  
ATOM 10472 C C    . GLN A 1 71  ? 6.254   -7.167  7.851   1.00 0.14  ? 71  GLN A C    5  
ATOM 10473 O O    . GLN A 1 71  ? 5.249   -6.467  8.004   1.00 0.14  ? 71  GLN A O    5  
ATOM 10474 C CB   . GLN A 1 71  ? 7.339   -6.763  10.005  1.00 0.15  ? 71  GLN A CB   5  
ATOM 10475 C CG   . GLN A 1 71  ? 8.168   -5.726  10.745  1.00 0.15  ? 71  GLN A CG   5  
ATOM 10476 C CD   . GLN A 1 71  ? 7.625   -4.329  10.593  1.00 0.16  ? 71  GLN A CD   5  
ATOM 10477 O OE1  . GLN A 1 71  ? 8.324   -3.346  10.811  1.00 0.27  ? 71  GLN A OE1  5  
ATOM 10478 N NE2  . GLN A 1 71  ? 6.403   -4.228  10.140  1.00 0.18  ? 71  GLN A NE2  5  
ATOM 10479 H H    . GLN A 1 71  ? 7.314   -4.816  7.924   1.00 0.15  ? 71  GLN A H    5  
ATOM 10480 H HA   . GLN A 1 71  ? 8.269   -7.584  8.254   1.00 0.14  ? 71  GLN A HA   5  
ATOM 10481 H HB2  . GLN A 1 71  ? 6.300   -6.551  10.179  1.00 0.17  ? 71  GLN A HB2  5  
ATOM 10482 H HB3  . GLN A 1 71  ? 7.571   -7.733  10.421  1.00 0.17  ? 71  GLN A HB3  5  
ATOM 10483 H HG2  . GLN A 1 71  ? 8.186   -5.978  11.789  1.00 0.20  ? 71  GLN A HG2  5  
ATOM 10484 H HG3  . GLN A 1 71  ? 9.176   -5.743  10.358  1.00 0.15  ? 71  GLN A HG3  5  
ATOM 10485 H HE21 . GLN A 1 71  ? 5.906   -5.051  9.916   1.00 0.26  ? 71  GLN A HE21 5  
ATOM 10486 H HE22 . GLN A 1 71  ? 6.038   -3.330  10.046  1.00 0.18  ? 71  GLN A HE22 5  
ATOM 10487 N N    . THR A 1 72  ? 6.296   -8.224  7.118   1.00 0.15  ? 72  THR A N    5  
ATOM 10488 C CA   . THR A 1 72  ? 5.259   -8.522  6.197   1.00 0.16  ? 72  THR A CA   5  
ATOM 10489 C C    . THR A 1 72  ? 4.458   -9.721  6.635   1.00 0.16  ? 72  THR A C    5  
ATOM 10490 O O    . THR A 1 72  ? 4.996   -10.811 6.828   1.00 0.17  ? 72  THR A O    5  
ATOM 10491 C CB   . THR A 1 72  ? 5.877   -8.776  4.838   1.00 0.17  ? 72  THR A CB   5  
ATOM 10492 O OG1  . THR A 1 72  ? 6.769   -7.705  4.507   1.00 0.19  ? 72  THR A OG1  5  
ATOM 10493 C CG2  . THR A 1 72  ? 4.804   -8.897  3.796   1.00 0.19  ? 72  THR A CG2  5  
ATOM 10494 H H    . THR A 1 72  ? 7.060   -8.836  7.202   1.00 0.17  ? 72  THR A H    5  
ATOM 10495 H HA   . THR A 1 72  ? 4.609   -7.667  6.121   1.00 0.17  ? 72  THR A HA   5  
ATOM 10496 H HB   . THR A 1 72  ? 6.430   -9.699  4.886   1.00 0.18  ? 72  THR A HB   5  
ATOM 10497 H HG1  . THR A 1 72  ? 6.646   -7.453  3.587   1.00 0.55  ? 72  THR A HG1  5  
ATOM 10498 H HG21 . THR A 1 72  ? 4.259   -7.967  3.744   1.00 1.04  ? 72  THR A HG21 5  
ATOM 10499 H HG22 . THR A 1 72  ? 4.134   -9.696  4.074   1.00 1.00  ? 72  THR A HG22 5  
ATOM 10500 H HG23 . THR A 1 72  ? 5.254   -9.112  2.840   1.00 1.00  ? 72  THR A HG23 5  
ATOM 10501 N N    . SER A 1 73  ? 3.171   -9.511  6.788   1.00 0.17  ? 73  SER A N    5  
ATOM 10502 C CA   . SER A 1 73  ? 2.276   -10.556 7.193   1.00 0.17  ? 73  SER A CA   5  
ATOM 10503 C C    . SER A 1 73  ? 1.479   -11.014 5.986   1.00 0.15  ? 73  SER A C    5  
ATOM 10504 O O    . SER A 1 73  ? 1.537   -10.402 4.916   1.00 0.26  ? 73  SER A O    5  
ATOM 10505 C CB   . SER A 1 73  ? 1.338   -10.040 8.285   1.00 0.23  ? 73  SER A CB   5  
ATOM 10506 O OG   . SER A 1 73  ? 1.969   -9.034  9.063   1.00 1.06  ? 73  SER A OG   5  
ATOM 10507 H H    . SER A 1 73  ? 2.806   -8.618  6.605   1.00 0.20  ? 73  SER A H    5  
ATOM 10508 H HA   . SER A 1 73  ? 2.861   -11.384 7.570   1.00 0.18  ? 73  SER A HA   5  
ATOM 10509 H HB2  . SER A 1 73  ? 0.450   -9.618  7.823   1.00 0.96  ? 73  SER A HB2  5  
ATOM 10510 H HB3  . SER A 1 73  ? 1.056   -10.857 8.934   1.00 1.03  ? 73  SER A HB3  5  
ATOM 10511 H HG   . SER A 1 73  ? 1.959   -8.209  8.568   1.00 1.54  ? 73  SER A HG   5  
ATOM 10512 N N    . LEU A 1 74  ? 0.750   -12.086 6.165   1.00 0.19  ? 74  LEU A N    5  
ATOM 10513 C CA   . LEU A 1 74  ? -0.063  -12.646 5.115   1.00 0.18  ? 74  LEU A CA   5  
ATOM 10514 C C    . LEU A 1 74  ? -1.492  -12.177 5.264   1.00 0.19  ? 74  LEU A C    5  
ATOM 10515 O O    . LEU A 1 74  ? -1.850  -11.603 6.291   1.00 0.21  ? 74  LEU A O    5  
ATOM 10516 C CB   . LEU A 1 74  ? 0.003   -14.172 5.151   1.00 0.22  ? 74  LEU A CB   5  
ATOM 10517 C CG   . LEU A 1 74  ? 1.318   -14.773 4.666   1.00 0.38  ? 74  LEU A CG   5  
ATOM 10518 C CD1  . LEU A 1 74  ? 1.133   -16.245 4.328   1.00 0.84  ? 74  LEU A CD1  5  
ATOM 10519 C CD2  . LEU A 1 74  ? 1.843   -13.990 3.473   1.00 0.72  ? 74  LEU A CD2  5  
ATOM 10520 H H    . LEU A 1 74  ? 0.758   -12.519 7.041   1.00 0.34  ? 74  LEU A H    5  
ATOM 10521 H HA   . LEU A 1 74  ? 0.325   -12.297 4.171   1.00 0.18  ? 74  LEU A HA   5  
ATOM 10522 H HB2  . LEU A 1 74  ? -0.152  -14.485 6.172   1.00 0.30  ? 74  LEU A HB2  5  
ATOM 10523 H HB3  . LEU A 1 74  ? -0.794  -14.566 4.547   1.00 0.20  ? 74  LEU A HB3  5  
ATOM 10524 H HG   . LEU A 1 74  ? 2.052   -14.707 5.459   1.00 0.97  ? 74  LEU A HG   5  
ATOM 10525 H HD11 . LEU A 1 74  ? 0.337   -16.350 3.606   1.00 1.51  ? 74  LEU A HD11 5  
ATOM 10526 H HD12 . LEU A 1 74  ? 0.880   -16.792 5.225   1.00 1.44  ? 74  LEU A HD12 5  
ATOM 10527 H HD13 . LEU A 1 74  ? 2.050   -16.640 3.913   1.00 1.32  ? 74  LEU A HD13 5  
ATOM 10528 H HD21 . LEU A 1 74  ? 2.731   -14.468 3.088   1.00 1.44  ? 74  LEU A HD21 5  
ATOM 10529 H HD22 . LEU A 1 74  ? 2.084   -12.981 3.790   1.00 1.33  ? 74  LEU A HD22 5  
ATOM 10530 H HD23 . LEU A 1 74  ? 1.085   -13.955 2.704   1.00 1.28  ? 74  LEU A HD23 5  
ATOM 10531 N N    . GLU A 1 75  ? -2.297  -12.398 4.236   1.00 0.21  ? 75  GLU A N    5  
ATOM 10532 C CA   . GLU A 1 75  ? -3.711  -12.062 4.284   1.00 0.26  ? 75  GLU A CA   5  
ATOM 10533 C C    . GLU A 1 75  ? -4.407  -12.755 5.462   1.00 0.32  ? 75  GLU A C    5  
ATOM 10534 O O    . GLU A 1 75  ? -5.498  -12.356 5.863   1.00 0.39  ? 75  GLU A O    5  
ATOM 10535 C CB   . GLU A 1 75  ? -4.400  -12.429 2.968   1.00 0.30  ? 75  GLU A CB   5  
ATOM 10536 C CG   . GLU A 1 75  ? -4.158  -13.857 2.516   1.00 0.34  ? 75  GLU A CG   5  
ATOM 10537 C CD   . GLU A 1 75  ? -4.879  -14.179 1.225   1.00 0.67  ? 75  GLU A CD   5  
ATOM 10538 O OE1  . GLU A 1 75  ? -4.487  -13.641 0.170   1.00 0.82  ? 75  GLU A OE1  5  
ATOM 10539 O OE2  . GLU A 1 75  ? -5.849  -14.960 1.264   1.00 1.14  ? 75  GLU A OE2  5  
ATOM 10540 H H    . GLU A 1 75  ? -1.927  -12.774 3.413   1.00 0.21  ? 75  GLU A H    5  
ATOM 10541 H HA   . GLU A 1 75  ? -3.778  -10.990 4.418   1.00 0.27  ? 75  GLU A HA   5  
ATOM 10542 H HB2  . GLU A 1 75  ? -5.465  -12.288 3.082   1.00 0.37  ? 75  GLU A HB2  5  
ATOM 10543 H HB3  . GLU A 1 75  ? -4.044  -11.766 2.195   1.00 0.29  ? 75  GLU A HB3  5  
ATOM 10544 H HG2  . GLU A 1 75  ? -3.098  -14.001 2.369   1.00 0.47  ? 75  GLU A HG2  5  
ATOM 10545 H HG3  . GLU A 1 75  ? -4.509  -14.529 3.286   1.00 0.54  ? 75  GLU A HG3  5  
ATOM 10546 N N    . ASN A 1 76  ? -3.775  -13.794 6.018   1.00 0.34  ? 76  ASN A N    5  
ATOM 10547 C CA   . ASN A 1 76  ? -4.338  -14.489 7.173   1.00 0.41  ? 76  ASN A CA   5  
ATOM 10548 C C    . ASN A 1 76  ? -3.698  -13.995 8.474   1.00 0.39  ? 76  ASN A C    5  
ATOM 10549 O O    . ASN A 1 76  ? -4.210  -14.252 9.562   1.00 0.51  ? 76  ASN A O    5  
ATOM 10550 C CB   . ASN A 1 76  ? -4.176  -16.014 7.047   1.00 0.50  ? 76  ASN A CB   5  
ATOM 10551 C CG   . ASN A 1 76  ? -2.860  -16.536 7.597   1.00 1.13  ? 76  ASN A CG   5  
ATOM 10552 O OD1  . ASN A 1 76  ? -2.745  -16.810 8.789   1.00 2.14  ? 76  ASN A OD1  5  
ATOM 10553 N ND2  . ASN A 1 76  ? -1.870  -16.706 6.736   1.00 1.13  ? 76  ASN A ND2  5  
ATOM 10554 H H    . ASN A 1 76  ? -2.916  -14.089 5.648   1.00 0.32  ? 76  ASN A H    5  
ATOM 10555 H HA   . ASN A 1 76  ? -5.392  -14.256 7.204   1.00 0.47  ? 76  ASN A HA   5  
ATOM 10556 H HB2  . ASN A 1 76  ? -4.974  -16.490 7.592   1.00 1.21  ? 76  ASN A HB2  5  
ATOM 10557 H HB3  . ASN A 1 76  ? -4.244  -16.289 6.004   1.00 1.00  ? 76  ASN A HB3  5  
ATOM 10558 H HD21 . ASN A 1 76  ? -2.026  -16.490 5.794   1.00 0.98  ? 76  ASN A HD21 5  
ATOM 10559 H HD22 . ASN A 1 76  ? -1.016  -17.059 7.083   1.00 1.79  ? 76  ASN A HD22 5  
ATOM 10560 N N    . GLY A 1 77  ? -2.577  -13.286 8.351   1.00 0.30  ? 77  GLY A N    5  
ATOM 10561 C CA   . GLY A 1 77  ? -1.900  -12.757 9.528   1.00 0.32  ? 77  GLY A CA   5  
ATOM 10562 C C    . GLY A 1 77  ? -0.461  -13.234 9.671   1.00 0.32  ? 77  GLY A C    5  
ATOM 10563 O O    . GLY A 1 77  ? 0.349   -12.585 10.332  1.00 0.51  ? 77  GLY A O    5  
ATOM 10564 H H    . GLY A 1 77  ? -2.227  -13.089 7.458   1.00 0.27  ? 77  GLY A H    5  
ATOM 10565 H HA2  . GLY A 1 77  ? -1.905  -11.679 9.472   1.00 0.32  ? 77  GLY A HA2  5  
ATOM 10566 H HA3  . GLY A 1 77  ? -2.451  -13.060 10.407  1.00 0.38  ? 77  GLY A HA3  5  
ATOM 10567 N N    . THR A 1 78  ? -0.138  -14.355 9.043   1.00 0.28  ? 78  THR A N    5  
ATOM 10568 C CA   . THR A 1 78  ? 1.186   -14.963 9.171   1.00 0.28  ? 78  THR A CA   5  
ATOM 10569 C C    . THR A 1 78  ? 2.289   -14.064 8.623   1.00 0.23  ? 78  THR A C    5  
ATOM 10570 O O    . THR A 1 78  ? 2.366   -13.831 7.422   1.00 0.21  ? 78  THR A O    5  
ATOM 10571 C CB   . THR A 1 78  ? 1.240   -16.311 8.436   1.00 0.34  ? 78  THR A CB   5  
ATOM 10572 O OG1  . THR A 1 78  ? 0.145   -17.133 8.848   1.00 0.46  ? 78  THR A OG1  5  
ATOM 10573 C CG2  . THR A 1 78  ? 2.551   -17.034 8.703   1.00 0.39  ? 78  THR A CG2  5  
ATOM 10574 H H    . THR A 1 78  ? -0.809  -14.797 8.491   1.00 0.39  ? 78  THR A H    5  
ATOM 10575 H HA   . THR A 1 78  ? 1.370   -15.136 10.214  1.00 0.32  ? 78  THR A HA   5  
ATOM 10576 H HB   . THR A 1 78  ? 1.161   -16.125 7.376   1.00 0.33  ? 78  THR A HB   5  
ATOM 10577 H HG1  . THR A 1 78  ? 0.093   -17.140 9.814   1.00 0.91  ? 78  THR A HG1  5  
ATOM 10578 H HG21 . THR A 1 78  ? 2.583   -17.946 8.124   1.00 1.16  ? 78  THR A HG21 5  
ATOM 10579 H HG22 . THR A 1 78  ? 2.623   -17.272 9.753   1.00 1.12  ? 78  THR A HG22 5  
ATOM 10580 H HG23 . THR A 1 78  ? 3.377   -16.399 8.420   1.00 0.98  ? 78  THR A HG23 5  
ATOM 10581 N N    . ARG A 1 79  ? 3.137   -13.561 9.508   1.00 0.24  ? 79  ARG A N    5  
ATOM 10582 C CA   . ARG A 1 79  ? 4.284   -12.773 9.087   1.00 0.22  ? 79  ARG A CA   5  
ATOM 10583 C C    . ARG A 1 79  ? 5.351   -13.664 8.491   1.00 0.24  ? 79  ARG A C    5  
ATOM 10584 O O    . ARG A 1 79  ? 5.892   -14.554 9.144   1.00 0.33  ? 79  ARG A O    5  
ATOM 10585 C CB   . ARG A 1 79  ? 4.833   -11.947 10.235  1.00 0.25  ? 79  ARG A CB   5  
ATOM 10586 C CG   . ARG A 1 79  ? 3.893   -10.828 10.612  1.00 0.25  ? 79  ARG A CG   5  
ATOM 10587 C CD   . ARG A 1 79  ? 4.645   -9.643  11.185  1.00 0.28  ? 79  ARG A CD   5  
ATOM 10588 N NE   . ARG A 1 79  ? 3.770   -8.487  11.372  1.00 0.33  ? 79  ARG A NE   5  
ATOM 10589 C CZ   . ARG A 1 79  ? 4.148   -7.354  11.966  1.00 0.38  ? 79  ARG A CZ   5  
ATOM 10590 N NH1  . ARG A 1 79  ? 5.383   -7.222  12.428  1.00 0.42  ? 79  ARG A NH1  5  
ATOM 10591 N NH2  . ARG A 1 79  ? 3.292   -6.349  12.096  1.00 0.47  ? 79  ARG A NH2  5  
ATOM 10592 H H    . ARG A 1 79  ? 2.987   -13.723 10.463  1.00 0.27  ? 79  ARG A H    5  
ATOM 10593 H HA   . ARG A 1 79  ? 3.955   -12.091 8.313   1.00 0.19  ? 79  ARG A HA   5  
ATOM 10594 H HB2  . ARG A 1 79  ? 4.977   -12.584 11.095  1.00 0.29  ? 79  ARG A HB2  5  
ATOM 10595 H HB3  . ARG A 1 79  ? 5.775   -11.518 9.943   1.00 0.25  ? 79  ARG A HB3  5  
ATOM 10596 H HG2  . ARG A 1 79  ? 3.357   -10.512 9.724   1.00 0.23  ? 79  ARG A HG2  5  
ATOM 10597 H HG3  . ARG A 1 79  ? 3.188   -11.197 11.345  1.00 0.29  ? 79  ARG A HG3  5  
ATOM 10598 H HD2  . ARG A 1 79  ? 5.061   -9.926  12.140  1.00 0.34  ? 79  ARG A HD2  5  
ATOM 10599 H HD3  . ARG A 1 79  ? 5.443   -9.377  10.501  1.00 0.31  ? 79  ARG A HD3  5  
ATOM 10600 H HE   . ARG A 1 79  ? 2.851   -8.558  11.022  1.00 0.39  ? 79  ARG A HE   5  
ATOM 10601 H HH11 . ARG A 1 79  ? 6.054   -7.976  12.329  1.00 0.43  ? 79  ARG A HH11 5  
ATOM 10602 H HH12 . ARG A 1 79  ? 5.661   -6.374  12.876  1.00 0.49  ? 79  ARG A HH12 5  
ATOM 10603 H HH21 . ARG A 1 79  ? 2.358   -6.430  11.748  1.00 0.54  ? 79  ARG A HH21 5  
ATOM 10604 H HH22 . ARG A 1 79  ? 3.587   -5.489  12.541  1.00 0.51  ? 79  ARG A HH22 5  
ATOM 10605 N N    . VAL A 1 80  ? 5.629   -13.412 7.233   1.00 0.20  ? 80  VAL A N    5  
ATOM 10606 C CA   . VAL A 1 80  ? 6.514   -14.245 6.450   1.00 0.22  ? 80  VAL A CA   5  
ATOM 10607 C C    . VAL A 1 80  ? 7.921   -13.670 6.426   1.00 0.21  ? 80  VAL A C    5  
ATOM 10608 O O    . VAL A 1 80  ? 8.862   -14.310 5.953   1.00 0.27  ? 80  VAL A O    5  
ATOM 10609 C CB   . VAL A 1 80  ? 5.983   -14.375 5.016   1.00 0.23  ? 80  VAL A CB   5  
ATOM 10610 C CG1  . VAL A 1 80  ? 4.646   -15.086 5.012   1.00 0.26  ? 80  VAL A CG1  5  
ATOM 10611 C CG2  . VAL A 1 80  ? 5.856   -13.006 4.365   1.00 0.22  ? 80  VAL A CG2  5  
ATOM 10612 H H    . VAL A 1 80  ? 5.227   -12.621 6.815   1.00 0.20  ? 80  VAL A H    5  
ATOM 10613 H HA   . VAL A 1 80  ? 6.537   -15.224 6.896   1.00 0.26  ? 80  VAL A HA   5  
ATOM 10614 H HB   . VAL A 1 80  ? 6.678   -14.961 4.443   1.00 0.27  ? 80  VAL A HB   5  
ATOM 10615 H HG11 . VAL A 1 80  ? 4.752   -16.061 5.459   1.00 0.98  ? 80  VAL A HG11 5  
ATOM 10616 H HG12 . VAL A 1 80  ? 4.297   -15.188 3.995   1.00 1.06  ? 80  VAL A HG12 5  
ATOM 10617 H HG13 . VAL A 1 80  ? 3.931   -14.507 5.580   1.00 1.01  ? 80  VAL A HG13 5  
ATOM 10618 H HG21 . VAL A 1 80  ? 6.821   -12.517 4.362   1.00 0.95  ? 80  VAL A HG21 5  
ATOM 10619 H HG22 . VAL A 1 80  ? 5.151   -12.407 4.921   1.00 1.01  ? 80  VAL A HG22 5  
ATOM 10620 H HG23 . VAL A 1 80  ? 5.510   -13.123 3.349   1.00 1.03  ? 80  VAL A HG23 5  
ATOM 10621 N N    . GLN A 1 81  ? 8.050   -12.456 6.929   1.00 0.18  ? 81  GLN A N    5  
ATOM 10622 C CA   . GLN A 1 81  ? 9.323   -11.768 6.944   1.00 0.19  ? 81  GLN A CA   5  
ATOM 10623 C C    . GLN A 1 81  ? 9.243   -10.559 7.863   1.00 0.19  ? 81  GLN A C    5  
ATOM 10624 O O    . GLN A 1 81  ? 8.184   -9.943  7.998   1.00 0.26  ? 81  GLN A O    5  
ATOM 10625 C CB   . GLN A 1 81  ? 9.713   -11.352 5.519   1.00 0.23  ? 81  GLN A CB   5  
ATOM 10626 C CG   . GLN A 1 81  ? 8.711   -10.430 4.846   1.00 0.23  ? 81  GLN A CG   5  
ATOM 10627 C CD   . GLN A 1 81  ? 8.967   -10.270 3.363   1.00 0.37  ? 81  GLN A CD   5  
ATOM 10628 O OE1  . GLN A 1 81  ? 9.715   -9.395  2.931   1.00 0.59  ? 81  GLN A OE1  5  
ATOM 10629 N NE2  . GLN A 1 81  ? 8.327   -11.115 2.569   1.00 0.50  ? 81  GLN A NE2  5  
ATOM 10630 H H    . GLN A 1 81  ? 7.264   -12.007 7.306   1.00 0.17  ? 81  GLN A H    5  
ATOM 10631 H HA   . GLN A 1 81  ? 10.067  -12.450 7.331   1.00 0.21  ? 81  GLN A HA   5  
ATOM 10632 H HB2  . GLN A 1 81  ? 10.668  -10.847 5.551   1.00 0.26  ? 81  GLN A HB2  5  
ATOM 10633 H HB3  . GLN A 1 81  ? 9.805   -12.238 4.913   1.00 0.24  ? 81  GLN A HB3  5  
ATOM 10634 H HG2  . GLN A 1 81  ? 7.719   -10.839 4.975   1.00 0.20  ? 81  GLN A HG2  5  
ATOM 10635 H HG3  . GLN A 1 81  ? 8.760   -9.463  5.312   1.00 0.25  ? 81  GLN A HG3  5  
ATOM 10636 H HE21 . GLN A 1 81  ? 7.739   -11.779 2.981   1.00 0.63  ? 81  GLN A HE21 5  
ATOM 10637 H HE22 . GLN A 1 81  ? 8.475   -11.044 1.604   1.00 0.59  ? 81  GLN A HE22 5  
ATOM 10638 N N    . GLU A 1 82  ? 10.348  -10.248 8.508   1.00 0.24  ? 82  GLU A N    5  
ATOM 10639 C CA   . GLU A 1 82  ? 10.435  -9.091  9.370   1.00 0.24  ? 82  GLU A CA   5  
ATOM 10640 C C    . GLU A 1 82  ? 11.872  -8.605  9.366   1.00 0.25  ? 82  GLU A C    5  
ATOM 10641 O O    . GLU A 1 82  ? 12.743  -9.187  10.007  1.00 0.41  ? 82  GLU A O    5  
ATOM 10642 C CB   . GLU A 1 82  ? 9.968   -9.442  10.787  1.00 0.35  ? 82  GLU A CB   5  
ATOM 10643 C CG   . GLU A 1 82  ? 9.991   -8.265  11.743  1.00 0.44  ? 82  GLU A CG   5  
ATOM 10644 C CD   . GLU A 1 82  ? 9.040   -8.434  12.913  1.00 0.82  ? 82  GLU A CD   5  
ATOM 10645 O OE1  . GLU A 1 82  ? 7.819   -8.539  12.681  1.00 1.34  ? 82  GLU A OE1  5  
ATOM 10646 O OE2  . GLU A 1 82  ? 9.521   -8.485  14.069  1.00 1.21  ? 82  GLU A OE2  5  
ATOM 10647 H H    . GLU A 1 82  ? 11.156  -10.796 8.371   1.00 0.35  ? 82  GLU A H    5  
ATOM 10648 H HA   . GLU A 1 82  ? 9.800   -8.319  8.963   1.00 0.24  ? 82  GLU A HA   5  
ATOM 10649 H HB2  . GLU A 1 82  ? 8.957   -9.817  10.737  1.00 0.43  ? 82  GLU A HB2  5  
ATOM 10650 H HB3  . GLU A 1 82  ? 10.609  -10.211 11.184  1.00 0.37  ? 82  GLU A HB3  5  
ATOM 10651 H HG2  . GLU A 1 82  ? 10.994  -8.147  12.128  1.00 0.68  ? 82  GLU A HG2  5  
ATOM 10652 H HG3  . GLU A 1 82  ? 9.712   -7.379  11.199  1.00 0.57  ? 82  GLU A HG3  5  
ATOM 10653 N N    . GLU A 1 83  ? 12.108  -7.530  8.634   1.00 0.22  ? 83  GLU A N    5  
ATOM 10654 C CA   . GLU A 1 83  ? 13.460  -7.075  8.374   1.00 0.26  ? 83  GLU A CA   5  
ATOM 10655 C C    . GLU A 1 83  ? 13.607  -5.619  8.758   1.00 0.23  ? 83  GLU A C    5  
ATOM 10656 O O    . GLU A 1 83  ? 13.012  -4.743  8.131   1.00 0.24  ? 83  GLU A O    5  
ATOM 10657 C CB   . GLU A 1 83  ? 13.806  -7.238  6.891   1.00 0.39  ? 83  GLU A CB   5  
ATOM 10658 C CG   . GLU A 1 83  ? 13.140  -8.428  6.210   1.00 1.20  ? 83  GLU A CG   5  
ATOM 10659 C CD   . GLU A 1 83  ? 13.652  -9.774  6.700   1.00 1.73  ? 83  GLU A CD   5  
ATOM 10660 O OE1  . GLU A 1 83  ? 14.876  -10.011 6.629   1.00 1.69  ? 83  GLU A OE1  5  
ATOM 10661 O OE2  . GLU A 1 83  ? 12.828  -10.610 7.134   1.00 2.59  ? 83  GLU A OE2  5  
ATOM 10662 H H    . GLU A 1 83  ? 11.350  -7.031  8.250   1.00 0.26  ? 83  GLU A H    5  
ATOM 10663 H HA   . GLU A 1 83  ? 14.134  -7.663  8.973   1.00 0.31  ? 83  GLU A HA   5  
ATOM 10664 H HB2  . GLU A 1 83  ? 13.505  -6.343  6.369   1.00 1.15  ? 83  GLU A HB2  5  
ATOM 10665 H HB3  . GLU A 1 83  ? 14.875  -7.352  6.799   1.00 1.13  ? 83  GLU A HB3  5  
ATOM 10666 H HG2  . GLU A 1 83  ? 12.074  -8.372  6.396   1.00 1.73  ? 83  GLU A HG2  5  
ATOM 10667 H HG3  . GLU A 1 83  ? 13.319  -8.357  5.147   1.00 1.68  ? 83  GLU A HG3  5  
ATOM 10668 N N    . PRO A 1 84  ? 14.420  -5.343  9.782   1.00 0.23  ? 84  PRO A N    5  
ATOM 10669 C CA   . PRO A 1 84  ? 14.614  -3.989  10.304  1.00 0.21  ? 84  PRO A CA   5  
ATOM 10670 C C    . PRO A 1 84  ? 15.292  -3.058  9.306   1.00 0.19  ? 84  PRO A C    5  
ATOM 10671 O O    . PRO A 1 84  ? 15.289  -1.843  9.491   1.00 0.20  ? 84  PRO A O    5  
ATOM 10672 C CB   . PRO A 1 84  ? 15.507  -4.199  11.531  1.00 0.25  ? 84  PRO A CB   5  
ATOM 10673 C CG   . PRO A 1 84  ? 16.198  -5.496  11.284  1.00 0.50  ? 84  PRO A CG   5  
ATOM 10674 C CD   . PRO A 1 84  ? 15.223  -6.337  10.516  1.00 0.31  ? 84  PRO A CD   5  
ATOM 10675 H HA   . PRO A 1 84  ? 13.677  -3.552  10.612  1.00 0.20  ? 84  PRO A HA   5  
ATOM 10676 H HB2  . PRO A 1 84  ? 16.212  -3.383  11.610  1.00 0.45  ? 84  PRO A HB2  5  
ATOM 10677 H HB3  . PRO A 1 84  ? 14.897  -4.241  12.420  1.00 0.41  ? 84  PRO A HB3  5  
ATOM 10678 H HG2  . PRO A 1 84  ? 17.092  -5.334  10.701  1.00 0.90  ? 84  PRO A HG2  5  
ATOM 10679 H HG3  . PRO A 1 84  ? 16.443  -5.969  12.223  1.00 0.88  ? 84  PRO A HG3  5  
ATOM 10680 H HD2  . PRO A 1 84  ? 15.747  -6.994  9.835   1.00 0.47  ? 84  PRO A HD2  5  
ATOM 10681 H HD3  . PRO A 1 84  ? 14.605  -6.907  11.193  1.00 0.50  ? 84  PRO A HD3  5  
ATOM 10682 N N    . GLU A 1 85  ? 15.835  -3.624  8.237   1.00 0.20  ? 85  GLU A N    5  
ATOM 10683 C CA   . GLU A 1 85  ? 16.597  -2.849  7.274   1.00 0.22  ? 85  GLU A CA   5  
ATOM 10684 C C    . GLU A 1 85  ? 16.520  -3.478  5.899   1.00 0.24  ? 85  GLU A C    5  
ATOM 10685 O O    . GLU A 1 85  ? 17.031  -4.573  5.666   1.00 0.35  ? 85  GLU A O    5  
ATOM 10686 C CB   . GLU A 1 85  ? 18.062  -2.758  7.710   1.00 0.31  ? 85  GLU A CB   5  
ATOM 10687 C CG   . GLU A 1 85  ? 18.724  -1.426  7.396   1.00 0.34  ? 85  GLU A CG   5  
ATOM 10688 C CD   . GLU A 1 85  ? 18.467  -0.393  8.472   1.00 0.90  ? 85  GLU A CD   5  
ATOM 10689 O OE1  . GLU A 1 85  ? 18.682  -0.697  9.661   1.00 1.30  ? 85  GLU A OE1  5  
ATOM 10690 O OE2  . GLU A 1 85  ? 18.079  0.745   8.137   1.00 1.37  ? 85  GLU A OE2  5  
ATOM 10691 H H    . GLU A 1 85  ? 15.704  -4.581  8.082   1.00 0.23  ? 85  GLU A H    5  
ATOM 10692 H HA   . GLU A 1 85  ? 16.169  -1.859  7.210   1.00 0.23  ? 85  GLU A HA   5  
ATOM 10693 H HB2  . GLU A 1 85  ? 18.120  -2.919  8.777   1.00 0.43  ? 85  GLU A HB2  5  
ATOM 10694 H HB3  . GLU A 1 85  ? 18.621  -3.538  7.209   1.00 0.36  ? 85  GLU A HB3  5  
ATOM 10695 H HG2  . GLU A 1 85  ? 19.790  -1.575  7.303   1.00 0.68  ? 85  GLU A HG2  5  
ATOM 10696 H HG3  . GLU A 1 85  ? 18.326  -1.052  6.461   1.00 0.66  ? 85  GLU A HG3  5  
ATOM 10697 N N    . LEU A 1 86  ? 15.856  -2.782  5.013   1.00 0.23  ? 86  LEU A N    5  
ATOM 10698 C CA   . LEU A 1 86  ? 15.814  -3.132  3.623   1.00 0.24  ? 86  LEU A CA   5  
ATOM 10699 C C    . LEU A 1 86  ? 16.150  -1.895  2.810   1.00 0.23  ? 86  LEU A C    5  
ATOM 10700 O O    . LEU A 1 86  ? 15.361  -0.954  2.741   1.00 0.25  ? 86  LEU A O    5  
ATOM 10701 C CB   . LEU A 1 86  ? 14.437  -3.667  3.253   1.00 0.26  ? 86  LEU A CB   5  
ATOM 10702 C CG   . LEU A 1 86  ? 14.229  -3.871  1.762   1.00 0.33  ? 86  LEU A CG   5  
ATOM 10703 C CD1  . LEU A 1 86  ? 15.202  -4.908  1.211   1.00 0.38  ? 86  LEU A CD1  5  
ATOM 10704 C CD2  . LEU A 1 86  ? 12.795  -4.272  1.469   1.00 0.38  ? 86  LEU A CD2  5  
ATOM 10705 H H    . LEU A 1 86  ? 15.351  -1.993  5.311   1.00 0.29  ? 86  LEU A H    5  
ATOM 10706 H HA   . LEU A 1 86  ? 16.558  -3.894  3.445   1.00 0.26  ? 86  LEU A HA   5  
ATOM 10707 H HB2  . LEU A 1 86  ? 14.289  -4.610  3.753   1.00 0.27  ? 86  LEU A HB2  5  
ATOM 10708 H HB3  . LEU A 1 86  ? 13.696  -2.968  3.607   1.00 0.27  ? 86  LEU A HB3  5  
ATOM 10709 H HG   . LEU A 1 86  ? 14.425  -2.932  1.273   1.00 0.35  ? 86  LEU A HG   5  
ATOM 10710 H HD11 . LEU A 1 86  ? 16.216  -4.565  1.355   1.00 1.08  ? 86  LEU A HD11 5  
ATOM 10711 H HD12 . LEU A 1 86  ? 15.016  -5.052  0.158   1.00 1.14  ? 86  LEU A HD12 5  
ATOM 10712 H HD13 . LEU A 1 86  ? 15.062  -5.844  1.733   1.00 1.05  ? 86  LEU A HD13 5  
ATOM 10713 H HD21 . LEU A 1 86  ? 12.678  -4.441  0.409   1.00 1.08  ? 86  LEU A HD21 5  
ATOM 10714 H HD22 . LEU A 1 86  ? 12.129  -3.484  1.784   1.00 1.04  ? 86  LEU A HD22 5  
ATOM 10715 H HD23 . LEU A 1 86  ? 12.560  -5.179  2.007   1.00 0.99  ? 86  LEU A HD23 5  
ATOM 10716 N N    . VAL A 1 87  ? 17.338  -1.878  2.244   1.00 0.24  ? 87  VAL A N    5  
ATOM 10717 C CA   . VAL A 1 87  ? 17.812  -0.717  1.522   1.00 0.22  ? 87  VAL A CA   5  
ATOM 10718 C C    . VAL A 1 87  ? 17.829  -1.011  0.020   1.00 0.21  ? 87  VAL A C    5  
ATOM 10719 O O    . VAL A 1 87  ? 18.199  -2.110  -0.396  1.00 0.28  ? 87  VAL A O    5  
ATOM 10720 C CB   . VAL A 1 87  ? 19.216  -0.307  2.030   1.00 0.27  ? 87  VAL A CB   5  
ATOM 10721 C CG1  . VAL A 1 87  ? 20.280  -1.298  1.585   1.00 1.00  ? 87  VAL A CG1  5  
ATOM 10722 C CG2  . VAL A 1 87  ? 19.563  1.097   1.584   1.00 0.94  ? 87  VAL A CG2  5  
ATOM 10723 H H    . VAL A 1 87  ? 17.910  -2.673  2.300   1.00 0.29  ? 87  VAL A H    5  
ATOM 10724 H HA   . VAL A 1 87  ? 17.124  0.101   1.714   1.00 0.20  ? 87  VAL A HA   5  
ATOM 10725 H HB   . VAL A 1 87  ? 19.190  -0.314  3.111   1.00 0.79  ? 87  VAL A HB   5  
ATOM 10726 H HG11 . VAL A 1 87  ? 20.058  -2.273  1.989   1.00 1.46  ? 87  VAL A HG11 5  
ATOM 10727 H HG12 . VAL A 1 87  ? 21.247  -0.970  1.935   1.00 1.48  ? 87  VAL A HG12 5  
ATOM 10728 H HG13 . VAL A 1 87  ? 20.284  -1.348  0.506   1.00 1.59  ? 87  VAL A HG13 5  
ATOM 10729 H HG21 . VAL A 1 87  ? 20.568  1.338   1.900   1.00 1.54  ? 87  VAL A HG21 5  
ATOM 10730 H HG22 . VAL A 1 87  ? 18.869  1.798   2.023   1.00 1.50  ? 87  VAL A HG22 5  
ATOM 10731 H HG23 . VAL A 1 87  ? 19.501  1.154   0.508   1.00 1.54  ? 87  VAL A HG23 5  
ATOM 10732 N N    . PHE A 1 88  ? 17.396  -0.047  -0.783  1.00 0.17  ? 88  PHE A N    5  
ATOM 10733 C CA   . PHE A 1 88  ? 17.277  -0.249  -2.226  1.00 0.19  ? 88  PHE A CA   5  
ATOM 10734 C C    . PHE A 1 88  ? 17.221  1.084   -2.957  1.00 0.20  ? 88  PHE A C    5  
ATOM 10735 O O    . PHE A 1 88  ? 17.029  2.137   -2.342  1.00 0.23  ? 88  PHE A O    5  
ATOM 10736 C CB   . PHE A 1 88  ? 16.021  -1.066  -2.544  1.00 0.21  ? 88  PHE A CB   5  
ATOM 10737 C CG   . PHE A 1 88  ? 14.731  -0.372  -2.194  1.00 0.18  ? 88  PHE A CG   5  
ATOM 10738 C CD1  . PHE A 1 88  ? 14.294  -0.316  -0.879  1.00 0.19  ? 88  PHE A CD1  5  
ATOM 10739 C CD2  . PHE A 1 88  ? 13.955  0.212   -3.181  1.00 0.17  ? 88  PHE A CD2  5  
ATOM 10740 C CE1  . PHE A 1 88  ? 13.109  0.313   -0.556  1.00 0.17  ? 88  PHE A CE1  5  
ATOM 10741 C CE2  . PHE A 1 88  ? 12.765  0.841   -2.866  1.00 0.16  ? 88  PHE A CE2  5  
ATOM 10742 C CZ   . PHE A 1 88  ? 12.342  0.890   -1.555  1.00 0.15  ? 88  PHE A CZ   5  
ATOM 10743 H H    . PHE A 1 88  ? 17.143  0.820   -0.399  1.00 0.18  ? 88  PHE A H    5  
ATOM 10744 H HA   . PHE A 1 88  ? 18.140  -0.799  -2.566  1.00 0.21  ? 88  PHE A HA   5  
ATOM 10745 H HB2  . PHE A 1 88  ? 16.002  -1.287  -3.600  1.00 0.25  ? 88  PHE A HB2  5  
ATOM 10746 H HB3  . PHE A 1 88  ? 16.058  -1.994  -1.990  1.00 0.24  ? 88  PHE A HB3  5  
ATOM 10747 H HD1  . PHE A 1 88  ? 14.894  -0.768  -0.098  1.00 0.21  ? 88  PHE A HD1  5  
ATOM 10748 H HD2  . PHE A 1 88  ? 14.287  0.173   -4.206  1.00 0.18  ? 88  PHE A HD2  5  
ATOM 10749 H HE1  . PHE A 1 88  ? 12.786  0.355   0.474   1.00 0.19  ? 88  PHE A HE1  5  
ATOM 10750 H HE2  . PHE A 1 88  ? 12.170  1.294   -3.646  1.00 0.16  ? 88  PHE A HE2  5  
ATOM 10751 H HZ   . PHE A 1 88  ? 11.410  1.376   -1.313  1.00 0.15  ? 88  PHE A HZ   5  
ATOM 10752 N N    . THR A 1 89  ? 17.392  1.026   -4.269  1.00 0.23  ? 89  THR A N    5  
ATOM 10753 C CA   . THR A 1 89  ? 17.263  2.195   -5.117  1.00 0.25  ? 89  THR A CA   5  
ATOM 10754 C C    . THR A 1 89  ? 15.801  2.387   -5.506  1.00 0.21  ? 89  THR A C    5  
ATOM 10755 O O    . THR A 1 89  ? 15.213  1.539   -6.183  1.00 0.22  ? 89  THR A O    5  
ATOM 10756 C CB   . THR A 1 89  ? 18.113  2.046   -6.390  1.00 0.33  ? 89  THR A CB   5  
ATOM 10757 O OG1  . THR A 1 89  ? 19.454  1.685   -6.035  1.00 0.42  ? 89  THR A OG1  5  
ATOM 10758 C CG2  . THR A 1 89  ? 18.125  3.340   -7.191  1.00 0.37  ? 89  THR A CG2  5  
ATOM 10759 H H    . THR A 1 89  ? 17.612  0.166   -4.682  1.00 0.28  ? 89  THR A H    5  
ATOM 10760 H HA   . THR A 1 89  ? 17.608  3.061   -4.571  1.00 0.26  ? 89  THR A HA   5  
ATOM 10761 H HB   . THR A 1 89  ? 17.687  1.263   -7.000  1.00 0.33  ? 89  THR A HB   5  
ATOM 10762 H HG1  . THR A 1 89  ? 19.933  2.469   -5.754  1.00 0.78  ? 89  THR A HG1  5  
ATOM 10763 H HG21 . THR A 1 89  ? 18.582  4.121   -6.605  1.00 1.05  ? 89  THR A HG21 5  
ATOM 10764 H HG22 . THR A 1 89  ? 17.110  3.621   -7.435  1.00 1.02  ? 89  THR A HG22 5  
ATOM 10765 H HG23 . THR A 1 89  ? 18.687  3.196   -8.101  1.00 1.07  ? 89  THR A HG23 5  
ATOM 10766 N N    . LEU A 1 90  ? 15.221  3.484   -5.049  1.00 0.19  ? 90  LEU A N    5  
ATOM 10767 C CA   . LEU A 1 90  ? 13.835  3.811   -5.346  1.00 0.16  ? 90  LEU A CA   5  
ATOM 10768 C C    . LEU A 1 90  ? 13.634  3.957   -6.851  1.00 0.15  ? 90  LEU A C    5  
ATOM 10769 O O    . LEU A 1 90  ? 14.362  4.693   -7.506  1.00 0.18  ? 90  LEU A O    5  
ATOM 10770 C CB   . LEU A 1 90  ? 13.464  5.114   -4.645  1.00 0.16  ? 90  LEU A CB   5  
ATOM 10771 C CG   . LEU A 1 90  ? 11.969  5.362   -4.490  1.00 0.34  ? 90  LEU A CG   5  
ATOM 10772 C CD1  . LEU A 1 90  ? 11.311  4.190   -3.786  1.00 0.60  ? 90  LEU A CD1  5  
ATOM 10773 C CD2  . LEU A 1 90  ? 11.727  6.653   -3.728  1.00 0.60  ? 90  LEU A CD2  5  
ATOM 10774 H H    . LEU A 1 90  ? 15.741  4.094   -4.485  1.00 0.20  ? 90  LEU A H    5  
ATOM 10775 H HA   . LEU A 1 90  ? 13.203  3.016   -4.975  1.00 0.17  ? 90  LEU A HA   5  
ATOM 10776 H HB2  . LEU A 1 90  ? 13.921  5.123   -3.678  1.00 0.37  ? 90  LEU A HB2  5  
ATOM 10777 H HB3  . LEU A 1 90  ? 13.876  5.926   -5.208  1.00 0.39  ? 90  LEU A HB3  5  
ATOM 10778 H HG   . LEU A 1 90  ? 11.523  5.460   -5.467  1.00 0.78  ? 90  LEU A HG   5  
ATOM 10779 H HD11 . LEU A 1 90  ? 11.482  3.287   -4.353  1.00 1.17  ? 90  LEU A HD11 5  
ATOM 10780 H HD12 . LEU A 1 90  ? 10.249  4.369   -3.705  1.00 1.31  ? 90  LEU A HD12 5  
ATOM 10781 H HD13 . LEU A 1 90  ? 11.734  4.079   -2.799  1.00 1.19  ? 90  LEU A HD13 5  
ATOM 10782 H HD21 . LEU A 1 90  ? 12.111  6.557   -2.723  1.00 1.19  ? 90  LEU A HD21 5  
ATOM 10783 H HD22 . LEU A 1 90  ? 10.668  6.855   -3.691  1.00 1.33  ? 90  LEU A HD22 5  
ATOM 10784 H HD23 . LEU A 1 90  ? 12.232  7.467   -4.229  1.00 1.18  ? 90  LEU A HD23 5  
ATOM 10785 N N    . GLY A 1 91  ? 12.672  3.239   -7.404  1.00 0.20  ? 91  GLY A N    5  
ATOM 10786 C CA   . GLY A 1 91  ? 12.364  3.376   -8.811  1.00 0.23  ? 91  GLY A CA   5  
ATOM 10787 C C    . GLY A 1 91  ? 13.136  2.412   -9.680  1.00 0.26  ? 91  GLY A C    5  
ATOM 10788 O O    . GLY A 1 91  ? 13.074  2.488   -10.907 1.00 0.37  ? 91  GLY A O    5  
ATOM 10789 H H    . GLY A 1 91  ? 12.171  2.584   -6.859  1.00 0.24  ? 91  GLY A H    5  
ATOM 10790 H HA2  . GLY A 1 91  ? 11.308  3.199   -8.956  1.00 0.26  ? 91  GLY A HA2  5  
ATOM 10791 H HA3  . GLY A 1 91  ? 12.592  4.385   -9.122  1.00 0.24  ? 91  GLY A HA3  5  
ATOM 10792 N N    . ASP A 1 92  ? 13.865  1.502   -9.055  1.00 0.27  ? 92  ASP A N    5  
ATOM 10793 C CA   . ASP A 1 92  ? 14.637  0.517   -9.800  1.00 0.32  ? 92  ASP A CA   5  
ATOM 10794 C C    . ASP A 1 92  ? 13.918  -0.815  -9.795  1.00 0.30  ? 92  ASP A C    5  
ATOM 10795 O O    . ASP A 1 92  ? 14.283  -1.736  -10.531 1.00 0.37  ? 92  ASP A O    5  
ATOM 10796 C CB   . ASP A 1 92  ? 16.044  0.368   -9.209  1.00 0.42  ? 92  ASP A CB   5  
ATOM 10797 C CG   . ASP A 1 92  ? 16.932  -0.562  -10.017 1.00 0.59  ? 92  ASP A CG   5  
ATOM 10798 O OD1  . ASP A 1 92  ? 17.582  -0.088  -10.968 1.00 0.93  ? 92  ASP A OD1  5  
ATOM 10799 O OD2  . ASP A 1 92  ? 16.979  -1.774  -9.708  1.00 0.82  ? 92  ASP A OD2  5  
ATOM 10800 H H    . ASP A 1 92  ? 13.883  1.489   -8.070  1.00 0.29  ? 92  ASP A H    5  
ATOM 10801 H HA   . ASP A 1 92  ? 14.714  0.854   -10.813 1.00 0.38  ? 92  ASP A HA   5  
ATOM 10802 H HB2  . ASP A 1 92  ? 16.517  1.340   -9.169  1.00 0.47  ? 92  ASP A HB2  5  
ATOM 10803 H HB3  . ASP A 1 92  ? 15.963  -0.027  -8.208  1.00 0.43  ? 92  ASP A HB3  5  
ATOM 10804 N N    . CYS A 1 93  ? 12.857  -0.893  -8.995  1.00 0.28  ? 93  CYS A N    5  
ATOM 10805 C CA   . CYS A 1 93  ? 12.168  -2.149  -8.762  1.00 0.27  ? 93  CYS A CA   5  
ATOM 10806 C C    . CYS A 1 93  ? 13.147  -3.162  -8.193  1.00 0.26  ? 93  CYS A C    5  
ATOM 10807 O O    . CYS A 1 93  ? 13.081  -4.354  -8.497  1.00 0.31  ? 93  CYS A O    5  
ATOM 10808 C CB   . CYS A 1 93  ? 11.547  -2.679  -10.053 1.00 0.38  ? 93  CYS A CB   5  
ATOM 10809 S SG   . CYS A 1 93  ? 10.542  -1.466  -10.934 1.00 0.62  ? 93  CYS A SG   5  
ATOM 10810 H H    . CYS A 1 93  ? 12.520  -0.076  -8.562  1.00 0.30  ? 93  CYS A H    5  
ATOM 10811 H HA   . CYS A 1 93  ? 11.386  -1.972  -8.035  1.00 0.26  ? 93  CYS A HA   5  
ATOM 10812 H HB2  . CYS A 1 93  ? 12.335  -3.001  -10.719 1.00 0.68  ? 93  CYS A HB2  5  
ATOM 10813 H HB3  . CYS A 1 93  ? 10.909  -3.522  -9.813  1.00 0.47  ? 93  CYS A HB3  5  
ATOM 10814 H HG   . CYS A 1 93  ? 11.363  -0.651  -11.590 1.00 1.55  ? 93  CYS A HG   5  
ATOM 10815 N N    . ASP A 1 94  ? 14.054  -2.682  -7.347  1.00 0.27  ? 94  ASP A N    5  
ATOM 10816 C CA   . ASP A 1 94  ? 15.019  -3.556  -6.708  1.00 0.33  ? 94  ASP A CA   5  
ATOM 10817 C C    . ASP A 1 94  ? 14.281  -4.408  -5.692  1.00 0.33  ? 94  ASP A C    5  
ATOM 10818 O O    . ASP A 1 94  ? 14.735  -5.465  -5.262  1.00 0.48  ? 94  ASP A O    5  
ATOM 10819 C CB   . ASP A 1 94  ? 16.125  -2.736  -6.035  1.00 0.41  ? 94  ASP A CB   5  
ATOM 10820 C CG   . ASP A 1 94  ? 17.217  -3.605  -5.445  1.00 0.65  ? 94  ASP A CG   5  
ATOM 10821 O OD1  . ASP A 1 94  ? 18.152  -3.979  -6.179  1.00 0.96  ? 94  ASP A OD1  5  
ATOM 10822 O OD2  . ASP A 1 94  ? 17.138  -3.919  -4.238  1.00 1.33  ? 94  ASP A OD2  5  
ATOM 10823 H H    . ASP A 1 94  ? 14.062  -1.721  -7.135  1.00 0.28  ? 94  ASP A H    5  
ATOM 10824 H HA   . ASP A 1 94  ? 15.446  -4.190  -7.465  1.00 0.37  ? 94  ASP A HA   5  
ATOM 10825 H HB2  . ASP A 1 94  ? 16.571  -2.080  -6.768  1.00 0.64  ? 94  ASP A HB2  5  
ATOM 10826 H HB3  . ASP A 1 94  ? 15.692  -2.142  -5.243  1.00 0.46  ? 94  ASP A HB3  5  
ATOM 10827 N N    . VAL A 1 95  ? 13.098  -3.927  -5.369  1.00 0.23  ? 95  VAL A N    5  
ATOM 10828 C CA   . VAL A 1 95  ? 12.222  -4.552  -4.403  1.00 0.21  ? 95  VAL A CA   5  
ATOM 10829 C C    . VAL A 1 95  ? 10.911  -4.951  -5.059  1.00 0.20  ? 95  VAL A C    5  
ATOM 10830 O O    . VAL A 1 95  ? 10.848  -5.154  -6.270  1.00 0.22  ? 95  VAL A O    5  
ATOM 10831 C CB   . VAL A 1 95  ? 11.923  -3.567  -3.269  1.00 0.20  ? 95  VAL A CB   5  
ATOM 10832 C CG1  . VAL A 1 95  ? 13.143  -3.394  -2.396  1.00 0.23  ? 95  VAL A CG1  5  
ATOM 10833 C CG2  . VAL A 1 95  ? 11.491  -2.228  -3.850  1.00 0.19  ? 95  VAL A CG2  5  
ATOM 10834 H H    . VAL A 1 95  ? 12.798  -3.106  -5.812  1.00 0.25  ? 95  VAL A H    5  
ATOM 10835 H HA   . VAL A 1 95  ? 12.712  -5.419  -3.994  1.00 0.23  ? 95  VAL A HA   5  
ATOM 10836 H HB   . VAL A 1 95  ? 11.118  -3.961  -2.670  1.00 0.20  ? 95  VAL A HB   5  
ATOM 10837 H HG11 . VAL A 1 95  ? 13.958  -3.015  -2.996  1.00 0.99  ? 95  VAL A HG11 5  
ATOM 10838 H HG12 . VAL A 1 95  ? 13.418  -4.346  -1.969  1.00 1.04  ? 95  VAL A HG12 5  
ATOM 10839 H HG13 . VAL A 1 95  ? 12.919  -2.692  -1.608  1.00 0.98  ? 95  VAL A HG13 5  
ATOM 10840 H HG21 . VAL A 1 95  ? 10.560  -2.349  -4.384  1.00 1.08  ? 95  VAL A HG21 5  
ATOM 10841 H HG22 . VAL A 1 95  ? 12.254  -1.871  -4.536  1.00 1.02  ? 95  VAL A HG22 5  
ATOM 10842 H HG23 . VAL A 1 95  ? 11.363  -1.514  -3.052  1.00 1.01  ? 95  VAL A HG23 5  
ATOM 10843 N N    . ILE A 1 96  ? 9.862   -5.045  -4.258  1.00 0.19  ? 96  ILE A N    5  
ATOM 10844 C CA   . ILE A 1 96  ? 8.546   -5.290  -4.775  1.00 0.19  ? 96  ILE A CA   5  
ATOM 10845 C C    . ILE A 1 96  ? 7.973   -3.960  -5.222  1.00 0.16  ? 96  ILE A C    5  
ATOM 10846 O O    . ILE A 1 96  ? 8.178   -2.941  -4.557  1.00 0.15  ? 96  ILE A O    5  
ATOM 10847 C CB   . ILE A 1 96  ? 7.640   -5.947  -3.713  1.00 0.22  ? 96  ILE A CB   5  
ATOM 10848 C CG1  . ILE A 1 96  ? 7.445   -5.016  -2.512  1.00 0.25  ? 96  ILE A CG1  5  
ATOM 10849 C CG2  . ILE A 1 96  ? 8.250   -7.265  -3.259  1.00 0.26  ? 96  ILE A CG2  5  
ATOM 10850 C CD1  . ILE A 1 96  ? 6.525   -5.569  -1.445  1.00 0.29  ? 96  ILE A CD1  5  
ATOM 10851 H H    . ILE A 1 96  ? 9.970   -4.907  -3.303  1.00 0.21  ? 96  ILE A H    5  
ATOM 10852 H HA   . ILE A 1 96  ? 8.629   -5.950  -5.627  1.00 0.21  ? 96  ILE A HA   5  
ATOM 10853 H HB   . ILE A 1 96  ? 6.680   -6.154  -4.163  1.00 0.22  ? 96  ILE A HB   5  
ATOM 10854 H HG12 . ILE A 1 96  ? 8.403   -4.830  -2.054  1.00 0.27  ? 96  ILE A HG12 5  
ATOM 10855 H HG13 . ILE A 1 96  ? 7.028   -4.080  -2.855  1.00 0.24  ? 96  ILE A HG13 5  
ATOM 10856 H HG21 . ILE A 1 96  ? 7.599   -7.734  -2.536  1.00 1.03  ? 96  ILE A HG21 5  
ATOM 10857 H HG22 . ILE A 1 96  ? 9.213   -7.077  -2.806  1.00 1.06  ? 96  ILE A HG22 5  
ATOM 10858 H HG23 . ILE A 1 96  ? 8.375   -7.919  -4.110  1.00 1.05  ? 96  ILE A HG23 5  
ATOM 10859 H HD11 . ILE A 1 96  ? 6.432   -4.854  -0.641  1.00 1.00  ? 96  ILE A HD11 5  
ATOM 10860 H HD12 . ILE A 1 96  ? 6.936   -6.490  -1.061  1.00 1.02  ? 96  ILE A HD12 5  
ATOM 10861 H HD13 . ILE A 1 96  ? 5.550   -5.760  -1.870  1.00 0.98  ? 96  ILE A HD13 5  
ATOM 10862 N N    . GLN A 1 97  ? 7.301   -3.950  -6.354  1.00 0.17  ? 97  GLN A N    5  
ATOM 10863 C CA   . GLN A 1 97  ? 6.832   -2.700  -6.934  1.00 0.17  ? 97  GLN A CA   5  
ATOM 10864 C C    . GLN A 1 97  ? 5.904   -1.969  -5.972  1.00 0.16  ? 97  GLN A C    5  
ATOM 10865 O O    . GLN A 1 97  ? 5.883   -0.742  -5.938  1.00 0.16  ? 97  GLN A O    5  
ATOM 10866 C CB   . GLN A 1 97  ? 6.116   -2.918  -8.262  1.00 0.19  ? 97  GLN A CB   5  
ATOM 10867 C CG   . GLN A 1 97  ? 5.998   -1.634  -9.065  1.00 0.25  ? 97  GLN A CG   5  
ATOM 10868 C CD   . GLN A 1 97  ? 7.278   -1.290  -9.810  1.00 0.31  ? 97  GLN A CD   5  
ATOM 10869 O OE1  . GLN A 1 97  ? 7.413   -1.607  -10.994 1.00 0.40  ? 97  GLN A OE1  5  
ATOM 10870 N NE2  . GLN A 1 97  ? 8.252   -0.691  -9.127  1.00 0.32  ? 97  GLN A NE2  5  
ATOM 10871 H H    . GLN A 1 97  ? 7.131   -4.795  -6.812  1.00 0.19  ? 97  GLN A H    5  
ATOM 10872 H HA   . GLN A 1 97  ? 7.697   -2.080  -7.106  1.00 0.17  ? 97  GLN A HA   5  
ATOM 10873 H HB2  . GLN A 1 97  ? 6.666   -3.641  -8.847  1.00 0.23  ? 97  GLN A HB2  5  
ATOM 10874 H HB3  . GLN A 1 97  ? 5.121   -3.293  -8.072  1.00 0.21  ? 97  GLN A HB3  5  
ATOM 10875 H HG2  . GLN A 1 97  ? 5.202   -1.750  -9.786  1.00 0.29  ? 97  GLN A HG2  5  
ATOM 10876 H HG3  . GLN A 1 97  ? 5.756   -0.824  -8.392  1.00 0.29  ? 97  GLN A HG3  5  
ATOM 10877 H HE21 . GLN A 1 97  ? 8.118   -0.494  -8.174  1.00 0.29  ? 97  GLN A HE21 5  
ATOM 10878 H HE22 . GLN A 1 97  ? 9.081   -0.469  -9.610  1.00 0.39  ? 97  GLN A HE22 5  
ATOM 10879 N N    . ALA A 1 98  ? 5.156   -2.732  -5.181  1.00 0.17  ? 98  ALA A N    5  
ATOM 10880 C CA   . ALA A 1 98  ? 4.293   -2.157  -4.160  1.00 0.18  ? 98  ALA A CA   5  
ATOM 10881 C C    . ALA A 1 98  ? 5.090   -1.257  -3.230  1.00 0.17  ? 98  ALA A C    5  
ATOM 10882 O O    . ALA A 1 98  ? 4.650   -0.167  -2.871  1.00 0.20  ? 98  ALA A O    5  
ATOM 10883 C CB   . ALA A 1 98  ? 3.625   -3.257  -3.361  1.00 0.20  ? 98  ALA A CB   5  
ATOM 10884 H H    . ALA A 1 98  ? 5.185   -3.708  -5.288  1.00 0.18  ? 98  ALA A H    5  
ATOM 10885 H HA   . ALA A 1 98  ? 3.525   -1.575  -4.648  1.00 0.19  ? 98  ALA A HA   5  
ATOM 10886 H HB1  . ALA A 1 98  ? 3.016   -3.861  -4.015  1.00 1.08  ? 98  ALA A HB1  5  
ATOM 10887 H HB2  . ALA A 1 98  ? 3.004   -2.819  -2.594  1.00 1.01  ? 98  ALA A HB2  5  
ATOM 10888 H HB3  . ALA A 1 98  ? 4.381   -3.875  -2.899  1.00 1.00  ? 98  ALA A HB3  5  
ATOM 10889 N N    . LEU A 1 99  ? 6.272   -1.718  -2.859  1.00 0.17  ? 99  LEU A N    5  
ATOM 10890 C CA   . LEU A 1 99  ? 7.131   -0.968  -1.950  1.00 0.17  ? 99  LEU A CA   5  
ATOM 10891 C C    . LEU A 1 99  ? 7.788   0.193   -2.674  1.00 0.15  ? 99  LEU A C    5  
ATOM 10892 O O    . LEU A 1 99  ? 7.883   1.299   -2.146  1.00 0.15  ? 99  LEU A O    5  
ATOM 10893 C CB   . LEU A 1 99  ? 8.218   -1.859  -1.358  1.00 0.19  ? 99  LEU A CB   5  
ATOM 10894 C CG   . LEU A 1 99  ? 9.155   -1.138  -0.388  1.00 0.18  ? 99  LEU A CG   5  
ATOM 10895 C CD1  . LEU A 1 99  ? 8.372   -0.554  0.778   1.00 0.21  ? 99  LEU A CD1  5  
ATOM 10896 C CD2  . LEU A 1 99  ? 10.234  -2.074  0.116   1.00 0.22  ? 99  LEU A CD2  5  
ATOM 10897 H H    . LEU A 1 99  ? 6.582   -2.575  -3.226  1.00 0.19  ? 99  LEU A H    5  
ATOM 10898 H HA   . LEU A 1 99  ? 6.518   -0.587  -1.155  1.00 0.17  ? 99  LEU A HA   5  
ATOM 10899 H HB2  . LEU A 1 99  ? 7.742   -2.679  -0.836  1.00 0.23  ? 99  LEU A HB2  5  
ATOM 10900 H HB3  . LEU A 1 99  ? 8.808   -2.256  -2.170  1.00 0.21  ? 99  LEU A HB3  5  
ATOM 10901 H HG   . LEU A 1 99  ? 9.636   -0.322  -0.907  1.00 0.15  ? 99  LEU A HG   5  
ATOM 10902 H HD11 . LEU A 1 99  ? 9.052   -0.062  1.455   1.00 1.03  ? 99  LEU A HD11 5  
ATOM 10903 H HD12 . LEU A 1 99  ? 7.855   -1.346  1.297   1.00 1.02  ? 99  LEU A HD12 5  
ATOM 10904 H HD13 . LEU A 1 99  ? 7.653   0.162   0.405   1.00 1.06  ? 99  LEU A HD13 5  
ATOM 10905 H HD21 . LEU A 1 99  ? 10.816  -2.435  -0.717  1.00 0.97  ? 99  LEU A HD21 5  
ATOM 10906 H HD22 . LEU A 1 99  ? 9.778   -2.908  0.627   1.00 1.01  ? 99  LEU A HD22 5  
ATOM 10907 H HD23 . LEU A 1 99  ? 10.879  -1.538  0.801   1.00 1.07  ? 99  LEU A HD23 5  
ATOM 10908 N N    . ASP A 1 100 ? 8.210   -0.077  -3.897  1.00 0.15  ? 100 ASP A N    5  
ATOM 10909 C CA   . ASP A 1 100 ? 8.937   0.885   -4.707  1.00 0.16  ? 100 ASP A CA   5  
ATOM 10910 C C    . ASP A 1 100 ? 8.072   2.116   -4.951  1.00 0.15  ? 100 ASP A C    5  
ATOM 10911 O O    . ASP A 1 100 ? 8.569   3.228   -5.139  1.00 0.16  ? 100 ASP A O    5  
ATOM 10912 C CB   . ASP A 1 100 ? 9.333   0.209   -6.028  1.00 0.17  ? 100 ASP A CB   5  
ATOM 10913 C CG   . ASP A 1 100 ? 10.072  1.113   -6.992  1.00 0.20  ? 100 ASP A CG   5  
ATOM 10914 O OD1  . ASP A 1 100 ? 9.410   1.865   -7.742  1.00 0.26  ? 100 ASP A OD1  5  
ATOM 10915 O OD2  . ASP A 1 100 ? 11.316  1.040   -7.028  1.00 0.21  ? 100 ASP A OD2  5  
ATOM 10916 H H    . ASP A 1 100 ? 8.006   -0.953  -4.281  1.00 0.16  ? 100 ASP A H    5  
ATOM 10917 H HA   . ASP A 1 100 ? 9.825   1.176   -4.171  1.00 0.16  ? 100 ASP A HA   5  
ATOM 10918 H HB2  . ASP A 1 100 ? 9.970   -0.629  -5.807  1.00 0.19  ? 100 ASP A HB2  5  
ATOM 10919 H HB3  . ASP A 1 100 ? 8.442   -0.155  -6.515  1.00 0.16  ? 100 ASP A HB3  5  
ATOM 10920 N N    . LEU A 1 101 ? 6.768   1.892   -4.952  1.00 0.16  ? 101 LEU A N    5  
ATOM 10921 C CA   . LEU A 1 101 ? 5.801   2.956   -5.095  1.00 0.16  ? 101 LEU A CA   5  
ATOM 10922 C C    . LEU A 1 101 ? 5.387   3.538   -3.739  1.00 0.15  ? 101 LEU A C    5  
ATOM 10923 O O    . LEU A 1 101 ? 5.172   4.747   -3.610  1.00 0.16  ? 101 LEU A O    5  
ATOM 10924 C CB   . LEU A 1 101 ? 4.582   2.424   -5.839  1.00 0.19  ? 101 LEU A CB   5  
ATOM 10925 C CG   . LEU A 1 101 ? 4.878   1.816   -7.213  1.00 0.22  ? 101 LEU A CG   5  
ATOM 10926 C CD1  . LEU A 1 101 ? 3.597   1.329   -7.873  1.00 0.25  ? 101 LEU A CD1  5  
ATOM 10927 C CD2  . LEU A 1 101 ? 5.600   2.824   -8.102  1.00 0.25  ? 101 LEU A CD2  5  
ATOM 10928 H H    . LEU A 1 101 ? 6.446   0.970   -4.875  1.00 0.16  ? 101 LEU A H    5  
ATOM 10929 H HA   . LEU A 1 101 ? 6.258   3.739   -5.679  1.00 0.17  ? 101 LEU A HA   5  
ATOM 10930 H HB2  . LEU A 1 101 ? 4.110   1.666   -5.224  1.00 0.20  ? 101 LEU A HB2  5  
ATOM 10931 H HB3  . LEU A 1 101 ? 3.893   3.231   -5.968  1.00 0.19  ? 101 LEU A HB3  5  
ATOM 10932 H HG   . LEU A 1 101 ? 5.527   0.961   -7.080  1.00 0.23  ? 101 LEU A HG   5  
ATOM 10933 H HD11 . LEU A 1 101 ? 3.822   0.946   -8.857  1.00 0.87  ? 101 LEU A HD11 5  
ATOM 10934 H HD12 . LEU A 1 101 ? 2.897   2.149   -7.955  1.00 1.03  ? 101 LEU A HD12 5  
ATOM 10935 H HD13 . LEU A 1 101 ? 3.160   0.543   -7.274  1.00 1.01  ? 101 LEU A HD13 5  
ATOM 10936 H HD21 . LEU A 1 101 ? 6.531   3.114   -7.634  1.00 1.01  ? 101 LEU A HD21 5  
ATOM 10937 H HD22 . LEU A 1 101 ? 4.980   3.697   -8.235  1.00 1.02  ? 101 LEU A HD22 5  
ATOM 10938 H HD23 . LEU A 1 101 ? 5.808   2.378   -9.064  1.00 1.06  ? 101 LEU A HD23 5  
ATOM 10939 N N    . SER A 1 102 ? 5.284   2.684   -2.729  1.00 0.15  ? 102 SER A N    5  
ATOM 10940 C CA   . SER A 1 102 ? 4.789   3.099   -1.429  1.00 0.17  ? 102 SER A CA   5  
ATOM 10941 C C    . SER A 1 102 ? 5.763   4.046   -0.744  1.00 0.15  ? 102 SER A C    5  
ATOM 10942 O O    . SER A 1 102 ? 5.358   4.882   0.059   1.00 0.18  ? 102 SER A O    5  
ATOM 10943 C CB   . SER A 1 102 ? 4.534   1.879   -0.539  1.00 0.23  ? 102 SER A CB   5  
ATOM 10944 O OG   . SER A 1 102 ? 4.124   2.269   0.759   1.00 1.01  ? 102 SER A OG   5  
ATOM 10945 H H    . SER A 1 102 ? 5.546   1.751   -2.856  1.00 0.15  ? 102 SER A H    5  
ATOM 10946 H HA   . SER A 1 102 ? 3.855   3.614   -1.589  1.00 0.20  ? 102 SER A HA   5  
ATOM 10947 H HB2  . SER A 1 102 ? 3.757   1.273   -0.977  1.00 0.79  ? 102 SER A HB2  5  
ATOM 10948 H HB3  . SER A 1 102 ? 5.441   1.297   -0.459  1.00 1.05  ? 102 SER A HB3  5  
ATOM 10949 H HG   . SER A 1 102 ? 4.662   3.012   1.057   1.00 1.53  ? 102 SER A HG   5  
ATOM 10950 N N    . VAL A 1 103 ? 7.041   3.909   -1.062  1.00 0.15  ? 103 VAL A N    5  
ATOM 10951 C CA   . VAL A 1 103 ? 8.076   4.732   -0.452  1.00 0.16  ? 103 VAL A CA   5  
ATOM 10952 C C    . VAL A 1 103 ? 7.948   6.210   -0.835  1.00 0.16  ? 103 VAL A C    5  
ATOM 10953 O O    . VAL A 1 103 ? 7.866   7.057   0.043   1.00 0.18  ? 103 VAL A O    5  
ATOM 10954 C CB   . VAL A 1 103 ? 9.472   4.226   -0.814  1.00 0.18  ? 103 VAL A CB   5  
ATOM 10955 C CG1  . VAL A 1 103 ? 10.547  5.218   -0.390  1.00 0.21  ? 103 VAL A CG1  5  
ATOM 10956 C CG2  . VAL A 1 103 ? 9.722   2.879   -0.172  1.00 0.19  ? 103 VAL A CG2  5  
ATOM 10957 H H    . VAL A 1 103 ? 7.299   3.229   -1.724  1.00 0.15  ? 103 VAL A H    5  
ATOM 10958 H HA   . VAL A 1 103 ? 7.965   4.644   0.612   1.00 0.17  ? 103 VAL A HA   5  
ATOM 10959 H HB   . VAL A 1 103 ? 9.507   4.105   -1.889  1.00 0.18  ? 103 VAL A HB   5  
ATOM 10960 H HG11 . VAL A 1 103 ? 11.510  4.879   -0.741  1.00 1.02  ? 103 VAL A HG11 5  
ATOM 10961 H HG12 . VAL A 1 103 ? 10.564  5.293   0.687   1.00 1.06  ? 103 VAL A HG12 5  
ATOM 10962 H HG13 . VAL A 1 103 ? 10.330  6.186   -0.814  1.00 1.00  ? 103 VAL A HG13 5  
ATOM 10963 H HG21 . VAL A 1 103 ? 10.778  2.673   -0.181  1.00 1.03  ? 103 VAL A HG21 5  
ATOM 10964 H HG22 . VAL A 1 103 ? 9.199   2.112   -0.726  1.00 1.00  ? 103 VAL A HG22 5  
ATOM 10965 H HG23 . VAL A 1 103 ? 9.365   2.894   0.848   1.00 1.03  ? 103 VAL A HG23 5  
ATOM 10966 N N    . PRO A 1 104 ? 7.936   6.551   -2.138  1.00 0.17  ? 104 PRO A N    5  
ATOM 10967 C CA   . PRO A 1 104 ? 7.706   7.934   -2.579  1.00 0.21  ? 104 PRO A CA   5  
ATOM 10968 C C    . PRO A 1 104 ? 6.313   8.432   -2.192  1.00 0.19  ? 104 PRO A C    5  
ATOM 10969 O O    . PRO A 1 104 ? 6.047   9.637   -2.177  1.00 0.22  ? 104 PRO A O    5  
ATOM 10970 C CB   . PRO A 1 104 ? 7.860   7.864   -4.102  1.00 0.27  ? 104 PRO A CB   5  
ATOM 10971 C CG   . PRO A 1 104 ? 7.678   6.426   -4.442  1.00 0.21  ? 104 PRO A CG   5  
ATOM 10972 C CD   . PRO A 1 104 ? 8.203   5.657   -3.275  1.00 0.17  ? 104 PRO A CD   5  
ATOM 10973 H HA   . PRO A 1 104 ? 8.450   8.602   -2.171  1.00 0.24  ? 104 PRO A HA   5  
ATOM 10974 H HB2  . PRO A 1 104 ? 7.108   8.480   -4.573  1.00 0.38  ? 104 PRO A HB2  5  
ATOM 10975 H HB3  . PRO A 1 104 ? 8.844   8.209   -4.380  1.00 0.41  ? 104 PRO A HB3  5  
ATOM 10976 H HG2  . PRO A 1 104 ? 6.632   6.210   -4.591  1.00 0.31  ? 104 PRO A HG2  5  
ATOM 10977 H HG3  . PRO A 1 104 ? 8.244   6.184   -5.325  1.00 0.33  ? 104 PRO A HG3  5  
ATOM 10978 H HD2  . PRO A 1 104 ? 7.677   4.719   -3.168  1.00 0.16  ? 104 PRO A HD2  5  
ATOM 10979 H HD3  . PRO A 1 104 ? 9.264   5.485   -3.387  1.00 0.20  ? 104 PRO A HD3  5  
ATOM 10980 N N    . LEU A 1 105 ? 5.421   7.492   -1.898  1.00 0.18  ? 105 LEU A N    5  
ATOM 10981 C CA   . LEU A 1 105 ? 4.100   7.821   -1.386  1.00 0.19  ? 105 LEU A CA   5  
ATOM 10982 C C    . LEU A 1 105 ? 4.128   8.024   0.126   1.00 0.22  ? 105 LEU A C    5  
ATOM 10983 O O    . LEU A 1 105 ? 3.169   8.525   0.713   1.00 0.32  ? 105 LEU A O    5  
ATOM 10984 C CB   . LEU A 1 105 ? 3.112   6.715   -1.738  1.00 0.18  ? 105 LEU A CB   5  
ATOM 10985 C CG   . LEU A 1 105 ? 2.654   6.688   -3.195  1.00 0.25  ? 105 LEU A CG   5  
ATOM 10986 C CD1  . LEU A 1 105 ? 1.440   5.794   -3.344  1.00 0.53  ? 105 LEU A CD1  5  
ATOM 10987 C CD2  . LEU A 1 105 ? 2.344   8.094   -3.692  1.00 0.64  ? 105 LEU A CD2  5  
ATOM 10988 H H    . LEU A 1 105 ? 5.656   6.547   -2.049  1.00 0.18  ? 105 LEU A H    5  
ATOM 10989 H HA   . LEU A 1 105 ? 3.781   8.739   -1.856  1.00 0.22  ? 105 LEU A HA   5  
ATOM 10990 H HB2  . LEU A 1 105 ? 3.593   5.765   -1.521  1.00 0.15  ? 105 LEU A HB2  5  
ATOM 10991 H HB3  . LEU A 1 105 ? 2.242   6.816   -1.109  1.00 0.22  ? 105 LEU A HB3  5  
ATOM 10992 H HG   . LEU A 1 105 ? 3.446   6.278   -3.804  1.00 0.63  ? 105 LEU A HG   5  
ATOM 10993 H HD11 . LEU A 1 105 ? 1.693   4.789   -3.040  1.00 1.26  ? 105 LEU A HD11 5  
ATOM 10994 H HD12 . LEU A 1 105 ? 1.123   5.788   -4.376  1.00 1.14  ? 105 LEU A HD12 5  
ATOM 10995 H HD13 . LEU A 1 105 ? 0.643   6.169   -2.723  1.00 1.09  ? 105 LEU A HD13 5  
ATOM 10996 H HD21 . LEU A 1 105 ? 1.522   8.502   -3.125  1.00 1.17  ? 105 LEU A HD21 5  
ATOM 10997 H HD22 . LEU A 1 105 ? 2.080   8.055   -4.738  1.00 1.35  ? 105 LEU A HD22 5  
ATOM 10998 H HD23 . LEU A 1 105 ? 3.215   8.722   -3.564  1.00 1.29  ? 105 LEU A HD23 5  
ATOM 10999 N N    . MET A 1 106 ? 5.212   7.599   0.753   1.00 0.20  ? 106 MET A N    5  
ATOM 11000 C CA   . MET A 1 106 ? 5.385   7.746   2.188   1.00 0.24  ? 106 MET A CA   5  
ATOM 11001 C C    . MET A 1 106 ? 6.397   8.857   2.508   1.00 0.21  ? 106 MET A C    5  
ATOM 11002 O O    . MET A 1 106 ? 7.394   9.023   1.806   1.00 0.26  ? 106 MET A O    5  
ATOM 11003 C CB   . MET A 1 106 ? 5.812   6.393   2.796   1.00 0.33  ? 106 MET A CB   5  
ATOM 11004 C CG   . MET A 1 106 ? 6.922   6.493   3.829   1.00 0.53  ? 106 MET A CG   5  
ATOM 11005 S SD   . MET A 1 106 ? 6.971   5.091   4.975   1.00 0.78  ? 106 MET A SD   5  
ATOM 11006 C CE   . MET A 1 106 ? 6.995   3.692   3.877   1.00 0.54  ? 106 MET A CE   5  
ATOM 11007 H H    . MET A 1 106 ? 5.926   7.162   0.232   1.00 0.21  ? 106 MET A H    5  
ATOM 11008 H HA   . MET A 1 106 ? 4.428   8.026   2.603   1.00 0.30  ? 106 MET A HA   5  
ATOM 11009 H HB2  . MET A 1 106 ? 4.954   5.940   3.272   1.00 0.74  ? 106 MET A HB2  5  
ATOM 11010 H HB3  . MET A 1 106 ? 6.150   5.746   1.999   1.00 0.76  ? 106 MET A HB3  5  
ATOM 11011 H HG2  . MET A 1 106 ? 7.870   6.559   3.318   1.00 0.87  ? 106 MET A HG2  5  
ATOM 11012 H HG3  . MET A 1 106 ? 6.757   7.399   4.405   1.00 0.79  ? 106 MET A HG3  5  
ATOM 11013 H HE1  . MET A 1 106 ? 6.948   2.784   4.466   1.00 1.31  ? 106 MET A HE1  5  
ATOM 11014 H HE2  . MET A 1 106 ? 7.904   3.702   3.296   1.00 1.14  ? 106 MET A HE2  5  
ATOM 11015 H HE3  . MET A 1 106 ? 6.141   3.737   3.218   1.00 1.28  ? 106 MET A HE3  5  
ATOM 11016 N N    . ASP A 1 107 ? 6.120   9.630   3.552   1.00 0.18  ? 107 ASP A N    5  
ATOM 11017 C CA   . ASP A 1 107 ? 7.024   10.694  3.981   1.00 0.18  ? 107 ASP A CA   5  
ATOM 11018 C C    . ASP A 1 107 ? 8.175   10.110  4.773   1.00 0.14  ? 107 ASP A C    5  
ATOM 11019 O O    . ASP A 1 107 ? 8.044   9.052   5.393   1.00 0.13  ? 107 ASP A O    5  
ATOM 11020 C CB   . ASP A 1 107 ? 6.294   11.738  4.830   1.00 0.25  ? 107 ASP A CB   5  
ATOM 11021 C CG   . ASP A 1 107 ? 5.459   12.686  4.001   1.00 0.56  ? 107 ASP A CG   5  
ATOM 11022 O OD1  . ASP A 1 107 ? 4.446   12.236  3.429   1.00 0.92  ? 107 ASP A OD1  5  
ATOM 11023 O OD2  . ASP A 1 107 ? 5.794   13.883  3.925   1.00 0.97  ? 107 ASP A OD2  5  
ATOM 11024 H H    . ASP A 1 107 ? 5.288   9.475   4.067   1.00 0.20  ? 107 ASP A H    5  
ATOM 11025 H HA   . ASP A 1 107 ? 7.419   11.173  3.095   1.00 0.21  ? 107 ASP A HA   5  
ATOM 11026 H HB2  . ASP A 1 107 ? 5.645   11.238  5.530   1.00 0.58  ? 107 ASP A HB2  5  
ATOM 11027 H HB3  . ASP A 1 107 ? 7.024   12.317  5.376   1.00 0.60  ? 107 ASP A HB3  5  
ATOM 11028 N N    . VAL A 1 108 ? 9.313   10.782  4.751   1.00 0.16  ? 108 VAL A N    5  
ATOM 11029 C CA   . VAL A 1 108 ? 10.461  10.292  5.482   1.00 0.16  ? 108 VAL A CA   5  
ATOM 11030 C C    . VAL A 1 108 ? 10.174  10.329  6.979   1.00 0.15  ? 108 VAL A C    5  
ATOM 11031 O O    . VAL A 1 108 ? 9.730   11.340  7.528   1.00 0.19  ? 108 VAL A O    5  
ATOM 11032 C CB   . VAL A 1 108 ? 11.755  11.077  5.136   1.00 0.21  ? 108 VAL A CB   5  
ATOM 11033 C CG1  . VAL A 1 108 ? 12.010  12.251  6.073   1.00 0.68  ? 108 VAL A CG1  5  
ATOM 11034 C CG2  . VAL A 1 108 ? 12.954  10.141  5.109   1.00 0.80  ? 108 VAL A CG2  5  
ATOM 11035 H H    . VAL A 1 108 ? 9.383   11.603  4.227   1.00 0.20  ? 108 VAL A H    5  
ATOM 11036 H HA   . VAL A 1 108 ? 10.609  9.261   5.192   1.00 0.16  ? 108 VAL A HA   5  
ATOM 11037 H HB   . VAL A 1 108 ? 11.629  11.481  4.143   1.00 0.63  ? 108 VAL A HB   5  
ATOM 11038 H HG11 . VAL A 1 108 ? 12.189  11.884  7.072   1.00 1.22  ? 108 VAL A HG11 5  
ATOM 11039 H HG12 . VAL A 1 108 ? 11.150  12.901  6.080   1.00 1.47  ? 108 VAL A HG12 5  
ATOM 11040 H HG13 . VAL A 1 108 ? 12.876  12.802  5.732   1.00 1.26  ? 108 VAL A HG13 5  
ATOM 11041 H HG21 . VAL A 1 108 ? 13.830  10.692  4.802   1.00 1.43  ? 108 VAL A HG21 5  
ATOM 11042 H HG22 . VAL A 1 108 ? 12.770  9.339   4.411   1.00 1.43  ? 108 VAL A HG22 5  
ATOM 11043 H HG23 . VAL A 1 108 ? 13.114  9.732   6.094   1.00 1.25  ? 108 VAL A HG23 5  
ATOM 11044 N N    . GLY A 1 109 ? 10.359  9.193   7.610   1.00 0.15  ? 109 GLY A N    5  
ATOM 11045 C CA   . GLY A 1 109 ? 10.185  9.104   9.038   1.00 0.17  ? 109 GLY A CA   5  
ATOM 11046 C C    . GLY A 1 109 ? 8.808   8.611   9.414   1.00 0.18  ? 109 GLY A C    5  
ATOM 11047 O O    . GLY A 1 109 ? 8.426   8.667   10.585  1.00 0.28  ? 109 GLY A O    5  
ATOM 11048 H H    . GLY A 1 109 ? 10.582  8.389   7.092   1.00 0.16  ? 109 GLY A H    5  
ATOM 11049 H HA2  . GLY A 1 109 ? 10.924  8.425   9.438   1.00 0.18  ? 109 GLY A HA2  5  
ATOM 11050 H HA3  . GLY A 1 109 ? 10.333  10.081  9.472   1.00 0.18  ? 109 GLY A HA3  5  
ATOM 11051 N N    . GLU A 1 110 ? 8.052   8.130   8.434   1.00 0.13  ? 110 GLU A N    5  
ATOM 11052 C CA   . GLU A 1 110 ? 6.737   7.589   8.711   1.00 0.13  ? 110 GLU A CA   5  
ATOM 11053 C C    . GLU A 1 110 ? 6.756   6.079   8.632   1.00 0.10  ? 110 GLU A C    5  
ATOM 11054 O O    . GLU A 1 110 ? 7.749   5.470   8.227   1.00 0.12  ? 110 GLU A O    5  
ATOM 11055 C CB   . GLU A 1 110 ? 5.658   8.133   7.768   1.00 0.17  ? 110 GLU A CB   5  
ATOM 11056 C CG   . GLU A 1 110 ? 5.600   7.478   6.409   1.00 0.20  ? 110 GLU A CG   5  
ATOM 11057 C CD   . GLU A 1 110 ? 4.324   7.772   5.627   1.00 0.27  ? 110 GLU A CD   5  
ATOM 11058 O OE1  . GLU A 1 110 ? 4.045   8.964   5.347   1.00 0.41  ? 110 GLU A OE1  5  
ATOM 11059 O OE2  . GLU A 1 110 ? 3.578   6.828   5.318   1.00 0.39  ? 110 GLU A OE2  5  
ATOM 11060 H H    . GLU A 1 110 ? 8.388   8.128   7.512   1.00 0.13  ? 110 GLU A H    5  
ATOM 11061 H HA   . GLU A 1 110 ? 6.484   7.866   9.723   1.00 0.15  ? 110 GLU A HA   5  
ATOM 11062 H HB2  . GLU A 1 110 ? 4.697   7.988   8.242   1.00 0.18  ? 110 GLU A HB2  5  
ATOM 11063 H HB3  . GLU A 1 110 ? 5.821   9.193   7.630   1.00 0.23  ? 110 GLU A HB3  5  
ATOM 11064 H HG2  . GLU A 1 110 ? 6.441   7.823   5.827   1.00 0.25  ? 110 GLU A HG2  5  
ATOM 11065 H HG3  . GLU A 1 110 ? 5.679   6.409   6.543   1.00 0.20  ? 110 GLU A HG3  5  
ATOM 11066 N N    . THR A 1 111 ? 5.668   5.481   9.058   1.00 0.10  ? 111 THR A N    5  
ATOM 11067 C CA   . THR A 1 111 ? 5.504   4.058   8.970   1.00 0.11  ? 111 THR A CA   5  
ATOM 11068 C C    . THR A 1 111 ? 4.132   3.768   8.406   1.00 0.11  ? 111 THR A C    5  
ATOM 11069 O O    . THR A 1 111 ? 3.116   4.169   8.978   1.00 0.12  ? 111 THR A O    5  
ATOM 11070 C CB   . THR A 1 111 ? 5.654   3.392   10.340  1.00 0.16  ? 111 THR A CB   5  
ATOM 11071 O OG1  . THR A 1 111 ? 6.816   3.903   11.006  1.00 0.22  ? 111 THR A OG1  5  
ATOM 11072 C CG2  . THR A 1 111 ? 5.768   1.882   10.209  1.00 0.19  ? 111 THR A CG2  5  
ATOM 11073 H H    . THR A 1 111 ? 4.927   6.021   9.403   1.00 0.12  ? 111 THR A H    5  
ATOM 11074 H HA   . THR A 1 111 ? 6.253   3.671   8.307   1.00 0.14  ? 111 THR A HA   5  
ATOM 11075 H HB   . THR A 1 111 ? 4.780   3.622   10.919  1.00 0.17  ? 111 THR A HB   5  
ATOM 11076 H HG1  . THR A 1 111 ? 7.281   4.507   10.417  1.00 0.27  ? 111 THR A HG1  5  
ATOM 11077 H HG21 . THR A 1 111 ? 6.625   1.638   9.598   1.00 1.07  ? 111 THR A HG21 5  
ATOM 11078 H HG22 . THR A 1 111 ? 4.874   1.493   9.747   1.00 1.02  ? 111 THR A HG22 5  
ATOM 11079 H HG23 . THR A 1 111 ? 5.883   1.442   11.191  1.00 1.01  ? 111 THR A HG23 5  
ATOM 11080 N N    . ALA A 1 112 ? 4.108   3.106   7.273   1.00 0.12  ? 112 ALA A N    5  
ATOM 11081 C CA   . ALA A 1 112 ? 2.867   2.839   6.589   1.00 0.13  ? 112 ALA A CA   5  
ATOM 11082 C C    . ALA A 1 112 ? 2.613   1.348   6.505   1.00 0.12  ? 112 ALA A C    5  
ATOM 11083 O O    . ALA A 1 112 ? 3.531   0.565   6.267   1.00 0.13  ? 112 ALA A O    5  
ATOM 11084 C CB   . ALA A 1 112 ? 2.896   3.451   5.200   1.00 0.18  ? 112 ALA A CB   5  
ATOM 11085 H H    . ALA A 1 112 ? 4.951   2.778   6.888   1.00 0.14  ? 112 ALA A H    5  
ATOM 11086 H HA   . ALA A 1 112 ? 2.069   3.304   7.146   1.00 0.14  ? 112 ALA A HA   5  
ATOM 11087 H HB1  . ALA A 1 112 ? 3.692   3.002   4.628   1.00 1.00  ? 112 ALA A HB1  5  
ATOM 11088 H HB2  . ALA A 1 112 ? 3.063   4.516   5.276   1.00 0.96  ? 112 ALA A HB2  5  
ATOM 11089 H HB3  . ALA A 1 112 ? 1.953   3.265   4.707   1.00 0.95  ? 112 ALA A HB3  5  
ATOM 11090 N N    . MET A 1 113 ? 1.371   0.967   6.703   1.00 0.12  ? 113 MET A N    5  
ATOM 11091 C CA   . MET A 1 113 ? 0.964   -0.410  6.521   1.00 0.12  ? 113 MET A CA   5  
ATOM 11092 C C    . MET A 1 113 ? 0.355   -0.528  5.153   1.00 0.12  ? 113 MET A C    5  
ATOM 11093 O O    . MET A 1 113 ? -0.654  0.107   4.858   1.00 0.14  ? 113 MET A O    5  
ATOM 11094 C CB   . MET A 1 113 ? -0.049  -0.828  7.589   1.00 0.16  ? 113 MET A CB   5  
ATOM 11095 C CG   . MET A 1 113 ? -0.724  -2.165  7.307   1.00 0.25  ? 113 MET A CG   5  
ATOM 11096 S SD   . MET A 1 113 ? -1.838  -2.674  8.628   1.00 0.53  ? 113 MET A SD   5  
ATOM 11097 C CE   . MET A 1 113 ? -2.365  -4.270  8.017   1.00 1.32  ? 113 MET A CE   5  
ATOM 11098 H H    . MET A 1 113 ? 0.696   1.642   6.944   1.00 0.13  ? 113 MET A H    5  
ATOM 11099 H HA   . MET A 1 113 ? 1.840   -1.045  6.575   1.00 0.13  ? 113 MET A HA   5  
ATOM 11100 H HB2  . MET A 1 113 ? 0.456   -0.897  8.541   1.00 0.19  ? 113 MET A HB2  5  
ATOM 11101 H HB3  . MET A 1 113 ? -0.816  -0.070  7.654   1.00 0.18  ? 113 MET A HB3  5  
ATOM 11102 H HG2  . MET A 1 113 ? -1.298  -2.071  6.396   1.00 0.27  ? 113 MET A HG2  5  
ATOM 11103 H HG3  . MET A 1 113 ? 0.032   -2.924  7.179   1.00 0.25  ? 113 MET A HG3  5  
ATOM 11104 H HE1  . MET A 1 113 ? -2.830  -4.149  7.053   1.00 1.94  ? 113 MET A HE1  5  
ATOM 11105 H HE2  . MET A 1 113 ? -3.073  -4.709  8.708   1.00 1.89  ? 113 MET A HE2  5  
ATOM 11106 H HE3  . MET A 1 113 ? -1.506  -4.917  7.920   1.00 1.90  ? 113 MET A HE3  5  
ATOM 11107 N N    . VAL A 1 114 ? 0.976   -1.319  4.320   1.00 0.12  ? 114 VAL A N    5  
ATOM 11108 C CA   . VAL A 1 114 ? 0.546   -1.444  2.953   1.00 0.12  ? 114 VAL A CA   5  
ATOM 11109 C C    . VAL A 1 114 ? 0.073   -2.845  2.707   1.00 0.13  ? 114 VAL A C    5  
ATOM 11110 O O    . VAL A 1 114 ? 0.746   -3.816  3.061   1.00 0.16  ? 114 VAL A O    5  
ATOM 11111 C CB   . VAL A 1 114 ? 1.689   -1.129  1.972   1.00 0.15  ? 114 VAL A CB   5  
ATOM 11112 C CG1  . VAL A 1 114 ? 1.177   -0.841  0.570   1.00 0.18  ? 114 VAL A CG1  5  
ATOM 11113 C CG2  . VAL A 1 114 ? 2.527   0.017   2.487   1.00 0.17  ? 114 VAL A CG2  5  
ATOM 11114 H H    . VAL A 1 114 ? 1.758   -1.839  4.633   1.00 0.12  ? 114 VAL A H    5  
ATOM 11115 H HA   . VAL A 1 114 ? -0.269  -0.754  2.782   1.00 0.13  ? 114 VAL A HA   5  
ATOM 11116 H HB   . VAL A 1 114 ? 2.313   -1.996  1.917   1.00 0.16  ? 114 VAL A HB   5  
ATOM 11117 H HG11 . VAL A 1 114 ? 0.534   0.030   0.595   1.00 1.06  ? 114 VAL A HG11 5  
ATOM 11118 H HG12 . VAL A 1 114 ? 0.619   -1.690  0.206   1.00 1.03  ? 114 VAL A HG12 5  
ATOM 11119 H HG13 . VAL A 1 114 ? 2.013   -0.649  -0.085  1.00 1.01  ? 114 VAL A HG13 5  
ATOM 11120 H HG21 . VAL A 1 114 ? 2.949   -0.254  3.442   1.00 0.97  ? 114 VAL A HG21 5  
ATOM 11121 H HG22 . VAL A 1 114 ? 1.903   0.889   2.601   1.00 0.98  ? 114 VAL A HG22 5  
ATOM 11122 H HG23 . VAL A 1 114 ? 3.318   0.223   1.785   1.00 0.95  ? 114 VAL A HG23 5  
ATOM 11123 N N    . THR A 1 115 ? -1.091  -2.961  2.136   1.00 0.14  ? 115 THR A N    5  
ATOM 11124 C CA   . THR A 1 115 ? -1.547  -4.235  1.698   1.00 0.14  ? 115 THR A CA   5  
ATOM 11125 C C    . THR A 1 115 ? -1.480  -4.272  0.198   1.00 0.13  ? 115 THR A C    5  
ATOM 11126 O O    . THR A 1 115 ? -2.162  -3.516  -0.496  1.00 0.16  ? 115 THR A O    5  
ATOM 11127 C CB   . THR A 1 115 ? -2.957  -4.568  2.188   1.00 0.17  ? 115 THR A CB   5  
ATOM 11128 O OG1  . THR A 1 115 ? -3.000  -4.514  3.616   1.00 0.21  ? 115 THR A OG1  5  
ATOM 11129 C CG2  . THR A 1 115 ? -3.336  -5.954  1.738   1.00 0.20  ? 115 THR A CG2  5  
ATOM 11130 H H    . THR A 1 115 ? -1.642  -2.163  1.980   1.00 0.16  ? 115 THR A H    5  
ATOM 11131 H HA   . THR A 1 115 ? -0.867  -4.980  2.089   1.00 0.15  ? 115 THR A HA   5  
ATOM 11132 H HB   . THR A 1 115 ? -3.656  -3.856  1.775   1.00 0.18  ? 115 THR A HB   5  
ATOM 11133 H HG1  . THR A 1 115 ? -2.105  -4.406  3.952   1.00 0.68  ? 115 THR A HG1  5  
ATOM 11134 H HG21 . THR A 1 115 ? -2.555  -6.638  2.035   1.00 1.03  ? 115 THR A HG21 5  
ATOM 11135 H HG22 . THR A 1 115 ? -3.439  -5.964  0.665   1.00 1.00  ? 115 THR A HG22 5  
ATOM 11136 H HG23 . THR A 1 115 ? -4.265  -6.243  2.200   1.00 1.02  ? 115 THR A HG23 5  
ATOM 11137 N N    . ALA A 1 116 ? -0.610  -5.124  -0.274  1.00 0.12  ? 116 ALA A N    5  
ATOM 11138 C CA   . ALA A 1 116 ? -0.360  -5.276  -1.688  1.00 0.13  ? 116 ALA A CA   5  
ATOM 11139 C C    . ALA A 1 116 ? -0.592  -6.707  -2.092  1.00 0.12  ? 116 ALA A C    5  
ATOM 11140 O O    . ALA A 1 116 ? -0.176  -7.621  -1.387  1.00 0.13  ? 116 ALA A O    5  
ATOM 11141 C CB   . ALA A 1 116 ? 1.061   -4.863  -2.010  1.00 0.15  ? 116 ALA A CB   5  
ATOM 11142 H H    . ALA A 1 116 ? -0.113  -5.686  0.365   1.00 0.13  ? 116 ALA A H    5  
ATOM 11143 H HA   . ALA A 1 116 ? -1.033  -4.634  -2.239  1.00 0.14  ? 116 ALA A HA   5  
ATOM 11144 H HB1  . ALA A 1 116 ? 1.751   -5.512  -1.491  1.00 1.01  ? 116 ALA A HB1  5  
ATOM 11145 H HB2  . ALA A 1 116 ? 1.221   -3.842  -1.691  1.00 0.97  ? 116 ALA A HB2  5  
ATOM 11146 H HB3  . ALA A 1 116 ? 1.227   -4.939  -3.073  1.00 0.99  ? 116 ALA A HB3  5  
ATOM 11147 N N    . ASP A 1 117 ? -1.276  -6.908  -3.203  1.00 0.13  ? 117 ASP A N    5  
ATOM 11148 C CA   . ASP A 1 117 ? -1.410  -8.245  -3.746  1.00 0.13  ? 117 ASP A CA   5  
ATOM 11149 C C    . ASP A 1 117 ? -0.023  -8.829  -3.955  1.00 0.11  ? 117 ASP A C    5  
ATOM 11150 O O    . ASP A 1 117 ? 0.927   -8.095  -4.239  1.00 0.12  ? 117 ASP A O    5  
ATOM 11151 C CB   . ASP A 1 117 ? -2.151  -8.240  -5.070  1.00 0.16  ? 117 ASP A CB   5  
ATOM 11152 C CG   . ASP A 1 117 ? -2.604  -9.635  -5.471  1.00 0.20  ? 117 ASP A CG   5  
ATOM 11153 O OD1  . ASP A 1 117 ? -1.754  -10.432 -5.937  1.00 0.50  ? 117 ASP A OD1  5  
ATOM 11154 O OD2  . ASP A 1 117 ? -3.802  -9.937  -5.330  1.00 0.58  ? 117 ASP A OD2  5  
ATOM 11155 H H    . ASP A 1 117 ? -1.720  -6.146  -3.647  1.00 0.15  ? 117 ASP A H    5  
ATOM 11156 H HA   . ASP A 1 117 ? -1.945  -8.850  -3.038  1.00 0.14  ? 117 ASP A HA   5  
ATOM 11157 H HB2  . ASP A 1 117 ? -3.007  -7.587  -5.010  1.00 0.20  ? 117 ASP A HB2  5  
ATOM 11158 H HB3  . ASP A 1 117 ? -1.483  -7.876  -5.825  1.00 0.16  ? 117 ASP A HB3  5  
ATOM 11159 N N    . SER A 1 118 ? 0.093   -10.137 -3.823  1.00 0.13  ? 118 SER A N    5  
ATOM 11160 C CA   . SER A 1 118 ? 1.372   -10.812 -3.955  1.00 0.16  ? 118 SER A CA   5  
ATOM 11161 C C    . SER A 1 118 ? 1.983   -10.517 -5.322  1.00 0.13  ? 118 SER A C    5  
ATOM 11162 O O    . SER A 1 118 ? 3.193   -10.524 -5.493  1.00 0.15  ? 118 SER A O    5  
ATOM 11163 C CB   . SER A 1 118 ? 1.186   -12.311 -3.768  1.00 0.27  ? 118 SER A CB   5  
ATOM 11164 O OG   . SER A 1 118 ? 2.390   -12.940 -3.376  1.00 0.82  ? 118 SER A OG   5  
ATOM 11165 H H    . SER A 1 118 ? -0.709  -10.666 -3.633  1.00 0.16  ? 118 SER A H    5  
ATOM 11166 H HA   . SER A 1 118 ? 2.031   -10.435 -3.188  1.00 0.20  ? 118 SER A HA   5  
ATOM 11167 H HB2  . SER A 1 118 ? 0.443   -12.484 -3.005  1.00 0.43  ? 118 SER A HB2  5  
ATOM 11168 H HB3  . SER A 1 118 ? 0.851   -12.746 -4.702  1.00 0.38  ? 118 SER A HB3  5  
ATOM 11169 H HG   . SER A 1 118 ? 2.194   -13.818 -3.025  1.00 1.04  ? 118 SER A HG   5  
ATOM 11170 N N    . LYS A 1 119 ? 1.136   -10.243 -6.291  1.00 0.13  ? 119 LYS A N    5  
ATOM 11171 C CA   . LYS A 1 119 ? 1.579   -9.837  -7.617  1.00 0.14  ? 119 LYS A CA   5  
ATOM 11172 C C    . LYS A 1 119 ? 2.506   -8.609  -7.542  1.00 0.14  ? 119 LYS A C    5  
ATOM 11173 O O    . LYS A 1 119 ? 3.419   -8.467  -8.357  1.00 0.18  ? 119 LYS A O    5  
ATOM 11174 C CB   . LYS A 1 119 ? 0.363   -9.539  -8.490  1.00 0.17  ? 119 LYS A CB   5  
ATOM 11175 C CG   . LYS A 1 119 ? -0.555  -8.508  -7.882  1.00 0.19  ? 119 LYS A CG   5  
ATOM 11176 C CD   . LYS A 1 119 ? -1.678  -8.114  -8.818  1.00 0.29  ? 119 LYS A CD   5  
ATOM 11177 C CE   . LYS A 1 119 ? -2.755  -9.177  -8.911  1.00 0.38  ? 119 LYS A CE   5  
ATOM 11178 N NZ   . LYS A 1 119 ? -3.780  -8.810  -9.922  1.00 0.81  ? 119 LYS A NZ   5  
ATOM 11179 H H    . LYS A 1 119 ? 0.174   -10.322 -6.113  1.00 0.13  ? 119 LYS A H    5  
ATOM 11180 H HA   . LYS A 1 119 ? 2.128   -10.661 -8.051  1.00 0.17  ? 119 LYS A HA   5  
ATOM 11181 H HB2  . LYS A 1 119 ? 0.702   -9.159  -9.435  1.00 0.19  ? 119 LYS A HB2  5  
ATOM 11182 H HB3  . LYS A 1 119 ? -0.193  -10.457 -8.645  1.00 0.21  ? 119 LYS A HB3  5  
ATOM 11183 H HG2  . LYS A 1 119 ? -0.985  -8.915  -6.977  1.00 0.18  ? 119 LYS A HG2  5  
ATOM 11184 H HG3  . LYS A 1 119 ? 0.029   -7.632  -7.639  1.00 0.20  ? 119 LYS A HG3  5  
ATOM 11185 H HD2  . LYS A 1 119 ? -2.127  -7.209  -8.448  1.00 0.33  ? 119 LYS A HD2  5  
ATOM 11186 H HD3  . LYS A 1 119 ? -1.269  -7.940  -9.803  1.00 0.34  ? 119 LYS A HD3  5  
ATOM 11187 H HE2  . LYS A 1 119 ? -2.295  -10.117 -9.187  1.00 0.57  ? 119 LYS A HE2  5  
ATOM 11188 H HE3  . LYS A 1 119 ? -3.227  -9.277  -7.945  1.00 0.72  ? 119 LYS A HE3  5  
ATOM 11189 H HZ1  . LYS A 1 119 ? -4.658  -9.347  -9.765  1.00 1.31  ? 119 LYS A HZ1  5  
ATOM 11190 H HZ2  . LYS A 1 119 ? -3.426  -9.021  -10.880 1.00 1.31  ? 119 LYS A HZ2  5  
ATOM 11191 H HZ3  . LYS A 1 119 ? -3.993  -7.792  -9.863  1.00 1.43  ? 119 LYS A HZ3  5  
ATOM 11192 N N    . TYR A 1 120 ? 2.286   -7.730  -6.556  1.00 0.13  ? 120 TYR A N    5  
ATOM 11193 C CA   . TYR A 1 120 ? 3.175   -6.589  -6.345  1.00 0.15  ? 120 TYR A CA   5  
ATOM 11194 C C    . TYR A 1 120 ? 4.123   -6.879  -5.201  1.00 0.15  ? 120 TYR A C    5  
ATOM 11195 O O    . TYR A 1 120 ? 4.831   -5.996  -4.718  1.00 0.19  ? 120 TYR A O    5  
ATOM 11196 C CB   . TYR A 1 120 ? 2.380   -5.305  -6.071  1.00 0.16  ? 120 TYR A CB   5  
ATOM 11197 C CG   . TYR A 1 120 ? 1.475   -4.933  -7.205  1.00 0.20  ? 120 TYR A CG   5  
ATOM 11198 C CD1  . TYR A 1 120 ? 1.958   -4.254  -8.309  1.00 0.28  ? 120 TYR A CD1  5  
ATOM 11199 C CD2  . TYR A 1 120 ? 0.143   -5.299  -7.183  1.00 0.23  ? 120 TYR A CD2  5  
ATOM 11200 C CE1  . TYR A 1 120 ? 1.126   -3.947  -9.369  1.00 0.34  ? 120 TYR A CE1  5  
ATOM 11201 C CE2  . TYR A 1 120 ? -0.694  -4.992  -8.225  1.00 0.30  ? 120 TYR A CE2  5  
ATOM 11202 C CZ   . TYR A 1 120 ? -0.203  -4.324  -9.320  1.00 0.34  ? 120 TYR A CZ   5  
ATOM 11203 O OH   . TYR A 1 120 ? -1.041  -4.041  -10.370 1.00 0.42  ? 120 TYR A OH   5  
ATOM 11204 H H    . TYR A 1 120 ? 1.511   -7.851  -5.953  1.00 0.12  ? 120 TYR A H    5  
ATOM 11205 H HA   . TYR A 1 120 ? 3.757   -6.460  -7.244  1.00 0.17  ? 120 TYR A HA   5  
ATOM 11206 H HB2  . TYR A 1 120 ? 1.764   -5.437  -5.194  1.00 0.16  ? 120 TYR A HB2  5  
ATOM 11207 H HB3  . TYR A 1 120 ? 3.068   -4.487  -5.908  1.00 0.18  ? 120 TYR A HB3  5  
ATOM 11208 H HD1  . TYR A 1 120 ? 3.002   -3.959  -8.328  1.00 0.32  ? 120 TYR A HD1  5  
ATOM 11209 H HD2  . TYR A 1 120 ? -0.243  -5.823  -6.321  1.00 0.25  ? 120 TYR A HD2  5  
ATOM 11210 H HE1  . TYR A 1 120 ? 1.514   -3.416  -10.224 1.00 0.41  ? 120 TYR A HE1  5  
ATOM 11211 H HE2  . TYR A 1 120 ? -1.730  -5.288  -8.184  1.00 0.35  ? 120 TYR A HE2  5  
ATOM 11212 H HH   . TYR A 1 120 ? -0.616  -4.320  -11.197 1.00 1.04  ? 120 TYR A HH   5  
ATOM 11213 N N    . CYS A 1 121 ? 4.126   -8.130  -4.782  1.00 0.14  ? 121 CYS A N    5  
ATOM 11214 C CA   . CYS A 1 121 ? 4.997   -8.586  -3.717  1.00 0.15  ? 121 CYS A CA   5  
ATOM 11215 C C    . CYS A 1 121 ? 5.820   -9.787  -4.176  1.00 0.16  ? 121 CYS A C    5  
ATOM 11216 O O    . CYS A 1 121 ? 6.879   -9.612  -4.768  1.00 0.18  ? 121 CYS A O    5  
ATOM 11217 C CB   . CYS A 1 121 ? 4.182   -8.921  -2.478  1.00 0.14  ? 121 CYS A CB   5  
ATOM 11218 S SG   . CYS A 1 121 ? 3.301   -7.507  -1.789  1.00 0.16  ? 121 CYS A SG   5  
ATOM 11219 H H    . CYS A 1 121 ? 3.522   -8.777  -5.213  1.00 0.14  ? 121 CYS A H    5  
ATOM 11220 H HA   . CYS A 1 121 ? 5.674   -7.776  -3.484  1.00 0.16  ? 121 CYS A HA   5  
ATOM 11221 H HB2  . CYS A 1 121 ? 3.448   -9.673  -2.733  1.00 0.14  ? 121 CYS A HB2  5  
ATOM 11222 H HB3  . CYS A 1 121 ? 4.839   -9.310  -1.710  1.00 0.15  ? 121 CYS A HB3  5  
ATOM 11223 H HG   . CYS A 1 121 ? 3.033   -6.670  -2.782  1.00 0.87  ? 121 CYS A HG   5  
ATOM 11224 N N    . TYR A 1 122 ? 5.339   -11.010 -3.926  1.00 0.16  ? 122 TYR A N    5  
ATOM 11225 C CA   . TYR A 1 122 ? 6.060   -12.195 -4.384  1.00 0.18  ? 122 TYR A CA   5  
ATOM 11226 C C    . TYR A 1 122 ? 5.109   -13.292 -4.883  1.00 0.18  ? 122 TYR A C    5  
ATOM 11227 O O    . TYR A 1 122 ? 5.337   -14.458 -4.595  1.00 0.20  ? 122 TYR A O    5  
ATOM 11228 C CB   . TYR A 1 122 ? 6.936   -12.771 -3.263  1.00 0.19  ? 122 TYR A CB   5  
ATOM 11229 C CG   . TYR A 1 122 ? 7.691   -11.749 -2.440  1.00 0.20  ? 122 TYR A CG   5  
ATOM 11230 C CD1  . TYR A 1 122 ? 7.126   -11.195 -1.301  1.00 0.19  ? 122 TYR A CD1  5  
ATOM 11231 C CD2  . TYR A 1 122 ? 8.958   -11.316 -2.819  1.00 0.21  ? 122 TYR A CD2  5  
ATOM 11232 C CE1  . TYR A 1 122 ? 7.800   -10.250 -0.556  1.00 0.20  ? 122 TYR A CE1  5  
ATOM 11233 C CE2  . TYR A 1 122 ? 9.638   -10.374 -2.078  1.00 0.23  ? 122 TYR A CE2  5  
ATOM 11234 C CZ   . TYR A 1 122 ? 9.102   -9.906  -0.910  1.00 0.22  ? 122 TYR A CZ   5  
ATOM 11235 O OH   . TYR A 1 122 ? 9.731   -8.895  -0.210  1.00 0.24  ? 122 TYR A OH   5  
ATOM 11236 H H    . TYR A 1 122 ? 4.500   -11.116 -3.420  1.00 0.15  ? 122 TYR A H    5  
ATOM 11237 H HA   . TYR A 1 122 ? 6.700   -11.894 -5.202  1.00 0.19  ? 122 TYR A HA   5  
ATOM 11238 H HB2  . TYR A 1 122 ? 6.331   -13.356 -2.591  1.00 0.20  ? 122 TYR A HB2  5  
ATOM 11239 H HB3  . TYR A 1 122 ? 7.673   -13.424 -3.712  1.00 0.22  ? 122 TYR A HB3  5  
ATOM 11240 H HD1  . TYR A 1 122 ? 6.144   -11.518 -0.995  1.00 0.19  ? 122 TYR A HD1  5  
ATOM 11241 H HD2  . TYR A 1 122 ? 9.414   -11.731 -3.705  1.00 0.23  ? 122 TYR A HD2  5  
ATOM 11242 H HE1  . TYR A 1 122 ? 7.345   -9.833  0.327   1.00 0.21  ? 122 TYR A HE1  5  
ATOM 11243 H HE2  . TYR A 1 122 ? 10.619  -10.055 -2.390  1.00 0.25  ? 122 TYR A HE2  5  
ATOM 11244 H HH   . TYR A 1 122 ? 10.159  -8.262  -0.801  1.00 0.96  ? 122 TYR A HH   5  
ATOM 11245 N N    . GLY A 1 123 ? 4.060   -12.929 -5.634  1.00 0.19  ? 123 GLY A N    5  
ATOM 11246 C CA   . GLY A 1 123 ? 3.138   -13.927 -6.180  1.00 0.21  ? 123 GLY A CA   5  
ATOM 11247 C C    . GLY A 1 123 ? 3.827   -15.023 -6.977  1.00 0.21  ? 123 GLY A C    5  
ATOM 11248 O O    . GLY A 1 123 ? 4.103   -16.097 -6.454  1.00 0.25  ? 123 GLY A O    5  
ATOM 11249 H H    . GLY A 1 123 ? 3.871   -11.968 -5.778  1.00 0.20  ? 123 GLY A H    5  
ATOM 11250 H HA2  . GLY A 1 123 ? 2.601   -14.384 -5.363  1.00 0.24  ? 123 GLY A HA2  5  
ATOM 11251 H HA3  . GLY A 1 123 ? 2.428   -13.425 -6.822  1.00 0.25  ? 123 GLY A HA3  5  
ATOM 11252 N N    . PRO A 1 124 ? 4.093   -14.791 -8.265  1.00 0.25  ? 124 PRO A N    5  
ATOM 11253 C CA   . PRO A 1 124 ? 4.833   -15.737 -9.098  1.00 0.30  ? 124 PRO A CA   5  
ATOM 11254 C C    . PRO A 1 124 ? 6.332   -15.611 -8.870  1.00 0.30  ? 124 PRO A C    5  
ATOM 11255 O O    . PRO A 1 124 ? 7.139   -16.200 -9.587  1.00 0.34  ? 124 PRO A O    5  
ATOM 11256 C CB   . PRO A 1 124 ? 4.480   -15.313 -10.533 1.00 0.37  ? 124 PRO A CB   5  
ATOM 11257 C CG   . PRO A 1 124 ? 3.494   -14.191 -10.408 1.00 0.58  ? 124 PRO A CG   5  
ATOM 11258 C CD   . PRO A 1 124 ? 3.672   -13.619 -9.033  1.00 0.32  ? 124 PRO A CD   5  
ATOM 11259 H HA   . PRO A 1 124 ? 4.521   -16.758 -8.925  1.00 0.33  ? 124 PRO A HA   5  
ATOM 11260 H HB2  . PRO A 1 124 ? 5.379   -14.988 -11.037 1.00 0.46  ? 124 PRO A HB2  5  
ATOM 11261 H HB3  . PRO A 1 124 ? 4.054   -16.153 -11.062 1.00 0.45  ? 124 PRO A HB3  5  
ATOM 11262 H HG2  . PRO A 1 124 ? 3.701   -13.437 -11.154 1.00 0.90  ? 124 PRO A HG2  5  
ATOM 11263 H HG3  . PRO A 1 124 ? 2.490   -14.571 -10.527 1.00 0.87  ? 124 PRO A HG3  5  
ATOM 11264 H HD2  . PRO A 1 124 ? 4.439   -12.856 -9.035  1.00 0.40  ? 124 PRO A HD2  5  
ATOM 11265 H HD3  . PRO A 1 124 ? 2.740   -13.225 -8.661  1.00 0.38  ? 124 PRO A HD3  5  
ATOM 11266 N N    . GLN A 1 125 ? 6.690   -14.826 -7.865  1.00 0.27  ? 125 GLN A N    5  
ATOM 11267 C CA   . GLN A 1 125 ? 8.075   -14.493 -7.607  1.00 0.30  ? 125 GLN A CA   5  
ATOM 11268 C C    . GLN A 1 125 ? 8.591   -15.282 -6.421  1.00 0.32  ? 125 GLN A C    5  
ATOM 11269 O O    . GLN A 1 125 ? 9.665   -15.879 -6.468  1.00 0.39  ? 125 GLN A O    5  
ATOM 11270 C CB   . GLN A 1 125 ? 8.186   -12.997 -7.336  1.00 0.30  ? 125 GLN A CB   5  
ATOM 11271 C CG   . GLN A 1 125 ? 7.491   -12.157 -8.394  1.00 0.33  ? 125 GLN A CG   5  
ATOM 11272 C CD   . GLN A 1 125 ? 7.364   -10.701 -8.003  1.00 0.35  ? 125 GLN A CD   5  
ATOM 11273 O OE1  . GLN A 1 125 ? 8.252   -9.890  -8.268  1.00 0.65  ? 125 GLN A OE1  5  
ATOM 11274 N NE2  . GLN A 1 125 ? 6.245   -10.356 -7.385  1.00 0.29  ? 125 GLN A NE2  5  
ATOM 11275 H H    . GLN A 1 125 ? 5.998   -14.483 -7.258  1.00 0.24  ? 125 GLN A H    5  
ATOM 11276 H HA   . GLN A 1 125 ? 8.656   -14.744 -8.481  1.00 0.34  ? 125 GLN A HA   5  
ATOM 11277 H HB2  . GLN A 1 125 ? 7.741   -12.779 -6.375  1.00 0.33  ? 125 GLN A HB2  5  
ATOM 11278 H HB3  . GLN A 1 125 ? 9.229   -12.720 -7.314  1.00 0.36  ? 125 GLN A HB3  5  
ATOM 11279 H HG2  . GLN A 1 125 ? 8.054   -12.222 -9.310  1.00 0.39  ? 125 GLN A HG2  5  
ATOM 11280 H HG3  . GLN A 1 125 ? 6.501   -12.560 -8.555  1.00 0.38  ? 125 GLN A HG3  5  
ATOM 11281 H HE21 . GLN A 1 125 ? 5.574   -11.047 -7.227  1.00 0.45  ? 125 GLN A HE21 5  
ATOM 11282 H HE22 . GLN A 1 125 ? 6.143   -9.425  -7.096  1.00 0.29  ? 125 GLN A HE22 5  
ATOM 11283 N N    . GLY A 1 126 ? 7.796   -15.283 -5.366  1.00 0.27  ? 126 GLY A N    5  
ATOM 11284 C CA   . GLY A 1 126 ? 8.182   -15.903 -4.128  1.00 0.27  ? 126 GLY A CA   5  
ATOM 11285 C C    . GLY A 1 126 ? 9.146   -15.049 -3.342  1.00 0.28  ? 126 GLY A C    5  
ATOM 11286 O O    . GLY A 1 126 ? 9.988   -14.351 -3.905  1.00 0.30  ? 126 GLY A O    5  
ATOM 11287 H H    . GLY A 1 126 ? 6.920   -14.856 -5.429  1.00 0.24  ? 126 GLY A H    5  
ATOM 11288 H HA2  . GLY A 1 126 ? 7.293   -16.049 -3.530  1.00 0.25  ? 126 GLY A HA2  5  
ATOM 11289 H HA3  . GLY A 1 126 ? 8.632   -16.861 -4.329  1.00 0.30  ? 126 GLY A HA3  5  
ATOM 11290 N N    . SER A 1 127 ? 9.000   -15.093 -2.040  1.00 0.27  ? 127 SER A N    5  
ATOM 11291 C CA   . SER A 1 127 ? 9.798   -14.271 -1.158  1.00 0.28  ? 127 SER A CA   5  
ATOM 11292 C C    . SER A 1 127 ? 11.067  -14.999 -0.710  1.00 0.32  ? 127 SER A C    5  
ATOM 11293 O O    . SER A 1 127 ? 11.141  -16.228 -0.762  1.00 0.33  ? 127 SER A O    5  
ATOM 11294 C CB   . SER A 1 127 ? 8.943   -13.817 0.040   1.00 0.27  ? 127 SER A CB   5  
ATOM 11295 O OG   . SER A 1 127 ? 9.733   -13.308 1.102   1.00 0.30  ? 127 SER A OG   5  
ATOM 11296 H H    . SER A 1 127 ? 8.307   -15.663 -1.664  1.00 0.26  ? 127 SER A H    5  
ATOM 11297 H HA   . SER A 1 127 ? 10.085  -13.414 -1.720  1.00 0.29  ? 127 SER A HA   5  
ATOM 11298 H HB2  . SER A 1 127 ? 8.266   -13.039 -0.278  1.00 0.25  ? 127 SER A HB2  5  
ATOM 11299 H HB3  . SER A 1 127 ? 8.355   -14.652 0.397   1.00 0.27  ? 127 SER A HB3  5  
ATOM 11300 H HG   . SER A 1 127 ? 9.795   -13.967 1.800   1.00 0.90  ? 127 SER A HG   5  
ATOM 11301 N N    . ARG A 1 128 ? 12.070  -14.214 -0.300  1.00 0.38  ? 128 ARG A N    5  
ATOM 11302 C CA   . ARG A 1 128 ? 13.384  -14.739 0.078   1.00 0.42  ? 128 ARG A CA   5  
ATOM 11303 C C    . ARG A 1 128 ? 13.289  -15.774 1.194   1.00 0.42  ? 128 ARG A C    5  
ATOM 11304 O O    . ARG A 1 128 ? 13.963  -16.800 1.145   1.00 0.52  ? 128 ARG A O    5  
ATOM 11305 C CB   . ARG A 1 128 ? 14.328  -13.601 0.482   1.00 0.52  ? 128 ARG A CB   5  
ATOM 11306 C CG   . ARG A 1 128 ? 13.712  -12.589 1.437   1.00 1.12  ? 128 ARG A CG   5  
ATOM 11307 C CD   . ARG A 1 128 ? 14.714  -11.515 1.819   1.00 1.41  ? 128 ARG A CD   5  
ATOM 11308 N NE   . ARG A 1 128 ? 14.066  -10.324 2.376   1.00 1.81  ? 128 ARG A NE   5  
ATOM 11309 C CZ   . ARG A 1 128 ? 14.707  -9.181  2.640   1.00 2.33  ? 128 ARG A CZ   5  
ATOM 11310 N NH1  . ARG A 1 128 ? 16.029  -9.107  2.500   1.00 2.45  ? 128 ARG A NH1  5  
ATOM 11311 N NH2  . ARG A 1 128 ? 14.027  -8.119  3.069   1.00 3.17  ? 128 ARG A NH2  5  
ATOM 11312 H H    . ARG A 1 128 ? 11.919  -13.248 -0.253  1.00 0.44  ? 128 ARG A H    5  
ATOM 11313 H HA   . ARG A 1 128 ? 13.795  -15.229 -0.793  1.00 0.43  ? 128 ARG A HA   5  
ATOM 11314 H HB2  . ARG A 1 128 ? 15.202  -14.024 0.955   1.00 0.97  ? 128 ARG A HB2  5  
ATOM 11315 H HB3  . ARG A 1 128 ? 14.636  -13.076 -0.412  1.00 1.07  ? 128 ARG A HB3  5  
ATOM 11316 H HG2  . ARG A 1 128 ? 12.867  -12.122 0.953   1.00 1.62  ? 128 ARG A HG2  5  
ATOM 11317 H HG3  . ARG A 1 128 ? 13.383  -13.102 2.330   1.00 1.72  ? 128 ARG A HG3  5  
ATOM 11318 H HD2  . ARG A 1 128 ? 15.391  -11.920 2.555   1.00 1.89  ? 128 ARG A HD2  5  
ATOM 11319 H HD3  . ARG A 1 128 ? 15.268  -11.233 0.936   1.00 1.87  ? 128 ARG A HD3  5  
ATOM 11320 H HE   . ARG A 1 128 ? 13.097  -10.371 2.531   1.00 2.16  ? 128 ARG A HE   5  
ATOM 11321 H HH11 . ARG A 1 128 ? 16.554  -9.914  2.197   1.00 2.38  ? 128 ARG A HH11 5  
ATOM 11322 H HH12 . ARG A 1 128 ? 16.516  -8.245  2.692   1.00 2.95  ? 128 ARG A HH12 5  
ATOM 11323 H HH21 . ARG A 1 128 ? 13.034  -8.174  3.197   1.00 3.53  ? 128 ARG A HH21 5  
ATOM 11324 H HH22 . ARG A 1 128 ? 14.503  -7.261  3.264   1.00 3.61  ? 128 ARG A HH22 5  
ATOM 11325 N N    . SER A 1 129 ? 12.472  -15.505 2.202   1.00 0.42  ? 129 SER A N    5  
ATOM 11326 C CA   . SER A 1 129 ? 12.260  -16.480 3.252   1.00 0.44  ? 129 SER A CA   5  
ATOM 11327 C C    . SER A 1 129 ? 11.245  -17.547 2.796   1.00 0.41  ? 129 SER A C    5  
ATOM 11328 O O    . SER A 1 129 ? 11.636  -18.696 2.586   1.00 0.44  ? 129 SER A O    5  
ATOM 11329 C CB   . SER A 1 129 ? 11.874  -15.776 4.560   1.00 0.48  ? 129 SER A CB   5  
ATOM 11330 O OG   . SER A 1 129 ? 11.380  -14.468 4.303   1.00 1.23  ? 129 SER A OG   5  
ATOM 11331 H H    . SER A 1 129 ? 12.021  -14.642 2.249   1.00 0.48  ? 129 SER A H    5  
ATOM 11332 H HA   . SER A 1 129 ? 13.208  -16.978 3.404   1.00 0.46  ? 129 SER A HA   5  
ATOM 11333 H HB2  . SER A 1 129 ? 11.109  -16.345 5.063   1.00 0.81  ? 129 SER A HB2  5  
ATOM 11334 H HB3  . SER A 1 129 ? 12.745  -15.703 5.195   1.00 1.00  ? 129 SER A HB3  5  
ATOM 11335 H HG   . SER A 1 129 ? 10.886  -14.157 5.073   1.00 1.52  ? 129 SER A HG   5  
ATOM 11336 N N    . PRO A 1 130 ? 9.939   -17.219 2.619   1.00 0.37  ? 130 PRO A N    5  
ATOM 11337 C CA   . PRO A 1 130 ? 8.975   -18.122 2.019   1.00 0.36  ? 130 PRO A CA   5  
ATOM 11338 C C    . PRO A 1 130 ? 8.602   -17.705 0.603   1.00 0.32  ? 130 PRO A C    5  
ATOM 11339 O O    . PRO A 1 130 ? 8.258   -16.550 0.374   1.00 0.27  ? 130 PRO A O    5  
ATOM 11340 C CB   . PRO A 1 130 ? 7.744   -17.920 2.922   1.00 0.37  ? 130 PRO A CB   5  
ATOM 11341 C CG   . PRO A 1 130 ? 7.983   -16.622 3.649   1.00 0.37  ? 130 PRO A CG   5  
ATOM 11342 C CD   . PRO A 1 130 ? 9.233   -16.022 3.060   1.00 0.37  ? 130 PRO A CD   5  
ATOM 11343 H HA   . PRO A 1 130 ? 9.293   -19.152 2.044   1.00 0.40  ? 130 PRO A HA   5  
ATOM 11344 H HB2  . PRO A 1 130 ? 6.858   -17.863 2.307   1.00 0.35  ? 130 PRO A HB2  5  
ATOM 11345 H HB3  . PRO A 1 130 ? 7.650   -18.743 3.607   1.00 0.44  ? 130 PRO A HB3  5  
ATOM 11346 H HG2  . PRO A 1 130 ? 7.143   -15.960 3.499   1.00 0.37  ? 130 PRO A HG2  5  
ATOM 11347 H HG3  . PRO A 1 130 ? 8.121   -16.815 4.702   1.00 0.41  ? 130 PRO A HG3  5  
ATOM 11348 H HD2  . PRO A 1 130 ? 8.990   -15.379 2.226   1.00 0.35  ? 130 PRO A HD2  5  
ATOM 11349 H HD3  . PRO A 1 130 ? 9.792   -15.487 3.804   1.00 0.40  ? 130 PRO A HD3  5  
ATOM 11350 N N    . TYR A 1 131 ? 8.665   -18.613 -0.347  1.00 0.33  ? 131 TYR A N    5  
ATOM 11351 C CA   . TYR A 1 131 ? 8.001   -18.381 -1.615  1.00 0.32  ? 131 TYR A CA   5  
ATOM 11352 C C    . TYR A 1 131 ? 6.533   -18.081 -1.334  1.00 0.30  ? 131 TYR A C    5  
ATOM 11353 O O    . TYR A 1 131 ? 5.743   -18.985 -1.060  1.00 0.32  ? 131 TYR A O    5  
ATOM 11354 C CB   . TYR A 1 131 ? 8.141   -19.596 -2.544  1.00 0.36  ? 131 TYR A CB   5  
ATOM 11355 C CG   . TYR A 1 131 ? 7.421   -19.444 -3.874  1.00 0.45  ? 131 TYR A CG   5  
ATOM 11356 C CD1  . TYR A 1 131 ? 6.058   -19.691 -3.985  1.00 0.78  ? 131 TYR A CD1  5  
ATOM 11357 C CD2  . TYR A 1 131 ? 8.105   -19.038 -5.012  1.00 1.00  ? 131 TYR A CD2  5  
ATOM 11358 C CE1  . TYR A 1 131 ? 5.396   -19.531 -5.186  1.00 0.87  ? 131 TYR A CE1  5  
ATOM 11359 C CE2  . TYR A 1 131 ? 7.452   -18.880 -6.219  1.00 1.14  ? 131 TYR A CE2  5  
ATOM 11360 C CZ   . TYR A 1 131 ? 6.096   -19.125 -6.300  1.00 0.81  ? 131 TYR A CZ   5  
ATOM 11361 O OH   . TYR A 1 131 ? 5.438   -18.950 -7.499  1.00 1.00  ? 131 TYR A OH   5  
ATOM 11362 H H    . TYR A 1 131 ? 9.196   -19.414 -0.218  1.00 0.36  ? 131 TYR A H    5  
ATOM 11363 H HA   . TYR A 1 131 ? 8.453   -17.518 -2.081  1.00 0.31  ? 131 TYR A HA   5  
ATOM 11364 H HB2  . TYR A 1 131 ? 9.188   -19.753 -2.751  1.00 0.39  ? 131 TYR A HB2  5  
ATOM 11365 H HB3  . TYR A 1 131 ? 7.742   -20.468 -2.047  1.00 0.43  ? 131 TYR A HB3  5  
ATOM 11366 H HD1  . TYR A 1 131 ? 5.510   -20.008 -3.109  1.00 1.27  ? 131 TYR A HD1  5  
ATOM 11367 H HD2  . TYR A 1 131 ? 9.165   -18.846 -4.945  1.00 1.48  ? 131 TYR A HD2  5  
ATOM 11368 H HE1  . TYR A 1 131 ? 4.337   -19.729 -5.250  1.00 1.32  ? 131 TYR A HE1  5  
ATOM 11369 H HE2  . TYR A 1 131 ? 8.002   -18.564 -7.092  1.00 1.69  ? 131 TYR A HE2  5  
ATOM 11370 H HH   . TYR A 1 131 ? 4.677   -18.372 -7.360  1.00 1.33  ? 131 TYR A HH   5  
ATOM 11371 N N    . ILE A 1 132 ? 6.192   -16.801 -1.337  1.00 0.27  ? 132 ILE A N    5  
ATOM 11372 C CA   . ILE A 1 132 ? 4.845   -16.379 -1.023  1.00 0.26  ? 132 ILE A CA   5  
ATOM 11373 C C    . ILE A 1 132 ? 3.875   -16.870 -2.091  1.00 0.25  ? 132 ILE A C    5  
ATOM 11374 O O    . ILE A 1 132 ? 4.143   -16.735 -3.283  1.00 0.25  ? 132 ILE A O    5  
ATOM 11375 C CB   . ILE A 1 132 ? 4.737   -14.837 -0.918  1.00 0.25  ? 132 ILE A CB   5  
ATOM 11376 C CG1  . ILE A 1 132 ? 5.734   -14.246 0.074   1.00 0.39  ? 132 ILE A CG1  5  
ATOM 11377 C CG2  . ILE A 1 132 ? 3.335   -14.444 -0.520  1.00 0.26  ? 132 ILE A CG2  5  
ATOM 11378 C CD1  . ILE A 1 132 ? 5.751   -14.917 1.417   1.00 0.23  ? 132 ILE A CD1  5  
ATOM 11379 H H    . ILE A 1 132 ? 6.867   -16.124 -1.527  1.00 0.27  ? 132 ILE A H    5  
ATOM 11380 H HA   . ILE A 1 132 ? 4.569   -16.808 -0.070  1.00 0.27  ? 132 ILE A HA   5  
ATOM 11381 H HB   . ILE A 1 132 ? 4.945   -14.424 -1.887  1.00 0.23  ? 132 ILE A HB   5  
ATOM 11382 H HG12 . ILE A 1 132 ? 6.728   -14.317 -0.339  1.00 0.58  ? 132 ILE A HG12 5  
ATOM 11383 H HG13 . ILE A 1 132 ? 5.488   -13.200 0.235   1.00 0.64  ? 132 ILE A HG13 5  
ATOM 11384 H HG21 . ILE A 1 132 ? 3.109   -14.878 0.444   1.00 1.06  ? 132 ILE A HG21 5  
ATOM 11385 H HG22 . ILE A 1 132 ? 2.639   -14.814 -1.256  1.00 1.06  ? 132 ILE A HG22 5  
ATOM 11386 H HG23 . ILE A 1 132 ? 3.265   -13.369 -0.458  1.00 1.01  ? 132 ILE A HG23 5  
ATOM 11387 H HD11 . ILE A 1 132 ? 6.534   -14.472 2.017   1.00 0.99  ? 132 ILE A HD11 5  
ATOM 11388 H HD12 . ILE A 1 132 ? 5.946   -15.971 1.290   1.00 1.02  ? 132 ILE A HD12 5  
ATOM 11389 H HD13 . ILE A 1 132 ? 4.798   -14.777 1.906   1.00 1.05  ? 132 ILE A HD13 5  
ATOM 11390 N N    . PRO A 1 133 ? 2.752   -17.477 -1.676  1.00 0.27  ? 133 PRO A N    5  
ATOM 11391 C CA   . PRO A 1 133 ? 1.699   -17.911 -2.594  1.00 0.28  ? 133 PRO A CA   5  
ATOM 11392 C C    . PRO A 1 133 ? 1.277   -16.794 -3.546  1.00 0.26  ? 133 PRO A C    5  
ATOM 11393 O O    . PRO A 1 133 ? 1.157   -15.631 -3.143  1.00 0.26  ? 133 PRO A O    5  
ATOM 11394 C CB   . PRO A 1 133 ? 0.534   -18.298 -1.667  1.00 0.34  ? 133 PRO A CB   5  
ATOM 11395 C CG   . PRO A 1 133 ? 0.924   -17.830 -0.304  1.00 0.61  ? 133 PRO A CG   5  
ATOM 11396 C CD